data_1O9S
# 
_entry.id   1O9S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O9S         
PDBE  EBI-11905    
WWPDB D_1290011905 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1H3I 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF THE HISTONE METHYLTRANSFERASE SET7/9' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O9S 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xiao, B.'        1  
'Jing, C.'        2  
'Wilson, J.R.'    3  
'Walker, P.A.'    4  
'Vasisht, N.'     5  
'Kelly, G.'       6  
'Howell, S.'      7  
'Taylor, I.A.'    8  
'Blackburn, G.M.' 9  
'Gamblin, S.J.'   10 
# 
_citation.id                        primary 
_citation.title                     'Structure and Catalytic Mechanism of the Human Histone Methyltransferase Set7/9' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            421 
_citation.page_first                652 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12540855 
_citation.pdbx_database_id_DOI      10.1038/NATURE01378 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xiao, B.'        1  
primary 'Jing, C.'        2  
primary 'Wilson, J.R.'    3  
primary 'Walker, P.A.'    4  
primary 'Vasisht, N.'     5  
primary 'Kelly, G.'       6  
primary 'Howell, S.'      7  
primary 'Taylor, I.A.'    8  
primary 'Blackburn, G.M.' 9  
primary 'Gamblin, S.J.'   10 
# 
_cell.entry_id           1O9S 
_cell.length_a           52.690 
_cell.length_b           75.438 
_cell.length_c           69.099 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.16 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O9S 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-4 SPECIFIC' 28912.133 2   2.1.1.43 ? 
'N-DOMAIN, SET-DOMAIN, RESIDUES 108-366' ? 
2 polymer     syn 'GENE FRAGMENT FOR HISTONE H3'                             1239.447  2   ?        ? 'RESIDUES 2-11' ? 
3 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                                  384.411   2   ?        ? ? ? 
4 water       nat water                                                      18.015    660 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HISTONE H3-K4 METHYLTRANSFERASE, H3-K4-HMTASE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPG
NSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTL
SLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGP
EAPEWYQVELKAFQATQQK
;
;GQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPG
NSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTL
SLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGP
EAPEWYQVELKAFQATQQK
;
A,B ? 
2 'polypeptide(L)' no yes 'ART(MLZ)QTARKY' ARTKQTARKY K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLN n 
1 3   TYR n 
1 4   LYS n 
1 5   ASP n 
1 6   ASN n 
1 7   ILE n 
1 8   ARG n 
1 9   HIS n 
1 10  GLY n 
1 11  VAL n 
1 12  CYS n 
1 13  TRP n 
1 14  ILE n 
1 15  TYR n 
1 16  TYR n 
1 17  PRO n 
1 18  ASP n 
1 19  GLY n 
1 20  GLY n 
1 21  SER n 
1 22  LEU n 
1 23  VAL n 
1 24  GLY n 
1 25  GLU n 
1 26  VAL n 
1 27  ASN n 
1 28  GLU n 
1 29  ASP n 
1 30  GLY n 
1 31  GLU n 
1 32  MET n 
1 33  THR n 
1 34  GLY n 
1 35  GLU n 
1 36  LYS n 
1 37  ILE n 
1 38  ALA n 
1 39  TYR n 
1 40  VAL n 
1 41  TYR n 
1 42  PRO n 
1 43  ASP n 
1 44  GLU n 
1 45  ARG n 
1 46  THR n 
1 47  ALA n 
1 48  LEU n 
1 49  TYR n 
1 50  GLY n 
1 51  LYS n 
1 52  PHE n 
1 53  ILE n 
1 54  ASP n 
1 55  GLY n 
1 56  GLU n 
1 57  MET n 
1 58  ILE n 
1 59  GLU n 
1 60  GLY n 
1 61  LYS n 
1 62  LEU n 
1 63  ALA n 
1 64  THR n 
1 65  LEU n 
1 66  MET n 
1 67  SER n 
1 68  THR n 
1 69  GLU n 
1 70  GLU n 
1 71  GLY n 
1 72  ARG n 
1 73  PRO n 
1 74  HIS n 
1 75  PHE n 
1 76  GLU n 
1 77  LEU n 
1 78  MET n 
1 79  PRO n 
1 80  GLY n 
1 81  ASN n 
1 82  SER n 
1 83  VAL n 
1 84  TYR n 
1 85  HIS n 
1 86  PHE n 
1 87  ASP n 
1 88  LYS n 
1 89  SER n 
1 90  THR n 
1 91  SER n 
1 92  SER n 
1 93  CYS n 
1 94  ILE n 
1 95  SER n 
1 96  THR n 
1 97  ASN n 
1 98  ALA n 
1 99  LEU n 
1 100 LEU n 
1 101 PRO n 
1 102 ASP n 
1 103 PRO n 
1 104 TYR n 
1 105 GLU n 
1 106 SER n 
1 107 GLU n 
1 108 ARG n 
1 109 VAL n 
1 110 TYR n 
1 111 VAL n 
1 112 ALA n 
1 113 GLU n 
1 114 SER n 
1 115 LEU n 
1 116 ILE n 
1 117 SER n 
1 118 SER n 
1 119 ALA n 
1 120 GLY n 
1 121 GLU n 
1 122 GLY n 
1 123 LEU n 
1 124 PHE n 
1 125 SER n 
1 126 LYS n 
1 127 VAL n 
1 128 ALA n 
1 129 VAL n 
1 130 GLY n 
1 131 PRO n 
1 132 ASN n 
1 133 THR n 
1 134 VAL n 
1 135 MET n 
1 136 SER n 
1 137 PHE n 
1 138 TYR n 
1 139 ASN n 
1 140 GLY n 
1 141 VAL n 
1 142 ARG n 
1 143 ILE n 
1 144 THR n 
1 145 HIS n 
1 146 GLN n 
1 147 GLU n 
1 148 VAL n 
1 149 ASP n 
1 150 SER n 
1 151 ARG n 
1 152 ASP n 
1 153 TRP n 
1 154 ALA n 
1 155 LEU n 
1 156 ASN n 
1 157 GLY n 
1 158 ASN n 
1 159 THR n 
1 160 LEU n 
1 161 SER n 
1 162 LEU n 
1 163 ASP n 
1 164 GLU n 
1 165 GLU n 
1 166 THR n 
1 167 VAL n 
1 168 ILE n 
1 169 ASP n 
1 170 VAL n 
1 171 PRO n 
1 172 GLU n 
1 173 PRO n 
1 174 TYR n 
1 175 ASN n 
1 176 HIS n 
1 177 VAL n 
1 178 SER n 
1 179 LYS n 
1 180 TYR n 
1 181 CYS n 
1 182 ALA n 
1 183 SER n 
1 184 LEU n 
1 185 GLY n 
1 186 HIS n 
1 187 LYS n 
1 188 ALA n 
1 189 ASN n 
1 190 HIS n 
1 191 SER n 
1 192 PHE n 
1 193 THR n 
1 194 PRO n 
1 195 ASN n 
1 196 CYS n 
1 197 ILE n 
1 198 TYR n 
1 199 ASP n 
1 200 MET n 
1 201 PHE n 
1 202 VAL n 
1 203 HIS n 
1 204 PRO n 
1 205 ARG n 
1 206 PHE n 
1 207 GLY n 
1 208 PRO n 
1 209 ILE n 
1 210 LYS n 
1 211 CYS n 
1 212 ILE n 
1 213 ARG n 
1 214 THR n 
1 215 LEU n 
1 216 ARG n 
1 217 ALA n 
1 218 VAL n 
1 219 GLU n 
1 220 ALA n 
1 221 ASP n 
1 222 GLU n 
1 223 GLU n 
1 224 LEU n 
1 225 THR n 
1 226 VAL n 
1 227 ALA n 
1 228 TYR n 
1 229 GLY n 
1 230 TYR n 
1 231 ASP n 
1 232 HIS n 
1 233 SER n 
1 234 PRO n 
1 235 PRO n 
1 236 GLY n 
1 237 LYS n 
1 238 SER n 
1 239 GLY n 
1 240 PRO n 
1 241 GLU n 
1 242 ALA n 
1 243 PRO n 
1 244 GLU n 
1 245 TRP n 
1 246 TYR n 
1 247 GLN n 
1 248 VAL n 
1 249 GLU n 
1 250 LEU n 
1 251 LYS n 
1 252 ALA n 
1 253 PHE n 
1 254 GLN n 
1 255 ALA n 
1 256 THR n 
1 257 GLN n 
1 258 GLN n 
1 259 LYS n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   MLZ n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   LYS n 
2 10  TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP SET7_HUMAN 1 ? ? Q8WTS6 ? 
2 UNP Q16776     2 ? ? Q16776 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O9S A 1 ? 259 ? Q8WTS6 108 ? 366 ? 108 366 
2 1 1O9S B 1 ? 259 ? Q8WTS6 108 ? 366 ? 108 366 
3 2 1O9S K 1 ? 10  ? Q16776 2   ? 11  ? 1   10  
4 2 1O9S L 1 ? 10  ? Q16776 2   ? 11  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1O9S TYR K 10 ? UNP Q16776 SER 11 conflict 10 1 
4 1O9S TYR L 10 ? UNP Q16776 SER 11 conflict 10 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
MLZ 'L-peptide linking' n N-METHYL-LYSINE           ? 'C7 H16 N2 O2'    160.214 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1O9S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.85 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.80' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1O9S 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   54703 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.05500 
_reflns.pdbx_netI_over_sigmaI        47.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              22.000 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1O9S 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     54441 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2440 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H3I' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4044 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             660 
_refine_hist.number_atoms_total               4754 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  1O9S 
_struct.title                     'Crystal structure of a ternary complex of the human histone methyltransferase SET7/9' 
_struct.pdbx_descriptor           
'HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-4 SPECIFIC (E.C.2.1.1.43), GENE FRAGMENT FOR HISTONE H3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O9S 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'METHYLATION, HISTONE H3, METHYLTRANSFERASE, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;THE DIMER IN THIS ENTRY IS FORMED BY THE                     
  COMPLEXOF CHAIN A WITH A PEPTIDE CHAIN K AND                        
 CHAIN B WITHPEPTIDE CHAIN L. CHAINS A AND B                          
 ARE MONOMERIC IN THEPHYSIOLOGICAL STATE.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 102 ? ARG A 108 ? ASP A 209 ARG A 215 1 ? 7  
HELX_P HELX_P2 2 THR A 144 ? SER A 150 ? THR A 251 SER A 257 1 ? 7  
HELX_P HELX_P3 3 ASP A 152 ? ASN A 156 ? ASP A 259 ASN A 263 5 ? 5  
HELX_P HELX_P4 4 LEU A 184 ? ALA A 188 ? LEU A 291 ALA A 295 5 ? 5  
HELX_P HELX_P5 5 PRO A 243 ? ALA A 255 ? PRO A 350 ALA A 362 1 ? 13 
HELX_P HELX_P6 6 ASP B 102 ? ARG B 108 ? ASP B 209 ARG B 215 1 ? 7  
HELX_P HELX_P7 7 HIS B 145 ? SER B 150 ? HIS B 252 SER B 257 1 ? 6  
HELX_P HELX_P8 8 LEU B 184 ? ALA B 188 ? LEU B 291 ALA B 295 5 ? 5  
HELX_P HELX_P9 9 PRO B 243 ? THR B 256 ? PRO B 350 THR B 363 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C THR 3 C ? ? ? 1_555 C MLZ 4 N ? ? K THR 3 K MLZ 4 1_555 ? ? ? ? ? ? ? 1.476 ? 
covale2 covale ? ? C MLZ 4 C ? ? ? 1_555 C GLN 5 N ? ? K MLZ 4 K GLN 5 1_555 ? ? ? ? ? ? ? 1.523 ? 
covale3 covale ? ? D THR 3 C ? ? ? 1_555 D MLZ 4 N ? ? L THR 3 L MLZ 4 1_555 ? ? ? ? ? ? ? 1.590 ? 
covale4 covale ? ? D MLZ 4 C ? ? ? 1_555 D GLN 5 N ? ? L MLZ 4 L GLN 5 1_555 ? ? ? ? ? ? ? 1.759 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 172 A . ? GLU 279 A PRO 173 A ? PRO 280 A 1 -6.68 
2 GLU 172 B . ? GLU 279 B PRO 173 B ? PRO 280 B 1 0.18  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 6 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 3 ? 
BA ? 6 ? 
BB ? 4 ? 
BC ? 3 ? 
BD ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 11  ? TYR A 15  ? VAL A 118 TYR A 122 
AA 2 SER A 21  ? GLU A 25  ? SER A 128 GLU A 132 
AA 3 GLY A 34  ? VAL A 40  ? GLY A 141 VAL A 147 
AA 4 THR A 46  ? ILE A 53  ? THR A 153 ILE A 160 
AA 5 GLU A 56  ? GLU A 69  ? GLU A 163 GLU A 176 
AA 6 VAL A 83  ? TYR A 84  ? VAL A 190 TYR A 191 
AB 1 VAL A 11  ? TYR A 15  ? VAL A 118 TYR A 122 
AB 2 SER A 21  ? GLU A 25  ? SER A 128 GLU A 132 
AB 3 GLY A 34  ? VAL A 40  ? GLY A 141 VAL A 147 
AB 4 THR A 46  ? ILE A 53  ? THR A 153 ILE A 160 
AB 5 GLU A 56  ? GLU A 69  ? GLU A 163 GLU A 176 
AB 6 ARG A 72  ? LEU A 77  ? ARG A 179 LEU A 184 
AC 1 VAL A 109 ? GLU A 113 ? VAL A 216 GLU A 220 
AC 2 GLU A 121 ? SER A 125 ? GLU A 228 SER A 232 
AC 3 GLU A 223 ? VAL A 226 ? GLU A 330 VAL A 333 
AC 4 ASN A 189 ? HIS A 190 ? ASN A 296 HIS A 297 
AD 1 VAL A 134 ? TYR A 138 ? VAL A 241 TYR A 245 
AD 2 GLY A 207 ? THR A 214 ? GLY A 314 THR A 321 
AD 3 CYS A 196 ? HIS A 203 ? CYS A 303 HIS A 310 
AE 1 VAL A 141 ? ILE A 143 ? VAL A 248 ILE A 250 
AE 2 VAL A 167 ? ASP A 169 ? VAL A 274 ASP A 276 
AE 3 LEU A 160 ? SER A 161 ? LEU A 267 SER A 268 
BA 1 VAL B 11  ? TYR B 15  ? VAL B 118 TYR B 122 
BA 2 SER B 21  ? GLU B 25  ? SER B 128 GLU B 132 
BA 3 GLY B 34  ? VAL B 40  ? GLY B 141 VAL B 147 
BA 4 THR B 46  ? ILE B 53  ? THR B 153 ILE B 160 
BA 5 GLU B 56  ? GLU B 69  ? GLU B 163 GLU B 176 
BA 6 ARG B 72  ? LEU B 77  ? ARG B 179 LEU B 184 
BB 1 VAL B 109 ? GLU B 113 ? VAL B 216 GLU B 220 
BB 2 GLU B 121 ? SER B 125 ? GLU B 228 SER B 232 
BB 3 GLU B 223 ? VAL B 226 ? GLU B 330 VAL B 333 
BB 4 ASN B 189 ? HIS B 190 ? ASN B 296 HIS B 297 
BC 1 VAL B 134 ? TYR B 138 ? VAL B 241 TYR B 245 
BC 2 GLY B 207 ? THR B 214 ? GLY B 314 THR B 321 
BC 3 CYS B 196 ? HIS B 203 ? CYS B 303 HIS B 310 
BD 1 VAL B 141 ? THR B 144 ? VAL B 248 THR B 251 
BD 2 THR B 166 ? ASP B 169 ? THR B 273 ASP B 276 
BD 3 LEU B 160 ? SER B 161 ? LEU B 267 SER B 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 14  ? N ILE A 121 O LEU A 22  ? O LEU A 129 
AA 2 3 N VAL A 23  ? N VAL A 130 O ALA A 38  ? O ALA A 145 
AA 3 4 N TYR A 39  ? N TYR A 146 O LEU A 48  ? O LEU A 155 
AA 4 5 N ILE A 53  ? N ILE A 160 O GLU A 56  ? O GLU A 163 
AA 5 6 N GLY A 60  ? N GLY A 167 O TYR A 84  ? O TYR A 191 
AB 1 2 N ILE A 14  ? N ILE A 121 O LEU A 22  ? O LEU A 129 
AB 2 3 N VAL A 23  ? N VAL A 130 O ALA A 38  ? O ALA A 145 
AB 3 4 N TYR A 39  ? N TYR A 146 O LEU A 48  ? O LEU A 155 
AB 4 5 N ILE A 53  ? N ILE A 160 O GLU A 56  ? O GLU A 163 
AB 5 6 N GLU A 69  ? N GLU A 176 O ARG A 72  ? O ARG A 179 
AC 1 2 N ALA A 112 ? N ALA A 219 O GLY A 122 ? O GLY A 229 
AC 2 3 O LEU A 123 ? O LEU A 230 N LEU A 224 ? N LEU A 331 
AC 3 4 N VAL A 226 ? N VAL A 333 O ASN A 189 ? O ASN A 296 
AD 1 2 N TYR A 138 ? N TYR A 245 O LYS A 210 ? O LYS A 317 
AD 2 3 N ARG A 213 ? N ARG A 320 O ILE A 197 ? O ILE A 304 
AE 1 2 N ILE A 143 ? N ILE A 250 O VAL A 167 ? O VAL A 274 
AE 2 3 N ILE A 168 ? N ILE A 275 O LEU A 160 ? O LEU A 267 
BA 1 2 N ILE B 14  ? N ILE B 121 O LEU B 22  ? O LEU B 129 
BA 2 3 N VAL B 23  ? N VAL B 130 O ALA B 38  ? O ALA B 145 
BA 3 4 N TYR B 39  ? N TYR B 146 O LEU B 48  ? O LEU B 155 
BA 4 5 N ILE B 53  ? N ILE B 160 O GLU B 56  ? O GLU B 163 
BA 5 6 N GLU B 69  ? N GLU B 176 O ARG B 72  ? O ARG B 179 
BB 1 2 N ALA B 112 ? N ALA B 219 O GLY B 122 ? O GLY B 229 
BB 2 3 O LEU B 123 ? O LEU B 230 N LEU B 224 ? N LEU B 331 
BB 3 4 N VAL B 226 ? N VAL B 333 O ASN B 189 ? O ASN B 296 
BC 1 2 N TYR B 138 ? N TYR B 245 O LYS B 210 ? O LYS B 317 
BC 2 3 N ARG B 213 ? N ARG B 320 O ILE B 197 ? O ILE B 304 
BD 1 2 N ILE B 143 ? N ILE B 250 O VAL B 167 ? O VAL B 274 
BD 2 3 N ILE B 168 ? N ILE B 275 O LEU B 160 ? O LEU B 267 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE SAH A1367' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE SAH B1367' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ALA A 119 ? ALA A 226  . ? 1_555 ? 
2  AC1 17 GLU A 121 ? GLU A 228  . ? 1_555 ? 
3  AC1 17 ASN A 158 ? ASN A 265  . ? 1_555 ? 
4  AC1 17 HIS A 186 ? HIS A 293  . ? 1_555 ? 
5  AC1 17 LYS A 187 ? LYS A 294  . ? 1_555 ? 
6  AC1 17 ASN A 189 ? ASN A 296  . ? 1_555 ? 
7  AC1 17 HIS A 190 ? HIS A 297  . ? 1_555 ? 
8  AC1 17 TYR A 228 ? TYR A 335  . ? 1_555 ? 
9  AC1 17 TRP A 245 ? TRP A 352  . ? 1_555 ? 
10 AC1 17 GLU A 249 ? GLU A 356  . ? 1_555 ? 
11 AC1 17 HOH G .   ? HOH A 2302 . ? 1_555 ? 
12 AC1 17 HOH G .   ? HOH A 2303 . ? 1_555 ? 
13 AC1 17 HOH G .   ? HOH A 2307 . ? 1_555 ? 
14 AC1 17 HOH G .   ? HOH A 2308 . ? 1_555 ? 
15 AC1 17 HOH G .   ? HOH A 2309 . ? 1_555 ? 
16 AC1 17 HOH G .   ? HOH A 2310 . ? 1_555 ? 
17 AC1 17 MLZ C 4   ? MLZ K 4    . ? 1_555 ? 
18 AC2 17 ALA B 119 ? ALA B 226  . ? 1_555 ? 
19 AC2 17 GLU B 121 ? GLU B 228  . ? 1_555 ? 
20 AC2 17 ASN B 158 ? ASN B 265  . ? 1_555 ? 
21 AC2 17 HIS B 186 ? HIS B 293  . ? 1_555 ? 
22 AC2 17 LYS B 187 ? LYS B 294  . ? 1_555 ? 
23 AC2 17 ASN B 189 ? ASN B 296  . ? 1_555 ? 
24 AC2 17 HIS B 190 ? HIS B 297  . ? 1_555 ? 
25 AC2 17 TYR B 228 ? TYR B 335  . ? 1_555 ? 
26 AC2 17 TRP B 245 ? TRP B 352  . ? 1_555 ? 
27 AC2 17 GLU B 249 ? GLU B 356  . ? 1_555 ? 
28 AC2 17 HOH H .   ? HOH B 2322 . ? 1_555 ? 
29 AC2 17 HOH H .   ? HOH B 2324 . ? 1_555 ? 
30 AC2 17 HOH H .   ? HOH B 2325 . ? 1_555 ? 
31 AC2 17 HOH H .   ? HOH B 2326 . ? 1_555 ? 
32 AC2 17 HOH H .   ? HOH B 2327 . ? 1_555 ? 
33 AC2 17 HOH H .   ? HOH B 2328 . ? 1_555 ? 
34 AC2 17 MLZ D 4   ? MLZ L 4    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1O9S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O9S 
_atom_sites.fract_transf_matrix[1][1]   0.018979 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001380 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013256 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014510 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 10  ? 31.852  -2.694  2.451   1.00 13.90 ? 117  GLY A N     1 
ATOM   2    C CA    . GLY A 1 10  ? 30.788  -1.711  2.826   1.00 13.55 ? 117  GLY A CA    1 
ATOM   3    C C     . GLY A 1 10  ? 30.367  -1.598  4.276   1.00 13.14 ? 117  GLY A C     1 
ATOM   4    O O     . GLY A 1 10  ? 29.481  -0.788  4.552   1.00 14.03 ? 117  GLY A O     1 
ATOM   5    N N     . VAL A 1 11  ? 30.820  -2.492  5.146   1.00 11.64 ? 118  VAL A N     1 
ATOM   6    C CA    . VAL A 1 11  ? 30.552  -2.429  6.568   1.00 10.23 ? 118  VAL A CA    1 
ATOM   7    C C     . VAL A 1 11  ? 30.691  -1.045  7.215   1.00 9.12  ? 118  VAL A C     1 
ATOM   8    O O     . VAL A 1 11  ? 31.738  -0.387  7.133   1.00 8.38  ? 118  VAL A O     1 
ATOM   9    C CB    . VAL A 1 11  ? 31.408  -3.477  7.277   1.00 10.37 ? 118  VAL A CB    1 
ATOM   10   C CG1   . VAL A 1 11  ? 30.860  -3.776  8.647   1.00 10.40 ? 118  VAL A CG1   1 
ATOM   11   C CG2   . VAL A 1 11  ? 31.444  -4.758  6.440   1.00 10.29 ? 118  VAL A CG2   1 
ATOM   12   N N     . CYS A 1 12  ? 29.609  -0.620  7.860   1.00 7.88  ? 119  CYS A N     1 
ATOM   13   C CA    . CYS A 1 12  ? 29.560  0.642   8.582   1.00 7.63  ? 119  CYS A CA    1 
ATOM   14   C C     . CYS A 1 12  ? 29.191  0.387   10.047  1.00 7.19  ? 119  CYS A C     1 
ATOM   15   O O     . CYS A 1 12  ? 28.248  -0.351  10.346  1.00 6.63  ? 119  CYS A O     1 
ATOM   16   C CB    . CYS A 1 12  ? 28.553  1.595   7.946   1.00 7.90  ? 119  CYS A CB    1 
ATOM   17   S SG    . CYS A 1 12  ? 28.136  3.044   8.935   1.00 8.87  ? 119  CYS A SG    1 
ATOM   18   N N     . TRP A 1 13  ? 29.963  0.979   10.949  1.00 6.31  ? 120  TRP A N     1 
ATOM   19   C CA    . TRP A 1 13  ? 29.692  0.897   12.381  1.00 6.30  ? 120  TRP A CA    1 
ATOM   20   C C     . TRP A 1 13  ? 29.190  2.262   12.847  1.00 6.01  ? 120  TRP A C     1 
ATOM   21   O O     . TRP A 1 13  ? 29.838  3.279   12.602  1.00 5.78  ? 120  TRP A O     1 
ATOM   22   C CB    . TRP A 1 13  ? 30.960  0.559   13.183  1.00 6.44  ? 120  TRP A CB    1 
ATOM   23   C CG    . TRP A 1 13  ? 31.500  -0.810  12.987  1.00 6.89  ? 120  TRP A CG    1 
ATOM   24   C CD1   . TRP A 1 13  ? 32.219  -1.265  11.920  1.00 7.26  ? 120  TRP A CD1   1 
ATOM   25   C CD2   . TRP A 1 13  ? 31.416  -1.902  13.908  1.00 7.94  ? 120  TRP A CD2   1 
ATOM   26   N NE1   . TRP A 1 13  ? 32.574  -2.580  12.117  1.00 8.17  ? 120  TRP A NE1   1 
ATOM   27   C CE2   . TRP A 1 13  ? 32.088  -2.997  13.327  1.00 8.70  ? 120  TRP A CE2   1 
ATOM   28   C CE3   . TRP A 1 13  ? 30.827  -2.073  15.164  1.00 8.69  ? 120  TRP A CE3   1 
ATOM   29   C CZ2   . TRP A 1 13  ? 32.196  -4.240  13.963  1.00 9.55  ? 120  TRP A CZ2   1 
ATOM   30   C CZ3   . TRP A 1 13  ? 30.926  -3.312  15.792  1.00 9.60  ? 120  TRP A CZ3   1 
ATOM   31   C CH2   . TRP A 1 13  ? 31.604  -4.378  15.188  1.00 9.83  ? 120  TRP A CH2   1 
ATOM   32   N N     . ILE A 1 14  ? 28.033  2.284   13.495  1.00 5.92  ? 121  ILE A N     1 
ATOM   33   C CA    . ILE A 1 14  ? 27.493  3.517   14.047  1.00 6.04  ? 121  ILE A CA    1 
ATOM   34   C C     . ILE A 1 14  ? 27.420  3.373   15.574  1.00 5.80  ? 121  ILE A C     1 
ATOM   35   O O     . ILE A 1 14  ? 26.590  2.634   16.101  1.00 5.54  ? 121  ILE A O     1 
ATOM   36   C CB    . ILE A 1 14  ? 26.105  3.817   13.469  1.00 6.35  ? 121  ILE A CB    1 
ATOM   37   C CG1   . ILE A 1 14  ? 26.154  3.835   11.936  1.00 6.79  ? 121  ILE A CG1   1 
ATOM   38   C CG2   . ILE A 1 14  ? 25.600  5.165   13.962  1.00 6.50  ? 121  ILE A CG2   1 
ATOM   39   C CD1   . ILE A 1 14  ? 24.786  4.013   11.282  1.00 7.65  ? 121  ILE A CD1   1 
ATOM   40   N N     . TYR A 1 15  ? 28.304  4.064   16.278  1.00 5.71  ? 122  TYR A N     1 
ATOM   41   C CA    . TYR A 1 15  ? 28.300  4.007   17.733  1.00 5.65  ? 122  TYR A CA    1 
ATOM   42   C C     . TYR A 1 15  ? 27.479  5.132   18.319  1.00 5.62  ? 122  TYR A C     1 
ATOM   43   O O     . TYR A 1 15  ? 27.680  6.304   17.993  1.00 6.01  ? 122  TYR A O     1 
ATOM   44   C CB    . TYR A 1 15  ? 29.719  4.092   18.288  1.00 5.69  ? 122  TYR A CB    1 
ATOM   45   C CG    . TYR A 1 15  ? 30.466  2.790   18.211  1.00 5.87  ? 122  TYR A CG    1 
ATOM   46   C CD1   . TYR A 1 15  ? 31.219  2.470   17.089  1.00 6.06  ? 122  TYR A CD1   1 
ATOM   47   C CD2   . TYR A 1 15  ? 30.420  1.877   19.257  1.00 5.78  ? 122  TYR A CD2   1 
ATOM   48   C CE1   . TYR A 1 15  ? 31.900  1.285   17.007  1.00 6.49  ? 122  TYR A CE1   1 
ATOM   49   C CE2   . TYR A 1 15  ? 31.106  0.683   19.184  1.00 6.65  ? 122  TYR A CE2   1 
ATOM   50   C CZ    . TYR A 1 15  ? 31.842  0.396   18.055  1.00 6.75  ? 122  TYR A CZ    1 
ATOM   51   O OH    . TYR A 1 15  ? 32.531  -0.783  17.973  1.00 9.10  ? 122  TYR A OH    1 
ATOM   52   N N     . TYR A 1 16  ? 26.551  4.773   19.190  1.00 5.73  ? 123  TYR A N     1 
ATOM   53   C CA    . TYR A 1 16  ? 25.770  5.769   19.901  1.00 6.09  ? 123  TYR A CA    1 
ATOM   54   C C     . TYR A 1 16  ? 26.603  6.258   21.080  1.00 5.50  ? 123  TYR A C     1 
ATOM   55   O O     . TYR A 1 16  ? 27.512  5.561   21.556  1.00 5.44  ? 123  TYR A O     1 
ATOM   56   C CB    . TYR A 1 16  ? 24.457  5.180   20.405  1.00 6.43  ? 123  TYR A CB    1 
ATOM   57   C CG    . TYR A 1 16  ? 23.532  4.727   19.308  1.00 7.37  ? 123  TYR A CG    1 
ATOM   58   C CD1   . TYR A 1 16  ? 23.343  3.381   19.055  1.00 8.49  ? 123  TYR A CD1   1 
ATOM   59   C CD2   . TYR A 1 16  ? 22.840  5.648   18.528  1.00 8.33  ? 123  TYR A CD2   1 
ATOM   60   C CE1   . TYR A 1 16  ? 22.488  2.952   18.050  1.00 8.58  ? 123  TYR A CE1   1 
ATOM   61   C CE2   . TYR A 1 16  ? 21.984  5.234   17.515  1.00 8.85  ? 123  TYR A CE2   1 
ATOM   62   C CZ    . TYR A 1 16  ? 21.815  3.883   17.284  1.00 9.47  ? 123  TYR A CZ    1 
ATOM   63   O OH    . TYR A 1 16  ? 20.969  3.448   16.296  1.00 11.11 ? 123  TYR A OH    1 
ATOM   64   N N     . PRO A 1 17  ? 26.303  7.453   21.564  1.00 5.04  ? 124  PRO A N     1 
ATOM   65   C CA    . PRO A 1 17  ? 27.026  8.012   22.709  1.00 4.56  ? 124  PRO A CA    1 
ATOM   66   C C     . PRO A 1 17  ? 26.979  7.113   23.955  1.00 3.98  ? 124  PRO A C     1 
ATOM   67   O O     . PRO A 1 17  ? 27.880  7.201   24.781  1.00 3.93  ? 124  PRO A O     1 
ATOM   68   C CB    . PRO A 1 17  ? 26.311  9.349   22.970  1.00 4.62  ? 124  PRO A CB    1 
ATOM   69   C CG    . PRO A 1 17  ? 25.365  9.565   21.870  1.00 5.23  ? 124  PRO A CG    1 
ATOM   70   C CD    . PRO A 1 17  ? 25.265  8.357   21.059  1.00 5.10  ? 124  PRO A CD    1 
ATOM   71   N N     . ASP A 1 18  ? 25.966  6.257   24.066  1.00 3.55  ? 125  ASP A N     1 
ATOM   72   C CA    . ASP A 1 18  ? 25.821  5.359   25.207  1.00 3.08  ? 125  ASP A CA    1 
ATOM   73   C C     . ASP A 1 18  ? 26.691  4.110   25.104  1.00 3.21  ? 125  ASP A C     1 
ATOM   74   O O     . ASP A 1 18  ? 26.774  3.342   26.056  1.00 2.98  ? 125  ASP A O     1 
ATOM   75   C CB    . ASP A 1 18  ? 24.365  4.953   25.422  1.00 2.63  ? 125  ASP A CB    1 
ATOM   76   C CG    . ASP A 1 18  ? 23.731  4.358   24.181  1.00 2.85  ? 125  ASP A CG    1 
ATOM   77   O OD1   . ASP A 1 18  ? 24.275  3.374   23.635  1.00 2.64  ? 125  ASP A OD1   1 
ATOM   78   O OD2   . ASP A 1 18  ? 22.675  4.814   23.706  1.00 3.02  ? 125  ASP A OD2   1 
ATOM   79   N N     . GLY A 1 19  ? 27.320  3.888   23.955  1.00 3.70  ? 126  GLY A N     1 
ATOM   80   C CA    . GLY A 1 19  ? 28.228  2.756   23.814  1.00 3.59  ? 126  GLY A CA    1 
ATOM   81   C C     . GLY A 1 19  ? 27.684  1.636   22.955  1.00 3.82  ? 126  GLY A C     1 
ATOM   82   O O     . GLY A 1 19  ? 28.433  0.769   22.515  1.00 3.55  ? 126  GLY A O     1 
ATOM   83   N N     . GLY A 1 20  ? 26.371  1.642   22.718  1.00 3.88  ? 127  GLY A N     1 
ATOM   84   C CA    . GLY A 1 20  ? 25.761  0.659   21.840  1.00 4.21  ? 127  GLY A CA    1 
ATOM   85   C C     . GLY A 1 20  ? 26.096  1.018   20.395  1.00 4.61  ? 127  GLY A C     1 
ATOM   86   O O     . GLY A 1 20  ? 26.593  2.109   20.109  1.00 4.48  ? 127  GLY A O     1 
ATOM   87   N N     . SER A 1 21  ? 25.825  0.110   19.470  1.00 5.37  ? 128  SER A N     1 
ATOM   88   C CA    . SER A 1 21  ? 26.140  0.372   18.070  1.00 5.88  ? 128  SER A CA    1 
ATOM   89   C C     . SER A 1 21  ? 25.253  -0.376  17.094  1.00 6.17  ? 128  SER A C     1 
ATOM   90   O O     . SER A 1 21  ? 24.612  -1.363  17.446  1.00 5.68  ? 128  SER A O     1 
ATOM   91   C CB    . SER A 1 21  ? 27.619  0.028   17.808  1.00 6.36  ? 128  SER A CB    1 
ATOM   92   O OG    . SER A 1 21  ? 27.904  -1.320  18.139  1.00 6.52  ? 128  SER A OG    1 
ATOM   93   N N     . LEU A 1 22  ? 25.203  0.150   15.870  1.00 6.68  ? 129  LEU A N     1 
ATOM   94   C CA    . LEU A 1 22  ? 24.546  -0.488  14.742  1.00 7.41  ? 129  LEU A CA    1 
ATOM   95   C C     . LEU A 1 22  ? 25.678  -0.852  13.776  1.00 7.31  ? 129  LEU A C     1 
ATOM   96   O O     . LEU A 1 22  ? 26.581  -0.041  13.520  1.00 7.01  ? 129  LEU A O     1 
ATOM   97   C CB    . LEU A 1 22  ? 23.546  0.469   14.084  1.00 7.78  ? 129  LEU A CB    1 
ATOM   98   C CG    . LEU A 1 22  ? 22.059  0.098   14.150  1.00 10.11 ? 129  LEU A CG    1 
ATOM   99   C CD1   . LEU A 1 22  ? 21.609  -0.271  15.535  1.00 11.82 ? 129  LEU A CD1   1 
ATOM   100  C CD2   . LEU A 1 22  ? 21.209  1.256   13.588  1.00 10.96 ? 129  LEU A CD2   1 
ATOM   101  N N     . VAL A 1 23  ? 25.652  -2.075  13.256  1.00 7.45  ? 130  VAL A N     1 
ATOM   102  C CA    . VAL A 1 23  ? 26.715  -2.540  12.373  1.00 7.62  ? 130  VAL A CA    1 
ATOM   103  C C     . VAL A 1 23  ? 26.200  -3.410  11.245  1.00 7.84  ? 130  VAL A C     1 
ATOM   104  O O     . VAL A 1 23  ? 25.346  -4.265  11.448  1.00 8.27  ? 130  VAL A O     1 
ATOM   105  C CB    . VAL A 1 23  ? 27.722  -3.377  13.136  1.00 7.81  ? 130  VAL A CB    1 
ATOM   106  C CG1   . VAL A 1 23  ? 28.953  -3.618  12.265  1.00 7.47  ? 130  VAL A CG1   1 
ATOM   107  C CG2   . VAL A 1 23  ? 28.079  -2.689  14.417  1.00 8.87  ? 130  VAL A CG2   1 
ATOM   108  N N     . GLY A 1 24  ? 26.740  -3.196  10.055  1.00 7.83  ? 131  GLY A N     1 
ATOM   109  C CA    . GLY A 1 24  ? 26.349  -3.988  8.903   1.00 7.72  ? 131  GLY A CA    1 
ATOM   110  C C     . GLY A 1 24  ? 26.744  -3.336  7.597   1.00 8.01  ? 131  GLY A C     1 
ATOM   111  O O     . GLY A 1 24  ? 27.115  -2.155  7.536   1.00 6.88  ? 131  GLY A O     1 
ATOM   112  N N     . GLU A 1 25  ? 26.693  -4.139  6.545   1.00 8.56  ? 132  GLU A N     1 
ATOM   113  C CA    . GLU A 1 25  ? 26.931  -3.650  5.207   1.00 9.76  ? 132  GLU A CA    1 
ATOM   114  C C     . GLU A 1 25  ? 25.855  -2.630  4.884   1.00 9.88  ? 132  GLU A C     1 
ATOM   115  O O     . GLU A 1 25  ? 24.685  -2.877  5.150   1.00 10.33 ? 132  GLU A O     1 
ATOM   116  C CB    . GLU A 1 25  ? 26.773  -4.795  4.209   1.00 10.61 ? 132  GLU A CB    1 
ATOM   117  C CG    . GLU A 1 25  ? 28.057  -5.375  3.662   1.00 12.77 ? 132  GLU A CG    1 
ATOM   118  C CD    . GLU A 1 25  ? 27.834  -6.071  2.335   1.00 14.90 ? 132  GLU A CD    1 
ATOM   119  O OE1   . GLU A 1 25  ? 26.692  -6.069  1.849   1.00 17.36 ? 132  GLU A OE1   1 
ATOM   120  O OE2   . GLU A 1 25  ? 28.804  -6.614  1.768   1.00 16.80 ? 132  GLU A OE2   1 
ATOM   121  N N     . VAL A 1 26  ? 26.231  -1.495  4.310   1.00 10.07 ? 133  VAL A N     1 
ATOM   122  C CA    . VAL A 1 26  ? 25.234  -0.516  3.848   1.00 10.25 ? 133  VAL A CA    1 
ATOM   123  C C     . VAL A 1 26  ? 24.729  -0.853  2.433   1.00 10.42 ? 133  VAL A C     1 
ATOM   124  O O     . VAL A 1 26  ? 25.398  -1.575  1.695   1.00 9.26  ? 133  VAL A O     1 
ATOM   125  C CB    . VAL A 1 26  ? 25.797  0.910   3.870   1.00 10.52 ? 133  VAL A CB    1 
ATOM   126  C CG1   . VAL A 1 26  ? 26.278  1.237   5.252   1.00 10.72 ? 133  VAL A CG1   1 
ATOM   127  C CG2   . VAL A 1 26  ? 26.920  1.082   2.851   1.00 10.68 ? 133  VAL A CG2   1 
ATOM   128  N N     . ASN A 1 27  ? 23.541  -0.339  2.077   1.00 10.94 ? 134  ASN A N     1 
ATOM   129  C CA    . ASN A 1 27  ? 22.936  -0.558  0.756   1.00 11.92 ? 134  ASN A CA    1 
ATOM   130  C C     . ASN A 1 27  ? 23.704  0.253   -0.293  1.00 12.39 ? 134  ASN A C     1 
ATOM   131  O O     . ASN A 1 27  ? 24.599  1.030   0.041   1.00 11.91 ? 134  ASN A O     1 
ATOM   132  C CB    . ASN A 1 27  ? 21.446  -0.102  0.768   1.00 11.89 ? 134  ASN A CB    1 
ATOM   133  C CG    A ASN A 1 27  ? 20.496  -1.066  0.269   0.50 13.75 ? 134  ASN A CG    1 
ATOM   134  C CG    B ASN A 1 27  ? 21.305  1.409   0.958   0.50 12.62 ? 134  ASN A CG    1 
ATOM   135  O OD1   A ASN A 1 27  ? 20.857  -2.146  -0.162  0.50 15.50 ? 134  ASN A OD1   1 
ATOM   136  O OD1   B ASN A 1 27  ? 22.289  2.136   1.015   0.50 13.62 ? 134  ASN A OD1   1 
ATOM   137  N ND2   A ASN A 1 27  ? 19.235  -0.632  0.183   0.50 14.57 ? 134  ASN A ND2   1 
ATOM   138  N ND2   B ASN A 1 27  ? 20.070  1.880   1.015   0.50 13.29 ? 134  ASN A ND2   1 
ATOM   139  N N     . GLU A 1 28  ? 23.340  0.089   -1.563  1.00 13.28 ? 135  GLU A N     1 
ATOM   140  C CA    . GLU A 1 28  ? 23.973  0.862   -2.630  1.00 14.12 ? 135  GLU A CA    1 
ATOM   141  C C     . GLU A 1 28  ? 23.812  2.368   -2.347  1.00 14.41 ? 135  GLU A C     1 
ATOM   142  O O     . GLU A 1 28  ? 24.527  3.190   -2.918  1.00 14.88 ? 135  GLU A O     1 
ATOM   143  C CB    . GLU A 1 28  ? 23.433  0.475   -4.026  1.00 14.45 ? 135  GLU A CB    1 
ATOM   144  C CG    . GLU A 1 28  ? 21.955  0.726   -4.294  1.00 15.44 ? 135  GLU A CG    1 
ATOM   145  C CD    . GLU A 1 28  ? 21.568  0.407   -5.735  1.00 16.94 ? 135  GLU A CD    1 
ATOM   146  O OE1   . GLU A 1 28  ? 22.468  0.069   -6.538  1.00 17.74 ? 135  GLU A OE1   1 
ATOM   147  O OE2   . GLU A 1 28  ? 20.366  0.501   -6.085  1.00 17.47 ? 135  GLU A OE2   1 
ATOM   148  N N     . ASP A 1 29  ? 22.890  2.713   -1.446  1.00 14.52 ? 136  ASP A N     1 
ATOM   149  C CA    . ASP A 1 29  ? 22.604  4.105   -1.083  1.00 14.64 ? 136  ASP A CA    1 
ATOM   150  C C     . ASP A 1 29  ? 23.153  4.501   0.291   1.00 14.53 ? 136  ASP A C     1 
ATOM   151  O O     . ASP A 1 29  ? 22.784  5.548   0.825   1.00 14.88 ? 136  ASP A O     1 
ATOM   152  C CB    . ASP A 1 29  ? 21.090  4.344   -1.066  1.00 14.86 ? 136  ASP A CB    1 
ATOM   153  C CG    . ASP A 1 29  ? 20.460  4.271   -2.443  1.00 15.26 ? 136  ASP A CG    1 
ATOM   154  O OD1   . ASP A 1 29  ? 21.185  4.369   -3.456  1.00 15.80 ? 136  ASP A OD1   1 
ATOM   155  O OD2   . ASP A 1 29  ? 19.233  4.120   -2.607  1.00 15.74 ? 136  ASP A OD2   1 
ATOM   156  N N     . GLY A 1 30  ? 24.008  3.666   0.876   1.00 14.11 ? 137  GLY A N     1 
ATOM   157  C CA    . GLY A 1 30  ? 24.585  3.960   2.179   1.00 13.69 ? 137  GLY A CA    1 
ATOM   158  C C     . GLY A 1 30  ? 23.634  3.851   3.361   1.00 13.26 ? 137  GLY A C     1 
ATOM   159  O O     . GLY A 1 30  ? 23.916  4.401   4.427   1.00 13.56 ? 137  GLY A O     1 
ATOM   160  N N     . GLU A 1 31  ? 22.520  3.142   3.197   1.00 12.56 ? 138  GLU A N     1 
ATOM   161  C CA    . GLU A 1 31  ? 21.573  2.951   4.302   1.00 12.13 ? 138  GLU A CA    1 
ATOM   162  C C     . GLU A 1 31  ? 21.793  1.602   4.988   1.00 11.37 ? 138  GLU A C     1 
ATOM   163  O O     . GLU A 1 31  ? 22.238  0.648   4.354   1.00 11.03 ? 138  GLU A O     1 
ATOM   164  C CB    . GLU A 1 31  ? 20.132  3.043   3.807   1.00 12.20 ? 138  GLU A CB    1 
ATOM   165  C CG    . GLU A 1 31  ? 19.762  4.404   3.243   1.00 13.10 ? 138  GLU A CG    1 
ATOM   166  C CD    . GLU A 1 31  ? 18.564  4.341   2.320   1.00 14.32 ? 138  GLU A CD    1 
ATOM   167  O OE1   . GLU A 1 31  ? 18.166  3.219   1.942   1.00 15.05 ? 138  GLU A OE1   1 
ATOM   168  O OE2   . GLU A 1 31  ? 18.026  5.410   1.957   1.00 15.58 ? 138  GLU A OE2   1 
ATOM   169  N N     . MET A 1 32  ? 21.489  1.528   6.285   1.00 10.72 ? 139  MET A N     1 
ATOM   170  C CA    . MET A 1 32  ? 21.592  0.284   7.038   1.00 10.35 ? 139  MET A CA    1 
ATOM   171  C C     . MET A 1 32  ? 20.399  -0.617  6.787   1.00 9.24  ? 139  MET A C     1 
ATOM   172  O O     . MET A 1 32  ? 19.541  -0.779  7.652   1.00 8.26  ? 139  MET A O     1 
ATOM   173  C CB    . MET A 1 32  ? 21.672  0.584   8.529   1.00 11.29 ? 139  MET A CB    1 
ATOM   174  C CG    . MET A 1 32  ? 22.928  1.315   8.887   1.00 14.10 ? 139  MET A CG    1 
ATOM   175  S SD    . MET A 1 32  ? 24.340  0.197   8.839   1.00 20.90 ? 139  MET A SD    1 
ATOM   176  C CE    . MET A 1 32  ? 24.057  -0.735  10.285  1.00 20.60 ? 139  MET A CE    1 
ATOM   177  N N     . THR A 1 33  ? 20.360  -1.203  5.592   1.00 8.20  ? 140  THR A N     1 
ATOM   178  C CA    . THR A 1 33  ? 19.276  -2.065  5.171   1.00 7.66  ? 140  THR A CA    1 
ATOM   179  C C     . THR A 1 33  ? 19.836  -3.369  4.643   1.00 7.44  ? 140  THR A C     1 
ATOM   180  O O     . THR A 1 33  ? 20.634  -3.367  3.717   1.00 7.48  ? 140  THR A O     1 
ATOM   181  C CB    . THR A 1 33  ? 18.526  -1.378  4.024   1.00 7.49  ? 140  THR A CB    1 
ATOM   182  O OG1   . THR A 1 33  ? 18.095  -0.077  4.443   1.00 7.44  ? 140  THR A OG1   1 
ATOM   183  C CG2   . THR A 1 33  ? 17.242  -2.114  3.657   1.00 7.50  ? 140  THR A CG2   1 
ATOM   184  N N     . GLY A 1 34  ? 19.409  -4.482  5.222   1.00 7.61  ? 141  GLY A N     1 
ATOM   185  C CA    . GLY A 1 34  ? 19.866  -5.789  4.789   1.00 7.57  ? 141  GLY A CA    1 
ATOM   186  C C     . GLY A 1 34  ? 19.420  -6.844  5.782   1.00 7.70  ? 141  GLY A C     1 
ATOM   187  O O     . GLY A 1 34  ? 18.803  -6.509  6.800   1.00 7.59  ? 141  GLY A O     1 
ATOM   188  N N     . GLU A 1 35  ? 19.767  -8.102  5.513   1.00 7.72  ? 142  GLU A N     1 
ATOM   189  C CA    . GLU A 1 35  ? 19.361  -9.232  6.356   1.00 8.07  ? 142  GLU A CA    1 
ATOM   190  C C     . GLU A 1 35  ? 20.414  -9.641  7.367   1.00 7.91  ? 142  GLU A C     1 
ATOM   191  O O     . GLU A 1 35  ? 20.180  -10.523 8.193   1.00 7.61  ? 142  GLU A O     1 
ATOM   192  C CB    . GLU A 1 35  ? 19.056  -10.442 5.475   1.00 8.60  ? 142  GLU A CB    1 
ATOM   193  C CG    . GLU A 1 35  ? 17.878  -10.230 4.541   1.00 10.48 ? 142  GLU A CG    1 
ATOM   194  C CD    . GLU A 1 35  ? 16.545  -10.378 5.242   1.00 12.69 ? 142  GLU A CD    1 
ATOM   195  O OE1   . GLU A 1 35  ? 16.516  -10.311 6.485   1.00 14.31 ? 142  GLU A OE1   1 
ATOM   196  O OE2   . GLU A 1 35  ? 15.527  -10.561 4.545   1.00 14.94 ? 142  GLU A OE2   1 
ATOM   197  N N     . LYS A 1 36  ? 21.576  -9.010  7.288   1.00 7.58  ? 143  LYS A N     1 
ATOM   198  C CA    . LYS A 1 36  ? 22.684  -9.353  8.160   1.00 7.56  ? 143  LYS A CA    1 
ATOM   199  C C     . LYS A 1 36  ? 23.183  -8.116  8.892   1.00 7.45  ? 143  LYS A C     1 
ATOM   200  O O     . LYS A 1 36  ? 24.385  -7.887  8.988   1.00 7.79  ? 143  LYS A O     1 
ATOM   201  C CB    . LYS A 1 36  ? 23.808  -9.985  7.341   1.00 7.63  ? 143  LYS A CB    1 
ATOM   202  C CG    . LYS A 1 36  ? 23.429  -11.335 6.723   1.00 7.75  ? 143  LYS A CG    1 
ATOM   203  C CD    . LYS A 1 36  ? 24.554  -11.902 5.871   1.00 8.89  ? 143  LYS A CD    1 
ATOM   204  C CE    . LYS A 1 36  ? 24.185  -13.242 5.262   1.00 10.51 ? 143  LYS A CE    1 
ATOM   205  N NZ    . LYS A 1 36  ? 25.306  -13.829 4.466   1.00 11.82 ? 143  LYS A NZ    1 
ATOM   206  N N     . ILE A 1 37  ? 22.256  -7.316  9.407   1.00 7.24  ? 144  ILE A N     1 
ATOM   207  C CA    . ILE A 1 37  ? 22.617  -6.111  10.157  1.00 7.37  ? 144  ILE A CA    1 
ATOM   208  C C     . ILE A 1 37  ? 22.461  -6.412  11.643  1.00 7.00  ? 144  ILE A C     1 
ATOM   209  O O     . ILE A 1 37  ? 21.740  -7.333  12.008  1.00 6.71  ? 144  ILE A O     1 
ATOM   210  C CB    . ILE A 1 37  ? 21.758  -4.926  9.725   1.00 7.95  ? 144  ILE A CB    1 
ATOM   211  C CG1   . ILE A 1 37  ? 22.066  -4.586  8.260   1.00 9.50  ? 144  ILE A CG1   1 
ATOM   212  C CG2   . ILE A 1 37  ? 21.998  -3.722  10.610  1.00 7.98  ? 144  ILE A CG2   1 
ATOM   213  C CD1   . ILE A 1 37  ? 21.303  -3.432  7.744   1.00 10.75 ? 144  ILE A CD1   1 
ATOM   214  N N     . ALA A 1 38  ? 23.161  -5.675  12.505  1.00 6.55  ? 145  ALA A N     1 
ATOM   215  C CA    . ALA A 1 38  ? 23.060  -5.947  13.924  1.00 6.38  ? 145  ALA A CA    1 
ATOM   216  C C     . ALA A 1 38  ? 23.103  -4.720  14.822  1.00 6.21  ? 145  ALA A C     1 
ATOM   217  O O     . ALA A 1 38  ? 23.744  -3.709  14.515  1.00 6.27  ? 145  ALA A O     1 
ATOM   218  C CB    . ALA A 1 38  ? 24.182  -6.892  14.344  1.00 6.56  ? 145  ALA A CB    1 
ATOM   219  N N     . TYR A 1 39  ? 22.397  -4.821  15.935  1.00 5.83  ? 146  TYR A N     1 
ATOM   220  C CA    . TYR A 1 39  ? 22.567  -3.855  16.991  1.00 5.75  ? 146  TYR A CA    1 
ATOM   221  C C     . TYR A 1 39  ? 23.451  -4.543  18.015  1.00 5.68  ? 146  TYR A C     1 
ATOM   222  O O     . TYR A 1 39  ? 23.214  -5.695  18.365  1.00 5.97  ? 146  TYR A O     1 
ATOM   223  C CB    . TYR A 1 39  ? 21.278  -3.491  17.680  1.00 5.65  ? 146  TYR A CB    1 
ATOM   224  C CG    . TYR A 1 39  ? 21.556  -2.722  18.955  1.00 5.17  ? 146  TYR A CG    1 
ATOM   225  C CD1   . TYR A 1 39  ? 21.855  -1.366  18.922  1.00 4.51  ? 146  TYR A CD1   1 
ATOM   226  C CD2   . TYR A 1 39  ? 21.566  -3.364  20.193  1.00 4.81  ? 146  TYR A CD2   1 
ATOM   227  C CE1   . TYR A 1 39  ? 22.124  -0.661  20.096  1.00 4.27  ? 146  TYR A CE1   1 
ATOM   228  C CE2   . TYR A 1 39  ? 21.825  -2.671  21.359  1.00 4.42  ? 146  TYR A CE2   1 
ATOM   229  C CZ    . TYR A 1 39  ? 22.107  -1.322  21.306  1.00 4.15  ? 146  TYR A CZ    1 
ATOM   230  O OH    . TYR A 1 39  ? 22.373  -0.623  22.469  1.00 3.48  ? 146  TYR A OH    1 
ATOM   231  N N     . VAL A 1 40  ? 24.458  -3.845  18.509  1.00 5.56  ? 147  VAL A N     1 
ATOM   232  C CA    . VAL A 1 40  ? 25.326  -4.434  19.509  1.00 5.28  ? 147  VAL A CA    1 
ATOM   233  C C     . VAL A 1 40  ? 25.213  -3.592  20.781  1.00 4.80  ? 147  VAL A C     1 
ATOM   234  O O     . VAL A 1 40  ? 25.357  -2.370  20.735  1.00 4.27  ? 147  VAL A O     1 
ATOM   235  C CB    . VAL A 1 40  ? 26.791  -4.503  19.025  1.00 5.60  ? 147  VAL A CB    1 
ATOM   236  C CG1   . VAL A 1 40  ? 27.644  -5.214  20.036  1.00 5.40  ? 147  VAL A CG1   1 
ATOM   237  C CG2   . VAL A 1 40  ? 26.869  -5.217  17.673  1.00 6.04  ? 147  VAL A CG2   1 
ATOM   238  N N     . TYR A 1 41  ? 24.933  -4.249  21.902  1.00 4.48  ? 148  TYR A N     1 
ATOM   239  C CA    . TYR A 1 41  ? 24.817  -3.575  23.194  1.00 4.13  ? 148  TYR A CA    1 
ATOM   240  C C     . TYR A 1 41  ? 26.181  -2.994  23.603  1.00 3.93  ? 148  TYR A C     1 
ATOM   241  O O     . TYR A 1 41  ? 27.193  -3.334  22.992  1.00 4.16  ? 148  TYR A O     1 
ATOM   242  C CB    . TYR A 1 41  ? 24.291  -4.555  24.243  1.00 3.94  ? 148  TYR A CB    1 
ATOM   243  C CG    . TYR A 1 41  ? 22.795  -4.859  24.136  1.00 3.58  ? 148  TYR A CG    1 
ATOM   244  C CD1   . TYR A 1 41  ? 22.327  -5.880  23.325  1.00 3.66  ? 148  TYR A CD1   1 
ATOM   245  C CD2   . TYR A 1 41  ? 21.869  -4.132  24.865  1.00 3.02  ? 148  TYR A CD2   1 
ATOM   246  C CE1   . TYR A 1 41  ? 20.983  -6.167  23.248  1.00 4.23  ? 148  TYR A CE1   1 
ATOM   247  C CE2   . TYR A 1 41  ? 20.515  -4.400  24.791  1.00 3.42  ? 148  TYR A CE2   1 
ATOM   248  C CZ    . TYR A 1 41  ? 20.076  -5.422  23.975  1.00 3.79  ? 148  TYR A CZ    1 
ATOM   249  O OH    . TYR A 1 41  ? 18.740  -5.721  23.900  1.00 4.39  ? 148  TYR A OH    1 
ATOM   250  N N     . PRO A 1 42  ? 26.216  -2.117  24.614  1.00 3.52  ? 149  PRO A N     1 
ATOM   251  C CA    . PRO A 1 42  ? 27.463  -1.488  25.059  1.00 3.71  ? 149  PRO A CA    1 
ATOM   252  C C     . PRO A 1 42  ? 28.520  -2.429  25.607  1.00 3.72  ? 149  PRO A C     1 
ATOM   253  O O     . PRO A 1 42  ? 29.644  -1.979  25.827  1.00 3.15  ? 149  PRO A O     1 
ATOM   254  C CB    . PRO A 1 42  ? 26.999  -0.534  26.166  1.00 3.63  ? 149  PRO A CB    1 
ATOM   255  C CG    . PRO A 1 42  ? 25.556  -0.323  25.932  1.00 3.10  ? 149  PRO A CG    1 
ATOM   256  C CD    . PRO A 1 42  ? 25.068  -1.619  25.385  1.00 3.36  ? 149  PRO A CD    1 
ATOM   257  N N     . ASP A 1 43  ? 28.195  -3.698  25.820  1.00 4.10  ? 150  ASP A N     1 
ATOM   258  C CA    . ASP A 1 43  ? 29.219  -4.647  26.257  1.00 4.16  ? 150  ASP A CA    1 
ATOM   259  C C     . ASP A 1 43  ? 30.088  -5.102  25.073  1.00 4.57  ? 150  ASP A C     1 
ATOM   260  O O     . ASP A 1 43  ? 31.110  -5.769  25.277  1.00 4.32  ? 150  ASP A O     1 
ATOM   261  C CB    . ASP A 1 43  ? 28.632  -5.834  27.034  1.00 4.16  ? 150  ASP A CB    1 
ATOM   262  C CG    . ASP A 1 43  ? 27.697  -6.702  26.218  1.00 4.50  ? 150  ASP A CG    1 
ATOM   263  O OD1   . ASP A 1 43  ? 27.395  -6.381  25.041  1.00 4.01  ? 150  ASP A OD1   1 
ATOM   264  O OD2   . ASP A 1 43  ? 27.199  -7.741  26.711  1.00 4.84  ? 150  ASP A OD2   1 
ATOM   265  N N     . GLU A 1 44  ? 29.710  -4.680  23.863  1.00 4.71  ? 151  GLU A N     1 
ATOM   266  C CA    . GLU A 1 44  ? 30.388  -5.043  22.617  1.00 5.51  ? 151  GLU A CA    1 
ATOM   267  C C     . GLU A 1 44  ? 30.408  -6.554  22.441  1.00 5.71  ? 151  GLU A C     1 
ATOM   268  O O     . GLU A 1 44  ? 31.357  -7.117  21.909  1.00 5.94  ? 151  GLU A O     1 
ATOM   269  C CB    . GLU A 1 44  ? 31.796  -4.464  22.555  1.00 6.19  ? 151  GLU A CB    1 
ATOM   270  C CG    . GLU A 1 44  ? 31.809  -2.948  22.701  1.00 7.98  ? 151  GLU A CG    1 
ATOM   271  C CD    . GLU A 1 44  ? 33.198  -2.358  22.605  1.00 9.90  ? 151  GLU A CD    1 
ATOM   272  O OE1   . GLU A 1 44  ? 33.909  -2.350  23.625  1.00 11.04 ? 151  GLU A OE1   1 
ATOM   273  O OE2   . GLU A 1 44  ? 33.570  -1.893  21.510  1.00 12.19 ? 151  GLU A OE2   1 
ATOM   274  N N     . ARG A 1 45  ? 29.336  -7.208  22.872  1.00 5.92  ? 152  ARG A N     1 
ATOM   275  C CA    . ARG A 1 45  ? 29.271  -8.663  22.846  1.00 6.09  ? 152  ARG A CA    1 
ATOM   276  C C     . ARG A 1 45  ? 27.870  -9.156  22.530  1.00 5.87  ? 152  ARG A C     1 
ATOM   277  O O     . ARG A 1 45  ? 27.682  -9.962  21.623  1.00 6.13  ? 152  ARG A O     1 
ATOM   278  C CB    . ARG A 1 45  ? 29.723  -9.216  24.206  1.00 6.65  ? 152  ARG A CB    1 
ATOM   279  C CG    . ARG A 1 45  ? 29.715  -10.730 24.288  1.00 7.72  ? 152  ARG A CG    1 
ATOM   280  C CD    . ARG A 1 45  ? 30.177  -11.289 25.644  1.00 9.71  ? 152  ARG A CD    1 
ATOM   281  N NE    . ARG A 1 45  ? 30.019  -12.741 25.683  1.00 11.70 ? 152  ARG A NE    1 
ATOM   282  C CZ    . ARG A 1 45  ? 31.007  -13.605 25.870  1.00 13.50 ? 152  ARG A CZ    1 
ATOM   283  N NH1   . ARG A 1 45  ? 32.247  -13.183 26.085  1.00 14.88 ? 152  ARG A NH1   1 
ATOM   284  N NH2   . ARG A 1 45  ? 30.753  -14.906 25.867  1.00 14.21 ? 152  ARG A NH2   1 
ATOM   285  N N     . THR A 1 46  ? 26.890  -8.686  23.291  1.00 5.66  ? 153  THR A N     1 
ATOM   286  C CA    . THR A 1 46  ? 25.507  -9.066  23.066  1.00 5.27  ? 153  THR A CA    1 
ATOM   287  C C     . THR A 1 46  ? 24.984  -8.289  21.884  1.00 5.05  ? 153  THR A C     1 
ATOM   288  O O     . THR A 1 46  ? 25.111  -7.060  21.842  1.00 4.35  ? 153  THR A O     1 
ATOM   289  C CB    . THR A 1 46  ? 24.656  -8.749  24.274  1.00 5.42  ? 153  THR A CB    1 
ATOM   290  O OG1   . THR A 1 46  ? 25.280  -9.288  25.445  1.00 6.02  ? 153  THR A OG1   1 
ATOM   291  C CG2   . THR A 1 46  ? 23.311  -9.467  24.197  1.00 5.91  ? 153  THR A CG2   1 
ATOM   292  N N     . ALA A 1 47  ? 24.373  -9.010  20.947  1.00 4.76  ? 154  ALA A N     1 
ATOM   293  C CA    . ALA A 1 47  ? 23.892  -8.413  19.723  1.00 4.85  ? 154  ALA A CA    1 
ATOM   294  C C     . ALA A 1 47  ? 22.514  -8.935  19.326  1.00 4.90  ? 154  ALA A C     1 
ATOM   295  O O     . ALA A 1 47  ? 22.090  -10.016 19.740  1.00 5.00  ? 154  ALA A O     1 
ATOM   296  C CB    . ALA A 1 47  ? 24.885  -8.678  18.600  1.00 4.69  ? 154  ALA A CB    1 
ATOM   297  N N     . LEU A 1 48  ? 21.838  -8.137  18.508  1.00 5.04  ? 155  LEU A N     1 
ATOM   298  C CA    . LEU A 1 48  ? 20.543  -8.475  17.934  1.00 4.96  ? 155  LEU A CA    1 
ATOM   299  C C     . LEU A 1 48  ? 20.792  -8.437  16.420  1.00 5.23  ? 155  LEU A C     1 
ATOM   300  O O     . LEU A 1 48  ? 20.928  -7.370  15.836  1.00 5.43  ? 155  LEU A O     1 
ATOM   301  C CB    . LEU A 1 48  ? 19.488  -7.453  18.363  1.00 4.60  ? 155  LEU A CB    1 
ATOM   302  C CG    . LEU A 1 48  ? 19.311  -7.227  19.871  1.00 4.30  ? 155  LEU A CG    1 
ATOM   303  C CD1   . LEU A 1 48  ? 18.176  -6.271  20.143  1.00 4.42  ? 155  LEU A CD1   1 
ATOM   304  C CD2   . LEU A 1 48  ? 19.082  -8.530  20.607  1.00 3.93  ? 155  LEU A CD2   1 
ATOM   305  N N     . TYR A 1 49  ? 20.866  -9.613  15.805  1.00 5.87  ? 156  TYR A N     1 
ATOM   306  C CA    . TYR A 1 49  ? 21.312  -9.782  14.422  1.00 6.34  ? 156  TYR A CA    1 
ATOM   307  C C     . TYR A 1 49  ? 20.205  -10.268 13.497  1.00 6.17  ? 156  TYR A C     1 
ATOM   308  O O     . TYR A 1 49  ? 19.532  -11.251 13.798  1.00 5.91  ? 156  TYR A O     1 
ATOM   309  C CB    . TYR A 1 49  ? 22.454  -10.815 14.445  1.00 6.89  ? 156  TYR A CB    1 
ATOM   310  C CG    . TYR A 1 49  ? 23.081  -11.169 13.117  1.00 8.47  ? 156  TYR A CG    1 
ATOM   311  C CD1   . TYR A 1 49  ? 24.005  -10.336 12.519  1.00 9.81  ? 156  TYR A CD1   1 
ATOM   312  C CD2   . TYR A 1 49  ? 22.790  -12.368 12.495  1.00 10.67 ? 156  TYR A CD2   1 
ATOM   313  C CE1   . TYR A 1 49  ? 24.604  -10.665 11.332  1.00 9.89  ? 156  TYR A CE1   1 
ATOM   314  C CE2   . TYR A 1 49  ? 23.380  -12.703 11.297  1.00 11.43 ? 156  TYR A CE2   1 
ATOM   315  C CZ    . TYR A 1 49  ? 24.300  -11.848 10.728  1.00 10.98 ? 156  TYR A CZ    1 
ATOM   316  O OH    . TYR A 1 49  ? 24.892  -12.163 9.533   1.00 11.95 ? 156  TYR A OH    1 
ATOM   317  N N     . GLY A 1 50  ? 20.027  -9.588  12.362  1.00 5.92  ? 157  GLY A N     1 
ATOM   318  C CA    . GLY A 1 50  ? 19.010  -9.977  11.407  1.00 6.02  ? 157  GLY A CA    1 
ATOM   319  C C     . GLY A 1 50  ? 18.607  -8.857  10.467  1.00 5.97  ? 157  GLY A C     1 
ATOM   320  O O     . GLY A 1 50  ? 19.444  -8.093  9.979   1.00 5.47  ? 157  GLY A O     1 
ATOM   321  N N     . LYS A 1 51  ? 17.304  -8.754  10.251  1.00 6.58  ? 158  LYS A N     1 
ATOM   322  C CA    . LYS A 1 51  ? 16.730  -7.820  9.289   1.00 6.79  ? 158  LYS A CA    1 
ATOM   323  C C     . LYS A 1 51  ? 16.539  -6.421  9.862   1.00 6.67  ? 158  LYS A C     1 
ATOM   324  O O     . LYS A 1 51  ? 15.893  -6.245  10.888  1.00 7.00  ? 158  LYS A O     1 
ATOM   325  C CB    . LYS A 1 51  ? 15.383  -8.366  8.800   1.00 7.28  ? 158  LYS A CB    1 
ATOM   326  C CG    . LYS A 1 51  ? 14.762  -7.570  7.673   1.00 8.22  ? 158  LYS A CG    1 
ATOM   327  C CD    . LYS A 1 51  ? 13.496  -8.225  7.123   1.00 9.35  ? 158  LYS A CD    1 
ATOM   328  C CE    . LYS A 1 51  ? 12.982  -7.512  5.882   1.00 10.69 ? 158  LYS A CE    1 
ATOM   329  N NZ    . LYS A 1 51  ? 14.055  -7.155  4.906   1.00 11.82 ? 158  LYS A NZ    1 
ATOM   330  N N     . PHE A 1 52  ? 17.132  -5.435  9.199   1.00 6.57  ? 159  PHE A N     1 
ATOM   331  C CA    . PHE A 1 52  ? 16.961  -4.033  9.558   1.00 6.42  ? 159  PHE A CA    1 
ATOM   332  C C     . PHE A 1 52  ? 16.630  -3.272  8.288   1.00 6.42  ? 159  PHE A C     1 
ATOM   333  O O     . PHE A 1 52  ? 17.075  -3.655  7.206   1.00 6.21  ? 159  PHE A O     1 
ATOM   334  C CB    . PHE A 1 52  ? 18.244  -3.424  10.113  1.00 6.39  ? 159  PHE A CB    1 
ATOM   335  C CG    . PHE A 1 52  ? 18.557  -3.810  11.527  1.00 6.21  ? 159  PHE A CG    1 
ATOM   336  C CD1   . PHE A 1 52  ? 18.938  -5.105  11.834  1.00 6.41  ? 159  PHE A CD1   1 
ATOM   337  C CD2   . PHE A 1 52  ? 18.510  -2.865  12.549  1.00 6.66  ? 159  PHE A CD2   1 
ATOM   338  C CE1   . PHE A 1 52  ? 19.258  -5.462  13.124  1.00 7.30  ? 159  PHE A CE1   1 
ATOM   339  C CE2   . PHE A 1 52  ? 18.840  -3.225  13.861  1.00 6.65  ? 159  PHE A CE2   1 
ATOM   340  C CZ    . PHE A 1 52  ? 19.205  -4.522  14.141  1.00 7.03  ? 159  PHE A CZ    1 
ATOM   341  N N     . ILE A 1 53  ? 15.872  -2.189  8.423   1.00 6.70  ? 160  ILE A N     1 
ATOM   342  C CA    . ILE A 1 53  ? 15.584  -1.310  7.295   1.00 6.91  ? 160  ILE A CA    1 
ATOM   343  C C     . ILE A 1 53  ? 15.891  0.123   7.731   1.00 7.39  ? 160  ILE A C     1 
ATOM   344  O O     . ILE A 1 53  ? 15.271  0.635   8.663   1.00 7.44  ? 160  ILE A O     1 
ATOM   345  C CB    . ILE A 1 53  ? 14.128  -1.421  6.841   1.00 6.96  ? 160  ILE A CB    1 
ATOM   346  C CG1   . ILE A 1 53  ? 13.857  -2.802  6.238   1.00 6.91  ? 160  ILE A CG1   1 
ATOM   347  C CG2   . ILE A 1 53  ? 13.854  -0.364  5.804   1.00 6.76  ? 160  ILE A CG2   1 
ATOM   348  C CD1   . ILE A 1 53  ? 12.379  -3.105  6.032   1.00 7.38  ? 160  ILE A CD1   1 
ATOM   349  N N     . ASP A 1 54  ? 16.870  0.747   7.084   1.00 7.95  ? 161  ASP A N     1 
ATOM   350  C CA    . ASP A 1 54  ? 17.286  2.105   7.420   1.00 8.37  ? 161  ASP A CA    1 
ATOM   351  C C     . ASP A 1 54  ? 17.607  2.256   8.905   1.00 8.18  ? 161  ASP A C     1 
ATOM   352  O O     . ASP A 1 54  ? 17.222  3.248   9.508   1.00 8.44  ? 161  ASP A O     1 
ATOM   353  C CB    . ASP A 1 54  ? 16.195  3.102   7.053   1.00 8.59  ? 161  ASP A CB    1 
ATOM   354  C CG    . ASP A 1 54  ? 16.708  4.528   6.967   1.00 10.23 ? 161  ASP A CG    1 
ATOM   355  O OD1   . ASP A 1 54  ? 17.935  4.715   6.802   1.00 11.11 ? 161  ASP A OD1   1 
ATOM   356  O OD2   . ASP A 1 54  ? 15.951  5.527   7.038   1.00 11.88 ? 161  ASP A OD2   1 
ATOM   357  N N     . GLY A 1 55  ? 18.292  1.272   9.486   1.00 8.28  ? 162  GLY A N     1 
ATOM   358  C CA    . GLY A 1 55  ? 18.703  1.321   10.888  1.00 7.95  ? 162  GLY A CA    1 
ATOM   359  C C     . GLY A 1 55  ? 17.660  0.834   11.883  1.00 7.65  ? 162  GLY A C     1 
ATOM   360  O O     . GLY A 1 55  ? 17.938  0.718   13.080  1.00 7.80  ? 162  GLY A O     1 
ATOM   361  N N     . GLU A 1 56  ? 16.464  0.540   11.390  1.00 7.22  ? 163  GLU A N     1 
ATOM   362  C CA    . GLU A 1 56  ? 15.357  0.112   12.228  1.00 7.06  ? 163  GLU A CA    1 
ATOM   363  C C     . GLU A 1 56  ? 15.312  -1.408  12.280  1.00 6.25  ? 163  GLU A C     1 
ATOM   364  O O     . GLU A 1 56  ? 15.342  -2.067  11.245  1.00 6.04  ? 163  GLU A O     1 
ATOM   365  C CB    . GLU A 1 56  ? 14.042  0.667   11.683  1.00 7.80  ? 163  GLU A CB    1 
ATOM   366  C CG    . GLU A 1 56  ? 12.835  0.348   12.546  1.00 9.55  ? 163  GLU A CG    1 
ATOM   367  C CD    . GLU A 1 56  ? 11.566  0.978   12.014  1.00 12.39 ? 163  GLU A CD    1 
ATOM   368  O OE1   . GLU A 1 56  ? 10.581  0.247   11.786  1.00 13.95 ? 163  GLU A OE1   1 
ATOM   369  O OE2   . GLU A 1 56  ? 11.561  2.208   11.819  1.00 15.05 ? 163  GLU A OE2   1 
ATOM   370  N N     . MET A 1 57  ? 15.232  -1.956  13.488  1.00 4.98  ? 164  MET A N     1 
ATOM   371  C CA    . MET A 1 57  ? 15.210  -3.396  13.688  1.00 4.77  ? 164  MET A CA    1 
ATOM   372  C C     . MET A 1 57  ? 13.870  -4.029  13.329  1.00 4.84  ? 164  MET A C     1 
ATOM   373  O O     . MET A 1 57  ? 12.851  -3.766  13.969  1.00 4.40  ? 164  MET A O     1 
ATOM   374  C CB    . MET A 1 57  ? 15.531  -3.723  15.143  1.00 4.72  ? 164  MET A CB    1 
ATOM   375  C CG    . MET A 1 57  ? 15.774  -5.202  15.382  1.00 4.94  ? 164  MET A CG    1 
ATOM   376  S SD    . MET A 1 57  ? 16.451  -5.533  17.027  1.00 5.80  ? 164  MET A SD    1 
ATOM   377  C CE    . MET A 1 57  ? 15.147  -4.981  17.997  1.00 5.96  ? 164  MET A CE    1 
ATOM   378  N N     . ILE A 1 58  ? 13.880  -4.863  12.296  1.00 5.00  ? 165  ILE A N     1 
ATOM   379  C CA    . ILE A 1 58  ? 12.671  -5.558  11.875  1.00 4.95  ? 165  ILE A CA    1 
ATOM   380  C C     . ILE A 1 58  ? 12.592  -6.946  12.525  1.00 5.29  ? 165  ILE A C     1 
ATOM   381  O O     . ILE A 1 58  ? 11.558  -7.315  13.093  1.00 4.78  ? 165  ILE A O     1 
ATOM   382  C CB    . ILE A 1 58  ? 12.608  -5.633  10.341  1.00 5.00  ? 165  ILE A CB    1 
ATOM   383  C CG1   . ILE A 1 58  ? 12.742  -4.223  9.744   1.00 4.62  ? 165  ILE A CG1   1 
ATOM   384  C CG2   . ILE A 1 58  ? 11.329  -6.307  9.929   1.00 5.38  ? 165  ILE A CG2   1 
ATOM   385  C CD1   . ILE A 1 58  ? 11.748  -3.208  10.282  1.00 4.68  ? 165  ILE A CD1   1 
ATOM   386  N N     . GLU A 1 59  ? 13.686  -7.705  12.446  1.00 6.00  ? 166  GLU A N     1 
ATOM   387  C CA    . GLU A 1 59  ? 13.785  -9.017  13.085  1.00 6.87  ? 166  GLU A CA    1 
ATOM   388  C C     . GLU A 1 59  ? 15.217  -9.261  13.538  1.00 6.98  ? 166  GLU A C     1 
ATOM   389  O O     . GLU A 1 59  ? 16.045  -9.709  12.749  1.00 6.92  ? 166  GLU A O     1 
ATOM   390  C CB    . GLU A 1 59  ? 13.403  -10.149 12.137  1.00 7.63  ? 166  GLU A CB    1 
ATOM   391  C CG    . GLU A 1 59  ? 13.470  -11.533 12.779  1.00 9.02  ? 166  GLU A CG    1 
ATOM   392  C CD    . GLU A 1 59  ? 13.503  -12.667 11.766  1.00 12.97 ? 166  GLU A CD    1 
ATOM   393  O OE1   . GLU A 1 59  ? 13.377  -12.407 10.552  1.00 15.93 ? 166  GLU A OE1   1 
ATOM   394  O OE2   . GLU A 1 59  ? 13.626  -13.836 12.185  1.00 14.80 ? 166  GLU A OE2   1 
ATOM   395  N N     . GLY A 1 60  ? 15.508  -8.980  14.803  1.00 7.29  ? 167  GLY A N     1 
ATOM   396  C CA    . GLY A 1 60  ? 16.842  -9.203  15.325  1.00 7.20  ? 167  GLY A CA    1 
ATOM   397  C C     . GLY A 1 60  ? 16.852  -10.404 16.256  1.00 7.48  ? 167  GLY A C     1 
ATOM   398  O O     . GLY A 1 60  ? 16.056  -10.456 17.191  1.00 7.66  ? 167  GLY A O     1 
ATOM   399  N N     . LYS A 1 61  ? 17.728  -11.373 15.984  1.00 7.23  ? 168  LYS A N     1 
ATOM   400  C CA    . LYS A 1 61  ? 17.818  -12.587 16.781  1.00 7.09  ? 168  LYS A CA    1 
ATOM   401  C C     . LYS A 1 61  ? 18.996  -12.428 17.710  1.00 6.71  ? 168  LYS A C     1 
ATOM   402  O O     . LYS A 1 61  ? 19.983  -11.812 17.337  1.00 6.28  ? 168  LYS A O     1 
ATOM   403  C CB    . LYS A 1 61  ? 18.026  -13.814 15.888  1.00 7.16  ? 168  LYS A CB    1 
ATOM   404  C CG    . LYS A 1 61  ? 16.896  -14.045 14.883  1.00 8.66  ? 168  LYS A CG    1 
ATOM   405  C CD    . LYS A 1 61  ? 17.128  -15.294 14.041  1.00 10.94 ? 168  LYS A CD    1 
ATOM   406  C CE    . LYS A 1 61  ? 16.025  -15.488 13.017  1.00 12.79 ? 168  LYS A CE    1 
ATOM   407  N NZ    . LYS A 1 61  ? 16.093  -16.800 12.293  1.00 15.02 ? 168  LYS A NZ    1 
ATOM   408  N N     . LEU A 1 62  ? 18.878  -12.976 18.916  1.00 6.73  ? 169  LEU A N     1 
ATOM   409  C CA    . LEU A 1 62  ? 19.933  -12.900 19.902  1.00 6.40  ? 169  LEU A CA    1 
ATOM   410  C C     . LEU A 1 62  ? 21.217  -13.531 19.363  1.00 5.72  ? 169  LEU A C     1 
ATOM   411  O O     . LEU A 1 62  ? 21.198  -14.661 18.882  1.00 5.15  ? 169  LEU A O     1 
ATOM   412  C CB    . LEU A 1 62  ? 19.498  -13.607 21.186  1.00 7.01  ? 169  LEU A CB    1 
ATOM   413  C CG    . LEU A 1 62  ? 20.474  -13.428 22.350  1.00 8.27  ? 169  LEU A CG    1 
ATOM   414  C CD1   . LEU A 1 62  ? 20.640  -11.955 22.716  1.00 9.19  ? 169  LEU A CD1   1 
ATOM   415  C CD2   . LEU A 1 62  ? 20.033  -14.232 23.569  1.00 9.49  ? 169  LEU A CD2   1 
ATOM   416  N N     . ALA A 1 63  ? 22.333  -12.815 19.490  1.00 5.12  ? 170  ALA A N     1 
ATOM   417  C CA    . ALA A 1 63  ? 23.604  -13.270 18.952  1.00 4.79  ? 170  ALA A CA    1 
ATOM   418  C C     . ALA A 1 63  ? 24.731  -12.807 19.849  1.00 4.58  ? 170  ALA A C     1 
ATOM   419  O O     . ALA A 1 63  ? 24.512  -12.012 20.759  1.00 4.70  ? 170  ALA A O     1 
ATOM   420  C CB    . ALA A 1 63  ? 23.813  -12.705 17.565  1.00 4.78  ? 170  ALA A CB    1 
ATOM   421  N N     . THR A 1 64  ? 25.933  -13.309 19.581  1.00 4.52  ? 171  THR A N     1 
ATOM   422  C CA    . THR A 1 64  ? 27.131  -12.873 20.290  1.00 4.42  ? 171  THR A CA    1 
ATOM   423  C C     . THR A 1 64  ? 28.120  -12.395 19.236  1.00 4.51  ? 171  THR A C     1 
ATOM   424  O O     . THR A 1 64  ? 28.397  -13.116 18.278  1.00 4.13  ? 171  THR A O     1 
ATOM   425  C CB    . THR A 1 64  ? 27.756  -14.026 21.085  1.00 4.30  ? 171  THR A CB    1 
ATOM   426  O OG1   . THR A 1 64  ? 26.837  -14.497 22.083  1.00 4.54  ? 171  THR A OG1   1 
ATOM   427  C CG2   . THR A 1 64  ? 28.977  -13.555 21.899  1.00 3.98  ? 171  THR A CG2   1 
ATOM   428  N N     . LEU A 1 65  ? 28.636  -11.184 19.406  1.00 5.15  ? 172  LEU A N     1 
ATOM   429  C CA    . LEU A 1 65  ? 29.680  -10.673 18.541  1.00 5.83  ? 172  LEU A CA    1 
ATOM   430  C C     . LEU A 1 65  ? 30.973  -11.365 18.989  1.00 6.16  ? 172  LEU A C     1 
ATOM   431  O O     . LEU A 1 65  ? 31.430  -11.155 20.111  1.00 6.30  ? 172  LEU A O     1 
ATOM   432  C CB    . LEU A 1 65  ? 29.805  -9.159  18.697  1.00 6.13  ? 172  LEU A CB    1 
ATOM   433  C CG    . LEU A 1 65  ? 31.000  -8.525  17.977  1.00 6.72  ? 172  LEU A CG    1 
ATOM   434  C CD1   . LEU A 1 65  ? 30.994  -8.877  16.496  1.00 7.77  ? 172  LEU A CD1   1 
ATOM   435  C CD2   . LEU A 1 65  ? 30.991  -7.020  18.167  1.00 7.70  ? 172  LEU A CD2   1 
ATOM   436  N N     . MET A 1 66  ? 31.553  -12.201 18.136  1.00 6.57  ? 173  MET A N     1 
ATOM   437  C CA    . MET A 1 66  ? 32.750  -12.965 18.519  1.00 7.57  ? 173  MET A CA    1 
ATOM   438  C C     . MET A 1 66  ? 34.060  -12.277 18.188  1.00 8.46  ? 173  MET A C     1 
ATOM   439  O O     . MET A 1 66  ? 34.958  -12.176 19.035  1.00 9.38  ? 173  MET A O     1 
ATOM   440  C CB    . MET A 1 66  ? 32.727  -14.331 17.850  1.00 7.41  ? 173  MET A CB    1 
ATOM   441  C CG    . MET A 1 66  ? 31.674  -15.243 18.433  1.00 7.25  ? 173  MET A CG    1 
ATOM   442  S SD    . MET A 1 66  ? 31.804  -16.910 17.822  1.00 7.63  ? 173  MET A SD    1 
ATOM   443  C CE    . MET A 1 66  ? 31.392  -16.676 16.148  1.00 8.74  ? 173  MET A CE    1 
ATOM   444  N N     . SER A 1 67  ? 34.182  -11.841 16.943  1.00 9.51  ? 174  SER A N     1 
ATOM   445  C CA    . SER A 1 67  ? 35.395  -11.198 16.472  1.00 9.87  ? 174  SER A CA    1 
ATOM   446  C C     . SER A 1 67  ? 35.028  -10.268 15.331  1.00 10.19 ? 174  SER A C     1 
ATOM   447  O O     . SER A 1 67  ? 33.887  -10.262 14.863  1.00 9.74  ? 174  SER A O     1 
ATOM   448  C CB    . SER A 1 67  ? 36.388  -12.243 15.965  1.00 10.03 ? 174  SER A CB    1 
ATOM   449  O OG    . SER A 1 67  ? 35.897  -12.880 14.801  1.00 10.72 ? 174  SER A OG    1 
ATOM   450  N N     . THR A 1 68  ? 36.002  -9.477  14.899  1.00 10.64 ? 175  THR A N     1 
ATOM   451  C CA    . THR A 1 68  ? 35.841  -8.599  13.752  1.00 11.10 ? 175  THR A CA    1 
ATOM   452  C C     . THR A 1 68  ? 37.079  -8.797  12.894  1.00 11.71 ? 175  THR A C     1 
ATOM   453  O O     . THR A 1 68  ? 38.192  -8.951  13.420  1.00 11.93 ? 175  THR A O     1 
ATOM   454  C CB    . THR A 1 68  ? 35.735  -7.125  14.184  1.00 11.03 ? 175  THR A CB    1 
ATOM   455  O OG1   . THR A 1 68  ? 34.539  -6.915  14.949  1.00 10.19 ? 175  THR A OG1   1 
ATOM   456  C CG2   . THR A 1 68  ? 35.544  -6.209  12.996  1.00 11.00 ? 175  THR A CG2   1 
ATOM   457  N N     . GLU A 1 69  ? 36.884  -8.814  11.584  1.00 12.23 ? 176  GLU A N     1 
ATOM   458  C CA    . GLU A 1 69  ? 37.970  -8.970  10.629  1.00 12.70 ? 176  GLU A CA    1 
ATOM   459  C C     . GLU A 1 69  ? 37.920  -7.818  9.635   1.00 12.62 ? 176  GLU A C     1 
ATOM   460  O O     . GLU A 1 69  ? 36.996  -7.741  8.824   1.00 12.20 ? 176  GLU A O     1 
ATOM   461  C CB    . GLU A 1 69  ? 37.824  -10.291 9.873   1.00 13.24 ? 176  GLU A CB    1 
ATOM   462  C CG    . GLU A 1 69  ? 38.742  -11.388 10.361  1.00 14.72 ? 176  GLU A CG    1 
ATOM   463  C CD    . GLU A 1 69  ? 40.202  -11.034 10.166  1.00 16.74 ? 176  GLU A CD    1 
ATOM   464  O OE1   . GLU A 1 69  ? 40.678  -11.080 9.006   1.00 18.24 ? 176  GLU A OE1   1 
ATOM   465  O OE2   . GLU A 1 69  ? 40.868  -10.699 11.167  1.00 17.70 ? 176  GLU A OE2   1 
ATOM   466  N N     . GLU A 1 70  ? 38.905  -6.924  9.702   1.00 12.51 ? 177  GLU A N     1 
ATOM   467  C CA    . GLU A 1 70  ? 38.963  -5.770  8.805   1.00 12.61 ? 177  GLU A CA    1 
ATOM   468  C C     . GLU A 1 70  ? 37.611  -5.035  8.763   1.00 12.30 ? 177  GLU A C     1 
ATOM   469  O O     . GLU A 1 70  ? 37.070  -4.742  7.689   1.00 12.20 ? 177  GLU A O     1 
ATOM   470  C CB    . GLU A 1 70  ? 39.451  -6.189  7.408   1.00 12.77 ? 177  GLU A CB    1 
ATOM   471  C CG    . GLU A 1 70  ? 40.878  -6.739  7.442   1.00 13.92 ? 177  GLU A CG    1 
ATOM   472  C CD    . GLU A 1 70  ? 41.661  -6.565  6.147   1.00 15.14 ? 177  GLU A CD    1 
ATOM   473  O OE1   . GLU A 1 70  ? 41.102  -6.076  5.141   1.00 15.39 ? 177  GLU A OE1   1 
ATOM   474  O OE2   . GLU A 1 70  ? 42.865  -6.919  6.154   1.00 15.99 ? 177  GLU A OE2   1 
ATOM   475  N N     . GLY A 1 71  ? 37.061  -4.764  9.948   1.00 11.92 ? 178  GLY A N     1 
ATOM   476  C CA    . GLY A 1 71  ? 35.806  -4.044  10.081  1.00 11.82 ? 178  GLY A CA    1 
ATOM   477  C C     . GLY A 1 71  ? 34.565  -4.927  10.041  1.00 11.59 ? 178  GLY A C     1 
ATOM   478  O O     . GLY A 1 71  ? 33.496  -4.517  10.489  1.00 11.30 ? 178  GLY A O     1 
ATOM   479  N N     . ARG A 1 72  ? 34.710  -6.143  9.526   1.00 11.63 ? 179  ARG A N     1 
ATOM   480  C CA    . ARG A 1 72  ? 33.580  -7.061  9.384   1.00 11.85 ? 179  ARG A CA    1 
ATOM   481  C C     . ARG A 1 72  ? 33.403  -7.917  10.632  1.00 11.75 ? 179  ARG A C     1 
ATOM   482  O O     . ARG A 1 72  ? 34.311  -8.634  11.031  1.00 11.24 ? 179  ARG A O     1 
ATOM   483  C CB    . ARG A 1 72  ? 33.790  -7.952  8.166   1.00 12.01 ? 179  ARG A CB    1 
ATOM   484  C CG    . ARG A 1 72  ? 34.275  -7.169  6.958   1.00 13.17 ? 179  ARG A CG    1 
ATOM   485  C CD    . ARG A 1 72  ? 34.204  -7.922  5.656   1.00 14.87 ? 179  ARG A CD    1 
ATOM   486  N NE    . ARG A 1 72  ? 34.631  -7.092  4.533   1.00 16.33 ? 179  ARG A NE    1 
ATOM   487  C CZ    . ARG A 1 72  ? 34.270  -7.297  3.276   1.00 18.07 ? 179  ARG A CZ    1 
ATOM   488  N NH1   . ARG A 1 72  ? 33.464  -8.308  2.968   1.00 18.99 ? 179  ARG A NH1   1 
ATOM   489  N NH2   . ARG A 1 72  ? 34.708  -6.485  2.318   1.00 18.61 ? 179  ARG A NH2   1 
ATOM   490  N N     . PRO A 1 73  ? 32.221  -7.865  11.232  1.00 11.83 ? 180  PRO A N     1 
ATOM   491  C CA    . PRO A 1 73  ? 31.961  -8.617  12.453  1.00 11.75 ? 180  PRO A CA    1 
ATOM   492  C C     . PRO A 1 73  ? 31.523  -10.035 12.171  1.00 11.47 ? 180  PRO A C     1 
ATOM   493  O O     . PRO A 1 73  ? 30.967  -10.320 11.112  1.00 11.35 ? 180  PRO A O     1 
ATOM   494  C CB    . PRO A 1 73  ? 30.799  -7.855  13.092  1.00 11.88 ? 180  PRO A CB    1 
ATOM   495  C CG    . PRO A 1 73  ? 30.346  -6.837  12.066  1.00 12.63 ? 180  PRO A CG    1 
ATOM   496  C CD    . PRO A 1 73  ? 31.036  -7.111  10.800  1.00 11.88 ? 180  PRO A CD    1 
ATOM   497  N N     . HIS A 1 74  ? 31.752  -10.908 13.140  1.00 10.99 ? 181  HIS A N     1 
ATOM   498  C CA    . HIS A 1 74  ? 31.373  -12.301 13.021  1.00 10.98 ? 181  HIS A CA    1 
ATOM   499  C C     . HIS A 1 74  ? 30.538  -12.655 14.237  1.00 10.32 ? 181  HIS A C     1 
ATOM   500  O O     . HIS A 1 74  ? 30.976  -12.486 15.378  1.00 10.37 ? 181  HIS A O     1 
ATOM   501  C CB    . HIS A 1 74  ? 32.644  -13.124 12.855  1.00 11.41 ? 181  HIS A CB    1 
ATOM   502  C CG    . HIS A 1 74  ? 33.479  -12.601 11.733  1.00 12.68 ? 181  HIS A CG    1 
ATOM   503  N ND1   . HIS A 1 74  ? 33.096  -12.732 10.413  1.00 14.33 ? 181  HIS A ND1   1 
ATOM   504  C CD2   . HIS A 1 74  ? 34.573  -11.806 11.730  1.00 13.34 ? 181  HIS A CD2   1 
ATOM   505  C CE1   . HIS A 1 74  ? 33.967  -12.106 9.642   1.00 14.59 ? 181  HIS A CE1   1 
ATOM   506  N NE2   . HIS A 1 74  ? 34.878  -11.542 10.417  1.00 14.53 ? 181  HIS A NE2   1 
ATOM   507  N N     . PHE A 1 75  ? 29.315  -13.102 13.977  1.00 9.47  ? 182  PHE A N     1 
ATOM   508  C CA    . PHE A 1 75  ? 28.364  -13.389 15.037  1.00 8.95  ? 182  PHE A CA    1 
ATOM   509  C C     . PHE A 1 75  ? 28.094  -14.868 15.172  1.00 8.41  ? 182  PHE A C     1 
ATOM   510  O O     . PHE A 1 75  ? 28.181  -15.608 14.200  1.00 7.90  ? 182  PHE A O     1 
ATOM   511  C CB    . PHE A 1 75  ? 27.026  -12.691 14.756  1.00 8.73  ? 182  PHE A CB    1 
ATOM   512  C CG    . PHE A 1 75  ? 27.112  -11.193 14.743  1.00 9.26  ? 182  PHE A CG    1 
ATOM   513  C CD1   . PHE A 1 75  ? 27.259  -10.506 13.551  1.00 9.46  ? 182  PHE A CD1   1 
ATOM   514  C CD2   . PHE A 1 75  ? 27.053  -10.472 15.926  1.00 10.44 ? 182  PHE A CD2   1 
ATOM   515  C CE1   . PHE A 1 75  ? 27.338  -9.131  13.540  1.00 10.19 ? 182  PHE A CE1   1 
ATOM   516  C CE2   . PHE A 1 75  ? 27.142  -9.092  15.921  1.00 10.72 ? 182  PHE A CE2   1 
ATOM   517  C CZ    . PHE A 1 75  ? 27.284  -8.423  14.722  1.00 11.01 ? 182  PHE A CZ    1 
ATOM   518  N N     . GLU A 1 76  ? 27.779  -15.294 16.390  1.00 7.69  ? 183  GLU A N     1 
ATOM   519  C CA    . GLU A 1 76  ? 27.266  -16.632 16.599  1.00 7.89  ? 183  GLU A CA    1 
ATOM   520  C C     . GLU A 1 76  ? 25.798  -16.403 16.965  1.00 7.71  ? 183  GLU A C     1 
ATOM   521  O O     . GLU A 1 76  ? 25.499  -15.538 17.783  1.00 6.70  ? 183  GLU A O     1 
ATOM   522  C CB    . GLU A 1 76  ? 28.026  -17.388 17.694  1.00 8.44  ? 183  GLU A CB    1 
ATOM   523  C CG    . GLU A 1 76  ? 27.883  -16.811 19.074  1.00 9.36  ? 183  GLU A CG    1 
ATOM   524  C CD    . GLU A 1 76  ? 28.444  -17.736 20.144  1.00 9.99  ? 183  GLU A CD    1 
ATOM   525  O OE1   . GLU A 1 76  ? 29.224  -18.651 19.813  1.00 11.50 ? 183  GLU A OE1   1 
ATOM   526  O OE2   . GLU A 1 76  ? 28.089  -17.561 21.314  1.00 10.33 ? 183  GLU A OE2   1 
ATOM   527  N N     . LEU A 1 77  ? 24.882  -17.106 16.300  1.00 7.86  ? 184  LEU A N     1 
ATOM   528  C CA    . LEU A 1 77  ? 23.455  -16.996 16.617  1.00 8.53  ? 184  LEU A CA    1 
ATOM   529  C C     . LEU A 1 77  ? 23.182  -17.842 17.847  1.00 8.40  ? 184  LEU A C     1 
ATOM   530  O O     . LEU A 1 77  ? 23.577  -19.002 17.892  1.00 8.35  ? 184  LEU A O     1 
ATOM   531  C CB    . LEU A 1 77  ? 22.575  -17.474 15.455  1.00 8.98  ? 184  LEU A CB    1 
ATOM   532  C CG    . LEU A 1 77  ? 21.860  -16.417 14.596  1.00 10.69 ? 184  LEU A CG    1 
ATOM   533  C CD1   . LEU A 1 77  ? 20.916  -17.109 13.631  1.00 11.63 ? 184  LEU A CD1   1 
ATOM   534  C CD2   . LEU A 1 77  ? 21.077  -15.394 15.406  1.00 11.85 ? 184  LEU A CD2   1 
ATOM   535  N N     . MET A 1 78  ? 22.524  -17.268 18.847  1.00 8.65  ? 185  MET A N     1 
ATOM   536  C CA    . MET A 1 78  ? 22.274  -17.994 20.092  1.00 9.49  ? 185  MET A CA    1 
ATOM   537  C C     . MET A 1 78  ? 21.012  -18.834 19.948  1.00 10.44 ? 185  MET A C     1 
ATOM   538  O O     . MET A 1 78  ? 20.171  -18.555 19.085  1.00 10.33 ? 185  MET A O     1 
ATOM   539  C CB    . MET A 1 78  ? 22.166  -17.032 21.277  1.00 9.31  ? 185  MET A CB    1 
ATOM   540  C CG    . MET A 1 78  ? 23.331  -16.044 21.374  1.00 9.03  ? 185  MET A CG    1 
ATOM   541  S SD    . MET A 1 78  ? 24.981  -16.799 21.366  1.00 8.67  ? 185  MET A SD    1 
ATOM   542  C CE    . MET A 1 78  ? 24.996  -17.487 22.988  1.00 8.51  ? 185  MET A CE    1 
ATOM   543  N N     . PRO A 1 79  ? 20.881  -19.871 20.767  1.00 11.73 ? 186  PRO A N     1 
ATOM   544  C CA    . PRO A 1 79  ? 19.702  -20.733 20.721  1.00 12.82 ? 186  PRO A CA    1 
ATOM   545  C C     . PRO A 1 79  ? 18.468  -20.025 21.262  1.00 13.67 ? 186  PRO A C     1 
ATOM   546  O O     . PRO A 1 79  ? 18.585  -18.993 21.920  1.00 14.31 ? 186  PRO A O     1 
ATOM   547  C CB    . PRO A 1 79  ? 20.089  -21.907 21.625  1.00 12.75 ? 186  PRO A CB    1 
ATOM   548  C CG    . PRO A 1 79  ? 21.528  -21.764 21.891  1.00 12.45 ? 186  PRO A CG    1 
ATOM   549  C CD    . PRO A 1 79  ? 21.842  -20.322 21.783  1.00 12.03 ? 186  PRO A CD    1 
ATOM   550  N N     . GLY A 1 80  ? 17.302  -20.592 21.002  1.00 14.68 ? 187  GLY A N     1 
ATOM   551  C CA    . GLY A 1 80  ? 16.051  -19.982 21.411  1.00 15.36 ? 187  GLY A CA    1 
ATOM   552  C C     . GLY A 1 80  ? 15.353  -19.478 20.158  1.00 15.85 ? 187  GLY A C     1 
ATOM   553  O O     . GLY A 1 80  ? 15.922  -19.536 19.066  1.00 16.33 ? 187  GLY A O     1 
ATOM   554  N N     . ASN A 1 81  ? 14.126  -18.993 20.295  1.00 16.29 ? 188  ASN A N     1 
ATOM   555  C CA    . ASN A 1 81  ? 13.382  -18.491 19.142  1.00 16.60 ? 188  ASN A CA    1 
ATOM   556  C C     . ASN A 1 81  ? 12.851  -17.074 19.338  1.00 16.40 ? 188  ASN A C     1 
ATOM   557  O O     . ASN A 1 81  ? 12.059  -16.586 18.529  1.00 16.84 ? 188  ASN A O     1 
ATOM   558  C CB    . ASN A 1 81  ? 12.224  -19.425 18.800  1.00 16.84 ? 188  ASN A CB    1 
ATOM   559  C CG    . ASN A 1 81  ? 12.685  -20.693 18.107  1.00 17.32 ? 188  ASN A CG    1 
ATOM   560  O OD1   . ASN A 1 81  ? 12.476  -20.872 16.903  1.00 17.36 ? 188  ASN A OD1   1 
ATOM   561  N ND2   . ASN A 1 81  ? 13.311  -21.584 18.869  1.00 17.33 ? 188  ASN A ND2   1 
ATOM   562  N N     . SER A 1 82  ? 13.274  -16.423 20.413  1.00 15.95 ? 189  SER A N     1 
ATOM   563  C CA    . SER A 1 82  ? 12.832  -15.063 20.697  1.00 15.52 ? 189  SER A CA    1 
ATOM   564  C C     . SER A 1 82  ? 13.394  -14.078 19.677  1.00 14.61 ? 189  SER A C     1 
ATOM   565  O O     . SER A 1 82  ? 14.597  -13.968 19.484  1.00 15.04 ? 189  SER A O     1 
ATOM   566  C CB    . SER A 1 82  ? 13.246  -14.644 22.106  1.00 15.67 ? 189  SER A CB    1 
ATOM   567  O OG    . SER A 1 82  ? 12.480  -15.339 23.080  1.00 16.44 ? 189  SER A OG    1 
ATOM   568  N N     . VAL A 1 83  ? 12.501  -13.380 18.998  1.00 13.84 ? 190  VAL A N     1 
ATOM   569  C CA    . VAL A 1 83  ? 12.926  -12.357 18.061  1.00 12.46 ? 190  VAL A CA    1 
ATOM   570  C C     . VAL A 1 83  ? 12.671  -11.017 18.737  1.00 10.30 ? 190  VAL A C     1 
ATOM   571  O O     . VAL A 1 83  ? 11.856  -10.935 19.651  1.00 9.90  ? 190  VAL A O     1 
ATOM   572  C CB    . VAL A 1 83  ? 12.127  -12.417 16.747  1.00 12.81 ? 190  VAL A CB    1 
ATOM   573  C CG1   . VAL A 1 83  ? 12.524  -13.627 15.919  1.00 13.83 ? 190  VAL A CG1   1 
ATOM   574  C CG2   . VAL A 1 83  ? 10.629  -12.440 17.024  1.00 13.36 ? 190  VAL A CG2   1 
ATOM   575  N N     . TYR A 1 84  ? 13.365  -9.978  18.297  1.00 7.89  ? 191  TYR A N     1 
ATOM   576  C CA    . TYR A 1 84  ? 13.065  -8.632  18.748  1.00 6.57  ? 191  TYR A CA    1 
ATOM   577  C C     . TYR A 1 84  ? 12.867  -7.717  17.548  1.00 5.86  ? 191  TYR A C     1 
ATOM   578  O O     . TYR A 1 84  ? 13.442  -7.941  16.490  1.00 5.27  ? 191  TYR A O     1 
ATOM   579  C CB    . TYR A 1 84  ? 14.196  -8.097  19.599  1.00 6.34  ? 191  TYR A CB    1 
ATOM   580  C CG    . TYR A 1 84  ? 14.589  -9.048  20.680  1.00 5.06  ? 191  TYR A CG    1 
ATOM   581  C CD1   . TYR A 1 84  ? 15.581  -9.990  20.460  1.00 5.67  ? 191  TYR A CD1   1 
ATOM   582  C CD2   . TYR A 1 84  ? 13.976  -9.015  21.936  1.00 4.68  ? 191  TYR A CD2   1 
ATOM   583  C CE1   . TYR A 1 84  ? 15.982  -10.870 21.483  1.00 4.58  ? 191  TYR A CE1   1 
ATOM   584  C CE2   . TYR A 1 84  ? 14.374  -9.904  22.956  1.00 3.96  ? 191  TYR A CE2   1 
ATOM   585  C CZ    . TYR A 1 84  ? 15.358  -10.831 22.705  1.00 3.98  ? 191  TYR A CZ    1 
ATOM   586  O OH    . TYR A 1 84  ? 15.770  -11.722 23.688  1.00 5.42  ? 191  TYR A OH    1 
ATOM   587  N N     . HIS A 1 85  ? 12.064  -6.680  17.733  1.00 5.52  ? 192  HIS A N     1 
ATOM   588  C CA    . HIS A 1 85  ? 11.834  -5.683  16.695  1.00 5.42  ? 192  HIS A CA    1 
ATOM   589  C C     . HIS A 1 85  ? 11.604  -4.308  17.310  1.00 4.59  ? 192  HIS A C     1 
ATOM   590  O O     . HIS A 1 85  ? 11.297  -4.196  18.500  1.00 4.80  ? 192  HIS A O     1 
ATOM   591  C CB    . HIS A 1 85  ? 10.640  -6.082  15.840  1.00 5.81  ? 192  HIS A CB    1 
ATOM   592  C CG    . HIS A 1 85  ? 9.337   -6.131  16.581  1.00 7.52  ? 192  HIS A CG    1 
ATOM   593  N ND1   . HIS A 1 85  ? 8.968   -7.201  17.368  1.00 8.54  ? 192  HIS A ND1   1 
ATOM   594  C CD2   . HIS A 1 85  ? 8.297   -5.263  16.618  1.00 8.65  ? 192  HIS A CD2   1 
ATOM   595  C CE1   . HIS A 1 85  ? 7.767   -6.981  17.874  1.00 8.22  ? 192  HIS A CE1   1 
ATOM   596  N NE2   . HIS A 1 85  ? 7.340   -5.810  17.439  1.00 8.91  ? 192  HIS A NE2   1 
ATOM   597  N N     . PHE A 1 86  ? 11.814  -3.269  16.514  1.00 3.78  ? 193  PHE A N     1 
ATOM   598  C CA    . PHE A 1 86  ? 11.499  -1.910  16.920  1.00 4.00  ? 193  PHE A CA    1 
ATOM   599  C C     . PHE A 1 86  ? 10.043  -1.917  17.354  1.00 4.11  ? 193  PHE A C     1 
ATOM   600  O O     . PHE A 1 86  ? 9.153   -2.237  16.552  1.00 3.97  ? 193  PHE A O     1 
ATOM   601  C CB    . PHE A 1 86  ? 11.713  -0.937  15.762  1.00 3.98  ? 193  PHE A CB    1 
ATOM   602  C CG    . PHE A 1 86  ? 11.543  0.513   16.132  1.00 4.65  ? 193  PHE A CG    1 
ATOM   603  C CD1   . PHE A 1 86  ? 12.275  1.085   17.162  1.00 5.34  ? 193  PHE A CD1   1 
ATOM   604  C CD2   . PHE A 1 86  ? 10.654  1.307   15.440  1.00 6.00  ? 193  PHE A CD2   1 
ATOM   605  C CE1   . PHE A 1 86  ? 12.114  2.427   17.484  1.00 5.11  ? 193  PHE A CE1   1 
ATOM   606  C CE2   . PHE A 1 86  ? 10.492  2.641   15.759  1.00 6.35  ? 193  PHE A CE2   1 
ATOM   607  C CZ    . PHE A 1 86  ? 11.224  3.201   16.773  1.00 6.20  ? 193  PHE A CZ    1 
ATOM   608  N N     . ASP A 1 87  ? 9.794   -1.561  18.607  1.00 4.35  ? 194  ASP A N     1 
ATOM   609  C CA    . ASP A 1 87  ? 8.458   -1.645  19.176  1.00 4.97  ? 194  ASP A CA    1 
ATOM   610  C C     . ASP A 1 87  ? 8.249   -0.494  20.162  1.00 5.45  ? 194  ASP A C     1 
ATOM   611  O O     . ASP A 1 87  ? 8.101   -0.711  21.369  1.00 5.31  ? 194  ASP A O     1 
ATOM   612  C CB    . ASP A 1 87  ? 8.290   -3.008  19.861  1.00 5.31  ? 194  ASP A CB    1 
ATOM   613  C CG    . ASP A 1 87  ? 6.876   -3.264  20.360  1.00 4.89  ? 194  ASP A CG    1 
ATOM   614  O OD1   . ASP A 1 87  ? 6.731   -3.777  21.498  1.00 4.65  ? 194  ASP A OD1   1 
ATOM   615  O OD2   . ASP A 1 87  ? 5.855   -2.991  19.698  1.00 6.48  ? 194  ASP A OD2   1 
ATOM   616  N N     . LYS A 1 88  ? 8.246   0.728   19.634  1.00 5.95  ? 195  LYS A N     1 
ATOM   617  C CA    . LYS A 1 88  ? 8.067   1.932   20.444  1.00 6.42  ? 195  LYS A CA    1 
ATOM   618  C C     . LYS A 1 88  ? 6.718   1.897   21.167  1.00 6.73  ? 195  LYS A C     1 
ATOM   619  O O     . LYS A 1 88  ? 5.701   1.507   20.582  1.00 5.99  ? 195  LYS A O     1 
ATOM   620  C CB    . LYS A 1 88  ? 8.163   3.173   19.549  1.00 6.85  ? 195  LYS A CB    1 
ATOM   621  C CG    . LYS A 1 88  ? 8.499   4.463   20.274  1.00 7.53  ? 195  LYS A CG    1 
ATOM   622  C CD    . LYS A 1 88  ? 8.571   5.668   19.330  1.00 9.24  ? 195  LYS A CD    1 
ATOM   623  C CE    . LYS A 1 88  ? 8.671   6.977   20.117  1.00 10.07 ? 195  LYS A CE    1 
ATOM   624  N NZ    . LYS A 1 88  ? 8.535   8.203   19.303  1.00 10.82 ? 195  LYS A NZ    1 
ATOM   625  N N     . SER A 1 89  ? 6.697   2.294   22.438  1.00 6.97  ? 196  SER A N     1 
ATOM   626  C CA    . SER A 1 89  ? 5.443   2.313   23.210  1.00 7.85  ? 196  SER A CA    1 
ATOM   627  C C     . SER A 1 89  ? 4.375   3.286   22.654  1.00 8.71  ? 196  SER A C     1 
ATOM   628  O O     . SER A 1 89  ? 4.719   4.256   21.987  1.00 8.40  ? 196  SER A O     1 
ATOM   629  C CB    . SER A 1 89  ? 5.741   2.699   24.653  1.00 7.66  ? 196  SER A CB    1 
ATOM   630  O OG    . SER A 1 89  ? 6.188   4.036   24.712  1.00 7.51  ? 196  SER A OG    1 
ATOM   631  N N     . THR A 1 90  ? 3.100   3.017   22.971  1.00 10.30 ? 197  THR A N     1 
ATOM   632  C CA    . THR A 1 90  ? 1.936   3.843   22.568  1.00 11.43 ? 197  THR A CA    1 
ATOM   633  C C     . THR A 1 90  ? 1.075   4.129   23.811  1.00 12.45 ? 197  THR A C     1 
ATOM   634  O O     . THR A 1 90  ? 1.409   3.702   24.907  1.00 12.65 ? 197  THR A O     1 
ATOM   635  C CB    . THR A 1 90  ? 1.071   3.161   21.458  1.00 11.80 ? 197  THR A CB    1 
ATOM   636  O OG1   . THR A 1 90  ? 0.256   2.116   22.010  1.00 12.85 ? 197  THR A OG1   1 
ATOM   637  C CG2   . THR A 1 90  ? 1.933   2.464   20.416  1.00 11.59 ? 197  THR A CG2   1 
ATOM   638  N N     . SER A 1 91  ? -0.051  4.818   23.658  1.00 13.61 ? 198  SER A N     1 
ATOM   639  C CA    . SER A 1 91  ? -0.866  5.162   24.829  1.00 14.55 ? 198  SER A CA    1 
ATOM   640  C C     . SER A 1 91  ? -1.754  3.982   25.168  1.00 15.46 ? 198  SER A C     1 
ATOM   641  O O     . SER A 1 91  ? -2.209  3.819   26.297  1.00 16.73 ? 198  SER A O     1 
ATOM   642  C CB    . SER A 1 91  ? -1.735  6.376   24.549  1.00 14.51 ? 198  SER A CB    1 
ATOM   643  O OG    . SER A 1 91  ? -2.410  6.197   23.325  1.00 13.76 ? 198  SER A OG    1 
ATOM   644  N N     . SER A 1 92  ? -2.002  3.166   24.158  1.00 15.77 ? 199  SER A N     1 
ATOM   645  C CA    . SER A 1 92  ? -2.797  1.972   24.318  1.00 16.24 ? 199  SER A CA    1 
ATOM   646  C C     . SER A 1 92  ? -1.869  0.749   24.425  1.00 16.21 ? 199  SER A C     1 
ATOM   647  O O     . SER A 1 92  ? -2.332  -0.385  24.516  1.00 16.42 ? 199  SER A O     1 
ATOM   648  C CB    . SER A 1 92  ? -3.745  1.838   23.130  1.00 16.54 ? 199  SER A CB    1 
ATOM   649  O OG    . SER A 1 92  ? -3.053  1.414   21.970  1.00 17.04 ? 199  SER A OG    1 
ATOM   650  N N     . CYS A 1 93  ? -0.559  0.976   24.438  1.00 15.86 ? 200  CYS A N     1 
ATOM   651  C CA    . CYS A 1 93  ? 0.386   -0.137  24.428  1.00 15.68 ? 200  CYS A CA    1 
ATOM   652  C C     . CYS A 1 93  ? 1.799   0.229   24.868  1.00 14.77 ? 200  CYS A C     1 
ATOM   653  O O     . CYS A 1 93  ? 2.528   0.896   24.140  1.00 15.85 ? 200  CYS A O     1 
ATOM   654  C CB    . CYS A 1 93  ? 0.453   -0.723  23.012  1.00 15.84 ? 200  CYS A CB    1 
ATOM   655  S SG    . CYS A 1 93  ? 1.110   -2.412  22.884  1.00 17.21 ? 200  CYS A SG    1 
ATOM   656  N N     . ILE A 1 94  ? 2.199   -0.229  26.052  1.00 13.28 ? 201  ILE A N     1 
ATOM   657  C CA    . ILE A 1 94  ? 3.565   -0.032  26.518  1.00 11.96 ? 201  ILE A CA    1 
ATOM   658  C C     . ILE A 1 94  ? 4.519   -0.889  25.680  1.00 10.34 ? 201  ILE A C     1 
ATOM   659  O O     . ILE A 1 94  ? 5.630   -0.469  25.380  1.00 9.68  ? 201  ILE A O     1 
ATOM   660  C CB    . ILE A 1 94  ? 3.689   -0.385  28.025  1.00 12.01 ? 201  ILE A CB    1 
ATOM   661  C CG1   . ILE A 1 94  ? 5.108   -0.137  28.534  1.00 12.80 ? 201  ILE A CG1   1 
ATOM   662  C CG2   . ILE A 1 94  ? 3.284   -1.817  28.271  1.00 11.38 ? 201  ILE A CG2   1 
ATOM   663  C CD1   . ILE A 1 94  ? 5.162   0.134   30.028  1.00 13.95 ? 201  ILE A CD1   1 
ATOM   664  N N     . SER A 1 95  ? 4.057   -2.075  25.284  1.00 9.04  ? 202  SER A N     1 
ATOM   665  C CA    . SER A 1 95  ? 4.859   -3.027  24.519  1.00 8.50  ? 202  SER A CA    1 
ATOM   666  C C     . SER A 1 95  ? 3.958   -4.114  23.917  1.00 8.85  ? 202  SER A C     1 
ATOM   667  O O     . SER A 1 95  ? 2.965   -4.520  24.529  1.00 8.96  ? 202  SER A O     1 
ATOM   668  C CB    . SER A 1 95  ? 5.929   -3.672  25.431  1.00 8.52  ? 202  SER A CB    1 
ATOM   669  O OG    . SER A 1 95  ? 6.646   -4.704  24.774  1.00 6.90  ? 202  SER A OG    1 
ATOM   670  N N     . THR A 1 96  ? 4.282   -4.557  22.703  1.00 8.53  ? 203  THR A N     1 
ATOM   671  C CA    . THR A 1 96  ? 3.553   -5.638  22.063  1.00 7.99  ? 203  THR A CA    1 
ATOM   672  C C     . THR A 1 96  ? 3.802   -6.953  22.780  1.00 7.35  ? 203  THR A C     1 
ATOM   673  O O     . THR A 1 96  ? 2.964   -7.850  22.759  1.00 6.77  ? 203  THR A O     1 
ATOM   674  C CB    . THR A 1 96  ? 4.000   -5.799  20.604  1.00 8.51  ? 203  THR A CB    1 
ATOM   675  O OG1   . THR A 1 96  ? 3.927   -4.539  19.917  1.00 9.13  ? 203  THR A OG1   1 
ATOM   676  C CG2   . THR A 1 96  ? 3.031   -6.653  19.837  1.00 9.16  ? 203  THR A CG2   1 
ATOM   677  N N     . ASN A 1 97  ? 4.983   -7.072  23.388  1.00 6.67  ? 204  ASN A N     1 
ATOM   678  C CA    . ASN A 1 97  ? 5.358   -8.269  24.108  1.00 6.32  ? 204  ASN A CA    1 
ATOM   679  C C     . ASN A 1 97  ? 5.896   -7.849  25.476  1.00 5.34  ? 204  ASN A C     1 
ATOM   680  O O     . ASN A 1 97  ? 7.112   -7.902  25.712  1.00 4.91  ? 204  ASN A O     1 
ATOM   681  C CB    . ASN A 1 97  ? 6.430   -9.031  23.340  1.00 7.02  ? 204  ASN A CB    1 
ATOM   682  C CG    . ASN A 1 97  ? 6.076   -9.229  21.901  1.00 9.04  ? 204  ASN A CG    1 
ATOM   683  O OD1   . ASN A 1 97  ? 5.442   -10.222 21.545  1.00 12.06 ? 204  ASN A OD1   1 
ATOM   684  N ND2   . ASN A 1 97  ? 6.473   -8.285  21.050  1.00 10.74 ? 204  ASN A ND2   1 
ATOM   685  N N     . ALA A 1 98  ? 4.991   -7.414  26.355  1.00 4.25  ? 205  ALA A N     1 
ATOM   686  C CA    . ALA A 1 98  ? 5.353   -6.895  27.687  1.00 4.45  ? 205  ALA A CA    1 
ATOM   687  C C     . ALA A 1 98  ? 6.107   -7.869  28.578  1.00 4.02  ? 205  ALA A C     1 
ATOM   688  O O     . ALA A 1 98  ? 6.748   -7.445  29.545  1.00 4.26  ? 205  ALA A O     1 
ATOM   689  C CB    . ALA A 1 98  ? 4.103   -6.433  28.415  1.00 4.36  ? 205  ALA A CB    1 
ATOM   690  N N     . LEU A 1 99  ? 5.996   -9.163  28.293  1.00 4.13  ? 206  LEU A N     1 
ATOM   691  C CA    . LEU A 1 99  ? 6.639   -10.193 29.127  1.00 4.05  ? 206  LEU A CA    1 
ATOM   692  C C     . LEU A 1 99  ? 7.883   -10.780 28.476  1.00 3.35  ? 206  LEU A C     1 
ATOM   693  O O     . LEU A 1 99  ? 8.445   -11.755 28.972  1.00 3.40  ? 206  LEU A O     1 
ATOM   694  C CB    . LEU A 1 99  ? 5.651   -11.310 29.467  1.00 4.39  ? 206  LEU A CB    1 
ATOM   695  C CG    . LEU A 1 99  ? 4.540   -10.873 30.442  1.00 5.48  ? 206  LEU A CG    1 
ATOM   696  C CD1   . LEU A 1 99  ? 3.623   -12.031 30.791  1.00 6.08  ? 206  LEU A CD1   1 
ATOM   697  C CD2   . LEU A 1 99  ? 5.105   -10.247 31.717  1.00 6.03  ? 206  LEU A CD2   1 
ATOM   698  N N     . LEU A 1 100 ? 8.298   -10.190 27.363  1.00 2.61  ? 207  LEU A N     1 
ATOM   699  C CA    . LEU A 1 100 ? 9.509   -10.600 26.677  1.00 2.48  ? 207  LEU A CA    1 
ATOM   700  C C     . LEU A 1 100 ? 10.639  -9.727  27.221  1.00 2.20  ? 207  LEU A C     1 
ATOM   701  O O     . LEU A 1 100 ? 10.736  -8.557  26.881  1.00 2.36  ? 207  LEU A O     1 
ATOM   702  C CB    . LEU A 1 100 ? 9.370   -10.388 25.167  1.00 2.30  ? 207  LEU A CB    1 
ATOM   703  C CG    . LEU A 1 100 ? 10.658  -10.610 24.363  1.00 2.38  ? 207  LEU A CG    1 
ATOM   704  C CD1   . LEU A 1 100 ? 11.119  -12.048 24.473  1.00 2.94  ? 207  LEU A CD1   1 
ATOM   705  C CD2   . LEU A 1 100 ? 10.491  -10.235 22.889  1.00 2.26  ? 207  LEU A CD2   1 
ATOM   706  N N     . PRO A 1 101 ? 11.487  -10.266 28.082  1.00 2.31  ? 208  PRO A N     1 
ATOM   707  C CA    . PRO A 1 101 ? 12.541  -9.447  28.692  1.00 2.22  ? 208  PRO A CA    1 
ATOM   708  C C     . PRO A 1 101 ? 13.622  -9.002  27.729  1.00 2.17  ? 208  PRO A C     1 
ATOM   709  O O     . PRO A 1 101 ? 13.744  -9.544  26.634  1.00 2.75  ? 208  PRO A O     1 
ATOM   710  C CB    . PRO A 1 101 ? 13.158  -10.383 29.746  1.00 2.19  ? 208  PRO A CB    1 
ATOM   711  C CG    . PRO A 1 101 ? 12.238  -11.522 29.864  1.00 2.61  ? 208  PRO A CG    1 
ATOM   712  C CD    . PRO A 1 101 ? 11.525  -11.654 28.555  1.00 2.13  ? 208  PRO A CD    1 
ATOM   713  N N     . ASP A 1 102 ? 14.382  -7.993  28.133  1.00 2.07  ? 209  ASP A N     1 
ATOM   714  C CA    . ASP A 1 102 ? 15.537  -7.558  27.370  1.00 2.07  ? 209  ASP A CA    1 
ATOM   715  C C     . ASP A 1 102 ? 16.696  -8.488  27.758  1.00 2.08  ? 209  ASP A C     1 
ATOM   716  O O     . ASP A 1 102 ? 16.986  -8.667  28.940  1.00 2.17  ? 209  ASP A O     1 
ATOM   717  C CB    . ASP A 1 102 ? 15.873  -6.108  27.671  1.00 2.16  ? 209  ASP A CB    1 
ATOM   718  C CG    . ASP A 1 102 ? 17.092  -5.642  26.921  1.00 2.83  ? 209  ASP A CG    1 
ATOM   719  O OD1   . ASP A 1 102 ? 18.215  -5.970  27.366  1.00 2.00  ? 209  ASP A OD1   1 
ATOM   720  O OD2   . ASP A 1 102 ? 17.026  -4.987  25.858  1.00 3.37  ? 209  ASP A OD2   1 
ATOM   721  N N     . PRO A 1 103 ? 17.378  -9.050  26.770  1.00 2.13  ? 210  PRO A N     1 
ATOM   722  C CA    . PRO A 1 103 ? 18.411  -10.064 27.006  1.00 2.49  ? 210  PRO A CA    1 
ATOM   723  C C     . PRO A 1 103 ? 19.684  -9.538  27.651  1.00 2.93  ? 210  PRO A C     1 
ATOM   724  O O     . PRO A 1 103 ? 20.321  -10.299 28.361  1.00 2.79  ? 210  PRO A O     1 
ATOM   725  C CB    . PRO A 1 103 ? 18.719  -10.589 25.599  1.00 2.35  ? 210  PRO A CB    1 
ATOM   726  C CG    . PRO A 1 103 ? 18.212  -9.574  24.665  1.00 2.21  ? 210  PRO A CG    1 
ATOM   727  C CD    . PRO A 1 103 ? 17.258  -8.704  25.352  1.00 2.18  ? 210  PRO A CD    1 
ATOM   728  N N     . TYR A 1 104 ? 20.043  -8.283  27.398  1.00 3.18  ? 211  TYR A N     1 
ATOM   729  C CA    . TYR A 1 104 ? 21.242  -7.682  27.950  1.00 3.33  ? 211  TYR A CA    1 
ATOM   730  C C     . TYR A 1 104 ? 20.962  -7.403  29.419  1.00 3.70  ? 211  TYR A C     1 
ATOM   731  O O     . TYR A 1 104 ? 21.770  -7.707  30.297  1.00 4.00  ? 211  TYR A O     1 
ATOM   732  C CB    . TYR A 1 104 ? 21.570  -6.388  27.200  1.00 3.46  ? 211  TYR A CB    1 
ATOM   733  C CG    . TYR A 1 104 ? 22.666  -5.539  27.817  1.00 2.30  ? 211  TYR A CG    1 
ATOM   734  C CD1   . TYR A 1 104 ? 23.995  -5.687  27.428  1.00 2.58  ? 211  TYR A CD1   1 
ATOM   735  C CD2   . TYR A 1 104 ? 22.371  -4.583  28.785  1.00 2.29  ? 211  TYR A CD2   1 
ATOM   736  C CE1   . TYR A 1 104 ? 25.015  -4.900  28.010  1.00 2.00  ? 211  TYR A CE1   1 
ATOM   737  C CE2   . TYR A 1 104 ? 23.356  -3.791  29.346  1.00 2.01  ? 211  TYR A CE2   1 
ATOM   738  C CZ    . TYR A 1 104 ? 24.685  -3.963  28.967  1.00 2.27  ? 211  TYR A CZ    1 
ATOM   739  O OH    . TYR A 1 104 ? 25.673  -3.168  29.545  1.00 2.08  ? 211  TYR A OH    1 
ATOM   740  N N     . GLU A 1 105 ? 19.782  -6.845  29.670  1.00 3.95  ? 212  GLU A N     1 
ATOM   741  C CA    . GLU A 1 105 ? 19.348  -6.519  31.018  1.00 4.61  ? 212  GLU A CA    1 
ATOM   742  C C     . GLU A 1 105 ? 19.214  -7.802  31.846  1.00 5.07  ? 212  GLU A C     1 
ATOM   743  O O     . GLU A 1 105 ? 19.640  -7.862  33.002  1.00 4.83  ? 212  GLU A O     1 
ATOM   744  C CB    . GLU A 1 105 ? 18.024  -5.773  30.929  1.00 4.52  ? 212  GLU A CB    1 
ATOM   745  C CG    . GLU A 1 105 ? 17.515  -5.155  32.202  1.00 4.94  ? 212  GLU A CG    1 
ATOM   746  C CD    . GLU A 1 105 ? 16.226  -4.392  31.966  1.00 4.99  ? 212  GLU A CD    1 
ATOM   747  O OE1   . GLU A 1 105 ? 15.347  -4.950  31.280  1.00 5.00  ? 212  GLU A OE1   1 
ATOM   748  O OE2   . GLU A 1 105 ? 16.086  -3.249  32.445  1.00 5.13  ? 212  GLU A OE2   1 
ATOM   749  N N     . SER A 1 106 ? 18.638  -8.830  31.228  1.00 5.54  ? 213  SER A N     1 
ATOM   750  C CA    . SER A 1 106 ? 18.421  -10.135 31.850  1.00 6.29  ? 213  SER A CA    1 
ATOM   751  C C     . SER A 1 106 ? 19.702  -10.733 32.444  1.00 6.29  ? 213  SER A C     1 
ATOM   752  O O     . SER A 1 106 ? 19.665  -11.412 33.479  1.00 6.32  ? 213  SER A O     1 
ATOM   753  C CB    . SER A 1 106 ? 17.821  -11.080 30.797  1.00 6.89  ? 213  SER A CB    1 
ATOM   754  O OG    . SER A 1 106 ? 17.892  -12.428 31.216  1.00 9.71  ? 213  SER A OG    1 
ATOM   755  N N     . GLU A 1 107 ? 20.832  -10.472 31.796  1.00 6.12  ? 214  GLU A N     1 
ATOM   756  C CA    . GLU A 1 107 ? 22.120  -10.969 32.278  1.00 5.99  ? 214  GLU A CA    1 
ATOM   757  C C     . GLU A 1 107 ? 22.679  -10.174 33.454  1.00 5.39  ? 214  GLU A C     1 
ATOM   758  O O     . GLU A 1 107 ? 23.514  -10.687 34.206  1.00 4.38  ? 214  GLU A O     1 
ATOM   759  C CB    . GLU A 1 107 ? 23.164  -10.915 31.166  1.00 6.73  ? 214  GLU A CB    1 
ATOM   760  C CG    . GLU A 1 107 ? 22.949  -11.904 30.036  1.00 9.30  ? 214  GLU A CG    1 
ATOM   761  C CD    . GLU A 1 107 ? 24.057  -11.830 28.999  1.00 12.66 ? 214  GLU A CD    1 
ATOM   762  O OE1   . GLU A 1 107 ? 24.949  -10.962 29.143  1.00 14.58 ? 214  GLU A OE1   1 
ATOM   763  O OE2   . GLU A 1 107 ? 24.032  -12.631 28.041  1.00 14.18 ? 214  GLU A OE2   1 
ATOM   764  N N     . ARG A 1 108 ? 22.222  -8.937  33.610  1.00 4.75  ? 215  ARG A N     1 
ATOM   765  C CA    . ARG A 1 108 ? 22.830  -8.018  34.578  1.00 4.90  ? 215  ARG A CA    1 
ATOM   766  C C     . ARG A 1 108 ? 21.957  -7.671  35.791  1.00 4.12  ? 215  ARG A C     1 
ATOM   767  O O     . ARG A 1 108 ? 22.487  -7.282  36.806  1.00 3.33  ? 215  ARG A O     1 
ATOM   768  C CB    . ARG A 1 108 ? 23.306  -6.746  33.853  1.00 5.24  ? 215  ARG A CB    1 
ATOM   769  C CG    . ARG A 1 108 ? 24.713  -6.896  33.276  1.00 8.07  ? 215  ARG A CG    1 
ATOM   770  C CD    . ARG A 1 108 ? 25.145  -5.883  32.213  1.00 10.65 ? 215  ARG A CD    1 
ATOM   771  N NE    . ARG A 1 108 ? 24.801  -6.383  30.908  1.00 14.29 ? 215  ARG A NE    1 
ATOM   772  C CZ    . ARG A 1 108 ? 25.577  -7.088  30.089  1.00 15.26 ? 215  ARG A CZ    1 
ATOM   773  N NH1   . ARG A 1 108 ? 26.820  -7.388  30.367  1.00 15.54 ? 215  ARG A NH1   1 
ATOM   774  N NH2   . ARG A 1 108 ? 25.065  -7.491  28.943  1.00 17.12 ? 215  ARG A NH2   1 
ATOM   775  N N     . VAL A 1 109 ? 20.629  -7.807  35.709  1.00 3.09  ? 216  VAL A N     1 
ATOM   776  C CA    . VAL A 1 109 ? 19.809  -7.429  36.873  1.00 2.91  ? 216  VAL A CA    1 
ATOM   777  C C     . VAL A 1 109 ? 18.647  -8.355  37.189  1.00 2.98  ? 216  VAL A C     1 
ATOM   778  O O     . VAL A 1 109 ? 18.168  -9.109  36.331  1.00 2.44  ? 216  VAL A O     1 
ATOM   779  C CB    . VAL A 1 109 ? 19.230  -6.002  36.738  1.00 2.96  ? 216  VAL A CB    1 
ATOM   780  C CG1   . VAL A 1 109 ? 20.332  -4.974  36.602  1.00 3.75  ? 216  VAL A CG1   1 
ATOM   781  C CG2   . VAL A 1 109 ? 18.252  -5.921  35.551  1.00 2.83  ? 216  VAL A CG2   1 
ATOM   782  N N     . TYR A 1 110 ? 18.199  -8.289  38.440  1.00 2.76  ? 217  TYR A N     1 
ATOM   783  C CA    . TYR A 1 110 ? 17.009  -9.020  38.865  1.00 2.74  ? 217  TYR A CA    1 
ATOM   784  C C     . TYR A 1 110 ? 16.202  -8.208  39.881  1.00 2.77  ? 217  TYR A C     1 
ATOM   785  O O     . TYR A 1 110 ? 16.737  -7.327  40.557  1.00 3.00  ? 217  TYR A O     1 
ATOM   786  C CB    . TYR A 1 110 ? 17.341  -10.412 39.382  1.00 2.54  ? 217  TYR A CB    1 
ATOM   787  C CG    . TYR A 1 110 ? 18.125  -10.454 40.662  1.00 2.38  ? 217  TYR A CG    1 
ATOM   788  C CD1   . TYR A 1 110 ? 17.486  -10.645 41.874  1.00 2.54  ? 217  TYR A CD1   1 
ATOM   789  C CD2   . TYR A 1 110 ? 19.507  -10.339 40.657  1.00 2.43  ? 217  TYR A CD2   1 
ATOM   790  C CE1   . TYR A 1 110 ? 18.183  -10.712 43.040  1.00 2.32  ? 217  TYR A CE1   1 
ATOM   791  C CE2   . TYR A 1 110 ? 20.220  -10.409 41.826  1.00 2.26  ? 217  TYR A CE2   1 
ATOM   792  C CZ    . TYR A 1 110 ? 19.553  -10.587 43.022  1.00 2.27  ? 217  TYR A CZ    1 
ATOM   793  O OH    . TYR A 1 110 ? 20.236  -10.656 44.219  1.00 2.99  ? 217  TYR A OH    1 
ATOM   794  N N     . VAL A 1 111 ? 14.908  -8.497  39.961  1.00 2.44  ? 218  VAL A N     1 
ATOM   795  C CA    . VAL A 1 111 ? 14.014  -7.831  40.890  1.00 2.69  ? 218  VAL A CA    1 
ATOM   796  C C     . VAL A 1 111 ? 13.833  -8.702  42.120  1.00 2.66  ? 218  VAL A C     1 
ATOM   797  O O     . VAL A 1 111 ? 13.617  -9.907  42.005  1.00 3.28  ? 218  VAL A O     1 
ATOM   798  C CB    . VAL A 1 111 ? 12.632  -7.579  40.228  1.00 3.00  ? 218  VAL A CB    1 
ATOM   799  C CG1   . VAL A 1 111 ? 11.610  -7.097  41.245  1.00 3.76  ? 218  VAL A CG1   1 
ATOM   800  C CG2   . VAL A 1 111 ? 12.778  -6.577  39.140  1.00 3.43  ? 218  VAL A CG2   1 
ATOM   801  N N     . ALA A 1 112 ? 13.917  -8.091  43.296  1.00 2.57  ? 219  ALA A N     1 
ATOM   802  C CA    . ALA A 1 112 ? 13.739  -8.791  44.555  1.00 2.48  ? 219  ALA A CA    1 
ATOM   803  C C     . ALA A 1 112 ? 13.301  -7.758  45.585  1.00 2.60  ? 219  ALA A C     1 
ATOM   804  O O     . ALA A 1 112 ? 13.221  -6.571  45.284  1.00 2.69  ? 219  ALA A O     1 
ATOM   805  C CB    . ALA A 1 112 ? 15.054  -9.468  45.000  1.00 2.68  ? 219  ALA A CB    1 
ATOM   806  N N     . GLU A 1 113 ? 13.021  -8.204  46.800  1.00 2.80  ? 220  GLU A N     1 
ATOM   807  C CA    . GLU A 1 113 ? 12.644  -7.286  47.867  1.00 3.50  ? 220  GLU A CA    1 
ATOM   808  C C     . GLU A 1 113 ? 13.792  -6.321  48.138  1.00 3.30  ? 220  GLU A C     1 
ATOM   809  O O     . GLU A 1 113 ? 14.942  -6.747  48.291  1.00 3.39  ? 220  GLU A O     1 
ATOM   810  C CB    . GLU A 1 113 ? 12.332  -8.043  49.165  1.00 4.18  ? 220  GLU A CB    1 
ATOM   811  C CG    . GLU A 1 113 ? 12.052  -7.104  50.330  1.00 5.43  ? 220  GLU A CG    1 
ATOM   812  C CD    . GLU A 1 113 ? 11.359  -7.774  51.506  1.00 7.31  ? 220  GLU A CD    1 
ATOM   813  O OE1   . GLU A 1 113 ? 11.761  -8.899  51.879  1.00 9.83  ? 220  GLU A OE1   1 
ATOM   814  O OE2   . GLU A 1 113 ? 10.420  -7.163  52.069  1.00 6.12  ? 220  GLU A OE2   1 
ATOM   815  N N     . SER A 1 114 ? 13.485  -5.032  48.215  1.00 3.07  ? 221  SER A N     1 
ATOM   816  C CA    . SER A 1 114 ? 14.500  -4.024  48.513  1.00 3.25  ? 221  SER A CA    1 
ATOM   817  C C     . SER A 1 114 ? 15.103  -4.174  49.913  1.00 3.41  ? 221  SER A C     1 
ATOM   818  O O     . SER A 1 114 ? 14.425  -4.601  50.853  1.00 2.86  ? 221  SER A O     1 
ATOM   819  C CB    . SER A 1 114 ? 13.896  -2.637  48.422  1.00 3.15  ? 221  SER A CB    1 
ATOM   820  O OG    . SER A 1 114 ? 14.888  -1.657  48.617  1.00 3.60  ? 221  SER A OG    1 
ATOM   821  N N     . LEU A 1 115 ? 16.375  -3.790  50.034  1.00 3.90  ? 222  LEU A N     1 
ATOM   822  C CA    . LEU A 1 115 ? 17.070  -3.766  51.321  1.00 4.56  ? 222  LEU A CA    1 
ATOM   823  C C     . LEU A 1 115 ? 16.723  -2.480  52.059  1.00 4.29  ? 222  LEU A C     1 
ATOM   824  O O     . LEU A 1 115 ? 17.001  -2.343  53.254  1.00 4.06  ? 222  LEU A O     1 
ATOM   825  C CB    . LEU A 1 115 ? 18.588  -3.834  51.130  1.00 5.30  ? 222  LEU A CB    1 
ATOM   826  C CG    . LEU A 1 115 ? 19.097  -4.976  50.249  1.00 7.15  ? 222  LEU A CG    1 
ATOM   827  C CD1   . LEU A 1 115 ? 20.607  -4.964  50.183  1.00 9.23  ? 222  LEU A CD1   1 
ATOM   828  C CD2   . LEU A 1 115 ? 18.609  -6.315  50.772  1.00 8.38  ? 222  LEU A CD2   1 
ATOM   829  N N     . ILE A 1 116 ? 16.138  -1.527  51.343  1.00 3.99  ? 223  ILE A N     1 
ATOM   830  C CA    . ILE A 1 116 ? 15.724  -0.267  51.944  1.00 4.02  ? 223  ILE A CA    1 
ATOM   831  C C     . ILE A 1 116 ? 14.411  -0.511  52.669  1.00 3.87  ? 223  ILE A C     1 
ATOM   832  O O     . ILE A 1 116 ? 13.503  -1.110  52.119  1.00 2.80  ? 223  ILE A O     1 
ATOM   833  C CB    . ILE A 1 116 ? 15.547  0.816   50.886  1.00 3.79  ? 223  ILE A CB    1 
ATOM   834  C CG1   . ILE A 1 116 ? 16.865  1.041   50.150  1.00 5.03  ? 223  ILE A CG1   1 
ATOM   835  C CG2   . ILE A 1 116 ? 15.073  2.118   51.527  1.00 3.14  ? 223  ILE A CG2   1 
ATOM   836  C CD1   . ILE A 1 116 ? 16.706  1.847   48.893  1.00 4.83  ? 223  ILE A CD1   1 
ATOM   837  N N     . SER A 1 117 ? 14.343  -0.082  53.923  1.00 3.63  ? 224  SER A N     1 
ATOM   838  C CA    . SER A 1 117 ? 13.162  -0.286  54.758  1.00 3.85  ? 224  SER A CA    1 
ATOM   839  C C     . SER A 1 117 ? 11.834  0.150   54.131  1.00 3.32  ? 224  SER A C     1 
ATOM   840  O O     . SER A 1 117 ? 11.658  1.317   53.811  1.00 2.78  ? 224  SER A O     1 
ATOM   841  C CB    . SER A 1 117 ? 13.353  0.467   56.075  1.00 4.59  ? 224  SER A CB    1 
ATOM   842  O OG    . SER A 1 117 ? 12.305  0.153   56.970  1.00 6.66  ? 224  SER A OG    1 
ATOM   843  N N     . SER A 1 118 ? 10.913  -0.801  53.972  1.00 3.00  ? 225  SER A N     1 
ATOM   844  C CA    . SER A 1 118 ? 9.545   -0.514  53.494  1.00 3.09  ? 225  SER A CA    1 
ATOM   845  C C     . SER A 1 118 ? 9.470   0.031   52.068  1.00 3.22  ? 225  SER A C     1 
ATOM   846  O O     . SER A 1 118 ? 8.407   0.502   51.627  1.00 3.34  ? 225  SER A O     1 
ATOM   847  C CB    . SER A 1 118 ? 8.874   0.469   54.462  1.00 2.88  ? 225  SER A CB    1 
ATOM   848  O OG    . SER A 1 118 ? 8.729   -0.106  55.745  1.00 3.17  ? 225  SER A OG    1 
ATOM   849  N N     . ALA A 1 119 ? 10.572  -0.066  51.331  1.00 3.38  ? 226  ALA A N     1 
ATOM   850  C CA    . ALA A 1 119 ? 10.683  0.493   49.987  1.00 3.48  ? 226  ALA A CA    1 
ATOM   851  C C     . ALA A 1 119 ? 10.060  -0.368  48.879  1.00 3.36  ? 226  ALA A C     1 
ATOM   852  O O     . ALA A 1 119 ? 10.057  0.036   47.717  1.00 3.94  ? 226  ALA A O     1 
ATOM   853  C CB    . ALA A 1 119 ? 12.139  0.766   49.672  1.00 3.48  ? 226  ALA A CB    1 
ATOM   854  N N     . GLY A 1 120 ? 9.531   -1.534  49.244  1.00 3.22  ? 227  GLY A N     1 
ATOM   855  C CA    . GLY A 1 120 ? 8.911   -2.445  48.299  1.00 2.87  ? 227  GLY A CA    1 
ATOM   856  C C     . GLY A 1 120 ? 9.944   -3.293  47.583  1.00 2.64  ? 227  GLY A C     1 
ATOM   857  O O     . GLY A 1 120 ? 10.914  -3.763  48.189  1.00 2.43  ? 227  GLY A O     1 
ATOM   858  N N     . GLU A 1 121 ? 9.747   -3.486  46.281  1.00 2.32  ? 228  GLU A N     1 
ATOM   859  C CA    . GLU A 1 121 ? 10.693  -4.244  45.484  1.00 2.34  ? 228  GLU A CA    1 
ATOM   860  C C     . GLU A 1 121 ? 11.825  -3.310  45.083  1.00 2.31  ? 228  GLU A C     1 
ATOM   861  O O     . GLU A 1 121 ? 11.652  -2.099  45.062  1.00 2.49  ? 228  GLU A O     1 
ATOM   862  C CB    . GLU A 1 121 ? 10.039  -4.814  44.223  1.00 2.52  ? 228  GLU A CB    1 
ATOM   863  C CG    . GLU A 1 121 ? 8.887   -5.768  44.488  1.00 3.17  ? 228  GLU A CG    1 
ATOM   864  C CD    . GLU A 1 121 ? 8.461   -6.522  43.236  1.00 4.92  ? 228  GLU A CD    1 
ATOM   865  O OE1   . GLU A 1 121 ? 8.462   -5.922  42.145  1.00 5.91  ? 228  GLU A OE1   1 
ATOM   866  O OE2   . GLU A 1 121 ? 8.141   -7.722  43.344  1.00 6.16  ? 228  GLU A OE2   1 
ATOM   867  N N     . GLY A 1 122 ? 12.980  -3.887  44.771  1.00 2.30  ? 229  GLY A N     1 
ATOM   868  C CA    . GLY A 1 122 ? 14.119  -3.135  44.286  1.00 2.20  ? 229  GLY A CA    1 
ATOM   869  C C     . GLY A 1 122 ? 14.778  -3.869  43.125  1.00 2.15  ? 229  GLY A C     1 
ATOM   870  O O     . GLY A 1 122 ? 14.360  -4.973  42.754  1.00 2.15  ? 229  GLY A O     1 
ATOM   871  N N     . LEU A 1 123 ? 15.812  -3.254  42.561  1.00 2.22  ? 230  LEU A N     1 
ATOM   872  C CA    . LEU A 1 123 ? 16.549  -3.802  41.435  1.00 2.13  ? 230  LEU A CA    1 
ATOM   873  C C     . LEU A 1 123 ? 17.956  -4.182  41.901  1.00 2.15  ? 230  LEU A C     1 
ATOM   874  O O     . LEU A 1 123 ? 18.621  -3.385  42.549  1.00 2.20  ? 230  LEU A O     1 
ATOM   875  C CB    . LEU A 1 123 ? 16.623  -2.757  40.328  1.00 2.21  ? 230  LEU A CB    1 
ATOM   876  C CG    . LEU A 1 123 ? 17.162  -3.248  38.983  1.00 2.18  ? 230  LEU A CG    1 
ATOM   877  C CD1   . LEU A 1 123 ? 16.210  -4.268  38.363  1.00 2.50  ? 230  LEU A CD1   1 
ATOM   878  C CD2   . LEU A 1 123 ? 17.388  -2.068  38.043  1.00 2.60  ? 230  LEU A CD2   1 
ATOM   879  N N     . PHE A 1 124 ? 18.396  -5.394  41.580  1.00 2.05  ? 231  PHE A N     1 
ATOM   880  C CA    . PHE A 1 124 ? 19.697  -5.875  42.041  1.00 2.38  ? 231  PHE A CA    1 
ATOM   881  C C     . PHE A 1 124 ? 20.609  -6.336  40.921  1.00 2.43  ? 231  PHE A C     1 
ATOM   882  O O     . PHE A 1 124 ? 20.168  -6.832  39.910  1.00 2.42  ? 231  PHE A O     1 
ATOM   883  C CB    . PHE A 1 124 ? 19.507  -7.041  43.007  1.00 2.23  ? 231  PHE A CB    1 
ATOM   884  C CG    . PHE A 1 124 ? 18.813  -6.666  44.269  1.00 2.69  ? 231  PHE A CG    1 
ATOM   885  C CD1   . PHE A 1 124 ? 17.443  -6.483  44.302  1.00 3.21  ? 231  PHE A CD1   1 
ATOM   886  C CD2   . PHE A 1 124 ? 19.534  -6.486  45.434  1.00 2.54  ? 231  PHE A CD2   1 
ATOM   887  C CE1   . PHE A 1 124 ? 16.807  -6.139  45.480  1.00 3.94  ? 231  PHE A CE1   1 
ATOM   888  C CE2   . PHE A 1 124 ? 18.900  -6.141  46.607  1.00 3.21  ? 231  PHE A CE2   1 
ATOM   889  C CZ    . PHE A 1 124 ? 17.542  -5.970  46.633  1.00 2.72  ? 231  PHE A CZ    1 
ATOM   890  N N     . SER A 1 125 ? 21.909  -6.195  41.130  1.00 2.69  ? 232  SER A N     1 
ATOM   891  C CA    . SER A 1 125 ? 22.862  -6.677  40.158  1.00 3.10  ? 232  SER A CA    1 
ATOM   892  C C     . SER A 1 125 ? 22.989  -8.182  40.259  1.00 2.97  ? 232  SER A C     1 
ATOM   893  O O     . SER A 1 125 ? 23.054  -8.736  41.364  1.00 2.99  ? 232  SER A O     1 
ATOM   894  C CB    . SER A 1 125 ? 24.242  -6.068  40.413  1.00 2.95  ? 232  SER A CB    1 
ATOM   895  O OG    A SER A 1 125 ? 24.570  -6.073  41.799  0.50 5.29  ? 232  SER A OG    1 
ATOM   896  O OG    B SER A 1 125 ? 25.105  -6.433  39.353  0.50 4.49  ? 232  SER A OG    1 
ATOM   897  N N     . LYS A 1 126 ? 23.064  -8.838  39.106  1.00 3.09  ? 233  LYS A N     1 
ATOM   898  C CA    . LYS A 1 126 ? 23.294  -10.273 39.050  1.00 3.64  ? 233  LYS A CA    1 
ATOM   899  C C     . LYS A 1 126 ? 24.779  -10.585 39.057  1.00 3.83  ? 233  LYS A C     1 
ATOM   900  O O     . LYS A 1 126 ? 25.189  -11.681 39.419  1.00 4.11  ? 233  LYS A O     1 
ATOM   901  C CB    . LYS A 1 126 ? 22.732  -10.849 37.748  1.00 3.60  ? 233  LYS A CB    1 
ATOM   902  C CG    . LYS A 1 126 ? 21.288  -11.149 37.782  1.00 4.20  ? 233  LYS A CG    1 
ATOM   903  C CD    . LYS A 1 126 ? 20.904  -12.027 36.601  1.00 4.67  ? 233  LYS A CD    1 
ATOM   904  C CE    . LYS A 1 126 ? 19.415  -12.173 36.504  1.00 4.71  ? 233  LYS A CE    1 
ATOM   905  N NZ    . LYS A 1 126 ? 19.004  -13.209 35.517  1.00 4.85  ? 233  LYS A NZ    1 
ATOM   906  N N     . VAL A 1 127 ? 25.584  -9.607  38.657  1.00 4.42  ? 234  VAL A N     1 
ATOM   907  C CA    . VAL A 1 127 ? 26.996  -9.819  38.406  1.00 4.40  ? 234  VAL A CA    1 
ATOM   908  C C     . VAL A 1 127 ? 27.836  -8.636  38.870  1.00 4.50  ? 234  VAL A C     1 
ATOM   909  O O     . VAL A 1 127 ? 27.306  -7.553  39.115  1.00 4.51  ? 234  VAL A O     1 
ATOM   910  C CB    . VAL A 1 127 ? 27.223  -10.020 36.886  1.00 4.65  ? 234  VAL A CB    1 
ATOM   911  C CG1   . VAL A 1 127 ? 26.545  -11.304 36.402  1.00 4.93  ? 234  VAL A CG1   1 
ATOM   912  C CG2   . VAL A 1 127 ? 26.683  -8.840  36.103  1.00 4.52  ? 234  VAL A CG2   1 
ATOM   913  N N     . ALA A 1 128 ? 29.141  -8.860  39.022  1.00 4.24  ? 235  ALA A N     1 
ATOM   914  C CA    . ALA A 1 128 ? 30.074  -7.799  39.364  1.00 3.86  ? 235  ALA A CA    1 
ATOM   915  C C     . ALA A 1 128 ? 30.358  -6.973  38.120  1.00 3.50  ? 235  ALA A C     1 
ATOM   916  O O     . ALA A 1 128 ? 30.673  -7.530  37.077  1.00 3.56  ? 235  ALA A O     1 
ATOM   917  C CB    . ALA A 1 128 ? 31.387  -8.386  39.903  1.00 4.11  ? 235  ALA A CB    1 
ATOM   918  N N     . VAL A 1 129 ? 30.255  -5.653  38.235  1.00 3.07  ? 236  VAL A N     1 
ATOM   919  C CA    . VAL A 1 129 ? 30.572  -4.751  37.131  1.00 2.74  ? 236  VAL A CA    1 
ATOM   920  C C     . VAL A 1 129 ? 31.426  -3.575  37.609  1.00 2.65  ? 236  VAL A C     1 
ATOM   921  O O     . VAL A 1 129 ? 31.505  -3.284  38.807  1.00 2.46  ? 236  VAL A O     1 
ATOM   922  C CB    . VAL A 1 129 ? 29.286  -4.217  36.449  1.00 2.68  ? 236  VAL A CB    1 
ATOM   923  C CG1   . VAL A 1 129 ? 28.513  -5.360  35.863  1.00 3.61  ? 236  VAL A CG1   1 
ATOM   924  C CG2   . VAL A 1 129 ? 28.426  -3.439  37.437  1.00 2.43  ? 236  VAL A CG2   1 
ATOM   925  N N     . GLY A 1 130 ? 32.080  -2.916  36.668  1.00 2.33  ? 237  GLY A N     1 
ATOM   926  C CA    . GLY A 1 130 ? 32.831  -1.722  36.973  1.00 2.18  ? 237  GLY A CA    1 
ATOM   927  C C     . GLY A 1 130 ? 31.965  -0.487  36.807  1.00 2.29  ? 237  GLY A C     1 
ATOM   928  O O     . GLY A 1 130 ? 30.770  -0.572  36.490  1.00 2.08  ? 237  GLY A O     1 
ATOM   929  N N     . PRO A 1 131 ? 32.567  0.675   37.015  1.00 2.31  ? 238  PRO A N     1 
ATOM   930  C CA    . PRO A 1 131 ? 31.876  1.948   36.840  1.00 2.21  ? 238  PRO A CA    1 
ATOM   931  C C     . PRO A 1 131 ? 31.507  2.156   35.382  1.00 2.28  ? 238  PRO A C     1 
ATOM   932  O O     . PRO A 1 131 ? 32.095  1.500   34.535  1.00 2.08  ? 238  PRO A O     1 
ATOM   933  C CB    . PRO A 1 131 ? 32.944  2.981   37.223  1.00 2.41  ? 238  PRO A CB    1 
ATOM   934  C CG    . PRO A 1 131 ? 34.019  2.248   37.840  1.00 2.81  ? 238  PRO A CG    1 
ATOM   935  C CD    . PRO A 1 131 ? 33.965  0.853   37.409  1.00 2.49  ? 238  PRO A CD    1 
ATOM   936  N N     . ASN A 1 132 ? 30.549  3.042   35.111  1.00 2.48  ? 239  ASN A N     1 
ATOM   937  C CA    . ASN A 1 132 ? 30.204  3.416   33.749  1.00 2.91  ? 239  ASN A CA    1 
ATOM   938  C C     . ASN A 1 132 ? 29.508  2.279   32.992  1.00 2.43  ? 239  ASN A C     1 
ATOM   939  O O     . ASN A 1 132 ? 29.484  2.301   31.763  1.00 2.65  ? 239  ASN A O     1 
ATOM   940  C CB    . ASN A 1 132 ? 31.457  3.843   32.981  1.00 3.61  ? 239  ASN A CB    1 
ATOM   941  C CG    . ASN A 1 132 ? 31.214  5.010   32.013  1.00 7.42  ? 239  ASN A CG    1 
ATOM   942  O OD1   . ASN A 1 132 ? 30.074  5.447   31.779  1.00 10.92 ? 239  ASN A OD1   1 
ATOM   943  N ND2   . ASN A 1 132 ? 32.302  5.510   31.430  1.00 11.07 ? 239  ASN A ND2   1 
ATOM   944  N N     . THR A 1 133 ? 28.933  1.315   33.708  1.00 2.07  ? 240  THR A N     1 
ATOM   945  C CA    . THR A 1 133 ? 28.302  0.157   33.059  1.00 2.01  ? 240  THR A CA    1 
ATOM   946  C C     . THR A 1 133 ? 26.777  0.275   32.950  1.00 2.04  ? 240  THR A C     1 
ATOM   947  O O     . THR A 1 133 ? 26.073  0.443   33.935  1.00 2.06  ? 240  THR A O     1 
ATOM   948  C CB    . THR A 1 133 ? 28.632  -1.143  33.799  1.00 2.12  ? 240  THR A CB    1 
ATOM   949  O OG1   . THR A 1 133 ? 30.051  -1.268  33.983  1.00 2.28  ? 240  THR A OG1   1 
ATOM   950  C CG2   . THR A 1 133 ? 28.262  -2.351  32.948  1.00 2.11  ? 240  THR A CG2   1 
ATOM   951  N N     . VAL A 1 134 ? 26.262  0.166   31.738  1.00 2.00  ? 241  VAL A N     1 
ATOM   952  C CA    . VAL A 1 134 ? 24.815  0.177   31.570  1.00 2.01  ? 241  VAL A CA    1 
ATOM   953  C C     . VAL A 1 134 ? 24.262  -1.130  32.134  1.00 2.16  ? 241  VAL A C     1 
ATOM   954  O O     . VAL A 1 134 ? 24.753  -2.217  31.809  1.00 2.29  ? 241  VAL A O     1 
ATOM   955  C CB    . VAL A 1 134 ? 24.419  0.335   30.105  1.00 2.05  ? 241  VAL A CB    1 
ATOM   956  C CG1   . VAL A 1 134 ? 22.902  0.169   29.941  1.00 2.07  ? 241  VAL A CG1   1 
ATOM   957  C CG2   . VAL A 1 134 ? 24.863  1.684   29.579  1.00 2.18  ? 241  VAL A CG2   1 
ATOM   958  N N     . MET A 1 135 ? 23.224  -1.036  32.958  1.00 2.59  ? 242  MET A N     1 
ATOM   959  C CA    . MET A 1 135 ? 22.672  -2.226  33.615  1.00 2.76  ? 242  MET A CA    1 
ATOM   960  C C     . MET A 1 135 ? 21.224  -2.534  33.297  1.00 2.34  ? 242  MET A C     1 
ATOM   961  O O     . MET A 1 135 ? 20.839  -3.689  33.299  1.00 2.18  ? 242  MET A O     1 
ATOM   962  C CB    . MET A 1 135 ? 22.756  -2.078  35.126  1.00 2.81  ? 242  MET A CB    1 
ATOM   963  C CG    . MET A 1 135 ? 24.163  -1.918  35.634  1.00 3.09  ? 242  MET A CG    1 
ATOM   964  S SD    . MET A 1 135 ? 25.119  -3.426  35.424  1.00 3.66  ? 242  MET A SD    1 
ATOM   965  C CE    . MET A 1 135 ? 24.649  -4.347  36.888  1.00 3.91  ? 242  MET A CE    1 
ATOM   966  N N     . SER A 1 136 ? 20.428  -1.493  33.089  1.00 2.43  ? 243  SER A N     1 
ATOM   967  C CA    . SER A 1 136 ? 18.988  -1.644  32.937  1.00 2.80  ? 243  SER A CA    1 
ATOM   968  C C     . SER A 1 136 ? 18.430  -0.532  32.059  1.00 2.74  ? 243  SER A C     1 
ATOM   969  O O     . SER A 1 136 ? 19.043  0.516   31.890  1.00 3.19  ? 243  SER A O     1 
ATOM   970  C CB    . SER A 1 136 ? 18.353  -1.584  34.332  1.00 2.79  ? 243  SER A CB    1 
ATOM   971  O OG    . SER A 1 136 ? 16.985  -1.910  34.357  1.00 3.90  ? 243  SER A OG    1 
ATOM   972  N N     . PHE A 1 137 ? 17.249  -0.764  31.516  1.00 2.66  ? 244  PHE A N     1 
ATOM   973  C CA    . PHE A 1 137 ? 16.602  0.200   30.632  1.00 2.43  ? 244  PHE A CA    1 
ATOM   974  C C     . PHE A 1 137 ? 15.324  0.716   31.253  1.00 2.17  ? 244  PHE A C     1 
ATOM   975  O O     . PHE A 1 137 ? 14.640  -0.013  31.958  1.00 2.24  ? 244  PHE A O     1 
ATOM   976  C CB    . PHE A 1 137 ? 16.358  -0.446  29.280  1.00 2.19  ? 244  PHE A CB    1 
ATOM   977  C CG    . PHE A 1 137 ? 17.611  -0.977  28.664  1.00 2.28  ? 244  PHE A CG    1 
ATOM   978  C CD1   . PHE A 1 137 ? 17.793  -2.334  28.481  1.00 2.21  ? 244  PHE A CD1   1 
ATOM   979  C CD2   . PHE A 1 137 ? 18.628  -0.111  28.298  1.00 2.35  ? 244  PHE A CD2   1 
ATOM   980  C CE1   . PHE A 1 137 ? 18.984  -2.818  27.945  1.00 2.25  ? 244  PHE A CE1   1 
ATOM   981  C CE2   . PHE A 1 137 ? 19.814  -0.595  27.763  1.00 2.45  ? 244  PHE A CE2   1 
ATOM   982  C CZ    . PHE A 1 137 ? 19.985  -1.948  27.588  1.00 2.16  ? 244  PHE A CZ    1 
ATOM   983  N N     . TYR A 1 138 ? 15.035  1.991   31.009  1.00 2.18  ? 245  TYR A N     1 
ATOM   984  C CA    . TYR A 1 138 ? 13.862  2.651   31.560  1.00 2.15  ? 245  TYR A CA    1 
ATOM   985  C C     . TYR A 1 138 ? 12.932  2.994   30.402  1.00 2.45  ? 245  TYR A C     1 
ATOM   986  O O     . TYR A 1 138 ? 12.892  4.136   29.945  1.00 2.43  ? 245  TYR A O     1 
ATOM   987  C CB    . TYR A 1 138 ? 14.256  3.924   32.353  1.00 2.20  ? 245  TYR A CB    1 
ATOM   988  C CG    . TYR A 1 138 ? 13.301  4.321   33.471  1.00 2.00  ? 245  TYR A CG    1 
ATOM   989  C CD1   . TYR A 1 138 ? 13.712  4.344   34.795  1.00 2.00  ? 245  TYR A CD1   1 
ATOM   990  C CD2   . TYR A 1 138 ? 11.988  4.684   33.201  1.00 2.44  ? 245  TYR A CD2   1 
ATOM   991  C CE1   . TYR A 1 138 ? 12.848  4.708   35.812  1.00 2.07  ? 245  TYR A CE1   1 
ATOM   992  C CE2   . TYR A 1 138 ? 11.121  5.048   34.214  1.00 2.16  ? 245  TYR A CE2   1 
ATOM   993  C CZ    . TYR A 1 138 ? 11.548  5.070   35.516  1.00 2.37  ? 245  TYR A CZ    1 
ATOM   994  O OH    . TYR A 1 138 ? 10.675  5.430   36.522  1.00 2.32  ? 245  TYR A OH    1 
ATOM   995  N N     . ASN A 1 139 ? 12.238  1.977   29.890  1.00 2.77  ? 246  ASN A N     1 
ATOM   996  C CA    . ASN A 1 139 ? 11.219  2.175   28.862  1.00 3.04  ? 246  ASN A CA    1 
ATOM   997  C C     . ASN A 1 139 ? 9.895   2.460   29.556  1.00 3.31  ? 246  ASN A C     1 
ATOM   998  O O     . ASN A 1 139 ? 9.744   2.209   30.747  1.00 3.44  ? 246  ASN A O     1 
ATOM   999  C CB    . ASN A 1 139 ? 11.057  0.938   27.976  1.00 2.93  ? 246  ASN A CB    1 
ATOM   1000 C CG    . ASN A 1 139 ? 10.037  1.154   26.861  1.00 2.79  ? 246  ASN A CG    1 
ATOM   1001 O OD1   . ASN A 1 139 ? 10.093  2.157   26.148  1.00 2.29  ? 246  ASN A OD1   1 
ATOM   1002 N ND2   . ASN A 1 139 ? 9.086   0.220   26.721  1.00 2.93  ? 246  ASN A ND2   1 
ATOM   1003 N N     . GLY A 1 140 ? 8.944   3.003   28.814  1.00 3.66  ? 247  GLY A N     1 
ATOM   1004 C CA    . GLY A 1 140 ? 7.616   3.268   29.336  1.00 3.80  ? 247  GLY A CA    1 
ATOM   1005 C C     . GLY A 1 140 ? 6.799   4.017   28.309  1.00 4.27  ? 247  GLY A C     1 
ATOM   1006 O O     . GLY A 1 140 ? 7.253   4.225   27.178  1.00 4.28  ? 247  GLY A O     1 
ATOM   1007 N N     . VAL A 1 141 ? 5.584   4.396   28.697  1.00 4.32  ? 248  VAL A N     1 
ATOM   1008 C CA    . VAL A 1 141 ? 4.708   5.179   27.852  1.00 4.50  ? 248  VAL A CA    1 
ATOM   1009 C C     . VAL A 1 141 ? 5.195   6.620   27.881  1.00 4.37  ? 248  VAL A C     1 
ATOM   1010 O O     . VAL A 1 141 ? 5.774   7.068   28.864  1.00 4.09  ? 248  VAL A O     1 
ATOM   1011 C CB    . VAL A 1 141 ? 3.233   5.103   28.304  1.00 4.48  ? 248  VAL A CB    1 
ATOM   1012 C CG1   . VAL A 1 141 ? 2.745   3.670   28.288  1.00 5.63  ? 248  VAL A CG1   1 
ATOM   1013 C CG2   . VAL A 1 141 ? 3.023   5.702   29.664  1.00 4.96  ? 248  VAL A CG2   1 
ATOM   1014 N N     . ARG A 1 142 ? 4.974   7.348   26.795  1.00 4.02  ? 249  ARG A N     1 
ATOM   1015 C CA    . ARG A 1 142 ? 5.419   8.733   26.726  1.00 4.38  ? 249  ARG A CA    1 
ATOM   1016 C C     . ARG A 1 142 ? 4.248   9.675   26.983  1.00 4.18  ? 249  ARG A C     1 
ATOM   1017 O O     . ARG A 1 142 ? 3.199   9.560   26.346  1.00 3.34  ? 249  ARG A O     1 
ATOM   1018 C CB    . ARG A 1 142 ? 6.013   9.022   25.353  1.00 5.06  ? 249  ARG A CB    1 
ATOM   1019 C CG    . ARG A 1 142 ? 7.450   8.604   25.238  1.00 6.52  ? 249  ARG A CG    1 
ATOM   1020 C CD    . ARG A 1 142 ? 7.815   7.997   23.918  1.00 9.42  ? 249  ARG A CD    1 
ATOM   1021 N NE    . ARG A 1 142 ? 8.843   6.985   24.094  1.00 11.70 ? 249  ARG A NE    1 
ATOM   1022 C CZ    . ARG A 1 142 ? 10.093  7.116   23.696  1.00 13.30 ? 249  ARG A CZ    1 
ATOM   1023 N NH1   . ARG A 1 142 ? 10.475  8.216   23.070  1.00 15.18 ? 249  ARG A NH1   1 
ATOM   1024 N NH2   . ARG A 1 142 ? 10.965  6.143   23.922  1.00 13.35 ? 249  ARG A NH2   1 
ATOM   1025 N N     . ILE A 1 143 ? 4.429   10.615  27.902  1.00 3.39  ? 250  ILE A N     1 
ATOM   1026 C CA    . ILE A 1 143 ? 3.389   11.580  28.226  1.00 3.73  ? 250  ILE A CA    1 
ATOM   1027 C C     . ILE A 1 143 ? 3.992   12.972  28.438  1.00 3.77  ? 250  ILE A C     1 
ATOM   1028 O O     . ILE A 1 143 ? 5.213   13.161  28.334  1.00 3.89  ? 250  ILE A O     1 
ATOM   1029 C CB    . ILE A 1 143 ? 2.611   11.120  29.460  1.00 4.31  ? 250  ILE A CB    1 
ATOM   1030 C CG1   . ILE A 1 143 ? 3.553   10.933  30.639  1.00 4.63  ? 250  ILE A CG1   1 
ATOM   1031 C CG2   . ILE A 1 143 ? 1.887   9.813   29.164  1.00 5.16  ? 250  ILE A CG2   1 
ATOM   1032 C CD1   . ILE A 1 143 ? 2.844   10.570  31.927  1.00 5.32  ? 250  ILE A CD1   1 
ATOM   1033 N N     . THR A 1 144 ? 3.148   13.951  28.740  1.00 3.68  ? 251  THR A N     1 
ATOM   1034 C CA    . THR A 1 144 ? 3.637   15.312  28.956  1.00 3.84  ? 251  THR A CA    1 
ATOM   1035 C C     . THR A 1 144 ? 3.874   15.648  30.430  1.00 4.23  ? 251  THR A C     1 
ATOM   1036 O O     . THR A 1 144 ? 3.304   15.034  31.329  1.00 3.85  ? 251  THR A O     1 
ATOM   1037 C CB    . THR A 1 144 ? 2.637   16.325  28.398  1.00 3.91  ? 251  THR A CB    1 
ATOM   1038 O OG1   . THR A 1 144 ? 1.476   16.366  29.245  1.00 2.98  ? 251  THR A OG1   1 
ATOM   1039 C CG2   . THR A 1 144 ? 2.135   15.916  27.032  1.00 3.69  ? 251  THR A CG2   1 
ATOM   1040 N N     . HIS A 1 145 ? 4.724   16.644  30.656  1.00 4.92  ? 252  HIS A N     1 
ATOM   1041 C CA    . HIS A 1 145 ? 4.997   17.135  31.987  1.00 5.37  ? 252  HIS A CA    1 
ATOM   1042 C C     . HIS A 1 145 ? 3.730   17.755  32.590  1.00 5.91  ? 252  HIS A C     1 
ATOM   1043 O O     . HIS A 1 145 ? 3.529   17.740  33.783  1.00 6.19  ? 252  HIS A O     1 
ATOM   1044 C CB    . HIS A 1 145 ? 6.129   18.167  31.939  1.00 5.54  ? 252  HIS A CB    1 
ATOM   1045 C CG    . HIS A 1 145 ? 7.471   17.579  31.608  1.00 5.74  ? 252  HIS A CG    1 
ATOM   1046 N ND1   . HIS A 1 145 ? 8.365   17.169  32.572  1.00 6.59  ? 252  HIS A ND1   1 
ATOM   1047 C CD2   . HIS A 1 145 ? 8.066   17.336  30.417  1.00 6.09  ? 252  HIS A CD2   1 
ATOM   1048 C CE1   . HIS A 1 145 ? 9.454   16.699  31.990  1.00 5.78  ? 252  HIS A CE1   1 
ATOM   1049 N NE2   . HIS A 1 145 ? 9.301   16.796  30.683  1.00 6.87  ? 252  HIS A NE2   1 
ATOM   1050 N N     . GLN A 1 146 ? 2.858   18.287  31.748  1.00 6.66  ? 253  GLN A N     1 
ATOM   1051 C CA    . GLN A 1 146 ? 1.646   18.938  32.236  1.00 7.22  ? 253  GLN A CA    1 
ATOM   1052 C C     . GLN A 1 146 ? 0.683   17.970  32.877  1.00 6.97  ? 253  GLN A C     1 
ATOM   1053 O O     . GLN A 1 146 ? 0.187   18.204  33.982  1.00 7.62  ? 253  GLN A O     1 
ATOM   1054 C CB    . GLN A 1 146 ? 0.923   19.618  31.094  1.00 7.93  ? 253  GLN A CB    1 
ATOM   1055 C CG    . GLN A 1 146 ? 1.585   20.884  30.621  1.00 9.76  ? 253  GLN A CG    1 
ATOM   1056 C CD    . GLN A 1 146 ? 2.804   20.650  29.728  1.00 11.24 ? 253  GLN A CD    1 
ATOM   1057 O OE1   . GLN A 1 146 ? 3.202   21.534  28.981  1.00 12.89 ? 253  GLN A OE1   1 
ATOM   1058 N NE2   . GLN A 1 146 ? 3.384   19.472  29.800  1.00 13.47 ? 253  GLN A NE2   1 
ATOM   1059 N N     . GLU A 1 147 ? 0.418   16.887  32.168  1.00 6.45  ? 254  GLU A N     1 
ATOM   1060 C CA    . GLU A 1 147 ? -0.470  15.849  32.654  1.00 7.11  ? 254  GLU A CA    1 
ATOM   1061 C C     . GLU A 1 147 ? 0.045   15.333  33.988  1.00 6.48  ? 254  GLU A C     1 
ATOM   1062 O O     . GLU A 1 147 ? -0.725  15.114  34.913  1.00 6.44  ? 254  GLU A O     1 
ATOM   1063 C CB    . GLU A 1 147 ? -0.530  14.696  31.648  1.00 7.42  ? 254  GLU A CB    1 
ATOM   1064 C CG    . GLU A 1 147 ? -1.409  13.521  32.075  1.00 9.67  ? 254  GLU A CG    1 
ATOM   1065 C CD    . GLU A 1 147 ? -1.514  12.426  31.008  1.00 12.85 ? 254  GLU A CD    1 
ATOM   1066 O OE1   . GLU A 1 147 ? -0.897  12.561  29.925  1.00 12.24 ? 254  GLU A OE1   1 
ATOM   1067 O OE2   . GLU A 1 147 ? -2.230  11.423  31.249  1.00 15.26 ? 254  GLU A OE2   1 
ATOM   1068 N N     . VAL A 1 148 ? 1.364   15.155  34.075  1.00 6.59  ? 255  VAL A N     1 
ATOM   1069 C CA    . VAL A 1 148 ? 2.005   14.650  35.278  1.00 6.49  ? 255  VAL A CA    1 
ATOM   1070 C C     . VAL A 1 148 ? 1.853   15.651  36.439  1.00 6.75  ? 255  VAL A C     1 
ATOM   1071 O O     . VAL A 1 148 ? 1.463   15.273  37.531  1.00 6.38  ? 255  VAL A O     1 
ATOM   1072 C CB    . VAL A 1 148 ? 3.505   14.345  35.012  1.00 6.42  ? 255  VAL A CB    1 
ATOM   1073 C CG1   . VAL A 1 148 ? 4.236   14.063  36.290  1.00 6.18  ? 255  VAL A CG1   1 
ATOM   1074 C CG2   . VAL A 1 148 ? 3.647   13.158  34.066  1.00 5.96  ? 255  VAL A CG2   1 
ATOM   1075 N N     . ASP A 1 149 ? 2.126   16.929  36.181  1.00 7.52  ? 256  ASP A N     1 
ATOM   1076 C CA    . ASP A 1 149 ? 2.012   17.982  37.199  1.00 8.01  ? 256  ASP A CA    1 
ATOM   1077 C C     . ASP A 1 149 ? 0.565   18.216  37.629  1.00 7.94  ? 256  ASP A C     1 
ATOM   1078 O O     . ASP A 1 149 ? 0.317   18.769  38.702  1.00 8.89  ? 256  ASP A O     1 
ATOM   1079 C CB    . ASP A 1 149 ? 2.583   19.306  36.678  1.00 8.71  ? 256  ASP A CB    1 
ATOM   1080 C CG    . ASP A 1 149 ? 4.066   19.221  36.343  1.00 10.13 ? 256  ASP A CG    1 
ATOM   1081 O OD1   . ASP A 1 149 ? 4.731   18.286  36.812  1.00 11.21 ? 256  ASP A OD1   1 
ATOM   1082 O OD2   . ASP A 1 149 ? 4.660   20.027  35.596  1.00 13.23 ? 256  ASP A OD2   1 
ATOM   1083 N N     . SER A 1 150 ? -0.382  17.788  36.802  1.00 7.19  ? 257  SER A N     1 
ATOM   1084 C CA    . SER A 1 150 ? -1.799  17.999  37.086  1.00 6.69  ? 257  SER A CA    1 
ATOM   1085 C C     . SER A 1 150 ? -2.443  16.794  37.772  1.00 6.14  ? 257  SER A C     1 
ATOM   1086 O O     . SER A 1 150 ? -3.653  16.773  37.998  1.00 6.30  ? 257  SER A O     1 
ATOM   1087 C CB    . SER A 1 150 ? -2.549  18.295  35.789  1.00 6.90  ? 257  SER A CB    1 
ATOM   1088 O OG    . SER A 1 150 ? -2.974  17.081  35.197  1.00 7.47  ? 257  SER A OG    1 
ATOM   1089 N N     . ARG A 1 151 ? -1.650  15.783  38.113  1.00 5.33  ? 258  ARG A N     1 
ATOM   1090 C CA    . ARG A 1 151 ? -2.224  14.601  38.751  1.00 4.73  ? 258  ARG A CA    1 
ATOM   1091 C C     . ARG A 1 151 ? -1.551  14.266  40.077  1.00 4.32  ? 258  ARG A C     1 
ATOM   1092 O O     . ARG A 1 151 ? -0.455  14.729  40.356  1.00 3.68  ? 258  ARG A O     1 
ATOM   1093 C CB    . ARG A 1 151 ? -2.178  13.397  37.822  1.00 4.74  ? 258  ARG A CB    1 
ATOM   1094 C CG    . ARG A 1 151 ? -0.801  12.948  37.443  1.00 4.66  ? 258  ARG A CG    1 
ATOM   1095 C CD    . ARG A 1 151 ? -0.806  11.964  36.291  1.00 4.23  ? 258  ARG A CD    1 
ATOM   1096 N NE    . ARG A 1 151 ? 0.439   11.225  36.181  1.00 3.76  ? 258  ARG A NE    1 
ATOM   1097 C CZ    . ARG A 1 151 ? 0.678   10.280  35.288  1.00 3.91  ? 258  ARG A CZ    1 
ATOM   1098 N NH1   . ARG A 1 151 ? -0.253  9.948   34.393  1.00 3.83  ? 258  ARG A NH1   1 
ATOM   1099 N NH2   . ARG A 1 151 ? 1.857   9.672   35.282  1.00 4.26  ? 258  ARG A NH2   1 
ATOM   1100 N N     . ASP A 1 152 ? -2.254  13.461  40.868  1.00 4.17  ? 259  ASP A N     1 
ATOM   1101 C CA    . ASP A 1 152 ? -1.831  13.025  42.202  1.00 3.92  ? 259  ASP A CA    1 
ATOM   1102 C C     . ASP A 1 152 ? -0.514  12.255  42.188  1.00 3.64  ? 259  ASP A C     1 
ATOM   1103 O O     . ASP A 1 152 ? -0.214  11.522  41.245  1.00 3.11  ? 259  ASP A O     1 
ATOM   1104 C CB    . ASP A 1 152 ? -2.930  12.122  42.753  1.00 4.24  ? 259  ASP A CB    1 
ATOM   1105 C CG    . ASP A 1 152 ? -2.800  11.847  44.221  1.00 5.85  ? 259  ASP A CG    1 
ATOM   1106 O OD1   . ASP A 1 152 ? -1.852  11.160  44.626  1.00 6.94  ? 259  ASP A OD1   1 
ATOM   1107 O OD2   . ASP A 1 152 ? -3.658  12.248  45.031  1.00 9.13  ? 259  ASP A OD2   1 
ATOM   1108 N N     . TRP A 1 153 ? 0.269   12.394  43.259  1.00 3.86  ? 260  TRP A N     1 
ATOM   1109 C CA    . TRP A 1 153 ? 1.550   11.696  43.325  1.00 3.80  ? 260  TRP A CA    1 
ATOM   1110 C C     . TRP A 1 153 ? 1.374   10.193  43.279  1.00 3.37  ? 260  TRP A C     1 
ATOM   1111 O O     . TRP A 1 153 ? 2.280   9.476   42.883  1.00 4.00  ? 260  TRP A O     1 
ATOM   1112 C CB    . TRP A 1 153 ? 2.322   12.060  44.581  1.00 4.34  ? 260  TRP A CB    1 
ATOM   1113 C CG    . TRP A 1 153 ? 3.204   13.248  44.416  1.00 5.06  ? 260  TRP A CG    1 
ATOM   1114 C CD1   . TRP A 1 153 ? 2.993   14.485  44.936  1.00 5.61  ? 260  TRP A CD1   1 
ATOM   1115 C CD2   . TRP A 1 153 ? 4.443   13.320  43.695  1.00 4.92  ? 260  TRP A CD2   1 
ATOM   1116 N NE1   . TRP A 1 153 ? 4.011   15.332  44.573  1.00 5.32  ? 260  TRP A NE1   1 
ATOM   1117 C CE2   . TRP A 1 153 ? 4.916   14.639  43.812  1.00 5.59  ? 260  TRP A CE2   1 
ATOM   1118 C CE3   . TRP A 1 153 ? 5.196   12.406  42.945  1.00 5.71  ? 260  TRP A CE3   1 
ATOM   1119 C CZ2   . TRP A 1 153 ? 6.103   15.066  43.222  1.00 6.33  ? 260  TRP A CZ2   1 
ATOM   1120 C CZ3   . TRP A 1 153 ? 6.383   12.839  42.357  1.00 6.16  ? 260  TRP A CZ3   1 
ATOM   1121 C CH2   . TRP A 1 153 ? 6.822   14.155  42.506  1.00 5.94  ? 260  TRP A CH2   1 
ATOM   1122 N N     . ALA A 1 154 ? 0.215   9.715   43.702  1.00 2.79  ? 261  ALA A N     1 
ATOM   1123 C CA    . ALA A 1 154 ? -0.050  8.292   43.691  1.00 2.81  ? 261  ALA A CA    1 
ATOM   1124 C C     . ALA A 1 154 ? 0.115   7.752   42.270  1.00 2.68  ? 261  ALA A C     1 
ATOM   1125 O O     . ALA A 1 154 ? 0.342   6.565   42.093  1.00 2.83  ? 261  ALA A O     1 
ATOM   1126 C CB    . ALA A 1 154 ? -1.418  8.005   44.207  1.00 3.00  ? 261  ALA A CB    1 
ATOM   1127 N N     . LEU A 1 155 ? 0.022   8.633   41.270  1.00 2.70  ? 262  LEU A N     1 
ATOM   1128 C CA    . LEU A 1 155 ? 0.198   8.252   39.866  1.00 2.95  ? 262  LEU A CA    1 
ATOM   1129 C C     . LEU A 1 155 ? 1.582   8.582   39.304  1.00 3.18  ? 262  LEU A C     1 
ATOM   1130 O O     . LEU A 1 155 ? 1.877   8.216   38.161  1.00 3.23  ? 262  LEU A O     1 
ATOM   1131 C CB    . LEU A 1 155 ? -0.841  8.985   38.993  1.00 2.95  ? 262  LEU A CB    1 
ATOM   1132 C CG    . LEU A 1 155 ? -2.312  8.808   39.386  1.00 3.70  ? 262  LEU A CG    1 
ATOM   1133 C CD1   . LEU A 1 155 ? -3.220  9.716   38.576  1.00 4.17  ? 262  LEU A CD1   1 
ATOM   1134 C CD2   . LEU A 1 155 ? -2.738  7.384   39.178  1.00 4.22  ? 262  LEU A CD2   1 
ATOM   1135 N N     . ASN A 1 156 ? 2.427   9.247   40.098  1.00 3.18  ? 263  ASN A N     1 
ATOM   1136 C CA    . ASN A 1 156 ? 3.719   9.748   39.623  1.00 3.19  ? 263  ASN A CA    1 
ATOM   1137 C C     . ASN A 1 156 ? 4.956   9.112   40.279  1.00 3.27  ? 263  ASN A C     1 
ATOM   1138 O O     . ASN A 1 156 ? 6.022   9.740   40.386  1.00 3.08  ? 263  ASN A O     1 
ATOM   1139 C CB    . ASN A 1 156 ? 3.757   11.274  39.771  1.00 3.19  ? 263  ASN A CB    1 
ATOM   1140 C CG    . ASN A 1 156 ? 2.767   11.976  38.847  1.00 3.20  ? 263  ASN A CG    1 
ATOM   1141 O OD1   . ASN A 1 156 ? 2.454   11.479  37.762  1.00 3.60  ? 263  ASN A OD1   1 
ATOM   1142 N ND2   . ASN A 1 156 ? 2.263   13.132  39.273  1.00 2.78  ? 263  ASN A ND2   1 
ATOM   1143 N N     . GLY A 1 157 ? 4.821   7.874   40.742  1.00 3.23  ? 264  GLY A N     1 
ATOM   1144 C CA    . GLY A 1 157 ? 5.955   7.159   41.309  1.00 2.91  ? 264  GLY A CA    1 
ATOM   1145 C C     . GLY A 1 157 ? 7.028   6.781   40.291  1.00 2.93  ? 264  GLY A C     1 
ATOM   1146 O O     . GLY A 1 157 ? 8.228   6.724   40.628  1.00 3.18  ? 264  GLY A O     1 
ATOM   1147 N N     . ASN A 1 158 ? 6.612   6.529   39.044  1.00 2.70  ? 265  ASN A N     1 
ATOM   1148 C CA    . ASN A 1 158 ? 7.515   6.059   37.998  1.00 2.83  ? 265  ASN A CA    1 
ATOM   1149 C C     . ASN A 1 158 ? 7.782   7.030   36.854  1.00 2.63  ? 265  ASN A C     1 
ATOM   1150 O O     . ASN A 1 158 ? 8.411   6.670   35.868  1.00 3.13  ? 265  ASN A O     1 
ATOM   1151 C CB    . ASN A 1 158 ? 6.995   4.736   37.440  1.00 3.16  ? 265  ASN A CB    1 
ATOM   1152 C CG    . ASN A 1 158 ? 7.070   3.609   38.466  1.00 4.64  ? 265  ASN A CG    1 
ATOM   1153 O OD1   . ASN A 1 158 ? 7.723   3.733   39.519  1.00 6.97  ? 265  ASN A OD1   1 
ATOM   1154 N ND2   . ASN A 1 158 ? 6.423   2.499   38.158  1.00 5.90  ? 265  ASN A ND2   1 
ATOM   1155 N N     . THR A 1 159 ? 7.312   8.260   36.975  1.00 2.76  ? 266  THR A N     1 
ATOM   1156 C CA    . THR A 1 159 ? 7.534   9.243   35.928  1.00 2.53  ? 266  THR A CA    1 
ATOM   1157 C C     . THR A 1 159 ? 8.988   9.687   35.950  1.00 2.81  ? 266  THR A C     1 
ATOM   1158 O O     . THR A 1 159 ? 9.516   10.009  37.015  1.00 3.23  ? 266  THR A O     1 
ATOM   1159 C CB    . THR A 1 159 ? 6.657   10.449  36.156  1.00 2.58  ? 266  THR A CB    1 
ATOM   1160 O OG1   . THR A 1 159 ? 6.755   10.851  37.536  1.00 2.28  ? 266  THR A OG1   1 
ATOM   1161 C CG2   . THR A 1 159 ? 5.182   10.097  35.948  1.00 2.42  ? 266  THR A CG2   1 
ATOM   1162 N N     . LEU A 1 160 ? 9.606   9.711   34.775  1.00 2.94  ? 267  LEU A N     1 
ATOM   1163 C CA    . LEU A 1 160 ? 10.987  10.109  34.596  1.00 3.68  ? 267  LEU A CA    1 
ATOM   1164 C C     . LEU A 1 160 ? 11.056  11.061  33.421  1.00 4.61  ? 267  LEU A C     1 
ATOM   1165 O O     . LEU A 1 160 ? 10.514  10.764  32.334  1.00 3.96  ? 267  LEU A O     1 
ATOM   1166 C CB    . LEU A 1 160 ? 11.856  8.890   34.312  1.00 3.83  ? 267  LEU A CB    1 
ATOM   1167 C CG    . LEU A 1 160 ? 13.291  9.198   33.862  1.00 3.83  ? 267  LEU A CG    1 
ATOM   1168 C CD1   . LEU A 1 160 ? 14.115  9.914   34.943  1.00 4.78  ? 267  LEU A CD1   1 
ATOM   1169 C CD2   . LEU A 1 160 ? 13.946  7.910   33.437  1.00 4.52  ? 267  LEU A CD2   1 
ATOM   1170 N N     . SER A 1 161 ? 11.692  12.210  33.629  1.00 5.56  ? 268  SER A N     1 
ATOM   1171 C CA    . SER A 1 161 ? 11.786  13.203  32.563  1.00 6.81  ? 268  SER A CA    1 
ATOM   1172 C C     . SER A 1 161 ? 12.801  12.694  31.527  1.00 7.87  ? 268  SER A C     1 
ATOM   1173 O O     . SER A 1 161 ? 13.968  12.392  31.860  1.00 8.21  ? 268  SER A O     1 
ATOM   1174 C CB    . SER A 1 161 ? 12.141  14.598  33.129  1.00 6.96  ? 268  SER A CB    1 
ATOM   1175 O OG    A SER A 1 161 ? 11.251  14.979  34.133  0.50 7.90  ? 268  SER A OG    1 
ATOM   1176 O OG    B SER A 1 161 ? 12.920  15.273  32.173  0.50 7.34  ? 268  SER A OG    1 
ATOM   1177 N N     . LEU A 1 162 ? 12.345  12.574  30.289  1.00 9.28  ? 269  LEU A N     1 
ATOM   1178 C CA    . LEU A 1 162 ? 13.168  12.087  29.190  1.00 10.67 ? 269  LEU A CA    1 
ATOM   1179 C C     . LEU A 1 162 ? 13.918  13.255  28.554  1.00 11.61 ? 269  LEU A C     1 
ATOM   1180 O O     . LEU A 1 162 ? 15.148  13.263  28.471  1.00 11.86 ? 269  LEU A O     1 
ATOM   1181 C CB    . LEU A 1 162 ? 12.292  11.404  28.140  1.00 10.48 ? 269  LEU A CB    1 
ATOM   1182 C CG    . LEU A 1 162 ? 12.909  10.303  27.274  1.00 11.51 ? 269  LEU A CG    1 
ATOM   1183 C CD1   . LEU A 1 162 ? 12.263  10.333  25.897  1.00 11.38 ? 269  LEU A CD1   1 
ATOM   1184 C CD2   . LEU A 1 162 ? 14.419  10.399  27.144  1.00 12.54 ? 269  LEU A CD2   1 
ATOM   1185 N N     . ASP A 1 163 ? 13.152  14.239  28.114  1.00 12.80 ? 270  ASP A N     1 
ATOM   1186 C CA    . ASP A 1 163 ? 13.676  15.440  27.491  1.00 13.69 ? 270  ASP A CA    1 
ATOM   1187 C C     . ASP A 1 163 ? 12.755  16.571  27.958  1.00 14.07 ? 270  ASP A C     1 
ATOM   1188 O O     . ASP A 1 163 ? 11.871  16.357  28.794  1.00 14.20 ? 270  ASP A O     1 
ATOM   1189 C CB    . ASP A 1 163 ? 13.689  15.311  25.962  1.00 13.95 ? 270  ASP A CB    1 
ATOM   1190 C CG    . ASP A 1 163 ? 12.311  15.213  25.376  1.00 14.89 ? 270  ASP A CG    1 
ATOM   1191 O OD1   . ASP A 1 163 ? 11.368  15.718  26.018  1.00 14.96 ? 270  ASP A OD1   1 
ATOM   1192 O OD2   . ASP A 1 163 ? 12.061  14.665  24.267  1.00 17.09 ? 270  ASP A OD2   1 
ATOM   1193 N N     . GLU A 1 164 ? 12.948  17.763  27.416  1.00 14.31 ? 271  GLU A N     1 
ATOM   1194 C CA    . GLU A 1 164 ? 12.154  18.915  27.816  1.00 14.56 ? 271  GLU A CA    1 
ATOM   1195 C C     . GLU A 1 164 ? 10.656  18.705  27.566  1.00 14.24 ? 271  GLU A C     1 
ATOM   1196 O O     . GLU A 1 164 ? 9.811   19.220  28.306  1.00 14.58 ? 271  GLU A O     1 
ATOM   1197 C CB    . GLU A 1 164 ? 12.632  20.138  27.034  1.00 15.14 ? 271  GLU A CB    1 
ATOM   1198 C CG    . GLU A 1 164 ? 12.577  21.432  27.821  1.00 16.67 ? 271  GLU A CG    1 
ATOM   1199 C CD    . GLU A 1 164 ? 13.173  22.603  27.053  1.00 18.56 ? 271  GLU A CD    1 
ATOM   1200 O OE1   . GLU A 1 164 ? 13.233  22.537  25.801  1.00 19.69 ? 271  GLU A OE1   1 
ATOM   1201 O OE2   . GLU A 1 164 ? 13.584  23.591  27.702  1.00 19.35 ? 271  GLU A OE2   1 
ATOM   1202 N N     . GLU A 1 165 ? 10.339  17.938  26.530  1.00 13.41 ? 272  GLU A N     1 
ATOM   1203 C CA    . GLU A 1 165 ? 8.964   17.740  26.095  1.00 12.91 ? 272  GLU A CA    1 
ATOM   1204 C C     . GLU A 1 165 ? 8.329   16.421  26.530  1.00 11.55 ? 272  GLU A C     1 
ATOM   1205 O O     . GLU A 1 165 ? 7.108   16.284  26.498  1.00 11.51 ? 272  GLU A O     1 
ATOM   1206 C CB    . GLU A 1 165 ? 8.919   17.825  24.564  1.00 13.45 ? 272  GLU A CB    1 
ATOM   1207 C CG    . GLU A 1 165 ? 7.646   17.287  23.930  1.00 15.09 ? 272  GLU A CG    1 
ATOM   1208 C CD    . GLU A 1 165 ? 6.425   18.139  24.229  1.00 17.47 ? 272  GLU A CD    1 
ATOM   1209 O OE1   . GLU A 1 165 ? 6.010   18.937  23.354  1.00 17.98 ? 272  GLU A OE1   1 
ATOM   1210 O OE2   . GLU A 1 165 ? 5.871   17.995  25.343  1.00 19.19 ? 272  GLU A OE2   1 
ATOM   1211 N N     . THR A 1 166 ? 9.134   15.452  26.944  1.00 9.75  ? 273  THR A N     1 
ATOM   1212 C CA    . THR A 1 166 ? 8.585   14.129  27.218  1.00 8.69  ? 273  THR A CA    1 
ATOM   1213 C C     . THR A 1 166 ? 8.942   13.528  28.565  1.00 7.33  ? 273  THR A C     1 
ATOM   1214 O O     . THR A 1 166 ? 10.073  13.621  29.005  1.00 7.19  ? 273  THR A O     1 
ATOM   1215 C CB    . THR A 1 166 ? 9.075   13.153  26.159  1.00 8.76  ? 273  THR A CB    1 
ATOM   1216 O OG1   . THR A 1 166 ? 9.047   13.781  24.869  1.00 9.12  ? 273  THR A OG1   1 
ATOM   1217 C CG2   . THR A 1 166 ? 8.126   11.978  26.041  1.00 9.77  ? 273  THR A CG2   1 
ATOM   1218 N N     . VAL A 1 167 ? 7.953   12.863  29.151  1.00 6.08  ? 274  VAL A N     1 
ATOM   1219 C CA    . VAL A 1 167 ? 8.077   12.124  30.390  1.00 5.63  ? 274  VAL A CA    1 
ATOM   1220 C C     . VAL A 1 167 ? 7.804   10.658  30.066  1.00 5.28  ? 274  VAL A C     1 
ATOM   1221 O O     . VAL A 1 167 ? 6.843   10.333  29.349  1.00 4.93  ? 274  VAL A O     1 
ATOM   1222 C CB    . VAL A 1 167 ? 7.038   12.603  31.427  1.00 5.35  ? 274  VAL A CB    1 
ATOM   1223 C CG1   . VAL A 1 167 ? 7.064   11.752  32.668  1.00 5.23  ? 274  VAL A CG1   1 
ATOM   1224 C CG2   . VAL A 1 167 ? 7.260   14.059  31.782  1.00 6.17  ? 274  VAL A CG2   1 
ATOM   1225 N N     . ILE A 1 168 ? 8.673   9.779   30.545  1.00 4.74  ? 275  ILE A N     1 
ATOM   1226 C CA    . ILE A 1 168 ? 8.492   8.345   30.395  1.00 5.25  ? 275  ILE A CA    1 
ATOM   1227 C C     . ILE A 1 168 ? 7.843   7.847   31.682  1.00 5.16  ? 275  ILE A C     1 
ATOM   1228 O O     . ILE A 1 168 ? 8.244   8.252   32.778  1.00 4.51  ? 275  ILE A O     1 
ATOM   1229 C CB    . ILE A 1 168 ? 9.845   7.644   30.146  1.00 6.00  ? 275  ILE A CB    1 
ATOM   1230 C CG1   . ILE A 1 168 ? 10.254  7.791   28.685  1.00 7.09  ? 275  ILE A CG1   1 
ATOM   1231 C CG2   . ILE A 1 168 ? 9.778   6.160   30.517  1.00 6.24  ? 275  ILE A CG2   1 
ATOM   1232 C CD1   . ILE A 1 168 ? 9.124   7.536   27.688  1.00 8.89  ? 275  ILE A CD1   1 
ATOM   1233 N N     . ASP A 1 169 ? 6.821   7.003   31.550  1.00 4.93  ? 276  ASP A N     1 
ATOM   1234 C CA    . ASP A 1 169 ? 6.097   6.499   32.712  1.00 4.99  ? 276  ASP A CA    1 
ATOM   1235 C C     . ASP A 1 169 ? 5.813   5.004   32.610  1.00 5.08  ? 276  ASP A C     1 
ATOM   1236 O O     . ASP A 1 169 ? 5.674   4.459   31.522  1.00 4.61  ? 276  ASP A O     1 
ATOM   1237 C CB    . ASP A 1 169 ? 4.781   7.268   32.855  1.00 5.23  ? 276  ASP A CB    1 
ATOM   1238 C CG    . ASP A 1 169 ? 4.056   6.983   34.159  1.00 5.97  ? 276  ASP A CG    1 
ATOM   1239 O OD1   . ASP A 1 169 ? 4.721   6.607   35.154  1.00 7.19  ? 276  ASP A OD1   1 
ATOM   1240 O OD2   . ASP A 1 169 ? 2.818   7.146   34.273  1.00 6.97  ? 276  ASP A OD2   1 
ATOM   1241 N N     . VAL A 1 170 ? 5.758   4.335   33.761  1.00 5.26  ? 277  VAL A N     1 
ATOM   1242 C CA    . VAL A 1 170 ? 5.382   2.928   33.811  1.00 5.55  ? 277  VAL A CA    1 
ATOM   1243 C C     . VAL A 1 170 ? 4.143   2.842   34.703  1.00 5.75  ? 277  VAL A C     1 
ATOM   1244 O O     . VAL A 1 170 ? 4.226   2.531   35.888  1.00 5.17  ? 277  VAL A O     1 
ATOM   1245 C CB    . VAL A 1 170 ? 6.506   2.054   34.354  1.00 6.07  ? 277  VAL A CB    1 
ATOM   1246 C CG1   . VAL A 1 170 ? 6.110   0.589   34.321  1.00 6.33  ? 277  VAL A CG1   1 
ATOM   1247 C CG2   . VAL A 1 170 ? 7.767   2.265   33.537  1.00 6.87  ? 277  VAL A CG2   1 
ATOM   1248 N N     . PRO A 1 171 ? 2.995   3.165   34.130  1.00 5.68  ? 278  PRO A N     1 
ATOM   1249 C CA    . PRO A 1 171 ? 1.717   3.192   34.842  1.00 6.20  ? 278  PRO A CA    1 
ATOM   1250 C C     . PRO A 1 171 ? 1.214   1.820   35.278  1.00 6.95  ? 278  PRO A C     1 
ATOM   1251 O O     . PRO A 1 171 ? 1.647   0.810   34.733  1.00 6.97  ? 278  PRO A O     1 
ATOM   1252 C CB    . PRO A 1 171 ? 0.738   3.734   33.780  1.00 6.37  ? 278  PRO A CB    1 
ATOM   1253 C CG    . PRO A 1 171 ? 1.493   3.937   32.561  1.00 6.28  ? 278  PRO A CG    1 
ATOM   1254 C CD    . PRO A 1 171 ? 2.853   3.518   32.708  1.00 5.79  ? 278  PRO A CD    1 
ATOM   1255 N N     . GLU A 1 172 ? 0.314   1.794   36.259  1.00 7.70  ? 279  GLU A N     1 
ATOM   1256 C CA    . GLU A 1 172 ? -0.341  0.559   36.691  1.00 8.29  ? 279  GLU A CA    1 
ATOM   1257 C C     . GLU A 1 172 ? -0.786  -0.106  35.394  1.00 8.23  ? 279  GLU A C     1 
ATOM   1258 O O     . GLU A 1 172 ? -1.127  0.658   34.486  1.00 8.51  ? 279  GLU A O     1 
ATOM   1259 C CB    . GLU A 1 172 ? -1.627  0.928   37.450  1.00 8.86  ? 279  GLU A CB    1 
ATOM   1260 C CG    . GLU A 1 172 ? -1.592  0.943   38.965  1.00 10.55 ? 279  GLU A CG    1 
ATOM   1261 C CD    . GLU A 1 172 ? -0.797  -0.198  39.546  1.00 11.50 ? 279  GLU A CD    1 
ATOM   1262 O OE1   . GLU A 1 172 ? -0.096  0.024   40.564  1.00 12.98 ? 279  GLU A OE1   1 
ATOM   1263 O OE2   . GLU A 1 172 ? -0.874  -1.317  38.996  1.00 12.19 ? 279  GLU A OE2   1 
ATOM   1264 N N     . PRO A 1 173 ? -0.849  -1.424  35.159  1.00 8.03  ? 280  PRO A N     1 
ATOM   1265 C CA    . PRO A 1 173 ? -0.438  -2.620  35.910  1.00 7.65  ? 280  PRO A CA    1 
ATOM   1266 C C     . PRO A 1 173 ? 1.043   -2.900  35.695  1.00 6.68  ? 280  PRO A C     1 
ATOM   1267 O O     . PRO A 1 173 ? 1.691   -3.577  36.482  1.00 7.93  ? 280  PRO A O     1 
ATOM   1268 C CB    . PRO A 1 173 ? -1.239  -3.753  35.191  1.00 7.99  ? 280  PRO A CB    1 
ATOM   1269 C CG    . PRO A 1 173 ? -1.963  -3.141  34.091  1.00 8.12  ? 280  PRO A CG    1 
ATOM   1270 C CD    . PRO A 1 173 ? -1.524  -1.783  33.914  1.00 8.30  ? 280  PRO A CD    1 
ATOM   1271 N N     . TYR A 1 174 ? 1.575   -2.321  34.628  1.00 5.83  ? 281  TYR A N     1 
ATOM   1272 C CA    . TYR A 1 174 ? 2.948   -2.492  34.168  1.00 4.98  ? 281  TYR A CA    1 
ATOM   1273 C C     . TYR A 1 174 ? 4.061   -2.236  35.181  1.00 4.34  ? 281  TYR A C     1 
ATOM   1274 O O     . TYR A 1 174 ? 5.201   -2.564  34.898  1.00 4.10  ? 281  TYR A O     1 
ATOM   1275 C CB    . TYR A 1 174 ? 3.143   -1.626  32.932  1.00 4.93  ? 281  TYR A CB    1 
ATOM   1276 C CG    . TYR A 1 174 ? 1.998   -1.853  31.958  1.00 5.13  ? 281  TYR A CG    1 
ATOM   1277 C CD1   . TYR A 1 174 ? 1.142   -0.824  31.599  1.00 6.00  ? 281  TYR A CD1   1 
ATOM   1278 C CD2   . TYR A 1 174 ? 1.748   -3.119  31.445  1.00 5.49  ? 281  TYR A CD2   1 
ATOM   1279 C CE1   . TYR A 1 174 ? 0.082   -1.048  30.733  1.00 6.35  ? 281  TYR A CE1   1 
ATOM   1280 C CE2   . TYR A 1 174 ? 0.697   -3.351  30.583  1.00 6.56  ? 281  TYR A CE2   1 
ATOM   1281 C CZ    . TYR A 1 174 ? -0.126  -2.314  30.231  1.00 6.60  ? 281  TYR A CZ    1 
ATOM   1282 O OH    . TYR A 1 174 ? -1.168  -2.555  29.374  1.00 7.98  ? 281  TYR A OH    1 
ATOM   1283 N N     . ASN A 1 175 ? 3.744   -1.655  36.335  1.00 3.78  ? 282  ASN A N     1 
ATOM   1284 C CA    . ASN A 1 175 ? 4.756   -1.474  37.377  1.00 3.97  ? 282  ASN A CA    1 
ATOM   1285 C C     . ASN A 1 175 ? 4.962   -2.793  38.130  1.00 3.55  ? 282  ASN A C     1 
ATOM   1286 O O     . ASN A 1 175 ? 5.766   -2.876  39.063  1.00 3.50  ? 282  ASN A O     1 
ATOM   1287 C CB    . ASN A 1 175 ? 4.402   -0.340  38.344  1.00 4.11  ? 282  ASN A CB    1 
ATOM   1288 C CG    . ASN A 1 175 ? 3.066   -0.537  39.012  1.00 5.03  ? 282  ASN A CG    1 
ATOM   1289 O OD1   . ASN A 1 175 ? 2.065   -0.819  38.361  1.00 5.68  ? 282  ASN A OD1   1 
ATOM   1290 N ND2   . ASN A 1 175 ? 3.043   -0.379  40.325  1.00 5.45  ? 282  ASN A ND2   1 
ATOM   1291 N N     . HIS A 1 176 ? 4.218   -3.820  37.729  1.00 3.14  ? 283  HIS A N     1 
ATOM   1292 C CA    . HIS A 1 176 ? 4.330   -5.155  38.302  1.00 2.99  ? 283  HIS A CA    1 
ATOM   1293 C C     . HIS A 1 176 ? 4.959   -6.077  37.250  1.00 3.18  ? 283  HIS A C     1 
ATOM   1294 O O     . HIS A 1 176 ? 4.542   -6.077  36.083  1.00 2.66  ? 283  HIS A O     1 
ATOM   1295 C CB    . HIS A 1 176 ? 2.958   -5.680  38.729  1.00 3.26  ? 283  HIS A CB    1 
ATOM   1296 C CG    . HIS A 1 176 ? 2.198   -4.747  39.619  1.00 3.72  ? 283  HIS A CG    1 
ATOM   1297 N ND1   . HIS A 1 176 ? 2.212   -4.855  40.997  1.00 5.84  ? 283  HIS A ND1   1 
ATOM   1298 C CD2   . HIS A 1 176 ? 1.427   -3.673  39.336  1.00 4.01  ? 283  HIS A CD2   1 
ATOM   1299 C CE1   . HIS A 1 176 ? 1.466   -3.896  41.517  1.00 5.78  ? 283  HIS A CE1   1 
ATOM   1300 N NE2   . HIS A 1 176 ? 0.967   -3.175  40.527  1.00 5.04  ? 283  HIS A NE2   1 
ATOM   1301 N N     . VAL A 1 177 ? 5.962   -6.852  37.664  1.00 3.38  ? 284  VAL A N     1 
ATOM   1302 C CA    . VAL A 1 177 ? 6.691   -7.754  36.772  1.00 3.93  ? 284  VAL A CA    1 
ATOM   1303 C C     . VAL A 1 177 ? 5.793   -8.835  36.177  1.00 3.60  ? 284  VAL A C     1 
ATOM   1304 O O     . VAL A 1 177 ? 6.077   -9.374  35.102  1.00 3.80  ? 284  VAL A O     1 
ATOM   1305 C CB    . VAL A 1 177 ? 7.902   -8.397  37.522  1.00 4.61  ? 284  VAL A CB    1 
ATOM   1306 C CG1   . VAL A 1 177 ? 8.480   -9.561  36.733  1.00 6.36  ? 284  VAL A CG1   1 
ATOM   1307 C CG2   . VAL A 1 177 ? 8.951   -7.367  37.765  1.00 5.28  ? 284  VAL A CG2   1 
ATOM   1308 N N     . SER A 1 178 ? 4.690   -9.129  36.857  1.00 3.21  ? 285  SER A N     1 
ATOM   1309 C CA    . SER A 1 178 ? 3.729   -10.112 36.374  1.00 3.59  ? 285  SER A CA    1 
ATOM   1310 C C     . SER A 1 178 ? 3.053   -9.624  35.091  1.00 3.14  ? 285  SER A C     1 
ATOM   1311 O O     . SER A 1 178 ? 2.489   -10.423 34.338  1.00 4.00  ? 285  SER A O     1 
ATOM   1312 C CB    . SER A 1 178 ? 2.665   -10.381 37.441  1.00 3.57  ? 285  SER A CB    1 
ATOM   1313 O OG    . SER A 1 178 ? 2.080   -9.175  37.898  1.00 3.13  ? 285  SER A OG    1 
ATOM   1314 N N     . LYS A 1 179 ? 3.093   -8.313  34.853  1.00 3.10  ? 286  LYS A N     1 
ATOM   1315 C CA    . LYS A 1 179 ? 2.439   -7.702  33.678  1.00 3.42  ? 286  LYS A CA    1 
ATOM   1316 C C     . LYS A 1 179 ? 3.405   -7.077  32.670  1.00 3.19  ? 286  LYS A C     1 
ATOM   1317 O O     . LYS A 1 179 ? 3.067   -6.937  31.484  1.00 3.19  ? 286  LYS A O     1 
ATOM   1318 C CB    . LYS A 1 179 ? 1.438   -6.633  34.123  1.00 3.77  ? 286  LYS A CB    1 
ATOM   1319 C CG    . LYS A 1 179 ? 0.123   -7.194  34.685  1.00 6.06  ? 286  LYS A CG    1 
ATOM   1320 C CD    . LYS A 1 179 ? -0.724  -7.896  33.666  1.00 8.22  ? 286  LYS A CD    1 
ATOM   1321 C CE    . LYS A 1 179 ? -1.925  -8.600  34.311  1.00 9.47  ? 286  LYS A CE    1 
ATOM   1322 N NZ    . LYS A 1 179 ? -2.793  -9.261  33.296  1.00 11.77 ? 286  LYS A NZ    1 
ATOM   1323 N N     . TYR A 1 180 ? 4.591   -6.686  33.135  1.00 3.08  ? 287  TYR A N     1 
ATOM   1324 C CA    . TYR A 1 180 ? 5.581   -6.043  32.283  1.00 2.92  ? 287  TYR A CA    1 
ATOM   1325 C C     . TYR A 1 180 ? 6.994   -6.291  32.781  1.00 3.16  ? 287  TYR A C     1 
ATOM   1326 O O     . TYR A 1 180 ? 7.328   -5.923  33.904  1.00 2.77  ? 287  TYR A O     1 
ATOM   1327 C CB    . TYR A 1 180 ? 5.327   -4.534  32.227  1.00 3.01  ? 287  TYR A CB    1 
ATOM   1328 C CG    . TYR A 1 180 ? 6.346   -3.785  31.403  1.00 2.82  ? 287  TYR A CG    1 
ATOM   1329 C CD1   . TYR A 1 180 ? 6.227   -3.716  30.020  1.00 2.65  ? 287  TYR A CD1   1 
ATOM   1330 C CD2   . TYR A 1 180 ? 7.438   -3.153  32.008  1.00 2.85  ? 287  TYR A CD2   1 
ATOM   1331 C CE1   . TYR A 1 180 ? 7.154   -3.039  29.258  1.00 3.46  ? 287  TYR A CE1   1 
ATOM   1332 C CE2   . TYR A 1 180 ? 8.375   -2.474  31.262  1.00 3.12  ? 287  TYR A CE2   1 
ATOM   1333 C CZ    . TYR A 1 180 ? 8.239   -2.428  29.883  1.00 3.19  ? 287  TYR A CZ    1 
ATOM   1334 O OH    . TYR A 1 180 ? 9.179   -1.762  29.138  1.00 3.19  ? 287  TYR A OH    1 
ATOM   1335 N N     . CYS A 1 181 ? 7.825   -6.899  31.943  1.00 3.14  ? 288  CYS A N     1 
ATOM   1336 C CA    . CYS A 1 181 ? 9.210   -7.146  32.319  1.00 3.38  ? 288  CYS A CA    1 
ATOM   1337 C C     . CYS A 1 181 ? 10.167  -6.940  31.143  1.00 3.21  ? 288  CYS A C     1 
ATOM   1338 O O     . CYS A 1 181 ? 11.324  -7.371  31.199  1.00 3.03  ? 288  CYS A O     1 
ATOM   1339 C CB    . CYS A 1 181 ? 9.379   -8.530  32.957  1.00 3.55  ? 288  CYS A CB    1 
ATOM   1340 S SG    . CYS A 1 181 ? 9.045   -9.938  31.904  1.00 4.82  ? 288  CYS A SG    1 
ATOM   1341 N N     . ALA A 1 182 ? 9.694   -6.258  30.100  1.00 2.71  ? 289  ALA A N     1 
ATOM   1342 C CA    . ALA A 1 182 ? 10.523  -5.935  28.941  1.00 2.80  ? 289  ALA A CA    1 
ATOM   1343 C C     . ALA A 1 182 ? 11.691  -5.033  29.332  1.00 3.28  ? 289  ALA A C     1 
ATOM   1344 O O     . ALA A 1 182 ? 12.757  -5.100  28.732  1.00 4.23  ? 289  ALA A O     1 
ATOM   1345 C CB    . ALA A 1 182 ? 9.680   -5.275  27.818  1.00 2.83  ? 289  ALA A CB    1 
ATOM   1346 N N     . SER A 1 183 ? 11.496  -4.204  30.354  1.00 3.41  ? 290  SER A N     1 
ATOM   1347 C CA    . SER A 1 183 ? 12.558  -3.353  30.882  1.00 3.17  ? 290  SER A CA    1 
ATOM   1348 C C     . SER A 1 183 ? 12.317  -3.286  32.377  1.00 3.07  ? 290  SER A C     1 
ATOM   1349 O O     . SER A 1 183 ? 11.195  -3.478  32.823  1.00 2.76  ? 290  SER A O     1 
ATOM   1350 C CB    . SER A 1 183 ? 12.535  -1.959  30.266  1.00 3.30  ? 290  SER A CB    1 
ATOM   1351 O OG    . SER A 1 183 ? 11.322  -1.293  30.525  1.00 2.87  ? 290  SER A OG    1 
ATOM   1352 N N     . LEU A 1 184 ? 13.349  -2.993  33.159  1.00 2.85  ? 291  LEU A N     1 
ATOM   1353 C CA    . LEU A 1 184 ? 13.206  -3.042  34.601  1.00 2.89  ? 291  LEU A CA    1 
ATOM   1354 C C     . LEU A 1 184 ? 13.712  -1.810  35.332  1.00 2.94  ? 291  LEU A C     1 
ATOM   1355 O O     . LEU A 1 184 ? 13.742  -1.805  36.562  1.00 2.78  ? 291  LEU A O     1 
ATOM   1356 C CB    . LEU A 1 184 ? 13.931  -4.286  35.143  1.00 2.91  ? 291  LEU A CB    1 
ATOM   1357 C CG    . LEU A 1 184 ? 13.374  -5.624  34.631  1.00 2.88  ? 291  LEU A CG    1 
ATOM   1358 C CD1   . LEU A 1 184 ? 14.284  -6.783  34.977  1.00 3.99  ? 291  LEU A CD1   1 
ATOM   1359 C CD2   . LEU A 1 184 ? 11.955  -5.886  35.147  1.00 2.41  ? 291  LEU A CD2   1 
ATOM   1360 N N     . GLY A 1 185 ? 14.073  -0.766  34.587  1.00 2.64  ? 292  GLY A N     1 
ATOM   1361 C CA    . GLY A 1 185 ? 14.630  0.449   35.169  1.00 2.69  ? 292  GLY A CA    1 
ATOM   1362 C C     . GLY A 1 185 ? 13.795  1.106   36.250  1.00 2.65  ? 292  GLY A C     1 
ATOM   1363 O O     . GLY A 1 185 ? 14.336  1.707   37.187  1.00 2.68  ? 292  GLY A O     1 
ATOM   1364 N N     . HIS A 1 186 ? 12.478  0.991   36.126  1.00 2.35  ? 293  HIS A N     1 
ATOM   1365 C CA    . HIS A 1 186 ? 11.550  1.619   37.055  1.00 2.26  ? 293  HIS A CA    1 
ATOM   1366 C C     . HIS A 1 186 ? 11.504  0.929   38.421  1.00 2.56  ? 293  HIS A C     1 
ATOM   1367 O O     . HIS A 1 186 ? 10.796  1.395   39.313  1.00 2.98  ? 293  HIS A O     1 
ATOM   1368 C CB    . HIS A 1 186 ? 10.148  1.602   36.437  1.00 2.29  ? 293  HIS A CB    1 
ATOM   1369 C CG    . HIS A 1 186 ? 9.712   0.229   36.055  1.00 2.25  ? 293  HIS A CG    1 
ATOM   1370 N ND1   . HIS A 1 186 ? 10.181  -0.403  34.926  1.00 2.25  ? 293  HIS A ND1   1 
ATOM   1371 C CD2   . HIS A 1 186 ? 8.918   -0.666  36.690  1.00 2.34  ? 293  HIS A CD2   1 
ATOM   1372 C CE1   . HIS A 1 186 ? 9.648   -1.609  34.848  1.00 2.36  ? 293  HIS A CE1   1 
ATOM   1373 N NE2   . HIS A 1 186 ? 8.885   -1.797  35.910  1.00 2.79  ? 293  HIS A NE2   1 
ATOM   1374 N N     . LYS A 1 187 ? 12.240  -0.172  38.582  1.00 2.27  ? 294  LYS A N     1 
ATOM   1375 C CA    . LYS A 1 187 ? 12.264  -0.919  39.839  1.00 2.63  ? 294  LYS A CA    1 
ATOM   1376 C C     . LYS A 1 187 ? 13.399  -0.470  40.746  1.00 2.51  ? 294  LYS A C     1 
ATOM   1377 O O     . LYS A 1 187 ? 13.471  -0.868  41.922  1.00 2.44  ? 294  LYS A O     1 
ATOM   1378 C CB    . LYS A 1 187 ? 12.376  -2.421  39.565  1.00 2.92  ? 294  LYS A CB    1 
ATOM   1379 C CG    . LYS A 1 187 ? 11.067  -3.031  39.101  1.00 3.32  ? 294  LYS A CG    1 
ATOM   1380 C CD    . LYS A 1 187 ? 10.086  -3.141  40.258  1.00 4.06  ? 294  LYS A CD    1 
ATOM   1381 C CE    . LYS A 1 187 ? 8.697   -3.522  39.807  1.00 4.08  ? 294  LYS A CE    1 
ATOM   1382 N NZ    . LYS A 1 187 ? 7.734   -3.623  40.939  1.00 4.41  ? 294  LYS A NZ    1 
ATOM   1383 N N     . ALA A 1 188 ? 14.293  0.366   40.230  1.00 2.47  ? 295  ALA A N     1 
ATOM   1384 C CA    . ALA A 1 188 ? 15.431  0.814   41.054  1.00 2.22  ? 295  ALA A CA    1 
ATOM   1385 C C     . ALA A 1 188 ? 14.970  1.893   42.034  1.00 2.25  ? 295  ALA A C     1 
ATOM   1386 O O     . ALA A 1 188 ? 14.358  2.889   41.637  1.00 2.76  ? 295  ALA A O     1 
ATOM   1387 C CB    . ALA A 1 188 ? 16.548  1.337   40.185  1.00 2.36  ? 295  ALA A CB    1 
ATOM   1388 N N     . ASN A 1 189 ? 15.253  1.682   43.313  1.00 2.13  ? 296  ASN A N     1 
ATOM   1389 C CA    . ASN A 1 189 ? 14.860  2.615   44.361  1.00 2.29  ? 296  ASN A CA    1 
ATOM   1390 C C     . ASN A 1 189 ? 15.786  3.816   44.496  1.00 2.15  ? 296  ASN A C     1 
ATOM   1391 O O     . ASN A 1 189 ? 16.853  3.860   43.893  1.00 2.45  ? 296  ASN A O     1 
ATOM   1392 C CB    . ASN A 1 189 ? 14.725  1.873   45.678  1.00 2.09  ? 296  ASN A CB    1 
ATOM   1393 C CG    . ASN A 1 189 ? 13.486  1.028   45.711  1.00 2.28  ? 296  ASN A CG    1 
ATOM   1394 O OD1   . ASN A 1 189 ? 12.422  1.486   45.279  1.00 2.81  ? 296  ASN A OD1   1 
ATOM   1395 N ND2   . ASN A 1 189 ? 13.615  -0.221  46.121  1.00 2.55  ? 296  ASN A ND2   1 
ATOM   1396 N N     . HIS A 1 190 ? 15.344  4.798   45.271  1.00 2.20  ? 297  HIS A N     1 
ATOM   1397 C CA    . HIS A 1 190 ? 16.080  6.034   45.450  1.00 2.13  ? 297  HIS A CA    1 
ATOM   1398 C C     . HIS A 1 190 ? 17.130  5.980   46.554  1.00 2.15  ? 297  HIS A C     1 
ATOM   1399 O O     . HIS A 1 190 ? 16.948  5.305   47.551  1.00 2.33  ? 297  HIS A O     1 
ATOM   1400 C CB    . HIS A 1 190 ? 15.121  7.173   45.807  1.00 2.21  ? 297  HIS A CB    1 
ATOM   1401 C CG    . HIS A 1 190 ? 15.829  8.394   46.302  1.00 2.34  ? 297  HIS A CG    1 
ATOM   1402 N ND1   . HIS A 1 190 ? 16.462  9.281   45.458  1.00 2.56  ? 297  HIS A ND1   1 
ATOM   1403 C CD2   . HIS A 1 190 ? 16.066  8.838   47.561  1.00 2.18  ? 297  HIS A CD2   1 
ATOM   1404 C CE1   . HIS A 1 190 ? 17.037  10.232  46.173  1.00 2.82  ? 297  HIS A CE1   1 
ATOM   1405 N NE2   . HIS A 1 190 ? 16.815  9.984   47.451  1.00 2.94  ? 297  HIS A NE2   1 
ATOM   1406 N N     . SER A 1 191 ? 18.216  6.721   46.364  1.00 2.19  ? 298  SER A N     1 
ATOM   1407 C CA    . SER A 1 191 ? 19.215  6.914   47.405  1.00 2.49  ? 298  SER A CA    1 
ATOM   1408 C C     . SER A 1 191 ? 19.911  8.241   47.136  1.00 2.39  ? 298  SER A C     1 
ATOM   1409 O O     . SER A 1 191 ? 20.109  8.615   45.982  1.00 2.37  ? 298  SER A O     1 
ATOM   1410 C CB    . SER A 1 191 ? 20.243  5.783   47.431  1.00 2.80  ? 298  SER A CB    1 
ATOM   1411 O OG    . SER A 1 191 ? 21.287  6.091   48.325  1.00 2.20  ? 298  SER A OG    1 
ATOM   1412 N N     . PHE A 1 192 ? 20.277  8.943   48.207  1.00 2.46  ? 299  PHE A N     1 
ATOM   1413 C CA    . PHE A 1 192 ? 21.037  10.186  48.092  1.00 2.65  ? 299  PHE A CA    1 
ATOM   1414 C C     . PHE A 1 192 ? 22.543  9.873   47.963  1.00 2.90  ? 299  PHE A C     1 
ATOM   1415 O O     . PHE A 1 192 ? 23.370  10.764  47.722  1.00 3.44  ? 299  PHE A O     1 
ATOM   1416 C CB    . PHE A 1 192 ? 20.745  11.104  49.279  1.00 2.42  ? 299  PHE A CB    1 
ATOM   1417 C CG    . PHE A 1 192 ? 19.338  11.659  49.286  1.00 2.34  ? 299  PHE A CG    1 
ATOM   1418 C CD1   . PHE A 1 192 ? 18.416  11.245  50.231  1.00 2.37  ? 299  PHE A CD1   1 
ATOM   1419 C CD2   . PHE A 1 192 ? 18.945  12.599  48.341  1.00 2.74  ? 299  PHE A CD2   1 
ATOM   1420 C CE1   . PHE A 1 192 ? 17.133  11.763  50.240  1.00 2.97  ? 299  PHE A CE1   1 
ATOM   1421 C CE2   . PHE A 1 192 ? 17.657  13.115  48.345  1.00 3.21  ? 299  PHE A CE2   1 
ATOM   1422 C CZ    . PHE A 1 192 ? 16.752  12.697  49.297  1.00 2.88  ? 299  PHE A CZ    1 
ATOM   1423 N N     . THR A 1 193 ? 22.901  8.605   48.151  1.00 2.84  ? 300  THR A N     1 
ATOM   1424 C CA    . THR A 1 193 ? 24.260  8.135   47.903  1.00 2.81  ? 300  THR A CA    1 
ATOM   1425 C C     . THR A 1 193 ? 24.177  6.940   46.941  1.00 2.44  ? 300  THR A C     1 
ATOM   1426 O O     . THR A 1 193 ? 24.554  5.827   47.265  1.00 2.31  ? 300  THR A O     1 
ATOM   1427 C CB    . THR A 1 193 ? 24.960  7.752   49.219  1.00 3.19  ? 300  THR A CB    1 
ATOM   1428 O OG1   . THR A 1 193 ? 24.282  6.645   49.839  1.00 3.63  ? 300  THR A OG1   1 
ATOM   1429 C CG2   . THR A 1 193 ? 24.845  8.865   50.233  1.00 3.94  ? 300  THR A CG2   1 
ATOM   1430 N N     . PRO A 1 194 ? 23.657  7.180   45.737  1.00 2.43  ? 301  PRO A N     1 
ATOM   1431 C CA    . PRO A 1 194 ? 23.378  6.110   44.781  1.00 2.16  ? 301  PRO A CA    1 
ATOM   1432 C C     . PRO A 1 194 ? 24.612  5.508   44.146  1.00 2.19  ? 301  PRO A C     1 
ATOM   1433 O O     . PRO A 1 194 ? 25.667  6.142   44.118  1.00 2.11  ? 301  PRO A O     1 
ATOM   1434 C CB    . PRO A 1 194 ? 22.571  6.820   43.687  1.00 2.48  ? 301  PRO A CB    1 
ATOM   1435 C CG    . PRO A 1 194 ? 22.859  8.261   43.848  1.00 2.59  ? 301  PRO A CG    1 
ATOM   1436 C CD    . PRO A 1 194 ? 23.355  8.504   45.187  1.00 2.30  ? 301  PRO A CD    1 
ATOM   1437 N N     . ASN A 1 195 ? 24.473  4.280   43.663  1.00 2.08  ? 302  ASN A N     1 
ATOM   1438 C CA    . ASN A 1 195 ? 25.544  3.631   42.923  1.00 2.30  ? 302  ASN A CA    1 
ATOM   1439 C C     . ASN A 1 195 ? 25.305  3.719   41.414  1.00 2.18  ? 302  ASN A C     1 
ATOM   1440 O O     . ASN A 1 195 ? 26.127  3.272   40.629  1.00 2.31  ? 302  ASN A O     1 
ATOM   1441 C CB    . ASN A 1 195 ? 25.760  2.176   43.368  1.00 2.54  ? 302  ASN A CB    1 
ATOM   1442 C CG    . ASN A 1 195 ? 24.503  1.347   43.345  1.00 2.93  ? 302  ASN A CG    1 
ATOM   1443 O OD1   . ASN A 1 195 ? 23.527  1.646   42.642  1.00 2.27  ? 302  ASN A OD1   1 
ATOM   1444 N ND2   . ASN A 1 195 ? 24.524  0.276   44.126  1.00 2.69  ? 302  ASN A ND2   1 
ATOM   1445 N N     . CYS A 1 196 ? 24.182  4.317   41.022  1.00 2.27  ? 303  CYS A N     1 
ATOM   1446 C CA    . CYS A 1 196 ? 23.833  4.451   39.602  1.00 2.49  ? 303  CYS A CA    1 
ATOM   1447 C C     . CYS A 1 196 ? 23.254  5.829   39.291  1.00 2.73  ? 303  CYS A C     1 
ATOM   1448 O O     . CYS A 1 196 ? 22.880  6.575   40.195  1.00 2.38  ? 303  CYS A O     1 
ATOM   1449 C CB    . CYS A 1 196 ? 22.792  3.396   39.210  1.00 2.78  ? 303  CYS A CB    1 
ATOM   1450 S SG    . CYS A 1 196 ? 23.339  1.693   39.246  1.00 3.80  ? 303  CYS A SG    1 
ATOM   1451 N N     . ILE A 1 197 ? 23.175  6.144   37.997  1.00 3.20  ? 304  ILE A N     1 
ATOM   1452 C CA    . ILE A 1 197 ? 22.551  7.362   37.507  1.00 4.01  ? 304  ILE A CA    1 
ATOM   1453 C C     . ILE A 1 197 ? 21.615  7.005   36.356  1.00 3.90  ? 304  ILE A C     1 
ATOM   1454 O O     . ILE A 1 197 ? 21.779  5.967   35.706  1.00 3.61  ? 304  ILE A O     1 
ATOM   1455 C CB    . ILE A 1 197 ? 23.589  8.352   36.962  1.00 4.63  ? 304  ILE A CB    1 
ATOM   1456 C CG1   . ILE A 1 197 ? 22.900  9.662   36.546  1.00 6.24  ? 304  ILE A CG1   1 
ATOM   1457 C CG2   . ILE A 1 197 ? 24.294  7.762   35.735  1.00 3.91  ? 304  ILE A CG2   1 
ATOM   1458 C CD1   . ILE A 1 197 ? 23.714  10.929  36.824  1.00 7.94  ? 304  ILE A CD1   1 
ATOM   1459 N N     . TYR A 1 198 ? 20.620  7.851   36.115  1.00 4.27  ? 305  TYR A N     1 
ATOM   1460 C CA    . TYR A 1 198 ? 19.811  7.719   34.905  1.00 4.17  ? 305  TYR A CA    1 
ATOM   1461 C C     . TYR A 1 198 ? 20.594  8.424   33.793  1.00 4.33  ? 305  TYR A C     1 
ATOM   1462 O O     . TYR A 1 198 ? 21.046  9.556   33.979  1.00 4.86  ? 305  TYR A O     1 
ATOM   1463 C CB    . TYR A 1 198 ? 18.446  8.396   35.049  1.00 4.27  ? 305  TYR A CB    1 
ATOM   1464 C CG    . TYR A 1 198 ? 17.518  7.784   36.075  1.00 4.35  ? 305  TYR A CG    1 
ATOM   1465 C CD1   . TYR A 1 198 ? 16.969  8.561   37.079  1.00 3.85  ? 305  TYR A CD1   1 
ATOM   1466 C CD2   . TYR A 1 198 ? 17.145  6.445   36.009  1.00 3.93  ? 305  TYR A CD2   1 
ATOM   1467 C CE1   . TYR A 1 198 ? 16.088  8.031   37.989  1.00 3.52  ? 305  TYR A CE1   1 
ATOM   1468 C CE2   . TYR A 1 198 ? 16.272  5.905   36.938  1.00 3.18  ? 305  TYR A CE2   1 
ATOM   1469 C CZ    . TYR A 1 198 ? 15.742  6.705   37.916  1.00 2.97  ? 305  TYR A CZ    1 
ATOM   1470 O OH    . TYR A 1 198 ? 14.899  6.178   38.864  1.00 3.40  ? 305  TYR A OH    1 
ATOM   1471 N N     . ASP A 1 199 ? 20.757  7.766   32.646  1.00 4.34  ? 306  ASP A N     1 
ATOM   1472 C CA    . ASP A 1 199 ? 21.513  8.308   31.529  1.00 4.40  ? 306  ASP A CA    1 
ATOM   1473 C C     . ASP A 1 199 ? 20.724  8.051   30.246  1.00 4.09  ? 306  ASP A C     1 
ATOM   1474 O O     . ASP A 1 199 ? 19.871  7.178   30.213  1.00 4.07  ? 306  ASP A O     1 
ATOM   1475 C CB    . ASP A 1 199 ? 22.849  7.584   31.422  1.00 4.75  ? 306  ASP A CB    1 
ATOM   1476 C CG    . ASP A 1 199 ? 23.936  8.435   30.780  1.00 7.01  ? 306  ASP A CG    1 
ATOM   1477 O OD1   . ASP A 1 199 ? 25.078  7.942   30.676  1.00 9.18  ? 306  ASP A OD1   1 
ATOM   1478 O OD2   . ASP A 1 199 ? 23.753  9.599   30.359  1.00 8.97  ? 306  ASP A OD2   1 
ATOM   1479 N N     . MET A 1 200 ? 21.019  8.816   29.205  1.00 4.07  ? 307  MET A N     1 
ATOM   1480 C CA    . MET A 1 200 ? 20.347  8.664   27.912  1.00 4.21  ? 307  MET A CA    1 
ATOM   1481 C C     . MET A 1 200 ? 20.701  7.330   27.284  1.00 3.48  ? 307  MET A C     1 
ATOM   1482 O O     . MET A 1 200 ? 21.779  6.778   27.512  1.00 3.03  ? 307  MET A O     1 
ATOM   1483 C CB    . MET A 1 200 ? 20.783  9.786   26.977  1.00 5.32  ? 307  MET A CB    1 
ATOM   1484 C CG    . MET A 1 200 ? 20.489  11.178  27.519  1.00 8.07  ? 307  MET A CG    1 
ATOM   1485 S SD    . MET A 1 200 ? 18.720  11.457  27.739  1.00 14.04 ? 307  MET A SD    1 
ATOM   1486 C CE    . MET A 1 200 ? 18.218  11.779  26.162  1.00 13.82 ? 307  MET A CE    1 
ATOM   1487 N N     . PHE A 1 201 ? 19.800  6.798   26.472  1.00 2.95  ? 308  PHE A N     1 
ATOM   1488 C CA    . PHE A 1 201 ? 20.089  5.560   25.787  1.00 2.68  ? 308  PHE A CA    1 
ATOM   1489 C C     . PHE A 1 201 ? 19.247  5.463   24.556  1.00 2.59  ? 308  PHE A C     1 
ATOM   1490 O O     . PHE A 1 201 ? 18.077  5.819   24.590  1.00 2.93  ? 308  PHE A O     1 
ATOM   1491 C CB    . PHE A 1 201 ? 19.816  4.342   26.658  1.00 2.48  ? 308  PHE A CB    1 
ATOM   1492 C CG    . PHE A 1 201 ? 20.525  3.109   26.175  1.00 2.58  ? 308  PHE A CG    1 
ATOM   1493 C CD1   . PHE A 1 201 ? 21.838  2.872   26.533  1.00 2.38  ? 308  PHE A CD1   1 
ATOM   1494 C CD2   . PHE A 1 201 ? 19.899  2.213   25.323  1.00 2.69  ? 308  PHE A CD2   1 
ATOM   1495 C CE1   . PHE A 1 201 ? 22.506  1.749   26.081  1.00 2.34  ? 308  PHE A CE1   1 
ATOM   1496 C CE2   . PHE A 1 201 ? 20.561  1.091   24.864  1.00 2.27  ? 308  PHE A CE2   1 
ATOM   1497 C CZ    . PHE A 1 201 ? 21.861  0.859   25.233  1.00 2.21  ? 308  PHE A CZ    1 
ATOM   1498 N N     . VAL A 1 202 ? 19.846  4.997   23.470  1.00 2.55  ? 309  VAL A N     1 
ATOM   1499 C CA    . VAL A 1 202 ? 19.084  4.741   22.238  1.00 2.34  ? 309  VAL A CA    1 
ATOM   1500 C C     . VAL A 1 202 ? 18.929  3.234   22.085  1.00 2.29  ? 309  VAL A C     1 
ATOM   1501 O O     . VAL A 1 202 ? 19.908  2.537   21.784  1.00 2.81  ? 309  VAL A O     1 
ATOM   1502 C CB    . VAL A 1 202 ? 19.779  5.286   20.996  1.00 2.39  ? 309  VAL A CB    1 
ATOM   1503 C CG1   . VAL A 1 202 ? 18.970  4.927   19.749  1.00 3.20  ? 309  VAL A CG1   1 
ATOM   1504 C CG2   . VAL A 1 202 ? 19.947  6.783   21.101  1.00 2.94  ? 309  VAL A CG2   1 
ATOM   1505 N N     . HIS A 1 203 ? 17.708  2.735   22.288  1.00 2.05  ? 310  HIS A N     1 
ATOM   1506 C CA    . HIS A 1 203 ? 17.437  1.302   22.283  1.00 2.05  ? 310  HIS A CA    1 
ATOM   1507 C C     . HIS A 1 203 ? 16.780  0.859   20.978  1.00 2.02  ? 310  HIS A C     1 
ATOM   1508 O O     . HIS A 1 203 ? 15.853  1.516   20.508  1.00 2.15  ? 310  HIS A O     1 
ATOM   1509 C CB    . HIS A 1 203 ? 16.515  0.970   23.451  1.00 2.06  ? 310  HIS A CB    1 
ATOM   1510 C CG    . HIS A 1 203 ? 16.542  -0.468  23.854  1.00 2.16  ? 310  HIS A CG    1 
ATOM   1511 N ND1   . HIS A 1 203 ? 15.910  -1.456  23.133  1.00 2.24  ? 310  HIS A ND1   1 
ATOM   1512 C CD2   . HIS A 1 203 ? 17.129  -1.087  24.907  1.00 2.11  ? 310  HIS A CD2   1 
ATOM   1513 C CE1   . HIS A 1 203 ? 16.094  -2.620  23.729  1.00 2.24  ? 310  HIS A CE1   1 
ATOM   1514 N NE2   . HIS A 1 203 ? 16.841  -2.424  24.804  1.00 2.07  ? 310  HIS A NE2   1 
ATOM   1515 N N     . PRO A 1 204 ? 17.236  -0.253  20.404  1.00 2.00  ? 311  PRO A N     1 
ATOM   1516 C CA    . PRO A 1 204 ? 16.729  -0.708  19.113  1.00 2.03  ? 311  PRO A CA    1 
ATOM   1517 C C     . PRO A 1 204 ? 15.305  -1.227  19.166  1.00 2.06  ? 311  PRO A C     1 
ATOM   1518 O O     . PRO A 1 204 ? 14.682  -1.344  18.121  1.00 2.04  ? 311  PRO A O     1 
ATOM   1519 C CB    . PRO A 1 204 ? 17.679  -1.853  18.779  1.00 2.05  ? 311  PRO A CB    1 
ATOM   1520 C CG    . PRO A 1 204 ? 18.002  -2.396  20.074  1.00 2.00  ? 311  PRO A CG    1 
ATOM   1521 C CD    . PRO A 1 204 ? 18.269  -1.178  20.901  1.00 2.25  ? 311  PRO A CD    1 
ATOM   1522 N N     . ARG A 1 205 ? 14.825  -1.556  20.363  1.00 2.07  ? 312  ARG A N     1 
ATOM   1523 C CA    . ARG A 1 205 ? 13.457  -2.019  20.544  1.00 2.05  ? 312  ARG A CA    1 
ATOM   1524 C C     . ARG A 1 205 ? 12.555  -0.906  21.079  1.00 2.01  ? 312  ARG A C     1 
ATOM   1525 O O     . ARG A 1 205 ? 11.441  -0.707  20.585  1.00 2.03  ? 312  ARG A O     1 
ATOM   1526 C CB    . ARG A 1 205 ? 13.451  -3.193  21.520  1.00 2.11  ? 312  ARG A CB    1 
ATOM   1527 C CG    . ARG A 1 205 ? 12.081  -3.729  21.869  1.00 2.61  ? 312  ARG A CG    1 
ATOM   1528 C CD    . ARG A 1 205 ? 12.183  -4.845  22.888  1.00 2.59  ? 312  ARG A CD    1 
ATOM   1529 N NE    . ARG A 1 205 ? 10.909  -5.399  23.321  1.00 2.54  ? 312  ARG A NE    1 
ATOM   1530 C CZ    . ARG A 1 205 ? 10.809  -6.309  24.281  1.00 2.35  ? 312  ARG A CZ    1 
ATOM   1531 N NH1   . ARG A 1 205 ? 11.910  -6.750  24.882  1.00 2.09  ? 312  ARG A NH1   1 
ATOM   1532 N NH2   . ARG A 1 205 ? 9.633   -6.785  24.651  1.00 2.21  ? 312  ARG A NH2   1 
ATOM   1533 N N     . PHE A 1 206 ? 13.048  -0.180  22.082  1.00 2.06  ? 313  PHE A N     1 
ATOM   1534 C CA    . PHE A 1 206 ? 12.272  0.852   22.768  1.00 2.15  ? 313  PHE A CA    1 
ATOM   1535 C C     . PHE A 1 206 ? 12.411  2.260   22.202  1.00 2.21  ? 313  PHE A C     1 
ATOM   1536 O O     . PHE A 1 206 ? 11.577  3.113   22.496  1.00 2.40  ? 313  PHE A O     1 
ATOM   1537 C CB    . PHE A 1 206 ? 12.646  0.908   24.252  1.00 2.09  ? 313  PHE A CB    1 
ATOM   1538 C CG    . PHE A 1 206 ? 12.593  -0.422  24.940  1.00 2.49  ? 313  PHE A CG    1 
ATOM   1539 C CD1   . PHE A 1 206 ? 13.706  -0.932  25.595  1.00 2.43  ? 313  PHE A CD1   1 
ATOM   1540 C CD2   . PHE A 1 206 ? 11.432  -1.170  24.924  1.00 3.07  ? 313  PHE A CD2   1 
ATOM   1541 C CE1   . PHE A 1 206 ? 13.649  -2.151  26.218  1.00 2.71  ? 313  PHE A CE1   1 
ATOM   1542 C CE2   . PHE A 1 206 ? 11.374  -2.388  25.543  1.00 3.93  ? 313  PHE A CE2   1 
ATOM   1543 C CZ    . PHE A 1 206 ? 12.476  -2.890  26.186  1.00 3.14  ? 313  PHE A CZ    1 
ATOM   1544 N N     . GLY A 1 207 ? 13.465  2.515   21.430  1.00 2.22  ? 314  GLY A N     1 
ATOM   1545 C CA    . GLY A 1 207 ? 13.703  3.846   20.898  1.00 2.38  ? 314  GLY A CA    1 
ATOM   1546 C C     . GLY A 1 207 ? 14.504  4.673   21.888  1.00 2.42  ? 314  GLY A C     1 
ATOM   1547 O O     . GLY A 1 207 ? 15.170  4.117   22.771  1.00 2.50  ? 314  GLY A O     1 
ATOM   1548 N N     . PRO A 1 208 ? 14.474  5.995   21.752  1.00 2.39  ? 315  PRO A N     1 
ATOM   1549 C CA    . PRO A 1 208 ? 15.205  6.863   22.682  1.00 2.53  ? 315  PRO A CA    1 
ATOM   1550 C C     . PRO A 1 208 ? 14.553  6.856   24.064  1.00 2.29  ? 315  PRO A C     1 
ATOM   1551 O O     . PRO A 1 208 ? 13.414  7.277   24.218  1.00 2.54  ? 315  PRO A O     1 
ATOM   1552 C CB    . PRO A 1 208 ? 15.125  8.244   22.017  1.00 2.53  ? 315  PRO A CB    1 
ATOM   1553 C CG    . PRO A 1 208 ? 14.561  8.011   20.631  1.00 2.82  ? 315  PRO A CG    1 
ATOM   1554 C CD    . PRO A 1 208 ? 13.766  6.768   20.718  1.00 2.60  ? 315  PRO A CD    1 
ATOM   1555 N N     . ILE A 1 209 ? 15.279  6.371   25.065  1.00 2.65  ? 316  ILE A N     1 
ATOM   1556 C CA    . ILE A 1 209 ? 14.766  6.267   26.421  1.00 2.47  ? 316  ILE A CA    1 
ATOM   1557 C C     . ILE A 1 209 ? 15.879  6.678   27.374  1.00 2.60  ? 316  ILE A C     1 
ATOM   1558 O O     . ILE A 1 209 ? 16.785  7.397   26.977  1.00 2.71  ? 316  ILE A O     1 
ATOM   1559 C CB    . ILE A 1 209 ? 14.346  4.822   26.706  1.00 2.35  ? 316  ILE A CB    1 
ATOM   1560 C CG1   . ILE A 1 209 ? 15.497  3.870   26.375  1.00 2.33  ? 316  ILE A CG1   1 
ATOM   1561 C CG2   . ILE A 1 209 ? 13.104  4.465   25.901  1.00 3.20  ? 316  ILE A CG2   1 
ATOM   1562 C CD1   . ILE A 1 209 ? 15.293  2.446   26.877  1.00 2.49  ? 316  ILE A CD1   1 
ATOM   1563 N N     . LYS A 1 210 ? 15.811  6.223   28.622  1.00 3.12  ? 317  LYS A N     1 
ATOM   1564 C CA    . LYS A 1 210 ? 16.918  6.422   29.560  1.00 3.53  ? 317  LYS A CA    1 
ATOM   1565 C C     . LYS A 1 210 ? 17.334  5.033   30.034  1.00 3.26  ? 317  LYS A C     1 
ATOM   1566 O O     . LYS A 1 210 ? 16.600  4.056   29.832  1.00 3.14  ? 317  LYS A O     1 
ATOM   1567 C CB    . LYS A 1 210 ? 16.561  7.348   30.733  1.00 4.01  ? 317  LYS A CB    1 
ATOM   1568 C CG    . LYS A 1 210 ? 16.618  8.849   30.330  1.00 5.08  ? 317  LYS A CG    1 
ATOM   1569 C CD    . LYS A 1 210 ? 16.663  9.811   31.503  1.00 5.59  ? 317  LYS A CD    1 
ATOM   1570 C CE    . LYS A 1 210 ? 16.792  11.261  31.003  1.00 5.93  ? 317  LYS A CE    1 
ATOM   1571 N NZ    . LYS A 1 210 ? 16.702  12.281  32.080  1.00 5.69  ? 317  LYS A NZ    1 
ATOM   1572 N N     . CYS A 1 211 ? 18.520  4.937   30.615  1.00 3.10  ? 318  CYS A N     1 
ATOM   1573 C CA    . CYS A 1 211 ? 19.029  3.676   31.146  1.00 2.84  ? 318  CYS A CA    1 
ATOM   1574 C C     . CYS A 1 211 ? 19.546  3.909   32.557  1.00 2.89  ? 318  CYS A C     1 
ATOM   1575 O O     . CYS A 1 211 ? 19.564  5.043   33.031  1.00 2.65  ? 318  CYS A O     1 
ATOM   1576 C CB    . CYS A 1 211 ? 20.146  3.121   30.260  1.00 2.61  ? 318  CYS A CB    1 
ATOM   1577 S SG    . CYS A 1 211 ? 21.710  4.019   30.351  1.00 3.58  ? 318  CYS A SG    1 
ATOM   1578 N N     . ILE A 1 212 ? 19.941  2.826   33.223  1.00 2.82  ? 319  ILE A N     1 
ATOM   1579 C CA    . ILE A 1 212 ? 20.562  2.902   34.537  1.00 3.48  ? 319  ILE A CA    1 
ATOM   1580 C C     . ILE A 1 212 ? 22.012  2.515   34.311  1.00 2.77  ? 319  ILE A C     1 
ATOM   1581 O O     . ILE A 1 212 ? 22.282  1.418   33.815  1.00 2.85  ? 319  ILE A O     1 
ATOM   1582 C CB    . ILE A 1 212 ? 19.903  1.905   35.512  1.00 3.96  ? 319  ILE A CB    1 
ATOM   1583 C CG1   . ILE A 1 212 ? 18.398  2.176   35.628  1.00 5.82  ? 319  ILE A CG1   1 
ATOM   1584 C CG2   . ILE A 1 212 ? 20.612  1.932   36.846  1.00 4.63  ? 319  ILE A CG2   1 
ATOM   1585 C CD1   . ILE A 1 212 ? 18.023  3.175   36.621  1.00 7.54  ? 319  ILE A CD1   1 
ATOM   1586 N N     . ARG A 1 213 ? 22.930  3.417   34.653  1.00 2.38  ? 320  ARG A N     1 
ATOM   1587 C CA    . ARG A 1 213 ? 24.357  3.199   34.461  1.00 2.26  ? 320  ARG A CA    1 
ATOM   1588 C C     . ARG A 1 213 ? 25.070  3.362   35.792  1.00 2.24  ? 320  ARG A C     1 
ATOM   1589 O O     . ARG A 1 213 ? 24.845  4.335   36.511  1.00 2.42  ? 320  ARG A O     1 
ATOM   1590 C CB    . ARG A 1 213 ? 24.902  4.228   33.482  1.00 2.37  ? 320  ARG A CB    1 
ATOM   1591 C CG    . ARG A 1 213 ? 26.360  4.064   33.145  1.00 2.44  ? 320  ARG A CG    1 
ATOM   1592 C CD    . ARG A 1 213 ? 26.901  5.216   32.313  1.00 2.34  ? 320  ARG A CD    1 
ATOM   1593 N NE    . ARG A 1 213 ? 26.315  5.275   30.983  1.00 2.76  ? 320  ARG A NE    1 
ATOM   1594 C CZ    . ARG A 1 213 ? 26.774  4.615   29.933  1.00 2.66  ? 320  ARG A CZ    1 
ATOM   1595 N NH1   . ARG A 1 213 ? 27.827  3.820   30.046  1.00 2.29  ? 320  ARG A NH1   1 
ATOM   1596 N NH2   . ARG A 1 213 ? 26.164  4.746   28.761  1.00 2.49  ? 320  ARG A NH2   1 
ATOM   1597 N N     . THR A 1 214 ? 25.943  2.419   36.115  1.00 2.12  ? 321  THR A N     1 
ATOM   1598 C CA    . THR A 1 214 ? 26.667  2.490   37.390  1.00 2.25  ? 321  THR A CA    1 
ATOM   1599 C C     . THR A 1 214 ? 27.605  3.696   37.421  1.00 2.65  ? 321  THR A C     1 
ATOM   1600 O O     . THR A 1 214 ? 28.131  4.132   36.388  1.00 2.48  ? 321  THR A O     1 
ATOM   1601 C CB    . THR A 1 214 ? 27.462  1.218   37.665  1.00 2.06  ? 321  THR A CB    1 
ATOM   1602 O OG1   . THR A 1 214 ? 28.545  1.097   36.736  1.00 2.59  ? 321  THR A OG1   1 
ATOM   1603 C CG2   . THR A 1 214 ? 26.650  -0.039  37.490  1.00 2.06  ? 321  THR A CG2   1 
ATOM   1604 N N     . LEU A 1 215 ? 27.791  4.227   38.628  1.00 3.11  ? 322  LEU A N     1 
ATOM   1605 C CA    . LEU A 1 215 ? 28.667  5.360   38.890  1.00 3.87  ? 322  LEU A CA    1 
ATOM   1606 C C     . LEU A 1 215 ? 29.987  4.870   39.476  1.00 4.18  ? 322  LEU A C     1 
ATOM   1607 O O     . LEU A 1 215 ? 30.979  5.597   39.508  1.00 4.32  ? 322  LEU A O     1 
ATOM   1608 C CB    . LEU A 1 215 ? 28.016  6.264   39.937  1.00 4.48  ? 322  LEU A CB    1 
ATOM   1609 C CG    . LEU A 1 215 ? 27.290  7.518   39.498  1.00 6.27  ? 322  LEU A CG    1 
ATOM   1610 C CD1   . LEU A 1 215 ? 26.431  7.277   38.300  1.00 9.03  ? 322  LEU A CD1   1 
ATOM   1611 C CD2   . LEU A 1 215 ? 26.468  7.993   40.693  1.00 6.96  ? 322  LEU A CD2   1 
ATOM   1612 N N     . ARG A 1 216 ? 29.970  3.649   39.985  1.00 4.39  ? 323  ARG A N     1 
ATOM   1613 C CA    . ARG A 1 216 ? 31.132  3.070   40.646  1.00 4.63  ? 323  ARG A CA    1 
ATOM   1614 C C     . ARG A 1 216 ? 31.090  1.571   40.424  1.00 4.50  ? 323  ARG A C     1 
ATOM   1615 O O     . ARG A 1 216 ? 30.161  1.064   39.814  1.00 5.16  ? 323  ARG A O     1 
ATOM   1616 C CB    . ARG A 1 216 ? 31.080  3.375   42.146  1.00 4.87  ? 323  ARG A CB    1 
ATOM   1617 C CG    . ARG A 1 216 ? 29.824  2.867   42.875  1.00 6.06  ? 323  ARG A CG    1 
ATOM   1618 C CD    . ARG A 1 216 ? 29.726  3.355   44.329  1.00 8.55  ? 323  ARG A CD    1 
ATOM   1619 N NE    . ARG A 1 216 ? 28.606  2.801   45.088  1.00 10.17 ? 323  ARG A NE    1 
ATOM   1620 C CZ    . ARG A 1 216 ? 27.802  3.516   45.885  1.00 12.22 ? 323  ARG A CZ    1 
ATOM   1621 N NH1   . ARG A 1 216 ? 27.966  4.828   46.029  1.00 11.79 ? 323  ARG A NH1   1 
ATOM   1622 N NH2   . ARG A 1 216 ? 26.815  2.918   46.539  1.00 14.22 ? 323  ARG A NH2   1 
ATOM   1623 N N     . ALA A 1 217 ? 32.084  0.846   40.915  1.00 4.31  ? 324  ALA A N     1 
ATOM   1624 C CA    . ALA A 1 217 ? 32.033  -0.602  40.779  1.00 4.08  ? 324  ALA A CA    1 
ATOM   1625 C C     . ALA A 1 217 ? 30.902  -1.132  41.665  1.00 4.02  ? 324  ALA A C     1 
ATOM   1626 O O     . ALA A 1 217 ? 30.613  -0.573  42.718  1.00 3.97  ? 324  ALA A O     1 
ATOM   1627 C CB    . ALA A 1 217 ? 33.333  -1.223  41.129  1.00 3.70  ? 324  ALA A CB    1 
ATOM   1628 N N     . VAL A 1 218 ? 30.235  -2.184  41.204  1.00 4.41  ? 325  VAL A N     1 
ATOM   1629 C CA    . VAL A 1 218 ? 29.097  -2.754  41.907  1.00 4.52  ? 325  VAL A CA    1 
ATOM   1630 C C     . VAL A 1 218 ? 29.304  -4.263  41.968  1.00 4.28  ? 325  VAL A C     1 
ATOM   1631 O O     . VAL A 1 218 ? 29.699  -4.874  40.979  1.00 4.13  ? 325  VAL A O     1 
ATOM   1632 C CB    . VAL A 1 218 ? 27.782  -2.415  41.193  1.00 4.82  ? 325  VAL A CB    1 
ATOM   1633 C CG1   . VAL A 1 218 ? 26.624  -3.204  41.766  1.00 5.53  ? 325  VAL A CG1   1 
ATOM   1634 C CG2   . VAL A 1 218 ? 27.496  -0.917  41.274  1.00 5.10  ? 325  VAL A CG2   1 
ATOM   1635 N N     . GLU A 1 219 ? 29.071  -4.862  43.130  1.00 4.39  ? 326  GLU A N     1 
ATOM   1636 C CA    . GLU A 1 219 ? 29.232  -6.304  43.270  1.00 4.62  ? 326  GLU A CA    1 
ATOM   1637 C C     . GLU A 1 219 ? 27.952  -7.052  42.956  1.00 4.33  ? 326  GLU A C     1 
ATOM   1638 O O     . GLU A 1 219 ? 26.871  -6.472  42.948  1.00 4.21  ? 326  GLU A O     1 
ATOM   1639 C CB    . GLU A 1 219 ? 29.656  -6.670  44.685  1.00 5.39  ? 326  GLU A CB    1 
ATOM   1640 C CG    . GLU A 1 219 ? 31.133  -7.007  44.791  1.00 6.97  ? 326  GLU A CG    1 
ATOM   1641 C CD    . GLU A 1 219 ? 31.551  -8.095  43.807  1.00 9.48  ? 326  GLU A CD    1 
ATOM   1642 O OE1   . GLU A 1 219 ? 30.686  -8.907  43.347  1.00 8.95  ? 326  GLU A OE1   1 
ATOM   1643 O OE2   . GLU A 1 219 ? 32.753  -8.133  43.478  1.00 11.36 ? 326  GLU A OE2   1 
ATOM   1644 N N     . ALA A 1 220 ? 28.089  -8.355  42.734  1.00 3.98  ? 327  ALA A N     1 
ATOM   1645 C CA    . ALA A 1 220 ? 26.940  -9.226  42.518  1.00 3.84  ? 327  ALA A CA    1 
ATOM   1646 C C     . ALA A 1 220 ? 25.998  -9.155  43.719  1.00 3.85  ? 327  ALA A C     1 
ATOM   1647 O O     . ALA A 1 220 ? 26.454  -9.146  44.870  1.00 3.06  ? 327  ALA A O     1 
ATOM   1648 C CB    . ALA A 1 220 ? 27.418  -10.657 42.330  1.00 3.86  ? 327  ALA A CB    1 
ATOM   1649 N N     . ASP A 1 221 ? 24.697  -9.120  43.453  1.00 3.85  ? 328  ASP A N     1 
ATOM   1650 C CA    . ASP A 1 221 ? 23.662  -9.100  44.490  1.00 4.37  ? 328  ASP A CA    1 
ATOM   1651 C C     . ASP A 1 221 ? 23.600  -7.799  45.295  1.00 4.84  ? 328  ASP A C     1 
ATOM   1652 O O     . ASP A 1 221 ? 22.965  -7.740  46.351  1.00 5.11  ? 328  ASP A O     1 
ATOM   1653 C CB    . ASP A 1 221 ? 23.813  -10.313 45.399  1.00 4.71  ? 328  ASP A CB    1 
ATOM   1654 C CG    . ASP A 1 221 ? 23.611  -11.610 44.651  1.00 4.46  ? 328  ASP A CG    1 
ATOM   1655 O OD1   . ASP A 1 221 ? 24.460  -12.518 44.789  1.00 4.47  ? 328  ASP A OD1   1 
ATOM   1656 O OD2   . ASP A 1 221 ? 22.646  -11.801 43.882  1.00 5.41  ? 328  ASP A OD2   1 
ATOM   1657 N N     . GLU A 1 222 ? 24.256  -6.757  44.797  1.00 4.98  ? 329  GLU A N     1 
ATOM   1658 C CA    . GLU A 1 222 ? 24.176  -5.439  45.411  1.00 4.94  ? 329  GLU A CA    1 
ATOM   1659 C C     . GLU A 1 222 ? 22.908  -4.745  44.876  1.00 4.42  ? 329  GLU A C     1 
ATOM   1660 O O     . GLU A 1 222 ? 22.546  -4.900  43.698  1.00 4.27  ? 329  GLU A O     1 
ATOM   1661 C CB    . GLU A 1 222 ? 25.431  -4.620  45.086  1.00 5.24  ? 329  GLU A CB    1 
ATOM   1662 C CG    . GLU A 1 222 ? 25.329  -3.153  45.470  1.00 6.22  ? 329  GLU A CG    1 
ATOM   1663 C CD    . GLU A 1 222 ? 26.680  -2.439  45.501  1.00 7.84  ? 329  GLU A CD    1 
ATOM   1664 O OE1   . GLU A 1 222 ? 27.745  -3.107  45.497  1.00 6.56  ? 329  GLU A OE1   1 
ATOM   1665 O OE2   . GLU A 1 222 ? 26.659  -1.189  45.515  1.00 9.56  ? 329  GLU A OE2   1 
ATOM   1666 N N     . GLU A 1 223 ? 22.204  -4.002  45.723  1.00 3.90  ? 330  GLU A N     1 
ATOM   1667 C CA    . GLU A 1 223 ? 21.009  -3.293  45.234  1.00 3.66  ? 330  GLU A CA    1 
ATOM   1668 C C     . GLU A 1 223 ? 21.439  -2.076  44.415  1.00 3.53  ? 330  GLU A C     1 
ATOM   1669 O O     . GLU A 1 223 ? 22.347  -1.328  44.822  1.00 3.55  ? 330  GLU A O     1 
ATOM   1670 C CB    . GLU A 1 223 ? 20.079  -2.861  46.373  1.00 3.79  ? 330  GLU A CB    1 
ATOM   1671 C CG    . GLU A 1 223 ? 18.758  -2.288  45.866  1.00 3.60  ? 330  GLU A CG    1 
ATOM   1672 C CD    . GLU A 1 223 ? 17.722  -2.054  46.950  1.00 4.19  ? 330  GLU A CD    1 
ATOM   1673 O OE1   . GLU A 1 223 ? 18.039  -2.252  48.125  1.00 4.83  ? 330  GLU A OE1   1 
ATOM   1674 O OE2   . GLU A 1 223 ? 16.567  -1.680  46.626  1.00 4.44  ? 330  GLU A OE2   1 
ATOM   1675 N N     . LEU A 1 224 ? 20.796  -1.891  43.264  1.00 3.45  ? 331  LEU A N     1 
ATOM   1676 C CA    . LEU A 1 224 ? 21.040  -0.743  42.397  1.00 3.33  ? 331  LEU A CA    1 
ATOM   1677 C C     . LEU A 1 224 ? 20.149  0.400   42.838  1.00 2.89  ? 331  LEU A C     1 
ATOM   1678 O O     . LEU A 1 224 ? 18.930  0.239   42.968  1.00 2.74  ? 331  LEU A O     1 
ATOM   1679 C CB    . LEU A 1 224 ? 20.753  -1.077  40.938  1.00 3.49  ? 331  LEU A CB    1 
ATOM   1680 C CG    . LEU A 1 224 ? 21.633  -2.168  40.332  1.00 4.45  ? 331  LEU A CG    1 
ATOM   1681 C CD1   . LEU A 1 224 ? 21.415  -2.275  38.821  1.00 4.93  ? 331  LEU A CD1   1 
ATOM   1682 C CD2   . LEU A 1 224 ? 23.105  -1.933  40.668  1.00 4.93  ? 331  LEU A CD2   1 
ATOM   1683 N N     . THR A 1 225 ? 20.752  1.552   43.089  1.00 2.38  ? 332  THR A N     1 
ATOM   1684 C CA    . THR A 1 225 ? 19.992  2.721   43.498  1.00 2.55  ? 332  THR A CA    1 
ATOM   1685 C C     . THR A 1 225 ? 20.363  3.913   42.642  1.00 2.57  ? 332  THR A C     1 
ATOM   1686 O O     . THR A 1 225 ? 21.450  3.969   42.082  1.00 2.47  ? 332  THR A O     1 
ATOM   1687 C CB    . THR A 1 225 ? 20.241  3.074   44.958  1.00 2.23  ? 332  THR A CB    1 
ATOM   1688 O OG1   . THR A 1 225 ? 21.648  3.262   45.174  1.00 3.52  ? 332  THR A OG1   1 
ATOM   1689 C CG2   . THR A 1 225 ? 19.851  1.934   45.860  1.00 2.12  ? 332  THR A CG2   1 
ATOM   1690 N N     . VAL A 1 226 ? 19.447  4.871   42.560  1.00 2.89  ? 333  VAL A N     1 
ATOM   1691 C CA    . VAL A 1 226 ? 19.650  6.071   41.761  1.00 3.37  ? 333  VAL A CA    1 
ATOM   1692 C C     . VAL A 1 226 ? 19.063  7.272   42.494  1.00 3.05  ? 333  VAL A C     1 
ATOM   1693 O O     . VAL A 1 226 ? 18.110  7.138   43.250  1.00 2.77  ? 333  VAL A O     1 
ATOM   1694 C CB    . VAL A 1 226 ? 18.935  5.964   40.381  1.00 3.63  ? 333  VAL A CB    1 
ATOM   1695 C CG1   . VAL A 1 226 ? 19.195  7.192   39.540  1.00 4.18  ? 333  VAL A CG1   1 
ATOM   1696 C CG2   . VAL A 1 226 ? 19.375  4.712   39.631  1.00 4.44  ? 333  VAL A CG2   1 
ATOM   1697 N N     . ALA A 1 227 ? 19.626  8.448   42.258  1.00 2.99  ? 334  ALA A N     1 
ATOM   1698 C CA    . ALA A 1 227 ? 19.081  9.671   42.831  1.00 2.93  ? 334  ALA A CA    1 
ATOM   1699 C C     . ALA A 1 227 ? 17.890  10.075  41.973  1.00 2.63  ? 334  ALA A C     1 
ATOM   1700 O O     . ALA A 1 227 ? 18.049  10.352  40.787  1.00 3.30  ? 334  ALA A O     1 
ATOM   1701 C CB    . ALA A 1 227 ? 20.136  10.765  42.851  1.00 3.06  ? 334  ALA A CB    1 
ATOM   1702 N N     . TYR A 1 228 ? 16.695  10.076  42.547  1.00 2.12  ? 335  TYR A N     1 
ATOM   1703 C CA    . TYR A 1 228 ? 15.488  10.421  41.772  1.00 2.13  ? 335  TYR A CA    1 
ATOM   1704 C C     . TYR A 1 228 ? 15.537  11.863  41.250  1.00 2.06  ? 335  TYR A C     1 
ATOM   1705 O O     . TYR A 1 228 ? 14.941  12.187  40.210  1.00 2.37  ? 335  TYR A O     1 
ATOM   1706 C CB    . TYR A 1 228 ? 14.226  10.153  42.591  1.00 2.12  ? 335  TYR A CB    1 
ATOM   1707 C CG    . TYR A 1 228 ? 13.822  8.679   42.649  1.00 2.19  ? 335  TYR A CG    1 
ATOM   1708 C CD1   . TYR A 1 228 ? 14.659  7.669   42.172  1.00 2.05  ? 335  TYR A CD1   1 
ATOM   1709 C CD2   . TYR A 1 228 ? 12.605  8.302   43.201  1.00 2.00  ? 335  TYR A CD2   1 
ATOM   1710 C CE1   . TYR A 1 228 ? 14.288  6.333   42.253  1.00 2.13  ? 335  TYR A CE1   1 
ATOM   1711 C CE2   . TYR A 1 228 ? 12.227  6.983   43.280  1.00 2.00  ? 335  TYR A CE2   1 
ATOM   1712 C CZ    . TYR A 1 228 ? 13.062  6.001   42.802  1.00 2.11  ? 335  TYR A CZ    1 
ATOM   1713 O OH    . TYR A 1 228 ? 12.679  4.679   42.880  1.00 2.37  ? 335  TYR A OH    1 
ATOM   1714 N N     . GLY A 1 229 ? 16.249  12.730  41.965  1.00 2.07  ? 336  GLY A N     1 
ATOM   1715 C CA    . GLY A 1 229 ? 16.435  14.105  41.538  1.00 2.14  ? 336  GLY A CA    1 
ATOM   1716 C C     . GLY A 1 229 ? 15.197  14.964  41.409  1.00 2.34  ? 336  GLY A C     1 
ATOM   1717 O O     . GLY A 1 229 ? 15.019  15.632  40.396  1.00 2.51  ? 336  GLY A O     1 
ATOM   1718 N N     . TYR A 1 230 ? 14.344  14.964  42.425  1.00 2.25  ? 337  TYR A N     1 
ATOM   1719 C CA    . TYR A 1 230 ? 13.200  15.861  42.424  1.00 2.45  ? 337  TYR A CA    1 
ATOM   1720 C C     . TYR A 1 230 ? 13.721  17.255  42.754  1.00 2.50  ? 337  TYR A C     1 
ATOM   1721 O O     . TYR A 1 230 ? 14.841  17.394  43.269  1.00 2.54  ? 337  TYR A O     1 
ATOM   1722 C CB    . TYR A 1 230 ? 12.150  15.412  43.440  1.00 2.38  ? 337  TYR A CB    1 
ATOM   1723 C CG    . TYR A 1 230 ? 11.528  14.084  43.097  1.00 2.24  ? 337  TYR A CG    1 
ATOM   1724 C CD1   . TYR A 1 230 ? 11.490  13.046  44.013  1.00 2.21  ? 337  TYR A CD1   1 
ATOM   1725 C CD2   . TYR A 1 230 ? 10.963  13.867  41.847  1.00 2.67  ? 337  TYR A CD2   1 
ATOM   1726 C CE1   . TYR A 1 230 ? 10.916  11.828  43.694  1.00 2.44  ? 337  TYR A CE1   1 
ATOM   1727 C CE2   . TYR A 1 230 ? 10.396  12.668  41.530  1.00 2.55  ? 337  TYR A CE2   1 
ATOM   1728 C CZ    . TYR A 1 230 ? 10.367  11.648  42.449  1.00 2.60  ? 337  TYR A CZ    1 
ATOM   1729 O OH    . TYR A 1 230 ? 9.790   10.446  42.091  1.00 2.91  ? 337  TYR A OH    1 
ATOM   1730 N N     . ASP A 1 231 ? 12.922  18.275  42.463  1.00 2.61  ? 338  ASP A N     1 
ATOM   1731 C CA    . ASP A 1 231 ? 13.279  19.658  42.726  1.00 3.24  ? 338  ASP A CA    1 
ATOM   1732 C C     . ASP A 1 231 ? 13.128  19.964  44.214  1.00 3.59  ? 338  ASP A C     1 
ATOM   1733 O O     . ASP A 1 231 ? 12.020  19.993  44.750  1.00 3.63  ? 338  ASP A O     1 
ATOM   1734 C CB    . ASP A 1 231 ? 12.413  20.600  41.906  1.00 3.78  ? 338  ASP A CB    1 
ATOM   1735 C CG    . ASP A 1 231 ? 12.916  22.029  41.916  1.00 4.73  ? 338  ASP A CG    1 
ATOM   1736 O OD1   . ASP A 1 231 ? 13.709  22.399  42.804  1.00 4.71  ? 338  ASP A OD1   1 
ATOM   1737 O OD2   . ASP A 1 231 ? 12.539  22.873  41.070  1.00 6.96  ? 338  ASP A OD2   1 
ATOM   1738 N N     . HIS A 1 232 ? 14.262  20.207  44.865  1.00 3.16  ? 339  HIS A N     1 
ATOM   1739 C CA    . HIS A 1 232 ? 14.304  20.488  46.296  1.00 3.75  ? 339  HIS A CA    1 
ATOM   1740 C C     . HIS A 1 232 ? 13.972  21.931  46.640  1.00 4.29  ? 339  HIS A C     1 
ATOM   1741 O O     . HIS A 1 232 ? 13.708  22.237  47.799  1.00 4.47  ? 339  HIS A O     1 
ATOM   1742 C CB    . HIS A 1 232 ? 15.695  20.166  46.843  1.00 3.35  ? 339  HIS A CB    1 
ATOM   1743 C CG    . HIS A 1 232 ? 16.044  18.711  46.790  1.00 3.17  ? 339  HIS A CG    1 
ATOM   1744 N ND1   . HIS A 1 232 ? 17.254  18.223  47.230  1.00 2.63  ? 339  HIS A ND1   1 
ATOM   1745 C CD2   . HIS A 1 232 ? 15.350  17.639  46.338  1.00 2.29  ? 339  HIS A CD2   1 
ATOM   1746 C CE1   . HIS A 1 232 ? 17.288  16.915  47.057  1.00 2.70  ? 339  HIS A CE1   1 
ATOM   1747 N NE2   . HIS A 1 232 ? 16.143  16.534  46.522  1.00 2.61  ? 339  HIS A NE2   1 
ATOM   1748 N N     . SER A 1 233 ? 13.989  22.813  45.642  1.00 4.86  ? 340  SER A N     1 
ATOM   1749 C CA    . SER A 1 233 ? 13.725  24.228  45.875  1.00 5.67  ? 340  SER A CA    1 
ATOM   1750 C C     . SER A 1 233 ? 12.992  24.922  44.726  1.00 6.73  ? 340  SER A C     1 
ATOM   1751 O O     . SER A 1 233 ? 13.558  25.757  44.031  1.00 6.15  ? 340  SER A O     1 
ATOM   1752 C CB    . SER A 1 233 ? 15.034  24.966  46.119  1.00 5.47  ? 340  SER A CB    1 
ATOM   1753 O OG    . SER A 1 233 ? 14.765  26.299  46.505  1.00 5.21  ? 340  SER A OG    1 
ATOM   1754 N N     . PRO A 1 234 ? 11.735  24.570  44.514  1.00 8.49  ? 341  PRO A N     1 
ATOM   1755 C CA    . PRO A 1 234 ? 10.935  25.205  43.464  1.00 9.84  ? 341  PRO A CA    1 
ATOM   1756 C C     . PRO A 1 234 ? 10.906  26.729  43.636  1.00 11.40 ? 341  PRO A C     1 
ATOM   1757 O O     . PRO A 1 234 ? 11.054  27.212  44.752  1.00 11.46 ? 341  PRO A O     1 
ATOM   1758 C CB    . PRO A 1 234 ? 9.548   24.564  43.621  1.00 9.67  ? 341  PRO A CB    1 
ATOM   1759 C CG    . PRO A 1 234 ? 9.663   23.509  44.656  1.00 9.19  ? 341  PRO A CG    1 
ATOM   1760 C CD    . PRO A 1 234 ? 11.008  23.538  45.251  1.00 8.47  ? 341  PRO A CD    1 
ATOM   1761 N N     . PRO A 1 235 ? 10.702  27.460  42.539  1.00 13.36 ? 342  PRO A N     1 
ATOM   1762 C CA    . PRO A 1 235 ? 10.795  28.924  42.514  1.00 14.64 ? 342  PRO A CA    1 
ATOM   1763 C C     . PRO A 1 235 ? 9.692   29.343  43.362  1.00 15.96 ? 342  PRO A C     1 
ATOM   1764 O O     . PRO A 1 235 ? 9.633   30.393  44.022  1.00 16.30 ? 342  PRO A O     1 
ATOM   1765 C CB    . PRO A 1 235 ? 10.413  29.298  41.083  1.00 14.54 ? 342  PRO A CB    1 
ATOM   1766 C CG    . PRO A 1 235 ? 10.091  28.070  40.386  1.00 14.08 ? 342  PRO A CG    1 
ATOM   1767 C CD    . PRO A 1 235 ? 10.255  26.912  41.264  1.00 13.41 ? 342  PRO A CD    1 
ATOM   1768 N N     . GLY A 1 236 ? 8.735   28.442  43.240  1.00 17.38 ? 343  GLY A N     1 
ATOM   1769 C CA    . GLY A 1 236 ? 7.569   28.478  44.029  1.00 18.23 ? 343  GLY A CA    1 
ATOM   1770 C C     . GLY A 1 236 ? 8.228   28.995  45.268  1.00 18.94 ? 343  GLY A C     1 
ATOM   1771 O O     . GLY A 1 236 ? 9.434   29.246  45.343  1.00 19.46 ? 343  GLY A O     1 
ATOM   1772 N N     . LYS A 1 237 ? 7.428   29.144  46.274  1.00 19.60 ? 344  LYS A N     1 
ATOM   1773 C CA    . LYS A 1 237 ? 7.914   29.735  47.463  1.00 20.09 ? 344  LYS A CA    1 
ATOM   1774 C C     . LYS A 1 237 ? 8.632   28.654  48.255  1.00 20.09 ? 344  LYS A C     1 
ATOM   1775 O O     . LYS A 1 237 ? 9.787   28.762  48.682  1.00 20.34 ? 344  LYS A O     1 
ATOM   1776 C CB    . LYS A 1 237 ? 6.668   30.125  48.244  1.00 20.41 ? 344  LYS A CB    1 
ATOM   1777 C CG    . LYS A 1 237 ? 6.315   29.099  49.302  1.00 21.21 ? 344  LYS A CG    1 
ATOM   1778 C CD    . LYS A 1 237 ? 5.275   29.602  50.247  1.00 22.19 ? 344  LYS A CD    1 
ATOM   1779 C CE    . LYS A 1 237 ? 4.668   28.474  51.058  1.00 22.78 ? 344  LYS A CE    1 
ATOM   1780 N NZ    . LYS A 1 237 ? 3.561   28.978  51.917  1.00 22.97 ? 344  LYS A NZ    1 
ATOM   1781 N N     . SER A 1 238 ? 7.861   27.577  48.261  1.00 19.82 ? 345  SER A N     1 
ATOM   1782 C CA    . SER A 1 238 ? 7.728   26.467  49.184  1.00 19.48 ? 345  SER A CA    1 
ATOM   1783 C C     . SER A 1 238 ? 8.360   25.117  49.402  1.00 18.72 ? 345  SER A C     1 
ATOM   1784 O O     . SER A 1 238 ? 7.650   24.234  49.879  1.00 19.17 ? 345  SER A O     1 
ATOM   1785 C CB    . SER A 1 238 ? 6.371   26.002  48.682  1.00 19.59 ? 345  SER A CB    1 
ATOM   1786 O OG    . SER A 1 238 ? 6.417   26.059  47.251  1.00 20.84 ? 345  SER A OG    1 
ATOM   1787 N N     . GLY A 1 239 ? 9.612   24.864  49.135  1.00 17.45 ? 346  GLY A N     1 
ATOM   1788 C CA    . GLY A 1 239 ? 10.055  23.530  49.496  1.00 16.41 ? 346  GLY A CA    1 
ATOM   1789 C C     . GLY A 1 239 ? 9.892   22.517  48.382  1.00 15.40 ? 346  GLY A C     1 
ATOM   1790 O O     . GLY A 1 239 ? 9.197   22.747  47.397  1.00 15.23 ? 346  GLY A O     1 
ATOM   1791 N N     . PRO A 1 240 ? 10.529  21.369  48.560  1.00 14.06 ? 347  PRO A N     1 
ATOM   1792 C CA    . PRO A 1 240 ? 10.630  20.358  47.508  1.00 13.20 ? 347  PRO A CA    1 
ATOM   1793 C C     . PRO A 1 240 ? 9.322   19.797  46.988  1.00 12.24 ? 347  PRO A C     1 
ATOM   1794 O O     . PRO A 1 240 ? 8.428   19.461  47.754  1.00 12.46 ? 347  PRO A O     1 
ATOM   1795 C CB    . PRO A 1 240 ? 11.447  19.236  48.160  1.00 13.19 ? 347  PRO A CB    1 
ATOM   1796 C CG    . PRO A 1 240 ? 11.825  19.687  49.517  1.00 13.71 ? 347  PRO A CG    1 
ATOM   1797 C CD    . PRO A 1 240 ? 11.199  20.970  49.801  1.00 14.23 ? 347  PRO A CD    1 
ATOM   1798 N N     . GLU A 1 241 ? 9.227   19.698  45.669  1.00 11.28 ? 348  GLU A N     1 
ATOM   1799 C CA    . GLU A 1 241 ? 8.063   19.073  45.047  1.00 10.48 ? 348  GLU A CA    1 
ATOM   1800 C C     . GLU A 1 241 ? 8.448   17.609  44.902  1.00 8.57  ? 348  GLU A C     1 
ATOM   1801 O O     . GLU A 1 241 ? 9.138   17.214  43.968  1.00 7.67  ? 348  GLU A O     1 
ATOM   1802 C CB    . GLU A 1 241 ? 7.728   19.695  43.700  1.00 11.42 ? 348  GLU A CB    1 
ATOM   1803 C CG    . GLU A 1 241 ? 6.239   20.027  43.515  1.00 14.16 ? 348  GLU A CG    1 
ATOM   1804 C CD    . GLU A 1 241 ? 5.301   19.258  44.447  1.00 17.81 ? 348  GLU A CD    1 
ATOM   1805 O OE1   . GLU A 1 241 ? 5.099   18.042  44.248  1.00 20.08 ? 348  GLU A OE1   1 
ATOM   1806 O OE2   . GLU A 1 241 ? 4.749   19.879  45.386  1.00 19.94 ? 348  GLU A OE2   1 
ATOM   1807 N N     . ALA A 1 242 ? 8.041   16.810  45.874  1.00 7.53  ? 349  ALA A N     1 
ATOM   1808 C CA    . ALA A 1 242 ? 8.433   15.419  45.919  1.00 6.82  ? 349  ALA A CA    1 
ATOM   1809 C C     . ALA A 1 242 ? 7.430   14.658  46.753  1.00 6.14  ? 349  ALA A C     1 
ATOM   1810 O O     . ALA A 1 242 ? 6.677   15.252  47.524  1.00 5.39  ? 349  ALA A O     1 
ATOM   1811 C CB    . ALA A 1 242 ? 9.829   15.300  46.541  1.00 6.96  ? 349  ALA A CB    1 
ATOM   1812 N N     . PRO A 1 243 ? 7.427   13.339  46.618  1.00 6.01  ? 350  PRO A N     1 
ATOM   1813 C CA    . PRO A 1 243 ? 6.539   12.502  47.408  1.00 5.75  ? 350  PRO A CA    1 
ATOM   1814 C C     . PRO A 1 243 ? 6.958   12.613  48.865  1.00 5.09  ? 350  PRO A C     1 
ATOM   1815 O O     . PRO A 1 243 ? 8.127   12.904  49.136  1.00 4.77  ? 350  PRO A O     1 
ATOM   1816 C CB    . PRO A 1 243 ? 6.814   11.089  46.884  1.00 6.19  ? 350  PRO A CB    1 
ATOM   1817 C CG    . PRO A 1 243 ? 7.616   11.243  45.665  1.00 6.43  ? 350  PRO A CG    1 
ATOM   1818 C CD    . PRO A 1 243 ? 8.290   12.542  45.737  1.00 6.39  ? 350  PRO A CD    1 
ATOM   1819 N N     . GLU A 1 244 ? 6.025   12.392  49.777  1.00 4.61  ? 351  GLU A N     1 
ATOM   1820 C CA    . GLU A 1 244 ? 6.289   12.547  51.198  1.00 4.26  ? 351  GLU A CA    1 
ATOM   1821 C C     . GLU A 1 244 ? 7.399   11.637  51.723  1.00 3.94  ? 351  GLU A C     1 
ATOM   1822 O O     . GLU A 1 244 ? 8.212   12.067  52.542  1.00 3.91  ? 351  GLU A O     1 
ATOM   1823 C CB    . GLU A 1 244 ? 5.007   12.350  52.004  1.00 4.18  ? 351  GLU A CB    1 
ATOM   1824 C CG    . GLU A 1 244 ? 5.192   12.539  53.512  1.00 3.77  ? 351  GLU A CG    1 
ATOM   1825 C CD    . GLU A 1 244 ? 5.700   13.918  53.922  1.00 3.90  ? 351  GLU A CD    1 
ATOM   1826 O OE1   . GLU A 1 244 ? 5.729   14.847  53.088  1.00 3.41  ? 351  GLU A OE1   1 
ATOM   1827 O OE2   . GLU A 1 244 ? 6.079   14.078  55.111  1.00 4.18  ? 351  GLU A OE2   1 
ATOM   1828 N N     . TRP A 1 245 ? 7.439   10.386  51.268  1.00 3.48  ? 352  TRP A N     1 
ATOM   1829 C CA    . TRP A 1 245 ? 8.464   9.448   51.727  1.00 3.30  ? 352  TRP A CA    1 
ATOM   1830 C C     . TRP A 1 245 ? 9.872   9.978   51.407  1.00 3.05  ? 352  TRP A C     1 
ATOM   1831 O O     . TRP A 1 245 ? 10.821  9.749   52.161  1.00 2.69  ? 352  TRP A O     1 
ATOM   1832 C CB    . TRP A 1 245 ? 8.244   8.051   51.132  1.00 3.23  ? 352  TRP A CB    1 
ATOM   1833 C CG    . TRP A 1 245 ? 8.373   7.984   49.655  1.00 2.44  ? 352  TRP A CG    1 
ATOM   1834 C CD1   . TRP A 1 245 ? 7.354   7.966   48.734  1.00 2.73  ? 352  TRP A CD1   1 
ATOM   1835 C CD2   . TRP A 1 245 ? 9.587   7.923   48.907  1.00 2.67  ? 352  TRP A CD2   1 
ATOM   1836 N NE1   . TRP A 1 245 ? 7.872   7.904   47.464  1.00 2.26  ? 352  TRP A NE1   1 
ATOM   1837 C CE2   . TRP A 1 245 ? 9.242   7.885   47.545  1.00 2.19  ? 352  TRP A CE2   1 
ATOM   1838 C CE3   . TRP A 1 245 ? 10.950  7.919   49.251  1.00 2.00  ? 352  TRP A CE3   1 
ATOM   1839 C CZ2   . TRP A 1 245 ? 10.193  7.823   46.534  1.00 2.44  ? 352  TRP A CZ2   1 
ATOM   1840 C CZ3   . TRP A 1 245 ? 11.888  7.860   48.247  1.00 2.01  ? 352  TRP A CZ3   1 
ATOM   1841 C CH2   . TRP A 1 245 ? 11.510  7.818   46.900  1.00 2.08  ? 352  TRP A CH2   1 
ATOM   1842 N N     . TYR A 1 246 ? 9.984   10.686  50.286  1.00 2.79  ? 353  TYR A N     1 
ATOM   1843 C CA    . TYR A 1 246 ? 11.239  11.243  49.798  1.00 2.97  ? 353  TYR A CA    1 
ATOM   1844 C C     . TYR A 1 246 ? 11.620  12.449  50.640  1.00 3.20  ? 353  TYR A C     1 
ATOM   1845 O O     . TYR A 1 246 ? 12.780  12.621  50.995  1.00 3.31  ? 353  TYR A O     1 
ATOM   1846 C CB    . TYR A 1 246 ? 11.074  11.636  48.332  1.00 2.84  ? 353  TYR A CB    1 
ATOM   1847 C CG    . TYR A 1 246 ? 12.258  12.302  47.667  1.00 2.38  ? 353  TYR A CG    1 
ATOM   1848 C CD1   . TYR A 1 246 ? 13.044  11.602  46.758  1.00 2.40  ? 353  TYR A CD1   1 
ATOM   1849 C CD2   . TYR A 1 246 ? 12.520  13.646  47.858  1.00 2.08  ? 353  TYR A CD2   1 
ATOM   1850 C CE1   . TYR A 1 246 ? 14.092  12.210  46.110  1.00 2.38  ? 353  TYR A CE1   1 
ATOM   1851 C CE2   . TYR A 1 246 ? 13.561  14.265  47.205  1.00 2.14  ? 353  TYR A CE2   1 
ATOM   1852 C CZ    . TYR A 1 246 ? 14.346  13.539  46.339  1.00 2.34  ? 353  TYR A CZ    1 
ATOM   1853 O OH    . TYR A 1 246 ? 15.372  14.143  45.669  1.00 3.35  ? 353  TYR A OH    1 
ATOM   1854 N N     . GLN A 1 247 ? 10.632  13.274  50.965  1.00 3.72  ? 354  GLN A N     1 
ATOM   1855 C CA    . GLN A 1 247 ? 10.862  14.427  51.829  1.00 4.18  ? 354  GLN A CA    1 
ATOM   1856 C C     . GLN A 1 247 ? 11.365  13.965  53.195  1.00 4.32  ? 354  GLN A C     1 
ATOM   1857 O O     . GLN A 1 247 ? 12.252  14.591  53.771  1.00 4.28  ? 354  GLN A O     1 
ATOM   1858 C CB    . GLN A 1 247 ? 9.589   15.248  51.985  1.00 4.39  ? 354  GLN A CB    1 
ATOM   1859 C CG    . GLN A 1 247 ? 9.064   15.734  50.649  1.00 5.35  ? 354  GLN A CG    1 
ATOM   1860 C CD    . GLN A 1 247 ? 8.216   16.977  50.735  1.00 6.61  ? 354  GLN A CD    1 
ATOM   1861 O OE1   . GLN A 1 247 ? 8.524   17.899  51.485  1.00 8.35  ? 354  GLN A OE1   1 
ATOM   1862 N NE2   . GLN A 1 247 ? 7.164   17.022  49.933  1.00 6.18  ? 354  GLN A NE2   1 
ATOM   1863 N N     . VAL A 1 248 ? 10.795  12.871  53.706  1.00 4.44  ? 355  VAL A N     1 
ATOM   1864 C CA    . VAL A 1 248 ? 11.211  12.316  55.001  1.00 4.83  ? 355  VAL A CA    1 
ATOM   1865 C C     . VAL A 1 248 ? 12.666  11.842  54.947  1.00 4.96  ? 355  VAL A C     1 
ATOM   1866 O O     . VAL A 1 248 ? 13.457  12.124  55.853  1.00 4.94  ? 355  VAL A O     1 
ATOM   1867 C CB    . VAL A 1 248 ? 10.322  11.120  55.416  1.00 4.90  ? 355  VAL A CB    1 
ATOM   1868 C CG1   . VAL A 1 248 ? 10.953  10.366  56.603  1.00 5.07  ? 355  VAL A CG1   1 
ATOM   1869 C CG2   . VAL A 1 248 ? 8.928   11.585  55.764  1.00 4.57  ? 355  VAL A CG2   1 
ATOM   1870 N N     . GLU A 1 249 ? 13.005  11.105  53.887  1.00 5.36  ? 356  GLU A N     1 
ATOM   1871 C CA    . GLU A 1 249 ? 14.367  10.585  53.709  1.00 5.54  ? 356  GLU A CA    1 
ATOM   1872 C C     . GLU A 1 249 ? 15.349  11.737  53.541  1.00 4.88  ? 356  GLU A C     1 
ATOM   1873 O O     . GLU A 1 249 ? 16.484  11.695  54.048  1.00 4.16  ? 356  GLU A O     1 
ATOM   1874 C CB    . GLU A 1 249 ? 14.446  9.650   52.495  1.00 6.54  ? 356  GLU A CB    1 
ATOM   1875 C CG    . GLU A 1 249 ? 15.780  8.917   52.429  1.00 9.22  ? 356  GLU A CG    1 
ATOM   1876 C CD    . GLU A 1 249 ? 15.801  7.726   51.489  1.00 13.26 ? 356  GLU A CD    1 
ATOM   1877 O OE1   . GLU A 1 249 ? 16.176  7.917   50.315  1.00 15.69 ? 356  GLU A OE1   1 
ATOM   1878 O OE2   . GLU A 1 249 ? 15.493  6.590   51.933  1.00 15.43 ? 356  GLU A OE2   1 
ATOM   1879 N N     . LEU A 1 250 ? 14.913  12.784  52.851  1.00 4.21  ? 357  LEU A N     1 
ATOM   1880 C CA    . LEU A 1 250 ? 15.751  13.967  52.671  1.00 4.57  ? 357  LEU A CA    1 
ATOM   1881 C C     . LEU A 1 250 ? 16.112  14.579  54.032  1.00 4.95  ? 357  LEU A C     1 
ATOM   1882 O O     . LEU A 1 250 ? 17.270  14.937  54.294  1.00 5.53  ? 357  LEU A O     1 
ATOM   1883 C CB    . LEU A 1 250 ? 15.024  15.006  51.825  1.00 3.91  ? 357  LEU A CB    1 
ATOM   1884 C CG    . LEU A 1 250 ? 15.813  16.279  51.499  1.00 3.60  ? 357  LEU A CG    1 
ATOM   1885 C CD1   . LEU A 1 250 ? 17.210  15.951  51.005  1.00 3.39  ? 357  LEU A CD1   1 
ATOM   1886 C CD2   . LEU A 1 250 ? 15.093  17.144  50.480  1.00 4.35  ? 357  LEU A CD2   1 
ATOM   1887 N N     . LYS A 1 251 ? 15.108  14.694  54.897  1.00 5.80  ? 358  LYS A N     1 
ATOM   1888 C CA    . LYS A 1 251 ? 15.295  15.243  56.242  1.00 6.34  ? 358  LYS A CA    1 
ATOM   1889 C C     . LYS A 1 251 ? 16.278  14.381  57.021  1.00 6.23  ? 358  LYS A C     1 
ATOM   1890 O O     . LYS A 1 251 ? 17.210  14.897  57.647  1.00 6.46  ? 358  LYS A O     1 
ATOM   1891 C CB    . LYS A 1 251 ? 13.954  15.311  56.986  1.00 6.79  ? 358  LYS A CB    1 
ATOM   1892 C CG    . LYS A 1 251 ? 14.039  15.852  58.408  1.00 8.85  ? 358  LYS A CG    1 
ATOM   1893 C CD    . LYS A 1 251 ? 12.667  15.963  59.081  1.00 11.56 ? 358  LYS A CD    1 
ATOM   1894 C CE    . LYS A 1 251 ? 12.778  15.922  60.608  1.00 13.45 ? 358  LYS A CE    1 
ATOM   1895 N NZ    . LYS A 1 251 ? 11.446  16.046  61.278  1.00 15.20 ? 358  LYS A NZ    1 
ATOM   1896 N N     . ALA A 1 252 ? 16.055  13.069  56.982  1.00 6.07  ? 359  ALA A N     1 
ATOM   1897 C CA    . ALA A 1 252 ? 16.879  12.101  57.687  1.00 6.00  ? 359  ALA A CA    1 
ATOM   1898 C C     . ALA A 1 252 ? 18.303  12.091  57.143  1.00 6.09  ? 359  ALA A C     1 
ATOM   1899 O O     . ALA A 1 252 ? 19.265  12.036  57.907  1.00 5.68  ? 359  ALA A O     1 
ATOM   1900 C CB    . ALA A 1 252 ? 16.277  10.724  57.587  1.00 6.19  ? 359  ALA A CB    1 
ATOM   1901 N N     . PHE A 1 253 ? 18.443  12.145  55.824  1.00 5.93  ? 360  PHE A N     1 
ATOM   1902 C CA    . PHE A 1 253 ? 19.774  12.143  55.219  1.00 6.25  ? 360  PHE A CA    1 
ATOM   1903 C C     . PHE A 1 253 ? 20.549  13.395  55.642  1.00 6.88  ? 360  PHE A C     1 
ATOM   1904 O O     . PHE A 1 253 ? 21.688  13.311  56.106  1.00 7.37  ? 360  PHE A O     1 
ATOM   1905 C CB    . PHE A 1 253 ? 19.692  12.075  53.691  1.00 6.09  ? 360  PHE A CB    1 
ATOM   1906 C CG    . PHE A 1 253 ? 21.035  12.164  53.015  1.00 5.08  ? 360  PHE A CG    1 
ATOM   1907 C CD1   . PHE A 1 253 ? 21.974  11.152  53.164  1.00 5.53  ? 360  PHE A CD1   1 
ATOM   1908 C CD2   . PHE A 1 253 ? 21.371  13.270  52.258  1.00 5.37  ? 360  PHE A CD2   1 
ATOM   1909 C CE1   . PHE A 1 253 ? 23.222  11.241  52.557  1.00 5.05  ? 360  PHE A CE1   1 
ATOM   1910 C CE2   . PHE A 1 253 ? 22.616  13.362  51.643  1.00 5.78  ? 360  PHE A CE2   1 
ATOM   1911 C CZ    . PHE A 1 253 ? 23.541  12.349  51.800  1.00 5.36  ? 360  PHE A CZ    1 
ATOM   1912 N N     . GLN A 1 254 ? 19.913  14.553  55.504  1.00 7.57  ? 361  GLN A N     1 
ATOM   1913 C CA    . GLN A 1 254 ? 20.535  15.826  55.850  1.00 8.38  ? 361  GLN A CA    1 
ATOM   1914 C C     . GLN A 1 254 ? 20.932  15.897  57.325  1.00 9.69  ? 361  GLN A C     1 
ATOM   1915 O O     . GLN A 1 254 ? 21.821  16.664  57.692  1.00 9.62  ? 361  GLN A O     1 
ATOM   1916 C CB    . GLN A 1 254 ? 19.603  16.971  55.489  1.00 7.94  ? 361  GLN A CB    1 
ATOM   1917 C CG    . GLN A 1 254 ? 19.627  17.293  53.983  1.00 7.07  ? 361  GLN A CG    1 
ATOM   1918 C CD    . GLN A 1 254 ? 21.036  17.618  53.478  1.00 5.92  ? 361  GLN A CD    1 
ATOM   1919 O OE1   . GLN A 1 254 ? 21.496  17.078  52.467  1.00 7.96  ? 361  GLN A OE1   1 
ATOM   1920 N NE2   . GLN A 1 254 ? 21.702  18.503  54.166  1.00 3.18  ? 361  GLN A NE2   1 
ATOM   1921 N N     . ALA A 1 255 ? 20.273  15.099  58.159  1.00 11.55 ? 362  ALA A N     1 
ATOM   1922 C CA    . ALA A 1 255 ? 20.615  15.019  59.590  1.00 13.25 ? 362  ALA A CA    1 
ATOM   1923 C C     . ALA A 1 255 ? 21.944  14.302  59.788  1.00 14.65 ? 362  ALA A C     1 
ATOM   1924 O O     . ALA A 1 255 ? 22.567  14.414  60.852  1.00 15.14 ? 362  ALA A O     1 
ATOM   1925 C CB    . ALA A 1 255 ? 19.511  14.306  60.361  1.00 13.47 ? 362  ALA A CB    1 
ATOM   1926 N N     . THR A 1 256 ? 22.382  13.561  58.772  1.00 16.29 ? 363  THR A N     1 
ATOM   1927 C CA    . THR A 1 256 ? 23.667  12.859  58.813  1.00 17.77 ? 363  THR A CA    1 
ATOM   1928 C C     . THR A 1 256 ? 24.732  13.750  58.195  1.00 18.76 ? 363  THR A C     1 
ATOM   1929 O O     . THR A 1 256 ? 25.922  13.421  58.208  1.00 18.78 ? 363  THR A O     1 
ATOM   1930 C CB    . THR A 1 256 ? 23.600  11.548  58.031  1.00 17.95 ? 363  THR A CB    1 
ATOM   1931 O OG1   . THR A 1 256 ? 22.493  10.765  58.497  1.00 18.76 ? 363  THR A OG1   1 
ATOM   1932 C CG2   . THR A 1 256 ? 24.814  10.663  58.314  1.00 18.15 ? 363  THR A CG2   1 
ATOM   1933 N N     . GLN A 1 257 ? 24.283  14.871  57.640  1.00 19.77 ? 364  GLN A N     1 
ATOM   1934 C CA    . GLN A 1 257 ? 25.158  15.851  57.022  1.00 20.96 ? 364  GLN A CA    1 
ATOM   1935 C C     . GLN A 1 257 ? 25.312  17.110  57.902  1.00 21.55 ? 364  GLN A C     1 
ATOM   1936 O O     . GLN A 1 257 ? 26.401  17.645  58.011  1.00 21.55 ? 364  GLN A O     1 
ATOM   1937 C CB    . GLN A 1 257 ? 24.616  16.229  55.640  1.00 21.24 ? 364  GLN A CB    1 
ATOM   1938 C CG    . GLN A 1 257 ? 25.490  15.801  54.446  1.00 22.43 ? 364  GLN A CG    1 
ATOM   1939 C CD    . GLN A 1 257 ? 25.668  14.294  54.277  1.00 23.32 ? 364  GLN A CD    1 
ATOM   1940 O OE1   . GLN A 1 257 ? 25.472  13.516  55.210  1.00 23.46 ? 364  GLN A OE1   1 
ATOM   1941 N NE2   . GLN A 1 257 ? 26.060  13.889  53.076  1.00 24.13 ? 364  GLN A NE2   1 
ATOM   1942 N N     . GLN A 1 258 ? 24.219  17.542  58.539  1.00 22.62 ? 365  GLN A N     1 
ATOM   1943 C CA    . GLN A 1 258 ? 24.114  18.807  59.294  1.00 23.44 ? 365  GLN A CA    1 
ATOM   1944 C C     . GLN A 1 258 ? 23.877  19.909  58.281  1.00 24.03 ? 365  GLN A C     1 
ATOM   1945 O O     . GLN A 1 258 ? 24.709  20.190  57.421  1.00 24.63 ? 365  GLN A O     1 
ATOM   1946 C CB    . GLN A 1 258 ? 25.287  19.137  60.218  1.00 23.70 ? 365  GLN A CB    1 
ATOM   1947 C CG    . GLN A 1 258 ? 24.879  19.207  61.721  1.00 24.10 ? 365  GLN A CG    1 
ATOM   1948 C CD    . GLN A 1 258 ? 24.542  20.613  62.236  1.00 24.69 ? 365  GLN A CD    1 
ATOM   1949 O OE1   . GLN A 1 258 ? 23.620  21.268  61.738  1.00 25.16 ? 365  GLN A OE1   1 
ATOM   1950 N NE2   . GLN A 1 258 ? 25.279  21.061  63.257  1.00 24.67 ? 365  GLN A NE2   1 
ATOM   1951 N N     . LYS A 1 259 ? 22.717  20.524  58.396  1.00 24.21 ? 366  LYS A N     1 
ATOM   1952 C CA    . LYS A 1 259 ? 22.284  21.522  57.454  1.00 24.37 ? 366  LYS A CA    1 
ATOM   1953 C C     . LYS A 1 259 ? 22.183  22.861  58.160  1.00 24.51 ? 366  LYS A C     1 
ATOM   1954 O O     . LYS A 1 259 ? 22.939  23.126  59.107  1.00 24.62 ? 366  LYS A O     1 
ATOM   1955 C CB    . LYS A 1 259 ? 20.933  21.079  56.920  1.00 24.52 ? 366  LYS A CB    1 
ATOM   1956 C CG    . LYS A 1 259 ? 20.046  20.537  58.053  1.00 24.53 ? 366  LYS A CG    1 
ATOM   1957 C CD    . LYS A 1 259 ? 19.425  19.211  57.731  1.00 24.45 ? 366  LYS A CD    1 
ATOM   1958 C CE    . LYS A 1 259 ? 18.536  18.713  58.859  1.00 24.03 ? 366  LYS A CE    1 
ATOM   1959 N NZ    . LYS A 1 259 ? 17.310  18.004  58.315  1.00 23.21 ? 366  LYS A NZ    1 
ATOM   1960 N N     . GLY B 1 10  ? 23.192  48.120  -18.749 1.00 13.32 ? 117  GLY B N     1 
ATOM   1961 C CA    . GLY B 1 10  ? 23.369  46.880  -17.944 1.00 12.90 ? 117  GLY B CA    1 
ATOM   1962 C C     . GLY B 1 10  ? 22.919  46.902  -16.506 1.00 12.58 ? 117  GLY B C     1 
ATOM   1963 O O     . GLY B 1 10  ? 23.509  47.453  -15.574 1.00 12.58 ? 117  GLY B O     1 
ATOM   1964 N N     . VAL B 1 11  ? 21.675  46.526  -16.522 1.00 12.09 ? 118  VAL B N     1 
ATOM   1965 C CA    . VAL B 1 11  ? 20.848  45.862  -15.633 1.00 11.58 ? 118  VAL B CA    1 
ATOM   1966 C C     . VAL B 1 11  ? 21.542  44.778  -14.899 1.00 10.46 ? 118  VAL B C     1 
ATOM   1967 O O     . VAL B 1 11  ? 22.120  43.843  -15.468 1.00 10.10 ? 118  VAL B O     1 
ATOM   1968 C CB    . VAL B 1 11  ? 19.923  45.266  -16.697 1.00 11.59 ? 118  VAL B CB    1 
ATOM   1969 C CG1   . VAL B 1 11  ? 18.703  44.619  -16.197 1.00 12.33 ? 118  VAL B CG1   1 
ATOM   1970 C CG2   . VAL B 1 11  ? 19.632  46.398  -17.729 1.00 12.15 ? 118  VAL B CG2   1 
ATOM   1971 N N     . CYS B 1 12  ? 21.508  44.958  -13.602 1.00 9.54  ? 119  CYS B N     1 
ATOM   1972 C CA    . CYS B 1 12  ? 21.989  43.982  -12.708 1.00 8.89  ? 119  CYS B CA    1 
ATOM   1973 C C     . CYS B 1 12  ? 20.669  43.501  -12.081 1.00 7.84  ? 119  CYS B C     1 
ATOM   1974 O O     . CYS B 1 12  ? 19.742  44.292  -11.914 1.00 7.34  ? 119  CYS B O     1 
ATOM   1975 C CB    . CYS B 1 12  ? 22.993  44.638  -11.737 1.00 9.04  ? 119  CYS B CB    1 
ATOM   1976 S SG    A CYS B 1 12  ? 24.334  45.523  -12.549 0.50 9.18  ? 119  CYS B SG    1 
ATOM   1977 S SG    B CYS B 1 12  ? 22.924  43.818  -10.179 0.50 10.32 ? 119  CYS B SG    1 
ATOM   1978 N N     . TRP B 1 13  ? 20.547  42.200  -11.854 1.00 6.92  ? 120  TRP B N     1 
ATOM   1979 C CA    . TRP B 1 13  ? 19.422  41.639  -11.127 1.00 6.59  ? 120  TRP B CA    1 
ATOM   1980 C C     . TRP B 1 13  ? 20.023  41.204  -9.806  1.00 6.49  ? 120  TRP B C     1 
ATOM   1981 O O     . TRP B 1 13  ? 20.881  40.346  -9.820  1.00 6.78  ? 120  TRP B O     1 
ATOM   1982 C CB    . TRP B 1 13  ? 18.856  40.395  -11.830 1.00 6.57  ? 120  TRP B CB    1 
ATOM   1983 C CG    . TRP B 1 13  ? 18.167  40.655  -13.116 1.00 6.53  ? 120  TRP B CG    1 
ATOM   1984 C CD1   . TRP B 1 13  ? 18.748  40.918  -14.319 1.00 6.83  ? 120  TRP B CD1   1 
ATOM   1985 C CD2   . TRP B 1 13  ? 16.755  40.625  -13.353 1.00 6.58  ? 120  TRP B CD2   1 
ATOM   1986 N NE1   . TRP B 1 13  ? 17.786  41.091  -15.284 1.00 6.80  ? 120  TRP B NE1   1 
ATOM   1987 C CE2   . TRP B 1 13  ? 16.552  40.914  -14.714 1.00 6.50  ? 120  TRP B CE2   1 
ATOM   1988 C CE3   . TRP B 1 13  ? 15.638  40.409  -12.542 1.00 6.37  ? 120  TRP B CE3   1 
ATOM   1989 C CZ2   . TRP B 1 13  ? 15.282  40.975  -15.285 1.00 6.46  ? 120  TRP B CZ2   1 
ATOM   1990 C CZ3   . TRP B 1 13  ? 14.372  40.473  -13.117 1.00 7.01  ? 120  TRP B CZ3   1 
ATOM   1991 C CH2   . TRP B 1 13  ? 14.212  40.760  -14.468 1.00 6.19  ? 120  TRP B CH2   1 
ATOM   1992 N N     . ILE B 1 14  ? 19.594  41.794  -8.694  1.00 6.22  ? 121  ILE B N     1 
ATOM   1993 C CA    . ILE B 1 14  ? 20.122  41.461  -7.368  1.00 6.42  ? 121  ILE B CA    1 
ATOM   1994 C C     . ILE B 1 14  ? 19.022  40.817  -6.528  1.00 6.35  ? 121  ILE B C     1 
ATOM   1995 O O     . ILE B 1 14  ? 18.134  41.509  -6.011  1.00 6.38  ? 121  ILE B O     1 
ATOM   1996 C CB    . ILE B 1 14  ? 20.660  42.730  -6.668  1.00 6.52  ? 121  ILE B CB    1 
ATOM   1997 C CG1   . ILE B 1 14  ? 21.542  43.530  -7.626  1.00 7.27  ? 121  ILE B CG1   1 
ATOM   1998 C CG2   . ILE B 1 14  ? 21.479  42.363  -5.416  1.00 6.97  ? 121  ILE B CG2   1 
ATOM   1999 C CD1   . ILE B 1 14  ? 21.890  44.925  -7.124  1.00 8.39  ? 121  ILE B CD1   1 
ATOM   2000 N N     . TYR B 1 15  ? 19.075  39.495  -6.399  1.00 6.10  ? 122  TYR B N     1 
ATOM   2001 C CA    . TYR B 1 15  ? 18.063  38.756  -5.656  1.00 5.74  ? 122  TYR B CA    1 
ATOM   2002 C C     . TYR B 1 15  ? 18.398  38.698  -4.184  1.00 5.72  ? 122  TYR B C     1 
ATOM   2003 O O     . TYR B 1 15  ? 19.550  38.476  -3.808  1.00 5.65  ? 122  TYR B O     1 
ATOM   2004 C CB    . TYR B 1 15  ? 17.923  37.322  -6.180  1.00 5.79  ? 122  TYR B CB    1 
ATOM   2005 C CG    . TYR B 1 15  ? 17.200  37.206  -7.504  1.00 6.74  ? 122  TYR B CG    1 
ATOM   2006 C CD1   . TYR B 1 15  ? 17.871  37.403  -8.698  1.00 7.70  ? 122  TYR B CD1   1 
ATOM   2007 C CD2   . TYR B 1 15  ? 15.849  36.881  -7.558  1.00 7.12  ? 122  TYR B CD2   1 
ATOM   2008 C CE1   . TYR B 1 15  ? 17.222  37.301  -9.901  1.00 7.66  ? 122  TYR B CE1   1 
ATOM   2009 C CE2   . TYR B 1 15  ? 15.190  36.769  -8.758  1.00 7.73  ? 122  TYR B CE2   1 
ATOM   2010 C CZ    . TYR B 1 15  ? 15.882  36.979  -9.930  1.00 7.93  ? 122  TYR B CZ    1 
ATOM   2011 O OH    . TYR B 1 15  ? 15.241  36.873  -11.135 1.00 8.75  ? 122  TYR B OH    1 
ATOM   2012 N N     . TYR B 1 16  ? 17.382  38.915  -3.361  1.00 5.44  ? 123  TYR B N     1 
ATOM   2013 C CA    . TYR B 1 16  ? 17.506  38.753  -1.934  1.00 5.79  ? 123  TYR B CA    1 
ATOM   2014 C C     . TYR B 1 16  ? 17.315  37.260  -1.701  1.00 5.38  ? 123  TYR B C     1 
ATOM   2015 O O     . TYR B 1 16  ? 16.698  36.585  -2.525  1.00 5.08  ? 123  TYR B O     1 
ATOM   2016 C CB    . TYR B 1 16  ? 16.419  39.537  -1.209  1.00 5.99  ? 123  TYR B CB    1 
ATOM   2017 C CG    . TYR B 1 16  ? 16.574  41.036  -1.293  1.00 7.68  ? 123  TYR B CG    1 
ATOM   2018 C CD1   . TYR B 1 16  ? 15.734  41.795  -2.096  1.00 9.40  ? 123  TYR B CD1   1 
ATOM   2019 C CD2   . TYR B 1 16  ? 17.540  41.695  -0.552  1.00 9.62  ? 123  TYR B CD2   1 
ATOM   2020 C CE1   . TYR B 1 16  ? 15.865  43.169  -2.171  1.00 10.33 ? 123  TYR B CE1   1 
ATOM   2021 C CE2   . TYR B 1 16  ? 17.679  43.069  -0.620  1.00 10.98 ? 123  TYR B CE2   1 
ATOM   2022 C CZ    . TYR B 1 16  ? 16.840  43.798  -1.432  1.00 11.40 ? 123  TYR B CZ    1 
ATOM   2023 O OH    . TYR B 1 16  ? 16.973  45.168  -1.496  1.00 13.38 ? 123  TYR B OH    1 
ATOM   2024 N N     . PRO B 1 17  ? 17.829  36.736  -0.600  1.00 4.92  ? 124  PRO B N     1 
ATOM   2025 C CA    . PRO B 1 17  ? 17.653  35.318  -0.294  1.00 4.58  ? 124  PRO B CA    1 
ATOM   2026 C C     . PRO B 1 17  ? 16.174  34.928  -0.268  1.00 3.83  ? 124  PRO B C     1 
ATOM   2027 O O     . PRO B 1 17  ? 15.866  33.776  -0.530  1.00 3.85  ? 124  PRO B O     1 
ATOM   2028 C CB    . PRO B 1 17  ? 18.278  35.165  1.097   1.00 4.88  ? 124  PRO B CB    1 
ATOM   2029 C CG    . PRO B 1 17  ? 19.037  36.403  1.370   1.00 5.17  ? 124  PRO B CG    1 
ATOM   2030 C CD    . PRO B 1 17  ? 18.637  37.430  0.415   1.00 4.91  ? 124  PRO B CD    1 
ATOM   2031 N N     . ASP B 1 18  ? 15.290  35.873  0.035   1.00 3.28  ? 125  ASP B N     1 
ATOM   2032 C CA    . ASP B 1 18  ? 13.846  35.586  0.093   1.00 3.24  ? 125  ASP B CA    1 
ATOM   2033 C C     . ASP B 1 18  ? 13.188  35.405  -1.277  1.00 3.42  ? 125  ASP B C     1 
ATOM   2034 O O     . ASP B 1 18  ? 12.030  34.980  -1.351  1.00 3.26  ? 125  ASP B O     1 
ATOM   2035 C CB    . ASP B 1 18  ? 13.095  36.644  0.913   1.00 3.14  ? 125  ASP B CB    1 
ATOM   2036 C CG    . ASP B 1 18  ? 13.346  38.059  0.440   1.00 3.79  ? 125  ASP B CG    1 
ATOM   2037 O OD1   . ASP B 1 18  ? 13.120  38.333  -0.764  1.00 3.96  ? 125  ASP B OD1   1 
ATOM   2038 O OD2   . ASP B 1 18  ? 13.738  38.971  1.221   1.00 3.94  ? 125  ASP B OD2   1 
ATOM   2039 N N     . GLY B 1 19  ? 13.899  35.722  -2.356  1.00 3.49  ? 126  GLY B N     1 
ATOM   2040 C CA    . GLY B 1 19  ? 13.343  35.547  -3.697  1.00 3.60  ? 126  GLY B CA    1 
ATOM   2041 C C     . GLY B 1 19  ? 12.947  36.836  -4.402  1.00 3.93  ? 126  GLY B C     1 
ATOM   2042 O O     . GLY B 1 19  ? 12.744  36.851  -5.624  1.00 3.81  ? 126  GLY B O     1 
ATOM   2043 N N     . GLY B 1 20  ? 12.783  37.905  -3.631  1.00 4.28  ? 127  GLY B N     1 
ATOM   2044 C CA    . GLY B 1 20  ? 12.545  39.228  -4.186  1.00 4.18  ? 127  GLY B CA    1 
ATOM   2045 C C     . GLY B 1 20  ? 13.867  39.719  -4.775  1.00 4.62  ? 127  GLY B C     1 
ATOM   2046 O O     . GLY B 1 20  ? 14.938  39.138  -4.494  1.00 4.53  ? 127  GLY B O     1 
ATOM   2047 N N     . SER B 1 21  ? 13.819  40.789  -5.564  1.00 5.13  ? 128  SER B N     1 
ATOM   2048 C CA    . SER B 1 21  ? 15.010  41.278  -6.253  1.00 5.68  ? 128  SER B CA    1 
ATOM   2049 C C     . SER B 1 21  ? 14.943  42.748  -6.630  1.00 6.02  ? 128  SER B C     1 
ATOM   2050 O O     . SER B 1 21  ? 13.865  43.335  -6.717  1.00 6.00  ? 128  SER B O     1 
ATOM   2051 C CB    . SER B 1 21  ? 15.228  40.481  -7.538  1.00 5.95  ? 128  SER B CB    1 
ATOM   2052 O OG    . SER B 1 21  ? 14.157  40.667  -8.448  1.00 6.77  ? 128  SER B OG    1 
ATOM   2053 N N     . LEU B 1 22  ? 16.125  43.323  -6.847  1.00 6.46  ? 129  LEU B N     1 
ATOM   2054 C CA    . LEU B 1 22  ? 16.272  44.679  -7.347  1.00 6.88  ? 129  LEU B CA    1 
ATOM   2055 C C     . LEU B 1 22  ? 16.819  44.575  -8.772  1.00 6.64  ? 129  LEU B C     1 
ATOM   2056 O O     . LEU B 1 22  ? 17.809  43.891  -9.011  1.00 6.47  ? 129  LEU B O     1 
ATOM   2057 C CB    . LEU B 1 22  ? 17.222  45.481  -6.463  1.00 6.98  ? 129  LEU B CB    1 
ATOM   2058 C CG    . LEU B 1 22  ? 16.562  46.392  -5.421  1.00 8.92  ? 129  LEU B CG    1 
ATOM   2059 C CD1   . LEU B 1 22  ? 15.364  45.737  -4.759  1.00 10.32 ? 129  LEU B CD1   1 
ATOM   2060 C CD2   . LEU B 1 22  ? 17.552  46.840  -4.370  1.00 9.78  ? 129  LEU B CD2   1 
ATOM   2061 N N     . VAL B 1 23  ? 16.170  45.239  -9.722  1.00 6.40  ? 130  VAL B N     1 
ATOM   2062 C CA    . VAL B 1 23  ? 16.595  45.161  -11.113 1.00 6.67  ? 130  VAL B CA    1 
ATOM   2063 C C     . VAL B 1 23  ? 16.651  46.531  -11.770 1.00 6.85  ? 130  VAL B C     1 
ATOM   2064 O O     . VAL B 1 23  ? 15.735  47.344  -11.624 1.00 5.89  ? 130  VAL B O     1 
ATOM   2065 C CB    . VAL B 1 23  ? 15.623  44.310  -11.953 1.00 6.74  ? 130  VAL B CB    1 
ATOM   2066 C CG1   . VAL B 1 23  ? 16.262  43.921  -13.285 1.00 6.38  ? 130  VAL B CG1   1 
ATOM   2067 C CG2   . VAL B 1 23  ? 15.198  43.083  -11.195 1.00 7.61  ? 130  VAL B CG2   1 
ATOM   2068 N N     . GLY B 1 24  ? 17.719  46.772  -12.519 1.00 7.33  ? 131  GLY B N     1 
ATOM   2069 C CA    . GLY B 1 24  ? 17.867  48.030  -13.220 1.00 8.04  ? 131  GLY B CA    1 
ATOM   2070 C C     . GLY B 1 24  ? 19.288  48.273  -13.668 1.00 8.68  ? 131  GLY B C     1 
ATOM   2071 O O     . GLY B 1 24  ? 20.201  47.537  -13.298 1.00 8.36  ? 131  GLY B O     1 
ATOM   2072 N N     . GLU B 1 25  ? 19.462  49.304  -14.489 1.00 9.80  ? 132  GLU B N     1 
ATOM   2073 C CA    . GLU B 1 25  ? 20.772  49.698  -14.976 1.00 10.84 ? 132  GLU B CA    1 
ATOM   2074 C C     . GLU B 1 25  ? 21.528  50.384  -13.852 1.00 11.72 ? 132  GLU B C     1 
ATOM   2075 O O     . GLU B 1 25  ? 21.026  51.317  -13.237 1.00 11.63 ? 132  GLU B O     1 
ATOM   2076 C CB    . GLU B 1 25  ? 20.631  50.660  -16.149 1.00 11.01 ? 132  GLU B CB    1 
ATOM   2077 C CG    . GLU B 1 25  ? 21.891  50.800  -16.985 1.00 11.45 ? 132  GLU B CG    1 
ATOM   2078 C CD    . GLU B 1 25  ? 21.697  51.722  -18.172 1.00 12.45 ? 132  GLU B CD    1 
ATOM   2079 O OE1   . GLU B 1 25  ? 20.837  51.424  -19.036 1.00 13.07 ? 132  GLU B OE1   1 
ATOM   2080 O OE2   . GLU B 1 25  ? 22.405  52.749  -18.237 1.00 12.74 ? 132  GLU B OE2   1 
ATOM   2081 N N     . VAL B 1 26  ? 22.738  49.915  -13.589 1.00 12.95 ? 133  VAL B N     1 
ATOM   2082 C CA    . VAL B 1 26  ? 23.555  50.467  -12.518 1.00 14.13 ? 133  VAL B CA    1 
ATOM   2083 C C     . VAL B 1 26  ? 24.205  51.778  -12.955 1.00 15.09 ? 133  VAL B C     1 
ATOM   2084 O O     . VAL B 1 26  ? 24.615  51.915  -14.108 1.00 15.40 ? 133  VAL B O     1 
ATOM   2085 C CB    . VAL B 1 26  ? 24.633  49.461  -12.078 1.00 14.23 ? 133  VAL B CB    1 
ATOM   2086 C CG1   . VAL B 1 26  ? 23.967  48.204  -11.541 1.00 14.21 ? 133  VAL B CG1   1 
ATOM   2087 C CG2   . VAL B 1 26  ? 25.555  49.117  -13.236 1.00 14.57 ? 133  VAL B CG2   1 
ATOM   2088 N N     . ASN B 1 27  ? 24.285  52.742  -12.038 1.00 16.03 ? 134  ASN B N     1 
ATOM   2089 C CA    . ASN B 1 27  ? 24.886  54.043  -12.348 1.00 16.74 ? 134  ASN B CA    1 
ATOM   2090 C C     . ASN B 1 27  ? 26.388  53.882  -12.586 1.00 17.18 ? 134  ASN B C     1 
ATOM   2091 O O     . ASN B 1 27  ? 26.965  52.836  -12.274 1.00 17.34 ? 134  ASN B O     1 
ATOM   2092 C CB    . ASN B 1 27  ? 24.583  55.079  -11.258 1.00 16.88 ? 134  ASN B CB    1 
ATOM   2093 C CG    . ASN B 1 27  ? 25.543  55.020  -10.103 1.00 17.23 ? 134  ASN B CG    1 
ATOM   2094 O OD1   . ASN B 1 27  ? 26.233  54.022  -9.896  1.00 17.59 ? 134  ASN B OD1   1 
ATOM   2095 N ND2   . ASN B 1 27  ? 25.594  56.102  -9.332  1.00 17.88 ? 134  ASN B ND2   1 
ATOM   2096 N N     . GLU B 1 28  ? 27.027  54.916  -13.125 1.00 17.62 ? 135  GLU B N     1 
ATOM   2097 C CA    . GLU B 1 28  ? 28.437  54.829  -13.507 1.00 17.86 ? 135  GLU B CA    1 
ATOM   2098 C C     . GLU B 1 28  ? 29.345  54.522  -12.336 1.00 18.03 ? 135  GLU B C     1 
ATOM   2099 O O     . GLU B 1 28  ? 30.559  54.399  -12.495 1.00 18.03 ? 135  GLU B O     1 
ATOM   2100 C CB    . GLU B 1 28  ? 28.894  56.117  -14.166 1.00 17.98 ? 135  GLU B CB    1 
ATOM   2101 C CG    . GLU B 1 28  ? 28.858  57.316  -13.246 1.00 18.27 ? 135  GLU B CG    1 
ATOM   2102 C CD    . GLU B 1 28  ? 28.603  58.583  -14.023 1.00 18.66 ? 135  GLU B CD    1 
ATOM   2103 O OE1   . GLU B 1 28  ? 27.488  58.708  -14.578 1.00 19.15 ? 135  GLU B OE1   1 
ATOM   2104 O OE2   . GLU B 1 28  ? 29.513  59.432  -14.105 1.00 18.73 ? 135  GLU B OE2   1 
ATOM   2105 N N     . ASP B 1 29  ? 28.755  54.416  -11.157 1.00 18.17 ? 136  ASP B N     1 
ATOM   2106 C CA    . ASP B 1 29  ? 29.511  54.045  -9.985  1.00 18.31 ? 136  ASP B CA    1 
ATOM   2107 C C     . ASP B 1 29  ? 29.045  52.667  -9.507  1.00 18.01 ? 136  ASP B C     1 
ATOM   2108 O O     . ASP B 1 29  ? 29.420  52.212  -8.427  1.00 18.17 ? 136  ASP B O     1 
ATOM   2109 C CB    . ASP B 1 29  ? 29.350  55.094  -8.895  1.00 18.58 ? 136  ASP B CB    1 
ATOM   2110 C CG    . ASP B 1 29  ? 30.622  55.300  -8.111  1.00 19.34 ? 136  ASP B CG    1 
ATOM   2111 O OD1   . ASP B 1 29  ? 31.718  55.258  -8.718  1.00 20.20 ? 136  ASP B OD1   1 
ATOM   2112 O OD2   . ASP B 1 29  ? 30.629  55.507  -6.883  1.00 20.47 ? 136  ASP B OD2   1 
ATOM   2113 N N     . GLY B 1 30  ? 28.236  52.001  -10.330 1.00 17.58 ? 137  GLY B N     1 
ATOM   2114 C CA    . GLY B 1 30  ? 27.695  50.699  -9.986  1.00 17.17 ? 137  GLY B CA    1 
ATOM   2115 C C     . GLY B 1 30  ? 26.615  50.779  -8.917  1.00 16.76 ? 137  GLY B C     1 
ATOM   2116 O O     . GLY B 1 30  ? 26.467  49.858  -8.116  1.00 16.80 ? 137  GLY B O     1 
ATOM   2117 N N     . GLU B 1 31  ? 25.858  51.874  -8.902  1.00 16.22 ? 138  GLU B N     1 
ATOM   2118 C CA    . GLU B 1 31  ? 24.778  52.056  -7.925  1.00 15.85 ? 138  GLU B CA    1 
ATOM   2119 C C     . GLU B 1 31  ? 23.407  51.881  -8.567  1.00 15.32 ? 138  GLU B C     1 
ATOM   2120 O O     . GLU B 1 31  ? 23.194  52.283  -9.712  1.00 15.01 ? 138  GLU B O     1 
ATOM   2121 C CB    . GLU B 1 31  ? 24.858  53.441  -7.275  1.00 16.02 ? 138  GLU B CB    1 
ATOM   2122 C CG    . GLU B 1 31  ? 26.037  53.601  -6.323  1.00 16.54 ? 138  GLU B CG    1 
ATOM   2123 C CD    . GLU B 1 31  ? 26.221  55.025  -5.831  1.00 17.12 ? 138  GLU B CD    1 
ATOM   2124 O OE1   . GLU B 1 31  ? 25.495  55.927  -6.295  1.00 17.62 ? 138  GLU B OE1   1 
ATOM   2125 O OE2   . GLU B 1 31  ? 27.101  55.243  -4.976  1.00 17.73 ? 138  GLU B OE2   1 
ATOM   2126 N N     . MET B 1 32  ? 22.481  51.278  -7.827  1.00 14.73 ? 139  MET B N     1 
ATOM   2127 C CA    . MET B 1 32  ? 21.112  51.110  -8.299  1.00 14.25 ? 139  MET B CA    1 
ATOM   2128 C C     . MET B 1 32  ? 20.386  52.446  -8.155  1.00 13.28 ? 139  MET B C     1 
ATOM   2129 O O     . MET B 1 32  ? 19.552  52.614  -7.261  1.00 12.76 ? 139  MET B O     1 
ATOM   2130 C CB    . MET B 1 32  ? 20.388  50.023  -7.503  1.00 14.68 ? 139  MET B CB    1 
ATOM   2131 C CG    . MET B 1 32  ? 20.711  48.602  -7.962  1.00 15.93 ? 139  MET B CG    1 
ATOM   2132 S SD    . MET B 1 32  ? 19.846  48.132  -9.499  1.00 18.35 ? 139  MET B SD    1 
ATOM   2133 C CE    . MET B 1 32  ? 18.291  47.862  -8.951  1.00 19.26 ? 139  MET B CE    1 
ATOM   2134 N N     . THR B 1 33  ? 20.729  53.393  -9.027  1.00 12.23 ? 140  THR B N     1 
ATOM   2135 C CA    . THR B 1 33  ? 20.154  54.733  -9.001  1.00 11.55 ? 140  THR B CA    1 
ATOM   2136 C C     . THR B 1 33  ? 19.654  55.102  -10.382 1.00 11.14 ? 140  THR B C     1 
ATOM   2137 O O     . THR B 1 33  ? 20.406  55.044  -11.349 1.00 11.16 ? 140  THR B O     1 
ATOM   2138 C CB    . THR B 1 33  ? 21.210  55.760  -8.598  1.00 11.40 ? 140  THR B CB    1 
ATOM   2139 O OG1   . THR B 1 33  ? 21.835  55.360  -7.373  1.00 11.10 ? 140  THR B OG1   1 
ATOM   2140 C CG2   . THR B 1 33  ? 20.581  57.112  -8.282  1.00 11.18 ? 140  THR B CG2   1 
ATOM   2141 N N     . GLY B 1 34  ? 18.390  55.495  -10.467 1.00 10.64 ? 141  GLY B N     1 
ATOM   2142 C CA    . GLY B 1 34  ? 17.807  55.875  -11.733 1.00 10.39 ? 141  GLY B CA    1 
ATOM   2143 C C     . GLY B 1 34  ? 16.294  55.977  -11.641 1.00 10.24 ? 141  GLY B C     1 
ATOM   2144 O O     . GLY B 1 34  ? 15.701  55.765  -10.583 1.00 9.49  ? 141  GLY B O     1 
ATOM   2145 N N     . GLU B 1 35  ? 15.671  56.296  -12.767 1.00 10.37 ? 142  GLU B N     1 
ATOM   2146 C CA    . GLU B 1 35  ? 14.226  56.455  -12.832 1.00 10.69 ? 142  GLU B CA    1 
ATOM   2147 C C     . GLU B 1 35  ? 13.525  55.207  -13.372 1.00 10.58 ? 142  GLU B C     1 
ATOM   2148 O O     . GLU B 1 35  ? 12.293  55.165  -13.440 1.00 10.40 ? 142  GLU B O     1 
ATOM   2149 C CB    . GLU B 1 35  ? 13.888  57.650  -13.725 1.00 11.27 ? 142  GLU B CB    1 
ATOM   2150 C CG    . GLU B 1 35  ? 14.317  58.992  -13.149 1.00 12.69 ? 142  GLU B CG    1 
ATOM   2151 C CD    . GLU B 1 35  ? 13.315  59.541  -12.154 1.00 14.88 ? 142  GLU B CD    1 
ATOM   2152 O OE1   . GLU B 1 35  ? 12.489  58.759  -11.643 1.00 16.57 ? 142  GLU B OE1   1 
ATOM   2153 O OE2   . GLU B 1 35  ? 13.349  60.759  -11.885 1.00 16.49 ? 142  GLU B OE2   1 
ATOM   2154 N N     . LYS B 1 36  ? 14.306  54.200  -13.761 1.00 10.30 ? 143  LYS B N     1 
ATOM   2155 C CA    . LYS B 1 36  ? 13.759  52.971  -14.337 1.00 10.01 ? 143  LYS B CA    1 
ATOM   2156 C C     . LYS B 1 36  ? 14.257  51.729  -13.590 1.00 9.69  ? 143  LYS B C     1 
ATOM   2157 O O     . LYS B 1 36  ? 14.616  50.718  -14.190 1.00 10.05 ? 143  LYS B O     1 
ATOM   2158 C CB    . LYS B 1 36  ? 14.108  52.896  -15.824 1.00 10.30 ? 143  LYS B CB    1 
ATOM   2159 C CG    . LYS B 1 36  ? 13.542  54.085  -16.624 1.00 10.90 ? 143  LYS B CG    1 
ATOM   2160 C CD    . LYS B 1 36  ? 13.462  53.824  -18.124 1.00 11.83 ? 143  LYS B CD    1 
ATOM   2161 C CE    . LYS B 1 36  ? 12.885  55.026  -18.874 1.00 12.74 ? 143  LYS B CE    1 
ATOM   2162 N NZ    . LYS B 1 36  ? 12.624  54.755  -20.326 1.00 13.80 ? 143  LYS B NZ    1 
ATOM   2163 N N     . ILE B 1 37  ? 14.286  51.823  -12.268 1.00 9.08  ? 144  ILE B N     1 
ATOM   2164 C CA    . ILE B 1 37  ? 14.697  50.707  -11.429 1.00 8.44  ? 144  ILE B CA    1 
ATOM   2165 C C     . ILE B 1 37  ? 13.451  50.054  -10.855 1.00 7.81  ? 144  ILE B C     1 
ATOM   2166 O O     . ILE B 1 37  ? 12.408  50.705  -10.723 1.00 7.74  ? 144  ILE B O     1 
ATOM   2167 C CB    . ILE B 1 37  ? 15.611  51.204  -10.322 1.00 8.86  ? 144  ILE B CB    1 
ATOM   2168 C CG1   . ILE B 1 37  ? 16.962  51.591  -10.924 1.00 9.73  ? 144  ILE B CG1   1 
ATOM   2169 C CG2   . ILE B 1 37  ? 15.777  50.140  -9.248  1.00 8.30  ? 144  ILE B CG2   1 
ATOM   2170 C CD1   . ILE B 1 37  ? 17.741  52.504  -10.059 1.00 10.55 ? 144  ILE B CD1   1 
ATOM   2171 N N     . ALA B 1 38  ? 13.527  48.764  -10.555 1.00 7.02  ? 145  ALA B N     1 
ATOM   2172 C CA    . ALA B 1 38  ? 12.382  48.073  -9.975  1.00 6.72  ? 145  ALA B CA    1 
ATOM   2173 C C     . ALA B 1 38  ? 12.750  47.122  -8.844  1.00 6.24  ? 145  ALA B C     1 
ATOM   2174 O O     . ALA B 1 38  ? 13.817  46.516  -8.836  1.00 6.26  ? 145  ALA B O     1 
ATOM   2175 C CB    . ALA B 1 38  ? 11.640  47.307  -11.033 1.00 6.82  ? 145  ALA B CB    1 
ATOM   2176 N N     . TYR B 1 39  ? 11.857  47.038  -7.869  1.00 5.71  ? 146  TYR B N     1 
ATOM   2177 C CA    . TYR B 1 39  ? 11.886  45.960  -6.918  1.00 5.30  ? 146  TYR B CA    1 
ATOM   2178 C C     . TYR B 1 39  ? 10.886  44.947  -7.460  1.00 5.28  ? 146  TYR B C     1 
ATOM   2179 O O     . TYR B 1 39  ? 9.759   45.319  -7.797  1.00 5.48  ? 146  TYR B O     1 
ATOM   2180 C CB    . TYR B 1 39  ? 11.416  46.373  -5.542  1.00 5.21  ? 146  TYR B CB    1 
ATOM   2181 C CG    . TYR B 1 39  ? 11.163  45.148  -4.696  1.00 5.31  ? 146  TYR B CG    1 
ATOM   2182 C CD1   . TYR B 1 39  ? 12.215  44.479  -4.062  1.00 5.47  ? 146  TYR B CD1   1 
ATOM   2183 C CD2   . TYR B 1 39  ? 9.884   44.637  -4.553  1.00 4.38  ? 146  TYR B CD2   1 
ATOM   2184 C CE1   . TYR B 1 39  ? 11.981  43.337  -3.300  1.00 5.58  ? 146  TYR B CE1   1 
ATOM   2185 C CE2   . TYR B 1 39  ? 9.640   43.511  -3.800  1.00 4.79  ? 146  TYR B CE2   1 
ATOM   2186 C CZ    . TYR B 1 39  ? 10.677  42.851  -3.193  1.00 5.19  ? 146  TYR B CZ    1 
ATOM   2187 O OH    . TYR B 1 39  ? 10.391  41.728  -2.441  1.00 4.72  ? 146  TYR B OH    1 
ATOM   2188 N N     . VAL B 1 40  ? 11.287  43.688  -7.545  1.00 5.19  ? 147  VAL B N     1 
ATOM   2189 C CA    . VAL B 1 40  ? 10.414  42.629  -8.033  1.00 5.37  ? 147  VAL B CA    1 
ATOM   2190 C C     . VAL B 1 40  ? 10.094  41.666  -6.898  1.00 5.32  ? 147  VAL B C     1 
ATOM   2191 O O     . VAL B 1 40  ? 10.999  41.132  -6.260  1.00 5.57  ? 147  VAL B O     1 
ATOM   2192 C CB    . VAL B 1 40  ? 11.069  41.878  -9.189  1.00 5.40  ? 147  VAL B CB    1 
ATOM   2193 C CG1   . VAL B 1 40  ? 10.163  40.739  -9.680  1.00 6.07  ? 147  VAL B CG1   1 
ATOM   2194 C CG2   . VAL B 1 40  ? 11.361  42.842  -10.326 1.00 6.79  ? 147  VAL B CG2   1 
ATOM   2195 N N     . TYR B 1 41  ? 8.807   41.444  -6.644  1.00 5.44  ? 148  TYR B N     1 
ATOM   2196 C CA    . TYR B 1 41  ? 8.391   40.548  -5.562  1.00 5.10  ? 148  TYR B CA    1 
ATOM   2197 C C     . TYR B 1 41  ? 8.828   39.113  -5.888  1.00 4.61  ? 148  TYR B C     1 
ATOM   2198 O O     . TYR B 1 41  ? 9.277   38.835  -6.997  1.00 4.80  ? 148  TYR B O     1 
ATOM   2199 C CB    . TYR B 1 41  ? 6.875   40.624  -5.358  1.00 4.80  ? 148  TYR B CB    1 
ATOM   2200 C CG    . TYR B 1 41  ? 6.382   41.876  -4.656  1.00 4.65  ? 148  TYR B CG    1 
ATOM   2201 C CD1   . TYR B 1 41  ? 6.018   43.000  -5.377  1.00 5.33  ? 148  TYR B CD1   1 
ATOM   2202 C CD2   . TYR B 1 41  ? 6.244   41.921  -3.267  1.00 4.77  ? 148  TYR B CD2   1 
ATOM   2203 C CE1   . TYR B 1 41  ? 5.540   44.135  -4.746  1.00 5.41  ? 148  TYR B CE1   1 
ATOM   2204 C CE2   . TYR B 1 41  ? 5.768   43.052  -2.627  1.00 4.50  ? 148  TYR B CE2   1 
ATOM   2205 C CZ    . TYR B 1 41  ? 5.413   44.157  -3.373  1.00 5.30  ? 148  TYR B CZ    1 
ATOM   2206 O OH    . TYR B 1 41  ? 4.928   45.292  -2.768  1.00 6.18  ? 148  TYR B OH    1 
ATOM   2207 N N     . PRO B 1 42  ? 8.744   38.209  -4.924  1.00 4.61  ? 149  PRO B N     1 
ATOM   2208 C CA    . PRO B 1 42  ? 9.191   36.826  -5.128  1.00 4.16  ? 149  PRO B CA    1 
ATOM   2209 C C     . PRO B 1 42  ? 8.446   36.035  -6.190  1.00 4.11  ? 149  PRO B C     1 
ATOM   2210 O O     . PRO B 1 42  ? 8.905   34.951  -6.536  1.00 3.62  ? 149  PRO B O     1 
ATOM   2211 C CB    . PRO B 1 42  ? 9.000   36.196  -3.743  1.00 3.94  ? 149  PRO B CB    1 
ATOM   2212 C CG    . PRO B 1 42  ? 9.020   37.326  -2.816  1.00 4.04  ? 149  PRO B CG    1 
ATOM   2213 C CD    . PRO B 1 42  ? 8.356   38.447  -3.523  1.00 4.58  ? 149  PRO B CD    1 
ATOM   2214 N N     . ASP B 1 43  ? 7.324   36.545  -6.690  1.00 4.21  ? 150  ASP B N     1 
ATOM   2215 C CA    . ASP B 1 43  ? 6.618   35.857  -7.760  1.00 4.50  ? 150  ASP B CA    1 
ATOM   2216 C C     . ASP B 1 43  ? 7.277   36.123  -9.124  1.00 5.16  ? 150  ASP B C     1 
ATOM   2217 O O     . ASP B 1 43  ? 6.852   35.563  -10.133 1.00 4.82  ? 150  ASP B O     1 
ATOM   2218 C CB    . ASP B 1 43  ? 5.115   36.195  -7.760  1.00 4.35  ? 150  ASP B CB    1 
ATOM   2219 C CG    . ASP B 1 43  ? 4.812   37.638  -8.098  1.00 3.78  ? 150  ASP B CG    1 
ATOM   2220 O OD1   . ASP B 1 43  ? 5.734   38.457  -8.268  1.00 3.70  ? 150  ASP B OD1   1 
ATOM   2221 O OD2   . ASP B 1 43  ? 3.631   38.039  -8.219  1.00 4.12  ? 150  ASP B OD2   1 
ATOM   2222 N N     . GLU B 1 44  ? 8.317   36.960  -9.144  1.00 6.07  ? 151  GLU B N     1 
ATOM   2223 C CA    . GLU B 1 44  ? 9.038   37.307  -10.373 1.00 7.15  ? 151  GLU B CA    1 
ATOM   2224 C C     . GLU B 1 44  ? 8.121   37.960  -11.404 1.00 7.47  ? 151  GLU B C     1 
ATOM   2225 O O     . GLU B 1 44  ? 8.411   37.938  -12.594 1.00 7.84  ? 151  GLU B O     1 
ATOM   2226 C CB    . GLU B 1 44  ? 9.710   36.073  -10.976 1.00 7.61  ? 151  GLU B CB    1 
ATOM   2227 C CG    . GLU B 1 44  ? 10.775  35.487  -10.069 1.00 9.55  ? 151  GLU B CG    1 
ATOM   2228 C CD    . GLU B 1 44  ? 11.626  34.435  -10.753 1.00 12.23 ? 151  GLU B CD    1 
ATOM   2229 O OE1   . GLU B 1 44  ? 11.147  33.286  -10.894 1.00 11.82 ? 151  GLU B OE1   1 
ATOM   2230 O OE2   . GLU B 1 44  ? 12.780  34.760  -11.123 1.00 14.96 ? 151  GLU B OE2   1 
ATOM   2231 N N     . ARG B 1 45  ? 7.018   38.535  -10.937 1.00 7.65  ? 152  ARG B N     1 
ATOM   2232 C CA    . ARG B 1 45  ? 6.043   39.166  -11.812 1.00 8.26  ? 152  ARG B CA    1 
ATOM   2233 C C     . ARG B 1 45  ? 5.605   40.539  -11.299 1.00 7.64  ? 152  ARG B C     1 
ATOM   2234 O O     . ARG B 1 45  ? 5.601   41.527  -12.051 1.00 7.93  ? 152  ARG B O     1 
ATOM   2235 C CB    . ARG B 1 45  ? 4.817   38.246  -11.952 1.00 8.72  ? 152  ARG B CB    1 
ATOM   2236 C CG    . ARG B 1 45  ? 3.676   38.848  -12.703 1.00 11.64 ? 152  ARG B CG    1 
ATOM   2237 C CD    . ARG B 1 45  ? 2.395   38.031  -12.637 1.00 14.09 ? 152  ARG B CD    1 
ATOM   2238 N NE    . ARG B 1 45  ? 1.354   38.658  -13.428 1.00 16.78 ? 152  ARG B NE    1 
ATOM   2239 C CZ    . ARG B 1 45  ? 0.867   38.163  -14.560 1.00 18.28 ? 152  ARG B CZ    1 
ATOM   2240 N NH1   . ARG B 1 45  ? 1.314   37.014  -15.047 1.00 19.49 ? 152  ARG B NH1   1 
ATOM   2241 N NH2   . ARG B 1 45  ? -0.067  38.822  -15.208 1.00 19.63 ? 152  ARG B NH2   1 
ATOM   2242 N N     . THR B 1 46  ? 5.200   40.590  -10.033 1.00 6.81  ? 153  THR B N     1 
ATOM   2243 C CA    . THR B 1 46  ? 4.734   41.823  -9.425  1.00 6.23  ? 153  THR B CA    1 
ATOM   2244 C C     . THR B 1 46  ? 5.923   42.683  -9.072  1.00 6.01  ? 153  THR B C     1 
ATOM   2245 O O     . THR B 1 46  ? 6.890   42.196  -8.472  1.00 5.71  ? 153  THR B O     1 
ATOM   2246 C CB    . THR B 1 46  ? 3.906   41.519  -8.182  1.00 6.15  ? 153  THR B CB    1 
ATOM   2247 O OG1   . THR B 1 46  ? 2.855   40.593  -8.516  1.00 5.72  ? 153  THR B OG1   1 
ATOM   2248 C CG2   . THR B 1 46  ? 3.173   42.754  -7.701  1.00 6.18  ? 153  THR B CG2   1 
ATOM   2249 N N     . ALA B 1 47  ? 5.859   43.959  -9.437  1.00 5.76  ? 154  ALA B N     1 
ATOM   2250 C CA    . ALA B 1 47  ? 6.985   44.863  -9.207  1.00 5.85  ? 154  ALA B CA    1 
ATOM   2251 C C     . ALA B 1 47  ? 6.585   46.265  -8.755  1.00 5.84  ? 154  ALA B C     1 
ATOM   2252 O O     . ALA B 1 47  ? 5.450   46.700  -8.922  1.00 6.38  ? 154  ALA B O     1 
ATOM   2253 C CB    . ALA B 1 47  ? 7.831   44.957  -10.471 1.00 5.71  ? 154  ALA B CB    1 
ATOM   2254 N N     . LEU B 1 48  ? 7.544   46.964  -8.179  1.00 5.88  ? 155  LEU B N     1 
ATOM   2255 C CA    . LEU B 1 48  ? 7.391   48.368  -7.826  1.00 5.91  ? 155  LEU B CA    1 
ATOM   2256 C C     . LEU B 1 48  ? 8.472   49.056  -8.639  1.00 5.68  ? 155  LEU B C     1 
ATOM   2257 O O     . LEU B 1 48  ? 9.670   48.942  -8.330  1.00 5.79  ? 155  LEU B O     1 
ATOM   2258 C CB    . LEU B 1 48  ? 7.585   48.610  -6.334  1.00 5.57  ? 155  LEU B CB    1 
ATOM   2259 C CG    . LEU B 1 48  ? 6.606   47.870  -5.418  1.00 6.30  ? 155  LEU B CG    1 
ATOM   2260 C CD1   . LEU B 1 48  ? 6.827   48.281  -3.974  1.00 7.27  ? 155  LEU B CD1   1 
ATOM   2261 C CD2   . LEU B 1 48  ? 5.161   48.118  -5.804  1.00 6.39  ? 155  LEU B CD2   1 
ATOM   2262 N N     . TYR B 1 49  ? 8.043   49.748  -9.687  1.00 5.66  ? 156  TYR B N     1 
ATOM   2263 C CA    . TYR B 1 49  ? 8.934   50.336  -10.671 1.00 5.67  ? 156  TYR B CA    1 
ATOM   2264 C C     . TYR B 1 49  ? 9.015   51.848  -10.540 1.00 5.34  ? 156  TYR B C     1 
ATOM   2265 O O     . TYR B 1 49  ? 7.993   52.509  -10.366 1.00 5.68  ? 156  TYR B O     1 
ATOM   2266 C CB    . TYR B 1 49  ? 8.389   49.967  -12.051 1.00 6.19  ? 156  TYR B CB    1 
ATOM   2267 C CG    . TYR B 1 49  ? 9.192   50.440  -13.229 1.00 7.56  ? 156  TYR B CG    1 
ATOM   2268 C CD1   . TYR B 1 49  ? 10.318  49.747  -13.655 1.00 8.40  ? 156  TYR B CD1   1 
ATOM   2269 C CD2   . TYR B 1 49  ? 8.798   51.551  -13.944 1.00 9.07  ? 156  TYR B CD2   1 
ATOM   2270 C CE1   . TYR B 1 49  ? 11.040  50.171  -14.756 1.00 9.22  ? 156  TYR B CE1   1 
ATOM   2271 C CE2   . TYR B 1 49  ? 9.501   51.981  -15.046 1.00 9.83  ? 156  TYR B CE2   1 
ATOM   2272 C CZ    . TYR B 1 49  ? 10.613  51.290  -15.456 1.00 10.18 ? 156  TYR B CZ    1 
ATOM   2273 O OH    . TYR B 1 49  ? 11.298  51.741  -16.559 1.00 10.35 ? 156  TYR B OH    1 
ATOM   2274 N N     . GLY B 1 50  ? 10.221  52.403  -10.640 1.00 4.72  ? 157  GLY B N     1 
ATOM   2275 C CA    . GLY B 1 50  ? 10.380  53.847  -10.606 1.00 4.87  ? 157  GLY B CA    1 
ATOM   2276 C C     . GLY B 1 50  ? 11.730  54.377  -10.181 1.00 5.43  ? 157  GLY B C     1 
ATOM   2277 O O     . GLY B 1 50  ? 12.785  53.872  -10.580 1.00 5.47  ? 157  GLY B O     1 
ATOM   2278 N N     . LYS B 1 51  ? 11.681  55.408  -9.341  1.00 5.58  ? 158  LYS B N     1 
ATOM   2279 C CA    . LYS B 1 51  ? 12.869  56.093  -8.881  1.00 5.70  ? 158  LYS B CA    1 
ATOM   2280 C C     . LYS B 1 51  ? 13.454  55.434  -7.642  1.00 5.65  ? 158  LYS B C     1 
ATOM   2281 O O     . LYS B 1 51  ? 12.774  55.291  -6.627  1.00 5.51  ? 158  LYS B O     1 
ATOM   2282 C CB    . LYS B 1 51  ? 12.533  57.544  -8.566  1.00 5.87  ? 158  LYS B CB    1 
ATOM   2283 C CG    . LYS B 1 51  ? 13.740  58.368  -8.157  1.00 6.96  ? 158  LYS B CG    1 
ATOM   2284 C CD    . LYS B 1 51  ? 13.380  59.822  -7.957  1.00 8.06  ? 158  LYS B CD    1 
ATOM   2285 C CE    . LYS B 1 51  ? 14.601  60.663  -7.706  1.00 8.61  ? 158  LYS B CE    1 
ATOM   2286 N NZ    . LYS B 1 51  ? 14.260  62.115  -7.771  1.00 9.55  ? 158  LYS B NZ    1 
ATOM   2287 N N     . PHE B 1 52  ? 14.718  55.038  -7.745  1.00 5.68  ? 159  PHE B N     1 
ATOM   2288 C CA    . PHE B 1 52  ? 15.454  54.443  -6.635  1.00 5.80  ? 159  PHE B CA    1 
ATOM   2289 C C     . PHE B 1 52  ? 16.768  55.199  -6.513  1.00 5.95  ? 159  PHE B C     1 
ATOM   2290 O O     . PHE B 1 52  ? 17.279  55.725  -7.502  1.00 5.81  ? 159  PHE B O     1 
ATOM   2291 C CB    . PHE B 1 52  ? 15.750  52.961  -6.893  1.00 5.77  ? 159  PHE B CB    1 
ATOM   2292 C CG    . PHE B 1 52  ? 14.552  52.052  -6.726  1.00 5.05  ? 159  PHE B CG    1 
ATOM   2293 C CD1   . PHE B 1 52  ? 13.462  52.125  -7.584  1.00 4.97  ? 159  PHE B CD1   1 
ATOM   2294 C CD2   . PHE B 1 52  ? 14.529  51.116  -5.713  1.00 5.38  ? 159  PHE B CD2   1 
ATOM   2295 C CE1   . PHE B 1 52  ? 12.373  51.273  -7.415  1.00 4.29  ? 159  PHE B CE1   1 
ATOM   2296 C CE2   . PHE B 1 52  ? 13.459  50.273  -5.537  1.00 5.04  ? 159  PHE B CE2   1 
ATOM   2297 C CZ    . PHE B 1 52  ? 12.380  50.347  -6.381  1.00 4.57  ? 159  PHE B CZ    1 
ATOM   2298 N N     . ILE B 1 53  ? 17.310  55.264  -5.302  1.00 6.53  ? 160  ILE B N     1 
ATOM   2299 C CA    . ILE B 1 53  ? 18.616  55.870  -5.079  1.00 6.79  ? 160  ILE B CA    1 
ATOM   2300 C C     . ILE B 1 53  ? 19.428  54.883  -4.239  1.00 7.14  ? 160  ILE B C     1 
ATOM   2301 O O     . ILE B 1 53  ? 19.042  54.581  -3.113  1.00 6.98  ? 160  ILE B O     1 
ATOM   2302 C CB    . ILE B 1 53  ? 18.478  57.221  -4.359  1.00 6.90  ? 160  ILE B CB    1 
ATOM   2303 C CG1   . ILE B 1 53  ? 17.824  58.249  -5.286  1.00 6.91  ? 160  ILE B CG1   1 
ATOM   2304 C CG2   . ILE B 1 53  ? 19.844  57.730  -3.908  1.00 6.95  ? 160  ILE B CG2   1 
ATOM   2305 C CD1   . ILE B 1 53  ? 17.435  59.543  -4.587  1.00 7.38  ? 160  ILE B CD1   1 
ATOM   2306 N N     . ASP B 1 54  ? 20.536  54.382  -4.787  1.00 7.59  ? 161  ASP B N     1 
ATOM   2307 C CA    . ASP B 1 54  ? 21.378  53.393  -4.104  1.00 8.09  ? 161  ASP B CA    1 
ATOM   2308 C C     . ASP B 1 54  ? 20.528  52.239  -3.563  1.00 7.90  ? 161  ASP B C     1 
ATOM   2309 O O     . ASP B 1 54  ? 20.677  51.826  -2.420  1.00 8.16  ? 161  ASP B O     1 
ATOM   2310 C CB    . ASP B 1 54  ? 22.215  54.037  -2.991  1.00 8.47  ? 161  ASP B CB    1 
ATOM   2311 C CG    . ASP B 1 54  ? 23.408  53.171  -2.564  1.00 9.85  ? 161  ASP B CG    1 
ATOM   2312 O OD1   . ASP B 1 54  ? 23.930  52.383  -3.382  1.00 11.51 ? 161  ASP B OD1   1 
ATOM   2313 O OD2   . ASP B 1 54  ? 23.906  53.219  -1.425  1.00 10.89 ? 161  ASP B OD2   1 
ATOM   2314 N N     . GLY B 1 55  ? 19.623  51.726  -4.392  1.00 7.60  ? 162  GLY B N     1 
ATOM   2315 C CA    . GLY B 1 55  ? 18.787  50.598  -4.011  1.00 7.44  ? 162  GLY B CA    1 
ATOM   2316 C C     . GLY B 1 55  ? 17.603  50.916  -3.119  1.00 7.06  ? 162  GLY B C     1 
ATOM   2317 O O     . GLY B 1 55  ? 16.851  50.015  -2.771  1.00 7.10  ? 162  GLY B O     1 
ATOM   2318 N N     . GLU B 1 56  ? 17.437  52.182  -2.749  1.00 6.90  ? 163  GLU B N     1 
ATOM   2319 C CA    . GLU B 1 56  ? 16.332  52.605  -1.897  1.00 6.85  ? 163  GLU B CA    1 
ATOM   2320 C C     . GLU B 1 56  ? 15.197  53.174  -2.756  1.00 6.34  ? 163  GLU B C     1 
ATOM   2321 O O     . GLU B 1 56  ? 15.424  54.036  -3.615  1.00 5.72  ? 163  GLU B O     1 
ATOM   2322 C CB    . GLU B 1 56  ? 16.818  53.639  -0.878  1.00 7.32  ? 163  GLU B CB    1 
ATOM   2323 C CG    . GLU B 1 56  ? 15.761  54.113  0.104   1.00 8.50  ? 163  GLU B CG    1 
ATOM   2324 C CD    . GLU B 1 56  ? 16.317  55.080  1.135   1.00 9.47  ? 163  GLU B CD    1 
ATOM   2325 O OE1   . GLU B 1 56  ? 15.735  56.173  1.307   1.00 11.20 ? 163  GLU B OE1   1 
ATOM   2326 O OE2   . GLU B 1 56  ? 17.337  54.752  1.775   1.00 10.00 ? 163  GLU B OE2   1 
ATOM   2327 N N     . MET B 1 57  ? 13.984  52.679  -2.519  1.00 5.69  ? 164  MET B N     1 
ATOM   2328 C CA    . MET B 1 57  ? 12.802  53.098  -3.263  1.00 5.68  ? 164  MET B CA    1 
ATOM   2329 C C     . MET B 1 57  ? 12.360  54.501  -2.838  1.00 5.24  ? 164  MET B C     1 
ATOM   2330 O O     . MET B 1 57  ? 11.999  54.730  -1.684  1.00 5.27  ? 164  MET B O     1 
ATOM   2331 C CB    . MET B 1 57  ? 11.667  52.091  -3.050  1.00 5.49  ? 164  MET B CB    1 
ATOM   2332 C CG    . MET B 1 57  ? 10.446  52.340  -3.921  1.00 5.81  ? 164  MET B CG    1 
ATOM   2333 S SD    . MET B 1 57  ? 9.283   50.979  -3.929  1.00 5.57  ? 164  MET B SD    1 
ATOM   2334 C CE    . MET B 1 57  ? 8.826   50.914  -2.243  1.00 7.40  ? 164  MET B CE    1 
ATOM   2335 N N     . ILE B 1 58  ? 12.409  55.432  -3.784  1.00 4.66  ? 165  ILE B N     1 
ATOM   2336 C CA    . ILE B 1 58  ? 11.984  56.802  -3.565  1.00 4.69  ? 165  ILE B CA    1 
ATOM   2337 C C     . ILE B 1 58  ? 10.545  56.954  -4.072  1.00 4.66  ? 165  ILE B C     1 
ATOM   2338 O O     . ILE B 1 58  ? 9.695   57.562  -3.419  1.00 4.41  ? 165  ILE B O     1 
ATOM   2339 C CB    . ILE B 1 58  ? 12.915  57.758  -4.321  1.00 4.89  ? 165  ILE B CB    1 
ATOM   2340 C CG1   . ILE B 1 58  ? 14.372  57.539  -3.879  1.00 4.78  ? 165  ILE B CG1   1 
ATOM   2341 C CG2   . ILE B 1 58  ? 12.486  59.202  -4.094  1.00 5.14  ? 165  ILE B CG2   1 
ATOM   2342 C CD1   . ILE B 1 58  ? 14.582  57.646  -2.378  1.00 5.64  ? 165  ILE B CD1   1 
ATOM   2343 N N     . GLU B 1 59  ? 10.286  56.392  -5.243  1.00 4.93  ? 166  GLU B N     1 
ATOM   2344 C CA    . GLU B 1 59  ? 8.942   56.418  -5.817  1.00 5.20  ? 166  GLU B CA    1 
ATOM   2345 C C     . GLU B 1 59  ? 8.711   55.184  -6.683  1.00 5.14  ? 166  GLU B C     1 
ATOM   2346 O O     . GLU B 1 59  ? 9.127   55.149  -7.844  1.00 5.35  ? 166  GLU B O     1 
ATOM   2347 C CB    . GLU B 1 59  ? 8.701   57.678  -6.655  1.00 5.63  ? 166  GLU B CB    1 
ATOM   2348 C CG    . GLU B 1 59  ? 7.237   57.821  -7.071  1.00 7.20  ? 166  GLU B CG    1 
ATOM   2349 C CD    . GLU B 1 59  ? 7.008   58.734  -8.265  1.00 10.01 ? 166  GLU B CD    1 
ATOM   2350 O OE1   . GLU B 1 59  ? 7.912   58.901  -9.109  1.00 12.06 ? 166  GLU B OE1   1 
ATOM   2351 O OE2   . GLU B 1 59  ? 5.887   59.263  -8.388  1.00 11.91 ? 166  GLU B OE2   1 
ATOM   2352 N N     . GLY B 1 60  ? 8.034   54.188  -6.117  1.00 4.67  ? 167  GLY B N     1 
ATOM   2353 C CA    . GLY B 1 60  ? 7.716   52.967  -6.826  1.00 4.55  ? 167  GLY B CA    1 
ATOM   2354 C C     . GLY B 1 60  ? 6.244   52.946  -7.240  1.00 4.38  ? 167  GLY B C     1 
ATOM   2355 O O     . GLY B 1 60  ? 5.372   53.339  -6.462  1.00 3.75  ? 167  GLY B O     1 
ATOM   2356 N N     . LYS B 1 61  ? 5.978   52.515  -8.472  1.00 4.37  ? 168  LYS B N     1 
ATOM   2357 C CA    . LYS B 1 61  ? 4.607   52.377  -8.979  1.00 4.54  ? 168  LYS B CA    1 
ATOM   2358 C C     . LYS B 1 61  ? 4.329   50.896  -9.287  1.00 4.48  ? 168  LYS B C     1 
ATOM   2359 O O     . LYS B 1 61  ? 5.193   50.192  -9.813  1.00 4.91  ? 168  LYS B O     1 
ATOM   2360 C CB    . LYS B 1 61  ? 4.401   53.230  -10.234 1.00 4.42  ? 168  LYS B CB    1 
ATOM   2361 C CG    . LYS B 1 61  ? 4.643   54.715  -10.022 1.00 5.00  ? 168  LYS B CG    1 
ATOM   2362 C CD    . LYS B 1 61  ? 4.398   55.524  -11.273 1.00 6.13  ? 168  LYS B CD    1 
ATOM   2363 C CE    . LYS B 1 61  ? 4.701   56.998  -11.048 1.00 6.98  ? 168  LYS B CE    1 
ATOM   2364 N NZ    . LYS B 1 61  ? 4.546   57.795  -12.300 1.00 7.29  ? 168  LYS B NZ    1 
ATOM   2365 N N     . LEU B 1 62  ? 3.143   50.416  -8.932  1.00 4.46  ? 169  LEU B N     1 
ATOM   2366 C CA    . LEU B 1 62  ? 2.796   49.022  -9.160  1.00 4.79  ? 169  LEU B CA    1 
ATOM   2367 C C     . LEU B 1 62  ? 2.931   48.679  -10.646 1.00 4.93  ? 169  LEU B C     1 
ATOM   2368 O O     . LEU B 1 62  ? 2.434   49.402  -11.507 1.00 4.99  ? 169  LEU B O     1 
ATOM   2369 C CB    . LEU B 1 62  ? 1.377   48.729  -8.686  1.00 4.91  ? 169  LEU B CB    1 
ATOM   2370 C CG    . LEU B 1 62  ? 0.968   47.249  -8.802  1.00 5.31  ? 169  LEU B CG    1 
ATOM   2371 C CD1   . LEU B 1 62  ? 1.885   46.358  -7.977  1.00 6.24  ? 169  LEU B CD1   1 
ATOM   2372 C CD2   . LEU B 1 62  ? -0.468  47.037  -8.376  1.00 4.97  ? 169  LEU B CD2   1 
ATOM   2373 N N     . ALA B 1 63  ? 3.591   47.564  -10.936 1.00 5.19  ? 170  ALA B N     1 
ATOM   2374 C CA    . ALA B 1 63  ? 3.840   47.154  -12.314 1.00 5.39  ? 170  ALA B CA    1 
ATOM   2375 C C     . ALA B 1 63  ? 3.922   45.637  -12.436 1.00 5.46  ? 170  ALA B C     1 
ATOM   2376 O O     . ALA B 1 63  ? 3.968   44.917  -11.431 1.00 5.68  ? 170  ALA B O     1 
ATOM   2377 C CB    . ALA B 1 63  ? 5.148   47.774  -12.799 1.00 5.71  ? 170  ALA B CB    1 
ATOM   2378 N N     . THR B 1 64  ? 3.972   45.164  -13.675 1.00 5.30  ? 171  THR B N     1 
ATOM   2379 C CA    . THR B 1 64  ? 4.121   43.747  -13.971 1.00 5.44  ? 171  THR B CA    1 
ATOM   2380 C C     . THR B 1 64  ? 5.247   43.580  -14.969 1.00 5.49  ? 171  THR B C     1 
ATOM   2381 O O     . THR B 1 64  ? 5.337   44.334  -15.949 1.00 5.20  ? 171  THR B O     1 
ATOM   2382 C CB    . THR B 1 64  ? 2.840   43.175  -14.624 1.00 5.49  ? 171  THR B CB    1 
ATOM   2383 O OG1   . THR B 1 64  ? 1.699   43.412  -13.789 1.00 5.97  ? 171  THR B OG1   1 
ATOM   2384 C CG2   . THR B 1 64  ? 2.902   41.659  -14.743 1.00 5.32  ? 171  THR B CG2   1 
ATOM   2385 N N     . LEU B 1 65  ? 6.072   42.571  -14.735 1.00 5.87  ? 172  LEU B N     1 
ATOM   2386 C CA    . LEU B 1 65  ? 7.165   42.221  -15.621 1.00 6.33  ? 172  LEU B CA    1 
ATOM   2387 C C     . LEU B 1 65  ? 6.560   41.426  -16.764 1.00 6.72  ? 172  LEU B C     1 
ATOM   2388 O O     . LEU B 1 65  ? 6.078   40.317  -16.563 1.00 6.98  ? 172  LEU B O     1 
ATOM   2389 C CB    . LEU B 1 65  ? 8.200   41.374  -14.870 1.00 5.88  ? 172  LEU B CB    1 
ATOM   2390 C CG    . LEU B 1 65  ? 9.344   40.795  -15.714 1.00 6.19  ? 172  LEU B CG    1 
ATOM   2391 C CD1   . LEU B 1 65  ? 10.184  41.904  -16.322 1.00 6.30  ? 172  LEU B CD1   1 
ATOM   2392 C CD2   . LEU B 1 65  ? 10.236  39.863  -14.909 1.00 6.61  ? 172  LEU B CD2   1 
ATOM   2393 N N     . MET B 1 66  ? 6.574   41.998  -17.960 1.00 7.38  ? 173  MET B N     1 
ATOM   2394 C CA    . MET B 1 66  ? 5.925   41.379  -19.121 1.00 8.00  ? 173  MET B CA    1 
ATOM   2395 C C     . MET B 1 66  ? 6.828   40.396  -19.854 1.00 8.28  ? 173  MET B C     1 
ATOM   2396 O O     . MET B 1 66  ? 6.360   39.362  -20.350 1.00 8.32  ? 173  MET B O     1 
ATOM   2397 C CB    . MET B 1 66  ? 5.500   42.455  -20.106 1.00 8.16  ? 173  MET B CB    1 
ATOM   2398 C CG    . MET B 1 66  ? 4.607   43.543  -19.535 1.00 9.26  ? 173  MET B CG    1 
ATOM   2399 S SD    . MET B 1 66  ? 3.278   42.984  -18.439 1.00 11.83 ? 173  MET B SD    1 
ATOM   2400 C CE    . MET B 1 66  ? 2.331   42.091  -19.318 1.00 13.86 ? 173  MET B CE    1 
ATOM   2401 N N     . SER B 1 67  ? 8.111   40.743  -19.951 1.00 7.93  ? 174  SER B N     1 
ATOM   2402 C CA    . SER B 1 67  ? 9.081   39.954  -20.691 1.00 8.17  ? 174  SER B CA    1 
ATOM   2403 C C     . SER B 1 67  ? 10.490  40.454  -20.379 1.00 8.46  ? 174  SER B C     1 
ATOM   2404 O O     . SER B 1 67  ? 10.657  41.473  -19.711 1.00 7.88  ? 174  SER B O     1 
ATOM   2405 C CB    . SER B 1 67  ? 8.846   40.089  -22.194 1.00 8.70  ? 174  SER B CB    1 
ATOM   2406 O OG    . SER B 1 67  ? 9.009   41.434  -22.627 1.00 8.23  ? 174  SER B OG    1 
ATOM   2407 N N     . THR B 1 68  ? 11.486  39.750  -20.907 1.00 8.81  ? 175  THR B N     1 
ATOM   2408 C CA    . THR B 1 68  ? 12.886  40.110  -20.713 1.00 9.44  ? 175  THR B CA    1 
ATOM   2409 C C     . THR B 1 68  ? 13.661  39.886  -21.998 1.00 9.56  ? 175  THR B C     1 
ATOM   2410 O O     . THR B 1 68  ? 13.403  38.925  -22.723 1.00 9.67  ? 175  THR B O     1 
ATOM   2411 C CB    . THR B 1 68  ? 13.492  39.250  -19.618 1.00 9.54  ? 175  THR B CB    1 
ATOM   2412 O OG1   . THR B 1 68  ? 12.667  39.322  -18.446 1.00 10.84 ? 175  THR B OG1   1 
ATOM   2413 C CG2   . THR B 1 68  ? 14.845  39.792  -19.180 1.00 10.10 ? 175  THR B CG2   1 
ATOM   2414 N N     . GLU B 1 69  ? 14.617  40.770  -22.268 1.00 9.82  ? 176  GLU B N     1 
ATOM   2415 C CA    . GLU B 1 69  ? 15.428  40.693  -23.475 1.00 10.34 ? 176  GLU B CA    1 
ATOM   2416 C C     . GLU B 1 69  ? 16.893  40.841  -23.155 1.00 10.19 ? 176  GLU B C     1 
ATOM   2417 O O     . GLU B 1 69  ? 17.333  41.932  -22.810 1.00 10.13 ? 176  GLU B O     1 
ATOM   2418 C CB    . GLU B 1 69  ? 15.030  41.796  -24.458 1.00 10.83 ? 176  GLU B CB    1 
ATOM   2419 C CG    . GLU B 1 69  ? 14.181  41.298  -25.601 1.00 12.40 ? 176  GLU B CG    1 
ATOM   2420 C CD    . GLU B 1 69  ? 14.791  40.096  -26.288 1.00 14.45 ? 176  GLU B CD    1 
ATOM   2421 O OE1   . GLU B 1 69  ? 15.552  40.287  -27.266 1.00 15.88 ? 176  GLU B OE1   1 
ATOM   2422 O OE2   . GLU B 1 69  ? 14.505  38.961  -25.848 1.00 15.29 ? 176  GLU B OE2   1 
ATOM   2423 N N     . GLU B 1 70  ? 17.645  39.749  -23.280 1.00 10.17 ? 177  GLU B N     1 
ATOM   2424 C CA    . GLU B 1 70  ? 19.071  39.758  -22.976 1.00 10.17 ? 177  GLU B CA    1 
ATOM   2425 C C     . GLU B 1 70  ? 19.297  40.372  -21.593 1.00 9.98  ? 177  GLU B C     1 
ATOM   2426 O O     . GLU B 1 70  ? 20.211  41.170  -21.390 1.00 10.37 ? 177  GLU B O     1 
ATOM   2427 C CB    . GLU B 1 70  ? 19.858  40.509  -24.057 1.00 10.15 ? 177  GLU B CB    1 
ATOM   2428 C CG    . GLU B 1 70  ? 20.087  39.688  -25.317 1.00 10.89 ? 177  GLU B CG    1 
ATOM   2429 C CD    . GLU B 1 70  ? 21.149  40.280  -26.231 1.00 11.61 ? 177  GLU B CD    1 
ATOM   2430 O OE1   . GLU B 1 70  ? 21.674  41.373  -25.920 1.00 12.50 ? 177  GLU B OE1   1 
ATOM   2431 O OE2   . GLU B 1 70  ? 21.469  39.647  -27.257 1.00 11.65 ? 177  GLU B OE2   1 
ATOM   2432 N N     . GLY B 1 71  ? 18.448  39.995  -20.641 1.00 9.75  ? 178  GLY B N     1 
ATOM   2433 C CA    . GLY B 1 71  ? 18.556  40.493  -19.276 1.00 9.46  ? 178  GLY B CA    1 
ATOM   2434 C C     . GLY B 1 71  ? 17.771  41.776  -19.036 1.00 9.34  ? 178  GLY B C     1 
ATOM   2435 O O     . GLY B 1 71  ? 17.494  42.132  -17.901 1.00 8.64  ? 178  GLY B O     1 
ATOM   2436 N N     . ARG B 1 72  ? 17.386  42.463  -20.107 1.00 9.52  ? 179  ARG B N     1 
ATOM   2437 C CA    . ARG B 1 72  ? 16.683  43.740  -19.996 1.00 10.09 ? 179  ARG B CA    1 
ATOM   2438 C C     . ARG B 1 72  ? 15.167  43.554  -19.905 1.00 9.82  ? 179  ARG B C     1 
ATOM   2439 O O     . ARG B 1 72  ? 14.502  43.254  -20.892 1.00 9.66  ? 179  ARG B O     1 
ATOM   2440 C CB    . ARG B 1 72  ? 17.003  44.633  -21.194 1.00 10.49 ? 179  ARG B CB    1 
ATOM   2441 C CG    . ARG B 1 72  ? 18.424  44.507  -21.708 1.00 12.39 ? 179  ARG B CG    1 
ATOM   2442 C CD    . ARG B 1 72  ? 18.607  45.239  -23.022 1.00 14.73 ? 179  ARG B CD    1 
ATOM   2443 N NE    . ARG B 1 72  ? 19.770  44.776  -23.769 1.00 16.87 ? 179  ARG B NE    1 
ATOM   2444 C CZ    . ARG B 1 72  ? 20.709  45.577  -24.255 1.00 18.75 ? 179  ARG B CZ    1 
ATOM   2445 N NH1   . ARG B 1 72  ? 20.623  46.892  -24.075 1.00 19.57 ? 179  ARG B NH1   1 
ATOM   2446 N NH2   . ARG B 1 72  ? 21.736  45.068  -24.923 1.00 19.26 ? 179  ARG B NH2   1 
ATOM   2447 N N     . PRO B 1 73  ? 14.635  43.744  -18.706 1.00 9.66  ? 180  PRO B N     1 
ATOM   2448 C CA    . PRO B 1 73  ? 13.208  43.648  -18.405 1.00 9.48  ? 180  PRO B CA    1 
ATOM   2449 C C     . PRO B 1 73  ? 12.360  44.751  -19.032 1.00 9.57  ? 180  PRO B C     1 
ATOM   2450 O O     . PRO B 1 73  ? 12.855  45.829  -19.368 1.00 9.13  ? 180  PRO B O     1 
ATOM   2451 C CB    . PRO B 1 73  ? 13.152  43.810  -16.879 1.00 9.76  ? 180  PRO B CB    1 
ATOM   2452 C CG    . PRO B 1 73  ? 14.507  44.025  -16.417 1.00 9.89  ? 180  PRO B CG    1 
ATOM   2453 C CD    . PRO B 1 73  ? 15.432  44.059  -17.522 1.00 9.66  ? 180  PRO B CD    1 
ATOM   2454 N N     . HIS B 1 74  ? 11.074  44.448  -19.185 1.00 9.17  ? 181  HIS B N     1 
ATOM   2455 C CA    . HIS B 1 74  ? 10.100  45.392  -19.688 1.00 9.05  ? 181  HIS B CA    1 
ATOM   2456 C C     . HIS B 1 74  ? 8.876   45.322  -18.803 1.00 8.32  ? 181  HIS B C     1 
ATOM   2457 O O     . HIS B 1 74  ? 8.184   44.312  -18.780 1.00 8.40  ? 181  HIS B O     1 
ATOM   2458 C CB    . HIS B 1 74  ? 9.704   45.066  -21.121 1.00 9.47  ? 181  HIS B CB    1 
ATOM   2459 C CG    . HIS B 1 74  ? 8.462   45.772  -21.567 1.00 10.74 ? 181  HIS B CG    1 
ATOM   2460 N ND1   . HIS B 1 74  ? 8.440   47.116  -21.871 1.00 11.69 ? 181  HIS B ND1   1 
ATOM   2461 C CD2   . HIS B 1 74  ? 7.198   45.324  -21.753 1.00 11.78 ? 181  HIS B CD2   1 
ATOM   2462 C CE1   . HIS B 1 74  ? 7.216   47.464  -22.227 1.00 11.53 ? 181  HIS B CE1   1 
ATOM   2463 N NE2   . HIS B 1 74  ? 6.443   46.395  -22.159 1.00 10.85 ? 181  HIS B NE2   1 
ATOM   2464 N N     . PHE B 1 75  ? 8.624   46.395  -18.069 1.00 8.18  ? 182  PHE B N     1 
ATOM   2465 C CA    . PHE B 1 75  ? 7.503   46.456  -17.144 1.00 8.54  ? 182  PHE B CA    1 
ATOM   2466 C C     . PHE B 1 75  ? 6.354   47.250  -17.729 1.00 8.64  ? 182  PHE B C     1 
ATOM   2467 O O     . PHE B 1 75  ? 6.569   48.165  -18.515 1.00 8.56  ? 182  PHE B O     1 
ATOM   2468 C CB    . PHE B 1 75  ? 7.919   47.140  -15.839 1.00 8.44  ? 182  PHE B CB    1 
ATOM   2469 C CG    . PHE B 1 75  ? 8.996   46.414  -15.082 1.00 8.90  ? 182  PHE B CG    1 
ATOM   2470 C CD1   . PHE B 1 75  ? 10.319  46.799  -15.205 1.00 8.90  ? 182  PHE B CD1   1 
ATOM   2471 C CD2   . PHE B 1 75  ? 8.685   45.365  -14.233 1.00 8.93  ? 182  PHE B CD2   1 
ATOM   2472 C CE1   . PHE B 1 75  ? 11.309  46.141  -14.513 1.00 9.15  ? 182  PHE B CE1   1 
ATOM   2473 C CE2   . PHE B 1 75  ? 9.684   44.708  -13.521 1.00 9.35  ? 182  PHE B CE2   1 
ATOM   2474 C CZ    . PHE B 1 75  ? 10.993  45.096  -13.672 1.00 9.15  ? 182  PHE B CZ    1 
ATOM   2475 N N     . GLU B 1 76  ? 5.146   46.892  -17.304 1.00 8.96  ? 183  GLU B N     1 
ATOM   2476 C CA    . GLU B 1 76  ? 3.931   47.603  -17.641 1.00 9.58  ? 183  GLU B CA    1 
ATOM   2477 C C     . GLU B 1 76  ? 3.253   48.028  -16.343 1.00 9.52  ? 183  GLU B C     1 
ATOM   2478 O O     . GLU B 1 76  ? 2.924   47.190  -15.505 1.00 8.96  ? 183  GLU B O     1 
ATOM   2479 C CB    . GLU B 1 76  ? 2.999   46.726  -18.467 1.00 9.74  ? 183  GLU B CB    1 
ATOM   2480 C CG    . GLU B 1 76  ? 3.054   47.061  -19.938 1.00 11.19 ? 183  GLU B CG    1 
ATOM   2481 C CD    . GLU B 1 76  ? 2.197   46.150  -20.776 1.00 12.96 ? 183  GLU B CD    1 
ATOM   2482 O OE1   . GLU B 1 76  ? 1.088   45.805  -20.325 1.00 14.49 ? 183  GLU B OE1   1 
ATOM   2483 O OE2   . GLU B 1 76  ? 2.647   45.786  -21.877 1.00 14.21 ? 183  GLU B OE2   1 
ATOM   2484 N N     . LEU B 1 77  ? 3.046   49.332  -16.192 1.00 9.83  ? 184  LEU B N     1 
ATOM   2485 C CA    . LEU B 1 77  ? 2.425   49.889  -14.996 1.00 10.11 ? 184  LEU B CA    1 
ATOM   2486 C C     . LEU B 1 77  ? 0.952   49.524  -14.874 1.00 9.95  ? 184  LEU B C     1 
ATOM   2487 O O     . LEU B 1 77  ? 0.195   49.534  -15.867 1.00 9.58  ? 184  LEU B O     1 
ATOM   2488 C CB    . LEU B 1 77  ? 2.580   51.415  -14.985 1.00 10.64 ? 184  LEU B CB    1 
ATOM   2489 C CG    . LEU B 1 77  ? 4.007   51.906  -14.668 1.00 11.60 ? 184  LEU B CG    1 
ATOM   2490 C CD1   . LEU B 1 77  ? 4.142   53.401  -14.902 1.00 13.02 ? 184  LEU B CD1   1 
ATOM   2491 C CD2   . LEU B 1 77  ? 4.402   51.580  -13.257 1.00 12.32 ? 184  LEU B CD2   1 
ATOM   2492 N N     . MET B 1 78  ? 0.548   49.202  -13.649 1.00 9.70  ? 185  MET B N     1 
ATOM   2493 C CA    . MET B 1 78  ? -0.846  48.928  -13.345 1.00 10.47 ? 185  MET B CA    1 
ATOM   2494 C C     . MET B 1 78  ? -1.575  50.273  -13.208 1.00 10.07 ? 185  MET B C     1 
ATOM   2495 O O     . MET B 1 78  ? -0.991  51.275  -12.830 1.00 9.78  ? 185  MET B O     1 
ATOM   2496 C CB    . MET B 1 78  ? -0.982  48.117  -12.062 1.00 10.97 ? 185  MET B CB    1 
ATOM   2497 C CG    . MET B 1 78  ? -0.363  46.726  -12.134 1.00 13.52 ? 185  MET B CG    1 
ATOM   2498 S SD    . MET B 1 78  ? -1.105  45.683  -13.392 1.00 17.68 ? 185  MET B SD    1 
ATOM   2499 C CE    . MET B 1 78  ? -2.710  45.274  -12.701 1.00 17.53 ? 185  MET B CE    1 
ATOM   2500 N N     . PRO B 1 79  ? -2.852  50.306  -13.525 1.00 10.33 ? 186  PRO B N     1 
ATOM   2501 C CA    . PRO B 1 79  ? -3.620  51.547  -13.429 1.00 10.17 ? 186  PRO B CA    1 
ATOM   2502 C C     . PRO B 1 79  ? -3.606  52.103  -12.016 1.00 9.95  ? 186  PRO B C     1 
ATOM   2503 O O     . PRO B 1 79  ? -3.211  51.392  -11.081 1.00 10.99 ? 186  PRO B O     1 
ATOM   2504 C CB    . PRO B 1 79  ? -5.036  51.123  -13.813 1.00 10.50 ? 186  PRO B CB    1 
ATOM   2505 C CG    . PRO B 1 79  ? -4.952  49.733  -14.318 1.00 10.74 ? 186  PRO B CG    1 
ATOM   2506 C CD    . PRO B 1 79  ? -3.647  49.175  -14.007 1.00 10.34 ? 186  PRO B CD    1 
ATOM   2507 N N     . GLY B 1 80  ? -3.986  53.365  -11.857 1.00 9.22  ? 187  GLY B N     1 
ATOM   2508 C CA    . GLY B 1 80  ? -4.012  53.985  -10.542 1.00 8.79  ? 187  GLY B CA    1 
ATOM   2509 C C     . GLY B 1 80  ? -2.876  54.968  -10.288 1.00 8.04  ? 187  GLY B C     1 
ATOM   2510 O O     . GLY B 1 80  ? -1.878  55.012  -11.013 1.00 7.32  ? 187  GLY B O     1 
ATOM   2511 N N     . ASN B 1 81  ? -3.050  55.761  -9.240  1.00 7.42  ? 188  ASN B N     1 
ATOM   2512 C CA    . ASN B 1 81  ? -2.110  56.818  -8.892  1.00 7.27  ? 188  ASN B CA    1 
ATOM   2513 C C     . ASN B 1 81  ? -1.323  56.523  -7.632  1.00 6.69  ? 188  ASN B C     1 
ATOM   2514 O O     . ASN B 1 81  ? -0.599  57.387  -7.133  1.00 6.71  ? 188  ASN B O     1 
ATOM   2515 C CB    . ASN B 1 81  ? -2.874  58.123  -8.705  1.00 7.36  ? 188  ASN B CB    1 
ATOM   2516 C CG    . ASN B 1 81  ? -3.404  58.659  -10.004 1.00 8.10  ? 188  ASN B CG    1 
ATOM   2517 O OD1   . ASN B 1 81  ? -2.649  58.840  -10.954 1.00 9.28  ? 188  ASN B OD1   1 
ATOM   2518 N ND2   . ASN B 1 81  ? -4.710  58.903  -10.064 1.00 8.87  ? 188  ASN B ND2   1 
ATOM   2519 N N     . SER B 1 82  ? -1.454  55.306  -7.119  1.00 6.09  ? 189  SER B N     1 
ATOM   2520 C CA    . SER B 1 82  ? -0.744  54.931  -5.899  1.00 5.71  ? 189  SER B CA    1 
ATOM   2521 C C     . SER B 1 82  ? 0.770   54.849  -6.107  1.00 5.09  ? 189  SER B C     1 
ATOM   2522 O O     . SER B 1 82  ? 1.249   54.419  -7.154  1.00 4.53  ? 189  SER B O     1 
ATOM   2523 C CB    . SER B 1 82  ? -1.273  53.599  -5.370  1.00 5.88  ? 189  SER B CB    1 
ATOM   2524 O OG    . SER B 1 82  ? -2.609  53.738  -4.921  1.00 6.53  ? 189  SER B OG    1 
ATOM   2525 N N     . VAL B 1 83  ? 1.522   55.277  -5.098  1.00 4.78  ? 190  VAL B N     1 
ATOM   2526 C CA    . VAL B 1 83  ? 2.976   55.190  -5.139  1.00 4.42  ? 190  VAL B CA    1 
ATOM   2527 C C     . VAL B 1 83  ? 3.436   54.606  -3.816  1.00 4.28  ? 190  VAL B C     1 
ATOM   2528 O O     . VAL B 1 83  ? 2.723   54.691  -2.811  1.00 4.45  ? 190  VAL B O     1 
ATOM   2529 C CB    . VAL B 1 83  ? 3.659   56.555  -5.349  1.00 4.34  ? 190  VAL B CB    1 
ATOM   2530 C CG1   . VAL B 1 83  ? 3.337   57.117  -6.716  1.00 4.64  ? 190  VAL B CG1   1 
ATOM   2531 C CG2   . VAL B 1 83  ? 3.267   57.528  -4.251  1.00 4.76  ? 190  VAL B CG2   1 
ATOM   2532 N N     . TYR B 1 84  ? 4.636   54.039  -3.815  1.00 4.08  ? 191  TYR B N     1 
ATOM   2533 C CA    . TYR B 1 84  ? 5.207   53.431  -2.614  1.00 3.66  ? 191  TYR B CA    1 
ATOM   2534 C C     . TYR B 1 84  ? 6.638   53.923  -2.430  1.00 3.82  ? 191  TYR B C     1 
ATOM   2535 O O     . TYR B 1 84  ? 7.352   54.152  -3.400  1.00 4.29  ? 191  TYR B O     1 
ATOM   2536 C CB    . TYR B 1 84  ? 5.194   51.906  -2.728  1.00 3.31  ? 191  TYR B CB    1 
ATOM   2537 C CG    . TYR B 1 84  ? 3.851   51.348  -3.122  1.00 3.99  ? 191  TYR B CG    1 
ATOM   2538 C CD1   . TYR B 1 84  ? 3.472   51.319  -4.450  1.00 3.46  ? 191  TYR B CD1   1 
ATOM   2539 C CD2   . TYR B 1 84  ? 2.954   50.878  -2.171  1.00 4.00  ? 191  TYR B CD2   1 
ATOM   2540 C CE1   . TYR B 1 84  ? 2.228   50.827  -4.837  1.00 4.51  ? 191  TYR B CE1   1 
ATOM   2541 C CE2   . TYR B 1 84  ? 1.707   50.382  -2.547  1.00 4.24  ? 191  TYR B CE2   1 
ATOM   2542 C CZ    . TYR B 1 84  ? 1.356   50.359  -3.884  1.00 4.39  ? 191  TYR B CZ    1 
ATOM   2543 O OH    . TYR B 1 84  ? 0.129   49.880  -4.286  1.00 4.41  ? 191  TYR B OH    1 
ATOM   2544 N N     . HIS B 1 85  ? 7.062   54.080  -1.182  1.00 3.72  ? 192  HIS B N     1 
ATOM   2545 C CA    . HIS B 1 85  ? 8.429   54.497  -0.907  1.00 3.68  ? 192  HIS B CA    1 
ATOM   2546 C C     . HIS B 1 85  ? 8.969   53.789  0.329   1.00 3.47  ? 192  HIS B C     1 
ATOM   2547 O O     . HIS B 1 85  ? 8.208   53.227  1.123   1.00 3.14  ? 192  HIS B O     1 
ATOM   2548 C CB    . HIS B 1 85  ? 8.517   56.014  -0.724  1.00 4.08  ? 192  HIS B CB    1 
ATOM   2549 C CG    . HIS B 1 85  ? 7.711   56.542  0.419   1.00 4.93  ? 192  HIS B CG    1 
ATOM   2550 N ND1   . HIS B 1 85  ? 6.383   56.893  0.295   1.00 6.43  ? 192  HIS B ND1   1 
ATOM   2551 C CD2   . HIS B 1 85  ? 8.051   56.810  1.701   1.00 5.47  ? 192  HIS B CD2   1 
ATOM   2552 C CE1   . HIS B 1 85  ? 5.939   57.341  1.457   1.00 6.03  ? 192  HIS B CE1   1 
ATOM   2553 N NE2   . HIS B 1 85  ? 6.931   57.302  2.324   1.00 5.83  ? 192  HIS B NE2   1 
ATOM   2554 N N     . PHE B 1 86  ? 10.292  53.785  0.450   1.00 2.79  ? 193  PHE B N     1 
ATOM   2555 C CA    . PHE B 1 86  ? 10.950  53.229  1.622   1.00 3.15  ? 193  PHE B CA    1 
ATOM   2556 C C     . PHE B 1 86  ? 10.417  54.010  2.815   1.00 3.22  ? 193  PHE B C     1 
ATOM   2557 O O     . PHE B 1 86  ? 10.514  55.240  2.847   1.00 3.43  ? 193  PHE B O     1 
ATOM   2558 C CB    . PHE B 1 86  ? 12.458  53.398  1.493   1.00 3.04  ? 193  PHE B CB    1 
ATOM   2559 C CG    . PHE B 1 86  ? 13.237  52.815  2.630   1.00 3.24  ? 193  PHE B CG    1 
ATOM   2560 C CD1   . PHE B 1 86  ? 13.200  51.458  2.888   1.00 3.20  ? 193  PHE B CD1   1 
ATOM   2561 C CD2   . PHE B 1 86  ? 14.006  53.629  3.436   1.00 3.61  ? 193  PHE B CD2   1 
ATOM   2562 C CE1   . PHE B 1 86  ? 13.925  50.919  3.944   1.00 3.59  ? 193  PHE B CE1   1 
ATOM   2563 C CE2   . PHE B 1 86  ? 14.739  53.100  4.483   1.00 4.19  ? 193  PHE B CE2   1 
ATOM   2564 C CZ    . PHE B 1 86  ? 14.696  51.741  4.737   1.00 4.40  ? 193  PHE B CZ    1 
ATOM   2565 N N     . ASP B 1 87  ? 9.881   53.297  3.800   1.00 3.02  ? 194  ASP B N     1 
ATOM   2566 C CA    . ASP B 1 87  ? 9.187   53.927  4.912   1.00 3.13  ? 194  ASP B CA    1 
ATOM   2567 C C     . ASP B 1 87  ? 9.340   53.061  6.153   1.00 3.11  ? 194  ASP B C     1 
ATOM   2568 O O     . ASP B 1 87  ? 8.368   52.565  6.707   1.00 2.86  ? 194  ASP B O     1 
ATOM   2569 C CB    . ASP B 1 87  ? 7.706   54.058  4.538   1.00 3.05  ? 194  ASP B CB    1 
ATOM   2570 C CG    . ASP B 1 87  ? 6.876   54.753  5.596   1.00 3.60  ? 194  ASP B CG    1 
ATOM   2571 O OD1   . ASP B 1 87  ? 5.691   54.366  5.744   1.00 3.80  ? 194  ASP B OD1   1 
ATOM   2572 O OD2   . ASP B 1 87  ? 7.299   55.695  6.310   1.00 3.33  ? 194  ASP B OD2   1 
ATOM   2573 N N     . LYS B 1 88  ? 10.581  52.861  6.568   1.00 3.72  ? 195  LYS B N     1 
ATOM   2574 C CA    . LYS B 1 88  ? 10.866  52.041  7.732   1.00 4.10  ? 195  LYS B CA    1 
ATOM   2575 C C     . LYS B 1 88  ? 10.143  52.566  8.968   1.00 4.32  ? 195  LYS B C     1 
ATOM   2576 O O     . LYS B 1 88  ? 10.111  53.766  9.223   1.00 4.84  ? 195  LYS B O     1 
ATOM   2577 C CB    . LYS B 1 88  ? 12.371  52.040  7.987   1.00 4.44  ? 195  LYS B CB    1 
ATOM   2578 C CG    . LYS B 1 88  ? 12.824  50.969  8.947   1.00 5.53  ? 195  LYS B CG    1 
ATOM   2579 C CD    . LYS B 1 88  ? 14.345  50.935  9.017   1.00 7.54  ? 195  LYS B CD    1 
ATOM   2580 C CE    . LYS B 1 88  ? 14.844  49.892  9.984   1.00 8.49  ? 195  LYS B CE    1 
ATOM   2581 N NZ    . LYS B 1 88  ? 16.325  49.845  9.990   1.00 10.55 ? 195  LYS B NZ    1 
ATOM   2582 N N     . SER B 1 89  ? 9.579   51.661  9.751   1.00 4.13  ? 196  SER B N     1 
ATOM   2583 C CA    . SER B 1 89  ? 8.882   52.054  10.962  1.00 4.28  ? 196  SER B CA    1 
ATOM   2584 C C     . SER B 1 89  ? 9.868   52.522  12.037  1.00 4.26  ? 196  SER B C     1 
ATOM   2585 O O     . SER B 1 89  ? 11.070  52.261  11.935  1.00 3.62  ? 196  SER B O     1 
ATOM   2586 C CB    . SER B 1 89  ? 8.085   50.871  11.500  1.00 4.54  ? 196  SER B CB    1 
ATOM   2587 O OG    . SER B 1 89  ? 8.964   49.862  11.982  1.00 4.18  ? 196  SER B OG    1 
ATOM   2588 N N     . THR B 1 90  ? 9.348   53.233  13.038  1.00 4.40  ? 197  THR B N     1 
ATOM   2589 C CA    . THR B 1 90  ? 10.119  53.629  14.205  1.00 5.03  ? 197  THR B CA    1 
ATOM   2590 C C     . THR B 1 90  ? 9.497   52.913  15.413  1.00 4.99  ? 197  THR B C     1 
ATOM   2591 O O     . THR B 1 90  ? 8.680   52.018  15.254  1.00 4.27  ? 197  THR B O     1 
ATOM   2592 C CB    . THR B 1 90  ? 10.113  55.158  14.422  1.00 5.11  ? 197  THR B CB    1 
ATOM   2593 O OG1   . THR B 1 90  ? 8.806   55.590  14.836  1.00 4.52  ? 197  THR B OG1   1 
ATOM   2594 C CG2   . THR B 1 90  ? 10.382  55.905  13.130  1.00 6.36  ? 197  THR B CG2   1 
ATOM   2595 N N     . SER B 1 91  ? 9.886   53.288  16.627  1.00 5.28  ? 198  SER B N     1 
ATOM   2596 C CA    . SER B 1 91  ? 9.289   52.656  17.801  1.00 5.60  ? 198  SER B CA    1 
ATOM   2597 C C     . SER B 1 91  ? 7.825   53.100  17.995  1.00 6.08  ? 198  SER B C     1 
ATOM   2598 O O     . SER B 1 91  ? 7.062   52.420  18.679  1.00 6.46  ? 198  SER B O     1 
ATOM   2599 C CB    . SER B 1 91  ? 10.100  52.958  19.063  1.00 5.76  ? 198  SER B CB    1 
ATOM   2600 O OG    . SER B 1 91  ? 9.926   54.303  19.448  1.00 6.41  ? 198  SER B OG    1 
ATOM   2601 N N     . SER B 1 92  ? 7.438   54.223  17.390  1.00 6.10  ? 199  SER B N     1 
ATOM   2602 C CA    . SER B 1 92  ? 6.098   54.790  17.585  1.00 6.77  ? 199  SER B CA    1 
ATOM   2603 C C     . SER B 1 92  ? 5.288   54.949  16.286  1.00 6.55  ? 199  SER B C     1 
ATOM   2604 O O     . SER B 1 92  ? 4.059   55.066  16.315  1.00 7.07  ? 199  SER B O     1 
ATOM   2605 C CB    . SER B 1 92  ? 6.209   56.146  18.291  1.00 7.09  ? 199  SER B CB    1 
ATOM   2606 O OG    . SER B 1 92  ? 6.801   57.120  17.447  1.00 7.95  ? 199  SER B OG    1 
ATOM   2607 N N     . CYS B 1 93  ? 5.973   54.960  15.151  1.00 6.17  ? 200  CYS B N     1 
ATOM   2608 C CA    . CYS B 1 93  ? 5.302   55.114  13.867  1.00 5.94  ? 200  CYS B CA    1 
ATOM   2609 C C     . CYS B 1 93  ? 5.376   53.815  13.072  1.00 5.42  ? 200  CYS B C     1 
ATOM   2610 O O     . CYS B 1 93  ? 6.453   53.428  12.620  1.00 5.15  ? 200  CYS B O     1 
ATOM   2611 C CB    . CYS B 1 93  ? 5.920   56.258  13.063  1.00 5.94  ? 200  CYS B CB    1 
ATOM   2612 S SG    . CYS B 1 93  ? 5.029   56.559  11.500  1.00 7.04  ? 200  CYS B SG    1 
ATOM   2613 N N     . ILE B 1 94  ? 4.235   53.144  12.912  1.00 5.11  ? 201  ILE B N     1 
ATOM   2614 C CA    . ILE B 1 94  ? 4.188   51.878  12.186  1.00 4.91  ? 201  ILE B CA    1 
ATOM   2615 C C     . ILE B 1 94  ? 4.323   52.084  10.680  1.00 4.63  ? 201  ILE B C     1 
ATOM   2616 O O     . ILE B 1 94  ? 4.869   51.236  9.982   1.00 4.08  ? 201  ILE B O     1 
ATOM   2617 C CB    . ILE B 1 94  ? 2.895   51.098  12.506  1.00 5.04  ? 201  ILE B CB    1 
ATOM   2618 C CG1   . ILE B 1 94  ? 3.028   49.647  12.054  1.00 5.85  ? 201  ILE B CG1   1 
ATOM   2619 C CG2   . ILE B 1 94  ? 1.682   51.757  11.879  1.00 4.82  ? 201  ILE B CG2   1 
ATOM   2620 C CD1   . ILE B 1 94  ? 1.983   48.735  12.668  1.00 6.56  ? 201  ILE B CD1   1 
ATOM   2621 N N     . SER B 1 95  ? 3.840   53.223  10.192  1.00 4.76  ? 202  SER B N     1 
ATOM   2622 C CA    . SER B 1 95  ? 3.868   53.519  8.765   1.00 4.49  ? 202  SER B CA    1 
ATOM   2623 C C     . SER B 1 95  ? 3.384   54.944  8.520   1.00 4.67  ? 202  SER B C     1 
ATOM   2624 O O     . SER B 1 95  ? 2.599   55.473  9.302   1.00 4.85  ? 202  SER B O     1 
ATOM   2625 C CB    . SER B 1 95  ? 2.972   52.524  8.020   1.00 4.64  ? 202  SER B CB    1 
ATOM   2626 O OG    . SER B 1 95  ? 2.742   52.891  6.664   1.00 3.45  ? 202  SER B OG    1 
ATOM   2627 N N     . THR B 1 96  ? 3.856   55.569  7.444   1.00 4.84  ? 203  THR B N     1 
ATOM   2628 C CA    . THR B 1 96  ? 3.372   56.893  7.061   1.00 5.29  ? 203  THR B CA    1 
ATOM   2629 C C     . THR B 1 96  ? 2.029   56.755  6.354   1.00 5.17  ? 203  THR B C     1 
ATOM   2630 O O     . THR B 1 96  ? 1.219   57.680  6.355   1.00 5.35  ? 203  THR B O     1 
ATOM   2631 C CB    . THR B 1 96  ? 4.352   57.585  6.113   1.00 5.60  ? 203  THR B CB    1 
ATOM   2632 O OG1   . THR B 1 96  ? 5.635   57.696  6.727   1.00 7.98  ? 203  THR B OG1   1 
ATOM   2633 C CG2   . THR B 1 96  ? 3.946   59.032  5.874   1.00 6.73  ? 203  THR B CG2   1 
ATOM   2634 N N     . ASN B 1 97  ? 1.815   55.605  5.723   1.00 4.69  ? 204  ASN B N     1 
ATOM   2635 C CA    . ASN B 1 97  ? 0.572   55.325  5.012   1.00 4.31  ? 204  ASN B CA    1 
ATOM   2636 C C     . ASN B 1 97  ? -0.051  54.044  5.554   1.00 3.45  ? 204  ASN B C     1 
ATOM   2637 O O     . ASN B 1 97  ? -0.139  53.043  4.849   1.00 3.29  ? 204  ASN B O     1 
ATOM   2638 C CB    . ASN B 1 97  ? 0.832   55.188  3.514   1.00 4.74  ? 204  ASN B CB    1 
ATOM   2639 C CG    . ASN B 1 97  ? 1.619   56.356  2.947   1.00 5.93  ? 204  ASN B CG    1 
ATOM   2640 O OD1   . ASN B 1 97  ? 1.046   57.344  2.491   1.00 9.47  ? 204  ASN B OD1   1 
ATOM   2641 N ND2   . ASN B 1 97  ? 2.933   56.236  2.950   1.00 6.34  ? 204  ASN B ND2   1 
ATOM   2642 N N     . ALA B 1 98  ? -0.487  54.087  6.810   1.00 2.52  ? 205  ALA B N     1 
ATOM   2643 C CA    . ALA B 1 98  ? -1.038  52.916  7.488   1.00 2.28  ? 205  ALA B CA    1 
ATOM   2644 C C     . ALA B 1 98  ? -2.186  52.245  6.728   1.00 2.44  ? 205  ALA B C     1 
ATOM   2645 O O     . ALA B 1 98  ? -2.343  51.033  6.812   1.00 2.36  ? 205  ALA B O     1 
ATOM   2646 C CB    . ALA B 1 98  ? -1.494  53.290  8.885   1.00 2.12  ? 205  ALA B CB    1 
ATOM   2647 N N     . LEU B 1 99  ? -2.968  53.023  5.984   1.00 2.61  ? 206  LEU B N     1 
ATOM   2648 C CA    . LEU B 1 99  ? -4.140  52.484  5.293   1.00 3.26  ? 206  LEU B CA    1 
ATOM   2649 C C     . LEU B 1 99  ? -3.897  52.091  3.836   1.00 3.09  ? 206  LEU B C     1 
ATOM   2650 O O     . LEU B 1 99  ? -4.836  51.675  3.152   1.00 2.82  ? 206  LEU B O     1 
ATOM   2651 C CB    . LEU B 1 99  ? -5.307  53.464  5.376   1.00 3.73  ? 206  LEU B CB    1 
ATOM   2652 C CG    . LEU B 1 99  ? -5.737  53.805  6.807   1.00 4.82  ? 206  LEU B CG    1 
ATOM   2653 C CD1   . LEU B 1 99  ? -6.988  54.676  6.811   1.00 4.60  ? 206  LEU B CD1   1 
ATOM   2654 C CD2   . LEU B 1 99  ? -5.958  52.530  7.634   1.00 6.42  ? 206  LEU B CD2   1 
ATOM   2655 N N     . LEU B 1 100 ? -2.651  52.221  3.382   1.00 2.96  ? 207  LEU B N     1 
ATOM   2656 C CA    . LEU B 1 100 ? -2.245  51.837  2.031   1.00 2.96  ? 207  LEU B CA    1 
ATOM   2657 C C     . LEU B 1 100 ? -1.718  50.407  2.039   1.00 3.11  ? 207  LEU B C     1 
ATOM   2658 O O     . LEU B 1 100 ? -0.609  50.149  2.525   1.00 3.33  ? 207  LEU B O     1 
ATOM   2659 C CB    . LEU B 1 100 ? -1.145  52.777  1.535   1.00 2.97  ? 207  LEU B CB    1 
ATOM   2660 C CG    . LEU B 1 100 ? -0.568  52.439  0.156   1.00 3.39  ? 207  LEU B CG    1 
ATOM   2661 C CD1   . LEU B 1 100 ? -1.639  52.531  -0.925  1.00 3.81  ? 207  LEU B CD1   1 
ATOM   2662 C CD2   . LEU B 1 100 ? 0.613   53.344  -0.181  1.00 3.25  ? 207  LEU B CD2   1 
ATOM   2663 N N     . PRO B 1 101 ? -2.497  49.470  1.514   1.00 3.51  ? 208  PRO B N     1 
ATOM   2664 C CA    . PRO B 1 101 ? -2.098  48.064  1.517   1.00 3.60  ? 208  PRO B CA    1 
ATOM   2665 C C     . PRO B 1 101 ? -0.920  47.747  0.612   1.00 3.27  ? 208  PRO B C     1 
ATOM   2666 O O     . PRO B 1 101 ? -0.545  48.535  -0.247  1.00 3.25  ? 208  PRO B O     1 
ATOM   2667 C CB    . PRO B 1 101 ? -3.339  47.337  0.988   1.00 3.58  ? 208  PRO B CB    1 
ATOM   2668 C CG    . PRO B 1 101 ? -4.442  48.345  0.951   1.00 4.46  ? 208  PRO B CG    1 
ATOM   2669 C CD    . PRO B 1 101 ? -3.797  49.673  0.865   1.00 3.62  ? 208  PRO B CD    1 
ATOM   2670 N N     . ASP B 1 102 ? -0.322  46.587  0.855   1.00 3.07  ? 209  ASP B N     1 
ATOM   2671 C CA    . ASP B 1 102 ? 0.703   46.056  -0.012  1.00 2.94  ? 209  ASP B CA    1 
ATOM   2672 C C     . ASP B 1 102 ? 0.013   45.298  -1.165  1.00 2.62  ? 209  ASP B C     1 
ATOM   2673 O O     . ASP B 1 102 ? -0.820  44.435  -0.932  1.00 2.48  ? 209  ASP B O     1 
ATOM   2674 C CB    . ASP B 1 102 ? 1.581   45.103  0.758   1.00 2.99  ? 209  ASP B CB    1 
ATOM   2675 C CG    . ASP B 1 102 ? 2.711   44.575  -0.072  1.00 3.45  ? 209  ASP B CG    1 
ATOM   2676 O OD1   . ASP B 1 102 ? 2.476   43.587  -0.792  1.00 3.54  ? 209  ASP B OD1   1 
ATOM   2677 O OD2   . ASP B 1 102 ? 3.853   45.095  -0.072  1.00 4.67  ? 209  ASP B OD2   1 
ATOM   2678 N N     . PRO B 1 103 ? 0.402   45.587  -2.399  1.00 2.91  ? 210  PRO B N     1 
ATOM   2679 C CA    . PRO B 1 103 ? -0.255  45.024  -3.583  1.00 2.97  ? 210  PRO B CA    1 
ATOM   2680 C C     . PRO B 1 103 ? -0.007  43.536  -3.802  1.00 3.15  ? 210  PRO B C     1 
ATOM   2681 O O     . PRO B 1 103 ? -0.878  42.868  -4.375  1.00 2.77  ? 210  PRO B O     1 
ATOM   2682 C CB    . PRO B 1 103 ? 0.354   45.825  -4.746  1.00 3.10  ? 210  PRO B CB    1 
ATOM   2683 C CG    . PRO B 1 103 ? 1.466   46.651  -4.176  1.00 2.80  ? 210  PRO B CG    1 
ATOM   2684 C CD    . PRO B 1 103 ? 1.535   46.443  -2.747  1.00 2.87  ? 210  PRO B CD    1 
ATOM   2685 N N     . TYR B 1 104 ? 1.165   43.049  -3.401  1.00 2.86  ? 211  TYR B N     1 
ATOM   2686 C CA    . TYR B 1 104 ? 1.500   41.631  -3.491  1.00 3.24  ? 211  TYR B CA    1 
ATOM   2687 C C     . TYR B 1 104 ? 0.597   40.864  -2.514  1.00 3.34  ? 211  TYR B C     1 
ATOM   2688 O O     . TYR B 1 104 ? 0.067   39.794  -2.838  1.00 3.05  ? 211  TYR B O     1 
ATOM   2689 C CB    . TYR B 1 104 ? 2.993   41.419  -3.195  1.00 3.63  ? 211  TYR B CB    1 
ATOM   2690 C CG    . TYR B 1 104 ? 3.454   39.975  -3.191  1.00 4.29  ? 211  TYR B CG    1 
ATOM   2691 C CD1   . TYR B 1 104 ? 3.904   39.361  -4.351  1.00 4.14  ? 211  TYR B CD1   1 
ATOM   2692 C CD2   . TYR B 1 104 ? 3.496   39.245  -2.007  1.00 4.72  ? 211  TYR B CD2   1 
ATOM   2693 C CE1   . TYR B 1 104 ? 4.344   38.046  -4.341  1.00 3.94  ? 211  TYR B CE1   1 
ATOM   2694 C CE2   . TYR B 1 104 ? 3.924   37.938  -1.990  1.00 3.73  ? 211  TYR B CE2   1 
ATOM   2695 C CZ    . TYR B 1 104 ? 4.350   37.341  -3.156  1.00 3.70  ? 211  TYR B CZ    1 
ATOM   2696 O OH    . TYR B 1 104 ? 4.781   36.031  -3.137  1.00 3.12  ? 211  TYR B OH    1 
ATOM   2697 N N     . GLU B 1 105 ? 0.388   41.442  -1.333  1.00 3.47  ? 212  GLU B N     1 
ATOM   2698 C CA    . GLU B 1 105 ? -0.501  40.867  -0.331  1.00 3.95  ? 212  GLU B CA    1 
ATOM   2699 C C     . GLU B 1 105 ? -1.947  40.906  -0.820  1.00 4.25  ? 212  GLU B C     1 
ATOM   2700 O O     . GLU B 1 105 ? -2.711  39.967  -0.614  1.00 3.68  ? 212  GLU B O     1 
ATOM   2701 C CB    . GLU B 1 105 ? -0.403  41.664  0.975   1.00 4.30  ? 212  GLU B CB    1 
ATOM   2702 C CG    . GLU B 1 105 ? 0.051   40.840  2.165   1.00 4.82  ? 212  GLU B CG    1 
ATOM   2703 C CD    . GLU B 1 105 ? 0.373   41.682  3.381   1.00 3.87  ? 212  GLU B CD    1 
ATOM   2704 O OE1   . GLU B 1 105 ? 0.054   42.887  3.378   1.00 3.79  ? 212  GLU B OE1   1 
ATOM   2705 O OE2   . GLU B 1 105 ? 0.937   41.126  4.340   1.00 3.19  ? 212  GLU B OE2   1 
ATOM   2706 N N     . SER B 1 106 ? -2.311  42.005  -1.465  1.00 5.03  ? 213  SER B N     1 
ATOM   2707 C CA    . SER B 1 106 ? -3.681  42.198  -1.961  1.00 5.94  ? 213  SER B CA    1 
ATOM   2708 C C     . SER B 1 106 ? -4.141  41.086  -2.914  1.00 6.53  ? 213  SER B C     1 
ATOM   2709 O O     . SER B 1 106 ? -5.340  40.813  -3.028  1.00 6.37  ? 213  SER B O     1 
ATOM   2710 C CB    . SER B 1 106 ? -3.794  43.562  -2.640  1.00 6.03  ? 213  SER B CB    1 
ATOM   2711 O OG    . SER B 1 106 ? -4.972  43.644  -3.433  1.00 8.97  ? 213  SER B OG    1 
ATOM   2712 N N     . GLU B 1 107 ? -3.201  40.442  -3.595  1.00 7.09  ? 214  GLU B N     1 
ATOM   2713 C CA    . GLU B 1 107 ? -3.552  39.366  -4.519  1.00 8.16  ? 214  GLU B CA    1 
ATOM   2714 C C     . GLU B 1 107 ? -3.467  37.986  -3.877  1.00 7.68  ? 214  GLU B C     1 
ATOM   2715 O O     . GLU B 1 107 ? -3.940  37.018  -4.451  1.00 7.98  ? 214  GLU B O     1 
ATOM   2716 C CB    . GLU B 1 107 ? -2.610  39.369  -5.721  1.00 9.14  ? 214  GLU B CB    1 
ATOM   2717 C CG    . GLU B 1 107 ? -2.588  40.641  -6.539  1.00 11.71 ? 214  GLU B CG    1 
ATOM   2718 C CD    . GLU B 1 107 ? -1.387  40.684  -7.473  1.00 15.59 ? 214  GLU B CD    1 
ATOM   2719 O OE1   . GLU B 1 107 ? -0.333  40.072  -7.122  1.00 18.06 ? 214  GLU B OE1   1 
ATOM   2720 O OE2   . GLU B 1 107 ? -1.480  41.341  -8.532  1.00 17.25 ? 214  GLU B OE2   1 
ATOM   2721 N N     . ARG B 1 108 ? -2.857  37.886  -2.695  1.00 7.12  ? 215  ARG B N     1 
ATOM   2722 C CA    . ARG B 1 108 ? -2.620  36.574  -2.088  1.00 6.87  ? 215  ARG B CA    1 
ATOM   2723 C C     . ARG B 1 108 ? -3.333  36.269  -0.766  1.00 5.88  ? 215  ARG B C     1 
ATOM   2724 O O     . ARG B 1 108 ? -3.566  35.105  -0.454  1.00 5.21  ? 215  ARG B O     1 
ATOM   2725 C CB    . ARG B 1 108 ? -1.117  36.369  -1.916  1.00 7.35  ? 215  ARG B CB    1 
ATOM   2726 C CG    . ARG B 1 108 ? -0.457  35.755  -3.154  1.00 8.66  ? 215  ARG B CG    1 
ATOM   2727 C CD    . ARG B 1 108 ? 1.045   36.041  -3.296  1.00 9.47  ? 215  ARG B CD    1 
ATOM   2728 N NE    . ARG B 1 108 ? 1.468   36.143  -4.714  1.00 11.11 ? 215  ARG B NE    1 
ATOM   2729 C CZ    A ARG B 1 108 ? 1.353   37.113  -5.582  0.50 11.13 ? 215  ARG B CZ    1 
ATOM   2730 C CZ    B ARG B 1 108 ? 1.758   35.153  -5.548  0.50 11.85 ? 215  ARG B CZ    1 
ATOM   2731 N NH1   A ARG B 1 108 ? 1.019   38.316  -5.128  0.50 10.41 ? 215  ARG B NH1   1 
ATOM   2732 N NH1   B ARG B 1 108 ? 1.727   33.874  -5.177  0.50 11.88 ? 215  ARG B NH1   1 
ATOM   2733 N NH2   A ARG B 1 108 ? 1.871   36.988  -6.787  0.50 11.66 ? 215  ARG B NH2   1 
ATOM   2734 N NH2   B ARG B 1 108 ? 2.101   35.472  -6.778  0.50 12.04 ? 215  ARG B NH2   1 
ATOM   2735 N N     . VAL B 1 109 ? -3.679  37.290  0.011   1.00 5.03  ? 216  VAL B N     1 
ATOM   2736 C CA    . VAL B 1 109 ? -4.313  37.046  1.308   1.00 4.67  ? 216  VAL B CA    1 
ATOM   2737 C C     . VAL B 1 109 ? -5.476  37.987  1.603   1.00 4.33  ? 216  VAL B C     1 
ATOM   2738 O O     . VAL B 1 109 ? -5.571  39.075  1.032   1.00 4.26  ? 216  VAL B O     1 
ATOM   2739 C CB    . VAL B 1 109 ? -3.285  37.161  2.470   1.00 4.50  ? 216  VAL B CB    1 
ATOM   2740 C CG1   . VAL B 1 109 ? -2.184  36.128  2.322   1.00 4.99  ? 216  VAL B CG1   1 
ATOM   2741 C CG2   . VAL B 1 109 ? -2.686  38.552  2.537   1.00 4.09  ? 216  VAL B CG2   1 
ATOM   2742 N N     . TYR B 1 110 ? -6.365  37.546  2.490   1.00 4.05  ? 217  TYR B N     1 
ATOM   2743 C CA    . TYR B 1 110 ? -7.447  38.391  2.979   1.00 3.83  ? 217  TYR B CA    1 
ATOM   2744 C C     . TYR B 1 110 ? -7.675  38.094  4.458   1.00 3.97  ? 217  TYR B C     1 
ATOM   2745 O O     . TYR B 1 110 ? -7.201  37.083  4.973   1.00 3.68  ? 217  TYR B O     1 
ATOM   2746 C CB    . TYR B 1 110 ? -8.728  38.230  2.165   1.00 3.79  ? 217  TYR B CB    1 
ATOM   2747 C CG    . TYR B 1 110 ? -9.397  36.888  2.216   1.00 3.24  ? 217  TYR B CG    1 
ATOM   2748 C CD1   . TYR B 1 110 ? -10.461 36.663  3.072   1.00 3.55  ? 217  TYR B CD1   1 
ATOM   2749 C CD2   . TYR B 1 110 ? -9.013  35.865  1.357   1.00 3.55  ? 217  TYR B CD2   1 
ATOM   2750 C CE1   . TYR B 1 110 ? -11.129 35.451  3.083   1.00 4.59  ? 217  TYR B CE1   1 
ATOM   2751 C CE2   . TYR B 1 110 ? -9.658  34.639  1.370   1.00 4.55  ? 217  TYR B CE2   1 
ATOM   2752 C CZ    . TYR B 1 110 ? -10.725 34.441  2.222   1.00 4.67  ? 217  TYR B CZ    1 
ATOM   2753 O OH    . TYR B 1 110 ? -11.373 33.232  2.234   1.00 3.80  ? 217  TYR B OH    1 
ATOM   2754 N N     . VAL B 1 111 ? -8.369  38.999  5.139   1.00 4.12  ? 218  VAL B N     1 
ATOM   2755 C CA    . VAL B 1 111 ? -8.656  38.839  6.564   1.00 3.73  ? 218  VAL B CA    1 
ATOM   2756 C C     . VAL B 1 111 ? -10.145 38.505  6.715   1.00 3.50  ? 218  VAL B C     1 
ATOM   2757 O O     . VAL B 1 111 ? -11.013 39.142  6.099   1.00 3.19  ? 218  VAL B O     1 
ATOM   2758 C CB    . VAL B 1 111 ? -8.324  40.102  7.359   1.00 3.37  ? 218  VAL B CB    1 
ATOM   2759 C CG1   . VAL B 1 111 ? -8.738  39.938  8.822   1.00 4.07  ? 218  VAL B CG1   1 
ATOM   2760 C CG2   . VAL B 1 111 ? -6.814  40.428  7.263   1.00 3.47  ? 218  VAL B CG2   1 
ATOM   2761 N N     . ALA B 1 112 ? -10.433 37.499  7.530   1.00 3.37  ? 219  ALA B N     1 
ATOM   2762 C CA    . ALA B 1 112 ? -11.797 37.072  7.793   1.00 3.43  ? 219  ALA B CA    1 
ATOM   2763 C C     . ALA B 1 112 ? -11.842 36.406  9.151   1.00 3.36  ? 219  ALA B C     1 
ATOM   2764 O O     . ALA B 1 112 ? -10.802 36.271  9.825   1.00 3.33  ? 219  ALA B O     1 
ATOM   2765 C CB    . ALA B 1 112 ? -12.284 36.115  6.716   1.00 3.99  ? 219  ALA B CB    1 
ATOM   2766 N N     . GLU B 1 113 ? -13.031 35.995  9.569   1.00 3.42  ? 220  GLU B N     1 
ATOM   2767 C CA    . GLU B 1 113 ? -13.176 35.304  10.841  1.00 4.04  ? 220  GLU B CA    1 
ATOM   2768 C C     . GLU B 1 113 ? -12.393 33.998  10.793  1.00 4.17  ? 220  GLU B C     1 
ATOM   2769 O O     . GLU B 1 113 ? -12.537 33.214  9.843   1.00 4.41  ? 220  GLU B O     1 
ATOM   2770 C CB    . GLU B 1 113 ? -14.643 35.021  11.150  1.00 4.62  ? 220  GLU B CB    1 
ATOM   2771 C CG    . GLU B 1 113 ? -14.821 34.266  12.457  1.00 5.21  ? 220  GLU B CG    1 
ATOM   2772 C CD    . GLU B 1 113 ? -16.267 34.127  12.884  1.00 6.98  ? 220  GLU B CD    1 
ATOM   2773 O OE1   . GLU B 1 113 ? -17.101 33.733  12.049  1.00 9.50  ? 220  GLU B OE1   1 
ATOM   2774 O OE2   . GLU B 1 113 ? -16.568 34.406  14.063  1.00 7.62  ? 220  GLU B OE2   1 
ATOM   2775 N N     . SER B 1 114 ? -11.575 33.761  11.813  1.00 4.13  ? 221  SER B N     1 
ATOM   2776 C CA    . SER B 1 114 ? -10.784 32.540  11.880  1.00 4.24  ? 221  SER B CA    1 
ATOM   2777 C C     . SER B 1 114 ? -11.678 31.310  11.958  1.00 4.02  ? 221  SER B C     1 
ATOM   2778 O O     . SER B 1 114 ? -12.798 31.384  12.458  1.00 3.82  ? 221  SER B O     1 
ATOM   2779 C CB    . SER B 1 114 ? -9.906  32.541  13.112  1.00 4.31  ? 221  SER B CB    1 
ATOM   2780 O OG    . SER B 1 114 ? -9.096  31.381  13.144  1.00 4.56  ? 221  SER B OG    1 
ATOM   2781 N N     . LEU B 1 115 ? -11.164 30.185  11.473  1.00 4.16  ? 222  LEU B N     1 
ATOM   2782 C CA    . LEU B 1 115 ? -11.854 28.908  11.568  1.00 4.70  ? 222  LEU B CA    1 
ATOM   2783 C C     . LEU B 1 115 ? -11.525 28.263  12.893  1.00 4.26  ? 222  LEU B C     1 
ATOM   2784 O O     . LEU B 1 115 ? -12.158 27.285  13.288  1.00 3.95  ? 222  LEU B O     1 
ATOM   2785 C CB    . LEU B 1 115 ? -11.426 27.972  10.443  1.00 5.39  ? 222  LEU B CB    1 
ATOM   2786 C CG    . LEU B 1 115 ? -11.668 28.538  9.045   1.00 7.02  ? 222  LEU B CG    1 
ATOM   2787 C CD1   . LEU B 1 115 ? -11.175 27.556  7.995   1.00 9.05  ? 222  LEU B CD1   1 
ATOM   2788 C CD2   . LEU B 1 115 ? -13.135 28.875  8.810   1.00 8.07  ? 222  LEU B CD2   1 
ATOM   2789 N N     . ILE B 1 116 ? -10.507 28.798  13.567  1.00 3.90  ? 223  ILE B N     1 
ATOM   2790 C CA    . ILE B 1 116 ? -10.124 28.303  14.883  1.00 3.82  ? 223  ILE B CA    1 
ATOM   2791 C C     . ILE B 1 116 ? -11.115 28.871  15.892  1.00 3.61  ? 223  ILE B C     1 
ATOM   2792 O O     . ILE B 1 116 ? -11.328 30.080  15.946  1.00 3.54  ? 223  ILE B O     1 
ATOM   2793 C CB    . ILE B 1 116 ? -8.689  28.714  15.235  1.00 3.84  ? 223  ILE B CB    1 
ATOM   2794 C CG1   . ILE B 1 116 ? -7.709  28.065  14.259  1.00 4.10  ? 223  ILE B CG1   1 
ATOM   2795 C CG2   . ILE B 1 116 ? -8.351  28.304  16.681  1.00 4.32  ? 223  ILE B CG2   1 
ATOM   2796 C CD1   . ILE B 1 116 ? -6.289  28.586  14.375  1.00 5.14  ? 223  ILE B CD1   1 
ATOM   2797 N N     . SER B 1 117 ? -11.731 27.989  16.670  1.00 3.59  ? 224  SER B N     1 
ATOM   2798 C CA    . SER B 1 117 ? -12.755 28.378  17.638  1.00 3.53  ? 224  SER B CA    1 
ATOM   2799 C C     . SER B 1 117 ? -12.335 29.544  18.535  1.00 2.86  ? 224  SER B C     1 
ATOM   2800 O O     . SER B 1 117 ? -11.329 29.447  19.261  1.00 2.25  ? 224  SER B O     1 
ATOM   2801 C CB    . SER B 1 117 ? -13.110 27.183  18.526  1.00 4.03  ? 224  SER B CB    1 
ATOM   2802 O OG    . SER B 1 117 ? -14.229 27.489  19.351  1.00 4.93  ? 224  SER B OG    1 
ATOM   2803 N N     . SER B 1 118 ? -13.119 30.626  18.490  1.00 2.21  ? 225  SER B N     1 
ATOM   2804 C CA    . SER B 1 118 ? -12.911 31.797  19.365  1.00 2.20  ? 225  SER B CA    1 
ATOM   2805 C C     . SER B 1 118 ? -11.569 32.518  19.189  1.00 2.12  ? 225  SER B C     1 
ATOM   2806 O O     . SER B 1 118 ? -11.167 33.285  20.064  1.00 2.22  ? 225  SER B O     1 
ATOM   2807 C CB    . SER B 1 118 ? -13.048 31.381  20.827  1.00 2.15  ? 225  SER B CB    1 
ATOM   2808 O OG    . SER B 1 118 ? -14.267 30.724  21.073  1.00 2.35  ? 225  SER B OG    1 
ATOM   2809 N N     . ALA B 1 119 ? -10.900 32.287  18.063  1.00 2.16  ? 226  ALA B N     1 
ATOM   2810 C CA    . ALA B 1 119 ? -9.591  32.850  17.781  1.00 2.31  ? 226  ALA B CA    1 
ATOM   2811 C C     . ALA B 1 119 ? -9.605  34.258  17.188  1.00 2.64  ? 226  ALA B C     1 
ATOM   2812 O O     . ALA B 1 119 ? -8.544  34.817  16.937  1.00 3.62  ? 226  ALA B O     1 
ATOM   2813 C CB    . ALA B 1 119 ? -8.814  31.916  16.877  1.00 2.27  ? 226  ALA B CB    1 
ATOM   2814 N N     . GLY B 1 120 ? -10.777 34.845  16.992  1.00 2.17  ? 227  GLY B N     1 
ATOM   2815 C CA    . GLY B 1 120 ? -10.870 36.194  16.460  1.00 2.16  ? 227  GLY B CA    1 
ATOM   2816 C C     . GLY B 1 120 ? -10.802 36.186  14.942  1.00 2.21  ? 227  GLY B C     1 
ATOM   2817 O O     . GLY B 1 120 ? -11.357 35.299  14.295  1.00 2.43  ? 227  GLY B O     1 
ATOM   2818 N N     . GLU B 1 121 ? -10.120 37.168  14.372  1.00 2.23  ? 228  GLU B N     1 
ATOM   2819 C CA    . GLU B 1 121 ? -9.904  37.186  12.930  1.00 2.25  ? 228  GLU B CA    1 
ATOM   2820 C C     . GLU B 1 121 ? -8.709  36.316  12.601  1.00 2.55  ? 228  GLU B C     1 
ATOM   2821 O O     . GLU B 1 121 ? -7.926  35.961  13.486  1.00 2.44  ? 228  GLU B O     1 
ATOM   2822 C CB    . GLU B 1 121 ? -9.652  38.599  12.438  1.00 2.29  ? 228  GLU B CB    1 
ATOM   2823 C CG    . GLU B 1 121 ? -10.866 39.495  12.584  1.00 2.63  ? 228  GLU B CG    1 
ATOM   2824 C CD    . GLU B 1 121 ? -10.654 40.851  11.961  1.00 3.79  ? 228  GLU B CD    1 
ATOM   2825 O OE1   . GLU B 1 121 ? -9.510  41.360  12.044  1.00 3.65  ? 228  GLU B OE1   1 
ATOM   2826 O OE2   . GLU B 1 121 ? -11.628 41.381  11.373  1.00 5.69  ? 228  GLU B OE2   1 
ATOM   2827 N N     . GLY B 1 122 ? -8.567  35.998  11.321  1.00 2.61  ? 229  GLY B N     1 
ATOM   2828 C CA    . GLY B 1 122 ? -7.467  35.194  10.833  1.00 2.84  ? 229  GLY B CA    1 
ATOM   2829 C C     . GLY B 1 122 ? -7.113  35.636  9.411   1.00 2.93  ? 229  GLY B C     1 
ATOM   2830 O O     . GLY B 1 122 ? -7.790  36.475  8.812   1.00 3.43  ? 229  GLY B O     1 
ATOM   2831 N N     . LEU B 1 123 ? -6.056  35.044  8.873   1.00 3.20  ? 230  LEU B N     1 
ATOM   2832 C CA    . LEU B 1 123 ? -5.508  35.377  7.575   1.00 2.50  ? 230  LEU B CA    1 
ATOM   2833 C C     . LEU B 1 123 ? -5.752  34.184  6.675   1.00 2.66  ? 230  LEU B C     1 
ATOM   2834 O O     . LEU B 1 123 ? -5.441  33.054  7.044   1.00 2.70  ? 230  LEU B O     1 
ATOM   2835 C CB    . LEU B 1 123 ? -3.995  35.637  7.694   1.00 2.77  ? 230  LEU B CB    1 
ATOM   2836 C CG    . LEU B 1 123 ? -3.295  36.195  6.454   1.00 2.64  ? 230  LEU B CG    1 
ATOM   2837 C CD1   . LEU B 1 123 ? -3.819  37.586  6.148   1.00 4.12  ? 230  LEU B CD1   1 
ATOM   2838 C CD2   . LEU B 1 123 ? -1.781  36.214  6.635   1.00 2.36  ? 230  LEU B CD2   1 
ATOM   2839 N N     . PHE B 1 124 ? -6.295  34.445  5.490   1.00 2.71  ? 231  PHE B N     1 
ATOM   2840 C CA    . PHE B 1 124 ? -6.676  33.393  4.547   1.00 2.95  ? 231  PHE B CA    1 
ATOM   2841 C C     . PHE B 1 124 ? -6.024  33.628  3.192   1.00 3.58  ? 231  PHE B C     1 
ATOM   2842 O O     . PHE B 1 124 ? -5.801  34.773  2.803   1.00 3.04  ? 231  PHE B O     1 
ATOM   2843 C CB    . PHE B 1 124 ? -8.194  33.406  4.364   1.00 2.65  ? 231  PHE B CB    1 
ATOM   2844 C CG    . PHE B 1 124 ? -8.955  32.978  5.578   1.00 2.44  ? 231  PHE B CG    1 
ATOM   2845 C CD1   . PHE B 1 124 ? -9.085  33.828  6.670   1.00 2.44  ? 231  PHE B CD1   1 
ATOM   2846 C CD2   . PHE B 1 124 ? -9.526  31.715  5.638   1.00 2.19  ? 231  PHE B CD2   1 
ATOM   2847 C CE1   . PHE B 1 124 ? -9.773  33.422  7.805   1.00 2.15  ? 231  PHE B CE1   1 
ATOM   2848 C CE2   . PHE B 1 124 ? -10.206 31.299  6.768   1.00 2.38  ? 231  PHE B CE2   1 
ATOM   2849 C CZ    . PHE B 1 124 ? -10.331 32.157  7.857   1.00 2.17  ? 231  PHE B CZ    1 
ATOM   2850 N N     . SER B 1 125 ? -5.732  32.544  2.472   1.00 4.81  ? 232  SER B N     1 
ATOM   2851 C CA    . SER B 1 125 ? -5.173  32.635  1.119   1.00 5.47  ? 232  SER B CA    1 
ATOM   2852 C C     . SER B 1 125 ? -6.258  32.894  0.082   1.00 5.72  ? 232  SER B C     1 
ATOM   2853 O O     . SER B 1 125 ? -7.327  32.274  0.119   1.00 5.38  ? 232  SER B O     1 
ATOM   2854 C CB    . SER B 1 125 ? -4.429  31.339  0.738   1.00 5.78  ? 232  SER B CB    1 
ATOM   2855 O OG    A SER B 1 125 ? -5.144  30.148  1.014   0.50 6.62  ? 232  SER B OG    1 
ATOM   2856 O OG    B SER B 1 125 ? -3.809  31.484  -0.524  0.50 6.23  ? 232  SER B OG    1 
ATOM   2857 N N     . LYS B 1 126 ? -5.988  33.812  -0.845  1.00 5.99  ? 233  LYS B N     1 
ATOM   2858 C CA    . LYS B 1 126 ? -6.939  34.105  -1.924  1.00 6.40  ? 233  LYS B CA    1 
ATOM   2859 C C     . LYS B 1 126 ? -6.836  33.086  -3.038  1.00 6.51  ? 233  LYS B C     1 
ATOM   2860 O O     . LYS B 1 126 ? -7.801  32.866  -3.773  1.00 6.39  ? 233  LYS B O     1 
ATOM   2861 C CB    . LYS B 1 126 ? -6.686  35.490  -2.528  1.00 6.75  ? 233  LYS B CB    1 
ATOM   2862 C CG    . LYS B 1 126 ? -7.339  36.639  -1.764  1.00 7.16  ? 233  LYS B CG    1 
ATOM   2863 C CD    . LYS B 1 126 ? -7.216  37.969  -2.493  1.00 7.13  ? 233  LYS B CD    1 
ATOM   2864 C CE    . LYS B 1 126 ? -7.862  39.098  -1.686  1.00 7.05  ? 233  LYS B CE    1 
ATOM   2865 N NZ    . LYS B 1 126 ? -7.894  40.411  -2.378  1.00 6.69  ? 233  LYS B NZ    1 
ATOM   2866 N N     . VAL B 1 127 ? -5.662  32.480  -3.182  1.00 6.54  ? 234  VAL B N     1 
ATOM   2867 C CA    . VAL B 1 127 ? -5.408  31.571  -4.294  1.00 7.08  ? 234  VAL B CA    1 
ATOM   2868 C C     . VAL B 1 127 ? -4.642  30.331  -3.849  1.00 6.22  ? 234  VAL B C     1 
ATOM   2869 O O     . VAL B 1 127 ? -4.114  30.285  -2.742  1.00 6.82  ? 234  VAL B O     1 
ATOM   2870 C CB    . VAL B 1 127 ? -4.584  32.275  -5.399  1.00 7.41  ? 234  VAL B CB    1 
ATOM   2871 C CG1   . VAL B 1 127 ? -5.380  33.411  -6.026  1.00 8.75  ? 234  VAL B CG1   1 
ATOM   2872 C CG2   . VAL B 1 127 ? -3.239  32.771  -4.823  1.00 8.48  ? 234  VAL B CG2   1 
ATOM   2873 N N     . ALA B 1 128 ? -4.588  29.327  -4.718  1.00 5.57  ? 235  ALA B N     1 
ATOM   2874 C CA    . ALA B 1 128 ? -3.826  28.114  -4.459  1.00 5.08  ? 235  ALA B CA    1 
ATOM   2875 C C     . ALA B 1 128 ? -2.349  28.408  -4.719  1.00 4.73  ? 235  ALA B C     1 
ATOM   2876 O O     . ALA B 1 128 ? -1.992  29.010  -5.734  1.00 4.39  ? 235  ALA B O     1 
ATOM   2877 C CB    . ALA B 1 128 ? -4.312  26.979  -5.358  1.00 5.30  ? 235  ALA B CB    1 
ATOM   2878 N N     . VAL B 1 129 ? -1.487  28.009  -3.792  1.00 4.61  ? 236  VAL B N     1 
ATOM   2879 C CA    . VAL B 1 129 ? -0.051  28.206  -3.953  1.00 4.14  ? 236  VAL B CA    1 
ATOM   2880 C C     . VAL B 1 129 ? 0.667   26.937  -3.547  1.00 3.41  ? 236  VAL B C     1 
ATOM   2881 O O     . VAL B 1 129 ? 0.112   26.105  -2.834  1.00 2.76  ? 236  VAL B O     1 
ATOM   2882 C CB    . VAL B 1 129 ? 0.479   29.375  -3.104  1.00 4.25  ? 236  VAL B CB    1 
ATOM   2883 C CG1   . VAL B 1 129 ? -0.181  30.675  -3.540  1.00 5.06  ? 236  VAL B CG1   1 
ATOM   2884 C CG2   . VAL B 1 129 ? 0.250   29.122  -1.624  1.00 3.74  ? 236  VAL B CG2   1 
ATOM   2885 N N     . GLY B 1 130 ? 1.898   26.788  -4.016  1.00 3.28  ? 237  GLY B N     1 
ATOM   2886 C CA    . GLY B 1 130 ? 2.707   25.644  -3.658  1.00 3.27  ? 237  GLY B CA    1 
ATOM   2887 C C     . GLY B 1 130 ? 3.494   25.973  -2.394  1.00 3.42  ? 237  GLY B C     1 
ATOM   2888 O O     . GLY B 1 130 ? 3.332   27.038  -1.811  1.00 3.44  ? 237  GLY B O     1 
ATOM   2889 N N     . PRO B 1 131 ? 4.329   25.045  -1.954  1.00 3.48  ? 238  PRO B N     1 
ATOM   2890 C CA    . PRO B 1 131 ? 5.190   25.259  -0.793  1.00 3.66  ? 238  PRO B CA    1 
ATOM   2891 C C     . PRO B 1 131 ? 6.262   26.312  -1.053  1.00 3.75  ? 238  PRO B C     1 
ATOM   2892 O O     . PRO B 1 131 ? 6.547   26.594  -2.218  1.00 3.55  ? 238  PRO B O     1 
ATOM   2893 C CB    . PRO B 1 131 ? 5.856   23.893  -0.604  1.00 3.66  ? 238  PRO B CB    1 
ATOM   2894 C CG    . PRO B 1 131 ? 5.102   22.942  -1.448  1.00 3.73  ? 238  PRO B CG    1 
ATOM   2895 C CD    . PRO B 1 131 ? 4.502   23.710  -2.535  1.00 3.72  ? 238  PRO B CD    1 
ATOM   2896 N N     . ASN B 1 132 ? 6.837   26.868  0.018   1.00 4.12  ? 239  ASN B N     1 
ATOM   2897 C CA    . ASN B 1 132 ? 7.917   27.864  -0.077  1.00 4.55  ? 239  ASN B CA    1 
ATOM   2898 C C     . ASN B 1 132 ? 7.429   29.203  -0.662  1.00 3.90  ? 239  ASN B C     1 
ATOM   2899 O O     . ASN B 1 132 ? 8.221   29.975  -1.187  1.00 3.91  ? 239  ASN B O     1 
ATOM   2900 C CB    . ASN B 1 132 ? 9.061   27.305  -0.936  1.00 5.36  ? 239  ASN B CB    1 
ATOM   2901 C CG    . ASN B 1 132 ? 10.434  27.797  -0.506  1.00 8.53  ? 239  ASN B CG    1 
ATOM   2902 O OD1   . ASN B 1 132 ? 10.577  28.603  0.421   1.00 12.11 ? 239  ASN B OD1   1 
ATOM   2903 N ND2   . ASN B 1 132 ? 11.474  27.272  -1.161  1.00 11.55 ? 239  ASN B ND2   1 
ATOM   2904 N N     . THR B 1 133 ? 6.134   29.485  -0.567  1.00 3.11  ? 240  THR B N     1 
ATOM   2905 C CA    . THR B 1 133 ? 5.585   30.719  -1.136  1.00 2.87  ? 240  THR B CA    1 
ATOM   2906 C C     . THR B 1 133 ? 5.381   31.830  -0.096  1.00 2.55  ? 240  THR B C     1 
ATOM   2907 O O     . THR B 1 133 ? 4.652   31.660  0.881   1.00 2.51  ? 240  THR B O     1 
ATOM   2908 C CB    . THR B 1 133 ? 4.220   30.448  -1.809  1.00 2.77  ? 240  THR B CB    1 
ATOM   2909 O OG1   . THR B 1 133 ? 4.304   29.372  -2.765  1.00 2.57  ? 240  THR B OG1   1 
ATOM   2910 C CG2   . THR B 1 133 ? 3.775   31.642  -2.652  1.00 3.13  ? 240  THR B CG2   1 
ATOM   2911 N N     . VAL B 1 134 ? 5.994   32.982  -0.340  1.00 2.34  ? 241  VAL B N     1 
ATOM   2912 C CA    . VAL B 1 134 ? 5.759   34.157  0.484   1.00 2.25  ? 241  VAL B CA    1 
ATOM   2913 C C     . VAL B 1 134 ? 4.313   34.606  0.261   1.00 2.47  ? 241  VAL B C     1 
ATOM   2914 O O     . VAL B 1 134 ? 3.883   34.733  -0.881  1.00 2.38  ? 241  VAL B O     1 
ATOM   2915 C CB    . VAL B 1 134 ? 6.723   35.292  0.122   1.00 2.35  ? 241  VAL B CB    1 
ATOM   2916 C CG1   . VAL B 1 134 ? 6.432   36.528  0.958   1.00 2.56  ? 241  VAL B CG1   1 
ATOM   2917 C CG2   . VAL B 1 134 ? 8.163   34.844  0.328   1.00 2.24  ? 241  VAL B CG2   1 
ATOM   2918 N N     . MET B 1 135 ? 3.573   34.837  1.339   1.00 2.41  ? 242  MET B N     1 
ATOM   2919 C CA    . MET B 1 135 ? 2.163   35.200  1.257   1.00 2.92  ? 242  MET B CA    1 
ATOM   2920 C C     . MET B 1 135 ? 1.846   36.541  1.890   1.00 2.71  ? 242  MET B C     1 
ATOM   2921 O O     . MET B 1 135 ? 1.014   37.285  1.395   1.00 2.73  ? 242  MET B O     1 
ATOM   2922 C CB    . MET B 1 135 ? 1.313   34.143  1.955   1.00 3.31  ? 242  MET B CB    1 
ATOM   2923 C CG    . MET B 1 135 ? 1.434   32.761  1.352   1.00 4.75  ? 242  MET B CG    1 
ATOM   2924 S SD    . MET B 1 135 ? 0.791   32.644  -0.282  1.00 7.60  ? 242  MET B SD    1 
ATOM   2925 C CE    . MET B 1 135 ? -0.982  32.652  0.064   1.00 7.33  ? 242  MET B CE    1 
ATOM   2926 N N     . SER B 1 136 ? 2.527   36.859  2.986   1.00 2.50  ? 243  SER B N     1 
ATOM   2927 C CA    . SER B 1 136 ? 2.182   38.045  3.741   1.00 2.51  ? 243  SER B CA    1 
ATOM   2928 C C     . SER B 1 136 ? 3.426   38.579  4.457   1.00 2.31  ? 243  SER B C     1 
ATOM   2929 O O     . SER B 1 136 ? 4.406   37.847  4.652   1.00 2.47  ? 243  SER B O     1 
ATOM   2930 C CB    . SER B 1 136 ? 1.073   37.704  4.744   1.00 2.71  ? 243  SER B CB    1 
ATOM   2931 O OG    . SER B 1 136 ? 0.704   38.815  5.549   1.00 2.89  ? 243  SER B OG    1 
ATOM   2932 N N     . PHE B 1 137 ? 3.370   39.857  4.815   1.00 2.24  ? 244  PHE B N     1 
ATOM   2933 C CA    . PHE B 1 137 ? 4.481   40.556  5.447   1.00 2.30  ? 244  PHE B CA    1 
ATOM   2934 C C     . PHE B 1 137 ? 4.145   40.924  6.871   1.00 2.55  ? 244  PHE B C     1 
ATOM   2935 O O     . PHE B 1 137 ? 3.026   41.329  7.180   1.00 3.37  ? 244  PHE B O     1 
ATOM   2936 C CB    . PHE B 1 137 ? 4.837   41.791  4.634   1.00 2.23  ? 244  PHE B CB    1 
ATOM   2937 C CG    . PHE B 1 137 ? 5.146   41.468  3.216   1.00 2.40  ? 244  PHE B CG    1 
ATOM   2938 C CD1   . PHE B 1 137 ? 4.284   41.842  2.194   1.00 2.14  ? 244  PHE B CD1   1 
ATOM   2939 C CD2   . PHE B 1 137 ? 6.275   40.729  2.898   1.00 2.12  ? 244  PHE B CD2   1 
ATOM   2940 C CE1   . PHE B 1 137 ? 4.561   41.510  0.889   1.00 2.47  ? 244  PHE B CE1   1 
ATOM   2941 C CE2   . PHE B 1 137 ? 6.543   40.392  1.578   1.00 2.59  ? 244  PHE B CE2   1 
ATOM   2942 C CZ    . PHE B 1 137 ? 5.685   40.789  0.580   1.00 2.30  ? 244  PHE B CZ    1 
ATOM   2943 N N     . TYR B 1 138 ? 5.121   40.758  7.744   1.00 2.55  ? 245  TYR B N     1 
ATOM   2944 C CA    . TYR B 1 138 ? 4.939   41.087  9.138   1.00 2.53  ? 245  TYR B CA    1 
ATOM   2945 C C     . TYR B 1 138 ? 5.728   42.346  9.437   1.00 2.47  ? 245  TYR B C     1 
ATOM   2946 O O     . TYR B 1 138 ? 6.854   42.278  9.919   1.00 3.27  ? 245  TYR B O     1 
ATOM   2947 C CB    . TYR B 1 138 ? 5.414   39.941  10.027  1.00 2.71  ? 245  TYR B CB    1 
ATOM   2948 C CG    . TYR B 1 138 ? 4.736   39.873  11.371  1.00 2.28  ? 245  TYR B CG    1 
ATOM   2949 C CD1   . TYR B 1 138 ? 4.019   38.755  11.739  1.00 2.54  ? 245  TYR B CD1   1 
ATOM   2950 C CD2   . TYR B 1 138 ? 4.838   40.913  12.287  1.00 2.87  ? 245  TYR B CD2   1 
ATOM   2951 C CE1   . TYR B 1 138 ? 3.433   38.655  12.989  1.00 2.63  ? 245  TYR B CE1   1 
ATOM   2952 C CE2   . TYR B 1 138 ? 4.234   40.828  13.534  1.00 2.64  ? 245  TYR B CE2   1 
ATOM   2953 C CZ    . TYR B 1 138 ? 3.526   39.690  13.868  1.00 2.40  ? 245  TYR B CZ    1 
ATOM   2954 O OH    . TYR B 1 138 ? 2.902   39.563  15.083  1.00 3.26  ? 245  TYR B OH    1 
ATOM   2955 N N     . ASN B 1 139 ? 5.144   43.493  9.117   1.00 2.45  ? 246  ASN B N     1 
ATOM   2956 C CA    . ASN B 1 139 ? 5.723   44.771  9.477   1.00 2.78  ? 246  ASN B CA    1 
ATOM   2957 C C     . ASN B 1 139 ? 5.149   45.186  10.832  1.00 2.53  ? 246  ASN B C     1 
ATOM   2958 O O     . ASN B 1 139 ? 4.108   44.700  11.247  1.00 3.11  ? 246  ASN B O     1 
ATOM   2959 C CB    . ASN B 1 139 ? 5.409   45.852  8.442   1.00 2.44  ? 246  ASN B CB    1 
ATOM   2960 C CG    . ASN B 1 139 ? 6.029   47.197  8.812   1.00 2.73  ? 246  ASN B CG    1 
ATOM   2961 O OD1   . ASN B 1 139 ? 7.242   47.302  9.001   1.00 2.40  ? 246  ASN B OD1   1 
ATOM   2962 N ND2   . ASN B 1 139 ? 5.196   48.216  8.953   1.00 3.17  ? 246  ASN B ND2   1 
ATOM   2963 N N     . GLY B 1 140 ? 5.796   46.115  11.507  1.00 2.33  ? 247  GLY B N     1 
ATOM   2964 C CA    . GLY B 1 140 ? 5.302   46.572  12.795  1.00 2.05  ? 247  GLY B CA    1 
ATOM   2965 C C     . GLY B 1 140 ? 6.232   47.643  13.303  1.00 2.08  ? 247  GLY B C     1 
ATOM   2966 O O     . GLY B 1 140 ? 7.240   47.917  12.664  1.00 2.37  ? 247  GLY B O     1 
ATOM   2967 N N     . VAL B 1 141 ? 5.896   48.267  14.425  1.00 2.01  ? 248  VAL B N     1 
ATOM   2968 C CA    . VAL B 1 141 ? 6.809   49.235  15.039  1.00 2.09  ? 248  VAL B CA    1 
ATOM   2969 C C     . VAL B 1 141 ? 8.020   48.439  15.493  1.00 2.37  ? 248  VAL B C     1 
ATOM   2970 O O     . VAL B 1 141 ? 7.908   47.237  15.746  1.00 2.39  ? 248  VAL B O     1 
ATOM   2971 C CB    . VAL B 1 141 ? 6.166   49.979  16.214  1.00 2.17  ? 248  VAL B CB    1 
ATOM   2972 C CG1   . VAL B 1 141 ? 4.976   50.785  15.727  1.00 2.33  ? 248  VAL B CG1   1 
ATOM   2973 C CG2   . VAL B 1 141 ? 5.744   49.023  17.311  1.00 2.04  ? 248  VAL B CG2   1 
ATOM   2974 N N     . ARG B 1 142 ? 9.173   49.101  15.590  1.00 2.67  ? 249  ARG B N     1 
ATOM   2975 C CA    . ARG B 1 142 ? 10.414  48.457  15.998  1.00 2.94  ? 249  ARG B CA    1 
ATOM   2976 C C     . ARG B 1 142 ? 10.770  48.871  17.416  1.00 2.58  ? 249  ARG B C     1 
ATOM   2977 O O     . ARG B 1 142 ? 11.073  50.031  17.655  1.00 2.49  ? 249  ARG B O     1 
ATOM   2978 C CB    . ARG B 1 142 ? 11.536  48.856  15.046  1.00 3.08  ? 249  ARG B CB    1 
ATOM   2979 C CG    . ARG B 1 142 ? 11.410  48.218  13.692  1.00 3.74  ? 249  ARG B CG    1 
ATOM   2980 C CD    . ARG B 1 142 ? 11.953  49.087  12.566  1.00 4.30  ? 249  ARG B CD    1 
ATOM   2981 N NE    . ARG B 1 142 ? 11.718  48.509  11.254  1.00 3.78  ? 249  ARG B NE    1 
ATOM   2982 C CZ    . ARG B 1 142 ? 12.467  47.566  10.707  1.00 4.24  ? 249  ARG B CZ    1 
ATOM   2983 N NH1   . ARG B 1 142 ? 13.508  47.074  11.362  1.00 4.71  ? 249  ARG B NH1   1 
ATOM   2984 N NH2   . ARG B 1 142 ? 12.180  47.109  9.501   1.00 4.07  ? 249  ARG B NH2   1 
ATOM   2985 N N     . ILE B 1 143 ? 10.677  47.923  18.343  1.00 2.56  ? 250  ILE B N     1 
ATOM   2986 C CA    . ILE B 1 143 ? 10.979  48.159  19.758  1.00 3.39  ? 250  ILE B CA    1 
ATOM   2987 C C     . ILE B 1 143 ? 12.017  47.127  20.198  1.00 3.00  ? 250  ILE B C     1 
ATOM   2988 O O     . ILE B 1 143 ? 12.290  46.165  19.491  1.00 3.29  ? 250  ILE B O     1 
ATOM   2989 C CB    . ILE B 1 143 ? 9.704   48.052  20.602  1.00 3.55  ? 250  ILE B CB    1 
ATOM   2990 C CG1   . ILE B 1 143 ? 8.932   46.773  20.256  1.00 4.88  ? 250  ILE B CG1   1 
ATOM   2991 C CG2   . ILE B 1 143 ? 8.791   49.247  20.332  1.00 4.73  ? 250  ILE B CG2   1 
ATOM   2992 C CD1   . ILE B 1 143 ? 7.736   46.541  21.165  1.00 5.95  ? 250  ILE B CD1   1 
ATOM   2993 N N     . THR B 1 144 ? 12.608  47.303  21.365  1.00 3.29  ? 251  THR B N     1 
ATOM   2994 C CA    . THR B 1 144 ? 13.655  46.366  21.767  1.00 3.11  ? 251  THR B CA    1 
ATOM   2995 C C     . THR B 1 144 ? 13.125  45.163  22.552  1.00 3.00  ? 251  THR B C     1 
ATOM   2996 O O     . THR B 1 144 ? 12.053  45.220  23.164  1.00 3.06  ? 251  THR B O     1 
ATOM   2997 C CB    . THR B 1 144 ? 14.697  47.080  22.602  1.00 3.30  ? 251  THR B CB    1 
ATOM   2998 O OG1   . THR B 1 144 ? 14.080  47.552  23.798  1.00 3.28  ? 251  THR B OG1   1 
ATOM   2999 C CG2   . THR B 1 144 ? 15.191  48.347  21.923  1.00 3.93  ? 251  THR B CG2   1 
ATOM   3000 N N     . HIS B 1 145 ? 13.884  44.069  22.527  1.00 2.64  ? 252  HIS B N     1 
ATOM   3001 C CA    . HIS B 1 145 ? 13.553  42.899  23.320  1.00 2.68  ? 252  HIS B CA    1 
ATOM   3002 C C     . HIS B 1 145 ? 13.529  43.321  24.804  1.00 3.21  ? 252  HIS B C     1 
ATOM   3003 O O     . HIS B 1 145 ? 12.691  42.857  25.579  1.00 2.70  ? 252  HIS B O     1 
ATOM   3004 C CB    . HIS B 1 145 ? 14.570  41.774  23.084  1.00 3.01  ? 252  HIS B CB    1 
ATOM   3005 C CG    . HIS B 1 145 ? 14.174  40.808  22.011  1.00 3.72  ? 252  HIS B CG    1 
ATOM   3006 N ND1   . HIS B 1 145 ? 13.231  39.826  22.211  1.00 5.52  ? 252  HIS B ND1   1 
ATOM   3007 C CD2   . HIS B 1 145 ? 14.590  40.673  20.730  1.00 5.00  ? 252  HIS B CD2   1 
ATOM   3008 C CE1   . HIS B 1 145 ? 13.057  39.145  21.088  1.00 6.23  ? 252  HIS B CE1   1 
ATOM   3009 N NE2   . HIS B 1 145 ? 13.881  39.633  20.176  1.00 5.83  ? 252  HIS B NE2   1 
ATOM   3010 N N     . GLN B 1 146 ? 14.459  44.201  25.188  1.00 3.84  ? 253  GLN B N     1 
ATOM   3011 C CA    . GLN B 1 146 ? 14.556  44.697  26.570  1.00 4.65  ? 253  GLN B CA    1 
ATOM   3012 C C     . GLN B 1 146 ? 13.229  45.289  27.049  1.00 5.40  ? 253  GLN B C     1 
ATOM   3013 O O     . GLN B 1 146 ? 12.775  45.010  28.153  1.00 4.76  ? 253  GLN B O     1 
ATOM   3014 C CB    . GLN B 1 146 ? 15.668  45.745  26.697  1.00 4.83  ? 253  GLN B CB    1 
ATOM   3015 C CG    . GLN B 1 146 ? 15.918  46.227  28.135  1.00 5.23  ? 253  GLN B CG    1 
ATOM   3016 C CD    . GLN B 1 146 ? 17.061  47.219  28.225  1.00 5.98  ? 253  GLN B CD    1 
ATOM   3017 O OE1   . GLN B 1 146 ? 17.770  47.438  27.244  1.00 6.92  ? 253  GLN B OE1   1 
ATOM   3018 N NE2   . GLN B 1 146 ? 17.242  47.819  29.395  1.00 5.54  ? 253  GLN B NE2   1 
ATOM   3019 N N     . GLU B 1 147 ? 12.612  46.102  26.199  1.00 6.45  ? 254  GLU B N     1 
ATOM   3020 C CA    . GLU B 1 147 ? 11.345  46.749  26.513  1.00 7.77  ? 254  GLU B CA    1 
ATOM   3021 C C     . GLU B 1 147 ? 10.193  45.746  26.602  1.00 8.18  ? 254  GLU B C     1 
ATOM   3022 O O     . GLU B 1 147 ? 9.381   45.800  27.527  1.00 8.17  ? 254  GLU B O     1 
ATOM   3023 C CB    . GLU B 1 147 ? 11.021  47.783  25.434  1.00 8.32  ? 254  GLU B CB    1 
ATOM   3024 C CG    . GLU B 1 147 ? 9.603   48.316  25.499  1.00 10.47 ? 254  GLU B CG    1 
ATOM   3025 C CD    . GLU B 1 147 ? 9.350   49.371  24.442  1.00 13.78 ? 254  GLU B CD    1 
ATOM   3026 O OE1   . GLU B 1 147 ? 10.362  49.867  23.884  1.00 15.77 ? 254  GLU B OE1   1 
ATOM   3027 O OE2   . GLU B 1 147 ? 8.163   49.695  24.167  1.00 14.69 ? 254  GLU B OE2   1 
ATOM   3028 N N     . VAL B 1 148 ? 10.143  44.828  25.644  1.00 8.38  ? 255  VAL B N     1 
ATOM   3029 C CA    . VAL B 1 148 ? 9.075   43.830  25.551  1.00 9.07  ? 255  VAL B CA    1 
ATOM   3030 C C     . VAL B 1 148 ? 9.119   42.771  26.646  1.00 10.14 ? 255  VAL B C     1 
ATOM   3031 O O     . VAL B 1 148 ? 8.089   42.284  27.099  1.00 9.81  ? 255  VAL B O     1 
ATOM   3032 C CB    . VAL B 1 148 ? 9.145   43.110  24.187  1.00 9.26  ? 255  VAL B CB    1 
ATOM   3033 C CG1   . VAL B 1 148 ? 8.187   41.937  24.144  1.00 9.80  ? 255  VAL B CG1   1 
ATOM   3034 C CG2   . VAL B 1 148 ? 8.815   44.079  23.052  1.00 9.23  ? 255  VAL B CG2   1 
ATOM   3035 N N     . ASP B 1 149 ? 10.325  42.395  27.052  1.00 11.17 ? 256  ASP B N     1 
ATOM   3036 C CA    . ASP B 1 149 ? 10.487  41.380  28.082  1.00 12.74 ? 256  ASP B CA    1 
ATOM   3037 C C     . ASP B 1 149 ? 10.136  41.934  29.480  1.00 14.11 ? 256  ASP B C     1 
ATOM   3038 O O     . ASP B 1 149 ? 9.771   41.160  30.368  1.00 14.79 ? 256  ASP B O     1 
ATOM   3039 C CB    . ASP B 1 149 ? 11.924  40.825  28.051  1.00 12.58 ? 256  ASP B CB    1 
ATOM   3040 C CG    . ASP B 1 149 ? 12.244  40.058  26.761  1.00 12.66 ? 256  ASP B CG    1 
ATOM   3041 O OD1   . ASP B 1 149 ? 11.364  39.918  25.854  1.00 14.91 ? 256  ASP B OD1   1 
ATOM   3042 O OD2   . ASP B 1 149 ? 13.375  39.572  26.546  1.00 10.92 ? 256  ASP B OD2   1 
ATOM   3043 N N     . SER B 1 150 ? 10.226  43.257  29.672  1.00 15.41 ? 257  SER B N     1 
ATOM   3044 C CA    . SER B 1 150 ? 9.900   43.887  30.968  1.00 16.80 ? 257  SER B CA    1 
ATOM   3045 C C     . SER B 1 150 ? 8.432   44.431  31.061  1.00 17.25 ? 257  SER B C     1 
ATOM   3046 O O     . SER B 1 150 ? 8.201   45.381  31.825  1.00 17.62 ? 257  SER B O     1 
ATOM   3047 C CB    . SER B 1 150 ? 10.937  44.986  31.334  1.00 16.98 ? 257  SER B CB    1 
ATOM   3048 O OG    . SER B 1 150 ? 10.713  46.209  30.649  1.00 18.56 ? 257  SER B OG    1 
ATOM   3049 N N     . ARG B 1 151 ? 7.480   43.815  30.315  1.00 17.89 ? 258  ARG B N     1 
ATOM   3050 C CA    . ARG B 1 151 ? 6.016   44.147  30.279  1.00 17.56 ? 258  ARG B CA    1 
ATOM   3051 C C     . ARG B 1 151 ? 5.054   42.880  30.168  1.00 18.09 ? 258  ARG B C     1 
ATOM   3052 O O     . ARG B 1 151 ? 5.526   41.780  29.872  1.00 18.55 ? 258  ARG B O     1 
ATOM   3053 C CB    . ARG B 1 151 ? 5.708   45.150  29.125  1.00 17.64 ? 258  ARG B CB    1 
ATOM   3054 C CG    . ARG B 1 151 ? 6.656   45.101  27.903  1.00 15.99 ? 258  ARG B CG    1 
ATOM   3055 C CD    . ARG B 1 151 ? 6.292   46.065  26.732  1.00 13.44 ? 258  ARG B CD    1 
ATOM   3056 N NE    . ARG B 1 151 ? 5.892   45.373  25.489  1.00 11.77 ? 258  ARG B NE    1 
ATOM   3057 C CZ    . ARG B 1 151 ? 5.577   45.977  24.332  1.00 10.49 ? 258  ARG B CZ    1 
ATOM   3058 N NH1   . ARG B 1 151 ? 5.568   47.297  24.210  1.00 9.97  ? 258  ARG B NH1   1 
ATOM   3059 N NH2   . ARG B 1 151 ? 5.233   45.253  23.277  1.00 10.43 ? 258  ARG B NH2   1 
ATOM   3060 N N     . ASP B 1 152 ? 3.728   43.061  30.365  1.00 17.96 ? 259  ASP B N     1 
ATOM   3061 C CA    . ASP B 1 152 ? 2.662   42.004  30.384  1.00 18.21 ? 259  ASP B CA    1 
ATOM   3062 C C     . ASP B 1 152 ? 2.142   41.400  29.047  1.00 17.68 ? 259  ASP B C     1 
ATOM   3063 O O     . ASP B 1 152 ? 2.220   42.053  28.021  1.00 17.68 ? 259  ASP B O     1 
ATOM   3064 C CB    . ASP B 1 152 ? 1.422   42.579  31.101  1.00 18.58 ? 259  ASP B CB    1 
ATOM   3065 C CG    . ASP B 1 152 ? 1.597   44.038  31.514  1.00 20.27 ? 259  ASP B CG    1 
ATOM   3066 O OD1   . ASP B 1 152 ? 2.706   44.608  31.315  1.00 21.41 ? 259  ASP B OD1   1 
ATOM   3067 O OD2   . ASP B 1 152 ? 0.691   44.683  32.088  1.00 21.50 ? 259  ASP B OD2   1 
ATOM   3068 N N     . TRP B 1 153 ? 1.590   40.172  29.079  1.00 17.34 ? 260  TRP B N     1 
ATOM   3069 C CA    . TRP B 1 153 ? 1.097   39.484  27.851  1.00 16.91 ? 260  TRP B CA    1 
ATOM   3070 C C     . TRP B 1 153 ? -0.050  40.185  27.226  1.00 15.88 ? 260  TRP B C     1 
ATOM   3071 O O     . TRP B 1 153 ? -0.336  39.994  26.038  1.00 16.29 ? 260  TRP B O     1 
ATOM   3072 C CB    . TRP B 1 153 ? 0.600   38.052  28.098  1.00 17.53 ? 260  TRP B CB    1 
ATOM   3073 C CG    . TRP B 1 153 ? 1.695   37.081  28.112  1.00 18.33 ? 260  TRP B CG    1 
ATOM   3074 C CD1   . TRP B 1 153 ? 2.152   36.410  29.186  1.00 19.43 ? 260  TRP B CD1   1 
ATOM   3075 C CD2   . TRP B 1 153 ? 2.514   36.685  27.003  1.00 19.24 ? 260  TRP B CD2   1 
ATOM   3076 N NE1   . TRP B 1 153 ? 3.213   35.612  28.832  1.00 20.22 ? 260  TRP B NE1   1 
ATOM   3077 C CE2   . TRP B 1 153 ? 3.446   35.756  27.489  1.00 19.71 ? 260  TRP B CE2   1 
ATOM   3078 C CE3   . TRP B 1 153 ? 2.541   37.011  25.635  1.00 19.52 ? 260  TRP B CE3   1 
ATOM   3079 C CZ2   . TRP B 1 153 ? 4.407   35.158  26.679  1.00 20.01 ? 260  TRP B CZ2   1 
ATOM   3080 C CZ3   . TRP B 1 153 ? 3.504   36.413  24.829  1.00 19.66 ? 260  TRP B CZ3   1 
ATOM   3081 C CH2   . TRP B 1 153 ? 4.425   35.499  25.361  1.00 19.61 ? 260  TRP B CH2   1 
ATOM   3082 N N     . ALA B 1 154 ? -0.767  40.936  28.040  1.00 14.45 ? 261  ALA B N     1 
ATOM   3083 C CA    . ALA B 1 154 ? -1.875  41.691  27.510  1.00 13.26 ? 261  ALA B CA    1 
ATOM   3084 C C     . ALA B 1 154 ? -1.260  42.619  26.468  1.00 11.62 ? 261  ALA B C     1 
ATOM   3085 O O     . ALA B 1 154 ? -1.924  43.031  25.531  1.00 12.15 ? 261  ALA B O     1 
ATOM   3086 C CB    . ALA B 1 154 ? -2.542  42.460  28.607  1.00 13.74 ? 261  ALA B CB    1 
ATOM   3087 N N     . LEU B 1 155 ? 0.033   42.927  26.622  1.00 9.74  ? 262  LEU B N     1 
ATOM   3088 C CA    . LEU B 1 155 ? 0.715   43.837  25.686  1.00 7.86  ? 262  LEU B CA    1 
ATOM   3089 C C     . LEU B 1 155 ? 1.524   43.135  24.595  1.00 6.60  ? 262  LEU B C     1 
ATOM   3090 O O     . LEU B 1 155 ? 1.874   43.757  23.593  1.00 5.83  ? 262  LEU B O     1 
ATOM   3091 C CB    . LEU B 1 155 ? 1.644   44.804  26.434  1.00 7.06  ? 262  LEU B CB    1 
ATOM   3092 C CG    . LEU B 1 155 ? 1.027   45.889  27.329  1.00 6.65  ? 262  LEU B CG    1 
ATOM   3093 C CD1   . LEU B 1 155 ? 2.102   46.812  27.915  1.00 6.14  ? 262  LEU B CD1   1 
ATOM   3094 C CD2   . LEU B 1 155 ? 0.007   46.723  26.595  1.00 6.22  ? 262  LEU B CD2   1 
ATOM   3095 N N     . ASN B 1 156 ? 1.820   41.852  24.781  1.00 5.71  ? 263  ASN B N     1 
ATOM   3096 C CA    . ASN B 1 156 ? 2.704   41.132  23.857  1.00 5.11  ? 263  ASN B CA    1 
ATOM   3097 C C     . ASN B 1 156 ? 2.013   40.149  22.900  1.00 4.76  ? 263  ASN B C     1 
ATOM   3098 O O     . ASN B 1 156 ? 2.609   39.173  22.450  1.00 4.61  ? 263  ASN B O     1 
ATOM   3099 C CB    . ASN B 1 156 ? 3.784   40.403  24.660  1.00 4.85  ? 263  ASN B CB    1 
ATOM   3100 C CG    . ASN B 1 156 ? 4.708   41.363  25.404  1.00 4.48  ? 263  ASN B CG    1 
ATOM   3101 O OD1   . ASN B 1 156 ? 4.665   42.571  25.183  1.00 3.33  ? 263  ASN B OD1   1 
ATOM   3102 N ND2   . ASN B 1 156 ? 5.544   40.823  26.298  1.00 5.49  ? 263  ASN B ND2   1 
ATOM   3103 N N     . GLY B 1 157 ? 0.757   40.409  22.572  1.00 4.53  ? 264  GLY B N     1 
ATOM   3104 C CA    . GLY B 1 157 ? 0.028   39.535  21.667  1.00 4.57  ? 264  GLY B CA    1 
ATOM   3105 C C     . GLY B 1 157 ? 0.583   39.489  20.247  1.00 4.33  ? 264  GLY B C     1 
ATOM   3106 O O     . GLY B 1 157 ? 0.534   38.457  19.589  1.00 3.68  ? 264  GLY B O     1 
ATOM   3107 N N     . ASN B 1 158 ? 1.149   40.600  19.788  1.00 4.26  ? 265  ASN B N     1 
ATOM   3108 C CA    . ASN B 1 158 ? 1.631   40.702  18.411  1.00 4.44  ? 265  ASN B CA    1 
ATOM   3109 C C     . ASN B 1 158 ? 3.129   40.928  18.256  1.00 4.69  ? 265  ASN B C     1 
ATOM   3110 O O     . ASN B 1 158 ? 3.594   41.298  17.176  1.00 5.24  ? 265  ASN B O     1 
ATOM   3111 C CB    . ASN B 1 158 ? 0.883   41.818  17.708  1.00 4.56  ? 265  ASN B CB    1 
ATOM   3112 C CG    . ASN B 1 158 ? -0.509  41.387  17.287  1.00 5.30  ? 265  ASN B CG    1 
ATOM   3113 O OD1   . ASN B 1 158 ? -0.891  40.227  17.480  1.00 6.00  ? 265  ASN B OD1   1 
ATOM   3114 N ND2   . ASN B 1 158 ? -1.271  42.309  16.713  1.00 4.88  ? 265  ASN B ND2   1 
ATOM   3115 N N     . THR B 1 159 ? 3.876   40.705  19.329  1.00 4.46  ? 266  THR B N     1 
ATOM   3116 C CA    . THR B 1 159 ? 5.322   40.890  19.292  1.00 4.52  ? 266  THR B CA    1 
ATOM   3117 C C     . THR B 1 159 ? 6.011   39.698  18.631  1.00 4.74  ? 266  THR B C     1 
ATOM   3118 O O     . THR B 1 159 ? 5.714   38.534  18.944  1.00 5.07  ? 266  THR B O     1 
ATOM   3119 C CB    . THR B 1 159 ? 5.850   41.107  20.704  1.00 4.42  ? 266  THR B CB    1 
ATOM   3120 O OG1   . THR B 1 159 ? 5.327   40.098  21.575  1.00 3.71  ? 266  THR B OG1   1 
ATOM   3121 C CG2   . THR B 1 159 ? 5.304   42.385  21.274  1.00 5.01  ? 266  THR B CG2   1 
ATOM   3122 N N     . LEU B 1 160 ? 6.904   40.003  17.692  1.00 4.57  ? 267  LEU B N     1 
ATOM   3123 C CA    . LEU B 1 160 ? 7.636   38.998  16.942  1.00 4.83  ? 267  LEU B CA    1 
ATOM   3124 C C     . LEU B 1 160 ? 9.112   39.376  16.937  1.00 4.66  ? 267  LEU B C     1 
ATOM   3125 O O     . LEU B 1 160 ? 9.455   40.508  16.622  1.00 4.34  ? 267  LEU B O     1 
ATOM   3126 C CB    . LEU B 1 160 ? 7.129   38.919  15.500  1.00 4.92  ? 267  LEU B CB    1 
ATOM   3127 C CG    . LEU B 1 160 ? 7.935   38.046  14.523  1.00 5.61  ? 267  LEU B CG    1 
ATOM   3128 C CD1   . LEU B 1 160 ? 7.926   36.566  14.912  1.00 6.32  ? 267  LEU B CD1   1 
ATOM   3129 C CD2   . LEU B 1 160 ? 7.419   38.215  13.113  1.00 6.57  ? 267  LEU B CD2   1 
ATOM   3130 N N     . SER B 1 161 ? 9.978   38.434  17.295  1.00 4.78  ? 268  SER B N     1 
ATOM   3131 C CA    . SER B 1 161 ? 11.419  38.688  17.261  1.00 5.13  ? 268  SER B CA    1 
ATOM   3132 C C     . SER B 1 161 ? 11.894  38.951  15.828  1.00 5.57  ? 268  SER B C     1 
ATOM   3133 O O     . SER B 1 161 ? 11.570  38.181  14.923  1.00 5.55  ? 268  SER B O     1 
ATOM   3134 C CB    . SER B 1 161 ? 12.172  37.485  17.819  1.00 5.40  ? 268  SER B CB    1 
ATOM   3135 O OG    . SER B 1 161 ? 13.508  37.823  18.141  1.00 6.20  ? 268  SER B OG    1 
ATOM   3136 N N     . LEU B 1 162 ? 12.644  40.035  15.626  1.00 6.08  ? 269  LEU B N     1 
ATOM   3137 C CA    . LEU B 1 162 ? 13.239  40.355  14.325  1.00 6.84  ? 269  LEU B CA    1 
ATOM   3138 C C     . LEU B 1 162 ? 14.688  39.857  14.322  1.00 7.52  ? 269  LEU B C     1 
ATOM   3139 O O     . LEU B 1 162 ? 15.096  39.081  13.456  1.00 7.56  ? 269  LEU B O     1 
ATOM   3140 C CB    . LEU B 1 162 ? 13.220  41.868  14.083  1.00 7.02  ? 269  LEU B CB    1 
ATOM   3141 C CG    . LEU B 1 162 ? 13.221  42.408  12.644  1.00 8.63  ? 269  LEU B CG    1 
ATOM   3142 C CD1   . LEU B 1 162 ? 14.258  43.523  12.585  1.00 8.77  ? 269  LEU B CD1   1 
ATOM   3143 C CD2   . LEU B 1 162 ? 13.492  41.360  11.570  1.00 8.67  ? 269  LEU B CD2   1 
ATOM   3144 N N     . ASP B 1 163 ? 15.453  40.336  15.299  1.00 7.75  ? 270  ASP B N     1 
ATOM   3145 C CA    . ASP B 1 163 ? 16.846  39.924  15.512  1.00 8.48  ? 270  ASP B CA    1 
ATOM   3146 C C     . ASP B 1 163 ? 17.097  39.876  17.015  1.00 8.58  ? 270  ASP B C     1 
ATOM   3147 O O     . ASP B 1 163 ? 16.151  39.893  17.803  1.00 8.44  ? 270  ASP B O     1 
ATOM   3148 C CB    . ASP B 1 163 ? 17.842  40.847  14.795  1.00 8.90  ? 270  ASP B CB    1 
ATOM   3149 C CG    . ASP B 1 163 ? 17.635  42.314  15.105  1.00 10.36 ? 270  ASP B CG    1 
ATOM   3150 O OD1   . ASP B 1 163 ? 17.300  42.653  16.255  1.00 11.90 ? 270  ASP B OD1   1 
ATOM   3151 O OD2   . ASP B 1 163 ? 17.805  43.207  14.242  1.00 11.93 ? 270  ASP B OD2   1 
ATOM   3152 N N     . GLU B 1 164 ? 18.368  39.823  17.416  1.00 8.71  ? 271  GLU B N     1 
ATOM   3153 C CA    . GLU B 1 164 ? 18.724  39.725  18.819  1.00 9.02  ? 271  GLU B CA    1 
ATOM   3154 C C     . GLU B 1 164 ? 18.279  40.938  19.627  1.00 8.47  ? 271  GLU B C     1 
ATOM   3155 O O     . GLU B 1 164 ? 17.883  40.810  20.782  1.00 8.81  ? 271  GLU B O     1 
ATOM   3156 C CB    . GLU B 1 164 ? 20.242  39.566  18.940  1.00 9.51  ? 271  GLU B CB    1 
ATOM   3157 C CG    . GLU B 1 164 ? 20.650  38.471  19.896  1.00 11.46 ? 271  GLU B CG    1 
ATOM   3158 C CD    . GLU B 1 164 ? 22.141  38.204  19.879  1.00 14.28 ? 271  GLU B CD    1 
ATOM   3159 O OE1   . GLU B 1 164 ? 22.907  39.082  19.411  1.00 16.48 ? 271  GLU B OE1   1 
ATOM   3160 O OE2   . GLU B 1 164 ? 22.550  37.113  20.342  1.00 15.27 ? 271  GLU B OE2   1 
ATOM   3161 N N     . GLU B 1 165 ? 18.347  42.111  19.009  1.00 8.01  ? 272  GLU B N     1 
ATOM   3162 C CA    . GLU B 1 165 ? 18.069  43.379  19.687  1.00 7.42  ? 272  GLU B CA    1 
ATOM   3163 C C     . GLU B 1 165 ? 16.621  43.840  19.613  1.00 7.06  ? 272  GLU B C     1 
ATOM   3164 O O     . GLU B 1 165 ? 16.092  44.370  20.597  1.00 6.76  ? 272  GLU B O     1 
ATOM   3165 C CB    . GLU B 1 165 ? 18.960  44.476  19.081  1.00 7.35  ? 272  GLU B CB    1 
ATOM   3166 C CG    . GLU B 1 165 ? 18.598  45.906  19.480  1.00 7.49  ? 272  GLU B CG    1 
ATOM   3167 C CD    . GLU B 1 165 ? 19.113  46.306  20.854  1.00 8.18  ? 272  GLU B CD    1 
ATOM   3168 O OE1   . GLU B 1 165 ? 19.774  45.481  21.523  1.00 8.71  ? 272  GLU B OE1   1 
ATOM   3169 O OE2   . GLU B 1 165 ? 18.864  47.461  21.267  1.00 8.79  ? 272  GLU B OE2   1 
ATOM   3170 N N     . THR B 1 166 ? 15.994  43.612  18.458  1.00 6.29  ? 273  THR B N     1 
ATOM   3171 C CA    . THR B 1 166 ? 14.688  44.195  18.127  1.00 6.20  ? 273  THR B CA    1 
ATOM   3172 C C     . THR B 1 166 ? 13.509  43.249  17.958  1.00 5.03  ? 273  THR B C     1 
ATOM   3173 O O     . THR B 1 166 ? 13.640  42.109  17.516  1.00 4.64  ? 273  THR B O     1 
ATOM   3174 C CB    . THR B 1 166 ? 14.854  44.988  16.829  1.00 6.27  ? 273  THR B CB    1 
ATOM   3175 O OG1   . THR B 1 166 ? 15.973  45.885  16.970  1.00 8.60  ? 273  THR B OG1   1 
ATOM   3176 C CG2   . THR B 1 166 ? 13.654  45.901  16.557  1.00 7.42  ? 273  THR B CG2   1 
ATOM   3177 N N     . VAL B 1 167 ? 12.345  43.775  18.318  1.00 4.51  ? 274  VAL B N     1 
ATOM   3178 C CA    . VAL B 1 167 ? 11.070  43.090  18.159  1.00 3.79  ? 274  VAL B CA    1 
ATOM   3179 C C     . VAL B 1 167 ? 10.197  43.915  17.217  1.00 3.99  ? 274  VAL B C     1 
ATOM   3180 O O     . VAL B 1 167 ? 10.269  45.141  17.232  1.00 4.01  ? 274  VAL B O     1 
ATOM   3181 C CB    . VAL B 1 167 ? 10.344  42.974  19.513  1.00 3.54  ? 274  VAL B CB    1 
ATOM   3182 C CG1   . VAL B 1 167 ? 8.898   42.516  19.336  1.00 4.18  ? 274  VAL B CG1   1 
ATOM   3183 C CG2   . VAL B 1 167 ? 11.094  42.015  20.436  1.00 3.53  ? 274  VAL B CG2   1 
ATOM   3184 N N     . ILE B 1 168 ? 9.398   43.234  16.395  1.00 3.60  ? 275  ILE B N     1 
ATOM   3185 C CA    . ILE B 1 168 ? 8.404   43.885  15.557  1.00 4.04  ? 275  ILE B CA    1 
ATOM   3186 C C     . ILE B 1 168 ? 7.081   43.695  16.290  1.00 3.42  ? 275  ILE B C     1 
ATOM   3187 O O     . ILE B 1 168 ? 6.768   42.587  16.709  1.00 3.63  ? 275  ILE B O     1 
ATOM   3188 C CB    . ILE B 1 168 ? 8.332   43.236  14.156  1.00 4.30  ? 275  ILE B CB    1 
ATOM   3189 C CG1   . ILE B 1 168 ? 9.621   43.496  13.380  1.00 5.61  ? 275  ILE B CG1   1 
ATOM   3190 C CG2   . ILE B 1 168 ? 7.138   43.767  13.391  1.00 5.00  ? 275  ILE B CG2   1 
ATOM   3191 C CD1   . ILE B 1 168 ? 10.062  44.927  13.402  1.00 7.46  ? 275  ILE B CD1   1 
ATOM   3192 N N     . ASP B 1 169 ? 6.317   44.767  16.462  1.00 3.20  ? 276  ASP B N     1 
ATOM   3193 C CA    . ASP B 1 169 ? 5.054   44.691  17.182  1.00 2.97  ? 276  ASP B CA    1 
ATOM   3194 C C     . ASP B 1 169 ? 3.951   45.411  16.410  1.00 2.67  ? 276  ASP B C     1 
ATOM   3195 O O     . ASP B 1 169 ? 4.210   46.363  15.678  1.00 2.54  ? 276  ASP B O     1 
ATOM   3196 C CB    . ASP B 1 169 ? 5.214   45.317  18.575  1.00 3.06  ? 276  ASP B CB    1 
ATOM   3197 C CG    . ASP B 1 169 ? 4.036   45.029  19.497  1.00 3.99  ? 276  ASP B CG    1 
ATOM   3198 O OD1   . ASP B 1 169 ? 3.230   44.108  19.207  1.00 4.55  ? 276  ASP B OD1   1 
ATOM   3199 O OD2   . ASP B 1 169 ? 3.838   45.691  20.542  1.00 4.24  ? 276  ASP B OD2   1 
ATOM   3200 N N     . VAL B 1 170 ? 2.724   44.930  16.562  1.00 2.50  ? 277  VAL B N     1 
ATOM   3201 C CA    . VAL B 1 170 ? 1.565   45.599  15.986  1.00 2.52  ? 277  VAL B CA    1 
ATOM   3202 C C     . VAL B 1 170 ? 0.615   45.886  17.135  1.00 2.63  ? 277  VAL B C     1 
ATOM   3203 O O     . VAL B 1 170 ? -0.342  45.161  17.363  1.00 2.97  ? 277  VAL B O     1 
ATOM   3204 C CB    . VAL B 1 170 ? 0.899   44.746  14.906  1.00 2.47  ? 277  VAL B CB    1 
ATOM   3205 C CG1   . VAL B 1 170 ? -0.331  45.460  14.326  1.00 2.54  ? 277  VAL B CG1   1 
ATOM   3206 C CG2   . VAL B 1 170 ? 1.899   44.470  13.819  1.00 2.30  ? 277  VAL B CG2   1 
ATOM   3207 N N     . PRO B 1 171 ? 0.907   46.948  17.868  1.00 3.13  ? 278  PRO B N     1 
ATOM   3208 C CA    . PRO B 1 171 ? 0.136   47.333  19.042  1.00 3.23  ? 278  PRO B CA    1 
ATOM   3209 C C     . PRO B 1 171 ? -1.189  47.957  18.685  1.00 3.09  ? 278  PRO B C     1 
ATOM   3210 O O     . PRO B 1 171 ? -1.465  48.272  17.518  1.00 2.82  ? 278  PRO B O     1 
ATOM   3211 C CB    . PRO B 1 171 ? 0.994   48.415  19.694  1.00 3.57  ? 278  PRO B CB    1 
ATOM   3212 C CG    . PRO B 1 171 ? 2.100   48.708  18.772  1.00 4.22  ? 278  PRO B CG    1 
ATOM   3213 C CD    . PRO B 1 171 ? 2.004   47.878  17.603  1.00 3.26  ? 278  PRO B CD    1 
ATOM   3214 N N     . GLU B 1 172 ? -1.993  48.167  19.714  1.00 2.96  ? 279  GLU B N     1 
ATOM   3215 C CA    . GLU B 1 172 ? -3.281  48.816  19.557  1.00 3.28  ? 279  GLU B CA    1 
ATOM   3216 C C     . GLU B 1 172 ? -3.003  50.213  19.077  1.00 3.37  ? 279  GLU B C     1 
ATOM   3217 O O     . GLU B 1 172 ? -2.102  50.857  19.623  1.00 3.41  ? 279  GLU B O     1 
ATOM   3218 C CB    . GLU B 1 172 ? -3.945  48.986  20.912  1.00 3.09  ? 279  GLU B CB    1 
ATOM   3219 C CG    . GLU B 1 172 ? -4.711  47.801  21.439  1.00 3.73  ? 279  GLU B CG    1 
ATOM   3220 C CD    . GLU B 1 172 ? -5.900  47.426  20.585  1.00 4.76  ? 279  GLU B CD    1 
ATOM   3221 O OE1   . GLU B 1 172 ? -6.296  46.248  20.647  1.00 5.28  ? 279  GLU B OE1   1 
ATOM   3222 O OE2   . GLU B 1 172 ? -6.434  48.293  19.855  1.00 4.29  ? 279  GLU B OE2   1 
ATOM   3223 N N     . PRO B 1 173 ? -3.731  50.812  18.148  1.00 3.53  ? 280  PRO B N     1 
ATOM   3224 C CA    . PRO B 1 173 ? -4.902  50.407  17.361  1.00 3.56  ? 280  PRO B CA    1 
ATOM   3225 C C     . PRO B 1 173 ? -4.644  49.615  16.095  1.00 3.42  ? 280  PRO B C     1 
ATOM   3226 O O     . PRO B 1 173 ? -5.583  49.183  15.391  1.00 3.25  ? 280  PRO B O     1 
ATOM   3227 C CB    . PRO B 1 173 ? -5.407  51.771  16.855  1.00 3.55  ? 280  PRO B CB    1 
ATOM   3228 C CG    . PRO B 1 173 ? -4.302  52.776  17.152  1.00 4.60  ? 280  PRO B CG    1 
ATOM   3229 C CD    . PRO B 1 173 ? -3.304  52.178  17.898  1.00 3.51  ? 280  PRO B CD    1 
ATOM   3230 N N     . TYR B 1 174 ? -3.372  49.480  15.778  1.00 2.87  ? 281  TYR B N     1 
ATOM   3231 C CA    . TYR B 1 174 ? -2.927  48.908  14.524  1.00 3.12  ? 281  TYR B CA    1 
ATOM   3232 C C     . TYR B 1 174 ? -3.249  47.434  14.308  1.00 2.74  ? 281  TYR B C     1 
ATOM   3233 O O     . TYR B 1 174 ? -3.066  46.928  13.206  1.00 2.66  ? 281  TYR B O     1 
ATOM   3234 C CB    . TYR B 1 174 ? -1.436  49.161  14.401  1.00 3.12  ? 281  TYR B CB    1 
ATOM   3235 C CG    . TYR B 1 174 ? -1.087  50.620  14.624  1.00 4.62  ? 281  TYR B CG    1 
ATOM   3236 C CD1   . TYR B 1 174 ? -0.172  50.995  15.599  1.00 6.09  ? 281  TYR B CD1   1 
ATOM   3237 C CD2   . TYR B 1 174 ? -1.682  51.619  13.878  1.00 6.10  ? 281  TYR B CD2   1 
ATOM   3238 C CE1   . TYR B 1 174 ? 0.148   52.324  15.805  1.00 7.28  ? 281  TYR B CE1   1 
ATOM   3239 C CE2   . TYR B 1 174 ? -1.370  52.952  14.081  1.00 6.98  ? 281  TYR B CE2   1 
ATOM   3240 C CZ    . TYR B 1 174 ? -0.453  53.295  15.045  1.00 8.46  ? 281  TYR B CZ    1 
ATOM   3241 O OH    . TYR B 1 174 ? -0.138  54.617  15.254  1.00 11.02 ? 281  TYR B OH    1 
ATOM   3242 N N     . ASN B 1 175 ? -3.730  46.758  15.345  1.00 2.70  ? 282  ASN B N     1 
ATOM   3243 C CA    . ASN B 1 175 ? -4.090  45.353  15.242  1.00 3.18  ? 282  ASN B CA    1 
ATOM   3244 C C     . ASN B 1 175 ? -5.497  45.218  14.664  1.00 3.20  ? 282  ASN B C     1 
ATOM   3245 O O     . ASN B 1 175 ? -6.055  44.122  14.632  1.00 3.77  ? 282  ASN B O     1 
ATOM   3246 C CB    . ASN B 1 175 ? -3.981  44.646  16.599  1.00 3.29  ? 282  ASN B CB    1 
ATOM   3247 C CG    . ASN B 1 175 ? -4.803  45.319  17.675  1.00 4.35  ? 282  ASN B CG    1 
ATOM   3248 O OD1   . ASN B 1 175 ? -4.753  46.537  17.845  1.00 3.81  ? 282  ASN B OD1   1 
ATOM   3249 N ND2   . ASN B 1 175 ? -5.597  44.528  18.388  1.00 6.73  ? 282  ASN B ND2   1 
ATOM   3250 N N     . HIS B 1 176 ? -6.066  46.348  14.230  1.00 2.89  ? 283  HIS B N     1 
ATOM   3251 C CA    . HIS B 1 176 ? -7.382  46.397  13.575  1.00 3.02  ? 283  HIS B CA    1 
ATOM   3252 C C     . HIS B 1 176 ? -7.177  46.949  12.166  1.00 3.22  ? 283  HIS B C     1 
ATOM   3253 O O     . HIS B 1 176 ? -6.546  47.996  11.987  1.00 3.11  ? 283  HIS B O     1 
ATOM   3254 C CB    . HIS B 1 176 ? -8.348  47.283  14.358  1.00 2.56  ? 283  HIS B CB    1 
ATOM   3255 C CG    . HIS B 1 176 ? -8.415  46.950  15.814  1.00 3.47  ? 283  HIS B CG    1 
ATOM   3256 N ND1   . HIS B 1 176 ? -9.292  46.018  16.325  1.00 3.37  ? 283  HIS B ND1   1 
ATOM   3257 C CD2   . HIS B 1 176 ? -7.686  47.397  16.866  1.00 3.16  ? 283  HIS B CD2   1 
ATOM   3258 C CE1   . HIS B 1 176 ? -9.107  45.913  17.629  1.00 3.62  ? 283  HIS B CE1   1 
ATOM   3259 N NE2   . HIS B 1 176 ? -8.145  46.747  17.984  1.00 3.00  ? 283  HIS B NE2   1 
ATOM   3260 N N     . VAL B 1 177 ? -7.717  46.253  11.168  1.00 3.66  ? 284  VAL B N     1 
ATOM   3261 C CA    . VAL B 1 177 ? -7.530  46.615  9.772   1.00 4.19  ? 284  VAL B CA    1 
ATOM   3262 C C     . VAL B 1 177 ? -8.071  48.002  9.410   1.00 3.81  ? 284  VAL B C     1 
ATOM   3263 O O     . VAL B 1 177 ? -7.665  48.589  8.407   1.00 4.23  ? 284  VAL B O     1 
ATOM   3264 C CB    . VAL B 1 177 ? -8.187  45.559  8.866   1.00 4.82  ? 284  VAL B CB    1 
ATOM   3265 C CG1   . VAL B 1 177 ? -8.233  46.032  7.455   1.00 6.72  ? 284  VAL B CG1   1 
ATOM   3266 C CG2   . VAL B 1 177 ? -7.441  44.233  8.986   1.00 5.49  ? 284  VAL B CG2   1 
ATOM   3267 N N     . SER B 1 178 ? -8.998  48.512  10.213  1.00 3.18  ? 285  SER B N     1 
ATOM   3268 C CA    . SER B 1 178 ? -9.544  49.841  10.010  1.00 2.89  ? 285  SER B CA    1 
ATOM   3269 C C     . SER B 1 178 ? -8.544  50.937  10.332  1.00 2.59  ? 285  SER B C     1 
ATOM   3270 O O     . SER B 1 178 ? -8.758  52.079  9.948   1.00 2.42  ? 285  SER B O     1 
ATOM   3271 C CB    . SER B 1 178 ? -10.809 50.038  10.843  1.00 3.22  ? 285  SER B CB    1 
ATOM   3272 O OG    . SER B 1 178 ? -10.577 49.725  12.198  1.00 2.69  ? 285  SER B OG    1 
ATOM   3273 N N     . LYS B 1 179 ? -7.472  50.591  11.061  1.00 2.69  ? 286  LYS B N     1 
ATOM   3274 C CA    . LYS B 1 179 ? -6.422  51.546  11.403  1.00 2.87  ? 286  LYS B CA    1 
ATOM   3275 C C     . LYS B 1 179 ? -5.069  51.198  10.784  1.00 2.77  ? 286  LYS B C     1 
ATOM   3276 O O     . LYS B 1 179 ? -4.179  52.046  10.721  1.00 2.44  ? 286  LYS B O     1 
ATOM   3277 C CB    . LYS B 1 179 ? -6.247  51.631  12.927  1.00 3.08  ? 286  LYS B CB    1 
ATOM   3278 C CG    . LYS B 1 179 ? -7.418  52.274  13.647  1.00 4.46  ? 286  LYS B CG    1 
ATOM   3279 C CD    . LYS B 1 179 ? -7.538  53.746  13.323  1.00 7.55  ? 286  LYS B CD    1 
ATOM   3280 C CE    . LYS B 1 179 ? -8.757  54.352  13.999  1.00 9.31  ? 286  LYS B CE    1 
ATOM   3281 N NZ    . LYS B 1 179 ? -9.250  55.554  13.317  1.00 9.88  ? 286  LYS B NZ    1 
ATOM   3282 N N     . TYR B 1 180 ? -4.905  49.958  10.337  1.00 2.65  ? 287  TYR B N     1 
ATOM   3283 C CA    . TYR B 1 180 ? -3.640  49.543  9.737   1.00 2.77  ? 287  TYR B CA    1 
ATOM   3284 C C     . TYR B 1 180 ? -3.842  48.321  8.861   1.00 2.58  ? 287  TYR B C     1 
ATOM   3285 O O     . TYR B 1 180 ? -4.306  47.288  9.334   1.00 2.71  ? 287  TYR B O     1 
ATOM   3286 C CB    . TYR B 1 180 ? -2.580  49.246  10.817  1.00 2.58  ? 287  TYR B CB    1 
ATOM   3287 C CG    . TYR B 1 180 ? -1.264  48.764  10.237  1.00 2.27  ? 287  TYR B CG    1 
ATOM   3288 C CD1   . TYR B 1 180 ? -0.364  49.655  9.668   1.00 2.23  ? 287  TYR B CD1   1 
ATOM   3289 C CD2   . TYR B 1 180 ? -0.945  47.419  10.218  1.00 2.37  ? 287  TYR B CD2   1 
ATOM   3290 C CE1   . TYR B 1 180 ? 0.817   49.221  9.106   1.00 2.07  ? 287  TYR B CE1   1 
ATOM   3291 C CE2   . TYR B 1 180 ? 0.231   46.974  9.649   1.00 2.56  ? 287  TYR B CE2   1 
ATOM   3292 C CZ    . TYR B 1 180 ? 1.111   47.881  9.101   1.00 2.29  ? 287  TYR B CZ    1 
ATOM   3293 O OH    . TYR B 1 180 ? 2.282   47.437  8.541   1.00 2.84  ? 287  TYR B OH    1 
ATOM   3294 N N     . CYS B 1 181 ? -3.472  48.437  7.589   1.00 2.69  ? 288  CYS B N     1 
ATOM   3295 C CA    . CYS B 1 181 ? -3.574  47.330  6.652   1.00 3.11  ? 288  CYS B CA    1 
ATOM   3296 C C     . CYS B 1 181 ? -2.421  47.324  5.643   1.00 2.97  ? 288  CYS B C     1 
ATOM   3297 O O     . CYS B 1 181 ? -2.509  46.676  4.606   1.00 3.31  ? 288  CYS B O     1 
ATOM   3298 C CB    . CYS B 1 181 ? -4.903  47.387  5.914   1.00 3.08  ? 288  CYS B CB    1 
ATOM   3299 S SG    . CYS B 1 181 ? -5.110  48.867  4.914   1.00 4.83  ? 288  CYS B SG    1 
ATOM   3300 N N     . ALA B 1 182 ? -1.353  48.052  5.948   1.00 2.71  ? 289  ALA B N     1 
ATOM   3301 C CA    . ALA B 1 182 ? -0.169  48.106  5.089   1.00 2.55  ? 289  ALA B CA    1 
ATOM   3302 C C     . ALA B 1 182 ? 0.450   46.717  4.956   1.00 2.32  ? 289  ALA B C     1 
ATOM   3303 O O     . ALA B 1 182 ? 0.979   46.367  3.910   1.00 2.24  ? 289  ALA B O     1 
ATOM   3304 C CB    . ALA B 1 182 ? 0.838   49.078  5.656   1.00 2.88  ? 289  ALA B CB    1 
ATOM   3305 N N     . SER B 1 183 ? 0.416   45.953  6.044   1.00 2.20  ? 290  SER B N     1 
ATOM   3306 C CA    . SER B 1 183 ? 0.876   44.565  6.051   1.00 2.32  ? 290  SER B CA    1 
ATOM   3307 C C     . SER B 1 183 ? -0.101  43.791  6.922   1.00 2.31  ? 290  SER B C     1 
ATOM   3308 O O     . SER B 1 183 ? -0.762  44.383  7.767   1.00 2.47  ? 290  SER B O     1 
ATOM   3309 C CB    . SER B 1 183 ? 2.299   44.444  6.579   1.00 2.25  ? 290  SER B CB    1 
ATOM   3310 O OG    . SER B 1 183 ? 2.382   44.832  7.945   1.00 2.07  ? 290  SER B OG    1 
ATOM   3311 N N     . LEU B 1 184 ? -0.174  42.476  6.745   1.00 2.43  ? 291  LEU B N     1 
ATOM   3312 C CA    . LEU B 1 184 ? -1.200  41.671  7.408   1.00 2.36  ? 291  LEU B CA    1 
ATOM   3313 C C     . LEU B 1 184 ? -0.684  40.423  8.125   1.00 2.38  ? 291  LEU B C     1 
ATOM   3314 O O     . LEU B 1 184 ? -1.472  39.623  8.618   1.00 2.55  ? 291  LEU B O     1 
ATOM   3315 C CB    . LEU B 1 184 ? -2.260  41.272  6.368   1.00 2.46  ? 291  LEU B CB    1 
ATOM   3316 C CG    . LEU B 1 184 ? -2.979  42.444  5.667   1.00 2.71  ? 291  LEU B CG    1 
ATOM   3317 C CD1   . LEU B 1 184 ? -3.766  41.975  4.438   1.00 2.64  ? 291  LEU B CD1   1 
ATOM   3318 C CD2   . LEU B 1 184 ? -3.914  43.183  6.618   1.00 3.03  ? 291  LEU B CD2   1 
ATOM   3319 N N     . GLY B 1 185 ? 0.632   40.264  8.219   1.00 2.14  ? 292  GLY B N     1 
ATOM   3320 C CA    . GLY B 1 185 ? 1.198   39.069  8.806   1.00 2.16  ? 292  GLY B CA    1 
ATOM   3321 C C     . GLY B 1 185 ? 0.748   38.788  10.235  1.00 2.16  ? 292  GLY B C     1 
ATOM   3322 O O     . GLY B 1 185 ? 0.642   37.635  10.633  1.00 2.34  ? 292  GLY B O     1 
ATOM   3323 N N     . HIS B 1 186 ? 0.486   39.847  10.994  1.00 2.15  ? 293  HIS B N     1 
ATOM   3324 C CA    . HIS B 1 186 ? 0.056   39.743  12.385  1.00 2.30  ? 293  HIS B CA    1 
ATOM   3325 C C     . HIS B 1 186 ? -1.344  39.152  12.539  1.00 2.36  ? 293  HIS B C     1 
ATOM   3326 O O     . HIS B 1 186 ? -1.779  38.888  13.658  1.00 2.32  ? 293  HIS B O     1 
ATOM   3327 C CB    . HIS B 1 186 ? 0.074   41.129  13.022  1.00 2.34  ? 293  HIS B CB    1 
ATOM   3328 C CG    . HIS B 1 186 ? -0.809  42.117  12.329  1.00 2.39  ? 293  HIS B CG    1 
ATOM   3329 N ND1   . HIS B 1 186 ? -0.505  42.651  11.094  1.00 2.49  ? 293  HIS B ND1   1 
ATOM   3330 C CD2   . HIS B 1 186 ? -1.996  42.658  12.691  1.00 3.05  ? 293  HIS B CD2   1 
ATOM   3331 C CE1   . HIS B 1 186 ? -1.467  43.481  10.729  1.00 2.63  ? 293  HIS B CE1   1 
ATOM   3332 N NE2   . HIS B 1 186 ? -2.391  43.491  11.671  1.00 2.82  ? 293  HIS B NE2   1 
ATOM   3333 N N     . LYS B 1 187 ? -2.063  38.973  11.428  1.00 2.27  ? 294  LYS B N     1 
ATOM   3334 C CA    . LYS B 1 187 ? -3.415  38.408  11.485  1.00 2.18  ? 294  LYS B CA    1 
ATOM   3335 C C     . LYS B 1 187 ? -3.400  36.867  11.414  1.00 2.42  ? 294  LYS B C     1 
ATOM   3336 O O     . LYS B 1 187 ? -4.415  36.220  11.655  1.00 2.53  ? 294  LYS B O     1 
ATOM   3337 C CB    . LYS B 1 187 ? -4.334  39.001  10.379  1.00 2.29  ? 294  LYS B CB    1 
ATOM   3338 C CG    . LYS B 1 187 ? -4.834  40.429  10.691  1.00 2.13  ? 294  LYS B CG    1 
ATOM   3339 C CD    . LYS B 1 187 ? -5.957  40.452  11.716  1.00 2.16  ? 294  LYS B CD    1 
ATOM   3340 C CE    . LYS B 1 187 ? -6.124  41.822  12.392  1.00 2.67  ? 294  LYS B CE    1 
ATOM   3341 N NZ    . LYS B 1 187 ? -7.199  41.831  13.435  1.00 2.08  ? 294  LYS B NZ    1 
ATOM   3342 N N     . ALA B 1 188 ? -2.249  36.275  11.106  1.00 2.48  ? 295  ALA B N     1 
ATOM   3343 C CA    . ALA B 1 188 ? -2.165  34.819  11.037  1.00 2.47  ? 295  ALA B CA    1 
ATOM   3344 C C     . ALA B 1 188 ? -2.144  34.209  12.453  1.00 2.47  ? 295  ALA B C     1 
ATOM   3345 O O     . ALA B 1 188 ? -1.277  34.537  13.289  1.00 2.38  ? 295  ALA B O     1 
ATOM   3346 C CB    . ALA B 1 188 ? -0.958  34.395  10.237  1.00 2.57  ? 295  ALA B CB    1 
ATOM   3347 N N     . ASN B 1 189 ? -3.121  33.341  12.711  1.00 2.35  ? 296  ASN B N     1 
ATOM   3348 C CA    . ASN B 1 189 ? -3.278  32.671  13.995  1.00 2.41  ? 296  ASN B CA    1 
ATOM   3349 C C     . ASN B 1 189 ? -2.298  31.524  14.167  1.00 2.36  ? 296  ASN B C     1 
ATOM   3350 O O     . ASN B 1 189 ? -1.648  31.072  13.218  1.00 2.31  ? 296  ASN B O     1 
ATOM   3351 C CB    . ASN B 1 189 ? -4.716  32.186  14.168  1.00 2.80  ? 296  ASN B CB    1 
ATOM   3352 C CG    . ASN B 1 189 ? -5.645  33.300  14.599  1.00 3.02  ? 296  ASN B CG    1 
ATOM   3353 O OD1   . ASN B 1 189 ? -5.270  34.174  15.383  1.00 2.70  ? 296  ASN B OD1   1 
ATOM   3354 N ND2   . ASN B 1 189 ? -6.854  33.290  14.078  1.00 4.69  ? 296  ASN B ND2   1 
ATOM   3355 N N     . HIS B 1 190 ? -2.198  31.046  15.394  1.00 2.19  ? 297  HIS B N     1 
ATOM   3356 C CA    . HIS B 1 190 ? -1.270  29.987  15.696  1.00 2.28  ? 297  HIS B CA    1 
ATOM   3357 C C     . HIS B 1 190 ? -1.809  28.585  15.485  1.00 2.22  ? 297  HIS B C     1 
ATOM   3358 O O     . HIS B 1 190 ? -2.954  28.300  15.801  1.00 2.57  ? 297  HIS B O     1 
ATOM   3359 C CB    . HIS B 1 190 ? -0.852  30.053  17.160  1.00 2.12  ? 297  HIS B CB    1 
ATOM   3360 C CG    . HIS B 1 190 ? -0.206  28.789  17.616  1.00 2.65  ? 297  HIS B CG    1 
ATOM   3361 N ND1   . HIS B 1 190 ? 1.131   28.530  17.408  1.00 2.69  ? 297  HIS B ND1   1 
ATOM   3362 C CD2   . HIS B 1 190 ? -0.719  27.680  18.200  1.00 2.94  ? 297  HIS B CD2   1 
ATOM   3363 C CE1   . HIS B 1 190 ? 1.418   27.325  17.865  1.00 2.47  ? 297  HIS B CE1   1 
ATOM   3364 N NE2   . HIS B 1 190 ? 0.317   26.792  18.361  1.00 2.46  ? 297  HIS B NE2   1 
ATOM   3365 N N     . SER B 1 191 ? -0.954  27.707  14.978  1.00 2.16  ? 298  SER B N     1 
ATOM   3366 C CA    . SER B 1 191 ? -1.245  26.287  14.939  1.00 2.19  ? 298  SER B CA    1 
ATOM   3367 C C     . SER B 1 191 ? 0.013   25.481  15.301  1.00 2.27  ? 298  SER B C     1 
ATOM   3368 O O     . SER B 1 191 ? 1.141   25.884  14.983  1.00 2.27  ? 298  SER B O     1 
ATOM   3369 C CB    . SER B 1 191 ? -1.726  25.857  13.563  1.00 2.24  ? 298  SER B CB    1 
ATOM   3370 O OG    . SER B 1 191 ? -1.975  24.461  13.583  1.00 2.41  ? 298  SER B OG    1 
ATOM   3371 N N     . PHE B 1 192 ? -0.183  24.348  15.974  1.00 2.54  ? 299  PHE B N     1 
ATOM   3372 C CA    . PHE B 1 192 ? 0.909   23.420  16.234  1.00 2.69  ? 299  PHE B CA    1 
ATOM   3373 C C     . PHE B 1 192 ? 1.139   22.510  15.020  1.00 2.79  ? 299  PHE B C     1 
ATOM   3374 O O     . PHE B 1 192 ? 2.096   21.745  14.987  1.00 2.61  ? 299  PHE B O     1 
ATOM   3375 C CB    . PHE B 1 192 ? 0.663   22.614  17.512  1.00 2.99  ? 299  PHE B CB    1 
ATOM   3376 C CG    . PHE B 1 192 ? 0.735   23.442  18.754  1.00 2.81  ? 299  PHE B CG    1 
ATOM   3377 C CD1   . PHE B 1 192 ? -0.404  23.729  19.478  1.00 2.56  ? 299  PHE B CD1   1 
ATOM   3378 C CD2   . PHE B 1 192 ? 1.951   23.954  19.195  1.00 3.92  ? 299  PHE B CD2   1 
ATOM   3379 C CE1   . PHE B 1 192 ? -0.328  24.502  20.634  1.00 3.14  ? 299  PHE B CE1   1 
ATOM   3380 C CE2   . PHE B 1 192 ? 2.025   24.723  20.343  1.00 3.86  ? 299  PHE B CE2   1 
ATOM   3381 C CZ    . PHE B 1 192 ? 0.885   24.996  21.062  1.00 3.51  ? 299  PHE B CZ    1 
ATOM   3382 N N     . THR B 1 193 ? 0.255   22.606  14.027  1.00 3.10  ? 300  THR B N     1 
ATOM   3383 C CA    . THR B 1 193 ? 0.430   21.915  12.747  1.00 3.18  ? 300  THR B CA    1 
ATOM   3384 C C     . THR B 1 193 ? 0.175   22.971  11.665  1.00 2.74  ? 300  THR B C     1 
ATOM   3385 O O     . THR B 1 193 ? -0.805  22.910  10.903  1.00 2.89  ? 300  THR B O     1 
ATOM   3386 C CB    . THR B 1 193 ? -0.506  20.708  12.582  1.00 3.24  ? 300  THR B CB    1 
ATOM   3387 O OG1   . THR B 1 193 ? -1.875  21.125  12.653  1.00 3.92  ? 300  THR B OG1   1 
ATOM   3388 C CG2   . THR B 1 193 ? -0.353  19.724  13.724  1.00 3.89  ? 300  THR B CG2   1 
ATOM   3389 N N     . PRO B 1 194 ? 1.080   23.939  11.605  1.00 2.26  ? 301  PRO B N     1 
ATOM   3390 C CA    . PRO B 1 194 ? 0.921   25.099  10.744  1.00 2.26  ? 301  PRO B CA    1 
ATOM   3391 C C     . PRO B 1 194 ? 1.196   24.781  9.294   1.00 2.33  ? 301  PRO B C     1 
ATOM   3392 O O     . PRO B 1 194 ? 1.851   23.779  8.999   1.00 2.32  ? 301  PRO B O     1 
ATOM   3393 C CB    . PRO B 1 194 ? 1.997   26.063  11.251  1.00 2.15  ? 301  PRO B CB    1 
ATOM   3394 C CG    . PRO B 1 194 ? 3.002   25.220  11.927  1.00 2.34  ? 301  PRO B CG    1 
ATOM   3395 C CD    . PRO B 1 194 ? 2.378   23.942  12.301  1.00 2.41  ? 301  PRO B CD    1 
ATOM   3396 N N     . ASN B 1 195 ? 0.686   25.633  8.410   1.00 2.28  ? 302  ASN B N     1 
ATOM   3397 C CA    . ASN B 1 195 ? 0.950   25.526  6.986   1.00 2.67  ? 302  ASN B CA    1 
ATOM   3398 C C     . ASN B 1 195 ? 1.942   26.582  6.504   1.00 2.43  ? 302  ASN B C     1 
ATOM   3399 O O     . ASN B 1 195 ? 2.282   26.622  5.321   1.00 2.32  ? 302  ASN B O     1 
ATOM   3400 C CB    . ASN B 1 195 ? -0.336  25.572  6.165   1.00 2.49  ? 302  ASN B CB    1 
ATOM   3401 C CG    . ASN B 1 195 ? -1.195  26.805  6.429   1.00 2.66  ? 302  ASN B CG    1 
ATOM   3402 O OD1   . ASN B 1 195 ? -0.732  27.827  6.919   1.00 2.96  ? 302  ASN B OD1   1 
ATOM   3403 N ND2   . ASN B 1 195 ? -2.470  26.707  6.057   1.00 2.58  ? 302  ASN B ND2   1 
ATOM   3404 N N     . CYS B 1 196 ? 2.402   27.424  7.429   1.00 2.25  ? 303  CYS B N     1 
ATOM   3405 C CA    . CYS B 1 196 ? 3.371   28.477  7.131   1.00 2.21  ? 303  CYS B CA    1 
ATOM   3406 C C     . CYS B 1 196 ? 4.425   28.621  8.234   1.00 2.33  ? 303  CYS B C     1 
ATOM   3407 O O     . CYS B 1 196 ? 4.270   28.098  9.335   1.00 2.42  ? 303  CYS B O     1 
ATOM   3408 C CB    . CYS B 1 196 ? 2.679   29.830  7.000   1.00 2.09  ? 303  CYS B CB    1 
ATOM   3409 S SG    . CYS B 1 196 ? 1.528   29.969  5.614   1.00 2.51  ? 303  CYS B SG    1 
ATOM   3410 N N     . ILE B 1 197 ? 5.480   29.357  7.910   1.00 2.60  ? 304  ILE B N     1 
ATOM   3411 C CA    . ILE B 1 197 ? 6.505   29.712  8.873   1.00 3.23  ? 304  ILE B CA    1 
ATOM   3412 C C     . ILE B 1 197 ? 6.764   31.198  8.787   1.00 3.16  ? 304  ILE B C     1 
ATOM   3413 O O     . ILE B 1 197 ? 6.424   31.847  7.798   1.00 2.77  ? 304  ILE B O     1 
ATOM   3414 C CB    . ILE B 1 197 ? 7.835   28.974  8.599   1.00 3.74  ? 304  ILE B CB    1 
ATOM   3415 C CG1   . ILE B 1 197 ? 8.303   29.222  7.164   1.00 4.40  ? 304  ILE B CG1   1 
ATOM   3416 C CG2   . ILE B 1 197 ? 7.671   27.509  8.893   1.00 4.94  ? 304  ILE B CG2   1 
ATOM   3417 C CD1   . ILE B 1 197 ? 9.688   28.740  6.870   1.00 6.61  ? 304  ILE B CD1   1 
ATOM   3418 N N     . TYR B 1 198 ? 7.398   31.727  9.827   1.00 3.10  ? 305  TYR B N     1 
ATOM   3419 C CA    . TYR B 1 198 ? 7.857   33.091  9.819   1.00 3.27  ? 305  TYR B CA    1 
ATOM   3420 C C     . TYR B 1 198 ? 9.245   32.992  9.197   1.00 3.84  ? 305  TYR B C     1 
ATOM   3421 O O     . TYR B 1 198 ? 10.038  32.108  9.563   1.00 3.20  ? 305  TYR B O     1 
ATOM   3422 C CB    . TYR B 1 198 ? 7.959   33.648  11.244  1.00 3.57  ? 305  TYR B CB    1 
ATOM   3423 C CG    . TYR B 1 198 ? 6.632   33.960  11.904  1.00 2.97  ? 305  TYR B CG    1 
ATOM   3424 C CD1   . TYR B 1 198 ? 6.311   33.413  13.130  1.00 3.00  ? 305  TYR B CD1   1 
ATOM   3425 C CD2   . TYR B 1 198 ? 5.689   34.790  11.294  1.00 4.14  ? 305  TYR B CD2   1 
ATOM   3426 C CE1   . TYR B 1 198 ? 5.121   33.694  13.756  1.00 3.08  ? 305  TYR B CE1   1 
ATOM   3427 C CE2   . TYR B 1 198 ? 4.482   35.066  11.914  1.00 3.99  ? 305  TYR B CE2   1 
ATOM   3428 C CZ    . TYR B 1 198 ? 4.209   34.515  13.155  1.00 3.92  ? 305  TYR B CZ    1 
ATOM   3429 O OH    . TYR B 1 198 ? 3.014   34.765  13.795  1.00 4.01  ? 305  TYR B OH    1 
ATOM   3430 N N     . ASP B 1 199 ? 9.548   33.881  8.262   1.00 4.27  ? 306  ASP B N     1 
ATOM   3431 C CA    . ASP B 1 199 ? 10.846  33.853  7.602   1.00 4.68  ? 306  ASP B CA    1 
ATOM   3432 C C     . ASP B 1 199 ? 11.381  35.269  7.419   1.00 4.73  ? 306  ASP B C     1 
ATOM   3433 O O     . ASP B 1 199 ? 10.646  36.246  7.553   1.00 4.48  ? 306  ASP B O     1 
ATOM   3434 C CB    . ASP B 1 199 ? 10.708  33.174  6.246   1.00 4.92  ? 306  ASP B CB    1 
ATOM   3435 C CG    . ASP B 1 199 ? 11.979  32.506  5.779   1.00 5.82  ? 306  ASP B CG    1 
ATOM   3436 O OD1   . ASP B 1 199 ? 11.934  31.834  4.730   1.00 7.28  ? 306  ASP B OD1   1 
ATOM   3437 O OD2   . ASP B 1 199 ? 13.071  32.588  6.364   1.00 6.63  ? 306  ASP B OD2   1 
ATOM   3438 N N     . MET B 1 200 ? 12.666  35.365  7.103   1.00 4.72  ? 307  MET B N     1 
ATOM   3439 C CA    . MET B 1 200 ? 13.317  36.640  6.861   1.00 5.32  ? 307  MET B CA    1 
ATOM   3440 C C     . MET B 1 200 ? 12.775  37.245  5.587   1.00 4.63  ? 307  MET B C     1 
ATOM   3441 O O     . MET B 1 200 ? 12.394  36.519  4.671   1.00 4.81  ? 307  MET B O     1 
ATOM   3442 C CB    . MET B 1 200 ? 14.820  36.424  6.683   1.00 6.09  ? 307  MET B CB    1 
ATOM   3443 C CG    . MET B 1 200 ? 15.452  35.755  7.852   1.00 9.41  ? 307  MET B CG    1 
ATOM   3444 S SD    . MET B 1 200 ? 15.140  36.792  9.263   1.00 14.91 ? 307  MET B SD    1 
ATOM   3445 C CE    . MET B 1 200 ? 16.343  38.037  8.978   1.00 15.29 ? 307  MET B CE    1 
ATOM   3446 N N     . PHE B 1 201 ? 12.714  38.571  5.534   1.00 3.90  ? 308  PHE B N     1 
ATOM   3447 C CA    . PHE B 1 201 ? 12.298  39.254  4.313   1.00 3.42  ? 308  PHE B CA    1 
ATOM   3448 C C     . PHE B 1 201 ? 12.833  40.675  4.250   1.00 3.30  ? 308  PHE B C     1 
ATOM   3449 O O     . PHE B 1 201 ? 12.902  41.366  5.255   1.00 3.78  ? 308  PHE B O     1 
ATOM   3450 C CB    . PHE B 1 201 ? 10.795  39.286  4.148   1.00 2.99  ? 308  PHE B CB    1 
ATOM   3451 C CG    . PHE B 1 201 ? 10.376  39.492  2.720   1.00 2.30  ? 308  PHE B CG    1 
ATOM   3452 C CD1   . PHE B 1 201 ? 10.278  38.412  1.863   1.00 2.42  ? 308  PHE B CD1   1 
ATOM   3453 C CD2   . PHE B 1 201 ? 10.147  40.759  2.222   1.00 2.28  ? 308  PHE B CD2   1 
ATOM   3454 C CE1   . PHE B 1 201 ? 9.917   38.586  0.544   1.00 2.09  ? 308  PHE B CE1   1 
ATOM   3455 C CE2   . PHE B 1 201 ? 9.773   40.938  0.899   1.00 2.42  ? 308  PHE B CE2   1 
ATOM   3456 C CZ    . PHE B 1 201 ? 9.666   39.849  0.067   1.00 2.14  ? 308  PHE B CZ    1 
ATOM   3457 N N     . VAL B 1 202 ? 13.229  41.096  3.056   1.00 2.56  ? 309  VAL B N     1 
ATOM   3458 C CA    . VAL B 1 202 ? 13.723  42.442  2.843   1.00 2.48  ? 309  VAL B CA    1 
ATOM   3459 C C     . VAL B 1 202 ? 12.704  43.107  1.907   1.00 2.40  ? 309  VAL B C     1 
ATOM   3460 O O     . VAL B 1 202 ? 12.608  42.755  0.740   1.00 2.51  ? 309  VAL B O     1 
ATOM   3461 C CB    . VAL B 1 202 ? 15.130  42.439  2.232   1.00 2.82  ? 309  VAL B CB    1 
ATOM   3462 C CG1   . VAL B 1 202 ? 15.615  43.862  1.997   1.00 3.55  ? 309  VAL B CG1   1 
ATOM   3463 C CG2   . VAL B 1 202 ? 16.102  41.712  3.142   1.00 4.00  ? 309  VAL B CG2   1 
ATOM   3464 N N     . HIS B 1 203 ? 11.937  44.042  2.451   1.00 2.11  ? 310  HIS B N     1 
ATOM   3465 C CA    . HIS B 1 203 ? 10.856  44.713  1.741   1.00 2.04  ? 310  HIS B CA    1 
ATOM   3466 C C     . HIS B 1 203 ? 11.296  46.132  1.334   1.00 2.01  ? 310  HIS B C     1 
ATOM   3467 O O     . HIS B 1 203 ? 11.927  46.832  2.110   1.00 2.20  ? 310  HIS B O     1 
ATOM   3468 C CB    . HIS B 1 203 ? 9.625   44.746  2.659   1.00 2.05  ? 310  HIS B CB    1 
ATOM   3469 C CG    . HIS B 1 203 ? 8.325   44.985  1.945   1.00 2.07  ? 310  HIS B CG    1 
ATOM   3470 N ND1   . HIS B 1 203 ? 7.888   46.242  1.593   1.00 2.20  ? 310  HIS B ND1   1 
ATOM   3471 C CD2   . HIS B 1 203 ? 7.353   44.126  1.553   1.00 2.46  ? 310  HIS B CD2   1 
ATOM   3472 C CE1   . HIS B 1 203 ? 6.716   46.145  0.982   1.00 2.45  ? 310  HIS B CE1   1 
ATOM   3473 N NE2   . HIS B 1 203 ? 6.369   44.871  0.946   1.00 2.70  ? 310  HIS B NE2   1 
ATOM   3474 N N     . PRO B 1 204 ? 10.984  46.575  0.114   1.00 2.00  ? 311  PRO B N     1 
ATOM   3475 C CA    . PRO B 1 204 ? 11.414  47.908  -0.326  1.00 2.00  ? 311  PRO B CA    1 
ATOM   3476 C C     . PRO B 1 204 ? 10.721  49.064  0.394   1.00 2.00  ? 311  PRO B C     1 
ATOM   3477 O O     . PRO B 1 204 ? 11.212  50.185  0.375   1.00 2.19  ? 311  PRO B O     1 
ATOM   3478 C CB    . PRO B 1 204 ? 11.029  47.915  -1.811  1.00 2.04  ? 311  PRO B CB    1 
ATOM   3479 C CG    . PRO B 1 204 ? 9.885   46.993  -1.868  1.00 2.00  ? 311  PRO B CG    1 
ATOM   3480 C CD    . PRO B 1 204 ? 10.242  45.871  -0.946  1.00 2.05  ? 311  PRO B CD    1 
ATOM   3481 N N     . ARG B 1 205 ? 9.581   48.792  1.005   1.00 2.00  ? 312  ARG B N     1 
ATOM   3482 C CA    . ARG B 1 205 ? 8.852   49.797  1.756   1.00 2.00  ? 312  ARG B CA    1 
ATOM   3483 C C     . ARG B 1 205 ? 9.144   49.671  3.261   1.00 2.00  ? 312  ARG B C     1 
ATOM   3484 O O     . ARG B 1 205 ? 9.506   50.649  3.922   1.00 2.11  ? 312  ARG B O     1 
ATOM   3485 C CB    . ARG B 1 205 ? 7.358   49.601  1.505   1.00 2.02  ? 312  ARG B CB    1 
ATOM   3486 C CG    . ARG B 1 205 ? 6.428   50.547  2.221   1.00 2.16  ? 312  ARG B CG    1 
ATOM   3487 C CD    . ARG B 1 205 ? 4.969   50.184  1.956   1.00 2.09  ? 312  ARG B CD    1 
ATOM   3488 N NE    . ARG B 1 205 ? 4.001   50.954  2.719   1.00 2.01  ? 312  ARG B NE    1 
ATOM   3489 C CZ    . ARG B 1 205 ? 2.687   50.778  2.620   1.00 2.44  ? 312  ARG B CZ    1 
ATOM   3490 N NH1   . ARG B 1 205 ? 2.198   49.871  1.786   1.00 2.38  ? 312  ARG B NH1   1 
ATOM   3491 N NH2   . ARG B 1 205 ? 1.856   51.513  3.341   1.00 2.92  ? 312  ARG B NH2   1 
ATOM   3492 N N     . PHE B 1 206 ? 9.001   48.459  3.786   1.00 2.00  ? 313  PHE B N     1 
ATOM   3493 C CA    . PHE B 1 206 ? 9.148   48.210  5.232   1.00 2.09  ? 313  PHE B CA    1 
ATOM   3494 C C     . PHE B 1 206 ? 10.584  47.983  5.694   1.00 2.08  ? 313  PHE B C     1 
ATOM   3495 O O     . PHE B 1 206 ? 10.878  48.097  6.899   1.00 2.39  ? 313  PHE B O     1 
ATOM   3496 C CB    . PHE B 1 206 ? 8.299   47.003  5.643   1.00 2.04  ? 313  PHE B CB    1 
ATOM   3497 C CG    . PHE B 1 206 ? 6.865   47.094  5.195   1.00 2.15  ? 313  PHE B CG    1 
ATOM   3498 C CD1   . PHE B 1 206 ? 6.301   46.096  4.428   1.00 2.06  ? 313  PHE B CD1   1 
ATOM   3499 C CD2   . PHE B 1 206 ? 6.092   48.186  5.541   1.00 2.23  ? 313  PHE B CD2   1 
ATOM   3500 C CE1   . PHE B 1 206 ? 4.988   46.186  4.018   1.00 2.86  ? 313  PHE B CE1   1 
ATOM   3501 C CE2   . PHE B 1 206 ? 4.793   48.281  5.145   1.00 2.59  ? 313  PHE B CE2   1 
ATOM   3502 C CZ    . PHE B 1 206 ? 4.235   47.283  4.368   1.00 3.10  ? 313  PHE B CZ    1 
ATOM   3503 N N     . GLY B 1 207 ? 11.476  47.637  4.769   1.00 2.15  ? 314  GLY B N     1 
ATOM   3504 C CA    . GLY B 1 207 ? 12.861  47.345  5.136   1.00 2.32  ? 314  GLY B CA    1 
ATOM   3505 C C     . GLY B 1 207 ? 12.985  45.897  5.593   1.00 2.53  ? 314  GLY B C     1 
ATOM   3506 O O     . GLY B 1 207 ? 12.146  45.067  5.238   1.00 2.46  ? 314  GLY B O     1 
ATOM   3507 N N     . PRO B 1 208 ? 14.047  45.559  6.323   1.00 2.68  ? 315  PRO B N     1 
ATOM   3508 C CA    . PRO B 1 208 ? 14.200  44.205  6.858   1.00 2.92  ? 315  PRO B CA    1 
ATOM   3509 C C     . PRO B 1 208 ? 13.155  43.867  7.916   1.00 3.11  ? 315  PRO B C     1 
ATOM   3510 O O     . PRO B 1 208 ? 13.187  44.405  9.033   1.00 2.83  ? 315  PRO B O     1 
ATOM   3511 C CB    . PRO B 1 208 ? 15.592  44.236  7.504   1.00 3.19  ? 315  PRO B CB    1 
ATOM   3512 C CG    . PRO B 1 208 ? 16.280  45.378  6.880   1.00 3.14  ? 315  PRO B CG    1 
ATOM   3513 C CD    . PRO B 1 208 ? 15.213  46.398  6.643   1.00 2.83  ? 315  PRO B CD    1 
ATOM   3514 N N     . ILE B 1 209 ? 12.248  42.969  7.547   1.00 2.75  ? 316  ILE B N     1 
ATOM   3515 C CA    . ILE B 1 209 ? 11.179  42.520  8.420   1.00 2.99  ? 316  ILE B CA    1 
ATOM   3516 C C     . ILE B 1 209 ? 11.129  40.988  8.388   1.00 2.99  ? 316  ILE B C     1 
ATOM   3517 O O     . ILE B 1 209 ? 12.144  40.331  8.120   1.00 2.81  ? 316  ILE B O     1 
ATOM   3518 C CB    . ILE B 1 209 ? 9.837   43.124  7.957   1.00 2.93  ? 316  ILE B CB    1 
ATOM   3519 C CG1   . ILE B 1 209 ? 9.590   42.839  6.472   1.00 3.09  ? 316  ILE B CG1   1 
ATOM   3520 C CG2   . ILE B 1 209 ? 9.831   44.624  8.204   1.00 3.36  ? 316  ILE B CG2   1 
ATOM   3521 C CD1   . ILE B 1 209 ? 8.155   43.109  6.016   1.00 3.53  ? 316  ILE B CD1   1 
ATOM   3522 N N     . LYS B 1 210 ? 9.966   40.430  8.701   1.00 2.77  ? 317  LYS B N     1 
ATOM   3523 C CA    . LYS B 1 210 ? 9.742   39.002  8.577   1.00 3.38  ? 317  LYS B CA    1 
ATOM   3524 C C     . LYS B 1 210 ? 8.523   38.834  7.663   1.00 3.03  ? 317  LYS B C     1 
ATOM   3525 O O     . LYS B 1 210 ? 7.764   39.787  7.459   1.00 2.87  ? 317  LYS B O     1 
ATOM   3526 C CB    . LYS B 1 210 ? 9.539   38.343  9.938   1.00 3.91  ? 317  LYS B CB    1 
ATOM   3527 C CG    . LYS B 1 210 ? 10.826  38.301  10.753  1.00 5.87  ? 317  LYS B CG    1 
ATOM   3528 C CD    . LYS B 1 210 ? 11.018  37.000  11.505  1.00 8.20  ? 317  LYS B CD    1 
ATOM   3529 C CE    . LYS B 1 210 ? 12.391  36.945  12.175  1.00 9.16  ? 317  LYS B CE    1 
ATOM   3530 N NZ    . LYS B 1 210 ? 12.546  35.810  13.128  1.00 10.05 ? 317  LYS B NZ    1 
ATOM   3531 N N     . CYS B 1 211 ? 8.356   37.652  7.085   1.00 2.95  ? 318  CYS B N     1 
ATOM   3532 C CA    . CYS B 1 211 ? 7.203   37.390  6.219   1.00 3.19  ? 318  CYS B CA    1 
ATOM   3533 C C     . CYS B 1 211 ? 6.563   36.081  6.648   1.00 3.39  ? 318  CYS B C     1 
ATOM   3534 O O     . CYS B 1 211 ? 7.086   35.393  7.525   1.00 3.01  ? 318  CYS B O     1 
ATOM   3535 C CB    . CYS B 1 211 ? 7.631   37.300  4.749   1.00 3.00  ? 318  CYS B CB    1 
ATOM   3536 S SG    . CYS B 1 211 ? 8.631   35.848  4.325   1.00 3.90  ? 318  CYS B SG    1 
ATOM   3537 N N     . ILE B 1 212 ? 5.419   35.770  6.045   1.00 3.48  ? 319  ILE B N     1 
ATOM   3538 C CA    . ILE B 1 212 ? 4.743   34.493  6.221   1.00 3.82  ? 319  ILE B CA    1 
ATOM   3539 C C     . ILE B 1 212 ? 5.012   33.709  4.937   1.00 3.17  ? 319  ILE B C     1 
ATOM   3540 O O     . ILE B 1 212 ? 4.666   34.187  3.860   1.00 3.71  ? 319  ILE B O     1 
ATOM   3541 C CB    . ILE B 1 212 ? 3.217   34.684  6.350   1.00 4.41  ? 319  ILE B CB    1 
ATOM   3542 C CG1   . ILE B 1 212 ? 2.854   35.661  7.469   1.00 6.15  ? 319  ILE B CG1   1 
ATOM   3543 C CG2   . ILE B 1 212 ? 2.543   33.326  6.548   1.00 4.72  ? 319  ILE B CG2   1 
ATOM   3544 C CD1   . ILE B 1 212 ? 2.718   35.042  8.782   1.00 8.41  ? 319  ILE B CD1   1 
ATOM   3545 N N     . ARG B 1 213 ? 5.617   32.526  5.042   1.00 2.51  ? 320  ARG B N     1 
ATOM   3546 C CA    . ARG B 1 213 ? 5.936   31.696  3.877   1.00 2.42  ? 320  ARG B CA    1 
ATOM   3547 C C     . ARG B 1 213 ? 5.314   30.306  4.066   1.00 2.39  ? 320  ARG B C     1 
ATOM   3548 O O     . ARG B 1 213 ? 5.451   29.710  5.124   1.00 2.16  ? 320  ARG B O     1 
ATOM   3549 C CB    . ARG B 1 213 ? 7.458   31.586  3.700   1.00 2.45  ? 320  ARG B CB    1 
ATOM   3550 C CG    . ARG B 1 213 ? 7.889   30.761  2.507   1.00 2.49  ? 320  ARG B CG    1 
ATOM   3551 C CD    . ARG B 1 213 ? 9.378   30.507  2.401   1.00 2.33  ? 320  ARG B CD    1 
ATOM   3552 N NE    . ARG B 1 213 ? 10.186  31.716  2.254   1.00 2.42  ? 320  ARG B NE    1 
ATOM   3553 C CZ    . ARG B 1 213 ? 10.479  32.287  1.096   1.00 2.23  ? 320  ARG B CZ    1 
ATOM   3554 N NH1   . ARG B 1 213 ? 10.001  31.778  -0.037  1.00 2.49  ? 320  ARG B NH1   1 
ATOM   3555 N NH2   . ARG B 1 213 ? 11.227  33.382  1.063   1.00 2.17  ? 320  ARG B NH2   1 
ATOM   3556 N N     . THR B 1 214 ? 4.599   29.785  3.063   1.00 2.17  ? 321  THR B N     1 
ATOM   3557 C CA    . THR B 1 214 ? 3.997   28.459  3.237   1.00 2.31  ? 321  THR B CA    1 
ATOM   3558 C C     . THR B 1 214 ? 5.062   27.353  3.401   1.00 2.75  ? 321  THR B C     1 
ATOM   3559 O O     . THR B 1 214 ? 6.165   27.456  2.839   1.00 2.36  ? 321  THR B O     1 
ATOM   3560 C CB    . THR B 1 214 ? 3.055   28.102  2.059   1.00 2.22  ? 321  THR B CB    1 
ATOM   3561 O OG1   . THR B 1 214 ? 3.831   27.881  0.876   1.00 2.14  ? 321  THR B OG1   1 
ATOM   3562 C CG2   . THR B 1 214 ? 2.119   29.251  1.715   1.00 2.52  ? 321  THR B CG2   1 
ATOM   3563 N N     . LEU B 1 215 ? 4.721   26.312  4.178   1.00 3.13  ? 322  LEU B N     1 
ATOM   3564 C CA    . LEU B 1 215 ? 5.559   25.126  4.383   1.00 3.89  ? 322  LEU B CA    1 
ATOM   3565 C C     . LEU B 1 215 ? 5.168   24.022  3.431   1.00 3.50  ? 322  LEU B C     1 
ATOM   3566 O O     . LEU B 1 215 ? 5.896   23.055  3.238   1.00 3.34  ? 322  LEU B O     1 
ATOM   3567 C CB    . LEU B 1 215 ? 5.342   24.538  5.790   1.00 4.35  ? 322  LEU B CB    1 
ATOM   3568 C CG    . LEU B 1 215 ? 6.122   25.141  6.908   1.00 6.98  ? 322  LEU B CG    1 
ATOM   3569 C CD1   . LEU B 1 215 ? 6.037   26.624  6.730   1.00 8.71  ? 322  LEU B CD1   1 
ATOM   3570 C CD2   . LEU B 1 215 ? 5.584   24.671  8.269   1.00 7.42  ? 322  LEU B CD2   1 
ATOM   3571 N N     . ARG B 1 216 ? 3.978   24.150  2.875   1.00 3.44  ? 323  ARG B N     1 
ATOM   3572 C CA    . ARG B 1 216 ? 3.432   23.129  2.016   1.00 3.44  ? 323  ARG B CA    1 
ATOM   3573 C C     . ARG B 1 216 ? 2.430   23.830  1.126   1.00 2.95  ? 323  ARG B C     1 
ATOM   3574 O O     . ARG B 1 216 ? 2.203   25.032  1.278   1.00 2.49  ? 323  ARG B O     1 
ATOM   3575 C CB    . ARG B 1 216 ? 2.726   22.076  2.858   1.00 3.92  ? 323  ARG B CB    1 
ATOM   3576 C CG    . ARG B 1 216 ? 1.464   22.618  3.524   1.00 5.65  ? 323  ARG B CG    1 
ATOM   3577 C CD    . ARG B 1 216 ? 0.988   21.791  4.681   1.00 8.98  ? 323  ARG B CD    1 
ATOM   3578 N NE    . ARG B 1 216 ? -0.119  22.369  5.435   1.00 11.13 ? 323  ARG B NE    1 
ATOM   3579 C CZ    . ARG B 1 216 ? -1.268  22.759  4.926   1.00 12.20 ? 323  ARG B CZ    1 
ATOM   3580 N NH1   . ARG B 1 216 ? -1.502  22.680  3.622   1.00 12.69 ? 323  ARG B NH1   1 
ATOM   3581 N NH2   . ARG B 1 216 ? -2.196  23.254  5.731   1.00 13.48 ? 323  ARG B NH2   1 
ATOM   3582 N N     . ALA B 1 217 ? 1.839   23.084  0.197   1.00 2.71  ? 324  ALA B N     1 
ATOM   3583 C CA    . ALA B 1 217 ? 0.842   23.649  -0.686  1.00 2.79  ? 324  ALA B CA    1 
ATOM   3584 C C     . ALA B 1 217 ? -0.350  24.079  0.158   1.00 2.94  ? 324  ALA B C     1 
ATOM   3585 O O     . ALA B 1 217 ? -0.679  23.428  1.151   1.00 3.43  ? 324  ALA B O     1 
ATOM   3586 C CB    . ALA B 1 217 ? 0.407   22.629  -1.749  1.00 2.69  ? 324  ALA B CB    1 
ATOM   3587 N N     . VAL B 1 218 ? -0.978  25.177  -0.244  1.00 2.65  ? 325  VAL B N     1 
ATOM   3588 C CA    . VAL B 1 218 ? -2.148  25.712  0.430   1.00 2.52  ? 325  VAL B CA    1 
ATOM   3589 C C     . VAL B 1 218 ? -3.208  25.975  -0.651  1.00 2.69  ? 325  VAL B C     1 
ATOM   3590 O O     . VAL B 1 218 ? -2.871  26.460  -1.727  1.00 2.55  ? 325  VAL B O     1 
ATOM   3591 C CB    . VAL B 1 218 ? -1.794  27.020  1.147   1.00 2.63  ? 325  VAL B CB    1 
ATOM   3592 C CG1   . VAL B 1 218 ? -3.023  27.740  1.648   1.00 2.77  ? 325  VAL B CG1   1 
ATOM   3593 C CG2   . VAL B 1 218 ? -0.829  26.734  2.311   1.00 2.31  ? 325  VAL B CG2   1 
ATOM   3594 N N     . GLU B 1 219 ? -4.464  25.638  -0.374  1.00 3.19  ? 326  GLU B N     1 
ATOM   3595 C CA    . GLU B 1 219 ? -5.543  25.895  -1.335  1.00 3.99  ? 326  GLU B CA    1 
ATOM   3596 C C     . GLU B 1 219 ? -6.201  27.262  -1.163  1.00 3.56  ? 326  GLU B C     1 
ATOM   3597 O O     . GLU B 1 219 ? -6.086  27.907  -0.127  1.00 3.52  ? 326  GLU B O     1 
ATOM   3598 C CB    . GLU B 1 219 ? -6.615  24.806  -1.248  1.00 4.43  ? 326  GLU B CB    1 
ATOM   3599 C CG    . GLU B 1 219 ? -6.554  23.811  -2.402  1.00 7.51  ? 326  GLU B CG    1 
ATOM   3600 C CD    . GLU B 1 219 ? -6.567  24.451  -3.787  1.00 10.00 ? 326  GLU B CD    1 
ATOM   3601 O OE1   . GLU B 1 219 ? -7.318  25.449  -4.017  1.00 10.77 ? 326  GLU B OE1   1 
ATOM   3602 O OE2   . GLU B 1 219 ? -5.823  23.928  -4.664  1.00 10.91 ? 326  GLU B OE2   1 
ATOM   3603 N N     . ALA B 1 220 ? -6.923  27.687  -2.191  1.00 3.26  ? 327  ALA B N     1 
ATOM   3604 C CA    . ALA B 1 220 ? -7.661  28.932  -2.129  1.00 3.14  ? 327  ALA B CA    1 
ATOM   3605 C C     . ALA B 1 220 ? -8.603  28.883  -0.923  1.00 3.18  ? 327  ALA B C     1 
ATOM   3606 O O     . ALA B 1 220 ? -9.276  27.872  -0.691  1.00 3.00  ? 327  ALA B O     1 
ATOM   3607 C CB    . ALA B 1 220 ? -8.450  29.140  -3.416  1.00 3.37  ? 327  ALA B CB    1 
ATOM   3608 N N     . ASP B 1 221 ? -8.605  29.964  -0.144  1.00 2.95  ? 328  ASP B N     1 
ATOM   3609 C CA    . ASP B 1 221 ? -9.483  30.128  1.012   1.00 3.08  ? 328  ASP B CA    1 
ATOM   3610 C C     . ASP B 1 221 ? -9.122  29.277  2.219   1.00 3.00  ? 328  ASP B C     1 
ATOM   3611 O O     . ASP B 1 221 ? -9.949  29.071  3.099   1.00 3.51  ? 328  ASP B O     1 
ATOM   3612 C CB    . ASP B 1 221 ? -10.931 29.926  0.605   1.00 3.03  ? 328  ASP B CB    1 
ATOM   3613 C CG    . ASP B 1 221 ? -11.349 30.913  -0.426  1.00 3.01  ? 328  ASP B CG    1 
ATOM   3614 O OD1   . ASP B 1 221 ? -11.786 30.481  -1.512  1.00 3.65  ? 328  ASP B OD1   1 
ATOM   3615 O OD2   . ASP B 1 221 ? -11.230 32.143  -0.254  1.00 2.51  ? 328  ASP B OD2   1 
ATOM   3616 N N     . GLU B 1 222 ? -7.901  28.764  2.234   1.00 2.93  ? 329  GLU B N     1 
ATOM   3617 C CA    . GLU B 1 222 ? -7.379  28.039  3.393   1.00 3.05  ? 329  GLU B CA    1 
ATOM   3618 C C     . GLU B 1 222 ? -6.827  29.070  4.374   1.00 2.84  ? 329  GLU B C     1 
ATOM   3619 O O     . GLU B 1 222 ? -6.169  30.033  3.972   1.00 2.61  ? 329  GLU B O     1 
ATOM   3620 C CB    . GLU B 1 222 ? -6.287  27.051  2.971   1.00 2.94  ? 329  GLU B CB    1 
ATOM   3621 C CG    . GLU B 1 222 ? -5.685  26.258  4.128   1.00 3.73  ? 329  GLU B CG    1 
ATOM   3622 C CD    . GLU B 1 222 ? -4.805  25.101  3.678   1.00 4.20  ? 329  GLU B CD    1 
ATOM   3623 O OE1   . GLU B 1 222 ? -4.845  24.722  2.485   1.00 3.62  ? 329  GLU B OE1   1 
ATOM   3624 O OE2   . GLU B 1 222 ? -4.069  24.557  4.532   1.00 5.16  ? 329  GLU B OE2   1 
ATOM   3625 N N     . GLU B 1 223 ? -7.103  28.884  5.662   1.00 3.01  ? 330  GLU B N     1 
ATOM   3626 C CA    . GLU B 1 223 ? -6.575  29.787  6.675   1.00 3.20  ? 330  GLU B CA    1 
ATOM   3627 C C     . GLU B 1 223 ? -5.085  29.524  6.795   1.00 3.07  ? 330  GLU B C     1 
ATOM   3628 O O     . GLU B 1 223 ? -4.647  28.372  6.820   1.00 3.31  ? 330  GLU B O     1 
ATOM   3629 C CB    . GLU B 1 223 ? -7.273  29.607  8.026   1.00 3.40  ? 330  GLU B CB    1 
ATOM   3630 C CG    . GLU B 1 223 ? -6.759  30.560  9.110   1.00 3.51  ? 330  GLU B CG    1 
ATOM   3631 C CD    . GLU B 1 223 ? -7.614  30.603  10.368  1.00 4.19  ? 330  GLU B CD    1 
ATOM   3632 O OE1   . GLU B 1 223 ? -8.551  29.785  10.513  1.00 6.15  ? 330  GLU B OE1   1 
ATOM   3633 O OE2   . GLU B 1 223 ? -7.357  31.483  11.211  1.00 3.66  ? 330  GLU B OE2   1 
ATOM   3634 N N     . LEU B 1 224 ? -4.309  30.599  6.838   1.00 3.08  ? 331  LEU B N     1 
ATOM   3635 C CA    . LEU B 1 224 ? -2.861  30.512  7.001   1.00 2.57  ? 331  LEU B CA    1 
ATOM   3636 C C     . LEU B 1 224 ? -2.535  30.548  8.487   1.00 2.41  ? 331  LEU B C     1 
ATOM   3637 O O     . LEU B 1 224 ? -3.004  31.422  9.209   1.00 2.23  ? 331  LEU B O     1 
ATOM   3638 C CB    . LEU B 1 224 ? -2.172  31.669  6.279   1.00 2.97  ? 331  LEU B CB    1 
ATOM   3639 C CG    . LEU B 1 224 ? -2.443  31.741  4.764   1.00 4.21  ? 331  LEU B CG    1 
ATOM   3640 C CD1   . LEU B 1 224 ? -1.826  32.983  4.150   1.00 5.45  ? 331  LEU B CD1   1 
ATOM   3641 C CD2   . LEU B 1 224 ? -1.956  30.489  4.022   1.00 4.86  ? 331  LEU B CD2   1 
ATOM   3642 N N     . THR B 1 225 ? -1.740  29.584  8.936   1.00 2.10  ? 332  THR B N     1 
ATOM   3643 C CA    . THR B 1 225 ? -1.370  29.511  10.342  1.00 2.07  ? 332  THR B CA    1 
ATOM   3644 C C     . THR B 1 225 ? 0.129   29.328  10.471  1.00 2.10  ? 332  THR B C     1 
ATOM   3645 O O     . THR B 1 225 ? 0.781   28.805  9.575   1.00 2.46  ? 332  THR B O     1 
ATOM   3646 C CB    . THR B 1 225 ? -2.083  28.365  11.040  1.00 2.08  ? 332  THR B CB    1 
ATOM   3647 O OG1   . THR B 1 225 ? -1.798  27.130  10.366  1.00 2.57  ? 332  THR B OG1   1 
ATOM   3648 C CG2   . THR B 1 225 ? -3.582  28.511  10.949  1.00 2.23  ? 332  THR B CG2   1 
ATOM   3649 N N     . VAL B 1 226 ? 0.664   29.752  11.601  1.00 2.14  ? 333  VAL B N     1 
ATOM   3650 C CA    . VAL B 1 226 ? 2.095   29.659  11.835  1.00 2.46  ? 333  VAL B CA    1 
ATOM   3651 C C     . VAL B 1 226 ? 2.286   29.231  13.284  1.00 2.24  ? 333  VAL B C     1 
ATOM   3652 O O     . VAL B 1 226 ? 1.454   29.543  14.128  1.00 2.19  ? 333  VAL B O     1 
ATOM   3653 C CB    . VAL B 1 226 ? 2.786   31.024  11.622  1.00 2.66  ? 333  VAL B CB    1 
ATOM   3654 C CG1   . VAL B 1 226 ? 4.294   30.880  11.695  1.00 4.00  ? 333  VAL B CG1   1 
ATOM   3655 C CG2   . VAL B 1 226 ? 2.384   31.663  10.312  1.00 3.80  ? 333  VAL B CG2   1 
ATOM   3656 N N     . ALA B 1 227 ? 3.361   28.498  13.559  1.00 2.49  ? 334  ALA B N     1 
ATOM   3657 C CA    . ALA B 1 227 ? 3.711   28.148  14.933  1.00 2.96  ? 334  ALA B CA    1 
ATOM   3658 C C     . ALA B 1 227 ? 4.332   29.391  15.570  1.00 3.32  ? 334  ALA B C     1 
ATOM   3659 O O     . ALA B 1 227 ? 5.351   29.878  15.096  1.00 4.09  ? 334  ALA B O     1 
ATOM   3660 C CB    . ALA B 1 227 ? 4.697   26.993  14.954  1.00 2.93  ? 334  ALA B CB    1 
ATOM   3661 N N     . TYR B 1 228 ? 3.722   29.900  16.636  1.00 3.26  ? 335  TYR B N     1 
ATOM   3662 C CA    . TYR B 1 228 ? 4.192   31.113  17.296  1.00 2.97  ? 335  TYR B CA    1 
ATOM   3663 C C     . TYR B 1 228 ? 5.570   30.885  17.949  1.00 3.27  ? 335  TYR B C     1 
ATOM   3664 O O     . TYR B 1 228 ? 6.352   31.816  18.088  1.00 3.56  ? 335  TYR B O     1 
ATOM   3665 C CB    . TYR B 1 228 ? 3.154   31.613  18.298  1.00 2.79  ? 335  TYR B CB    1 
ATOM   3666 C CG    . TYR B 1 228 ? 1.973   32.343  17.669  1.00 2.29  ? 335  TYR B CG    1 
ATOM   3667 C CD1   . TYR B 1 228 ? 1.760   32.333  16.289  1.00 2.44  ? 335  TYR B CD1   1 
ATOM   3668 C CD2   . TYR B 1 228 ? 1.078   33.042  18.457  1.00 2.05  ? 335  TYR B CD2   1 
ATOM   3669 C CE1   . TYR B 1 228 ? 0.673   33.007  15.722  1.00 2.18  ? 335  TYR B CE1   1 
ATOM   3670 C CE2   . TYR B 1 228 ? -0.002  33.721  17.906  1.00 2.31  ? 335  TYR B CE2   1 
ATOM   3671 C CZ    . TYR B 1 228 ? -0.203  33.698  16.538  1.00 2.08  ? 335  TYR B CZ    1 
ATOM   3672 O OH    . TYR B 1 228 ? -1.282  34.377  16.007  1.00 2.69  ? 335  TYR B OH    1 
ATOM   3673 N N     . GLY B 1 229 ? 5.859   29.643  18.326  1.00 3.31  ? 336  GLY B N     1 
ATOM   3674 C CA    . GLY B 1 229 ? 7.176   29.265  18.818  1.00 3.76  ? 336  GLY B CA    1 
ATOM   3675 C C     . GLY B 1 229 ? 7.515   29.737  20.212  1.00 4.27  ? 336  GLY B C     1 
ATOM   3676 O O     . GLY B 1 229 ? 8.692   30.016  20.521  1.00 4.46  ? 336  GLY B O     1 
ATOM   3677 N N     . TYR B 1 230 ? 6.519   29.785  21.083  1.00 4.72  ? 337  TYR B N     1 
ATOM   3678 C CA    . TYR B 1 230 ? 6.763   30.178  22.469  1.00 5.82  ? 337  TYR B CA    1 
ATOM   3679 C C     . TYR B 1 230 ? 7.488   29.081  23.253  1.00 7.33  ? 337  TYR B C     1 
ATOM   3680 O O     . TYR B 1 230 ? 7.323   27.885  23.004  1.00 6.70  ? 337  TYR B O     1 
ATOM   3681 C CB    . TYR B 1 230 ? 5.456   30.516  23.180  1.00 5.62  ? 337  TYR B CB    1 
ATOM   3682 C CG    . TYR B 1 230 ? 4.707   31.714  22.623  1.00 5.17  ? 337  TYR B CG    1 
ATOM   3683 C CD1   . TYR B 1 230 ? 3.359   31.615  22.298  1.00 4.87  ? 337  TYR B CD1   1 
ATOM   3684 C CD2   . TYR B 1 230 ? 5.328   32.947  22.441  1.00 4.69  ? 337  TYR B CD2   1 
ATOM   3685 C CE1   . TYR B 1 230 ? 2.653   32.691  21.807  1.00 4.50  ? 337  TYR B CE1   1 
ATOM   3686 C CE2   . TYR B 1 230 ? 4.610   34.046  21.934  1.00 4.87  ? 337  TYR B CE2   1 
ATOM   3687 C CZ    . TYR B 1 230 ? 3.275   33.900  21.622  1.00 5.05  ? 337  TYR B CZ    1 
ATOM   3688 O OH    . TYR B 1 230 ? 2.524   34.956  21.122  1.00 5.47  ? 337  TYR B OH    1 
ATOM   3689 N N     . ASP B 1 231 ? 8.300   29.504  24.210  1.00 9.00  ? 338  ASP B N     1 
ATOM   3690 C CA    . ASP B 1 231 ? 8.956   28.561  25.097  1.00 11.00 ? 338  ASP B CA    1 
ATOM   3691 C C     . ASP B 1 231 ? 7.860   27.806  25.837  1.00 11.55 ? 338  ASP B C     1 
ATOM   3692 O O     . ASP B 1 231 ? 6.828   28.378  26.181  1.00 11.92 ? 338  ASP B O     1 
ATOM   3693 C CB    . ASP B 1 231 ? 9.844   29.296  26.091  1.00 11.65 ? 338  ASP B CB    1 
ATOM   3694 C CG    . ASP B 1 231 ? 11.077  29.897  25.439  1.00 14.73 ? 338  ASP B CG    1 
ATOM   3695 O OD1   . ASP B 1 231 ? 11.475  31.017  25.844  1.00 17.17 ? 338  ASP B OD1   1 
ATOM   3696 O OD2   . ASP B 1 231 ? 11.711  29.322  24.520  1.00 17.20 ? 338  ASP B OD2   1 
ATOM   3697 N N     . HIS B 1 232 ? 8.065   26.521  26.071  1.00 12.52 ? 339  HIS B N     1 
ATOM   3698 C CA    . HIS B 1 232 ? 7.068   25.719  26.759  1.00 13.67 ? 339  HIS B CA    1 
ATOM   3699 C C     . HIS B 1 232 ? 7.432   25.462  28.223  1.00 15.18 ? 339  HIS B C     1 
ATOM   3700 O O     . HIS B 1 232 ? 7.026   24.444  28.769  1.00 15.38 ? 339  HIS B O     1 
ATOM   3701 C CB    . HIS B 1 232 ? 6.876   24.399  26.011  1.00 13.54 ? 339  HIS B CB    1 
ATOM   3702 C CG    . HIS B 1 232 ? 6.318   24.577  24.629  1.00 13.67 ? 339  HIS B CG    1 
ATOM   3703 N ND1   . HIS B 1 232 ? 6.381   23.597  23.661  1.00 14.03 ? 339  HIS B ND1   1 
ATOM   3704 C CD2   . HIS B 1 232 ? 5.696   25.632  24.056  1.00 13.29 ? 339  HIS B CD2   1 
ATOM   3705 C CE1   . HIS B 1 232 ? 5.822   24.043  22.550  1.00 13.87 ? 339  HIS B CE1   1 
ATOM   3706 N NE2   . HIS B 1 232 ? 5.390   25.272  22.765  1.00 13.72 ? 339  HIS B NE2   1 
ATOM   3707 N N     . SER B 1 233 ? 8.159   26.398  28.847  1.00 16.89 ? 340  SER B N     1 
ATOM   3708 C CA    . SER B 1 233 ? 8.619   26.274  30.239  1.00 18.40 ? 340  SER B CA    1 
ATOM   3709 C C     . SER B 1 233 ? 7.751   27.059  31.249  1.00 20.05 ? 340  SER B C     1 
ATOM   3710 O O     . SER B 1 233 ? 7.145   28.075  30.915  1.00 20.60 ? 340  SER B O     1 
ATOM   3711 C CB    . SER B 1 233 ? 10.073  26.737  30.336  1.00 18.30 ? 340  SER B CB    1 
ATOM   3712 O OG    . SER B 1 233 ? 10.167  28.115  30.035  1.00 18.32 ? 340  SER B OG    1 
ATOM   3713 N N     . PRO B 1 234 ? 7.713   26.561  32.482  1.00 21.75 ? 341  PRO B N     1 
ATOM   3714 C CA    . PRO B 1 234 ? 6.853   27.056  33.574  1.00 22.82 ? 341  PRO B CA    1 
ATOM   3715 C C     . PRO B 1 234 ? 6.989   28.485  34.128  1.00 23.77 ? 341  PRO B C     1 
ATOM   3716 O O     . PRO B 1 234 ? 6.842   29.444  33.387  1.00 24.55 ? 341  PRO B O     1 
ATOM   3717 C CB    . PRO B 1 234 ? 7.075   26.026  34.688  1.00 22.80 ? 341  PRO B CB    1 
ATOM   3718 C CG    . PRO B 1 234 ? 8.029   25.034  34.205  1.00 22.59 ? 341  PRO B CG    1 
ATOM   3719 C CD    . PRO B 1 234 ? 8.496   25.391  32.878  1.00 21.89 ? 341  PRO B CD    1 
ATOM   3720 N N     . PRO B 1 235 ? 7.235   28.641  35.421  1.00 24.92 ? 342  PRO B N     1 
ATOM   3721 C CA    . PRO B 1 235 ? 7.117   29.959  36.029  1.00 25.39 ? 342  PRO B CA    1 
ATOM   3722 C C     . PRO B 1 235 ? 8.194   30.849  35.518  1.00 25.69 ? 342  PRO B C     1 
ATOM   3723 O O     . PRO B 1 235 ? 8.095   31.540  34.499  1.00 25.83 ? 342  PRO B O     1 
ATOM   3724 C CB    . PRO B 1 235 ? 7.393   29.704  37.520  1.00 25.37 ? 342  PRO B CB    1 
ATOM   3725 C CG    . PRO B 1 235 ? 7.857   28.318  37.657  1.00 25.22 ? 342  PRO B CG    1 
ATOM   3726 C CD    . PRO B 1 235 ? 7.772   27.655  36.362  1.00 24.98 ? 342  PRO B CD    1 
ATOM   3727 N N     . GLY B 1 236 ? 9.265   30.788  36.282  1.00 25.94 ? 343  GLY B N     1 
ATOM   3728 C CA    . GLY B 1 236 ? 10.441  31.556  36.024  1.00 26.14 ? 343  GLY B CA    1 
ATOM   3729 C C     . GLY B 1 236 ? 10.728  32.379  37.250  1.00 26.23 ? 343  GLY B C     1 
ATOM   3730 O O     . GLY B 1 236 ? 11.155  31.884  38.298  1.00 26.65 ? 343  GLY B O     1 
ATOM   3731 N N     . LYS B 1 237 ? 10.507  33.667  37.064  1.00 26.28 ? 344  LYS B N     1 
ATOM   3732 C CA    . LYS B 1 237 ? 10.637  34.701  38.056  1.00 26.15 ? 344  LYS B CA    1 
ATOM   3733 C C     . LYS B 1 237 ? 10.282  35.929  37.235  1.00 25.81 ? 344  LYS B C     1 
ATOM   3734 O O     . LYS B 1 237 ? 10.594  37.055  37.607  1.00 26.17 ? 344  LYS B O     1 
ATOM   3735 C CB    . LYS B 1 237 ? 12.066  34.821  38.607  1.00 26.36 ? 344  LYS B CB    1 
ATOM   3736 C CG    . LYS B 1 237 ? 13.138  34.091  37.806  1.00 26.93 ? 344  LYS B CG    1 
ATOM   3737 C CD    . LYS B 1 237 ? 14.518  34.291  38.402  1.00 27.31 ? 344  LYS B CD    1 
ATOM   3738 C CE    . LYS B 1 237 ? 14.829  33.262  39.468  1.00 27.56 ? 344  LYS B CE    1 
ATOM   3739 N NZ    . LYS B 1 237 ? 16.084  33.589  40.192  1.00 27.79 ? 344  LYS B NZ    1 
ATOM   3740 N N     . SER B 1 238 ? 9.632   35.691  36.097  1.00 25.23 ? 345  SER B N     1 
ATOM   3741 C CA    . SER B 1 238 ? 9.383   36.744  35.124  1.00 24.80 ? 345  SER B CA    1 
ATOM   3742 C C     . SER B 1 238 ? 7.985   36.714  34.533  1.00 24.05 ? 345  SER B C     1 
ATOM   3743 O O     . SER B 1 238 ? 7.632   37.564  33.712  1.00 24.58 ? 345  SER B O     1 
ATOM   3744 C CB    . SER B 1 238 ? 10.403  36.626  33.993  1.00 24.84 ? 345  SER B CB    1 
ATOM   3745 O OG    . SER B 1 238 ? 9.984   37.363  32.860  1.00 25.44 ? 345  SER B OG    1 
ATOM   3746 N N     . GLY B 1 239 ? 7.182   35.742  34.945  1.00 22.87 ? 346  GLY B N     1 
ATOM   3747 C CA    . GLY B 1 239 ? 5.836   35.619  34.434  1.00 21.59 ? 346  GLY B CA    1 
ATOM   3748 C C     . GLY B 1 239 ? 5.788   34.458  33.457  1.00 20.38 ? 346  GLY B C     1 
ATOM   3749 O O     . GLY B 1 239 ? 6.766   33.743  33.267  1.00 20.29 ? 346  GLY B O     1 
ATOM   3750 N N     . PRO B 1 240 ? 4.646   34.268  32.826  1.00 19.10 ? 347  PRO B N     1 
ATOM   3751 C CA    . PRO B 1 240 ? 4.462   33.167  31.885  1.00 17.70 ? 347  PRO B CA    1 
ATOM   3752 C C     . PRO B 1 240 ? 5.388   33.295  30.698  1.00 16.19 ? 347  PRO B C     1 
ATOM   3753 O O     . PRO B 1 240 ? 5.725   34.411  30.295  1.00 15.74 ? 347  PRO B O     1 
ATOM   3754 C CB    . PRO B 1 240 ? 3.003   33.314  31.435  1.00 18.15 ? 347  PRO B CB    1 
ATOM   3755 C CG    . PRO B 1 240 ? 2.409   34.407  32.234  1.00 18.74 ? 347  PRO B CG    1 
ATOM   3756 C CD    . PRO B 1 240 ? 3.453   35.105  32.965  1.00 19.18 ? 347  PRO B CD    1 
ATOM   3757 N N     . GLU B 1 241 ? 5.807   32.155  30.159  1.00 14.66 ? 348  GLU B N     1 
ATOM   3758 C CA    . GLU B 1 241 ? 6.636   32.142  28.969  1.00 13.76 ? 348  GLU B CA    1 
ATOM   3759 C C     . GLU B 1 241 ? 5.732   32.010  27.745  1.00 11.97 ? 348  GLU B C     1 
ATOM   3760 O O     . GLU B 1 241 ? 6.209   32.002  26.617  1.00 12.15 ? 348  GLU B O     1 
ATOM   3761 C CB    . GLU B 1 241 ? 7.633   30.993  29.019  1.00 14.07 ? 348  GLU B CB    1 
ATOM   3762 C CG    . GLU B 1 241 ? 8.482   30.987  30.287  1.00 15.60 ? 348  GLU B CG    1 
ATOM   3763 C CD    . GLU B 1 241 ? 9.380   32.204  30.416  1.00 17.98 ? 348  GLU B CD    1 
ATOM   3764 O OE1   . GLU B 1 241 ? 9.708   32.839  29.392  1.00 20.14 ? 348  GLU B OE1   1 
ATOM   3765 O OE2   . GLU B 1 241 ? 9.765   32.520  31.551  1.00 19.74 ? 348  GLU B OE2   1 
ATOM   3766 N N     . ALA B 1 242 ? 4.426   31.903  27.982  1.00 10.23 ? 349  ALA B N     1 
ATOM   3767 C CA    . ALA B 1 242 ? 3.438   31.804  26.896  1.00 8.66  ? 349  ALA B CA    1 
ATOM   3768 C C     . ALA B 1 242 ? 2.046   32.223  27.376  1.00 7.81  ? 349  ALA B C     1 
ATOM   3769 O O     . ALA B 1 242 ? 1.683   32.026  28.528  1.00 7.43  ? 349  ALA B O     1 
ATOM   3770 C CB    . ALA B 1 242 ? 3.391   30.383  26.347  1.00 8.18  ? 349  ALA B CB    1 
ATOM   3771 N N     . PRO B 1 243 ? 1.259   32.786  26.469  1.00 6.75  ? 350  PRO B N     1 
ATOM   3772 C CA    . PRO B 1 243 ? -0.111  33.203  26.772  1.00 6.26  ? 350  PRO B CA    1 
ATOM   3773 C C     . PRO B 1 243 ? -0.974  32.015  27.193  1.00 6.09  ? 350  PRO B C     1 
ATOM   3774 O O     . PRO B 1 243 ? -0.775  30.904  26.696  1.00 6.73  ? 350  PRO B O     1 
ATOM   3775 C CB    . PRO B 1 243 ? -0.622  33.754  25.432  1.00 6.31  ? 350  PRO B CB    1 
ATOM   3776 C CG    . PRO B 1 243 ? 0.526   33.784  24.513  1.00 6.11  ? 350  PRO B CG    1 
ATOM   3777 C CD    . PRO B 1 243 ? 1.647   33.059  25.084  1.00 6.83  ? 350  PRO B CD    1 
ATOM   3778 N N     . GLU B 1 244 ? -1.953  32.249  28.058  1.00 5.30  ? 351  GLU B N     1 
ATOM   3779 C CA    . GLU B 1 244 ? -2.778  31.158  28.577  1.00 4.97  ? 351  GLU B CA    1 
ATOM   3780 C C     . GLU B 1 244 ? -3.490  30.348  27.486  1.00 4.20  ? 351  GLU B C     1 
ATOM   3781 O O     . GLU B 1 244 ? -3.549  29.121  27.569  1.00 3.81  ? 351  GLU B O     1 
ATOM   3782 C CB    . GLU B 1 244 ? -3.789  31.689  29.590  1.00 5.24  ? 351  GLU B CB    1 
ATOM   3783 C CG    . GLU B 1 244 ? -4.663  30.612  30.224  1.00 5.80  ? 351  GLU B CG    1 
ATOM   3784 C CD    . GLU B 1 244 ? -3.897  29.558  31.017  1.00 5.86  ? 351  GLU B CD    1 
ATOM   3785 O OE1   . GLU B 1 244 ? -2.707  29.759  31.367  1.00 6.04  ? 351  GLU B OE1   1 
ATOM   3786 O OE2   . GLU B 1 244 ? -4.503  28.506  31.308  1.00 5.89  ? 351  GLU B OE2   1 
ATOM   3787 N N     . TRP B 1 245 ? -4.036  31.021  26.471  1.00 3.60  ? 352  TRP B N     1 
ATOM   3788 C CA    . TRP B 1 245 ? -4.753  30.316  25.410  1.00 2.83  ? 352  TRP B CA    1 
ATOM   3789 C C     . TRP B 1 245 ? -3.839  29.314  24.700  1.00 2.68  ? 352  TRP B C     1 
ATOM   3790 O O     . TRP B 1 245 ? -4.288  28.264  24.239  1.00 2.42  ? 352  TRP B O     1 
ATOM   3791 C CB    . TRP B 1 245 ? -5.358  31.301  24.398  1.00 2.90  ? 352  TRP B CB    1 
ATOM   3792 C CG    . TRP B 1 245 ? -4.376  32.148  23.671  1.00 2.35  ? 352  TRP B CG    1 
ATOM   3793 C CD1   . TRP B 1 245 ? -4.062  33.440  23.945  1.00 2.57  ? 352  TRP B CD1   1 
ATOM   3794 C CD2   . TRP B 1 245 ? -3.584  31.777  22.536  1.00 2.30  ? 352  TRP B CD2   1 
ATOM   3795 N NE1   . TRP B 1 245 ? -3.129  33.902  23.049  1.00 2.79  ? 352  TRP B NE1   1 
ATOM   3796 C CE2   . TRP B 1 245 ? -2.808  32.899  22.180  1.00 2.27  ? 352  TRP B CE2   1 
ATOM   3797 C CE3   . TRP B 1 245 ? -3.456  30.610  21.777  1.00 2.46  ? 352  TRP B CE3   1 
ATOM   3798 C CZ2   . TRP B 1 245 ? -1.921  32.889  21.116  1.00 2.41  ? 352  TRP B CZ2   1 
ATOM   3799 C CZ3   . TRP B 1 245 ? -2.579  30.598  20.719  1.00 3.11  ? 352  TRP B CZ3   1 
ATOM   3800 C CH2   . TRP B 1 245 ? -1.819  31.730  20.395  1.00 3.51  ? 352  TRP B CH2   1 
ATOM   3801 N N     . TYR B 1 246 ? -2.559  29.667  24.604  1.00 2.29  ? 353  TYR B N     1 
ATOM   3802 C CA    . TYR B 1 246 ? -1.543  28.847  23.954  1.00 2.23  ? 353  TYR B CA    1 
ATOM   3803 C C     . TYR B 1 246 ? -1.256  27.609  24.812  1.00 2.45  ? 353  TYR B C     1 
ATOM   3804 O O     . TYR B 1 246 ? -1.090  26.499  24.298  1.00 2.55  ? 353  TYR B O     1 
ATOM   3805 C CB    . TYR B 1 246 ? -0.282  29.690  23.758  1.00 2.20  ? 353  TYR B CB    1 
ATOM   3806 C CG    . TYR B 1 246 ? 0.885   29.008  23.089  1.00 2.39  ? 353  TYR B CG    1 
ATOM   3807 C CD1   . TYR B 1 246 ? 1.117   29.161  21.724  1.00 2.58  ? 353  TYR B CD1   1 
ATOM   3808 C CD2   . TYR B 1 246 ? 1.757   28.223  23.811  1.00 2.27  ? 353  TYR B CD2   1 
ATOM   3809 C CE1   . TYR B 1 246 ? 2.197   28.557  21.115  1.00 2.51  ? 353  TYR B CE1   1 
ATOM   3810 C CE2   . TYR B 1 246 ? 2.835   27.618  23.214  1.00 2.71  ? 353  TYR B CE2   1 
ATOM   3811 C CZ    . TYR B 1 246 ? 3.052   27.786  21.864  1.00 2.76  ? 353  TYR B CZ    1 
ATOM   3812 O OH    . TYR B 1 246 ? 4.132   27.180  21.274  1.00 3.88  ? 353  TYR B OH    1 
ATOM   3813 N N     . GLN B 1 247 ? -1.207  27.806  26.126  1.00 2.54  ? 354  GLN B N     1 
ATOM   3814 C CA    . GLN B 1 247 ? -0.987  26.699  27.045  1.00 2.81  ? 354  GLN B CA    1 
ATOM   3815 C C     . GLN B 1 247 ? -2.154  25.712  26.984  1.00 2.81  ? 354  GLN B C     1 
ATOM   3816 O O     . GLN B 1 247 ? -1.962  24.488  26.959  1.00 2.48  ? 354  GLN B O     1 
ATOM   3817 C CB    . GLN B 1 247 ? -0.798  27.232  28.468  1.00 3.50  ? 354  GLN B CB    1 
ATOM   3818 C CG    . GLN B 1 247 ? 0.281   28.304  28.529  1.00 5.42  ? 354  GLN B CG    1 
ATOM   3819 C CD    . GLN B 1 247 ? 0.713   28.634  29.926  1.00 8.22  ? 354  GLN B CD    1 
ATOM   3820 O OE1   . GLN B 1 247 ? 1.012   27.737  30.704  1.00 11.47 ? 354  GLN B OE1   1 
ATOM   3821 N NE2   . GLN B 1 247 ? 0.769   29.927  30.250  1.00 9.70  ? 354  GLN B NE2   1 
ATOM   3822 N N     . VAL B 1 248 ? -3.363  26.264  26.945  1.00 3.03  ? 355  VAL B N     1 
ATOM   3823 C CA    . VAL B 1 248 ? -4.582  25.477  26.869  1.00 3.04  ? 355  VAL B CA    1 
ATOM   3824 C C     . VAL B 1 248 ? -4.595  24.701  25.553  1.00 3.26  ? 355  VAL B C     1 
ATOM   3825 O O     . VAL B 1 248 ? -4.934  23.526  25.528  1.00 3.75  ? 355  VAL B O     1 
ATOM   3826 C CB    . VAL B 1 248 ? -5.814  26.376  26.964  1.00 3.31  ? 355  VAL B CB    1 
ATOM   3827 C CG1   . VAL B 1 248 ? -7.065  25.632  26.481  1.00 3.80  ? 355  VAL B CG1   1 
ATOM   3828 C CG2   . VAL B 1 248 ? -5.997  26.893  28.371  1.00 2.82  ? 355  VAL B CG2   1 
ATOM   3829 N N     . GLU B 1 249 ? -4.213  25.361  24.463  1.00 3.25  ? 356  GLU B N     1 
ATOM   3830 C CA    . GLU B 1 249 ? -4.162  24.720  23.151  1.00 3.82  ? 356  GLU B CA    1 
ATOM   3831 C C     . GLU B 1 249 ? -3.074  23.644  23.101  1.00 3.64  ? 356  GLU B C     1 
ATOM   3832 O O     . GLU B 1 249 ? -3.245  22.595  22.474  1.00 3.51  ? 356  GLU B O     1 
ATOM   3833 C CB    . GLU B 1 249 ? -3.921  25.760  22.056  1.00 3.78  ? 356  GLU B CB    1 
ATOM   3834 C CG    . GLU B 1 249 ? -4.267  25.277  20.653  1.00 5.39  ? 356  GLU B CG    1 
ATOM   3835 C CD    A GLU B 1 249 ? -5.616  24.566  20.402  0.50 8.70  ? 356  GLU B CD    1 
ATOM   3836 C CD    B GLU B 1 249 ? -4.645  26.467  19.803  0.50 7.78  ? 356  GLU B CD    1 
ATOM   3837 O OE1   A GLU B 1 249 ? -6.667  24.543  21.419  0.50 14.15 ? 356  GLU B OE1   1 
ATOM   3838 O OE1   B GLU B 1 249 ? -3.865  26.857  19.115  0.50 8.79  ? 356  GLU B OE1   1 
ATOM   3839 O OE2   A GLU B 1 249 ? -5.765  23.565  19.563  0.50 13.63 ? 356  GLU B OE2   1 
ATOM   3840 O OE2   B GLU B 1 249 ? -6.047  26.986  20.055  0.50 18.45 ? 356  GLU B OE2   1 
ATOM   3841 N N     . LEU B 1 250 ? -1.957  23.909  23.767  1.00 3.92  ? 357  LEU B N     1 
ATOM   3842 C CA    . LEU B 1 250 ? -0.847  22.962  23.825  1.00 4.06  ? 357  LEU B CA    1 
ATOM   3843 C C     . LEU B 1 250 ? -1.318  21.660  24.468  1.00 4.30  ? 357  LEU B C     1 
ATOM   3844 O O     . LEU B 1 250 ? -1.002  20.576  23.994  1.00 4.22  ? 357  LEU B O     1 
ATOM   3845 C CB    . LEU B 1 250 ? 0.328   23.559  24.601  1.00 3.98  ? 357  LEU B CB    1 
ATOM   3846 C CG    . LEU B 1 250 ? 1.570   22.656  24.712  1.00 4.03  ? 357  LEU B CG    1 
ATOM   3847 C CD1   . LEU B 1 250 ? 2.019   22.188  23.324  1.00 4.04  ? 357  LEU B CD1   1 
ATOM   3848 C CD2   . LEU B 1 250 ? 2.709   23.363  25.431  1.00 3.26  ? 357  LEU B CD2   1 
ATOM   3849 N N     . LYS B 1 251 ? -2.079  21.786  25.551  1.00 5.11  ? 358  LYS B N     1 
ATOM   3850 C CA    . LYS B 1 251 ? -2.657  20.644  26.257  1.00 5.40  ? 358  LYS B CA    1 
ATOM   3851 C C     . LYS B 1 251 ? -3.605  19.852  25.350  1.00 5.57  ? 358  LYS B C     1 
ATOM   3852 O O     . LYS B 1 251 ? -3.530  18.630  25.287  1.00 5.92  ? 358  LYS B O     1 
ATOM   3853 C CB    . LYS B 1 251 ? -3.403  21.123  27.506  1.00 5.60  ? 358  LYS B CB    1 
ATOM   3854 C CG    . LYS B 1 251 ? -4.107  20.019  28.281  1.00 5.61  ? 358  LYS B CG    1 
ATOM   3855 C CD    . LYS B 1 251 ? -4.827  20.584  29.495  1.00 5.88  ? 358  LYS B CD    1 
ATOM   3856 C CE    . LYS B 1 251 ? -5.800  19.587  30.095  1.00 6.54  ? 358  LYS B CE    1 
ATOM   3857 N NZ    . LYS B 1 251 ? -6.356  20.132  31.371  1.00 7.56  ? 358  LYS B NZ    1 
ATOM   3858 N N     . ALA B 1 252 ? -4.501  20.550  24.659  1.00 5.55  ? 359  ALA B N     1 
ATOM   3859 C CA    . ALA B 1 252 ? -5.447  19.910  23.753  1.00 5.66  ? 359  ALA B CA    1 
ATOM   3860 C C     . ALA B 1 252 ? -4.701  19.242  22.596  1.00 5.46  ? 359  ALA B C     1 
ATOM   3861 O O     . ALA B 1 252 ? -5.030  18.130  22.189  1.00 4.82  ? 359  ALA B O     1 
ATOM   3862 C CB    . ALA B 1 252 ? -6.433  20.927  23.228  1.00 5.68  ? 359  ALA B CB    1 
ATOM   3863 N N     . PHE B 1 253 ? -3.679  19.922  22.088  1.00 5.58  ? 360  PHE B N     1 
ATOM   3864 C CA    . PHE B 1 253 ? -2.882  19.400  20.984  1.00 6.05  ? 360  PHE B CA    1 
ATOM   3865 C C     . PHE B 1 253 ? -2.188  18.094  21.361  1.00 6.18  ? 360  PHE B C     1 
ATOM   3866 O O     . PHE B 1 253 ? -2.301  17.098  20.658  1.00 5.55  ? 360  PHE B O     1 
ATOM   3867 C CB    . PHE B 1 253 ? -1.842  20.428  20.543  1.00 6.42  ? 360  PHE B CB    1 
ATOM   3868 C CG    . PHE B 1 253 ? -0.893  19.908  19.508  1.00 7.13  ? 360  PHE B CG    1 
ATOM   3869 C CD1   . PHE B 1 253 ? -1.362  19.530  18.260  1.00 9.04  ? 360  PHE B CD1   1 
ATOM   3870 C CD2   . PHE B 1 253 ? 0.462   19.782  19.783  1.00 8.12  ? 360  PHE B CD2   1 
ATOM   3871 C CE1   . PHE B 1 253 ? -0.502  19.045  17.310  1.00 9.05  ? 360  PHE B CE1   1 
ATOM   3872 C CE2   . PHE B 1 253 ? 1.328   19.296  18.825  1.00 8.19  ? 360  PHE B CE2   1 
ATOM   3873 C CZ    . PHE B 1 253 ? 0.838   18.928  17.586  1.00 8.64  ? 360  PHE B CZ    1 
ATOM   3874 N N     . GLN B 1 254 ? -1.493  18.096  22.497  1.00 6.27  ? 361  GLN B N     1 
ATOM   3875 C CA    . GLN B 1 254 ? -0.756  16.921  22.948  1.00 7.03  ? 361  GLN B CA    1 
ATOM   3876 C C     . GLN B 1 254 ? -1.657  15.723  23.200  1.00 7.14  ? 361  GLN B C     1 
ATOM   3877 O O     . GLN B 1 254 ? -1.249  14.582  22.994  1.00 6.73  ? 361  GLN B O     1 
ATOM   3878 C CB    . GLN B 1 254 ? 0.039   17.256  24.213  1.00 7.28  ? 361  GLN B CB    1 
ATOM   3879 C CG    . GLN B 1 254 ? 1.267   18.109  23.940  1.00 9.08  ? 361  GLN B CG    1 
ATOM   3880 C CD    . GLN B 1 254 ? 2.252   17.436  22.996  1.00 12.30 ? 361  GLN B CD    1 
ATOM   3881 O OE1   . GLN B 1 254 ? 2.911   18.106  22.199  1.00 14.85 ? 361  GLN B OE1   1 
ATOM   3882 N NE2   . GLN B 1 254 ? 2.360   16.115  23.086  1.00 14.41 ? 361  GLN B NE2   1 
ATOM   3883 N N     . ALA B 1 255 ? -2.893  15.988  23.615  1.00 7.77  ? 362  ALA B N     1 
ATOM   3884 C CA    . ALA B 1 255 ? -3.853  14.927  23.912  1.00 8.20  ? 362  ALA B CA    1 
ATOM   3885 C C     . ALA B 1 255 ? -4.175  14.093  22.667  1.00 8.89  ? 362  ALA B C     1 
ATOM   3886 O O     . ALA B 1 255 ? -4.612  12.945  22.775  1.00 8.84  ? 362  ALA B O     1 
ATOM   3887 C CB    . ALA B 1 255 ? -5.120  15.524  24.497  1.00 8.18  ? 362  ALA B CB    1 
ATOM   3888 N N     . THR B 1 256 ? -3.937  14.674  21.495  1.00 9.49  ? 363  THR B N     1 
ATOM   3889 C CA    . THR B 1 256 ? -4.210  14.020  20.219  1.00 10.34 ? 363  THR B CA    1 
ATOM   3890 C C     . THR B 1 256 ? -2.936  13.559  19.536  1.00 10.67 ? 363  THR B C     1 
ATOM   3891 O O     . THR B 1 256 ? -2.990  12.917  18.490  1.00 10.67 ? 363  THR B O     1 
ATOM   3892 C CB    . THR B 1 256 ? -4.905  15.021  19.287  1.00 10.55 ? 363  THR B CB    1 
ATOM   3893 O OG1   . THR B 1 256 ? -6.172  15.393  19.834  1.00 11.27 ? 363  THR B OG1   1 
ATOM   3894 C CG2   . THR B 1 256 ? -5.236  14.412  17.956  1.00 11.02 ? 363  THR B CG2   1 
ATOM   3895 N N     . GLN B 1 257 ? -1.789  13.895  20.116  1.00 10.90 ? 364  GLN B N     1 
ATOM   3896 C CA    . GLN B 1 257 ? -0.505  13.570  19.506  1.00 11.26 ? 364  GLN B CA    1 
ATOM   3897 C C     . GLN B 1 257 ? -0.002  12.184  19.867  1.00 11.59 ? 364  GLN B C     1 
ATOM   3898 O O     . GLN B 1 257 ? -0.260  11.675  20.959  1.00 11.39 ? 364  GLN B O     1 
ATOM   3899 C CB    . GLN B 1 257 ? 0.546   14.604  19.901  1.00 11.56 ? 364  GLN B CB    1 
ATOM   3900 C CG    . GLN B 1 257 ? 0.499   15.871  19.062  1.00 11.92 ? 364  GLN B CG    1 
ATOM   3901 C CD    . GLN B 1 257 ? 0.684   15.606  17.577  1.00 12.39 ? 364  GLN B CD    1 
ATOM   3902 O OE1   . GLN B 1 257 ? 1.800   15.351  17.119  1.00 12.74 ? 364  GLN B OE1   1 
ATOM   3903 N NE2   . GLN B 1 257 ? -0.414  15.671  16.819  1.00 12.51 ? 364  GLN B NE2   1 
ATOM   3904 N N     . GLN B 1 258 ? 0.706   11.572  18.926  1.00 12.06 ? 365  GLN B N     1 
ATOM   3905 C CA    . GLN B 1 258 ? 1.367   10.308  19.187  1.00 12.61 ? 365  GLN B CA    1 
ATOM   3906 C C     . GLN B 1 258 ? 2.616   10.655  19.967  1.00 13.02 ? 365  GLN B C     1 
ATOM   3907 O O     . GLN B 1 258 ? 3.588   11.151  19.398  1.00 13.14 ? 365  GLN B O     1 
ATOM   3908 C CB    . GLN B 1 258 ? 1.732   9.578   17.898  1.00 12.78 ? 365  GLN B CB    1 
ATOM   3909 C CG    . GLN B 1 258 ? 0.520   8.934   17.231  1.00 13.30 ? 365  GLN B CG    1 
ATOM   3910 C CD    . GLN B 1 258 ? 0.865   7.931   16.152  1.00 14.12 ? 365  GLN B CD    1 
ATOM   3911 O OE1   . GLN B 1 258 ? 1.942   7.338   16.156  1.00 14.94 ? 365  GLN B OE1   1 
ATOM   3912 N NE2   . GLN B 1 258 ? -0.068  7.730   15.218  1.00 14.99 ? 365  GLN B NE2   1 
ATOM   3913 N N     . LYS B 1 259 ? 2.566   10.422  21.274  1.00 13.29 ? 366  LYS B N     1 
ATOM   3914 C CA    . LYS B 1 259 ? 3.681   10.713  22.156  1.00 13.59 ? 366  LYS B CA    1 
ATOM   3915 C C     . LYS B 1 259 ? 4.513   9.444   22.354  1.00 13.75 ? 366  LYS B C     1 
ATOM   3916 O O     . LYS B 1 259 ? 3.992   8.328   22.268  1.00 14.10 ? 366  LYS B O     1 
ATOM   3917 C CB    . LYS B 1 259 ? 3.166   11.233  23.498  1.00 13.64 ? 366  LYS B CB    1 
ATOM   3918 C CG    . LYS B 1 259 ? 2.373   12.528  23.383  1.00 13.53 ? 366  LYS B CG    1 
ATOM   3919 C CD    . LYS B 1 259 ? 1.670   12.886  24.690  1.00 13.32 ? 366  LYS B CD    1 
ATOM   3920 C CE    . LYS B 1 259 ? 0.420   12.049  24.905  1.00 13.16 ? 366  LYS B CE    1 
ATOM   3921 N NZ    . LYS B 1 259 ? -0.535  12.167  23.782  1.00 13.08 ? 366  LYS B NZ    1 
ATOM   3922 N N     . ALA C 2 1   ? 8.996   19.908  38.353  1.00 12.39 ? 1    ALA K N     1 
ATOM   3923 C CA    . ALA C 2 1   ? 8.059   18.939  37.729  1.00 12.32 ? 1    ALA K CA    1 
ATOM   3924 C C     . ALA C 2 1   ? 7.923   17.674  38.576  1.00 11.87 ? 1    ALA K C     1 
ATOM   3925 O O     . ALA C 2 1   ? 8.855   17.304  39.301  1.00 11.99 ? 1    ALA K O     1 
ATOM   3926 C CB    . ALA C 2 1   ? 8.537   18.584  36.343  1.00 12.87 ? 1    ALA K CB    1 
ATOM   3927 N N     . ARG C 2 2   ? 6.723   17.102  38.604  1.00 10.65 ? 2    ARG K N     1 
ATOM   3928 C CA    . ARG C 2 2   ? 6.470   15.840  39.291  1.00 10.19 ? 2    ARG K CA    1 
ATOM   3929 C C     . ARG C 2 2   ? 7.094   14.579  38.700  1.00 9.34  ? 2    ARG K C     1 
ATOM   3930 O O     . ARG C 2 2   ? 6.421   13.555  38.530  1.00 8.70  ? 2    ARG K O     1 
ATOM   3931 C CB    . ARG C 2 2   ? 4.974   15.667  39.504  1.00 10.49 ? 2    ARG K CB    1 
ATOM   3932 C CG    . ARG C 2 2   ? 4.415   16.668  40.510  1.00 11.49 ? 2    ARG K CG    1 
ATOM   3933 C CD    . ARG C 2 2   ? 3.077   16.269  41.101  1.00 13.38 ? 2    ARG K CD    1 
ATOM   3934 N NE    . ARG C 2 2   ? 2.519   17.280  41.994  1.00 14.59 ? 2    ARG K NE    1 
ATOM   3935 C CZ    . ARG C 2 2   ? 1.339   17.177  42.589  1.00 16.21 ? 2    ARG K CZ    1 
ATOM   3936 N NH1   . ARG C 2 2   ? 0.571   16.115  42.374  1.00 16.66 ? 2    ARG K NH1   1 
ATOM   3937 N NH2   . ARG C 2 2   ? 0.918   18.135  43.406  1.00 17.20 ? 2    ARG K NH2   1 
ATOM   3938 N N     . THR C 2 3   ? 8.389   14.649  38.415  1.00 8.38  ? 3    THR K N     1 
ATOM   3939 C CA    . THR C 2 3   ? 9.111   13.512  37.888  1.00 8.36  ? 3    THR K CA    1 
ATOM   3940 C C     . THR C 2 3   ? 10.587  13.644  38.268  1.00 7.71  ? 3    THR K C     1 
ATOM   3941 O O     . THR C 2 3   ? 11.070  14.728  38.566  1.00 6.59  ? 3    THR K O     1 
ATOM   3942 C CB    . THR C 2 3   ? 8.979   13.404  36.364  1.00 9.04  ? 3    THR K CB    1 
ATOM   3943 O OG1   . THR C 2 3   ? 10.130  13.974  35.730  1.00 11.22 ? 3    THR K OG1   1 
ATOM   3944 C CG2   . THR C 2 3   ? 7.815   14.212  35.820  1.00 8.63  ? 3    THR K CG2   1 
HETATM 3945 N N     . MLZ C 2 4   ? 11.029  12.295  37.865  1.00 3.37  ? 4    MLZ K N     1 
HETATM 3946 C CA    . MLZ C 2 4   ? 12.449  12.304  38.194  1.00 2.52  ? 4    MLZ K CA    1 
HETATM 3947 C CB    . MLZ C 2 4   ? 12.904  10.873  38.053  1.00 2.54  ? 4    MLZ K CB    1 
HETATM 3948 C CG    . MLZ C 2 4   ? 12.084  9.965   38.945  1.00 2.40  ? 4    MLZ K CG    1 
HETATM 3949 C CD    . MLZ C 2 4   ? 12.364  8.512   38.589  1.00 2.45  ? 4    MLZ K CD    1 
HETATM 3950 C CE    . MLZ C 2 4   ? 11.574  7.615   39.523  1.00 2.66  ? 4    MLZ K CE    1 
HETATM 3951 N NZ    . MLZ C 2 4   ? 11.719  6.209   39.159  1.00 2.32  ? 4    MLZ K NZ    1 
HETATM 3952 C CM    . MLZ C 2 4   ? 11.009  5.204   39.930  1.00 2.73  ? 4    MLZ K CM    1 
HETATM 3953 C C     . MLZ C 2 4   ? 13.197  13.193  37.235  1.00 3.01  ? 4    MLZ K C     1 
HETATM 3954 O O     . MLZ C 2 4   ? 12.962  13.222  36.056  1.00 2.56  ? 4    MLZ K O     1 
ATOM   3955 N N     . GLN C 2 5   ? 14.584  13.478  37.797  1.00 7.22  ? 5    GLN K N     1 
ATOM   3956 C CA    . GLN C 2 5   ? 15.450  14.271  36.884  1.00 8.17  ? 5    GLN K CA    1 
ATOM   3957 C C     . GLN C 2 5   ? 14.750  15.431  36.194  1.00 8.64  ? 5    GLN K C     1 
ATOM   3958 O O     . GLN C 2 5   ? 15.022  15.707  35.035  1.00 8.44  ? 5    GLN K O     1 
ATOM   3959 C CB    . GLN C 2 5   ? 16.054  13.370  35.828  1.00 8.43  ? 5    GLN K CB    1 
ATOM   3960 C CG    . GLN C 2 5   ? 16.970  12.351  36.383  1.00 8.88  ? 5    GLN K CG    1 
ATOM   3961 C CD    . GLN C 2 5   ? 18.081  11.997  35.430  1.00 9.35  ? 5    GLN K CD    1 
ATOM   3962 O OE1   . GLN C 2 5   ? 17.869  11.885  34.227  1.00 8.97  ? 5    GLN K OE1   1 
ATOM   3963 N NE2   . GLN C 2 5   ? 19.276  11.807  35.972  1.00 9.42  ? 5    GLN K NE2   1 
ATOM   3964 N N     . THR C 2 6   ? 13.745  15.998  36.835  1.00 9.60  ? 6    THR K N     1 
ATOM   3965 C CA    . THR C 2 6   ? 13.138  17.229  36.381  1.00 10.73 ? 6    THR K CA    1 
ATOM   3966 C C     . THR C 2 6   ? 14.104  18.390  36.122  1.00 11.09 ? 6    THR K C     1 
ATOM   3967 O O     . THR C 2 6   ? 14.998  18.679  36.930  1.00 10.66 ? 6    THR K O     1 
ATOM   3968 C CB    . THR C 2 6   ? 12.040  17.631  37.363  1.00 10.90 ? 6    THR K CB    1 
ATOM   3969 O OG1   . THR C 2 6   ? 11.316  18.746  36.833  1.00 12.28 ? 6    THR K OG1   1 
ATOM   3970 C CG2   . THR C 2 6   ? 12.600  18.116  38.676  1.00 11.76 ? 6    THR K CG2   1 
ATOM   3971 N N     . ALA C 2 7   ? 13.884  19.030  34.973  1.00 11.81 ? 7    ALA K N     1 
ATOM   3972 C CA    . ALA C 2 7   ? 14.630  20.184  34.495  1.00 12.53 ? 7    ALA K CA    1 
ATOM   3973 C C     . ALA C 2 7   ? 14.556  21.319  35.484  1.00 13.22 ? 7    ALA K C     1 
ATOM   3974 O O     . ALA C 2 7   ? 13.501  21.601  36.053  1.00 13.11 ? 7    ALA K O     1 
ATOM   3975 C CB    . ALA C 2 7   ? 14.059  20.649  33.157  1.00 12.47 ? 7    ALA K CB    1 
ATOM   3976 N N     . ARG C 2 8   ? 15.686  21.985  35.664  1.00 14.21 ? 8    ARG K N     1 
ATOM   3977 C CA    . ARG C 2 8   ? 15.771  23.093  36.588  1.00 14.87 ? 8    ARG K CA    1 
ATOM   3978 C C     . ARG C 2 8   ? 15.329  24.395  35.926  1.00 14.75 ? 8    ARG K C     1 
ATOM   3979 O O     . ARG C 2 8   ? 15.383  24.535  34.715  1.00 14.65 ? 8    ARG K O     1 
ATOM   3980 C CB    . ARG C 2 8   ? 17.199  23.225  37.085  1.00 15.34 ? 8    ARG K CB    1 
ATOM   3981 C CG    . ARG C 2 8   ? 17.295  23.916  38.407  1.00 16.87 ? 8    ARG K CG    1 
ATOM   3982 C CD    . ARG C 2 8   ? 18.715  24.179  38.833  1.00 18.48 ? 8    ARG K CD    1 
ATOM   3983 N NE    . ARG C 2 8   ? 18.899  25.527  39.347  1.00 19.64 ? 8    ARG K NE    1 
ATOM   3984 C CZ    . ARG C 2 8   ? 19.763  25.839  40.293  1.00 20.69 ? 8    ARG K CZ    1 
ATOM   3985 N NH1   . ARG C 2 8   ? 20.502  24.888  40.845  1.00 21.86 ? 8    ARG K NH1   1 
ATOM   3986 N NH2   . ARG C 2 8   ? 19.885  27.095  40.703  1.00 20.91 ? 8    ARG K NH2   1 
ATOM   3987 N N     . LYS C 2 9   ? 14.897  25.343  36.745  1.00 14.92 ? 9    LYS K N     1 
ATOM   3988 C CA    . LYS C 2 9   ? 14.466  26.644  36.275  1.00 14.95 ? 9    LYS K CA    1 
ATOM   3989 C C     . LYS C 2 9   ? 15.529  27.676  36.635  1.00 14.60 ? 9    LYS K C     1 
ATOM   3990 O O     . LYS C 2 9   ? 16.025  27.681  37.755  1.00 14.59 ? 9    LYS K O     1 
ATOM   3991 C CB    . LYS C 2 9   ? 13.143  27.010  36.942  1.00 15.30 ? 9    LYS K CB    1 
ATOM   3992 C CG    . LYS C 2 9   ? 12.515  28.277  36.408  1.00 15.99 ? 9    LYS K CG    1 
ATOM   3993 C CD    . LYS C 2 9   ? 12.015  28.080  34.985  1.00 16.93 ? 9    LYS K CD    1 
ATOM   3994 C CE    . LYS C 2 9   ? 11.418  29.347  34.407  1.00 17.56 ? 9    LYS K CE    1 
ATOM   3995 N NZ    . LYS C 2 9   ? 10.839  29.172  33.040  1.00 18.06 ? 9    LYS K NZ    1 
ATOM   3996 N N     . TYR C 2 10  ? 15.874  28.546  35.689  1.00 14.19 ? 10   TYR K N     1 
ATOM   3997 C CA    . TYR C 2 10  ? 16.904  29.561  35.916  1.00 14.11 ? 10   TYR K CA    1 
ATOM   3998 C C     . TYR C 2 10  ? 16.349  30.958  35.649  1.00 14.14 ? 10   TYR K C     1 
ATOM   3999 O O     . TYR C 2 10  ? 15.294  31.125  35.050  1.00 14.51 ? 10   TYR K O     1 
ATOM   4000 C CB    . TYR C 2 10  ? 18.127  29.273  35.050  1.00 13.87 ? 10   TYR K CB    1 
ATOM   4001 C CG    . TYR C 2 10  ? 18.817  27.984  35.439  1.00 13.76 ? 10   TYR K CG    1 
ATOM   4002 C CD1   . TYR C 2 10  ? 18.440  26.775  34.878  1.00 13.67 ? 10   TYR K CD1   1 
ATOM   4003 C CD2   . TYR C 2 10  ? 19.836  27.976  36.386  1.00 13.60 ? 10   TYR K CD2   1 
ATOM   4004 C CE1   . TYR C 2 10  ? 19.061  25.596  35.241  1.00 14.13 ? 10   TYR K CE1   1 
ATOM   4005 C CE2   . TYR C 2 10  ? 20.462  26.800  36.751  1.00 13.59 ? 10   TYR K CE2   1 
ATOM   4006 C CZ    . TYR C 2 10  ? 20.074  25.616  36.175  1.00 14.21 ? 10   TYR K CZ    1 
ATOM   4007 O OH    . TYR C 2 10  ? 20.694  24.442  36.532  1.00 15.41 ? 10   TYR K OH    1 
ATOM   4008 O OXT   . TYR C 2 10  ? 16.895  31.990  36.032  1.00 14.07 ? 10   TYR K OXT   1 
ATOM   4009 N N     . ALA D 2 1   ? 11.824  34.165  26.026  1.00 28.54 ? 1    ALA L N     1 
ATOM   4010 C CA    . ALA D 2 1   ? 11.376  35.354  25.266  1.00 28.38 ? 1    ALA L CA    1 
ATOM   4011 C C     . ALA D 2 1   ? 9.847   35.349  25.111  1.00 28.43 ? 1    ALA L C     1 
ATOM   4012 O O     . ALA D 2 1   ? 9.316   34.540  24.363  1.00 28.03 ? 1    ALA L O     1 
ATOM   4013 C CB    . ALA D 2 1   ? 12.050  35.378  23.899  1.00 28.57 ? 1    ALA L CB    1 
ATOM   4014 N N     . ARG D 2 2   ? 9.153   36.092  25.971  1.00 28.53 ? 2    ARG L N     1 
ATOM   4015 C CA    . ARG D 2 2   ? 7.756   36.498  25.797  1.00 28.73 ? 2    ARG L CA    1 
ATOM   4016 C C     . ARG D 2 2   ? 7.272   36.996  24.407  1.00 28.20 ? 2    ARG L C     1 
ATOM   4017 O O     . ARG D 2 2   ? 6.285   37.714  24.349  1.00 28.20 ? 2    ARG L O     1 
ATOM   4018 C CB    . ARG D 2 2   ? 7.405   37.544  26.870  1.00 29.06 ? 2    ARG L CB    1 
ATOM   4019 C CG    . ARG D 2 2   ? 6.665   36.972  28.090  1.00 30.59 ? 2    ARG L CG    1 
ATOM   4020 C CD    . ARG D 2 2   ? 6.006   38.044  28.970  1.00 31.87 ? 2    ARG L CD    1 
ATOM   4021 N NE    . ARG D 2 2   ? 5.745   37.602  30.334  1.00 32.48 ? 2    ARG L NE    1 
ATOM   4022 C CZ    . ARG D 2 2   ? 5.856   38.387  31.402  1.00 33.34 ? 2    ARG L CZ    1 
ATOM   4023 N NH1   . ARG D 2 2   ? 6.233   39.652  31.278  1.00 33.73 ? 2    ARG L NH1   1 
ATOM   4024 N NH2   . ARG D 2 2   ? 5.596   37.910  32.604  1.00 33.56 ? 2    ARG L NH2   1 
ATOM   4025 N N     . THR D 2 3   ? 7.938   36.624  23.309  1.00 27.76 ? 3    THR L N     1 
ATOM   4026 C CA    . THR D 2 3   ? 7.435   36.926  21.962  1.00 27.42 ? 3    THR L CA    1 
ATOM   4027 C C     . THR D 2 3   ? 7.524   35.746  20.988  1.00 27.02 ? 3    THR L C     1 
ATOM   4028 O O     . THR D 2 3   ? 7.914   34.633  21.330  1.00 26.49 ? 3    THR L O     1 
ATOM   4029 C CB    . THR D 2 3   ? 8.180   38.101  21.333  1.00 27.47 ? 3    THR L CB    1 
ATOM   4030 O OG1   . THR D 2 3   ? 9.465   37.668  20.861  1.00 27.07 ? 3    THR L OG1   1 
ATOM   4031 C CG2   . THR D 2 3   ? 8.507   39.137  22.338  1.00 27.44 ? 3    THR L CG2   1 
HETATM 4032 N N     . MLZ D 2 4   ? 6.985   35.958  19.507  1.00 20.15 ? 4    MLZ L N     1 
HETATM 4033 C CA    . MLZ D 2 4   ? 7.232   34.812  18.653  1.00 19.70 ? 4    MLZ L CA    1 
HETATM 4034 C CB    . MLZ D 2 4   ? 6.277   34.967  17.497  1.00 20.19 ? 4    MLZ L CB    1 
HETATM 4035 C CG    . MLZ D 2 4   ? 4.838   35.224  17.943  1.00 20.01 ? 4    MLZ L CG    1 
HETATM 4036 C CD    . MLZ D 2 4   ? 4.119   36.009  16.860  1.00 20.19 ? 4    MLZ L CD    1 
HETATM 4037 C CE    . MLZ D 2 4   ? 2.642   36.092  17.184  1.00 19.90 ? 4    MLZ L CE    1 
HETATM 4038 N NZ    . MLZ D 2 4   ? 1.970   36.643  16.020  1.00 19.28 ? 4    MLZ L NZ    1 
HETATM 4039 C CM    . MLZ D 2 4   ? 0.533   36.868  16.070  1.00 18.90 ? 4    MLZ L CM    1 
HETATM 4040 C C     . MLZ D 2 4   ? 8.659   34.819  18.160  1.00 19.26 ? 4    MLZ L C     1 
HETATM 4041 O O     . MLZ D 2 4   ? 9.223   35.860  17.894  1.00 18.53 ? 4    MLZ L O     1 
ATOM   4042 N N     . GLN D 2 5   ? 8.812   33.163  17.588  1.00 35.50 ? 5    GLN L N     1 
ATOM   4043 C CA    . GLN D 2 5   ? 10.255  33.105  17.239  1.00 35.70 ? 5    GLN L CA    1 
ATOM   4044 C C     . GLN D 2 5   ? 10.485  32.094  16.135  1.00 35.78 ? 5    GLN L C     1 
ATOM   4045 O O     . GLN D 2 5   ? 9.811   31.063  16.077  1.00 35.79 ? 5    GLN L O     1 
ATOM   4046 C CB    . GLN D 2 5   ? 11.094  32.740  18.474  1.00 35.78 ? 5    GLN L CB    1 
ATOM   4047 C CG    . GLN D 2 5   ? 10.282  32.445  19.723  1.00 36.16 ? 5    GLN L CG    1 
ATOM   4048 C CD    . GLN D 2 5   ? 10.389  33.544  20.754  1.00 37.17 ? 5    GLN L CD    1 
ATOM   4049 O OE1   . GLN D 2 5   ? 11.083  34.539  20.538  1.00 38.87 ? 5    GLN L OE1   1 
ATOM   4050 N NE2   . GLN D 2 5   ? 9.718   33.365  21.888  1.00 37.35 ? 5    GLN L NE2   1 
ATOM   4051 N N     . THR D 2 6   ? 11.299  32.489  15.165  1.00 35.86 ? 6    THR L N     1 
ATOM   4052 C CA    . THR D 2 6   ? 11.848  31.618  14.149  1.00 35.88 ? 6    THR L CA    1 
ATOM   4053 C C     . THR D 2 6   ? 13.025  30.776  14.641  1.00 35.87 ? 6    THR L C     1 
ATOM   4054 O O     . THR D 2 6   ? 13.048  29.557  14.447  1.00 35.87 ? 6    THR L O     1 
ATOM   4055 C CB    . THR D 2 6   ? 12.295  32.509  12.994  1.00 35.95 ? 6    THR L CB    1 
ATOM   4056 O OG1   . THR D 2 6   ? 11.755  33.831  13.167  1.00 36.37 ? 6    THR L OG1   1 
ATOM   4057 C CG2   . THR D 2 6   ? 11.693  32.057  11.691  1.00 35.82 ? 6    THR L CG2   1 
HETATM 4058 N N     . SAH E 3 .   ? 9.794   -0.121  45.501  1.00 41.18 ? 1367 SAH A N     1 
HETATM 4059 C CA    . SAH E 3 .   ? 9.219   0.183   44.185  1.00 41.19 ? 1367 SAH A CA    1 
HETATM 4060 C CB    . SAH E 3 .   ? 10.235  0.369   43.049  1.00 40.73 ? 1367 SAH A CB    1 
HETATM 4061 C CG    . SAH E 3 .   ? 10.669  1.774   42.642  1.00 40.21 ? 1367 SAH A CG    1 
HETATM 4062 S SD    . SAH E 3 .   ? 9.362   2.829   41.941  1.00 40.07 ? 1367 SAH A SD    1 
HETATM 4063 C C     . SAH E 3 .   ? 8.314   -0.968  43.757  1.00 41.24 ? 1367 SAH A C     1 
HETATM 4064 O O     . SAH E 3 .   ? 8.297   -2.058  44.325  1.00 40.90 ? 1367 SAH A O     1 
HETATM 4065 C "C5'" . SAH E 3 .   ? 9.401   4.162   43.144  1.00 39.88 ? 1367 SAH A "C5'" 1 
HETATM 4066 C "C4'" . SAH E 3 .   ? 8.664   3.778   44.420  1.00 40.55 ? 1367 SAH A "C4'" 1 
HETATM 4067 O "O4'" . SAH E 3 .   ? 9.530   2.983   45.238  1.00 40.00 ? 1367 SAH A "O4'" 1 
HETATM 4068 C "C3'" . SAH E 3 .   ? 8.191   4.947   45.270  1.00 41.32 ? 1367 SAH A "C3'" 1 
HETATM 4069 O "O3'" . SAH E 3 .   ? 6.840   5.321   45.046  1.00 41.73 ? 1367 SAH A "O3'" 1 
HETATM 4070 C "C2'" . SAH E 3 .   ? 8.352   4.430   46.689  1.00 40.93 ? 1367 SAH A "C2'" 1 
HETATM 4071 O "O2'" . SAH E 3 .   ? 7.161   3.829   47.167  1.00 41.07 ? 1367 SAH A "O2'" 1 
HETATM 4072 C "C1'" . SAH E 3 .   ? 9.449   3.389   46.590  1.00 40.22 ? 1367 SAH A "C1'" 1 
HETATM 4073 N N9    . SAH E 3 .   ? 10.788  3.906   46.999  1.00 40.52 ? 1367 SAH A N9    1 
HETATM 4074 C C8    . SAH E 3 .   ? 11.866  4.115   46.184  1.00 40.63 ? 1367 SAH A C8    1 
HETATM 4075 N N7    . SAH E 3 .   ? 12.911  4.552   46.930  1.00 40.77 ? 1367 SAH A N7    1 
HETATM 4076 C C5    . SAH E 3 .   ? 12.513  4.611   48.221  1.00 40.71 ? 1367 SAH A C5    1 
HETATM 4077 C C6    . SAH E 3 .   ? 13.174  4.980   49.395  1.00 41.16 ? 1367 SAH A C6    1 
HETATM 4078 N N6    . SAH E 3 .   ? 14.445  5.380   49.372  1.00 40.82 ? 1367 SAH A N6    1 
HETATM 4079 N N1    . SAH E 3 .   ? 12.490  4.933   50.576  1.00 39.76 ? 1367 SAH A N1    1 
HETATM 4080 C C2    . SAH E 3 .   ? 11.180  4.520   50.620  1.00 41.78 ? 1367 SAH A C2    1 
HETATM 4081 N N3    . SAH E 3 .   ? 10.520  4.152   49.451  1.00 40.16 ? 1367 SAH A N3    1 
HETATM 4082 C C4    . SAH E 3 .   ? 11.186  4.199   48.278  1.00 40.49 ? 1367 SAH A C4    1 
HETATM 4083 N N     . SAH F 3 .   ? -6.671  36.612  15.991  1.00 39.04 ? 1367 SAH B N     1 
HETATM 4084 C CA    . SAH F 3 .   ? -5.912  37.843  15.844  1.00 38.93 ? 1367 SAH B CA    1 
HETATM 4085 C CB    . SAH F 3 .   ? -4.809  37.615  14.831  1.00 38.49 ? 1367 SAH B CB    1 
HETATM 4086 C CG    . SAH F 3 .   ? -3.626  36.848  15.429  1.00 38.09 ? 1367 SAH B CG    1 
HETATM 4087 S SD    . SAH F 3 .   ? -2.777  37.976  16.576  1.00 39.35 ? 1367 SAH B SD    1 
HETATM 4088 C C     . SAH F 3 .   ? -6.780  39.039  15.448  1.00 39.32 ? 1367 SAH B C     1 
HETATM 4089 O O     . SAH F 3 .   ? -8.008  38.867  15.483  1.00 40.25 ? 1367 SAH B O     1 
HETATM 4090 C "C5'" . SAH F 3 .   ? -2.579  36.770  17.929  1.00 39.96 ? 1367 SAH B "C5'" 1 
HETATM 4091 C "C4'" . SAH F 3 .   ? -3.810  36.720  18.826  1.00 40.31 ? 1367 SAH B "C4'" 1 
HETATM 4092 O "O4'" . SAH F 3 .   ? -4.776  35.903  18.165  1.00 39.57 ? 1367 SAH B "O4'" 1 
HETATM 4093 C "C3'" . SAH F 3 .   ? -3.636  36.135  20.233  1.00 41.09 ? 1367 SAH B "C3'" 1 
HETATM 4094 O "O3'" . SAH F 3 .   ? -3.496  37.142  21.215  1.00 43.16 ? 1367 SAH B "O3'" 1 
HETATM 4095 C "C2'" . SAH F 3 .   ? -4.901  35.326  20.430  1.00 40.69 ? 1367 SAH B "C2'" 1 
HETATM 4096 O "O2'" . SAH F 3 .   ? -5.949  36.070  21.002  1.00 42.23 ? 1367 SAH B "O2'" 1 
HETATM 4097 C "C1'" . SAH F 3 .   ? -5.340  34.955  19.030  1.00 39.16 ? 1367 SAH B "C1'" 1 
HETATM 4098 N N9    . SAH F 3 .   ? -4.954  33.595  18.632  1.00 37.20 ? 1367 SAH B N9    1 
HETATM 4099 C C8    . SAH F 3 .   ? -4.002  33.265  17.707  1.00 36.60 ? 1367 SAH B C8    1 
HETATM 4100 N N7    . SAH F 3 .   ? -3.969  31.931  17.585  1.00 37.21 ? 1367 SAH B N7    1 
HETATM 4101 C C5    . SAH F 3 .   ? -4.889  31.405  18.411  1.00 37.56 ? 1367 SAH B C5    1 
HETATM 4102 C C6    . SAH F 3 .   ? -5.261  30.098  18.668  1.00 38.29 ? 1367 SAH B C6    1 
HETATM 4103 N N6    . SAH F 3 .   ? -4.686  29.076  18.059  1.00 40.94 ? 1367 SAH B N6    1 
HETATM 4104 N N1    . SAH F 3 .   ? -6.244  29.839  19.576  1.00 38.98 ? 1367 SAH B N1    1 
HETATM 4105 C C2    . SAH F 3 .   ? -6.868  30.874  20.225  1.00 38.04 ? 1367 SAH B C2    1 
HETATM 4106 N N3    . SAH F 3 .   ? -6.500  32.170  19.981  1.00 37.61 ? 1367 SAH B N3    1 
HETATM 4107 C C4    . SAH F 3 .   ? -5.521  32.435  19.066  1.00 37.37 ? 1367 SAH B C4    1 
HETATM 4108 O O     . HOH G 4 .   ? 34.320  -3.341  4.161   1.00 42.50 ? 2001 HOH A O     1 
HETATM 4109 O O     . HOH G 4 .   ? 30.643  1.494   4.439   1.00 30.28 ? 2002 HOH A O     1 
HETATM 4110 O O     . HOH G 4 .   ? 29.278  -3.135  -0.147  1.00 32.95 ? 2003 HOH A O     1 
HETATM 4111 O O     . HOH G 4 .   ? 34.906  -1.859  15.819  1.00 39.44 ? 2004 HOH A O     1 
HETATM 4112 O O     . HOH G 4 .   ? 18.775  1.671   17.511  1.00 33.02 ? 2005 HOH A O     1 
HETATM 4113 O O     . HOH G 4 .   ? 30.058  6.494   21.057  1.00 33.77 ? 2006 HOH A O     1 
HETATM 4114 O O     . HOH G 4 .   ? 19.153  4.826   15.215  1.00 42.93 ? 2007 HOH A O     1 
HETATM 4115 O O     . HOH G 4 .   ? 27.905  9.147   27.472  1.00 43.91 ? 2008 HOH A O     1 
HETATM 4116 O O     . HOH G 4 .   ? 29.018  5.719   27.209  1.00 29.38 ? 2009 HOH A O     1 
HETATM 4117 O O     . HOH G 4 .   ? 22.904  7.534   23.788  1.00 23.19 ? 2010 HOH A O     1 
HETATM 4118 O O     . HOH G 4 .   ? 24.436  8.656   25.898  1.00 25.92 ? 2011 HOH A O     1 
HETATM 4119 O O     . HOH G 4 .   ? 28.490  2.141   27.717  1.00 18.45 ? 2012 HOH A O     1 
HETATM 4120 O O     . HOH G 4 .   ? 28.475  -1.634  20.828  1.00 22.71 ? 2013 HOH A O     1 
HETATM 4121 O O     . HOH G 4 .   ? 30.301  -2.820  19.152  1.00 43.41 ? 2014 HOH A O     1 
HETATM 4122 O O     . HOH G 4 .   ? 26.236  -6.857  10.865  1.00 18.76 ? 2015 HOH A O     1 
HETATM 4123 O O     . HOH G 4 .   ? 23.651  -5.948  1.774   1.00 42.31 ? 2016 HOH A O     1 
HETATM 4124 O O     . HOH G 4 .   ? 30.346  -4.044  -2.205  1.00 44.74 ? 2017 HOH A O     1 
HETATM 4125 O O     . HOH G 4 .   ? 21.861  -2.152  -2.355  1.00 31.18 ? 2018 HOH A O     1 
HETATM 4126 O O     . HOH G 4 .   ? 19.307  -2.572  -2.436  1.00 41.87 ? 2019 HOH A O     1 
HETATM 4127 O O     . HOH G 4 .   ? 15.944  -0.790  0.024   1.00 29.51 ? 2020 HOH A O     1 
HETATM 4128 O O     . HOH G 4 .   ? 17.741  0.335   -4.507  1.00 34.84 ? 2021 HOH A O     1 
HETATM 4129 O O     . HOH G 4 .   ? 17.787  3.301   -0.781  1.00 31.66 ? 2022 HOH A O     1 
HETATM 4130 O O     . HOH G 4 .   ? 20.572  3.512   7.716   1.00 41.01 ? 2023 HOH A O     1 
HETATM 4131 O O     . HOH G 4 .   ? 16.422  1.301   3.006   1.00 29.53 ? 2024 HOH A O     1 
HETATM 4132 O O     . HOH G 4 .   ? 19.489  -4.783  1.131   1.00 44.80 ? 2025 HOH A O     1 
HETATM 4133 O O     . HOH G 4 .   ? 22.950  -4.739  3.918   1.00 23.74 ? 2026 HOH A O     1 
HETATM 4134 O O     . HOH G 4 .   ? 20.985  -8.487  2.966   1.00 26.05 ? 2027 HOH A O     1 
HETATM 4135 O O     . HOH G 4 .   ? 17.596  -11.684 8.089   1.00 32.96 ? 2028 HOH A O     1 
HETATM 4136 O O     . HOH G 4 .   ? 22.961  -6.967  5.554   1.00 24.31 ? 2029 HOH A O     1 
HETATM 4137 O O     . HOH G 4 .   ? 26.026  -6.892  6.926   1.00 25.75 ? 2030 HOH A O     1 
HETATM 4138 O O     . HOH G 4 .   ? 27.941  -13.104 6.241   1.00 44.92 ? 2031 HOH A O     1 
HETATM 4139 O O     . HOH G 4 .   ? 22.580  1.950   22.124  1.00 18.59 ? 2032 HOH A O     1 
HETATM 4140 O O     . HOH G 4 .   ? 16.216  -6.858  22.714  1.00 41.85 ? 2033 HOH A O     1 
HETATM 4141 O O     . HOH G 4 .   ? 35.820  -0.547  24.201  1.00 33.36 ? 2034 HOH A O     1 
HETATM 4142 O O     . HOH G 4 .   ? 35.633  -0.392  21.053  1.00 35.16 ? 2035 HOH A O     1 
HETATM 4143 O O     . HOH G 4 .   ? 27.766  -15.603 25.125  1.00 46.74 ? 2036 HOH A O     1 
HETATM 4144 O O     . HOH G 4 .   ? 30.779  -17.534 27.724  1.00 40.95 ? 2037 HOH A O     1 
HETATM 4145 O O     . HOH G 4 .   ? 30.677  -17.613 25.186  1.00 21.97 ? 2038 HOH A O     1 
HETATM 4146 O O     . HOH G 4 .   ? 19.035  -13.591 11.919  1.00 46.16 ? 2039 HOH A O     1 
HETATM 4147 O O     . HOH G 4 .   ? 15.807  -5.381  5.082   1.00 27.74 ? 2040 HOH A O     1 
HETATM 4148 O O     . HOH G 4 .   ? 32.179  -5.341  -2.174  1.00 33.67 ? 2041 HOH A O     1 
HETATM 4149 O O     . HOH G 4 .   ? 12.827  1.695   8.406   1.00 36.59 ? 2042 HOH A O     1 
HETATM 4150 O O     . HOH G 4 .   ? 15.815  7.841   9.275   1.00 47.61 ? 2043 HOH A O     1 
HETATM 4151 O O     . HOH G 4 .   ? 21.690  9.663   22.740  1.00 25.53 ? 2044 HOH A O     1 
HETATM 4152 O O     . HOH G 4 .   ? 18.181  -0.253  15.579  1.00 21.12 ? 2045 HOH A O     1 
HETATM 4153 O O     . HOH G 4 .   ? 17.488  3.357   14.141  1.00 26.78 ? 2046 HOH A O     1 
HETATM 4154 O O     . HOH G 4 .   ? 9.892   -2.770  13.301  1.00 27.80 ? 2047 HOH A O     1 
HETATM 4155 O O     . HOH G 4 .   ? 15.682  1.557   -0.707  1.00 31.76 ? 2048 HOH A O     1 
HETATM 4156 O O     . HOH G 4 .   ? 10.673  -9.617  14.060  1.00 50.59 ? 2049 HOH A O     1 
HETATM 4157 O O     . HOH G 4 .   ? 8.910   -6.437  12.670  1.00 30.69 ? 2050 HOH A O     1 
HETATM 4158 O O     . HOH G 4 .   ? 16.656  -12.315 10.416  1.00 37.37 ? 2051 HOH A O     1 
HETATM 4159 O O     . HOH G 4 .   ? 20.887  4.991   10.622  1.00 54.51 ? 2052 HOH A O     1 
HETATM 4160 O O     . HOH G 4 .   ? 24.728  -12.961 23.534  1.00 27.08 ? 2053 HOH A O     1 
HETATM 4161 O O     . HOH G 4 .   ? 25.459  -15.840 26.294  1.00 46.52 ? 2054 HOH A O     1 
HETATM 4162 O O     . HOH G 4 .   ? 34.873  -7.593  17.785  1.00 40.49 ? 2055 HOH A O     1 
HETATM 4163 O O     . HOH G 4 .   ? 15.384  2.497   15.593  1.00 22.95 ? 2056 HOH A O     1 
HETATM 4164 O O     . HOH G 4 .   ? 21.596  10.362  20.346  1.00 47.96 ? 2057 HOH A O     1 
HETATM 4165 O O     . HOH G 4 .   ? 23.113  11.796  24.095  1.00 38.72 ? 2058 HOH A O     1 
HETATM 4166 O O     . HOH G 4 .   ? 36.567  -9.699  6.816   1.00 46.85 ? 2059 HOH A O     1 
HETATM 4167 O O     . HOH G 4 .   ? 38.204  -13.198 7.963   1.00 42.07 ? 2060 HOH A O     1 
HETATM 4168 O O     . HOH G 4 .   ? 8.624   -8.879  10.286  1.00 36.97 ? 2061 HOH A O     1 
HETATM 4169 O O     . HOH G 4 .   ? 36.634  -4.837  5.130   1.00 38.58 ? 2062 HOH A O     1 
HETATM 4170 O O     . HOH G 4 .   ? 23.242  -14.986 25.110  1.00 38.55 ? 2063 HOH A O     1 
HETATM 4171 O O     . HOH G 4 .   ? 13.638  3.985   14.343  1.00 34.63 ? 2064 HOH A O     1 
HETATM 4172 O O     . HOH G 4 .   ? 28.448  -13.692 11.301  1.00 28.64 ? 2065 HOH A O     1 
HETATM 4173 O O     . HOH G 4 .   ? 28.231  -17.338 23.575  1.00 30.20 ? 2066 HOH A O     1 
HETATM 4174 O O     . HOH G 4 .   ? 27.784  -20.024 20.427  1.00 24.72 ? 2067 HOH A O     1 
HETATM 4175 O O     . HOH G 4 .   ? 17.210  -16.128 25.262  1.00 38.25 ? 2068 HOH A O     1 
HETATM 4176 O O     . HOH G 4 .   ? 21.794  -17.648 24.629  1.00 37.66 ? 2069 HOH A O     1 
HETATM 4177 O O     . HOH G 4 .   ? 22.722  -21.681 18.321  1.00 31.81 ? 2070 HOH A O     1 
HETATM 4178 O O     . HOH G 4 .   ? 18.997  -16.377 18.712  1.00 28.62 ? 2071 HOH A O     1 
HETATM 4179 O O     . HOH G 4 .   ? 17.519  -16.883 21.132  1.00 43.09 ? 2072 HOH A O     1 
HETATM 4180 O O     . HOH G 4 .   ? 19.708  -17.981 24.073  1.00 38.97 ? 2073 HOH A O     1 
HETATM 4181 O O     . HOH G 4 .   ? 1.648   -1.333  19.693  1.00 37.22 ? 2074 HOH A O     1 
HETATM 4182 O O     . HOH G 4 .   ? 2.744   -0.570  17.664  1.00 38.19 ? 2075 HOH A O     1 
HETATM 4183 O O     . HOH G 4 .   ? 7.180   3.781   15.650  1.00 40.96 ? 2076 HOH A O     1 
HETATM 4184 O O     . HOH G 4 .   ? 12.161  4.840   59.120  1.00 39.76 ? 2077 HOH A O     1 
HETATM 4185 O O     . HOH G 4 .   ? 12.769  -21.352 21.094  1.00 36.40 ? 2078 HOH A O     1 
HETATM 4186 O O     . HOH G 4 .   ? 13.156  -23.519 16.231  1.00 43.53 ? 2079 HOH A O     1 
HETATM 4187 O O     . HOH G 4 .   ? 12.693  -17.858 16.095  1.00 42.90 ? 2080 HOH A O     1 
HETATM 4188 O O     . HOH G 4 .   ? 13.350  -14.355 25.403  1.00 39.06 ? 2081 HOH A O     1 
HETATM 4189 O O     . HOH G 4 .   ? 16.356  -16.257 17.280  1.00 40.89 ? 2082 HOH A O     1 
HETATM 4190 O O     . HOH G 4 .   ? 15.565  -15.848 23.127  1.00 25.51 ? 2083 HOH A O     1 
HETATM 4191 O O     . HOH G 4 .   ? 11.205  11.811  63.452  1.00 41.80 ? 2084 HOH A O     1 
HETATM 4192 O O     . HOH G 4 .   ? 9.328   -10.122 19.554  1.00 35.68 ? 2085 HOH A O     1 
HETATM 4193 O O     . HOH G 4 .   ? 0.389   -6.401  27.939  1.00 41.73 ? 2086 HOH A O     1 
HETATM 4194 O O     . HOH G 4 .   ? 14.547  -12.185 26.020  1.00 21.64 ? 2087 HOH A O     1 
HETATM 4195 O O     . HOH G 4 .   ? -8.918  17.773  47.644  1.00 34.54 ? 2088 HOH A O     1 
HETATM 4196 O O     . HOH G 4 .   ? -8.838  10.722  38.008  1.00 37.74 ? 2089 HOH A O     1 
HETATM 4197 O O     . HOH G 4 .   ? 10.681  -6.674  20.355  1.00 25.69 ? 2090 HOH A O     1 
HETATM 4198 O O     . HOH G 4 .   ? 18.225  -14.219 26.986  1.00 34.61 ? 2091 HOH A O     1 
HETATM 4199 O O     . HOH G 4 .   ? 15.047  -9.417  32.798  1.00 27.09 ? 2092 HOH A O     1 
HETATM 4200 O O     . HOH G 4 .   ? 21.720  -14.743 33.284  1.00 41.95 ? 2093 HOH A O     1 
HETATM 4201 O O     . HOH G 4 .   ? 11.755  -11.832 33.606  1.00 39.09 ? 2094 HOH A O     1 
HETATM 4202 O O     . HOH G 4 .   ? 7.535   -1.015  15.069  1.00 38.82 ? 2095 HOH A O     1 
HETATM 4203 O O     . HOH G 4 .   ? 24.083  -14.746 36.821  1.00 41.82 ? 2096 HOH A O     1 
HETATM 4204 O O     . HOH G 4 .   ? -3.446  -4.356  26.603  1.00 39.90 ? 2097 HOH A O     1 
HETATM 4205 O O     . HOH G 4 .   ? 4.099   -1.023  21.118  1.00 30.40 ? 2098 HOH A O     1 
HETATM 4206 O O     . HOH G 4 .   ? 5.187   -2.655  17.255  1.00 45.97 ? 2099 HOH A O     1 
HETATM 4207 O O     . HOH G 4 .   ? 13.677  -11.966 38.433  1.00 44.20 ? 2100 HOH A O     1 
HETATM 4208 O O     . HOH G 4 .   ? 4.866   1.248   18.144  1.00 27.71 ? 2101 HOH A O     1 
HETATM 4209 O O     . HOH G 4 .   ? 8.977   8.006   16.835  1.00 40.69 ? 2102 HOH A O     1 
HETATM 4210 O O     . HOH G 4 .   ? 7.211   1.051   16.871  1.00 27.72 ? 2103 HOH A O     1 
HETATM 4211 O O     . HOH G 4 .   ? 20.820  14.906  42.522  1.00 36.94 ? 2104 HOH A O     1 
HETATM 4212 O O     . HOH G 4 .   ? 23.934  16.761  44.446  1.00 38.43 ? 2105 HOH A O     1 
HETATM 4213 O O     . HOH G 4 .   ? 4.297   5.465   19.614  1.00 32.70 ? 2106 HOH A O     1 
HETATM 4214 O O     . HOH G 4 .   ? 6.128   6.283   22.404  1.00 36.29 ? 2107 HOH A O     1 
HETATM 4215 O O     . HOH G 4 .   ? 15.552  3.584   55.842  1.00 43.21 ? 2108 HOH A O     1 
HETATM 4216 O O     . HOH G 4 .   ? 11.282  3.822   56.787  1.00 31.90 ? 2109 HOH A O     1 
HETATM 4217 O O     . HOH G 4 .   ? -0.526  0.289   19.744  1.00 32.83 ? 2110 HOH A O     1 
HETATM 4218 O O     . HOH G 4 .   ? 5.209   -11.373 40.191  1.00 43.29 ? 2111 HOH A O     1 
HETATM 4219 O O     . HOH G 4 .   ? 9.957   -10.794 40.812  1.00 47.85 ? 2112 HOH A O     1 
HETATM 4220 O O     . HOH G 4 .   ? -3.795  1.728   28.085  1.00 49.74 ? 2113 HOH A O     1 
HETATM 4221 O O     . HOH G 4 .   ? 16.339  13.497  24.487  1.00 34.03 ? 2114 HOH A O     1 
HETATM 4222 O O     . HOH G 4 .   ? 19.302  13.077  23.632  1.00 49.09 ? 2115 HOH A O     1 
HETATM 4223 O O     . HOH G 4 .   ? 20.539  -14.280 40.261  1.00 38.78 ? 2116 HOH A O     1 
HETATM 4224 O O     . HOH G 4 .   ? 7.869   -0.758  24.208  1.00 18.06 ? 2117 HOH A O     1 
HETATM 4225 O O     . HOH G 4 .   ? 8.552   -3.497  23.534  1.00 20.64 ? 2118 HOH A O     1 
HETATM 4226 O O     . HOH G 4 .   ? 8.030   -6.235  22.247  1.00 25.39 ? 2119 HOH A O     1 
HETATM 4227 O O     . HOH G 4 .   ? 6.564   -12.057 23.075  1.00 40.92 ? 2120 HOH A O     1 
HETATM 4228 O O     . HOH G 4 .   ? 5.006   -10.395 19.057  1.00 49.15 ? 2121 HOH A O     1 
HETATM 4229 O O     . HOH G 4 .   ? 10.663  10.075  61.901  1.00 41.47 ? 2122 HOH A O     1 
HETATM 4230 O O     . HOH G 4 .   ? 2.070   -7.733  25.699  1.00 23.76 ? 2123 HOH A O     1 
HETATM 4231 O O     . HOH G 4 .   ? 5.003   -10.889 25.976  1.00 35.05 ? 2124 HOH A O     1 
HETATM 4232 O O     . HOH G 4 .   ? 9.058   -14.423 27.005  1.00 38.92 ? 2125 HOH A O     1 
HETATM 4233 O O     . HOH G 4 .   ? 8.171   -13.442 31.160  1.00 31.96 ? 2126 HOH A O     1 
HETATM 4234 O O     . HOH G 4 .   ? -2.580  20.805  32.429  1.00 34.99 ? 2127 HOH A O     1 
HETATM 4235 O O     . HOH G 4 .   ? -0.451  7.254   30.152  1.00 28.53 ? 2128 HOH A O     1 
HETATM 4236 O O     . HOH G 4 .   ? 1.326   22.795  38.052  1.00 43.44 ? 2129 HOH A O     1 
HETATM 4237 O O     . HOH G 4 .   ? 14.794  -5.956  24.475  1.00 17.05 ? 2130 HOH A O     1 
HETATM 4238 O O     . HOH G 4 .   ? -6.863  13.634  46.573  1.00 40.18 ? 2131 HOH A O     1 
HETATM 4239 O O     . HOH G 4 .   ? -4.815  16.563  46.830  1.00 46.39 ? 2132 HOH A O     1 
HETATM 4240 O O     . HOH G 4 .   ? -7.088  15.936  45.416  1.00 43.93 ? 2133 HOH A O     1 
HETATM 4241 O O     . HOH G 4 .   ? -5.864  11.689  37.556  1.00 22.50 ? 2134 HOH A O     1 
HETATM 4242 O O     . HOH G 4 .   ? 1.136   14.478  48.004  1.00 37.40 ? 2135 HOH A O     1 
HETATM 4243 O O     . HOH G 4 .   ? 20.203  -13.076 28.393  1.00 30.36 ? 2136 HOH A O     1 
HETATM 4244 O O     . HOH G 4 .   ? 28.456  -3.118  29.052  1.00 20.69 ? 2137 HOH A O     1 
HETATM 4245 O O     . HOH G 4 .   ? 15.092  -12.956 32.132  1.00 38.33 ? 2138 HOH A O     1 
HETATM 4246 O O     . HOH G 4 .   ? 19.645  -14.162 31.075  1.00 46.74 ? 2139 HOH A O     1 
HETATM 4247 O O     . HOH G 4 .   ? 15.288  -14.007 29.966  1.00 35.47 ? 2140 HOH A O     1 
HETATM 4248 O O     . HOH G 4 .   ? 16.526  -12.651 27.982  1.00 29.50 ? 2141 HOH A O     1 
HETATM 4249 O O     . HOH G 4 .   ? 24.089  -13.615 34.482  1.00 28.11 ? 2142 HOH A O     1 
HETATM 4250 O O     . HOH G 4 .   ? 2.659   1.533   43.614  1.00 40.76 ? 2143 HOH A O     1 
HETATM 4251 O O     . HOH G 4 .   ? -5.582  -2.984  28.763  1.00 51.28 ? 2144 HOH A O     1 
HETATM 4252 O O     . HOH G 4 .   ? 15.956  -10.026 35.206  1.00 20.05 ? 2145 HOH A O     1 
HETATM 4253 O O     . HOH G 4 .   ? 3.940   -1.341  44.106  1.00 27.11 ? 2146 HOH A O     1 
HETATM 4254 O O     . HOH G 4 .   ? 0.222   -13.747 35.262  1.00 37.37 ? 2147 HOH A O     1 
HETATM 4255 O O     . HOH G 4 .   ? 4.570   -14.945 33.018  1.00 53.74 ? 2148 HOH A O     1 
HETATM 4256 O O     . HOH G 4 .   ? 14.249  -9.991  37.429  1.00 35.41 ? 2149 HOH A O     1 
HETATM 4257 O O     . HOH G 4 .   ? 14.259  -12.476 43.342  1.00 39.30 ? 2150 HOH A O     1 
HETATM 4258 O O     . HOH G 4 .   ? 12.975  -11.136 47.432  1.00 27.39 ? 2151 HOH A O     1 
HETATM 4259 O O     . HOH G 4 .   ? 16.348  -8.862  48.829  1.00 30.96 ? 2152 HOH A O     1 
HETATM 4260 O O     . HOH G 4 .   ? 15.090  -6.906  52.296  1.00 39.28 ? 2153 HOH A O     1 
HETATM 4261 O O     . HOH G 4 .   ? 20.182  2.714   50.092  1.00 34.73 ? 2154 HOH A O     1 
HETATM 4262 O O     . HOH G 4 .   ? 15.258  -3.667  55.305  1.00 43.12 ? 2155 HOH A O     1 
HETATM 4263 O O     . HOH G 4 .   ? 23.449  14.749  48.896  1.00 36.61 ? 2156 HOH A O     1 
HETATM 4264 O O     . HOH G 4 .   ? 19.950  14.215  44.970  1.00 39.77 ? 2157 HOH A O     1 
HETATM 4265 O O     . HOH G 4 .   ? 23.822  12.206  43.664  1.00 28.72 ? 2158 HOH A O     1 
HETATM 4266 O O     . HOH G 4 .   ? 23.027  15.541  46.463  1.00 34.31 ? 2159 HOH A O     1 
HETATM 4267 O O     . HOH G 4 .   ? 22.965  7.645   54.231  1.00 28.25 ? 2160 HOH A O     1 
HETATM 4268 O O     . HOH G 4 .   ? 26.145  10.744  43.839  1.00 37.70 ? 2161 HOH A O     1 
HETATM 4269 O O     . HOH G 4 .   ? 16.680  1.191   55.208  1.00 26.49 ? 2162 HOH A O     1 
HETATM 4270 O O     . HOH G 4 .   ? 12.934  3.504   54.622  1.00 26.19 ? 2163 HOH A O     1 
HETATM 4271 O O     . HOH G 4 .   ? 10.216  1.070   57.613  1.00 22.43 ? 2164 HOH A O     1 
HETATM 4272 O O     . HOH G 4 .   ? 23.548  11.136  41.312  1.00 21.88 ? 2165 HOH A O     1 
HETATM 4273 O O     . HOH G 4 .   ? 6.854   0.636   49.486  1.00 18.91 ? 2166 HOH A O     1 
HETATM 4274 O O     . HOH G 4 .   ? 7.332   2.945   52.510  1.00 27.76 ? 2167 HOH A O     1 
HETATM 4275 O O     . HOH G 4 .   ? 26.795  11.895  32.886  1.00 46.40 ? 2168 HOH A O     1 
HETATM 4276 O O     . HOH G 4 .   ? 8.982   -3.361  51.573  1.00 22.54 ? 2169 HOH A O     1 
HETATM 4277 O O     . HOH G 4 .   ? 6.430   -6.767  40.552  1.00 19.25 ? 2170 HOH A O     1 
HETATM 4278 O O     . HOH G 4 .   ? 10.252  -9.832  44.730  1.00 28.99 ? 2171 HOH A O     1 
HETATM 4279 O O     . HOH G 4 .   ? 7.223   -9.657  41.924  1.00 38.82 ? 2172 HOH A O     1 
HETATM 4280 O O     . HOH G 4 .   ? 13.507  6.168   17.067  1.00 33.98 ? 2173 HOH A O     1 
HETATM 4281 O O     . HOH G 4 .   ? 17.247  7.817   18.281  1.00 41.26 ? 2174 HOH A O     1 
HETATM 4282 O O     . HOH G 4 .   ? 15.468  11.339  23.838  1.00 40.53 ? 2175 HOH A O     1 
HETATM 4283 O O     . HOH G 4 .   ? 18.926  9.829   23.123  1.00 39.20 ? 2176 HOH A O     1 
HETATM 4284 O O     . HOH G 4 .   ? 28.618  9.406   35.841  1.00 50.16 ? 2177 HOH A O     1 
HETATM 4285 O O     . HOH G 4 .   ? 27.445  -13.202 39.408  1.00 30.51 ? 2178 HOH A O     1 
HETATM 4286 O O     . HOH G 4 .   ? 16.137  -12.813 36.003  1.00 43.84 ? 2179 HOH A O     1 
HETATM 4287 O O     . HOH G 4 .   ? 19.999  -10.216 50.940  1.00 36.97 ? 2180 HOH A O     1 
HETATM 4288 O O     . HOH G 4 .   ? 23.700  -15.358 41.649  1.00 36.45 ? 2181 HOH A O     1 
HETATM 4289 O O     . HOH G 4 .   ? 29.797  -11.567 38.495  1.00 35.54 ? 2182 HOH A O     1 
HETATM 4290 O O     . HOH G 4 .   ? 32.168  -9.522  36.161  1.00 32.87 ? 2183 HOH A O     1 
HETATM 4291 O O     . HOH G 4 .   ? 32.963  -4.854  40.769  1.00 27.24 ? 2184 HOH A O     1 
HETATM 4292 O O     . HOH G 4 .   ? 32.025  -3.457  34.016  1.00 26.38 ? 2185 HOH A O     1 
HETATM 4293 O O     . HOH G 4 .   ? 34.953  3.420   32.546  1.00 41.43 ? 2186 HOH A O     1 
HETATM 4294 O O     . HOH G 4 .   ? 29.331  6.726   29.321  1.00 34.41 ? 2187 HOH A O     1 
HETATM 4295 O O     . HOH G 4 .   ? 31.578  5.918   34.470  1.00 32.43 ? 2188 HOH A O     1 
HETATM 4296 O O     . HOH G 4 .   ? 31.831  -0.830  31.793  1.00 34.32 ? 2189 HOH A O     1 
HETATM 4297 O O     . HOH G 4 .   ? 28.031  -0.101  29.502  1.00 16.96 ? 2190 HOH A O     1 
HETATM 4298 O O     . HOH G 4 .   ? 1.932   17.644  52.030  1.00 28.83 ? 2191 HOH A O     1 
HETATM 4299 O O     . HOH G 4 .   ? 9.816   6.782   56.047  1.00 26.42 ? 2192 HOH A O     1 
HETATM 4300 O O     . HOH G 4 .   ? 13.679  7.868   55.688  1.00 38.98 ? 2193 HOH A O     1 
HETATM 4301 O O     . HOH G 4 .   ? 12.391  9.886   59.735  1.00 29.86 ? 2194 HOH A O     1 
HETATM 4302 O O     . HOH G 4 .   ? 18.289  5.570   54.174  1.00 46.17 ? 2195 HOH A O     1 
HETATM 4303 O O     . HOH G 4 .   ? 9.179   2.904   23.878  1.00 16.45 ? 2196 HOH A O     1 
HETATM 4304 O O     . HOH G 4 .   ? -0.695  18.079  28.532  1.00 22.16 ? 2197 HOH A O     1 
HETATM 4305 O O     . HOH G 4 .   ? -0.297  20.910  34.383  1.00 34.71 ? 2198 HOH A O     1 
HETATM 4306 O O     . HOH G 4 .   ? 5.834   21.803  32.328  1.00 33.72 ? 2199 HOH A O     1 
HETATM 4307 O O     . HOH G 4 .   ? 0.413   13.757  28.527  1.00 22.04 ? 2200 HOH A O     1 
HETATM 4308 O O     . HOH G 4 .   ? -2.013  18.838  31.013  1.00 33.39 ? 2201 HOH A O     1 
HETATM 4309 O O     . HOH G 4 .   ? -2.229  8.841   30.465  1.00 35.40 ? 2202 HOH A O     1 
HETATM 4310 O O     . HOH G 4 .   ? 6.296   16.235  34.902  1.00 48.67 ? 2203 HOH A O     1 
HETATM 4311 O O     . HOH G 4 .   ? 1.716   20.560  40.062  1.00 37.94 ? 2204 HOH A O     1 
HETATM 4312 O O     . HOH G 4 .   ? -3.425  14.947  34.210  1.00 37.62 ? 2205 HOH A O     1 
HETATM 4313 O O     . HOH G 4 .   ? -1.540  6.667   34.581  1.00 29.96 ? 2206 HOH A O     1 
HETATM 4314 O O     . HOH G 4 .   ? -2.884  10.675  34.027  1.00 28.71 ? 2207 HOH A O     1 
HETATM 4315 O O     . HOH G 4 .   ? -4.433  13.024  47.149  1.00 23.41 ? 2208 HOH A O     1 
HETATM 4316 O O     . HOH G 4 .   ? -4.141  15.281  44.115  1.00 33.47 ? 2209 HOH A O     1 
HETATM 4317 O O     . HOH G 4 .   ? -6.719  11.032  44.777  1.00 34.55 ? 2210 HOH A O     1 
HETATM 4318 O O     . HOH G 4 .   ? -5.067  12.743  39.995  1.00 21.11 ? 2211 HOH A O     1 
HETATM 4319 O O     . HOH G 4 .   ? -0.643  14.429  45.434  1.00 21.08 ? 2212 HOH A O     1 
HETATM 4320 O O     . HOH G 4 .   ? 4.293   8.227   44.524  1.00 19.11 ? 2213 HOH A O     1 
HETATM 4321 O O     . HOH G 4 .   ? 2.903   5.863   41.230  1.00 20.88 ? 2214 HOH A O     1 
HETATM 4322 O O     . HOH G 4 .   ? 0.544   4.448   39.164  1.00 34.58 ? 2215 HOH A O     1 
HETATM 4323 O O     . HOH G 4 .   ? 1.063   4.870   45.065  1.00 24.85 ? 2216 HOH A O     1 
HETATM 4324 O O     . HOH G 4 .   ? 0.767   6.472   36.192  1.00 19.41 ? 2217 HOH A O     1 
HETATM 4325 O O     . HOH G 4 .   ? 8.524   10.160  39.776  1.00 16.32 ? 2218 HOH A O     1 
HETATM 4326 O O     . HOH G 4 .   ? 8.818   7.988   43.029  1.00 17.00 ? 2219 HOH A O     1 
HETATM 4327 O O     . HOH G 4 .   ? 7.967   0.485   39.745  1.00 18.80 ? 2220 HOH A O     1 
HETATM 4328 O O     . HOH G 4 .   ? 5.951   2.689   41.580  1.00 26.73 ? 2221 HOH A O     1 
HETATM 4329 O O     . HOH G 4 .   ? 14.039  17.686  31.212  1.00 40.50 ? 2222 HOH A O     1 
HETATM 4330 O O     . HOH G 4 .   ? 5.293   15.905  23.495  1.00 52.44 ? 2223 HOH A O     1 
HETATM 4331 O O     . HOH G 4 .   ? 5.076   20.676  20.693  1.00 46.53 ? 2224 HOH A O     1 
HETATM 4332 O O     . HOH G 4 .   ? 8.917   20.893  25.241  1.00 46.29 ? 2225 HOH A O     1 
HETATM 4333 O O     . HOH G 4 .   ? 5.977   17.928  28.246  1.00 24.29 ? 2226 HOH A O     1 
HETATM 4334 O O     . HOH G 4 .   ? 3.990   6.664   37.698  1.00 16.93 ? 2227 HOH A O     1 
HETATM 4335 O O     . HOH G 4 .   ? 0.554   7.607   32.921  1.00 20.08 ? 2228 HOH A O     1 
HETATM 4336 O O     . HOH G 4 .   ? 3.066   3.976   38.080  1.00 17.60 ? 2229 HOH A O     1 
HETATM 4337 O O     . HOH G 4 .   ? -0.836  4.523   37.299  1.00 26.73 ? 2230 HOH A O     1 
HETATM 4338 O O     . HOH G 4 .   ? 1.050   2.321   41.690  1.00 37.06 ? 2231 HOH A O     1 
HETATM 4339 O O     . HOH G 4 .   ? -0.838  -1.275  42.960  1.00 33.81 ? 2232 HOH A O     1 
HETATM 4340 O O     . HOH G 4 .   ? -3.050  -2.672  39.961  1.00 23.84 ? 2233 HOH A O     1 
HETATM 4341 O O     . HOH G 4 .   ? 7.143   -4.041  36.097  1.00 15.22 ? 2234 HOH A O     1 
HETATM 4342 O O     . HOH G 4 .   ? -3.742  -2.720  30.518  1.00 52.21 ? 2235 HOH A O     1 
HETATM 4343 O O     . HOH G 4 .   ? 3.603   3.181   40.451  1.00 20.30 ? 2236 HOH A O     1 
HETATM 4344 O O     . HOH G 4 .   ? 5.231   0.044   41.990  1.00 22.04 ? 2237 HOH A O     1 
HETATM 4345 O O     . HOH G 4 .   ? 2.923   -7.653  41.820  1.00 30.16 ? 2238 HOH A O     1 
HETATM 4346 O O     . HOH G 4 .   ? 6.762   -12.022 34.845  1.00 39.36 ? 2239 HOH A O     1 
HETATM 4347 O O     . HOH G 4 .   ? 0.065   -11.178 33.709  1.00 41.69 ? 2240 HOH A O     1 
HETATM 4348 O O     . HOH G 4 .   ? 2.758   -13.149 34.427  1.00 44.27 ? 2241 HOH A O     1 
HETATM 4349 O O     . HOH G 4 .   ? 4.283   -8.950  39.942  1.00 25.86 ? 2242 HOH A O     1 
HETATM 4350 O O     . HOH G 4 .   ? -1.753  -7.310  30.510  1.00 42.94 ? 2243 HOH A O     1 
HETATM 4351 O O     . HOH G 4 .   ? 1.049   -7.966  30.222  1.00 34.30 ? 2244 HOH A O     1 
HETATM 4352 O O     . HOH G 4 .   ? 14.003  -7.310  30.931  1.00 18.52 ? 2245 HOH A O     1 
HETATM 4353 O O     . HOH G 4 .   ? 11.171  0.492   32.486  1.00 16.36 ? 2246 HOH A O     1 
HETATM 4354 O O     . HOH G 4 .   ? 5.157   -4.708  42.039  1.00 23.99 ? 2247 HOH A O     1 
HETATM 4355 O O     . HOH G 4 .   ? 18.054  5.020   50.009  1.00 19.65 ? 2248 HOH A O     1 
HETATM 4356 O O     . HOH G 4 .   ? 22.481  3.865   49.080  1.00 28.85 ? 2249 HOH A O     1 
HETATM 4357 O O     . HOH G 4 .   ? 19.624  7.660   50.851  1.00 22.60 ? 2250 HOH A O     1 
HETATM 4358 O O     . HOH G 4 .   ? 22.445  12.909  46.106  1.00 33.25 ? 2251 HOH A O     1 
HETATM 4359 O O     . HOH G 4 .   ? 25.429  12.406  48.332  1.00 28.93 ? 2252 HOH A O     1 
HETATM 4360 O O     . HOH G 4 .   ? 22.125  7.274   51.728  1.00 28.86 ? 2253 HOH A O     1 
HETATM 4361 O O     . HOH G 4 .   ? 26.743  8.465   44.933  1.00 22.34 ? 2254 HOH A O     1 
HETATM 4362 O O     . HOH G 4 .   ? 21.998  9.056   40.528  1.00 16.10 ? 2255 HOH A O     1 
HETATM 4363 O O     . HOH G 4 .   ? 14.014  3.671   39.035  1.00 14.80 ? 2256 HOH A O     1 
HETATM 4364 O O     . HOH G 4 .   ? 20.478  10.079  38.349  1.00 26.80 ? 2257 HOH A O     1 
HETATM 4365 O O     . HOH G 4 .   ? 27.191  9.394   31.657  1.00 37.47 ? 2258 HOH A O     1 
HETATM 4366 O O     . HOH G 4 .   ? 24.369  6.995   28.175  1.00 21.88 ? 2259 HOH A O     1 
HETATM 4367 O O     . HOH G 4 .   ? 16.390  2.964   18.163  1.00 28.26 ? 2260 HOH A O     1 
HETATM 4368 O O     . HOH G 4 .   ? 15.483  -0.272  15.802  1.00 17.12 ? 2261 HOH A O     1 
HETATM 4369 O O     . HOH G 4 .   ? 15.502  5.539   18.305  1.00 35.19 ? 2262 HOH A O     1 
HETATM 4370 O O     . HOH G 4 .   ? 17.136  9.181   24.660  1.00 29.47 ? 2263 HOH A O     1 
HETATM 4371 O O     . HOH G 4 .   ? 28.354  6.762   35.021  1.00 26.76 ? 2264 HOH A O     1 
HETATM 4372 O O     . HOH G 4 .   ? 28.713  0.373   45.024  1.00 24.47 ? 2265 HOH A O     1 
HETATM 4373 O O     . HOH G 4 .   ? 32.553  0.616   44.490  1.00 20.71 ? 2266 HOH A O     1 
HETATM 4374 O O     . HOH G 4 .   ? 31.185  -11.789 41.427  1.00 36.07 ? 2267 HOH A O     1 
HETATM 4375 O O     . HOH G 4 .   ? 28.741  -10.187 45.769  1.00 35.30 ? 2268 HOH A O     1 
HETATM 4376 O O     . HOH G 4 .   ? 26.794  -12.263 46.390  1.00 37.50 ? 2269 HOH A O     1 
HETATM 4377 O O     . HOH G 4 .   ? 21.543  -8.714  48.443  1.00 34.70 ? 2270 HOH A O     1 
HETATM 4378 O O     . HOH G 4 .   ? 25.145  -14.509 43.149  1.00 44.37 ? 2271 HOH A O     1 
HETATM 4379 O O     . HOH G 4 .   ? 30.547  -2.649  46.103  1.00 31.62 ? 2272 HOH A O     1 
HETATM 4380 O O     . HOH G 4 .   ? 20.001  -1.110  49.436  1.00 25.15 ? 2273 HOH A O     1 
HETATM 4381 O O     . HOH G 4 .   ? 23.144  -3.951  48.342  1.00 28.21 ? 2274 HOH A O     1 
HETATM 4382 O O     . HOH G 4 .   ? 16.572  -0.811  43.965  1.00 15.41 ? 2275 HOH A O     1 
HETATM 4383 O O     . HOH G 4 .   ? 23.078  2.205   47.131  1.00 31.68 ? 2276 HOH A O     1 
HETATM 4384 O O     . HOH G 4 .   ? 18.979  12.013  39.028  1.00 34.36 ? 2277 HOH A O     1 
HETATM 4385 O O     . HOH G 4 .   ? 17.710  12.953  44.419  1.00 15.83 ? 2278 HOH A O     1 
HETATM 4386 O O     . HOH G 4 .   ? 17.493  17.084  43.227  1.00 25.59 ? 2279 HOH A O     1 
HETATM 4387 O O     . HOH G 4 .   ? 13.151  25.040  39.423  1.00 41.36 ? 2280 HOH A O     1 
HETATM 4388 O O     . HOH G 4 .   ? 10.857  21.958  39.304  1.00 44.15 ? 2281 HOH A O     1 
HETATM 4389 O O     . HOH G 4 .   ? 20.447  16.744  46.392  1.00 21.68 ? 2282 HOH A O     1 
HETATM 4390 O O     . HOH G 4 .   ? 19.631  18.211  44.519  1.00 37.06 ? 2283 HOH A O     1 
HETATM 4391 O O     . HOH G 4 .   ? 14.189  28.552  45.273  1.00 39.80 ? 2284 HOH A O     1 
HETATM 4392 O O     . HOH G 4 .   ? 13.863  28.493  42.350  1.00 37.54 ? 2285 HOH A O     1 
HETATM 4393 O O     . HOH G 4 .   ? 4.884   -0.396  46.401  1.00 26.20 ? 2286 HOH A O     1 
HETATM 4394 O O     . HOH G 4 .   ? 4.180   15.497  48.428  1.00 27.72 ? 2287 HOH A O     1 
HETATM 4395 O O     . HOH G 4 .   ? 3.518   12.482  48.797  1.00 30.76 ? 2288 HOH A O     1 
HETATM 4396 O O     . HOH G 4 .   ? 3.970   15.875  51.223  1.00 24.06 ? 2289 HOH A O     1 
HETATM 4397 O O     . HOH G 4 .   ? 11.237  7.581   53.926  1.00 33.79 ? 2290 HOH A O     1 
HETATM 4398 O O     . HOH G 4 .   ? 7.643   20.426  50.603  1.00 35.02 ? 2291 HOH A O     1 
HETATM 4399 O O     . HOH G 4 .   ? 12.395  17.337  53.270  1.00 28.26 ? 2292 HOH A O     1 
HETATM 4400 O O     . HOH G 4 .   ? 10.459  18.694  52.992  1.00 36.56 ? 2293 HOH A O     1 
HETATM 4401 O O     . HOH G 4 .   ? 12.945  12.502  58.598  1.00 26.03 ? 2294 HOH A O     1 
HETATM 4402 O O     . HOH G 4 .   ? 18.076  8.289   53.402  1.00 44.64 ? 2295 HOH A O     1 
HETATM 4403 O O     . HOH G 4 .   ? 10.457  13.791  59.292  1.00 48.13 ? 2296 HOH A O     1 
HETATM 4404 O O     . HOH G 4 .   ? 14.737  13.323  60.248  1.00 28.45 ? 2297 HOH A O     1 
HETATM 4405 O O     . HOH G 4 .   ? 20.977  15.766  50.044  1.00 29.64 ? 2298 HOH A O     1 
HETATM 4406 O O     . HOH G 4 .   ? 27.256  12.643  50.092  1.00 38.69 ? 2299 HOH A O     1 
HETATM 4407 O O     . HOH G 4 .   ? 25.545  22.481  60.043  1.00 29.92 ? 2300 HOH A O     1 
HETATM 4408 O O     . HOH G 4 .   ? 16.551  19.207  56.304  1.00 33.71 ? 2301 HOH A O     1 
HETATM 4409 O O     . HOH G 4 .   ? 6.166   -3.569  44.123  1.00 23.81 ? 2302 HOH A O     1 
HETATM 4410 O O     . HOH G 4 .   ? 7.755   4.014   49.934  1.00 22.76 ? 2303 HOH A O     1 
HETATM 4411 O O     . HOH G 4 .   ? 3.859   2.384   47.311  1.00 23.05 ? 2304 HOH A O     1 
HETATM 4412 O O     . HOH G 4 .   ? 4.371   5.621   47.813  1.00 21.84 ? 2305 HOH A O     1 
HETATM 4413 O O     . HOH G 4 .   ? 3.573   5.556   44.362  1.00 18.97 ? 2306 HOH A O     1 
HETATM 4414 O O     . HOH G 4 .   ? 6.831   8.020   44.735  1.00 17.79 ? 2307 HOH A O     1 
HETATM 4415 O O     . HOH G 4 .   ? 5.104   4.252   45.909  1.00 15.91 ? 2308 HOH A O     1 
HETATM 4416 O O     . HOH G 4 .   ? 13.021  5.776   52.910  1.00 22.99 ? 2309 HOH A O     1 
HETATM 4417 O O     . HOH G 4 .   ? 7.090   0.726   46.541  1.00 20.67 ? 2310 HOH A O     1 
HETATM 4418 O O     . HOH G 4 .   ? 5.089   2.601   44.374  1.00 29.43 ? 2311 HOH A O     1 
HETATM 4419 O O     . HOH H 4 .   ? 25.910  48.385  -17.965 1.00 34.44 ? 2001 HOH B O     1 
HETATM 4420 O O     . HOH H 4 .   ? 22.378  47.301  -21.229 1.00 29.98 ? 2002 HOH B O     1 
HETATM 4421 O O     . HOH H 4 .   ? 22.814  49.424  -21.911 1.00 37.58 ? 2003 HOH B O     1 
HETATM 4422 O O     . HOH H 4 .   ? 25.022  50.605  -19.014 1.00 36.93 ? 2004 HOH B O     1 
HETATM 4423 O O     . HOH H 4 .   ? 18.983  42.787  -3.697  1.00 32.84 ? 2005 HOH B O     1 
HETATM 4424 O O     . HOH H 4 .   ? 15.545  36.933  -14.563 1.00 42.69 ? 2006 HOH B O     1 
HETATM 4425 O O     . HOH H 4 .   ? 18.619  46.362  -0.038  1.00 37.10 ? 2007 HOH B O     1 
HETATM 4426 O O     . HOH H 4 .   ? 14.628  46.413  -0.834  1.00 31.06 ? 2008 HOH B O     1 
HETATM 4427 O O     . HOH H 4 .   ? 13.616  31.653  -1.247  1.00 38.30 ? 2009 HOH B O     1 
HETATM 4428 O O     . HOH H 4 .   ? 10.354  33.102  -2.631  1.00 22.38 ? 2010 HOH B O     1 
HETATM 4429 O O     . HOH H 4 .   ? 12.578  40.776  -1.217  1.00 19.63 ? 2011 HOH B O     1 
HETATM 4430 O O     . HOH H 4 .   ? 15.923  37.893  2.474   1.00 19.75 ? 2012 HOH B O     1 
HETATM 4431 O O     . HOH H 4 .   ? 15.424  34.921  3.329   1.00 26.58 ? 2013 HOH B O     1 
HETATM 4432 O O     . HOH H 4 .   ? 12.082  38.508  -7.811  1.00 16.87 ? 2014 HOH B O     1 
HETATM 4433 O O     . HOH H 4 .   ? 11.966  34.413  -6.497  1.00 34.37 ? 2015 HOH B O     1 
HETATM 4434 O O     . HOH H 4 .   ? 13.024  38.865  -10.458 1.00 37.07 ? 2016 HOH B O     1 
HETATM 4435 O O     . HOH H 4 .   ? 19.991  53.559  -13.496 1.00 28.76 ? 2017 HOH B O     1 
HETATM 4436 O O     . HOH H 4 .   ? 17.938  52.050  -17.895 1.00 35.30 ? 2018 HOH B O     1 
HETATM 4437 O O     . HOH H 4 .   ? 19.298  48.752  -20.079 1.00 53.73 ? 2019 HOH B O     1 
HETATM 4438 O O     . HOH H 4 .   ? 31.267  58.980  -12.108 1.00 45.85 ? 2020 HOH B O     1 
HETATM 4439 O O     . HOH H 4 .   ? 33.683  53.672  -5.716  1.00 39.41 ? 2021 HOH B O     1 
HETATM 4440 O O     . HOH H 4 .   ? 22.668  50.340  -5.061  1.00 38.68 ? 2022 HOH B O     1 
HETATM 4441 O O     . HOH H 4 .   ? 17.350  57.112  -14.928 1.00 41.61 ? 2023 HOH B O     1 
HETATM 4442 O O     . HOH H 4 .   ? 11.146  61.369  -10.638 1.00 37.93 ? 2024 HOH B O     1 
HETATM 4443 O O     . HOH H 4 .   ? 17.174  53.672  -14.306 1.00 25.11 ? 2025 HOH B O     1 
HETATM 4444 O O     . HOH H 4 .   ? 14.363  47.991  -14.212 1.00 20.14 ? 2026 HOH B O     1 
HETATM 4445 O O     . HOH H 4 .   ? 17.033  50.529  -15.556 1.00 26.37 ? 2027 HOH B O     1 
HETATM 4446 O O     . HOH H 4 .   ? 11.146  52.620  -21.195 1.00 49.05 ? 2028 HOH B O     1 
HETATM 4447 O O     . HOH H 4 .   ? 12.514  57.251  -21.069 1.00 41.03 ? 2029 HOH B O     1 
HETATM 4448 O O     . HOH H 4 .   ? 14.226  33.001  -12.372 1.00 27.65 ? 2030 HOH B O     1 
HETATM 4449 O O     . HOH H 4 .   ? 10.515  33.013  -13.974 1.00 47.22 ? 2031 HOH B O     1 
HETATM 4450 O O     . HOH H 4 .   ? 0.832   39.609  -17.435 1.00 29.10 ? 2032 HOH B O     1 
HETATM 4451 O O     . HOH H 4 .   ? -0.726  41.502  -16.918 1.00 35.32 ? 2033 HOH B O     1 
HETATM 4452 O O     . HOH H 4 .   ? 1.773   41.235  -11.248 1.00 34.72 ? 2034 HOH B O     1 
HETATM 4453 O O     . HOH H 4 .   ? 7.359   55.034  -11.822 1.00 33.10 ? 2035 HOH B O     1 
HETATM 4454 O O     . HOH H 4 .   ? 12.540  49.913  -17.961 1.00 35.15 ? 2036 HOH B O     1 
HETATM 4455 O O     . HOH H 4 .   ? 13.965  62.484  -10.135 1.00 40.11 ? 2037 HOH B O     1 
HETATM 4456 O O     . HOH H 4 .   ? 12.826  63.360  -5.136  1.00 49.38 ? 2038 HOH B O     1 
HETATM 4457 O O     . HOH H 4 .   ? 24.250  49.824  -24.087 1.00 45.65 ? 2039 HOH B O     1 
HETATM 4458 O O     . HOH H 4 .   ? 16.129  65.539  -6.295  1.00 45.50 ? 2040 HOH B O     1 
HETATM 4459 O O     . HOH H 4 .   ? 16.805  63.311  -5.019  1.00 46.08 ? 2041 HOH B O     1 
HETATM 4460 O O     . HOH H 4 .   ? 21.010  41.823  -2.036  1.00 34.97 ? 2042 HOH B O     1 
HETATM 4461 O O     . HOH H 4 .   ? 12.972  36.591  -14.894 1.00 33.29 ? 2043 HOH B O     1 
HETATM 4462 O O     . HOH H 4 .   ? 16.384  37.224  -17.228 1.00 44.93 ? 2044 HOH B O     1 
HETATM 4463 O O     . HOH H 4 .   ? 19.823  50.467  0.329   1.00 45.26 ? 2045 HOH B O     1 
HETATM 4464 O O     . HOH H 4 .   ? 17.701  38.802  4.057   1.00 30.24 ? 2046 HOH B O     1 
HETATM 4465 O O     . HOH H 4 .   ? 17.850  48.959  -0.293  1.00 24.82 ? 2047 HOH B O     1 
HETATM 4466 O O     . HOH H 4 .   ? 14.482  48.785  -2.512  1.00 18.69 ? 2048 HOH B O     1 
HETATM 4467 O O     . HOH H 4 .   ? 17.291  51.394  2.361   1.00 42.03 ? 2049 HOH B O     1 
HETATM 4468 O O     . HOH H 4 .   ? 17.104  47.212  -18.804 1.00 38.86 ? 2050 HOH B O     1 
HETATM 4469 O O     . HOH H 4 .   ? 10.298  58.993  -0.965  1.00 21.89 ? 2051 HOH B O     1 
HETATM 4470 O O     . HOH H 4 .   ? 6.288   60.129  -10.995 1.00 44.41 ? 2052 HOH B O     1 
HETATM 4471 O O     . HOH H 4 .   ? 9.569   61.169  -8.556  1.00 42.09 ? 2053 HOH B O     1 
HETATM 4472 O O     . HOH H 4 .   ? 8.843   57.113  -10.435 1.00 31.57 ? 2054 HOH B O     1 
HETATM 4473 O O     . HOH H 4 .   ? 21.579  47.832  -3.470  1.00 51.49 ? 2055 HOH B O     1 
HETATM 4474 O O     . HOH H 4 .   ? 5.594   59.834  -14.922 1.00 41.52 ? 2056 HOH B O     1 
HETATM 4475 O O     . HOH H 4 .   ? 5.870   57.479  -14.456 1.00 47.87 ? 2057 HOH B O     1 
HETATM 4476 O O     . HOH H 4 .   ? 16.088  48.122  -16.531 1.00 42.04 ? 2058 HOH B O     1 
HETATM 4477 O O     . HOH H 4 .   ? 1.387   43.908  -11.088 1.00 27.67 ? 2059 HOH B O     1 
HETATM 4478 O O     . HOH H 4 .   ? -0.674  42.257  -14.443 1.00 31.01 ? 2060 HOH B O     1 
HETATM 4479 O O     . HOH H 4 .   ? 14.088  33.121  -15.160 1.00 52.27 ? 2061 HOH B O     1 
HETATM 4480 O O     . HOH H 4 .   ? 10.351  36.145  -15.312 1.00 49.26 ? 2062 HOH B O     1 
HETATM 4481 O O     . HOH H 4 .   ? -3.161  40.058  -16.808 1.00 36.89 ? 2063 HOH B O     1 
HETATM 4482 O O     . HOH H 4 .   ? 3.518   38.500  -17.118 1.00 34.33 ? 2064 HOH B O     1 
HETATM 4483 O O     . HOH H 4 .   ? 7.356   54.994  -14.340 1.00 39.01 ? 2065 HOH B O     1 
HETATM 4484 O O     . HOH H 4 .   ? 15.756  50.047  1.149   1.00 23.16 ? 2066 HOH B O     1 
HETATM 4485 O O     . HOH H 4 .   ? 19.234  36.794  5.189   1.00 32.68 ? 2067 HOH B O     1 
HETATM 4486 O O     . HOH H 4 .   ? 19.868  40.033  2.409   1.00 39.70 ? 2068 HOH B O     1 
HETATM 4487 O O     . HOH H 4 .   ? 20.425  42.548  1.698   1.00 38.21 ? 2069 HOH B O     1 
HETATM 4488 O O     . HOH H 4 .   ? 20.751  37.147  -27.343 1.00 43.11 ? 2070 HOH B O     1 
HETATM 4489 O O     . HOH H 4 .   ? -4.312  40.022  -14.243 1.00 41.66 ? 2071 HOH B O     1 
HETATM 4490 O O     . HOH H 4 .   ? 19.336  49.557  -25.326 1.00 46.12 ? 2072 HOH B O     1 
HETATM 4491 O O     . HOH H 4 .   ? 22.076  38.791  2.534   1.00 39.71 ? 2073 HOH B O     1 
HETATM 4492 O O     . HOH H 4 .   ? 10.550  48.646  -21.281 1.00 38.86 ? 2074 HOH B O     1 
HETATM 4493 O O     . HOH H 4 .   ? 8.157   45.057  -26.342 1.00 42.14 ? 2075 HOH B O     1 
HETATM 4494 O O     . HOH H 4 .   ? 10.192  48.635  -18.727 1.00 29.97 ? 2076 HOH B O     1 
HETATM 4495 O O     . HOH H 4 .   ? 3.581   28.897  -9.919  1.00 37.97 ? 2077 HOH B O     1 
HETATM 4496 O O     . HOH H 4 .   ? -0.452  44.467  -21.190 1.00 22.02 ? 2078 HOH B O     1 
HETATM 4497 O O     . HOH H 4 .   ? -3.419  49.085  -6.976  1.00 32.71 ? 2079 HOH B O     1 
HETATM 4498 O O     . HOH H 4 .   ? -7.837  62.660  -14.550 1.00 35.43 ? 2080 HOH B O     1 
HETATM 4499 O O     . HOH H 4 .   ? -2.312  50.348  -16.256 1.00 40.34 ? 2081 HOH B O     1 
HETATM 4500 O O     . HOH H 4 .   ? -7.083  50.681  -0.353  1.00 40.55 ? 2082 HOH B O     1 
HETATM 4501 O O     . HOH H 4 .   ? -8.110  46.290  4.241   1.00 36.98 ? 2083 HOH B O     1 
HETATM 4502 O O     . HOH H 4 .   ? -5.990  49.871  -2.269  1.00 41.67 ? 2084 HOH B O     1 
HETATM 4503 O O     . HOH H 4 .   ? 0.795   51.665  -11.066 1.00 21.78 ? 2085 HOH B O     1 
HETATM 4504 O O     . HOH H 4 .   ? -0.630  53.741  -13.805 1.00 37.36 ? 2086 HOH B O     1 
HETATM 4505 O O     . HOH H 4 .   ? 5.412   31.902  -8.955  1.00 45.33 ? 2087 HOH B O     1 
HETATM 4506 O O     . HOH H 4 .   ? -3.758  48.953  -9.707  1.00 21.07 ? 2088 HOH B O     1 
HETATM 4507 O O     . HOH H 4 .   ? 8.185   57.848  10.025  1.00 34.00 ? 2089 HOH B O     1 
HETATM 4508 O O     . HOH H 4 .   ? -16.807 29.232  -1.427  1.00 30.92 ? 2090 HOH B O     1 
HETATM 4509 O O     . HOH H 4 .   ? -16.736 41.334  7.525   1.00 38.60 ? 2091 HOH B O     1 
HETATM 4510 O O     . HOH H 4 .   ? 20.493  54.815  6.682   1.00 44.03 ? 2092 HOH B O     1 
HETATM 4511 O O     . HOH H 4 .   ? -14.342 46.350  3.248   1.00 40.84 ? 2093 HOH B O     1 
HETATM 4512 O O     . HOH H 4 .   ? -11.571 47.123  4.210   1.00 27.92 ? 2094 HOH B O     1 
HETATM 4513 O O     . HOH H 4 .   ? -2.929  54.903  -14.211 1.00 40.76 ? 2095 HOH B O     1 
HETATM 4514 O O     . HOH H 4 .   ? 0.928   54.397  -11.561 1.00 32.21 ? 2096 HOH B O     1 
HETATM 4515 O O     . HOH H 4 .   ? -16.426 44.949  10.444  1.00 42.84 ? 2097 HOH B O     1 
HETATM 4516 O O     . HOH H 4 .   ? -14.691 45.347  6.498   1.00 30.37 ? 2098 HOH B O     1 
HETATM 4517 O O     . HOH H 4 .   ? -6.137  60.595  -12.262 1.00 26.82 ? 2099 HOH B O     1 
HETATM 4518 O O     . HOH H 4 .   ? -3.542  57.408  -13.243 1.00 32.74 ? 2100 HOH B O     1 
HETATM 4519 O O     . HOH H 4 .   ? -6.494  58.726  -7.704  1.00 39.39 ? 2101 HOH B O     1 
HETATM 4520 O O     . HOH H 4 .   ? -11.186 44.553  -0.911  1.00 36.95 ? 2102 HOH B O     1 
HETATM 4521 O O     . HOH H 4 .   ? -2.553  52.534  -8.072  1.00 41.43 ? 2103 HOH B O     1 
HETATM 4522 O O     . HOH H 4 .   ? 0.939   51.994  -8.223  1.00 21.46 ? 2104 HOH B O     1 
HETATM 4523 O O     . HOH H 4 .   ? 1.288   56.113  -9.544  1.00 22.87 ? 2105 HOH B O     1 
HETATM 4524 O O     . HOH H 4 .   ? 3.381   55.591  -0.469  1.00 25.22 ? 2106 HOH B O     1 
HETATM 4525 O O     . HOH H 4 .   ? 0.212   55.993  -2.657  1.00 22.18 ? 2107 HOH B O     1 
HETATM 4526 O O     . HOH H 4 .   ? -1.627  55.962  11.361  1.00 39.21 ? 2108 HOH B O     1 
HETATM 4527 O O     . HOH H 4 .   ? -8.324  48.909  1.954   1.00 50.47 ? 2109 HOH B O     1 
HETATM 4528 O O     . HOH H 4 .   ? 17.595  50.238  15.685  1.00 43.19 ? 2110 HOH B O     1 
HETATM 4529 O O     . HOH H 4 .   ? -0.904  50.299  -6.594  1.00 24.50 ? 2111 HOH B O     1 
HETATM 4530 O O     . HOH H 4 .   ? -3.954  50.818  -2.995  1.00 28.44 ? 2112 HOH B O     1 
HETATM 4531 O O     . HOH H 4 .   ? 4.849   53.483  0.842   1.00 23.18 ? 2113 HOH B O     1 
HETATM 4532 O O     . HOH H 4 .   ? -3.585  46.463  -5.859  1.00 27.58 ? 2114 HOH B O     1 
HETATM 4533 O O     . HOH H 4 .   ? 4.630   32.125  -6.752  1.00 33.29 ? 2115 HOH B O     1 
HETATM 4534 O O     . HOH H 4 .   ? -9.397  36.662  -5.391  1.00 35.83 ? 2116 HOH B O     1 
HETATM 4535 O O     . HOH H 4 .   ? 4.963   51.752  5.538   1.00 17.46 ? 2117 HOH B O     1 
HETATM 4536 O O     . HOH H 4 .   ? 7.529   55.227  9.059   1.00 26.19 ? 2118 HOH B O     1 
HETATM 4537 O O     . HOH H 4 .   ? 9.237   57.745  5.693   1.00 33.31 ? 2119 HOH B O     1 
HETATM 4538 O O     . HOH H 4 .   ? -6.899  42.621  3.607   1.00 20.02 ? 2120 HOH B O     1 
HETATM 4539 O O     . HOH H 4 .   ? -15.066 30.102  0.833   1.00 24.08 ? 2121 HOH B O     1 
HETATM 4540 O O     . HOH H 4 .   ? -16.651 32.484  1.807   1.00 28.84 ? 2122 HOH B O     1 
HETATM 4541 O O     . HOH H 4 .   ? -15.298 35.475  3.138   1.00 27.18 ? 2123 HOH B O     1 
HETATM 4542 O O     . HOH H 4 .   ? -15.264 33.758  5.230   1.00 40.99 ? 2124 HOH B O     1 
HETATM 4543 O O     . HOH H 4 .   ? -11.629 43.319  3.833   1.00 18.16 ? 2125 HOH B O     1 
HETATM 4544 O O     . HOH H 4 .   ? -8.305  43.965  4.840   1.00 33.17 ? 2126 HOH B O     1 
HETATM 4545 O O     . HOH H 4 .   ? -14.936 37.936  5.283   1.00 25.52 ? 2127 HOH B O     1 
HETATM 4546 O O     . HOH H 4 .   ? -14.330 41.539  4.012   1.00 20.82 ? 2128 HOH B O     1 
HETATM 4547 O O     . HOH H 4 .   ? -14.632 39.749  7.701   1.00 29.41 ? 2129 HOH B O     1 
HETATM 4548 O O     . HOH H 4 .   ? -11.430 43.183  6.844   1.00 30.94 ? 2130 HOH B O     1 
HETATM 4549 O O     . HOH H 4 .   ? -9.377  57.396  7.332   1.00 46.37 ? 2131 HOH B O     1 
HETATM 4550 O O     . HOH H 4 .   ? 17.545  52.202  7.975   1.00 40.79 ? 2132 HOH B O     1 
HETATM 4551 O O     . HOH H 4 .   ? 11.352  55.840  8.668   1.00 42.31 ? 2133 HOH B O     1 
HETATM 4552 O O     . HOH H 4 .   ? 12.451  54.993  6.045   1.00 28.64 ? 2134 HOH B O     1 
HETATM 4553 O O     . HOH H 4 .   ? -15.533 31.483  6.190   1.00 38.71 ? 2135 HOH B O     1 
HETATM 4554 O O     . HOH H 4 .   ? -11.581 27.366  22.647  1.00 40.01 ? 2136 HOH B O     1 
HETATM 4555 O O     . HOH H 4 .   ? -8.814  24.154  16.186  1.00 42.35 ? 2137 HOH B O     1 
HETATM 4556 O O     . HOH H 4 .   ? -13.315 44.031  9.044   1.00 23.38 ? 2138 HOH B O     1 
HETATM 4557 O O     . HOH H 4 .   ? -12.530 46.000  9.931   1.00 20.47 ? 2139 HOH B O     1 
HETATM 4558 O O     . HOH H 4 .   ? -12.398 45.646  14.056  1.00 46.04 ? 2140 HOH B O     1 
HETATM 4559 O O     . HOH H 4 .   ? 8.380   58.557  19.800  1.00 41.88 ? 2141 HOH B O     1 
HETATM 4560 O O     . HOH H 4 .   ? 9.194   56.670  17.836  1.00 35.21 ? 2142 HOH B O     1 
HETATM 4561 O O     . HOH H 4 .   ? 5.880   58.959  15.971  1.00 36.49 ? 2143 HOH B O     1 
HETATM 4562 O O     . HOH H 4 .   ? 2.261   53.146  18.429  1.00 40.48 ? 2144 HOH B O     1 
HETATM 4563 O O     . HOH H 4 .   ? -10.150 44.140  1.038   1.00 36.94 ? 2145 HOH B O     1 
HETATM 4564 O O     . HOH H 4 .   ? 5.913   16.115  0.538   1.00 50.41 ? 2146 HOH B O     1 
HETATM 4565 O O     . HOH H 4 .   ? -13.570 22.860  -2.437  1.00 38.03 ? 2147 HOH B O     1 
HETATM 4566 O O     . HOH H 4 .   ? -8.302  23.323  4.845   1.00 39.69 ? 2148 HOH B O     1 
HETATM 4567 O O     . HOH H 4 .   ? 6.452   50.837  7.855   1.00 20.29 ? 2149 HOH B O     1 
HETATM 4568 O O     . HOH H 4 .   ? 6.116   29.061  -9.248  1.00 40.38 ? 2150 HOH B O     1 
HETATM 4569 O O     . HOH H 4 .   ? -3.916  24.257  30.227  1.00 31.06 ? 2151 HOH B O     1 
HETATM 4570 O O     . HOH H 4 .   ? 3.919   53.751  3.512   1.00 22.21 ? 2152 HOH B O     1 
HETATM 4571 O O     . HOH H 4 .   ? 3.324   59.454  2.030   1.00 24.23 ? 2153 HOH B O     1 
HETATM 4572 O O     . HOH H 4 .   ? -0.903  56.591  8.352   1.00 33.28 ? 2154 HOH B O     1 
HETATM 4573 O O     . HOH H 4 .   ? 15.214  49.793  15.798  1.00 36.01 ? 2155 HOH B O     1 
HETATM 4574 O O     . HOH H 4 .   ? -7.585  51.272  3.539   1.00 26.15 ? 2156 HOH B O     1 
HETATM 4575 O O     . HOH H 4 .   ? 21.719  49.395  28.963  1.00 32.35 ? 2157 HOH B O     1 
HETATM 4576 O O     . HOH H 4 .   ? 5.001   51.791  25.074  1.00 48.31 ? 2158 HOH B O     1 
HETATM 4577 O O     . HOH H 4 .   ? -1.962  49.177  -2.398  1.00 19.42 ? 2159 HOH B O     1 
HETATM 4578 O O     . HOH H 4 .   ? 3.720   47.919  -0.022  1.00 18.48 ? 2160 HOH B O     1 
HETATM 4579 O O     . HOH H 4 .   ? -3.746  40.425  23.428  1.00 39.49 ? 2161 HOH B O     1 
HETATM 4580 O O     . HOH H 4 .   ? -2.172  44.133  -6.524  1.00 32.75 ? 2162 HOH B O     1 
HETATM 4581 O O     . HOH H 4 .   ? -2.174  44.744  21.939  1.00 28.63 ? 2163 HOH B O     1 
HETATM 4582 O O     . HOH H 4 .   ? 5.894   34.240  -4.873  1.00 31.63 ? 2164 HOH B O     1 
HETATM 4583 O O     . HOH H 4 .   ? -1.778  44.751  2.705   1.00 16.75 ? 2165 HOH B O     1 
HETATM 4584 O O     . HOH H 4 .   ? -3.652  43.629  1.028   1.00 17.76 ? 2166 HOH B O     1 
HETATM 4585 O O     . HOH H 4 .   ? -6.567  46.281  -5.402  1.00 42.35 ? 2167 HOH B O     1 
HETATM 4586 O O     . HOH H 4 .   ? -6.644  45.069  -1.442  1.00 35.19 ? 2168 HOH B O     1 
HETATM 4587 O O     . HOH H 4 .   ? -3.256  46.843  -3.080  1.00 19.26 ? 2169 HOH B O     1 
HETATM 4588 O O     . HOH H 4 .   ? -6.104  37.047  -6.177  1.00 26.07 ? 2170 HOH B O     1 
HETATM 4589 O O     . HOH H 4 .   ? -0.360  43.289  -9.751  1.00 36.30 ? 2171 HOH B O     1 
HETATM 4590 O O     . HOH H 4 .   ? -5.603  41.799  1.426   1.00 17.40 ? 2172 HOH B O     1 
HETATM 4591 O O     . HOH H 4 .   ? -6.634  40.164  22.908  1.00 36.50 ? 2173 HOH B O     1 
HETATM 4592 O O     . HOH H 4 .   ? -14.863 32.984  2.911   1.00 29.03 ? 2174 HOH B O     1 
HETATM 4593 O O     . HOH H 4 .   ? -11.472 54.935  7.414   1.00 32.07 ? 2175 HOH B O     1 
HETATM 4594 O O     . HOH H 4 .   ? -6.109  55.978  10.404  1.00 39.84 ? 2176 HOH B O     1 
HETATM 4595 O O     . HOH H 4 .   ? -4.121  55.483  13.932  1.00 33.43 ? 2177 HOH B O     1 
HETATM 4596 O O     . HOH H 4 .   ? -12.781 41.537  5.358   1.00 24.87 ? 2178 HOH B O     1 
HETATM 4597 O O     . HOH H 4 .   ? -13.318 39.513  3.856   1.00 33.75 ? 2179 HOH B O     1 
HETATM 4598 O O     . HOH H 4 .   ? -9.429  41.214  3.691   1.00 20.69 ? 2180 HOH B O     1 
HETATM 4599 O O     . HOH H 4 .   ? -14.848 32.810  8.175   1.00 44.07 ? 2181 HOH B O     1 
HETATM 4600 O O     . HOH H 4 .   ? -15.486 36.557  7.816   1.00 17.01 ? 2182 HOH B O     1 
HETATM 4601 O O     . HOH H 4 .   ? -4.043  18.829  16.286  1.00 36.62 ? 2183 HOH B O     1 
HETATM 4602 O O     . HOH H 4 .   ? -9.873  27.491  20.194  1.00 36.10 ? 2184 HOH B O     1 
HETATM 4603 O O     . HOH H 4 .   ? -11.200 25.104  16.583  1.00 28.83 ? 2185 HOH B O     1 
HETATM 4604 O O     . HOH H 4 .   ? -14.215 28.204  21.779  1.00 30.73 ? 2186 HOH B O     1 
HETATM 4605 O O     . HOH H 4 .   ? 6.960   25.417  12.079  1.00 23.19 ? 2187 HOH B O     1 
HETATM 4606 O O     . HOH H 4 .   ? -9.583  35.867  20.239  1.00 25.70 ? 2188 HOH B O     1 
HETATM 4607 O O     . HOH H 4 .   ? -10.304 33.023  22.451  1.00 23.00 ? 2189 HOH B O     1 
HETATM 4608 O O     . HOH H 4 .   ? -12.968 33.125  15.321  1.00 34.02 ? 2190 HOH B O     1 
HETATM 4609 O O     . HOH H 4 .   ? 16.490  47.068  3.665   1.00 21.72 ? 2191 HOH B O     1 
HETATM 4610 O O     . HOH H 4 .   ? -9.371  44.108  12.318  1.00 17.88 ? 2192 HOH B O     1 
HETATM 4611 O O     . HOH H 4 .   ? -13.953 42.099  12.900  1.00 41.64 ? 2193 HOH B O     1 
HETATM 4612 O O     . HOH H 4 .   ? -12.096 44.188  10.818  1.00 25.36 ? 2194 HOH B O     1 
HETATM 4613 O O     . HOH H 4 .   ? -12.477 41.825  8.289   1.00 32.08 ? 2195 HOH B O     1 
HETATM 4614 O O     . HOH H 4 .   ? -13.356 39.533  9.934   1.00 35.20 ? 2196 HOH B O     1 
HETATM 4615 O O     . HOH H 4 .   ? 16.684  40.767  10.355  1.00 38.45 ? 2197 HOH B O     1 
HETATM 4616 O O     . HOH H 4 .   ? 17.151  40.353  6.579   1.00 39.59 ? 2198 HOH B O     1 
HETATM 4617 O O     . HOH H 4 .   ? 2.659   18.758  -3.561  1.00 28.49 ? 2199 HOH B O     1 
HETATM 4618 O O     . HOH H 4 .   ? 4.170   17.807  -1.875  1.00 40.64 ? 2200 HOH B O     1 
HETATM 4619 O O     . HOH H 4 .   ? -7.520  42.488  -0.364  1.00 28.58 ? 2201 HOH B O     1 
HETATM 4620 O O     . HOH H 4 .   ? -10.169 28.382  -6.925  1.00 31.30 ? 2202 HOH B O     1 
HETATM 4621 O O     . HOH H 4 .   ? -11.606 26.861  -4.641  1.00 38.90 ? 2203 HOH B O     1 
HETATM 4622 O O     . HOH H 4 .   ? -12.083 24.686  0.233   1.00 32.11 ? 2204 HOH B O     1 
HETATM 4623 O O     . HOH H 4 .   ? -14.155 26.719  1.253   1.00 38.00 ? 2205 HOH B O     1 
HETATM 4624 O O     . HOH H 4 .   ? -9.789  24.465  2.702   1.00 44.65 ? 2206 HOH B O     1 
HETATM 4625 O O     . HOH H 4 .   ? -8.185  22.521  -0.233  1.00 38.64 ? 2207 HOH B O     1 
HETATM 4626 O O     . HOH H 4 .   ? -8.012  25.458  8.106   1.00 35.87 ? 2208 HOH B O     1 
HETATM 4627 O O     . HOH H 4 .   ? -6.156  29.407  -7.101  1.00 27.81 ? 2209 HOH B O     1 
HETATM 4628 O O     . HOH H 4 .   ? 9.392   25.690  1.005   1.00 37.68 ? 2210 HOH B O     1 
HETATM 4629 O O     . HOH H 4 .   ? 13.083  30.016  0.491   1.00 37.82 ? 2211 HOH B O     1 
HETATM 4630 O O     . HOH H 4 .   ? 5.187   29.771  -5.410  1.00 39.47 ? 2212 HOH B O     1 
HETATM 4631 O O     . HOH H 4 .   ? 7.589   33.186  -2.813  1.00 18.03 ? 2213 HOH B O     1 
HETATM 4632 O O     . HOH H 4 .   ? 5.784   24.651  17.489  1.00 34.80 ? 2214 HOH B O     1 
HETATM 4633 O O     . HOH H 4 .   ? -1.538  22.791  30.666  1.00 40.04 ? 2215 HOH B O     1 
HETATM 4634 O O     . HOH H 4 .   ? -9.102  23.117  24.905  1.00 36.06 ? 2216 HOH B O     1 
HETATM 4635 O O     . HOH H 4 .   ? -7.586  19.371  26.608  1.00 40.97 ? 2217 HOH B O     1 
HETATM 4636 O O     . HOH H 4 .   ? -4.675  16.075  28.393  1.00 31.42 ? 2218 HOH B O     1 
HETATM 4637 O O     . HOH H 4 .   ? 5.129   4.786   17.285  1.00 48.37 ? 2219 HOH B O     1 
HETATM 4638 O O     . HOH H 4 .   ? 15.082  48.103  13.666  1.00 27.00 ? 2220 HOH B O     1 
HETATM 4639 O O     . HOH H 4 .   ? 16.341  46.216  10.474  1.00 29.82 ? 2221 HOH B O     1 
HETATM 4640 O O     . HOH H 4 .   ? 13.647  50.329  19.048  1.00 43.84 ? 2222 HOH B O     1 
HETATM 4641 O O     . HOH H 4 .   ? -1.318  8.612   26.681  1.00 37.98 ? 2223 HOH B O     1 
HETATM 4642 O O     . HOH H 4 .   ? 15.077  49.629  25.948  1.00 37.89 ? 2224 HOH B O     1 
HETATM 4643 O O     . HOH H 4 .   ? 19.793  49.192  27.134  1.00 25.42 ? 2225 HOH B O     1 
HETATM 4644 O O     . HOH H 4 .   ? 14.077  43.757  29.860  1.00 26.02 ? 2226 HOH B O     1 
HETATM 4645 O O     . HOH H 4 .   ? 18.263  46.936  24.262  1.00 26.25 ? 2227 HOH B O     1 
HETATM 4646 O O     . HOH H 4 .   ? 8.089   49.842  27.572  1.00 37.20 ? 2228 HOH B O     1 
HETATM 4647 O O     . HOH H 4 .   ? 6.336   49.391  25.623  1.00 33.47 ? 2229 HOH B O     1 
HETATM 4648 O O     . HOH H 4 .   ? 6.529   51.028  23.266  1.00 34.62 ? 2230 HOH B O     1 
HETATM 4649 O O     . HOH H 4 .   ? 6.989   41.779  31.567  1.00 33.13 ? 2231 HOH B O     1 
HETATM 4650 O O     . HOH H 4 .   ? -1.592  37.939  24.983  1.00 20.30 ? 2232 HOH B O     1 
HETATM 4651 O O     . HOH H 4 .   ? -4.317  41.559  25.449  1.00 28.94 ? 2233 HOH B O     1 
HETATM 4652 O O     . HOH H 4 .   ? -1.439  42.456  23.230  1.00 24.08 ? 2234 HOH B O     1 
HETATM 4653 O O     . HOH H 4 .   ? 1.355   46.607  22.908  1.00 22.42 ? 2235 HOH B O     1 
HETATM 4654 O O     . HOH H 4 .   ? -3.516  40.888  15.209  1.00 17.82 ? 2236 HOH B O     1 
HETATM 4655 O O     . HOH H 4 .   ? 13.982  35.600  19.618  1.00 41.95 ? 2237 HOH B O     1 
HETATM 4656 O O     . HOH H 4 .   ? 24.609  37.049  21.517  1.00 26.82 ? 2238 HOH B O     1 
HETATM 4657 O O     . HOH H 4 .   ? 17.060  38.768  21.991  1.00 27.87 ? 2239 HOH B O     1 
HETATM 4658 O O     . HOH H 4 .   ? 17.065  44.587  23.326  1.00 18.80 ? 2240 HOH B O     1 
HETATM 4659 O O     . HOH H 4 .   ? 17.956  49.286  19.532  1.00 30.69 ? 2241 HOH B O     1 
HETATM 4660 O O     . HOH H 4 .   ? 15.742  48.205  18.486  1.00 38.58 ? 2242 HOH B O     1 
HETATM 4661 O O     . HOH H 4 .   ? 4.370   48.120  21.542  1.00 24.88 ? 2243 HOH B O     1 
HETATM 4662 O O     . HOH H 4 .   ? 1.345   43.297  20.886  1.00 15.26 ? 2244 HOH B O     1 
HETATM 4663 O O     . HOH H 4 .   ? -0.326  53.189  19.256  1.00 43.28 ? 2245 HOH B O     1 
HETATM 4664 O O     . HOH H 4 .   ? -5.167  44.044  21.870  1.00 25.56 ? 2246 HOH B O     1 
HETATM 4665 O O     . HOH H 4 .   ? -9.117  46.129  21.555  1.00 25.55 ? 2247 HOH B O     1 
HETATM 4666 O O     . HOH H 4 .   ? -1.269  47.119  22.372  1.00 18.78 ? 2248 HOH B O     1 
HETATM 4667 O O     . HOH H 4 .   ? 1.838   54.920  13.655  1.00 32.26 ? 2249 HOH B O     1 
HETATM 4668 O O     . HOH H 4 .   ? -6.868  42.305  20.357  1.00 24.22 ? 2250 HOH B O     1 
HETATM 4669 O O     . HOH H 4 .   ? -6.086  41.804  17.870  1.00 26.23 ? 2251 HOH B O     1 
HETATM 4670 O O     . HOH H 4 .   ? -8.635  50.455  6.653   1.00 25.64 ? 2252 HOH B O     1 
HETATM 4671 O O     . HOH H 4 .   ? -11.229 47.216  12.170  1.00 18.04 ? 2253 HOH B O     1 
HETATM 4672 O O     . HOH H 4 .   ? -8.869  54.962  10.280  1.00 33.07 ? 2254 HOH B O     1 
HETATM 4673 O O     . HOH H 4 .   ? -10.040 52.933  7.950   1.00 34.07 ? 2255 HOH B O     1 
HETATM 4674 O O     . HOH H 4 .   ? -4.120  54.681  11.491  1.00 26.54 ? 2256 HOH B O     1 
HETATM 4675 O O     . HOH H 4 .   ? -11.453 55.337  14.957  1.00 47.31 ? 2257 HOH B O     1 
HETATM 4676 O O     . HOH H 4 .   ? 2.193   43.165  9.986   1.00 16.94 ? 2258 HOH B O     1 
HETATM 4677 O O     . HOH H 4 .   ? -4.488  45.301  11.439  1.00 15.92 ? 2259 HOH B O     1 
HETATM 4678 O O     . HOH H 4 .   ? -4.529  26.208  16.066  1.00 22.81 ? 2260 HOH B O     1 
HETATM 4679 O O     . HOH H 4 .   ? -5.114  24.404  13.799  1.00 49.48 ? 2261 HOH B O     1 
HETATM 4680 O O     . HOH H 4 .   ? -2.850  23.638  16.767  1.00 29.42 ? 2262 HOH B O     1 
HETATM 4681 O O     . HOH H 4 .   ? -3.076  21.605  14.982  1.00 33.65 ? 2263 HOH B O     1 
HETATM 4682 O O     . HOH H 4 .   ? -1.481  21.632  8.726   1.00 32.39 ? 2264 HOH B O     1 
HETATM 4683 O O     . HOH H 4 .   ? 5.619   27.684  11.608  1.00 19.99 ? 2265 HOH B O     1 
HETATM 4684 O O     . HOH H 4 .   ? 0.900   36.088  12.842  1.00 18.05 ? 2266 HOH B O     1 
HETATM 4685 O O     . HOH H 4 .   ? 7.532   29.534  11.964  1.00 23.35 ? 2267 HOH B O     1 
HETATM 4686 O O     . HOH H 4 .   ? 12.673  34.326  3.192   1.00 28.01 ? 2268 HOH B O     1 
HETATM 4687 O O     . HOH H 4 .   ? 14.686  47.555  1.758   1.00 27.73 ? 2269 HOH B O     1 
HETATM 4688 O O     . HOH H 4 .   ? 13.699  50.627  -0.572  1.00 16.80 ? 2270 HOH B O     1 
HETATM 4689 O O     . HOH H 4 .   ? 9.640   48.847  9.169   1.00 19.94 ? 2271 HOH B O     1 
HETATM 4690 O O     . HOH H 4 .   ? 14.933  40.696  8.125   1.00 30.93 ? 2272 HOH B O     1 
HETATM 4691 O O     . HOH H 4 .   ? 15.376  36.139  13.764  1.00 44.25 ? 2273 HOH B O     1 
HETATM 4692 O O     . HOH H 4 .   ? 8.908   27.153  3.861   1.00 28.99 ? 2274 HOH B O     1 
HETATM 4693 O O     . HOH H 4 .   ? 8.506   23.139  2.845   1.00 39.81 ? 2275 HOH B O     1 
HETATM 4694 O O     . HOH H 4 .   ? 2.271   20.057  -0.220  1.00 36.21 ? 2276 HOH B O     1 
HETATM 4695 O O     . HOH H 4 .   ? -3.206  21.493  0.633   1.00 41.99 ? 2277 HOH B O     1 
HETATM 4696 O O     . HOH H 4 .   ? -2.795  24.164  -3.601  1.00 26.90 ? 2278 HOH B O     1 
HETATM 4697 O O     . HOH H 4 .   ? -7.431  21.600  -4.543  1.00 32.85 ? 2279 HOH B O     1 
HETATM 4698 O O     . HOH H 4 .   ? -8.090  27.096  -6.422  1.00 31.32 ? 2280 HOH B O     1 
HETATM 4699 O O     . HOH H 4 .   ? -5.064  24.078  -7.322  1.00 33.31 ? 2281 HOH B O     1 
HETATM 4700 O O     . HOH H 4 .   ? -10.643 25.883  1.602   1.00 41.45 ? 2282 HOH B O     1 
HETATM 4701 O O     . HOH H 4 .   ? -10.449 25.940  -2.060  1.00 27.74 ? 2283 HOH B O     1 
HETATM 4702 O O     . HOH H 4 .   ? -12.793 28.995  4.529   1.00 38.04 ? 2284 HOH B O     1 
HETATM 4703 O O     . HOH H 4 .   ? -12.579 28.351  -2.392  1.00 26.88 ? 2285 HOH B O     1 
HETATM 4704 O O     . HOH H 4 .   ? -11.826 32.065  -3.602  1.00 41.47 ? 2286 HOH B O     1 
HETATM 4705 O O     . HOH H 4 .   ? -14.501 33.045  -0.823  1.00 44.56 ? 2287 HOH B O     1 
HETATM 4706 O O     . HOH H 4 .   ? -5.231  21.879  1.790   1.00 33.13 ? 2288 HOH B O     1 
HETATM 4707 O O     . HOH H 4 .   ? -7.861  27.012  10.683  1.00 30.17 ? 2289 HOH B O     1 
HETATM 4708 O O     . HOH H 4 .   ? -5.411  25.486  7.328   1.00 36.84 ? 2290 HOH B O     1 
HETATM 4709 O O     . HOH H 4 .   ? -8.842  26.698  6.224   1.00 29.04 ? 2291 HOH B O     1 
HETATM 4710 O O     . HOH H 4 .   ? -4.926  32.783  10.561  1.00 15.33 ? 2292 HOH B O     1 
HETATM 4711 O O     . HOH H 4 .   ? -3.536  24.996  9.798   1.00 35.70 ? 2293 HOH B O     1 
HETATM 4712 O O     . HOH H 4 .   ? 7.816   30.200  14.723  1.00 22.40 ? 2294 HOH B O     1 
HETATM 4713 O O     . HOH H 4 .   ? 10.245  26.787  21.557  1.00 42.17 ? 2295 HOH B O     1 
HETATM 4714 O O     . HOH H 4 .   ? 0.089   35.871  20.771  1.00 18.53 ? 2296 HOH B O     1 
HETATM 4715 O O     . HOH H 4 .   ? 3.855   37.303  20.931  1.00 20.90 ? 2297 HOH B O     1 
HETATM 4716 O O     . HOH H 4 .   ? 8.443   32.055  25.019  1.00 30.70 ? 2298 HOH B O     1 
HETATM 4717 O O     . HOH H 4 .   ? 9.888   23.329  28.260  1.00 47.82 ? 2299 HOH B O     1 
HETATM 4718 O O     . HOH H 4 .   ? 3.741   25.195  28.829  1.00 43.38 ? 2300 HOH B O     1 
HETATM 4719 O O     . HOH H 4 .   ? 13.595  39.025  37.977  1.00 49.98 ? 2301 HOH B O     1 
HETATM 4720 O O     . HOH H 4 .   ? 11.710  35.222  29.872  1.00 38.11 ? 2302 HOH B O     1 
HETATM 4721 O O     . HOH H 4 .   ? -9.439  39.531  18.966  1.00 26.88 ? 2303 HOH B O     1 
HETATM 4722 O O     . HOH H 4 .   ? -10.457 43.290  18.664  1.00 25.55 ? 2304 HOH B O     1 
HETATM 4723 O O     . HOH H 4 .   ? -0.201  33.868  30.614  1.00 32.41 ? 2305 HOH B O     1 
HETATM 4724 O O     . HOH H 4 .   ? -0.723  31.429  32.193  1.00 33.63 ? 2306 HOH B O     1 
HETATM 4725 O O     . HOH H 4 .   ? -6.749  27.668  23.388  1.00 25.29 ? 2307 HOH B O     1 
HETATM 4726 O O     . HOH H 4 .   ? 4.549   26.954  18.589  1.00 18.90 ? 2308 HOH B O     1 
HETATM 4727 O O     . HOH H 4 .   ? -0.262  23.204  28.330  1.00 45.56 ? 2309 HOH B O     1 
HETATM 4728 O O     . HOH H 4 .   ? -6.968  22.149  27.122  1.00 35.54 ? 2310 HOH B O     1 
HETATM 4729 O O     . HOH H 4 .   ? -7.954  24.868  23.159  1.00 33.67 ? 2311 HOH B O     1 
HETATM 4730 O O     . HOH H 4 .   ? -5.565  20.552  18.675  1.00 39.56 ? 2312 HOH B O     1 
HETATM 4731 O O     . HOH H 4 .   ? -2.499  16.939  26.947  1.00 23.29 ? 2313 HOH B O     1 
HETATM 4732 O O     . HOH H 4 .   ? -7.885  17.314  22.349  1.00 40.80 ? 2314 HOH B O     1 
HETATM 4733 O O     . HOH H 4 .   ? -3.009  16.819  17.974  1.00 34.32 ? 2315 HOH B O     1 
HETATM 4734 O O     . HOH H 4 .   ? -1.388  14.298  26.488  1.00 24.57 ? 2316 HOH B O     1 
HETATM 4735 O O     . HOH H 4 .   ? -5.189  11.578  24.762  1.00 31.47 ? 2317 HOH B O     1 
HETATM 4736 O O     . HOH H 4 .   ? -7.346  16.494  16.840  1.00 42.55 ? 2318 HOH B O     1 
HETATM 4737 O O     . HOH H 4 .   ? 4.135   8.079   16.464  1.00 39.38 ? 2319 HOH B O     1 
HETATM 4738 O O     . HOH H 4 .   ? 1.451   5.518   18.863  1.00 30.56 ? 2320 HOH B O     1 
HETATM 4739 O O     . HOH H 4 .   ? 0.374   9.393   22.962  1.00 25.48 ? 2321 HOH B O     1 
HETATM 4740 O O     . HOH H 4 .   ? -5.993  36.672  23.885  1.00 32.95 ? 2322 HOH B O     1 
HETATM 4741 O O     . HOH H 4 .   ? -6.907  34.932  24.330  1.00 23.04 ? 2323 HOH B O     1 
HETATM 4742 O O     . HOH H 4 .   ? -1.536  36.309  22.848  1.00 20.66 ? 2324 HOH B O     1 
HETATM 4743 O O     . HOH H 4 .   ? -7.724  33.815  22.022  1.00 21.53 ? 2325 HOH B O     1 
HETATM 4744 O O     . HOH H 4 .   ? -7.716  37.545  18.578  1.00 17.65 ? 2326 HOH B O     1 
HETATM 4745 O O     . HOH H 4 .   ? -5.069  38.314  22.137  1.00 35.89 ? 2327 HOH B O     1 
HETATM 4746 O O     . HOH H 4 .   ? -9.767  40.997  16.002  1.00 25.09 ? 2328 HOH B O     1 
HETATM 4747 O O     . HOH I 4 .   ? 10.306  17.856  41.557  1.00 20.90 ? 2001 HOH K O     1 
HETATM 4748 O O     . HOH I 4 .   ? 8.583   20.530  40.793  1.00 28.18 ? 2002 HOH K O     1 
HETATM 4749 O O     . HOH I 4 .   ? 6.190   19.865  39.816  1.00 39.41 ? 2003 HOH K O     1 
HETATM 4750 O O     . HOH I 4 .   ? 3.712   19.915  41.481  1.00 27.91 ? 2004 HOH K O     1 
HETATM 4751 O O     . HOH I 4 .   ? 19.998  12.010  32.039  1.00 37.10 ? 2005 HOH K O     1 
HETATM 4752 O O     . HOH I 4 .   ? 16.457  17.606  38.948  1.00 29.13 ? 2006 HOH K O     1 
HETATM 4753 O O     . HOH I 4 .   ? 11.933  18.405  32.936  1.00 33.40 ? 2007 HOH K O     1 
HETATM 4754 O O     . HOH I 4 .   ? 20.656  22.236  40.108  1.00 41.76 ? 2008 HOH K O     1 
HETATM 4755 O O     . HOH I 4 .   ? 13.373  24.586  32.912  1.00 42.42 ? 2009 HOH K O     1 
HETATM 4756 O O     . HOH I 4 .   ? 15.902  25.081  32.170  1.00 39.52 ? 2010 HOH K O     1 
HETATM 4757 O O     . HOH I 4 .   ? 20.982  25.685  43.704  1.00 38.90 ? 2011 HOH K O     1 
HETATM 4758 O O     . HOH I 4 .   ? 13.511  27.700  31.251  1.00 43.64 ? 2012 HOH K O     1 
HETATM 4759 O O     . HOH I 4 .   ? 17.296  28.781  39.853  1.00 36.53 ? 2013 HOH K O     1 
HETATM 4760 O O     . HOH I 4 .   ? 13.246  33.015  34.432  1.00 52.66 ? 2014 HOH K O     1 
HETATM 4761 O O     . HOH I 4 .   ? 14.213  31.457  32.984  1.00 39.46 ? 2015 HOH K O     1 
HETATM 4762 O O     . HOH I 4 .   ? 18.206  17.683  40.733  1.00 41.18 ? 2016 HOH K O     1 
HETATM 4763 O O     . HOH J 4 .   ? 14.826  33.696  25.355  1.00 34.44 ? 2001 HOH L O     1 
HETATM 4764 O O     . HOH J 4 .   ? 2.771   39.132  31.847  1.00 45.11 ? 2002 HOH L O     1 
HETATM 4765 O O     . HOH J 4 .   ? 10.794  37.410  27.656  1.00 45.18 ? 2003 HOH L O     1 
HETATM 4766 O O     . HOH J 4 .   ? 13.528  34.098  17.242  1.00 44.74 ? 2004 HOH L O     1 
HETATM 4767 O O     . HOH J 4 .   ? 0.545   38.131  32.223  1.00 45.68 ? 2005 HOH L O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 10  ? 0.1733 0.1732 0.1813 0.0014  0.0021  0.0015  117  GLY A N     
2    C CA    . GLY A 10  ? 0.1717 0.1693 0.1739 0.0004  0.0025  -0.0001 117  GLY A CA    
3    C C     . GLY A 10  ? 0.1686 0.1622 0.1683 0.0019  0.0031  0.0027  117  GLY A C     
4    O O     . GLY A 10  ? 0.1780 0.1722 0.1826 0.0042  0.0074  0.0020  117  GLY A O     
5    N N     . VAL A 11  ? 0.1465 0.1473 0.1482 0.0014  0.0015  -0.0001 118  VAL A N     
6    C CA    . VAL A 11  ? 0.1281 0.1290 0.1316 -0.0009 -0.0021 -0.0012 118  VAL A CA    
7    C C     . VAL A 11  ? 0.1144 0.1175 0.1144 0.0007  -0.0002 0.0015  118  VAL A C     
8    O O     . VAL A 11  ? 0.1097 0.1080 0.1006 -0.0010 -0.0048 -0.0003 118  VAL A O     
9    C CB    . VAL A 11  ? 0.1326 0.1290 0.1322 0.0010  0.0005  0.0001  118  VAL A CB    
10   C CG1   . VAL A 11  ? 0.1310 0.1307 0.1333 -0.0007 0.0009  -0.0010 118  VAL A CG1   
11   C CG2   . VAL A 11  ? 0.1281 0.1310 0.1317 -0.0010 -0.0033 -0.0013 118  VAL A CG2   
12   N N     . CYS A 12  ? 0.0974 0.1023 0.0998 -0.0006 -0.0054 0.0009  119  CYS A N     
13   C CA    . CYS A 12  ? 0.0959 0.0985 0.0952 -0.0005 -0.0020 0.0005  119  CYS A CA    
14   C C     . CYS A 12  ? 0.0901 0.0917 0.0913 -0.0010 -0.0003 -0.0002 119  CYS A C     
15   O O     . CYS A 12  ? 0.0827 0.0870 0.0822 -0.0031 -0.0037 -0.0022 119  CYS A O     
16   C CB    . CYS A 12  ? 0.0964 0.1017 0.1020 -0.0010 -0.0019 -0.0008 119  CYS A CB    
17   S SG    . CYS A 12  ? 0.1081 0.1140 0.1147 0.0011  -0.0058 -0.0031 119  CYS A SG    
18   N N     . TRP A 13  ? 0.0774 0.0821 0.0803 -0.0007 -0.0027 -0.0001 120  TRP A N     
19   C CA    . TRP A 13  ? 0.0788 0.0808 0.0796 0.0000  -0.0011 -0.0001 120  TRP A CA    
20   C C     . TRP A 13  ? 0.0767 0.0783 0.0732 -0.0005 -0.0013 -0.0002 120  TRP A C     
21   O O     . TRP A 13  ? 0.0750 0.0756 0.0688 -0.0026 -0.0023 -0.0052 120  TRP A O     
22   C CB    . TRP A 13  ? 0.0786 0.0843 0.0817 0.0000  -0.0024 0.0007  120  TRP A CB    
23   C CG    . TRP A 13  ? 0.0834 0.0871 0.0910 -0.0014 -0.0030 -0.0026 120  TRP A CG    
24   C CD1   . TRP A 13  ? 0.0865 0.0952 0.0938 -0.0026 -0.0023 -0.0028 120  TRP A CD1   
25   C CD2   . TRP A 13  ? 0.1017 0.0985 0.1012 -0.0014 -0.0021 0.0022  120  TRP A CD2   
26   N NE1   . TRP A 13  ? 0.1062 0.0999 0.1039 -0.0005 -0.0016 -0.0002 120  TRP A NE1   
27   C CE2   . TRP A 13  ? 0.1140 0.1078 0.1088 0.0000  0.0027  -0.0008 120  TRP A CE2   
28   C CE3   . TRP A 13  ? 0.1090 0.1117 0.1093 -0.0002 0.0006  -0.0020 120  TRP A CE3   
29   C CZ2   . TRP A 13  ? 0.1295 0.1159 0.1175 0.0000  0.0020  0.0003  120  TRP A CZ2   
30   C CZ3   . TRP A 13  ? 0.1260 0.1180 0.1205 -0.0007 0.0023  0.0005  120  TRP A CZ3   
31   C CH2   . TRP A 13  ? 0.1287 0.1220 0.1225 0.0008  0.0022  0.0008  120  TRP A CH2   
32   N N     . ILE A 14  ? 0.0761 0.0769 0.0718 -0.0001 -0.0011 -0.0008 121  ILE A N     
33   C CA    . ILE A 14  ? 0.0773 0.0784 0.0736 0.0000  -0.0007 0.0001  121  ILE A CA    
34   C C     . ILE A 14  ? 0.0740 0.0762 0.0700 -0.0004 -0.0014 -0.0006 121  ILE A C     
35   O O     . ILE A 14  ? 0.0689 0.0785 0.0631 -0.0008 -0.0051 -0.0011 121  ILE A O     
36   C CB    . ILE A 14  ? 0.0797 0.0814 0.0800 0.0006  0.0001  -0.0006 121  ILE A CB    
37   C CG1   . ILE A 14  ? 0.0874 0.0888 0.0818 0.0013  -0.0014 -0.0001 121  ILE A CG1   
38   C CG2   . ILE A 14  ? 0.0814 0.0842 0.0813 -0.0012 -0.0015 -0.0025 121  ILE A CG2   
39   C CD1   . ILE A 14  ? 0.0944 0.0975 0.0986 0.0020  -0.0011 0.0014  121  ILE A CD1   
40   N N     . TYR A 15  ? 0.0723 0.0746 0.0697 0.0003  -0.0001 0.0011  122  TYR A N     
41   C CA    . TYR A 15  ? 0.0721 0.0736 0.0687 0.0000  -0.0022 0.0000  122  TYR A CA    
42   C C     . TYR A 15  ? 0.0716 0.0743 0.0675 -0.0001 -0.0026 -0.0003 122  TYR A C     
43   O O     . TYR A 15  ? 0.0802 0.0794 0.0687 0.0023  -0.0024 0.0015  122  TYR A O     
44   C CB    . TYR A 15  ? 0.0722 0.0749 0.0691 0.0002  -0.0009 -0.0006 122  TYR A CB    
45   C CG    . TYR A 15  ? 0.0763 0.0743 0.0724 0.0000  -0.0028 -0.0004 122  TYR A CG    
46   C CD1   . TYR A 15  ? 0.0755 0.0778 0.0770 -0.0001 -0.0020 0.0007  122  TYR A CD1   
47   C CD2   . TYR A 15  ? 0.0722 0.0744 0.0730 -0.0047 -0.0049 -0.0036 122  TYR A CD2   
48   C CE1   . TYR A 15  ? 0.0772 0.0812 0.0880 -0.0007 -0.0013 -0.0028 122  TYR A CE1   
49   C CE2   . TYR A 15  ? 0.0820 0.0842 0.0861 0.0003  -0.0019 -0.0002 122  TYR A CE2   
50   C CZ    . TYR A 15  ? 0.0852 0.0887 0.0825 -0.0023 -0.0035 -0.0019 122  TYR A CZ    
51   O OH    . TYR A 15  ? 0.1173 0.1058 0.1226 0.0039  -0.0018 -0.0055 122  TYR A OH    
52   N N     . TYR A 16  ? 0.0720 0.0747 0.0708 -0.0005 -0.0024 0.0000  123  TYR A N     
53   C CA    . TYR A 16  ? 0.0765 0.0763 0.0783 -0.0003 0.0004  -0.0003 123  TYR A CA    
54   C C     . TYR A 16  ? 0.0704 0.0694 0.0690 0.0001  0.0002  -0.0001 123  TYR A C     
55   O O     . TYR A 16  ? 0.0651 0.0702 0.0713 -0.0008 0.0007  -0.0006 123  TYR A O     
56   C CB    . TYR A 16  ? 0.0807 0.0796 0.0838 -0.0003 0.0020  0.0006  123  TYR A CB    
57   C CG    . TYR A 16  ? 0.0924 0.0957 0.0919 -0.0006 0.0001  -0.0014 123  TYR A CG    
58   C CD1   . TYR A 16  ? 0.1089 0.1029 0.1106 -0.0013 0.0019  -0.0020 123  TYR A CD1   
59   C CD2   . TYR A 16  ? 0.1057 0.1045 0.1061 0.0011  -0.0004 0.0009  123  TYR A CD2   
60   C CE1   . TYR A 16  ? 0.1082 0.1107 0.1071 -0.0015 -0.0017 -0.0003 123  TYR A CE1   
61   C CE2   . TYR A 16  ? 0.1103 0.1133 0.1126 -0.0003 -0.0013 0.0007  123  TYR A CE2   
62   C CZ    . TYR A 16  ? 0.1217 0.1176 0.1205 0.0000  0.0006  -0.0003 123  TYR A CZ    
63   O OH    . TYR A 16  ? 0.1359 0.1478 0.1382 -0.0037 -0.0051 0.0027  123  TYR A OH    
64   N N     . PRO A 17  ? 0.0633 0.0649 0.0631 -0.0004 -0.0003 0.0000  124  PRO A N     
65   C CA    . PRO A 17  ? 0.0578 0.0582 0.0570 -0.0004 0.0003  0.0006  124  PRO A CA    
66   C C     . PRO A 17  ? 0.0490 0.0512 0.0509 -0.0008 -0.0005 -0.0007 124  PRO A C     
67   O O     . PRO A 17  ? 0.0457 0.0501 0.0534 0.0005  -0.0005 0.0021  124  PRO A O     
68   C CB    . PRO A 17  ? 0.0597 0.0592 0.0564 -0.0005 0.0004  -0.0007 124  PRO A CB    
69   C CG    . PRO A 17  ? 0.0657 0.0654 0.0675 -0.0004 0.0017  0.0005  124  PRO A CG    
70   C CD    . PRO A 17  ? 0.0664 0.0658 0.0617 -0.0013 0.0013  -0.0011 124  PRO A CD    
71   N N     . ASP A 18  ? 0.0449 0.0448 0.0453 0.0001  0.0006  -0.0005 125  ASP A N     
72   C CA    . ASP A 18  ? 0.0379 0.0400 0.0389 -0.0004 -0.0013 -0.0002 125  ASP A CA    
73   C C     . ASP A 18  ? 0.0390 0.0408 0.0421 -0.0012 0.0001  -0.0005 125  ASP A C     
74   O O     . ASP A 18  ? 0.0323 0.0390 0.0418 -0.0014 -0.0032 0.0020  125  ASP A O     
75   C CB    . ASP A 18  ? 0.0314 0.0367 0.0317 0.0004  -0.0038 0.0002  125  ASP A CB    
76   C CG    . ASP A 18  ? 0.0372 0.0360 0.0350 -0.0014 -0.0009 -0.0015 125  ASP A CG    
77   O OD1   . ASP A 18  ? 0.0323 0.0414 0.0264 -0.0015 0.0028  -0.0008 125  ASP A OD1   
78   O OD2   . ASP A 18  ? 0.0294 0.0409 0.0445 0.0016  0.0003  0.0012  125  ASP A OD2   
79   N N     . GLY A 19  ? 0.0463 0.0448 0.0493 -0.0009 0.0032  0.0006  126  GLY A N     
80   C CA    . GLY A 19  ? 0.0427 0.0472 0.0464 0.0016  -0.0008 0.0021  126  GLY A CA    
81   C C     . GLY A 19  ? 0.0459 0.0490 0.0501 0.0008  0.0011  0.0008  126  GLY A C     
82   O O     . GLY A 19  ? 0.0354 0.0497 0.0497 0.0034  -0.0016 0.0028  126  GLY A O     
83   N N     . GLY A 20  ? 0.0457 0.0517 0.0500 0.0012  -0.0021 0.0024  127  GLY A N     
84   C CA    . GLY A 20  ? 0.0517 0.0546 0.0536 0.0015  -0.0009 0.0007  127  GLY A CA    
85   C C     . GLY A 20  ? 0.0558 0.0594 0.0599 0.0000  -0.0003 0.0008  127  GLY A C     
86   O O     . GLY A 20  ? 0.0528 0.0574 0.0599 -0.0010 -0.0019 0.0007  127  GLY A O     
87   N N     . SER A 21  ? 0.0670 0.0683 0.0686 0.0007  0.0013  0.0003  128  SER A N     
88   C CA    . SER A 21  ? 0.0731 0.0746 0.0755 0.0000  0.0006  0.0006  128  SER A CA    
89   C C     . SER A 21  ? 0.0779 0.0782 0.0781 0.0006  -0.0001 0.0005  128  SER A C     
90   O O     . SER A 21  ? 0.0691 0.0773 0.0693 0.0029  -0.0032 0.0012  128  SER A O     
91   C CB    . SER A 21  ? 0.0791 0.0777 0.0848 0.0023  0.0046  0.0021  128  SER A CB    
92   O OG    . SER A 21  ? 0.0754 0.0839 0.0882 0.0045  0.0033  0.0044  128  SER A OG    
93   N N     . LEU A 22  ? 0.0860 0.0863 0.0814 -0.0003 -0.0013 0.0006  129  LEU A N     
94   C CA    . LEU A 22  ? 0.0954 0.0939 0.0920 -0.0009 -0.0010 -0.0012 129  LEU A CA    
95   C C     . LEU A 22  ? 0.0956 0.0931 0.0889 -0.0008 -0.0013 -0.0011 129  LEU A C     
96   O O     . LEU A 22  ? 0.0953 0.0900 0.0811 -0.0012 -0.0015 -0.0037 129  LEU A O     
97   C CB    . LEU A 22  ? 0.1028 0.0978 0.0950 0.0000  -0.0030 -0.0004 129  LEU A CB    
98   C CG    . LEU A 22  ? 0.1236 0.1298 0.1305 0.0012  -0.0001 0.0010  129  LEU A CG    
99   C CD1   . LEU A 22  ? 0.1516 0.1498 0.1474 0.0014  0.0059  0.0022  129  LEU A CD1   
100  C CD2   . LEU A 22  ? 0.1376 0.1367 0.1419 0.0017  -0.0001 0.0002  129  LEU A CD2   
101  N N     . VAL A 23  ? 0.0973 0.0936 0.0922 0.0002  -0.0012 0.0011  130  VAL A N     
102  C CA    . VAL A 23  ? 0.0979 0.0957 0.0956 -0.0001 -0.0006 0.0000  130  VAL A CA    
103  C C     . VAL A 23  ? 0.1011 0.0985 0.0980 -0.0010 0.0000  -0.0010 130  VAL A C     
104  O O     . VAL A 23  ? 0.1095 0.1011 0.1033 -0.0013 0.0035  0.0001  130  VAL A O     
105  C CB    . VAL A 23  ? 0.0958 0.0999 0.1010 -0.0009 -0.0015 -0.0023 130  VAL A CB    
106  C CG1   . VAL A 23  ? 0.0936 0.0967 0.0932 -0.0014 -0.0034 -0.0023 130  VAL A CG1   
107  C CG2   . VAL A 23  ? 0.1165 0.1105 0.1098 0.0031  0.0010  0.0007  130  VAL A CG2   
108  N N     . GLY A 24  ? 0.1012 0.0989 0.0975 -0.0016 0.0001  -0.0025 131  GLY A N     
109  C CA    . GLY A 24  ? 0.0977 0.0999 0.0955 -0.0005 -0.0027 -0.0004 131  GLY A CA    
110  C C     . GLY A 24  ? 0.0994 0.1031 0.1016 0.0003  -0.0016 0.0003  131  GLY A C     
111  O O     . GLY A 24  ? 0.0853 0.0952 0.0807 0.0032  -0.0072 0.0008  131  GLY A O     
112  N N     . GLU A 25  ? 0.1064 0.1114 0.1072 0.0000  -0.0034 -0.0011 132  GLU A N     
113  C CA    . GLU A 25  ? 0.1224 0.1251 0.1232 -0.0008 0.0002  0.0007  132  GLU A CA    
114  C C     . GLU A 25  ? 0.1243 0.1263 0.1247 0.0005  -0.0003 0.0004  132  GLU A C     
115  O O     . GLU A 25  ? 0.1274 0.1323 0.1325 0.0002  0.0005  0.0014  132  GLU A O     
116  C CB    . GLU A 25  ? 0.1352 0.1318 0.1362 -0.0025 0.0014  -0.0006 132  GLU A CB    
117  C CG    . GLU A 25  ? 0.1569 0.1578 0.1702 0.0014  0.0051  0.0000  132  GLU A CG    
118  C CD    . GLU A 25  ? 0.1967 0.1864 0.1828 -0.0030 -0.0007 -0.0018 132  GLU A CD    
119  O OE1   . GLU A 25  ? 0.2095 0.2135 0.2364 0.0027  0.0025  0.0010  132  GLU A OE1   
120  O OE2   . GLU A 25  ? 0.2143 0.2079 0.2159 0.0030  0.0036  -0.0009 132  GLU A OE2   
121  N N     . VAL A 26  ? 0.1262 0.1288 0.1276 0.0006  -0.0006 0.0007  133  VAL A N     
122  C CA    . VAL A 26  ? 0.1293 0.1314 0.1287 0.0007  -0.0009 -0.0003 133  VAL A CA    
123  C C     . VAL A 26  ? 0.1320 0.1345 0.1292 0.0021  -0.0011 0.0008  133  VAL A C     
124  O O     . VAL A 26  ? 0.1127 0.1272 0.1118 0.0037  -0.0089 0.0032  133  VAL A O     
125  C CB    . VAL A 26  ? 0.1342 0.1329 0.1325 0.0015  0.0008  0.0013  133  VAL A CB    
126  C CG1   . VAL A 26  ? 0.1370 0.1372 0.1331 0.0000  -0.0016 -0.0006 133  VAL A CG1   
127  C CG2   . VAL A 26  ? 0.1349 0.1348 0.1358 0.0015  0.0004  0.0018  133  VAL A CG2   
128  N N     . ASN A 27  ? 0.1376 0.1425 0.1354 0.0006  -0.0028 -0.0005 134  ASN A N     
129  C CA    . ASN A 27  ? 0.1519 0.1534 0.1473 0.0010  -0.0013 0.0000  134  ASN A CA    
130  C C     . ASN A 27  ? 0.1565 0.1586 0.1556 0.0000  -0.0003 0.0004  134  ASN A C     
131  O O     . ASN A 27  ? 0.1517 0.1565 0.1442 0.0023  -0.0049 0.0011  134  ASN A O     
132  C CB    . ASN A 27  ? 0.1508 0.1570 0.1439 0.0013  -0.0023 0.0003  134  ASN A CB    
133  C CG    A ASN A 27  ? 0.1728 0.1740 0.1754 -0.0043 0.0002  0.0003  134  ASN A CG    
134  C CG    B ASN A 27  ? 0.1638 0.1620 0.1536 0.0018  -0.0027 0.0015  134  ASN A CG    
135  O OD1   A ASN A 27  ? 0.1953 0.1881 0.2053 0.0013  0.0053  -0.0026 134  ASN A OD1   
136  O OD1   B ASN A 27  ? 0.1744 0.1702 0.1726 -0.0017 0.0009  0.0007  134  ASN A OD1   
137  N ND2   A ASN A 27  ? 0.1828 0.1844 0.1863 0.0041  0.0017  0.0049  134  ASN A ND2   
138  N ND2   B ASN A 27  ? 0.1714 0.1718 0.1618 0.0020  0.0013  0.0000  134  ASN A ND2   
139  N N     . GLU A 28  ? 0.1692 0.1701 0.1650 0.0004  -0.0017 -0.0007 135  GLU A N     
140  C CA    . GLU A 28  ? 0.1785 0.1786 0.1791 -0.0003 0.0007  0.0007  135  GLU A CA    
141  C C     . GLU A 28  ? 0.1829 0.1813 0.1831 0.0000  0.0005  -0.0001 135  GLU A C     
142  O O     . GLU A 28  ? 0.1883 0.1846 0.1924 -0.0013 0.0028  -0.0009 135  GLU A O     
143  C CB    . GLU A 28  ? 0.1842 0.1822 0.1823 -0.0002 0.0000  -0.0003 135  GLU A CB    
144  C CG    . GLU A 28  ? 0.1913 0.1942 0.2011 0.0004  0.0010  0.0011  135  GLU A CG    
145  C CD    . GLU A 28  ? 0.2141 0.2130 0.2163 -0.0004 -0.0003 -0.0024 135  GLU A CD    
146  O OE1   . GLU A 28  ? 0.2212 0.2236 0.2291 0.0005  0.0042  -0.0011 135  GLU A OE1   
147  O OE2   . GLU A 28  ? 0.2170 0.2218 0.2249 0.0007  -0.0030 -0.0008 135  GLU A OE2   
148  N N     . ASP A 29  ? 0.1833 0.1838 0.1845 0.0000  0.0004  0.0004  136  ASP A N     
149  C CA    . ASP A 29  ? 0.1849 0.1849 0.1864 0.0000  0.0000  0.0000  136  ASP A CA    
150  C C     . ASP A 29  ? 0.1839 0.1827 0.1854 0.0003  0.0008  0.0006  136  ASP A C     
151  O O     . ASP A 29  ? 0.1883 0.1848 0.1923 0.0002  0.0023  0.0001  136  ASP A O     
152  C CB    . ASP A 29  ? 0.1871 0.1872 0.1902 0.0002  0.0009  0.0002  136  ASP A CB    
153  C CG    . ASP A 29  ? 0.1929 0.1928 0.1942 -0.0006 -0.0006 -0.0006 136  ASP A CG    
154  O OD1   . ASP A 29  ? 0.1992 0.2005 0.2004 -0.0009 0.0024  0.0012  136  ASP A OD1   
155  O OD2   . ASP A 29  ? 0.1945 0.1979 0.2055 0.0024  -0.0003 0.0019  136  ASP A OD2   
156  N N     . GLY A 30  ? 0.1776 0.1785 0.1797 -0.0005 -0.0004 0.0000  137  GLY A N     
157  C CA    . GLY A 30  ? 0.1733 0.1736 0.1733 0.0000  0.0005  0.0001  137  GLY A CA    
158  C C     . GLY A 30  ? 0.1670 0.1676 0.1692 -0.0005 -0.0002 0.0000  137  GLY A C     
159  O O     . GLY A 30  ? 0.1702 0.1700 0.1748 -0.0007 -0.0001 -0.0023 137  GLY A O     
160  N N     . GLU A 31  ? 0.1603 0.1598 0.1568 0.0000  -0.0008 0.0000  138  GLU A N     
161  C CA    . GLU A 31  ? 0.1540 0.1530 0.1538 -0.0002 -0.0003 -0.0006 138  GLU A CA    
162  C C     . GLU A 31  ? 0.1445 0.1453 0.1420 -0.0001 0.0000  -0.0002 138  GLU A C     
163  O O     . GLU A 31  ? 0.1427 0.1417 0.1347 -0.0009 -0.0008 0.0007  138  GLU A O     
164  C CB    . GLU A 31  ? 0.1552 0.1563 0.1520 0.0002  -0.0010 -0.0004 138  GLU A CB    
165  C CG    . GLU A 31  ? 0.1683 0.1626 0.1668 0.0003  0.0013  -0.0011 138  GLU A CG    
166  C CD    . GLU A 31  ? 0.1755 0.1839 0.1843 -0.0006 -0.0021 0.0000  138  GLU A CD    
167  O OE1   . GLU A 31  ? 0.1869 0.1866 0.1982 -0.0005 -0.0007 -0.0006 138  GLU A OE1   
168  O OE2   . GLU A 31  ? 0.1981 0.1908 0.2029 0.0007  0.0018  -0.0002 138  GLU A OE2   
169  N N     . MET A 32  ? 0.1350 0.1355 0.1366 -0.0008 -0.0006 -0.0015 139  MET A N     
170  C CA    . MET A 32  ? 0.1303 0.1342 0.1286 -0.0019 -0.0027 -0.0007 139  MET A CA    
171  C C     . MET A 32  ? 0.1202 0.1189 0.1119 -0.0008 -0.0002 -0.0018 139  MET A C     
172  O O     . MET A 32  ? 0.1090 0.1090 0.0955 -0.0047 -0.0062 -0.0061 139  MET A O     
173  C CB    . MET A 32  ? 0.1477 0.1435 0.1377 0.0001  0.0006  -0.0023 139  MET A CB    
174  C CG    . MET A 32  ? 0.1763 0.1833 0.1759 -0.0100 -0.0049 0.0016  139  MET A CG    
175  S SD    . MET A 32  ? 0.2549 0.2531 0.2861 0.0143  0.0154  0.0014  139  MET A SD    
176  C CE    . MET A 32  ? 0.2613 0.2611 0.2602 0.0017  -0.0001 -0.0015 139  MET A CE    
177  N N     . THR A 33  ? 0.1058 0.1054 0.1003 -0.0015 -0.0012 -0.0006 140  THR A N     
178  C CA    . THR A 33  ? 0.0969 0.0983 0.0955 0.0000  -0.0021 0.0011  140  THR A CA    
179  C C     . THR A 33  ? 0.0927 0.0966 0.0930 -0.0008 -0.0028 0.0000  140  THR A C     
180  O O     . THR A 33  ? 0.0923 0.0971 0.0948 -0.0014 -0.0029 -0.0012 140  THR A O     
181  C CB    . THR A 33  ? 0.0958 0.0960 0.0924 0.0000  -0.0018 0.0006  140  THR A CB    
182  O OG1   . THR A 33  ? 0.0952 0.0926 0.0946 -0.0004 -0.0039 0.0042  140  THR A OG1   
183  C CG2   . THR A 33  ? 0.0960 0.0948 0.0939 -0.0019 0.0000  0.0007  140  THR A CG2   
184  N N     . GLY A 34  ? 0.0947 0.0973 0.0970 -0.0001 -0.0007 0.0000  141  GLY A N     
185  C CA    . GLY A 34  ? 0.0957 0.0966 0.0951 0.0004  -0.0001 -0.0001 141  GLY A CA    
186  C C     . GLY A 34  ? 0.0973 0.0973 0.0977 -0.0007 0.0004  0.0000  141  GLY A C     
187  O O     . GLY A 34  ? 0.0945 0.0940 0.0998 0.0000  0.0020  -0.0014 141  GLY A O     
188  N N     . GLU A 35  ? 0.0984 0.0980 0.0967 -0.0013 -0.0006 -0.0025 142  GLU A N     
189  C CA    . GLU A 35  ? 0.1023 0.1023 0.1018 0.0000  -0.0010 -0.0005 142  GLU A CA    
190  C C     . GLU A 35  ? 0.1014 0.0994 0.0996 -0.0003 0.0005  -0.0004 142  GLU A C     
191  O O     . GLU A 35  ? 0.0991 0.0974 0.0925 0.0007  -0.0031 0.0001  142  GLU A O     
192  C CB    . GLU A 35  ? 0.1112 0.1058 0.1095 -0.0019 0.0019  -0.0022 142  GLU A CB    
193  C CG    . GLU A 35  ? 0.1326 0.1311 0.1343 0.0027  -0.0040 0.0010  142  GLU A CG    
194  C CD    . GLU A 35  ? 0.1579 0.1585 0.1656 -0.0016 0.0063  -0.0002 142  GLU A CD    
195  O OE1   . GLU A 35  ? 0.1778 0.1845 0.1811 0.0026  0.0017  0.0033  142  GLU A OE1   
196  O OE2   . GLU A 35  ? 0.1800 0.1915 0.1960 0.0034  -0.0018 0.0030  142  GLU A OE2   
197  N N     . LYS A 36  ? 0.0956 0.0971 0.0951 -0.0002 -0.0019 -0.0013 143  LYS A N     
198  C CA    . LYS A 36  ? 0.0956 0.0954 0.0960 0.0008  -0.0012 0.0011  143  LYS A CA    
199  C C     . LYS A 36  ? 0.0939 0.0942 0.0948 0.0007  -0.0019 -0.0001 143  LYS A C     
200  O O     . LYS A 36  ? 0.0934 0.0962 0.1063 0.0026  0.0003  0.0005  143  LYS A O     
201  C CB    . LYS A 36  ? 0.0990 0.0970 0.0937 0.0014  -0.0002 0.0011  143  LYS A CB    
202  C CG    . LYS A 36  ? 0.0974 0.1000 0.0969 -0.0009 -0.0051 0.0021  143  LYS A CG    
203  C CD    . LYS A 36  ? 0.1107 0.1166 0.1104 0.0015  -0.0013 -0.0001 143  LYS A CD    
204  C CE    . LYS A 36  ? 0.1346 0.1277 0.1370 0.0012  0.0001  0.0018  143  LYS A CE    
205  N NZ    . LYS A 36  ? 0.1542 0.1477 0.1471 0.0031  0.0062  -0.0001 143  LYS A NZ    
206  N N     . ILE A 37  ? 0.0897 0.0927 0.0928 0.0009  -0.0026 0.0000  144  ILE A N     
207  C CA    . ILE A 37  ? 0.0920 0.0950 0.0928 -0.0012 -0.0018 -0.0011 144  ILE A CA    
208  C C     . ILE A 37  ? 0.0877 0.0880 0.0900 -0.0016 0.0000  -0.0019 144  ILE A C     
209  O O     . ILE A 37  ? 0.0849 0.0846 0.0855 -0.0020 -0.0001 -0.0005 144  ILE A O     
210  C CB    . ILE A 37  ? 0.1047 0.0985 0.0988 -0.0003 0.0002  -0.0010 144  ILE A CB    
211  C CG1   . ILE A 37  ? 0.1275 0.1204 0.1130 0.0005  0.0038  0.0009  144  ILE A CG1   
212  C CG2   . ILE A 37  ? 0.1036 0.1009 0.0985 -0.0007 -0.0021 0.0014  144  ILE A CG2   
213  C CD1   . ILE A 37  ? 0.1359 0.1346 0.1377 0.0024  0.0042  0.0005  144  ILE A CD1   
214  N N     . ALA A 38  ? 0.0817 0.0824 0.0847 -0.0002 -0.0025 -0.0005 145  ALA A N     
215  C CA    . ALA A 38  ? 0.0794 0.0799 0.0830 -0.0007 -0.0004 -0.0012 145  ALA A CA    
216  C C     . ALA A 38  ? 0.0783 0.0779 0.0798 0.0001  0.0003  -0.0001 145  ALA A C     
217  O O     . ALA A 38  ? 0.0807 0.0758 0.0815 -0.0010 -0.0021 -0.0022 145  ALA A O     
218  C CB    . ALA A 38  ? 0.0851 0.0804 0.0836 0.0017  0.0027  0.0017  145  ALA A CB    
219  N N     . TYR A 39  ? 0.0724 0.0730 0.0760 -0.0001 -0.0017 -0.0001 146  TYR A N     
220  C CA    . TYR A 39  ? 0.0721 0.0732 0.0732 0.0004  0.0000  0.0000  146  TYR A CA    
221  C C     . TYR A 39  ? 0.0705 0.0718 0.0736 0.0003  -0.0007 0.0004  146  TYR A C     
222  O O     . TYR A 39  ? 0.0755 0.0756 0.0755 -0.0011 0.0013  -0.0006 146  TYR A O     
223  C CB    . TYR A 39  ? 0.0715 0.0707 0.0723 0.0001  -0.0009 0.0002  146  TYR A CB    
224  C CG    . TYR A 39  ? 0.0664 0.0652 0.0647 -0.0005 -0.0004 0.0002  146  TYR A CG    
225  C CD1   . TYR A 39  ? 0.0581 0.0601 0.0528 -0.0001 0.0009  -0.0008 146  TYR A CD1   
226  C CD2   . TYR A 39  ? 0.0585 0.0613 0.0629 0.0015  0.0000  -0.0012 146  TYR A CD2   
227  C CE1   . TYR A 39  ? 0.0512 0.0585 0.0522 -0.0012 -0.0020 -0.0014 146  TYR A CE1   
228  C CE2   . TYR A 39  ? 0.0511 0.0566 0.0600 0.0006  -0.0028 0.0000  146  TYR A CE2   
229  C CZ    . TYR A 39  ? 0.0534 0.0514 0.0527 0.0000  -0.0005 -0.0013 146  TYR A CZ    
230  O OH    . TYR A 39  ? 0.0447 0.0527 0.0347 -0.0002 -0.0036 0.0022  146  TYR A OH    
231  N N     . VAL A 40  ? 0.0707 0.0707 0.0696 -0.0003 0.0007  -0.0008 147  VAL A N     
232  C CA    . VAL A 40  ? 0.0658 0.0668 0.0678 0.0001  0.0000  -0.0011 147  VAL A CA    
233  C C     . VAL A 40  ? 0.0595 0.0623 0.0606 0.0010  0.0001  0.0002  147  VAL A C     
234  O O     . VAL A 40  ? 0.0498 0.0580 0.0542 0.0031  -0.0019 -0.0021 147  VAL A O     
235  C CB    . VAL A 40  ? 0.0725 0.0701 0.0702 0.0009  0.0027  0.0000  147  VAL A CB    
236  C CG1   . VAL A 40  ? 0.0686 0.0677 0.0689 -0.0002 0.0002  -0.0001 147  VAL A CG1   
237  C CG2   . VAL A 40  ? 0.0802 0.0742 0.0751 -0.0004 0.0024  -0.0011 147  VAL A CG2   
238  N N     . TYR A 41  ? 0.0539 0.0590 0.0572 0.0009  -0.0001 -0.0007 148  TYR A N     
239  C CA    . TYR A 41  ? 0.0499 0.0541 0.0528 0.0000  -0.0001 -0.0006 148  TYR A CA    
240  C C     . TYR A 41  ? 0.0484 0.0509 0.0499 0.0008  -0.0003 -0.0002 148  TYR A C     
241  O O     . TYR A 41  ? 0.0507 0.0542 0.0529 -0.0014 0.0019  -0.0024 148  TYR A O     
242  C CB    . TYR A 41  ? 0.0458 0.0521 0.0517 0.0011  -0.0009 0.0002  148  TYR A CB    
243  C CG    . TYR A 41  ? 0.0459 0.0490 0.0408 -0.0004 -0.0017 -0.0033 148  TYR A CG    
244  C CD1   . TYR A 41  ? 0.0435 0.0433 0.0519 0.0015  -0.0018 -0.0004 148  TYR A CD1   
245  C CD2   . TYR A 41  ? 0.0354 0.0419 0.0372 0.0015  -0.0045 0.0000  148  TYR A CD2   
246  C CE1   . TYR A 41  ? 0.0535 0.0505 0.0566 -0.0019 0.0011  -0.0027 148  TYR A CE1   
247  C CE2   . TYR A 41  ? 0.0425 0.0446 0.0427 -0.0026 -0.0005 -0.0001 148  TYR A CE2   
248  C CZ    . TYR A 41  ? 0.0498 0.0471 0.0469 -0.0004 -0.0017 -0.0007 148  TYR A CZ    
249  O OH    . TYR A 41  ? 0.0528 0.0537 0.0600 0.0035  -0.0013 0.0032  148  TYR A OH    
250  N N     . PRO A 42  ? 0.0416 0.0467 0.0452 0.0002  -0.0018 -0.0002 149  PRO A N     
251  C CA    . PRO A 42  ? 0.0468 0.0470 0.0471 -0.0009 0.0003  -0.0004 149  PRO A CA    
252  C C     . PRO A 42  ? 0.0458 0.0476 0.0479 -0.0012 -0.0001 -0.0006 149  PRO A C     
253  O O     . PRO A 42  ? 0.0364 0.0427 0.0404 -0.0018 -0.0042 -0.0025 149  PRO A O     
254  C CB    . PRO A 42  ? 0.0434 0.0461 0.0482 -0.0031 0.0000  -0.0037 149  PRO A CB    
255  C CG    . PRO A 42  ? 0.0409 0.0421 0.0345 0.0016  -0.0030 0.0036  149  PRO A CG    
256  C CD    . PRO A 42  ? 0.0458 0.0432 0.0383 0.0001  -0.0017 0.0019  149  PRO A CD    
257  N N     . ASP A 43  ? 0.0512 0.0508 0.0538 -0.0009 0.0004  0.0000  150  ASP A N     
258  C CA    . ASP A 43  ? 0.0505 0.0532 0.0541 0.0002  -0.0011 -0.0002 150  ASP A CA    
259  C C     . ASP A 43  ? 0.0551 0.0571 0.0612 0.0006  0.0011  0.0006  150  ASP A C     
260  O O     . ASP A 43  ? 0.0450 0.0571 0.0618 0.0016  -0.0026 0.0016  150  ASP A O     
261  C CB    . ASP A 43  ? 0.0531 0.0527 0.0521 0.0016  -0.0009 0.0000  150  ASP A CB    
262  C CG    . ASP A 43  ? 0.0588 0.0548 0.0573 0.0003  0.0003  0.0000  150  ASP A CG    
263  O OD1   . ASP A 43  ? 0.0515 0.0550 0.0458 0.0013  -0.0037 -0.0004 150  ASP A OD1   
264  O OD2   . ASP A 43  ? 0.0717 0.0577 0.0544 0.0017  -0.0001 0.0012  150  ASP A OD2   
265  N N     . GLU A 44  ? 0.0541 0.0612 0.0637 -0.0002 -0.0035 -0.0008 151  GLU A N     
266  C CA    . GLU A 44  ? 0.0679 0.0719 0.0695 0.0006  -0.0016 0.0004  151  GLU A CA    
267  C C     . GLU A 44  ? 0.0708 0.0731 0.0728 0.0000  0.0000  0.0000  151  GLU A C     
268  O O     . GLU A 44  ? 0.0703 0.0749 0.0803 -0.0029 0.0025  -0.0009 151  GLU A O     
269  C CB    . GLU A 44  ? 0.0778 0.0796 0.0778 -0.0011 0.0009  0.0000  151  GLU A CB    
270  C CG    . GLU A 44  ? 0.1079 0.0949 0.1003 0.0014  0.0026  0.0001  151  GLU A CG    
271  C CD    . GLU A 44  ? 0.1240 0.1231 0.1289 -0.0040 0.0003  -0.0036 151  GLU A CD    
272  O OE1   . GLU A 44  ? 0.1335 0.1414 0.1446 0.0010  -0.0030 0.0023  151  GLU A OE1   
273  O OE2   . GLU A 44  ? 0.1597 0.1530 0.1502 -0.0062 0.0059  0.0000  151  GLU A OE2   
274  N N     . ARG A 45  ? 0.0720 0.0763 0.0764 0.0007  0.0003  0.0008  152  ARG A N     
275  C CA    . ARG A 45  ? 0.0756 0.0778 0.0778 0.0000  -0.0008 0.0000  152  ARG A CA    
276  C C     . ARG A 45  ? 0.0751 0.0747 0.0729 0.0000  0.0006  0.0000  152  ARG A C     
277  O O     . ARG A 45  ? 0.0761 0.0754 0.0810 -0.0030 0.0005  -0.0047 152  ARG A O     
278  C CB    . ARG A 45  ? 0.0859 0.0863 0.0805 0.0004  0.0014  0.0014  152  ARG A CB    
279  C CG    . ARG A 45  ? 0.0997 0.0948 0.0986 0.0012  0.0006  -0.0004 152  ARG A CG    
280  C CD    . ARG A 45  ? 0.1283 0.1278 0.1125 0.0000  -0.0023 0.0006  152  ARG A CD    
281  N NE    . ARG A 45  ? 0.1600 0.1440 0.1404 -0.0017 -0.0006 0.0002  152  ARG A NE    
282  C CZ    . ARG A 45  ? 0.1723 0.1708 0.1696 0.0039  0.0003  -0.0005 152  ARG A CZ    
283  N NH1   . ARG A 45  ? 0.1884 0.1859 0.1908 -0.0022 0.0025  -0.0009 152  ARG A NH1   
284  N NH2   . ARG A 45  ? 0.1828 0.1786 0.1782 -0.0029 0.0013  -0.0013 152  ARG A NH2   
285  N N     . THR A 46  ? 0.0726 0.0702 0.0721 -0.0004 0.0000  -0.0008 153  THR A N     
286  C CA    . THR A 46  ? 0.0659 0.0672 0.0669 -0.0004 -0.0007 0.0006  153  THR A CA    
287  C C     . THR A 46  ? 0.0642 0.0642 0.0633 -0.0006 0.0000  0.0001  153  THR A C     
288  O O     . THR A 46  ? 0.0518 0.0603 0.0529 -0.0021 -0.0026 -0.0002 153  THR A O     
289  C CB    . THR A 46  ? 0.0675 0.0693 0.0689 -0.0005 -0.0021 -0.0023 153  THR A CB    
290  O OG1   . THR A 46  ? 0.0817 0.0724 0.0746 0.0006  0.0023  0.0023  153  THR A OG1   
291  C CG2   . THR A 46  ? 0.0734 0.0729 0.0782 -0.0018 0.0022  -0.0010 153  THR A CG2   
292  N N     . ALA A 47  ? 0.0570 0.0624 0.0613 -0.0008 -0.0005 0.0012  154  ALA A N     
293  C CA    . ALA A 47  ? 0.0596 0.0618 0.0627 -0.0006 -0.0003 0.0008  154  ALA A CA    
294  C C     . ALA A 47  ? 0.0600 0.0630 0.0632 -0.0001 -0.0007 0.0005  154  ALA A C     
295  O O     . ALA A 47  ? 0.0611 0.0646 0.0640 -0.0011 0.0002  0.0001  154  ALA A O     
296  C CB    . ALA A 47  ? 0.0558 0.0603 0.0619 0.0006  -0.0016 0.0009  154  ALA A CB    
297  N N     . LEU A 48  ? 0.0617 0.0649 0.0650 0.0006  -0.0012 0.0014  155  LEU A N     
298  C CA    . LEU A 48  ? 0.0614 0.0639 0.0628 -0.0006 -0.0018 0.0000  155  LEU A CA    
299  C C     . LEU A 48  ? 0.0641 0.0684 0.0662 0.0002  -0.0024 0.0013  155  LEU A C     
300  O O     . LEU A 48  ? 0.0654 0.0706 0.0704 -0.0004 -0.0051 -0.0008 155  LEU A O     
301  C CB    . LEU A 48  ? 0.0571 0.0605 0.0569 -0.0001 -0.0031 0.0007  155  LEU A CB    
302  C CG    . LEU A 48  ? 0.0524 0.0554 0.0556 -0.0030 -0.0033 -0.0014 155  LEU A CG    
303  C CD1   . LEU A 48  ? 0.0599 0.0560 0.0519 -0.0024 -0.0021 -0.0033 155  LEU A CD1   
304  C CD2   . LEU A 48  ? 0.0510 0.0546 0.0435 -0.0007 -0.0027 -0.0011 155  LEU A CD2   
305  N N     . TYR A 49  ? 0.0743 0.0742 0.0744 0.0011  -0.0014 0.0018  156  TYR A N     
306  C CA    . TYR A 49  ? 0.0796 0.0810 0.0800 -0.0005 -0.0011 -0.0005 156  TYR A CA    
307  C C     . TYR A 49  ? 0.0769 0.0787 0.0788 0.0004  0.0000  0.0014  156  TYR A C     
308  O O     . TYR A 49  ? 0.0740 0.0771 0.0733 0.0005  -0.0027 -0.0005 156  TYR A O     
309  C CB    . TYR A 49  ? 0.0866 0.0842 0.0907 -0.0011 0.0000  -0.0003 156  TYR A CB    
310  C CG    . TYR A 49  ? 0.1067 0.1129 0.1020 -0.0022 0.0007  -0.0042 156  TYR A CG    
311  C CD1   . TYR A 49  ? 0.1285 0.1212 0.1228 -0.0034 0.0042  0.0003  156  TYR A CD1   
312  C CD2   . TYR A 49  ? 0.1420 0.1270 0.1361 -0.0027 0.0038  -0.0032 156  TYR A CD2   
313  C CE1   . TYR A 49  ? 0.1228 0.1283 0.1245 -0.0018 -0.0009 0.0001  156  TYR A CE1   
314  C CE2   . TYR A 49  ? 0.1530 0.1409 0.1403 -0.0031 0.0064  -0.0026 156  TYR A CE2   
315  C CZ    . TYR A 49  ? 0.1398 0.1367 0.1405 -0.0017 0.0000  -0.0018 156  TYR A CZ    
316  O OH    . TYR A 49  ? 0.1444 0.1498 0.1597 0.0015  0.0112  0.0004  156  TYR A OH    
317  N N     . GLY A 50  ? 0.0733 0.0769 0.0744 -0.0004 -0.0031 -0.0009 157  GLY A N     
318  C CA    . GLY A 50  ? 0.0754 0.0757 0.0776 0.0013  0.0003  0.0014  157  GLY A CA    
319  C C     . GLY A 50  ? 0.0765 0.0778 0.0723 -0.0002 -0.0030 0.0018  157  GLY A C     
320  O O     . GLY A 50  ? 0.0724 0.0722 0.0629 0.0044  -0.0039 0.0050  157  GLY A O     
321  N N     . LYS A 51  ? 0.0832 0.0819 0.0848 0.0016  0.0015  0.0019  158  LYS A N     
322  C CA    . LYS A 51  ? 0.0870 0.0862 0.0847 0.0009  -0.0009 0.0010  158  LYS A CA    
323  C C     . LYS A 51  ? 0.0848 0.0843 0.0843 0.0014  0.0000  0.0015  158  LYS A C     
324  O O     . LYS A 51  ? 0.0905 0.0868 0.0886 0.0038  0.0030  0.0036  158  LYS A O     
325  C CB    . LYS A 51  ? 0.0920 0.0907 0.0937 -0.0005 0.0020  -0.0001 158  LYS A CB    
326  C CG    . LYS A 51  ? 0.1044 0.1019 0.1060 0.0010  0.0003  0.0020  158  LYS A CG    
327  C CD    . LYS A 51  ? 0.1169 0.1197 0.1186 -0.0028 -0.0023 -0.0030 158  LYS A CD    
328  C CE    . LYS A 51  ? 0.1363 0.1320 0.1376 0.0014  0.0007  0.0031  158  LYS A CE    
329  N NZ    . LYS A 51  ? 0.1493 0.1458 0.1538 0.0007  0.0066  0.0017  158  LYS A NZ    
330  N N     . PHE A 52  ? 0.0833 0.0837 0.0824 0.0009  0.0000  0.0007  159  PHE A N     
331  C CA    . PHE A 52  ? 0.0796 0.0821 0.0818 -0.0001 -0.0001 0.0000  159  PHE A CA    
332  C C     . PHE A 52  ? 0.0799 0.0823 0.0815 -0.0006 -0.0014 0.0000  159  PHE A C     
333  O O     . PHE A 52  ? 0.0773 0.0803 0.0783 -0.0001 -0.0026 0.0007  159  PHE A O     
334  C CB    . PHE A 52  ? 0.0797 0.0816 0.0813 -0.0008 -0.0008 -0.0010 159  PHE A CB    
335  C CG    . PHE A 52  ? 0.0738 0.0814 0.0806 -0.0002 -0.0020 -0.0011 159  PHE A CG    
336  C CD1   . PHE A 52  ? 0.0785 0.0806 0.0841 -0.0005 -0.0013 -0.0004 159  PHE A CD1   
337  C CD2   . PHE A 52  ? 0.0823 0.0888 0.0818 0.0024  -0.0005 -0.0002 159  PHE A CD2   
338  C CE1   . PHE A 52  ? 0.0954 0.0912 0.0907 -0.0004 0.0028  -0.0019 159  PHE A CE1   
339  C CE2   . PHE A 52  ? 0.0840 0.0865 0.0818 0.0015  -0.0018 -0.0004 159  PHE A CE2   
340  C CZ    . PHE A 52  ? 0.0911 0.0904 0.0854 -0.0003 -0.0012 -0.0010 159  PHE A CZ    
341  N N     . ILE A 53  ? 0.0828 0.0857 0.0861 -0.0002 -0.0014 0.0001  160  ILE A N     
342  C CA    . ILE A 53  ? 0.0866 0.0891 0.0866 0.0000  -0.0006 0.0002  160  ILE A CA    
343  C C     . ILE A 53  ? 0.0922 0.0938 0.0946 0.0003  -0.0003 -0.0005 160  ILE A C     
344  O O     . ILE A 53  ? 0.0904 0.0940 0.0983 -0.0003 -0.0003 -0.0013 160  ILE A O     
345  C CB    . ILE A 53  ? 0.0862 0.0879 0.0901 0.0001  0.0000  0.0003  160  ILE A CB    
346  C CG1   . ILE A 53  ? 0.0868 0.0889 0.0866 0.0006  -0.0020 -0.0003 160  ILE A CG1   
347  C CG2   . ILE A 53  ? 0.0862 0.0858 0.0845 0.0001  0.0008  -0.0015 160  ILE A CG2   
348  C CD1   . ILE A 53  ? 0.0889 0.0921 0.0992 0.0004  0.0030  -0.0003 160  ILE A CD1   
349  N N     . ASP A 54  ? 0.1013 0.1016 0.0992 -0.0004 0.0013  -0.0003 161  ASP A N     
350  C CA    . ASP A 54  ? 0.1075 0.1064 0.1039 -0.0007 0.0003  -0.0015 161  ASP A CA    
351  C C     . ASP A 54  ? 0.1045 0.1055 0.1008 0.0002  -0.0002 -0.0003 161  ASP A C     
352  O O     . ASP A 54  ? 0.1096 0.1084 0.1025 0.0006  0.0000  -0.0021 161  ASP A O     
353  C CB    . ASP A 54  ? 0.1102 0.1111 0.1050 0.0003  0.0001  -0.0003 161  ASP A CB    
354  C CG    . ASP A 54  ? 0.1310 0.1261 0.1313 -0.0037 0.0024  -0.0036 161  ASP A CG    
355  O OD1   . ASP A 54  ? 0.1317 0.1441 0.1461 0.0006  0.0003  -0.0048 161  ASP A OD1   
356  O OD2   . ASP A 54  ? 0.1470 0.1452 0.1591 0.0039  0.0011  -0.0020 161  ASP A OD2   
357  N N     . GLY A 55  ? 0.1070 0.1044 0.1029 0.0004  0.0016  -0.0002 162  GLY A N     
358  C CA    . GLY A 55  ? 0.1007 0.1022 0.0990 0.0000  -0.0003 -0.0008 162  GLY A CA    
359  C C     . GLY A 55  ? 0.0973 0.0979 0.0955 0.0008  -0.0006 0.0006  162  GLY A C     
360  O O     . GLY A 55  ? 0.0974 0.1039 0.0951 -0.0010 -0.0015 -0.0021 162  GLY A O     
361  N N     . GLU A 56  ? 0.0926 0.0935 0.0879 -0.0004 -0.0013 -0.0007 163  GLU A N     
362  C CA    . GLU A 56  ? 0.0923 0.0891 0.0866 -0.0002 -0.0007 0.0000  163  GLU A CA    
363  C C     . GLU A 56  ? 0.0803 0.0813 0.0758 -0.0013 -0.0002 -0.0002 163  GLU A C     
364  O O     . GLU A 56  ? 0.0870 0.0765 0.0657 0.0014  0.0019  0.0033  163  GLU A O     
365  C CB    . GLU A 56  ? 0.0991 0.0985 0.0988 0.0001  -0.0006 -0.0009 163  GLU A CB    
366  C CG    . GLU A 56  ? 0.1211 0.1222 0.1194 -0.0041 0.0055  -0.0010 163  GLU A CG    
367  C CD    . GLU A 56  ? 0.1507 0.1589 0.1608 0.0053  -0.0006 0.0011  163  GLU A CD    
368  O OE1   . GLU A 56  ? 0.1699 0.1735 0.1866 -0.0043 0.0046  -0.0076 163  GLU A OE1   
369  O OE2   . GLU A 56  ? 0.1948 0.1738 0.2030 0.0023  0.0092  0.0032  163  GLU A OE2   
370  N N     . MET A 57  ? 0.0625 0.0674 0.0591 -0.0001 -0.0044 -0.0004 164  MET A N     
371  C CA    . MET A 57  ? 0.0597 0.0641 0.0575 -0.0006 -0.0022 -0.0012 164  MET A CA    
372  C C     . MET A 57  ? 0.0614 0.0643 0.0579 -0.0008 -0.0009 -0.0003 164  MET A C     
373  O O     . MET A 57  ? 0.0576 0.0629 0.0464 -0.0028 -0.0031 -0.0018 164  MET A O     
374  C CB    . MET A 57  ? 0.0608 0.0631 0.0551 0.0006  -0.0026 0.0016  164  MET A CB    
375  C CG    . MET A 57  ? 0.0651 0.0630 0.0594 -0.0015 -0.0001 -0.0033 164  MET A CG    
376  S SD    . MET A 57  ? 0.0756 0.0754 0.0692 0.0064  -0.0004 0.0006  164  MET A SD    
377  C CE    . MET A 57  ? 0.0832 0.0739 0.0693 0.0008  0.0058  0.0012  164  MET A CE    
378  N N     . ILE A 58  ? 0.0630 0.0640 0.0627 -0.0010 0.0004  -0.0012 165  ILE A N     
379  C CA    . ILE A 58  ? 0.0635 0.0653 0.0593 -0.0006 -0.0022 -0.0013 165  ILE A CA    
380  C C     . ILE A 58  ? 0.0682 0.0685 0.0643 -0.0016 -0.0023 -0.0025 165  ILE A C     
381  O O     . ILE A 58  ? 0.0610 0.0638 0.0565 0.0020  -0.0056 -0.0038 165  ILE A O     
382  C CB    . ILE A 58  ? 0.0644 0.0642 0.0611 0.0003  -0.0005 0.0002  165  ILE A CB    
383  C CG1   . ILE A 58  ? 0.0582 0.0635 0.0538 0.0012  -0.0036 -0.0003 165  ILE A CG1   
384  C CG2   . ILE A 58  ? 0.0714 0.0683 0.0647 -0.0012 0.0012  0.0005  165  ILE A CG2   
385  C CD1   . ILE A 58  ? 0.0662 0.0605 0.0511 0.0024  -0.0013 0.0027  165  ILE A CD1   
386  N N     . GLU A 59  ? 0.0748 0.0782 0.0749 -0.0007 -0.0028 -0.0024 166  GLU A N     
387  C CA    . GLU A 59  ? 0.0868 0.0884 0.0855 -0.0006 -0.0018 0.0005  166  GLU A CA    
388  C C     . GLU A 59  ? 0.0876 0.0906 0.0868 0.0011  -0.0014 0.0007  166  GLU A C     
389  O O     . GLU A 59  ? 0.0860 0.0941 0.0825 0.0021  -0.0031 0.0014  166  GLU A O     
390  C CB    . GLU A 59  ? 0.0973 0.0975 0.0948 -0.0014 -0.0003 -0.0019 166  GLU A CB    
391  C CG    . GLU A 59  ? 0.1099 0.1164 0.1163 -0.0015 -0.0065 0.0052  166  GLU A CG    
392  C CD    . GLU A 59  ? 0.1731 0.1563 0.1634 0.0026  0.0023  -0.0073 166  GLU A CD    
393  O OE1   . GLU A 59  ? 0.2223 0.1962 0.1866 -0.0018 0.0064  -0.0002 166  GLU A OE1   
394  O OE2   . GLU A 59  ? 0.1937 0.1779 0.1906 0.0046  0.0007  0.0020  166  GLU A OE2   
395  N N     . GLY A 60  ? 0.0934 0.0925 0.0910 0.0004  0.0009  -0.0005 167  GLY A N     
396  C CA    . GLY A 60  ? 0.0927 0.0925 0.0884 0.0011  -0.0007 0.0011  167  GLY A CA    
397  C C     . GLY A 60  ? 0.0976 0.0928 0.0937 0.0005  0.0031  0.0009  167  GLY A C     
398  O O     . GLY A 60  ? 0.1059 0.0951 0.0899 0.0023  0.0041  0.0026  167  GLY A O     
399  N N     . LYS A 61  ? 0.0919 0.0922 0.0905 0.0009  0.0011  0.0025  168  LYS A N     
400  C CA    . LYS A 61  ? 0.0867 0.0913 0.0913 0.0005  -0.0011 0.0012  168  LYS A CA    
401  C C     . LYS A 61  ? 0.0848 0.0873 0.0828 0.0003  -0.0008 0.0010  168  LYS A C     
402  O O     . LYS A 61  ? 0.0775 0.0826 0.0785 0.0002  -0.0039 0.0030  168  LYS A O     
403  C CB    . LYS A 61  ? 0.0901 0.0929 0.0889 0.0015  -0.0015 0.0007  168  LYS A CB    
404  C CG    . LYS A 61  ? 0.1033 0.1144 0.1112 -0.0015 -0.0043 0.0022  168  LYS A CG    
405  C CD    . LYS A 61  ? 0.1425 0.1341 0.1390 0.0030  0.0031  -0.0005 168  LYS A CD    
406  C CE    . LYS A 61  ? 0.1635 0.1649 0.1574 -0.0026 -0.0009 -0.0002 168  LYS A CE    
407  N NZ    . LYS A 61  ? 0.2032 0.1774 0.1898 0.0013  0.0082  -0.0014 168  LYS A NZ    
408  N N     . LEU A 62  ? 0.0822 0.0842 0.0892 0.0013  0.0011  0.0017  169  LEU A N     
409  C CA    . LEU A 62  ? 0.0810 0.0815 0.0804 0.0004  -0.0001 -0.0006 169  LEU A CA    
410  C C     . LEU A 62  ? 0.0741 0.0728 0.0702 -0.0012 0.0000  0.0000  169  LEU A C     
411  O O     . LEU A 62  ? 0.0647 0.0712 0.0595 -0.0010 -0.0019 -0.0024 169  LEU A O     
412  C CB    . LEU A 62  ? 0.0866 0.0871 0.0923 -0.0003 0.0038  0.0011  169  LEU A CB    
413  C CG    . LEU A 62  ? 0.1060 0.1052 0.1027 0.0008  -0.0009 -0.0011 169  LEU A CG    
414  C CD1   . LEU A 62  ? 0.1204 0.1093 0.1192 -0.0014 0.0027  0.0001  169  LEU A CD1   
415  C CD2   . LEU A 62  ? 0.1244 0.1154 0.1207 -0.0009 0.0070  0.0023  169  LEU A CD2   
416  N N     . ALA A 63  ? 0.0643 0.0677 0.0622 0.0018  -0.0015 0.0007  170  ALA A N     
417  C CA    . ALA A 63  ? 0.0599 0.0631 0.0588 -0.0002 -0.0019 0.0002  170  ALA A CA    
418  C C     . ALA A 63  ? 0.0552 0.0612 0.0573 0.0003  -0.0026 -0.0010 170  ALA A C     
419  O O     . ALA A 63  ? 0.0522 0.0653 0.0611 0.0017  -0.0029 -0.0039 170  ALA A O     
420  C CB    . ALA A 63  ? 0.0578 0.0629 0.0607 0.0000  -0.0009 0.0012  170  ALA A CB    
421  N N     . THR A 64  ? 0.0561 0.0603 0.0552 -0.0021 -0.0020 -0.0029 171  THR A N     
422  C CA    . THR A 64  ? 0.0536 0.0593 0.0550 -0.0003 -0.0029 -0.0011 171  THR A CA    
423  C C     . THR A 64  ? 0.0536 0.0607 0.0569 0.0015  -0.0031 0.0009  171  THR A C     
424  O O     . THR A 64  ? 0.0460 0.0613 0.0496 0.0017  -0.0056 0.0046  171  THR A O     
425  C CB    . THR A 64  ? 0.0524 0.0580 0.0529 -0.0022 -0.0031 -0.0019 171  THR A CB    
426  O OG1   . THR A 64  ? 0.0540 0.0640 0.0542 -0.0068 -0.0034 -0.0023 171  THR A OG1   
427  C CG2   . THR A 64  ? 0.0495 0.0557 0.0459 -0.0031 -0.0048 -0.0032 171  THR A CG2   
428  N N     . LEU A 65  ? 0.0640 0.0661 0.0655 0.0031  -0.0017 0.0019  172  LEU A N     
429  C CA    . LEU A 65  ? 0.0726 0.0747 0.0742 0.0003  -0.0002 0.0003  172  LEU A CA    
430  C C     . LEU A 65  ? 0.0756 0.0792 0.0793 0.0007  -0.0016 0.0015  172  LEU A C     
431  O O     . LEU A 65  ? 0.0769 0.0793 0.0828 -0.0014 0.0015  -0.0010 172  LEU A O     
432  C CB    . LEU A 65  ? 0.0780 0.0771 0.0777 0.0023  -0.0005 0.0009  172  LEU A CB    
433  C CG    . LEU A 65  ? 0.0828 0.0860 0.0866 0.0000  -0.0017 0.0016  172  LEU A CG    
434  C CD1   . LEU A 65  ? 0.1026 0.0956 0.0970 0.0016  0.0047  0.0010  172  LEU A CD1   
435  C CD2   . LEU A 65  ? 0.1010 0.0940 0.0976 0.0004  0.0009  0.0001  172  LEU A CD2   
436  N N     . MET A 66  ? 0.0822 0.0855 0.0817 0.0004  -0.0024 -0.0001 173  MET A N     
437  C CA    . MET A 66  ? 0.0953 0.0960 0.0961 0.0012  -0.0004 0.0005  173  MET A CA    
438  C C     . MET A 66  ? 0.1054 0.1076 0.1083 0.0005  0.0000  0.0000  173  MET A C     
439  O O     . MET A 66  ? 0.1182 0.1146 0.1234 -0.0030 0.0023  -0.0005 173  MET A O     
440  C CB    . MET A 66  ? 0.0940 0.0942 0.0930 0.0016  -0.0005 0.0010  173  MET A CB    
441  C CG    . MET A 66  ? 0.0854 0.0965 0.0935 0.0011  -0.0026 0.0011  173  MET A CG    
442  S SD    . MET A 66  ? 0.0844 0.1027 0.1026 -0.0012 -0.0045 0.0000  173  MET A SD    
443  C CE    . MET A 66  ? 0.1132 0.1106 0.1082 0.0007  0.0014  0.0016  173  MET A CE    
444  N N     . SER A 67  ? 0.1199 0.1188 0.1225 0.0012  0.0026  0.0025  174  SER A N     
445  C CA    . SER A 67  ? 0.1235 0.1249 0.1267 -0.0004 -0.0001 0.0007  174  SER A CA    
446  C C     . SER A 67  ? 0.1284 0.1294 0.1294 0.0006  -0.0004 0.0009  174  SER A C     
447  O O     . SER A 67  ? 0.1179 0.1252 0.1267 0.0002  -0.0014 0.0000  174  SER A O     
448  C CB    . SER A 67  ? 0.1257 0.1262 0.1289 0.0000  0.0000  0.0008  174  SER A CB    
449  O OG    . SER A 67  ? 0.1433 0.1339 0.1299 -0.0015 0.0013  0.0008  174  SER A OG    
450  N N     . THR A 68  ? 0.1330 0.1352 0.1358 -0.0004 -0.0001 0.0004  175  THR A N     
451  C CA    . THR A 68  ? 0.1398 0.1400 0.1416 0.0003  -0.0008 0.0010  175  THR A CA    
452  C C     . THR A 68  ? 0.1474 0.1480 0.1495 0.0001  0.0005  0.0006  175  THR A C     
453  O O     . THR A 68  ? 0.1484 0.1512 0.1537 0.0006  -0.0006 0.0016  175  THR A O     
454  C CB    . THR A 68  ? 0.1395 0.1403 0.1392 -0.0003 0.0008  0.0004  175  THR A CB    
455  O OG1   . THR A 68  ? 0.1261 0.1300 0.1310 0.0030  -0.0077 0.0014  175  THR A OG1   
456  C CG2   . THR A 68  ? 0.1355 0.1401 0.1421 -0.0002 -0.0012 -0.0003 175  THR A CG2   
457  N N     . GLU A 69  ? 0.1558 0.1544 0.1543 0.0003  -0.0013 0.0009  176  GLU A N     
458  C CA    . GLU A 69  ? 0.1604 0.1613 0.1607 0.0000  -0.0004 0.0003  176  GLU A CA    
459  C C     . GLU A 69  ? 0.1600 0.1594 0.1599 -0.0002 0.0000  -0.0001 176  GLU A C     
460  O O     . GLU A 69  ? 0.1533 0.1542 0.1557 0.0000  -0.0011 -0.0008 176  GLU A O     
461  C CB    . GLU A 69  ? 0.1697 0.1672 0.1661 -0.0008 0.0003  -0.0004 176  GLU A CB    
462  C CG    . GLU A 69  ? 0.1888 0.1842 0.1863 0.0030  -0.0016 0.0006  176  GLU A CG    
463  C CD    . GLU A 69  ? 0.2076 0.2113 0.2168 -0.0026 0.0020  0.0000  176  GLU A CD    
464  O OE1   . GLU A 69  ? 0.2385 0.2314 0.2230 -0.0014 0.0039  0.0003  176  GLU A OE1   
465  O OE2   . GLU A 69  ? 0.2275 0.2266 0.2184 -0.0015 -0.0044 0.0012  176  GLU A OE2   
466  N N     . GLU A 70  ? 0.1576 0.1589 0.1588 -0.0003 -0.0008 -0.0002 177  GLU A N     
467  C CA    . GLU A 70  ? 0.1593 0.1592 0.1605 -0.0008 0.0000  0.0000  177  GLU A CA    
468  C C     . GLU A 70  ? 0.1565 0.1554 0.1551 -0.0012 -0.0004 -0.0002 177  GLU A C     
469  O O     . GLU A 70  ? 0.1568 0.1544 0.1522 -0.0011 0.0000  0.0009  177  GLU A O     
470  C CB    . GLU A 70  ? 0.1622 0.1620 0.1608 -0.0017 -0.0012 -0.0007 177  GLU A CB    
471  C CG    . GLU A 70  ? 0.1755 0.1745 0.1788 0.0015  0.0005  -0.0001 177  GLU A CG    
472  C CD    . GLU A 70  ? 0.1934 0.1920 0.1898 -0.0001 0.0032  0.0005  177  GLU A CD    
473  O OE1   . GLU A 70  ? 0.1970 0.1950 0.1925 -0.0007 -0.0029 -0.0019 177  GLU A OE1   
474  O OE2   . GLU A 70  ? 0.2019 0.2021 0.2032 0.0018  0.0027  0.0001  177  GLU A OE2   
475  N N     . GLY A 71  ? 0.1504 0.1509 0.1516 -0.0016 -0.0014 -0.0008 178  GLY A N     
476  C CA    . GLY A 71  ? 0.1497 0.1491 0.1502 -0.0010 -0.0001 -0.0008 178  GLY A CA    
477  C C     . GLY A 71  ? 0.1461 0.1473 0.1467 -0.0009 -0.0014 -0.0010 178  GLY A C     
478  O O     . GLY A 71  ? 0.1442 0.1421 0.1429 -0.0021 -0.0051 -0.0016 178  GLY A O     
479  N N     . ARG A 72  ? 0.1464 0.1477 0.1474 -0.0007 -0.0009 -0.0007 179  ARG A N     
480  C CA    . ARG A 72  ? 0.1502 0.1498 0.1502 -0.0002 -0.0002 0.0000  179  ARG A CA    
481  C C     . ARG A 72  ? 0.1494 0.1480 0.1488 0.0000  0.0001  -0.0001 179  ARG A C     
482  O O     . ARG A 72  ? 0.1429 0.1440 0.1400 -0.0005 -0.0033 0.0003  179  ARG A O     
483  C CB    . ARG A 72  ? 0.1518 0.1528 0.1516 -0.0002 -0.0014 -0.0017 179  ARG A CB    
484  C CG    . ARG A 72  ? 0.1653 0.1666 0.1684 -0.0018 -0.0002 0.0022  179  ARG A CG    
485  C CD    . ARG A 72  ? 0.1898 0.1892 0.1861 0.0000  -0.0013 -0.0039 179  ARG A CD    
486  N NE    . ARG A 72  ? 0.2073 0.2047 0.2082 -0.0018 0.0018  0.0029  179  ARG A NE    
487  C CZ    . ARG A 72  ? 0.2319 0.2308 0.2237 -0.0001 -0.0014 -0.0007 179  ARG A CZ    
488  N NH1   . ARG A 72  ? 0.2423 0.2370 0.2420 -0.0032 0.0004  -0.0004 179  ARG A NH1   
489  N NH2   . ARG A 72  ? 0.2370 0.2345 0.2354 -0.0017 0.0016  0.0008  179  ARG A NH2   
490  N N     . PRO A 73  ? 0.1508 0.1489 0.1497 0.0000  0.0007  0.0002  180  PRO A N     
491  C CA    . PRO A 73  ? 0.1501 0.1481 0.1482 0.0000  -0.0001 0.0003  180  PRO A CA    
492  C C     . PRO A 73  ? 0.1465 0.1450 0.1441 -0.0005 0.0001  0.0007  180  PRO A C     
493  O O     . PRO A 73  ? 0.1472 0.1414 0.1425 -0.0011 -0.0033 0.0024  180  PRO A O     
494  C CB    . PRO A 73  ? 0.1517 0.1507 0.1491 0.0000  0.0003  0.0004  180  PRO A CB    
495  C CG    . PRO A 73  ? 0.1623 0.1560 0.1614 0.0020  0.0047  0.0016  180  PRO A CG    
496  C CD    . PRO A 73  ? 0.1545 0.1497 0.1472 0.0001  -0.0015 -0.0006 180  PRO A CD    
497  N N     . HIS A 74  ? 0.1372 0.1394 0.1408 0.0004  -0.0017 0.0005  181  HIS A N     
498  C CA    . HIS A 74  ? 0.1390 0.1391 0.1391 0.0004  0.0004  0.0005  181  HIS A CA    
499  C C     . HIS A 74  ? 0.1300 0.1302 0.1318 0.0002  -0.0006 0.0001  181  HIS A C     
500  O O     . HIS A 74  ? 0.1312 0.1316 0.1312 -0.0034 -0.0013 -0.0030 181  HIS A O     
501  C CB    . HIS A 74  ? 0.1441 0.1441 0.1452 0.0007  -0.0006 -0.0004 181  HIS A CB    
502  C CG    . HIS A 74  ? 0.1595 0.1622 0.1598 -0.0007 0.0022  0.0017  181  HIS A CG    
503  N ND1   . HIS A 74  ? 0.1867 0.1855 0.1721 -0.0016 -0.0005 -0.0010 181  HIS A ND1   
504  C CD2   . HIS A 74  ? 0.1674 0.1699 0.1694 -0.0012 -0.0037 0.0001  181  HIS A CD2   
505  C CE1   . HIS A 74  ? 0.1853 0.1870 0.1818 -0.0026 0.0003  0.0000  181  HIS A CE1   
506  N NE2   . HIS A 74  ? 0.1883 0.1848 0.1788 -0.0017 0.0020  0.0003  181  HIS A NE2   
507  N N     . PHE A 75  ? 0.1200 0.1195 0.1201 0.0010  0.0003  0.0003  182  PHE A N     
508  C CA    . PHE A 75  ? 0.1138 0.1125 0.1135 0.0001  -0.0002 0.0000  182  PHE A CA    
509  C C     . PHE A 75  ? 0.1062 0.1074 0.1059 -0.0001 0.0008  -0.0008 182  PHE A C     
510  O O     . PHE A 75  ? 0.1005 0.1025 0.0972 0.0004  -0.0008 -0.0006 182  PHE A O     
511  C CB    . PHE A 75  ? 0.1089 0.1142 0.1084 -0.0010 -0.0026 0.0000  182  PHE A CB    
512  C CG    . PHE A 75  ? 0.1134 0.1189 0.1194 -0.0005 -0.0030 0.0018  182  PHE A CG    
513  C CD1   . PHE A 75  ? 0.1165 0.1231 0.1198 -0.0010 -0.0004 0.0003  182  PHE A CD1   
514  C CD2   . PHE A 75  ? 0.1338 0.1309 0.1317 0.0005  0.0036  0.0000  182  PHE A CD2   
515  C CE1   . PHE A 75  ? 0.1290 0.1281 0.1299 -0.0013 -0.0006 0.0023  182  PHE A CE1   
516  C CE2   . PHE A 75  ? 0.1372 0.1333 0.1368 0.0023  0.0017  0.0015  182  PHE A CE2   
517  C CZ    . PHE A 75  ? 0.1457 0.1351 0.1372 0.0032  0.0036  0.0013  182  PHE A CZ    
518  N N     . GLU A 76  ? 0.0984 0.1007 0.0930 0.0001  -0.0045 -0.0016 183  GLU A N     
519  C CA    . GLU A 76  ? 0.0999 0.1030 0.0970 0.0007  -0.0020 0.0014  183  GLU A CA    
520  C C     . GLU A 76  ? 0.0994 0.0994 0.0939 0.0012  -0.0012 0.0017  183  GLU A C     
521  O O     . GLU A 76  ? 0.0851 0.0916 0.0778 0.0005  -0.0084 0.0013  183  GLU A O     
522  C CB    . GLU A 76  ? 0.1062 0.1085 0.1059 -0.0003 -0.0010 0.0003  183  GLU A CB    
523  C CG    . GLU A 76  ? 0.1186 0.1218 0.1152 -0.0009 0.0003  0.0003  183  GLU A CG    
524  C CD    . GLU A 76  ? 0.1224 0.1336 0.1235 0.0008  -0.0043 0.0043  183  GLU A CD    
525  O OE1   . GLU A 76  ? 0.1547 0.1449 0.1373 0.0009  -0.0013 0.0007  183  GLU A OE1   
526  O OE2   . GLU A 76  ? 0.1208 0.1377 0.1338 -0.0006 -0.0005 -0.0003 183  GLU A OE2   
527  N N     . LEU A 77  ? 0.0994 0.1013 0.0976 0.0000  -0.0028 0.0002  184  LEU A N     
528  C CA    . LEU A 77  ? 0.1067 0.1093 0.1082 0.0001  -0.0004 0.0002  184  LEU A CA    
529  C C     . LEU A 77  ? 0.1038 0.1088 0.1064 -0.0012 -0.0035 -0.0002 184  LEU A C     
530  O O     . LEU A 77  ? 0.1048 0.1069 0.1056 -0.0040 -0.0002 -0.0027 184  LEU A O     
531  C CB    . LEU A 77  ? 0.1127 0.1147 0.1135 -0.0009 -0.0002 -0.0019 184  LEU A CB    
532  C CG    . LEU A 77  ? 0.1401 0.1341 0.1319 0.0011  0.0007  0.0035  184  LEU A CG    
533  C CD1   . LEU A 77  ? 0.1456 0.1472 0.1489 -0.0015 0.0015  -0.0008 184  LEU A CD1   
534  C CD2   . LEU A 77  ? 0.1529 0.1467 0.1506 0.0018  0.0042  -0.0007 184  LEU A CD2   
535  N N     . MET A 78  ? 0.1041 0.1133 0.1113 0.0003  -0.0037 -0.0011 185  MET A N     
536  C CA    . MET A 78  ? 0.1185 0.1210 0.1210 0.0010  -0.0003 0.0004  185  MET A CA    
537  C C     . MET A 78  ? 0.1284 0.1341 0.1340 -0.0001 -0.0015 -0.0010 185  MET A C     
538  O O     . MET A 78  ? 0.1260 0.1347 0.1318 -0.0016 -0.0029 -0.0024 185  MET A O     
539  C CB    . MET A 78  ? 0.1166 0.1179 0.1190 0.0003  -0.0004 0.0003  185  MET A CB    
540  C CG    . MET A 78  ? 0.1127 0.1144 0.1160 0.0015  -0.0014 0.0021  185  MET A CG    
541  S SD    . MET A 78  ? 0.1084 0.1147 0.1062 -0.0056 -0.0016 -0.0033 185  MET A SD    
542  C CE    . MET A 78  ? 0.1083 0.1073 0.1075 -0.0002 0.0006  0.0017  185  MET A CE    
543  N N     . PRO A 79  ? 0.1469 0.1493 0.1493 0.0006  -0.0009 0.0006  186  PRO A N     
544  C CA    . PRO A 79  ? 0.1631 0.1609 0.1629 -0.0008 0.0007  0.0000  186  PRO A CA    
545  C C     . PRO A 79  ? 0.1728 0.1729 0.1738 0.0012  0.0013  0.0001  186  PRO A C     
546  O O     . PRO A 79  ? 0.1850 0.1781 0.1805 0.0033  0.0049  -0.0002 186  PRO A O     
547  C CB    . PRO A 79  ? 0.1606 0.1610 0.1626 0.0000  0.0003  -0.0002 186  PRO A CB    
548  C CG    . PRO A 79  ? 0.1583 0.1557 0.1591 0.0004  0.0008  -0.0001 186  PRO A CG    
549  C CD    . PRO A 79  ? 0.1514 0.1523 0.1533 0.0004  0.0002  -0.0001 186  PRO A CD    
550  N N     . GLY A 80  ? 0.1862 0.1856 0.1858 0.0001  0.0000  0.0002  187  GLY A N     
551  C CA    . GLY A 80  ? 0.1940 0.1945 0.1950 0.0006  0.0016  -0.0001 187  GLY A CA    
552  C C     . GLY A 80  ? 0.2011 0.2009 0.2002 0.0000  0.0000  0.0006  187  GLY A C     
553  O O     . GLY A 80  ? 0.2069 0.2064 0.2070 0.0000  0.0032  0.0008  187  GLY A O     
554  N N     . ASN A 81  ? 0.2067 0.2059 0.2063 0.0002  0.0015  -0.0003 188  ASN A N     
555  C CA    . ASN A 81  ? 0.2111 0.2096 0.2100 0.0011  0.0005  0.0001  188  ASN A CA    
556  C C     . ASN A 81  ? 0.2089 0.2072 0.2070 0.0002  0.0008  -0.0005 188  ASN A C     
557  O O     . ASN A 81  ? 0.2147 0.2126 0.2124 0.0027  0.0014  0.0007  188  ASN A O     
558  C CB    . ASN A 81  ? 0.2138 0.2122 0.2138 -0.0008 0.0013  -0.0010 188  ASN A CB    
559  C CG    . ASN A 81  ? 0.2223 0.2172 0.2183 0.0021  0.0017  -0.0005 188  ASN A CG    
560  O OD1   . ASN A 81  ? 0.2237 0.2198 0.2158 -0.0008 -0.0014 -0.0006 188  ASN A OD1   
561  N ND2   . ASN A 81  ? 0.2213 0.2195 0.2174 0.0003  0.0001  0.0014  188  ASN A ND2   
562  N N     . SER A 82  ? 0.2031 0.2007 0.2023 0.0002  0.0011  0.0002  189  SER A N     
563  C CA    . SER A 82  ? 0.1984 0.1959 0.1953 0.0002  0.0009  0.0011  189  SER A CA    
564  C C     . SER A 82  ? 0.1867 0.1851 0.1833 0.0022  -0.0013 0.0004  189  SER A C     
565  O O     . SER A 82  ? 0.1981 0.1869 0.1861 -0.0022 0.0044  -0.0009 189  SER A O     
566  C CB    . SER A 82  ? 0.1994 0.1979 0.1980 0.0000  -0.0001 0.0000  189  SER A CB    
567  O OG    . SER A 82  ? 0.2158 0.2055 0.2033 0.0019  0.0042  0.0031  189  SER A OG    
568  N N     . VAL A 83  ? 0.1815 0.1708 0.1734 0.0000  0.0043  0.0010  190  VAL A N     
569  C CA    . VAL A 83  ? 0.1620 0.1543 0.1569 0.0021  0.0016  -0.0006 190  VAL A CA    
570  C C     . VAL A 83  ? 0.1328 0.1310 0.1273 -0.0013 -0.0006 0.0023  190  VAL A C     
571  O O     . VAL A 83  ? 0.1335 0.1255 0.1168 0.0007  -0.0036 -0.0029 190  VAL A O     
572  C CB    . VAL A 83  ? 0.1634 0.1612 0.1622 0.0000  -0.0004 -0.0001 190  VAL A CB    
573  C CG1   . VAL A 83  ? 0.1763 0.1708 0.1781 0.0036  0.0046  0.0000  190  VAL A CG1   
574  C CG2   . VAL A 83  ? 0.1692 0.1667 0.1714 0.0018  0.0026  0.0011  190  VAL A CG2   
575  N N     . TYR A 84  ? 0.1022 0.1030 0.0944 0.0014  -0.0062 -0.0018 191  TYR A N     
576  C CA    . TYR A 84  ? 0.0833 0.0870 0.0793 -0.0008 -0.0034 0.0017  191  TYR A CA    
577  C C     . TYR A 84  ? 0.0734 0.0758 0.0732 0.0003  -0.0031 0.0000  191  TYR A C     
578  O O     . TYR A 84  ? 0.0658 0.0693 0.0652 0.0005  -0.0063 0.0060  191  TYR A O     
579  C CB    . TYR A 84  ? 0.0802 0.0782 0.0823 -0.0002 -0.0009 0.0000  191  TYR A CB    
580  C CG    . TYR A 84  ? 0.0617 0.0686 0.0618 -0.0013 -0.0054 0.0000  191  TYR A CG    
581  C CD1   . TYR A 84  ? 0.0736 0.0688 0.0728 0.0023  0.0030  0.0032  191  TYR A CD1   
582  C CD2   . TYR A 84  ? 0.0587 0.0541 0.0648 -0.0002 -0.0011 0.0004  191  TYR A CD2   
583  C CE1   . TYR A 84  ? 0.0587 0.0619 0.0532 0.0027  -0.0027 0.0010  191  TYR A CE1   
584  C CE2   . TYR A 84  ? 0.0539 0.0529 0.0436 -0.0027 -0.0040 -0.0058 191  TYR A CE2   
585  C CZ    . TYR A 84  ? 0.0480 0.0556 0.0475 0.0000  -0.0074 -0.0032 191  TYR A CZ    
586  O OH    . TYR A 84  ? 0.0796 0.0609 0.0654 0.0044  0.0046  -0.0001 191  TYR A OH    
587  N N     . HIS A 85  ? 0.0713 0.0712 0.0672 -0.0015 -0.0021 0.0002  192  HIS A N     
588  C CA    . HIS A 85  ? 0.0697 0.0692 0.0669 0.0001  -0.0016 -0.0008 192  HIS A CA    
589  C C     . HIS A 85  ? 0.0554 0.0613 0.0578 -0.0003 -0.0035 0.0000  192  HIS A C     
590  O O     . HIS A 85  ? 0.0610 0.0592 0.0619 0.0005  0.0020  -0.0021 192  HIS A O     
591  C CB    . HIS A 85  ? 0.0743 0.0736 0.0728 -0.0011 -0.0027 -0.0008 192  HIS A CB    
592  C CG    . HIS A 85  ? 0.0941 0.0961 0.0953 -0.0016 0.0048  0.0007  192  HIS A CG    
593  N ND1   . HIS A 85  ? 0.1135 0.1076 0.1033 -0.0010 0.0036  0.0053  192  HIS A ND1   
594  C CD2   . HIS A 85  ? 0.1093 0.1041 0.1151 0.0004  0.0033  -0.0001 192  HIS A CD2   
595  C CE1   . HIS A 85  ? 0.1048 0.1074 0.1001 0.0004  -0.0014 0.0025  192  HIS A CE1   
596  N NE2   . HIS A 85  ? 0.1137 0.1090 0.1157 -0.0008 0.0046  -0.0005 192  HIS A NE2   
597  N N     . PHE A 86  ? 0.0448 0.0537 0.0449 -0.0017 -0.0055 -0.0019 193  PHE A N     
598  C CA    . PHE A 86  ? 0.0480 0.0539 0.0499 -0.0015 -0.0036 -0.0020 193  PHE A CA    
599  C C     . PHE A 86  ? 0.0504 0.0536 0.0519 -0.0010 -0.0026 -0.0006 193  PHE A C     
600  O O     . PHE A 86  ? 0.0413 0.0520 0.0573 -0.0042 -0.0041 -0.0032 193  PHE A O     
601  C CB    . PHE A 86  ? 0.0467 0.0542 0.0500 -0.0006 -0.0023 -0.0016 193  PHE A CB    
602  C CG    . PHE A 86  ? 0.0568 0.0606 0.0592 -0.0008 -0.0005 -0.0021 193  PHE A CG    
603  C CD1   . PHE A 86  ? 0.0674 0.0688 0.0667 -0.0016 -0.0014 -0.0017 193  PHE A CD1   
604  C CD2   . PHE A 86  ? 0.0774 0.0726 0.0777 0.0019  -0.0005 0.0002  193  PHE A CD2   
605  C CE1   . PHE A 86  ? 0.0627 0.0690 0.0625 -0.0005 -0.0036 -0.0016 193  PHE A CE1   
606  C CE2   . PHE A 86  ? 0.0823 0.0769 0.0818 0.0013  -0.0003 -0.0009 193  PHE A CE2   
607  C CZ    . PHE A 86  ? 0.0792 0.0741 0.0822 0.0000  0.0010  0.0001  193  PHE A CZ    
608  N N     . ASP A 87  ? 0.0538 0.0560 0.0554 -0.0014 -0.0025 -0.0007 194  ASP A N     
609  C CA    . ASP A 87  ? 0.0631 0.0639 0.0617 0.0005  -0.0004 0.0002  194  ASP A CA    
610  C C     . ASP A 87  ? 0.0689 0.0687 0.0694 0.0000  -0.0001 -0.0009 194  ASP A C     
611  O O     . ASP A 87  ? 0.0687 0.0660 0.0668 0.0005  0.0008  -0.0034 194  ASP A O     
612  C CB    . ASP A 87  ? 0.0692 0.0643 0.0680 -0.0003 0.0032  -0.0005 194  ASP A CB    
613  C CG    . ASP A 87  ? 0.0603 0.0617 0.0636 -0.0005 -0.0022 -0.0013 194  ASP A CG    
614  O OD1   . ASP A 87  ? 0.0505 0.0584 0.0677 0.0000  0.0017  -0.0021 194  ASP A OD1   
615  O OD2   . ASP A 87  ? 0.0794 0.0835 0.0833 0.0015  -0.0006 0.0025  194  ASP A OD2   
616  N N     . LYS A 88  ? 0.0744 0.0750 0.0765 0.0001  -0.0004 0.0004  195  LYS A N     
617  C CA    . LYS A 88  ? 0.0798 0.0825 0.0815 0.0002  -0.0019 -0.0007 195  LYS A CA    
618  C C     . LYS A 88  ? 0.0841 0.0856 0.0860 0.0000  -0.0003 -0.0011 195  LYS A C     
619  O O     . LYS A 88  ? 0.0719 0.0805 0.0750 0.0020  -0.0073 -0.0009 195  LYS A O     
620  C CB    . LYS A 88  ? 0.0853 0.0865 0.0883 0.0008  0.0000  0.0012  195  LYS A CB    
621  C CG    . LYS A 88  ? 0.0949 0.0971 0.0938 0.0008  -0.0030 -0.0015 195  LYS A CG    
622  C CD    . LYS A 88  ? 0.1203 0.1142 0.1165 -0.0013 0.0016  0.0031  195  LYS A CD    
623  C CE    . LYS A 88  ? 0.1321 0.1252 0.1251 -0.0011 -0.0004 -0.0017 195  LYS A CE    
624  N NZ    . LYS A 88  ? 0.1408 0.1336 0.1367 0.0007  0.0011  0.0022  195  LYS A NZ    
625  N N     . SER A 89  ? 0.0866 0.0904 0.0876 0.0017  -0.0052 0.0000  196  SER A N     
626  C CA    . SER A 89  ? 0.1006 0.1001 0.0975 0.0004  -0.0006 -0.0006 196  SER A CA    
627  C C     . SER A 89  ? 0.1106 0.1109 0.1091 0.0024  -0.0041 0.0014  196  SER A C     
628  O O     . SER A 89  ? 0.1022 0.1104 0.1062 0.0027  -0.0062 0.0031  196  SER A O     
629  C CB    . SER A 89  ? 0.0964 0.0975 0.0968 0.0009  -0.0033 0.0007  196  SER A CB    
630  O OG    . SER A 89  ? 0.1005 0.0927 0.0921 0.0022  -0.0005 -0.0003 196  SER A OG    
631  N N     . THR A 90  ? 0.1306 0.1292 0.1313 0.0011  0.0020  0.0025  197  THR A N     
632  C CA    . THR A 90  ? 0.1427 0.1455 0.1460 0.0015  -0.0021 0.0010  197  THR A CA    
633  C C     . THR A 90  ? 0.1561 0.1595 0.1574 0.0003  -0.0001 0.0005  197  THR A C     
634  O O     . THR A 90  ? 0.1624 0.1626 0.1555 0.0050  -0.0013 0.0033  197  THR A O     
635  C CB    . THR A 90  ? 0.1499 0.1477 0.1508 0.0012  0.0011  0.0008  197  THR A CB    
636  O OG1   . THR A 90  ? 0.1577 0.1573 0.1732 -0.0027 0.0053  -0.0006 197  THR A OG1   
637  C CG2   . THR A 90  ? 0.1478 0.1491 0.1434 -0.0007 -0.0018 0.0003  197  THR A CG2   
638  N N     . SER A 91  ? 0.1709 0.1711 0.1751 0.0020  -0.0003 0.0021  198  SER A N     
639  C CA    . SER A 91  ? 0.1851 0.1836 0.1840 0.0014  0.0012  0.0000  198  SER A CA    
640  C C     . SER A 91  ? 0.1984 0.1927 0.1964 0.0002  0.0022  0.0010  198  SER A C     
641  O O     . SER A 91  ? 0.2209 0.2058 0.2090 0.0003  0.0101  0.0015  198  SER A O     
642  C CB    . SER A 91  ? 0.1836 0.1837 0.1840 0.0017  0.0000  0.0003  198  SER A CB    
643  O OG    . SER A 91  ? 0.1703 0.1760 0.1762 0.0028  -0.0031 0.0026  198  SER A OG    
644  N N     . SER A 92  ? 0.2000 0.1993 0.1998 0.0004  -0.0008 0.0014  199  SER A N     
645  C CA    . SER A 92  ? 0.2057 0.2041 0.2072 0.0000  0.0008  0.0005  199  SER A CA    
646  C C     . SER A 92  ? 0.2035 0.2035 0.2089 -0.0004 0.0004  -0.0009 199  SER A C     
647  O O     . SER A 92  ? 0.2032 0.2042 0.2164 0.0007  0.0015  0.0018  199  SER A O     
648  C CB    . SER A 92  ? 0.2084 0.2081 0.2119 -0.0016 0.0017  -0.0009 199  SER A CB    
649  O OG    . SER A 92  ? 0.2177 0.2160 0.2136 -0.0031 0.0027  -0.0039 199  SER A OG    
650  N N     . CYS A 93  ? 0.1998 0.1994 0.2034 0.0008  -0.0005 0.0009  200  CYS A N     
651  C CA    . CYS A 93  ? 0.2000 0.1979 0.1977 0.0007  0.0005  0.0009  200  CYS A CA    
652  C C     . CYS A 93  ? 0.1901 0.1859 0.1849 0.0016  0.0009  0.0023  200  CYS A C     
653  O O     . CYS A 93  ? 0.2090 0.1969 0.1960 0.0029  0.0094  0.0047  200  CYS A O     
654  C CB    . CYS A 93  ? 0.2003 0.2017 0.1997 0.0000  0.0000  0.0012  200  CYS A CB    
655  S SG    . CYS A 93  ? 0.2194 0.2176 0.2170 0.0046  0.0002  0.0030  200  CYS A SG    
656  N N     . ILE A 94  ? 0.1709 0.1679 0.1655 0.0021  0.0014  0.0009  201  ILE A N     
657  C CA    . ILE A 94  ? 0.1565 0.1490 0.1487 0.0013  0.0013  0.0011  201  ILE A CA    
658  C C     . ILE A 94  ? 0.1346 0.1308 0.1274 0.0004  -0.0027 0.0037  201  ILE A C     
659  O O     . ILE A 94  ? 0.1268 0.1234 0.1174 0.0011  -0.0061 0.0048  201  ILE A O     
660  C CB    . ILE A 94  ? 0.1574 0.1508 0.1480 0.0019  0.0006  0.0008  201  ILE A CB    
661  C CG1   . ILE A 94  ? 0.1644 0.1581 0.1638 0.0000  0.0000  0.0022  201  ILE A CG1   
662  C CG2   . ILE A 94  ? 0.1494 0.1454 0.1374 0.0002  -0.0021 -0.0003 201  ILE A CG2   
663  C CD1   . ILE A 94  ? 0.1794 0.1728 0.1776 -0.0010 0.0042  -0.0016 201  ILE A CD1   
664  N N     . SER A 95  ? 0.1140 0.1186 0.1105 0.0020  -0.0047 0.0033  202  SER A N     
665  C CA    . SER A 95  ? 0.1064 0.1113 0.1053 -0.0001 -0.0038 0.0009  202  SER A CA    
666  C C     . SER A 95  ? 0.1138 0.1117 0.1107 -0.0002 0.0017  -0.0002 202  SER A C     
667  O O     . SER A 95  ? 0.1141 0.1151 0.1109 -0.0043 0.0010  -0.0032 202  SER A O     
668  C CB    . SER A 95  ? 0.1080 0.1089 0.1066 0.0023  -0.0008 0.0010  202  SER A CB    
669  O OG    . SER A 95  ? 0.0863 0.0915 0.0842 0.0001  -0.0117 0.0024  202  SER A OG    
670  N N     . THR A 96  ? 0.1091 0.1068 0.1081 -0.0001 0.0014  -0.0001 203  THR A N     
671  C CA    . THR A 96  ? 0.1010 0.1030 0.0996 0.0009  -0.0025 0.0011  203  THR A CA    
672  C C     . THR A 96  ? 0.0911 0.0952 0.0929 -0.0005 -0.0018 0.0001  203  THR A C     
673  O O     . THR A 96  ? 0.0791 0.0934 0.0844 0.0008  -0.0090 0.0020  203  THR A O     
674  C CB    . THR A 96  ? 0.1082 0.1073 0.1078 0.0008  0.0021  0.0001  203  THR A CB    
675  O OG1   . THR A 96  ? 0.1268 0.1139 0.1060 -0.0001 0.0021  0.0017  203  THR A OG1   
676  C CG2   . THR A 96  ? 0.1181 0.1157 0.1140 -0.0014 -0.0007 0.0008  203  THR A CG2   
677  N N     . ASN A 97  ? 0.0855 0.0859 0.0819 -0.0010 -0.0026 -0.0003 204  ASN A N     
678  C CA    . ASN A 97  ? 0.0787 0.0831 0.0781 -0.0009 -0.0024 -0.0007 204  ASN A CA    
679  C C     . ASN A 97  ? 0.0665 0.0713 0.0649 -0.0006 -0.0017 0.0000  204  ASN A C     
680  O O     . ASN A 97  ? 0.0597 0.0666 0.0601 0.0018  0.0000  0.0045  204  ASN A O     
681  C CB    . ASN A 97  ? 0.0871 0.0894 0.0901 -0.0019 0.0002  -0.0015 204  ASN A CB    
682  C CG    . ASN A 97  ? 0.1168 0.1193 0.1073 0.0012  -0.0008 -0.0012 204  ASN A CG    
683  O OD1   . ASN A 97  ? 0.1575 0.1432 0.1574 -0.0079 0.0022  -0.0029 204  ASN A OD1   
684  N ND2   . ASN A 97  ? 0.1419 0.1278 0.1383 -0.0059 0.0033  0.0016  204  ASN A ND2   
685  N N     . ALA A 98  ? 0.0507 0.0595 0.0511 -0.0008 -0.0064 0.0009  205  ALA A N     
686  C CA    . ALA A 98  ? 0.0581 0.0568 0.0541 0.0000  0.0004  0.0002  205  ALA A CA    
687  C C     . ALA A 98  ? 0.0491 0.0530 0.0504 0.0000  -0.0016 0.0002  205  ALA A C     
688  O O     . ALA A 98  ? 0.0583 0.0583 0.0452 0.0001  0.0006  0.0010  205  ALA A O     
689  C CB    . ALA A 98  ? 0.0528 0.0561 0.0565 0.0012  -0.0016 0.0015  205  ALA A CB    
690  N N     . LEU A 99  ? 0.0542 0.0541 0.0486 0.0031  0.0000  0.0023  206  LEU A N     
691  C CA    . LEU A 99  ? 0.0503 0.0529 0.0506 0.0017  0.0000  0.0014  206  LEU A CA    
692  C C     . LEU A 99  ? 0.0416 0.0444 0.0411 0.0003  -0.0016 0.0014  206  LEU A C     
693  O O     . LEU A 99  ? 0.0422 0.0467 0.0401 0.0001  0.0002  0.0010  206  LEU A O     
694  C CB    . LEU A 99  ? 0.0561 0.0534 0.0570 -0.0008 -0.0006 0.0010  206  LEU A CB    
695  C CG    . LEU A 99  ? 0.0698 0.0693 0.0690 0.0002  0.0032  -0.0006 206  LEU A CG    
696  C CD1   . LEU A 99  ? 0.0770 0.0743 0.0795 -0.0019 0.0026  -0.0004 206  LEU A CD1   
697  C CD2   . LEU A 99  ? 0.0771 0.0735 0.0785 0.0000  0.0007  0.0007  206  LEU A CD2   
698  N N     . LEU A 100 ? 0.0300 0.0354 0.0338 -0.0008 -0.0019 0.0000  207  LEU A N     
699  C CA    . LEU A 100 ? 0.0323 0.0320 0.0297 -0.0006 -0.0006 0.0005  207  LEU A CA    
700  C C     . LEU A 100 ? 0.0278 0.0296 0.0259 -0.0005 -0.0012 0.0000  207  LEU A C     
701  O O     . LEU A 100 ? 0.0326 0.0314 0.0255 -0.0012 -0.0012 -0.0002 207  LEU A O     
702  C CB    . LEU A 100 ? 0.0286 0.0317 0.0270 -0.0008 -0.0024 0.0006  207  LEU A CB    
703  C CG    . LEU A 100 ? 0.0308 0.0328 0.0266 0.0002  -0.0013 0.0008  207  LEU A CG    
704  C CD1   . LEU A 100 ? 0.0380 0.0364 0.0371 0.0000  -0.0016 0.0001  207  LEU A CD1   
705  C CD2   . LEU A 100 ? 0.0290 0.0296 0.0270 -0.0014 -0.0020 -0.0007 207  LEU A CD2   
706  N N     . PRO A 101 ? 0.0292 0.0285 0.0299 0.0007  0.0004  0.0004  208  PRO A N     
707  C CA    . PRO A 101 ? 0.0282 0.0290 0.0269 0.0009  -0.0015 0.0011  208  PRO A CA    
708  C C     . PRO A 101 ? 0.0271 0.0278 0.0273 0.0007  -0.0010 0.0013  208  PRO A C     
709  O O     . PRO A 101 ? 0.0363 0.0303 0.0379 -0.0003 0.0026  -0.0009 208  PRO A O     
710  C CB    . PRO A 101 ? 0.0270 0.0298 0.0262 0.0000  -0.0011 0.0008  208  PRO A CB    
711  C CG    . PRO A 101 ? 0.0323 0.0326 0.0343 -0.0005 -0.0007 0.0007  208  PRO A CG    
712  C CD    . PRO A 101 ? 0.0272 0.0278 0.0260 0.0003  0.0002  0.0006  208  PRO A CD    
713  N N     . ASP A 102 ? 0.0272 0.0261 0.0254 0.0011  -0.0004 -0.0002 209  ASP A N     
714  C CA    . ASP A 102 ? 0.0258 0.0264 0.0261 0.0003  -0.0004 0.0003  209  ASP A CA    
715  C C     . ASP A 102 ? 0.0259 0.0267 0.0263 -0.0003 -0.0006 0.0009  209  ASP A C     
716  O O     . ASP A 102 ? 0.0259 0.0287 0.0279 -0.0009 0.0002  0.0018  209  ASP A O     
717  C CB    . ASP A 102 ? 0.0263 0.0291 0.0266 0.0013  -0.0004 0.0008  209  ASP A CB    
718  C CG    . ASP A 102 ? 0.0378 0.0332 0.0365 0.0011  0.0034  0.0018  209  ASP A CG    
719  O OD1   . ASP A 102 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  209  ASP A OD1   
720  O OD2   . ASP A 102 ? 0.0482 0.0430 0.0368 0.0050  -0.0061 0.0019  209  ASP A OD2   
721  N N     . PRO A 103 ? 0.0262 0.0282 0.0262 0.0005  -0.0006 0.0007  210  PRO A N     
722  C CA    . PRO A 103 ? 0.0320 0.0319 0.0307 0.0003  0.0000  0.0002  210  PRO A CA    
723  C C     . PRO A 103 ? 0.0355 0.0374 0.0385 0.0008  0.0003  0.0015  210  PRO A C     
724  O O     . PRO A 103 ? 0.0311 0.0381 0.0366 0.0007  -0.0036 0.0029  210  PRO A O     
725  C CB    . PRO A 103 ? 0.0283 0.0305 0.0303 -0.0005 -0.0010 0.0001  210  PRO A CB    
726  C CG    . PRO A 103 ? 0.0305 0.0275 0.0257 0.0001  -0.0013 -0.0004 210  PRO A CG    
727  C CD    . PRO A 103 ? 0.0292 0.0278 0.0259 -0.0014 -0.0003 -0.0006 210  PRO A CD    
728  N N     . TYR A 104 ? 0.0406 0.0389 0.0410 0.0000  0.0015  0.0011  211  TYR A N     
729  C CA    . TYR A 104 ? 0.0420 0.0419 0.0425 0.0011  0.0008  0.0016  211  TYR A CA    
730  C C     . TYR A 104 ? 0.0473 0.0467 0.0464 -0.0010 0.0002  -0.0009 211  TYR A C     
731  O O     . TYR A 104 ? 0.0461 0.0524 0.0534 0.0000  0.0048  0.0036  211  TYR A O     
732  C CB    . TYR A 104 ? 0.0433 0.0417 0.0465 -0.0023 0.0016  0.0003  211  TYR A CB    
733  C CG    . TYR A 104 ? 0.0287 0.0315 0.0272 0.0018  -0.0021 0.0006  211  TYR A CG    
734  C CD1   . TYR A 104 ? 0.0385 0.0293 0.0300 -0.0057 0.0052  -0.0011 211  TYR A CD1   
735  C CD2   . TYR A 104 ? 0.0253 0.0267 0.0348 0.0001  0.0003  0.0037  211  TYR A CD2   
736  C CE1   . TYR A 104 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  211  TYR A CE1   
737  C CE2   . TYR A 104 ? 0.0255 0.0253 0.0253 0.0000  0.0000  0.0000  211  TYR A CE2   
738  C CZ    . TYR A 104 ? 0.0254 0.0290 0.0318 -0.0003 0.0005  0.0016  211  TYR A CZ    
739  O OH    . TYR A 104 ? 0.0281 0.0253 0.0253 0.0004  -0.0003 0.0000  211  TYR A OH    
740  N N     . GLU A 105 ? 0.0487 0.0510 0.0502 -0.0010 -0.0013 -0.0011 212  GLU A N     
741  C CA    . GLU A 105 ? 0.0570 0.0593 0.0589 -0.0005 0.0000  -0.0011 212  GLU A CA    
742  C C     . GLU A 105 ? 0.0637 0.0654 0.0634 0.0001  0.0000  0.0003  212  GLU A C     
743  O O     . GLU A 105 ? 0.0545 0.0659 0.0628 0.0004  -0.0033 -0.0006 212  GLU A O     
744  C CB    . GLU A 105 ? 0.0575 0.0575 0.0566 -0.0001 -0.0028 0.0001  212  GLU A CB    
745  C CG    . GLU A 105 ? 0.0613 0.0624 0.0638 -0.0009 0.0000  -0.0008 212  GLU A CG    
746  C CD    . GLU A 105 ? 0.0636 0.0630 0.0629 -0.0003 -0.0021 -0.0003 212  GLU A CD    
747  O OE1   . GLU A 105 ? 0.0570 0.0653 0.0676 0.0048  0.0002  0.0016  212  GLU A OE1   
748  O OE2   . GLU A 105 ? 0.0683 0.0641 0.0624 0.0030  -0.0009 0.0017  212  GLU A OE2   
749  N N     . SER A 106 ? 0.0664 0.0724 0.0714 -0.0003 -0.0018 -0.0016 213  SER A N     
750  C CA    . SER A 106 ? 0.0785 0.0805 0.0797 0.0002  -0.0010 0.0007  213  SER A CA    
751  C C     . SER A 106 ? 0.0797 0.0804 0.0789 0.0008  0.0004  0.0009  213  SER A C     
752  O O     . SER A 106 ? 0.0816 0.0820 0.0762 0.0022  -0.0038 0.0021  213  SER A O     
753  C CB    . SER A 106 ? 0.0890 0.0868 0.0859 0.0000  0.0017  -0.0009 213  SER A CB    
754  O OG    . SER A 106 ? 0.1276 0.1105 0.1305 0.0001  0.0077  0.0038  213  SER A OG    
755  N N     . GLU A 107 ? 0.0779 0.0774 0.0771 -0.0001 -0.0007 -0.0002 214  GLU A N     
756  C CA    . GLU A 107 ? 0.0761 0.0770 0.0744 0.0005  -0.0031 -0.0002 214  GLU A CA    
757  C C     . GLU A 107 ? 0.0688 0.0680 0.0678 0.0005  -0.0010 0.0003  214  GLU A C     
758  O O     . GLU A 107 ? 0.0544 0.0599 0.0520 0.0016  -0.0036 0.0000  214  GLU A O     
759  C CB    . GLU A 107 ? 0.0845 0.0875 0.0837 0.0003  -0.0007 0.0028  214  GLU A CB    
760  C CG    . GLU A 107 ? 0.1219 0.1134 0.1177 -0.0022 -0.0024 -0.0052 214  GLU A CG    
761  C CD    . GLU A 107 ? 0.1587 0.1653 0.1567 -0.0017 0.0103  -0.0016 214  GLU A CD    
762  O OE1   . GLU A 107 ? 0.1821 0.1869 0.1850 -0.0078 0.0044  -0.0040 214  GLU A OE1   
763  O OE2   . GLU A 107 ? 0.1879 0.1751 0.1756 -0.0020 0.0053  -0.0046 214  GLU A OE2   
764  N N     . ARG A 108 ? 0.0603 0.0625 0.0576 0.0007  -0.0034 0.0000  215  ARG A N     
765  C CA    . ARG A 108 ? 0.0593 0.0629 0.0636 0.0006  -0.0001 0.0000  215  ARG A CA    
766  C C     . ARG A 108 ? 0.0504 0.0523 0.0537 -0.0005 -0.0013 -0.0005 215  ARG A C     
767  O O     . ARG A 108 ? 0.0357 0.0468 0.0440 0.0003  -0.0016 0.0025  215  ARG A O     
768  C CB    . ARG A 108 ? 0.0648 0.0665 0.0676 -0.0010 -0.0066 0.0021  215  ARG A CB    
769  C CG    . ARG A 108 ? 0.0980 0.1012 0.1074 0.0018  0.0053  -0.0011 215  ARG A CG    
770  C CD    . ARG A 108 ? 0.1344 0.1299 0.1402 -0.0008 0.0001  0.0097  215  ARG A CD    
771  N NE    . ARG A 108 ? 0.1919 0.1764 0.1743 0.0006  0.0026  0.0041  215  ARG A NE    
772  C CZ    . ARG A 108 ? 0.1979 0.1889 0.1928 0.0062  0.0040  0.0044  215  ARG A CZ    
773  N NH1   . ARG A 108 ? 0.1914 0.1950 0.2041 -0.0025 -0.0007 0.0020  215  ARG A NH1   
774  N NH2   . ARG A 108 ? 0.2154 0.2149 0.2199 -0.0008 -0.0016 -0.0040 215  ARG A NH2   
775  N N     . VAL A 109 ? 0.0355 0.0417 0.0399 -0.0008 -0.0034 0.0006  216  VAL A N     
776  C CA    . VAL A 109 ? 0.0338 0.0385 0.0383 -0.0007 -0.0035 0.0003  216  VAL A CA    
777  C C     . VAL A 109 ? 0.0375 0.0381 0.0374 0.0001  0.0000  0.0003  216  VAL A C     
778  O O     . VAL A 109 ? 0.0329 0.0336 0.0262 -0.0022 -0.0026 0.0013  216  VAL A O     
779  C CB    . VAL A 109 ? 0.0343 0.0390 0.0388 -0.0009 -0.0023 -0.0019 216  VAL A CB    
780  C CG1   . VAL A 109 ? 0.0461 0.0447 0.0515 -0.0007 0.0025  -0.0010 216  VAL A CG1   
781  C CG2   . VAL A 109 ? 0.0344 0.0370 0.0360 0.0005  -0.0029 0.0020  216  VAL A CG2   
782  N N     . TYR A 110 ? 0.0333 0.0385 0.0328 -0.0003 -0.0030 -0.0017 217  TYR A N     
783  C CA    . TYR A 110 ? 0.0348 0.0362 0.0330 -0.0011 -0.0011 -0.0010 217  TYR A CA    
784  C C     . TYR A 110 ? 0.0361 0.0371 0.0318 -0.0026 0.0000  -0.0004 217  TYR A C     
785  O O     . TYR A 110 ? 0.0372 0.0399 0.0368 -0.0058 -0.0008 -0.0016 217  TYR A O     
786  C CB    . TYR A 110 ? 0.0305 0.0354 0.0303 -0.0001 -0.0020 -0.0013 217  TYR A CB    
787  C CG    . TYR A 110 ? 0.0298 0.0312 0.0293 0.0009  -0.0018 0.0038  217  TYR A CG    
788  C CD1   . TYR A 110 ? 0.0254 0.0342 0.0368 0.0008  0.0002  -0.0016 217  TYR A CD1   
789  C CD2   . TYR A 110 ? 0.0305 0.0287 0.0328 -0.0007 0.0005  0.0013  217  TYR A CD2   
790  C CE1   . TYR A 110 ? 0.0301 0.0308 0.0272 -0.0021 0.0005  0.0025  217  TYR A CE1   
791  C CE2   . TYR A 110 ? 0.0255 0.0302 0.0300 0.0002  -0.0009 -0.0010 217  TYR A CE2   
792  C CZ    . TYR A 110 ? 0.0260 0.0276 0.0324 0.0008  0.0012  0.0040  217  TYR A CZ    
793  O OH    . TYR A 110 ? 0.0351 0.0403 0.0381 -0.0056 -0.0035 -0.0075 217  TYR A OH    
794  N N     . VAL A 111 ? 0.0283 0.0335 0.0308 0.0000  -0.0040 -0.0003 218  VAL A N     
795  C CA    . VAL A 111 ? 0.0323 0.0361 0.0338 -0.0011 -0.0028 -0.0002 218  VAL A CA    
796  C C     . VAL A 111 ? 0.0306 0.0349 0.0355 -0.0004 -0.0016 -0.0002 218  VAL A C     
797  O O     . VAL A 111 ? 0.0475 0.0379 0.0390 0.0006  0.0000  -0.0007 218  VAL A O     
798  C CB    . VAL A 111 ? 0.0334 0.0403 0.0402 -0.0005 -0.0017 -0.0002 218  VAL A CB    
799  C CG1   . VAL A 111 ? 0.0458 0.0475 0.0494 -0.0013 0.0016  -0.0046 218  VAL A CG1   
800  C CG2   . VAL A 111 ? 0.0418 0.0457 0.0428 0.0000  -0.0026 0.0022  218  VAL A CG2   
801  N N     . ALA A 112 ? 0.0274 0.0333 0.0367 -0.0001 -0.0011 0.0003  219  ALA A N     
802  C CA    . ALA A 112 ? 0.0279 0.0330 0.0334 0.0002  -0.0015 0.0006  219  ALA A CA    
803  C C     . ALA A 112 ? 0.0256 0.0344 0.0387 -0.0003 -0.0016 0.0004  219  ALA A C     
804  O O     . ALA A 112 ? 0.0253 0.0342 0.0427 0.0002  -0.0005 0.0010  219  ALA A O     
805  C CB    . ALA A 112 ? 0.0293 0.0334 0.0391 -0.0008 -0.0005 -0.0018 219  ALA A CB    
806  N N     . GLU A 113 ? 0.0328 0.0385 0.0348 -0.0004 -0.0033 0.0009  220  GLU A N     
807  C CA    . GLU A 113 ? 0.0428 0.0445 0.0455 0.0008  -0.0003 0.0000  220  GLU A CA    
808  C C     . GLU A 113 ? 0.0410 0.0433 0.0409 0.0000  -0.0008 -0.0008 220  GLU A C     
809  O O     . GLU A 113 ? 0.0402 0.0456 0.0430 0.0034  0.0004  -0.0013 220  GLU A O     
810  C CB    . GLU A 113 ? 0.0540 0.0533 0.0516 -0.0018 0.0016  0.0002  220  GLU A CB    
811  C CG    . GLU A 113 ? 0.0692 0.0692 0.0678 0.0002  0.0005  -0.0033 220  GLU A CG    
812  C CD    . GLU A 113 ? 0.0942 0.0962 0.0871 0.0015  0.0066  0.0023  220  GLU A CD    
813  O OE1   . GLU A 113 ? 0.1322 0.1140 0.1270 0.0080  0.0077  0.0057  220  GLU A OE1   
814  O OE2   . GLU A 113 ? 0.0762 0.0882 0.0679 0.0035  -0.0041 0.0009  220  GLU A OE2   
815  N N     . SER A 114 ? 0.0351 0.0422 0.0394 0.0010  -0.0031 0.0008  221  SER A N     
816  C CA    . SER A 114 ? 0.0401 0.0427 0.0404 -0.0003 -0.0015 0.0005  221  SER A CA    
817  C C     . SER A 114 ? 0.0408 0.0461 0.0424 0.0004  -0.0024 0.0009  221  SER A C     
818  O O     . SER A 114 ? 0.0309 0.0436 0.0342 -0.0003 -0.0070 0.0007  221  SER A O     
819  C CB    . SER A 114 ? 0.0384 0.0424 0.0388 0.0000  -0.0018 0.0003  221  SER A CB    
820  O OG    . SER A 114 ? 0.0444 0.0417 0.0506 0.0009  0.0000  0.0006  221  SER A OG    
821  N N     . LEU A 115 ? 0.0479 0.0525 0.0476 -0.0014 -0.0015 0.0000  222  LEU A N     
822  C CA    . LEU A 115 ? 0.0571 0.0597 0.0562 0.0001  -0.0020 -0.0013 222  LEU A CA    
823  C C     . LEU A 115 ? 0.0533 0.0568 0.0527 0.0002  -0.0016 -0.0006 222  LEU A C     
824  O O     . LEU A 115 ? 0.0540 0.0525 0.0474 -0.0013 0.0004  -0.0030 222  LEU A O     
825  C CB    . LEU A 115 ? 0.0641 0.0695 0.0678 -0.0010 0.0000  0.0000  222  LEU A CB    
826  C CG    . LEU A 115 ? 0.0928 0.0877 0.0910 0.0022  -0.0007 -0.0042 222  LEU A CG    
827  C CD1   . LEU A 115 ? 0.1097 0.1159 0.1250 -0.0016 0.0058  -0.0027 222  LEU A CD1   
828  C CD2   . LEU A 115 ? 0.1081 0.1027 0.1074 -0.0012 0.0026  0.0009  222  LEU A CD2   
829  N N     . ILE A 116 ? 0.0536 0.0517 0.0462 -0.0004 0.0009  -0.0006 223  ILE A N     
830  C CA    . ILE A 116 ? 0.0509 0.0511 0.0505 -0.0006 0.0014  -0.0005 223  ILE A CA    
831  C C     . ILE A 116 ? 0.0494 0.0487 0.0487 -0.0007 0.0009  -0.0007 223  ILE A C     
832  O O     . ILE A 116 ? 0.0357 0.0415 0.0291 0.0004  -0.0034 -0.0006 223  ILE A O     
833  C CB    . ILE A 116 ? 0.0473 0.0490 0.0476 0.0002  -0.0026 -0.0015 223  ILE A CB    
834  C CG1   . ILE A 116 ? 0.0672 0.0596 0.0642 0.0000  0.0062  -0.0002 223  ILE A CG1   
835  C CG2   . ILE A 116 ? 0.0368 0.0457 0.0366 -0.0006 -0.0060 0.0000  223  ILE A CG2   
836  C CD1   . ILE A 116 ? 0.0641 0.0618 0.0577 0.0012  -0.0021 -0.0003 223  ILE A CD1   
837  N N     . SER A 117 ? 0.0492 0.0466 0.0421 -0.0016 -0.0013 -0.0011 224  SER A N     
838  C CA    . SER A 117 ? 0.0479 0.0506 0.0477 0.0004  -0.0018 0.0004  224  SER A CA    
839  C C     . SER A 117 ? 0.0418 0.0424 0.0417 0.0004  -0.0008 -0.0006 224  SER A C     
840  O O     . SER A 117 ? 0.0335 0.0379 0.0341 0.0003  -0.0043 -0.0011 224  SER A O     
841  C CB    . SER A 117 ? 0.0609 0.0552 0.0580 -0.0005 0.0034  -0.0024 224  SER A CB    
842  O OG    . SER A 117 ? 0.0876 0.0834 0.0819 -0.0002 0.0125  -0.0004 224  SER A OG    
843  N N     . SER A 118 ? 0.0344 0.0408 0.0388 0.0014  -0.0033 0.0005  225  SER A N     
844  C CA    . SER A 118 ? 0.0347 0.0396 0.0429 0.0014  -0.0015 -0.0001 225  SER A CA    
845  C C     . SER A 118 ? 0.0367 0.0414 0.0440 0.0014  -0.0018 0.0003  225  SER A C     
846  O O     . SER A 118 ? 0.0342 0.0420 0.0506 0.0036  -0.0031 -0.0011 225  SER A O     
847  C CB    . SER A 118 ? 0.0333 0.0382 0.0377 0.0006  -0.0027 0.0004  225  SER A CB    
848  O OG    . SER A 118 ? 0.0336 0.0407 0.0461 -0.0032 -0.0005 -0.0060 225  SER A OG    
849  N N     . ALA A 119 ? 0.0400 0.0428 0.0456 0.0025  -0.0013 0.0002  226  ALA A N     
850  C CA    . ALA A 119 ? 0.0438 0.0433 0.0452 0.0007  -0.0002 0.0000  226  ALA A CA    
851  C C     . ALA A 119 ? 0.0449 0.0421 0.0406 -0.0001 -0.0001 0.0000  226  ALA A C     
852  O O     . ALA A 119 ? 0.0568 0.0511 0.0416 -0.0027 -0.0014 -0.0014 226  ALA A O     
853  C CB    . ALA A 119 ? 0.0411 0.0432 0.0479 -0.0006 -0.0005 0.0007  226  ALA A CB    
854  N N     . GLY A 120 ? 0.0429 0.0407 0.0385 0.0000  0.0007  -0.0018 227  GLY A N     
855  C CA    . GLY A 120 ? 0.0359 0.0371 0.0361 0.0002  0.0000  -0.0007 227  GLY A CA    
856  C C     . GLY A 120 ? 0.0326 0.0351 0.0323 -0.0003 0.0002  -0.0009 227  GLY A C     
857  O O     . GLY A 120 ? 0.0330 0.0328 0.0263 0.0016  -0.0022 -0.0020 227  GLY A O     
858  N N     . GLU A 121 ? 0.0274 0.0328 0.0278 -0.0010 -0.0017 -0.0019 228  GLU A N     
859  C CA    . GLU A 121 ? 0.0282 0.0328 0.0278 -0.0004 -0.0022 -0.0010 228  GLU A CA    
860  C C     . GLU A 121 ? 0.0310 0.0299 0.0267 -0.0007 -0.0007 -0.0023 228  GLU A C     
861  O O     . GLU A 121 ? 0.0320 0.0329 0.0295 -0.0006 -0.0026 -0.0039 228  GLU A O     
862  C CB    . GLU A 121 ? 0.0354 0.0324 0.0278 -0.0008 -0.0002 -0.0028 228  GLU A CB    
863  C CG    . GLU A 121 ? 0.0353 0.0436 0.0412 -0.0018 -0.0026 0.0001  228  GLU A CG    
864  C CD    . GLU A 121 ? 0.0662 0.0627 0.0577 -0.0012 -0.0007 -0.0051 228  GLU A CD    
865  O OE1   . GLU A 121 ? 0.0756 0.0746 0.0742 0.0010  -0.0009 0.0001  228  GLU A OE1   
866  O OE2   . GLU A 121 ? 0.0821 0.0726 0.0792 -0.0087 0.0002  -0.0033 228  GLU A OE2   
867  N N     . GLY A 122 ? 0.0283 0.0297 0.0293 -0.0006 -0.0015 -0.0011 229  GLY A N     
868  C CA    . GLY A 122 ? 0.0288 0.0275 0.0272 -0.0008 -0.0015 -0.0011 229  GLY A CA    
869  C C     . GLY A 122 ? 0.0273 0.0271 0.0273 -0.0002 -0.0011 0.0004  229  GLY A C     
870  O O     . GLY A 122 ? 0.0282 0.0271 0.0263 -0.0007 -0.0006 -0.0009 229  GLY A O     
871  N N     . LEU A 123 ? 0.0263 0.0294 0.0286 -0.0010 -0.0013 -0.0007 230  LEU A N     
872  C CA    . LEU A 123 ? 0.0255 0.0268 0.0285 0.0000  -0.0006 -0.0009 230  LEU A CA    
873  C C     . LEU A 123 ? 0.0255 0.0288 0.0273 -0.0002 -0.0007 -0.0001 230  LEU A C     
874  O O     . LEU A 123 ? 0.0253 0.0258 0.0325 -0.0001 0.0004  -0.0018 230  LEU A O     
875  C CB    . LEU A 123 ? 0.0258 0.0296 0.0283 -0.0008 -0.0008 -0.0008 230  LEU A CB    
876  C CG    . LEU A 123 ? 0.0255 0.0283 0.0288 0.0006  -0.0006 -0.0016 230  LEU A CG    
877  C CD1   . LEU A 123 ? 0.0301 0.0319 0.0330 0.0000  -0.0017 -0.0039 230  LEU A CD1   
878  C CD2   . LEU A 123 ? 0.0302 0.0319 0.0365 0.0017  0.0028  -0.0017 230  LEU A CD2   
879  N N     . PHE A 124 ? 0.0253 0.0272 0.0253 0.0003  0.0000  -0.0003 231  PHE A N     
880  C CA    . PHE A 124 ? 0.0273 0.0307 0.0323 0.0005  0.0003  0.0007  231  PHE A CA    
881  C C     . PHE A 124 ? 0.0288 0.0330 0.0305 0.0007  0.0000  0.0001  231  PHE A C     
882  O O     . PHE A 124 ? 0.0258 0.0332 0.0328 0.0000  -0.0019 0.0012  231  PHE A O     
883  C CB    . PHE A 124 ? 0.0259 0.0301 0.0285 0.0004  -0.0013 -0.0002 231  PHE A CB    
884  C CG    . PHE A 124 ? 0.0338 0.0354 0.0328 -0.0001 -0.0006 -0.0006 231  PHE A CG    
885  C CD1   . PHE A 124 ? 0.0360 0.0466 0.0390 -0.0020 -0.0010 -0.0014 231  PHE A CD1   
886  C CD2   . PHE A 124 ? 0.0313 0.0376 0.0276 -0.0001 -0.0034 -0.0003 231  PHE A CD2   
887  C CE1   . PHE A 124 ? 0.0496 0.0537 0.0463 -0.0007 0.0006  -0.0032 231  PHE A CE1   
888  C CE2   . PHE A 124 ? 0.0373 0.0449 0.0396 -0.0007 0.0004  -0.0030 231  PHE A CE2   
889  C CZ    . PHE A 124 ? 0.0333 0.0324 0.0376 0.0001  0.0000  -0.0007 231  PHE A CZ    
890  N N     . SER A 125 ? 0.0325 0.0362 0.0335 0.0003  -0.0014 0.0027  232  SER A N     
891  C CA    . SER A 125 ? 0.0384 0.0405 0.0388 0.0001  0.0000  0.0008  232  SER A CA    
892  C C     . SER A 125 ? 0.0355 0.0390 0.0381 -0.0004 -0.0016 -0.0005 232  SER A C     
893  O O     . SER A 125 ? 0.0410 0.0323 0.0402 -0.0038 0.0050  -0.0030 232  SER A O     
894  C CB    . SER A 125 ? 0.0344 0.0386 0.0391 -0.0003 -0.0048 0.0010  232  SER A CB    
895  O OG    A SER A 125 ? 0.0724 0.0678 0.0606 0.0026  0.0034  0.0010  232  SER A OG    
896  O OG    B SER A 125 ? 0.0574 0.0586 0.0546 0.0030  0.0014  0.0011  232  SER A OG    
897  N N     . LYS A 126 ? 0.0383 0.0420 0.0371 -0.0009 -0.0025 -0.0011 233  LYS A N     
898  C CA    . LYS A 126 ? 0.0479 0.0462 0.0439 -0.0007 -0.0015 -0.0011 233  LYS A CA    
899  C C     . LYS A 126 ? 0.0513 0.0486 0.0455 0.0002  0.0005  -0.0010 233  LYS A C     
900  O O     . LYS A 126 ? 0.0582 0.0503 0.0474 -0.0004 -0.0001 -0.0016 233  LYS A O     
901  C CB    . LYS A 126 ? 0.0468 0.0469 0.0431 -0.0002 -0.0004 -0.0003 233  LYS A CB    
902  C CG    . LYS A 126 ? 0.0517 0.0564 0.0512 -0.0030 -0.0010 -0.0002 233  LYS A CG    
903  C CD    . LYS A 126 ? 0.0637 0.0560 0.0578 -0.0038 0.0034  -0.0039 233  LYS A CD    
904  C CE    . LYS A 126 ? 0.0608 0.0603 0.0577 0.0007  -0.0009 0.0015  233  LYS A CE    
905  N NZ    . LYS A 126 ? 0.0699 0.0583 0.0560 -0.0050 0.0006  -0.0007 233  LYS A NZ    
906  N N     . VAL A 127 ? 0.0602 0.0540 0.0538 0.0004  0.0020  -0.0001 234  VAL A N     
907  C CA    . VAL A 127 ? 0.0565 0.0565 0.0542 -0.0004 -0.0010 -0.0004 234  VAL A CA    
908  C C     . VAL A 127 ? 0.0569 0.0551 0.0589 -0.0002 0.0017  0.0006  234  VAL A C     
909  O O     . VAL A 127 ? 0.0550 0.0551 0.0612 0.0005  0.0013  0.0012  234  VAL A O     
910  C CB    . VAL A 127 ? 0.0597 0.0582 0.0585 -0.0004 0.0016  0.0004  234  VAL A CB    
911  C CG1   . VAL A 127 ? 0.0637 0.0624 0.0610 -0.0005 0.0010  -0.0013 234  VAL A CG1   
912  C CG2   . VAL A 127 ? 0.0559 0.0607 0.0550 -0.0019 -0.0016 -0.0008 234  VAL A CG2   
913  N N     . ALA A 128 ? 0.0553 0.0522 0.0533 0.0003  0.0014  0.0007  235  ALA A N     
914  C CA    . ALA A 128 ? 0.0496 0.0495 0.0473 0.0000  0.0000  0.0003  235  ALA A CA    
915  C C     . ALA A 128 ? 0.0462 0.0435 0.0432 -0.0001 -0.0011 0.0000  235  ALA A C     
916  O O     . ALA A 128 ? 0.0494 0.0431 0.0427 0.0001  0.0011  0.0030  235  ALA A O     
917  C CB    . ALA A 128 ? 0.0532 0.0511 0.0518 -0.0003 0.0014  0.0004  235  ALA A CB    
918  N N     . VAL A 129 ? 0.0403 0.0403 0.0361 0.0001  -0.0019 0.0001  236  VAL A N     
919  C CA    . VAL A 129 ? 0.0337 0.0359 0.0345 0.0004  -0.0016 0.0000  236  VAL A CA    
920  C C     . VAL A 129 ? 0.0338 0.0335 0.0333 0.0010  0.0011  0.0012  236  VAL A C     
921  O O     . VAL A 129 ? 0.0265 0.0328 0.0340 -0.0025 -0.0014 -0.0007 236  VAL A O     
922  C CB    . VAL A 129 ? 0.0315 0.0368 0.0333 0.0009  -0.0013 0.0016  236  VAL A CB    
923  C CG1   . VAL A 129 ? 0.0524 0.0414 0.0431 0.0024  0.0017  0.0014  236  VAL A CG1   
924  C CG2   . VAL A 129 ? 0.0276 0.0332 0.0316 0.0005  -0.0034 0.0022  236  VAL A CG2   
925  N N     . GLY A 130 ? 0.0282 0.0289 0.0312 0.0016  0.0003  0.0015  237  GLY A N     
926  C CA    . GLY A 130 ? 0.0276 0.0289 0.0263 0.0004  -0.0015 0.0002  237  GLY A CA    
927  C C     . GLY A 130 ? 0.0295 0.0282 0.0291 -0.0010 0.0003  -0.0008 237  GLY A C     
928  O O     . GLY A 130 ? 0.0270 0.0253 0.0265 0.0002  -0.0014 -0.0002 237  GLY A O     
929  N N     . PRO A 131 ? 0.0305 0.0303 0.0267 -0.0004 -0.0008 -0.0009 238  PRO A N     
930  C CA    . PRO A 131 ? 0.0275 0.0292 0.0271 -0.0006 -0.0011 -0.0015 238  PRO A CA    
931  C C     . PRO A 131 ? 0.0299 0.0302 0.0263 0.0005  -0.0009 0.0000  238  PRO A C     
932  O O     . PRO A 131 ? 0.0257 0.0274 0.0258 0.0009  -0.0004 -0.0010 238  PRO A O     
933  C CB    . PRO A 131 ? 0.0320 0.0315 0.0278 -0.0008 -0.0013 0.0010  238  PRO A CB    
934  C CG    . PRO A 131 ? 0.0329 0.0344 0.0391 0.0000  0.0005  -0.0015 238  PRO A CG    
935  C CD    . PRO A 131 ? 0.0325 0.0324 0.0294 -0.0021 0.0007  -0.0020 238  PRO A CD    
936  N N     . ASN A 132 ? 0.0296 0.0325 0.0321 -0.0025 -0.0017 -0.0029 239  ASN A N     
937  C CA    . ASN A 132 ? 0.0369 0.0378 0.0357 0.0005  -0.0033 0.0001  239  ASN A CA    
938  C C     . ASN A 132 ? 0.0311 0.0321 0.0291 -0.0017 -0.0027 -0.0009 239  ASN A C     
939  O O     . ASN A 132 ? 0.0343 0.0361 0.0301 -0.0030 -0.0033 0.0000  239  ASN A O     
940  C CB    . ASN A 132 ? 0.0422 0.0519 0.0430 -0.0016 -0.0039 -0.0029 239  ASN A CB    
941  C CG    . ASN A 132 ? 0.0973 0.0842 0.1001 0.0007  0.0003  0.0054  239  ASN A CG    
942  O OD1   . ASN A 132 ? 0.1281 0.1412 0.1456 0.0109  -0.0027 0.0068  239  ASN A OD1   
943  N ND2   . ASN A 132 ? 0.1338 0.1367 0.1500 -0.0057 0.0132  0.0041  239  ASN A ND2   
944  N N     . THR A 133 ? 0.0260 0.0264 0.0259 0.0000  -0.0006 -0.0001 240  THR A N     
945  C CA    . THR A 133 ? 0.0253 0.0256 0.0253 0.0000  0.0000  0.0000  240  THR A CA    
946  C C     . THR A 133 ? 0.0254 0.0264 0.0255 -0.0003 0.0001  -0.0005 240  THR A C     
947  O O     . THR A 133 ? 0.0255 0.0267 0.0260 -0.0005 0.0004  -0.0010 240  THR A O     
948  C CB    . THR A 133 ? 0.0260 0.0259 0.0284 -0.0003 0.0015  -0.0007 240  THR A CB    
949  O OG1   . THR A 133 ? 0.0306 0.0296 0.0262 -0.0006 -0.0017 0.0014  240  THR A OG1   
950  C CG2   . THR A 133 ? 0.0254 0.0292 0.0253 -0.0007 0.0000  -0.0004 240  THR A CG2   
951  N N     . VAL A 134 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  241  VAL A N     
952  C CA    . VAL A 134 ? 0.0253 0.0257 0.0253 0.0000  0.0000  -0.0001 241  VAL A CA    
953  C C     . VAL A 134 ? 0.0272 0.0291 0.0258 -0.0005 -0.0007 -0.0007 241  VAL A C     
954  O O     . VAL A 134 ? 0.0260 0.0311 0.0297 0.0018  -0.0007 -0.0002 241  VAL A O     
955  C CB    . VAL A 134 ? 0.0262 0.0262 0.0253 -0.0009 0.0000  0.0000  241  VAL A CB    
956  C CG1   . VAL A 134 ? 0.0253 0.0265 0.0267 0.0000  0.0000  0.0013  241  VAL A CG1   
957  C CG2   . VAL A 134 ? 0.0290 0.0276 0.0262 -0.0015 -0.0005 -0.0009 241  VAL A CG2   
958  N N     . MET A 135 ? 0.0355 0.0327 0.0298 -0.0001 0.0015  -0.0014 242  MET A N     
959  C CA    . MET A 135 ? 0.0357 0.0343 0.0346 -0.0016 0.0007  -0.0016 242  MET A CA    
960  C C     . MET A 135 ? 0.0304 0.0314 0.0269 0.0001  -0.0028 -0.0005 242  MET A C     
961  O O     . MET A 135 ? 0.0266 0.0281 0.0281 -0.0006 -0.0018 0.0006  242  MET A O     
962  C CB    . MET A 135 ? 0.0384 0.0357 0.0325 0.0019  -0.0005 0.0013  242  MET A CB    
963  C CG    . MET A 135 ? 0.0416 0.0395 0.0362 -0.0038 -0.0004 -0.0010 242  MET A CG    
964  S SD    . MET A 135 ? 0.0349 0.0520 0.0519 0.0015  -0.0021 0.0012  242  MET A SD    
965  C CE    . MET A 135 ? 0.0419 0.0543 0.0524 -0.0006 -0.0001 -0.0018 242  MET A CE    
966  N N     . SER A 136 ? 0.0302 0.0322 0.0297 -0.0003 -0.0021 0.0000  243  SER A N     
967  C CA    . SER A 136 ? 0.0358 0.0356 0.0349 -0.0001 -0.0004 0.0004  243  SER A CA    
968  C C     . SER A 136 ? 0.0345 0.0352 0.0343 -0.0004 -0.0001 -0.0004 243  SER A C     
969  O O     . SER A 136 ? 0.0430 0.0364 0.0418 -0.0002 0.0022  -0.0020 243  SER A O     
970  C CB    . SER A 136 ? 0.0387 0.0362 0.0309 0.0004  -0.0014 0.0004  243  SER A CB    
971  O OG    . SER A 136 ? 0.0483 0.0515 0.0483 -0.0012 -0.0016 0.0020  243  SER A OG    
972  N N     . PHE A 137 ? 0.0340 0.0346 0.0325 0.0007  -0.0008 -0.0003 244  PHE A N     
973  C CA    . PHE A 137 ? 0.0326 0.0309 0.0286 0.0006  -0.0004 -0.0005 244  PHE A CA    
974  C C     . PHE A 137 ? 0.0268 0.0289 0.0265 -0.0006 -0.0011 -0.0005 244  PHE A C     
975  O O     . PHE A 137 ? 0.0276 0.0301 0.0271 0.0000  -0.0020 0.0000  244  PHE A O     
976  C CB    . PHE A 137 ? 0.0271 0.0293 0.0267 -0.0008 -0.0013 -0.0006 244  PHE A CB    
977  C CG    . PHE A 137 ? 0.0291 0.0304 0.0271 0.0014  -0.0023 0.0004  244  PHE A CG    
978  C CD1   . PHE A 137 ? 0.0288 0.0278 0.0271 0.0017  -0.0021 -0.0001 244  PHE A CD1   
979  C CD2   . PHE A 137 ? 0.0283 0.0334 0.0274 -0.0010 -0.0020 -0.0015 244  PHE A CD2   
980  C CE1   . PHE A 137 ? 0.0303 0.0282 0.0269 -0.0023 0.0025  -0.0019 244  PHE A CE1   
981  C CE2   . PHE A 137 ? 0.0367 0.0304 0.0257 0.0000  0.0001  -0.0014 244  PHE A CE2   
982  C CZ    . PHE A 137 ? 0.0292 0.0275 0.0254 0.0013  0.0004  -0.0002 244  PHE A CZ    
983  N N     . TYR A 138 ? 0.0281 0.0283 0.0263 -0.0017 -0.0004 -0.0011 245  TYR A N     
984  C CA    . TYR A 138 ? 0.0261 0.0282 0.0274 -0.0006 -0.0010 -0.0005 245  TYR A CA    
985  C C     . TYR A 138 ? 0.0281 0.0318 0.0331 0.0002  -0.0003 0.0003  245  TYR A C     
986  O O     . TYR A 138 ? 0.0254 0.0317 0.0351 -0.0009 -0.0004 0.0003  245  TYR A O     
987  C CB    . TYR A 138 ? 0.0263 0.0281 0.0288 0.0003  0.0003  0.0001  245  TYR A CB    
988  C CG    . TYR A 138 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  245  TYR A CG    
989  C CD1   . TYR A 138 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  245  TYR A CD1   
990  C CD2   . TYR A 138 ? 0.0261 0.0309 0.0354 0.0021  0.0008  0.0019  245  TYR A CD2   
991  C CE1   . TYR A 138 ? 0.0258 0.0269 0.0257 0.0007  -0.0002 0.0000  245  TYR A CE1   
992  C CE2   . TYR A 138 ? 0.0259 0.0282 0.0278 0.0011  -0.0009 -0.0006 245  TYR A CE2   
993  C CZ    . TYR A 138 ? 0.0304 0.0293 0.0303 0.0028  0.0020  0.0016  245  TYR A CZ    
994  O OH    . TYR A 138 ? 0.0340 0.0266 0.0274 0.0033  -0.0007 0.0000  245  TYR A OH    
995  N N     . ASN A 139 ? 0.0359 0.0339 0.0352 -0.0001 -0.0006 -0.0002 246  ASN A N     
996  C CA    . ASN A 139 ? 0.0392 0.0382 0.0379 0.0000  -0.0006 -0.0001 246  ASN A CA    
997  C C     . ASN A 139 ? 0.0426 0.0407 0.0422 -0.0004 0.0001  0.0000  246  ASN A C     
998  O O     . ASN A 139 ? 0.0462 0.0432 0.0412 0.0007  -0.0002 0.0005  246  ASN A O     
999  C CB    . ASN A 139 ? 0.0390 0.0355 0.0368 0.0006  0.0000  0.0017  246  ASN A CB    
1000 C CG    . ASN A 139 ? 0.0352 0.0330 0.0378 -0.0006 0.0022  -0.0011 246  ASN A CG    
1001 O OD1   . ASN A 139 ? 0.0262 0.0318 0.0288 0.0023  0.0011  0.0034  246  ASN A OD1   
1002 N ND2   . ASN A 139 ? 0.0265 0.0397 0.0451 0.0030  -0.0029 0.0016  246  ASN A ND2   
1003 N N     . GLY A 140 ? 0.0485 0.0468 0.0435 0.0002  -0.0001 -0.0002 247  GLY A N     
1004 C CA    . GLY A 140 ? 0.0483 0.0478 0.0481 -0.0006 0.0005  -0.0007 247  GLY A CA    
1005 C C     . GLY A 140 ? 0.0550 0.0530 0.0540 -0.0003 0.0022  -0.0003 247  GLY A C     
1006 O O     . GLY A 140 ? 0.0570 0.0545 0.0509 -0.0001 0.0005  0.0030  247  GLY A O     
1007 N N     . VAL A 141 ? 0.0509 0.0554 0.0578 0.0003  0.0003  -0.0007 248  VAL A N     
1008 C CA    . VAL A 141 ? 0.0594 0.0570 0.0545 -0.0003 0.0003  -0.0002 248  VAL A CA    
1009 C C     . VAL A 141 ? 0.0558 0.0558 0.0543 -0.0007 -0.0001 0.0002  248  VAL A C     
1010 O O     . VAL A 141 ? 0.0544 0.0540 0.0467 0.0017  -0.0034 0.0037  248  VAL A O     
1011 C CB    . VAL A 141 ? 0.0560 0.0586 0.0554 -0.0003 -0.0011 0.0000  248  VAL A CB    
1012 C CG1   . VAL A 141 ? 0.0776 0.0667 0.0694 0.0003  0.0045  -0.0005 248  VAL A CG1   
1013 C CG2   . VAL A 141 ? 0.0596 0.0657 0.0631 -0.0031 -0.0010 -0.0043 248  VAL A CG2   
1014 N N     . ARG A 142 ? 0.0511 0.0534 0.0481 0.0002  -0.0031 0.0004  249  ARG A N     
1015 C CA    . ARG A 142 ? 0.0549 0.0560 0.0552 0.0012  -0.0027 0.0003  249  ARG A CA    
1016 C C     . ARG A 142 ? 0.0516 0.0534 0.0539 -0.0008 -0.0004 -0.0020 249  ARG A C     
1017 O O     . ARG A 142 ? 0.0455 0.0441 0.0370 -0.0023 -0.0068 -0.0068 249  ARG A O     
1018 C CB    . ARG A 142 ? 0.0647 0.0639 0.0637 -0.0004 0.0007  -0.0010 249  ARG A CB    
1019 C CG    . ARG A 142 ? 0.0776 0.0840 0.0860 0.0003  -0.0044 0.0013  249  ARG A CG    
1020 C CD    . ARG A 142 ? 0.1222 0.1222 0.1135 -0.0004 0.0034  -0.0030 249  ARG A CD    
1021 N NE    . ARG A 142 ? 0.1469 0.1525 0.1451 0.0078  -0.0037 0.0058  249  ARG A NE    
1022 C CZ    . ARG A 142 ? 0.1643 0.1747 0.1661 0.0001  0.0028  0.0011  249  ARG A CZ    
1023 N NH1   . ARG A 142 ? 0.1991 0.1873 0.1903 0.0016  0.0038  0.0054  249  ARG A NH1   
1024 N NH2   . ARG A 142 ? 0.1638 0.1690 0.1741 0.0025  0.0000  0.0032  249  ARG A NH2   
1025 N N     . ILE A 143 ? 0.0427 0.0483 0.0376 -0.0031 -0.0055 -0.0026 250  ILE A N     
1026 C CA    . ILE A 143 ? 0.0485 0.0498 0.0433 -0.0010 -0.0034 -0.0012 250  ILE A CA    
1027 C C     . ILE A 143 ? 0.0486 0.0501 0.0444 0.0006  -0.0014 0.0004  250  ILE A C     
1028 O O     . ILE A 143 ? 0.0494 0.0492 0.0491 0.0005  0.0015  -0.0022 250  ILE A O     
1029 C CB    . ILE A 143 ? 0.0525 0.0547 0.0563 -0.0011 0.0002  -0.0017 250  ILE A CB    
1030 C CG1   . ILE A 143 ? 0.0604 0.0592 0.0563 0.0003  -0.0001 0.0012  250  ILE A CG1   
1031 C CG2   . ILE A 143 ? 0.0671 0.0614 0.0674 -0.0022 0.0044  -0.0027 250  ILE A CG2   
1032 C CD1   . ILE A 143 ? 0.0697 0.0661 0.0660 0.0019  0.0029  0.0022  250  ILE A CD1   
1033 N N     . THR A 144 ? 0.0465 0.0487 0.0444 0.0009  -0.0022 0.0005  251  THR A N     
1034 C CA    . THR A 144 ? 0.0488 0.0504 0.0465 0.0008  -0.0010 0.0010  251  THR A CA    
1035 C C     . THR A 144 ? 0.0531 0.0547 0.0526 -0.0002 -0.0009 -0.0004 251  THR A C     
1036 O O     . THR A 144 ? 0.0463 0.0545 0.0454 -0.0021 -0.0031 -0.0035 251  THR A O     
1037 C CB    . THR A 144 ? 0.0480 0.0502 0.0503 -0.0001 0.0010  -0.0008 251  THR A CB    
1038 O OG1   . THR A 144 ? 0.0363 0.0414 0.0353 -0.0015 -0.0065 0.0002  251  THR A OG1   
1039 C CG2   . THR A 144 ? 0.0494 0.0462 0.0443 -0.0004 -0.0002 0.0007  251  THR A CG2   
1040 N N     . HIS A 145 ? 0.0649 0.0608 0.0610 -0.0006 0.0004  0.0009  252  HIS A N     
1041 C CA    . HIS A 145 ? 0.0686 0.0670 0.0684 -0.0005 -0.0015 0.0008  252  HIS A CA    
1042 C C     . HIS A 145 ? 0.0764 0.0735 0.0746 -0.0005 -0.0005 0.0000  252  HIS A C     
1043 O O     . HIS A 145 ? 0.0875 0.0755 0.0720 -0.0007 0.0013  0.0035  252  HIS A O     
1044 C CB    . HIS A 145 ? 0.0710 0.0684 0.0709 -0.0001 -0.0003 0.0004  252  HIS A CB    
1045 C CG    . HIS A 145 ? 0.0698 0.0710 0.0772 -0.0007 0.0002  -0.0012 252  HIS A CG    
1046 N ND1   . HIS A 145 ? 0.0862 0.0821 0.0820 -0.0013 0.0012  -0.0013 252  HIS A ND1   
1047 C CD2   . HIS A 145 ? 0.0745 0.0780 0.0787 -0.0006 -0.0003 0.0001  252  HIS A CD2   
1048 C CE1   . HIS A 145 ? 0.0695 0.0719 0.0779 0.0000  -0.0049 0.0009  252  HIS A CE1   
1049 N NE2   . HIS A 145 ? 0.0866 0.0838 0.0906 -0.0001 0.0028  0.0005  252  HIS A NE2   
1050 N N     . GLN A 146 ? 0.0871 0.0840 0.0819 -0.0002 -0.0002 0.0019  253  GLN A N     
1051 C CA    . GLN A 146 ? 0.0920 0.0913 0.0911 0.0015  -0.0005 0.0013  253  GLN A CA    
1052 C C     . GLN A 146 ? 0.0865 0.0893 0.0889 0.0016  -0.0029 0.0020  253  GLN A C     
1053 O O     . GLN A 146 ? 0.0917 0.0944 0.1032 0.0018  0.0044  -0.0021 253  GLN A O     
1054 C CB    . GLN A 146 ? 0.1009 0.1005 0.0999 0.0011  0.0000  0.0005  253  GLN A CB    
1055 C CG    . GLN A 146 ? 0.1281 0.1171 0.1253 -0.0020 0.0017  0.0019  253  GLN A CG    
1056 C CD    . GLN A 146 ? 0.1339 0.1511 0.1417 0.0025  -0.0017 0.0025  253  GLN A CD    
1057 O OE1   . GLN A 146 ? 0.1600 0.1630 0.1665 -0.0027 0.0054  0.0006  253  GLN A OE1   
1058 N NE2   . GLN A 146 ? 0.1668 0.1627 0.1823 0.0019  0.0035  -0.0031 253  GLN A NE2   
1059 N N     . GLU A 147 ? 0.0806 0.0865 0.0778 0.0028  -0.0052 0.0020  254  GLU A N     
1060 C CA    . GLU A 147 ? 0.0896 0.0909 0.0894 0.0000  -0.0006 0.0004  254  GLU A CA    
1061 C C     . GLU A 147 ? 0.0803 0.0833 0.0825 0.0002  -0.0022 0.0003  254  GLU A C     
1062 O O     . GLU A 147 ? 0.0744 0.0827 0.0873 -0.0007 -0.0023 -0.0018 254  GLU A O     
1063 C CB    . GLU A 147 ? 0.0953 0.0977 0.0889 0.0005  -0.0032 -0.0015 254  GLU A CB    
1064 C CG    . GLU A 147 ? 0.1218 0.1254 0.1200 -0.0069 0.0006  0.0014  254  GLU A CG    
1065 C CD    . GLU A 147 ? 0.1708 0.1562 0.1612 -0.0030 0.0087  -0.0094 254  GLU A CD    
1066 O OE1   . GLU A 147 ? 0.1595 0.1595 0.1459 -0.0039 0.0003  -0.0058 254  GLU A OE1   
1067 O OE2   . GLU A 147 ? 0.2003 0.1772 0.2019 -0.0104 0.0081  -0.0039 254  GLU A OE2   
1068 N N     . VAL A 148 ? 0.0831 0.0832 0.0841 -0.0002 0.0006  -0.0008 255  VAL A N     
1069 C CA    . VAL A 148 ? 0.0805 0.0822 0.0839 0.0003  0.0000  0.0004  255  VAL A CA    
1070 C C     . VAL A 148 ? 0.0848 0.0863 0.0853 0.0012  0.0000  -0.0002 255  VAL A C     
1071 O O     . VAL A 148 ? 0.0791 0.0799 0.0833 0.0014  -0.0014 0.0009  255  VAL A O     
1072 C CB    . VAL A 148 ? 0.0804 0.0811 0.0823 0.0014  0.0007  0.0003  255  VAL A CB    
1073 C CG1   . VAL A 148 ? 0.0778 0.0778 0.0791 -0.0014 -0.0002 -0.0014 255  VAL A CG1   
1074 C CG2   . VAL A 148 ? 0.0749 0.0786 0.0727 0.0001  -0.0035 0.0009  255  VAL A CG2   
1075 N N     . ASP A 149 ? 0.0957 0.0933 0.0965 0.0000  0.0022  0.0001  256  ASP A N     
1076 C CA    . ASP A 149 ? 0.1022 0.1014 0.1006 0.0002  0.0000  -0.0004 256  ASP A CA    
1077 C C     . ASP A 149 ? 0.1024 0.0986 0.1005 -0.0023 0.0016  -0.0013 256  ASP A C     
1078 O O     . ASP A 149 ? 0.1156 0.1076 0.1144 -0.0046 0.0070  -0.0027 256  ASP A O     
1079 C CB    . ASP A 149 ? 0.1141 0.1075 0.1091 -0.0018 0.0023  -0.0003 256  ASP A CB    
1080 C CG    . ASP A 149 ? 0.1241 0.1333 0.1273 0.0028  -0.0026 0.0000  256  ASP A CG    
1081 O OD1   . ASP A 149 ? 0.1404 0.1426 0.1428 -0.0006 -0.0035 -0.0003 256  ASP A OD1   
1082 O OD2   . ASP A 149 ? 0.1637 0.1603 0.1784 -0.0048 0.0054  0.0057  256  ASP A OD2   
1083 N N     . SER A 150 ? 0.0907 0.0908 0.0916 0.0002  0.0000  0.0016  257  SER A N     
1084 C CA    . SER A 150 ? 0.0854 0.0845 0.0840 -0.0001 -0.0009 0.0014  257  SER A CA    
1085 C C     . SER A 150 ? 0.0768 0.0785 0.0777 0.0019  -0.0018 0.0017  257  SER A C     
1086 O O     . SER A 150 ? 0.0800 0.0809 0.0783 0.0025  -0.0017 0.0044  257  SER A O     
1087 C CB    . SER A 150 ? 0.0904 0.0875 0.0841 0.0002  0.0004  0.0016  257  SER A CB    
1088 O OG    . SER A 150 ? 0.0986 0.0982 0.0870 -0.0015 -0.0027 0.0011  257  SER A OG    
1089 N N     . ARG A 151 ? 0.0679 0.0692 0.0654 -0.0004 -0.0016 0.0026  258  ARG A N     
1090 C CA    . ARG A 151 ? 0.0603 0.0617 0.0578 0.0013  -0.0027 0.0016  258  ARG A CA    
1091 C C     . ARG A 151 ? 0.0568 0.0568 0.0503 0.0000  -0.0011 0.0017  258  ARG A C     
1092 O O     . ARG A 151 ? 0.0474 0.0505 0.0417 0.0027  -0.0028 0.0054  258  ARG A O     
1093 C CB    . ARG A 151 ? 0.0608 0.0615 0.0576 0.0002  -0.0015 0.0004  258  ARG A CB    
1094 C CG    . ARG A 151 ? 0.0603 0.0595 0.0570 -0.0011 0.0008  0.0000  258  ARG A CG    
1095 C CD    . ARG A 151 ? 0.0525 0.0542 0.0539 -0.0023 -0.0009 0.0000  258  ARG A CD    
1096 N NE    . ARG A 151 ? 0.0502 0.0485 0.0439 -0.0013 -0.0038 0.0019  258  ARG A NE    
1097 C CZ    . ARG A 151 ? 0.0508 0.0507 0.0470 -0.0018 -0.0015 0.0003  258  ARG A CZ    
1098 N NH1   . ARG A 151 ? 0.0482 0.0529 0.0445 -0.0011 -0.0049 -0.0036 258  ARG A NH1   
1099 N NH2   . ARG A 151 ? 0.0553 0.0548 0.0515 -0.0010 0.0021  -0.0023 258  ARG A NH2   
1100 N N     . ASP A 152 ? 0.0549 0.0540 0.0494 0.0001  -0.0013 0.0015  259  ASP A N     
1101 C CA    . ASP A 152 ? 0.0509 0.0529 0.0451 0.0001  -0.0033 0.0002  259  ASP A CA    
1102 C C     . ASP A 152 ? 0.0453 0.0491 0.0439 0.0000  -0.0023 0.0002  259  ASP A C     
1103 O O     . ASP A 152 ? 0.0353 0.0448 0.0378 0.0016  -0.0056 0.0019  259  ASP A O     
1104 C CB    . ASP A 152 ? 0.0535 0.0570 0.0506 -0.0004 -0.0024 0.0007  259  ASP A CB    
1105 C CG    . ASP A 152 ? 0.0768 0.0781 0.0672 -0.0035 -0.0015 0.0022  259  ASP A CG    
1106 O OD1   . ASP A 152 ? 0.0904 0.0898 0.0832 0.0048  -0.0004 0.0036  259  ASP A OD1   
1107 O OD2   . ASP A 152 ? 0.1311 0.1178 0.0977 0.0015  0.0095  -0.0011 259  ASP A OD2   
1108 N N     . TRP A 153 ? 0.0497 0.0494 0.0472 0.0005  -0.0002 0.0013  260  TRP A N     
1109 C CA    . TRP A 153 ? 0.0478 0.0488 0.0476 0.0010  -0.0004 0.0012  260  TRP A CA    
1110 C C     . TRP A 153 ? 0.0429 0.0443 0.0408 0.0014  -0.0005 0.0022  260  TRP A C     
1111 O O     . TRP A 153 ? 0.0516 0.0481 0.0521 0.0029  0.0059  0.0033  260  TRP A O     
1112 C CB    . TRP A 153 ? 0.0556 0.0538 0.0553 0.0010  0.0005  0.0008  260  TRP A CB    
1113 C CG    . TRP A 153 ? 0.0690 0.0607 0.0625 -0.0007 0.0016  0.0032  260  TRP A CG    
1114 C CD1   . TRP A 153 ? 0.0728 0.0705 0.0698 -0.0008 0.0013  -0.0008 260  TRP A CD1   
1115 C CD2   . TRP A 153 ? 0.0615 0.0656 0.0598 0.0003  -0.0032 0.0038  260  TRP A CD2   
1116 N NE1   . TRP A 153 ? 0.0693 0.0722 0.0607 -0.0037 -0.0059 -0.0032 260  TRP A NE1   
1117 C CE2   . TRP A 153 ? 0.0724 0.0733 0.0666 -0.0010 -0.0030 -0.0016 260  TRP A CE2   
1118 C CE3   . TRP A 153 ? 0.0759 0.0701 0.0709 0.0012  -0.0004 0.0021  260  TRP A CE3   
1119 C CZ2   . TRP A 153 ? 0.0821 0.0804 0.0778 -0.0056 0.0017  -0.0040 260  TRP A CZ2   
1120 C CZ3   . TRP A 153 ? 0.0774 0.0774 0.0791 0.0014  -0.0012 0.0035  260  TRP A CZ3   
1121 C CH2   . TRP A 153 ? 0.0724 0.0758 0.0773 0.0005  -0.0038 0.0013  260  TRP A CH2   
1122 N N     . ALA A 154 ? 0.0368 0.0375 0.0315 0.0018  -0.0019 0.0001  261  ALA A N     
1123 C CA    . ALA A 154 ? 0.0372 0.0356 0.0337 0.0019  -0.0006 0.0005  261  ALA A CA    
1124 C C     . ALA A 154 ? 0.0374 0.0344 0.0299 0.0001  -0.0002 0.0003  261  ALA A C     
1125 O O     . ALA A 154 ? 0.0484 0.0334 0.0257 0.0004  0.0017  0.0015  261  ALA A O     
1126 C CB    . ALA A 154 ? 0.0386 0.0379 0.0373 0.0005  0.0005  0.0000  261  ALA A CB    
1127 N N     . LEU A 155 ? 0.0312 0.0354 0.0360 -0.0010 -0.0025 0.0000  262  LEU A N     
1128 C CA    . LEU A 155 ? 0.0362 0.0381 0.0374 0.0004  -0.0005 0.0004  262  LEU A CA    
1129 C C     . LEU A 155 ? 0.0406 0.0408 0.0393 0.0001  0.0008  0.0002  262  LEU A C     
1130 O O     . LEU A 155 ? 0.0443 0.0420 0.0362 0.0000  -0.0002 -0.0030 262  LEU A O     
1131 C CB    . LEU A 155 ? 0.0374 0.0385 0.0359 -0.0009 -0.0034 -0.0017 262  LEU A CB    
1132 C CG    . LEU A 155 ? 0.0460 0.0484 0.0460 -0.0001 0.0009  0.0002  262  LEU A CG    
1133 C CD1   . LEU A 155 ? 0.0489 0.0514 0.0581 -0.0002 0.0009  -0.0006 262  LEU A CD1   
1134 C CD2   . LEU A 155 ? 0.0477 0.0531 0.0592 0.0010  -0.0021 0.0023  262  LEU A CD2   
1135 N N     . ASN A 156 ? 0.0411 0.0406 0.0392 -0.0003 0.0018  -0.0008 263  ASN A N     
1136 C CA    . ASN A 156 ? 0.0403 0.0404 0.0405 -0.0002 0.0011  -0.0012 263  ASN A CA    
1137 C C     . ASN A 156 ? 0.0411 0.0394 0.0438 0.0011  0.0029  -0.0017 263  ASN A C     
1138 O O     . ASN A 156 ? 0.0395 0.0353 0.0421 0.0001  0.0023  -0.0057 263  ASN A O     
1139 C CB    . ASN A 156 ? 0.0413 0.0405 0.0394 0.0004  0.0009  -0.0022 263  ASN A CB    
1140 C CG    . ASN A 156 ? 0.0383 0.0409 0.0421 -0.0013 -0.0010 -0.0013 263  ASN A CG    
1141 O OD1   . ASN A 156 ? 0.0470 0.0442 0.0454 0.0028  0.0049  -0.0040 263  ASN A OD1   
1142 N ND2   . ASN A 156 ? 0.0312 0.0407 0.0335 -0.0038 -0.0043 -0.0051 263  ASN A ND2   
1143 N N     . GLY A 157 ? 0.0406 0.0381 0.0438 0.0008  0.0035  -0.0007 264  GLY A N     
1144 C CA    . GLY A 157 ? 0.0361 0.0391 0.0350 0.0007  -0.0019 0.0001  264  GLY A CA    
1145 C C     . GLY A 157 ? 0.0363 0.0382 0.0366 0.0005  -0.0014 0.0000  264  GLY A C     
1146 O O     . GLY A 157 ? 0.0388 0.0432 0.0389 -0.0013 -0.0025 -0.0021 264  GLY A O     
1147 N N     . ASN A 158 ? 0.0315 0.0368 0.0343 0.0008  -0.0027 0.0000  265  ASN A N     
1148 C CA    . ASN A 158 ? 0.0328 0.0378 0.0368 0.0008  -0.0018 0.0000  265  ASN A CA    
1149 C C     . ASN A 158 ? 0.0288 0.0356 0.0354 0.0018  -0.0024 -0.0001 265  ASN A C     
1150 O O     . ASN A 158 ? 0.0395 0.0399 0.0392 0.0031  -0.0013 0.0014  265  ASN A O     
1151 C CB    . ASN A 158 ? 0.0363 0.0409 0.0429 0.0022  0.0000  -0.0003 265  ASN A CB    
1152 C CG    . ASN A 158 ? 0.0596 0.0564 0.0600 0.0011  0.0017  0.0040  265  ASN A CG    
1153 O OD1   . ASN A 158 ? 0.0880 0.0849 0.0918 -0.0028 -0.0002 -0.0082 265  ASN A OD1   
1154 N ND2   . ASN A 158 ? 0.0725 0.0702 0.0814 -0.0050 0.0022  -0.0024 265  ASN A ND2   
1155 N N     . THR A 159 ? 0.0322 0.0368 0.0358 -0.0018 0.0000  -0.0014 266  THR A N     
1156 C CA    . THR A 159 ? 0.0293 0.0346 0.0321 0.0000  -0.0012 -0.0004 266  THR A CA    
1157 C C     . THR A 159 ? 0.0323 0.0379 0.0362 0.0000  -0.0015 -0.0006 266  THR A C     
1158 O O     . THR A 159 ? 0.0375 0.0455 0.0395 -0.0038 0.0029  -0.0001 266  THR A O     
1159 C CB    . THR A 159 ? 0.0312 0.0348 0.0318 -0.0015 -0.0005 -0.0018 266  THR A CB    
1160 O OG1   . THR A 159 ? 0.0253 0.0314 0.0299 0.0000  0.0001  0.0002  266  THR A OG1   
1161 C CG2   . THR A 159 ? 0.0270 0.0334 0.0313 0.0007  0.0003  -0.0009 266  THR A CG2   
1162 N N     . LEU A 160 ? 0.0358 0.0413 0.0343 0.0008  -0.0029 0.0010  267  LEU A N     
1163 C CA    . LEU A 160 ? 0.0464 0.0488 0.0443 -0.0002 -0.0017 0.0000  267  LEU A CA    
1164 C C     . LEU A 160 ? 0.0588 0.0588 0.0573 0.0004  0.0001  0.0005  267  LEU A C     
1165 O O     . LEU A 160 ? 0.0507 0.0512 0.0484 0.0002  -0.0021 0.0015  267  LEU A O     
1166 C CB    . LEU A 160 ? 0.0496 0.0496 0.0464 0.0000  0.0013  0.0004  267  LEU A CB    
1167 C CG    . LEU A 160 ? 0.0469 0.0501 0.0483 0.0004  -0.0021 0.0008  267  LEU A CG    
1168 C CD1   . LEU A 160 ? 0.0611 0.0575 0.0627 -0.0008 -0.0011 0.0005  267  LEU A CD1   
1169 C CD2   . LEU A 160 ? 0.0565 0.0568 0.0583 0.0027  0.0016  0.0014  267  LEU A CD2   
1170 N N     . SER A 161 ? 0.0666 0.0704 0.0742 0.0001  -0.0010 -0.0010 268  SER A N     
1171 C CA    . SER A 161 ? 0.0864 0.0854 0.0871 -0.0015 0.0000  0.0001  268  SER A CA    
1172 C C     . SER A 161 ? 0.0975 0.0988 0.1024 -0.0006 0.0010  -0.0008 268  SER A C     
1173 O O     . SER A 161 ? 0.1007 0.1036 0.1074 0.0031  0.0005  0.0003  268  SER A O     
1174 C CB    . SER A 161 ? 0.0900 0.0866 0.0877 -0.0031 0.0020  -0.0017 268  SER A CB    
1175 O OG    A SER A 161 ? 0.1007 0.0974 0.1021 -0.0030 0.0052  -0.0039 268  SER A OG    
1176 O OG    B SER A 161 ? 0.0977 0.0869 0.0943 -0.0014 0.0026  -0.0012 268  SER A OG    
1177 N N     . LEU A 162 ? 0.1160 0.1177 0.1186 -0.0009 -0.0007 -0.0004 269  LEU A N     
1178 C CA    . LEU A 162 ? 0.1335 0.1349 0.1368 0.0004  0.0016  -0.0012 269  LEU A CA    
1179 C C     . LEU A 162 ? 0.1463 0.1470 0.1476 -0.0014 0.0008  0.0001  269  LEU A C     
1180 O O     . LEU A 162 ? 0.1482 0.1491 0.1531 -0.0018 0.0024  -0.0017 269  LEU A O     
1181 C CB    . LEU A 162 ? 0.1316 0.1341 0.1323 0.0000  -0.0026 0.0004  269  LEU A CB    
1182 C CG    . LEU A 162 ? 0.1452 0.1456 0.1464 0.0012  0.0000  0.0000  269  LEU A CG    
1183 C CD1   . LEU A 162 ? 0.1437 0.1447 0.1440 0.0007  -0.0015 -0.0008 269  LEU A CD1   
1184 C CD2   . LEU A 162 ? 0.1546 0.1619 0.1598 -0.0009 0.0032  -0.0006 269  LEU A CD2   
1185 N N     . ASP A 163 ? 0.1629 0.1604 0.1630 0.0013  0.0010  0.0001  270  ASP A N     
1186 C CA    . ASP A 163 ? 0.1744 0.1708 0.1749 -0.0008 0.0019  0.0000  270  ASP A CA    
1187 C C     . ASP A 163 ? 0.1796 0.1755 0.1795 0.0005  0.0021  0.0000  270  ASP A C     
1188 O O     . ASP A 163 ? 0.1816 0.1748 0.1830 -0.0007 0.0036  -0.0003 270  ASP A O     
1189 C CB    . ASP A 163 ? 0.1796 0.1734 0.1771 0.0011  0.0026  0.0018  270  ASP A CB    
1190 C CG    . ASP A 163 ? 0.1869 0.1878 0.1907 -0.0013 0.0004  0.0012  270  ASP A CG    
1191 O OD1   . ASP A 163 ? 0.1960 0.1904 0.1819 -0.0006 -0.0001 -0.0044 270  ASP A OD1   
1192 O OD2   . ASP A 163 ? 0.2239 0.2134 0.2120 0.0008  0.0051  -0.0024 270  ASP A OD2   
1193 N N     . GLU A 164 ? 0.1828 0.1793 0.1814 -0.0003 0.0013  0.0011  271  GLU A N     
1194 C CA    . GLU A 164 ? 0.1842 0.1836 0.1852 0.0004  0.0005  0.0005  271  GLU A CA    
1195 C C     . GLU A 164 ? 0.1819 0.1773 0.1816 -0.0011 0.0025  0.0000  271  GLU A C     
1196 O O     . GLU A 164 ? 0.1852 0.1790 0.1895 0.0002  0.0054  0.0010  271  GLU A O     
1197 C CB    . GLU A 164 ? 0.1900 0.1901 0.1950 -0.0010 0.0021  0.0009  271  GLU A CB    
1198 C CG    . GLU A 164 ? 0.2120 0.2083 0.2130 0.0004  0.0010  -0.0047 271  GLU A CG    
1199 C CD    . GLU A 164 ? 0.2380 0.2303 0.2366 -0.0030 0.0036  0.0023  271  GLU A CD    
1200 O OE1   . GLU A 164 ? 0.2529 0.2505 0.2448 -0.0004 0.0023  -0.0010 271  GLU A OE1   
1201 O OE2   . GLU A 164 ? 0.2470 0.2420 0.2460 -0.0037 0.0003  -0.0043 271  GLU A OE2   
1202 N N     . GLU A 165 ? 0.1700 0.1691 0.1703 -0.0010 0.0005  0.0009  272  GLU A N     
1203 C CA    . GLU A 165 ? 0.1641 0.1614 0.1649 -0.0003 0.0010  0.0014  272  GLU A CA    
1204 C C     . GLU A 165 ? 0.1456 0.1453 0.1479 0.0022  0.0000  0.0006  272  GLU A C     
1205 O O     . GLU A 165 ? 0.1449 0.1439 0.1484 0.0009  -0.0002 0.0017  272  GLU A O     
1206 C CB    . GLU A 165 ? 0.1730 0.1692 0.1685 -0.0002 0.0016  0.0006  272  GLU A CB    
1207 C CG    . GLU A 165 ? 0.1905 0.1920 0.1908 -0.0028 -0.0022 0.0015  272  GLU A CG    
1208 C CD    . GLU A 165 ? 0.2201 0.2166 0.2269 0.0041  0.0042  -0.0006 272  GLU A CD    
1209 O OE1   . GLU A 165 ? 0.2251 0.2292 0.2287 0.0005  -0.0060 0.0009  272  GLU A OE1   
1210 O OE2   . GLU A 165 ? 0.2450 0.2422 0.2417 0.0001  0.0075  -0.0006 272  GLU A OE2   
1211 N N     . THR A 166 ? 0.1249 0.1247 0.1209 -0.0014 -0.0011 0.0017  273  THR A N     
1212 C CA    . THR A 166 ? 0.1114 0.1126 0.1061 0.0002  -0.0013 0.0013  273  THR A CA    
1213 C C     . THR A 166 ? 0.0934 0.0947 0.0903 -0.0009 -0.0014 0.0005  273  THR A C     
1214 O O     . THR A 166 ? 0.0952 0.0920 0.0858 -0.0019 0.0008  0.0002  273  THR A O     
1215 C CB    . THR A 166 ? 0.1102 0.1142 0.1082 -0.0001 -0.0023 0.0001  273  THR A CB    
1216 O OG1   . THR A 166 ? 0.1169 0.1149 0.1147 0.0021  0.0013  0.0011  273  THR A OG1   
1217 C CG2   . THR A 166 ? 0.1271 0.1210 0.1228 -0.0043 0.0018  -0.0024 273  THR A CG2   
1218 N N     . VAL A 167 ? 0.0784 0.0804 0.0719 0.0005  -0.0044 0.0006  274  VAL A N     
1219 C CA    . VAL A 167 ? 0.0702 0.0718 0.0716 -0.0011 -0.0011 -0.0007 274  VAL A CA    
1220 C C     . VAL A 167 ? 0.0663 0.0682 0.0660 -0.0001 -0.0015 -0.0005 274  VAL A C     
1221 O O     . VAL A 167 ? 0.0569 0.0660 0.0643 -0.0002 -0.0015 0.0000  274  VAL A O     
1222 C CB    . VAL A 167 ? 0.0642 0.0703 0.0687 -0.0015 -0.0023 0.0001  274  VAL A CB    
1223 C CG1   . VAL A 167 ? 0.0640 0.0674 0.0672 -0.0014 -0.0018 -0.0028 274  VAL A CG1   
1224 C CG2   . VAL A 167 ? 0.0799 0.0777 0.0767 -0.0024 0.0022  -0.0029 274  VAL A CG2   
1225 N N     . ILE A 168 ? 0.0561 0.0653 0.0585 -0.0003 -0.0050 -0.0016 275  ILE A N     
1226 C CA    . ILE A 168 ? 0.0657 0.0686 0.0651 0.0000  -0.0032 0.0005  275  ILE A CA    
1227 C C     . ILE A 168 ? 0.0642 0.0658 0.0659 0.0001  -0.0003 -0.0014 275  ILE A C     
1228 O O     . ILE A 168 ? 0.0590 0.0602 0.0518 -0.0018 -0.0040 0.0014  275  ILE A O     
1229 C CB    . ILE A 168 ? 0.0757 0.0738 0.0784 0.0001  0.0016  -0.0015 275  ILE A CB    
1230 C CG1   . ILE A 168 ? 0.0907 0.0913 0.0872 0.0000  0.0021  0.0010  275  ILE A CG1   
1231 C CG2   . ILE A 168 ? 0.0807 0.0778 0.0783 -0.0005 -0.0007 -0.0001 275  ILE A CG2   
1232 C CD1   . ILE A 168 ? 0.1136 0.1107 0.1134 -0.0013 0.0006  -0.0023 275  ILE A CD1   
1233 N N     . ASP A 169 ? 0.0605 0.0634 0.0634 -0.0002 -0.0020 -0.0021 276  ASP A N     
1234 C CA    . ASP A 169 ? 0.0624 0.0645 0.0627 0.0000  -0.0015 -0.0004 276  ASP A CA    
1235 C C     . ASP A 169 ? 0.0647 0.0648 0.0634 0.0005  -0.0006 0.0000  276  ASP A C     
1236 O O     . ASP A 169 ? 0.0603 0.0611 0.0538 0.0010  -0.0030 0.0019  276  ASP A O     
1237 C CB    . ASP A 169 ? 0.0692 0.0659 0.0636 0.0005  -0.0022 -0.0020 276  ASP A CB    
1238 C CG    . ASP A 169 ? 0.0774 0.0735 0.0758 -0.0018 0.0015  0.0001  276  ASP A CG    
1239 O OD1   . ASP A 169 ? 0.0995 0.0879 0.0855 0.0000  0.0016  -0.0023 276  ASP A OD1   
1240 O OD2   . ASP A 169 ? 0.0927 0.0813 0.0907 0.0002  0.0037  -0.0007 276  ASP A OD2   
1241 N N     . VAL A 170 ? 0.0683 0.0689 0.0625 0.0007  -0.0001 0.0003  277  VAL A N     
1242 C CA    . VAL A 170 ? 0.0720 0.0710 0.0676 0.0003  -0.0005 0.0003  277  VAL A CA    
1243 C C     . VAL A 170 ? 0.0747 0.0733 0.0703 0.0005  0.0007  0.0012  277  VAL A C     
1244 O O     . VAL A 170 ? 0.0662 0.0704 0.0596 0.0017  -0.0053 0.0004  277  VAL A O     
1245 C CB    . VAL A 170 ? 0.0768 0.0751 0.0786 0.0005  0.0009  0.0006  277  VAL A CB    
1246 C CG1   . VAL A 170 ? 0.0799 0.0769 0.0834 -0.0003 0.0023  0.0006  277  VAL A CG1   
1247 C CG2   . VAL A 170 ? 0.0858 0.0829 0.0922 0.0007  0.0060  0.0003  277  VAL A CG2   
1248 N N     . PRO A 171 ? 0.0752 0.0748 0.0656 0.0006  -0.0039 0.0009  278  PRO A N     
1249 C CA    . PRO A 171 ? 0.0812 0.0810 0.0732 0.0000  -0.0015 -0.0002 278  PRO A CA    
1250 C C     . PRO A 171 ? 0.0909 0.0871 0.0857 0.0013  -0.0008 0.0016  278  PRO A C     
1251 O O     . PRO A 171 ? 0.0932 0.0893 0.0822 -0.0015 0.0001  -0.0001 278  PRO A O     
1252 C CB    . PRO A 171 ? 0.0838 0.0798 0.0784 0.0020  0.0000  0.0026  278  PRO A CB    
1253 C CG    . PRO A 171 ? 0.0823 0.0817 0.0743 0.0025  -0.0003 0.0009  278  PRO A CG    
1254 C CD    . PRO A 171 ? 0.0772 0.0744 0.0682 -0.0012 -0.0020 0.0017  278  PRO A CD    
1255 N N     . GLU A 172 ? 0.0973 0.0967 0.0983 0.0008  0.0010  -0.0004 279  GLU A N     
1256 C CA    . GLU A 172 ? 0.1049 0.1033 0.1068 0.0007  -0.0009 0.0016  279  GLU A CA    
1257 C C     . GLU A 172 ? 0.1067 0.1021 0.1038 -0.0007 0.0005  0.0003  279  GLU A C     
1258 O O     . GLU A 172 ? 0.1111 0.1038 0.1084 -0.0028 -0.0003 0.0014  279  GLU A O     
1259 C CB    . GLU A 172 ? 0.1150 0.1095 0.1121 0.0010  0.0011  0.0010  279  GLU A CB    
1260 C CG    . GLU A 172 ? 0.1387 0.1322 0.1299 0.0000  0.0032  -0.0010 279  GLU A CG    
1261 C CD    . GLU A 172 ? 0.1445 0.1483 0.1440 0.0043  0.0008  0.0010  279  GLU A CD    
1262 O OE1   . GLU A 172 ? 0.1614 0.1612 0.1705 -0.0055 -0.0002 -0.0026 279  GLU A OE1   
1263 O OE2   . GLU A 172 ? 0.1542 0.1522 0.1567 -0.0009 -0.0004 0.0015  279  GLU A OE2   
1264 N N     . PRO A 173 ? 0.1029 0.0997 0.1024 0.0004  0.0000  0.0006  280  PRO A N     
1265 C CA    . PRO A 173 ? 0.0992 0.0970 0.0941 -0.0006 0.0000  -0.0014 280  PRO A CA    
1266 C C     . PRO A 173 ? 0.0863 0.0878 0.0794 -0.0004 -0.0032 -0.0013 280  PRO A C     
1267 O O     . PRO A 173 ? 0.1045 0.0944 0.1024 0.0024  0.0033  0.0023  280  PRO A O     
1268 C CB    . PRO A 173 ? 0.0977 0.0982 0.1077 -0.0022 0.0011  -0.0004 280  PRO A CB    
1269 C CG    . PRO A 173 ? 0.1043 0.1034 0.1006 -0.0029 0.0008  -0.0021 280  PRO A CG    
1270 C CD    . PRO A 173 ? 0.1053 0.1045 0.1055 -0.0032 0.0022  -0.0011 280  PRO A CD    
1271 N N     . TYR A 174 ? 0.0730 0.0752 0.0730 0.0035  -0.0032 0.0001  281  TYR A N     
1272 C CA    . TYR A 174 ? 0.0607 0.0652 0.0630 -0.0010 -0.0043 0.0003  281  TYR A CA    
1273 C C     . TYR A 174 ? 0.0536 0.0573 0.0537 0.0018  -0.0027 0.0008  281  TYR A C     
1274 O O     . TYR A 174 ? 0.0497 0.0558 0.0502 -0.0012 -0.0033 0.0015  281  TYR A O     
1275 C CB    . TYR A 174 ? 0.0592 0.0650 0.0631 0.0007  -0.0028 0.0002  281  TYR A CB    
1276 C CG    . TYR A 174 ? 0.0617 0.0679 0.0651 -0.0004 -0.0042 -0.0002 281  TYR A CG    
1277 C CD1   . TYR A 174 ? 0.0718 0.0719 0.0842 -0.0013 0.0000  -0.0032 281  TYR A CD1   
1278 C CD2   . TYR A 174 ? 0.0651 0.0703 0.0732 0.0027  -0.0032 0.0020  281  TYR A CD2   
1279 C CE1   . TYR A 174 ? 0.0793 0.0828 0.0790 0.0025  -0.0032 0.0019  281  TYR A CE1   
1280 C CE2   . TYR A 174 ? 0.0789 0.0844 0.0857 -0.0006 -0.0006 -0.0008 281  TYR A CE2   
1281 C CZ    . TYR A 174 ? 0.0817 0.0834 0.0856 0.0008  -0.0014 0.0015  281  TYR A CZ    
1282 O OH    . TYR A 174 ? 0.0917 0.1049 0.1065 -0.0025 -0.0021 -0.0018 281  TYR A OH    
1283 N N     . ASN A 175 ? 0.0452 0.0506 0.0478 0.0018  -0.0052 0.0026  282  ASN A N     
1284 C CA    . ASN A 175 ? 0.0494 0.0504 0.0509 0.0005  -0.0014 -0.0001 282  ASN A CA    
1285 C C     . ASN A 175 ? 0.0441 0.0461 0.0445 -0.0002 -0.0021 -0.0001 282  ASN A C     
1286 O O     . ASN A 175 ? 0.0485 0.0437 0.0406 0.0008  -0.0050 -0.0039 282  ASN A O     
1287 C CB    . ASN A 175 ? 0.0523 0.0528 0.0511 0.0005  -0.0017 -0.0005 282  ASN A CB    
1288 C CG    . ASN A 175 ? 0.0657 0.0640 0.0614 -0.0019 0.0042  0.0000  282  ASN A CG    
1289 O OD1   . ASN A 175 ? 0.0685 0.0743 0.0728 -0.0003 -0.0027 -0.0018 282  ASN A OD1   
1290 N ND2   . ASN A 175 ? 0.0748 0.0724 0.0599 0.0000  -0.0006 -0.0023 282  ASN A ND2   
1291 N N     . HIS A 176 ? 0.0419 0.0424 0.0349 0.0002  -0.0047 -0.0019 283  HIS A N     
1292 C CA    . HIS A 176 ? 0.0386 0.0415 0.0334 -0.0003 -0.0045 -0.0012 283  HIS A CA    
1293 C C     . HIS A 176 ? 0.0393 0.0415 0.0400 0.0001  -0.0017 0.0001  283  HIS A C     
1294 O O     . HIS A 176 ? 0.0342 0.0342 0.0324 0.0004  -0.0014 -0.0003 283  HIS A O     
1295 C CB    . HIS A 176 ? 0.0460 0.0445 0.0331 -0.0010 -0.0027 -0.0016 283  HIS A CB    
1296 C CG    . HIS A 176 ? 0.0498 0.0497 0.0416 0.0011  -0.0052 -0.0013 283  HIS A CG    
1297 N ND1   . HIS A 176 ? 0.0886 0.0748 0.0583 0.0049  0.0061  0.0025  283  HIS A ND1   
1298 C CD2   . HIS A 176 ? 0.0482 0.0552 0.0489 -0.0021 -0.0066 -0.0017 283  HIS A CD2   
1299 C CE1   . HIS A 176 ? 0.0816 0.0746 0.0633 0.0064  0.0010  0.0028  283  HIS A CE1   
1300 N NE2   . HIS A 176 ? 0.0605 0.0673 0.0634 0.0021  0.0021  0.0009  283  HIS A NE2   
1301 N N     . VAL A 177 ? 0.0407 0.0444 0.0431 0.0017  -0.0028 0.0020  284  VAL A N     
1302 C CA    . VAL A 177 ? 0.0501 0.0502 0.0489 0.0011  -0.0005 0.0017  284  VAL A CA    
1303 C C     . VAL A 177 ? 0.0443 0.0477 0.0446 0.0029  -0.0016 0.0018  284  VAL A C     
1304 O O     . VAL A 177 ? 0.0409 0.0500 0.0535 0.0049  -0.0010 0.0000  284  VAL A O     
1305 C CB    . VAL A 177 ? 0.0538 0.0593 0.0620 0.0009  0.0004  -0.0008 284  VAL A CB    
1306 C CG1   . VAL A 177 ? 0.0823 0.0739 0.0852 0.0018  0.0088  -0.0010 284  VAL A CG1   
1307 C CG2   . VAL A 177 ? 0.0662 0.0657 0.0686 -0.0001 0.0014  0.0004  284  VAL A CG2   
1308 N N     . SER A 178 ? 0.0429 0.0433 0.0355 0.0012  -0.0043 0.0012  285  SER A N     
1309 C CA    . SER A 178 ? 0.0473 0.0444 0.0446 0.0006  0.0014  0.0015  285  SER A CA    
1310 C C     . SER A 178 ? 0.0399 0.0424 0.0369 0.0001  -0.0027 0.0003  285  SER A C     
1311 O O     . SER A 178 ? 0.0549 0.0437 0.0531 0.0014  0.0053  0.0003  285  SER A O     
1312 C CB    . SER A 178 ? 0.0481 0.0452 0.0423 0.0018  0.0005  0.0010  285  SER A CB    
1313 O OG    . SER A 178 ? 0.0437 0.0429 0.0321 0.0017  -0.0051 -0.0017 285  SER A OG    
1314 N N     . LYS A 179 ? 0.0410 0.0412 0.0354 -0.0006 -0.0026 -0.0009 286  LYS A N     
1315 C CA    . LYS A 179 ? 0.0442 0.0451 0.0403 0.0000  -0.0020 0.0007  286  LYS A CA    
1316 C C     . LYS A 179 ? 0.0409 0.0413 0.0387 0.0000  -0.0022 0.0003  286  LYS A C     
1317 O O     . LYS A 179 ? 0.0429 0.0411 0.0370 -0.0054 -0.0009 -0.0002 286  LYS A O     
1318 C CB    . LYS A 179 ? 0.0506 0.0487 0.0437 0.0015  -0.0030 0.0000  286  LYS A CB    
1319 C CG    . LYS A 179 ? 0.0767 0.0769 0.0764 0.0008  0.0067  0.0031  286  LYS A CG    
1320 C CD    . LYS A 179 ? 0.1052 0.1039 0.1030 -0.0001 -0.0017 -0.0017 286  LYS A CD    
1321 C CE    . LYS A 179 ? 0.1205 0.1201 0.1192 -0.0003 0.0054  0.0011  286  LYS A CE    
1322 N NZ    . LYS A 179 ? 0.1523 0.1474 0.1474 0.0006  0.0010  -0.0029 286  LYS A NZ    
1323 N N     . TYR A 180 ? 0.0419 0.0392 0.0358 -0.0007 -0.0003 -0.0006 287  TYR A N     
1324 C CA    . TYR A 180 ? 0.0372 0.0382 0.0353 -0.0001 -0.0006 -0.0012 287  TYR A CA    
1325 C C     . TYR A 180 ? 0.0399 0.0403 0.0397 0.0010  0.0010  -0.0004 287  TYR A C     
1326 O O     . TYR A 180 ? 0.0257 0.0419 0.0376 0.0017  -0.0016 -0.0015 287  TYR A O     
1327 C CB    . TYR A 180 ? 0.0400 0.0386 0.0358 0.0004  0.0006  -0.0006 287  TYR A CB    
1328 C CG    . TYR A 180 ? 0.0344 0.0368 0.0359 0.0000  -0.0013 -0.0010 287  TYR A CG    
1329 C CD1   . TYR A 180 ? 0.0303 0.0352 0.0351 0.0006  -0.0005 -0.0018 287  TYR A CD1   
1330 C CD2   . TYR A 180 ? 0.0371 0.0372 0.0338 0.0006  0.0010  0.0000  287  TYR A CD2   
1331 C CE1   . TYR A 180 ? 0.0436 0.0408 0.0468 -0.0023 0.0037  -0.0013 287  TYR A CE1   
1332 C CE2   . TYR A 180 ? 0.0404 0.0392 0.0386 0.0011  0.0009  -0.0002 287  TYR A CE2   
1333 C CZ    . TYR A 180 ? 0.0391 0.0433 0.0386 0.0005  -0.0032 0.0025  287  TYR A CZ    
1334 O OH    . TYR A 180 ? 0.0391 0.0413 0.0407 0.0024  -0.0021 0.0053  287  TYR A OH    
1335 N N     . CYS A 181 ? 0.0402 0.0407 0.0384 0.0017  -0.0013 -0.0004 288  CYS A N     
1336 C CA    . CYS A 181 ? 0.0411 0.0435 0.0437 0.0000  -0.0001 -0.0010 288  CYS A CA    
1337 C C     . CYS A 181 ? 0.0413 0.0414 0.0393 0.0012  0.0007  0.0000  288  CYS A C     
1338 O O     . CYS A 181 ? 0.0354 0.0475 0.0322 0.0041  -0.0051 0.0001  288  CYS A O     
1339 C CB    . CYS A 181 ? 0.0429 0.0453 0.0466 0.0019  -0.0007 0.0007  288  CYS A CB    
1340 S SG    . CYS A 181 ? 0.0568 0.0561 0.0703 -0.0021 -0.0039 -0.0001 288  CYS A SG    
1341 N N     . ALA A 182 ? 0.0292 0.0379 0.0358 -0.0014 -0.0054 -0.0028 289  ALA A N     
1342 C CA    . ALA A 182 ? 0.0354 0.0387 0.0323 0.0004  -0.0029 -0.0002 289  ALA A CA    
1343 C C     . ALA A 182 ? 0.0404 0.0414 0.0427 -0.0001 0.0011  -0.0004 289  ALA A C     
1344 O O     . ALA A 182 ? 0.0585 0.0530 0.0490 -0.0044 0.0076  -0.0021 289  ALA A O     
1345 C CB    . ALA A 182 ? 0.0306 0.0386 0.0383 0.0033  -0.0034 0.0023  289  ALA A CB    
1346 N N     . SER A 183 ? 0.0411 0.0434 0.0449 -0.0018 0.0007  -0.0021 290  SER A N     
1347 C CA    . SER A 183 ? 0.0396 0.0414 0.0395 -0.0001 0.0000  -0.0006 290  SER A CA    
1348 C C     . SER A 183 ? 0.0376 0.0406 0.0384 -0.0007 -0.0001 0.0000  290  SER A C     
1349 O O     . SER A 183 ? 0.0310 0.0401 0.0334 -0.0027 -0.0024 -0.0011 290  SER A O     
1350 C CB    . SER A 183 ? 0.0441 0.0415 0.0398 -0.0001 0.0032  0.0000  290  SER A CB    
1351 O OG    . SER A 183 ? 0.0339 0.0375 0.0374 -0.0015 0.0009  -0.0017 290  SER A OG    
1352 N N     . LEU A 184 ? 0.0326 0.0378 0.0377 0.0000  0.0003  0.0003  291  LEU A N     
1353 C CA    . LEU A 184 ? 0.0341 0.0379 0.0377 0.0000  0.0003  -0.0004 291  LEU A CA    
1354 C C     . LEU A 184 ? 0.0340 0.0384 0.0390 -0.0002 0.0012  -0.0005 291  LEU A C     
1355 O O     . LEU A 184 ? 0.0328 0.0375 0.0351 0.0006  -0.0028 -0.0009 291  LEU A O     
1356 C CB    . LEU A 184 ? 0.0371 0.0376 0.0357 0.0005  0.0005  0.0019  291  LEU A CB    
1357 C CG    . LEU A 184 ? 0.0370 0.0395 0.0327 0.0003  -0.0009 0.0009  291  LEU A CG    
1358 C CD1   . LEU A 184 ? 0.0472 0.0469 0.0575 0.0020  0.0008  0.0008  291  LEU A CD1   
1359 C CD2   . LEU A 184 ? 0.0340 0.0312 0.0262 -0.0001 -0.0027 0.0002  291  LEU A CD2   
1360 N N     . GLY A 185 ? 0.0306 0.0341 0.0354 0.0023  -0.0016 0.0015  292  GLY A N     
1361 C CA    . GLY A 185 ? 0.0331 0.0354 0.0336 0.0008  -0.0007 -0.0007 292  GLY A CA    
1362 C C     . GLY A 185 ? 0.0314 0.0356 0.0335 0.0005  0.0002  0.0000  292  GLY A C     
1363 O O     . GLY A 185 ? 0.0352 0.0392 0.0271 -0.0020 -0.0025 -0.0005 292  GLY A O     
1364 N N     . HIS A 186 ? 0.0280 0.0326 0.0285 -0.0010 -0.0024 -0.0017 293  HIS A N     
1365 C CA    . HIS A 186 ? 0.0264 0.0309 0.0284 0.0005  -0.0018 -0.0002 293  HIS A CA    
1366 C C     . HIS A 186 ? 0.0309 0.0335 0.0326 -0.0004 0.0012  -0.0006 293  HIS A C     
1367 O O     . HIS A 186 ? 0.0415 0.0397 0.0319 -0.0003 0.0020  -0.0021 293  HIS A O     
1368 C CB    . HIS A 186 ? 0.0257 0.0308 0.0302 0.0004  -0.0014 -0.0010 293  HIS A CB    
1369 C CG    . HIS A 186 ? 0.0271 0.0293 0.0290 0.0014  -0.0021 0.0002  293  HIS A CG    
1370 N ND1   . HIS A 186 ? 0.0278 0.0302 0.0274 0.0033  0.0018  0.0029  293  HIS A ND1   
1371 C CD2   . HIS A 186 ? 0.0288 0.0294 0.0304 0.0017  -0.0034 0.0006  293  HIS A CD2   
1372 C CE1   . HIS A 186 ? 0.0301 0.0289 0.0305 0.0026  0.0000  0.0017  293  HIS A CE1   
1373 N NE2   . HIS A 186 ? 0.0325 0.0350 0.0384 0.0028  0.0008  0.0006  293  HIS A NE2   
1374 N N     . LYS A 187 ? 0.0272 0.0326 0.0262 -0.0004 -0.0012 -0.0002 294  LYS A N     
1375 C CA    . LYS A 187 ? 0.0321 0.0342 0.0336 -0.0002 0.0006  0.0000  294  LYS A CA    
1376 C C     . LYS A 187 ? 0.0284 0.0343 0.0325 0.0000  0.0003  0.0009  294  LYS A C     
1377 O O     . LYS A 187 ? 0.0290 0.0356 0.0282 -0.0002 0.0011  0.0011  294  LYS A O     
1378 C CB    . LYS A 187 ? 0.0374 0.0385 0.0349 -0.0012 0.0017  0.0000  294  LYS A CB    
1379 C CG    . LYS A 187 ? 0.0409 0.0415 0.0437 -0.0007 -0.0005 -0.0019 294  LYS A CG    
1380 C CD    . LYS A 187 ? 0.0522 0.0511 0.0507 -0.0016 0.0019  -0.0022 294  LYS A CD    
1381 C CE    . LYS A 187 ? 0.0515 0.0524 0.0512 -0.0018 -0.0017 -0.0017 294  LYS A CE    
1382 N NZ    . LYS A 187 ? 0.0605 0.0565 0.0502 -0.0046 -0.0006 -0.0054 294  LYS A NZ    
1383 N N     . ALA A 188 ? 0.0305 0.0327 0.0305 -0.0005 -0.0007 0.0009  295  ALA A N     
1384 C CA    . ALA A 188 ? 0.0267 0.0299 0.0278 0.0008  -0.0016 0.0005  295  ALA A CA    
1385 C C     . ALA A 188 ? 0.0260 0.0297 0.0298 -0.0007 -0.0015 0.0010  295  ALA A C     
1386 O O     . ALA A 188 ? 0.0376 0.0302 0.0369 0.0014  0.0011  0.0014  295  ALA A O     
1387 C CB    . ALA A 188 ? 0.0262 0.0314 0.0318 0.0005  -0.0010 -0.0001 295  ALA A CB    
1388 N N     . ASN A 189 ? 0.0267 0.0269 0.0273 -0.0012 0.0001  -0.0011 296  ASN A N     
1389 C CA    . ASN A 189 ? 0.0277 0.0285 0.0306 -0.0002 0.0017  0.0008  296  ASN A CA    
1390 C C     . ASN A 189 ? 0.0263 0.0283 0.0268 0.0001  -0.0012 0.0002  296  ASN A C     
1391 O O     . ASN A 189 ? 0.0282 0.0323 0.0322 0.0012  -0.0011 0.0023  296  ASN A O     
1392 C CB    . ASN A 189 ? 0.0259 0.0276 0.0258 0.0002  -0.0005 0.0000  296  ASN A CB    
1393 C CG    . ASN A 189 ? 0.0331 0.0271 0.0260 -0.0007 -0.0024 0.0004  296  ASN A CG    
1394 O OD1   . ASN A 189 ? 0.0255 0.0283 0.0529 -0.0001 0.0019  0.0026  296  ASN A OD1   
1395 N ND2   . ASN A 189 ? 0.0379 0.0325 0.0263 -0.0025 -0.0036 0.0008  296  ASN A ND2   
1396 N N     . HIS A 190 ? 0.0269 0.0289 0.0276 0.0005  -0.0017 0.0006  297  HIS A N     
1397 C CA    . HIS A 190 ? 0.0260 0.0273 0.0274 0.0002  -0.0008 0.0011  297  HIS A CA    
1398 C C     . HIS A 190 ? 0.0267 0.0285 0.0264 0.0004  -0.0005 0.0002  297  HIS A C     
1399 O O     . HIS A 190 ? 0.0253 0.0278 0.0353 0.0000  0.0000  0.0031  297  HIS A O     
1400 C CB    . HIS A 190 ? 0.0267 0.0297 0.0273 0.0003  -0.0006 0.0007  297  HIS A CB    
1401 C CG    . HIS A 190 ? 0.0296 0.0301 0.0291 0.0018  0.0019  -0.0016 297  HIS A CG    
1402 N ND1   . HIS A 190 ? 0.0376 0.0295 0.0298 0.0019  0.0012  -0.0002 297  HIS A ND1   
1403 C CD2   . HIS A 190 ? 0.0282 0.0273 0.0274 0.0017  -0.0024 -0.0014 297  HIS A CD2   
1404 C CE1   . HIS A 190 ? 0.0377 0.0351 0.0344 0.0013  0.0001  -0.0003 297  HIS A CE1   
1405 N NE2   . HIS A 190 ? 0.0418 0.0338 0.0361 0.0016  0.0033  0.0022  297  HIS A NE2   
1406 N N     . SER A 191 ? 0.0263 0.0296 0.0272 -0.0008 -0.0012 0.0000  298  SER A N     
1407 C CA    . SER A 191 ? 0.0303 0.0312 0.0330 0.0003  -0.0001 -0.0011 298  SER A CA    
1408 C C     . SER A 191 ? 0.0276 0.0314 0.0317 0.0003  -0.0005 0.0001  298  SER A C     
1409 O O     . SER A 191 ? 0.0258 0.0302 0.0338 0.0011  -0.0010 0.0015  298  SER A O     
1410 C CB    . SER A 191 ? 0.0331 0.0344 0.0390 -0.0004 -0.0003 0.0003  298  SER A CB    
1411 O OG    . SER A 191 ? 0.0273 0.0308 0.0254 0.0032  0.0000  -0.0002 298  SER A OG    
1412 N N     . PHE A 192 ? 0.0327 0.0301 0.0304 0.0000  -0.0009 -0.0018 299  PHE A N     
1413 C CA    . PHE A 192 ? 0.0355 0.0337 0.0314 0.0002  0.0000  0.0005  299  PHE A CA    
1414 C C     . PHE A 192 ? 0.0388 0.0365 0.0348 -0.0004 0.0017  -0.0011 299  PHE A C     
1415 O O     . PHE A 192 ? 0.0510 0.0414 0.0382 -0.0013 0.0027  -0.0008 299  PHE A O     
1416 C CB    . PHE A 192 ? 0.0295 0.0316 0.0306 -0.0003 -0.0021 -0.0008 299  PHE A CB    
1417 C CG    . PHE A 192 ? 0.0313 0.0299 0.0275 -0.0020 -0.0008 -0.0023 299  PHE A CG    
1418 C CD1   . PHE A 192 ? 0.0290 0.0320 0.0288 -0.0020 -0.0018 -0.0027 299  PHE A CD1   
1419 C CD2   . PHE A 192 ? 0.0291 0.0344 0.0405 -0.0007 -0.0028 0.0014  299  PHE A CD2   
1420 C CE1   . PHE A 192 ? 0.0416 0.0343 0.0368 0.0021  0.0033  -0.0030 299  PHE A CE1   
1421 C CE2   . PHE A 192 ? 0.0390 0.0421 0.0409 0.0018  0.0010  0.0012  299  PHE A CE2   
1422 C CZ    . PHE A 192 ? 0.0325 0.0400 0.0370 -0.0005 -0.0027 0.0016  299  PHE A CZ    
1423 N N     . THR A 193 ? 0.0396 0.0346 0.0334 -0.0007 0.0019  0.0004  300  THR A N     
1424 C CA    . THR A 193 ? 0.0349 0.0372 0.0344 -0.0005 -0.0016 0.0004  300  THR A CA    
1425 C C     . THR A 193 ? 0.0291 0.0325 0.0310 -0.0007 -0.0018 0.0010  300  THR A C     
1426 O O     . THR A 193 ? 0.0265 0.0332 0.0278 0.0003  -0.0014 0.0022  300  THR A O     
1427 C CB    . THR A 193 ? 0.0416 0.0411 0.0384 0.0000  -0.0001 0.0006  300  THR A CB    
1428 O OG1   . THR A 193 ? 0.0512 0.0430 0.0436 -0.0004 0.0006  0.0016  300  THR A OG1   
1429 C CG2   . THR A 193 ? 0.0484 0.0485 0.0526 -0.0002 -0.0002 -0.0016 300  THR A CG2   
1430 N N     . PRO A 194 ? 0.0330 0.0292 0.0300 0.0001  0.0000  0.0018  301  PRO A N     
1431 C CA    . PRO A 194 ? 0.0266 0.0284 0.0271 0.0000  -0.0012 0.0013  301  PRO A CA    
1432 C C     . PRO A 194 ? 0.0287 0.0274 0.0271 0.0006  -0.0002 0.0018  301  PRO A C     
1433 O O     . PRO A 194 ? 0.0253 0.0253 0.0295 0.0000  0.0000  0.0000  301  PRO A O     
1434 C CB    . PRO A 194 ? 0.0342 0.0289 0.0309 0.0010  0.0003  0.0013  301  PRO A CB    
1435 C CG    . PRO A 194 ? 0.0361 0.0307 0.0313 0.0003  0.0011  0.0011  301  PRO A CG    
1436 C CD    . PRO A 194 ? 0.0261 0.0303 0.0307 0.0004  -0.0018 0.0015  301  PRO A CD    
1437 N N     . ASN A 195 ? 0.0264 0.0267 0.0259 -0.0007 -0.0007 0.0003  302  ASN A N     
1438 C CA    . ASN A 195 ? 0.0288 0.0301 0.0285 0.0007  -0.0006 0.0002  302  ASN A CA    
1439 C C     . ASN A 195 ? 0.0267 0.0289 0.0269 -0.0005 -0.0008 -0.0015 302  ASN A C     
1440 O O     . ASN A 195 ? 0.0259 0.0302 0.0316 -0.0013 -0.0006 -0.0013 302  ASN A O     
1441 C CB    . ASN A 195 ? 0.0342 0.0315 0.0307 -0.0002 0.0009  -0.0010 302  ASN A CB    
1442 C CG    . ASN A 195 ? 0.0346 0.0340 0.0426 0.0011  0.0030  0.0011  302  ASN A CG    
1443 O OD1   . ASN A 195 ? 0.0286 0.0317 0.0258 -0.0014 -0.0008 -0.0008 302  ASN A OD1   
1444 N ND2   . ASN A 195 ? 0.0314 0.0364 0.0342 0.0016  -0.0019 0.0061  302  ASN A ND2   
1445 N N     . CYS A 196 ? 0.0279 0.0299 0.0283 0.0007  -0.0017 -0.0001 303  CYS A N     
1446 C CA    . CYS A 196 ? 0.0300 0.0339 0.0304 0.0001  -0.0020 0.0003  303  CYS A CA    
1447 C C     . CYS A 196 ? 0.0323 0.0360 0.0354 0.0002  -0.0015 -0.0007 303  CYS A C     
1448 O O     . CYS A 196 ? 0.0297 0.0334 0.0271 0.0018  -0.0019 0.0018  303  CYS A O     
1449 C CB    . CYS A 196 ? 0.0341 0.0368 0.0344 0.0000  -0.0001 0.0013  303  CYS A CB    
1450 S SG    . CYS A 196 ? 0.0456 0.0476 0.0510 -0.0013 0.0039  -0.0006 303  CYS A SG    
1451 N N     . ILE A 197 ? 0.0380 0.0438 0.0396 0.0011  -0.0001 0.0007  304  ILE A N     
1452 C CA    . ILE A 197 ? 0.0493 0.0506 0.0522 0.0013  -0.0004 -0.0003 304  ILE A CA    
1453 C C     . ILE A 197 ? 0.0481 0.0512 0.0486 0.0021  -0.0016 0.0005  304  ILE A C     
1454 O O     . ILE A 197 ? 0.0434 0.0461 0.0476 0.0053  -0.0043 0.0014  304  ILE A O     
1455 C CB    . ILE A 197 ? 0.0574 0.0590 0.0595 0.0010  0.0025  -0.0002 304  ILE A CB    
1456 C CG1   . ILE A 197 ? 0.0787 0.0776 0.0807 0.0040  -0.0012 0.0015  304  ILE A CG1   
1457 C CG2   . ILE A 197 ? 0.0456 0.0547 0.0480 -0.0001 -0.0049 -0.0022 304  ILE A CG2   
1458 C CD1   . ILE A 197 ? 0.1020 0.0970 0.1027 -0.0035 0.0012  -0.0004 304  ILE A CD1   
1459 N N     . TYR A 198 ? 0.0534 0.0533 0.0554 0.0029  -0.0002 0.0008  305  TYR A N     
1460 C CA    . TYR A 198 ? 0.0518 0.0540 0.0526 -0.0004 -0.0017 -0.0018 305  TYR A CA    
1461 C C     . TYR A 198 ? 0.0539 0.0556 0.0549 -0.0009 -0.0014 -0.0015 305  TYR A C     
1462 O O     . TYR A 198 ? 0.0672 0.0592 0.0580 -0.0011 0.0013  -0.0017 305  TYR A O     
1463 C CB    . TYR A 198 ? 0.0538 0.0524 0.0560 0.0018  0.0005  0.0004  305  TYR A CB    
1464 C CG    . TYR A 198 ? 0.0543 0.0509 0.0601 0.0026  0.0028  -0.0002 305  TYR A CG    
1465 C CD1   . TYR A 198 ? 0.0552 0.0473 0.0436 -0.0026 -0.0005 -0.0002 305  TYR A CD1   
1466 C CD2   . TYR A 198 ? 0.0465 0.0485 0.0542 -0.0008 0.0007  0.0017  305  TYR A CD2   
1467 C CE1   . TYR A 198 ? 0.0529 0.0406 0.0400 0.0033  -0.0005 0.0007  305  TYR A CE1   
1468 C CE2   . TYR A 198 ? 0.0421 0.0394 0.0392 -0.0010 -0.0031 -0.0003 305  TYR A CE2   
1469 C CZ    . TYR A 198 ? 0.0322 0.0422 0.0381 -0.0033 -0.0046 -0.0020 305  TYR A CZ    
1470 O OH    . TYR A 198 ? 0.0365 0.0505 0.0420 -0.0056 -0.0030 -0.0050 305  TYR A OH    
1471 N N     . ASP A 199 ? 0.0552 0.0555 0.0541 -0.0023 -0.0014 -0.0028 306  ASP A N     
1472 C CA    . ASP A 199 ? 0.0574 0.0583 0.0512 -0.0014 -0.0032 -0.0025 306  ASP A CA    
1473 C C     . ASP A 199 ? 0.0540 0.0539 0.0476 -0.0009 -0.0022 -0.0026 306  ASP A C     
1474 O O     . ASP A 199 ? 0.0572 0.0570 0.0403 -0.0013 -0.0009 -0.0053 306  ASP A O     
1475 C CB    . ASP A 199 ? 0.0629 0.0621 0.0556 0.0009  -0.0041 -0.0030 306  ASP A CB    
1476 C CG    . ASP A 199 ? 0.0887 0.0882 0.0894 -0.0027 0.0046  0.0012  306  ASP A CG    
1477 O OD1   . ASP A 199 ? 0.1036 0.1140 0.1309 0.0037  0.0032  0.0014  306  ASP A OD1   
1478 O OD2   . ASP A 199 ? 0.1203 0.1022 0.1183 0.0041  0.0047  0.0039  306  ASP A OD2   
1479 N N     . MET A 200 ? 0.0554 0.0527 0.0466 -0.0018 -0.0026 -0.0052 307  MET A N     
1480 C CA    . MET A 200 ? 0.0551 0.0551 0.0496 0.0017  -0.0030 -0.0004 307  MET A CA    
1481 C C     . MET A 200 ? 0.0451 0.0487 0.0384 -0.0004 -0.0034 -0.0010 307  MET A C     
1482 O O     . MET A 200 ? 0.0414 0.0449 0.0288 0.0034  -0.0036 -0.0050 307  MET A O     
1483 C CB    . MET A 200 ? 0.0687 0.0698 0.0634 -0.0006 0.0003  0.0014  307  MET A CB    
1484 C CG    . MET A 200 ? 0.1139 0.0905 0.1020 -0.0025 -0.0017 -0.0021 307  MET A CG    
1485 S SD    . MET A 200 ? 0.1677 0.1700 0.1955 0.0054  0.0172  0.0012  307  MET A SD    
1486 C CE    . MET A 200 ? 0.1680 0.1727 0.1843 -0.0013 0.0019  -0.0026 307  MET A CE    
1487 N N     . PHE A 201 ? 0.0382 0.0381 0.0356 0.0020  -0.0022 -0.0006 308  PHE A N     
1488 C CA    . PHE A 201 ? 0.0339 0.0367 0.0311 0.0012  -0.0018 0.0004  308  PHE A CA    
1489 C C     . PHE A 201 ? 0.0339 0.0346 0.0298 -0.0005 -0.0027 -0.0018 308  PHE A C     
1490 O O     . PHE A 201 ? 0.0373 0.0411 0.0326 0.0004  -0.0014 -0.0020 308  PHE A O     
1491 C CB    . PHE A 201 ? 0.0285 0.0335 0.0319 -0.0013 -0.0030 -0.0005 308  PHE A CB    
1492 C CG    . PHE A 201 ? 0.0337 0.0331 0.0312 0.0007  -0.0018 -0.0002 308  PHE A CG    
1493 C CD1   . PHE A 201 ? 0.0291 0.0342 0.0269 -0.0017 -0.0006 -0.0032 308  PHE A CD1   
1494 C CD2   . PHE A 201 ? 0.0378 0.0318 0.0323 0.0001  0.0023  -0.0005 308  PHE A CD2   
1495 C CE1   . PHE A 201 ? 0.0344 0.0278 0.0267 0.0000  -0.0032 -0.0008 308  PHE A CE1   
1496 C CE2   . PHE A 201 ? 0.0332 0.0272 0.0256 0.0008  -0.0003 0.0007  308  PHE A CE2   
1497 C CZ    . PHE A 201 ? 0.0270 0.0282 0.0287 -0.0014 0.0004  -0.0023 308  PHE A CZ    
1498 N N     . VAL A 202 ? 0.0340 0.0338 0.0288 0.0008  -0.0013 0.0003  309  VAL A N     
1499 C CA    . VAL A 202 ? 0.0280 0.0319 0.0288 -0.0009 -0.0029 -0.0004 309  VAL A CA    
1500 C C     . VAL A 202 ? 0.0279 0.0311 0.0279 0.0006  -0.0013 0.0008  309  VAL A C     
1501 O O     . VAL A 202 ? 0.0308 0.0378 0.0380 -0.0025 -0.0007 -0.0025 309  VAL A O     
1502 C CB    . VAL A 202 ? 0.0282 0.0325 0.0298 -0.0010 -0.0034 -0.0001 309  VAL A CB    
1503 C CG1   . VAL A 202 ? 0.0437 0.0418 0.0358 -0.0016 0.0000  -0.0006 309  VAL A CG1   
1504 C CG2   . VAL A 202 ? 0.0410 0.0378 0.0328 0.0001  -0.0028 0.0000  309  VAL A CG2   
1505 N N     . HIS A 203 ? 0.0259 0.0257 0.0261 0.0002  -0.0007 -0.0003 310  HIS A N     
1506 C CA    . HIS A 203 ? 0.0254 0.0270 0.0254 0.0005  0.0001  0.0003  310  HIS A CA    
1507 C C     . HIS A 203 ? 0.0253 0.0254 0.0257 0.0000  0.0000  0.0000  310  HIS A C     
1508 O O     . HIS A 203 ? 0.0266 0.0294 0.0257 0.0011  -0.0007 -0.0003 310  HIS A O     
1509 C CB    . HIS A 203 ? 0.0256 0.0271 0.0253 0.0007  0.0000  0.0000  310  HIS A CB    
1510 C CG    . HIS A 203 ? 0.0262 0.0256 0.0301 0.0002  0.0020  0.0002  310  HIS A CG    
1511 N ND1   . HIS A 203 ? 0.0280 0.0312 0.0259 0.0027  -0.0010 -0.0002 310  HIS A ND1   
1512 C CD2   . HIS A 203 ? 0.0275 0.0260 0.0264 0.0004  -0.0015 -0.0004 310  HIS A CD2   
1513 C CE1   . HIS A 203 ? 0.0307 0.0268 0.0274 0.0010  -0.0008 -0.0009 310  HIS A CE1   
1514 N NE2   . HIS A 203 ? 0.0269 0.0255 0.0262 -0.0005 -0.0012 0.0004  310  HIS A NE2   
1515 N N     . PRO A 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO A N     
1516 C CA    . PRO A 204 ? 0.0256 0.0253 0.0261 0.0000  0.0004  0.0000  311  PRO A CA    
1517 C C     . PRO A 204 ? 0.0261 0.0255 0.0264 -0.0004 0.0009  -0.0005 311  PRO A C     
1518 O O     . PRO A 204 ? 0.0257 0.0260 0.0258 0.0005  0.0004  0.0006  311  PRO A O     
1519 C CB    . PRO A 204 ? 0.0264 0.0261 0.0253 -0.0001 0.0001  0.0000  311  PRO A CB    
1520 C CG    . PRO A 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO A CG    
1521 C CD    . PRO A 204 ? 0.0298 0.0254 0.0300 0.0000  0.0010  0.0007  311  PRO A CD    
1522 N N     . ARG A 205 ? 0.0261 0.0253 0.0272 0.0001  0.0012  0.0002  312  ARG A N     
1523 C CA    . ARG A 205 ? 0.0269 0.0256 0.0254 -0.0007 0.0002  -0.0001 312  ARG A CA    
1524 C C     . ARG A 205 ? 0.0253 0.0254 0.0255 0.0000  0.0000  0.0001  312  ARG A C     
1525 O O     . ARG A 205 ? 0.0253 0.0261 0.0257 -0.0002 0.0001  -0.0005 312  ARG A O     
1526 C CB    . ARG A 205 ? 0.0270 0.0255 0.0274 0.0003  -0.0018 -0.0003 312  ARG A CB    
1527 C CG    . ARG A 205 ? 0.0396 0.0295 0.0300 -0.0004 0.0043  0.0001  312  ARG A CG    
1528 C CD    . ARG A 205 ? 0.0349 0.0319 0.0313 0.0032  0.0009  0.0024  312  ARG A CD    
1529 N NE    . ARG A 205 ? 0.0315 0.0332 0.0315 -0.0015 -0.0027 0.0011  312  ARG A NE    
1530 C CZ    . ARG A 205 ? 0.0272 0.0311 0.0308 0.0014  0.0003  0.0011  312  ARG A CZ    
1531 N NH1   . ARG A 205 ? 0.0261 0.0276 0.0256 -0.0013 -0.0005 0.0009  312  ARG A NH1   
1532 N NH2   . ARG A 205 ? 0.0259 0.0285 0.0292 0.0001  -0.0015 -0.0014 312  ARG A NH2   
1533 N N     . PHE A 206 ? 0.0260 0.0262 0.0259 0.0005  -0.0005 -0.0006 313  PHE A N     
1534 C CA    . PHE A 206 ? 0.0264 0.0274 0.0276 0.0005  -0.0006 0.0000  313  PHE A CA    
1535 C C     . PHE A 206 ? 0.0297 0.0279 0.0264 0.0005  -0.0001 0.0008  313  PHE A C     
1536 O O     . PHE A 206 ? 0.0299 0.0294 0.0317 0.0024  -0.0013 0.0032  313  PHE A O     
1537 C CB    . PHE A 206 ? 0.0267 0.0269 0.0256 0.0004  -0.0005 -0.0005 313  PHE A CB    
1538 C CG    . PHE A 206 ? 0.0342 0.0303 0.0299 -0.0006 -0.0015 -0.0005 313  PHE A CG    
1539 C CD1   . PHE A 206 ? 0.0261 0.0315 0.0346 -0.0005 0.0010  0.0001  313  PHE A CD1   
1540 C CD2   . PHE A 206 ? 0.0318 0.0403 0.0446 0.0026  0.0005  0.0038  313  PHE A CD2   
1541 C CE1   . PHE A 206 ? 0.0301 0.0349 0.0379 0.0015  -0.0001 0.0011  313  PHE A CE1   
1542 C CE2   . PHE A 206 ? 0.0446 0.0470 0.0578 -0.0014 0.0028  0.0017  313  PHE A CE2   
1543 C CZ    . PHE A 206 ? 0.0406 0.0402 0.0382 -0.0005 -0.0013 0.0012  313  PHE A CZ    
1544 N N     . GLY A 207 ? 0.0286 0.0295 0.0260 0.0017  0.0000  0.0015  314  GLY A N     
1545 C CA    . GLY A 207 ? 0.0319 0.0295 0.0288 0.0005  0.0019  -0.0011 314  GLY A CA    
1546 C C     . GLY A 207 ? 0.0308 0.0310 0.0298 0.0006  -0.0002 0.0001  314  GLY A C     
1547 O O     . GLY A 207 ? 0.0342 0.0303 0.0303 0.0017  0.0009  -0.0031 314  GLY A O     
1548 N N     . PRO A 208 ? 0.0311 0.0311 0.0285 0.0007  -0.0015 -0.0011 315  PRO A N     
1549 C CA    . PRO A 208 ? 0.0298 0.0317 0.0346 0.0001  -0.0002 -0.0008 315  PRO A CA    
1550 C C     . PRO A 208 ? 0.0286 0.0306 0.0278 0.0001  -0.0022 -0.0023 315  PRO A C     
1551 O O     . PRO A 208 ? 0.0304 0.0369 0.0291 -0.0002 -0.0030 -0.0047 315  PRO A O     
1552 C CB    . PRO A 208 ? 0.0316 0.0325 0.0318 -0.0009 -0.0014 -0.0010 315  PRO A CB    
1553 C CG    . PRO A 208 ? 0.0345 0.0341 0.0383 -0.0001 -0.0007 0.0000  315  PRO A CG    
1554 C CD    . PRO A 208 ? 0.0314 0.0329 0.0342 -0.0005 0.0000  -0.0009 315  PRO A CD    
1555 N N     . ILE A 209 ? 0.0329 0.0320 0.0358 0.0000  0.0018  0.0000  316  ILE A N     
1556 C CA    . ILE A 209 ? 0.0307 0.0326 0.0303 0.0000  -0.0015 -0.0013 316  ILE A CA    
1557 C C     . ILE A 209 ? 0.0341 0.0332 0.0313 0.0001  -0.0013 -0.0023 316  ILE A C     
1558 O O     . ILE A 209 ? 0.0417 0.0345 0.0268 -0.0003 0.0005  -0.0036 316  ILE A O     
1559 C CB    . ILE A 209 ? 0.0315 0.0312 0.0265 0.0012  -0.0013 -0.0004 316  ILE A CB    
1560 C CG1   . ILE A 209 ? 0.0284 0.0323 0.0278 -0.0011 -0.0027 0.0003  316  ILE A CG1   
1561 C CG2   . ILE A 209 ? 0.0400 0.0383 0.0431 -0.0020 0.0006  -0.0004 316  ILE A CG2   
1562 C CD1   . ILE A 209 ? 0.0288 0.0325 0.0330 -0.0031 -0.0019 -0.0013 316  ILE A CD1   
1563 N N     . LYS A 210 ? 0.0383 0.0391 0.0410 0.0009  0.0004  0.0001  317  LYS A N     
1564 C CA    . LYS A 210 ? 0.0462 0.0433 0.0445 0.0000  0.0006  -0.0006 317  LYS A CA    
1565 C C     . LYS A 210 ? 0.0410 0.0411 0.0417 0.0006  0.0005  0.0004  317  LYS A C     
1566 O O     . LYS A 210 ? 0.0405 0.0380 0.0407 0.0023  0.0020  -0.0013 317  LYS A O     
1567 C CB    . LYS A 210 ? 0.0517 0.0498 0.0506 0.0014  0.0034  0.0000  317  LYS A CB    
1568 C CG    . LYS A 210 ? 0.0661 0.0586 0.0683 -0.0011 0.0039  -0.0001 317  LYS A CG    
1569 C CD    . LYS A 210 ? 0.0703 0.0705 0.0714 -0.0016 0.0003  -0.0025 317  LYS A CD    
1570 C CE    . LYS A 210 ? 0.0787 0.0741 0.0724 0.0004  0.0006  0.0001  317  LYS A CE    
1571 N NZ    . LYS A 210 ? 0.0686 0.0687 0.0787 0.0017  -0.0003 -0.0008 317  LYS A NZ    
1572 N N     . CYS A 211 ? 0.0387 0.0377 0.0411 -0.0006 0.0000  -0.0018 318  CYS A N     
1573 C CA    . CYS A 211 ? 0.0359 0.0369 0.0348 0.0000  -0.0013 -0.0004 318  CYS A CA    
1574 C C     . CYS A 211 ? 0.0321 0.0371 0.0406 -0.0005 -0.0005 -0.0022 318  CYS A C     
1575 O O     . CYS A 211 ? 0.0256 0.0360 0.0389 0.0005  0.0015  -0.0047 318  CYS A O     
1576 C CB    . CYS A 211 ? 0.0303 0.0356 0.0331 0.0033  -0.0044 0.0026  318  CYS A CB    
1577 S SG    . CYS A 211 ? 0.0499 0.0422 0.0437 -0.0041 -0.0029 -0.0053 318  CYS A SG    
1578 N N     . ILE A 212 ? 0.0330 0.0392 0.0349 -0.0007 -0.0039 -0.0008 319  ILE A N     
1579 C CA    . ILE A 212 ? 0.0418 0.0447 0.0456 0.0013  -0.0003 -0.0010 319  ILE A CA    
1580 C C     . ILE A 212 ? 0.0327 0.0377 0.0348 0.0006  -0.0037 0.0003  319  ILE A C     
1581 O O     . ILE A 212 ? 0.0278 0.0368 0.0434 0.0027  -0.0055 0.0012  319  ILE A O     
1582 C CB    . ILE A 212 ? 0.0497 0.0507 0.0500 -0.0005 -0.0007 -0.0006 319  ILE A CB    
1583 C CG1   . ILE A 212 ? 0.0631 0.0771 0.0808 -0.0007 -0.0001 -0.0022 319  ILE A CG1   
1584 C CG2   . ILE A 212 ? 0.0621 0.0574 0.0561 -0.0019 0.0026  -0.0024 319  ILE A CG2   
1585 C CD1   . ILE A 212 ? 0.0881 0.0969 0.1012 -0.0008 0.0018  -0.0060 319  ILE A CD1   
1586 N N     . ARG A 213 ? 0.0300 0.0313 0.0290 0.0025  -0.0011 0.0005  320  ARG A N     
1587 C CA    . ARG A 213 ? 0.0283 0.0308 0.0265 0.0002  -0.0019 0.0000  320  ARG A CA    
1588 C C     . ARG A 213 ? 0.0288 0.0292 0.0271 0.0000  -0.0004 -0.0019 320  ARG A C     
1589 O O     . ARG A 213 ? 0.0269 0.0310 0.0337 -0.0003 0.0026  -0.0035 320  ARG A O     
1590 C CB    . ARG A 213 ? 0.0303 0.0330 0.0267 -0.0015 -0.0010 -0.0025 320  ARG A CB    
1591 C CG    . ARG A 213 ? 0.0309 0.0346 0.0272 -0.0018 -0.0009 -0.0021 320  ARG A CG    
1592 C CD    . ARG A 213 ? 0.0270 0.0310 0.0307 0.0011  -0.0020 0.0000  320  ARG A CD    
1593 N NE    . ARG A 213 ? 0.0390 0.0345 0.0314 -0.0034 0.0013  -0.0022 320  ARG A NE    
1594 C CZ    . ARG A 213 ? 0.0332 0.0344 0.0336 -0.0001 0.0017  -0.0012 320  ARG A CZ    
1595 N NH1   . ARG A 213 ? 0.0312 0.0297 0.0258 -0.0015 -0.0018 0.0004  320  ARG A NH1   
1596 N NH2   . ARG A 213 ? 0.0350 0.0325 0.0270 0.0021  -0.0001 -0.0021 320  ARG A NH2   
1597 N N     . THR A 214 ? 0.0259 0.0290 0.0256 0.0012  0.0001  0.0008  321  THR A N     
1598 C CA    . THR A 214 ? 0.0307 0.0287 0.0260 -0.0002 -0.0014 -0.0010 321  THR A CA    
1599 C C     . THR A 214 ? 0.0343 0.0333 0.0331 0.0006  -0.0002 0.0002  321  THR A C     
1600 O O     . THR A 214 ? 0.0373 0.0305 0.0262 0.0012  -0.0032 -0.0005 321  THR A O     
1601 C CB    . THR A 214 ? 0.0273 0.0253 0.0255 0.0003  -0.0006 -0.0001 321  THR A CB    
1602 O OG1   . THR A 214 ? 0.0464 0.0264 0.0254 -0.0047 0.0017  -0.0004 321  THR A OG1   
1603 C CG2   . THR A 214 ? 0.0253 0.0271 0.0256 0.0003  0.0001  0.0007  321  THR A CG2   
1604 N N     . LEU A 215 ? 0.0425 0.0398 0.0359 0.0016  -0.0024 0.0008  322  LEU A N     
1605 C CA    . LEU A 215 ? 0.0470 0.0501 0.0499 -0.0007 -0.0026 -0.0001 322  LEU A CA    
1606 C C     . LEU A 215 ? 0.0506 0.0523 0.0560 0.0010  -0.0015 0.0011  322  LEU A C     
1607 O O     . LEU A 215 ? 0.0502 0.0541 0.0597 0.0008  -0.0019 0.0039  322  LEU A O     
1608 C CB    . LEU A 215 ? 0.0533 0.0568 0.0602 -0.0023 -0.0008 -0.0021 322  LEU A CB    
1609 C CG    . LEU A 215 ? 0.0747 0.0755 0.0877 0.0013  -0.0005 0.0000  322  LEU A CG    
1610 C CD1   . LEU A 215 ? 0.1162 0.1151 0.1117 -0.0001 0.0016  0.0000  322  LEU A CD1   
1611 C CD2   . LEU A 215 ? 0.0843 0.0911 0.0888 -0.0002 0.0005  0.0003  322  LEU A CD2   
1612 N N     . ARG A 216 ? 0.0550 0.0550 0.0565 0.0000  -0.0015 0.0006  323  ARG A N     
1613 C CA    . ARG A 216 ? 0.0581 0.0590 0.0587 0.0012  -0.0010 0.0007  323  ARG A CA    
1614 C C     . ARG A 216 ? 0.0572 0.0577 0.0560 0.0011  -0.0009 0.0005  323  ARG A C     
1615 O O     . ARG A 216 ? 0.0618 0.0636 0.0705 0.0012  0.0019  0.0009  323  ARG A O     
1616 C CB    . ARG A 216 ? 0.0610 0.0627 0.0611 -0.0001 -0.0032 -0.0003 323  ARG A CB    
1617 C CG    . ARG A 216 ? 0.0742 0.0775 0.0784 -0.0019 -0.0012 0.0009  323  ARG A CG    
1618 C CD    . ARG A 216 ? 0.1138 0.1082 0.1027 0.0007  0.0008  -0.0038 323  ARG A CD    
1619 N NE    . ARG A 216 ? 0.1269 0.1337 0.1257 -0.0055 -0.0002 0.0009  323  ARG A NE    
1620 C CZ    . ARG A 216 ? 0.1573 0.1541 0.1527 0.0003  0.0001  -0.0039 323  ARG A CZ    
1621 N NH1   . ARG A 216 ? 0.1498 0.1527 0.1453 0.0032  -0.0019 0.0007  323  ARG A NH1   
1622 N NH2   . ARG A 216 ? 0.1811 0.1833 0.1757 -0.0026 0.0072  0.0011  323  ARG A NH2   
1623 N N     . ALA A 217 ? 0.0549 0.0545 0.0545 0.0010  0.0010  0.0000  324  ALA A N     
1624 C CA    . ALA A 217 ? 0.0521 0.0523 0.0504 0.0001  -0.0001 -0.0004 324  ALA A CA    
1625 C C     . ALA A 217 ? 0.0512 0.0532 0.0480 0.0006  -0.0019 0.0001  324  ALA A C     
1626 O O     . ALA A 217 ? 0.0536 0.0507 0.0464 0.0001  -0.0020 0.0015  324  ALA A O     
1627 C CB    . ALA A 217 ? 0.0438 0.0490 0.0475 0.0002  -0.0007 -0.0010 324  ALA A CB    
1628 N N     . VAL A 218 ? 0.0591 0.0536 0.0546 -0.0023 0.0021  -0.0009 325  VAL A N     
1629 C CA    . VAL A 218 ? 0.0596 0.0570 0.0549 -0.0006 0.0009  -0.0009 325  VAL A CA    
1630 C C     . VAL A 218 ? 0.0540 0.0547 0.0535 -0.0020 -0.0012 -0.0006 325  VAL A C     
1631 O O     . VAL A 218 ? 0.0509 0.0502 0.0559 -0.0005 0.0006  0.0025  325  VAL A O     
1632 C CB    . VAL A 218 ? 0.0618 0.0595 0.0618 -0.0001 0.0018  0.0000  325  VAL A CB    
1633 C CG1   . VAL A 218 ? 0.0728 0.0682 0.0691 -0.0010 0.0053  0.0020  325  VAL A CG1   
1634 C CG2   . VAL A 218 ? 0.0639 0.0617 0.0680 -0.0004 0.0044  -0.0014 325  VAL A CG2   
1635 N N     . GLU A 219 ? 0.0545 0.0568 0.0552 -0.0023 -0.0013 -0.0006 326  GLU A N     
1636 C CA    . GLU A 219 ? 0.0585 0.0591 0.0577 -0.0009 -0.0015 -0.0005 326  GLU A CA    
1637 C C     . GLU A 219 ? 0.0561 0.0550 0.0532 -0.0005 0.0003  0.0000  326  GLU A C     
1638 O O     . GLU A 219 ? 0.0538 0.0543 0.0516 0.0004  -0.0008 0.0025  326  GLU A O     
1639 C CB    . GLU A 219 ? 0.0726 0.0661 0.0658 -0.0013 0.0008  0.0004  326  GLU A CB    
1640 C CG    . GLU A 219 ? 0.0859 0.0926 0.0864 -0.0012 -0.0017 0.0018  326  GLU A CG    
1641 C CD    . GLU A 219 ? 0.1218 0.1142 0.1241 -0.0001 0.0054  -0.0063 326  GLU A CD    
1642 O OE1   . GLU A 219 ? 0.0984 0.1287 0.1127 0.0024  -0.0066 0.0000  326  GLU A OE1   
1643 O OE2   . GLU A 219 ? 0.1241 0.1515 0.1559 -0.0048 0.0005  -0.0054 326  GLU A OE2   
1644 N N     . ALA A 220 ? 0.0503 0.0519 0.0490 -0.0013 -0.0010 0.0000  327  ALA A N     
1645 C CA    . ALA A 220 ? 0.0505 0.0497 0.0456 -0.0005 -0.0005 -0.0001 327  ALA A CA    
1646 C C     . ALA A 220 ? 0.0504 0.0498 0.0459 0.0000  -0.0004 0.0002  327  ALA A C     
1647 O O     . ALA A 220 ? 0.0403 0.0442 0.0317 0.0002  -0.0044 -0.0011 327  ALA A O     
1648 C CB    . ALA A 220 ? 0.0512 0.0500 0.0453 -0.0002 -0.0005 -0.0010 327  ALA A CB    
1649 N N     . ASP A 221 ? 0.0514 0.0500 0.0446 0.0002  -0.0029 0.0000  328  ASP A N     
1650 C CA    . ASP A 221 ? 0.0568 0.0560 0.0530 -0.0001 -0.0004 0.0003  328  ASP A CA    
1651 C C     . ASP A 221 ? 0.0650 0.0587 0.0599 -0.0002 0.0023  0.0000  328  ASP A C     
1652 O O     . ASP A 221 ? 0.0693 0.0600 0.0645 -0.0014 0.0045  -0.0021 328  ASP A O     
1653 C CB    . ASP A 221 ? 0.0620 0.0571 0.0597 0.0014  0.0033  -0.0001 328  ASP A CB    
1654 C CG    . ASP A 221 ? 0.0562 0.0557 0.0572 -0.0010 -0.0006 -0.0011 328  ASP A CG    
1655 O OD1   . ASP A 221 ? 0.0626 0.0501 0.0569 -0.0008 -0.0034 -0.0028 328  ASP A OD1   
1656 O OD2   . ASP A 221 ? 0.0663 0.0656 0.0734 -0.0005 0.0009  -0.0021 328  ASP A OD2   
1657 N N     . GLU A 222 ? 0.0646 0.0617 0.0626 -0.0021 0.0025  -0.0010 329  GLU A N     
1658 C CA    . GLU A 222 ? 0.0622 0.0617 0.0638 0.0000  0.0015  -0.0012 329  GLU A CA    
1659 C C     . GLU A 222 ? 0.0566 0.0555 0.0555 -0.0005 -0.0001 -0.0008 329  GLU A C     
1660 O O     . GLU A 222 ? 0.0537 0.0517 0.0567 -0.0008 0.0009  -0.0032 329  GLU A O     
1661 C CB    . GLU A 222 ? 0.0642 0.0682 0.0665 -0.0028 -0.0010 -0.0031 329  GLU A CB    
1662 C CG    . GLU A 222 ? 0.0767 0.0777 0.0818 0.0002  -0.0016 -0.0023 329  GLU A CG    
1663 C CD    . GLU A 222 ? 0.0904 0.0972 0.1101 -0.0039 0.0062  -0.0025 329  GLU A CD    
1664 O OE1   . GLU A 222 ? 0.0829 0.0879 0.0783 -0.0011 -0.0108 0.0022  329  GLU A OE1   
1665 O OE2   . GLU A 222 ? 0.1182 0.1098 0.1351 -0.0042 0.0076  -0.0035 329  GLU A OE2   
1666 N N     . GLU A 223 ? 0.0457 0.0499 0.0522 0.0012  -0.0017 0.0003  330  GLU A N     
1667 C CA    . GLU A 223 ? 0.0461 0.0467 0.0461 0.0001  -0.0009 0.0006  330  GLU A CA    
1668 C C     . GLU A 223 ? 0.0429 0.0447 0.0466 0.0005  -0.0008 0.0003  330  GLU A C     
1669 O O     . GLU A 223 ? 0.0438 0.0466 0.0441 -0.0012 -0.0027 0.0012  330  GLU A O     
1670 C CB    . GLU A 223 ? 0.0470 0.0457 0.0512 0.0026  0.0003  0.0005  330  GLU A CB    
1671 C CG    . GLU A 223 ? 0.0445 0.0470 0.0450 0.0014  -0.0015 0.0029  330  GLU A CG    
1672 C CD    . GLU A 223 ? 0.0562 0.0510 0.0519 0.0022  0.0007  0.0006  330  GLU A CD    
1673 O OE1   . GLU A 223 ? 0.0528 0.0728 0.0577 -0.0009 -0.0028 0.0032  330  GLU A OE1   
1674 O OE2   . GLU A 223 ? 0.0508 0.0597 0.0579 -0.0008 -0.0008 -0.0034 330  GLU A OE2   
1675 N N     . LEU A 224 ? 0.0446 0.0432 0.0430 -0.0011 0.0003  0.0000  331  LEU A N     
1676 C CA    . LEU A 224 ? 0.0409 0.0417 0.0439 -0.0005 -0.0004 -0.0001 331  LEU A CA    
1677 C C     . LEU A 224 ? 0.0358 0.0370 0.0369 0.0001  -0.0018 0.0019  331  LEU A C     
1678 O O     . LEU A 224 ? 0.0343 0.0337 0.0359 -0.0024 -0.0021 0.0010  331  LEU A O     
1679 C CB    . LEU A 224 ? 0.0445 0.0443 0.0436 -0.0002 -0.0004 0.0016  331  LEU A CB    
1680 C CG    . LEU A 224 ? 0.0583 0.0541 0.0564 0.0029  0.0013  0.0006  331  LEU A CG    
1681 C CD1   . LEU A 224 ? 0.0618 0.0649 0.0606 0.0018  -0.0001 0.0000  331  LEU A CD1   
1682 C CD2   . LEU A 224 ? 0.0628 0.0634 0.0609 0.0031  0.0008  0.0037  331  LEU A CD2   
1683 N N     . THR A 225 ? 0.0274 0.0320 0.0309 0.0009  -0.0029 0.0016  332  THR A N     
1684 C CA    . THR A 225 ? 0.0327 0.0330 0.0311 0.0004  -0.0002 -0.0010 332  THR A CA    
1685 C C     . THR A 225 ? 0.0339 0.0339 0.0298 0.0004  -0.0002 0.0010  332  THR A C     
1686 O O     . THR A 225 ? 0.0289 0.0319 0.0328 0.0038  -0.0003 0.0039  332  THR A O     
1687 C CB    . THR A 225 ? 0.0282 0.0290 0.0274 0.0013  -0.0023 -0.0002 332  THR A CB    
1688 O OG1   . THR A 225 ? 0.0405 0.0453 0.0478 -0.0005 0.0026  -0.0031 332  THR A OG1   
1689 C CG2   . THR A 225 ? 0.0264 0.0282 0.0256 0.0002  -0.0004 -0.0008 332  THR A CG2   
1690 N N     . VAL A 226 ? 0.0356 0.0379 0.0361 0.0010  -0.0009 0.0000  333  VAL A N     
1691 C CA    . VAL A 226 ? 0.0425 0.0428 0.0427 0.0008  -0.0002 0.0009  333  VAL A CA    
1692 C C     . VAL A 226 ? 0.0399 0.0393 0.0365 0.0002  -0.0002 0.0009  333  VAL A C     
1693 O O     . VAL A 226 ? 0.0350 0.0362 0.0341 0.0021  -0.0001 0.0011  333  VAL A O     
1694 C CB    . VAL A 226 ? 0.0471 0.0473 0.0433 0.0003  -0.0009 0.0002  333  VAL A CB    
1695 C CG1   . VAL A 226 ? 0.0464 0.0538 0.0586 -0.0005 0.0001  0.0000  333  VAL A CG1   
1696 C CG2   . VAL A 226 ? 0.0604 0.0564 0.0517 0.0012  0.0001  -0.0019 333  VAL A CG2   
1697 N N     . ALA A 227 ? 0.0385 0.0380 0.0369 -0.0009 -0.0005 -0.0014 334  ALA A N     
1698 C CA    . ALA A 227 ? 0.0362 0.0378 0.0373 0.0006  0.0003  0.0006  334  ALA A CA    
1699 C C     . ALA A 227 ? 0.0348 0.0336 0.0313 0.0013  -0.0004 0.0013  334  ALA A C     
1700 O O     . ALA A 227 ? 0.0441 0.0403 0.0409 0.0011  0.0035  0.0017  334  ALA A O     
1701 C CB    . ALA A 227 ? 0.0397 0.0370 0.0395 0.0015  0.0002  -0.0001 334  ALA A CB    
1702 N N     . TYR A 228 ? 0.0266 0.0279 0.0258 0.0006  -0.0006 0.0002  335  TYR A N     
1703 C CA    . TYR A 228 ? 0.0259 0.0275 0.0273 0.0006  -0.0007 0.0006  335  TYR A CA    
1704 C C     . TYR A 228 ? 0.0257 0.0264 0.0262 0.0003  -0.0005 -0.0002 335  TYR A C     
1705 O O     . TYR A 228 ? 0.0313 0.0276 0.0308 0.0017  -0.0011 0.0028  335  TYR A O     
1706 C CB    . TYR A 228 ? 0.0257 0.0281 0.0267 0.0003  -0.0003 0.0015  335  TYR A CB    
1707 C CG    . TYR A 228 ? 0.0265 0.0286 0.0281 0.0017  0.0000  0.0013  335  TYR A CG    
1708 C CD1   . TYR A 228 ? 0.0253 0.0271 0.0253 -0.0002 0.0000  -0.0002 335  TYR A CD1   
1709 C CD2   . TYR A 228 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  335  TYR A CD2   
1710 C CE1   . TYR A 228 ? 0.0255 0.0293 0.0261 -0.0010 0.0004  -0.0018 335  TYR A CE1   
1711 C CE2   . TYR A 228 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  335  TYR A CE2   
1712 C CZ    . TYR A 228 ? 0.0265 0.0282 0.0254 -0.0018 0.0004  -0.0006 335  TYR A CZ    
1713 O OH    . TYR A 228 ? 0.0298 0.0315 0.0286 0.0019  0.0034  0.0034  335  TYR A OH    
1714 N N     . GLY A 229 ? 0.0254 0.0269 0.0262 0.0000  -0.0003 0.0003  336  GLY A N     
1715 C CA    . GLY A 229 ? 0.0260 0.0282 0.0269 -0.0003 -0.0010 0.0005  336  GLY A CA    
1716 C C     . GLY A 229 ? 0.0279 0.0303 0.0307 -0.0010 0.0000  0.0011  336  GLY A C     
1717 O O     . GLY A 229 ? 0.0272 0.0355 0.0326 0.0003  -0.0016 0.0036  336  GLY A O     
1718 N N     . TYR A 230 ? 0.0268 0.0314 0.0270 0.0001  -0.0016 0.0000  337  TYR A N     
1719 C CA    . TYR A 230 ? 0.0304 0.0324 0.0302 0.0002  0.0000  0.0001  337  TYR A CA    
1720 C C     . TYR A 230 ? 0.0294 0.0343 0.0310 -0.0011 -0.0004 -0.0008 337  TYR A C     
1721 O O     . TYR A 230 ? 0.0301 0.0341 0.0320 0.0009  -0.0018 0.0022  337  TYR A O     
1722 C CB    . TYR A 230 ? 0.0293 0.0319 0.0289 0.0012  0.0000  0.0001  337  TYR A CB    
1723 C CG    . TYR A 230 ? 0.0260 0.0313 0.0275 -0.0001 -0.0012 -0.0003 337  TYR A CG    
1724 C CD1   . TYR A 230 ? 0.0268 0.0298 0.0272 0.0003  -0.0014 -0.0018 337  TYR A CD1   
1725 C CD2   . TYR A 230 ? 0.0411 0.0344 0.0260 0.0000  -0.0031 -0.0006 337  TYR A CD2   
1726 C CE1   . TYR A 230 ? 0.0312 0.0297 0.0317 -0.0003 0.0002  0.0011  337  TYR A CE1   
1727 C CE2   . TYR A 230 ? 0.0316 0.0342 0.0309 -0.0006 -0.0013 0.0019  337  TYR A CE2   
1728 C CZ    . TYR A 230 ? 0.0325 0.0341 0.0320 -0.0015 -0.0030 0.0000  337  TYR A CZ    
1729 O OH    . TYR A 230 ? 0.0315 0.0337 0.0452 0.0002  0.0020  0.0022  337  TYR A OH    
1730 N N     . ASP A 231 ? 0.0294 0.0380 0.0317 0.0001  -0.0041 0.0002  338  ASP A N     
1731 C CA    . ASP A 231 ? 0.0366 0.0438 0.0425 -0.0011 -0.0021 0.0001  338  ASP A CA    
1732 C C     . ASP A 231 ? 0.0426 0.0456 0.0480 -0.0005 0.0019  0.0012  338  ASP A C     
1733 O O     . ASP A 231 ? 0.0359 0.0492 0.0526 0.0020  0.0003  0.0043  338  ASP A O     
1734 C CB    . ASP A 231 ? 0.0480 0.0478 0.0476 0.0006  0.0007  0.0010  338  ASP A CB    
1735 C CG    . ASP A 231 ? 0.0603 0.0582 0.0612 -0.0033 0.0000  -0.0028 338  ASP A CG    
1736 O OD1   . ASP A 231 ? 0.0558 0.0616 0.0613 0.0061  -0.0038 0.0065  338  ASP A OD1   
1737 O OD2   . ASP A 231 ? 0.0962 0.0823 0.0859 -0.0033 -0.0008 0.0054  338  ASP A OD2   
1738 N N     . HIS A 232 ? 0.0349 0.0445 0.0404 0.0002  -0.0042 0.0001  339  HIS A N     
1739 C CA    . HIS A 232 ? 0.0455 0.0484 0.0486 0.0008  0.0001  0.0011  339  HIS A CA    
1740 C C     . HIS A 232 ? 0.0533 0.0543 0.0553 -0.0004 0.0000  -0.0015 339  HIS A C     
1741 O O     . HIS A 232 ? 0.0604 0.0544 0.0547 0.0002  0.0020  0.0009  339  HIS A O     
1742 C CB    . HIS A 232 ? 0.0397 0.0439 0.0434 -0.0008 -0.0020 -0.0023 339  HIS A CB    
1743 C CG    . HIS A 232 ? 0.0324 0.0409 0.0470 -0.0002 -0.0004 0.0020  339  HIS A CG    
1744 N ND1   . HIS A 232 ? 0.0355 0.0368 0.0273 0.0026  -0.0036 0.0018  339  HIS A ND1   
1745 C CD2   . HIS A 232 ? 0.0285 0.0326 0.0258 0.0036  -0.0011 -0.0004 339  HIS A CD2   
1746 C CE1   . HIS A 232 ? 0.0336 0.0344 0.0343 0.0021  -0.0020 0.0022  339  HIS A CE1   
1747 N NE2   . HIS A 232 ? 0.0364 0.0344 0.0280 0.0005  0.0009  -0.0003 339  HIS A NE2   
1748 N N     . SER A 233 ? 0.0597 0.0638 0.0608 -0.0007 -0.0019 0.0015  340  SER A N     
1749 C CA    . SER A 233 ? 0.0701 0.0721 0.0732 0.0000  -0.0010 0.0000  340  SER A CA    
1750 C C     . SER A 233 ? 0.0823 0.0865 0.0867 0.0010  -0.0034 0.0024  340  SER A C     
1751 O O     . SER A 233 ? 0.0690 0.0813 0.0832 0.0017  -0.0076 0.0020  340  SER A O     
1752 C CB    . SER A 233 ? 0.0672 0.0702 0.0702 -0.0003 -0.0026 0.0006  340  SER A CB    
1753 O OG    . SER A 233 ? 0.0568 0.0710 0.0700 0.0008  -0.0045 -0.0006 340  SER A OG    
1754 N N     . PRO A 234 ? 0.1029 0.1090 0.1107 -0.0007 -0.0014 0.0004  341  PRO A N     
1755 C CA    . PRO A 234 ? 0.1216 0.1271 0.1249 0.0003  -0.0021 0.0015  341  PRO A CA    
1756 C C     . PRO A 234 ? 0.1430 0.1427 0.1473 0.0000  -0.0004 -0.0010 341  PRO A C     
1757 O O     . PRO A 234 ? 0.1422 0.1451 0.1478 0.0011  -0.0013 -0.0003 341  PRO A O     
1758 C CB    . PRO A 234 ? 0.1198 0.1231 0.1244 0.0005  -0.0019 0.0018  341  PRO A CB    
1759 C CG    . PRO A 234 ? 0.1126 0.1183 0.1182 -0.0005 -0.0015 -0.0008 341  PRO A CG    
1760 C CD    . PRO A 234 ? 0.1036 0.1079 0.1101 -0.0003 -0.0022 0.0003  341  PRO A CD    
1761 N N     . PRO A 235 ? 0.1681 0.1697 0.1695 0.0005  0.0001  0.0013  342  PRO A N     
1762 C CA    . PRO A 235 ? 0.1863 0.1827 0.1871 0.0000  0.0001  0.0004  342  PRO A CA    
1763 C C     . PRO A 235 ? 0.2014 0.2025 0.2024 0.0009  0.0020  -0.0005 342  PRO A C     
1764 O O     . PRO A 235 ? 0.2077 0.2062 0.2053 0.0001  0.0017  0.0000  342  PRO A O     
1765 C CB    . PRO A 235 ? 0.1835 0.1833 0.1855 0.0000  0.0000  -0.0005 342  PRO A CB    
1766 C CG    . PRO A 235 ? 0.1786 0.1771 0.1790 0.0000  0.0007  0.0013  342  PRO A CG    
1767 C CD    . PRO A 235 ? 0.1693 0.1706 0.1696 0.0000  -0.0009 0.0000  342  PRO A CD    
1768 N N     . GLY A 236 ? 0.2193 0.2177 0.2232 -0.0013 0.0011  0.0001  343  GLY A N     
1769 C CA    . GLY A 236 ? 0.2294 0.2305 0.2325 0.0003  0.0024  0.0004  343  GLY A CA    
1770 C C     . GLY A 236 ? 0.2388 0.2399 0.2408 -0.0005 -0.0003 0.0003  343  GLY A C     
1771 O O     . GLY A 236 ? 0.2436 0.2456 0.2502 0.0008  0.0030  0.0028  343  GLY A O     
1772 N N     . LYS A 237 ? 0.2469 0.2491 0.2486 -0.0004 0.0010  0.0002  344  LYS A N     
1773 C CA    . LYS A 237 ? 0.2542 0.2540 0.2548 0.0000  0.0002  0.0001  344  LYS A CA    
1774 C C     . LYS A 237 ? 0.2531 0.2540 0.2560 -0.0001 0.0006  0.0002  344  LYS A C     
1775 O O     . LYS A 237 ? 0.2545 0.2582 0.2599 0.0000  -0.0002 -0.0008 344  LYS A O     
1776 C CB    . LYS A 237 ? 0.2571 0.2587 0.2597 0.0004  0.0011  0.0000  344  LYS A CB    
1777 C CG    . LYS A 237 ? 0.2695 0.2673 0.2689 -0.0001 0.0008  0.0021  344  LYS A CG    
1778 C CD    . LYS A 237 ? 0.2807 0.2808 0.2814 0.0013  0.0032  -0.0007 344  LYS A CD    
1779 C CE    . LYS A 237 ? 0.2895 0.2867 0.2891 -0.0006 0.0028  0.0012  344  LYS A CE    
1780 N NZ    . LYS A 237 ? 0.2923 0.2896 0.2907 0.0014  0.0023  0.0015  344  LYS A NZ    
1781 N N     . SER A 238 ? 0.2510 0.2497 0.2522 -0.0001 0.0008  0.0002  345  SER A N     
1782 C CA    . SER A 238 ? 0.2467 0.2448 0.2486 0.0008  0.0010  0.0005  345  SER A CA    
1783 C C     . SER A 238 ? 0.2352 0.2371 0.2389 -0.0002 0.0016  -0.0003 345  SER A C     
1784 O O     . SER A 238 ? 0.2448 0.2385 0.2449 -0.0005 0.0038  0.0007  345  SER A O     
1785 C CB    . SER A 238 ? 0.2476 0.2471 0.2494 -0.0001 -0.0006 -0.0004 345  SER A CB    
1786 O OG    . SER A 238 ? 0.2670 0.2626 0.2621 -0.0003 0.0056  0.0000  345  SER A OG    
1787 N N     . GLY A 239 ? 0.2220 0.2188 0.2222 0.0004  -0.0008 0.0000  346  GLY A N     
1788 C CA    . GLY A 239 ? 0.2080 0.2083 0.2071 -0.0004 -0.0007 -0.0010 346  GLY A CA    
1789 C C     . GLY A 239 ? 0.1946 0.1945 0.1959 0.0016  -0.0007 0.0007  346  GLY A C     
1790 O O     . GLY A 239 ? 0.1920 0.1950 0.1915 0.0016  -0.0030 0.0000  346  GLY A O     
1791 N N     . PRO A 240 ? 0.1774 0.1799 0.1766 0.0000  -0.0013 -0.0005 347  PRO A N     
1792 C CA    . PRO A 240 ? 0.1664 0.1678 0.1670 -0.0004 -0.0012 0.0000  347  PRO A CA    
1793 C C     . PRO A 240 ? 0.1546 0.1566 0.1537 0.0004  -0.0010 0.0010  347  PRO A C     
1794 O O     . PRO A 240 ? 0.1588 0.1583 0.1560 0.0000  0.0004  0.0010  347  PRO A O     
1795 C CB    . PRO A 240 ? 0.1665 0.1677 0.1669 -0.0003 -0.0011 -0.0003 347  PRO A CB    
1796 C CG    . PRO A 240 ? 0.1745 0.1747 0.1717 0.0007  -0.0009 0.0006  347  PRO A CG    
1797 C CD    . PRO A 240 ? 0.1812 0.1787 0.1806 0.0013  0.0011  0.0000  347  PRO A CD    
1798 N N     . GLU A 241 ? 0.1429 0.1423 0.1430 -0.0006 -0.0010 -0.0005 348  GLU A N     
1799 C CA    . GLU A 241 ? 0.1305 0.1332 0.1342 -0.0002 -0.0025 -0.0006 348  GLU A CA    
1800 C C     . GLU A 241 ? 0.1033 0.1161 0.1061 -0.0018 -0.0060 0.0005  348  GLU A C     
1801 O O     . GLU A 241 ? 0.0886 0.1063 0.0964 -0.0025 -0.0139 0.0015  348  GLU A O     
1802 C CB    . GLU A 241 ? 0.1499 0.1419 0.1419 0.0005  0.0002  0.0011  348  GLU A CB    
1803 C CG    . GLU A 241 ? 0.1717 0.1805 0.1855 0.0023  -0.0032 -0.0028 348  GLU A CG    
1804 C CD    . GLU A 241 ? 0.2249 0.2252 0.2264 -0.0053 0.0069  0.0041  348  GLU A CD    
1805 O OE1   . GLU A 241 ? 0.2603 0.2384 0.2642 -0.0028 0.0053  -0.0020 348  GLU A OE1   
1806 O OE2   . GLU A 241 ? 0.2490 0.2545 0.2538 0.0032  0.0081  -0.0029 348  GLU A OE2   
1807 N N     . ALA A 242 ? 0.0883 0.0985 0.0991 0.0001  -0.0044 -0.0014 349  ALA A N     
1808 C CA    . ALA A 242 ? 0.0832 0.0900 0.0859 -0.0006 -0.0030 0.0001  349  ALA A CA    
1809 C C     . ALA A 242 ? 0.0751 0.0811 0.0772 0.0004  -0.0048 -0.0008 349  ALA A C     
1810 O O     . ALA A 242 ? 0.0636 0.0739 0.0673 0.0005  -0.0095 0.0008  349  ALA A O     
1811 C CB    . ALA A 242 ? 0.0843 0.0908 0.0892 -0.0001 -0.0013 -0.0014 349  ALA A CB    
1812 N N     . PRO A 243 ? 0.0756 0.0786 0.0742 0.0000  -0.0015 -0.0004 350  PRO A N     
1813 C CA    . PRO A 243 ? 0.0739 0.0738 0.0706 -0.0008 -0.0005 -0.0007 350  PRO A CA    
1814 C C     . PRO A 243 ? 0.0645 0.0662 0.0626 -0.0006 -0.0002 0.0000  350  PRO A C     
1815 O O     . PRO A 243 ? 0.0639 0.0630 0.0541 -0.0008 -0.0030 0.0007  350  PRO A O     
1816 C CB    . PRO A 243 ? 0.0827 0.0773 0.0751 -0.0008 0.0020  -0.0014 350  PRO A CB    
1817 C CG    . PRO A 243 ? 0.0824 0.0815 0.0803 -0.0025 0.0027  -0.0015 350  PRO A CG    
1818 C CD    . PRO A 243 ? 0.0807 0.0808 0.0811 -0.0009 0.0006  -0.0015 350  PRO A CD    
1819 N N     . GLU A 244 ? 0.0571 0.0596 0.0583 -0.0022 -0.0018 -0.0005 351  GLU A N     
1820 C CA    . GLU A 244 ? 0.0543 0.0548 0.0528 -0.0002 0.0006  0.0000  351  GLU A CA    
1821 C C     . GLU A 244 ? 0.0496 0.0503 0.0497 -0.0010 -0.0001 -0.0002 351  GLU A C     
1822 O O     . GLU A 244 ? 0.0499 0.0516 0.0468 -0.0015 -0.0015 -0.0014 351  GLU A O     
1823 C CB    . GLU A 244 ? 0.0501 0.0538 0.0548 -0.0018 -0.0002 -0.0005 351  GLU A CB    
1824 C CG    . GLU A 244 ? 0.0466 0.0497 0.0468 -0.0005 -0.0027 0.0000  351  GLU A CG    
1825 C CD    . GLU A 244 ? 0.0487 0.0493 0.0501 -0.0010 -0.0012 0.0018  351  GLU A CD    
1826 O OE1   . GLU A 244 ? 0.0421 0.0505 0.0370 -0.0017 -0.0068 -0.0018 351  GLU A OE1   
1827 O OE2   . GLU A 244 ? 0.0544 0.0500 0.0542 -0.0024 -0.0030 0.0003  351  GLU A OE2   
1828 N N     . TRP A 245 ? 0.0438 0.0469 0.0415 -0.0008 -0.0013 -0.0002 352  TRP A N     
1829 C CA    . TRP A 245 ? 0.0404 0.0424 0.0423 -0.0001 0.0011  -0.0001 352  TRP A CA    
1830 C C     . TRP A 245 ? 0.0370 0.0392 0.0396 -0.0006 -0.0008 -0.0001 352  TRP A C     
1831 O O     . TRP A 245 ? 0.0396 0.0370 0.0256 0.0000  -0.0019 -0.0003 352  TRP A O     
1832 C CB    . TRP A 245 ? 0.0389 0.0411 0.0426 0.0000  0.0013  -0.0015 352  TRP A CB    
1833 C CG    . TRP A 245 ? 0.0263 0.0355 0.0306 -0.0007 -0.0023 0.0009  352  TRP A CG    
1834 C CD1   . TRP A 245 ? 0.0324 0.0331 0.0380 0.0002  0.0016  0.0002  352  TRP A CD1   
1835 C CD2   . TRP A 245 ? 0.0279 0.0358 0.0377 0.0023  0.0012  0.0008  352  TRP A CD2   
1836 N NE1   . TRP A 245 ? 0.0273 0.0292 0.0293 0.0021  -0.0010 0.0011  352  TRP A NE1   
1837 C CE2   . TRP A 245 ? 0.0257 0.0286 0.0288 -0.0008 0.0003  -0.0029 352  TRP A CE2   
1838 C CE3   . TRP A 245 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  352  TRP A CE3   
1839 C CZ2   . TRP A 245 ? 0.0264 0.0338 0.0322 -0.0028 -0.0001 -0.0028 352  TRP A CZ2   
1840 C CZ3   . TRP A 245 ? 0.0253 0.0253 0.0257 0.0000  -0.0001 0.0000  352  TRP A CZ3   
1841 C CH2   . TRP A 245 ? 0.0254 0.0254 0.0279 0.0001  0.0004  0.0005  352  TRP A CH2   
1842 N N     . TYR A 246 ? 0.0339 0.0374 0.0344 -0.0005 -0.0027 -0.0006 353  TYR A N     
1843 C CA    . TYR A 246 ? 0.0388 0.0377 0.0362 -0.0001 -0.0005 0.0010  353  TYR A CA    
1844 C C     . TYR A 246 ? 0.0420 0.0415 0.0378 -0.0002 -0.0011 0.0007  353  TYR A C     
1845 O O     . TYR A 246 ? 0.0396 0.0398 0.0464 -0.0035 0.0007  -0.0012 353  TYR A O     
1846 C CB    . TYR A 246 ? 0.0377 0.0375 0.0327 0.0015  -0.0003 0.0012  353  TYR A CB    
1847 C CG    . TYR A 246 ? 0.0319 0.0317 0.0269 0.0007  -0.0025 0.0015  353  TYR A CG    
1848 C CD1   . TYR A 246 ? 0.0273 0.0311 0.0325 0.0019  -0.0005 0.0048  353  TYR A CD1   
1849 C CD2   . TYR A 246 ? 0.0253 0.0282 0.0253 0.0002  0.0000  0.0000  353  TYR A CD2   
1850 C CE1   . TYR A 246 ? 0.0290 0.0322 0.0289 0.0019  -0.0018 0.0029  353  TYR A CE1   
1851 C CE2   . TYR A 246 ? 0.0263 0.0290 0.0257 0.0007  -0.0006 -0.0003 353  TYR A CE2   
1852 C CZ    . TYR A 246 ? 0.0285 0.0329 0.0273 0.0007  -0.0025 -0.0007 353  TYR A CZ    
1853 O OH    . TYR A 246 ? 0.0303 0.0462 0.0505 -0.0019 -0.0006 -0.0055 353  TYR A OH    
1854 N N     . GLN A 247 ? 0.0497 0.0475 0.0439 0.0005  0.0001  0.0008  354  GLN A N     
1855 C CA    . GLN A 247 ? 0.0543 0.0529 0.0516 -0.0003 -0.0010 -0.0003 354  GLN A CA    
1856 C C     . GLN A 247 ? 0.0551 0.0549 0.0538 0.0005  -0.0012 0.0009  354  GLN A C     
1857 O O     . GLN A 247 ? 0.0566 0.0519 0.0537 -0.0015 0.0007  -0.0012 354  GLN A O     
1858 C CB    . GLN A 247 ? 0.0566 0.0555 0.0546 0.0000  0.0000  -0.0008 354  GLN A CB    
1859 C CG    . GLN A 247 ? 0.0700 0.0707 0.0623 0.0001  -0.0021 0.0015  354  GLN A CG    
1860 C CD    . GLN A 247 ? 0.0863 0.0828 0.0818 0.0017  0.0004  0.0017  354  GLN A CD    
1861 O OE1   . GLN A 247 ? 0.1218 0.1001 0.0953 -0.0024 0.0010  -0.0026 354  GLN A OE1   
1862 N NE2   . GLN A 247 ? 0.0784 0.0847 0.0713 0.0026  -0.0055 -0.0025 354  GLN A NE2   
1863 N N     . VAL A 248 ? 0.0547 0.0561 0.0576 0.0005  -0.0017 0.0010  355  VAL A N     
1864 C CA    . VAL A 248 ? 0.0623 0.0600 0.0610 -0.0002 0.0003  0.0010  355  VAL A CA    
1865 C C     . VAL A 248 ? 0.0627 0.0622 0.0636 -0.0011 0.0003  0.0006  355  VAL A C     
1866 O O     . VAL A 248 ? 0.0624 0.0626 0.0625 0.0006  0.0000  0.0035  355  VAL A O     
1867 C CB    . VAL A 248 ? 0.0608 0.0619 0.0634 0.0008  0.0003  0.0020  355  VAL A CB    
1868 C CG1   . VAL A 248 ? 0.0659 0.0643 0.0624 -0.0003 0.0014  0.0010  355  VAL A CG1   
1869 C CG2   . VAL A 248 ? 0.0575 0.0585 0.0576 -0.0035 0.0002  -0.0011 355  VAL A CG2   
1870 N N     . GLU A 249 ? 0.0700 0.0665 0.0669 -0.0008 0.0025  0.0016  356  GLU A N     
1871 C CA    . GLU A 249 ? 0.0687 0.0708 0.0709 -0.0009 -0.0010 0.0009  356  GLU A CA    
1872 C C     . GLU A 249 ? 0.0610 0.0628 0.0615 0.0001  -0.0013 0.0002  356  GLU A C     
1873 O O     . GLU A 249 ? 0.0475 0.0544 0.0561 0.0014  -0.0020 0.0026  356  GLU A O     
1874 C CB    . GLU A 249 ? 0.0868 0.0800 0.0817 -0.0012 0.0010  0.0002  356  GLU A CB    
1875 C CG    . GLU A 249 ? 0.1073 0.1181 0.1248 0.0001  0.0020  0.0026  356  GLU A CG    
1876 C CD    . GLU A 249 ? 0.1788 0.1609 0.1639 0.0007  0.0031  -0.0097 356  GLU A CD    
1877 O OE1   . GLU A 249 ? 0.2119 0.1975 0.1867 0.0043  0.0037  0.0069  356  GLU A OE1   
1878 O OE2   . GLU A 249 ? 0.2120 0.1872 0.1869 -0.0069 0.0092  -0.0005 356  GLU A OE2   
1879 N N     . LEU A 250 ? 0.0491 0.0572 0.0536 -0.0013 -0.0041 -0.0016 357  LEU A N     
1880 C CA    . LEU A 250 ? 0.0589 0.0575 0.0570 0.0000  0.0001  0.0003  357  LEU A CA    
1881 C C     . LEU A 250 ? 0.0628 0.0643 0.0609 0.0004  -0.0024 0.0000  357  LEU A C     
1882 O O     . LEU A 250 ? 0.0755 0.0669 0.0674 -0.0052 0.0029  -0.0026 357  LEU A O     
1883 C CB    . LEU A 250 ? 0.0473 0.0540 0.0472 0.0002  -0.0045 0.0005  357  LEU A CB    
1884 C CG    . LEU A 250 ? 0.0433 0.0503 0.0430 0.0000  -0.0049 -0.0031 357  LEU A CG    
1885 C CD1   . LEU A 250 ? 0.0486 0.0417 0.0383 -0.0021 0.0009  -0.0041 357  LEU A CD1   
1886 C CD2   . LEU A 250 ? 0.0616 0.0506 0.0528 -0.0008 0.0020  0.0012  357  LEU A CD2   
1887 N N     . LYS A 251 ? 0.0743 0.0733 0.0728 0.0002  0.0004  0.0002  358  LYS A N     
1888 C CA    . LYS A 251 ? 0.0811 0.0809 0.0786 -0.0003 -0.0017 -0.0005 358  LYS A CA    
1889 C C     . LYS A 251 ? 0.0790 0.0794 0.0783 -0.0009 -0.0003 -0.0005 358  LYS A C     
1890 O O     . LYS A 251 ? 0.0830 0.0793 0.0830 -0.0017 -0.0002 -0.0003 358  LYS A O     
1891 C CB    . LYS A 251 ? 0.0841 0.0874 0.0862 -0.0010 -0.0010 0.0001  358  LYS A CB    
1892 C CG    . LYS A 251 ? 0.1150 0.1107 0.1103 -0.0009 -0.0023 -0.0014 358  LYS A CG    
1893 C CD    . LYS A 251 ? 0.1415 0.1469 0.1508 0.0008  0.0045  0.0003  358  LYS A CD    
1894 C CE    . LYS A 251 ? 0.1728 0.1704 0.1678 -0.0009 0.0018  0.0013  358  LYS A CE    
1895 N NZ    . LYS A 251 ? 0.1855 0.1914 0.2003 0.0021  0.0092  0.0005  358  LYS A NZ    
1896 N N     . ALA A 252 ? 0.0769 0.0769 0.0767 -0.0010 -0.0004 -0.0016 359  ALA A N     
1897 C CA    . ALA A 252 ? 0.0769 0.0770 0.0740 -0.0011 -0.0016 -0.0010 359  ALA A CA    
1898 C C     . ALA A 252 ? 0.0782 0.0770 0.0760 -0.0002 0.0000  0.0000  359  ALA A C     
1899 O O     . ALA A 252 ? 0.0754 0.0782 0.0619 0.0004  -0.0048 0.0041  359  ALA A O     
1900 C CB    . ALA A 252 ? 0.0794 0.0784 0.0772 -0.0006 -0.0008 0.0006  359  ALA A CB    
1901 N N     . PHE A 253 ? 0.0762 0.0768 0.0721 -0.0008 -0.0029 0.0005  360  PHE A N     
1902 C CA    . PHE A 253 ? 0.0796 0.0806 0.0772 0.0003  -0.0007 0.0008  360  PHE A CA    
1903 C C     . PHE A 253 ? 0.0872 0.0882 0.0858 -0.0013 -0.0012 0.0004  360  PHE A C     
1904 O O     . PHE A 253 ? 0.0896 0.0915 0.0987 0.0008  0.0017  0.0036  360  PHE A O     
1905 C CB    . PHE A 253 ? 0.0787 0.0787 0.0738 -0.0021 -0.0006 -0.0014 360  PHE A CB    
1906 C CG    . PHE A 253 ? 0.0657 0.0690 0.0583 0.0000  -0.0063 -0.0027 360  PHE A CG    
1907 C CD1   . PHE A 253 ? 0.0742 0.0691 0.0666 0.0000  0.0019  -0.0012 360  PHE A CD1   
1908 C CD2   . PHE A 253 ? 0.0652 0.0693 0.0693 -0.0019 -0.0033 -0.0018 360  PHE A CD2   
1909 C CE1   . PHE A 253 ? 0.0638 0.0666 0.0615 0.0018  -0.0039 0.0007  360  PHE A CE1   
1910 C CE2   . PHE A 253 ? 0.0752 0.0705 0.0739 0.0021  0.0017  0.0001  360  PHE A CE2   
1911 C CZ    . PHE A 253 ? 0.0654 0.0692 0.0690 -0.0029 -0.0004 -0.0022 360  PHE A CZ    
1912 N N     . GLN A 254 ? 0.0949 0.0982 0.0944 -0.0005 -0.0026 0.0007  361  GLN A N     
1913 C CA    . GLN A 254 ? 0.1087 0.1057 0.1040 0.0001  -0.0004 0.0006  361  GLN A CA    
1914 C C     . GLN A 254 ? 0.1246 0.1254 0.1182 0.0005  -0.0043 0.0002  361  GLN A C     
1915 O O     . GLN A 254 ? 0.1301 0.1228 0.1126 -0.0014 -0.0010 0.0010  361  GLN A O     
1916 C CB    . GLN A 254 ? 0.0998 0.1036 0.0983 0.0005  -0.0019 0.0005  361  GLN A CB    
1917 C CG    . GLN A 254 ? 0.0910 0.0880 0.0894 0.0000  0.0008  -0.0004 361  GLN A CG    
1918 C CD    . GLN A 254 ? 0.0837 0.0691 0.0719 0.0001  -0.0056 0.0026  361  GLN A CD    
1919 O OE1   . GLN A 254 ? 0.1073 0.0896 0.1053 0.0067  0.0093  0.0028  361  GLN A OE1   
1920 N NE2   . GLN A 254 ? 0.0381 0.0443 0.0381 0.0060  -0.0012 0.0071  361  GLN A NE2   
1921 N N     . ALA A 255 ? 0.1479 0.1483 0.1426 -0.0015 -0.0013 0.0025  362  ALA A N     
1922 C CA    . ALA A 255 ? 0.1712 0.1690 0.1632 -0.0020 -0.0007 0.0002  362  ALA A CA    
1923 C C     . ALA A 255 ? 0.1850 0.1871 0.1844 -0.0003 -0.0022 0.0019  362  ALA A C     
1924 O O     . ALA A 255 ? 0.1929 0.1944 0.1878 -0.0015 -0.0021 0.0000  362  ALA A O     
1925 C CB    . ALA A 255 ? 0.1724 0.1718 0.1672 -0.0005 0.0005  0.0010  362  ALA A CB    
1926 N N     . THR A 256 ? 0.2076 0.2079 0.2035 -0.0009 -0.0012 -0.0006 363  THR A N     
1927 C CA    . THR A 256 ? 0.2229 0.2258 0.2264 0.0015  -0.0005 0.0003  363  THR A CA    
1928 C C     . THR A 256 ? 0.2348 0.2382 0.2395 -0.0013 0.0002  0.0000  363  THR A C     
1929 O O     . THR A 256 ? 0.2345 0.2380 0.2410 0.0016  -0.0026 0.0033  363  THR A O     
1930 C CB    . THR A 256 ? 0.2254 0.2268 0.2298 0.0005  -0.0005 0.0000  363  THR A CB    
1931 O OG1   . THR A 256 ? 0.2316 0.2362 0.2447 0.0010  0.0003  0.0039  363  THR A OG1   
1932 C CG2   . THR A 256 ? 0.2276 0.2313 0.2306 0.0000  -0.0009 0.0005  363  THR A CG2   
1933 N N     . GLN A 257 ? 0.2490 0.2502 0.2519 0.0012  -0.0030 0.0002  364  GLN A N     
1934 C CA    . GLN A 257 ? 0.2642 0.2654 0.2665 0.0000  0.0000  0.0019  364  GLN A CA    
1935 C C     . GLN A 257 ? 0.2736 0.2726 0.2724 -0.0001 -0.0024 0.0008  364  GLN A C     
1936 O O     . GLN A 257 ? 0.2692 0.2747 0.2747 0.0000  -0.0024 0.0019  364  GLN A O     
1937 C CB    . GLN A 257 ? 0.2700 0.2684 0.2687 -0.0004 -0.0013 0.0005  364  GLN A CB    
1938 C CG    . GLN A 257 ? 0.2840 0.2844 0.2839 0.0014  0.0034  0.0012  364  GLN A CG    
1939 C CD    . GLN A 257 ? 0.2993 0.2903 0.2963 -0.0006 0.0010  -0.0010 364  GLN A CD    
1940 O OE1   . GLN A 257 ? 0.2996 0.2971 0.2944 0.0003  -0.0016 0.0009  364  GLN A OE1   
1941 N NE2   . GLN A 257 ? 0.3066 0.3045 0.3056 0.0000  0.0027  -0.0020 364  GLN A NE2   
1942 N N     . GLN A 258 ? 0.2862 0.2871 0.2860 0.0007  0.0005  0.0013  365  GLN A N     
1943 C CA    . GLN A 258 ? 0.2982 0.2959 0.2962 0.0000  0.0007  -0.0005 365  GLN A CA    
1944 C C     . GLN A 258 ? 0.3060 0.3018 0.3050 0.0004  0.0018  0.0005  365  GLN A C     
1945 O O     . GLN A 258 ? 0.3157 0.3080 0.3119 0.0006  0.0054  0.0011  365  GLN A O     
1946 C CB    . GLN A 258 ? 0.3000 0.2991 0.3014 0.0005  0.0008  0.0003  365  GLN A CB    
1947 C CG    . GLN A 258 ? 0.3056 0.3057 0.3044 -0.0003 0.0007  0.0003  365  GLN A CG    
1948 C CD    . GLN A 258 ? 0.3131 0.3107 0.3143 -0.0001 0.0002  -0.0006 365  GLN A CD    
1949 O OE1   . GLN A 258 ? 0.3165 0.3191 0.3203 0.0007  -0.0009 0.0018  365  GLN A OE1   
1950 N NE2   . GLN A 258 ? 0.3143 0.3118 0.3109 -0.0003 -0.0003 -0.0004 365  GLN A NE2   
1951 N N     . LYS A 259 ? 0.3066 0.3061 0.3069 -0.0004 0.0003  -0.0003 366  LYS A N     
1952 C CA    . LYS A 259 ? 0.3087 0.3082 0.3089 -0.0004 -0.0001 0.0002  366  LYS A CA    
1953 C C     . LYS A 259 ? 0.3110 0.3101 0.3101 0.0002  0.0004  0.0001  366  LYS A C     
1954 O O     . LYS A 259 ? 0.3100 0.3109 0.3144 -0.0010 -0.0001 0.0000  366  LYS A O     
1955 C CB    . LYS A 259 ? 0.3095 0.3102 0.3117 0.0000  0.0001  0.0010  366  LYS A CB    
1956 C CG    . LYS A 259 ? 0.3104 0.3105 0.3110 -0.0004 -0.0008 0.0008  366  LYS A CG    
1957 C CD    . LYS A 259 ? 0.3082 0.3083 0.3124 -0.0002 0.0014  0.0007  366  LYS A CD    
1958 C CE    . LYS A 259 ? 0.3023 0.3051 0.3053 -0.0006 -0.0012 -0.0001 366  LYS A CE    
1959 N NZ    . LYS A 259 ? 0.2950 0.2951 0.2916 -0.0004 -0.0020 -0.0013 366  LYS A NZ    
1960 N N     . GLY B 10  ? 0.1708 0.1668 0.1685 0.0003  -0.0006 0.0011  117  GLY B N     
1961 C CA    . GLY B 10  ? 0.1644 0.1629 0.1628 0.0007  0.0002  0.0000  117  GLY B CA    
1962 C C     . GLY B 10  ? 0.1588 0.1598 0.1595 0.0002  -0.0004 0.0009  117  GLY B C     
1963 O O     . GLY B 10  ? 0.1604 0.1588 0.1587 -0.0003 -0.0013 0.0004  117  GLY B O     
1964 N N     . VAL B 11  ? 0.1526 0.1535 0.1530 -0.0008 0.0003  0.0005  118  VAL B N     
1965 C CA    . VAL B 11  ? 0.1484 0.1449 0.1465 0.0001  0.0000  0.0010  118  VAL B CA    
1966 C C     . VAL B 11  ? 0.1314 0.1340 0.1316 -0.0010 -0.0009 -0.0007 118  VAL B C     
1967 O O     . VAL B 11  ? 0.1281 0.1303 0.1252 -0.0016 -0.0032 0.0005  118  VAL B O     
1968 C CB    . VAL B 11  ? 0.1458 0.1476 0.1467 0.0000  -0.0016 0.0000  118  VAL B CB    
1969 C CG1   . VAL B 11  ? 0.1583 0.1531 0.1569 -0.0008 0.0043  0.0007  118  VAL B CG1   
1970 C CG2   . VAL B 11  ? 0.1558 0.1513 0.1542 0.0001  0.0005  0.0011  118  VAL B CG2   
1971 N N     . CYS B 12  ? 0.1212 0.1196 0.1214 0.0000  -0.0008 -0.0011 119  CYS B N     
1972 C CA    . CYS B 12  ? 0.1123 0.1126 0.1125 -0.0005 0.0003  -0.0006 119  CYS B CA    
1973 C C     . CYS B 12  ? 0.0998 0.0991 0.0989 0.0000  -0.0031 -0.0021 119  CYS B C     
1974 O O     . CYS B 12  ? 0.0902 0.0962 0.0923 -0.0039 -0.0046 -0.0016 119  CYS B O     
1975 C CB    . CYS B 12  ? 0.1155 0.1135 0.1142 -0.0005 -0.0011 -0.0026 119  CYS B CB    
1976 S SG    A CYS B 12  ? 0.1147 0.1190 0.1151 -0.0003 -0.0041 -0.0014 119  CYS B SG    
1977 S SG    B CYS B 12  ? 0.1383 0.1233 0.1306 0.0020  0.0067  0.0036  119  CYS B SG    
1978 N N     . TRP B 13  ? 0.0863 0.0901 0.0864 -0.0018 -0.0032 -0.0016 120  TRP B N     
1979 C CA    . TRP B 13  ? 0.0827 0.0851 0.0822 0.0011  -0.0024 0.0000  120  TRP B CA    
1980 C C     . TRP B 13  ? 0.0828 0.0823 0.0814 0.0008  -0.0012 0.0019  120  TRP B C     
1981 O O     . TRP B 13  ? 0.0893 0.0848 0.0832 0.0025  -0.0008 0.0033  120  TRP B O     
1982 C CB    . TRP B 13  ? 0.0820 0.0840 0.0834 -0.0004 -0.0013 -0.0001 120  TRP B CB    
1983 C CG    . TRP B 13  ? 0.0815 0.0826 0.0840 0.0020  0.0000  0.0023  120  TRP B CG    
1984 C CD1   . TRP B 13  ? 0.0856 0.0868 0.0868 0.0010  0.0013  0.0027  120  TRP B CD1   
1985 C CD2   . TRP B 13  ? 0.0824 0.0827 0.0848 -0.0023 -0.0006 -0.0006 120  TRP B CD2   
1986 N NE1   . TRP B 13  ? 0.0834 0.0850 0.0899 -0.0002 -0.0007 -0.0013 120  TRP B NE1   
1987 C CE2   . TRP B 13  ? 0.0790 0.0825 0.0853 0.0007  -0.0013 -0.0008 120  TRP B CE2   
1988 C CE3   . TRP B 13  ? 0.0786 0.0834 0.0799 0.0001  -0.0029 0.0001  120  TRP B CE3   
1989 C CZ2   . TRP B 13  ? 0.0798 0.0838 0.0818 0.0011  -0.0025 0.0036  120  TRP B CZ2   
1990 C CZ3   . TRP B 13  ? 0.0866 0.0901 0.0894 -0.0015 0.0004  -0.0005 120  TRP B CZ3   
1991 C CH2   . TRP B 13  ? 0.0695 0.0833 0.0823 0.0023  -0.0054 0.0009  120  TRP B CH2   
1992 N N     . ILE B 14  ? 0.0798 0.0791 0.0774 0.0010  -0.0024 0.0023  121  ILE B N     
1993 C CA    . ILE B 14  ? 0.0817 0.0817 0.0805 0.0005  0.0001  0.0007  121  ILE B CA    
1994 C C     . ILE B 14  ? 0.0822 0.0789 0.0802 0.0004  0.0005  0.0004  121  ILE B C     
1995 O O     . ILE B 14  ? 0.0799 0.0797 0.0828 0.0005  0.0005  0.0033  121  ILE B O     
1996 C CB    . ILE B 14  ? 0.0826 0.0837 0.0812 -0.0002 -0.0027 0.0002  121  ILE B CB    
1997 C CG1   . ILE B 14  ? 0.0947 0.0942 0.0870 -0.0012 -0.0019 0.0007  121  ILE B CG1   
1998 C CG2   . ILE B 14  ? 0.0907 0.0882 0.0859 0.0003  0.0003  0.0009  121  ILE B CG2   
1999 C CD1   . ILE B 14  ? 0.1095 0.1016 0.1074 -0.0024 0.0006  -0.0013 121  ILE B CD1   
2000 N N     . TYR B 15  ? 0.0779 0.0768 0.0769 0.0010  0.0007  0.0000  122  TYR B N     
2001 C CA    . TYR B 15  ? 0.0723 0.0747 0.0709 0.0007  -0.0013 0.0008  122  TYR B CA    
2002 C C     . TYR B 15  ? 0.0717 0.0745 0.0709 0.0002  -0.0002 0.0000  122  TYR B C     
2003 O O     . TYR B 15  ? 0.0722 0.0764 0.0661 -0.0016 -0.0005 0.0007  122  TYR B O     
2004 C CB    . TYR B 15  ? 0.0737 0.0749 0.0711 0.0012  0.0004  0.0014  122  TYR B CB    
2005 C CG    . TYR B 15  ? 0.0873 0.0856 0.0829 -0.0010 -0.0016 0.0020  122  TYR B CG    
2006 C CD1   . TYR B 15  ? 0.1003 0.0968 0.0952 -0.0029 0.0037  -0.0018 122  TYR B CD1   
2007 C CD2   . TYR B 15  ? 0.0901 0.0926 0.0878 -0.0001 0.0008  0.0023  122  TYR B CD2   
2008 C CE1   . TYR B 15  ? 0.0958 0.0989 0.0964 0.0012  -0.0001 0.0036  122  TYR B CE1   
2009 C CE2   . TYR B 15  ? 0.0953 0.0996 0.0984 0.0003  -0.0015 0.0002  122  TYR B CE2   
2010 C CZ    . TYR B 15  ? 0.0992 0.1001 0.1020 0.0001  0.0019  0.0008  122  TYR B CZ    
2011 O OH    . TYR B 15  ? 0.1130 0.1126 0.1067 0.0021  -0.0010 0.0003  122  TYR B OH    
2012 N N     . TYR B 16  ? 0.0657 0.0721 0.0688 -0.0013 -0.0023 -0.0009 123  TYR B N     
2013 C CA    . TYR B 16  ? 0.0731 0.0734 0.0733 -0.0009 0.0009  -0.0001 123  TYR B CA    
2014 C C     . TYR B 16  ? 0.0665 0.0694 0.0682 -0.0011 0.0006  -0.0003 123  TYR B C     
2015 O O     . TYR B 16  ? 0.0620 0.0665 0.0644 -0.0008 -0.0029 0.0000  123  TYR B O     
2016 C CB    . TYR B 16  ? 0.0746 0.0799 0.0730 0.0013  -0.0004 0.0002  123  TYR B CB    
2017 C CG    . TYR B 16  ? 0.0994 0.0952 0.0970 0.0000  0.0026  0.0001  123  TYR B CG    
2018 C CD1   . TYR B 16  ? 0.1166 0.1199 0.1204 0.0030  -0.0007 0.0028  123  TYR B CD1   
2019 C CD2   . TYR B 16  ? 0.1176 0.1225 0.1251 -0.0019 0.0010  -0.0014 123  TYR B CD2   
2020 C CE1   . TYR B 16  ? 0.1303 0.1274 0.1346 0.0013  0.0000  0.0007  123  TYR B CE1   
2021 C CE2   . TYR B 16  ? 0.1397 0.1324 0.1451 -0.0002 0.0026  0.0005  123  TYR B CE2   
2022 C CZ    . TYR B 16  ? 0.1456 0.1455 0.1418 -0.0013 -0.0012 0.0002  123  TYR B CZ    
2023 O OH    . TYR B 16  ? 0.1816 0.1574 0.1692 -0.0021 0.0018  0.0002  123  TYR B OH    
2024 N N     . PRO B 17  ? 0.0600 0.0628 0.0641 -0.0015 0.0005  -0.0015 124  PRO B N     
2025 C CA    . PRO B 17  ? 0.0548 0.0593 0.0597 -0.0014 0.0008  -0.0007 124  PRO B CA    
2026 C C     . PRO B 17  ? 0.0460 0.0507 0.0486 -0.0002 -0.0016 -0.0005 124  PRO B C     
2027 O O     . PRO B 17  ? 0.0401 0.0527 0.0535 0.0000  -0.0014 -0.0012 124  PRO B O     
2028 C CB    . PRO B 17  ? 0.0614 0.0612 0.0628 -0.0011 0.0013  -0.0023 124  PRO B CB    
2029 C CG    . PRO B 17  ? 0.0628 0.0644 0.0689 -0.0033 0.0025  -0.0030 124  PRO B CG    
2030 C CD    . PRO B 17  ? 0.0583 0.0643 0.0638 -0.0006 -0.0002 -0.0002 124  PRO B CD    
2031 N N     . ASP B 18  ? 0.0393 0.0446 0.0404 -0.0016 -0.0023 -0.0001 125  ASP B N     
2032 C CA    . ASP B 18  ? 0.0382 0.0432 0.0414 -0.0002 -0.0014 0.0001  125  ASP B CA    
2033 C C     . ASP B 18  ? 0.0417 0.0448 0.0431 -0.0012 -0.0002 -0.0015 125  ASP B C     
2034 O O     . ASP B 18  ? 0.0313 0.0475 0.0447 0.0005  -0.0032 -0.0022 125  ASP B O     
2035 C CB    . ASP B 18  ? 0.0351 0.0438 0.0403 -0.0006 -0.0035 -0.0003 125  ASP B CB    
2036 C CG    . ASP B 18  ? 0.0445 0.0486 0.0507 -0.0012 -0.0002 0.0001  125  ASP B CG    
2037 O OD1   . ASP B 18  ? 0.0441 0.0548 0.0516 -0.0056 0.0009  -0.0005 125  ASP B OD1   
2038 O OD2   . ASP B 18  ? 0.0452 0.0542 0.0501 -0.0028 -0.0016 -0.0048 125  ASP B OD2   
2039 N N     . GLY B 19  ? 0.0423 0.0453 0.0448 -0.0013 0.0002  -0.0001 126  GLY B N     
2040 C CA    . GLY B 19  ? 0.0452 0.0472 0.0442 0.0009  -0.0018 -0.0002 126  GLY B CA    
2041 C C     . GLY B 19  ? 0.0504 0.0498 0.0491 -0.0016 -0.0001 -0.0004 126  GLY B C     
2042 O O     . GLY B 19  ? 0.0503 0.0512 0.0433 0.0001  -0.0017 0.0013  126  GLY B O     
2043 N N     . GLY B 20  ? 0.0554 0.0542 0.0530 -0.0008 0.0001  -0.0013 127  GLY B N     
2044 C CA    . GLY B 20  ? 0.0520 0.0546 0.0520 -0.0002 -0.0029 0.0001  127  GLY B CA    
2045 C C     . GLY B 20  ? 0.0580 0.0593 0.0581 -0.0007 -0.0017 -0.0010 127  GLY B C     
2046 O O     . GLY B 20  ? 0.0525 0.0550 0.0644 -0.0021 -0.0013 -0.0036 127  GLY B O     
2047 N N     . SER B 21  ? 0.0637 0.0638 0.0673 0.0004  -0.0016 0.0003  128  SER B N     
2048 C CA    . SER B 21  ? 0.0711 0.0712 0.0734 -0.0013 0.0000  -0.0001 128  SER B CA    
2049 C C     . SER B 21  ? 0.0759 0.0754 0.0772 -0.0002 -0.0010 0.0013  128  SER B C     
2050 O O     . SER B 21  ? 0.0759 0.0706 0.0815 -0.0026 0.0013  0.0006  128  SER B O     
2051 C CB    . SER B 21  ? 0.0744 0.0741 0.0774 -0.0003 0.0017  0.0003  128  SER B CB    
2052 O OG    . SER B 21  ? 0.0852 0.0867 0.0850 0.0005  0.0019  -0.0010 128  SER B OG    
2053 N N     . LEU B 22  ? 0.0814 0.0807 0.0831 0.0000  -0.0004 0.0021  129  LEU B N     
2054 C CA    . LEU B 22  ? 0.0867 0.0855 0.0890 -0.0001 0.0003  0.0008  129  LEU B CA    
2055 C C     . LEU B 22  ? 0.0839 0.0825 0.0859 0.0000  -0.0002 0.0011  129  LEU B C     
2056 O O     . LEU B 22  ? 0.0790 0.0801 0.0864 0.0020  -0.0023 0.0032  129  LEU B O     
2057 C CB    . LEU B 22  ? 0.0841 0.0906 0.0905 -0.0008 -0.0030 0.0009  129  LEU B CB    
2058 C CG    . LEU B 22  ? 0.1106 0.1106 0.1174 0.0025  0.0022  -0.0018 129  LEU B CG    
2059 C CD1   . LEU B 22  ? 0.1297 0.1289 0.1335 0.0000  0.0047  0.0028  129  LEU B CD1   
2060 C CD2   . LEU B 22  ? 0.1288 0.1221 0.1207 0.0005  0.0011  -0.0005 129  LEU B CD2   
2061 N N     . VAL B 23  ? 0.0793 0.0821 0.0817 0.0008  -0.0027 0.0010  130  VAL B N     
2062 C CA    . VAL B 23  ? 0.0842 0.0847 0.0842 0.0014  -0.0005 0.0004  130  VAL B CA    
2063 C C     . VAL B 23  ? 0.0896 0.0855 0.0850 0.0003  0.0001  -0.0011 130  VAL B C     
2064 O O     . VAL B 23  ? 0.0758 0.0783 0.0696 0.0013  -0.0062 0.0006  130  VAL B O     
2065 C CB    . VAL B 23  ? 0.0882 0.0855 0.0825 -0.0001 -0.0002 -0.0014 130  VAL B CB    
2066 C CG1   . VAL B 23  ? 0.0792 0.0841 0.0789 0.0031  -0.0022 0.0028  130  VAL B CG1   
2067 C CG2   . VAL B 23  ? 0.0961 0.0944 0.0986 -0.0004 0.0020  0.0007  130  VAL B CG2   
2068 N N     . GLY B 24  ? 0.0931 0.0938 0.0917 0.0007  -0.0005 -0.0011 131  GLY B N     
2069 C CA    . GLY B 24  ? 0.1047 0.1003 0.1004 -0.0005 -0.0004 -0.0009 131  GLY B CA    
2070 C C     . GLY B 24  ? 0.1096 0.1105 0.1094 0.0000  -0.0014 -0.0021 131  GLY B C     
2071 O O     . GLY B 24  ? 0.1059 0.1049 0.1066 -0.0012 -0.0010 -0.0014 131  GLY B O     
2072 N N     . GLU B 25  ? 0.1273 0.1227 0.1222 0.0000  -0.0005 0.0002  132  GLU B N     
2073 C CA    . GLU B 25  ? 0.1365 0.1377 0.1374 0.0002  0.0001  0.0000  132  GLU B CA    
2074 C C     . GLU B 25  ? 0.1505 0.1481 0.1465 -0.0008 -0.0003 -0.0003 132  GLU B C     
2075 O O     . GLU B 25  ? 0.1468 0.1492 0.1457 0.0006  -0.0010 0.0000  132  GLU B O     
2076 C CB    . GLU B 25  ? 0.1415 0.1388 0.1377 -0.0002 0.0001  0.0002  132  GLU B CB    
2077 C CG    . GLU B 25  ? 0.1421 0.1459 0.1469 -0.0002 -0.0011 -0.0013 132  GLU B CG    
2078 C CD    . GLU B 25  ? 0.1615 0.1562 0.1552 -0.0003 0.0003  0.0018  132  GLU B CD    
2079 O OE1   . GLU B 25  ? 0.1630 0.1658 0.1676 -0.0008 -0.0034 -0.0009 132  GLU B OE1   
2080 O OE2   . GLU B 25  ? 0.1613 0.1610 0.1617 -0.0006 -0.0019 -0.0004 132  GLU B OE2   
2081 N N     . VAL B 26  ? 0.1625 0.1645 0.1648 0.0014  0.0004  0.0004  133  VAL B N     
2082 C CA    . VAL B 26  ? 0.1793 0.1790 0.1783 0.0001  -0.0001 -0.0009 133  VAL B CA    
2083 C C     . VAL B 26  ? 0.1916 0.1898 0.1918 -0.0005 0.0016  0.0007  133  VAL B C     
2084 O O     . VAL B 26  ? 0.1981 0.1935 0.1933 -0.0002 0.0019  -0.0002 133  VAL B O     
2085 C CB    . VAL B 26  ? 0.1801 0.1796 0.1807 0.0000  0.0004  0.0002  133  VAL B CB    
2086 C CG1   . VAL B 26  ? 0.1806 0.1796 0.1794 0.0014  -0.0005 0.0011  133  VAL B CG1   
2087 C CG2   . VAL B 26  ? 0.1843 0.1831 0.1861 -0.0002 0.0023  -0.0007 133  VAL B CG2   
2088 N N     . ASN B 27  ? 0.2038 0.2025 0.2027 -0.0006 0.0006  -0.0022 134  ASN B N     
2089 C CA    . ASN B 27  ? 0.2130 0.2108 0.2121 -0.0005 0.0007  0.0001  134  ASN B CA    
2090 C C     . ASN B 27  ? 0.2175 0.2173 0.2177 0.0002  0.0008  -0.0001 134  ASN B C     
2091 O O     . ASN B 27  ? 0.2207 0.2182 0.2197 0.0004  0.0012  0.0002  134  ASN B O     
2092 C CB    . ASN B 27  ? 0.2145 0.2129 0.2138 -0.0002 0.0011  -0.0003 134  ASN B CB    
2093 C CG    . ASN B 27  ? 0.2177 0.2193 0.2176 -0.0011 0.0001  0.0002  134  ASN B CG    
2094 O OD1   . ASN B 27  ? 0.2273 0.2206 0.2205 0.0006  0.0016  0.0008  134  ASN B OD1   
2095 N ND2   . ASN B 27  ? 0.2303 0.2249 0.2239 0.0002  0.0015  -0.0013 134  ASN B ND2   
2096 N N     . GLU B 28  ? 0.2239 0.2222 0.2230 -0.0003 0.0007  0.0000  135  GLU B N     
2097 C CA    . GLU B 28  ? 0.2259 0.2265 0.2262 0.0001  0.0000  0.0000  135  GLU B CA    
2098 C C     . GLU B 28  ? 0.2282 0.2284 0.2281 0.0000  -0.0002 0.0000  135  GLU B C     
2099 O O     . GLU B 28  ? 0.2276 0.2295 0.2279 0.0003  -0.0005 0.0000  135  GLU B O     
2100 C CB    . GLU B 28  ? 0.2280 0.2275 0.2275 0.0003  -0.0003 0.0003  135  GLU B CB    
2101 C CG    . GLU B 28  ? 0.2317 0.2315 0.2309 0.0001  -0.0007 -0.0010 135  GLU B CG    
2102 C CD    . GLU B 28  ? 0.2377 0.2351 0.2360 0.0001  -0.0003 0.0006  135  GLU B CD    
2103 O OE1   . GLU B 28  ? 0.2414 0.2427 0.2433 0.0012  -0.0016 -0.0005 135  GLU B OE1   
2104 O OE2   . GLU B 28  ? 0.2356 0.2382 0.2376 0.0000  -0.0012 0.0002  135  GLU B OE2   
2105 N N     . ASP B 29  ? 0.2302 0.2302 0.2297 0.0000  0.0000  0.0000  136  ASP B N     
2106 C CA    . ASP B 29  ? 0.2326 0.2314 0.2317 -0.0001 0.0000  0.0002  136  ASP B CA    
2107 C C     . ASP B 29  ? 0.2284 0.2283 0.2275 0.0000  -0.0004 -0.0004 136  ASP B C     
2108 O O     . ASP B 29  ? 0.2322 0.2296 0.2285 0.0007  0.0000  0.0001  136  ASP B O     
2109 C CB    . ASP B 29  ? 0.2371 0.2343 0.2345 0.0002  0.0011  -0.0002 136  ASP B CB    
2110 C CG    . ASP B 29  ? 0.2450 0.2438 0.2456 -0.0004 -0.0015 0.0000  136  ASP B CG    
2111 O OD1   . ASP B 29  ? 0.2571 0.2553 0.2551 0.0001  0.0037  -0.0006 136  ASP B OD1   
2112 O OD2   . ASP B 29  ? 0.2663 0.2590 0.2522 0.0008  0.0023  0.0000  136  ASP B OD2   
2113 N N     . GLY B 30  ? 0.2231 0.2221 0.2225 -0.0001 0.0005  0.0001  137  GLY B N     
2114 C CA    . GLY B 30  ? 0.2172 0.2181 0.2171 0.0004  0.0002  0.0000  137  GLY B CA    
2115 C C     . GLY B 30  ? 0.2118 0.2121 0.2128 0.0006  -0.0003 0.0000  137  GLY B C     
2116 O O     . GLY B 30  ? 0.2106 0.2132 0.2144 0.0014  -0.0002 0.0012  137  GLY B O     
2117 N N     . GLU B 31  ? 0.2055 0.2060 0.2047 -0.0002 -0.0002 -0.0003 138  GLU B N     
2118 C CA    . GLU B 31  ? 0.2002 0.2013 0.2006 -0.0002 -0.0009 0.0001  138  GLU B CA    
2119 C C     . GLU B 31  ? 0.1946 0.1935 0.1939 -0.0003 0.0009  0.0002  138  GLU B C     
2120 O O     . GLU B 31  ? 0.1884 0.1916 0.1903 -0.0006 -0.0028 -0.0002 138  GLU B O     
2121 C CB    . GLU B 31  ? 0.2039 0.2023 0.2022 -0.0003 0.0007  -0.0002 138  GLU B CB    
2122 C CG    . GLU B 31  ? 0.2076 0.2108 0.2098 0.0004  -0.0004 0.0006  138  GLU B CG    
2123 C CD    . GLU B 31  ? 0.2171 0.2159 0.2174 -0.0006 0.0008  -0.0008 138  GLU B CD    
2124 O OE1   . GLU B 31  ? 0.2263 0.2211 0.2220 0.0011  0.0002  0.0012  138  GLU B OE1   
2125 O OE2   . GLU B 31  ? 0.2245 0.2249 0.2240 0.0004  -0.0002 0.0004  138  GLU B OE2   
2126 N N     . MET B 32  ? 0.1866 0.1862 0.1868 0.0000  0.0000  -0.0001 139  MET B N     
2127 C CA    . MET B 32  ? 0.1809 0.1797 0.1808 0.0004  0.0000  -0.0002 139  MET B CA    
2128 C C     . MET B 32  ? 0.1677 0.1684 0.1683 -0.0015 0.0002  0.0000  139  MET B C     
2129 O O     . MET B 32  ? 0.1588 0.1626 0.1633 -0.0026 -0.0029 -0.0009 139  MET B O     
2130 C CB    . MET B 32  ? 0.1864 0.1869 0.1843 -0.0005 0.0002  0.0010  139  MET B CB    
2131 C CG    . MET B 32  ? 0.2035 0.1982 0.2036 0.0004  0.0013  0.0000  139  MET B CG    
2132 S SD    . MET B 32  ? 0.2365 0.2400 0.2207 0.0004  -0.0009 -0.0046 139  MET B SD    
2133 C CE    . MET B 32  ? 0.2436 0.2437 0.2444 -0.0018 0.0034  -0.0017 139  MET B CE    
2134 N N     . THR B 33  ? 0.1541 0.1558 0.1547 0.0012  -0.0004 -0.0003 140  THR B N     
2135 C CA    . THR B 33  ? 0.1459 0.1478 0.1451 0.0000  -0.0003 0.0001  140  THR B CA    
2136 C C     . THR B 33  ? 0.1406 0.1415 0.1408 0.0006  0.0002  0.0000  140  THR B C     
2137 O O     . THR B 33  ? 0.1414 0.1423 0.1402 0.0019  0.0006  0.0005  140  THR B O     
2138 C CB    . THR B 33  ? 0.1438 0.1460 0.1431 0.0007  0.0000  0.0002  140  THR B CB    
2139 O OG1   . THR B 33  ? 0.1404 0.1411 0.1403 0.0002  -0.0005 -0.0018 140  THR B OG1   
2140 C CG2   . THR B 33  ? 0.1420 0.1428 0.1398 -0.0002 -0.0002 0.0000  140  THR B CG2   
2141 N N     . GLY B 34  ? 0.1352 0.1348 0.1340 0.0001  -0.0003 -0.0001 141  GLY B N     
2142 C CA    . GLY B 34  ? 0.1309 0.1323 0.1316 0.0000  -0.0002 -0.0003 141  GLY B CA    
2143 C C     . GLY B 34  ? 0.1286 0.1304 0.1298 0.0006  -0.0003 0.0000  141  GLY B C     
2144 O O     . GLY B 34  ? 0.1177 0.1240 0.1187 0.0017  -0.0052 0.0013  141  GLY B O     
2145 N N     . GLU B 35  ? 0.1335 0.1314 0.1290 0.0000  -0.0004 0.0004  142  GLU B N     
2146 C CA    . GLU B 35  ? 0.1351 0.1356 0.1353 0.0001  -0.0004 0.0000  142  GLU B CA    
2147 C C     . GLU B 35  ? 0.1341 0.1335 0.1344 0.0007  0.0007  0.0004  142  GLU B C     
2148 O O     . GLU B 35  ? 0.1319 0.1313 0.1318 0.0011  -0.0013 0.0006  142  GLU B O     
2149 C CB    . GLU B 35  ? 0.1436 0.1429 0.1415 0.0005  0.0009  0.0016  142  GLU B CB    
2150 C CG    . GLU B 35  ? 0.1636 0.1562 0.1621 -0.0024 -0.0016 -0.0006 142  GLU B CG    
2151 C CD    . GLU B 35  ? 0.1904 0.1899 0.1849 0.0027  0.0044  -0.0024 142  GLU B CD    
2152 O OE1   . GLU B 35  ? 0.2103 0.2057 0.2135 -0.0038 0.0059  -0.0014 142  GLU B OE1   
2153 O OE2   . GLU B 35  ? 0.2176 0.2009 0.2081 0.0000  0.0023  -0.0013 142  GLU B OE2   
2154 N N     . LYS B 36  ? 0.1309 0.1294 0.1308 0.0004  0.0003  0.0005  143  LYS B N     
2155 C CA    . LYS B 36  ? 0.1269 0.1264 0.1269 0.0001  -0.0010 0.0007  143  LYS B CA    
2156 C C     . LYS B 36  ? 0.1240 0.1217 0.1223 -0.0003 0.0010  -0.0008 143  LYS B C     
2157 O O     . LYS B 36  ? 0.1308 0.1231 0.1280 -0.0005 0.0018  -0.0016 143  LYS B O     
2158 C CB    . LYS B 36  ? 0.1305 0.1298 0.1308 -0.0005 0.0015  -0.0013 143  LYS B CB    
2159 C CG    . LYS B 36  ? 0.1380 0.1368 0.1391 0.0000  -0.0011 0.0001  143  LYS B CG    
2160 C CD    . LYS B 36  ? 0.1529 0.1504 0.1460 -0.0005 0.0008  -0.0005 143  LYS B CD    
2161 C CE    . LYS B 36  ? 0.1609 0.1599 0.1633 -0.0001 -0.0008 0.0001  143  LYS B CE    
2162 N NZ    . LYS B 36  ? 0.1791 0.1745 0.1707 -0.0009 0.0013  0.0004  143  LYS B NZ    
2163 N N     . ILE B 37  ? 0.1168 0.1119 0.1162 0.0008  0.0005  0.0007  144  ILE B N     
2164 C CA    . ILE B 37  ? 0.1062 0.1076 0.1065 0.0007  -0.0006 -0.0001 144  ILE B CA    
2165 C C     . ILE B 37  ? 0.1010 0.0985 0.0969 0.0016  -0.0009 0.0001  144  ILE B C     
2166 O O     . ILE B 37  ? 0.0974 0.0977 0.0986 0.0016  0.0000  -0.0022 144  ILE B O     
2167 C CB    . ILE B 37  ? 0.1138 0.1104 0.1123 0.0007  0.0005  0.0004  144  ILE B CB    
2168 C CG1   . ILE B 37  ? 0.1213 0.1237 0.1243 -0.0012 0.0010  0.0011  144  ILE B CG1   
2169 C CG2   . ILE B 37  ? 0.1044 0.1065 0.1041 0.0006  -0.0031 -0.0011 144  ILE B CG2   
2170 C CD1   . ILE B 37  ? 0.1346 0.1331 0.1331 -0.0016 0.0004  -0.0015 144  ILE B CD1   
2171 N N     . ALA B 38  ? 0.0880 0.0914 0.0873 0.0013  -0.0010 0.0000  145  ALA B N     
2172 C CA    . ALA B 38  ? 0.0860 0.0853 0.0839 0.0013  -0.0001 0.0000  145  ALA B CA    
2173 C C     . ALA B 38  ? 0.0768 0.0800 0.0800 0.0004  0.0000  0.0003  145  ALA B C     
2174 O O     . ALA B 38  ? 0.0769 0.0809 0.0799 0.0000  -0.0012 0.0001  145  ALA B O     
2175 C CB    . ALA B 38  ? 0.0853 0.0852 0.0885 0.0012  0.0013  0.0002  145  ALA B CB    
2176 N N     . TYR B 39  ? 0.0703 0.0741 0.0725 0.0002  -0.0021 -0.0001 146  TYR B N     
2177 C CA    . TYR B 39  ? 0.0644 0.0690 0.0677 0.0003  -0.0024 -0.0003 146  TYR B CA    
2178 C C     . TYR B 39  ? 0.0665 0.0685 0.0656 0.0007  -0.0010 0.0000  146  TYR B C     
2179 O O     . TYR B 39  ? 0.0645 0.0712 0.0725 -0.0003 -0.0027 -0.0007 146  TYR B O     
2180 C CB    . TYR B 39  ? 0.0621 0.0684 0.0673 0.0003  -0.0017 0.0007  146  TYR B CB    
2181 C CG    . TYR B 39  ? 0.0654 0.0677 0.0684 0.0003  0.0012  -0.0001 146  TYR B CG    
2182 C CD1   . TYR B 39  ? 0.0672 0.0698 0.0709 -0.0002 0.0000  0.0007  146  TYR B CD1   
2183 C CD2   . TYR B 39  ? 0.0568 0.0573 0.0521 0.0002  -0.0049 -0.0006 146  TYR B CD2   
2184 C CE1   . TYR B 39  ? 0.0690 0.0684 0.0744 0.0006  0.0033  0.0010  146  TYR B CE1   
2185 C CE2   . TYR B 39  ? 0.0610 0.0602 0.0607 -0.0008 0.0006  -0.0020 146  TYR B CE2   
2186 C CZ    . TYR B 39  ? 0.0637 0.0638 0.0696 0.0004  -0.0007 0.0016  146  TYR B CZ    
2187 O OH    . TYR B 39  ? 0.0500 0.0636 0.0658 0.0013  0.0035  0.0006  146  TYR B OH    
2188 N N     . VAL B 40  ? 0.0670 0.0663 0.0636 0.0006  -0.0022 0.0007  147  VAL B N     
2189 C CA    . VAL B 40  ? 0.0670 0.0689 0.0679 0.0003  -0.0023 0.0001  147  VAL B CA    
2190 C C     . VAL B 40  ? 0.0669 0.0666 0.0683 -0.0001 -0.0007 -0.0013 147  VAL B C     
2191 O O     . VAL B 40  ? 0.0797 0.0686 0.0631 0.0029  0.0009  -0.0015 147  VAL B O     
2192 C CB    . VAL B 40  ? 0.0665 0.0709 0.0677 0.0004  -0.0037 -0.0005 147  VAL B CB    
2193 C CG1   . VAL B 40  ? 0.0784 0.0754 0.0768 -0.0022 0.0016  -0.0007 147  VAL B CG1   
2194 C CG2   . VAL B 40  ? 0.0876 0.0812 0.0891 -0.0027 0.0066  -0.0010 147  VAL B CG2   
2195 N N     . TYR B 41  ? 0.0728 0.0665 0.0674 0.0020  0.0034  -0.0001 148  TYR B N     
2196 C CA    . TYR B 41  ? 0.0661 0.0646 0.0629 0.0012  0.0014  -0.0003 148  TYR B CA    
2197 C C     . TYR B 41  ? 0.0590 0.0610 0.0551 0.0031  -0.0017 0.0010  148  TYR B C     
2198 O O     . TYR B 41  ? 0.0641 0.0637 0.0543 0.0031  -0.0019 -0.0016 148  TYR B O     
2199 C CB    . TYR B 41  ? 0.0606 0.0639 0.0579 0.0021  -0.0028 0.0001  148  TYR B CB    
2200 C CG    . TYR B 41  ? 0.0571 0.0626 0.0568 0.0018  -0.0028 0.0002  148  TYR B CG    
2201 C CD1   . TYR B 41  ? 0.0743 0.0646 0.0636 -0.0005 -0.0002 0.0010  148  TYR B CD1   
2202 C CD2   . TYR B 41  ? 0.0565 0.0632 0.0613 0.0038  -0.0009 0.0014  148  TYR B CD2   
2203 C CE1   . TYR B 41  ? 0.0721 0.0676 0.0657 0.0014  -0.0005 0.0010  148  TYR B CE1   
2204 C CE2   . TYR B 41  ? 0.0624 0.0602 0.0484 -0.0024 -0.0032 -0.0012 148  TYR B CE2   
2205 C CZ    . TYR B 41  ? 0.0700 0.0652 0.0662 -0.0018 -0.0025 -0.0003 148  TYR B CZ    
2206 O OH    . TYR B 41  ? 0.0796 0.0799 0.0753 -0.0002 -0.0001 -0.0020 148  TYR B OH    
2207 N N     . PRO B 42  ? 0.0608 0.0591 0.0551 0.0013  0.0018  -0.0007 149  PRO B N     
2208 C CA    . PRO B 42  ? 0.0542 0.0534 0.0502 0.0001  0.0001  0.0000  149  PRO B CA    
2209 C C     . PRO B 42  ? 0.0530 0.0533 0.0498 0.0013  -0.0013 -0.0005 149  PRO B C     
2210 O O     . PRO B 42  ? 0.0465 0.0496 0.0411 0.0036  -0.0061 0.0011  149  PRO B O     
2211 C CB    . PRO B 42  ? 0.0480 0.0517 0.0497 -0.0004 -0.0020 0.0000  149  PRO B CB    
2212 C CG    . PRO B 42  ? 0.0496 0.0546 0.0492 0.0026  -0.0023 -0.0008 149  PRO B CG    
2213 C CD    . PRO B 42  ? 0.0624 0.0573 0.0542 0.0010  0.0021  0.0005  149  PRO B CD    
2214 N N     . ASP B 43  ? 0.0556 0.0544 0.0500 0.0005  -0.0011 0.0004  150  ASP B N     
2215 C CA    . ASP B 43  ? 0.0570 0.0578 0.0561 -0.0004 -0.0016 -0.0014 150  ASP B CA    
2216 C C     . ASP B 43  ? 0.0670 0.0667 0.0621 0.0006  -0.0008 -0.0003 150  ASP B C     
2217 O O     . ASP B 43  ? 0.0649 0.0630 0.0549 -0.0006 -0.0018 -0.0013 150  ASP B O     
2218 C CB    . ASP B 43  ? 0.0555 0.0552 0.0546 0.0005  -0.0013 -0.0009 150  ASP B CB    
2219 C CG    . ASP B 43  ? 0.0484 0.0539 0.0412 -0.0008 -0.0024 0.0004  150  ASP B CG    
2220 O OD1   . ASP B 43  ? 0.0516 0.0528 0.0359 -0.0003 -0.0022 0.0036  150  ASP B OD1   
2221 O OD2   . ASP B 43  ? 0.0506 0.0582 0.0474 0.0008  0.0031  0.0028  150  ASP B OD2   
2222 N N     . GLU B 44  ? 0.0785 0.0787 0.0733 -0.0003 -0.0020 -0.0006 151  GLU B N     
2223 C CA    . GLU B 44  ? 0.0912 0.0911 0.0893 -0.0007 0.0005  0.0003  151  GLU B CA    
2224 C C     . GLU B 44  ? 0.0983 0.0939 0.0915 0.0009  0.0001  0.0005  151  GLU B C     
2225 O O     . GLU B 44  ? 0.1053 0.0974 0.0948 0.0021  0.0028  0.0012  151  GLU B O     
2226 C CB    . GLU B 44  ? 0.0965 0.0960 0.0965 -0.0005 0.0016  0.0000  151  GLU B CB    
2227 C CG    . GLU B 44  ? 0.1215 0.1215 0.1196 0.0000  -0.0019 0.0035  151  GLU B CG    
2228 C CD    . GLU B 44  ? 0.1576 0.1453 0.1615 0.0053  0.0061  -0.0025 151  GLU B CD    
2229 O OE1   . GLU B 44  ? 0.1445 0.1496 0.1549 -0.0008 -0.0053 -0.0046 151  GLU B OE1   
2230 O OE2   . GLU B 44  ? 0.1807 0.1852 0.2024 -0.0035 0.0131  -0.0008 151  GLU B OE2   
2231 N N     . ARG B 45  ? 0.0983 0.0976 0.0947 0.0001  -0.0004 -0.0003 152  ARG B N     
2232 C CA    . ARG B 45  ? 0.1068 0.1031 0.1038 0.0003  0.0000  0.0005  152  ARG B CA    
2233 C C     . ARG B 45  ? 0.0981 0.0976 0.0945 -0.0005 -0.0002 0.0006  152  ARG B C     
2234 O O     . ARG B 45  ? 0.1027 0.0985 0.1001 -0.0011 -0.0002 0.0000  152  ARG B O     
2235 C CB    . ARG B 45  ? 0.1113 0.1115 0.1083 -0.0029 -0.0004 -0.0001 152  ARG B CB    
2236 C CG    . ARG B 45  ? 0.1493 0.1456 0.1475 0.0052  0.0016  0.0019  152  ARG B CG    
2237 C CD    . ARG B 45  ? 0.1756 0.1775 0.1822 -0.0077 0.0020  -0.0028 152  ARG B CD    
2238 N NE    . ARG B 45  ? 0.2136 0.2079 0.2158 0.0016  0.0018  0.0033  152  ARG B NE    
2239 C CZ    . ARG B 45  ? 0.2325 0.2338 0.2283 -0.0034 -0.0024 -0.0023 152  ARG B CZ    
2240 N NH1   . ARG B 45  ? 0.2514 0.2439 0.2452 -0.0001 0.0018  -0.0030 152  ARG B NH1   
2241 N NH2   . ARG B 45  ? 0.2490 0.2455 0.2511 0.0027  0.0024  0.0027  152  ARG B NH2   
2242 N N     . THR B 46  ? 0.0868 0.0855 0.0861 0.0010  -0.0022 0.0014  153  THR B N     
2243 C CA    . THR B 46  ? 0.0789 0.0803 0.0773 0.0009  -0.0024 0.0021  153  THR B CA    
2244 C C     . THR B 46  ? 0.0755 0.0757 0.0771 0.0006  -0.0009 0.0010  153  THR B C     
2245 O O     . THR B 46  ? 0.0780 0.0726 0.0662 0.0019  -0.0031 0.0019  153  THR B O     
2246 C CB    . THR B 46  ? 0.0785 0.0775 0.0777 -0.0002 -0.0011 0.0015  153  THR B CB    
2247 O OG1   . THR B 46  ? 0.0729 0.0769 0.0673 0.0000  -0.0058 0.0024  153  THR B OG1   
2248 C CG2   . THR B 46  ? 0.0787 0.0786 0.0772 0.0015  -0.0002 0.0024  153  THR B CG2   
2249 N N     . ALA B 47  ? 0.0719 0.0747 0.0720 0.0010  -0.0022 0.0011  154  ALA B N     
2250 C CA    . ALA B 47  ? 0.0741 0.0738 0.0742 0.0001  0.0002  0.0008  154  ALA B CA    
2251 C C     . ALA B 47  ? 0.0743 0.0742 0.0732 0.0005  -0.0001 0.0001  154  ALA B C     
2252 O O     . ALA B 47  ? 0.0791 0.0788 0.0843 -0.0001 0.0037  -0.0007 154  ALA B O     
2253 C CB    . ALA B 47  ? 0.0745 0.0727 0.0696 0.0004  -0.0013 -0.0004 154  ALA B CB    
2254 N N     . LEU B 48  ? 0.0729 0.0743 0.0760 0.0014  -0.0004 -0.0007 155  LEU B N     
2255 C CA    . LEU B 48  ? 0.0733 0.0747 0.0763 0.0007  0.0004  -0.0011 155  LEU B CA    
2256 C C     . LEU B 48  ? 0.0704 0.0734 0.0719 0.0002  -0.0007 -0.0011 155  LEU B C     
2257 O O     . LEU B 48  ? 0.0649 0.0770 0.0781 0.0002  -0.0025 -0.0033 155  LEU B O     
2258 C CB    . LEU B 48  ? 0.0686 0.0730 0.0699 0.0006  -0.0039 -0.0003 155  LEU B CB    
2259 C CG    . LEU B 48  ? 0.0789 0.0805 0.0801 -0.0003 -0.0005 -0.0010 155  LEU B CG    
2260 C CD1   . LEU B 48  ? 0.0964 0.0933 0.0864 -0.0006 -0.0002 -0.0019 155  LEU B CD1   
2261 C CD2   . LEU B 48  ? 0.0828 0.0795 0.0804 0.0011  0.0009  0.0033  155  LEU B CD2   
2262 N N     . TYR B 49  ? 0.0674 0.0729 0.0746 0.0000  -0.0019 -0.0010 156  TYR B N     
2263 C CA    . TYR B 49  ? 0.0694 0.0737 0.0720 0.0015  -0.0026 0.0012  156  TYR B CA    
2264 C C     . TYR B 49  ? 0.0669 0.0704 0.0654 0.0003  -0.0015 0.0000  156  TYR B C     
2265 O O     . TYR B 49  ? 0.0668 0.0741 0.0748 -0.0006 0.0005  -0.0054 156  TYR B O     
2266 C CB    . TYR B 49  ? 0.0783 0.0778 0.0791 0.0013  0.0000  -0.0017 156  TYR B CB    
2267 C CG    . TYR B 49  ? 0.0955 0.0995 0.0920 -0.0002 0.0025  0.0023  156  TYR B CG    
2268 C CD1   . TYR B 49  ? 0.1038 0.1086 0.1065 0.0037  -0.0002 0.0017  156  TYR B CD1   
2269 C CD2   . TYR B 49  ? 0.1142 0.1118 0.1186 0.0049  0.0015  0.0045  156  TYR B CD2   
2270 C CE1   . TYR B 49  ? 0.1156 0.1205 0.1141 0.0012  0.0014  0.0022  156  TYR B CE1   
2271 C CE2   . TYR B 49  ? 0.1220 0.1251 0.1263 0.0021  0.0029  0.0044  156  TYR B CE2   
2272 C CZ    . TYR B 49  ? 0.1306 0.1244 0.1318 0.0026  0.0058  0.0030  156  TYR B CZ    
2273 O OH    . TYR B 49  ? 0.1395 0.1314 0.1221 -0.0004 0.0031  0.0029  156  TYR B OH    
2274 N N     . GLY B 50  ? 0.0575 0.0646 0.0570 0.0026  -0.0049 0.0011  157  GLY B N     
2275 C CA    . GLY B 50  ? 0.0602 0.0645 0.0601 0.0017  -0.0026 0.0006  157  GLY B CA    
2276 C C     . GLY B 50  ? 0.0673 0.0687 0.0701 0.0001  0.0012  -0.0004 157  GLY B C     
2277 O O     . GLY B 50  ? 0.0678 0.0673 0.0727 0.0031  0.0029  -0.0005 157  GLY B O     
2278 N N     . LYS B 51  ? 0.0691 0.0700 0.0726 0.0011  0.0006  -0.0008 158  LYS B N     
2279 C CA    . LYS B 51  ? 0.0721 0.0731 0.0713 0.0001  -0.0010 0.0003  158  LYS B CA    
2280 C C     . LYS B 51  ? 0.0722 0.0705 0.0717 0.0007  0.0001  0.0006  158  LYS B C     
2281 O O     . LYS B 51  ? 0.0708 0.0694 0.0691 0.0019  -0.0015 0.0008  158  LYS B O     
2282 C CB    . LYS B 51  ? 0.0746 0.0753 0.0728 0.0018  -0.0007 0.0000  158  LYS B CB    
2283 C CG    . LYS B 51  ? 0.0870 0.0888 0.0886 -0.0006 0.0003  0.0018  158  LYS B CG    
2284 C CD    . LYS B 51  ? 0.1055 0.0990 0.1017 0.0011  0.0016  -0.0001 158  LYS B CD    
2285 C CE    . LYS B 51  ? 0.1101 0.1100 0.1068 -0.0004 -0.0011 -0.0002 158  LYS B CE    
2286 N NZ    . LYS B 51  ? 0.1272 0.1174 0.1181 0.0011  -0.0001 0.0002  158  LYS B NZ    
2287 N N     . PHE B 52  ? 0.0714 0.0731 0.0710 0.0008  -0.0011 0.0009  159  PHE B N     
2288 C CA    . PHE B 52  ? 0.0752 0.0731 0.0718 0.0005  -0.0002 0.0000  159  PHE B CA    
2289 C C     . PHE B 52  ? 0.0741 0.0765 0.0752 0.0015  -0.0013 0.0008  159  PHE B C     
2290 O O     . PHE B 52  ? 0.0711 0.0758 0.0738 0.0011  -0.0019 -0.0004 159  PHE B O     
2291 C CB    . PHE B 52  ? 0.0754 0.0723 0.0715 0.0016  0.0001  0.0016  159  PHE B CB    
2292 C CG    . PHE B 52  ? 0.0617 0.0664 0.0635 0.0026  -0.0027 0.0000  159  PHE B CG    
2293 C CD1   . PHE B 52  ? 0.0653 0.0620 0.0615 0.0000  0.0011  0.0005  159  PHE B CD1   
2294 C CD2   . PHE B 52  ? 0.0661 0.0672 0.0709 -0.0012 0.0031  -0.0010 159  PHE B CD2   
2295 C CE1   . PHE B 52  ? 0.0484 0.0594 0.0550 0.0030  -0.0058 0.0006  159  PHE B CE1   
2296 C CE2   . PHE B 52  ? 0.0623 0.0621 0.0668 0.0013  -0.0003 -0.0003 159  PHE B CE2   
2297 C CZ    . PHE B 52  ? 0.0602 0.0572 0.0562 -0.0023 0.0051  -0.0042 159  PHE B CZ    
2298 N N     . ILE B 53  ? 0.0841 0.0825 0.0816 0.0012  0.0000  -0.0001 160  ILE B N     
2299 C CA    . ILE B 53  ? 0.0862 0.0870 0.0847 -0.0008 -0.0003 0.0000  160  ILE B CA    
2300 C C     . ILE B 53  ? 0.0898 0.0907 0.0906 -0.0007 -0.0002 0.0008  160  ILE B C     
2301 O O     . ILE B 53  ? 0.0872 0.0918 0.0860 -0.0021 -0.0022 0.0004  160  ILE B O     
2302 C CB    . ILE B 53  ? 0.0870 0.0862 0.0889 0.0000  0.0011  0.0009  160  ILE B CB    
2303 C CG1   . ILE B 53  ? 0.0873 0.0894 0.0856 -0.0016 -0.0013 -0.0006 160  ILE B CG1   
2304 C CG2   . ILE B 53  ? 0.0912 0.0879 0.0848 0.0010  -0.0006 0.0004  160  ILE B CG2   
2305 C CD1   . ILE B 53  ? 0.0920 0.0916 0.0966 0.0012  0.0006  0.0001  160  ILE B CD1   
2306 N N     . ASP B 54  ? 0.0950 0.0964 0.0969 -0.0005 0.0003  -0.0003 161  ASP B N     
2307 C CA    . ASP B 54  ? 0.1034 0.1018 0.1022 0.0002  0.0006  0.0004  161  ASP B CA    
2308 C C     . ASP B 54  ? 0.1002 0.1000 0.0997 -0.0001 -0.0003 -0.0008 161  ASP B C     
2309 O O     . ASP B 54  ? 0.1060 0.1020 0.1020 -0.0016 0.0012  -0.0015 161  ASP B O     
2310 C CB    . ASP B 54  ? 0.1080 0.1068 0.1067 -0.0011 0.0009  -0.0009 161  ASP B CB    
2311 C CG    . ASP B 54  ? 0.1255 0.1238 0.1250 0.0021  -0.0005 0.0013  161  ASP B CG    
2312 O OD1   . ASP B 54  ? 0.1512 0.1406 0.1453 0.0066  0.0057  -0.0020 161  ASP B OD1   
2313 O OD2   . ASP B 54  ? 0.1368 0.1416 0.1352 0.0022  -0.0016 0.0023  161  ASP B OD2   
2314 N N     . GLY B 55  ? 0.0964 0.0957 0.0964 0.0008  0.0004  0.0000  162  GLY B N     
2315 C CA    . GLY B 55  ? 0.0948 0.0936 0.0939 0.0005  0.0005  -0.0004 162  GLY B CA    
2316 C C     . GLY B 55  ? 0.0886 0.0896 0.0898 0.0003  -0.0009 0.0005  162  GLY B C     
2317 O O     . GLY B 55  ? 0.0886 0.0897 0.0914 0.0001  -0.0008 -0.0009 162  GLY B O     
2318 N N     . GLU B 56  ? 0.0866 0.0883 0.0871 -0.0001 -0.0002 -0.0005 163  GLU B N     
2319 C CA    . GLU B 56  ? 0.0859 0.0875 0.0869 0.0000  -0.0002 0.0003  163  GLU B CA    
2320 C C     . GLU B 56  ? 0.0809 0.0794 0.0806 0.0005  0.0020  -0.0009 163  GLU B C     
2321 O O     . GLU B 56  ? 0.0729 0.0754 0.0690 0.0026  -0.0017 -0.0018 163  GLU B O     
2322 C CB    . GLU B 56  ? 0.0946 0.0911 0.0924 0.0000  0.0005  0.0001  163  GLU B CB    
2323 C CG    . GLU B 56  ? 0.1060 0.1086 0.1084 0.0007  0.0056  0.0015  163  GLU B CG    
2324 C CD    . GLU B 56  ? 0.1195 0.1226 0.1175 -0.0013 -0.0006 0.0005  163  GLU B CD    
2325 O OE1   . GLU B 56  ? 0.1471 0.1363 0.1422 0.0014  0.0038  -0.0016 163  GLU B OE1   
2326 O OE2   . GLU B 56  ? 0.1220 0.1336 0.1242 -0.0001 -0.0028 -0.0016 163  GLU B OE2   
2327 N N     . MET B 57  ? 0.0716 0.0726 0.0720 -0.0007 -0.0016 -0.0009 164  MET B N     
2328 C CA    . MET B 57  ? 0.0714 0.0711 0.0733 0.0000  0.0018  -0.0005 164  MET B CA    
2329 C C     . MET B 57  ? 0.0657 0.0670 0.0665 -0.0028 0.0005  -0.0011 164  MET B C     
2330 O O     . MET B 57  ? 0.0687 0.0677 0.0637 -0.0063 0.0003  -0.0045 164  MET B O     
2331 C CB    . MET B 57  ? 0.0681 0.0698 0.0704 -0.0004 -0.0005 -0.0021 164  MET B CB    
2332 C CG    . MET B 57  ? 0.0705 0.0711 0.0790 0.0021  0.0022  0.0018  164  MET B CG    
2333 S SD    . MET B 57  ? 0.0715 0.0633 0.0768 0.0040  -0.0050 -0.0077 164  MET B SD    
2334 C CE    . MET B 57  ? 0.0943 0.0910 0.0956 0.0008  0.0083  0.0021  164  MET B CE    
2335 N N     . ILE B 58  ? 0.0531 0.0628 0.0611 -0.0005 -0.0034 -0.0007 165  ILE B N     
2336 C CA    . ILE B 58  ? 0.0554 0.0616 0.0609 -0.0014 -0.0021 -0.0012 165  ILE B CA    
2337 C C     . ILE B 58  ? 0.0559 0.0607 0.0605 0.0006  -0.0024 0.0003  165  ILE B C     
2338 O O     . ILE B 58  ? 0.0504 0.0593 0.0579 -0.0015 -0.0049 -0.0005 165  ILE B O     
2339 C CB    . ILE B 58  ? 0.0599 0.0631 0.0628 0.0000  -0.0001 0.0000  165  ILE B CB    
2340 C CG1   . ILE B 58  ? 0.0575 0.0616 0.0625 -0.0014 -0.0025 -0.0010 165  ILE B CG1   
2341 C CG2   . ILE B 58  ? 0.0635 0.0664 0.0652 0.0019  0.0010  0.0016  165  ILE B CG2   
2342 C CD1   . ILE B 58  ? 0.0720 0.0725 0.0696 0.0026  0.0019  0.0003  165  ILE B CD1   
2343 N N     . GLU B 59  ? 0.0594 0.0632 0.0647 -0.0005 0.0000  -0.0006 166  GLU B N     
2344 C CA    . GLU B 59  ? 0.0628 0.0679 0.0666 -0.0006 -0.0020 -0.0016 166  GLU B CA    
2345 C C     . GLU B 59  ? 0.0636 0.0662 0.0653 0.0000  0.0006  -0.0005 166  GLU B C     
2346 O O     . GLU B 59  ? 0.0667 0.0716 0.0651 -0.0007 -0.0001 -0.0037 166  GLU B O     
2347 C CB    . GLU B 59  ? 0.0703 0.0707 0.0726 -0.0005 0.0007  -0.0004 166  GLU B CB    
2348 C CG    . GLU B 59  ? 0.0831 0.0970 0.0935 -0.0028 -0.0027 -0.0058 166  GLU B CG    
2349 C CD    . GLU B 59  ? 0.1279 0.1226 0.1297 -0.0006 -0.0016 0.0063  166  GLU B CD    
2350 O OE1   . GLU B 59  ? 0.1492 0.1539 0.1550 -0.0029 0.0056  0.0020  166  GLU B OE1   
2351 O OE2   . GLU B 59  ? 0.1451 0.1505 0.1568 0.0050  0.0019  0.0022  166  GLU B OE2   
2352 N N     . GLY B 60  ? 0.0582 0.0610 0.0581 -0.0002 -0.0023 -0.0004 167  GLY B N     
2353 C CA    . GLY B 60  ? 0.0557 0.0591 0.0581 0.0006  -0.0004 -0.0005 167  GLY B CA    
2354 C C     . GLY B 60  ? 0.0522 0.0576 0.0566 -0.0022 -0.0014 -0.0021 167  GLY B C     
2355 O O     . GLY B 60  ? 0.0381 0.0535 0.0509 -0.0057 -0.0059 -0.0061 167  GLY B O     
2356 N N     . LYS B 61  ? 0.0540 0.0561 0.0559 -0.0001 -0.0006 0.0000  168  LYS B N     
2357 C CA    . LYS B 61  ? 0.0568 0.0589 0.0567 -0.0002 -0.0007 -0.0003 168  LYS B CA    
2358 C C     . LYS B 61  ? 0.0584 0.0593 0.0523 0.0005  -0.0017 0.0004  168  LYS B C     
2359 O O     . LYS B 61  ? 0.0707 0.0641 0.0514 0.0000  -0.0003 -0.0002 168  LYS B O     
2360 C CB    . LYS B 61  ? 0.0533 0.0586 0.0560 0.0004  -0.0009 0.0005  168  LYS B CB    
2361 C CG    . LYS B 61  ? 0.0608 0.0653 0.0638 -0.0014 -0.0023 -0.0045 168  LYS B CG    
2362 C CD    . LYS B 61  ? 0.0744 0.0777 0.0806 -0.0001 0.0005  0.0008  168  LYS B CD    
2363 C CE    . LYS B 61  ? 0.0889 0.0854 0.0907 -0.0011 0.0013  -0.0006 168  LYS B CE    
2364 N NZ    . LYS B 61  ? 0.0922 0.0968 0.0876 -0.0006 -0.0022 -0.0003 168  LYS B NZ    
2365 N N     . LEU B 62  ? 0.0615 0.0597 0.0483 0.0000  -0.0030 0.0006  169  LEU B N     
2366 C CA    . LEU B 62  ? 0.0631 0.0609 0.0578 0.0004  -0.0007 0.0004  169  LEU B CA    
2367 C C     . LEU B 62  ? 0.0635 0.0634 0.0603 0.0001  -0.0007 0.0000  169  LEU B C     
2368 O O     . LEU B 62  ? 0.0608 0.0627 0.0657 0.0029  0.0005  0.0023  169  LEU B O     
2369 C CB    . LEU B 62  ? 0.0640 0.0633 0.0591 0.0018  0.0003  0.0008  169  LEU B CB    
2370 C CG    . LEU B 62  ? 0.0678 0.0681 0.0657 -0.0006 -0.0001 -0.0011 169  LEU B CG    
2371 C CD1   . LEU B 62  ? 0.0839 0.0780 0.0753 0.0044  0.0008  0.0043  169  LEU B CD1   
2372 C CD2   . LEU B 62  ? 0.0630 0.0654 0.0603 0.0022  -0.0020 0.0002  169  LEU B CD2   
2373 N N     . ALA B 63  ? 0.0655 0.0656 0.0659 -0.0001 0.0000  -0.0008 170  ALA B N     
2374 C CA    . ALA B 63  ? 0.0682 0.0685 0.0679 -0.0003 0.0007  0.0000  170  ALA B CA    
2375 C C     . ALA B 63  ? 0.0692 0.0693 0.0689 -0.0013 0.0005  -0.0002 170  ALA B C     
2376 O O     . ALA B 63  ? 0.0734 0.0724 0.0699 -0.0023 0.0015  -0.0001 170  ALA B O     
2377 C CB    . ALA B 63  ? 0.0712 0.0718 0.0737 -0.0003 0.0011  0.0001  170  ALA B CB    
2378 N N     . THR B 64  ? 0.0675 0.0684 0.0654 -0.0024 -0.0009 -0.0007 171  THR B N     
2379 C CA    . THR B 64  ? 0.0690 0.0694 0.0682 -0.0011 -0.0005 0.0002  171  THR B CA    
2380 C C     . THR B 64  ? 0.0701 0.0691 0.0691 -0.0025 -0.0009 -0.0017 171  THR B C     
2381 O O     . THR B 64  ? 0.0675 0.0645 0.0656 -0.0064 0.0007  -0.0054 171  THR B O     
2382 C CB    . THR B 64  ? 0.0694 0.0700 0.0691 -0.0013 -0.0001 -0.0012 171  THR B CB    
2383 O OG1   . THR B 64  ? 0.0733 0.0756 0.0778 -0.0005 0.0014  0.0000  171  THR B OG1   
2384 C CG2   . THR B 64  ? 0.0671 0.0688 0.0662 -0.0011 -0.0014 0.0002  171  THR B CG2   
2385 N N     . LEU B 65  ? 0.0746 0.0731 0.0751 -0.0014 -0.0003 -0.0009 172  LEU B N     
2386 C CA    . LEU B 65  ? 0.0809 0.0793 0.0802 -0.0005 0.0014  0.0000  172  LEU B CA    
2387 C C     . LEU B 65  ? 0.0844 0.0850 0.0857 0.0000  -0.0009 -0.0005 172  LEU B C     
2388 O O     . LEU B 65  ? 0.0918 0.0861 0.0872 0.0004  0.0014  0.0035  172  LEU B O     
2389 C CB    . LEU B 65  ? 0.0732 0.0772 0.0731 -0.0008 -0.0036 -0.0004 172  LEU B CB    
2390 C CG    . LEU B 65  ? 0.0806 0.0806 0.0739 -0.0011 -0.0014 -0.0002 172  LEU B CG    
2391 C CD1   . LEU B 65  ? 0.0821 0.0815 0.0758 -0.0004 -0.0024 0.0005  172  LEU B CD1   
2392 C CD2   . LEU B 65  ? 0.0801 0.0819 0.0890 0.0000  -0.0009 0.0007  172  LEU B CD2   
2393 N N     . MET B 66  ? 0.0940 0.0932 0.0929 0.0000  0.0003  0.0004  173  MET B N     
2394 C CA    . MET B 66  ? 0.1012 0.1012 0.1012 -0.0015 0.0001  -0.0018 173  MET B CA    
2395 C C     . MET B 66  ? 0.1039 0.1038 0.1067 -0.0023 0.0025  -0.0023 173  MET B C     
2396 O O     . MET B 66  ? 0.0994 0.1054 0.1110 -0.0046 0.0010  -0.0042 173  MET B O     
2397 C CB    . MET B 66  ? 0.1030 0.1054 0.1017 -0.0020 -0.0025 -0.0005 173  MET B CB    
2398 C CG    . MET B 66  ? 0.1211 0.1186 0.1119 0.0011  -0.0036 -0.0043 173  MET B CG    
2399 S SD    . MET B 66  ? 0.1465 0.1590 0.1439 0.0039  0.0036  0.0031  173  MET B SD    
2400 C CE    . MET B 66  ? 0.1742 0.1711 0.1810 -0.0014 0.0044  -0.0008 173  MET B CE    
2401 N N     . SER B 67  ? 0.0961 0.1033 0.1017 -0.0022 -0.0044 -0.0018 174  SER B N     
2402 C CA    . SER B 67  ? 0.0996 0.1048 0.1057 -0.0001 -0.0030 -0.0005 174  SER B CA    
2403 C C     . SER B 67  ? 0.1029 0.1086 0.1099 -0.0013 -0.0022 -0.0008 174  SER B C     
2404 O O     . SER B 67  ? 0.0911 0.1061 0.1021 -0.0004 -0.0064 -0.0005 174  SER B O     
2405 C CB    . SER B 67  ? 0.1088 0.1079 0.1136 -0.0009 0.0026  0.0000  174  SER B CB    
2406 O OG    . SER B 67  ? 0.1003 0.1044 0.1080 0.0004  -0.0021 0.0024  174  SER B OG    
2407 N N     . THR B 68  ? 0.1097 0.1121 0.1129 0.0002  -0.0022 -0.0006 175  THR B N     
2408 C CA    . THR B 68  ? 0.1167 0.1200 0.1218 -0.0003 -0.0007 -0.0001 175  THR B CA    
2409 C C     . THR B 68  ? 0.1210 0.1219 0.1203 0.0005  -0.0012 0.0000  175  THR B C     
2410 O O     . THR B 68  ? 0.1199 0.1226 0.1250 -0.0011 -0.0008 -0.0013 175  THR B O     
2411 C CB    . THR B 68  ? 0.1224 0.1212 0.1186 -0.0005 -0.0016 -0.0001 175  THR B CB    
2412 O OG1   . THR B 68  ? 0.1348 0.1363 0.1406 -0.0012 0.0047  0.0000  175  THR B OG1   
2413 C CG2   . THR B 68  ? 0.1236 0.1273 0.1326 0.0000  0.0000  -0.0006 175  THR B CG2   
2414 N N     . GLU B 69  ? 0.1233 0.1256 0.1241 0.0000  -0.0027 0.0004  176  GLU B N     
2415 C CA    . GLU B 69  ? 0.1298 0.1321 0.1308 0.0000  -0.0004 0.0005  176  GLU B CA    
2416 C C     . GLU B 69  ? 0.1283 0.1296 0.1291 0.0000  -0.0003 0.0004  176  GLU B C     
2417 O O     . GLU B 69  ? 0.1254 0.1289 0.1303 -0.0004 -0.0001 0.0001  176  GLU B O     
2418 C CB    . GLU B 69  ? 0.1361 0.1363 0.1391 0.0012  0.0004  0.0022  176  GLU B CB    
2419 C CG    . GLU B 69  ? 0.1555 0.1583 0.1573 -0.0024 -0.0017 -0.0003 176  GLU B CG    
2420 C CD    . GLU B 69  ? 0.1841 0.1769 0.1880 0.0034  0.0022  -0.0031 176  GLU B CD    
2421 O OE1   . GLU B 69  ? 0.2037 0.1993 0.2003 -0.0013 0.0071  0.0000  176  GLU B OE1   
2422 O OE2   . GLU B 69  ? 0.1971 0.1899 0.1940 -0.0011 0.0007  0.0029  176  GLU B OE2   
2423 N N     . GLU B 70  ? 0.1280 0.1295 0.1287 -0.0002 -0.0002 0.0000  177  GLU B N     
2424 C CA    . GLU B 70  ? 0.1273 0.1285 0.1304 0.0004  -0.0002 0.0002  177  GLU B CA    
2425 C C     . GLU B 70  ? 0.1254 0.1267 0.1271 0.0007  0.0006  0.0001  177  GLU B C     
2426 O O     . GLU B 70  ? 0.1321 0.1270 0.1349 -0.0013 0.0034  -0.0010 177  GLU B O     
2427 C CB    . GLU B 70  ? 0.1273 0.1296 0.1288 0.0006  -0.0011 0.0009  177  GLU B CB    
2428 C CG    . GLU B 70  ? 0.1373 0.1363 0.1399 0.0012  -0.0001 -0.0002 177  GLU B CG    
2429 C CD    . GLU B 70  ? 0.1461 0.1475 0.1474 -0.0002 0.0020  0.0007  177  GLU B CD    
2430 O OE1   . GLU B 70  ? 0.1560 0.1523 0.1663 -0.0008 0.0010  0.0009  177  GLU B OE1   
2431 O OE2   . GLU B 70  ? 0.1494 0.1471 0.1462 -0.0018 0.0010  0.0001  177  GLU B OE2   
2432 N N     . GLY B 71  ? 0.1228 0.1234 0.1243 0.0011  0.0002  0.0003  178  GLY B N     
2433 C CA    . GLY B 71  ? 0.1194 0.1203 0.1195 0.0003  -0.0014 0.0003  178  GLY B CA    
2434 C C     . GLY B 71  ? 0.1168 0.1200 0.1178 0.0003  -0.0014 0.0000  178  GLY B C     
2435 O O     . GLY B 71  ? 0.1086 0.1134 0.1061 0.0025  -0.0066 0.0041  178  GLY B O     
2436 N N     . ARG B 72  ? 0.1208 0.1226 0.1181 0.0009  -0.0028 0.0012  179  ARG B N     
2437 C CA    . ARG B 72  ? 0.1278 0.1281 0.1272 0.0002  -0.0009 -0.0008 179  ARG B CA    
2438 C C     . ARG B 72  ? 0.1249 0.1254 0.1227 0.0000  -0.0014 -0.0002 179  ARG B C     
2439 O O     . ARG B 72  ? 0.1233 0.1246 0.1188 0.0018  -0.0033 0.0038  179  ARG B O     
2440 C CB    . ARG B 72  ? 0.1354 0.1320 0.1311 -0.0004 -0.0014 0.0003  179  ARG B CB    
2441 C CG    . ARG B 72  ? 0.1513 0.1579 0.1614 0.0000  0.0014  -0.0033 179  ARG B CG    
2442 C CD    . ARG B 72  ? 0.1905 0.1844 0.1846 -0.0020 0.0002  0.0038  179  ARG B CD    
2443 N NE    . ARG B 72  ? 0.2117 0.2130 0.2163 0.0034  0.0041  -0.0023 179  ARG B NE    
2444 C CZ    . ARG B 72  ? 0.2355 0.2354 0.2414 -0.0036 0.0046  0.0010  179  ARG B CZ    
2445 N NH1   . ARG B 72  ? 0.2479 0.2427 0.2530 -0.0001 0.0026  -0.0014 179  ARG B NH1   
2446 N NH2   . ARG B 72  ? 0.2423 0.2423 0.2472 0.0004  0.0036  -0.0021 179  ARG B NH2   
2447 N N     . PRO B 73  ? 0.1219 0.1232 0.1217 0.0000  -0.0014 0.0009  180  PRO B N     
2448 C CA    . PRO B 73  ? 0.1192 0.1211 0.1197 0.0000  -0.0028 0.0008  180  PRO B CA    
2449 C C     . PRO B 73  ? 0.1177 0.1193 0.1266 0.0003  0.0012  0.0015  180  PRO B C     
2450 O O     . PRO B 73  ? 0.1072 0.1152 0.1243 0.0013  -0.0016 0.0019  180  PRO B O     
2451 C CB    . PRO B 73  ? 0.1232 0.1234 0.1243 0.0004  0.0012  0.0008  180  PRO B CB    
2452 C CG    . PRO B 73  ? 0.1237 0.1275 0.1246 -0.0021 -0.0011 -0.0025 180  PRO B CG    
2453 C CD    . PRO B 73  ? 0.1230 0.1253 0.1184 -0.0015 -0.0022 -0.0015 180  PRO B CD    
2454 N N     . HIS B 74  ? 0.1138 0.1152 0.1195 0.0011  -0.0014 0.0023  181  HIS B N     
2455 C CA    . HIS B 74  ? 0.1136 0.1163 0.1137 -0.0001 -0.0018 0.0004  181  HIS B CA    
2456 C C     . HIS B 74  ? 0.1021 0.1097 0.1040 0.0013  -0.0067 0.0014  181  HIS B C     
2457 O O     . HIS B 74  ? 0.1064 0.1085 0.1042 0.0039  -0.0039 0.0044  181  HIS B O     
2458 C CB    . HIS B 74  ? 0.1202 0.1204 0.1190 0.0000  -0.0008 0.0012  181  HIS B CB    
2459 C CG    . HIS B 74  ? 0.1328 0.1366 0.1384 0.0018  -0.0010 -0.0002 181  HIS B CG    
2460 N ND1   . HIS B 74  ? 0.1452 0.1435 0.1553 -0.0011 0.0025  0.0012  181  HIS B ND1   
2461 C CD2   . HIS B 74  ? 0.1445 0.1442 0.1588 -0.0005 0.0033  0.0004  181  HIS B CD2   
2462 C CE1   . HIS B 74  ? 0.1470 0.1460 0.1447 0.0000  -0.0026 0.0028  181  HIS B CE1   
2463 N NE2   . HIS B 74  ? 0.1327 0.1463 0.1331 -0.0006 -0.0068 0.0016  181  HIS B NE2   
2464 N N     . PHE B 75  ? 0.0998 0.1067 0.1041 0.0010  -0.0048 0.0014  182  PHE B N     
2465 C CA    . PHE B 75  ? 0.1063 0.1091 0.1087 -0.0003 -0.0014 0.0002  182  PHE B CA    
2466 C C     . PHE B 75  ? 0.1093 0.1114 0.1075 0.0008  -0.0017 0.0003  182  PHE B C     
2467 O O     . PHE B 75  ? 0.1055 0.1113 0.1084 -0.0004 -0.0032 -0.0006 182  PHE B O     
2468 C CB    . PHE B 75  ? 0.1051 0.1084 0.1071 -0.0003 -0.0009 -0.0002 182  PHE B CB    
2469 C CG    . PHE B 75  ? 0.1115 0.1121 0.1145 0.0003  -0.0001 0.0009  182  PHE B CG    
2470 C CD1   . PHE B 75  ? 0.1109 0.1133 0.1137 0.0007  -0.0020 0.0013  182  PHE B CD1   
2471 C CD2   . PHE B 75  ? 0.1089 0.1141 0.1163 0.0000  0.0001  0.0010  182  PHE B CD2   
2472 C CE1   . PHE B 75  ? 0.1153 0.1159 0.1165 0.0002  -0.0005 -0.0008 182  PHE B CE1   
2473 C CE2   . PHE B 75  ? 0.1188 0.1186 0.1177 -0.0006 0.0002  -0.0017 182  PHE B CE2   
2474 C CZ    . PHE B 75  ? 0.1140 0.1157 0.1180 0.0007  -0.0026 -0.0001 182  PHE B CZ    
2475 N N     . GLU B 76  ? 0.1136 0.1159 0.1108 -0.0015 -0.0023 0.0000  183  GLU B N     
2476 C CA    . GLU B 76  ? 0.1211 0.1210 0.1218 -0.0005 0.0006  -0.0007 183  GLU B CA    
2477 C C     . GLU B 76  ? 0.1202 0.1216 0.1198 -0.0012 -0.0008 -0.0003 183  GLU B C     
2478 O O     . GLU B 76  ? 0.1153 0.1161 0.1090 0.0013  -0.0042 0.0000  183  GLU B O     
2479 C CB    . GLU B 76  ? 0.1199 0.1242 0.1259 -0.0009 -0.0024 -0.0017 183  GLU B CB    
2480 C CG    . GLU B 76  ? 0.1431 0.1404 0.1416 0.0012  0.0026  0.0016  183  GLU B CG    
2481 C CD    . GLU B 76  ? 0.1668 0.1594 0.1662 -0.0043 -0.0021 -0.0061 183  GLU B CD    
2482 O OE1   . GLU B 76  ? 0.1769 0.1803 0.1932 -0.0028 0.0059  -0.0054 183  GLU B OE1   
2483 O OE2   . GLU B 76  ? 0.1922 0.1763 0.1713 -0.0030 0.0042  -0.0023 183  GLU B OE2   
2484 N N     . LEU B 77  ? 0.1239 0.1243 0.1250 -0.0014 -0.0011 -0.0016 184  LEU B N     
2485 C CA    . LEU B 77  ? 0.1272 0.1286 0.1281 0.0000  -0.0006 0.0000  184  LEU B CA    
2486 C C     . LEU B 77  ? 0.1256 0.1260 0.1262 0.0003  -0.0008 -0.0005 184  LEU B C     
2487 O O     . LEU B 77  ? 0.1244 0.1221 0.1173 0.0012  -0.0014 0.0016  184  LEU B O     
2488 C CB    . LEU B 77  ? 0.1342 0.1329 0.1371 0.0004  0.0006  -0.0013 184  LEU B CB    
2489 C CG    . LEU B 77  ? 0.1432 0.1481 0.1494 -0.0010 -0.0001 -0.0010 184  LEU B CG    
2490 C CD1   . LEU B 77  ? 0.1654 0.1586 0.1706 -0.0030 0.0032  -0.0017 184  LEU B CD1   
2491 C CD2   . LEU B 77  ? 0.1541 0.1561 0.1579 -0.0014 -0.0006 -0.0002 184  LEU B CD2   
2492 N N     . MET B 78  ? 0.1228 0.1252 0.1203 0.0026  -0.0053 0.0010  185  MET B N     
2493 C CA    . MET B 78  ? 0.1333 0.1326 0.1318 -0.0002 0.0001  -0.0008 185  MET B CA    
2494 C C     . MET B 78  ? 0.1267 0.1285 0.1273 0.0005  -0.0017 0.0006  185  MET B C     
2495 O O     . MET B 78  ? 0.1219 0.1232 0.1262 0.0015  0.0002  0.0007  185  MET B O     
2496 C CB    . MET B 78  ? 0.1383 0.1419 0.1363 0.0000  -0.0019 0.0014  185  MET B CB    
2497 C CG    . MET B 78  ? 0.1738 0.1649 0.1748 0.0028  0.0060  0.0032  185  MET B CG    
2498 S SD    . MET B 78  ? 0.2354 0.2148 0.2216 -0.0048 0.0033  -0.0050 185  MET B SD    
2499 C CE    . MET B 78  ? 0.2240 0.2193 0.2225 0.0000  0.0000  -0.0007 185  MET B CE    
2500 N N     . PRO B 79  ? 0.1311 0.1296 0.1315 -0.0004 0.0010  -0.0005 186  PRO B N     
2501 C CA    . PRO B 79  ? 0.1280 0.1285 0.1299 0.0004  -0.0009 0.0001  186  PRO B CA    
2502 C C     . PRO B 79  ? 0.1256 0.1249 0.1273 0.0001  0.0001  -0.0003 186  PRO B C     
2503 O O     . PRO B 79  ? 0.1440 0.1334 0.1401 -0.0018 0.0046  0.0028  186  PRO B O     
2504 C CB    . PRO B 79  ? 0.1324 0.1314 0.1350 -0.0008 0.0017  -0.0012 186  PRO B CB    
2505 C CG    . PRO B 79  ? 0.1360 0.1331 0.1387 0.0000  0.0015  -0.0006 186  PRO B CG    
2506 C CD    . PRO B 79  ? 0.1299 0.1306 0.1322 -0.0004 0.0002  -0.0009 186  PRO B CD    
2507 N N     . GLY B 80  ? 0.1145 0.1200 0.1158 -0.0001 -0.0023 0.0002  187  GLY B N     
2508 C CA    . GLY B 80  ? 0.1107 0.1111 0.1120 -0.0017 0.0004  -0.0007 187  GLY B CA    
2509 C C     . GLY B 80  ? 0.1002 0.1036 0.1015 -0.0002 -0.0011 -0.0015 187  GLY B C     
2510 O O     . GLY B 80  ? 0.0880 0.0959 0.0942 -0.0013 -0.0070 -0.0027 187  GLY B O     
2511 N N     . ASN B 81  ? 0.0920 0.0965 0.0932 -0.0009 -0.0024 -0.0001 188  ASN B N     
2512 C CA    . ASN B 81  ? 0.0925 0.0929 0.0907 -0.0002 -0.0011 0.0001  188  ASN B CA    
2513 C C     . ASN B 81  ? 0.0856 0.0852 0.0834 -0.0003 -0.0007 0.0007  188  ASN B C     
2514 O O     . ASN B 81  ? 0.0899 0.0860 0.0789 -0.0022 -0.0014 0.0000  188  ASN B O     
2515 C CB    . ASN B 81  ? 0.0918 0.0935 0.0942 0.0002  -0.0018 0.0002  188  ASN B CB    
2516 C CG    . ASN B 81  ? 0.1051 0.1029 0.0997 -0.0010 -0.0022 0.0005  188  ASN B CG    
2517 O OD1   . ASN B 81  ? 0.1169 0.1199 0.1157 -0.0011 0.0038  0.0004  188  ASN B OD1   
2518 N ND2   . ASN B 81  ? 0.1072 0.1140 0.1156 -0.0009 0.0002  -0.0005 188  ASN B ND2   
2519 N N     . SER B 82  ? 0.0777 0.0785 0.0750 -0.0007 -0.0008 -0.0003 189  SER B N     
2520 C CA    . SER B 82  ? 0.0723 0.0729 0.0718 0.0001  -0.0006 0.0004  189  SER B CA    
2521 C C     . SER B 82  ? 0.0653 0.0645 0.0634 -0.0006 -0.0013 -0.0004 189  SER B C     
2522 O O     . SER B 82  ? 0.0589 0.0609 0.0522 -0.0012 -0.0054 0.0031  189  SER B O     
2523 C CB    . SER B 82  ? 0.0739 0.0745 0.0748 0.0000  -0.0007 0.0010  189  SER B CB    
2524 O OG    . SER B 82  ? 0.0806 0.0813 0.0862 -0.0007 0.0012  -0.0006 189  SER B OG    
2525 N N     . VAL B 83  ? 0.0616 0.0606 0.0593 0.0003  0.0000  0.0011  190  VAL B N     
2526 C CA    . VAL B 83  ? 0.0571 0.0567 0.0539 0.0005  -0.0010 0.0011  190  VAL B CA    
2527 C C     . VAL B 83  ? 0.0553 0.0547 0.0525 0.0010  -0.0004 0.0017  190  VAL B C     
2528 O O     . VAL B 83  ? 0.0547 0.0565 0.0578 0.0014  0.0021  0.0062  190  VAL B O     
2529 C CB    . VAL B 83  ? 0.0537 0.0562 0.0547 0.0005  -0.0020 0.0006  190  VAL B CB    
2530 C CG1   . VAL B 83  ? 0.0640 0.0572 0.0551 0.0009  0.0021  0.0012  190  VAL B CG1   
2531 C CG2   . VAL B 83  ? 0.0605 0.0604 0.0599 -0.0022 0.0024  -0.0004 190  VAL B CG2   
2532 N N     . TYR B 84  ? 0.0536 0.0515 0.0496 0.0014  0.0011  0.0023  191  TYR B N     
2533 C CA    . TYR B 84  ? 0.0468 0.0490 0.0430 0.0007  -0.0026 0.0009  191  TYR B CA    
2534 C C     . TYR B 84  ? 0.0497 0.0494 0.0457 0.0000  0.0002  0.0014  191  TYR B C     
2535 O O     . TYR B 84  ? 0.0594 0.0558 0.0477 0.0015  0.0009  0.0029  191  TYR B O     
2536 C CB    . TYR B 84  ? 0.0401 0.0469 0.0387 0.0023  -0.0048 0.0028  191  TYR B CB    
2537 C CG    . TYR B 84  ? 0.0507 0.0510 0.0499 -0.0032 0.0018  -0.0016 191  TYR B CG    
2538 C CD1   . TYR B 84  ? 0.0429 0.0489 0.0396 0.0013  -0.0048 0.0029  191  TYR B CD1   
2539 C CD2   . TYR B 84  ? 0.0490 0.0521 0.0506 -0.0008 -0.0003 0.0021  191  TYR B CD2   
2540 C CE1   . TYR B 84  ? 0.0555 0.0557 0.0601 -0.0063 0.0035  -0.0045 191  TYR B CE1   
2541 C CE2   . TYR B 84  ? 0.0511 0.0543 0.0555 -0.0030 0.0000  -0.0007 191  TYR B CE2   
2542 C CZ    . TYR B 84  ? 0.0563 0.0552 0.0549 -0.0035 0.0018  -0.0017 191  TYR B CZ    
2543 O OH    . TYR B 84  ? 0.0521 0.0635 0.0517 0.0001  -0.0025 0.0005  191  TYR B OH    
2544 N N     . HIS B 85  ? 0.0475 0.0502 0.0433 -0.0014 -0.0007 0.0006  192  HIS B N     
2545 C CA    . HIS B 85  ? 0.0462 0.0485 0.0450 0.0000  -0.0007 0.0014  192  HIS B CA    
2546 C C     . HIS B 85  ? 0.0443 0.0459 0.0413 -0.0012 0.0008  0.0002  192  HIS B C     
2547 O O     . HIS B 85  ? 0.0353 0.0432 0.0407 -0.0022 0.0003  -0.0009 192  HIS B O     
2548 C CB    . HIS B 85  ? 0.0524 0.0514 0.0509 -0.0026 0.0005  0.0005  192  HIS B CB    
2549 C CG    . HIS B 85  ? 0.0626 0.0607 0.0640 -0.0016 0.0019  -0.0011 192  HIS B CG    
2550 N ND1   . HIS B 85  ? 0.0781 0.0811 0.0851 0.0027  0.0042  0.0014  192  HIS B ND1   
2551 C CD2   . HIS B 85  ? 0.0744 0.0689 0.0643 0.0013  0.0016  0.0032  192  HIS B CD2   
2552 C CE1   . HIS B 85  ? 0.0755 0.0784 0.0752 -0.0011 -0.0001 0.0001  192  HIS B CE1   
2553 N NE2   . HIS B 85  ? 0.0749 0.0738 0.0725 0.0032  0.0025  0.0056  192  HIS B NE2   
2554 N N     . PHE B 86  ? 0.0341 0.0380 0.0340 -0.0006 -0.0035 0.0007  193  PHE B N     
2555 C CA    . PHE B 86  ? 0.0412 0.0400 0.0382 -0.0005 -0.0001 0.0006  193  PHE B CA    
2556 C C     . PHE B 86  ? 0.0416 0.0403 0.0401 0.0000  0.0006  0.0004  193  PHE B C     
2557 O O     . PHE B 86  ? 0.0490 0.0404 0.0406 0.0020  -0.0005 0.0015  193  PHE B O     
2558 C CB    . PHE B 86  ? 0.0375 0.0402 0.0375 -0.0001 -0.0018 0.0012  193  PHE B CB    
2559 C CG    . PHE B 86  ? 0.0418 0.0428 0.0382 0.0017  -0.0002 0.0017  193  PHE B CG    
2560 C CD1   . PHE B 86  ? 0.0379 0.0407 0.0430 0.0021  0.0011  0.0011  193  PHE B CD1   
2561 C CD2   . PHE B 86  ? 0.0429 0.0456 0.0486 -0.0011 0.0009  -0.0004 193  PHE B CD2   
2562 C CE1   . PHE B 86  ? 0.0449 0.0476 0.0438 -0.0001 -0.0014 0.0016  193  PHE B CE1   
2563 C CE2   . PHE B 86  ? 0.0575 0.0512 0.0502 0.0003  -0.0008 0.0014  193  PHE B CE2   
2564 C CZ    . PHE B 86  ? 0.0595 0.0524 0.0553 -0.0005 0.0014  -0.0020 193  PHE B CZ    
2565 N N     . ASP B 87  ? 0.0382 0.0391 0.0374 0.0013  -0.0007 0.0017  194  ASP B N     
2566 C CA    . ASP B 87  ? 0.0397 0.0410 0.0381 0.0001  -0.0009 0.0009  194  ASP B CA    
2567 C C     . ASP B 87  ? 0.0392 0.0422 0.0364 0.0004  -0.0020 0.0008  194  ASP B C     
2568 O O     . ASP B 87  ? 0.0378 0.0418 0.0290 0.0008  -0.0026 0.0016  194  ASP B O     
2569 C CB    . ASP B 87  ? 0.0364 0.0422 0.0369 -0.0003 -0.0024 -0.0001 194  ASP B CB    
2570 C CG    . ASP B 87  ? 0.0459 0.0454 0.0454 0.0004  -0.0001 -0.0015 194  ASP B CG    
2571 O OD1   . ASP B 87  ? 0.0500 0.0474 0.0468 -0.0022 0.0009  -0.0062 194  ASP B OD1   
2572 O OD2   . ASP B 87  ? 0.0409 0.0414 0.0443 0.0003  -0.0061 -0.0002 194  ASP B OD2   
2573 N N     . LYS B 88  ? 0.0459 0.0495 0.0457 -0.0010 -0.0010 0.0000  195  LYS B N     
2574 C CA    . LYS B 88  ? 0.0522 0.0526 0.0507 0.0001  -0.0015 0.0005  195  LYS B CA    
2575 C C     . LYS B 88  ? 0.0551 0.0545 0.0543 0.0000  0.0000  0.0009  195  LYS B C     
2576 O O     . LYS B 88  ? 0.0694 0.0583 0.0560 0.0001  0.0015  -0.0010 195  LYS B O     
2577 C CB    . LYS B 88  ? 0.0535 0.0585 0.0566 -0.0012 -0.0006 0.0001  195  LYS B CB    
2578 C CG    . LYS B 88  ? 0.0731 0.0701 0.0670 -0.0002 -0.0036 0.0010  195  LYS B CG    
2579 C CD    . LYS B 88  ? 0.0898 0.0980 0.0986 0.0002  0.0027  0.0005  195  LYS B CD    
2580 C CE    . LYS B 88  ? 0.1080 0.1079 0.1064 -0.0005 -0.0048 0.0006  195  LYS B CE    
2581 N NZ    . LYS B 88  ? 0.1212 0.1362 0.1431 0.0007  0.0054  0.0015  195  LYS B NZ    
2582 N N     . SER B 89  ? 0.0509 0.0535 0.0524 -0.0012 -0.0017 -0.0001 196  SER B N     
2583 C CA    . SER B 89  ? 0.0533 0.0543 0.0548 -0.0006 -0.0007 0.0000  196  SER B CA    
2584 C C     . SER B 89  ? 0.0531 0.0554 0.0531 0.0001  -0.0014 0.0010  196  SER B C     
2585 O O     . SER B 89  ? 0.0460 0.0481 0.0432 -0.0017 -0.0067 0.0009  196  SER B O     
2586 C CB    . SER B 89  ? 0.0587 0.0553 0.0584 0.0000  0.0016  0.0000  196  SER B CB    
2587 O OG    . SER B 89  ? 0.0472 0.0570 0.0543 0.0001  0.0000  0.0031  196  SER B OG    
2588 N N     . THR B 90  ? 0.0542 0.0562 0.0566 -0.0001 -0.0011 0.0008  197  THR B N     
2589 C CA    . THR B 90  ? 0.0660 0.0639 0.0610 0.0000  -0.0002 0.0001  197  THR B CA    
2590 C C     . THR B 90  ? 0.0652 0.0637 0.0606 -0.0010 -0.0006 0.0007  197  THR B C     
2591 O O     . THR B 90  ? 0.0562 0.0590 0.0469 -0.0008 -0.0054 -0.0001 197  THR B O     
2592 C CB    . THR B 90  ? 0.0667 0.0643 0.0630 0.0014  -0.0018 -0.0002 197  THR B CB    
2593 O OG1   . THR B 90  ? 0.0637 0.0598 0.0482 -0.0005 -0.0004 0.0006  197  THR B OG1   
2594 C CG2   . THR B 90  ? 0.0882 0.0758 0.0774 -0.0002 0.0063  0.0009  197  THR B CG2   
2595 N N     . SER B 91  ? 0.0676 0.0676 0.0652 -0.0022 -0.0018 -0.0027 198  SER B N     
2596 C CA    . SER B 91  ? 0.0724 0.0714 0.0689 -0.0014 -0.0016 -0.0007 198  SER B CA    
2597 C C     . SER B 91  ? 0.0780 0.0768 0.0759 -0.0016 0.0007  -0.0020 198  SER B C     
2598 O O     . SER B 91  ? 0.0841 0.0813 0.0799 -0.0032 0.0020  -0.0019 198  SER B O     
2599 C CB    . SER B 91  ? 0.0755 0.0735 0.0697 -0.0010 0.0003  -0.0017 198  SER B CB    
2600 O OG    . SER B 91  ? 0.0875 0.0778 0.0781 0.0002  0.0009  -0.0012 198  SER B OG    
2601 N N     . SER B 92  ? 0.0773 0.0797 0.0746 -0.0009 -0.0032 -0.0005 199  SER B N     
2602 C CA    . SER B 92  ? 0.0874 0.0863 0.0834 -0.0005 0.0005  -0.0004 199  SER B CA    
2603 C C     . SER B 92  ? 0.0827 0.0841 0.0821 -0.0002 0.0000  0.0000  199  SER B C     
2604 O O     . SER B 92  ? 0.0919 0.0923 0.0844 0.0018  -0.0002 0.0000  199  SER B O     
2605 C CB    . SER B 92  ? 0.0894 0.0891 0.0906 -0.0008 0.0006  -0.0003 199  SER B CB    
2606 O OG    . SER B 92  ? 0.1029 0.1009 0.0982 -0.0012 0.0013  0.0032  199  SER B OG    
2607 N N     . CYS B 93  ? 0.0793 0.0783 0.0767 -0.0008 -0.0011 0.0000  200  CYS B N     
2608 C CA    . CYS B 93  ? 0.0768 0.0752 0.0735 0.0003  -0.0008 0.0004  200  CYS B CA    
2609 C C     . CYS B 93  ? 0.0701 0.0696 0.0660 -0.0003 -0.0004 0.0005  200  CYS B C     
2610 O O     . CYS B 93  ? 0.0705 0.0662 0.0590 -0.0021 -0.0011 0.0000  200  CYS B O     
2611 C CB    . CYS B 93  ? 0.0740 0.0770 0.0746 -0.0002 -0.0016 0.0008  200  CYS B CB    
2612 S SG    . CYS B 93  ? 0.0997 0.0869 0.0808 0.0022  -0.0079 0.0042  200  CYS B SG    
2613 N N     . ILE B 94  ? 0.0675 0.0665 0.0600 0.0007  0.0000  0.0001  201  ILE B N     
2614 C CA    . ILE B 94  ? 0.0630 0.0631 0.0602 0.0001  -0.0001 0.0011  201  ILE B CA    
2615 C C     . ILE B 94  ? 0.0599 0.0591 0.0566 0.0006  -0.0004 0.0011  201  ILE B C     
2616 O O     . ILE B 94  ? 0.0568 0.0522 0.0458 -0.0007 -0.0025 0.0029  201  ILE B O     
2617 C CB    . ILE B 94  ? 0.0650 0.0659 0.0606 0.0005  0.0010  0.0014  201  ILE B CB    
2618 C CG1   . ILE B 94  ? 0.0745 0.0737 0.0741 -0.0005 0.0013  -0.0016 201  ILE B CG1   
2619 C CG2   . ILE B 94  ? 0.0582 0.0630 0.0617 -0.0010 -0.0006 -0.0029 201  ILE B CG2   
2620 C CD1   . ILE B 94  ? 0.0856 0.0802 0.0831 -0.0051 0.0041  -0.0033 201  ILE B CD1   
2621 N N     . SER B 95  ? 0.0618 0.0605 0.0584 -0.0006 0.0007  0.0000  202  SER B N     
2622 C CA    . SER B 95  ? 0.0569 0.0585 0.0550 -0.0005 -0.0015 0.0007  202  SER B CA    
2623 C C     . SER B 95  ? 0.0576 0.0610 0.0585 0.0001  -0.0021 -0.0004 202  SER B C     
2624 O O     . SER B 95  ? 0.0618 0.0630 0.0592 -0.0003 -0.0006 -0.0004 202  SER B O     
2625 C CB    . SER B 95  ? 0.0621 0.0588 0.0554 -0.0007 0.0011  0.0013  202  SER B CB    
2626 O OG    . SER B 95  ? 0.0450 0.0467 0.0392 -0.0007 -0.0067 0.0023  202  SER B OG    
2627 N N     . THR B 96  ? 0.0577 0.0625 0.0636 -0.0017 -0.0007 -0.0013 203  THR B N     
2628 C CA    . THR B 96  ? 0.0674 0.0676 0.0660 -0.0003 -0.0023 0.0001  203  THR B CA    
2629 C C     . THR B 96  ? 0.0633 0.0651 0.0677 0.0004  0.0007  -0.0012 203  THR B C     
2630 O O     . THR B 96  ? 0.0668 0.0669 0.0694 0.0037  -0.0035 0.0028  203  THR B O     
2631 C CB    . THR B 96  ? 0.0726 0.0718 0.0681 -0.0005 -0.0018 0.0004  203  THR B CB    
2632 O OG1   . THR B 96  ? 0.0908 0.0945 0.1179 -0.0006 0.0070  0.0020  203  THR B OG1   
2633 C CG2   . THR B 96  ? 0.0865 0.0795 0.0894 -0.0008 0.0034  -0.0002 203  THR B CG2   
2634 N N     . ASN B 97  ? 0.0577 0.0601 0.0603 0.0000  0.0002  -0.0006 204  ASN B N     
2635 C CA    . ASN B 97  ? 0.0549 0.0544 0.0544 -0.0002 0.0007  -0.0001 204  ASN B CA    
2636 C C     . ASN B 97  ? 0.0434 0.0449 0.0425 0.0005  -0.0001 -0.0010 204  ASN B C     
2637 O O     . ASN B 97  ? 0.0422 0.0425 0.0402 -0.0005 0.0002  -0.0003 204  ASN B O     
2638 C CB    . ASN B 97  ? 0.0606 0.0606 0.0587 0.0009  0.0010  -0.0006 204  ASN B CB    
2639 C CG    . ASN B 97  ? 0.0743 0.0782 0.0728 -0.0029 0.0018  0.0008  204  ASN B CG    
2640 O OD1   . ASN B 97  ? 0.1192 0.1029 0.1377 0.0071  0.0085  0.0057  204  ASN B OD1   
2641 N ND2   . ASN B 97  ? 0.0737 0.0822 0.0848 -0.0002 0.0008  0.0000  204  ASN B ND2   
2642 N N     . ALA B 98  ? 0.0316 0.0333 0.0306 -0.0011 -0.0028 -0.0008 205  ALA B N     
2643 C CA    . ALA B 98  ? 0.0273 0.0303 0.0291 0.0001  -0.0015 -0.0009 205  ALA B CA    
2644 C C     . ALA B 98  ? 0.0314 0.0309 0.0303 -0.0015 -0.0006 -0.0004 205  ALA B C     
2645 O O     . ALA B 98  ? 0.0277 0.0306 0.0311 -0.0014 0.0001  0.0000  205  ALA B O     
2646 C CB    . ALA B 98  ? 0.0258 0.0288 0.0259 0.0003  -0.0005 0.0004  205  ALA B CB    
2647 N N     . LEU B 99  ? 0.0322 0.0337 0.0333 -0.0001 -0.0013 -0.0007 206  LEU B N     
2648 C CA    . LEU B 99  ? 0.0418 0.0418 0.0402 -0.0009 0.0000  0.0005  206  LEU B CA    
2649 C C     . LEU B 99  ? 0.0399 0.0403 0.0371 -0.0015 -0.0006 0.0001  206  LEU B C     
2650 O O     . LEU B 99  ? 0.0333 0.0365 0.0371 0.0003  -0.0033 0.0043  206  LEU B O     
2651 C CB    . LEU B 99  ? 0.0471 0.0453 0.0493 0.0024  0.0003  0.0012  206  LEU B CB    
2652 C CG    . LEU B 99  ? 0.0610 0.0623 0.0597 0.0028  0.0017  0.0000  206  LEU B CG    
2653 C CD1   . LEU B 99  ? 0.0572 0.0642 0.0532 0.0031  -0.0020 0.0006  206  LEU B CD1   
2654 C CD2   . LEU B 99  ? 0.0840 0.0774 0.0825 0.0007  0.0065  0.0025  206  LEU B CD2   
2655 N N     . LEU B 100 ? 0.0371 0.0396 0.0357 0.0005  -0.0014 -0.0001 207  LEU B N     
2656 C CA    . LEU B 100 ? 0.0379 0.0393 0.0350 0.0004  -0.0019 0.0010  207  LEU B CA    
2657 C C     . LEU B 100 ? 0.0403 0.0405 0.0371 0.0000  -0.0007 -0.0005 207  LEU B C     
2658 O O     . LEU B 100 ? 0.0447 0.0417 0.0401 0.0018  0.0012  0.0012  207  LEU B O     
2659 C CB    . LEU B 100 ? 0.0375 0.0398 0.0354 0.0004  -0.0018 0.0005  207  LEU B CB    
2660 C CG    . LEU B 100 ? 0.0439 0.0437 0.0412 -0.0006 0.0014  -0.0014 207  LEU B CG    
2661 C CD1   . LEU B 100 ? 0.0467 0.0470 0.0507 0.0006  -0.0007 0.0008  207  LEU B CD1   
2662 C CD2   . LEU B 100 ? 0.0419 0.0426 0.0388 -0.0011 -0.0019 -0.0012 207  LEU B CD2   
2663 N N     . PRO B 101 ? 0.0470 0.0442 0.0421 0.0019  -0.0001 0.0014  208  PRO B N     
2664 C CA    . PRO B 101 ? 0.0475 0.0444 0.0448 0.0001  0.0005  0.0002  208  PRO B CA    
2665 C C     . PRO B 101 ? 0.0432 0.0407 0.0403 0.0003  0.0000  0.0007  208  PRO B C     
2666 O O     . PRO B 101 ? 0.0412 0.0414 0.0407 0.0018  -0.0022 0.0022  208  PRO B O     
2667 C CB    . PRO B 101 ? 0.0456 0.0470 0.0433 0.0012  -0.0013 0.0025  208  PRO B CB    
2668 C CG    . PRO B 101 ? 0.0609 0.0520 0.0565 0.0004  0.0046  -0.0002 208  PRO B CG    
2669 C CD    . PRO B 101 ? 0.0482 0.0463 0.0431 -0.0018 0.0002  -0.0004 208  PRO B CD    
2670 N N     . ASP B 102 ? 0.0407 0.0388 0.0372 0.0000  0.0001  0.0003  209  ASP B N     
2671 C CA    . ASP B 102 ? 0.0366 0.0372 0.0378 0.0000  -0.0001 0.0003  209  ASP B CA    
2672 C C     . ASP B 102 ? 0.0328 0.0349 0.0315 0.0019  -0.0026 0.0015  209  ASP B C     
2673 O O     . ASP B 102 ? 0.0319 0.0339 0.0281 0.0018  -0.0024 0.0032  209  ASP B O     
2674 C CB    . ASP B 102 ? 0.0377 0.0390 0.0367 -0.0003 -0.0007 0.0012  209  ASP B CB    
2675 C CG    . ASP B 102 ? 0.0457 0.0446 0.0406 0.0029  0.0003  0.0007  209  ASP B CG    
2676 O OD1   . ASP B 102 ? 0.0401 0.0411 0.0532 0.0036  -0.0030 -0.0003 209  ASP B OD1   
2677 O OD2   . ASP B 102 ? 0.0556 0.0604 0.0612 -0.0018 0.0020  0.0004  209  ASP B OD2   
2678 N N     . PRO B 103 ? 0.0347 0.0374 0.0384 0.0009  -0.0004 0.0000  210  PRO B N     
2679 C CA    . PRO B 103 ? 0.0379 0.0371 0.0375 0.0001  0.0000  -0.0008 210  PRO B CA    
2680 C C     . PRO B 103 ? 0.0405 0.0388 0.0402 -0.0003 0.0004  -0.0006 210  PRO B C     
2681 O O     . PRO B 103 ? 0.0329 0.0385 0.0337 0.0007  -0.0039 -0.0013 210  PRO B O     
2682 C CB    . PRO B 103 ? 0.0414 0.0374 0.0388 -0.0013 0.0014  -0.0020 210  PRO B CB    
2683 C CG    . PRO B 103 ? 0.0307 0.0348 0.0406 0.0016  -0.0017 0.0015  210  PRO B CG    
2684 C CD    . PRO B 103 ? 0.0336 0.0369 0.0385 -0.0009 -0.0006 -0.0018 210  PRO B CD    
2685 N N     . TYR B 104 ? 0.0354 0.0395 0.0335 -0.0008 -0.0049 -0.0022 211  TYR B N     
2686 C CA    . TYR B 104 ? 0.0416 0.0424 0.0391 -0.0006 -0.0015 -0.0016 211  TYR B CA    
2687 C C     . TYR B 104 ? 0.0420 0.0431 0.0416 0.0004  -0.0010 -0.0012 211  TYR B C     
2688 O O     . TYR B 104 ? 0.0358 0.0424 0.0376 -0.0005 0.0013  -0.0010 211  TYR B O     
2689 C CB    . TYR B 104 ? 0.0457 0.0469 0.0453 0.0016  0.0004  0.0001  211  TYR B CB    
2690 C CG    . TYR B 104 ? 0.0591 0.0518 0.0521 0.0034  0.0020  0.0007  211  TYR B CG    
2691 C CD1   . TYR B 104 ? 0.0537 0.0520 0.0513 0.0002  -0.0037 -0.0012 211  TYR B CD1   
2692 C CD2   . TYR B 104 ? 0.0662 0.0566 0.0565 0.0020  0.0030  0.0010  211  TYR B CD2   
2693 C CE1   . TYR B 104 ? 0.0501 0.0501 0.0495 -0.0003 -0.0028 0.0000  211  TYR B CE1   
2694 C CE2   . TYR B 104 ? 0.0450 0.0499 0.0467 0.0016  -0.0019 0.0026  211  TYR B CE2   
2695 C CZ    . TYR B 104 ? 0.0465 0.0475 0.0463 -0.0001 -0.0018 -0.0001 211  TYR B CZ    
2696 O OH    . TYR B 104 ? 0.0383 0.0478 0.0323 -0.0003 -0.0076 -0.0016 211  TYR B OH    
2697 N N     . GLU B 105 ? 0.0426 0.0468 0.0424 0.0001  -0.0027 -0.0010 212  GLU B N     
2698 C CA    . GLU B 105 ? 0.0484 0.0510 0.0504 0.0003  -0.0018 -0.0007 212  GLU B CA    
2699 C C     . GLU B 105 ? 0.0512 0.0570 0.0531 0.0005  -0.0029 0.0002  212  GLU B C     
2700 O O     . GLU B 105 ? 0.0409 0.0520 0.0466 0.0030  -0.0054 0.0020  212  GLU B O     
2701 C CB    . GLU B 105 ? 0.0539 0.0580 0.0512 0.0007  -0.0025 -0.0007 212  GLU B CB    
2702 C CG    . GLU B 105 ? 0.0660 0.0577 0.0592 0.0018  0.0000  -0.0012 212  GLU B CG    
2703 C CD    . GLU B 105 ? 0.0456 0.0496 0.0518 0.0000  -0.0052 0.0000  212  GLU B CD    
2704 O OE1   . GLU B 105 ? 0.0520 0.0463 0.0457 -0.0004 -0.0057 -0.0005 212  GLU B OE1   
2705 O OE2   . GLU B 105 ? 0.0459 0.0432 0.0320 0.0021  -0.0006 0.0014  212  GLU B OE2   
2706 N N     . SER B 106 ? 0.0619 0.0639 0.0651 0.0010  -0.0005 0.0006  213  SER B N     
2707 C CA    . SER B 106 ? 0.0724 0.0783 0.0749 0.0000  -0.0019 -0.0001 213  SER B CA    
2708 C C     . SER B 106 ? 0.0814 0.0831 0.0834 0.0000  -0.0014 0.0000  213  SER B C     
2709 O O     . SER B 106 ? 0.0809 0.0834 0.0775 -0.0029 -0.0032 -0.0026 213  SER B O     
2710 C CB    . SER B 106 ? 0.0726 0.0776 0.0788 0.0009  0.0003  0.0023  213  SER B CB    
2711 O OG    . SER B 106 ? 0.1116 0.1156 0.1136 -0.0008 -0.0018 -0.0022 213  SER B OG    
2712 N N     . GLU B 107 ? 0.0895 0.0920 0.0879 0.0000  -0.0017 -0.0002 214  GLU B N     
2713 C CA    . GLU B 107 ? 0.1048 0.1026 0.1025 0.0004  -0.0005 -0.0004 214  GLU B CA    
2714 C C     . GLU B 107 ? 0.0985 0.0985 0.0946 -0.0003 -0.0003 -0.0002 214  GLU B C     
2715 O O     . GLU B 107 ? 0.1071 0.1021 0.0940 -0.0004 -0.0021 0.0022  214  GLU B O     
2716 C CB    . GLU B 107 ? 0.1166 0.1168 0.1138 0.0008  0.0037  -0.0018 214  GLU B CB    
2717 C CG    . GLU B 107 ? 0.1527 0.1405 0.1518 0.0013  -0.0023 0.0034  214  GLU B CG    
2718 C CD    . GLU B 107 ? 0.1942 0.2009 0.1970 0.0000  0.0111  0.0013  214  GLU B CD    
2719 O OE1   . GLU B 107 ? 0.2269 0.2236 0.2358 0.0059  0.0047  0.0008  214  GLU B OE1   
2720 O OE2   . GLU B 107 ? 0.2244 0.2212 0.2095 0.0014  0.0010  0.0041  214  GLU B OE2   
2721 N N     . ARG B 108 ? 0.0926 0.0909 0.0869 0.0014  -0.0004 0.0015  215  ARG B N     
2722 C CA    . ARG B 108 ? 0.0887 0.0869 0.0854 -0.0001 0.0007  -0.0002 215  ARG B CA    
2723 C C     . ARG B 108 ? 0.0760 0.0737 0.0736 0.0009  -0.0013 0.0000  215  ARG B C     
2724 O O     . ARG B 108 ? 0.0664 0.0674 0.0640 -0.0008 -0.0021 -0.0024 215  ARG B O     
2725 C CB    . ARG B 108 ? 0.0948 0.0906 0.0936 0.0007  0.0002  0.0011  215  ARG B CB    
2726 C CG    . ARG B 108 ? 0.1140 0.1079 0.1068 -0.0002 0.0046  -0.0016 215  ARG B CG    
2727 C CD    . ARG B 108 ? 0.1133 0.1197 0.1265 -0.0001 -0.0056 0.0008  215  ARG B CD    
2728 N NE    . ARG B 108 ? 0.1331 0.1443 0.1447 -0.0009 0.0020  -0.0010 215  ARG B NE    
2729 C CZ    A ARG B 108 ? 0.1389 0.1399 0.1441 0.0004  0.0002  0.0017  215  ARG B CZ    
2730 C CZ    B ARG B 108 ? 0.1476 0.1500 0.1527 -0.0002 0.0007  -0.0018 215  ARG B CZ    
2731 N NH1   A ARG B 108 ? 0.1307 0.1342 0.1302 -0.0018 -0.0010 0.0015  215  ARG B NH1   
2732 N NH1   B ARG B 108 ? 0.1445 0.1506 0.1561 0.0001  -0.0019 0.0019  215  ARG B NH1   
2733 N NH2   A ARG B 108 ? 0.1479 0.1454 0.1494 -0.0011 0.0024  -0.0025 215  ARG B NH2   
2734 N NH2   B ARG B 108 ? 0.1511 0.1548 0.1516 -0.0006 -0.0013 0.0006  215  ARG B NH2   
2735 N N     . VAL B 109 ? 0.0636 0.0665 0.0611 0.0001  -0.0021 0.0016  216  VAL B N     
2736 C CA    . VAL B 109 ? 0.0588 0.0598 0.0585 0.0001  -0.0012 -0.0003 216  VAL B CA    
2737 C C     . VAL B 109 ? 0.0552 0.0561 0.0529 -0.0008 -0.0014 -0.0003 216  VAL B C     
2738 O O     . VAL B 109 ? 0.0538 0.0554 0.0524 0.0020  -0.0005 0.0009  216  VAL B O     
2739 C CB    . VAL B 109 ? 0.0573 0.0569 0.0565 -0.0002 -0.0009 0.0017  216  VAL B CB    
2740 C CG1   . VAL B 109 ? 0.0626 0.0615 0.0652 -0.0003 0.0008  0.0011  216  VAL B CG1   
2741 C CG2   . VAL B 109 ? 0.0505 0.0546 0.0501 -0.0006 -0.0033 -0.0011 216  VAL B CG2   
2742 N N     . TYR B 110 ? 0.0521 0.0527 0.0487 0.0005  -0.0010 -0.0002 217  TYR B N     
2743 C CA    . TYR B 110 ? 0.0479 0.0499 0.0475 -0.0001 -0.0011 0.0006  217  TYR B CA    
2744 C C     . TYR B 110 ? 0.0511 0.0497 0.0498 0.0000  0.0015  -0.0003 217  TYR B C     
2745 O O     . TYR B 110 ? 0.0450 0.0459 0.0485 -0.0011 0.0017  0.0000  217  TYR B O     
2746 C CB    . TYR B 110 ? 0.0480 0.0485 0.0474 0.0004  -0.0001 -0.0015 217  TYR B CB    
2747 C CG    . TYR B 110 ? 0.0321 0.0474 0.0436 -0.0007 -0.0058 -0.0010 217  TYR B CG    
2748 C CD1   . TYR B 110 ? 0.0487 0.0484 0.0378 0.0013  -0.0006 0.0000  217  TYR B CD1   
2749 C CD2   . TYR B 110 ? 0.0344 0.0514 0.0490 -0.0009 -0.0033 -0.0022 217  TYR B CD2   
2750 C CE1   . TYR B 110 ? 0.0668 0.0519 0.0556 -0.0006 0.0031  0.0004  217  TYR B CE1   
2751 C CE2   . TYR B 110 ? 0.0640 0.0538 0.0549 -0.0017 0.0035  -0.0027 217  TYR B CE2   
2752 C CZ    . TYR B 110 ? 0.0676 0.0547 0.0548 -0.0034 0.0052  -0.0007 217  TYR B CZ    
2753 O OH    . TYR B 110 ? 0.0568 0.0515 0.0361 -0.0033 0.0035  -0.0060 217  TYR B OH    
2754 N N     . VAL B 111 ? 0.0545 0.0509 0.0511 0.0000  0.0026  -0.0006 218  VAL B N     
2755 C CA    . VAL B 111 ? 0.0489 0.0458 0.0470 0.0002  0.0007  0.0005  218  VAL B CA    
2756 C C     . VAL B 111 ? 0.0450 0.0431 0.0448 0.0007  -0.0001 -0.0003 218  VAL B C     
2757 O O     . VAL B 111 ? 0.0457 0.0402 0.0350 -0.0005 -0.0040 0.0000  218  VAL B O     
2758 C CB    . VAL B 111 ? 0.0410 0.0443 0.0426 -0.0001 -0.0021 0.0000  218  VAL B CB    
2759 C CG1   . VAL B 111 ? 0.0494 0.0516 0.0535 -0.0007 0.0032  -0.0016 218  VAL B CG1   
2760 C CG2   . VAL B 111 ? 0.0446 0.0455 0.0414 -0.0015 0.0012  0.0000  218  VAL B CG2   
2761 N N     . ALA B 112 ? 0.0438 0.0423 0.0419 0.0028  -0.0006 0.0020  219  ALA B N     
2762 C CA    . ALA B 112 ? 0.0434 0.0442 0.0424 -0.0005 -0.0020 0.0001  219  ALA B CA    
2763 C C     . ALA B 112 ? 0.0428 0.0427 0.0418 0.0007  -0.0017 -0.0003 219  ALA B C     
2764 O O     . ALA B 112 ? 0.0407 0.0451 0.0405 -0.0006 -0.0045 -0.0024 219  ALA B O     
2765 C CB    . ALA B 112 ? 0.0578 0.0469 0.0466 -0.0008 0.0030  -0.0001 219  ALA B CB    
2766 N N     . GLU B 113 ? 0.0441 0.0449 0.0410 0.0000  -0.0035 -0.0009 220  GLU B N     
2767 C CA    . GLU B 113 ? 0.0517 0.0508 0.0507 -0.0005 -0.0006 -0.0011 220  GLU B CA    
2768 C C     . GLU B 113 ? 0.0552 0.0521 0.0509 -0.0008 0.0003  -0.0001 220  GLU B C     
2769 O O     . GLU B 113 ? 0.0578 0.0536 0.0560 -0.0004 0.0027  -0.0016 220  GLU B O     
2770 C CB    . GLU B 113 ? 0.0590 0.0569 0.0595 -0.0021 0.0033  -0.0033 220  GLU B CB    
2771 C CG    . GLU B 113 ? 0.0686 0.0647 0.0647 0.0016  -0.0025 0.0023  220  GLU B CG    
2772 C CD    . GLU B 113 ? 0.0845 0.0911 0.0895 0.0020  0.0036  0.0045  220  GLU B CD    
2773 O OE1   . GLU B 113 ? 0.1222 0.1198 0.1187 -0.0102 0.0041  -0.0090 220  GLU B OE1   
2774 O OE2   . GLU B 113 ? 0.1008 0.0970 0.0917 -0.0029 0.0031  -0.0017 220  GLU B OE2   
2775 N N     . SER B 114 ? 0.0530 0.0509 0.0528 -0.0003 0.0007  0.0000  221  SER B N     
2776 C CA    . SER B 114 ? 0.0555 0.0529 0.0527 0.0001  0.0012  0.0002  221  SER B CA    
2777 C C     . SER B 114 ? 0.0506 0.0523 0.0496 -0.0010 -0.0013 0.0004  221  SER B C     
2778 O O     . SER B 114 ? 0.0524 0.0508 0.0419 -0.0001 -0.0013 0.0020  221  SER B O     
2779 C CB    . SER B 114 ? 0.0575 0.0514 0.0548 -0.0002 0.0018  0.0008  221  SER B CB    
2780 O OG    . SER B 114 ? 0.0604 0.0557 0.0569 0.0032  0.0038  0.0020  221  SER B OG    
2781 N N     . LEU B 115 ? 0.0506 0.0551 0.0524 -0.0010 -0.0018 -0.0010 222  LEU B N     
2782 C CA    . LEU B 115 ? 0.0605 0.0589 0.0590 -0.0010 -0.0003 -0.0002 222  LEU B CA    
2783 C C     . LEU B 115 ? 0.0525 0.0541 0.0551 -0.0002 -0.0007 -0.0006 222  LEU B C     
2784 O O     . LEU B 115 ? 0.0471 0.0508 0.0521 -0.0034 -0.0040 -0.0053 222  LEU B O     
2785 C CB    . LEU B 115 ? 0.0708 0.0659 0.0678 -0.0009 0.0023  -0.0018 222  LEU B CB    
2786 C CG    . LEU B 115 ? 0.0931 0.0889 0.0844 -0.0005 -0.0030 0.0021  222  LEU B CG    
2787 C CD1   . LEU B 115 ? 0.1202 0.1091 0.1144 0.0040  0.0044  -0.0013 222  LEU B CD1   
2788 C CD2   . LEU B 115 ? 0.1022 0.0994 0.1046 0.0003  0.0023  -0.0002 222  LEU B CD2   
2789 N N     . ILE B 116 ? 0.0516 0.0496 0.0469 -0.0012 -0.0011 -0.0022 223  ILE B N     
2790 C CA    . ILE B 116 ? 0.0490 0.0482 0.0479 0.0010  0.0000  0.0008  223  ILE B CA    
2791 C C     . ILE B 116 ? 0.0494 0.0462 0.0414 0.0004  -0.0008 0.0002  223  ILE B C     
2792 O O     . ILE B 116 ? 0.0521 0.0476 0.0345 0.0012  -0.0012 0.0013  223  ILE B O     
2793 C CB    . ILE B 116 ? 0.0505 0.0491 0.0461 -0.0004 -0.0018 0.0000  223  ILE B CB    
2794 C CG1   . ILE B 116 ? 0.0500 0.0541 0.0515 0.0009  -0.0013 -0.0012 223  ILE B CG1   
2795 C CG2   . ILE B 116 ? 0.0595 0.0539 0.0507 0.0000  0.0018  0.0006  223  ILE B CG2   
2796 C CD1   . ILE B 116 ? 0.0614 0.0659 0.0680 -0.0034 0.0008  0.0001  223  ILE B CD1   
2797 N N     . SER B 117 ? 0.0490 0.0442 0.0432 0.0006  0.0014  -0.0001 224  SER B N     
2798 C CA    . SER B 117 ? 0.0465 0.0431 0.0446 -0.0003 0.0007  -0.0002 224  SER B CA    
2799 C C     . SER B 117 ? 0.0371 0.0352 0.0362 -0.0006 0.0000  -0.0011 224  SER B C     
2800 O O     . SER B 117 ? 0.0287 0.0280 0.0289 0.0025  -0.0016 0.0002  224  SER B O     
2801 C CB    . SER B 117 ? 0.0531 0.0475 0.0523 -0.0012 0.0035  0.0005  224  SER B CB    
2802 O OG    . SER B 117 ? 0.0598 0.0597 0.0675 -0.0017 0.0051  -0.0016 224  SER B OG    
2803 N N     . SER B 118 ? 0.0296 0.0279 0.0262 -0.0010 -0.0015 -0.0005 225  SER B N     
2804 C CA    . SER B 118 ? 0.0288 0.0280 0.0267 -0.0002 -0.0008 -0.0002 225  SER B CA    
2805 C C     . SER B 118 ? 0.0269 0.0271 0.0264 -0.0001 -0.0012 -0.0005 225  SER B C     
2806 O O     . SER B 118 ? 0.0286 0.0283 0.0274 -0.0030 0.0013  -0.0017 225  SER B O     
2807 C CB    . SER B 118 ? 0.0301 0.0261 0.0255 0.0001  0.0000  -0.0003 225  SER B CB    
2808 O OG    . SER B 118 ? 0.0312 0.0313 0.0265 0.0004  -0.0026 0.0002  225  SER B OG    
2809 N N     . ALA B 119 ? 0.0271 0.0284 0.0264 -0.0003 -0.0014 0.0000  226  ALA B N     
2810 C CA    . ALA B 119 ? 0.0294 0.0297 0.0287 0.0002  -0.0010 0.0004  226  ALA B CA    
2811 C C     . ALA B 119 ? 0.0329 0.0311 0.0363 0.0012  0.0008  0.0004  226  ALA B C     
2812 O O     . ALA B 119 ? 0.0358 0.0425 0.0591 0.0058  0.0052  0.0063  226  ALA B O     
2813 C CB    . ALA B 119 ? 0.0296 0.0299 0.0266 0.0005  -0.0021 0.0008  226  ALA B CB    
2814 N N     . GLY B 120 ? 0.0261 0.0289 0.0273 -0.0003 -0.0010 -0.0010 227  GLY B N     
2815 C CA    . GLY B 120 ? 0.0272 0.0284 0.0264 -0.0009 -0.0005 -0.0013 227  GLY B CA    
2816 C C     . GLY B 120 ? 0.0277 0.0281 0.0281 0.0009  0.0000  0.0015  227  GLY B C     
2817 O O     . GLY B 120 ? 0.0371 0.0295 0.0256 0.0019  -0.0017 -0.0007 227  GLY B O     
2818 N N     . GLU B 121 ? 0.0262 0.0288 0.0297 0.0013  -0.0001 0.0005  228  GLU B N     
2819 C CA    . GLU B 121 ? 0.0264 0.0301 0.0288 0.0003  -0.0019 0.0001  228  GLU B CA    
2820 C C     . GLU B 121 ? 0.0323 0.0326 0.0319 -0.0015 0.0008  -0.0004 228  GLU B C     
2821 O O     . GLU B 121 ? 0.0262 0.0328 0.0334 0.0000  -0.0026 0.0026  228  GLU B O     
2822 C CB    . GLU B 121 ? 0.0260 0.0315 0.0294 -0.0010 -0.0013 -0.0009 228  GLU B CB    
2823 C CG    . GLU B 121 ? 0.0326 0.0358 0.0314 0.0016  -0.0047 -0.0003 228  GLU B CG    
2824 C CD    . GLU B 121 ? 0.0499 0.0477 0.0463 -0.0050 -0.0013 0.0000  228  GLU B CD    
2825 O OE1   . GLU B 121 ? 0.0445 0.0415 0.0524 0.0000  0.0017  0.0007  228  GLU B OE1   
2826 O OE2   . GLU B 121 ? 0.0711 0.0655 0.0795 0.0076  0.0046  0.0067  228  GLU B OE2   
2827 N N     . GLY B 122 ? 0.0318 0.0355 0.0316 -0.0027 -0.0024 -0.0027 229  GLY B N     
2828 C CA    . GLY B 122 ? 0.0343 0.0369 0.0365 -0.0016 -0.0004 -0.0019 229  GLY B CA    
2829 C C     . GLY B 122 ? 0.0344 0.0387 0.0381 0.0004  0.0000  0.0015  229  GLY B C     
2830 O O     . GLY B 122 ? 0.0426 0.0427 0.0450 -0.0025 0.0040  0.0000  229  GLY B O     
2831 N N     . LEU B 123 ? 0.0383 0.0404 0.0427 0.0005  0.0031  0.0008  230  LEU B N     
2832 C CA    . LEU B 123 ? 0.0301 0.0346 0.0303 0.0008  -0.0031 0.0015  230  LEU B CA    
2833 C C     . LEU B 123 ? 0.0304 0.0346 0.0362 0.0001  -0.0008 0.0010  230  LEU B C     
2834 O O     . LEU B 123 ? 0.0330 0.0363 0.0330 -0.0035 -0.0008 0.0030  230  LEU B O     
2835 C CB    . LEU B 123 ? 0.0332 0.0368 0.0351 -0.0009 -0.0003 -0.0003 230  LEU B CB    
2836 C CG    . LEU B 123 ? 0.0305 0.0373 0.0324 -0.0020 -0.0024 -0.0008 230  LEU B CG    
2837 C CD1   . LEU B 123 ? 0.0593 0.0461 0.0509 -0.0010 0.0043  -0.0005 230  LEU B CD1   
2838 C CD2   . LEU B 123 ? 0.0317 0.0292 0.0287 0.0022  0.0004  0.0004  230  LEU B CD2   
2839 N N     . PHE B 124 ? 0.0371 0.0361 0.0296 -0.0012 -0.0019 0.0014  231  PHE B N     
2840 C CA    . PHE B 124 ? 0.0385 0.0372 0.0363 -0.0004 -0.0010 0.0001  231  PHE B CA    
2841 C C     . PHE B 124 ? 0.0475 0.0473 0.0411 -0.0024 -0.0003 -0.0018 231  PHE B C     
2842 O O     . PHE B 124 ? 0.0450 0.0427 0.0277 -0.0013 -0.0004 -0.0036 231  PHE B O     
2843 C CB    . PHE B 124 ? 0.0332 0.0348 0.0325 0.0007  -0.0021 -0.0004 231  PHE B CB    
2844 C CG    . PHE B 124 ? 0.0318 0.0317 0.0289 0.0032  -0.0030 0.0018  231  PHE B CG    
2845 C CD1   . PHE B 124 ? 0.0284 0.0286 0.0357 -0.0007 0.0009  -0.0007 231  PHE B CD1   
2846 C CD2   . PHE B 124 ? 0.0257 0.0292 0.0283 0.0008  -0.0010 -0.0029 231  PHE B CD2   
2847 C CE1   . PHE B 124 ? 0.0261 0.0287 0.0265 0.0007  -0.0010 -0.0009 231  PHE B CE1   
2848 C CE2   . PHE B 124 ? 0.0280 0.0291 0.0333 -0.0024 0.0011  -0.0022 231  PHE B CE2   
2849 C CZ    . PHE B 124 ? 0.0262 0.0300 0.0259 0.0017  0.0003  0.0014  231  PHE B CZ    
2850 N N     . SER B 125 ? 0.0612 0.0584 0.0629 -0.0012 0.0027  -0.0014 232  SER B N     
2851 C CA    . SER B 125 ? 0.0710 0.0688 0.0679 -0.0011 0.0017  -0.0008 232  SER B CA    
2852 C C     . SER B 125 ? 0.0726 0.0715 0.0732 0.0001  0.0013  -0.0009 232  SER B C     
2853 O O     . SER B 125 ? 0.0696 0.0678 0.0668 -0.0010 -0.0010 -0.0029 232  SER B O     
2854 C CB    . SER B 125 ? 0.0722 0.0712 0.0760 0.0014  0.0017  0.0014  232  SER B CB    
2855 O OG    A SER B 125 ? 0.0835 0.0817 0.0863 -0.0011 -0.0012 -0.0006 232  SER B OG    
2856 O OG    B SER B 125 ? 0.0795 0.0798 0.0773 -0.0005 0.0004  -0.0014 232  SER B OG    
2857 N N     . LYS B 126 ? 0.0790 0.0760 0.0726 0.0000  0.0010  -0.0009 233  LYS B N     
2858 C CA    . LYS B 126 ? 0.0807 0.0809 0.0816 -0.0001 -0.0005 -0.0006 233  LYS B CA    
2859 C C     . LYS B 126 ? 0.0823 0.0828 0.0821 -0.0010 -0.0002 -0.0009 233  LYS B C     
2860 O O     . LYS B 126 ? 0.0809 0.0813 0.0805 -0.0007 -0.0041 -0.0036 233  LYS B O     
2861 C CB    . LYS B 126 ? 0.0882 0.0848 0.0833 -0.0004 0.0016  0.0000  233  LYS B CB    
2862 C CG    . LYS B 126 ? 0.0906 0.0886 0.0926 0.0006  0.0023  0.0000  233  LYS B CG    
2863 C CD    . LYS B 126 ? 0.0887 0.0899 0.0921 0.0012  -0.0003 0.0010  233  LYS B CD    
2864 C CE    . LYS B 126 ? 0.0912 0.0898 0.0867 -0.0009 -0.0005 -0.0005 233  LYS B CE    
2865 N NZ    . LYS B 126 ? 0.0867 0.0875 0.0797 -0.0010 -0.0043 0.0004  233  LYS B NZ    
2866 N N     . VAL B 127 ? 0.0826 0.0839 0.0818 -0.0009 -0.0025 -0.0008 234  VAL B N     
2867 C CA    . VAL B 127 ? 0.0904 0.0884 0.0902 -0.0001 0.0017  -0.0010 234  VAL B CA    
2868 C C     . VAL B 127 ? 0.0780 0.0806 0.0776 0.0000  -0.0009 -0.0006 234  VAL B C     
2869 O O     . VAL B 127 ? 0.0936 0.0849 0.0804 -0.0030 0.0036  -0.0021 234  VAL B O     
2870 C CB    . VAL B 127 ? 0.0938 0.0946 0.0931 -0.0003 0.0003  0.0003  234  VAL B CB    
2871 C CG1   . VAL B 127 ? 0.1111 0.1053 0.1161 0.0008  0.0044  0.0007  234  VAL B CG1   
2872 C CG2   . VAL B 127 ? 0.1068 0.1050 0.1102 -0.0025 0.0035  -0.0028 234  VAL B CG2   
2873 N N     . ALA B 128 ? 0.0698 0.0718 0.0700 0.0000  -0.0014 0.0015  235  ALA B N     
2874 C CA    . ALA B 128 ? 0.0637 0.0656 0.0636 -0.0004 -0.0005 -0.0008 235  ALA B CA    
2875 C C     . ALA B 128 ? 0.0603 0.0611 0.0581 0.0004  -0.0016 0.0000  235  ALA B C     
2876 O O     . ALA B 128 ? 0.0555 0.0580 0.0530 0.0018  -0.0054 0.0015  235  ALA B O     
2877 C CB    . ALA B 128 ? 0.0661 0.0678 0.0674 0.0000  0.0000  -0.0007 235  ALA B CB    
2878 N N     . VAL B 129 ? 0.0570 0.0588 0.0593 0.0010  0.0003  0.0013  236  VAL B N     
2879 C CA    . VAL B 129 ? 0.0526 0.0525 0.0520 0.0000  -0.0006 0.0000  236  VAL B CA    
2880 C C     . VAL B 129 ? 0.0417 0.0460 0.0417 -0.0006 -0.0029 -0.0015 236  VAL B C     
2881 O O     . VAL B 129 ? 0.0314 0.0397 0.0338 0.0016  -0.0071 -0.0010 236  VAL B O     
2882 C CB    . VAL B 129 ? 0.0528 0.0546 0.0540 0.0000  -0.0001 0.0003  236  VAL B CB    
2883 C CG1   . VAL B 129 ? 0.0681 0.0602 0.0638 0.0021  0.0022  0.0027  236  VAL B CG1   
2884 C CG2   . VAL B 129 ? 0.0434 0.0493 0.0493 -0.0005 -0.0031 -0.0002 236  VAL B CG2   
2885 N N     . GLY B 130 ? 0.0425 0.0431 0.0390 -0.0017 -0.0023 -0.0025 237  GLY B N     
2886 C CA    . GLY B 130 ? 0.0404 0.0426 0.0411 -0.0013 -0.0013 -0.0015 237  GLY B CA    
2887 C C     . GLY B 130 ? 0.0426 0.0424 0.0449 -0.0014 -0.0002 -0.0016 237  GLY B C     
2888 O O     . GLY B 130 ? 0.0451 0.0408 0.0446 -0.0039 -0.0006 -0.0043 237  GLY B O     
2889 N N     . PRO B 131 ? 0.0422 0.0450 0.0449 -0.0008 -0.0020 -0.0019 238  PRO B N     
2890 C CA    . PRO B 131 ? 0.0449 0.0460 0.0480 0.0001  -0.0009 -0.0001 238  PRO B CA    
2891 C C     . PRO B 131 ? 0.0463 0.0465 0.0495 0.0001  -0.0004 0.0006  238  PRO B C     
2892 O O     . PRO B 131 ? 0.0432 0.0440 0.0475 -0.0010 -0.0020 -0.0008 238  PRO B O     
2893 C CB    . PRO B 131 ? 0.0445 0.0453 0.0493 -0.0007 -0.0017 -0.0010 238  PRO B CB    
2894 C CG    . PRO B 131 ? 0.0486 0.0477 0.0455 -0.0009 0.0000  -0.0013 238  PRO B CG    
2895 C CD    . PRO B 131 ? 0.0423 0.0469 0.0521 0.0002  -0.0007 0.0000  238  PRO B CD    
2896 N N     . ASN B 132 ? 0.0541 0.0514 0.0508 0.0009  -0.0003 0.0009  239  ASN B N     
2897 C CA    . ASN B 132 ? 0.0587 0.0570 0.0569 0.0000  -0.0008 0.0015  239  ASN B CA    
2898 C C     . ASN B 132 ? 0.0485 0.0488 0.0507 0.0005  0.0010  0.0006  239  ASN B C     
2899 O O     . ASN B 132 ? 0.0456 0.0489 0.0540 0.0019  0.0010  0.0021  239  ASN B O     
2900 C CB    . ASN B 132 ? 0.0694 0.0661 0.0681 0.0034  0.0016  0.0018  239  ASN B CB    
2901 C CG    . ASN B 132 ? 0.1028 0.1071 0.1139 -0.0062 0.0001  0.0006  239  ASN B CG    
2902 O OD1   . ASN B 132 ? 0.1599 0.1459 0.1543 -0.0037 0.0059  -0.0094 239  ASN B OD1   
2903 N ND2   . ASN B 132 ? 0.1426 0.1434 0.1527 -0.0003 0.0129  -0.0064 239  ASN B ND2   
2904 N N     . THR B 133 ? 0.0405 0.0388 0.0388 0.0000  -0.0007 0.0016  240  THR B N     
2905 C CA    . THR B 133 ? 0.0373 0.0360 0.0356 0.0002  0.0006  0.0004  240  THR B CA    
2906 C C     . THR B 133 ? 0.0324 0.0324 0.0320 -0.0003 -0.0013 0.0009  240  THR B C     
2907 O O     . THR B 133 ? 0.0400 0.0297 0.0256 -0.0006 -0.0021 0.0004  240  THR B O     
2908 C CB    . THR B 133 ? 0.0366 0.0342 0.0341 -0.0003 0.0004  0.0001  240  THR B CB    
2909 O OG1   . THR B 133 ? 0.0365 0.0336 0.0272 0.0008  0.0032  0.0031  240  THR B OG1   
2910 C CG2   . THR B 133 ? 0.0433 0.0379 0.0377 0.0003  0.0008  0.0016  240  THR B CG2   
2911 N N     . VAL B 134 ? 0.0276 0.0317 0.0294 0.0002  -0.0027 0.0010  241  VAL B N     
2912 C CA    . VAL B 134 ? 0.0279 0.0310 0.0264 -0.0001 -0.0016 0.0002  241  VAL B CA    
2913 C C     . VAL B 134 ? 0.0319 0.0323 0.0293 0.0012  -0.0004 0.0011  241  VAL B C     
2914 O O     . VAL B 134 ? 0.0262 0.0365 0.0275 -0.0009 -0.0013 0.0020  241  VAL B O     
2915 C CB    . VAL B 134 ? 0.0326 0.0306 0.0260 0.0017  -0.0005 0.0017  241  VAL B CB    
2916 C CG1   . VAL B 134 ? 0.0339 0.0294 0.0340 0.0004  -0.0002 0.0008  241  VAL B CG1   
2917 C CG2   . VAL B 134 ? 0.0271 0.0291 0.0288 -0.0014 -0.0017 -0.0007 241  VAL B CG2   
2918 N N     . MET B 135 ? 0.0318 0.0325 0.0269 0.0015  -0.0016 0.0019  242  MET B N     
2919 C CA    . MET B 135 ? 0.0374 0.0379 0.0356 -0.0006 -0.0008 -0.0001 242  MET B CA    
2920 C C     . MET B 135 ? 0.0346 0.0358 0.0323 -0.0008 -0.0017 -0.0009 242  MET B C     
2921 O O     . MET B 135 ? 0.0320 0.0367 0.0348 -0.0039 -0.0039 -0.0035 242  MET B O     
2922 C CB    . MET B 135 ? 0.0409 0.0426 0.0421 0.0000  0.0006  0.0020  242  MET B CB    
2923 C CG    . MET B 135 ? 0.0553 0.0550 0.0699 0.0014  0.0032  -0.0010 242  MET B CG    
2924 S SD    . MET B 135 ? 0.1027 0.0888 0.0970 -0.0048 0.0040  -0.0122 242  MET B SD    
2925 C CE    . MET B 135 ? 0.0961 0.0892 0.0930 -0.0025 -0.0001 -0.0062 242  MET B CE    
2926 N N     . SER B 136 ? 0.0317 0.0331 0.0301 -0.0009 -0.0029 -0.0018 243  SER B N     
2927 C CA    . SER B 136 ? 0.0316 0.0323 0.0314 -0.0023 -0.0021 -0.0022 243  SER B CA    
2928 C C     . SER B 136 ? 0.0277 0.0305 0.0294 -0.0005 -0.0026 -0.0020 243  SER B C     
2929 O O     . SER B 136 ? 0.0347 0.0307 0.0282 -0.0022 -0.0034 -0.0020 243  SER B O     
2930 C CB    . SER B 136 ? 0.0305 0.0350 0.0373 -0.0035 0.0000  -0.0037 243  SER B CB    
2931 O OG    . SER B 136 ? 0.0283 0.0356 0.0457 0.0010  -0.0005 -0.0051 243  SER B OG    
2932 N N     . PHE B 137 ? 0.0274 0.0289 0.0288 0.0001  -0.0027 -0.0004 244  PHE B N     
2933 C CA    . PHE B 137 ? 0.0273 0.0296 0.0302 -0.0006 -0.0014 -0.0001 244  PHE B CA    
2934 C C     . PHE B 137 ? 0.0302 0.0314 0.0352 0.0002  -0.0001 -0.0016 244  PHE B C     
2935 O O     . PHE B 137 ? 0.0389 0.0409 0.0480 -0.0024 0.0043  -0.0043 244  PHE B O     
2936 C CB    . PHE B 137 ? 0.0264 0.0279 0.0302 0.0002  -0.0023 -0.0005 244  PHE B CB    
2937 C CG    . PHE B 137 ? 0.0336 0.0284 0.0292 0.0013  0.0022  0.0014  244  PHE B CG    
2938 C CD1   . PHE B 137 ? 0.0261 0.0266 0.0285 0.0005  -0.0016 -0.0007 244  PHE B CD1   
2939 C CD2   . PHE B 137 ? 0.0257 0.0282 0.0266 -0.0010 -0.0007 0.0018  244  PHE B CD2   
2940 C CE1   . PHE B 137 ? 0.0326 0.0260 0.0350 0.0012  0.0030  0.0026  244  PHE B CE1   
2941 C CE2   . PHE B 137 ? 0.0363 0.0291 0.0329 0.0014  0.0025  0.0006  244  PHE B CE2   
2942 C CZ    . PHE B 137 ? 0.0258 0.0291 0.0325 -0.0013 0.0001  -0.0011 244  PHE B CZ    
2943 N N     . TYR B 138 ? 0.0317 0.0317 0.0331 -0.0008 -0.0003 -0.0017 245  TYR B N     
2944 C CA    . TYR B 138 ? 0.0327 0.0322 0.0310 0.0005  -0.0003 0.0006  245  TYR B CA    
2945 C C     . TYR B 138 ? 0.0329 0.0321 0.0286 -0.0002 -0.0011 -0.0009 245  TYR B C     
2946 O O     . TYR B 138 ? 0.0428 0.0387 0.0428 0.0010  0.0035  0.0005  245  TYR B O     
2947 C CB    . TYR B 138 ? 0.0344 0.0334 0.0348 0.0011  0.0015  0.0001  245  TYR B CB    
2948 C CG    . TYR B 138 ? 0.0304 0.0285 0.0275 0.0012  -0.0025 0.0009  245  TYR B CG    
2949 C CD1   . TYR B 138 ? 0.0287 0.0348 0.0330 0.0028  -0.0004 0.0029  245  TYR B CD1   
2950 C CD2   . TYR B 138 ? 0.0381 0.0327 0.0383 0.0025  0.0025  0.0011  245  TYR B CD2   
2951 C CE1   . TYR B 138 ? 0.0278 0.0318 0.0400 0.0029  0.0030  -0.0021 245  TYR B CE1   
2952 C CE2   . TYR B 138 ? 0.0326 0.0341 0.0335 0.0030  -0.0002 0.0002  245  TYR B CE2   
2953 C CZ    . TYR B 138 ? 0.0277 0.0329 0.0304 0.0029  -0.0024 0.0002  245  TYR B CZ    
2954 O OH    . TYR B 138 ? 0.0428 0.0384 0.0426 0.0093  0.0045  0.0085  245  TYR B OH    
2955 N N     . ASN B 139 ? 0.0339 0.0331 0.0261 -0.0008 -0.0016 -0.0017 246  ASN B N     
2956 C CA    . ASN B 139 ? 0.0363 0.0333 0.0357 -0.0002 0.0018  0.0005  246  ASN B CA    
2957 C C     . ASN B 139 ? 0.0343 0.0319 0.0298 -0.0012 0.0002  0.0006  246  ASN B C     
2958 O O     . ASN B 139 ? 0.0383 0.0390 0.0408 -0.0046 0.0040  -0.0002 246  ASN B O     
2959 C CB    . ASN B 139 ? 0.0304 0.0332 0.0289 0.0000  -0.0032 -0.0009 246  ASN B CB    
2960 C CG    . ASN B 139 ? 0.0341 0.0328 0.0369 -0.0009 0.0012  0.0006  246  ASN B CG    
2961 O OD1   . ASN B 139 ? 0.0327 0.0316 0.0267 0.0015  -0.0001 0.0015  246  ASN B OD1   
2962 N ND2   . ASN B 139 ? 0.0449 0.0351 0.0403 0.0001  -0.0007 -0.0024 246  ASN B ND2   
2963 N N     . GLY B 140 ? 0.0276 0.0289 0.0317 -0.0004 0.0010  0.0013  247  GLY B N     
2964 C CA    . GLY B 140 ? 0.0257 0.0258 0.0262 -0.0004 -0.0006 0.0006  247  GLY B CA    
2965 C C     . GLY B 140 ? 0.0254 0.0267 0.0268 -0.0003 -0.0003 0.0014  247  GLY B C     
2966 O O     . GLY B 140 ? 0.0312 0.0309 0.0278 -0.0006 0.0010  0.0020  247  GLY B O     
2967 N N     . VAL B 141 ? 0.0254 0.0253 0.0254 0.0000  -0.0001 0.0000  248  VAL B N     
2968 C CA    . VAL B 141 ? 0.0269 0.0264 0.0260 -0.0009 -0.0008 0.0008  248  VAL B CA    
2969 C C     . VAL B 141 ? 0.0295 0.0296 0.0307 -0.0013 -0.0013 -0.0010 248  VAL B C     
2970 O O     . VAL B 141 ? 0.0286 0.0294 0.0328 -0.0017 -0.0010 -0.0011 248  VAL B O     
2971 C CB    . VAL B 141 ? 0.0261 0.0271 0.0290 -0.0008 -0.0007 -0.0007 248  VAL B CB    
2972 C CG1   . VAL B 141 ? 0.0330 0.0296 0.0258 0.0020  -0.0005 0.0011  248  VAL B CG1   
2973 C CG2   . VAL B 141 ? 0.0254 0.0260 0.0260 -0.0002 -0.0002 0.0007  248  VAL B CG2   
2974 N N     . ARG B 142 ? 0.0300 0.0345 0.0367 -0.0004 -0.0004 0.0000  249  ARG B N     
2975 C CA    . ARG B 142 ? 0.0366 0.0377 0.0375 0.0010  0.0000  -0.0006 249  ARG B CA    
2976 C C     . ARG B 142 ? 0.0274 0.0361 0.0345 -0.0005 -0.0031 -0.0011 249  ARG B C     
2977 O O     . ARG B 142 ? 0.0255 0.0380 0.0310 0.0006  -0.0012 -0.0018 249  ARG B O     
2978 C CB    . ARG B 142 ? 0.0363 0.0384 0.0421 0.0007  0.0000  0.0012  249  ARG B CB    
2979 C CG    . ARG B 142 ? 0.0481 0.0476 0.0463 0.0016  -0.0001 -0.0002 249  ARG B CG    
2980 C CD    . ARG B 142 ? 0.0572 0.0512 0.0549 0.0002  0.0040  0.0007  249  ARG B CD    
2981 N NE    . ARG B 142 ? 0.0423 0.0498 0.0513 0.0021  -0.0046 0.0029  249  ARG B NE    
2982 C CZ    . ARG B 142 ? 0.0544 0.0527 0.0539 0.0002  -0.0006 -0.0009 249  ARG B CZ    
2983 N NH1   . ARG B 142 ? 0.0580 0.0584 0.0625 0.0030  -0.0009 0.0012  249  ARG B NH1   
2984 N NH2   . ARG B 142 ? 0.0540 0.0538 0.0467 0.0023  -0.0039 0.0007  249  ARG B NH2   
2985 N N     . ILE B 143 ? 0.0281 0.0369 0.0323 -0.0009 -0.0041 -0.0014 250  ILE B N     
2986 C CA    . ILE B 143 ? 0.0436 0.0439 0.0412 0.0008  -0.0002 0.0007  250  ILE B CA    
2987 C C     . ILE B 143 ? 0.0348 0.0423 0.0369 -0.0003 -0.0034 -0.0003 250  ILE B C     
2988 O O     . ILE B 143 ? 0.0365 0.0447 0.0438 0.0018  -0.0037 0.0016  250  ILE B O     
2989 C CB    . ILE B 143 ? 0.0410 0.0496 0.0440 0.0017  -0.0015 0.0001  250  ILE B CB    
2990 C CG1   . ILE B 143 ? 0.0629 0.0579 0.0645 -0.0001 0.0019  0.0011  250  ILE B CG1   
2991 C CG2   . ILE B 143 ? 0.0649 0.0548 0.0600 0.0029  0.0047  0.0009  250  ILE B CG2   
2992 C CD1   . ILE B 143 ? 0.0704 0.0750 0.0806 -0.0004 0.0046  0.0008  250  ILE B CD1   
2993 N N     . THR B 144 ? 0.0443 0.0420 0.0385 0.0009  0.0000  0.0007  251  THR B N     
2994 C CA    . THR B 144 ? 0.0396 0.0402 0.0383 0.0008  -0.0001 -0.0003 251  THR B CA    
2995 C C     . THR B 144 ? 0.0380 0.0389 0.0370 0.0011  -0.0011 -0.0001 251  THR B C     
2996 O O     . THR B 144 ? 0.0406 0.0368 0.0387 0.0031  -0.0013 0.0014  251  THR B O     
2997 C CB    . THR B 144 ? 0.0406 0.0428 0.0417 0.0021  0.0001  0.0005  251  THR B CB    
2998 O OG1   . THR B 144 ? 0.0477 0.0414 0.0355 0.0018  0.0018  0.0022  251  THR B OG1   
2999 C CG2   . THR B 144 ? 0.0486 0.0457 0.0548 0.0005  0.0049  0.0008  251  THR B CG2   
3000 N N     . HIS B 145 ? 0.0321 0.0370 0.0311 0.0008  -0.0024 -0.0019 252  HIS B N     
3001 C CA    . HIS B 145 ? 0.0314 0.0369 0.0332 -0.0009 -0.0039 -0.0013 252  HIS B CA    
3002 C C     . HIS B 145 ? 0.0405 0.0422 0.0393 0.0005  -0.0002 -0.0012 252  HIS B C     
3003 O O     . HIS B 145 ? 0.0358 0.0377 0.0289 -0.0008 -0.0033 -0.0038 252  HIS B O     
3004 C CB    . HIS B 145 ? 0.0388 0.0390 0.0364 -0.0004 -0.0017 -0.0015 252  HIS B CB    
3005 C CG    . HIS B 145 ? 0.0441 0.0497 0.0474 0.0015  -0.0043 -0.0029 252  HIS B CG    
3006 N ND1   . HIS B 145 ? 0.0753 0.0636 0.0708 -0.0060 0.0054  -0.0039 252  HIS B ND1   
3007 C CD2   . HIS B 145 ? 0.0617 0.0646 0.0634 -0.0007 0.0046  -0.0029 252  HIS B CD2   
3008 C CE1   . HIS B 145 ? 0.0891 0.0740 0.0734 -0.0016 0.0045  -0.0028 252  HIS B CE1   
3009 N NE2   . HIS B 145 ? 0.0771 0.0711 0.0732 -0.0016 0.0018  -0.0040 252  HIS B NE2   
3010 N N     . GLN B 146 ? 0.0474 0.0486 0.0496 -0.0005 -0.0014 0.0000  253  GLN B N     
3011 C CA    . GLN B 146 ? 0.0591 0.0594 0.0578 0.0000  -0.0007 -0.0002 253  GLN B CA    
3012 C C     . GLN B 146 ? 0.0682 0.0684 0.0684 0.0000  0.0007  -0.0010 253  GLN B C     
3013 O O     . GLN B 146 ? 0.0586 0.0632 0.0587 0.0025  -0.0035 0.0002  253  GLN B O     
3014 C CB    . GLN B 146 ? 0.0613 0.0603 0.0616 0.0002  0.0007  0.0005  253  GLN B CB    
3015 C CG    . GLN B 146 ? 0.0621 0.0662 0.0702 0.0003  -0.0005 -0.0027 253  GLN B CG    
3016 C CD    . GLN B 146 ? 0.0768 0.0723 0.0780 -0.0026 0.0013  -0.0009 253  GLN B CD    
3017 O OE1   . GLN B 146 ? 0.0877 0.0847 0.0905 -0.0007 0.0069  0.0024  253  GLN B OE1   
3018 N NE2   . GLN B 146 ? 0.0646 0.0689 0.0770 -0.0047 -0.0013 -0.0020 253  GLN B NE2   
3019 N N     . GLU B 147 ? 0.0820 0.0829 0.0801 -0.0001 -0.0020 0.0016  254  GLU B N     
3020 C CA    . GLU B 147 ? 0.0973 0.0988 0.0992 0.0005  0.0006  -0.0003 254  GLU B CA    
3021 C C     . GLU B 147 ? 0.1019 0.1029 0.1060 -0.0003 0.0007  0.0002  254  GLU B C     
3022 O O     . GLU B 147 ? 0.1058 0.1019 0.1026 -0.0006 0.0006  -0.0024 254  GLU B O     
3023 C CB    . GLU B 147 ? 0.1053 0.1057 0.1052 -0.0015 -0.0010 0.0009  254  GLU B CB    
3024 C CG    . GLU B 147 ? 0.1263 0.1372 0.1342 0.0023  0.0000  -0.0034 254  GLU B CG    
3025 C CD    . GLU B 147 ? 0.1806 0.1688 0.1740 0.0040  0.0014  0.0071  254  GLU B CD    
3026 O OE1   . GLU B 147 ? 0.2015 0.1967 0.2010 -0.0058 0.0066  0.0031  254  GLU B OE1   
3027 O OE2   . GLU B 147 ? 0.1782 0.1905 0.1894 0.0001  -0.0028 -0.0007 254  GLU B OE2   
3028 N N     . VAL B 148 ? 0.1069 0.1077 0.1038 0.0010  -0.0026 0.0007  255  VAL B N     
3029 C CA    . VAL B 148 ? 0.1111 0.1175 0.1157 0.0003  -0.0031 0.0004  255  VAL B CA    
3030 C C     . VAL B 148 ? 0.1260 0.1292 0.1297 -0.0006 0.0008  0.0006  255  VAL B C     
3031 O O     . VAL B 148 ? 0.1145 0.1290 0.1290 0.0026  -0.0017 0.0002  255  VAL B O     
3032 C CB    . VAL B 148 ? 0.1153 0.1179 0.1184 -0.0005 0.0003  -0.0005 255  VAL B CB    
3033 C CG1   . VAL B 148 ? 0.1281 0.1196 0.1246 -0.0039 0.0039  -0.0036 255  VAL B CG1   
3034 C CG2   . VAL B 148 ? 0.1167 0.1172 0.1166 0.0000  -0.0024 -0.0007 255  VAL B CG2   
3035 N N     . ASP B 149 ? 0.1348 0.1474 0.1421 0.0028  -0.0050 0.0019  256  ASP B N     
3036 C CA    . ASP B 149 ? 0.1589 0.1621 0.1629 0.0013  -0.0006 0.0029  256  ASP B CA    
3037 C C     . ASP B 149 ? 0.1780 0.1817 0.1763 0.0029  0.0004  0.0015  256  ASP B C     
3038 O O     . ASP B 149 ? 0.1873 0.1863 0.1881 0.0029  0.0034  0.0031  256  ASP B O     
3039 C CB    . ASP B 149 ? 0.1572 0.1630 0.1576 0.0030  -0.0020 0.0045  256  ASP B CB    
3040 C CG    . ASP B 149 ? 0.1582 0.1591 0.1635 0.0036  0.0005  0.0000  256  ASP B CG    
3041 O OD1   . ASP B 149 ? 0.1746 0.1902 0.2014 -0.0012 -0.0047 0.0042  256  ASP B OD1   
3042 O OD2   . ASP B 149 ? 0.1365 0.1442 0.1343 -0.0008 -0.0154 0.0033  256  ASP B OD2   
3043 N N     . SER B 150 ? 0.1948 0.1954 0.1954 0.0002  -0.0012 0.0009  257  SER B N     
3044 C CA    . SER B 150 ? 0.2127 0.2123 0.2131 0.0007  0.0021  -0.0008 257  SER B CA    
3045 C C     . SER B 150 ? 0.2159 0.2192 0.2202 0.0015  0.0005  -0.0003 257  SER B C     
3046 O O     . SER B 150 ? 0.2202 0.2214 0.2277 0.0037  0.0026  0.0004  257  SER B O     
3047 C CB    . SER B 150 ? 0.2157 0.2166 0.2129 0.0001  0.0004  -0.0015 257  SER B CB    
3048 O OG    . SER B 150 ? 0.2392 0.2274 0.2384 0.0034  0.0065  0.0027  257  SER B OG    
3049 N N     . ARG B 151 ? 0.2269 0.2261 0.2266 0.0005  0.0024  -0.0003 258  ARG B N     
3050 C CA    . ARG B 151 ? 0.2232 0.2236 0.2202 0.0016  -0.0004 0.0015  258  ARG B CA    
3051 C C     . ARG B 151 ? 0.2322 0.2277 0.2273 0.0018  0.0026  0.0022  258  ARG B C     
3052 O O     . ARG B 151 ? 0.2449 0.2312 0.2285 0.0045  0.0054  0.0030  258  ARG B O     
3053 C CB    . ARG B 151 ? 0.2237 0.2230 0.2235 0.0015  0.0044  0.0012  258  ARG B CB    
3054 C CG    . ARG B 151 ? 0.2081 0.1995 0.1998 0.0017  -0.0014 0.0045  258  ARG B CG    
3055 C CD    . ARG B 151 ? 0.1695 0.1729 0.1681 -0.0025 -0.0029 -0.0084 258  ARG B CD    
3056 N NE    . ARG B 151 ? 0.1511 0.1454 0.1505 0.0025  -0.0015 0.0040  258  ARG B NE    
3057 C CZ    . ARG B 151 ? 0.1346 0.1309 0.1328 -0.0057 -0.0008 -0.0073 258  ARG B CZ    
3058 N NH1   . ARG B 151 ? 0.1248 0.1304 0.1237 -0.0011 -0.0028 -0.0024 258  ARG B NH1   
3059 N NH2   . ARG B 151 ? 0.1344 0.1334 0.1282 0.0054  0.0008  0.0034  258  ARG B NH2   
3060 N N     . ASP B 152 ? 0.2271 0.2291 0.2261 0.0012  -0.0010 0.0011  259  ASP B N     
3061 C CA    . ASP B 152 ? 0.2323 0.2301 0.2294 0.0000  0.0000  0.0001  259  ASP B CA    
3062 C C     . ASP B 152 ? 0.2236 0.2243 0.2236 -0.0005 -0.0006 -0.0002 259  ASP B C     
3063 O O     . ASP B 152 ? 0.2215 0.2247 0.2255 0.0010  -0.0027 0.0013  259  ASP B O     
3064 C CB    . ASP B 152 ? 0.2361 0.2369 0.2326 -0.0005 0.0009  0.0000  259  ASP B CB    
3065 C CG    . ASP B 152 ? 0.2624 0.2491 0.2584 0.0013  0.0032  0.0000  259  ASP B CG    
3066 O OD1   . ASP B 152 ? 0.2716 0.2694 0.2723 -0.0017 0.0066  0.0017  259  ASP B OD1   
3067 O OD2   . ASP B 152 ? 0.2654 0.2746 0.2767 0.0067  0.0055  0.0034  259  ASP B OD2   
3068 N N     . TRP B 153 ? 0.2183 0.2213 0.2192 0.0000  -0.0004 -0.0009 260  TRP B N     
3069 C CA    . TRP B 153 ? 0.2151 0.2147 0.2126 0.0000  0.0002  -0.0006 260  TRP B CA    
3070 C C     . TRP B 153 ? 0.2017 0.2012 0.2005 0.0000  0.0020  -0.0010 260  TRP B C     
3071 O O     . TRP B 153 ? 0.2123 0.2072 0.1992 -0.0016 0.0034  -0.0007 260  TRP B O     
3072 C CB    . TRP B 153 ? 0.2244 0.2201 0.2213 -0.0006 0.0031  0.0005  260  TRP B CB    
3073 C CG    . TRP B 153 ? 0.2291 0.2331 0.2342 0.0000  -0.0008 0.0000  260  TRP B CG    
3074 C CD1   . TRP B 153 ? 0.2469 0.2454 0.2459 -0.0002 0.0000  0.0028  260  TRP B CD1   
3075 C CD2   . TRP B 153 ? 0.2459 0.2426 0.2424 -0.0013 0.0022  -0.0024 260  TRP B CD2   
3076 N NE1   . TRP B 153 ? 0.2596 0.2524 0.2561 0.0000  0.0058  -0.0007 260  TRP B NE1   
3077 C CE2   . TRP B 153 ? 0.2508 0.2468 0.2510 -0.0010 0.0008  -0.0007 260  TRP B CE2   
3078 C CE3   . TRP B 153 ? 0.2513 0.2443 0.2458 -0.0002 0.0012  -0.0002 260  TRP B CE3   
3079 C CZ2   . TRP B 153 ? 0.2573 0.2506 0.2522 -0.0006 0.0027  -0.0015 260  TRP B CZ2   
3080 C CZ3   . TRP B 153 ? 0.2508 0.2470 0.2490 0.0000  0.0024  -0.0002 260  TRP B CZ3   
3081 C CH2   . TRP B 153 ? 0.2485 0.2473 0.2489 -0.0006 -0.0010 0.0000  260  TRP B CH2   
3082 N N     . ALA B 154 ? 0.1835 0.1829 0.1823 -0.0004 -0.0010 0.0006  261  ALA B N     
3083 C CA    . ALA B 154 ? 0.1688 0.1669 0.1680 -0.0014 0.0016  0.0000  261  ALA B CA    
3084 C C     . ALA B 154 ? 0.1443 0.1483 0.1486 -0.0007 -0.0004 -0.0016 261  ALA B C     
3085 O O     . ALA B 154 ? 0.1515 0.1544 0.1554 -0.0018 0.0015  0.0008  261  ALA B O     
3086 C CB    . ALA B 154 ? 0.1738 0.1722 0.1758 -0.0001 0.0041  -0.0008 261  ALA B CB    
3087 N N     . LEU B 155 ? 0.1254 0.1211 0.1235 0.0013  0.0028  0.0020  262  LEU B N     
3088 C CA    . LEU B 155 ? 0.0980 0.0996 0.1009 0.0005  0.0000  -0.0012 262  LEU B CA    
3089 C C     . LEU B 155 ? 0.0808 0.0834 0.0866 -0.0001 -0.0025 0.0006  262  LEU B C     
3090 O O     . LEU B 155 ? 0.0701 0.0767 0.0745 0.0007  -0.0049 -0.0006 262  LEU B O     
3091 C CB    . LEU B 155 ? 0.0857 0.0946 0.0880 0.0032  -0.0049 -0.0013 262  LEU B CB    
3092 C CG    . LEU B 155 ? 0.0794 0.0857 0.0873 0.0002  -0.0031 0.0003  262  LEU B CG    
3093 C CD1   . LEU B 155 ? 0.0781 0.0796 0.0753 0.0013  -0.0010 0.0003  262  LEU B CD1   
3094 C CD2   . LEU B 155 ? 0.0766 0.0823 0.0771 0.0009  -0.0013 -0.0003 262  LEU B CD2   
3095 N N     . ASN B 156 ? 0.0679 0.0737 0.0752 -0.0014 -0.0019 -0.0011 263  ASN B N     
3096 C CA    . ASN B 156 ? 0.0626 0.0648 0.0664 -0.0002 -0.0016 0.0000  263  ASN B CA    
3097 C C     . ASN B 156 ? 0.0546 0.0613 0.0649 0.0000  -0.0028 -0.0004 263  ASN B C     
3098 O O     . ASN B 156 ? 0.0458 0.0630 0.0663 -0.0027 -0.0049 -0.0032 263  ASN B O     
3099 C CB    . ASN B 156 ? 0.0560 0.0615 0.0667 -0.0005 -0.0016 -0.0011 263  ASN B CB    
3100 C CG    . ASN B 156 ? 0.0571 0.0555 0.0576 -0.0014 -0.0019 0.0000  263  ASN B CG    
3101 O OD1   . ASN B 156 ? 0.0340 0.0452 0.0473 -0.0038 -0.0063 0.0008  263  ASN B OD1   
3102 N ND2   . ASN B 156 ? 0.0567 0.0675 0.0843 0.0034  0.0010  0.0025  263  ASN B ND2   
3103 N N     . GLY B 157 ? 0.0520 0.0572 0.0629 0.0014  -0.0018 0.0007  264  GLY B N     
3104 C CA    . GLY B 157 ? 0.0570 0.0579 0.0586 0.0006  0.0000  -0.0001 264  GLY B CA    
3105 C C     . GLY B 157 ? 0.0529 0.0549 0.0565 0.0013  -0.0004 0.0003  264  GLY B C     
3106 O O     . GLY B 157 ? 0.0388 0.0537 0.0473 -0.0006 -0.0089 0.0000  264  GLY B O     
3107 N N     . ASN B 158 ? 0.0498 0.0555 0.0566 0.0006  -0.0006 0.0010  265  ASN B N     
3108 C CA    . ASN B 158 ? 0.0545 0.0581 0.0557 0.0001  -0.0012 -0.0007 265  ASN B CA    
3109 C C     . ASN B 158 ? 0.0597 0.0595 0.0590 0.0003  0.0016  0.0000  265  ASN B C     
3110 O O     . ASN B 158 ? 0.0678 0.0648 0.0663 0.0001  0.0047  -0.0001 265  ASN B O     
3111 C CB    . ASN B 158 ? 0.0575 0.0574 0.0582 0.0011  -0.0002 0.0007  265  ASN B CB    
3112 C CG    . ASN B 158 ? 0.0612 0.0683 0.0718 0.0006  -0.0003 0.0016  265  ASN B CG    
3113 O OD1   . ASN B 158 ? 0.0685 0.0775 0.0817 -0.0003 -0.0032 -0.0003 265  ASN B OD1   
3114 N ND2   . ASN B 158 ? 0.0573 0.0680 0.0599 0.0048  -0.0043 0.0055  265  ASN B ND2   
3115 N N     . THR B 159 ? 0.0533 0.0571 0.0589 -0.0007 -0.0017 -0.0003 266  THR B N     
3116 C CA    . THR B 159 ? 0.0559 0.0588 0.0568 -0.0006 -0.0009 -0.0004 266  THR B CA    
3117 C C     . THR B 159 ? 0.0611 0.0602 0.0589 0.0004  -0.0001 0.0005  266  THR B C     
3118 O O     . THR B 159 ? 0.0681 0.0657 0.0587 0.0016  0.0013  0.0021  266  THR B O     
3119 C CB    . THR B 159 ? 0.0555 0.0579 0.0545 -0.0001 -0.0013 0.0002  266  THR B CB    
3120 O OG1   . THR B 159 ? 0.0359 0.0567 0.0482 -0.0019 -0.0079 0.0007  266  THR B OG1   
3121 C CG2   . THR B 159 ? 0.0658 0.0630 0.0613 -0.0004 0.0007  -0.0020 266  THR B CG2   
3122 N N     . LEU B 160 ? 0.0552 0.0574 0.0607 -0.0003 -0.0007 0.0006  267  LEU B N     
3123 C CA    . LEU B 160 ? 0.0587 0.0612 0.0636 -0.0002 0.0003  0.0010  267  LEU B CA    
3124 C C     . LEU B 160 ? 0.0562 0.0595 0.0613 -0.0011 0.0000  -0.0008 267  LEU B C     
3125 O O     . LEU B 160 ? 0.0536 0.0574 0.0539 0.0016  0.0011  0.0008  267  LEU B O     
3126 C CB    . LEU B 160 ? 0.0587 0.0626 0.0657 -0.0002 -0.0006 0.0000  267  LEU B CB    
3127 C CG    . LEU B 160 ? 0.0696 0.0713 0.0720 0.0006  0.0013  -0.0013 267  LEU B CG    
3128 C CD1   . LEU B 160 ? 0.0880 0.0775 0.0746 -0.0021 0.0037  -0.0014 267  LEU B CD1   
3129 C CD2   . LEU B 160 ? 0.0789 0.0857 0.0850 0.0000  0.0016  0.0002  267  LEU B CD2   
3130 N N     . SER B 161 ? 0.0601 0.0616 0.0597 0.0001  -0.0019 -0.0007 268  SER B N     
3131 C CA    . SER B 161 ? 0.0638 0.0661 0.0648 -0.0008 -0.0018 -0.0009 268  SER B CA    
3132 C C     . SER B 161 ? 0.0690 0.0725 0.0701 0.0005  -0.0017 -0.0001 268  SER B C     
3133 O O     . SER B 161 ? 0.0729 0.0726 0.0652 -0.0016 -0.0009 -0.0024 268  SER B O     
3134 C CB    . SER B 161 ? 0.0671 0.0672 0.0708 0.0001  -0.0001 -0.0009 268  SER B CB    
3135 O OG    . SER B 161 ? 0.0751 0.0720 0.0884 -0.0006 -0.0009 -0.0031 268  SER B OG    
3136 N N     . LEU B 162 ? 0.0757 0.0780 0.0770 0.0000  -0.0037 0.0002  269  LEU B N     
3137 C CA    . LEU B 162 ? 0.0855 0.0884 0.0858 0.0000  -0.0019 -0.0002 269  LEU B CA    
3138 C C     . LEU B 162 ? 0.0955 0.0944 0.0956 0.0007  0.0014  -0.0006 269  LEU B C     
3139 O O     . LEU B 162 ? 0.0978 0.0938 0.0957 0.0011  0.0029  -0.0007 269  LEU B O     
3140 C CB    . LEU B 162 ? 0.0885 0.0904 0.0876 0.0001  -0.0037 -0.0012 269  LEU B CB    
3141 C CG    . LEU B 162 ? 0.1121 0.1072 0.1086 0.0000  0.0053  0.0016  269  LEU B CG    
3142 C CD1   . LEU B 162 ? 0.1082 0.1148 0.1100 -0.0044 -0.0001 -0.0046 269  LEU B CD1   
3143 C CD2   . LEU B 162 ? 0.1113 0.1101 0.1080 -0.0006 0.0005  -0.0030 269  LEU B CD2   
3144 N N     . ASP B 163 ? 0.0951 0.1004 0.0987 0.0000  -0.0024 -0.0009 270  ASP B N     
3145 C CA    . ASP B 163 ? 0.1053 0.1084 0.1086 0.0017  0.0000  -0.0003 270  ASP B CA    
3146 C C     . ASP B 163 ? 0.1047 0.1106 0.1107 0.0005  -0.0006 -0.0004 270  ASP B C     
3147 O O     . ASP B 163 ? 0.1017 0.1119 0.1070 0.0027  -0.0034 -0.0008 270  ASP B O     
3148 C CB    . ASP B 163 ? 0.1083 0.1144 0.1152 0.0006  0.0002  0.0001  270  ASP B CB    
3149 C CG    . ASP B 163 ? 0.1336 0.1260 0.1339 0.0011  0.0002  -0.0025 270  ASP B CG    
3150 O OD1   . ASP B 163 ? 0.1545 0.1510 0.1465 0.0013  0.0046  -0.0012 270  ASP B OD1   
3151 O OD2   . ASP B 163 ? 0.1575 0.1439 0.1516 0.0012  0.0037  0.0014  270  ASP B OD2   
3152 N N     . GLU B 164 ? 0.1070 0.1133 0.1104 0.0018  -0.0009 -0.0001 271  GLU B N     
3153 C CA    . GLU B 164 ? 0.1123 0.1143 0.1160 0.0002  -0.0001 -0.0004 271  GLU B CA    
3154 C C     . GLU B 164 ? 0.1043 0.1085 0.1088 0.0011  -0.0001 0.0010  271  GLU B C     
3155 O O     . GLU B 164 ? 0.1064 0.1117 0.1164 0.0031  0.0042  0.0020  271  GLU B O     
3156 C CB    . GLU B 164 ? 0.1162 0.1230 0.1221 0.0014  0.0002  -0.0013 271  GLU B CB    
3157 C CG    . GLU B 164 ? 0.1514 0.1408 0.1432 -0.0007 -0.0012 0.0028  271  GLU B CG    
3158 C CD    . GLU B 164 ? 0.1733 0.1818 0.1874 0.0036  0.0028  -0.0021 271  GLU B CD    
3159 O OE1   . GLU B 164 ? 0.2167 0.1989 0.2105 -0.0056 0.0082  0.0022  271  GLU B OE1   
3160 O OE2   . GLU B 164 ? 0.2024 0.1890 0.1885 0.0012  -0.0011 0.0038  271  GLU B OE2   
3161 N N     . GLU B 165 ? 0.1012 0.1018 0.1012 0.0012  0.0008  0.0003  272  GLU B N     
3162 C CA    . GLU B 165 ? 0.0932 0.0961 0.0926 0.0001  -0.0014 0.0002  272  GLU B CA    
3163 C C     . GLU B 165 ? 0.0888 0.0901 0.0894 -0.0008 0.0002  -0.0004 272  GLU B C     
3164 O O     . GLU B 165 ? 0.0805 0.0901 0.0863 -0.0017 -0.0020 -0.0002 272  GLU B O     
3165 C CB    . GLU B 165 ? 0.0926 0.0953 0.0913 -0.0012 -0.0020 -0.0005 272  GLU B CB    
3166 C CG    . GLU B 165 ? 0.0934 0.0960 0.0951 0.0019  -0.0015 0.0018  272  GLU B CG    
3167 C CD    . GLU B 165 ? 0.1035 0.1042 0.1029 -0.0009 -0.0003 -0.0015 272  GLU B CD    
3168 O OE1   . GLU B 165 ? 0.1157 0.1109 0.1041 0.0020  0.0016  0.0031  272  GLU B OE1   
3169 O OE2   . GLU B 165 ? 0.1096 0.1088 0.1154 0.0022  0.0016  -0.0016 272  GLU B OE2   
3170 N N     . THR B 166 ? 0.0784 0.0823 0.0782 0.0010  -0.0030 0.0001  273  THR B N     
3171 C CA    . THR B 166 ? 0.0767 0.0775 0.0812 -0.0010 0.0007  0.0001  273  THR B CA    
3172 C C     . THR B 166 ? 0.0614 0.0667 0.0630 0.0017  -0.0030 0.0009  273  THR B C     
3173 O O     . THR B 166 ? 0.0523 0.0647 0.0592 0.0010  -0.0027 0.0008  273  THR B O     
3174 C CB    . THR B 166 ? 0.0753 0.0843 0.0786 -0.0002 -0.0035 -0.0004 273  THR B CB    
3175 O OG1   . THR B 166 ? 0.1161 0.0958 0.1148 -0.0066 0.0082  -0.0009 273  THR B OG1   
3176 C CG2   . THR B 166 ? 0.0975 0.0876 0.0967 0.0031  0.0041  0.0015  273  THR B CG2   
3177 N N     . VAL B 167 ? 0.0589 0.0565 0.0557 0.0000  -0.0002 0.0023  274  VAL B N     
3178 C CA    . VAL B 167 ? 0.0473 0.0491 0.0473 0.0015  -0.0029 0.0019  274  VAL B CA    
3179 C C     . VAL B 167 ? 0.0565 0.0483 0.0467 0.0003  0.0000  0.0017  274  VAL B C     
3180 O O     . VAL B 167 ? 0.0612 0.0481 0.0428 0.0011  0.0000  0.0041  274  VAL B O     
3181 C CB    . VAL B 167 ? 0.0429 0.0462 0.0453 0.0019  -0.0042 0.0019  274  VAL B CB    
3182 C CG1   . VAL B 167 ? 0.0546 0.0514 0.0526 -0.0019 0.0011  0.0026  274  VAL B CG1   
3183 C CG2   . VAL B 167 ? 0.0489 0.0468 0.0385 0.0026  -0.0008 0.0022  274  VAL B CG2   
3184 N N     . ILE B 168 ? 0.0447 0.0473 0.0446 0.0012  -0.0033 0.0021  275  ILE B N     
3185 C CA    . ILE B 168 ? 0.0518 0.0515 0.0500 0.0006  0.0000  0.0008  275  ILE B CA    
3186 C C     . ILE B 168 ? 0.0423 0.0449 0.0425 0.0004  -0.0028 0.0004  275  ILE B C     
3187 O O     . ILE B 168 ? 0.0426 0.0470 0.0484 -0.0011 -0.0005 0.0004  275  ILE B O     
3188 C CB    . ILE B 168 ? 0.0555 0.0564 0.0513 0.0010  -0.0024 0.0006  275  ILE B CB    
3189 C CG1   . ILE B 168 ? 0.0727 0.0752 0.0653 0.0000  0.0015  0.0012  275  ILE B CG1   
3190 C CG2   . ILE B 168 ? 0.0634 0.0633 0.0630 0.0015  -0.0002 -0.0001 275  ILE B CG2   
3191 C CD1   . ILE B 168 ? 0.1023 0.0875 0.0933 -0.0032 0.0037  -0.0013 275  ILE B CD1   
3192 N N     . ASP B 169 ? 0.0413 0.0419 0.0380 -0.0014 -0.0008 -0.0004 276  ASP B N     
3193 C CA    . ASP B 169 ? 0.0358 0.0386 0.0385 0.0011  -0.0017 -0.0002 276  ASP B CA    
3194 C C     . ASP B 169 ? 0.0309 0.0352 0.0354 0.0013  -0.0007 0.0017  276  ASP B C     
3195 O O     . ASP B 169 ? 0.0253 0.0326 0.0385 0.0004  0.0005  -0.0009 276  ASP B O     
3196 C CB    . ASP B 169 ? 0.0357 0.0395 0.0408 0.0030  -0.0019 0.0017  276  ASP B CB    
3197 C CG    . ASP B 169 ? 0.0497 0.0504 0.0513 0.0022  0.0015  0.0019  276  ASP B CG    
3198 O OD1   . ASP B 169 ? 0.0528 0.0567 0.0633 0.0000  -0.0048 -0.0033 276  ASP B OD1   
3199 O OD2   . ASP B 169 ? 0.0441 0.0607 0.0562 0.0041  -0.0055 0.0000  276  ASP B OD2   
3200 N N     . VAL B 170 ? 0.0334 0.0306 0.0306 0.0006  -0.0018 0.0008  277  VAL B N     
3201 C CA    . VAL B 170 ? 0.0308 0.0324 0.0322 0.0007  -0.0017 0.0007  277  VAL B CA    
3202 C C     . VAL B 170 ? 0.0315 0.0340 0.0342 0.0014  -0.0020 0.0017  277  VAL B C     
3203 O O     . VAL B 170 ? 0.0353 0.0356 0.0419 0.0029  0.0011  0.0042  277  VAL B O     
3204 C CB    . VAL B 170 ? 0.0307 0.0320 0.0310 -0.0001 -0.0010 -0.0010 277  VAL B CB    
3205 C CG1   . VAL B 170 ? 0.0359 0.0324 0.0281 0.0012  -0.0003 -0.0001 277  VAL B CG1   
3206 C CG2   . VAL B 170 ? 0.0308 0.0287 0.0279 0.0014  -0.0017 0.0015  277  VAL B CG2   
3207 N N     . PRO B 171 ? 0.0381 0.0405 0.0401 0.0033  -0.0002 0.0033  278  PRO B N     
3208 C CA    . PRO B 171 ? 0.0397 0.0409 0.0419 0.0017  -0.0001 0.0010  278  PRO B CA    
3209 C C     . PRO B 171 ? 0.0381 0.0406 0.0387 0.0016  -0.0012 0.0006  278  PRO B C     
3210 O O     . PRO B 171 ? 0.0362 0.0381 0.0328 -0.0024 -0.0022 0.0005  278  PRO B O     
3211 C CB    . PRO B 171 ? 0.0422 0.0454 0.0478 0.0015  0.0003  0.0011  278  PRO B CB    
3212 C CG    . PRO B 171 ? 0.0563 0.0501 0.0536 0.0020  0.0066  0.0013  278  PRO B CG    
3213 C CD    . PRO B 171 ? 0.0396 0.0431 0.0410 -0.0007 -0.0012 0.0000  278  PRO B CD    
3214 N N     . GLU B 172 ? 0.0389 0.0398 0.0337 0.0029  -0.0023 0.0039  279  GLU B N     
3215 C CA    . GLU B 172 ? 0.0386 0.0431 0.0429 0.0000  -0.0014 -0.0014 279  GLU B CA    
3216 C C     . GLU B 172 ? 0.0400 0.0440 0.0439 0.0009  -0.0020 0.0008  279  GLU B C     
3217 O O     . GLU B 172 ? 0.0463 0.0456 0.0375 -0.0022 -0.0025 -0.0051 279  GLU B O     
3218 C CB    . GLU B 172 ? 0.0366 0.0431 0.0377 0.0027  -0.0035 0.0019  279  GLU B CB    
3219 C CG    . GLU B 172 ? 0.0448 0.0487 0.0480 0.0003  -0.0013 0.0007  279  GLU B CG    
3220 C CD    . GLU B 172 ? 0.0626 0.0592 0.0591 -0.0003 0.0000  0.0005  279  GLU B CD    
3221 O OE1   . GLU B 172 ? 0.0706 0.0646 0.0653 -0.0036 -0.0001 -0.0019 279  GLU B OE1   
3222 O OE2   . GLU B 172 ? 0.0468 0.0592 0.0569 -0.0008 -0.0068 0.0020  279  GLU B OE2   
3223 N N     . PRO B 173 ? 0.0447 0.0475 0.0420 -0.0014 -0.0014 -0.0020 280  PRO B N     
3224 C CA    . PRO B 173 ? 0.0451 0.0462 0.0438 -0.0009 -0.0004 -0.0001 280  PRO B CA    
3225 C C     . PRO B 173 ? 0.0429 0.0441 0.0429 -0.0012 0.0003  -0.0005 280  PRO B C     
3226 O O     . PRO B 173 ? 0.0378 0.0447 0.0408 -0.0003 -0.0020 0.0029  280  PRO B O     
3227 C CB    . PRO B 173 ? 0.0448 0.0488 0.0411 0.0009  -0.0039 -0.0026 280  PRO B CB    
3228 C CG    . PRO B 173 ? 0.0574 0.0549 0.0624 -0.0013 0.0044  0.0000  280  PRO B CG    
3229 C CD    . PRO B 173 ? 0.0438 0.0490 0.0404 -0.0002 -0.0033 0.0000  280  PRO B CD    
3230 N N     . TYR B 174 ? 0.0334 0.0401 0.0355 -0.0007 -0.0048 0.0005  281  TYR B N     
3231 C CA    . TYR B 174 ? 0.0370 0.0413 0.0401 0.0001  -0.0007 -0.0002 281  TYR B CA    
3232 C C     . TYR B 174 ? 0.0293 0.0374 0.0371 0.0018  -0.0021 -0.0001 281  TYR B C     
3233 O O     . TYR B 174 ? 0.0269 0.0380 0.0362 0.0020  -0.0036 0.0006  281  TYR B O     
3234 C CB    . TYR B 174 ? 0.0361 0.0468 0.0356 0.0003  -0.0040 -0.0016 281  TYR B CB    
3235 C CG    . TYR B 174 ? 0.0557 0.0588 0.0610 -0.0015 0.0018  0.0006  281  TYR B CG    
3236 C CD1   . TYR B 174 ? 0.0746 0.0845 0.0723 -0.0007 -0.0043 -0.0034 281  TYR B CD1   
3237 C CD2   . TYR B 174 ? 0.0769 0.0772 0.0774 0.0008  -0.0002 0.0019  281  TYR B CD2   
3238 C CE1   . TYR B 174 ? 0.0902 0.0931 0.0933 -0.0020 -0.0007 -0.0003 281  TYR B CE1   
3239 C CE2   . TYR B 174 ? 0.0929 0.0863 0.0857 -0.0011 0.0010  0.0010  281  TYR B CE2   
3240 C CZ    . TYR B 174 ? 0.1012 0.1085 0.1116 0.0000  -0.0017 -0.0001 281  TYR B CZ    
3241 O OH    . TYR B 174 ? 0.1427 0.1249 0.1509 -0.0059 0.0078  -0.0052 281  TYR B OH    
3242 N N     . ASN B 175 ? 0.0307 0.0376 0.0343 0.0010  -0.0030 -0.0004 282  ASN B N     
3243 C CA    . ASN B 175 ? 0.0408 0.0401 0.0398 0.0005  -0.0003 0.0003  282  ASN B CA    
3244 C C     . ASN B 175 ? 0.0407 0.0396 0.0412 -0.0008 -0.0003 -0.0012 282  ASN B C     
3245 O O     . ASN B 175 ? 0.0502 0.0436 0.0493 -0.0023 0.0033  -0.0021 282  ASN B O     
3246 C CB    . ASN B 175 ? 0.0387 0.0447 0.0415 0.0012  -0.0027 0.0020  282  ASN B CB    
3247 C CG    . ASN B 175 ? 0.0620 0.0554 0.0478 0.0006  0.0003  -0.0019 282  ASN B CG    
3248 O OD1   . ASN B 175 ? 0.0595 0.0502 0.0349 -0.0044 -0.0004 0.0030  282  ASN B OD1   
3249 N ND2   . ASN B 175 ? 0.0953 0.0815 0.0786 -0.0061 0.0068  0.0041  282  ASN B ND2   
3250 N N     . HIS B 176 ? 0.0365 0.0376 0.0357 -0.0001 -0.0026 0.0003  283  HIS B N     
3251 C CA    . HIS B 176 ? 0.0371 0.0380 0.0395 -0.0010 -0.0008 -0.0007 283  HIS B CA    
3252 C C     . HIS B 176 ? 0.0399 0.0413 0.0409 -0.0003 -0.0003 -0.0011 283  HIS B C     
3253 O O     . HIS B 176 ? 0.0411 0.0394 0.0376 -0.0012 0.0006  -0.0025 283  HIS B O     
3254 C CB    . HIS B 176 ? 0.0290 0.0339 0.0341 -0.0008 -0.0046 -0.0006 283  HIS B CB    
3255 C CG    . HIS B 176 ? 0.0459 0.0432 0.0426 -0.0014 0.0020  0.0003  283  HIS B CG    
3256 N ND1   . HIS B 176 ? 0.0387 0.0447 0.0447 -0.0011 -0.0009 -0.0010 283  HIS B ND1   
3257 C CD2   . HIS B 176 ? 0.0321 0.0427 0.0450 -0.0008 -0.0010 0.0021  283  HIS B CD2   
3258 C CE1   . HIS B 176 ? 0.0505 0.0440 0.0431 -0.0038 -0.0004 -0.0009 283  HIS B CE1   
3259 N NE2   . HIS B 176 ? 0.0263 0.0435 0.0441 0.0034  -0.0019 0.0032  283  HIS B NE2   
3260 N N     . VAL B 177 ? 0.0439 0.0454 0.0495 -0.0012 -0.0002 -0.0014 284  VAL B N     
3261 C CA    . VAL B 177 ? 0.0518 0.0530 0.0542 -0.0003 -0.0002 -0.0011 284  VAL B CA    
3262 C C     . VAL B 177 ? 0.0492 0.0478 0.0475 -0.0016 0.0007  -0.0015 284  VAL B C     
3263 O O     . VAL B 177 ? 0.0553 0.0513 0.0539 0.0008  0.0023  0.0007  284  VAL B O     
3264 C CB    . VAL B 177 ? 0.0624 0.0587 0.0619 -0.0008 0.0002  -0.0022 284  VAL B CB    
3265 C CG1   . VAL B 177 ? 0.0938 0.0826 0.0786 -0.0004 0.0026  -0.0005 284  VAL B CG1   
3266 C CG2   . VAL B 177 ? 0.0690 0.0664 0.0730 0.0000  0.0036  -0.0030 284  VAL B CG2   
3267 N N     . SER B 178 ? 0.0394 0.0420 0.0394 -0.0014 -0.0026 -0.0007 285  SER B N     
3268 C CA    . SER B 178 ? 0.0363 0.0385 0.0347 -0.0004 -0.0014 0.0004  285  SER B CA    
3269 C C     . SER B 178 ? 0.0324 0.0351 0.0309 -0.0004 -0.0026 0.0000  285  SER B C     
3270 O O     . SER B 178 ? 0.0280 0.0333 0.0305 -0.0012 -0.0029 -0.0026 285  SER B O     
3271 C CB    . SER B 178 ? 0.0438 0.0395 0.0390 -0.0004 0.0027  0.0012  285  SER B CB    
3272 O OG    . SER B 178 ? 0.0360 0.0388 0.0274 0.0013  -0.0047 -0.0017 285  SER B OG    
3273 N N     . LYS B 179 ? 0.0323 0.0373 0.0326 0.0000  -0.0022 -0.0006 286  LYS B N     
3274 C CA    . LYS B 179 ? 0.0366 0.0371 0.0352 -0.0009 0.0000  -0.0002 286  LYS B CA    
3275 C C     . LYS B 179 ? 0.0359 0.0340 0.0352 0.0002  0.0006  0.0009  286  LYS B C     
3276 O O     . LYS B 179 ? 0.0269 0.0329 0.0328 -0.0011 -0.0026 -0.0029 286  LYS B O     
3277 C CB    . LYS B 179 ? 0.0401 0.0409 0.0358 -0.0021 -0.0037 0.0000  286  LYS B CB    
3278 C CG    . LYS B 179 ? 0.0579 0.0627 0.0486 0.0016  0.0001  0.0001  286  LYS B CG    
3279 C CD    . LYS B 179 ? 0.1011 0.0854 0.1003 -0.0007 0.0030  0.0006  286  LYS B CD    
3280 C CE    . LYS B 179 ? 0.1158 0.1148 0.1232 0.0008  0.0085  -0.0004 286  LYS B CE    
3281 N NZ    . LYS B 179 ? 0.1209 0.1308 0.1236 0.0000  -0.0023 0.0031  286  LYS B NZ    
3282 N N     . TYR B 180 ? 0.0319 0.0341 0.0345 -0.0015 -0.0007 -0.0003 287  TYR B N     
3283 C CA    . TYR B 180 ? 0.0348 0.0340 0.0362 0.0003  0.0010  -0.0005 287  TYR B CA    
3284 C C     . TYR B 180 ? 0.0297 0.0345 0.0336 -0.0005 -0.0014 -0.0001 287  TYR B C     
3285 O O     . TYR B 180 ? 0.0312 0.0373 0.0345 -0.0008 -0.0002 -0.0011 287  TYR B O     
3286 C CB    . TYR B 180 ? 0.0338 0.0328 0.0314 -0.0012 0.0006  -0.0019 287  TYR B CB    
3287 C CG    . TYR B 180 ? 0.0315 0.0288 0.0257 -0.0014 -0.0006 -0.0009 287  TYR B CG    
3288 C CD1   . TYR B 180 ? 0.0300 0.0289 0.0256 -0.0010 -0.0005 -0.0008 287  TYR B CD1   
3289 C CD2   . TYR B 180 ? 0.0290 0.0335 0.0276 0.0011  -0.0017 0.0027  287  TYR B CD2   
3290 C CE1   . TYR B 180 ? 0.0263 0.0265 0.0258 -0.0010 -0.0007 0.0007  287  TYR B CE1   
3291 C CE2   . TYR B 180 ? 0.0322 0.0354 0.0295 0.0013  -0.0009 0.0029  287  TYR B CE2   
3292 C CZ    . TYR B 180 ? 0.0288 0.0301 0.0278 -0.0001 -0.0029 0.0005  287  TYR B CZ    
3293 O OH    . TYR B 180 ? 0.0329 0.0372 0.0376 -0.0024 0.0015  0.0008  287  TYR B OH    
3294 N N     . CYS B 181 ? 0.0301 0.0353 0.0366 0.0001  -0.0014 0.0004  288  CYS B N     
3295 C CA    . CYS B 181 ? 0.0396 0.0385 0.0398 0.0007  0.0007  0.0003  288  CYS B CA    
3296 C C     . CYS B 181 ? 0.0390 0.0370 0.0367 -0.0011 0.0007  0.0004  288  CYS B C     
3297 O O     . CYS B 181 ? 0.0472 0.0424 0.0362 -0.0012 0.0004  -0.0007 288  CYS B O     
3298 C CB    . CYS B 181 ? 0.0388 0.0394 0.0386 -0.0011 0.0007  -0.0024 288  CYS B CB    
3299 S SG    . CYS B 181 ? 0.0679 0.0593 0.0562 0.0026  -0.0005 0.0016  288  CYS B SG    
3300 N N     . ALA B 182 ? 0.0354 0.0355 0.0319 0.0002  -0.0002 0.0000  289  ALA B N     
3301 C CA    . ALA B 182 ? 0.0309 0.0332 0.0327 0.0000  -0.0009 -0.0001 289  ALA B CA    
3302 C C     . ALA B 182 ? 0.0264 0.0313 0.0304 -0.0010 -0.0004 -0.0013 289  ALA B C     
3303 O O     . ALA B 182 ? 0.0264 0.0314 0.0272 -0.0004 -0.0012 -0.0012 289  ALA B O     
3304 C CB    . ALA B 182 ? 0.0365 0.0341 0.0388 -0.0003 0.0012  -0.0012 289  ALA B CB    
3305 N N     . SER B 183 ? 0.0255 0.0295 0.0286 0.0007  0.0003  -0.0004 290  SER B N     
3306 C CA    . SER B 183 ? 0.0299 0.0294 0.0286 -0.0006 0.0008  -0.0008 290  SER B CA    
3307 C C     . SER B 183 ? 0.0294 0.0299 0.0284 0.0001  0.0003  -0.0007 290  SER B C     
3308 O O     . SER B 183 ? 0.0322 0.0297 0.0317 0.0017  0.0010  -0.0008 290  SER B O     
3309 C CB    . SER B 183 ? 0.0289 0.0284 0.0282 0.0006  0.0013  0.0004  290  SER B CB    
3310 O OG    . SER B 183 ? 0.0256 0.0271 0.0257 0.0000  -0.0001 -0.0007 290  SER B OG    
3311 N N     . LEU B 184 ? 0.0322 0.0305 0.0294 0.0007  0.0017  -0.0005 291  LEU B N     
3312 C CA    . LEU B 184 ? 0.0289 0.0308 0.0297 0.0004  0.0009  -0.0010 291  LEU B CA    
3313 C C     . LEU B 184 ? 0.0286 0.0310 0.0306 -0.0009 0.0013  -0.0017 291  LEU B C     
3314 O O     . LEU B 184 ? 0.0310 0.0351 0.0305 -0.0017 0.0006  -0.0021 291  LEU B O     
3315 C CB    . LEU B 184 ? 0.0306 0.0333 0.0296 -0.0006 0.0000  0.0008  291  LEU B CB    
3316 C CG    . LEU B 184 ? 0.0351 0.0346 0.0333 0.0008  -0.0005 -0.0005 291  LEU B CG    
3317 C CD1   . LEU B 184 ? 0.0330 0.0350 0.0322 0.0006  -0.0013 -0.0009 291  LEU B CD1   
3318 C CD2   . LEU B 184 ? 0.0424 0.0395 0.0332 0.0006  -0.0010 -0.0012 291  LEU B CD2   
3319 N N     . GLY B 185 ? 0.0259 0.0281 0.0274 -0.0009 -0.0002 -0.0012 292  GLY B N     
3320 C CA    . GLY B 185 ? 0.0261 0.0280 0.0278 -0.0012 -0.0004 -0.0005 292  GLY B CA    
3321 C C     . GLY B 185 ? 0.0259 0.0287 0.0275 -0.0012 -0.0007 0.0005  292  GLY B C     
3322 O O     . GLY B 185 ? 0.0265 0.0312 0.0310 -0.0020 -0.0023 0.0018  292  GLY B O     
3323 N N     . HIS B 186 ? 0.0255 0.0299 0.0260 0.0000  -0.0003 0.0013  293  HIS B N     
3324 C CA    . HIS B 186 ? 0.0262 0.0310 0.0302 -0.0013 0.0000  -0.0001 293  HIS B CA    
3325 C C     . HIS B 186 ? 0.0255 0.0330 0.0312 -0.0012 0.0000  0.0000  293  HIS B C     
3326 O O     . HIS B 186 ? 0.0262 0.0363 0.0256 -0.0032 -0.0005 0.0019  293  HIS B O     
3327 C CB    . HIS B 186 ? 0.0271 0.0312 0.0306 -0.0001 0.0001  -0.0011 293  HIS B CB    
3328 C CG    . HIS B 186 ? 0.0295 0.0310 0.0300 -0.0018 -0.0026 0.0013  293  HIS B CG    
3329 N ND1   . HIS B 186 ? 0.0328 0.0342 0.0276 -0.0016 -0.0029 -0.0025 293  HIS B ND1   
3330 C CD2   . HIS B 186 ? 0.0387 0.0379 0.0392 0.0006  0.0052  0.0030  293  HIS B CD2   
3331 C CE1   . HIS B 186 ? 0.0378 0.0354 0.0267 0.0022  -0.0001 0.0009  293  HIS B CE1   
3332 N NE2   . HIS B 186 ? 0.0360 0.0405 0.0306 0.0016  -0.0011 -0.0008 293  HIS B NE2   
3333 N N     . LYS B 187 ? 0.0303 0.0300 0.0256 0.0000  -0.0010 0.0006  294  LYS B N     
3334 C CA    . LYS B 187 ? 0.0272 0.0294 0.0261 0.0013  0.0000  0.0015  294  LYS B CA    
3335 C C     . LYS B 187 ? 0.0314 0.0320 0.0282 0.0008  0.0011  0.0009  294  LYS B C     
3336 O O     . LYS B 187 ? 0.0339 0.0320 0.0300 -0.0022 0.0001  -0.0041 294  LYS B O     
3337 C CB    . LYS B 187 ? 0.0307 0.0305 0.0258 -0.0007 -0.0016 0.0000  294  LYS B CB    
3338 C CG    . LYS B 187 ? 0.0259 0.0295 0.0256 0.0011  0.0001  0.0009  294  LYS B CG    
3339 C CD    . LYS B 187 ? 0.0266 0.0279 0.0274 -0.0001 -0.0015 0.0010  294  LYS B CD    
3340 C CE    . LYS B 187 ? 0.0298 0.0335 0.0380 0.0007  0.0007  0.0006  294  LYS B CE    
3341 N NZ    . LYS B 187 ? 0.0269 0.0265 0.0253 0.0014  -0.0002 -0.0002 294  LYS B NZ    
3342 N N     . ALA B 188 ? 0.0338 0.0320 0.0281 0.0012  -0.0003 0.0002  295  ALA B N     
3343 C CA    . ALA B 188 ? 0.0327 0.0314 0.0297 0.0020  -0.0001 0.0020  295  ALA B CA    
3344 C C     . ALA B 188 ? 0.0319 0.0315 0.0301 -0.0001 -0.0009 0.0003  295  ALA B C     
3345 O O     . ALA B 188 ? 0.0312 0.0275 0.0315 0.0027  -0.0003 0.0023  295  ALA B O     
3346 C CB    . ALA B 188 ? 0.0300 0.0323 0.0352 0.0015  0.0005  0.0036  295  ALA B CB    
3347 N N     . ASN B 189 ? 0.0291 0.0310 0.0289 -0.0009 -0.0001 -0.0003 296  ASN B N     
3348 C CA    . ASN B 189 ? 0.0281 0.0316 0.0318 -0.0006 -0.0006 -0.0002 296  ASN B CA    
3349 C C     . ASN B 189 ? 0.0315 0.0297 0.0283 -0.0011 0.0002  0.0000  296  ASN B C     
3350 O O     . ASN B 189 ? 0.0287 0.0333 0.0254 -0.0002 -0.0005 0.0002  296  ASN B O     
3351 C CB    . ASN B 189 ? 0.0352 0.0349 0.0361 -0.0014 0.0012  -0.0003 296  ASN B CB    
3352 C CG    . ASN B 189 ? 0.0376 0.0355 0.0413 0.0016  0.0015  0.0005  296  ASN B CG    
3353 O OD1   . ASN B 189 ? 0.0269 0.0378 0.0376 0.0005  -0.0044 -0.0030 296  ASN B OD1   
3354 N ND2   . ASN B 189 ? 0.0436 0.0589 0.0755 -0.0031 -0.0061 -0.0050 296  ASN B ND2   
3355 N N     . HIS B 190 ? 0.0268 0.0289 0.0272 0.0002  -0.0015 -0.0013 297  HIS B N     
3356 C CA    . HIS B 190 ? 0.0302 0.0302 0.0262 0.0000  -0.0006 0.0000  297  HIS B CA    
3357 C C     . HIS B 190 ? 0.0277 0.0307 0.0257 0.0000  -0.0009 0.0003  297  HIS B C     
3358 O O     . HIS B 190 ? 0.0299 0.0378 0.0296 0.0016  -0.0016 0.0035  297  HIS B O     
3359 C CB    . HIS B 190 ? 0.0253 0.0297 0.0254 0.0001  0.0000  -0.0005 297  HIS B CB    
3360 C CG    . HIS B 190 ? 0.0365 0.0297 0.0343 0.0004  0.0034  -0.0012 297  HIS B CG    
3361 N ND1   . HIS B 190 ? 0.0307 0.0321 0.0390 -0.0002 -0.0016 -0.0019 297  HIS B ND1   
3362 C CD2   . HIS B 190 ? 0.0376 0.0327 0.0410 0.0000  0.0038  -0.0011 297  HIS B CD2   
3363 C CE1   . HIS B 190 ? 0.0287 0.0344 0.0308 0.0022  -0.0026 0.0032  297  HIS B CE1   
3364 N NE2   . HIS B 190 ? 0.0265 0.0334 0.0336 0.0002  -0.0028 0.0031  297  HIS B NE2   
3365 N N     . SER B 191 ? 0.0267 0.0291 0.0260 0.0008  -0.0007 0.0005  298  SER B N     
3366 C CA    . SER B 191 ? 0.0273 0.0296 0.0260 0.0000  -0.0009 -0.0010 298  SER B CA    
3367 C C     . SER B 191 ? 0.0296 0.0288 0.0277 0.0001  -0.0003 -0.0006 298  SER B C     
3368 O O     . SER B 191 ? 0.0283 0.0297 0.0282 0.0009  -0.0021 0.0000  298  SER B O     
3369 C CB    . SER B 191 ? 0.0300 0.0285 0.0262 0.0002  0.0013  -0.0012 298  SER B CB    
3370 O OG    . SER B 191 ? 0.0296 0.0307 0.0312 0.0005  0.0029  -0.0042 298  SER B OG    
3371 N N     . PHE B 192 ? 0.0335 0.0336 0.0295 -0.0004 -0.0003 -0.0012 299  PHE B N     
3372 C CA    . PHE B 192 ? 0.0353 0.0345 0.0321 0.0001  -0.0002 0.0009  299  PHE B CA    
3373 C C     . PHE B 192 ? 0.0355 0.0355 0.0349 0.0004  0.0000  0.0011  299  PHE B C     
3374 O O     . PHE B 192 ? 0.0384 0.0315 0.0293 0.0024  0.0018  0.0037  299  PHE B O     
3375 C CB    . PHE B 192 ? 0.0388 0.0384 0.0364 0.0010  0.0019  0.0009  299  PHE B CB    
3376 C CG    . PHE B 192 ? 0.0377 0.0360 0.0329 0.0003  -0.0025 0.0008  299  PHE B CG    
3377 C CD1   . PHE B 192 ? 0.0332 0.0330 0.0308 -0.0003 -0.0023 0.0021  299  PHE B CD1   
3378 C CD2   . PHE B 192 ? 0.0466 0.0486 0.0534 -0.0008 0.0020  -0.0003 299  PHE B CD2   
3379 C CE1   . PHE B 192 ? 0.0388 0.0384 0.0421 0.0011  -0.0003 -0.0011 299  PHE B CE1   
3380 C CE2   . PHE B 192 ? 0.0461 0.0495 0.0509 -0.0001 0.0003  0.0000  299  PHE B CE2   
3381 C CZ    . PHE B 192 ? 0.0450 0.0428 0.0453 -0.0001 0.0006  0.0018  299  PHE B CZ    
3382 N N     . THR B 193 ? 0.0428 0.0391 0.0357 -0.0015 0.0003  0.0000  300  THR B N     
3383 C CA    . THR B 193 ? 0.0422 0.0399 0.0386 -0.0001 0.0005  0.0004  300  THR B CA    
3384 C C     . THR B 193 ? 0.0336 0.0360 0.0344 -0.0003 -0.0012 0.0006  300  THR B C     
3385 O O     . THR B 193 ? 0.0424 0.0394 0.0277 -0.0025 -0.0009 -0.0005 300  THR B O     
3386 C CB    . THR B 193 ? 0.0419 0.0415 0.0393 -0.0014 -0.0012 -0.0004 300  THR B CB    
3387 O OG1   . THR B 193 ? 0.0498 0.0462 0.0527 -0.0010 0.0035  -0.0041 300  THR B OG1   
3388 C CG2   . THR B 193 ? 0.0483 0.0473 0.0521 -0.0008 0.0025  0.0010  300  THR B CG2   
3389 N N     . PRO B 194 ? 0.0276 0.0310 0.0271 0.0000  -0.0018 0.0003  301  PRO B N     
3390 C CA    . PRO B 194 ? 0.0263 0.0286 0.0308 -0.0010 -0.0007 0.0003  301  PRO B CA    
3391 C C     . PRO B 194 ? 0.0287 0.0288 0.0311 -0.0012 0.0012  0.0001  301  PRO B C     
3392 O O     . PRO B 194 ? 0.0282 0.0284 0.0313 -0.0020 0.0017  0.0013  301  PRO B O     
3393 C CB    . PRO B 194 ? 0.0289 0.0272 0.0254 0.0000  -0.0006 0.0000  301  PRO B CB    
3394 C CG    . PRO B 194 ? 0.0267 0.0319 0.0300 -0.0017 -0.0015 -0.0017 301  PRO B CG    
3395 C CD    . PRO B 194 ? 0.0310 0.0295 0.0308 -0.0003 -0.0014 -0.0013 301  PRO B CD    
3396 N N     . ASN B 195 ? 0.0284 0.0291 0.0290 -0.0006 -0.0018 0.0001  302  ASN B N     
3397 C CA    . ASN B 195 ? 0.0337 0.0323 0.0354 -0.0006 0.0023  -0.0007 302  ASN B CA    
3398 C C     . ASN B 195 ? 0.0290 0.0311 0.0322 -0.0009 0.0009  -0.0005 302  ASN B C     
3399 O O     . ASN B 195 ? 0.0264 0.0338 0.0277 -0.0005 -0.0016 0.0006  302  ASN B O     
3400 C CB    . ASN B 195 ? 0.0327 0.0344 0.0273 0.0000  -0.0012 0.0002  302  ASN B CB    
3401 C CG    . ASN B 195 ? 0.0330 0.0358 0.0322 0.0004  0.0010  -0.0015 302  ASN B CG    
3402 O OD1   . ASN B 195 ? 0.0257 0.0384 0.0483 -0.0023 0.0000  -0.0006 302  ASN B OD1   
3403 N ND2   . ASN B 195 ? 0.0282 0.0345 0.0353 -0.0036 0.0003  0.0025  302  ASN B ND2   
3404 N N     . CYS B 196 ? 0.0290 0.0310 0.0255 -0.0001 -0.0007 0.0002  303  CYS B N     
3405 C CA    . CYS B 196 ? 0.0267 0.0299 0.0275 -0.0005 -0.0016 -0.0001 303  CYS B CA    
3406 C C     . CYS B 196 ? 0.0276 0.0329 0.0280 0.0000  -0.0024 0.0003  303  CYS B C     
3407 O O     . CYS B 196 ? 0.0253 0.0310 0.0353 0.0001  -0.0005 0.0007  303  CYS B O     
3408 C CB    . CYS B 196 ? 0.0255 0.0282 0.0254 -0.0004 -0.0001 -0.0001 303  CYS B CB    
3409 S SG    . CYS B 196 ? 0.0283 0.0358 0.0312 -0.0038 -0.0039 0.0027  303  CYS B SG    
3410 N N     . ILE B 197 ? 0.0330 0.0362 0.0295 0.0000  -0.0033 0.0012  304  ILE B N     
3411 C CA    . ILE B 197 ? 0.0382 0.0426 0.0416 -0.0013 -0.0022 -0.0004 304  ILE B CA    
3412 C C     . ILE B 197 ? 0.0382 0.0413 0.0402 0.0000  -0.0015 0.0006  304  ILE B C     
3413 O O     . ILE B 197 ? 0.0291 0.0411 0.0349 -0.0026 -0.0053 -0.0017 304  ILE B O     
3414 C CB    . ILE B 197 ? 0.0451 0.0475 0.0492 0.0016  -0.0006 0.0005  304  ILE B CB    
3415 C CG1   . ILE B 197 ? 0.0551 0.0598 0.0522 -0.0004 -0.0040 0.0017  304  ILE B CG1   
3416 C CG2   . ILE B 197 ? 0.0661 0.0572 0.0642 0.0000  0.0027  0.0004  304  ILE B CG2   
3417 C CD1   . ILE B 197 ? 0.0832 0.0814 0.0864 0.0037  0.0068  0.0023  304  ILE B CD1   
3418 N N     . TYR B 198 ? 0.0383 0.0417 0.0374 -0.0014 -0.0032 -0.0008 305  TYR B N     
3419 C CA    . TYR B 198 ? 0.0403 0.0425 0.0413 -0.0002 -0.0031 0.0006  305  TYR B CA    
3420 C C     . TYR B 198 ? 0.0494 0.0468 0.0495 0.0002  0.0012  0.0000  305  TYR B C     
3421 O O     . TYR B 198 ? 0.0324 0.0428 0.0464 0.0001  -0.0033 0.0030  305  TYR B O     
3422 C CB    . TYR B 198 ? 0.0496 0.0428 0.0433 -0.0019 0.0024  -0.0015 305  TYR B CB    
3423 C CG    . TYR B 198 ? 0.0333 0.0415 0.0377 -0.0035 -0.0061 -0.0023 305  TYR B CG    
3424 C CD1   . TYR B 198 ? 0.0332 0.0433 0.0373 0.0008  -0.0049 0.0022  305  TYR B CD1   
3425 C CD2   . TYR B 198 ? 0.0534 0.0466 0.0571 0.0023  0.0040  0.0013  305  TYR B CD2   
3426 C CE1   . TYR B 198 ? 0.0406 0.0420 0.0343 -0.0034 -0.0039 -0.0022 305  TYR B CE1   
3427 C CE2   . TYR B 198 ? 0.0503 0.0499 0.0513 0.0009  -0.0003 -0.0002 305  TYR B CE2   
3428 C CZ    . TYR B 198 ? 0.0507 0.0454 0.0526 0.0024  0.0011  0.0013  305  TYR B CZ    
3429 O OH    . TYR B 198 ? 0.0591 0.0483 0.0449 0.0006  0.0012  -0.0009 305  TYR B OH    
3430 N N     . ASP B 199 ? 0.0567 0.0512 0.0542 0.0001  0.0001  0.0021  306  ASP B N     
3431 C CA    . ASP B 199 ? 0.0585 0.0583 0.0609 0.0003  0.0004  0.0011  306  ASP B CA    
3432 C C     . ASP B 199 ? 0.0599 0.0591 0.0605 0.0000  0.0000  0.0006  306  ASP B C     
3433 O O     . ASP B 199 ? 0.0532 0.0559 0.0611 -0.0003 -0.0008 0.0021  306  ASP B O     
3434 C CB    . ASP B 199 ? 0.0631 0.0616 0.0622 -0.0024 -0.0007 0.0006  306  ASP B CB    
3435 C CG    . ASP B 199 ? 0.0715 0.0740 0.0754 0.0006  0.0004  0.0008  306  ASP B CG    
3436 O OD1   . ASP B 199 ? 0.0938 0.0903 0.0922 0.0006  0.0014  -0.0029 306  ASP B OD1   
3437 O OD2   . ASP B 199 ? 0.0856 0.0888 0.0774 0.0011  -0.0004 0.0000  306  ASP B OD2   
3438 N N     . MET B 200 ? 0.0593 0.0619 0.0580 0.0011  -0.0019 0.0015  307  MET B N     
3439 C CA    . MET B 200 ? 0.0682 0.0679 0.0657 -0.0004 -0.0012 0.0007  307  MET B CA    
3440 C C     . MET B 200 ? 0.0616 0.0574 0.0567 -0.0002 0.0000  0.0004  307  MET B C     
3441 O O     . MET B 200 ? 0.0649 0.0576 0.0602 -0.0019 -0.0005 -0.0014 307  MET B O     
3442 C CB    . MET B 200 ? 0.0740 0.0786 0.0788 -0.0001 0.0011  -0.0009 307  MET B CB    
3443 C CG    . MET B 200 ? 0.1181 0.1191 0.1203 -0.0026 -0.0027 0.0083  307  MET B CG    
3444 S SD    . MET B 200 ? 0.1982 0.1909 0.1770 -0.0002 0.0078  -0.0072 307  MET B SD    
3445 C CE    . MET B 200 ? 0.1960 0.1929 0.1917 -0.0020 0.0016  -0.0010 307  MET B CE    
3446 N N     . PHE B 201 ? 0.0515 0.0510 0.0455 -0.0013 -0.0014 -0.0011 308  PHE B N     
3447 C CA    . PHE B 201 ? 0.0436 0.0437 0.0424 0.0000  0.0008  0.0008  308  PHE B CA    
3448 C C     . PHE B 201 ? 0.0454 0.0408 0.0391 -0.0002 0.0011  -0.0007 308  PHE B C     
3449 O O     . PHE B 201 ? 0.0601 0.0466 0.0369 0.0000  0.0038  0.0001  308  PHE B O     
3450 C CB    . PHE B 201 ? 0.0413 0.0384 0.0336 -0.0018 -0.0025 -0.0009 308  PHE B CB    
3451 C CG    . PHE B 201 ? 0.0305 0.0296 0.0271 0.0012  -0.0027 0.0005  308  PHE B CG    
3452 C CD1   . PHE B 201 ? 0.0335 0.0312 0.0271 0.0038  -0.0006 0.0023  308  PHE B CD1   
3453 C CD2   . PHE B 201 ? 0.0301 0.0288 0.0276 -0.0001 -0.0013 -0.0026 308  PHE B CD2   
3454 C CE1   . PHE B 201 ? 0.0255 0.0283 0.0254 -0.0007 0.0001  -0.0005 308  PHE B CE1   
3455 C CE2   . PHE B 201 ? 0.0285 0.0295 0.0339 -0.0023 0.0011  0.0009  308  PHE B CE2   
3456 C CZ    . PHE B 201 ? 0.0253 0.0303 0.0255 0.0000  0.0000  -0.0010 308  PHE B CZ    
3457 N N     . VAL B 202 ? 0.0344 0.0345 0.0284 0.0028  -0.0028 0.0007  309  VAL B N     
3458 C CA    . VAL B 202 ? 0.0324 0.0326 0.0289 0.0013  -0.0024 0.0001  309  VAL B CA    
3459 C C     . VAL B 202 ? 0.0315 0.0296 0.0300 0.0014  -0.0007 0.0001  309  VAL B C     
3460 O O     . VAL B 202 ? 0.0328 0.0322 0.0303 0.0045  -0.0029 0.0012  309  VAL B O     
3461 C CB    . VAL B 202 ? 0.0372 0.0363 0.0335 0.0001  -0.0008 -0.0001 309  VAL B CB    
3462 C CG1   . VAL B 202 ? 0.0454 0.0408 0.0487 -0.0008 0.0012  -0.0017 309  VAL B CG1   
3463 C CG2   . VAL B 202 ? 0.0517 0.0475 0.0528 0.0033  0.0019  0.0027  309  VAL B CG2   
3464 N N     . HIS B 203 ? 0.0265 0.0270 0.0266 0.0003  -0.0001 -0.0005 310  HIS B N     
3465 C CA    . HIS B 203 ? 0.0263 0.0258 0.0253 0.0007  -0.0002 -0.0001 310  HIS B CA    
3466 C C     . HIS B 203 ? 0.0254 0.0255 0.0253 0.0001  0.0000  0.0000  310  HIS B C     
3467 O O     . HIS B 203 ? 0.0306 0.0272 0.0255 0.0003  -0.0009 -0.0002 310  HIS B O     
3468 C CB    . HIS B 203 ? 0.0260 0.0261 0.0257 0.0004  -0.0005 -0.0003 310  HIS B CB    
3469 C CG    . HIS B 203 ? 0.0263 0.0268 0.0254 0.0012  -0.0002 -0.0003 310  HIS B CG    
3470 N ND1   . HIS B 203 ? 0.0279 0.0294 0.0263 0.0014  -0.0015 -0.0013 310  HIS B ND1   
3471 C CD2   . HIS B 203 ? 0.0283 0.0317 0.0333 -0.0006 -0.0036 0.0025  310  HIS B CD2   
3472 C CE1   . HIS B 203 ? 0.0272 0.0299 0.0357 -0.0006 -0.0002 0.0003  310  HIS B CE1   
3473 N NE2   . HIS B 203 ? 0.0333 0.0325 0.0367 0.0009  0.0014  0.0007  310  HIS B NE2   
3474 N N     . PRO B 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO B N     
3475 C CA    . PRO B 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO B CA    
3476 C C     . PRO B 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO B C     
3477 O O     . PRO B 204 ? 0.0306 0.0272 0.0253 0.0032  -0.0002 -0.0001 311  PRO B O     
3478 C CB    . PRO B 204 ? 0.0263 0.0257 0.0253 0.0006  0.0001  0.0000  311  PRO B CB    
3479 C CG    . PRO B 204 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  311  PRO B CG    
3480 C CD    . PRO B 204 ? 0.0258 0.0253 0.0267 0.0000  0.0008  -0.0001 311  PRO B CD    
3481 N N     . ARG B 205 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  312  ARG B N     
3482 C CA    . ARG B 205 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  312  ARG B CA    
3483 C C     . ARG B 205 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  312  ARG B C     
3484 O O     . ARG B 205 ? 0.0286 0.0263 0.0253 0.0018  -0.0003 -0.0002 312  ARG B O     
3485 C CB    . ARG B 205 ? 0.0255 0.0257 0.0254 -0.0003 0.0001  -0.0001 312  ARG B CB    
3486 C CG    . ARG B 205 ? 0.0254 0.0282 0.0281 -0.0006 0.0004  -0.0018 312  ARG B CG    
3487 C CD    . ARG B 205 ? 0.0253 0.0283 0.0255 -0.0003 0.0000  0.0008  312  ARG B CD    
3488 N NE    . ARG B 205 ? 0.0253 0.0256 0.0253 0.0000  0.0000  0.0000  312  ARG B NE    
3489 C CZ    . ARG B 205 ? 0.0298 0.0322 0.0306 -0.0017 0.0007  -0.0006 312  ARG B CZ    
3490 N NH1   . ARG B 205 ? 0.0293 0.0289 0.0322 0.0021  0.0008  -0.0004 312  ARG B NH1   
3491 N NH2   . ARG B 205 ? 0.0285 0.0395 0.0426 0.0000  0.0012  -0.0016 312  ARG B NH2   
3492 N N     . PHE B 206 ? 0.0253 0.0253 0.0253 0.0000  0.0000  0.0000  313  PHE B N     
3493 C CA    . PHE B 206 ? 0.0270 0.0270 0.0253 -0.0001 0.0000  0.0000  313  PHE B CA    
3494 C C     . PHE B 206 ? 0.0254 0.0280 0.0254 -0.0004 0.0000  -0.0003 313  PHE B C     
3495 O O     . PHE B 206 ? 0.0315 0.0335 0.0258 -0.0016 0.0009  -0.0018 313  PHE B O     
3496 C CB    . PHE B 206 ? 0.0253 0.0269 0.0253 0.0000  0.0000  0.0000  313  PHE B CB    
3497 C CG    . PHE B 206 ? 0.0267 0.0269 0.0278 0.0007  0.0000  0.0005  313  PHE B CG    
3498 C CD1   . PHE B 206 ? 0.0264 0.0262 0.0253 0.0010  -0.0001 -0.0001 313  PHE B CD1   
3499 C CD2   . PHE B 206 ? 0.0301 0.0266 0.0278 -0.0024 0.0003  -0.0004 313  PHE B CD2   
3500 C CE1   . PHE B 206 ? 0.0294 0.0351 0.0439 -0.0009 0.0015  -0.0038 313  PHE B CE1   
3501 C CE2   . PHE B 206 ? 0.0302 0.0329 0.0351 0.0027  -0.0006 -0.0030 313  PHE B CE2   
3502 C CZ    . PHE B 206 ? 0.0350 0.0353 0.0472 -0.0017 0.0023  -0.0036 313  PHE B CZ    
3503 N N     . GLY B 207 ? 0.0264 0.0297 0.0256 -0.0005 -0.0005 -0.0001 314  GLY B N     
3504 C CA    . GLY B 207 ? 0.0272 0.0295 0.0314 0.0001  -0.0004 0.0001  314  GLY B CA    
3505 C C     . GLY B 207 ? 0.0299 0.0324 0.0336 0.0003  -0.0003 0.0003  314  GLY B C     
3506 O O     . GLY B 207 ? 0.0280 0.0294 0.0358 -0.0003 0.0014  0.0007  314  GLY B O     
3507 N N     . PRO B 208 ? 0.0335 0.0347 0.0336 -0.0012 -0.0015 0.0006  315  PRO B N     
3508 C CA    . PRO B 208 ? 0.0364 0.0369 0.0375 -0.0006 -0.0007 0.0000  315  PRO B CA    
3509 C C     . PRO B 208 ? 0.0406 0.0382 0.0393 -0.0008 0.0013  0.0000  315  PRO B C     
3510 O O     . PRO B 208 ? 0.0347 0.0390 0.0336 -0.0022 -0.0046 0.0031  315  PRO B O     
3511 C CB    . PRO B 208 ? 0.0402 0.0396 0.0413 0.0000  -0.0007 0.0005  315  PRO B CB    
3512 C CG    . PRO B 208 ? 0.0401 0.0384 0.0408 -0.0008 -0.0005 0.0005  315  PRO B CG    
3513 C CD    . PRO B 208 ? 0.0339 0.0372 0.0362 -0.0002 -0.0007 0.0007  315  PRO B CD    
3514 N N     . ILE B 209 ? 0.0344 0.0380 0.0318 -0.0013 -0.0028 -0.0003 316  ILE B N     
3515 C CA    . ILE B 209 ? 0.0386 0.0388 0.0361 0.0001  -0.0001 0.0000  316  ILE B CA    
3516 C C     . ILE B 209 ? 0.0399 0.0398 0.0337 0.0006  -0.0004 0.0007  316  ILE B C     
3517 O O     . ILE B 209 ? 0.0422 0.0377 0.0269 0.0033  -0.0034 0.0025  316  ILE B O     
3518 C CB    . ILE B 209 ? 0.0366 0.0377 0.0368 -0.0004 0.0013  0.0009  316  ILE B CB    
3519 C CG1   . ILE B 209 ? 0.0392 0.0392 0.0388 0.0008  -0.0010 -0.0004 316  ILE B CG1   
3520 C CG2   . ILE B 209 ? 0.0404 0.0442 0.0429 -0.0010 0.0007  -0.0015 316  ILE B CG2   
3521 C CD1   . ILE B 209 ? 0.0444 0.0439 0.0458 0.0021  0.0017  0.0022  316  ILE B CD1   
3522 N N     . LYS B 210 ? 0.0348 0.0387 0.0315 0.0011  -0.0050 0.0004  317  LYS B N     
3523 C CA    . LYS B 210 ? 0.0421 0.0446 0.0415 0.0003  -0.0015 0.0002  317  LYS B CA    
3524 C C     . LYS B 210 ? 0.0374 0.0398 0.0379 0.0000  -0.0015 -0.0001 317  LYS B C     
3525 O O     . LYS B 210 ? 0.0359 0.0391 0.0340 0.0001  -0.0011 0.0006  317  LYS B O     
3526 C CB    . LYS B 210 ? 0.0504 0.0481 0.0500 -0.0018 0.0018  -0.0011 317  LYS B CB    
3527 C CG    . LYS B 210 ? 0.0704 0.0803 0.0720 0.0003  -0.0017 0.0011  317  LYS B CG    
3528 C CD    . LYS B 210 ? 0.1066 0.0965 0.1082 0.0027  0.0043  0.0040  317  LYS B CD    
3529 C CE    . LYS B 210 ? 0.1168 0.1170 0.1142 -0.0014 -0.0007 -0.0015 317  LYS B CE    
3530 N NZ    . LYS B 210 ? 0.1251 0.1250 0.1316 0.0038  0.0013  0.0026  317  LYS B NZ    
3531 N N     . CYS B 211 ? 0.0375 0.0400 0.0344 0.0014  -0.0027 0.0019  318  CYS B N     
3532 C CA    . CYS B 211 ? 0.0387 0.0408 0.0417 0.0001  -0.0006 0.0000  318  CYS B CA    
3533 C C     . CYS B 211 ? 0.0418 0.0432 0.0436 0.0010  -0.0001 0.0009  318  CYS B C     
3534 O O     . CYS B 211 ? 0.0411 0.0406 0.0324 0.0005  -0.0037 0.0007  318  CYS B O     
3535 C CB    . CYS B 211 ? 0.0353 0.0401 0.0383 0.0021  -0.0037 0.0024  318  CYS B CB    
3536 S SG    . CYS B 211 ? 0.0527 0.0430 0.0524 0.0041  0.0018  0.0005  318  CYS B SG    
3537 N N     . ILE B 212 ? 0.0424 0.0448 0.0451 0.0002  -0.0004 -0.0010 319  ILE B N     
3538 C CA    . ILE B 212 ? 0.0473 0.0479 0.0496 0.0000  0.0002  -0.0004 319  ILE B CA    
3539 C C     . ILE B 212 ? 0.0368 0.0413 0.0421 -0.0016 -0.0018 -0.0010 319  ILE B C     
3540 O O     . ILE B 212 ? 0.0454 0.0434 0.0521 0.0001  0.0023  0.0031  319  ILE B O     
3541 C CB    . ILE B 212 ? 0.0521 0.0566 0.0588 -0.0015 -0.0003 -0.0014 319  ILE B CB    
3542 C CG1   . ILE B 212 ? 0.0800 0.0732 0.0804 0.0009  0.0009  -0.0047 319  ILE B CG1   
3543 C CG2   . ILE B 212 ? 0.0592 0.0570 0.0629 0.0002  0.0039  0.0018  319  ILE B CG2   
3544 C CD1   . ILE B 212 ? 0.1177 0.1036 0.0983 -0.0014 0.0050  0.0007  319  ILE B CD1   
3545 N N     . ARG B 213 ? 0.0294 0.0333 0.0325 -0.0026 -0.0021 -0.0010 320  ARG B N     
3546 C CA    . ARG B 213 ? 0.0286 0.0318 0.0315 -0.0011 -0.0016 0.0002  320  ARG B CA    
3547 C C     . ARG B 213 ? 0.0316 0.0306 0.0286 -0.0013 -0.0008 -0.0020 320  ARG B C     
3548 O O     . ARG B 213 ? 0.0268 0.0267 0.0283 0.0005  -0.0020 -0.0001 320  ARG B O     
3549 C CB    . ARG B 213 ? 0.0304 0.0309 0.0316 -0.0007 -0.0008 0.0012  320  ARG B CB    
3550 C CG    . ARG B 213 ? 0.0321 0.0319 0.0306 -0.0004 0.0004  0.0016  320  ARG B CG    
3551 C CD    . ARG B 213 ? 0.0318 0.0298 0.0268 -0.0005 -0.0027 0.0015  320  ARG B CD    
3552 N NE    . ARG B 213 ? 0.0334 0.0318 0.0266 0.0008  -0.0008 0.0026  320  ARG B NE    
3553 C CZ    . ARG B 213 ? 0.0303 0.0286 0.0257 -0.0004 -0.0007 0.0010  320  ARG B CZ    
3554 N NH1   . ARG B 213 ? 0.0372 0.0309 0.0265 -0.0044 0.0028  -0.0012 320  ARG B NH1   
3555 N NH2   . ARG B 213 ? 0.0257 0.0311 0.0254 -0.0015 -0.0001 0.0007  320  ARG B NH2   
3556 N N     . THR B 214 ? 0.0263 0.0293 0.0266 -0.0006 -0.0011 0.0007  321  THR B N     
3557 C CA    . THR B 214 ? 0.0291 0.0309 0.0276 -0.0012 -0.0023 -0.0012 321  THR B CA    
3558 C C     . THR B 214 ? 0.0349 0.0357 0.0338 -0.0012 -0.0012 -0.0014 321  THR B C     
3559 O O     . THR B 214 ? 0.0314 0.0309 0.0271 -0.0030 -0.0024 -0.0006 321  THR B O     
3560 C CB    . THR B 214 ? 0.0284 0.0286 0.0270 -0.0022 -0.0014 -0.0002 321  THR B CB    
3561 O OG1   . THR B 214 ? 0.0282 0.0278 0.0253 -0.0027 0.0001  -0.0001 321  THR B OG1   
3562 C CG2   . THR B 214 ? 0.0318 0.0330 0.0307 -0.0017 -0.0021 -0.0017 321  THR B CG2   
3563 N N     . LEU B 215 ? 0.0411 0.0422 0.0354 -0.0008 -0.0015 0.0001  322  LEU B N     
3564 C CA    . LEU B 215 ? 0.0512 0.0482 0.0484 -0.0001 0.0004  -0.0002 322  LEU B CA    
3565 C C     . LEU B 215 ? 0.0429 0.0443 0.0458 -0.0006 -0.0019 -0.0008 322  LEU B C     
3566 O O     . LEU B 215 ? 0.0384 0.0409 0.0475 -0.0030 -0.0034 -0.0031 322  LEU B O     
3567 C CB    . LEU B 215 ? 0.0558 0.0560 0.0534 0.0031  -0.0001 0.0031  322  LEU B CB    
3568 C CG    . LEU B 215 ? 0.0893 0.0863 0.0892 -0.0012 0.0018  -0.0026 322  LEU B CG    
3569 C CD1   . LEU B 215 ? 0.1140 0.1029 0.1137 0.0026  0.0028  0.0045  322  LEU B CD1   
3570 C CD2   . LEU B 215 ? 0.0977 0.0933 0.0908 -0.0013 0.0021  0.0014  322  LEU B CD2   
3571 N N     . ARG B 216 ? 0.0429 0.0430 0.0445 0.0004  -0.0013 -0.0010 323  ARG B N     
3572 C CA    . ARG B 216 ? 0.0424 0.0442 0.0439 0.0000  -0.0025 -0.0006 323  ARG B CA    
3573 C C     . ARG B 216 ? 0.0343 0.0388 0.0387 -0.0005 -0.0018 -0.0009 323  ARG B C     
3574 O O     . ARG B 216 ? 0.0269 0.0344 0.0333 -0.0010 -0.0032 -0.0012 323  ARG B O     
3575 C CB    . ARG B 216 ? 0.0498 0.0499 0.0490 -0.0020 -0.0028 -0.0001 323  ARG B CB    
3576 C CG    . ARG B 216 ? 0.0689 0.0743 0.0711 0.0030  -0.0028 -0.0049 323  ARG B CG    
3577 C CD    . ARG B 216 ? 0.1236 0.1113 0.1062 0.0009  0.0026  0.0059  323  ARG B CD    
3578 N NE    . ARG B 216 ? 0.1394 0.1416 0.1417 0.0077  0.0046  0.0039  323  ARG B NE    
3579 C CZ    . ARG B 216 ? 0.1529 0.1540 0.1566 -0.0031 -0.0034 -0.0047 323  ARG B CZ    
3580 N NH1   . ARG B 216 ? 0.1631 0.1607 0.1583 -0.0009 0.0004  0.0017  323  ARG B NH1   
3581 N NH2   . ARG B 216 ? 0.1686 0.1727 0.1708 -0.0011 0.0037  -0.0029 323  ARG B NH2   
3582 N N     . ALA B 217 ? 0.0351 0.0345 0.0331 -0.0004 -0.0010 -0.0012 324  ALA B N     
3583 C CA    . ALA B 217 ? 0.0350 0.0351 0.0356 -0.0002 0.0002  0.0000  324  ALA B CA    
3584 C C     . ALA B 217 ? 0.0396 0.0366 0.0354 0.0008  0.0013  -0.0002 324  ALA B C     
3585 O O     . ALA B 217 ? 0.0460 0.0428 0.0414 0.0001  0.0036  0.0000  324  ALA B O     
3586 C CB    . ALA B 217 ? 0.0372 0.0350 0.0299 0.0005  -0.0004 0.0001  324  ALA B CB    
3587 N N     . VAL B 218 ? 0.0311 0.0361 0.0333 0.0005  -0.0017 0.0006  325  VAL B N     
3588 C CA    . VAL B 218 ? 0.0314 0.0350 0.0290 0.0005  -0.0036 0.0000  325  VAL B CA    
3589 C C     . VAL B 218 ? 0.0300 0.0375 0.0347 0.0009  -0.0043 0.0009  325  VAL B C     
3590 O O     . VAL B 218 ? 0.0274 0.0365 0.0330 0.0014  -0.0039 -0.0014 325  VAL B O     
3591 C CB    . VAL B 218 ? 0.0289 0.0363 0.0346 0.0005  -0.0031 0.0002  325  VAL B CB    
3592 C CG1   . VAL B 218 ? 0.0335 0.0388 0.0330 0.0001  -0.0023 -0.0013 325  VAL B CG1   
3593 C CG2   . VAL B 218 ? 0.0297 0.0319 0.0259 0.0001  -0.0016 -0.0002 325  VAL B CG2   
3594 N N     . GLU B 219 ? 0.0395 0.0431 0.0385 0.0012  -0.0026 0.0001  326  GLU B N     
3595 C CA    . GLU B 219 ? 0.0480 0.0522 0.0513 0.0000  -0.0014 -0.0006 326  GLU B CA    
3596 C C     . GLU B 219 ? 0.0437 0.0476 0.0439 -0.0002 -0.0020 0.0000  326  GLU B C     
3597 O O     . GLU B 219 ? 0.0419 0.0470 0.0446 -0.0021 -0.0032 -0.0014 326  GLU B O     
3598 C CB    . GLU B 219 ? 0.0502 0.0626 0.0555 -0.0027 -0.0045 0.0000  326  GLU B CB    
3599 C CG    . GLU B 219 ? 0.0926 0.0893 0.1033 0.0000  0.0061  -0.0070 326  GLU B CG    
3600 C CD    . GLU B 219 ? 0.1311 0.1258 0.1228 0.0005  0.0005  0.0023  326  GLU B CD    
3601 O OE1   . GLU B 219 ? 0.1303 0.1316 0.1471 0.0042  0.0008  -0.0003 326  GLU B OE1   
3602 O OE2   . GLU B 219 ? 0.1417 0.1373 0.1355 0.0023  0.0053  -0.0011 326  GLU B OE2   
3603 N N     . ALA B 220 ? 0.0399 0.0428 0.0410 -0.0004 -0.0016 -0.0003 327  ALA B N     
3604 C CA    . ALA B 220 ? 0.0396 0.0406 0.0388 -0.0005 -0.0006 -0.0010 327  ALA B CA    
3605 C C     . ALA B 220 ? 0.0386 0.0401 0.0419 -0.0003 0.0000  -0.0002 327  ALA B C     
3606 O O     . ALA B 220 ? 0.0370 0.0379 0.0389 -0.0003 -0.0004 -0.0023 327  ALA B O     
3607 C CB    . ALA B 220 ? 0.0423 0.0428 0.0430 0.0013  0.0001  0.0011  327  ALA B CB    
3608 N N     . ASP B 221 ? 0.0383 0.0382 0.0355 -0.0007 -0.0009 -0.0014 328  ASP B N     
3609 C CA    . ASP B 221 ? 0.0378 0.0397 0.0393 0.0007  0.0000  0.0003  328  ASP B CA    
3610 C C     . ASP B 221 ? 0.0389 0.0401 0.0347 -0.0007 -0.0006 -0.0003 328  ASP B C     
3611 O O     . ASP B 221 ? 0.0474 0.0472 0.0387 0.0021  -0.0002 0.0005  328  ASP B O     
3612 C CB    . ASP B 221 ? 0.0397 0.0383 0.0370 -0.0006 0.0003  -0.0018 328  ASP B CB    
3613 C CG    . ASP B 221 ? 0.0355 0.0383 0.0403 0.0027  -0.0006 0.0007  328  ASP B CG    
3614 O OD1   . ASP B 221 ? 0.0529 0.0394 0.0462 -0.0024 0.0011  -0.0036 328  ASP B OD1   
3615 O OD2   . ASP B 221 ? 0.0283 0.0366 0.0304 -0.0017 -0.0028 -0.0021 328  ASP B OD2   
3616 N N     . GLU B 222 ? 0.0384 0.0393 0.0332 0.0019  -0.0005 0.0018  329  GLU B N     
3617 C CA    . GLU B 222 ? 0.0391 0.0394 0.0371 0.0005  -0.0007 0.0010  329  GLU B CA    
3618 C C     . GLU B 222 ? 0.0350 0.0384 0.0341 0.0016  -0.0009 0.0016  329  GLU B C     
3619 O O     . GLU B 222 ? 0.0353 0.0366 0.0271 0.0024  -0.0029 0.0025  329  GLU B O     
3620 C CB    . GLU B 222 ? 0.0377 0.0392 0.0345 0.0015  -0.0019 0.0002  329  GLU B CB    
3621 C CG    . GLU B 222 ? 0.0490 0.0479 0.0449 0.0020  -0.0014 0.0015  329  GLU B CG    
3622 C CD    . GLU B 222 ? 0.0572 0.0528 0.0494 0.0029  0.0020  -0.0012 329  GLU B CD    
3623 O OE1   . GLU B 222 ? 0.0458 0.0476 0.0439 -0.0034 -0.0055 -0.0019 329  GLU B OE1   
3624 O OE2   . GLU B 222 ? 0.0659 0.0656 0.0646 0.0004  -0.0048 -0.0044 329  GLU B OE2   
3625 N N     . GLU B 223 ? 0.0381 0.0391 0.0372 0.0001  0.0002  0.0007  330  GLU B N     
3626 C CA    . GLU B 223 ? 0.0395 0.0406 0.0412 -0.0006 0.0011  0.0003  330  GLU B CA    
3627 C C     . GLU B 223 ? 0.0384 0.0386 0.0395 -0.0005 -0.0001 0.0005  330  GLU B C     
3628 O O     . GLU B 223 ? 0.0376 0.0411 0.0471 -0.0022 0.0023  0.0005  330  GLU B O     
3629 C CB    . GLU B 223 ? 0.0469 0.0425 0.0395 -0.0002 0.0005  0.0003  330  GLU B CB    
3630 C CG    . GLU B 223 ? 0.0374 0.0469 0.0491 -0.0021 -0.0008 -0.0007 330  GLU B CG    
3631 C CD    . GLU B 223 ? 0.0508 0.0565 0.0520 0.0009  -0.0025 -0.0022 330  GLU B CD    
3632 O OE1   . GLU B 223 ? 0.0682 0.0718 0.0937 -0.0034 0.0073  0.0018  330  GLU B OE1   
3633 O OE2   . GLU B 223 ? 0.0384 0.0515 0.0488 0.0023  -0.0007 -0.0025 330  GLU B OE2   
3634 N N     . LEU B 224 ? 0.0364 0.0388 0.0419 -0.0008 0.0030  -0.0004 331  LEU B N     
3635 C CA    . LEU B 224 ? 0.0310 0.0349 0.0317 0.0009  -0.0022 0.0003  331  LEU B CA    
3636 C C     . LEU B 224 ? 0.0283 0.0314 0.0317 -0.0003 0.0000  -0.0011 331  LEU B C     
3637 O O     . LEU B 224 ? 0.0258 0.0293 0.0293 -0.0012 -0.0006 0.0000  331  LEU B O     
3638 C CB    . LEU B 224 ? 0.0320 0.0388 0.0419 -0.0001 -0.0010 -0.0009 331  LEU B CB    
3639 C CG    . LEU B 224 ? 0.0536 0.0546 0.0515 0.0011  0.0010  0.0008  331  LEU B CG    
3640 C CD1   . LEU B 224 ? 0.0713 0.0637 0.0721 -0.0011 0.0039  0.0000  331  LEU B CD1   
3641 C CD2   . LEU B 224 ? 0.0584 0.0617 0.0645 -0.0004 0.0016  -0.0013 331  LEU B CD2   
3642 N N     . THR B 225 ? 0.0271 0.0270 0.0256 -0.0008 -0.0006 0.0004  332  THR B N     
3643 C CA    . THR B 225 ? 0.0254 0.0276 0.0254 0.0003  0.0000  0.0000  332  THR B CA    
3644 C C     . THR B 225 ? 0.0264 0.0279 0.0255 0.0012  0.0002  0.0005  332  THR B C     
3645 O O     . THR B 225 ? 0.0270 0.0321 0.0341 0.0024  0.0031  0.0015  332  THR B O     
3646 C CB    . THR B 225 ? 0.0258 0.0275 0.0254 0.0007  0.0000  0.0002  332  THR B CB    
3647 O OG1   . THR B 225 ? 0.0342 0.0347 0.0285 0.0013  -0.0021 0.0005  332  THR B OG1   
3648 C CG2   . THR B 225 ? 0.0275 0.0315 0.0257 0.0001  -0.0010 0.0000  332  THR B CG2   
3649 N N     . VAL B 226 ? 0.0260 0.0280 0.0273 0.0001  -0.0011 0.0005  333  VAL B N     
3650 C CA    . VAL B 226 ? 0.0301 0.0334 0.0300 0.0000  -0.0016 0.0000  333  VAL B CA    
3651 C C     . VAL B 226 ? 0.0276 0.0304 0.0268 -0.0008 -0.0018 0.0001  333  VAL B C     
3652 O O     . VAL B 226 ? 0.0271 0.0299 0.0260 -0.0011 -0.0011 0.0009  333  VAL B O     
3653 C CB    . VAL B 226 ? 0.0342 0.0353 0.0313 -0.0014 -0.0038 0.0001  333  VAL B CB    
3654 C CG1   . VAL B 226 ? 0.0447 0.0487 0.0585 -0.0018 0.0057  -0.0003 333  VAL B CG1   
3655 C CG2   . VAL B 226 ? 0.0493 0.0456 0.0493 -0.0028 0.0002  0.0019  333  VAL B CG2   
3656 N N     . ALA B 227 ? 0.0299 0.0338 0.0307 0.0014  -0.0006 0.0008  334  ALA B N     
3657 C CA    . ALA B 227 ? 0.0371 0.0385 0.0368 0.0000  0.0005  0.0006  334  ALA B CA    
3658 C C     . ALA B 227 ? 0.0403 0.0433 0.0424 -0.0014 0.0012  -0.0012 334  ALA B C     
3659 O O     . ALA B 227 ? 0.0492 0.0547 0.0513 -0.0054 0.0020  -0.0016 334  ALA B O     
3660 C CB    . ALA B 227 ? 0.0349 0.0391 0.0373 0.0011  0.0009  0.0016  334  ALA B CB    
3661 N N     . TYR B 228 ? 0.0389 0.0407 0.0441 0.0000  0.0016  -0.0004 335  TYR B N     
3662 C CA    . TYR B 228 ? 0.0364 0.0394 0.0368 -0.0006 -0.0009 0.0000  335  TYR B CA    
3663 C C     . TYR B 228 ? 0.0381 0.0426 0.0433 -0.0011 -0.0012 -0.0014 335  TYR B C     
3664 O O     . TYR B 228 ? 0.0448 0.0450 0.0455 -0.0008 0.0006  -0.0009 335  TYR B O     
3665 C CB    . TYR B 228 ? 0.0321 0.0370 0.0366 -0.0006 -0.0003 0.0002  335  TYR B CB    
3666 C CG    . TYR B 228 ? 0.0302 0.0291 0.0277 -0.0019 -0.0002 -0.0026 335  TYR B CG    
3667 C CD1   . TYR B 228 ? 0.0254 0.0350 0.0323 -0.0009 -0.0006 0.0028  335  TYR B CD1   
3668 C CD2   . TYR B 228 ? 0.0255 0.0268 0.0255 -0.0005 -0.0002 0.0005  335  TYR B CD2   
3669 C CE1   . TYR B 228 ? 0.0294 0.0276 0.0254 -0.0013 -0.0004 -0.0003 335  TYR B CE1   
3670 C CE2   . TYR B 228 ? 0.0306 0.0283 0.0286 -0.0008 -0.0020 -0.0023 335  TYR B CE2   
3671 C CZ    . TYR B 228 ? 0.0261 0.0273 0.0256 0.0010  0.0000  0.0004  335  TYR B CZ    
3672 O OH    . TYR B 228 ? 0.0308 0.0349 0.0363 -0.0010 0.0009  -0.0013 335  TYR B OH    
3673 N N     . GLY B 229 ? 0.0398 0.0434 0.0422 -0.0018 -0.0038 -0.0004 336  GLY B N     
3674 C CA    . GLY B 229 ? 0.0451 0.0496 0.0479 -0.0003 -0.0008 -0.0011 336  GLY B CA    
3675 C C     . GLY B 229 ? 0.0520 0.0568 0.0534 -0.0017 -0.0027 -0.0012 336  GLY B C     
3676 O O     . GLY B 229 ? 0.0507 0.0601 0.0585 -0.0054 0.0002  -0.0040 336  GLY B O     
3677 N N     . TYR B 230 ? 0.0538 0.0646 0.0606 -0.0006 -0.0029 -0.0023 337  TYR B N     
3678 C CA    . TYR B 230 ? 0.0734 0.0761 0.0713 0.0003  -0.0013 -0.0009 337  TYR B CA    
3679 C C     . TYR B 230 ? 0.0929 0.0923 0.0929 0.0014  -0.0009 0.0000  337  TYR B C     
3680 O O     . TYR B 230 ? 0.0853 0.0871 0.0819 0.0026  -0.0051 -0.0008 337  TYR B O     
3681 C CB    . TYR B 230 ? 0.0732 0.0723 0.0678 -0.0010 -0.0006 -0.0008 337  TYR B CB    
3682 C CG    . TYR B 230 ? 0.0629 0.0656 0.0676 0.0010  -0.0008 0.0011  337  TYR B CG    
3683 C CD1   . TYR B 230 ? 0.0621 0.0616 0.0611 -0.0027 0.0013  -0.0017 337  TYR B CD1   
3684 C CD2   . TYR B 230 ? 0.0562 0.0633 0.0585 0.0012  -0.0013 0.0003  337  TYR B CD2   
3685 C CE1   . TYR B 230 ? 0.0595 0.0598 0.0516 -0.0005 -0.0022 -0.0011 337  TYR B CE1   
3686 C CE2   . TYR B 230 ? 0.0643 0.0618 0.0589 -0.0017 0.0001  0.0000  337  TYR B CE2   
3687 C CZ    . TYR B 230 ? 0.0635 0.0648 0.0633 -0.0011 0.0001  0.0006  337  TYR B CZ    
3688 O OH    . TYR B 230 ? 0.0672 0.0719 0.0687 -0.0021 -0.0013 -0.0020 337  TYR B OH    
3689 N N     . ASP B 231 ? 0.1137 0.1169 0.1114 -0.0005 -0.0029 -0.0018 338  ASP B N     
3690 C CA    . ASP B 231 ? 0.1397 0.1395 0.1386 0.0015  -0.0019 0.0007  338  ASP B CA    
3691 C C     . ASP B 231 ? 0.1455 0.1492 0.1441 -0.0006 -0.0027 0.0003  338  ASP B C     
3692 O O     . ASP B 231 ? 0.1520 0.1510 0.1496 -0.0010 0.0014  0.0001  338  ASP B O     
3693 C CB    . ASP B 231 ? 0.1486 0.1466 0.1473 -0.0001 -0.0026 -0.0019 338  ASP B CB    
3694 C CG    . ASP B 231 ? 0.1801 0.1875 0.1918 -0.0034 0.0062  0.0017  338  ASP B CG    
3695 O OD1   . ASP B 231 ? 0.2117 0.2071 0.2334 -0.0087 0.0054  -0.0075 338  ASP B OD1   
3696 O OD2   . ASP B 231 ? 0.2184 0.2205 0.2146 0.0032  0.0095  -0.0044 338  ASP B OD2   
3697 N N     . HIS B 232 ? 0.1587 0.1608 0.1559 0.0018  -0.0050 0.0006  339  HIS B N     
3698 C CA    . HIS B 232 ? 0.1719 0.1744 0.1728 0.0000  -0.0025 0.0010  339  HIS B CA    
3699 C C     . HIS B 232 ? 0.1964 0.1936 0.1866 0.0012  -0.0012 0.0022  339  HIS B C     
3700 O O     . HIS B 232 ? 0.2007 0.1937 0.1900 -0.0017 -0.0019 0.0007  339  HIS B O     
3701 C CB    . HIS B 232 ? 0.1708 0.1727 0.1710 0.0020  -0.0031 0.0026  339  HIS B CB    
3702 C CG    . HIS B 232 ? 0.1751 0.1740 0.1703 -0.0007 -0.0010 -0.0012 339  HIS B CG    
3703 N ND1   . HIS B 232 ? 0.1774 0.1777 0.1779 0.0024  -0.0003 -0.0008 339  HIS B ND1   
3704 C CD2   . HIS B 232 ? 0.1676 0.1694 0.1677 0.0001  -0.0019 -0.0004 339  HIS B CD2   
3705 C CE1   . HIS B 232 ? 0.1784 0.1754 0.1730 -0.0013 -0.0001 -0.0019 339  HIS B CE1   
3706 N NE2   . HIS B 232 ? 0.1758 0.1749 0.1704 -0.0004 0.0009  -0.0014 339  HIS B NE2   
3707 N N     . SER B 233 ? 0.2132 0.2133 0.2152 -0.0015 -0.0022 0.0006  340  SER B N     
3708 C CA    . SER B 233 ? 0.2336 0.2340 0.2314 -0.0007 -0.0021 0.0013  340  SER B CA    
3709 C C     . SER B 233 ? 0.2535 0.2537 0.2547 0.0009  0.0012  -0.0007 340  SER B C     
3710 O O     . SER B 233 ? 0.2609 0.2589 0.2629 0.0011  0.0016  0.0026  340  SER B O     
3711 C CB    . SER B 233 ? 0.2318 0.2326 0.2306 -0.0002 -0.0019 0.0010  340  SER B CB    
3712 O OG    . SER B 233 ? 0.2309 0.2329 0.2322 -0.0056 -0.0019 -0.0033 340  SER B OG    
3713 N N     . PRO B 234 ? 0.2762 0.2753 0.2749 0.0005  0.0003  0.0021  341  PRO B N     
3714 C CA    . PRO B 234 ? 0.2893 0.2893 0.2882 0.0009  0.0019  0.0009  341  PRO B CA    
3715 C C     . PRO B 234 ? 0.3016 0.2996 0.3018 -0.0002 0.0000  -0.0001 341  PRO B C     
3716 O O     . PRO B 234 ? 0.3133 0.3047 0.3145 -0.0001 0.0042  0.0011  341  PRO B O     
3717 C CB    . PRO B 234 ? 0.2886 0.2882 0.2894 0.0011  0.0015  0.0009  341  PRO B CB    
3718 C CG    . PRO B 234 ? 0.2873 0.2859 0.2852 -0.0005 0.0031  0.0007  341  PRO B CG    
3719 C CD    . PRO B 234 ? 0.2781 0.2772 0.2763 0.0005  -0.0004 0.0010  341  PRO B CD    
3720 N N     . PRO B 235 ? 0.3163 0.3145 0.3158 0.0000  0.0014  0.0000  342  PRO B N     
3721 C CA    . PRO B 235 ? 0.3227 0.3198 0.3221 0.0000  0.0015  -0.0008 342  PRO B CA    
3722 C C     . PRO B 235 ? 0.3258 0.3247 0.3254 -0.0006 0.0013  -0.0003 342  PRO B C     
3723 O O     . PRO B 235 ? 0.3297 0.3268 0.3246 0.0014  0.0005  0.0006  342  PRO B O     
3724 C CB    . PRO B 235 ? 0.3207 0.3200 0.3229 0.0001  0.0002  0.0000  342  PRO B CB    
3725 C CG    . PRO B 235 ? 0.3184 0.3186 0.3212 -0.0004 0.0003  -0.0015 342  PRO B CG    
3726 C CD    . PRO B 235 ? 0.3164 0.3165 0.3160 0.0006  0.0003  0.0009  342  PRO B CD    
3727 N N     . GLY B 236 ? 0.3285 0.3285 0.3283 0.0008  0.0004  0.0008  343  GLY B N     
3728 C CA    . GLY B 236 ? 0.3308 0.3306 0.3317 -0.0004 0.0005  -0.0002 343  GLY B CA    
3729 C C     . GLY B 236 ? 0.3323 0.3321 0.3320 0.0001  0.0002  0.0000  343  GLY B C     
3730 O O     . GLY B 236 ? 0.3374 0.3355 0.3396 -0.0012 0.0025  -0.0008 343  GLY B O     
3731 N N     . LYS B 237 ? 0.3327 0.3324 0.3333 0.0000  0.0003  -0.0004 344  LYS B N     
3732 C CA    . LYS B 237 ? 0.3318 0.3309 0.3306 0.0001  0.0000  0.0001  344  LYS B CA    
3733 C C     . LYS B 237 ? 0.3273 0.3270 0.3262 -0.0005 0.0002  -0.0007 344  LYS B C     
3734 O O     . LYS B 237 ? 0.3347 0.3287 0.3309 -0.0001 0.0038  -0.0003 344  LYS B O     
3735 C CB    . LYS B 237 ? 0.3334 0.3335 0.3346 -0.0005 -0.0002 -0.0004 344  LYS B CB    
3736 C CG    . LYS B 237 ? 0.3403 0.3405 0.3422 0.0000  0.0017  -0.0010 344  LYS B CG    
3737 C CD    . LYS B 237 ? 0.3442 0.3468 0.3463 0.0000  -0.0006 0.0000  344  LYS B CD    
3738 C CE    . LYS B 237 ? 0.3498 0.3487 0.3483 -0.0006 0.0000  0.0000  344  LYS B CE    
3739 N NZ    . LYS B 237 ? 0.3487 0.3519 0.3552 0.0016  -0.0009 -0.0002 344  LYS B NZ    
3740 N N     . SER B 238 ? 0.3203 0.3191 0.3189 0.0004  0.0005  0.0009  345  SER B N     
3741 C CA    . SER B 238 ? 0.3139 0.3138 0.3144 -0.0006 0.0006  -0.0004 345  SER B CA    
3742 C C     . SER B 238 ? 0.3053 0.3031 0.3050 -0.0011 0.0021  0.0006  345  SER B C     
3743 O O     . SER B 238 ? 0.3133 0.3082 0.3124 -0.0008 0.0027  0.0014  345  SER B O     
3744 C CB    . SER B 238 ? 0.3145 0.3144 0.3148 -0.0007 0.0005  -0.0007 345  SER B CB    
3745 O OG    . SER B 238 ? 0.3229 0.3221 0.3214 0.0009  0.0010  0.0017  345  SER B OG    
3746 N N     . GLY B 239 ? 0.2894 0.2896 0.2898 0.0000  0.0001  -0.0013 346  GLY B N     
3747 C CA    . GLY B 239 ? 0.2750 0.2725 0.2727 0.0005  0.0000  -0.0010 346  GLY B CA    
3748 C C     . GLY B 239 ? 0.2562 0.2602 0.2576 0.0000  -0.0023 0.0000  346  GLY B C     
3749 O O     . GLY B 239 ? 0.2572 0.2582 0.2556 -0.0004 -0.0016 -0.0016 346  GLY B O     
3750 N N     . PRO B 240 ? 0.2420 0.2406 0.2430 0.0007  0.0009  -0.0013 347  PRO B N     
3751 C CA    . PRO B 240 ? 0.2225 0.2268 0.2230 0.0003  -0.0010 0.0003  347  PRO B CA    
3752 C C     . PRO B 240 ? 0.2038 0.2062 0.2052 0.0007  -0.0044 -0.0015 347  PRO B C     
3753 O O     . PRO B 240 ? 0.1947 0.2046 0.1985 0.0007  -0.0073 -0.0031 347  PRO B O     
3754 C CB    . PRO B 240 ? 0.2277 0.2304 0.2314 0.0003  0.0011  -0.0004 347  PRO B CB    
3755 C CG    . PRO B 240 ? 0.2373 0.2370 0.2376 0.0009  0.0010  -0.0014 347  PRO B CG    
3756 C CD    . PRO B 240 ? 0.2411 0.2431 0.2445 0.0007  0.0000  -0.0005 347  PRO B CD    
3757 N N     . GLU B 241 ? 0.1830 0.1901 0.1836 -0.0003 -0.0031 0.0017  348  GLU B N     
3758 C CA    . GLU B 241 ? 0.1724 0.1760 0.1743 0.0000  -0.0027 -0.0005 348  GLU B CA    
3759 C C     . GLU B 241 ? 0.1477 0.1539 0.1530 0.0018  -0.0010 0.0017  348  GLU B C     
3760 O O     . GLU B 241 ? 0.1462 0.1554 0.1601 0.0014  0.0012  -0.0011 348  GLU B O     
3761 C CB    . GLU B 241 ? 0.1791 0.1785 0.1769 0.0014  -0.0002 0.0014  348  GLU B CB    
3762 C CG    . GLU B 241 ? 0.1947 0.2016 0.1964 0.0028  -0.0035 -0.0002 348  GLU B CG    
3763 C CD    . GLU B 241 ? 0.2234 0.2241 0.2357 -0.0036 -0.0008 -0.0009 348  GLU B CD    
3764 O OE1   . GLU B 241 ? 0.2553 0.2516 0.2580 -0.0004 0.0060  0.0075  348  GLU B OE1   
3765 O OE2   . GLU B 241 ? 0.2516 0.2500 0.2482 -0.0062 0.0029  -0.0036 348  GLU B OE2   
3766 N N     . ALA B 242 ? 0.1305 0.1314 0.1267 0.0000  -0.0037 -0.0003 349  ALA B N     
3767 C CA    . ALA B 242 ? 0.1068 0.1118 0.1101 0.0015  -0.0022 0.0009  349  ALA B CA    
3768 C C     . ALA B 242 ? 0.0996 0.1008 0.0964 0.0005  -0.0030 0.0009  349  ALA B C     
3769 O O     . ALA B 242 ? 0.0908 0.1001 0.0915 -0.0024 -0.0063 -0.0046 349  ALA B O     
3770 C CB    . ALA B 242 ? 0.1020 0.1088 0.1000 0.0018  -0.0052 -0.0001 349  ALA B CB    
3771 N N     . PRO B 243 ? 0.0844 0.0894 0.0828 0.0012  -0.0021 0.0001  350  PRO B N     
3772 C CA    . PRO B 243 ? 0.0803 0.0814 0.0758 0.0004  -0.0019 0.0005  350  PRO B CA    
3773 C C     . PRO B 243 ? 0.0788 0.0779 0.0745 0.0015  0.0009  0.0007  350  PRO B C     
3774 O O     . PRO B 243 ? 0.0874 0.0811 0.0870 0.0025  0.0054  0.0015  350  PRO B O     
3775 C CB    . PRO B 243 ? 0.0831 0.0820 0.0744 0.0003  -0.0006 0.0010  350  PRO B CB    
3776 C CG    . PRO B 243 ? 0.0776 0.0823 0.0720 0.0000  -0.0043 0.0007  350  PRO B CG    
3777 C CD    . PRO B 243 ? 0.0846 0.0871 0.0877 0.0016  0.0000  0.0014  350  PRO B CD    
3778 N N     . GLU B 244 ? 0.0682 0.0671 0.0659 0.0003  -0.0009 0.0000  351  GLU B N     
3779 C CA    . GLU B 244 ? 0.0630 0.0626 0.0629 0.0005  -0.0006 -0.0008 351  GLU B CA    
3780 C C     . GLU B 244 ? 0.0534 0.0536 0.0523 0.0013  -0.0010 0.0008  351  GLU B C     
3781 O O     . GLU B 244 ? 0.0476 0.0498 0.0471 -0.0002 -0.0016 -0.0005 351  GLU B O     
3782 C CB    . GLU B 244 ? 0.0677 0.0658 0.0657 0.0003  0.0015  -0.0003 351  GLU B CB    
3783 C CG    . GLU B 244 ? 0.0717 0.0711 0.0775 -0.0014 0.0019  -0.0010 351  GLU B CG    
3784 C CD    . GLU B 244 ? 0.0766 0.0748 0.0710 -0.0025 -0.0004 -0.0015 351  GLU B CD    
3785 O OE1   . GLU B 244 ? 0.0680 0.0791 0.0823 0.0014  -0.0006 0.0063  351  GLU B OE1   
3786 O OE2   . GLU B 244 ? 0.0746 0.0775 0.0716 -0.0035 -0.0002 -0.0005 351  GLU B OE2   
3787 N N     . TRP B 245 ? 0.0468 0.0454 0.0447 -0.0005 -0.0004 -0.0011 352  TRP B N     
3788 C CA    . TRP B 245 ? 0.0351 0.0374 0.0347 0.0002  -0.0014 0.0009  352  TRP B CA    
3789 C C     . TRP B 245 ? 0.0340 0.0335 0.0341 -0.0006 -0.0002 0.0007  352  TRP B C     
3790 O O     . TRP B 245 ? 0.0271 0.0321 0.0325 -0.0003 -0.0035 -0.0002 352  TRP B O     
3791 C CB    . TRP B 245 ? 0.0396 0.0369 0.0335 0.0004  -0.0015 0.0008  352  TRP B CB    
3792 C CG    . TRP B 245 ? 0.0282 0.0328 0.0280 0.0001  -0.0028 0.0000  352  TRP B CG    
3793 C CD1   . TRP B 245 ? 0.0333 0.0306 0.0335 0.0022  -0.0009 0.0036  352  TRP B CD1   
3794 C CD2   . TRP B 245 ? 0.0274 0.0307 0.0293 0.0008  -0.0023 0.0016  352  TRP B CD2   
3795 N NE1   . TRP B 245 ? 0.0267 0.0335 0.0456 -0.0009 0.0002  -0.0012 352  TRP B NE1   
3796 C CE2   . TRP B 245 ? 0.0268 0.0315 0.0278 -0.0001 -0.0019 0.0000  352  TRP B CE2   
3797 C CE3   . TRP B 245 ? 0.0316 0.0265 0.0353 -0.0001 0.0022  0.0018  352  TRP B CE3   
3798 C CZ2   . TRP B 245 ? 0.0266 0.0348 0.0299 0.0000  -0.0024 0.0012  352  TRP B CZ2   
3799 C CZ3   . TRP B 245 ? 0.0411 0.0348 0.0421 0.0001  0.0060  0.0004  352  TRP B CZ3   
3800 C CH2   . TRP B 245 ? 0.0445 0.0395 0.0494 -0.0004 0.0053  -0.0015 352  TRP B CH2   
3801 N N     . TYR B 246 ? 0.0283 0.0305 0.0281 -0.0003 -0.0028 -0.0003 353  TYR B N     
3802 C CA    . TYR B 246 ? 0.0293 0.0288 0.0265 -0.0004 -0.0020 -0.0005 353  TYR B CA    
3803 C C     . TYR B 246 ? 0.0304 0.0317 0.0309 -0.0003 -0.0010 -0.0008 353  TYR B C     
3804 O O     . TYR B 246 ? 0.0306 0.0319 0.0344 -0.0008 -0.0028 -0.0014 353  TYR B O     
3805 C CB    . TYR B 246 ? 0.0294 0.0284 0.0258 0.0015  -0.0001 0.0010  353  TYR B CB    
3806 C CG    . TYR B 246 ? 0.0351 0.0286 0.0270 -0.0001 0.0017  0.0000  353  TYR B CG    
3807 C CD1   . TYR B 246 ? 0.0375 0.0351 0.0254 0.0000  0.0007  0.0005  353  TYR B CD1   
3808 C CD2   . TYR B 246 ? 0.0288 0.0314 0.0259 -0.0016 -0.0010 -0.0006 353  TYR B CD2   
3809 C CE1   . TYR B 246 ? 0.0358 0.0327 0.0265 -0.0001 -0.0006 -0.0017 353  TYR B CE1   
3810 C CE2   . TYR B 246 ? 0.0401 0.0351 0.0278 0.0016  0.0000  -0.0014 353  TYR B CE2   
3811 C CZ    . TYR B 246 ? 0.0383 0.0327 0.0338 -0.0010 -0.0002 -0.0003 353  TYR B CZ    
3812 O OH    . TYR B 246 ? 0.0492 0.0492 0.0488 -0.0013 0.0054  -0.0053 353  TYR B OH    
3813 N N     . GLN B 247 ? 0.0309 0.0338 0.0315 -0.0017 -0.0021 -0.0009 354  GLN B N     
3814 C CA    . GLN B 247 ? 0.0350 0.0369 0.0348 0.0000  -0.0022 0.0001  354  GLN B CA    
3815 C C     . GLN B 247 ? 0.0361 0.0374 0.0333 0.0004  -0.0016 0.0009  354  GLN B C     
3816 O O     . GLN B 247 ? 0.0297 0.0351 0.0294 -0.0020 -0.0038 -0.0007 354  GLN B O     
3817 C CB    . GLN B 247 ? 0.0449 0.0463 0.0416 0.0024  -0.0002 -0.0004 354  GLN B CB    
3818 C CG    . GLN B 247 ? 0.0679 0.0653 0.0727 -0.0043 0.0030  -0.0011 354  GLN B CG    
3819 C CD    . GLN B 247 ? 0.1003 0.1114 0.1006 -0.0004 -0.0051 -0.0036 354  GLN B CD    
3820 O OE1   . GLN B 247 ? 0.1652 0.1341 0.1362 0.0022  0.0033  0.0063  354  GLN B OE1   
3821 N NE2   . GLN B 247 ? 0.1238 0.1162 0.1285 0.0041  0.0009  -0.0021 354  GLN B NE2   
3822 N N     . VAL B 248 ? 0.0372 0.0384 0.0395 -0.0007 0.0006  0.0002  355  VAL B N     
3823 C CA    . VAL B 248 ? 0.0351 0.0398 0.0403 0.0000  -0.0019 0.0006  355  VAL B CA    
3824 C C     . VAL B 248 ? 0.0363 0.0416 0.0460 0.0002  0.0006  -0.0001 355  VAL B C     
3825 O O     . VAL B 248 ? 0.0416 0.0448 0.0558 -0.0012 0.0038  -0.0015 355  VAL B O     
3826 C CB    . VAL B 248 ? 0.0411 0.0410 0.0435 0.0003  0.0005  -0.0006 355  VAL B CB    
3827 C CG1   . VAL B 248 ? 0.0406 0.0485 0.0551 -0.0011 0.0003  -0.0027 355  VAL B CG1   
3828 C CG2   . VAL B 248 ? 0.0298 0.0361 0.0410 -0.0026 -0.0018 -0.0007 355  VAL B CG2   
3829 N N     . GLU B 249 ? 0.0356 0.0447 0.0429 0.0012  -0.0030 0.0001  356  GLU B N     
3830 C CA    . GLU B 249 ? 0.0476 0.0475 0.0498 -0.0001 0.0009  -0.0010 356  GLU B CA    
3831 C C     . GLU B 249 ? 0.0473 0.0460 0.0449 0.0011  -0.0019 0.0012  356  GLU B C     
3832 O O     . GLU B 249 ? 0.0483 0.0454 0.0395 0.0042  -0.0042 0.0024  356  GLU B O     
3833 C CB    . GLU B 249 ? 0.0476 0.0489 0.0469 0.0014  -0.0030 0.0014  356  GLU B CB    
3834 C CG    . GLU B 249 ? 0.0719 0.0649 0.0680 -0.0040 0.0071  -0.0055 356  GLU B CG    
3835 C CD    A GLU B 249 ? 0.1080 0.1113 0.1109 -0.0044 -0.0034 0.0006  356  GLU B CD    
3836 C CD    B GLU B 249 ? 0.1023 0.1009 0.0923 0.0002  -0.0056 0.0032  356  GLU B CD    
3837 O OE1   A GLU B 249 ? 0.1763 0.1821 0.1792 -0.0014 -0.0034 -0.0010 356  GLU B OE1   
3838 O OE1   B GLU B 249 ? 0.1014 0.1199 0.1125 0.0037  -0.0096 0.0016  356  GLU B OE1   
3839 O OE2   A GLU B 249 ? 0.1696 0.1719 0.1763 0.0020  -0.0011 0.0044  356  GLU B OE2   
3840 O OE2   B GLU B 249 ? 0.2432 0.2314 0.2262 -0.0051 0.0032  -0.0008 356  GLU B OE2   
3841 N N     . LEU B 250 ? 0.0499 0.0499 0.0491 0.0003  -0.0002 -0.0002 357  LEU B N     
3842 C CA    . LEU B 250 ? 0.0528 0.0516 0.0497 0.0007  0.0003  -0.0008 357  LEU B CA    
3843 C C     . LEU B 250 ? 0.0570 0.0534 0.0527 0.0004  -0.0007 0.0003  357  LEU B C     
3844 O O     . LEU B 250 ? 0.0586 0.0530 0.0484 0.0005  0.0006  0.0028  357  LEU B O     
3845 C CB    . LEU B 250 ? 0.0494 0.0507 0.0511 0.0002  -0.0009 -0.0001 357  LEU B CB    
3846 C CG    . LEU B 250 ? 0.0515 0.0481 0.0534 -0.0013 0.0017  -0.0028 357  LEU B CG    
3847 C CD1   . LEU B 250 ? 0.0548 0.0495 0.0493 0.0017  0.0009  0.0008  357  LEU B CD1   
3848 C CD2   . LEU B 250 ? 0.0390 0.0443 0.0402 0.0027  -0.0031 0.0036  357  LEU B CD2   
3849 N N     . LYS B 251 ? 0.0665 0.0615 0.0659 0.0012  0.0037  -0.0003 358  LYS B N     
3850 C CA    . LYS B 251 ? 0.0701 0.0663 0.0686 0.0005  0.0012  0.0002  358  LYS B CA    
3851 C C     . LYS B 251 ? 0.0712 0.0688 0.0714 0.0009  0.0013  0.0000  358  LYS B C     
3852 O O     . LYS B 251 ? 0.0796 0.0709 0.0742 -0.0016 0.0035  -0.0022 358  LYS B O     
3853 C CB    . LYS B 251 ? 0.0722 0.0688 0.0715 0.0013  0.0017  0.0010  358  LYS B CB    
3854 C CG    . LYS B 251 ? 0.0692 0.0720 0.0719 0.0002  -0.0016 0.0014  358  LYS B CG    
3855 C CD    . LYS B 251 ? 0.0725 0.0779 0.0728 0.0022  -0.0026 0.0013  358  LYS B CD    
3856 C CE    . LYS B 251 ? 0.0834 0.0845 0.0806 0.0011  -0.0013 0.0028  358  LYS B CE    
3857 N NZ    . LYS B 251 ? 0.0944 0.0974 0.0955 0.0034  0.0043  0.0001  358  LYS B NZ    
3858 N N     . ALA B 252 ? 0.0703 0.0703 0.0703 -0.0009 -0.0002 -0.0010 359  ALA B N     
3859 C CA    . ALA B 252 ? 0.0718 0.0721 0.0710 0.0007  -0.0001 0.0000  359  ALA B CA    
3860 C C     . ALA B 252 ? 0.0695 0.0704 0.0673 0.0005  -0.0026 0.0000  359  ALA B C     
3861 O O     . ALA B 252 ? 0.0588 0.0658 0.0582 0.0013  -0.0075 0.0016  359  ALA B O     
3862 C CB    . ALA B 252 ? 0.0700 0.0722 0.0734 0.0010  -0.0013 -0.0002 359  ALA B CB    
3863 N N     . PHE B 253 ? 0.0701 0.0737 0.0680 0.0001  -0.0032 0.0008  360  PHE B N     
3864 C CA    . PHE B 253 ? 0.0760 0.0787 0.0749 0.0000  -0.0020 -0.0004 360  PHE B CA    
3865 C C     . PHE B 253 ? 0.0806 0.0791 0.0750 0.0000  -0.0006 -0.0002 360  PHE B C     
3866 O O     . PHE B 253 ? 0.0752 0.0766 0.0588 -0.0007 -0.0036 -0.0017 360  PHE B O     
3867 C CB    . PHE B 253 ? 0.0810 0.0813 0.0815 -0.0005 -0.0013 0.0008  360  PHE B CB    
3868 C CG    . PHE B 253 ? 0.0916 0.0899 0.0892 -0.0013 0.0000  0.0004  360  PHE B CG    
3869 C CD1   . PHE B 253 ? 0.1214 0.1125 0.1093 -0.0006 0.0043  -0.0027 360  PHE B CD1   
3870 C CD2   . PHE B 253 ? 0.1025 0.1010 0.1048 0.0022  0.0014  0.0022  360  PHE B CD2   
3871 C CE1   . PHE B 253 ? 0.1182 0.1127 0.1127 -0.0016 0.0045  -0.0028 360  PHE B CE1   
3872 C CE2   . PHE B 253 ? 0.1068 0.1022 0.1021 -0.0018 0.0016  -0.0001 360  PHE B CE2   
3873 C CZ    . PHE B 253 ? 0.1133 0.1097 0.1050 0.0009  -0.0004 0.0003  360  PHE B CZ    
3874 N N     . GLN B 254 ? 0.0791 0.0840 0.0749 -0.0005 -0.0039 -0.0011 361  GLN B N     
3875 C CA    . GLN B 254 ? 0.0898 0.0905 0.0866 0.0003  -0.0014 -0.0002 361  GLN B CA    
3876 C C     . GLN B 254 ? 0.0900 0.0926 0.0884 -0.0002 -0.0026 -0.0004 361  GLN B C     
3877 O O     . GLN B 254 ? 0.0798 0.0908 0.0848 0.0012  -0.0048 0.0006  361  GLN B O     
3878 C CB    . GLN B 254 ? 0.0940 0.0955 0.0870 0.0019  -0.0037 0.0001  361  GLN B CB    
3879 C CG    . GLN B 254 ? 0.1166 0.1138 0.1143 -0.0026 -0.0026 0.0046  361  GLN B CG    
3880 C CD    . GLN B 254 ? 0.1550 0.1579 0.1542 0.0066  0.0040  -0.0010 361  GLN B CD    
3881 O OE1   . GLN B 254 ? 0.1901 0.1863 0.1875 -0.0013 0.0083  0.0054  361  GLN B OE1   
3882 N NE2   . GLN B 254 ? 0.1876 0.1687 0.1908 -0.0014 0.0059  -0.0005 361  GLN B NE2   
3883 N N     . ALA B 255 ? 0.0987 0.1006 0.0957 0.0003  -0.0004 -0.0009 362  ALA B N     
3884 C CA    . ALA B 255 ? 0.1028 0.1055 0.1032 -0.0001 -0.0011 0.0000  362  ALA B CA    
3885 C C     . ALA B 255 ? 0.1112 0.1127 0.1139 0.0002  0.0000  -0.0018 362  ALA B C     
3886 O O     . ALA B 255 ? 0.1069 0.1132 0.1155 -0.0011 0.0000  -0.0024 362  ALA B O     
3887 C CB    . ALA B 255 ? 0.1037 0.1054 0.1017 0.0000  -0.0012 0.0000  362  ALA B CB    
3888 N N     . THR B 256 ? 0.1193 0.1217 0.1195 0.0002  -0.0011 -0.0001 363  THR B N     
3889 C CA    . THR B 256 ? 0.1303 0.1320 0.1303 0.0002  -0.0005 -0.0007 363  THR B CA    
3890 C C     . THR B 256 ? 0.1345 0.1358 0.1351 0.0000  0.0005  -0.0012 363  THR B C     
3891 O O     . THR B 256 ? 0.1320 0.1377 0.1354 -0.0004 -0.0031 -0.0016 363  THR B O     
3892 C CB    . THR B 256 ? 0.1327 0.1352 0.1329 0.0003  -0.0006 -0.0010 363  THR B CB    
3893 O OG1   . THR B 256 ? 0.1355 0.1490 0.1434 0.0010  -0.0027 -0.0014 363  THR B OG1   
3894 C CG2   . THR B 256 ? 0.1355 0.1427 0.1404 0.0009  -0.0003 -0.0004 363  THR B CG2   
3895 N N     . GLN B 257 ? 0.1385 0.1401 0.1354 -0.0001 -0.0023 -0.0002 364  GLN B N     
3896 C CA    . GLN B 257 ? 0.1426 0.1447 0.1405 0.0004  -0.0017 0.0000  364  GLN B CA    
3897 C C     . GLN B 257 ? 0.1452 0.1487 0.1462 -0.0001 -0.0018 0.0000  364  GLN B C     
3898 O O     . GLN B 257 ? 0.1419 0.1462 0.1447 0.0019  -0.0019 0.0024  364  GLN B O     
3899 C CB    . GLN B 257 ? 0.1469 0.1463 0.1460 0.0000  0.0005  0.0004  364  GLN B CB    
3900 C CG    . GLN B 257 ? 0.1500 0.1514 0.1515 0.0007  -0.0003 0.0006  364  GLN B CG    
3901 C CD    . GLN B 257 ? 0.1574 0.1591 0.1543 -0.0001 -0.0024 -0.0013 364  GLN B CD    
3902 O OE1   . GLN B 257 ? 0.1633 0.1657 0.1549 -0.0020 -0.0006 -0.0040 364  GLN B OE1   
3903 N NE2   . GLN B 257 ? 0.1613 0.1579 0.1561 -0.0001 -0.0013 -0.0006 364  GLN B NE2   
3904 N N     . GLN B 258 ? 0.1513 0.1556 0.1512 -0.0002 -0.0012 -0.0008 365  GLN B N     
3905 C CA    . GLN B 258 ? 0.1596 0.1602 0.1593 0.0000  -0.0006 0.0000  365  GLN B CA    
3906 C C     . GLN B 258 ? 0.1633 0.1658 0.1655 -0.0007 -0.0003 -0.0005 365  GLN B C     
3907 O O     . GLN B 258 ? 0.1659 0.1669 0.1664 -0.0013 0.0007  0.0000  365  GLN B O     
3908 C CB    . GLN B 258 ? 0.1620 0.1627 0.1606 0.0000  -0.0004 -0.0007 365  GLN B CB    
3909 C CG    . GLN B 258 ? 0.1645 0.1697 0.1709 -0.0003 -0.0014 0.0003  365  GLN B CG    
3910 C CD    . GLN B 258 ? 0.1796 0.1794 0.1775 -0.0017 -0.0011 -0.0033 365  GLN B CD    
3911 O OE1   . GLN B 258 ? 0.1894 0.1905 0.1875 -0.0001 -0.0008 -0.0045 365  GLN B OE1   
3912 N NE2   . GLN B 258 ? 0.1909 0.1912 0.1874 -0.0007 0.0013  0.0002  365  GLN B NE2   
3913 N N     . LYS B 259 ? 0.1678 0.1694 0.1677 -0.0004 -0.0007 0.0000  366  LYS B N     
3914 C CA    . LYS B 259 ? 0.1713 0.1730 0.1720 -0.0001 -0.0004 0.0001  366  LYS B CA    
3915 C C     . LYS B 259 ? 0.1736 0.1743 0.1745 0.0010  -0.0010 0.0004  366  LYS B C     
3916 O O     . LYS B 259 ? 0.1812 0.1773 0.1770 0.0014  -0.0005 -0.0003 366  LYS B O     
3917 C CB    . LYS B 259 ? 0.1709 0.1727 0.1744 0.0000  0.0000  -0.0012 366  LYS B CB    
3918 C CG    . LYS B 259 ? 0.1707 0.1719 0.1713 -0.0012 -0.0006 -0.0003 366  LYS B CG    
3919 C CD    . LYS B 259 ? 0.1690 0.1684 0.1686 0.0000  -0.0005 0.0001  366  LYS B CD    
3920 C CE    . LYS B 259 ? 0.1686 0.1663 0.1649 0.0001  0.0011  0.0000  366  LYS B CE    
3921 N NZ    . LYS B 259 ? 0.1649 0.1662 0.1657 0.0013  -0.0001 0.0002  366  LYS B NZ    
3922 N N     . ALA C 1   ? 0.1553 0.1561 0.1593 -0.0005 0.0006  -0.0004 1    ALA K N     
3923 C CA    . ALA C 1   ? 0.1575 0.1550 0.1554 0.0006  0.0004  0.0013  1    ALA K CA    
3924 C C     . ALA C 1   ? 0.1494 0.1495 0.1518 -0.0003 0.0011  0.0007  1    ALA K C     
3925 O O     . ALA C 1   ? 0.1512 0.1517 0.1525 -0.0016 -0.0015 -0.0006 1    ALA K O     
3926 C CB    . ALA C 1   ? 0.1645 0.1600 0.1642 0.0013  0.0041  0.0011  1    ALA K CB    
3927 N N     . ARG C 2   ? 0.1348 0.1362 0.1333 0.0008  -0.0024 0.0001  2    ARG K N     
3928 C CA    . ARG C 2   ? 0.1274 0.1298 0.1298 0.0000  -0.0015 -0.0022 2    ARG K CA    
3929 C C     . ARG C 2   ? 0.1160 0.1203 0.1184 -0.0007 -0.0007 0.0005  2    ARG K C     
3930 O O     . ARG C 2   ? 0.1032 0.1121 0.1151 0.0010  0.0009  0.0019  2    ARG K O     
3931 C CB    . ARG C 2   ? 0.1303 0.1336 0.1347 -0.0003 -0.0009 0.0000  2    ARG K CB    
3932 C CG    . ARG C 2   ? 0.1460 0.1459 0.1446 0.0001  -0.0028 -0.0028 2    ARG K CG    
3933 C CD    . ARG C 2   ? 0.1670 0.1704 0.1710 -0.0042 0.0034  0.0008  2    ARG K CD    
3934 N NE    . ARG C 2   ? 0.1876 0.1832 0.1835 -0.0016 -0.0002 -0.0047 2    ARG K NE    
3935 C CZ    . ARG C 2   ? 0.2006 0.2077 0.2076 0.0001  0.0022  -0.0003 2    ARG K CZ    
3936 N NH1   . ARG C 2   ? 0.2107 0.2111 0.2109 -0.0009 0.0006  -0.0015 2    ARG K NH1   
3937 N NH2   . ARG C 2   ? 0.2157 0.2156 0.2222 -0.0008 0.0021  -0.0036 2    ARG K NH2   
3938 N N     . THR C 3   ? 0.1019 0.1088 0.1077 -0.0009 -0.0053 0.0000  3    THR K N     
3939 C CA    . THR C 3   ? 0.1017 0.1089 0.1068 -0.0011 -0.0035 0.0015  3    THR K CA    
3940 C C     . THR C 3   ? 0.0922 0.0983 0.1022 0.0012  -0.0034 0.0010  3    THR K C     
3941 O O     . THR C 3   ? 0.0751 0.0917 0.0834 0.0013  -0.0097 0.0015  3    THR K O     
3942 C CB    . THR C 3   ? 0.1096 0.1167 0.1169 0.0003  0.0000  0.0000  3    THR K CB    
3943 O OG1   . THR C 3   ? 0.1422 0.1478 0.1363 -0.0088 0.0063  0.0070  3    THR K OG1   
3944 C CG2   . THR C 3   ? 0.1100 0.1088 0.1089 -0.0013 -0.0013 0.0020  3    THR K CG2   
3945 N N     . MLZ C 4   ? 0.0293 0.0458 0.0529 -0.0027 0.0000  -0.0035 4    MLZ K N     
3946 C CA    . MLZ C 4   ? 0.0267 0.0345 0.0345 -0.0006 -0.0021 -0.0011 4    MLZ K CA    
3947 C CB    . MLZ C 4   ? 0.0267 0.0374 0.0323 -0.0015 -0.0028 -0.0007 4    MLZ K CB    
3948 C CG    . MLZ C 4   ? 0.0283 0.0332 0.0294 0.0004  -0.0033 -0.0024 4    MLZ K CG    
3949 C CD    . MLZ C 4   ? 0.0274 0.0344 0.0310 0.0011  -0.0033 0.0000  4    MLZ K CD    
3950 C CE    . MLZ C 4   ? 0.0305 0.0378 0.0327 0.0024  -0.0001 -0.0035 4    MLZ K CE    
3951 N NZ    . MLZ C 4   ? 0.0261 0.0329 0.0292 0.0012  -0.0004 0.0039  4    MLZ K NZ    
3952 C CM    . MLZ C 4   ? 0.0278 0.0331 0.0427 0.0030  0.0017  -0.0010 4    MLZ K CM    
3953 C C     . MLZ C 4   ? 0.0338 0.0397 0.0408 -0.0011 0.0031  -0.0009 4    MLZ K C     
3954 O O     . MLZ C 4   ? 0.0279 0.0376 0.0317 -0.0031 -0.0031 -0.0010 4    MLZ K O     
3955 N N     . GLN C 5   ? 0.0844 0.0988 0.0911 -0.0016 -0.0118 -0.0020 5    GLN K N     
3956 C CA    . GLN C 5   ? 0.1025 0.1068 0.1010 -0.0019 -0.0039 -0.0004 5    GLN K CA    
3957 C C     . GLN C 5   ? 0.1054 0.1123 0.1106 -0.0025 -0.0039 0.0001  5    GLN K C     
3958 O O     . GLN C 5   ? 0.0998 0.1135 0.1071 -0.0014 -0.0035 0.0012  5    GLN K O     
3959 C CB    . GLN C 5   ? 0.1065 0.1076 0.1060 -0.0019 -0.0015 0.0000  5    GLN K CB    
3960 C CG    . GLN C 5   ? 0.1100 0.1134 0.1138 -0.0013 -0.0019 -0.0016 5    GLN K CG    
3961 C CD    . GLN C 5   ? 0.1174 0.1208 0.1170 0.0011  0.0016  -0.0002 5    GLN K CD    
3962 O OE1   . GLN C 5   ? 0.1058 0.1188 0.1161 0.0030  -0.0055 0.0026  5    GLN K OE1   
3963 N NE2   . GLN C 5   ? 0.1142 0.1247 0.1188 -0.0014 -0.0034 -0.0004 5    GLN K NE2   
3964 N N     . THR C 6   ? 0.1198 0.1239 0.1209 -0.0018 -0.0013 -0.0014 6    THR K N     
3965 C CA    . THR C 6   ? 0.1361 0.1344 0.1369 -0.0003 0.0002  -0.0003 6    THR K CA    
3966 C C     . THR C 6   ? 0.1392 0.1403 0.1418 -0.0013 0.0000  -0.0014 6    THR K C     
3967 O O     . THR C 6   ? 0.1386 0.1349 0.1314 0.0002  0.0003  0.0010  6    THR K O     
3968 C CB    . THR C 6   ? 0.1356 0.1390 0.1393 -0.0019 0.0000  -0.0017 6    THR K CB    
3969 O OG1   . THR C 6   ? 0.1618 0.1482 0.1565 0.0012  0.0063  -0.0011 6    THR K OG1   
3970 C CG2   . THR C 6   ? 0.1512 0.1484 0.1470 -0.0003 0.0031  -0.0004 6    THR K CG2   
3971 N N     . ALA C 7   ? 0.1509 0.1505 0.1473 0.0000  -0.0004 0.0000  7    ALA K N     
3972 C CA    . ALA C 7   ? 0.1587 0.1587 0.1587 -0.0007 -0.0001 0.0001  7    ALA K CA    
3973 C C     . ALA C 7   ? 0.1689 0.1684 0.1648 -0.0001 -0.0003 -0.0008 7    ALA K C     
3974 O O     . ALA C 7   ? 0.1683 0.1686 0.1612 -0.0004 -0.0025 -0.0025 7    ALA K O     
3975 C CB    . ALA C 7   ? 0.1591 0.1582 0.1563 -0.0003 -0.0006 -0.0004 7    ALA K CB    
3976 N N     . ARG C 8   ? 0.1807 0.1798 0.1791 -0.0011 0.0006  0.0004  8    ARG K N     
3977 C CA    . ARG C 8   ? 0.1893 0.1876 0.1879 -0.0006 0.0001  -0.0003 8    ARG K CA    
3978 C C     . ARG C 8   ? 0.1873 0.1867 0.1865 -0.0011 -0.0005 0.0000  8    ARG K C     
3979 O O     . ARG C 8   ? 0.1854 0.1849 0.1862 -0.0016 0.0009  0.0005  8    ARG K O     
3980 C CB    . ARG C 8   ? 0.1931 0.1942 0.1955 0.0002  0.0000  0.0018  8    ARG K CB    
3981 C CG    . ARG C 8   ? 0.2168 0.2125 0.2113 -0.0004 0.0016  -0.0021 8    ARG K CG    
3982 C CD    . ARG C 8   ? 0.2280 0.2361 0.2379 -0.0006 -0.0009 0.0011  8    ARG K CD    
3983 N NE    . ARG C 8   ? 0.2520 0.2456 0.2486 -0.0005 0.0009  -0.0020 8    ARG K NE    
3984 C CZ    . ARG C 8   ? 0.2618 0.2652 0.2589 -0.0007 -0.0008 0.0000  8    ARG K CZ    
3985 N NH1   . ARG C 8   ? 0.2767 0.2746 0.2793 0.0031  0.0016  0.0021  8    ARG K NH1   
3986 N NH2   . ARG C 8   ? 0.2653 0.2653 0.2638 -0.0007 -0.0007 0.0007  8    ARG K NH2   
3987 N N     . LYS C 9   ? 0.1894 0.1884 0.1891 -0.0004 0.0007  0.0002  9    LYS K N     
3988 C CA    . LYS C 9   ? 0.1890 0.1898 0.1889 0.0000  0.0000  0.0000  9    LYS K CA    
3989 C C     . LYS C 9   ? 0.1843 0.1852 0.1850 -0.0004 -0.0002 0.0004  9    LYS K C     
3990 O O     . LYS C 9   ? 0.1877 0.1849 0.1819 -0.0007 0.0000  0.0011  9    LYS K O     
3991 C CB    . LYS C 9   ? 0.1919 0.1951 0.1940 -0.0008 0.0004  -0.0005 9    LYS K CB    
3992 C CG    . LYS C 9   ? 0.2018 0.2021 0.2035 0.0006  0.0003  0.0015  9    LYS K CG    
3993 C CD    . LYS C 9   ? 0.2142 0.2162 0.2128 -0.0002 -0.0006 -0.0012 9    LYS K CD    
3994 C CE    . LYS C 9   ? 0.2231 0.2214 0.2224 0.0004  -0.0002 0.0000  9    LYS K CE    
3995 N NZ    . LYS C 9   ? 0.2285 0.2305 0.2271 0.0017  -0.0002 0.0009  9    LYS K NZ    
3996 N N     . TYR C 10  ? 0.1792 0.1812 0.1786 0.0002  -0.0016 0.0004  10   TYR K N     
3997 C CA    . TYR C 10  ? 0.1794 0.1790 0.1777 0.0000  0.0000  0.0001  10   TYR K CA    
3998 C C     . TYR C 10  ? 0.1792 0.1796 0.1782 0.0000  0.0000  0.0002  10   TYR K C     
3999 O O     . TYR C 10  ? 0.1840 0.1832 0.1840 0.0015  0.0011  0.0006  10   TYR K O     
4000 C CB    . TYR C 10  ? 0.1755 0.1765 0.1747 -0.0003 -0.0013 0.0000  10   TYR K CB    
4001 C CG    . TYR C 10  ? 0.1730 0.1755 0.1741 -0.0007 -0.0009 0.0003  10   TYR K CG    
4002 C CD1   . TYR C 10  ? 0.1731 0.1754 0.1709 -0.0001 -0.0012 -0.0004 10   TYR K CD1   
4003 C CD2   . TYR C 10  ? 0.1718 0.1726 0.1720 -0.0007 -0.0007 -0.0013 10   TYR K CD2   
4004 C CE1   . TYR C 10  ? 0.1786 0.1790 0.1793 0.0001  -0.0004 -0.0015 10   TYR K CE1   
4005 C CE2   . TYR C 10  ? 0.1697 0.1765 0.1701 -0.0004 -0.0020 0.0008  10   TYR K CE2   
4006 C CZ    . TYR C 10  ? 0.1803 0.1809 0.1787 -0.0005 -0.0001 0.0003  10   TYR K CZ    
4007 O OH    . TYR C 10  ? 0.1932 0.1943 0.1978 0.0031  0.0016  0.0027  10   TYR K OH    
4008 O OXT   . TYR C 10  ? 0.1783 0.1790 0.1771 0.0000  0.0005  0.0002  10   TYR K OXT   
4009 N N     . ALA D 1   ? 0.3597 0.3611 0.3633 -0.0003 -0.0005 -0.0001 1    ALA L N     
4010 C CA    . ALA D 1   ? 0.3585 0.3607 0.3591 -0.0001 -0.0013 0.0000  1    ALA L CA    
4011 C C     . ALA D 1   ? 0.3588 0.3606 0.3606 -0.0002 -0.0002 0.0000  1    ALA L C     
4012 O O     . ALA D 1   ? 0.3541 0.3572 0.3537 0.0001  -0.0022 0.0003  1    ALA L O     
4013 C CB    . ALA D 1   ? 0.3603 0.3619 0.3634 0.0001  0.0010  -0.0001 1    ALA L CB    
4014 N N     . ARG D 2   ? 0.3605 0.3620 0.3615 -0.0002 -0.0005 0.0000  2    ARG L N     
4015 C CA    . ARG D 2   ? 0.3635 0.3642 0.3638 0.0000  0.0000  0.0003  2    ARG L CA    
4016 C C     . ARG D 2   ? 0.3559 0.3574 0.3579 -0.0003 0.0000  -0.0007 2    ARG L C     
4017 O O     . ARG D 2   ? 0.3559 0.3589 0.3566 -0.0008 -0.0014 -0.0018 2    ARG L O     
4018 C CB    . ARG D 2   ? 0.3689 0.3672 0.3680 -0.0001 -0.0004 -0.0016 2    ARG L CB    
4019 C CG    . ARG D 2   ? 0.3893 0.3859 0.3870 -0.0027 0.0041  0.0014  2    ARG L CG    
4020 C CD    . ARG D 2   ? 0.4066 0.3994 0.4047 0.0011  0.0043  -0.0022 2    ARG L CD    
4021 N NE    . ARG D 2   ? 0.4141 0.4130 0.4068 -0.0009 0.0001  0.0013  2    ARG L NE    
4022 C CZ    . ARG D 2   ? 0.4240 0.4214 0.4211 0.0000  0.0005  -0.0013 2    ARG L CZ    
4023 N NH1   . ARG D 2   ? 0.4276 0.4249 0.4289 -0.0005 0.0009  0.0000  2    ARG L NH1   
4024 N NH2   . ARG D 2   ? 0.4285 0.4251 0.4215 0.0010  0.0004  0.0002  2    ARG L NH2   
4025 N N     . THR D 3   ? 0.3503 0.3515 0.3528 -0.0008 -0.0011 -0.0002 3    THR L N     
4026 C CA    . THR D 3   ? 0.3461 0.3469 0.3488 -0.0002 0.0001  -0.0004 3    THR L CA    
4027 C C     . THR D 3   ? 0.3396 0.3439 0.3430 -0.0015 -0.0019 -0.0003 3    THR L C     
4028 O O     . THR D 3   ? 0.3296 0.3388 0.3379 -0.0012 -0.0034 -0.0018 3    THR L O     
4029 C CB    . THR D 3   ? 0.3476 0.3477 0.3485 0.0001  0.0008  -0.0003 3    THR L CB    
4030 O OG1   . THR D 3   ? 0.3418 0.3444 0.3422 -0.0020 -0.0035 -0.0003 3    THR L OG1   
4031 C CG2   . THR D 3   ? 0.3465 0.3483 0.3475 -0.0004 -0.0013 0.0000  3    THR L CG2   
4032 N N     . MLZ D 4   ? 0.2563 0.2509 0.2582 0.0043  0.0044  0.0037  4    MLZ L N     
4033 C CA    . MLZ D 4   ? 0.2496 0.2494 0.2493 0.0008  0.0000  0.0012  4    MLZ L CA    
4034 C CB    . MLZ D 4   ? 0.2569 0.2538 0.2564 0.0008  0.0029  0.0011  4    MLZ L CB    
4035 C CG    . MLZ D 4   ? 0.2520 0.2525 0.2554 0.0016  -0.0002 0.0014  4    MLZ L CG    
4036 C CD    . MLZ D 4   ? 0.2552 0.2548 0.2569 -0.0028 0.0005  -0.0023 4    MLZ L CD    
4037 C CE    . MLZ D 4   ? 0.2521 0.2494 0.2545 0.0016  0.0002  0.0007  4    MLZ L CE    
4038 N NZ    . MLZ D 4   ? 0.2407 0.2437 0.2480 -0.0049 0.0006  -0.0041 4    MLZ L NZ    
4039 C CM    . MLZ D 4   ? 0.2400 0.2372 0.2406 0.0003  0.0000  -0.0001 4    MLZ L CM    
4040 C C     . MLZ D 4   ? 0.2421 0.2458 0.2438 0.0017  -0.0024 0.0014  4    MLZ L C     
4041 O O     . MLZ D 4   ? 0.2257 0.2414 0.2370 0.0046  -0.0072 0.0025  4    MLZ L O     
4042 N N     . GLN D 5   ? 0.4487 0.4503 0.4496 -0.0006 -0.0015 -0.0003 5    GLN L N     
4043 C CA    . GLN D 5   ? 0.4517 0.4523 0.4523 -0.0003 -0.0003 -0.0004 5    GLN L CA    
4044 C C     . GLN D 5   ? 0.4533 0.4533 0.4526 -0.0005 0.0000  -0.0004 5    GLN L C     
4045 O O     . GLN D 5   ? 0.4534 0.4539 0.4523 -0.0007 0.0001  -0.0004 5    GLN L O     
4046 C CB    . GLN D 5   ? 0.4530 0.4530 0.4534 0.0000  -0.0002 0.0000  5    GLN L CB    
4047 C CG    . GLN D 5   ? 0.4569 0.4596 0.4575 0.0000  0.0000  0.0013  5    GLN L CG    
4048 C CD    . GLN D 5   ? 0.4700 0.4706 0.4716 0.0012  0.0003  -0.0028 5    GLN L CD    
4049 O OE1   . GLN D 5   ? 0.4950 0.4837 0.4978 -0.0021 0.0066  0.0017  5    GLN L OE1   
4050 N NE2   . GLN D 5   ? 0.4719 0.4731 0.4740 0.0002  0.0017  0.0000  5    GLN L NE2   
4051 N N     . THR D 6   ? 0.4542 0.4540 0.4541 -0.0005 0.0002  -0.0002 6    THR L N     
4052 C CA    . THR D 6   ? 0.4549 0.4543 0.4538 0.0001  0.0002  -0.0001 6    THR L CA    
4053 C C     . THR D 6   ? 0.4547 0.4540 0.4542 0.0001  0.0005  -0.0001 6    THR L C     
4054 O O     . THR D 6   ? 0.4554 0.4537 0.4537 0.0004  0.0007  0.0003  6    THR L O     
4055 C CB    . THR D 6   ? 0.4561 0.4548 0.4549 -0.0001 0.0008  -0.0002 6    THR L CB    
4056 O OG1   . THR D 6   ? 0.4632 0.4569 0.4617 0.0002  0.0031  -0.0018 6    THR L OG1   
4057 C CG2   . THR D 6   ? 0.4529 0.4544 0.4534 0.0000  -0.0004 0.0000  6    THR L CG2   
4058 N N     . SAH E .   ? 0.5183 0.5264 0.5200 0.0017  -0.0091 0.0001  1367 SAH A N     
4059 C CA    . SAH E .   ? 0.5203 0.5227 0.5218 -0.0005 -0.0019 -0.0002 1367 SAH A CA    
4060 C CB    . SAH E .   ? 0.5139 0.5204 0.5131 0.0018  -0.0068 -0.0001 1367 SAH A CB    
4061 C CG    . SAH E .   ? 0.5087 0.5111 0.5077 0.0106  -0.0057 0.0020  1367 SAH A CG    
4062 S SD    . SAH E .   ? 0.4845 0.5465 0.4911 0.0072  -0.0501 -0.0015 1367 SAH A SD    
4063 C C     . SAH E .   ? 0.5166 0.5254 0.5249 0.0001  -0.0055 0.0000  1367 SAH A C     
4064 O O     . SAH E .   ? 0.5108 0.5257 0.5174 -0.0013 -0.0110 0.0035  1367 SAH A O     
4065 C "C5'" . SAH E .   ? 0.4957 0.5088 0.5106 0.0078  -0.0089 0.0062  1367 SAH A "C5'" 
4066 C "C4'" . SAH E .   ? 0.5077 0.5211 0.5118 0.0025  -0.0067 0.0028  1367 SAH A "C4'" 
4067 O "O4'" . SAH E .   ? 0.4989 0.5146 0.5060 0.0024  -0.0115 -0.0028 1367 SAH A "O4'" 
4068 C "C3'" . SAH E .   ? 0.5190 0.5289 0.5219 0.0045  -0.0037 0.0019  1367 SAH A "C3'" 
4069 O "O3'" . SAH E .   ? 0.5183 0.5486 0.5185 0.0006  -0.0183 -0.0041 1367 SAH A "O3'" 
4070 C "C2'" . SAH E .   ? 0.5166 0.5231 0.5152 0.0000  -0.0037 0.0012  1367 SAH A "C2'" 
4071 O "O2'" . SAH E .   ? 0.5076 0.5398 0.5128 0.0068  -0.0134 -0.0003 1367 SAH A "O2'" 
4072 C "C1'" . SAH E .   ? 0.5027 0.5188 0.5065 -0.0016 -0.0048 -0.0004 1367 SAH A "C1'" 
4073 N N9    . SAH E .   ? 0.5053 0.5281 0.5061 -0.0054 -0.0037 -0.0020 1367 SAH A N9    
4074 C C8    . SAH E .   ? 0.5124 0.5241 0.5069 -0.0041 -0.0037 -0.0027 1367 SAH A C8    
4075 N N7    . SAH E .   ? 0.5047 0.5294 0.5148 -0.0027 -0.0061 0.0003  1367 SAH A N7    
4076 C C5    . SAH E .   ? 0.5070 0.5268 0.5128 -0.0039 -0.0061 -0.0023 1367 SAH A C5    
4077 C C6    . SAH E .   ? 0.5163 0.5314 0.5161 -0.0010 -0.0018 -0.0008 1367 SAH A C6    
4078 N N6    . SAH E .   ? 0.5077 0.5274 0.5159 -0.0032 -0.0152 -0.0002 1367 SAH A N6    
4079 N N1    . SAH E .   ? 0.4994 0.5200 0.4910 0.0027  -0.0173 0.0000  1367 SAH A N1    
4080 C C2    . SAH E .   ? 0.5259 0.5387 0.5227 -0.0042 -0.0049 -0.0033 1367 SAH A C2    
4081 N N3    . SAH E .   ? 0.4992 0.5239 0.5027 0.0008  -0.0093 -0.0042 1367 SAH A N3    
4082 C C4    . SAH E .   ? 0.5045 0.5237 0.5100 -0.0027 -0.0032 -0.0019 1367 SAH A C4    
4083 N N     . SAH F .   ? 0.4874 0.5066 0.4891 0.0000  -0.0122 0.0007  1367 SAH B N     
4084 C CA    . SAH F .   ? 0.4916 0.4979 0.4895 0.0016  -0.0065 0.0008  1367 SAH B CA    
4085 C CB    . SAH F .   ? 0.4875 0.4920 0.4826 0.0031  -0.0067 0.0003  1367 SAH B CB    
4086 C CG    . SAH F .   ? 0.4823 0.4839 0.4808 -0.0031 -0.0083 -0.0037 1367 SAH B CG    
4087 S SD    . SAH F .   ? 0.4866 0.5276 0.4809 -0.0098 -0.0450 -0.0004 1367 SAH B SD    
4088 C C     . SAH F .   ? 0.4939 0.5097 0.4903 0.0048  -0.0066 0.0023  1367 SAH B C     
4089 O O     . SAH F .   ? 0.4988 0.5226 0.5076 0.0028  -0.0080 0.0044  1367 SAH B O     
4090 C "C5'" . SAH F .   ? 0.5056 0.5115 0.5011 -0.0043 -0.0091 0.0015  1367 SAH B "C5'" 
4091 C "C4'" . SAH F .   ? 0.5117 0.5138 0.5058 -0.0039 -0.0053 -0.0021 1367 SAH B "C4'" 
4092 O "O4'" . SAH F .   ? 0.4901 0.5274 0.4859 -0.0038 -0.0131 0.0030  1367 SAH B "O4'" 
4093 C "C3'" . SAH F .   ? 0.5223 0.5261 0.5126 -0.0014 -0.0057 0.0012  1367 SAH B "C3'" 
4094 O "O3'" . SAH F .   ? 0.5491 0.5542 0.5363 0.0040  -0.0085 -0.0079 1367 SAH B "O3'" 
4095 C "C2'" . SAH F .   ? 0.5206 0.5278 0.4975 -0.0027 -0.0081 -0.0031 1367 SAH B "C2'" 
4096 O "O2'" . SAH F .   ? 0.5307 0.5550 0.5188 0.0040  -0.0196 -0.0044 1367 SAH B "O2'" 
4097 C "C1'" . SAH F .   ? 0.4876 0.5082 0.4919 -0.0031 -0.0119 0.0000  1367 SAH B "C1'" 
4098 N N9    . SAH F .   ? 0.4554 0.5063 0.4515 0.0003  -0.0197 0.0013  1367 SAH B N9    
4099 C C8    . SAH F .   ? 0.4532 0.4813 0.4562 0.0005  -0.0139 -0.0001 1367 SAH B C8    
4100 N N7    . SAH F .   ? 0.4617 0.4896 0.4623 -0.0028 -0.0247 0.0054  1367 SAH B N7    
4101 C C5    . SAH F .   ? 0.4644 0.5023 0.4603 -0.0005 -0.0183 0.0017  1367 SAH B C5    
4102 C C6    . SAH F .   ? 0.4759 0.5038 0.4751 -0.0003 -0.0183 0.0065  1367 SAH B C6    
4103 N N6    . SAH F .   ? 0.5166 0.5339 0.5050 0.0048  -0.0144 -0.0048 1367 SAH B N6    
4104 N N1    . SAH F .   ? 0.4820 0.5200 0.4790 0.0045  -0.0138 -0.0005 1367 SAH B N1    
4105 C C2    . SAH F .   ? 0.4815 0.4943 0.4693 0.0021  -0.0199 0.0010  1367 SAH B C2    
4106 N N3    . SAH F .   ? 0.4674 0.5015 0.4599 -0.0054 -0.0161 0.0062  1367 SAH B N3    
4107 C C4    . SAH F .   ? 0.4599 0.4984 0.4613 -0.0006 -0.0181 0.0019  1367 SAH B C4    
4108 O O     . HOH G .   ? 0.5451 0.5375 0.5319 -0.0012 0.0005  0.0000  2001 HOH A O     
4109 O O     . HOH G .   ? 0.3893 0.3830 0.3779 0.0005  0.0000  0.0008  2002 HOH A O     
4110 O O     . HOH G .   ? 0.4161 0.4290 0.4067 -0.0041 -0.0032 -0.0032 2003 HOH A O     
4111 O O     . HOH G .   ? 0.5006 0.4993 0.4985 -0.0006 0.0016  -0.0018 2004 HOH A O     
4112 O O     . HOH G .   ? 0.4157 0.4199 0.4190 -0.0017 0.0016  -0.0017 2005 HOH A O     
4113 O O     . HOH G .   ? 0.4224 0.4310 0.4297 -0.0038 -0.0033 -0.0029 2006 HOH A O     
4114 O O     . HOH G .   ? 0.5446 0.5436 0.5427 0.0023  -0.0012 0.0036  2007 HOH A O     
4115 O O     . HOH G .   ? 0.5584 0.5527 0.5571 -0.0040 0.0029  -0.0025 2008 HOH A O     
4116 O O     . HOH G .   ? 0.3620 0.3772 0.3768 0.0025  -0.0010 0.0045  2009 HOH A O     
4117 O O     . HOH G .   ? 0.2896 0.2942 0.2972 0.0015  -0.0015 0.0000  2010 HOH A O     
4118 O O     . HOH G .   ? 0.3430 0.3261 0.3155 0.0031  0.0073  -0.0022 2011 HOH A O     
4119 O O     . HOH G .   ? 0.2344 0.2388 0.2277 0.0008  0.0003  0.0032  2012 HOH A O     
4120 O O     . HOH G .   ? 0.2885 0.2807 0.2934 -0.0027 -0.0002 -0.0015 2013 HOH A O     
4121 O O     . HOH G .   ? 0.5504 0.5485 0.5505 0.0016  0.0015  0.0007  2014 HOH A O     
4122 O O     . HOH G .   ? 0.2264 0.2476 0.2385 0.0004  -0.0070 -0.0005 2015 HOH A O     
4123 O O     . HOH G .   ? 0.5410 0.5362 0.5301 -0.0010 -0.0005 -0.0020 2016 HOH A O     
4124 O O     . HOH G .   ? 0.5689 0.5663 0.5645 -0.0001 0.0008  -0.0006 2017 HOH A O     
4125 O O     . HOH G .   ? 0.3838 0.4017 0.3989 -0.0006 -0.0024 0.0000  2018 HOH A O     
4126 O O     . HOH G .   ? 0.5276 0.5307 0.5322 0.0008  0.0036  0.0028  2019 HOH A O     
4127 O O     . HOH G .   ? 0.3707 0.3662 0.3842 -0.0002 0.0055  0.0009  2020 HOH A O     
4128 O O     . HOH G .   ? 0.4471 0.4466 0.4298 0.0035  -0.0008 0.0008  2021 HOH A O     
4129 O O     . HOH G .   ? 0.3936 0.4079 0.4011 0.0009  -0.0067 -0.0003 2022 HOH A O     
4130 O O     . HOH G .   ? 0.5208 0.5182 0.5191 -0.0043 0.0010  -0.0026 2023 HOH A O     
4131 O O     . HOH G .   ? 0.3765 0.3719 0.3734 0.0000  0.0029  0.0018  2024 HOH A O     
4132 O O     . HOH G .   ? 0.5720 0.5679 0.5623 0.0005  -0.0008 0.0024  2025 HOH A O     
4133 O O     . HOH G .   ? 0.2893 0.3127 0.3000 -0.0049 -0.0061 -0.0056 2026 HOH A O     
4134 O O     . HOH G .   ? 0.3309 0.3303 0.3286 -0.0017 -0.0002 -0.0031 2027 HOH A O     
4135 O O     . HOH G .   ? 0.4098 0.4150 0.4276 0.0006  0.0011  -0.0001 2028 HOH A O     
4136 O O     . HOH G .   ? 0.3066 0.3083 0.3088 -0.0010 0.0032  -0.0039 2029 HOH A O     
4137 O O     . HOH G .   ? 0.3264 0.3288 0.3230 -0.0027 -0.0035 -0.0072 2030 HOH A O     
4138 O O     . HOH G .   ? 0.5677 0.5707 0.5682 0.0012  0.0000  0.0000  2031 HOH A O     
4139 O O     . HOH G .   ? 0.2246 0.2480 0.2337 0.0003  -0.0010 -0.0046 2032 HOH A O     
4140 O O     . HOH G .   ? 0.5263 0.5327 0.5310 0.0003  -0.0030 0.0001  2033 HOH A O     
4141 O O     . HOH G .   ? 0.4216 0.4255 0.4202 -0.0049 0.0006  -0.0042 2034 HOH A O     
4142 O O     . HOH G .   ? 0.4479 0.4443 0.4435 -0.0026 0.0031  -0.0013 2035 HOH A O     
4143 O O     . HOH G .   ? 0.5917 0.5925 0.5916 -0.0002 -0.0011 -0.0005 2036 HOH A O     
4144 O O     . HOH G .   ? 0.5138 0.5210 0.5210 -0.0014 0.0000  -0.0027 2037 HOH A O     
4145 O O     . HOH G .   ? 0.2674 0.2829 0.2843 -0.0034 0.0025  0.0005  2038 HOH A O     
4146 O O     . HOH G .   ? 0.5896 0.5818 0.5824 -0.0013 -0.0005 0.0011  2039 HOH A O     
4147 O O     . HOH G .   ? 0.3476 0.3548 0.3513 0.0012  -0.0006 -0.0006 2040 HOH A O     
4148 O O     . HOH G .   ? 0.4176 0.4304 0.4311 0.0021  -0.0051 0.0019  2041 HOH A O     
4149 O O     . HOH G .   ? 0.4665 0.4643 0.4594 -0.0031 -0.0036 -0.0030 2042 HOH A O     
4150 O O     . HOH G .   ? 0.6045 0.6010 0.6032 0.0000  0.0017  0.0018  2043 HOH A O     
4151 O O     . HOH G .   ? 0.3264 0.3196 0.3238 -0.0024 -0.0019 -0.0015 2044 HOH A O     
4152 O O     . HOH G .   ? 0.2801 0.2652 0.2571 -0.0012 -0.0020 -0.0011 2045 HOH A O     
4153 O O     . HOH G .   ? 0.3423 0.3413 0.3338 0.0016  -0.0028 -0.0018 2046 HOH A O     
4154 O O     . HOH G .   ? 0.3594 0.3543 0.3425 -0.0017 -0.0033 -0.0043 2047 HOH A O     
4155 O O     . HOH G .   ? 0.3987 0.4017 0.4062 0.0001  0.0000  0.0012  2048 HOH A O     
4156 O O     . HOH G .   ? 0.6399 0.6416 0.6404 -0.0014 0.0004  -0.0014 2049 HOH A O     
4157 O O     . HOH G .   ? 0.3904 0.4033 0.3722 0.0020  -0.0045 0.0006  2050 HOH A O     
4158 O O     . HOH G .   ? 0.4744 0.4759 0.4696 -0.0019 -0.0018 -0.0018 2051 HOH A O     
4159 O O     . HOH G .   ? 0.6930 0.6892 0.6888 -0.0008 0.0000  0.0005  2052 HOH A O     
4160 O O     . HOH G .   ? 0.3582 0.3454 0.3252 0.0021  -0.0011 -0.0019 2053 HOH A O     
4161 O O     . HOH G .   ? 0.5906 0.5858 0.5911 -0.0014 0.0021  -0.0005 2054 HOH A O     
4162 O O     . HOH G .   ? 0.5114 0.5154 0.5116 -0.0013 -0.0008 -0.0004 2055 HOH A O     
4163 O O     . HOH G .   ? 0.2916 0.2926 0.2875 0.0032  -0.0058 0.0029  2056 HOH A O     
4164 O O     . HOH G .   ? 0.6125 0.6036 0.6059 -0.0009 0.0007  0.0005  2057 HOH A O     
4165 O O     . HOH G .   ? 0.4897 0.4869 0.4944 0.0014  0.0009  -0.0013 2058 HOH A O     
4166 O O     . HOH G .   ? 0.5942 0.5942 0.5917 -0.0015 0.0000  -0.0018 2059 HOH A O     
4167 O O     . HOH G .   ? 0.5324 0.5317 0.5343 -0.0002 -0.0007 0.0005  2060 HOH A O     
4168 O O     . HOH G .   ? 0.4669 0.4726 0.4648 -0.0048 -0.0029 -0.0023 2061 HOH A O     
4169 O O     . HOH G .   ? 0.4953 0.4867 0.4836 0.0014  0.0012  0.0027  2062 HOH A O     
4170 O O     . HOH G .   ? 0.4875 0.4906 0.4866 0.0000  -0.0008 0.0009  2063 HOH A O     
4171 O O     . HOH G .   ? 0.4403 0.4477 0.4278 -0.0013 -0.0052 0.0004  2064 HOH A O     
4172 O O     . HOH G .   ? 0.3689 0.3691 0.3500 0.0025  -0.0030 0.0016  2065 HOH A O     
4173 O O     . HOH G .   ? 0.3807 0.3820 0.3846 0.0004  -0.0009 0.0013  2066 HOH A O     
4174 O O     . HOH G .   ? 0.3113 0.3229 0.3047 -0.0010 0.0016  -0.0031 2067 HOH A O     
4175 O O     . HOH G .   ? 0.4841 0.4825 0.4867 -0.0006 0.0027  0.0013  2068 HOH A O     
4176 O O     . HOH G .   ? 0.4760 0.4822 0.4727 0.0021  -0.0034 0.0015  2069 HOH A O     
4177 O O     . HOH G .   ? 0.3990 0.4002 0.4094 -0.0053 -0.0021 -0.0043 2070 HOH A O     
4178 O O     . HOH G .   ? 0.3560 0.3590 0.3722 -0.0041 -0.0029 -0.0040 2071 HOH A O     
4179 O O     . HOH G .   ? 0.5375 0.5496 0.5500 0.0002  -0.0053 0.0011  2072 HOH A O     
4180 O O     . HOH G .   ? 0.4953 0.4881 0.4970 0.0014  0.0040  0.0003  2073 HOH A O     
4181 O O     . HOH G .   ? 0.4650 0.4728 0.4764 0.0029  -0.0005 0.0016  2074 HOH A O     
4182 O O     . HOH G .   ? 0.4764 0.4873 0.4871 0.0000  -0.0021 0.0008  2075 HOH A O     
4183 O O     . HOH G .   ? 0.5154 0.5238 0.5169 0.0016  -0.0024 0.0008  2076 HOH A O     
4184 O O     . HOH G .   ? 0.5026 0.5057 0.5024 -0.0003 -0.0014 -0.0009 2077 HOH A O     
4185 O O     . HOH G .   ? 0.4606 0.4565 0.4659 -0.0028 0.0025  -0.0026 2078 HOH A O     
4186 O O     . HOH G .   ? 0.5536 0.5503 0.5497 -0.0002 0.0012  -0.0017 2079 HOH A O     
4187 O O     . HOH G .   ? 0.5439 0.5401 0.5458 -0.0028 0.0007  -0.0034 2080 HOH A O     
4188 O O     . HOH G .   ? 0.4952 0.4908 0.4978 0.0022  0.0008  0.0019  2081 HOH A O     
4189 O O     . HOH G .   ? 0.5191 0.5157 0.5187 0.0020  0.0017  0.0006  2082 HOH A O     
4190 O O     . HOH G .   ? 0.3254 0.3268 0.3171 -0.0035 -0.0073 -0.0009 2083 HOH A O     
4191 O O     . HOH G .   ? 0.5305 0.5268 0.5308 -0.0013 0.0008  -0.0015 2084 HOH A O     
4192 O O     . HOH G .   ? 0.4571 0.4525 0.4459 -0.0008 0.0033  0.0002  2085 HOH A O     
4193 O O     . HOH G .   ? 0.5298 0.5298 0.5257 -0.0007 -0.0001 -0.0004 2086 HOH A O     
4194 O O     . HOH G .   ? 0.2793 0.2744 0.2683 0.0034  -0.0015 -0.0012 2087 HOH A O     
4195 O O     . HOH G .   ? 0.4355 0.4414 0.4352 0.0019  -0.0038 0.0009  2088 HOH A O     
4196 O O     . HOH G .   ? 0.4745 0.4816 0.4777 -0.0019 -0.0008 0.0012  2089 HOH A O     
4197 O O     . HOH G .   ? 0.3270 0.3285 0.3204 0.0002  -0.0032 0.0000  2090 HOH A O     
4198 O O     . HOH G .   ? 0.4376 0.4411 0.4362 0.0000  -0.0004 -0.0005 2091 HOH A O     
4199 O O     . HOH G .   ? 0.3315 0.3404 0.3574 0.0025  -0.0003 -0.0025 2092 HOH A O     
4200 O O     . HOH G .   ? 0.5265 0.5306 0.5365 0.0001  -0.0011 0.0011  2093 HOH A O     
4201 O O     . HOH G .   ? 0.5029 0.4947 0.4874 -0.0008 0.0007  0.0010  2094 HOH A O     
4202 O O     . HOH G .   ? 0.4857 0.4924 0.4967 -0.0016 -0.0037 -0.0014 2095 HOH A O     
4203 O O     . HOH G .   ? 0.5393 0.5256 0.5239 0.0001  0.0006  -0.0002 2096 HOH A O     
4204 O O     . HOH G .   ? 0.5049 0.5070 0.5039 0.0028  -0.0015 -0.0013 2097 HOH A O     
4205 O O     . HOH G .   ? 0.3899 0.3819 0.3832 -0.0004 -0.0022 0.0005  2098 HOH A O     
4206 O O     . HOH G .   ? 0.5829 0.5835 0.5800 -0.0012 0.0004  -0.0013 2099 HOH A O     
4207 O O     . HOH G .   ? 0.5558 0.5621 0.5615 0.0005  0.0000  0.0014  2100 HOH A O     
4208 O O     . HOH G .   ? 0.3448 0.3561 0.3518 -0.0006 -0.0060 -0.0001 2101 HOH A O     
4209 O O     . HOH G .   ? 0.5128 0.5213 0.5120 0.0000  -0.0053 -0.0009 2102 HOH A O     
4210 O O     . HOH G .   ? 0.3548 0.3465 0.3519 0.0006  0.0005  0.0030  2103 HOH A O     
4211 O O     . HOH G .   ? 0.4727 0.4672 0.4634 0.0015  0.0000  0.0032  2104 HOH A O     
4212 O O     . HOH G .   ? 0.4874 0.4879 0.4847 0.0018  0.0002  0.0054  2105 HOH A O     
4213 O O     . HOH G .   ? 0.4242 0.4122 0.4061 0.0025  -0.0002 0.0012  2106 HOH A O     
4214 O O     . HOH G .   ? 0.4507 0.4605 0.4674 0.0025  0.0002  0.0049  2107 HOH A O     
4215 O O     . HOH G .   ? 0.5410 0.5460 0.5545 -0.0011 -0.0001 0.0010  2108 HOH A O     
4216 O O     . HOH G .   ? 0.4008 0.4085 0.4025 0.0000  0.0000  0.0004  2109 HOH A O     
4217 O O     . HOH G .   ? 0.4068 0.4191 0.4212 0.0010  -0.0003 0.0035  2110 HOH A O     
4218 O O     . HOH G .   ? 0.5477 0.5496 0.5475 -0.0023 0.0020  -0.0035 2111 HOH A O     
4219 O O     . HOH G .   ? 0.6104 0.6073 0.6002 0.0000  -0.0009 0.0010  2112 HOH A O     
4220 O O     . HOH G .   ? 0.6324 0.6261 0.6312 0.0004  0.0019  0.0011  2113 HOH A O     
4221 O O     . HOH G .   ? 0.4333 0.4354 0.4241 -0.0003 -0.0036 -0.0047 2114 HOH A O     
4222 O O     . HOH G .   ? 0.6235 0.6179 0.6236 0.0001  0.0044  0.0005  2115 HOH A O     
4223 O O     . HOH G .   ? 0.5002 0.4897 0.4835 -0.0022 -0.0009 -0.0038 2116 HOH A O     
4224 O O     . HOH G .   ? 0.2171 0.2402 0.2287 0.0042  -0.0024 -0.0010 2117 HOH A O     
4225 O O     . HOH G .   ? 0.2721 0.2612 0.2508 -0.0024 -0.0013 -0.0039 2118 HOH A O     
4226 O O     . HOH G .   ? 0.3176 0.3253 0.3216 0.0048  0.0029  0.0005  2119 HOH A O     
4227 O O     . HOH G .   ? 0.5155 0.5245 0.5145 -0.0033 -0.0020 -0.0011 2120 HOH A O     
4228 O O     . HOH G .   ? 0.6181 0.6242 0.6249 0.0006  -0.0019 -0.0005 2121 HOH A O     
4229 O O     . HOH G .   ? 0.5231 0.5263 0.5259 -0.0025 -0.0020 -0.0006 2122 HOH A O     
4230 O O     . HOH G .   ? 0.2851 0.3166 0.3008 -0.0057 -0.0057 -0.0116 2123 HOH A O     
4231 O O     . HOH G .   ? 0.4468 0.4386 0.4461 0.0001  -0.0005 -0.0016 2124 HOH A O     
4232 O O     . HOH G .   ? 0.5003 0.4875 0.4907 -0.0002 0.0034  -0.0016 2125 HOH A O     
4233 O O     . HOH G .   ? 0.4173 0.4028 0.3941 0.0010  0.0019  0.0033  2126 HOH A O     
4234 O O     . HOH G .   ? 0.4460 0.4489 0.4343 -0.0030 -0.0017 -0.0012 2127 HOH A O     
4235 O O     . HOH G .   ? 0.3556 0.3684 0.3599 -0.0019 -0.0090 -0.0051 2128 HOH A O     
4236 O O     . HOH G .   ? 0.5482 0.5489 0.5532 -0.0006 -0.0007 -0.0011 2129 HOH A O     
4237 O O     . HOH G .   ? 0.2090 0.2213 0.2172 0.0049  -0.0044 0.0042  2130 HOH A O     
4238 O O     . HOH G .   ? 0.5046 0.5126 0.5093 0.0045  0.0000  0.0030  2131 HOH A O     
4239 O O     . HOH G .   ? 0.5870 0.5853 0.5901 0.0014  0.0011  0.0002  2132 HOH A O     
4240 O O     . HOH G .   ? 0.5558 0.5543 0.5588 0.0033  0.0007  0.0030  2133 HOH A O     
4241 O O     . HOH G .   ? 0.2806 0.2949 0.2792 0.0050  -0.0096 0.0035  2134 HOH A O     
4242 O O     . HOH G .   ? 0.4816 0.4697 0.4694 0.0043  0.0014  0.0028  2135 HOH A O     
4243 O O     . HOH G .   ? 0.3887 0.3821 0.3829 0.0056  -0.0025 0.0038  2136 HOH A O     
4244 O O     . HOH G .   ? 0.2453 0.2760 0.2645 -0.0025 -0.0005 -0.0031 2137 HOH A O     
4245 O O     . HOH G .   ? 0.4888 0.4871 0.4801 -0.0009 -0.0040 0.0006  2138 HOH A O     
4246 O O     . HOH G .   ? 0.5943 0.5907 0.5907 0.0013  0.0017  0.0016  2139 HOH A O     
4247 O O     . HOH G .   ? 0.4466 0.4438 0.4571 -0.0032 0.0043  -0.0018 2140 HOH A O     
4248 O O     . HOH G .   ? 0.3817 0.3733 0.3658 0.0001  -0.0021 0.0022  2141 HOH A O     
4249 O O     . HOH G .   ? 0.3595 0.3541 0.3542 0.0020  0.0000  -0.0007 2142 HOH A O     
4250 O O     . HOH G .   ? 0.5114 0.5151 0.5221 -0.0020 0.0006  -0.0009 2143 HOH A O     
4251 O O     . HOH G .   ? 0.6488 0.6468 0.6528 0.0008  0.0035  0.0000  2144 HOH A O     
4252 O O     . HOH G .   ? 0.2540 0.2637 0.2441 0.0026  0.0000  -0.0038 2145 HOH A O     
4253 O O     . HOH G .   ? 0.3433 0.3485 0.3383 -0.0024 0.0010  -0.0017 2146 HOH A O     
4254 O O     . HOH G .   ? 0.4765 0.4720 0.4713 -0.0002 0.0002  -0.0001 2147 HOH A O     
4255 O O     . HOH G .   ? 0.6813 0.6781 0.6825 0.0006  0.0008  0.0002  2148 HOH A O     
4256 O O     . HOH G .   ? 0.4478 0.4444 0.4532 -0.0026 0.0021  -0.0036 2149 HOH A O     
4257 O O     . HOH G .   ? 0.4937 0.4998 0.4996 0.0022  -0.0012 0.0024  2150 HOH A O     
4258 O O     . HOH G .   ? 0.3515 0.3443 0.3447 0.0037  -0.0002 0.0017  2151 HOH A O     
4259 O O     . HOH G .   ? 0.3823 0.3921 0.4019 0.0015  0.0002  0.0001  2152 HOH A O     
4260 O O     . HOH G .   ? 0.4955 0.4990 0.4979 -0.0010 -0.0022 0.0017  2153 HOH A O     
4261 O O     . HOH G .   ? 0.4295 0.4474 0.4426 -0.0001 -0.0054 0.0042  2154 HOH A O     
4262 O O     . HOH G .   ? 0.5507 0.5448 0.5427 -0.0003 0.0031  0.0000  2155 HOH A O     
4263 O O     . HOH G .   ? 0.4703 0.4622 0.4584 0.0008  0.0001  0.0010  2156 HOH A O     
4264 O O     . HOH G .   ? 0.5048 0.5043 0.5017 -0.0043 0.0005  -0.0035 2157 HOH A O     
4265 O O     . HOH G .   ? 0.3665 0.3640 0.3607 0.0016  -0.0027 0.0039  2158 HOH A O     
4266 O O     . HOH G .   ? 0.4263 0.4392 0.4378 -0.0043 -0.0027 -0.0005 2159 HOH A O     
4267 O O     . HOH G .   ? 0.3534 0.3595 0.3602 -0.0005 -0.0023 0.0013  2160 HOH A O     
4268 O O     . HOH G .   ? 0.4708 0.4710 0.4905 0.0009  0.0034  0.0001  2161 HOH A O     
4269 O O     . HOH G .   ? 0.3286 0.3423 0.3353 -0.0043 -0.0036 -0.0020 2162 HOH A O     
4270 O O     . HOH G .   ? 0.3348 0.3283 0.3318 -0.0008 -0.0006 -0.0055 2163 HOH A O     
4271 O O     . HOH G .   ? 0.2794 0.2891 0.2837 -0.0007 -0.0042 0.0002  2164 HOH A O     
4272 O O     . HOH G .   ? 0.2828 0.2760 0.2723 0.0024  0.0000  0.0032  2165 HOH A O     
4273 O O     . HOH G .   ? 0.2308 0.2478 0.2399 -0.0018 -0.0043 -0.0028 2166 HOH A O     
4274 O O     . HOH G .   ? 0.3491 0.3509 0.3545 0.0038  -0.0005 0.0062  2167 HOH A O     
4275 O O     . HOH G .   ? 0.5892 0.5879 0.5857 -0.0003 0.0003  0.0002  2168 HOH A O     
4276 O O     . HOH G .   ? 0.3004 0.2831 0.2729 0.0029  -0.0005 0.0021  2169 HOH A O     
4277 O O     . HOH G .   ? 0.2415 0.2446 0.2452 -0.0027 0.0023  0.0028  2170 HOH A O     
4278 O O     . HOH G .   ? 0.3657 0.3732 0.3625 0.0016  -0.0033 0.0006  2171 HOH A O     
4279 O O     . HOH G .   ? 0.4938 0.4978 0.4834 -0.0011 -0.0042 -0.0002 2172 HOH A O     
4280 O O     . HOH G .   ? 0.4384 0.4354 0.4170 0.0000  -0.0002 0.0009  2173 HOH A O     
4281 O O     . HOH G .   ? 0.5237 0.5244 0.5192 0.0012  0.0018  0.0019  2174 HOH A O     
4282 O O     . HOH G .   ? 0.5125 0.5083 0.5190 -0.0016 0.0049  -0.0004 2175 HOH A O     
4283 O O     . HOH G .   ? 0.4971 0.4948 0.4973 0.0020  0.0013  0.0006  2176 HOH A O     
4284 O O     . HOH G .   ? 0.6307 0.6338 0.6412 0.0000  0.0006  -0.0010 2177 HOH A O     
4285 O O     . HOH G .   ? 0.3856 0.3813 0.3923 0.0007  -0.0016 0.0011  2178 HOH A O     
4286 O O     . HOH G .   ? 0.5489 0.5531 0.5636 -0.0013 0.0002  0.0007  2179 HOH A O     
4287 O O     . HOH G .   ? 0.4733 0.4708 0.4605 -0.0017 -0.0034 -0.0001 2180 HOH A O     
4288 O O     . HOH G .   ? 0.4655 0.4659 0.4534 -0.0008 -0.0053 -0.0011 2181 HOH A O     
4289 O O     . HOH G .   ? 0.4447 0.4449 0.4605 -0.0010 0.0011  -0.0012 2182 HOH A O     
4290 O O     . HOH G .   ? 0.4116 0.4203 0.4168 -0.0006 -0.0010 -0.0007 2183 HOH A O     
4291 O O     . HOH G .   ? 0.3326 0.3454 0.3569 0.0057  -0.0059 0.0000  2184 HOH A O     
4292 O O     . HOH G .   ? 0.3381 0.3323 0.3320 0.0023  0.0013  0.0027  2185 HOH A O     
4293 O O     . HOH G .   ? 0.5245 0.5221 0.5274 0.0012  0.0030  0.0003  2186 HOH A O     
4294 O O     . HOH G .   ? 0.4402 0.4292 0.4379 -0.0026 0.0022  -0.0025 2187 HOH A O     
4295 O O     . HOH G .   ? 0.4201 0.4064 0.4054 -0.0044 -0.0033 -0.0026 2188 HOH A O     
4296 O O     . HOH G .   ? 0.4316 0.4391 0.4332 0.0013  -0.0013 0.0000  2189 HOH A O     
4297 O O     . HOH G .   ? 0.2180 0.2199 0.2062 -0.0015 0.0036  0.0042  2190 HOH A O     
4298 O O     . HOH G .   ? 0.3546 0.3715 0.3692 0.0006  -0.0070 -0.0029 2191 HOH A O     
4299 O O     . HOH G .   ? 0.3345 0.3391 0.3301 0.0010  0.0005  0.0003  2192 HOH A O     
4300 O O     . HOH G .   ? 0.4916 0.4922 0.4971 -0.0001 -0.0015 0.0015  2193 HOH A O     
4301 O O     . HOH G .   ? 0.3828 0.3797 0.3720 0.0029  -0.0045 0.0034  2194 HOH A O     
4302 O O     . HOH G .   ? 0.5860 0.5809 0.5870 0.0014  0.0044  0.0024  2195 HOH A O     
4303 O O     . HOH G .   ? 0.2064 0.2085 0.2100 0.0051  -0.0057 0.0096  2196 HOH A O     
4304 O O     . HOH G .   ? 0.2880 0.2742 0.2796 0.0013  0.0006  0.0036  2197 HOH A O     
4305 O O     . HOH G .   ? 0.4435 0.4351 0.4401 0.0003  0.0034  -0.0006 2198 HOH A O     
4306 O O     . HOH G .   ? 0.4241 0.4262 0.4306 0.0017  -0.0024 0.0005  2199 HOH A O     
4307 O O     . HOH G .   ? 0.2643 0.2794 0.2935 -0.0018 -0.0016 0.0010  2200 HOH A O     
4308 O O     . HOH G .   ? 0.4195 0.4219 0.4270 0.0040  -0.0024 0.0042  2201 HOH A O     
4309 O O     . HOH G .   ? 0.4456 0.4443 0.4550 0.0009  0.0006  -0.0018 2202 HOH A O     
4310 O O     . HOH G .   ? 0.6137 0.6176 0.6176 -0.0003 -0.0008 0.0000  2203 HOH A O     
4311 O O     . HOH G .   ? 0.4734 0.4808 0.4872 -0.0024 -0.0015 -0.0020 2204 HOH A O     
4312 O O     . HOH G .   ? 0.4725 0.4773 0.4794 0.0027  -0.0036 0.0018  2205 HOH A O     
4313 O O     . HOH G .   ? 0.3756 0.3807 0.3821 -0.0007 -0.0025 -0.0006 2206 HOH A O     
4314 O O     . HOH G .   ? 0.3504 0.3676 0.3726 0.0028  -0.0022 -0.0013 2207 HOH A O     
4315 O O     . HOH G .   ? 0.3121 0.2898 0.2876 0.0076  0.0043  0.0056  2208 HOH A O     
4316 O O     . HOH G .   ? 0.4293 0.4179 0.4243 0.0005  0.0028  0.0014  2209 HOH A O     
4317 O O     . HOH G .   ? 0.4353 0.4372 0.4400 -0.0022 -0.0013 0.0009  2210 HOH A O     
4318 O O     . HOH G .   ? 0.2650 0.2711 0.2658 0.0029  -0.0066 0.0024  2211 HOH A O     
4319 O O     . HOH G .   ? 0.2745 0.2599 0.2663 -0.0041 -0.0018 -0.0028 2212 HOH A O     
4320 O O     . HOH G .   ? 0.2370 0.2423 0.2468 0.0046  0.0012  0.0062  2213 HOH A O     
4321 O O     . HOH G .   ? 0.2480 0.2625 0.2825 0.0001  -0.0008 -0.0002 2214 HOH A O     
4322 O O     . HOH G .   ? 0.4293 0.4372 0.4472 -0.0003 0.0010  -0.0038 2215 HOH A O     
4323 O O     . HOH G .   ? 0.3149 0.3099 0.3192 -0.0073 0.0023  -0.0059 2216 HOH A O     
4324 O O     . HOH G .   ? 0.2456 0.2418 0.2500 -0.0012 0.0006  -0.0007 2217 HOH A O     
4325 O O     . HOH G .   ? 0.2126 0.2085 0.1990 -0.0013 -0.0029 0.0000  2218 HOH A O     
4326 O O     . HOH G .   ? 0.2190 0.2086 0.2180 -0.0037 -0.0021 -0.0040 2219 HOH A O     
4327 O O     . HOH G .   ? 0.2362 0.2529 0.2251 0.0020  0.0000  0.0060  2220 HOH A O     
4328 O O     . HOH G .   ? 0.3436 0.3348 0.3370 -0.0024 0.0015  -0.0050 2221 HOH A O     
4329 O O     . HOH G .   ? 0.5165 0.5109 0.5114 -0.0026 0.0014  -0.0017 2222 HOH A O     
4330 O O     . HOH G .   ? 0.6669 0.6628 0.6627 0.0001  -0.0001 0.0009  2223 HOH A O     
4331 O O     . HOH G .   ? 0.5946 0.5886 0.5845 -0.0017 0.0025  -0.0022 2224 HOH A O     
4332 O O     . HOH G .   ? 0.5849 0.5830 0.5906 0.0031  0.0040  0.0034  2225 HOH A O     
4333 O O     . HOH G .   ? 0.3150 0.3089 0.2988 0.0021  -0.0010 0.0039  2226 HOH A O     
4334 O O     . HOH G .   ? 0.2157 0.2225 0.2051 0.0031  -0.0072 0.0002  2227 HOH A O     
4335 O O     . HOH G .   ? 0.2495 0.2547 0.2586 0.0043  -0.0003 0.0005  2228 HOH A O     
4336 O O     . HOH G .   ? 0.2089 0.2457 0.2140 -0.0004 -0.0046 -0.0031 2229 HOH A O     
4337 O O     . HOH G .   ? 0.3337 0.3349 0.3467 0.0036  -0.0005 0.0063  2230 HOH A O     
4338 O O     . HOH G .   ? 0.4710 0.4649 0.4719 -0.0064 0.0060  -0.0041 2231 HOH A O     
4339 O O     . HOH G .   ? 0.4296 0.4216 0.4335 -0.0033 0.0048  -0.0038 2232 HOH A O     
4340 O O     . HOH G .   ? 0.2923 0.3025 0.3109 -0.0013 0.0025  0.0007  2233 HOH A O     
4341 O O     . HOH G .   ? 0.1898 0.2002 0.1882 -0.0038 0.0013  0.0011  2234 HOH A O     
4342 O O     . HOH G .   ? 0.6589 0.6615 0.6632 -0.0004 0.0006  -0.0001 2235 HOH A O     
4343 O O     . HOH G .   ? 0.2623 0.2624 0.2463 -0.0057 -0.0063 -0.0088 2236 HOH A O     
4344 O O     . HOH G .   ? 0.2759 0.2799 0.2815 0.0067  0.0011  0.0039  2237 HOH A O     
4345 O O     . HOH G .   ? 0.3806 0.3861 0.3791 -0.0003 -0.0043 -0.0030 2238 HOH A O     
4346 O O     . HOH G .   ? 0.4975 0.4954 0.5024 0.0001  0.0005  -0.0007 2239 HOH A O     
4347 O O     . HOH G .   ? 0.5247 0.5294 0.5298 -0.0015 0.0021  -0.0012 2240 HOH A O     
4348 O O     . HOH G .   ? 0.5671 0.5552 0.5598 -0.0003 0.0043  0.0002  2241 HOH A O     
4349 O O     . HOH G .   ? 0.3338 0.3216 0.3270 -0.0016 0.0025  0.0007  2242 HOH A O     
4350 O O     . HOH G .   ? 0.5442 0.5424 0.5446 0.0010  0.0026  -0.0001 2243 HOH A O     
4351 O O     . HOH G .   ? 0.4345 0.4347 0.4338 -0.0030 0.0005  -0.0016 2244 HOH A O     
4352 O O     . HOH G .   ? 0.2341 0.2302 0.2393 0.0011  -0.0062 -0.0009 2245 HOH A O     
4353 O O     . HOH G .   ? 0.2044 0.2166 0.2003 -0.0001 -0.0021 0.0058  2246 HOH A O     
4354 O O     . HOH G .   ? 0.2958 0.3140 0.3014 -0.0034 -0.0082 -0.0011 2247 HOH A O     
4355 O O     . HOH G .   ? 0.2437 0.2467 0.2562 0.0041  -0.0015 0.0049  2248 HOH A O     
4356 O O     . HOH G .   ? 0.3644 0.3623 0.3693 0.0037  0.0028  0.0014  2249 HOH A O     
4357 O O     . HOH G .   ? 0.3000 0.2876 0.2710 0.0031  0.0035  0.0044  2250 HOH A O     
4358 O O     . HOH G .   ? 0.4082 0.4213 0.4338 0.0007  -0.0014 0.0024  2251 HOH A O     
4359 O O     . HOH G .   ? 0.3655 0.3634 0.3702 -0.0052 -0.0015 -0.0021 2252 HOH A O     
4360 O O     . HOH G .   ? 0.3631 0.3628 0.3705 -0.0012 0.0004  0.0009  2253 HOH A O     
4361 O O     . HOH G .   ? 0.2906 0.2819 0.2761 0.0003  -0.0012 -0.0054 2254 HOH A O     
4362 O O     . HOH G .   ? 0.2114 0.2014 0.1988 0.0016  0.0037  0.0015  2255 HOH A O     
4363 O O     . HOH G .   ? 0.1816 0.1914 0.1893 -0.0007 -0.0011 0.0030  2256 HOH A O     
4364 O O     . HOH G .   ? 0.3510 0.3378 0.3295 0.0074  0.0016  0.0003  2257 HOH A O     
4365 O O     . HOH G .   ? 0.4686 0.4782 0.4769 -0.0025 0.0002  0.0013  2258 HOH A O     
4366 O O     . HOH G .   ? 0.2823 0.2794 0.2695 0.0007  -0.0038 -0.0078 2259 HOH A O     
4367 O O     . HOH G .   ? 0.3610 0.3605 0.3523 0.0003  -0.0009 0.0044  2260 HOH A O     
4368 O O     . HOH G .   ? 0.2165 0.2170 0.2168 -0.0001 0.0036  0.0017  2261 HOH A O     
4369 O O     . HOH G .   ? 0.4502 0.4421 0.4447 -0.0029 0.0021  -0.0027 2262 HOH A O     
4370 O O     . HOH G .   ? 0.3728 0.3736 0.3731 0.0017  0.0016  0.0022  2263 HOH A O     
4371 O O     . HOH G .   ? 0.3339 0.3386 0.3440 -0.0013 0.0005  -0.0057 2264 HOH A O     
4372 O O     . HOH G .   ? 0.2984 0.3164 0.3150 -0.0088 -0.0056 -0.0030 2265 HOH A O     
4373 O O     . HOH G .   ? 0.2652 0.2679 0.2536 0.0038  -0.0065 0.0047  2266 HOH A O     
4374 O O     . HOH G .   ? 0.4603 0.4577 0.4522 0.0029  -0.0013 0.0032  2267 HOH A O     
4375 O O     . HOH G .   ? 0.4424 0.4500 0.4485 -0.0015 -0.0021 0.0007  2268 HOH A O     
4376 O O     . HOH G .   ? 0.4733 0.4743 0.4772 0.0044  -0.0007 0.0031  2269 HOH A O     
4377 O O     . HOH G .   ? 0.4401 0.4383 0.4398 0.0056  0.0008  0.0053  2270 HOH A O     
4378 O O     . HOH G .   ? 0.5672 0.5600 0.5586 0.0017  0.0012  0.0014  2271 HOH A O     
4379 O O     . HOH G .   ? 0.3956 0.4025 0.4032 0.0032  -0.0071 0.0055  2272 HOH A O     
4380 O O     . HOH G .   ? 0.3113 0.3309 0.3133 0.0024  -0.0029 0.0022  2273 HOH A O     
4381 O O     . HOH G .   ? 0.3553 0.3641 0.3522 0.0018  -0.0052 0.0035  2274 HOH A O     
4382 O O     . HOH G .   ? 0.1849 0.1983 0.2023 0.0014  0.0058  -0.0058 2275 HOH A O     
4383 O O     . HOH G .   ? 0.3952 0.4048 0.4034 -0.0002 0.0001  0.0019  2276 HOH A O     
4384 O O     . HOH G .   ? 0.4396 0.4330 0.4329 0.0004  0.0013  0.0048  2277 HOH A O     
4385 O O     . HOH G .   ? 0.1874 0.1966 0.2172 -0.0036 -0.0038 -0.0039 2278 HOH A O     
4386 O O     . HOH G .   ? 0.3155 0.3265 0.3304 0.0001  0.0000  -0.0044 2279 HOH A O     
4387 O O     . HOH G .   ? 0.5290 0.5217 0.5205 0.0013  0.0029  -0.0001 2280 HOH A O     
4388 O O     . HOH G .   ? 0.5622 0.5547 0.5603 0.0005  0.0001  0.0003  2281 HOH A O     
4389 O O     . HOH G .   ? 0.2603 0.2821 0.2811 -0.0029 -0.0031 -0.0060 2282 HOH A O     
4390 O O     . HOH G .   ? 0.4680 0.4670 0.4728 0.0000  -0.0009 -0.0018 2283 HOH A O     
4391 O O     . HOH G .   ? 0.5083 0.5006 0.5032 0.0006  0.0010  -0.0020 2284 HOH A O     
4392 O O     . HOH G .   ? 0.4713 0.4775 0.4775 0.0007  -0.0013 0.0006  2285 HOH A O     
4393 O O     . HOH G .   ? 0.3287 0.3349 0.3318 -0.0010 -0.0033 -0.0016 2286 HOH A O     
4394 O O     . HOH G .   ? 0.3397 0.3535 0.3600 -0.0008 -0.0010 -0.0015 2287 HOH A O     
4395 O O     . HOH G .   ? 0.3904 0.3884 0.3899 0.0030  0.0037  -0.0003 2288 HOH A O     
4396 O O     . HOH G .   ? 0.3109 0.3036 0.2994 -0.0021 0.0021  0.0015  2289 HOH A O     
4397 O O     . HOH G .   ? 0.4388 0.4266 0.4184 0.0034  0.0036  0.0074  2290 HOH A O     
4398 O O     . HOH G .   ? 0.4351 0.4435 0.4519 -0.0010 -0.0032 -0.0002 2291 HOH A O     
4399 O O     . HOH G .   ? 0.3589 0.3509 0.3637 -0.0025 0.0004  -0.0022 2292 HOH A O     
4400 O O     . HOH G .   ? 0.4688 0.4603 0.4600 0.0021  0.0019  0.0049  2293 HOH A O     
4401 O O     . HOH G .   ? 0.3378 0.3293 0.3216 -0.0048 0.0015  -0.0045 2294 HOH A O     
4402 O O     . HOH G .   ? 0.5712 0.5650 0.5597 -0.0016 0.0022  -0.0019 2295 HOH A O     
4403 O O     . HOH G .   ? 0.6104 0.6091 0.6091 0.0005  0.0005  0.0003  2296 HOH A O     
4404 O O     . HOH G .   ? 0.3628 0.3623 0.3556 -0.0052 0.0020  -0.0122 2297 HOH A O     
4405 O O     . HOH G .   ? 0.3831 0.3720 0.3708 0.0000  0.0035  0.0011  2298 HOH A O     
4406 O O     . HOH G .   ? 0.4855 0.4929 0.4916 -0.0026 -0.0012 -0.0054 2299 HOH A O     
4407 O O     . HOH G .   ? 0.3834 0.3805 0.3727 -0.0035 0.0002  -0.0020 2300 HOH A O     
4408 O O     . HOH G .   ? 0.4307 0.4274 0.4225 0.0018  -0.0013 0.0040  2301 HOH A O     
4409 O O     . HOH G .   ? 0.2891 0.3157 0.2998 -0.0056 -0.0019 -0.0016 2302 HOH A O     
4410 O O     . HOH G .   ? 0.2892 0.2872 0.2882 -0.0010 -0.0006 -0.0055 2303 HOH A O     
4411 O O     . HOH G .   ? 0.3044 0.2829 0.2885 0.0015  0.0066  0.0006  2304 HOH A O     
4412 O O     . HOH G .   ? 0.2803 0.2807 0.2685 -0.0015 0.0004  -0.0014 2305 HOH A O     
4413 O O     . HOH G .   ? 0.2558 0.2395 0.2253 -0.0037 -0.0008 -0.0077 2306 HOH A O     
4414 O O     . HOH G .   ? 0.2236 0.2294 0.2229 0.0042  -0.0035 -0.0029 2307 HOH A O     
4415 O O     . HOH G .   ? 0.1973 0.2134 0.1936 0.0080  -0.0032 0.0015  2308 HOH A O     
4416 O O     . HOH G .   ? 0.2989 0.3006 0.2740 -0.0011 -0.0060 -0.0014 2309 HOH A O     
4417 O O     . HOH G .   ? 0.2473 0.2668 0.2710 0.0007  -0.0037 -0.0011 2310 HOH A O     
4418 O O     . HOH G .   ? 0.3653 0.3759 0.3768 0.0016  -0.0018 -0.0027 2311 HOH A O     
4419 O O     . HOH H .   ? 0.4418 0.4350 0.4315 -0.0005 -0.0031 -0.0023 2001 HOH B O     
4420 O O     . HOH H .   ? 0.3754 0.3768 0.3869 0.0036  -0.0003 0.0033  2002 HOH B O     
4421 O O     . HOH H .   ? 0.4764 0.4730 0.4781 -0.0020 0.0015  0.0000  2003 HOH B O     
4422 O O     . HOH H .   ? 0.4695 0.4711 0.4624 0.0020  -0.0032 0.0019  2004 HOH B O     
4423 O O     . HOH H .   ? 0.4138 0.4186 0.4151 -0.0009 -0.0030 -0.0002 2005 HOH B O     
4424 O O     . HOH H .   ? 0.5375 0.5417 0.5428 -0.0030 -0.0022 -0.0008 2006 HOH B O     
4425 O O     . HOH H .   ? 0.4686 0.4694 0.4715 -0.0015 0.0015  -0.0030 2007 HOH B O     
4426 O O     . HOH H .   ? 0.3988 0.3930 0.3884 0.0025  0.0020  0.0004  2008 HOH B O     
4427 O O     . HOH H .   ? 0.4847 0.4832 0.4871 0.0009  0.0006  0.0016  2009 HOH B O     
4428 O O     . HOH H .   ? 0.2819 0.2828 0.2854 0.0023  0.0035  0.0006  2010 HOH B O     
4429 O O     . HOH H .   ? 0.2442 0.2515 0.2501 -0.0046 -0.0045 0.0026  2011 HOH B O     
4430 O O     . HOH H .   ? 0.2461 0.2475 0.2567 0.0040  -0.0010 0.0066  2012 HOH B O     
4431 O O     . HOH H .   ? 0.3362 0.3376 0.3361 0.0019  -0.0014 0.0069  2013 HOH B O     
4432 O O     . HOH H .   ? 0.2258 0.2073 0.2079 0.0015  -0.0009 -0.0009 2014 HOH B O     
4433 O O     . HOH H .   ? 0.4397 0.4402 0.4259 0.0027  -0.0055 0.0002  2015 HOH B O     
4434 O O     . HOH H .   ? 0.4691 0.4709 0.4685 0.0027  -0.0008 0.0011  2016 HOH B O     
4435 O O     . HOH H .   ? 0.3708 0.3651 0.3568 -0.0014 0.0021  0.0003  2017 HOH B O     
4436 O O     . HOH H .   ? 0.4437 0.4459 0.4514 0.0036  0.0014  0.0016  2018 HOH B O     
4437 O O     . HOH H .   ? 0.6791 0.6792 0.6830 -0.0002 0.0001  0.0003  2019 HOH B O     
4438 O O     . HOH H .   ? 0.5800 0.5800 0.5819 -0.0002 0.0001  -0.0001 2020 HOH B O     
4439 O O     . HOH H .   ? 0.4960 0.5000 0.5012 -0.0008 -0.0012 -0.0006 2021 HOH B O     
4440 O O     . HOH H .   ? 0.4852 0.4893 0.4951 0.0012  -0.0002 -0.0006 2022 HOH B O     
4441 O O     . HOH H .   ? 0.5270 0.5248 0.5290 -0.0004 0.0022  -0.0001 2023 HOH B O     
4442 O O     . HOH H .   ? 0.4836 0.4810 0.4763 0.0038  -0.0011 0.0040  2024 HOH B O     
4443 O O     . HOH H .   ? 0.3189 0.3164 0.3185 -0.0013 -0.0038 0.0010  2025 HOH B O     
4444 O O     . HOH H .   ? 0.2630 0.2539 0.2482 0.0003  -0.0012 -0.0009 2026 HOH B O     
4445 O O     . HOH H .   ? 0.3421 0.3297 0.3301 0.0046  0.0030  0.0038  2027 HOH B O     
4446 O O     . HOH H .   ? 0.6227 0.6197 0.6213 0.0004  0.0014  0.0000  2028 HOH B O     
4447 O O     . HOH H .   ? 0.5169 0.5218 0.5201 0.0017  -0.0009 0.0023  2029 HOH B O     
4448 O O     . HOH H .   ? 0.3391 0.3515 0.3599 0.0011  -0.0017 0.0006  2030 HOH B O     
4449 O O     . HOH H .   ? 0.5938 0.6009 0.5994 -0.0014 -0.0013 -0.0021 2031 HOH B O     
4450 O O     . HOH H .   ? 0.3742 0.3708 0.3604 -0.0018 -0.0024 0.0000  2032 HOH B O     
4451 O O     . HOH H .   ? 0.4454 0.4501 0.4465 0.0000  -0.0033 -0.0022 2033 HOH B O     
4452 O O     . HOH H .   ? 0.4351 0.4417 0.4423 -0.0015 -0.0005 0.0001  2034 HOH B O     
4453 O O     . HOH H .   ? 0.4193 0.4175 0.4207 0.0022  0.0022  0.0016  2035 HOH B O     
4454 O O     . HOH H .   ? 0.4458 0.4456 0.4439 -0.0007 0.0009  -0.0006 2036 HOH B O     
4455 O O     . HOH H .   ? 0.5085 0.5050 0.5103 0.0000  0.0006  0.0005  2037 HOH B O     
4456 O O     . HOH H .   ? 0.6278 0.6228 0.6255 0.0016  0.0018  0.0012  2038 HOH B O     
4457 O O     . HOH H .   ? 0.5821 0.5764 0.5758 0.0010  0.0004  -0.0001 2039 HOH B O     
4458 O O     . HOH H .   ? 0.5780 0.5777 0.5728 0.0018  0.0014  0.0010  2040 HOH B O     
4459 O O     . HOH H .   ? 0.5796 0.5848 0.5865 0.0012  -0.0012 0.0004  2041 HOH B O     
4460 O O     . HOH H .   ? 0.4399 0.4479 0.4408 0.0002  -0.0028 -0.0003 2042 HOH B O     
4461 O O     . HOH H .   ? 0.4208 0.4206 0.4233 0.0000  -0.0005 0.0007  2043 HOH B O     
4462 O O     . HOH H .   ? 0.5671 0.5675 0.5722 -0.0006 0.0011  -0.0001 2044 HOH B O     
4463 O O     . HOH H .   ? 0.5711 0.5723 0.5761 -0.0004 -0.0004 -0.0006 2045 HOH B O     
4464 O O     . HOH H .   ? 0.3768 0.3912 0.3808 0.0004  -0.0060 -0.0009 2046 HOH B O     
4465 O O     . HOH H .   ? 0.3055 0.3202 0.3171 0.0014  -0.0027 0.0041  2047 HOH B O     
4466 O O     . HOH H .   ? 0.2390 0.2392 0.2316 -0.0007 -0.0039 0.0013  2048 HOH B O     
4467 O O     . HOH H .   ? 0.5279 0.5331 0.5357 -0.0008 0.0004  0.0000  2049 HOH B O     
4468 O O     . HOH H .   ? 0.4903 0.4953 0.4910 -0.0006 -0.0001 0.0004  2050 HOH B O     
4469 O O     . HOH H .   ? 0.2792 0.2829 0.2695 -0.0015 0.0027  -0.0023 2051 HOH B O     
4470 O O     . HOH H .   ? 0.5691 0.5581 0.5601 0.0017  0.0029  0.0009  2052 HOH B O     
4471 O O     . HOH H .   ? 0.5345 0.5335 0.5313 -0.0009 -0.0006 -0.0011 2053 HOH B O     
4472 O O     . HOH H .   ? 0.4067 0.4006 0.3921 0.0006  -0.0030 0.0018  2054 HOH B O     
4473 O O     . HOH H .   ? 0.6517 0.6528 0.6516 0.0015  0.0002  -0.0001 2055 HOH B O     
4474 O O     . HOH H .   ? 0.5263 0.5248 0.5261 0.0000  -0.0017 0.0008  2056 HOH B O     
4475 O O     . HOH H .   ? 0.6094 0.6035 0.6059 0.0009  0.0031  0.0003  2057 HOH B O     
4476 O O     . HOH H .   ? 0.5308 0.5343 0.5321 -0.0012 -0.0003 -0.0006 2058 HOH B O     
4477 O O     . HOH H .   ? 0.3507 0.3542 0.3463 -0.0020 -0.0025 -0.0005 2059 HOH B O     
4478 O O     . HOH H .   ? 0.3879 0.3933 0.3969 0.0007  0.0000  -0.0016 2060 HOH B O     
4479 O O     . HOH H .   ? 0.6641 0.6601 0.6617 -0.0031 0.0020  -0.0010 2061 HOH B O     
4480 O O     . HOH H .   ? 0.6259 0.6217 0.6237 -0.0021 0.0005  -0.0016 2062 HOH B O     
4481 O O     . HOH H .   ? 0.4642 0.4711 0.4664 -0.0021 -0.0001 0.0001  2063 HOH B O     
4482 O O     . HOH H .   ? 0.4375 0.4326 0.4343 -0.0007 0.0000  -0.0014 2064 HOH B O     
4483 O O     . HOH H .   ? 0.4959 0.4912 0.4948 0.0008  0.0029  0.0021  2065 HOH B O     
4484 O O     . HOH H .   ? 0.2853 0.2943 0.3004 0.0011  0.0021  0.0012  2066 HOH B O     
4485 O O     . HOH H .   ? 0.4200 0.4157 0.4059 0.0053  -0.0004 0.0057  2067 HOH B O     
4486 O O     . HOH H .   ? 0.4986 0.5054 0.5045 -0.0031 -0.0039 -0.0004 2068 HOH B O     
4487 O O     . HOH H .   ? 0.4774 0.4882 0.4860 0.0000  -0.0035 -0.0025 2069 HOH B O     
4488 O O     . HOH H .   ? 0.5471 0.5451 0.5456 -0.0020 0.0003  -0.0032 2070 HOH B O     
4489 O O     . HOH H .   ? 0.5272 0.5295 0.5261 -0.0026 -0.0019 -0.0014 2071 HOH B O     
4490 O O     . HOH H .   ? 0.5803 0.5853 0.5868 0.0007  0.0011  0.0009  2072 HOH B O     
4491 O O     . HOH H .   ? 0.4984 0.5041 0.5060 -0.0012 -0.0013 -0.0020 2073 HOH B O     
4492 O O     . HOH H .   ? 0.4924 0.4927 0.4913 -0.0028 0.0013  -0.0016 2074 HOH B O     
4493 O O     . HOH H .   ? 0.5339 0.5347 0.5325 -0.0019 -0.0018 -0.0001 2075 HOH B O     
4494 O O     . HOH H .   ? 0.3819 0.3737 0.3829 -0.0015 0.0030  0.0021  2076 HOH B O     
4495 O O     . HOH H .   ? 0.4827 0.4798 0.4801 -0.0001 0.0000  0.0014  2077 HOH B O     
4496 O O     . HOH H .   ? 0.2593 0.2827 0.2944 -0.0007 -0.0091 -0.0024 2078 HOH B O     
4497 O O     . HOH H .   ? 0.4170 0.4101 0.4157 0.0014  0.0021  0.0033  2079 HOH B O     
4498 O O     . HOH H .   ? 0.4511 0.4474 0.4474 0.0041  0.0013  0.0002  2080 HOH B O     
4499 O O     . HOH H .   ? 0.5112 0.5088 0.5128 -0.0009 -0.0008 -0.0012 2081 HOH B O     
4500 O O     . HOH H .   ? 0.5116 0.5100 0.5188 0.0022  0.0028  0.0004  2082 HOH B O     
4501 O O     . HOH H .   ? 0.4543 0.4811 0.4695 -0.0049 -0.0158 -0.0034 2083 HOH B O     
4502 O O     . HOH H .   ? 0.5288 0.5305 0.5237 -0.0019 -0.0025 0.0000  2084 HOH B O     
4503 O O     . HOH H .   ? 0.2658 0.2743 0.2874 0.0009  0.0016  -0.0063 2085 HOH B O     
4504 O O     . HOH H .   ? 0.4709 0.4694 0.4789 -0.0006 0.0009  -0.0001 2086 HOH B O     
4505 O O     . HOH H .   ? 0.5773 0.5758 0.5691 0.0014  -0.0016 0.0003  2087 HOH B O     
4506 O O     . HOH H .   ? 0.2674 0.2689 0.2642 0.0009  -0.0034 0.0000  2088 HOH B O     
4507 O O     . HOH H .   ? 0.4333 0.4321 0.4264 -0.0018 0.0012  0.0011  2089 HOH B O     
4508 O O     . HOH H .   ? 0.3941 0.3893 0.3912 0.0000  -0.0014 0.0048  2090 HOH B O     
4509 O O     . HOH H .   ? 0.4852 0.4848 0.4964 -0.0015 0.0012  0.0006  2091 HOH B O     
4510 O O     . HOH H .   ? 0.5564 0.5548 0.5615 0.0007  0.0024  0.0022  2092 HOH B O     
4511 O O     . HOH H .   ? 0.5228 0.5139 0.5150 -0.0036 0.0047  -0.0025 2093 HOH B O     
4512 O O     . HOH H .   ? 0.3474 0.3394 0.3737 0.0011  -0.0023 0.0034  2094 HOH B O     
4513 O O     . HOH H .   ? 0.5186 0.5146 0.5153 -0.0014 -0.0019 -0.0007 2095 HOH B O     
4514 O O     . HOH H .   ? 0.4086 0.4062 0.4088 0.0032  0.0026  0.0031  2096 HOH B O     
4515 O O     . HOH H .   ? 0.5448 0.5390 0.5438 0.0016  0.0015  0.0021  2097 HOH B O     
4516 O O     . HOH H .   ? 0.3847 0.3853 0.3839 -0.0030 -0.0019 -0.0023 2098 HOH B O     
4517 O O     . HOH H .   ? 0.3343 0.3414 0.3432 0.0020  -0.0032 0.0016  2099 HOH B O     
4518 O O     . HOH H .   ? 0.4279 0.4086 0.4075 0.0020  0.0026  0.0012  2100 HOH B O     
4519 O O     . HOH H .   ? 0.4953 0.4970 0.5043 0.0013  0.0012  0.0002  2101 HOH B O     
4520 O O     . HOH H .   ? 0.4701 0.4663 0.4673 0.0031  -0.0012 0.0040  2102 HOH B O     
4521 O O     . HOH H .   ? 0.5261 0.5203 0.5276 -0.0017 0.0010  -0.0011 2103 HOH B O     
4522 O O     . HOH H .   ? 0.2708 0.2712 0.2732 -0.0031 -0.0025 -0.0021 2104 HOH B O     
4523 O O     . HOH H .   ? 0.2849 0.2916 0.2922 0.0042  -0.0031 0.0034  2105 HOH B O     
4524 O O     . HOH H .   ? 0.3338 0.3142 0.3100 -0.0024 0.0048  0.0015  2106 HOH B O     
4525 O O     . HOH H .   ? 0.2850 0.2744 0.2832 0.0032  -0.0003 -0.0013 2107 HOH B O     
4526 O O     . HOH H .   ? 0.4946 0.4937 0.5014 -0.0012 0.0003  -0.0024 2108 HOH B O     
4527 O O     . HOH H .   ? 0.6387 0.6388 0.6400 0.0040  -0.0011 0.0017  2109 HOH B O     
4528 O O     . HOH H .   ? 0.5441 0.5442 0.5524 -0.0001 0.0016  0.0000  2110 HOH B O     
4529 O O     . HOH H .   ? 0.3100 0.3205 0.3001 0.0021  -0.0011 0.0028  2111 HOH B O     
4530 O O     . HOH H .   ? 0.3543 0.3645 0.3616 0.0048  -0.0019 -0.0008 2112 HOH B O     
4531 O O     . HOH H .   ? 0.3008 0.2870 0.2928 0.0001  0.0034  0.0046  2113 HOH B O     
4532 O O     . HOH H .   ? 0.3475 0.3588 0.3416 -0.0016 -0.0049 0.0022  2114 HOH B O     
4533 O O     . HOH H .   ? 0.4215 0.4213 0.4218 0.0032  0.0020  0.0010  2115 HOH B O     
4534 O O     . HOH H .   ? 0.4583 0.4608 0.4420 0.0055  -0.0036 0.0019  2116 HOH B O     
4535 O O     . HOH H .   ? 0.2168 0.2212 0.2253 -0.0029 -0.0038 0.0005  2117 HOH B O     
4536 O O     . HOH H .   ? 0.3335 0.3311 0.3302 0.0080  0.0020  0.0019  2118 HOH B O     
4537 O O     . HOH H .   ? 0.4241 0.4179 0.4233 -0.0009 -0.0012 -0.0014 2119 HOH B O     
4538 O O     . HOH H .   ? 0.2570 0.2735 0.2302 0.0022  -0.0028 0.0012  2120 HOH B O     
4539 O O     . HOH H .   ? 0.2917 0.3173 0.3058 0.0015  0.0000  0.0011  2121 HOH B O     
4540 O O     . HOH H .   ? 0.3655 0.3674 0.3627 -0.0032 0.0002  -0.0034 2122 HOH B O     
4541 O O     . HOH H .   ? 0.3424 0.3509 0.3391 -0.0026 -0.0113 -0.0037 2123 HOH B O     
4542 O O     . HOH H .   ? 0.5183 0.5207 0.5182 -0.0017 -0.0007 -0.0012 2124 HOH B O     
4543 O O     . HOH H .   ? 0.2162 0.2259 0.2477 -0.0005 -0.0126 0.0043  2125 HOH B O     
4544 O O     . HOH H .   ? 0.4143 0.4305 0.4154 0.0018  -0.0064 0.0021  2126 HOH B O     
4545 O O     . HOH H .   ? 0.3093 0.3218 0.3383 -0.0111 0.0056  -0.0079 2127 HOH B O     
4546 O O     . HOH H .   ? 0.2702 0.2657 0.2551 -0.0062 -0.0030 -0.0104 2128 HOH B O     
4547 O O     . HOH H .   ? 0.3687 0.3690 0.3797 -0.0023 -0.0008 -0.0010 2129 HOH B O     
4548 O O     . HOH H .   ? 0.3876 0.3956 0.3921 -0.0014 -0.0070 -0.0051 2130 HOH B O     
4549 O O     . HOH H .   ? 0.5839 0.5872 0.5906 0.0038  0.0001  0.0017  2131 HOH B O     
4550 O O     . HOH H .   ? 0.5190 0.5176 0.5133 -0.0011 -0.0014 -0.0011 2132 HOH B O     
4551 O O     . HOH H .   ? 0.5359 0.5300 0.5416 -0.0011 0.0025  -0.0008 2133 HOH B O     
4552 O O     . HOH H .   ? 0.3615 0.3688 0.3579 -0.0037 -0.0022 0.0013  2134 HOH B O     
4553 O O     . HOH H .   ? 0.4839 0.4922 0.4947 0.0004  -0.0023 0.0000  2135 HOH B O     
4554 O O     . HOH H .   ? 0.5050 0.5061 0.5088 -0.0003 -0.0011 0.0007  2136 HOH B O     
4555 O O     . HOH H .   ? 0.5371 0.5338 0.5381 -0.0033 0.0025  -0.0028 2137 HOH B O     
4556 O O     . HOH H .   ? 0.2872 0.3064 0.2946 0.0009  -0.0053 0.0071  2138 HOH B O     
4557 O O     . HOH H .   ? 0.2701 0.2736 0.2338 0.0025  -0.0077 0.0010  2139 HOH B O     
4558 O O     . HOH H .   ? 0.5851 0.5799 0.5842 0.0001  0.0042  0.0000  2140 HOH B O     
4559 O O     . HOH H .   ? 0.5306 0.5270 0.5336 -0.0020 0.0020  -0.0004 2141 HOH B O     
4560 O O     . HOH H .   ? 0.4465 0.4435 0.4476 0.0020  -0.0031 -0.0010 2142 HOH B O     
4561 O O     . HOH H .   ? 0.4721 0.4619 0.4524 -0.0001 -0.0025 -0.0020 2143 HOH B O     
4562 O O     . HOH H .   ? 0.5078 0.5166 0.5134 0.0003  -0.0025 -0.0008 2144 HOH B O     
4563 O O     . HOH H .   ? 0.4675 0.4701 0.4657 0.0007  -0.0002 -0.0031 2145 HOH B O     
4564 O O     . HOH H .   ? 0.6376 0.6351 0.6425 -0.0005 0.0037  -0.0007 2146 HOH B O     
4565 O O     . HOH H .   ? 0.4802 0.4876 0.4770 0.0011  -0.0040 0.0022  2147 HOH B O     
4566 O O     . HOH H .   ? 0.5049 0.5002 0.5027 0.0038  -0.0003 -0.0029 2148 HOH B O     
4567 O O     . HOH H .   ? 0.2554 0.2542 0.2612 -0.0087 0.0005  -0.0073 2149 HOH B O     
4568 O O     . HOH H .   ? 0.5127 0.5118 0.5096 0.0007  -0.0026 0.0000  2150 HOH B O     
4569 O O     . HOH H .   ? 0.3904 0.3977 0.3919 0.0023  -0.0033 -0.0015 2151 HOH B O     
4570 O O     . HOH H .   ? 0.2842 0.2830 0.2766 -0.0018 -0.0002 -0.0040 2152 HOH B O     
4571 O O     . HOH H .   ? 0.3096 0.3041 0.3069 -0.0025 -0.0005 -0.0039 2153 HOH B O     
4572 O O     . HOH H .   ? 0.4253 0.4154 0.4237 -0.0013 0.0029  -0.0026 2154 HOH B O     
4573 O O     . HOH H .   ? 0.4471 0.4574 0.4636 -0.0023 0.0019  0.0000  2155 HOH B O     
4574 O O     . HOH H .   ? 0.3191 0.3286 0.3458 0.0006  -0.0022 -0.0008 2156 HOH B O     
4575 O O     . HOH H .   ? 0.4118 0.4062 0.4109 0.0006  -0.0009 -0.0001 2157 HOH B O     
4576 O O     . HOH H .   ? 0.6120 0.6124 0.6110 0.0000  0.0007  -0.0003 2158 HOH B O     
4577 O O     . HOH H .   ? 0.2448 0.2430 0.2498 -0.0044 -0.0029 0.0009  2159 HOH B O     
4578 O O     . HOH H .   ? 0.2398 0.2400 0.2222 -0.0004 -0.0005 -0.0043 2160 HOH B O     
4579 O O     . HOH H .   ? 0.4993 0.5042 0.4967 -0.0001 0.0006  -0.0005 2161 HOH B O     
4580 O O     . HOH H .   ? 0.4238 0.4188 0.4014 -0.0016 -0.0041 0.0009  2162 HOH B O     
4581 O O     . HOH H .   ? 0.3681 0.3630 0.3567 0.0015  -0.0030 -0.0006 2163 HOH B O     
4582 O O     . HOH H .   ? 0.4068 0.4002 0.3948 -0.0011 0.0042  0.0020  2164 HOH B O     
4583 O O     . HOH H .   ? 0.2211 0.2075 0.2078 -0.0022 0.0036  -0.0009 2165 HOH B O     
4584 O O     . HOH H .   ? 0.2346 0.2216 0.2185 -0.0044 -0.0016 -0.0064 2166 HOH B O     
4585 O O     . HOH H .   ? 0.5326 0.5373 0.5388 -0.0018 -0.0017 -0.0032 2167 HOH B O     
4586 O O     . HOH H .   ? 0.4451 0.4451 0.4467 -0.0006 0.0001  -0.0020 2168 HOH B O     
4587 O O     . HOH H .   ? 0.2480 0.2439 0.2396 0.0001  0.0024  0.0014  2169 HOH B O     
4588 O O     . HOH H .   ? 0.3397 0.3299 0.3209 0.0014  0.0048  0.0039  2170 HOH B O     
4589 O O     . HOH H .   ? 0.4579 0.4614 0.4598 0.0001  -0.0006 -0.0021 2171 HOH B O     
4590 O O     . HOH H .   ? 0.2228 0.2209 0.2174 -0.0043 -0.0006 -0.0031 2172 HOH B O     
4591 O O     . HOH H .   ? 0.4588 0.4628 0.4650 0.0000  -0.0014 -0.0010 2173 HOH B O     
4592 O O     . HOH H .   ? 0.3673 0.3688 0.3668 -0.0021 0.0025  0.0042  2174 HOH B O     
4593 O O     . HOH H .   ? 0.4060 0.4099 0.4024 0.0025  -0.0081 0.0029  2175 HOH B O     
4594 O O     . HOH H .   ? 0.5120 0.5027 0.4990 -0.0010 0.0009  0.0001  2176 HOH B O     
4595 O O     . HOH H .   ? 0.4207 0.4194 0.4300 0.0010  0.0008  -0.0013 2177 HOH B O     
4596 O O     . HOH H .   ? 0.3156 0.3261 0.3031 0.0075  0.0000  0.0063  2178 HOH B O     
4597 O O     . HOH H .   ? 0.4229 0.4242 0.4348 0.0027  -0.0003 0.0062  2179 HOH B O     
4598 O O     . HOH H .   ? 0.2605 0.2598 0.2655 0.0073  0.0034  0.0054  2180 HOH B O     
4599 O O     . HOH H .   ? 0.5616 0.5570 0.5557 -0.0001 -0.0013 0.0003  2181 HOH B O     
4600 O O     . HOH H .   ? 0.2069 0.2189 0.2203 -0.0025 -0.0050 -0.0027 2182 HOH B O     
4601 O O     . HOH H .   ? 0.4625 0.4662 0.4625 -0.0012 -0.0012 0.0003  2183 HOH B O     
4602 O O     . HOH H .   ? 0.4585 0.4536 0.4593 0.0017  -0.0004 0.0020  2184 HOH B O     
4603 O O     . HOH H .   ? 0.3778 0.3625 0.3548 -0.0014 0.0001  -0.0002 2185 HOH B O     
4604 O O     . HOH H .   ? 0.3915 0.3884 0.3877 -0.0004 -0.0001 -0.0008 2186 HOH B O     
4605 O O     . HOH H .   ? 0.2924 0.2910 0.2977 0.0031  0.0034  0.0040  2187 HOH B O     
4606 O O     . HOH H .   ? 0.3305 0.3274 0.3185 -0.0067 0.0033  -0.0041 2188 HOH B O     
4607 O O     . HOH H .   ? 0.2827 0.3029 0.2883 -0.0017 -0.0040 -0.0017 2189 HOH B O     
4608 O O     . HOH H .   ? 0.4348 0.4319 0.4256 0.0018  0.0020  0.0035  2190 HOH B O     
4609 O O     . HOH H .   ? 0.2619 0.2816 0.2817 0.0004  -0.0021 0.0061  2191 HOH B O     
4610 O O     . HOH H .   ? 0.2236 0.2256 0.2299 -0.0023 0.0052  0.0031  2192 HOH B O     
4611 O O     . HOH H .   ? 0.5252 0.5277 0.5290 -0.0018 -0.0002 -0.0012 2193 HOH B O     
4612 O O     . HOH H .   ? 0.3200 0.3147 0.3287 0.0028  0.0025  -0.0052 2194 HOH B O     
4613 O O     . HOH H .   ? 0.4110 0.4163 0.3915 -0.0002 -0.0065 0.0030  2195 HOH B O     
4614 O O     . HOH H .   ? 0.4502 0.4378 0.4494 -0.0029 0.0022  -0.0009 2196 HOH B O     
4615 O O     . HOH H .   ? 0.4846 0.4871 0.4892 0.0012  -0.0008 -0.0001 2197 HOH B O     
4616 O O     . HOH H .   ? 0.5036 0.5003 0.5002 0.0002  0.0000  0.0002  2198 HOH B O     
4617 O O     . HOH H .   ? 0.3470 0.3719 0.3635 0.0000  -0.0046 -0.0059 2199 HOH B O     
4618 O O     . HOH H .   ? 0.5114 0.5141 0.5183 -0.0008 -0.0002 0.0011  2200 HOH B O     
4619 O O     . HOH H .   ? 0.3553 0.3671 0.3633 -0.0029 -0.0015 -0.0008 2201 HOH B O     
4620 O O     . HOH H .   ? 0.3851 0.4058 0.3983 -0.0021 -0.0068 0.0000  2202 HOH B O     
4621 O O     . HOH H .   ? 0.4901 0.4900 0.4978 0.0023  0.0031  0.0033  2203 HOH B O     
4622 O O     . HOH H .   ? 0.4059 0.4040 0.4102 0.0060  -0.0003 0.0077  2204 HOH B O     
4623 O O     . HOH H .   ? 0.4777 0.4768 0.4891 -0.0051 0.0002  -0.0014 2205 HOH B O     
4624 O O     . HOH H .   ? 0.5696 0.5609 0.5661 0.0008  0.0021  0.0021  2206 HOH B O     
4625 O O     . HOH H .   ? 0.4987 0.4788 0.4904 0.0007  0.0053  -0.0020 2207 HOH B O     
4626 O O     . HOH H .   ? 0.4556 0.4586 0.4484 -0.0016 -0.0036 -0.0001 2208 HOH B O     
4627 O O     . HOH H .   ? 0.3581 0.3524 0.3460 0.0049  -0.0029 0.0038  2209 HOH B O     
4628 O O     . HOH H .   ? 0.4724 0.4720 0.4873 0.0018  0.0006  0.0018  2210 HOH B O     
4629 O O     . HOH H .   ? 0.4776 0.4798 0.4795 0.0033  0.0008  0.0000  2211 HOH B O     
4630 O O     . HOH H .   ? 0.5020 0.5011 0.4966 -0.0027 -0.0007 -0.0016 2212 HOH B O     
4631 O O     . HOH H .   ? 0.2335 0.2239 0.2274 -0.0001 0.0047  0.0040  2213 HOH B O     
4632 O O     . HOH H .   ? 0.4461 0.4378 0.4382 0.0001  0.0039  0.0013  2214 HOH B O     
4633 O O     . HOH H .   ? 0.5097 0.5080 0.5035 0.0020  -0.0003 0.0018  2215 HOH B O     
4634 O O     . HOH H .   ? 0.4494 0.4580 0.4627 -0.0045 -0.0006 -0.0034 2216 HOH B O     
4635 O O     . HOH H .   ? 0.5143 0.5184 0.5240 -0.0013 0.0017  0.0017  2217 HOH B O     
4636 O O     . HOH H .   ? 0.3966 0.3986 0.3986 -0.0022 0.0001  -0.0014 2218 HOH B O     
4637 O O     . HOH H .   ? 0.6165 0.6130 0.6080 0.0013  -0.0014 0.0002  2219 HOH B O     
4638 O O     . HOH H .   ? 0.3359 0.3497 0.3402 0.0039  0.0011  0.0023  2220 HOH B O     
4639 O O     . HOH H .   ? 0.3766 0.3845 0.3719 0.0025  -0.0053 -0.0017 2221 HOH B O     
4640 O O     . HOH H .   ? 0.5550 0.5513 0.5594 0.0038  0.0028  0.0051  2222 HOH B O     
4641 O O     . HOH H .   ? 0.4868 0.4706 0.4855 0.0002  0.0053  0.0000  2223 HOH B O     
4642 O O     . HOH H .   ? 0.4845 0.4751 0.4798 0.0012  -0.0006 0.0042  2224 HOH B O     
4643 O O     . HOH H .   ? 0.3268 0.3206 0.3183 -0.0024 0.0031  -0.0008 2225 HOH B O     
4644 O O     . HOH H .   ? 0.3316 0.3404 0.3165 0.0071  -0.0086 0.0083  2226 HOH B O     
4645 O O     . HOH H .   ? 0.3114 0.3414 0.3446 -0.0021 -0.0033 -0.0027 2227 HOH B O     
4646 O O     . HOH H .   ? 0.4704 0.4700 0.4730 -0.0008 -0.0004 0.0006  2228 HOH B O     
4647 O O     . HOH H .   ? 0.4211 0.4290 0.4213 -0.0036 -0.0018 -0.0049 2229 HOH B O     
4648 O O     . HOH H .   ? 0.4468 0.4389 0.4294 -0.0006 0.0009  -0.0026 2230 HOH B O     
4649 O O     . HOH H .   ? 0.4223 0.4192 0.4172 0.0023  0.0013  0.0038  2231 HOH B O     
4650 O O     . HOH H .   ? 0.2510 0.2639 0.2564 -0.0011 -0.0063 -0.0095 2232 HOH B O     
4651 O O     . HOH H .   ? 0.3707 0.3656 0.3632 0.0037  -0.0016 0.0013  2233 HOH B O     
4652 O O     . HOH H .   ? 0.2934 0.2968 0.3245 0.0062  0.0026  0.0099  2234 HOH B O     
4653 O O     . HOH H .   ? 0.2699 0.2855 0.2965 -0.0037 0.0032  -0.0020 2235 HOH B O     
4654 O O     . HOH H .   ? 0.2309 0.2211 0.2248 -0.0009 -0.0080 0.0013  2236 HOH B O     
4655 O O     . HOH H .   ? 0.5334 0.5280 0.5321 0.0028  -0.0006 0.0032  2237 HOH B O     
4656 O O     . HOH H .   ? 0.3448 0.3429 0.3312 0.0020  -0.0041 -0.0026 2238 HOH B O     
4657 O O     . HOH H .   ? 0.3606 0.3514 0.3467 0.0046  -0.0047 0.0032  2239 HOH B O     
4658 O O     . HOH H .   ? 0.2281 0.2434 0.2427 -0.0006 -0.0071 -0.0002 2240 HOH B O     
4659 O O     . HOH H .   ? 0.3827 0.3897 0.3936 -0.0006 0.0012  -0.0012 2241 HOH B O     
4660 O O     . HOH H .   ? 0.4862 0.4874 0.4921 0.0006  0.0041  -0.0001 2242 HOH B O     
4661 O O     . HOH H .   ? 0.3213 0.3237 0.3002 0.0033  -0.0030 0.0000  2243 HOH B O     
4662 O O     . HOH H .   ? 0.1989 0.1996 0.1812 -0.0114 -0.0094 -0.0075 2244 HOH B O     
4663 O O     . HOH H .   ? 0.5522 0.5423 0.5500 0.0007  0.0027  0.0002  2245 HOH B O     
4664 O O     . HOH H .   ? 0.3175 0.3247 0.3287 -0.0008 0.0065  0.0029  2246 HOH B O     
4665 O O     . HOH H .   ? 0.3258 0.3217 0.3232 0.0024  0.0041  0.0026  2247 HOH B O     
4666 O O     . HOH H .   ? 0.2411 0.2345 0.2377 -0.0055 0.0010  -0.0083 2248 HOH B O     
4667 O O     . HOH H .   ? 0.4106 0.4057 0.4094 0.0038  0.0053  0.0014  2249 HOH B O     
4668 O O     . HOH H .   ? 0.3034 0.3103 0.3065 0.0040  0.0010  0.0000  2250 HOH B O     
4669 O O     . HOH H .   ? 0.3394 0.3363 0.3207 0.0024  -0.0055 -0.0031 2251 HOH B O     
4670 O O     . HOH H .   ? 0.3350 0.3220 0.3170 0.0001  0.0004  0.0039  2252 HOH B O     
4671 O O     . HOH H .   ? 0.2309 0.2341 0.2203 0.0071  -0.0012 0.0117  2253 HOH B O     
4672 O O     . HOH H .   ? 0.4263 0.4164 0.4134 0.0035  0.0001  0.0035  2254 HOH B O     
4673 O O     . HOH H .   ? 0.4265 0.4342 0.4338 0.0036  -0.0026 0.0028  2255 HOH B O     
4674 O O     . HOH H .   ? 0.3384 0.3302 0.3394 -0.0004 0.0002  -0.0006 2256 HOH B O     
4675 O O     . HOH H .   ? 0.6026 0.5959 0.5990 0.0012  0.0031  0.0000  2257 HOH B O     
4676 O O     . HOH H .   ? 0.2221 0.2095 0.2117 0.0012  0.0022  0.0016  2258 HOH B O     
4677 O O     . HOH H .   ? 0.2064 0.2025 0.1957 0.0020  -0.0008 0.0014  2259 HOH B O     
4678 O O     . HOH H .   ? 0.2760 0.2896 0.3008 -0.0020 -0.0021 -0.0015 2260 HOH B O     
4679 O O     . HOH H .   ? 0.6303 0.6261 0.6236 -0.0025 0.0011  0.0007  2261 HOH B O     
4680 O O     . HOH H .   ? 0.3786 0.3665 0.3727 -0.0012 0.0028  -0.0014 2262 HOH B O     
4681 O O     . HOH H .   ? 0.4225 0.4231 0.4327 0.0028  0.0005  0.0006  2263 HOH B O     
4682 O O     . HOH H .   ? 0.4147 0.4071 0.4085 0.0020  -0.0003 -0.0021 2264 HOH B O     
4683 O O     . HOH H .   ? 0.2414 0.2559 0.2620 0.0005  0.0009  0.0015  2265 HOH B O     
4684 O O     . HOH H .   ? 0.2383 0.2262 0.2213 0.0026  0.0005  0.0062  2266 HOH B O     
4685 O O     . HOH H .   ? 0.2819 0.3038 0.3015 -0.0014 -0.0043 0.0019  2267 HOH B O     
4686 O O     . HOH H .   ? 0.3608 0.3532 0.3499 -0.0013 0.0007  -0.0001 2268 HOH B O     
4687 O O     . HOH H .   ? 0.3477 0.3445 0.3611 0.0007  0.0049  -0.0003 2269 HOH B O     
4688 O O     . HOH H .   ? 0.2139 0.2227 0.2015 0.0000  0.0055  -0.0009 2270 HOH B O     
4689 O O     . HOH H .   ? 0.2541 0.2513 0.2523 -0.0045 0.0077  -0.0006 2271 HOH B O     
4690 O O     . HOH H .   ? 0.3836 0.3959 0.3955 -0.0004 -0.0032 -0.0031 2272 HOH B O     
4691 O O     . HOH H .   ? 0.5596 0.5596 0.5618 0.0029  0.0005  0.0010  2273 HOH B O     
4692 O O     . HOH H .   ? 0.3747 0.3656 0.3611 -0.0010 0.0005  0.0001  2274 HOH B O     
4693 O O     . HOH H .   ? 0.5019 0.5036 0.5070 0.0020  0.0030  0.0005  2275 HOH B O     
4694 O O     . HOH H .   ? 0.4586 0.4556 0.4616 -0.0011 0.0031  -0.0028 2276 HOH B O     
4695 O O     . HOH H .   ? 0.5320 0.5286 0.5346 0.0000  0.0023  0.0011  2277 HOH B O     
4696 O O     . HOH H .   ? 0.3505 0.3345 0.3370 0.0043  -0.0006 0.0012  2278 HOH B O     
4697 O O     . HOH H .   ? 0.4152 0.4196 0.4134 -0.0002 0.0008  -0.0022 2279 HOH B O     
4698 O O     . HOH H .   ? 0.3902 0.4034 0.3961 0.0050  -0.0061 0.0021  2280 HOH B O     
4699 O O     . HOH H .   ? 0.4343 0.4205 0.4107 -0.0025 -0.0001 0.0001  2281 HOH B O     
4700 O O     . HOH H .   ? 0.5304 0.5245 0.5200 -0.0040 0.0019  -0.0023 2282 HOH B O     
4701 O O     . HOH H .   ? 0.3452 0.3517 0.3570 0.0006  0.0011  -0.0054 2283 HOH B O     
4702 O O     . HOH H .   ? 0.4853 0.4829 0.4772 0.0034  -0.0022 0.0013  2284 HOH B O     
4703 O O     . HOH H .   ? 0.3364 0.3520 0.3329 -0.0063 -0.0100 -0.0057 2285 HOH B O     
4704 O O     . HOH H .   ? 0.5337 0.5210 0.5208 0.0008  0.0014  0.0019  2286 HOH B O     
4705 O O     . HOH H .   ? 0.5597 0.5675 0.5656 0.0011  -0.0022 0.0016  2287 HOH B O     
4706 O O     . HOH H .   ? 0.4248 0.4185 0.4154 0.0039  -0.0014 0.0024  2288 HOH B O     
4707 O O     . HOH H .   ? 0.3922 0.3766 0.3773 -0.0024 0.0024  -0.0006 2289 HOH B O     
4708 O O     . HOH H .   ? 0.4647 0.4654 0.4695 -0.0004 0.0014  0.0010  2290 HOH B O     
4709 O O     . HOH H .   ? 0.3791 0.3662 0.3578 -0.0024 -0.0022 -0.0002 2291 HOH B O     
4710 O O     . HOH H .   ? 0.1904 0.1949 0.1969 -0.0052 0.0020  -0.0053 2292 HOH B O     
4711 O O     . HOH H .   ? 0.4555 0.4535 0.4473 -0.0013 -0.0017 -0.0021 2293 HOH B O     
4712 O O     . HOH H .   ? 0.2766 0.2939 0.2805 -0.0040 -0.0056 -0.0032 2294 HOH B O     
4713 O O     . HOH H .   ? 0.5294 0.5348 0.5379 -0.0001 -0.0012 -0.0010 2295 HOH B O     
4714 O O     . HOH H .   ? 0.2234 0.2330 0.2475 -0.0051 0.0015  -0.0001 2296 HOH B O     
4715 O O     . HOH H .   ? 0.2641 0.2624 0.2674 -0.0059 -0.0035 0.0002  2297 HOH B O     
4716 O O     . HOH H .   ? 0.3858 0.3871 0.3935 -0.0011 0.0063  0.0000  2298 HOH B O     
4717 O O     . HOH H .   ? 0.6077 0.6014 0.6075 0.0000  0.0002  -0.0003 2299 HOH B O     
4718 O O     . HOH H .   ? 0.5484 0.5470 0.5528 -0.0003 0.0043  0.0000  2300 HOH B O     
4719 O O     . HOH H .   ? 0.6333 0.6342 0.6313 -0.0005 -0.0004 0.0003  2301 HOH B O     
4720 O O     . HOH H .   ? 0.4758 0.4852 0.4869 0.0013  -0.0004 0.0044  2302 HOH B O     
4721 O O     . HOH H .   ? 0.3487 0.3359 0.3364 0.0004  0.0047  0.0019  2303 HOH B O     
4722 O O     . HOH H .   ? 0.3191 0.3240 0.3276 0.0042  0.0029  0.0033  2304 HOH B O     
4723 O O     . HOH H .   ? 0.3990 0.4116 0.4206 0.0015  -0.0014 0.0045  2305 HOH B O     
4724 O O     . HOH H .   ? 0.4280 0.4257 0.4240 -0.0004 -0.0009 0.0012  2306 HOH B O     
4725 O O     . HOH H .   ? 0.3273 0.3274 0.3060 0.0030  -0.0035 0.0046  2307 HOH B O     
4726 O O     . HOH H .   ? 0.2475 0.2317 0.2388 -0.0005 0.0003  -0.0024 2308 HOH B O     
4727 O O     . HOH H .   ? 0.5763 0.5828 0.5718 0.0002  -0.0052 0.0002  2309 HOH B O     
4728 O O     . HOH H .   ? 0.4584 0.4455 0.4461 -0.0030 0.0033  -0.0008 2310 HOH B O     
4729 O O     . HOH H .   ? 0.4257 0.4297 0.4237 0.0033  -0.0020 0.0022  2311 HOH B O     
4730 O O     . HOH H .   ? 0.5051 0.5011 0.4969 0.0026  0.0015  0.0020  2312 HOH B O     
4731 O O     . HOH H .   ? 0.3020 0.2947 0.2882 -0.0016 0.0036  -0.0023 2313 HOH B O     
4732 O O     . HOH H .   ? 0.5146 0.5144 0.5210 -0.0005 0.0009  -0.0020 2314 HOH B O     
4733 O O     . HOH H .   ? 0.4345 0.4325 0.4369 0.0002  0.0003  -0.0025 2315 HOH B O     
4734 O O     . HOH H .   ? 0.3027 0.3107 0.3200 0.0021  -0.0034 0.0026  2316 HOH B O     
4735 O O     . HOH H .   ? 0.3895 0.4054 0.4007 -0.0011 -0.0040 -0.0013 2317 HOH B O     
4736 O O     . HOH H .   ? 0.5329 0.5409 0.5429 -0.0025 0.0007  -0.0007 2318 HOH B O     
4737 O O     . HOH H .   ? 0.4977 0.4963 0.5022 -0.0002 0.0000  -0.0029 2319 HOH B O     
4738 O O     . HOH H .   ? 0.3785 0.3873 0.3950 -0.0007 0.0003  0.0000  2320 HOH B O     
4739 O O     . HOH H .   ? 0.3249 0.3322 0.3109 0.0049  -0.0065 -0.0016 2321 HOH B O     
4740 O O     . HOH H .   ? 0.4246 0.4148 0.4123 0.0035  -0.0023 0.0028  2322 HOH B O     
4741 O O     . HOH H .   ? 0.2858 0.2986 0.2908 0.0009  -0.0047 0.0014  2323 HOH B O     
4742 O O     . HOH H .   ? 0.2637 0.2593 0.2617 -0.0042 -0.0071 -0.0038 2324 HOH B O     
4743 O O     . HOH H .   ? 0.2684 0.2773 0.2724 0.0056  0.0020  0.0047  2325 HOH B O     
4744 O O     . HOH H .   ? 0.2328 0.2199 0.2176 -0.0010 -0.0032 -0.0049 2326 HOH B O     
4745 O O     . HOH H .   ? 0.4619 0.4585 0.4429 -0.0020 -0.0008 -0.0036 2327 HOH B O     
4746 O O     . HOH H .   ? 0.3117 0.3118 0.3296 0.0050  0.0036  0.0026  2328 HOH B O     
4747 O O     . HOH I .   ? 0.2647 0.2637 0.2656 -0.0036 -0.0007 0.0020  2001 HOH K O     
4748 O O     . HOH I .   ? 0.3676 0.3525 0.3506 0.0006  -0.0041 0.0025  2002 HOH K O     
4749 O O     . HOH I .   ? 0.4925 0.4989 0.5057 -0.0029 -0.0006 -0.0020 2003 HOH K O     
4750 O O     . HOH I .   ? 0.3537 0.3526 0.3541 0.0002  -0.0006 0.0013  2004 HOH K O     
4751 O O     . HOH I .   ? 0.4660 0.4722 0.4713 -0.0013 -0.0023 -0.0020 2005 HOH K O     
4752 O O     . HOH I .   ? 0.3683 0.3710 0.3673 0.0012  -0.0062 0.0029  2006 HOH K O     
4753 O O     . HOH I .   ? 0.4201 0.4178 0.4311 -0.0001 0.0007  0.0002  2007 HOH K O     
4754 O O     . HOH I .   ? 0.5253 0.5303 0.5310 0.0001  -0.0018 0.0017  2008 HOH K O     
4755 O O     . HOH I .   ? 0.5354 0.5346 0.5417 -0.0010 0.0014  -0.0011 2009 HOH K O     
4756 O O     . HOH I .   ? 0.4984 0.5015 0.5016 -0.0016 -0.0027 -0.0008 2010 HOH K O     
4757 O O     . HOH I .   ? 0.4957 0.4921 0.4903 0.0002  -0.0003 -0.0004 2011 HOH K O     
4758 O O     . HOH I .   ? 0.5546 0.5546 0.5490 -0.0005 -0.0003 -0.0006 2012 HOH K O     
4759 O O     . HOH I .   ? 0.4617 0.4679 0.4582 -0.0021 -0.0025 -0.0012 2013 HOH K O     
4760 O O     . HOH I .   ? 0.6668 0.6671 0.6667 -0.0015 0.0003  0.0004  2014 HOH K O     
4761 O O     . HOH I .   ? 0.4956 0.4999 0.5037 0.0005  0.0004  0.0003  2015 HOH K O     
4762 O O     . HOH I .   ? 0.5201 0.5207 0.5237 -0.0016 -0.0001 0.0000  2016 HOH K O     
4763 O O     . HOH J .   ? 0.4289 0.4385 0.4409 -0.0002 0.0025  -0.0024 2001 HOH L O     
4764 O O     . HOH J .   ? 0.5742 0.5663 0.5733 0.0037  0.0025  0.0017  2002 HOH L O     
4765 O O     . HOH J .   ? 0.5729 0.5723 0.5711 0.0011  -0.0010 0.0000  2003 HOH L O     
4766 O O     . HOH J .   ? 0.5638 0.5661 0.5700 0.0000  0.0003  -0.0001 2004 HOH L O     
4767 O O     . HOH J .   ? 0.5865 0.5718 0.5771 0.0021  0.0014  -0.0003 2005 HOH L O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   108 ?   ?   ?   A . n 
A 1 2   GLN 2   109 ?   ?   ?   A . n 
A 1 3   TYR 3   110 ?   ?   ?   A . n 
A 1 4   LYS 4   111 ?   ?   ?   A . n 
A 1 5   ASP 5   112 ?   ?   ?   A . n 
A 1 6   ASN 6   113 ?   ?   ?   A . n 
A 1 7   ILE 7   114 ?   ?   ?   A . n 
A 1 8   ARG 8   115 ?   ?   ?   A . n 
A 1 9   HIS 9   116 ?   ?   ?   A . n 
A 1 10  GLY 10  117 117 GLY GLY A . n 
A 1 11  VAL 11  118 118 VAL VAL A . n 
A 1 12  CYS 12  119 119 CYS CYS A . n 
A 1 13  TRP 13  120 120 TRP TRP A . n 
A 1 14  ILE 14  121 121 ILE ILE A . n 
A 1 15  TYR 15  122 122 TYR TYR A . n 
A 1 16  TYR 16  123 123 TYR TYR A . n 
A 1 17  PRO 17  124 124 PRO PRO A . n 
A 1 18  ASP 18  125 125 ASP ASP A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  GLY 20  127 127 GLY GLY A . n 
A 1 21  SER 21  128 128 SER SER A . n 
A 1 22  LEU 22  129 129 LEU LEU A . n 
A 1 23  VAL 23  130 130 VAL VAL A . n 
A 1 24  GLY 24  131 131 GLY GLY A . n 
A 1 25  GLU 25  132 132 GLU GLU A . n 
A 1 26  VAL 26  133 133 VAL VAL A . n 
A 1 27  ASN 27  134 134 ASN ASN A . n 
A 1 28  GLU 28  135 135 GLU GLU A . n 
A 1 29  ASP 29  136 136 ASP ASP A . n 
A 1 30  GLY 30  137 137 GLY GLY A . n 
A 1 31  GLU 31  138 138 GLU GLU A . n 
A 1 32  MET 32  139 139 MET MET A . n 
A 1 33  THR 33  140 140 THR THR A . n 
A 1 34  GLY 34  141 141 GLY GLY A . n 
A 1 35  GLU 35  142 142 GLU GLU A . n 
A 1 36  LYS 36  143 143 LYS LYS A . n 
A 1 37  ILE 37  144 144 ILE ILE A . n 
A 1 38  ALA 38  145 145 ALA ALA A . n 
A 1 39  TYR 39  146 146 TYR TYR A . n 
A 1 40  VAL 40  147 147 VAL VAL A . n 
A 1 41  TYR 41  148 148 TYR TYR A . n 
A 1 42  PRO 42  149 149 PRO PRO A . n 
A 1 43  ASP 43  150 150 ASP ASP A . n 
A 1 44  GLU 44  151 151 GLU GLU A . n 
A 1 45  ARG 45  152 152 ARG ARG A . n 
A 1 46  THR 46  153 153 THR THR A . n 
A 1 47  ALA 47  154 154 ALA ALA A . n 
A 1 48  LEU 48  155 155 LEU LEU A . n 
A 1 49  TYR 49  156 156 TYR TYR A . n 
A 1 50  GLY 50  157 157 GLY GLY A . n 
A 1 51  LYS 51  158 158 LYS LYS A . n 
A 1 52  PHE 52  159 159 PHE PHE A . n 
A 1 53  ILE 53  160 160 ILE ILE A . n 
A 1 54  ASP 54  161 161 ASP ASP A . n 
A 1 55  GLY 55  162 162 GLY GLY A . n 
A 1 56  GLU 56  163 163 GLU GLU A . n 
A 1 57  MET 57  164 164 MET MET A . n 
A 1 58  ILE 58  165 165 ILE ILE A . n 
A 1 59  GLU 59  166 166 GLU GLU A . n 
A 1 60  GLY 60  167 167 GLY GLY A . n 
A 1 61  LYS 61  168 168 LYS LYS A . n 
A 1 62  LEU 62  169 169 LEU LEU A . n 
A 1 63  ALA 63  170 170 ALA ALA A . n 
A 1 64  THR 64  171 171 THR THR A . n 
A 1 65  LEU 65  172 172 LEU LEU A . n 
A 1 66  MET 66  173 173 MET MET A . n 
A 1 67  SER 67  174 174 SER SER A . n 
A 1 68  THR 68  175 175 THR THR A . n 
A 1 69  GLU 69  176 176 GLU GLU A . n 
A 1 70  GLU 70  177 177 GLU GLU A . n 
A 1 71  GLY 71  178 178 GLY GLY A . n 
A 1 72  ARG 72  179 179 ARG ARG A . n 
A 1 73  PRO 73  180 180 PRO PRO A . n 
A 1 74  HIS 74  181 181 HIS HIS A . n 
A 1 75  PHE 75  182 182 PHE PHE A . n 
A 1 76  GLU 76  183 183 GLU GLU A . n 
A 1 77  LEU 77  184 184 LEU LEU A . n 
A 1 78  MET 78  185 185 MET MET A . n 
A 1 79  PRO 79  186 186 PRO PRO A . n 
A 1 80  GLY 80  187 187 GLY GLY A . n 
A 1 81  ASN 81  188 188 ASN ASN A . n 
A 1 82  SER 82  189 189 SER SER A . n 
A 1 83  VAL 83  190 190 VAL VAL A . n 
A 1 84  TYR 84  191 191 TYR TYR A . n 
A 1 85  HIS 85  192 192 HIS HIS A . n 
A 1 86  PHE 86  193 193 PHE PHE A . n 
A 1 87  ASP 87  194 194 ASP ASP A . n 
A 1 88  LYS 88  195 195 LYS LYS A . n 
A 1 89  SER 89  196 196 SER SER A . n 
A 1 90  THR 90  197 197 THR THR A . n 
A 1 91  SER 91  198 198 SER SER A . n 
A 1 92  SER 92  199 199 SER SER A . n 
A 1 93  CYS 93  200 200 CYS CYS A . n 
A 1 94  ILE 94  201 201 ILE ILE A . n 
A 1 95  SER 95  202 202 SER SER A . n 
A 1 96  THR 96  203 203 THR THR A . n 
A 1 97  ASN 97  204 204 ASN ASN A . n 
A 1 98  ALA 98  205 205 ALA ALA A . n 
A 1 99  LEU 99  206 206 LEU LEU A . n 
A 1 100 LEU 100 207 207 LEU LEU A . n 
A 1 101 PRO 101 208 208 PRO PRO A . n 
A 1 102 ASP 102 209 209 ASP ASP A . n 
A 1 103 PRO 103 210 210 PRO PRO A . n 
A 1 104 TYR 104 211 211 TYR TYR A . n 
A 1 105 GLU 105 212 212 GLU GLU A . n 
A 1 106 SER 106 213 213 SER SER A . n 
A 1 107 GLU 107 214 214 GLU GLU A . n 
A 1 108 ARG 108 215 215 ARG ARG A . n 
A 1 109 VAL 109 216 216 VAL VAL A . n 
A 1 110 TYR 110 217 217 TYR TYR A . n 
A 1 111 VAL 111 218 218 VAL VAL A . n 
A 1 112 ALA 112 219 219 ALA ALA A . n 
A 1 113 GLU 113 220 220 GLU GLU A . n 
A 1 114 SER 114 221 221 SER SER A . n 
A 1 115 LEU 115 222 222 LEU LEU A . n 
A 1 116 ILE 116 223 223 ILE ILE A . n 
A 1 117 SER 117 224 224 SER SER A . n 
A 1 118 SER 118 225 225 SER SER A . n 
A 1 119 ALA 119 226 226 ALA ALA A . n 
A 1 120 GLY 120 227 227 GLY GLY A . n 
A 1 121 GLU 121 228 228 GLU GLU A . n 
A 1 122 GLY 122 229 229 GLY GLY A . n 
A 1 123 LEU 123 230 230 LEU LEU A . n 
A 1 124 PHE 124 231 231 PHE PHE A . n 
A 1 125 SER 125 232 232 SER SER A . n 
A 1 126 LYS 126 233 233 LYS LYS A . n 
A 1 127 VAL 127 234 234 VAL VAL A . n 
A 1 128 ALA 128 235 235 ALA ALA A . n 
A 1 129 VAL 129 236 236 VAL VAL A . n 
A 1 130 GLY 130 237 237 GLY GLY A . n 
A 1 131 PRO 131 238 238 PRO PRO A . n 
A 1 132 ASN 132 239 239 ASN ASN A . n 
A 1 133 THR 133 240 240 THR THR A . n 
A 1 134 VAL 134 241 241 VAL VAL A . n 
A 1 135 MET 135 242 242 MET MET A . n 
A 1 136 SER 136 243 243 SER SER A . n 
A 1 137 PHE 137 244 244 PHE PHE A . n 
A 1 138 TYR 138 245 245 TYR TYR A . n 
A 1 139 ASN 139 246 246 ASN ASN A . n 
A 1 140 GLY 140 247 247 GLY GLY A . n 
A 1 141 VAL 141 248 248 VAL VAL A . n 
A 1 142 ARG 142 249 249 ARG ARG A . n 
A 1 143 ILE 143 250 250 ILE ILE A . n 
A 1 144 THR 144 251 251 THR THR A . n 
A 1 145 HIS 145 252 252 HIS HIS A . n 
A 1 146 GLN 146 253 253 GLN GLN A . n 
A 1 147 GLU 147 254 254 GLU GLU A . n 
A 1 148 VAL 148 255 255 VAL VAL A . n 
A 1 149 ASP 149 256 256 ASP ASP A . n 
A 1 150 SER 150 257 257 SER SER A . n 
A 1 151 ARG 151 258 258 ARG ARG A . n 
A 1 152 ASP 152 259 259 ASP ASP A . n 
A 1 153 TRP 153 260 260 TRP TRP A . n 
A 1 154 ALA 154 261 261 ALA ALA A . n 
A 1 155 LEU 155 262 262 LEU LEU A . n 
A 1 156 ASN 156 263 263 ASN ASN A . n 
A 1 157 GLY 157 264 264 GLY GLY A . n 
A 1 158 ASN 158 265 265 ASN ASN A . n 
A 1 159 THR 159 266 266 THR THR A . n 
A 1 160 LEU 160 267 267 LEU LEU A . n 
A 1 161 SER 161 268 268 SER SER A . n 
A 1 162 LEU 162 269 269 LEU LEU A . n 
A 1 163 ASP 163 270 270 ASP ASP A . n 
A 1 164 GLU 164 271 271 GLU GLU A . n 
A 1 165 GLU 165 272 272 GLU GLU A . n 
A 1 166 THR 166 273 273 THR THR A . n 
A 1 167 VAL 167 274 274 VAL VAL A . n 
A 1 168 ILE 168 275 275 ILE ILE A . n 
A 1 169 ASP 169 276 276 ASP ASP A . n 
A 1 170 VAL 170 277 277 VAL VAL A . n 
A 1 171 PRO 171 278 278 PRO PRO A . n 
A 1 172 GLU 172 279 279 GLU GLU A . n 
A 1 173 PRO 173 280 280 PRO PRO A . n 
A 1 174 TYR 174 281 281 TYR TYR A . n 
A 1 175 ASN 175 282 282 ASN ASN A . n 
A 1 176 HIS 176 283 283 HIS HIS A . n 
A 1 177 VAL 177 284 284 VAL VAL A . n 
A 1 178 SER 178 285 285 SER SER A . n 
A 1 179 LYS 179 286 286 LYS LYS A . n 
A 1 180 TYR 180 287 287 TYR TYR A . n 
A 1 181 CYS 181 288 288 CYS CYS A . n 
A 1 182 ALA 182 289 289 ALA ALA A . n 
A 1 183 SER 183 290 290 SER SER A . n 
A 1 184 LEU 184 291 291 LEU LEU A . n 
A 1 185 GLY 185 292 292 GLY GLY A . n 
A 1 186 HIS 186 293 293 HIS HIS A . n 
A 1 187 LYS 187 294 294 LYS LYS A . n 
A 1 188 ALA 188 295 295 ALA ALA A . n 
A 1 189 ASN 189 296 296 ASN ASN A . n 
A 1 190 HIS 190 297 297 HIS HIS A . n 
A 1 191 SER 191 298 298 SER SER A . n 
A 1 192 PHE 192 299 299 PHE PHE A . n 
A 1 193 THR 193 300 300 THR THR A . n 
A 1 194 PRO 194 301 301 PRO PRO A . n 
A 1 195 ASN 195 302 302 ASN ASN A . n 
A 1 196 CYS 196 303 303 CYS CYS A . n 
A 1 197 ILE 197 304 304 ILE ILE A . n 
A 1 198 TYR 198 305 305 TYR TYR A . n 
A 1 199 ASP 199 306 306 ASP ASP A . n 
A 1 200 MET 200 307 307 MET MET A . n 
A 1 201 PHE 201 308 308 PHE PHE A . n 
A 1 202 VAL 202 309 309 VAL VAL A . n 
A 1 203 HIS 203 310 310 HIS HIS A . n 
A 1 204 PRO 204 311 311 PRO PRO A . n 
A 1 205 ARG 205 312 312 ARG ARG A . n 
A 1 206 PHE 206 313 313 PHE PHE A . n 
A 1 207 GLY 207 314 314 GLY GLY A . n 
A 1 208 PRO 208 315 315 PRO PRO A . n 
A 1 209 ILE 209 316 316 ILE ILE A . n 
A 1 210 LYS 210 317 317 LYS LYS A . n 
A 1 211 CYS 211 318 318 CYS CYS A . n 
A 1 212 ILE 212 319 319 ILE ILE A . n 
A 1 213 ARG 213 320 320 ARG ARG A . n 
A 1 214 THR 214 321 321 THR THR A . n 
A 1 215 LEU 215 322 322 LEU LEU A . n 
A 1 216 ARG 216 323 323 ARG ARG A . n 
A 1 217 ALA 217 324 324 ALA ALA A . n 
A 1 218 VAL 218 325 325 VAL VAL A . n 
A 1 219 GLU 219 326 326 GLU GLU A . n 
A 1 220 ALA 220 327 327 ALA ALA A . n 
A 1 221 ASP 221 328 328 ASP ASP A . n 
A 1 222 GLU 222 329 329 GLU GLU A . n 
A 1 223 GLU 223 330 330 GLU GLU A . n 
A 1 224 LEU 224 331 331 LEU LEU A . n 
A 1 225 THR 225 332 332 THR THR A . n 
A 1 226 VAL 226 333 333 VAL VAL A . n 
A 1 227 ALA 227 334 334 ALA ALA A . n 
A 1 228 TYR 228 335 335 TYR TYR A . n 
A 1 229 GLY 229 336 336 GLY GLY A . n 
A 1 230 TYR 230 337 337 TYR TYR A . n 
A 1 231 ASP 231 338 338 ASP ASP A . n 
A 1 232 HIS 232 339 339 HIS HIS A . n 
A 1 233 SER 233 340 340 SER SER A . n 
A 1 234 PRO 234 341 341 PRO PRO A . n 
A 1 235 PRO 235 342 342 PRO PRO A . n 
A 1 236 GLY 236 343 343 GLY GLY A . n 
A 1 237 LYS 237 344 344 LYS LYS A . n 
A 1 238 SER 238 345 345 SER SER A . n 
A 1 239 GLY 239 346 346 GLY GLY A . n 
A 1 240 PRO 240 347 347 PRO PRO A . n 
A 1 241 GLU 241 348 348 GLU GLU A . n 
A 1 242 ALA 242 349 349 ALA ALA A . n 
A 1 243 PRO 243 350 350 PRO PRO A . n 
A 1 244 GLU 244 351 351 GLU GLU A . n 
A 1 245 TRP 245 352 352 TRP TRP A . n 
A 1 246 TYR 246 353 353 TYR TYR A . n 
A 1 247 GLN 247 354 354 GLN GLN A . n 
A 1 248 VAL 248 355 355 VAL VAL A . n 
A 1 249 GLU 249 356 356 GLU GLU A . n 
A 1 250 LEU 250 357 357 LEU LEU A . n 
A 1 251 LYS 251 358 358 LYS LYS A . n 
A 1 252 ALA 252 359 359 ALA ALA A . n 
A 1 253 PHE 253 360 360 PHE PHE A . n 
A 1 254 GLN 254 361 361 GLN GLN A . n 
A 1 255 ALA 255 362 362 ALA ALA A . n 
A 1 256 THR 256 363 363 THR THR A . n 
A 1 257 GLN 257 364 364 GLN GLN A . n 
A 1 258 GLN 258 365 365 GLN GLN A . n 
A 1 259 LYS 259 366 366 LYS LYS A . n 
B 1 1   GLY 1   108 ?   ?   ?   B . n 
B 1 2   GLN 2   109 ?   ?   ?   B . n 
B 1 3   TYR 3   110 ?   ?   ?   B . n 
B 1 4   LYS 4   111 ?   ?   ?   B . n 
B 1 5   ASP 5   112 ?   ?   ?   B . n 
B 1 6   ASN 6   113 ?   ?   ?   B . n 
B 1 7   ILE 7   114 ?   ?   ?   B . n 
B 1 8   ARG 8   115 ?   ?   ?   B . n 
B 1 9   HIS 9   116 ?   ?   ?   B . n 
B 1 10  GLY 10  117 117 GLY GLY B . n 
B 1 11  VAL 11  118 118 VAL VAL B . n 
B 1 12  CYS 12  119 119 CYS CYS B . n 
B 1 13  TRP 13  120 120 TRP TRP B . n 
B 1 14  ILE 14  121 121 ILE ILE B . n 
B 1 15  TYR 15  122 122 TYR TYR B . n 
B 1 16  TYR 16  123 123 TYR TYR B . n 
B 1 17  PRO 17  124 124 PRO PRO B . n 
B 1 18  ASP 18  125 125 ASP ASP B . n 
B 1 19  GLY 19  126 126 GLY GLY B . n 
B 1 20  GLY 20  127 127 GLY GLY B . n 
B 1 21  SER 21  128 128 SER SER B . n 
B 1 22  LEU 22  129 129 LEU LEU B . n 
B 1 23  VAL 23  130 130 VAL VAL B . n 
B 1 24  GLY 24  131 131 GLY GLY B . n 
B 1 25  GLU 25  132 132 GLU GLU B . n 
B 1 26  VAL 26  133 133 VAL VAL B . n 
B 1 27  ASN 27  134 134 ASN ASN B . n 
B 1 28  GLU 28  135 135 GLU GLU B . n 
B 1 29  ASP 29  136 136 ASP ASP B . n 
B 1 30  GLY 30  137 137 GLY GLY B . n 
B 1 31  GLU 31  138 138 GLU GLU B . n 
B 1 32  MET 32  139 139 MET MET B . n 
B 1 33  THR 33  140 140 THR THR B . n 
B 1 34  GLY 34  141 141 GLY GLY B . n 
B 1 35  GLU 35  142 142 GLU GLU B . n 
B 1 36  LYS 36  143 143 LYS LYS B . n 
B 1 37  ILE 37  144 144 ILE ILE B . n 
B 1 38  ALA 38  145 145 ALA ALA B . n 
B 1 39  TYR 39  146 146 TYR TYR B . n 
B 1 40  VAL 40  147 147 VAL VAL B . n 
B 1 41  TYR 41  148 148 TYR TYR B . n 
B 1 42  PRO 42  149 149 PRO PRO B . n 
B 1 43  ASP 43  150 150 ASP ASP B . n 
B 1 44  GLU 44  151 151 GLU GLU B . n 
B 1 45  ARG 45  152 152 ARG ARG B . n 
B 1 46  THR 46  153 153 THR THR B . n 
B 1 47  ALA 47  154 154 ALA ALA B . n 
B 1 48  LEU 48  155 155 LEU LEU B . n 
B 1 49  TYR 49  156 156 TYR TYR B . n 
B 1 50  GLY 50  157 157 GLY GLY B . n 
B 1 51  LYS 51  158 158 LYS LYS B . n 
B 1 52  PHE 52  159 159 PHE PHE B . n 
B 1 53  ILE 53  160 160 ILE ILE B . n 
B 1 54  ASP 54  161 161 ASP ASP B . n 
B 1 55  GLY 55  162 162 GLY GLY B . n 
B 1 56  GLU 56  163 163 GLU GLU B . n 
B 1 57  MET 57  164 164 MET MET B . n 
B 1 58  ILE 58  165 165 ILE ILE B . n 
B 1 59  GLU 59  166 166 GLU GLU B . n 
B 1 60  GLY 60  167 167 GLY GLY B . n 
B 1 61  LYS 61  168 168 LYS LYS B . n 
B 1 62  LEU 62  169 169 LEU LEU B . n 
B 1 63  ALA 63  170 170 ALA ALA B . n 
B 1 64  THR 64  171 171 THR THR B . n 
B 1 65  LEU 65  172 172 LEU LEU B . n 
B 1 66  MET 66  173 173 MET MET B . n 
B 1 67  SER 67  174 174 SER SER B . n 
B 1 68  THR 68  175 175 THR THR B . n 
B 1 69  GLU 69  176 176 GLU GLU B . n 
B 1 70  GLU 70  177 177 GLU GLU B . n 
B 1 71  GLY 71  178 178 GLY GLY B . n 
B 1 72  ARG 72  179 179 ARG ARG B . n 
B 1 73  PRO 73  180 180 PRO PRO B . n 
B 1 74  HIS 74  181 181 HIS HIS B . n 
B 1 75  PHE 75  182 182 PHE PHE B . n 
B 1 76  GLU 76  183 183 GLU GLU B . n 
B 1 77  LEU 77  184 184 LEU LEU B . n 
B 1 78  MET 78  185 185 MET MET B . n 
B 1 79  PRO 79  186 186 PRO PRO B . n 
B 1 80  GLY 80  187 187 GLY GLY B . n 
B 1 81  ASN 81  188 188 ASN ASN B . n 
B 1 82  SER 82  189 189 SER SER B . n 
B 1 83  VAL 83  190 190 VAL VAL B . n 
B 1 84  TYR 84  191 191 TYR TYR B . n 
B 1 85  HIS 85  192 192 HIS HIS B . n 
B 1 86  PHE 86  193 193 PHE PHE B . n 
B 1 87  ASP 87  194 194 ASP ASP B . n 
B 1 88  LYS 88  195 195 LYS LYS B . n 
B 1 89  SER 89  196 196 SER SER B . n 
B 1 90  THR 90  197 197 THR THR B . n 
B 1 91  SER 91  198 198 SER SER B . n 
B 1 92  SER 92  199 199 SER SER B . n 
B 1 93  CYS 93  200 200 CYS CYS B . n 
B 1 94  ILE 94  201 201 ILE ILE B . n 
B 1 95  SER 95  202 202 SER SER B . n 
B 1 96  THR 96  203 203 THR THR B . n 
B 1 97  ASN 97  204 204 ASN ASN B . n 
B 1 98  ALA 98  205 205 ALA ALA B . n 
B 1 99  LEU 99  206 206 LEU LEU B . n 
B 1 100 LEU 100 207 207 LEU LEU B . n 
B 1 101 PRO 101 208 208 PRO PRO B . n 
B 1 102 ASP 102 209 209 ASP ASP B . n 
B 1 103 PRO 103 210 210 PRO PRO B . n 
B 1 104 TYR 104 211 211 TYR TYR B . n 
B 1 105 GLU 105 212 212 GLU GLU B . n 
B 1 106 SER 106 213 213 SER SER B . n 
B 1 107 GLU 107 214 214 GLU GLU B . n 
B 1 108 ARG 108 215 215 ARG ARG B . n 
B 1 109 VAL 109 216 216 VAL VAL B . n 
B 1 110 TYR 110 217 217 TYR TYR B . n 
B 1 111 VAL 111 218 218 VAL VAL B . n 
B 1 112 ALA 112 219 219 ALA ALA B . n 
B 1 113 GLU 113 220 220 GLU GLU B . n 
B 1 114 SER 114 221 221 SER SER B . n 
B 1 115 LEU 115 222 222 LEU LEU B . n 
B 1 116 ILE 116 223 223 ILE ILE B . n 
B 1 117 SER 117 224 224 SER SER B . n 
B 1 118 SER 118 225 225 SER SER B . n 
B 1 119 ALA 119 226 226 ALA ALA B . n 
B 1 120 GLY 120 227 227 GLY GLY B . n 
B 1 121 GLU 121 228 228 GLU GLU B . n 
B 1 122 GLY 122 229 229 GLY GLY B . n 
B 1 123 LEU 123 230 230 LEU LEU B . n 
B 1 124 PHE 124 231 231 PHE PHE B . n 
B 1 125 SER 125 232 232 SER SER B . n 
B 1 126 LYS 126 233 233 LYS LYS B . n 
B 1 127 VAL 127 234 234 VAL VAL B . n 
B 1 128 ALA 128 235 235 ALA ALA B . n 
B 1 129 VAL 129 236 236 VAL VAL B . n 
B 1 130 GLY 130 237 237 GLY GLY B . n 
B 1 131 PRO 131 238 238 PRO PRO B . n 
B 1 132 ASN 132 239 239 ASN ASN B . n 
B 1 133 THR 133 240 240 THR THR B . n 
B 1 134 VAL 134 241 241 VAL VAL B . n 
B 1 135 MET 135 242 242 MET MET B . n 
B 1 136 SER 136 243 243 SER SER B . n 
B 1 137 PHE 137 244 244 PHE PHE B . n 
B 1 138 TYR 138 245 245 TYR TYR B . n 
B 1 139 ASN 139 246 246 ASN ASN B . n 
B 1 140 GLY 140 247 247 GLY GLY B . n 
B 1 141 VAL 141 248 248 VAL VAL B . n 
B 1 142 ARG 142 249 249 ARG ARG B . n 
B 1 143 ILE 143 250 250 ILE ILE B . n 
B 1 144 THR 144 251 251 THR THR B . n 
B 1 145 HIS 145 252 252 HIS HIS B . n 
B 1 146 GLN 146 253 253 GLN GLN B . n 
B 1 147 GLU 147 254 254 GLU GLU B . n 
B 1 148 VAL 148 255 255 VAL VAL B . n 
B 1 149 ASP 149 256 256 ASP ASP B . n 
B 1 150 SER 150 257 257 SER SER B . n 
B 1 151 ARG 151 258 258 ARG ARG B . n 
B 1 152 ASP 152 259 259 ASP ASP B . n 
B 1 153 TRP 153 260 260 TRP TRP B . n 
B 1 154 ALA 154 261 261 ALA ALA B . n 
B 1 155 LEU 155 262 262 LEU LEU B . n 
B 1 156 ASN 156 263 263 ASN ASN B . n 
B 1 157 GLY 157 264 264 GLY GLY B . n 
B 1 158 ASN 158 265 265 ASN ASN B . n 
B 1 159 THR 159 266 266 THR THR B . n 
B 1 160 LEU 160 267 267 LEU LEU B . n 
B 1 161 SER 161 268 268 SER SER B . n 
B 1 162 LEU 162 269 269 LEU LEU B . n 
B 1 163 ASP 163 270 270 ASP ASP B . n 
B 1 164 GLU 164 271 271 GLU GLU B . n 
B 1 165 GLU 165 272 272 GLU GLU B . n 
B 1 166 THR 166 273 273 THR THR B . n 
B 1 167 VAL 167 274 274 VAL VAL B . n 
B 1 168 ILE 168 275 275 ILE ILE B . n 
B 1 169 ASP 169 276 276 ASP ASP B . n 
B 1 170 VAL 170 277 277 VAL VAL B . n 
B 1 171 PRO 171 278 278 PRO PRO B . n 
B 1 172 GLU 172 279 279 GLU GLU B . n 
B 1 173 PRO 173 280 280 PRO PRO B . n 
B 1 174 TYR 174 281 281 TYR TYR B . n 
B 1 175 ASN 175 282 282 ASN ASN B . n 
B 1 176 HIS 176 283 283 HIS HIS B . n 
B 1 177 VAL 177 284 284 VAL VAL B . n 
B 1 178 SER 178 285 285 SER SER B . n 
B 1 179 LYS 179 286 286 LYS LYS B . n 
B 1 180 TYR 180 287 287 TYR TYR B . n 
B 1 181 CYS 181 288 288 CYS CYS B . n 
B 1 182 ALA 182 289 289 ALA ALA B . n 
B 1 183 SER 183 290 290 SER SER B . n 
B 1 184 LEU 184 291 291 LEU LEU B . n 
B 1 185 GLY 185 292 292 GLY GLY B . n 
B 1 186 HIS 186 293 293 HIS HIS B . n 
B 1 187 LYS 187 294 294 LYS LYS B . n 
B 1 188 ALA 188 295 295 ALA ALA B . n 
B 1 189 ASN 189 296 296 ASN ASN B . n 
B 1 190 HIS 190 297 297 HIS HIS B . n 
B 1 191 SER 191 298 298 SER SER B . n 
B 1 192 PHE 192 299 299 PHE PHE B . n 
B 1 193 THR 193 300 300 THR THR B . n 
B 1 194 PRO 194 301 301 PRO PRO B . n 
B 1 195 ASN 195 302 302 ASN ASN B . n 
B 1 196 CYS 196 303 303 CYS CYS B . n 
B 1 197 ILE 197 304 304 ILE ILE B . n 
B 1 198 TYR 198 305 305 TYR TYR B . n 
B 1 199 ASP 199 306 306 ASP ASP B . n 
B 1 200 MET 200 307 307 MET MET B . n 
B 1 201 PHE 201 308 308 PHE PHE B . n 
B 1 202 VAL 202 309 309 VAL VAL B . n 
B 1 203 HIS 203 310 310 HIS HIS B . n 
B 1 204 PRO 204 311 311 PRO PRO B . n 
B 1 205 ARG 205 312 312 ARG ARG B . n 
B 1 206 PHE 206 313 313 PHE PHE B . n 
B 1 207 GLY 207 314 314 GLY GLY B . n 
B 1 208 PRO 208 315 315 PRO PRO B . n 
B 1 209 ILE 209 316 316 ILE ILE B . n 
B 1 210 LYS 210 317 317 LYS LYS B . n 
B 1 211 CYS 211 318 318 CYS CYS B . n 
B 1 212 ILE 212 319 319 ILE ILE B . n 
B 1 213 ARG 213 320 320 ARG ARG B . n 
B 1 214 THR 214 321 321 THR THR B . n 
B 1 215 LEU 215 322 322 LEU LEU B . n 
B 1 216 ARG 216 323 323 ARG ARG B . n 
B 1 217 ALA 217 324 324 ALA ALA B . n 
B 1 218 VAL 218 325 325 VAL VAL B . n 
B 1 219 GLU 219 326 326 GLU GLU B . n 
B 1 220 ALA 220 327 327 ALA ALA B . n 
B 1 221 ASP 221 328 328 ASP ASP B . n 
B 1 222 GLU 222 329 329 GLU GLU B . n 
B 1 223 GLU 223 330 330 GLU GLU B . n 
B 1 224 LEU 224 331 331 LEU LEU B . n 
B 1 225 THR 225 332 332 THR THR B . n 
B 1 226 VAL 226 333 333 VAL VAL B . n 
B 1 227 ALA 227 334 334 ALA ALA B . n 
B 1 228 TYR 228 335 335 TYR TYR B . n 
B 1 229 GLY 229 336 336 GLY GLY B . n 
B 1 230 TYR 230 337 337 TYR TYR B . n 
B 1 231 ASP 231 338 338 ASP ASP B . n 
B 1 232 HIS 232 339 339 HIS HIS B . n 
B 1 233 SER 233 340 340 SER SER B . n 
B 1 234 PRO 234 341 341 PRO PRO B . n 
B 1 235 PRO 235 342 342 PRO PRO B . n 
B 1 236 GLY 236 343 343 GLY GLY B . n 
B 1 237 LYS 237 344 344 LYS LYS B . n 
B 1 238 SER 238 345 345 SER SER B . n 
B 1 239 GLY 239 346 346 GLY GLY B . n 
B 1 240 PRO 240 347 347 PRO PRO B . n 
B 1 241 GLU 241 348 348 GLU GLU B . n 
B 1 242 ALA 242 349 349 ALA ALA B . n 
B 1 243 PRO 243 350 350 PRO PRO B . n 
B 1 244 GLU 244 351 351 GLU GLU B . n 
B 1 245 TRP 245 352 352 TRP TRP B . n 
B 1 246 TYR 246 353 353 TYR TYR B . n 
B 1 247 GLN 247 354 354 GLN GLN B . n 
B 1 248 VAL 248 355 355 VAL VAL B . n 
B 1 249 GLU 249 356 356 GLU GLU B . n 
B 1 250 LEU 250 357 357 LEU LEU B . n 
B 1 251 LYS 251 358 358 LYS LYS B . n 
B 1 252 ALA 252 359 359 ALA ALA B . n 
B 1 253 PHE 253 360 360 PHE PHE B . n 
B 1 254 GLN 254 361 361 GLN GLN B . n 
B 1 255 ALA 255 362 362 ALA ALA B . n 
B 1 256 THR 256 363 363 THR THR B . n 
B 1 257 GLN 257 364 364 GLN GLN B . n 
B 1 258 GLN 258 365 365 GLN GLN B . n 
B 1 259 LYS 259 366 366 LYS LYS B . n 
C 2 1   ALA 1   1   1   ALA ALA K . n 
C 2 2   ARG 2   2   2   ARG ARG K . n 
C 2 3   THR 3   3   3   THR THR K . n 
C 2 4   MLZ 4   4   4   MLZ MLZ K . n 
C 2 5   GLN 5   5   5   GLN GLN K . n 
C 2 6   THR 6   6   6   THR THR K . n 
C 2 7   ALA 7   7   7   ALA ALA K . n 
C 2 8   ARG 8   8   8   ARG ARG K . n 
C 2 9   LYS 9   9   9   LYS LYS K . n 
C 2 10  TYR 10  10  10  TYR TYR K . n 
D 2 1   ALA 1   1   1   ALA ALA L . n 
D 2 2   ARG 2   2   2   ARG ARG L . n 
D 2 3   THR 3   3   3   THR THR L . n 
D 2 4   MLZ 4   4   4   MLZ MLZ L . n 
D 2 5   GLN 5   5   5   GLN GLN L . n 
D 2 6   THR 6   6   6   THR THR L . n 
D 2 7   ALA 7   7   ?   ?   ?   L . n 
D 2 8   ARG 8   8   ?   ?   ?   L . n 
D 2 9   LYS 9   9   ?   ?   ?   L . n 
D 2 10  TYR 10  10  ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SAH 1   1367 1367 SAH SAH A . 
F 3 SAH 1   1367 1367 SAH SAH B . 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
G 4 HOH 112 2112 2112 HOH HOH A . 
G 4 HOH 113 2113 2113 HOH HOH A . 
G 4 HOH 114 2114 2114 HOH HOH A . 
G 4 HOH 115 2115 2115 HOH HOH A . 
G 4 HOH 116 2116 2116 HOH HOH A . 
G 4 HOH 117 2117 2117 HOH HOH A . 
G 4 HOH 118 2118 2118 HOH HOH A . 
G 4 HOH 119 2119 2119 HOH HOH A . 
G 4 HOH 120 2120 2120 HOH HOH A . 
G 4 HOH 121 2121 2121 HOH HOH A . 
G 4 HOH 122 2122 2122 HOH HOH A . 
G 4 HOH 123 2123 2123 HOH HOH A . 
G 4 HOH 124 2124 2124 HOH HOH A . 
G 4 HOH 125 2125 2125 HOH HOH A . 
G 4 HOH 126 2126 2126 HOH HOH A . 
G 4 HOH 127 2127 2127 HOH HOH A . 
G 4 HOH 128 2128 2128 HOH HOH A . 
G 4 HOH 129 2129 2129 HOH HOH A . 
G 4 HOH 130 2130 2130 HOH HOH A . 
G 4 HOH 131 2131 2131 HOH HOH A . 
G 4 HOH 132 2132 2132 HOH HOH A . 
G 4 HOH 133 2133 2133 HOH HOH A . 
G 4 HOH 134 2134 2134 HOH HOH A . 
G 4 HOH 135 2135 2135 HOH HOH A . 
G 4 HOH 136 2136 2136 HOH HOH A . 
G 4 HOH 137 2137 2137 HOH HOH A . 
G 4 HOH 138 2138 2138 HOH HOH A . 
G 4 HOH 139 2139 2139 HOH HOH A . 
G 4 HOH 140 2140 2140 HOH HOH A . 
G 4 HOH 141 2141 2141 HOH HOH A . 
G 4 HOH 142 2142 2142 HOH HOH A . 
G 4 HOH 143 2143 2143 HOH HOH A . 
G 4 HOH 144 2144 2144 HOH HOH A . 
G 4 HOH 145 2145 2145 HOH HOH A . 
G 4 HOH 146 2146 2146 HOH HOH A . 
G 4 HOH 147 2147 2147 HOH HOH A . 
G 4 HOH 148 2148 2148 HOH HOH A . 
G 4 HOH 149 2149 2149 HOH HOH A . 
G 4 HOH 150 2150 2150 HOH HOH A . 
G 4 HOH 151 2151 2151 HOH HOH A . 
G 4 HOH 152 2152 2152 HOH HOH A . 
G 4 HOH 153 2153 2153 HOH HOH A . 
G 4 HOH 154 2154 2154 HOH HOH A . 
G 4 HOH 155 2155 2155 HOH HOH A . 
G 4 HOH 156 2156 2156 HOH HOH A . 
G 4 HOH 157 2157 2157 HOH HOH A . 
G 4 HOH 158 2158 2158 HOH HOH A . 
G 4 HOH 159 2159 2159 HOH HOH A . 
G 4 HOH 160 2160 2160 HOH HOH A . 
G 4 HOH 161 2161 2161 HOH HOH A . 
G 4 HOH 162 2162 2162 HOH HOH A . 
G 4 HOH 163 2163 2163 HOH HOH A . 
G 4 HOH 164 2164 2164 HOH HOH A . 
G 4 HOH 165 2165 2165 HOH HOH A . 
G 4 HOH 166 2166 2166 HOH HOH A . 
G 4 HOH 167 2167 2167 HOH HOH A . 
G 4 HOH 168 2168 2168 HOH HOH A . 
G 4 HOH 169 2169 2169 HOH HOH A . 
G 4 HOH 170 2170 2170 HOH HOH A . 
G 4 HOH 171 2171 2171 HOH HOH A . 
G 4 HOH 172 2172 2172 HOH HOH A . 
G 4 HOH 173 2173 2173 HOH HOH A . 
G 4 HOH 174 2174 2174 HOH HOH A . 
G 4 HOH 175 2175 2175 HOH HOH A . 
G 4 HOH 176 2176 2176 HOH HOH A . 
G 4 HOH 177 2177 2177 HOH HOH A . 
G 4 HOH 178 2178 2178 HOH HOH A . 
G 4 HOH 179 2179 2179 HOH HOH A . 
G 4 HOH 180 2180 2180 HOH HOH A . 
G 4 HOH 181 2181 2181 HOH HOH A . 
G 4 HOH 182 2182 2182 HOH HOH A . 
G 4 HOH 183 2183 2183 HOH HOH A . 
G 4 HOH 184 2184 2184 HOH HOH A . 
G 4 HOH 185 2185 2185 HOH HOH A . 
G 4 HOH 186 2186 2186 HOH HOH A . 
G 4 HOH 187 2187 2187 HOH HOH A . 
G 4 HOH 188 2188 2188 HOH HOH A . 
G 4 HOH 189 2189 2189 HOH HOH A . 
G 4 HOH 190 2190 2190 HOH HOH A . 
G 4 HOH 191 2191 2191 HOH HOH A . 
G 4 HOH 192 2192 2192 HOH HOH A . 
G 4 HOH 193 2193 2193 HOH HOH A . 
G 4 HOH 194 2194 2194 HOH HOH A . 
G 4 HOH 195 2195 2195 HOH HOH A . 
G 4 HOH 196 2196 2196 HOH HOH A . 
G 4 HOH 197 2197 2197 HOH HOH A . 
G 4 HOH 198 2198 2198 HOH HOH A . 
G 4 HOH 199 2199 2199 HOH HOH A . 
G 4 HOH 200 2200 2200 HOH HOH A . 
G 4 HOH 201 2201 2201 HOH HOH A . 
G 4 HOH 202 2202 2202 HOH HOH A . 
G 4 HOH 203 2203 2203 HOH HOH A . 
G 4 HOH 204 2204 2204 HOH HOH A . 
G 4 HOH 205 2205 2205 HOH HOH A . 
G 4 HOH 206 2206 2206 HOH HOH A . 
G 4 HOH 207 2207 2207 HOH HOH A . 
G 4 HOH 208 2208 2208 HOH HOH A . 
G 4 HOH 209 2209 2209 HOH HOH A . 
G 4 HOH 210 2210 2210 HOH HOH A . 
G 4 HOH 211 2211 2211 HOH HOH A . 
G 4 HOH 212 2212 2212 HOH HOH A . 
G 4 HOH 213 2213 2213 HOH HOH A . 
G 4 HOH 214 2214 2214 HOH HOH A . 
G 4 HOH 215 2215 2215 HOH HOH A . 
G 4 HOH 216 2216 2216 HOH HOH A . 
G 4 HOH 217 2217 2217 HOH HOH A . 
G 4 HOH 218 2218 2218 HOH HOH A . 
G 4 HOH 219 2219 2219 HOH HOH A . 
G 4 HOH 220 2220 2220 HOH HOH A . 
G 4 HOH 221 2221 2221 HOH HOH A . 
G 4 HOH 222 2222 2222 HOH HOH A . 
G 4 HOH 223 2223 2223 HOH HOH A . 
G 4 HOH 224 2224 2224 HOH HOH A . 
G 4 HOH 225 2225 2225 HOH HOH A . 
G 4 HOH 226 2226 2226 HOH HOH A . 
G 4 HOH 227 2227 2227 HOH HOH A . 
G 4 HOH 228 2228 2228 HOH HOH A . 
G 4 HOH 229 2229 2229 HOH HOH A . 
G 4 HOH 230 2230 2230 HOH HOH A . 
G 4 HOH 231 2231 2231 HOH HOH A . 
G 4 HOH 232 2232 2232 HOH HOH A . 
G 4 HOH 233 2233 2233 HOH HOH A . 
G 4 HOH 234 2234 2234 HOH HOH A . 
G 4 HOH 235 2235 2235 HOH HOH A . 
G 4 HOH 236 2236 2236 HOH HOH A . 
G 4 HOH 237 2237 2237 HOH HOH A . 
G 4 HOH 238 2238 2238 HOH HOH A . 
G 4 HOH 239 2239 2239 HOH HOH A . 
G 4 HOH 240 2240 2240 HOH HOH A . 
G 4 HOH 241 2241 2241 HOH HOH A . 
G 4 HOH 242 2242 2242 HOH HOH A . 
G 4 HOH 243 2243 2243 HOH HOH A . 
G 4 HOH 244 2244 2244 HOH HOH A . 
G 4 HOH 245 2245 2245 HOH HOH A . 
G 4 HOH 246 2246 2246 HOH HOH A . 
G 4 HOH 247 2247 2247 HOH HOH A . 
G 4 HOH 248 2248 2248 HOH HOH A . 
G 4 HOH 249 2249 2249 HOH HOH A . 
G 4 HOH 250 2250 2250 HOH HOH A . 
G 4 HOH 251 2251 2251 HOH HOH A . 
G 4 HOH 252 2252 2252 HOH HOH A . 
G 4 HOH 253 2253 2253 HOH HOH A . 
G 4 HOH 254 2254 2254 HOH HOH A . 
G 4 HOH 255 2255 2255 HOH HOH A . 
G 4 HOH 256 2256 2256 HOH HOH A . 
G 4 HOH 257 2257 2257 HOH HOH A . 
G 4 HOH 258 2258 2258 HOH HOH A . 
G 4 HOH 259 2259 2259 HOH HOH A . 
G 4 HOH 260 2260 2260 HOH HOH A . 
G 4 HOH 261 2261 2261 HOH HOH A . 
G 4 HOH 262 2262 2262 HOH HOH A . 
G 4 HOH 263 2263 2263 HOH HOH A . 
G 4 HOH 264 2264 2264 HOH HOH A . 
G 4 HOH 265 2265 2265 HOH HOH A . 
G 4 HOH 266 2266 2266 HOH HOH A . 
G 4 HOH 267 2267 2267 HOH HOH A . 
G 4 HOH 268 2268 2268 HOH HOH A . 
G 4 HOH 269 2269 2269 HOH HOH A . 
G 4 HOH 270 2270 2270 HOH HOH A . 
G 4 HOH 271 2271 2271 HOH HOH A . 
G 4 HOH 272 2272 2272 HOH HOH A . 
G 4 HOH 273 2273 2273 HOH HOH A . 
G 4 HOH 274 2274 2274 HOH HOH A . 
G 4 HOH 275 2275 2275 HOH HOH A . 
G 4 HOH 276 2276 2276 HOH HOH A . 
G 4 HOH 277 2277 2277 HOH HOH A . 
G 4 HOH 278 2278 2278 HOH HOH A . 
G 4 HOH 279 2279 2279 HOH HOH A . 
G 4 HOH 280 2280 2280 HOH HOH A . 
G 4 HOH 281 2281 2281 HOH HOH A . 
G 4 HOH 282 2282 2282 HOH HOH A . 
G 4 HOH 283 2283 2283 HOH HOH A . 
G 4 HOH 284 2284 2284 HOH HOH A . 
G 4 HOH 285 2285 2285 HOH HOH A . 
G 4 HOH 286 2286 2286 HOH HOH A . 
G 4 HOH 287 2287 2287 HOH HOH A . 
G 4 HOH 288 2288 2288 HOH HOH A . 
G 4 HOH 289 2289 2289 HOH HOH A . 
G 4 HOH 290 2290 2290 HOH HOH A . 
G 4 HOH 291 2291 2291 HOH HOH A . 
G 4 HOH 292 2292 2292 HOH HOH A . 
G 4 HOH 293 2293 2293 HOH HOH A . 
G 4 HOH 294 2294 2294 HOH HOH A . 
G 4 HOH 295 2295 2295 HOH HOH A . 
G 4 HOH 296 2296 2296 HOH HOH A . 
G 4 HOH 297 2297 2297 HOH HOH A . 
G 4 HOH 298 2298 2298 HOH HOH A . 
G 4 HOH 299 2299 2299 HOH HOH A . 
G 4 HOH 300 2300 2300 HOH HOH A . 
G 4 HOH 301 2301 2301 HOH HOH A . 
G 4 HOH 302 2302 2302 HOH HOH A . 
G 4 HOH 303 2303 2303 HOH HOH A . 
G 4 HOH 304 2304 2304 HOH HOH A . 
G 4 HOH 305 2305 2305 HOH HOH A . 
G 4 HOH 306 2306 2306 HOH HOH A . 
G 4 HOH 307 2307 2307 HOH HOH A . 
G 4 HOH 308 2308 2308 HOH HOH A . 
G 4 HOH 309 2309 2309 HOH HOH A . 
G 4 HOH 310 2310 2310 HOH HOH A . 
G 4 HOH 311 2311 2311 HOH HOH A . 
H 4 HOH 1   2001 2001 HOH HOH B . 
H 4 HOH 2   2002 2002 HOH HOH B . 
H 4 HOH 3   2003 2003 HOH HOH B . 
H 4 HOH 4   2004 2004 HOH HOH B . 
H 4 HOH 5   2005 2005 HOH HOH B . 
H 4 HOH 6   2006 2006 HOH HOH B . 
H 4 HOH 7   2007 2007 HOH HOH B . 
H 4 HOH 8   2008 2008 HOH HOH B . 
H 4 HOH 9   2009 2009 HOH HOH B . 
H 4 HOH 10  2010 2010 HOH HOH B . 
H 4 HOH 11  2011 2011 HOH HOH B . 
H 4 HOH 12  2012 2012 HOH HOH B . 
H 4 HOH 13  2013 2013 HOH HOH B . 
H 4 HOH 14  2014 2014 HOH HOH B . 
H 4 HOH 15  2015 2015 HOH HOH B . 
H 4 HOH 16  2016 2016 HOH HOH B . 
H 4 HOH 17  2017 2017 HOH HOH B . 
H 4 HOH 18  2018 2018 HOH HOH B . 
H 4 HOH 19  2019 2019 HOH HOH B . 
H 4 HOH 20  2020 2020 HOH HOH B . 
H 4 HOH 21  2021 2021 HOH HOH B . 
H 4 HOH 22  2022 2022 HOH HOH B . 
H 4 HOH 23  2023 2023 HOH HOH B . 
H 4 HOH 24  2024 2024 HOH HOH B . 
H 4 HOH 25  2025 2025 HOH HOH B . 
H 4 HOH 26  2026 2026 HOH HOH B . 
H 4 HOH 27  2027 2027 HOH HOH B . 
H 4 HOH 28  2028 2028 HOH HOH B . 
H 4 HOH 29  2029 2029 HOH HOH B . 
H 4 HOH 30  2030 2030 HOH HOH B . 
H 4 HOH 31  2031 2031 HOH HOH B . 
H 4 HOH 32  2032 2032 HOH HOH B . 
H 4 HOH 33  2033 2033 HOH HOH B . 
H 4 HOH 34  2034 2034 HOH HOH B . 
H 4 HOH 35  2035 2035 HOH HOH B . 
H 4 HOH 36  2036 2036 HOH HOH B . 
H 4 HOH 37  2037 2037 HOH HOH B . 
H 4 HOH 38  2038 2038 HOH HOH B . 
H 4 HOH 39  2039 2039 HOH HOH B . 
H 4 HOH 40  2040 2040 HOH HOH B . 
H 4 HOH 41  2041 2041 HOH HOH B . 
H 4 HOH 42  2042 2042 HOH HOH B . 
H 4 HOH 43  2043 2043 HOH HOH B . 
H 4 HOH 44  2044 2044 HOH HOH B . 
H 4 HOH 45  2045 2045 HOH HOH B . 
H 4 HOH 46  2046 2046 HOH HOH B . 
H 4 HOH 47  2047 2047 HOH HOH B . 
H 4 HOH 48  2048 2048 HOH HOH B . 
H 4 HOH 49  2049 2049 HOH HOH B . 
H 4 HOH 50  2050 2050 HOH HOH B . 
H 4 HOH 51  2051 2051 HOH HOH B . 
H 4 HOH 52  2052 2052 HOH HOH B . 
H 4 HOH 53  2053 2053 HOH HOH B . 
H 4 HOH 54  2054 2054 HOH HOH B . 
H 4 HOH 55  2055 2055 HOH HOH B . 
H 4 HOH 56  2056 2056 HOH HOH B . 
H 4 HOH 57  2057 2057 HOH HOH B . 
H 4 HOH 58  2058 2058 HOH HOH B . 
H 4 HOH 59  2059 2059 HOH HOH B . 
H 4 HOH 60  2060 2060 HOH HOH B . 
H 4 HOH 61  2061 2061 HOH HOH B . 
H 4 HOH 62  2062 2062 HOH HOH B . 
H 4 HOH 63  2063 2063 HOH HOH B . 
H 4 HOH 64  2064 2064 HOH HOH B . 
H 4 HOH 65  2065 2065 HOH HOH B . 
H 4 HOH 66  2066 2066 HOH HOH B . 
H 4 HOH 67  2067 2067 HOH HOH B . 
H 4 HOH 68  2068 2068 HOH HOH B . 
H 4 HOH 69  2069 2069 HOH HOH B . 
H 4 HOH 70  2070 2070 HOH HOH B . 
H 4 HOH 71  2071 2071 HOH HOH B . 
H 4 HOH 72  2072 2072 HOH HOH B . 
H 4 HOH 73  2073 2073 HOH HOH B . 
H 4 HOH 74  2074 2074 HOH HOH B . 
H 4 HOH 75  2075 2075 HOH HOH B . 
H 4 HOH 76  2076 2076 HOH HOH B . 
H 4 HOH 77  2077 2077 HOH HOH B . 
H 4 HOH 78  2078 2078 HOH HOH B . 
H 4 HOH 79  2079 2079 HOH HOH B . 
H 4 HOH 80  2080 2080 HOH HOH B . 
H 4 HOH 81  2081 2081 HOH HOH B . 
H 4 HOH 82  2082 2082 HOH HOH B . 
H 4 HOH 83  2083 2083 HOH HOH B . 
H 4 HOH 84  2084 2084 HOH HOH B . 
H 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 86  2086 2086 HOH HOH B . 
H 4 HOH 87  2087 2087 HOH HOH B . 
H 4 HOH 88  2088 2088 HOH HOH B . 
H 4 HOH 89  2089 2089 HOH HOH B . 
H 4 HOH 90  2090 2090 HOH HOH B . 
H 4 HOH 91  2091 2091 HOH HOH B . 
H 4 HOH 92  2092 2092 HOH HOH B . 
H 4 HOH 93  2093 2093 HOH HOH B . 
H 4 HOH 94  2094 2094 HOH HOH B . 
H 4 HOH 95  2095 2095 HOH HOH B . 
H 4 HOH 96  2096 2096 HOH HOH B . 
H 4 HOH 97  2097 2097 HOH HOH B . 
H 4 HOH 98  2098 2098 HOH HOH B . 
H 4 HOH 99  2099 2099 HOH HOH B . 
H 4 HOH 100 2100 2100 HOH HOH B . 
H 4 HOH 101 2101 2101 HOH HOH B . 
H 4 HOH 102 2102 2102 HOH HOH B . 
H 4 HOH 103 2103 2103 HOH HOH B . 
H 4 HOH 104 2104 2104 HOH HOH B . 
H 4 HOH 105 2105 2105 HOH HOH B . 
H 4 HOH 106 2106 2106 HOH HOH B . 
H 4 HOH 107 2107 2107 HOH HOH B . 
H 4 HOH 108 2108 2108 HOH HOH B . 
H 4 HOH 109 2109 2109 HOH HOH B . 
H 4 HOH 110 2110 2110 HOH HOH B . 
H 4 HOH 111 2111 2111 HOH HOH B . 
H 4 HOH 112 2112 2112 HOH HOH B . 
H 4 HOH 113 2113 2113 HOH HOH B . 
H 4 HOH 114 2114 2114 HOH HOH B . 
H 4 HOH 115 2115 2115 HOH HOH B . 
H 4 HOH 116 2116 2116 HOH HOH B . 
H 4 HOH 117 2117 2117 HOH HOH B . 
H 4 HOH 118 2118 2118 HOH HOH B . 
H 4 HOH 119 2119 2119 HOH HOH B . 
H 4 HOH 120 2120 2120 HOH HOH B . 
H 4 HOH 121 2121 2121 HOH HOH B . 
H 4 HOH 122 2122 2122 HOH HOH B . 
H 4 HOH 123 2123 2123 HOH HOH B . 
H 4 HOH 124 2124 2124 HOH HOH B . 
H 4 HOH 125 2125 2125 HOH HOH B . 
H 4 HOH 126 2126 2126 HOH HOH B . 
H 4 HOH 127 2127 2127 HOH HOH B . 
H 4 HOH 128 2128 2128 HOH HOH B . 
H 4 HOH 129 2129 2129 HOH HOH B . 
H 4 HOH 130 2130 2130 HOH HOH B . 
H 4 HOH 131 2131 2131 HOH HOH B . 
H 4 HOH 132 2132 2132 HOH HOH B . 
H 4 HOH 133 2133 2133 HOH HOH B . 
H 4 HOH 134 2134 2134 HOH HOH B . 
H 4 HOH 135 2135 2135 HOH HOH B . 
H 4 HOH 136 2136 2136 HOH HOH B . 
H 4 HOH 137 2137 2137 HOH HOH B . 
H 4 HOH 138 2138 2138 HOH HOH B . 
H 4 HOH 139 2139 2139 HOH HOH B . 
H 4 HOH 140 2140 2140 HOH HOH B . 
H 4 HOH 141 2141 2141 HOH HOH B . 
H 4 HOH 142 2142 2142 HOH HOH B . 
H 4 HOH 143 2143 2143 HOH HOH B . 
H 4 HOH 144 2144 2144 HOH HOH B . 
H 4 HOH 145 2145 2145 HOH HOH B . 
H 4 HOH 146 2146 2146 HOH HOH B . 
H 4 HOH 147 2147 2147 HOH HOH B . 
H 4 HOH 148 2148 2148 HOH HOH B . 
H 4 HOH 149 2149 2149 HOH HOH B . 
H 4 HOH 150 2150 2150 HOH HOH B . 
H 4 HOH 151 2151 2151 HOH HOH B . 
H 4 HOH 152 2152 2152 HOH HOH B . 
H 4 HOH 153 2153 2153 HOH HOH B . 
H 4 HOH 154 2154 2154 HOH HOH B . 
H 4 HOH 155 2155 2155 HOH HOH B . 
H 4 HOH 156 2156 2156 HOH HOH B . 
H 4 HOH 157 2157 2157 HOH HOH B . 
H 4 HOH 158 2158 2158 HOH HOH B . 
H 4 HOH 159 2159 2159 HOH HOH B . 
H 4 HOH 160 2160 2160 HOH HOH B . 
H 4 HOH 161 2161 2161 HOH HOH B . 
H 4 HOH 162 2162 2162 HOH HOH B . 
H 4 HOH 163 2163 2163 HOH HOH B . 
H 4 HOH 164 2164 2164 HOH HOH B . 
H 4 HOH 165 2165 2165 HOH HOH B . 
H 4 HOH 166 2166 2166 HOH HOH B . 
H 4 HOH 167 2167 2167 HOH HOH B . 
H 4 HOH 168 2168 2168 HOH HOH B . 
H 4 HOH 169 2169 2169 HOH HOH B . 
H 4 HOH 170 2170 2170 HOH HOH B . 
H 4 HOH 171 2171 2171 HOH HOH B . 
H 4 HOH 172 2172 2172 HOH HOH B . 
H 4 HOH 173 2173 2173 HOH HOH B . 
H 4 HOH 174 2174 2174 HOH HOH B . 
H 4 HOH 175 2175 2175 HOH HOH B . 
H 4 HOH 176 2176 2176 HOH HOH B . 
H 4 HOH 177 2177 2177 HOH HOH B . 
H 4 HOH 178 2178 2178 HOH HOH B . 
H 4 HOH 179 2179 2179 HOH HOH B . 
H 4 HOH 180 2180 2180 HOH HOH B . 
H 4 HOH 181 2181 2181 HOH HOH B . 
H 4 HOH 182 2182 2182 HOH HOH B . 
H 4 HOH 183 2183 2183 HOH HOH B . 
H 4 HOH 184 2184 2184 HOH HOH B . 
H 4 HOH 185 2185 2185 HOH HOH B . 
H 4 HOH 186 2186 2186 HOH HOH B . 
H 4 HOH 187 2187 2187 HOH HOH B . 
H 4 HOH 188 2188 2188 HOH HOH B . 
H 4 HOH 189 2189 2189 HOH HOH B . 
H 4 HOH 190 2190 2190 HOH HOH B . 
H 4 HOH 191 2191 2191 HOH HOH B . 
H 4 HOH 192 2192 2192 HOH HOH B . 
H 4 HOH 193 2193 2193 HOH HOH B . 
H 4 HOH 194 2194 2194 HOH HOH B . 
H 4 HOH 195 2195 2195 HOH HOH B . 
H 4 HOH 196 2196 2196 HOH HOH B . 
H 4 HOH 197 2197 2197 HOH HOH B . 
H 4 HOH 198 2198 2198 HOH HOH B . 
H 4 HOH 199 2199 2199 HOH HOH B . 
H 4 HOH 200 2200 2200 HOH HOH B . 
H 4 HOH 201 2201 2201 HOH HOH B . 
H 4 HOH 202 2202 2202 HOH HOH B . 
H 4 HOH 203 2203 2203 HOH HOH B . 
H 4 HOH 204 2204 2204 HOH HOH B . 
H 4 HOH 205 2205 2205 HOH HOH B . 
H 4 HOH 206 2206 2206 HOH HOH B . 
H 4 HOH 207 2207 2207 HOH HOH B . 
H 4 HOH 208 2208 2208 HOH HOH B . 
H 4 HOH 209 2209 2209 HOH HOH B . 
H 4 HOH 210 2210 2210 HOH HOH B . 
H 4 HOH 211 2211 2211 HOH HOH B . 
H 4 HOH 212 2212 2212 HOH HOH B . 
H 4 HOH 213 2213 2213 HOH HOH B . 
H 4 HOH 214 2214 2214 HOH HOH B . 
H 4 HOH 215 2215 2215 HOH HOH B . 
H 4 HOH 216 2216 2216 HOH HOH B . 
H 4 HOH 217 2217 2217 HOH HOH B . 
H 4 HOH 218 2218 2218 HOH HOH B . 
H 4 HOH 219 2219 2219 HOH HOH B . 
H 4 HOH 220 2220 2220 HOH HOH B . 
H 4 HOH 221 2221 2221 HOH HOH B . 
H 4 HOH 222 2222 2222 HOH HOH B . 
H 4 HOH 223 2223 2223 HOH HOH B . 
H 4 HOH 224 2224 2224 HOH HOH B . 
H 4 HOH 225 2225 2225 HOH HOH B . 
H 4 HOH 226 2226 2226 HOH HOH B . 
H 4 HOH 227 2227 2227 HOH HOH B . 
H 4 HOH 228 2228 2228 HOH HOH B . 
H 4 HOH 229 2229 2229 HOH HOH B . 
H 4 HOH 230 2230 2230 HOH HOH B . 
H 4 HOH 231 2231 2231 HOH HOH B . 
H 4 HOH 232 2232 2232 HOH HOH B . 
H 4 HOH 233 2233 2233 HOH HOH B . 
H 4 HOH 234 2234 2234 HOH HOH B . 
H 4 HOH 235 2235 2235 HOH HOH B . 
H 4 HOH 236 2236 2236 HOH HOH B . 
H 4 HOH 237 2237 2237 HOH HOH B . 
H 4 HOH 238 2238 2238 HOH HOH B . 
H 4 HOH 239 2239 2239 HOH HOH B . 
H 4 HOH 240 2240 2240 HOH HOH B . 
H 4 HOH 241 2241 2241 HOH HOH B . 
H 4 HOH 242 2242 2242 HOH HOH B . 
H 4 HOH 243 2243 2243 HOH HOH B . 
H 4 HOH 244 2244 2244 HOH HOH B . 
H 4 HOH 245 2245 2245 HOH HOH B . 
H 4 HOH 246 2246 2246 HOH HOH B . 
H 4 HOH 247 2247 2247 HOH HOH B . 
H 4 HOH 248 2248 2248 HOH HOH B . 
H 4 HOH 249 2249 2249 HOH HOH B . 
H 4 HOH 250 2250 2250 HOH HOH B . 
H 4 HOH 251 2251 2251 HOH HOH B . 
H 4 HOH 252 2252 2252 HOH HOH B . 
H 4 HOH 253 2253 2253 HOH HOH B . 
H 4 HOH 254 2254 2254 HOH HOH B . 
H 4 HOH 255 2255 2255 HOH HOH B . 
H 4 HOH 256 2256 2256 HOH HOH B . 
H 4 HOH 257 2257 2257 HOH HOH B . 
H 4 HOH 258 2258 2258 HOH HOH B . 
H 4 HOH 259 2259 2259 HOH HOH B . 
H 4 HOH 260 2260 2260 HOH HOH B . 
H 4 HOH 261 2261 2261 HOH HOH B . 
H 4 HOH 262 2262 2262 HOH HOH B . 
H 4 HOH 263 2263 2263 HOH HOH B . 
H 4 HOH 264 2264 2264 HOH HOH B . 
H 4 HOH 265 2265 2265 HOH HOH B . 
H 4 HOH 266 2266 2266 HOH HOH B . 
H 4 HOH 267 2267 2267 HOH HOH B . 
H 4 HOH 268 2268 2268 HOH HOH B . 
H 4 HOH 269 2269 2269 HOH HOH B . 
H 4 HOH 270 2270 2270 HOH HOH B . 
H 4 HOH 271 2271 2271 HOH HOH B . 
H 4 HOH 272 2272 2272 HOH HOH B . 
H 4 HOH 273 2273 2273 HOH HOH B . 
H 4 HOH 274 2274 2274 HOH HOH B . 
H 4 HOH 275 2275 2275 HOH HOH B . 
H 4 HOH 276 2276 2276 HOH HOH B . 
H 4 HOH 277 2277 2277 HOH HOH B . 
H 4 HOH 278 2278 2278 HOH HOH B . 
H 4 HOH 279 2279 2279 HOH HOH B . 
H 4 HOH 280 2280 2280 HOH HOH B . 
H 4 HOH 281 2281 2281 HOH HOH B . 
H 4 HOH 282 2282 2282 HOH HOH B . 
H 4 HOH 283 2283 2283 HOH HOH B . 
H 4 HOH 284 2284 2284 HOH HOH B . 
H 4 HOH 285 2285 2285 HOH HOH B . 
H 4 HOH 286 2286 2286 HOH HOH B . 
H 4 HOH 287 2287 2287 HOH HOH B . 
H 4 HOH 288 2288 2288 HOH HOH B . 
H 4 HOH 289 2289 2289 HOH HOH B . 
H 4 HOH 290 2290 2290 HOH HOH B . 
H 4 HOH 291 2291 2291 HOH HOH B . 
H 4 HOH 292 2292 2292 HOH HOH B . 
H 4 HOH 293 2293 2293 HOH HOH B . 
H 4 HOH 294 2294 2294 HOH HOH B . 
H 4 HOH 295 2295 2295 HOH HOH B . 
H 4 HOH 296 2296 2296 HOH HOH B . 
H 4 HOH 297 2297 2297 HOH HOH B . 
H 4 HOH 298 2298 2298 HOH HOH B . 
H 4 HOH 299 2299 2299 HOH HOH B . 
H 4 HOH 300 2300 2300 HOH HOH B . 
H 4 HOH 301 2301 2301 HOH HOH B . 
H 4 HOH 302 2302 2302 HOH HOH B . 
H 4 HOH 303 2303 2303 HOH HOH B . 
H 4 HOH 304 2304 2304 HOH HOH B . 
H 4 HOH 305 2305 2305 HOH HOH B . 
H 4 HOH 306 2306 2306 HOH HOH B . 
H 4 HOH 307 2307 2307 HOH HOH B . 
H 4 HOH 308 2308 2308 HOH HOH B . 
H 4 HOH 309 2309 2309 HOH HOH B . 
H 4 HOH 310 2310 2310 HOH HOH B . 
H 4 HOH 311 2311 2311 HOH HOH B . 
H 4 HOH 312 2312 2312 HOH HOH B . 
H 4 HOH 313 2313 2313 HOH HOH B . 
H 4 HOH 314 2314 2314 HOH HOH B . 
H 4 HOH 315 2315 2315 HOH HOH B . 
H 4 HOH 316 2316 2316 HOH HOH B . 
H 4 HOH 317 2317 2317 HOH HOH B . 
H 4 HOH 318 2318 2318 HOH HOH B . 
H 4 HOH 319 2319 2319 HOH HOH B . 
H 4 HOH 320 2320 2320 HOH HOH B . 
H 4 HOH 321 2321 2321 HOH HOH B . 
H 4 HOH 322 2322 2322 HOH HOH B . 
H 4 HOH 323 2323 2323 HOH HOH B . 
H 4 HOH 324 2324 2324 HOH HOH B . 
H 4 HOH 325 2325 2325 HOH HOH B . 
H 4 HOH 326 2326 2326 HOH HOH B . 
H 4 HOH 327 2327 2327 HOH HOH B . 
H 4 HOH 328 2328 2328 HOH HOH B . 
I 4 HOH 1   2001 2001 HOH HOH K . 
I 4 HOH 2   2002 2002 HOH HOH K . 
I 4 HOH 3   2003 2003 HOH HOH K . 
I 4 HOH 4   2004 2004 HOH HOH K . 
I 4 HOH 5   2005 2005 HOH HOH K . 
I 4 HOH 6   2006 2006 HOH HOH K . 
I 4 HOH 7   2007 2007 HOH HOH K . 
I 4 HOH 8   2008 2008 HOH HOH K . 
I 4 HOH 9   2009 2009 HOH HOH K . 
I 4 HOH 10  2010 2010 HOH HOH K . 
I 4 HOH 11  2011 2011 HOH HOH K . 
I 4 HOH 12  2012 2012 HOH HOH K . 
I 4 HOH 13  2013 2013 HOH HOH K . 
I 4 HOH 14  2014 2014 HOH HOH K . 
I 4 HOH 15  2015 2015 HOH HOH K . 
I 4 HOH 16  2016 2016 HOH HOH K . 
J 4 HOH 1   2001 2001 HOH HOH L . 
J 4 HOH 2   2002 2002 HOH HOH L . 
J 4 HOH 3   2003 2003 HOH HOH L . 
J 4 HOH 4   2004 2004 HOH HOH L . 
J 4 HOH 5   2005 2005 HOH HOH L . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C MLZ 4 K MLZ 4 ? LYS N-METHYL-LYSINE 
2 D MLZ 4 L MLZ 4 ? LYS N-METHYL-LYSINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,I 
2 1 B,D,F,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-02-06 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
AMoRE     phasing          . ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O     A PRO 342  ? ? O   A GLY 343  ? ? 1.76 
2  1 O     B HOH 2206 ? ? O   B HOH 2282 ? ? 1.99 
3  1 O     B HOH 2322 ? ? O   B HOH 2323 ? ? 2.02 
4  1 O     B HOH 2128 ? ? O   B HOH 2178 ? ? 2.05 
5  1 O     B HOH 2139 ? ? O   B HOH 2194 ? ? 2.06 
6  1 OE1   A GLU 183  ? ? O   A HOH 2067 ? ? 2.08 
7  1 NZ    B LYS 317  ? ? OG1 L THR 6    ? ? 2.13 
8  1 O     B HOH 2138 ? ? O   B HOH 2194 ? ? 2.16 
9  1 O     B HOH 2122 ? ? O   B HOH 2174 ? ? 2.16 
10 1 "O3'" B SAH 1367 ? ? O   B HOH 2327 ? ? 2.17 
11 1 O     A HOH 2069 ? ? O   A HOH 2073 ? ? 2.18 
12 1 OE1   B GLU 356  ? A O   B HOH 2311 ? ? 2.19 
13 1 OG    A SER 268  ? A OG1 K THR 3    ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    SD 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    MET 
_pdbx_validate_symm_contact.auth_seq_id_1     185 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NE2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    GLN 
_pdbx_validate_symm_contact.auth_seq_id_2     365 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD B GLU 356 ? A OE1 B GLU 356 ? A 1.463 1.252 0.211  0.011 N 
2 1 CD B GLU 356 ? B OE1 B GLU 356 ? B 1.111 1.252 -0.141 0.011 N 
3 1 CD B GLU 356 ? B OE2 B GLU 356 ? B 1.516 1.252 0.264  0.011 N 
4 1 C  K THR 3   ? ? N   K MLZ 4   ? ? 1.476 1.336 0.140  0.023 Y 
5 1 C  K MLZ 4   ? ? N   K GLN 5   ? ? 1.523 1.336 0.187  0.023 Y 
6 1 C  L THR 3   ? ? N   L MLZ 4   ? ? 1.590 1.336 0.254  0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A ASP 256 ? ? CG A ASP 256 ? ? OD2 A ASP 256 ? ? 123.96 118.30 5.66   0.90 N 
2  1 CB  A ASP 306 ? ? CG A ASP 306 ? ? OD2 A ASP 306 ? ? 123.88 118.30 5.58   0.90 N 
3  1 N   A GLY 343 ? ? CA A GLY 343 ? ? C   A GLY 343 ? ? 96.21  113.10 -16.89 2.50 N 
4  1 CB  A SER 345 ? ? CA A SER 345 ? ? C   A SER 345 ? ? 98.52  110.10 -11.58 1.90 N 
5  1 N   A SER 345 ? ? CA A SER 345 ? ? CB  A SER 345 ? ? 96.08  110.50 -14.42 1.50 N 
6  1 N   A SER 345 ? ? CA A SER 345 ? ? C   A SER 345 ? ? 137.71 111.00 26.71  2.70 N 
7  1 N   B VAL 118 ? ? CA B VAL 118 ? ? CB  B VAL 118 ? ? 95.82  111.50 -15.68 2.20 N 
8  1 CB  B ASP 194 ? ? CG B ASP 194 ? ? OD2 B ASP 194 ? ? 123.87 118.30 5.57   0.90 N 
9  1 CB  B ASP 306 ? ? CG B ASP 306 ? ? OD2 B ASP 306 ? ? 124.43 118.30 6.13   0.90 N 
10 1 OE1 B GLU 356 ? A CD B GLU 356 ? A OE2 B GLU 356 ? A 110.51 123.30 -12.79 1.20 N 
11 1 CA  K THR 3   ? ? C  K THR 3   ? ? N   K MLZ 4   ? ? 98.18  117.20 -19.02 2.20 Y 
12 1 O   K THR 3   ? ? C  K THR 3   ? ? N   K MLZ 4   ? ? 139.30 122.70 16.60  1.60 Y 
13 1 C   K THR 3   ? ? N  K MLZ 4   ? ? CA  K MLZ 4   ? ? 102.97 121.70 -18.73 2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 152 ? ? -144.42 -53.35  
2  1 CYS A 200 ? ? -162.20 108.91  
3  1 TYR A 245 ? ? -113.71 76.08   
4  1 CYS A 288 ? ? -141.50 16.79   
5  1 ILE A 316 ? ? -139.25 -156.74 
6  1 SER A 345 ? ? -88.02  32.68   
7  1 GLN A 365 ? ? 80.80   116.28  
8  1 VAL B 118 ? ? -37.98  120.95  
9  1 ARG B 152 ? ? -133.78 -51.30  
10 1 ASP B 194 ? ? -150.17 60.64   
11 1 THR B 197 ? ? -115.23 -168.93 
12 1 CYS B 288 ? ? -144.55 16.99   
13 1 ILE B 316 ? ? -131.74 -155.92 
14 1 PRO B 341 ? ? -62.53  -122.56 
15 1 PRO B 342 ? ? -68.44  -90.76  
16 1 LYS B 344 ? ? 178.93  18.12   
17 1 ARG K 2   ? ? -68.81  49.48   
18 1 GLN K 5   ? ? 42.59   29.47   
19 1 ARG L 2   ? ? -43.19  23.50   
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             MLZ 
_pdbx_validate_main_chain_plane.auth_asym_id             K 
_pdbx_validate_main_chain_plane.auth_seq_id              4 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -12.64 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    GLU 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     356 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.076 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   L 
_pdbx_validate_polymer_linkage.auth_comp_id_1   MLZ 
_pdbx_validate_polymer_linkage.auth_seq_id_1    4 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   L 
_pdbx_validate_polymer_linkage.auth_comp_id_2   GLN 
_pdbx_validate_polymer_linkage.auth_seq_id_2    5 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.76 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2058 ? 5.95 . 
2  1 O ? A HOH 2088 ? 8.06 . 
3  1 O ? A HOH 2089 ? 7.68 . 
4  1 O ? A HOH 2105 ? 6.86 . 
5  1 O ? A HOH 2115 ? 6.38 . 
6  1 O ? A HOH 2122 ? 6.05 . 
7  1 O ? A HOH 2180 ? 6.00 . 
8  1 O ? B HOH 2067 ? 5.96 . 
9  1 O ? B HOH 2077 ? 6.49 . 
10 1 O ? B HOH 2080 ? 6.63 . 
11 1 O ? B HOH 2091 ? 6.29 . 
12 1 O ? B HOH 2092 ? 5.83 . 
13 1 O ? B HOH 2093 ? 8.44 . 
14 1 O ? B HOH 2094 ? 5.92 . 
15 1 O ? B HOH 2097 ? 6.05 . 
16 1 O ? B HOH 2098 ? 6.99 . 
17 1 O ? B HOH 2131 ? 5.96 . 
18 1 O ? B HOH 2146 ? 7.45 . 
19 1 O ? B HOH 2147 ? 6.83 . 
20 1 O ? B HOH 2150 ? 6.60 . 
21 1 O ? B HOH 2200 ? 6.13 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A SAH 1367 ? OXT ? E SAH 1 OXT 
2 1 N 1 B SAH 1367 ? OXT ? F SAH 1 OXT 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 108 ? A GLY 1  
2  1 Y 1 A GLN 109 ? A GLN 2  
3  1 Y 1 A TYR 110 ? A TYR 3  
4  1 Y 1 A LYS 111 ? A LYS 4  
5  1 Y 1 A ASP 112 ? A ASP 5  
6  1 Y 1 A ASN 113 ? A ASN 6  
7  1 Y 1 A ILE 114 ? A ILE 7  
8  1 Y 1 A ARG 115 ? A ARG 8  
9  1 Y 1 A HIS 116 ? A HIS 9  
10 1 Y 1 B GLY 108 ? B GLY 1  
11 1 Y 1 B GLN 109 ? B GLN 2  
12 1 Y 1 B TYR 110 ? B TYR 3  
13 1 Y 1 B LYS 111 ? B LYS 4  
14 1 Y 1 B ASP 112 ? B ASP 5  
15 1 Y 1 B ASN 113 ? B ASN 6  
16 1 Y 1 B ILE 114 ? B ILE 7  
17 1 Y 1 B ARG 115 ? B ARG 8  
18 1 Y 1 B HIS 116 ? B HIS 9  
19 1 Y 1 L ALA 7   ? D ALA 7  
20 1 Y 1 L ARG 8   ? D ARG 8  
21 1 Y 1 L LYS 9   ? D LYS 9  
22 1 Y 1 L TYR 10  ? D TYR 10 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 S-ADENOSYL-L-HOMOCYSTEINE SAH 
4 water                     HOH 
#