data_1O9U
# 
_entry.id   1O9U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1O9U         
PDBE  EBI-11907    
WWPDB D_1290011907 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GNG unspecified 'GLYCOGEN SYNTHASE 3BETA (GSK3) COMPLEX WITH FRATTIDE PEPTIDE' 
PDB 1H8F unspecified 'GLYCOGEN SYNTHASE KINASE 3 BETA.' 
PDB 1I09 unspecified 'STRUCTURE OF GLYCOGEN SYNTHASE KINASE-3 (GSK3B)' 
PDB 1O6K unspecified 'STRUCTURE OF ACTIVATED FORM OF PKB KINASE DOMAIN S474D WITH GSK3 PEPTIDE AND AMP-PNP' 
PDB 1O6L unspecified 
'CRYSTAL STRUCTURE OF AN ACTIVATED AKT/ PROTEIN KINASE B (PKB-PIF CHIMERA) TERNARY COMPLEX WITH AMP-PNP AND GSK3 PEPTIDE' 
PDB 1DK8 unspecified 'CRYSTAL STRUCTURE OF THE RGS-HOMOLOGOUS DOMAIN OF AXIN' 
PDB 1EMU unspecified 'STRUCTURE OF THE AXIN RGS-HOMOLOGOUS DOMAIN IN COMPLEX WITH A SAMP REPEAT FROM APC' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1O9U 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dajani, R.'  1 
'Pearl, L.H.' 2 
'Roe, S.M.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for Recruitment of Glycogen Synthase Kinase 3Beta to the Axin-Apc Scaffold Complex' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            22 
_citation.page_first                494 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12554650 
_citation.pdbx_database_id_DOI      10.1093/EMBOJ/CDG068 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dajani, R.'   1 
primary 'Fraser, E.'   2 
primary 'Roe, S.M.'    3 
primary 'Yeo, M.'      4 
primary 'Good, V.'     5 
primary 'Thompson, V.' 6 
primary 'Dale, T.C.'   7 
primary 'Pearl, L.H.'  8 
# 
_cell.entry_id           1O9U 
_cell.length_a           81.950 
_cell.length_b           81.950 
_cell.length_c           282.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1O9U 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA' 39622.484 1   2.7.1.37 ? 'RESIDUES 35-384'  'PHOSPHOTYROSINE AT A216' 
2 polymer     syn 'AXIN PEPTIDE'                    2139.428  1   ?        ? 'RESIDUES 383-400' ?                         
3 non-polymer syn 9-METHYL-9H-PURIN-6-AMINE         149.153   1   ?        ? ?                  ?                         
4 water       nat water                             18.015    133 ?        ? ?                  ?                         
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'GSK-3 BETA, GSK3B'                             
2 'AXIS INHIBITION PROTEIN 1, HAXIN, AXIN1, AXIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPATVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEII
KVLGTPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL
PNGRDTPALFNFTTQELSSNPPLATILIPPHARI
;
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPATVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGR
DTPALFNFTTQELSSNPPLATILIPPHARI
;
A ? 
2 'polypeptide(L)' no no  VEPQKFAEELIHRLEAVQ VEPQKFAEELIHRLEAVQ B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   THR n 
1 6   VAL n 
1 7   VAL n 
1 8   ALA n 
1 9   THR n 
1 10  PRO n 
1 11  GLY n 
1 12  GLN n 
1 13  GLY n 
1 14  PRO n 
1 15  ASP n 
1 16  ARG n 
1 17  PRO n 
1 18  GLN n 
1 19  GLU n 
1 20  VAL n 
1 21  SER n 
1 22  TYR n 
1 23  THR n 
1 24  ASP n 
1 25  THR n 
1 26  LYS n 
1 27  VAL n 
1 28  ILE n 
1 29  GLY n 
1 30  ASN n 
1 31  GLY n 
1 32  SER n 
1 33  PHE n 
1 34  GLY n 
1 35  VAL n 
1 36  VAL n 
1 37  TYR n 
1 38  GLN n 
1 39  ALA n 
1 40  LYS n 
1 41  LEU n 
1 42  CYS n 
1 43  ASP n 
1 44  SER n 
1 45  GLY n 
1 46  GLU n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  ILE n 
1 51  LYS n 
1 52  LYS n 
1 53  VAL n 
1 54  LEU n 
1 55  GLN n 
1 56  GLY n 
1 57  LYS n 
1 58  ALA n 
1 59  PHE n 
1 60  LYS n 
1 61  ASN n 
1 62  ARG n 
1 63  GLU n 
1 64  LEU n 
1 65  GLN n 
1 66  ILE n 
1 67  MET n 
1 68  ARG n 
1 69  LYS n 
1 70  LEU n 
1 71  ASP n 
1 72  HIS n 
1 73  CYS n 
1 74  ASN n 
1 75  ILE n 
1 76  VAL n 
1 77  ARG n 
1 78  LEU n 
1 79  ARG n 
1 80  TYR n 
1 81  PHE n 
1 82  PHE n 
1 83  TYR n 
1 84  SER n 
1 85  SER n 
1 86  GLY n 
1 87  GLU n 
1 88  LYS n 
1 89  LYS n 
1 90  ASP n 
1 91  GLU n 
1 92  VAL n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  VAL n 
1 98  LEU n 
1 99  ASP n 
1 100 TYR n 
1 101 VAL n 
1 102 PRO n 
1 103 ALA n 
1 104 THR n 
1 105 VAL n 
1 106 TYR n 
1 107 ARG n 
1 108 VAL n 
1 109 ALA n 
1 110 ARG n 
1 111 HIS n 
1 112 TYR n 
1 113 SER n 
1 114 ARG n 
1 115 ALA n 
1 116 LYS n 
1 117 GLN n 
1 118 THR n 
1 119 LEU n 
1 120 PRO n 
1 121 VAL n 
1 122 ILE n 
1 123 TYR n 
1 124 VAL n 
1 125 LYS n 
1 126 LEU n 
1 127 TYR n 
1 128 MET n 
1 129 TYR n 
1 130 GLN n 
1 131 LEU n 
1 132 PHE n 
1 133 ARG n 
1 134 SER n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 ILE n 
1 139 HIS n 
1 140 SER n 
1 141 PHE n 
1 142 GLY n 
1 143 ILE n 
1 144 CYS n 
1 145 HIS n 
1 146 ARG n 
1 147 ASP n 
1 148 ILE n 
1 149 LYS n 
1 150 PRO n 
1 151 GLN n 
1 152 ASN n 
1 153 LEU n 
1 154 LEU n 
1 155 LEU n 
1 156 ASP n 
1 157 PRO n 
1 158 ASP n 
1 159 THR n 
1 160 ALA n 
1 161 VAL n 
1 162 LEU n 
1 163 LYS n 
1 164 LEU n 
1 165 CYS n 
1 166 ASP n 
1 167 PHE n 
1 168 GLY n 
1 169 SER n 
1 170 ALA n 
1 171 LYS n 
1 172 GLN n 
1 173 LEU n 
1 174 VAL n 
1 175 ARG n 
1 176 GLY n 
1 177 GLU n 
1 178 PRO n 
1 179 ASN n 
1 180 VAL n 
1 181 SER n 
1 182 PTR n 
1 183 ILE n 
1 184 CYS n 
1 185 SER n 
1 186 ARG n 
1 187 TYR n 
1 188 TYR n 
1 189 ARG n 
1 190 ALA n 
1 191 PRO n 
1 192 GLU n 
1 193 LEU n 
1 194 ILE n 
1 195 PHE n 
1 196 GLY n 
1 197 ALA n 
1 198 THR n 
1 199 ASP n 
1 200 TYR n 
1 201 THR n 
1 202 SER n 
1 203 SER n 
1 204 ILE n 
1 205 ASP n 
1 206 VAL n 
1 207 TRP n 
1 208 SER n 
1 209 ALA n 
1 210 GLY n 
1 211 CYS n 
1 212 VAL n 
1 213 LEU n 
1 214 ALA n 
1 215 GLU n 
1 216 LEU n 
1 217 LEU n 
1 218 LEU n 
1 219 GLY n 
1 220 GLN n 
1 221 PRO n 
1 222 ILE n 
1 223 PHE n 
1 224 PRO n 
1 225 GLY n 
1 226 ASP n 
1 227 SER n 
1 228 GLY n 
1 229 VAL n 
1 230 ASP n 
1 231 GLN n 
1 232 LEU n 
1 233 VAL n 
1 234 GLU n 
1 235 ILE n 
1 236 ILE n 
1 237 LYS n 
1 238 VAL n 
1 239 LEU n 
1 240 GLY n 
1 241 THR n 
1 242 PRO n 
1 243 THR n 
1 244 ARG n 
1 245 GLU n 
1 246 GLN n 
1 247 ILE n 
1 248 ARG n 
1 249 GLU n 
1 250 MET n 
1 251 ASN n 
1 252 PRO n 
1 253 ASN n 
1 254 TYR n 
1 255 THR n 
1 256 GLU n 
1 257 PHE n 
1 258 ALA n 
1 259 PHE n 
1 260 PRO n 
1 261 GLN n 
1 262 ILE n 
1 263 LYS n 
1 264 ALA n 
1 265 HIS n 
1 266 PRO n 
1 267 TRP n 
1 268 THR n 
1 269 LYS n 
1 270 VAL n 
1 271 PHE n 
1 272 ARG n 
1 273 PRO n 
1 274 ARG n 
1 275 THR n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 ALA n 
1 280 ILE n 
1 281 ALA n 
1 282 LEU n 
1 283 CYS n 
1 284 SER n 
1 285 ARG n 
1 286 LEU n 
1 287 LEU n 
1 288 GLU n 
1 289 TYR n 
1 290 THR n 
1 291 PRO n 
1 292 THR n 
1 293 ALA n 
1 294 ARG n 
1 295 LEU n 
1 296 THR n 
1 297 PRO n 
1 298 LEU n 
1 299 GLU n 
1 300 ALA n 
1 301 CYS n 
1 302 ALA n 
1 303 HIS n 
1 304 SER n 
1 305 PHE n 
1 306 PHE n 
1 307 ASP n 
1 308 GLU n 
1 309 LEU n 
1 310 ARG n 
1 311 ASP n 
1 312 PRO n 
1 313 ASN n 
1 314 VAL n 
1 315 LYS n 
1 316 LEU n 
1 317 PRO n 
1 318 ASN n 
1 319 GLY n 
1 320 ARG n 
1 321 ASP n 
1 322 THR n 
1 323 PRO n 
1 324 ALA n 
1 325 LEU n 
1 326 PHE n 
1 327 ASN n 
1 328 PHE n 
1 329 THR n 
1 330 THR n 
1 331 GLN n 
1 332 GLU n 
1 333 LEU n 
1 334 SER n 
1 335 SER n 
1 336 ASN n 
1 337 PRO n 
1 338 PRO n 
1 339 LEU n 
1 340 ALA n 
1 341 THR n 
1 342 ILE n 
1 343 LEU n 
1 344 ILE n 
1 345 PRO n 
1 346 PRO n 
1 347 HIS n 
1 348 ALA n 
1 349 ARG n 
1 350 ILE n 
2 1   VAL n 
2 2   GLU n 
2 3   PRO n 
2 4   GLN n 
2 5   LYS n 
2 6   PHE n 
2 7   ALA n 
2 8   GLU n 
2 9   GLU n 
2 10  LEU n 
2 11  ILE n 
2 12  HIS n 
2 13  ARG n 
2 14  LEU n 
2 15  GLU n 
2 16  ALA n 
2 17  VAL n 
2 18  GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'SPODOPTERA FRUGIPERDA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SF9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PFASTBAC HTA' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'AXIN PEPTIDE' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KG3B_HUMAN 1 ? ? P49841 ? 
2 UNP AXN1_HUMAN 2 ? ? O15169 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1O9U A 1 ? 350 ? P49841 35  ? 384 ? 35  384 
2 2 1O9U B 1 ? 18  ? O15169 383 ? 400 ? 383 400 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1O9U 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      316 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P49841 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          350 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            350 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADZ non-polymer         . 9-METHYL-9H-PURIN-6-AMINE ?                 'C6 H7 N5'       149.153 
ALA 'L-peptide linking' y ALANINE                   ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                 ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                     ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE         PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE                    ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1O9U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   55.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTAL WERE GROWN BY THE HANGING DROP METHOD. 1UL OF PROTEIN SOLUTION (6MG/ML GSK3B AND 0.37MG/ML AXIN PEPTIDE) IN 25MM HEPES-NAOH, 250MM NACL, 1MM DTT, PH 7.0) WAS MIXED WITH 1UL PRECIPITANT (18% PEG4000, 150MM MGCL2, 100MM TRIS- HCL, PH 7.5)
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-09-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9253 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.9253 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1O9U 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             24.000 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   22740 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07600 
_reflns.pdbx_netI_over_sigmaI        6.9000 
_reflns.B_iso_Wilson_estimate        41.00 
_reflns.pdbx_redundancy              6.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.30500 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        3.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1O9U 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22658 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               2031993.380 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             23.31 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          0.233 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.260 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1132 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               54.20 
_refine.aniso_B[1][1]                            4.08000 
_refine.aniso_B[2][2]                            4.08000 
_refine.aniso_B[3][3]                            -8.16000 
_refine.aniso_B[1][2]                            5.26000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.37 
_refine.solvent_model_param_bsol                 53.15 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H8F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1O9U 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.28 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2942 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               3086 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        23.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.10  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.00 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.76  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.830 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.160 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.310 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.540 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             3523 
_refine_ls_shell.R_factor_R_work                  0.2760 
_refine_ls_shell.percent_reflns_obs               99.60 
_refine_ls_shell.R_factor_R_free                  0.2700 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            5.10 
_refine_ls_shell.number_reflns_R_free             189 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 ADE_GOL.PAR       ADE_GOL.TOP 
# 
_struct.entry_id                  1O9U 
_struct.title                     'GLYCOGEN SYNTHASE KINASE 3 BETA COMPLEXED WITH AXIN PEPTIDE' 
_struct.pdbx_descriptor           'GLYCOGEN SYNTHASE KINASE-3 BETA (E.C.2.7.1.37), AXIN PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1O9U 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE SUBSTRATE' 
_struct_keywords.text            
;TRANSFERASE-TRANSFERASE SUBSTRATE COMPLEX, KINASE, INSULIN PATHWAY, TRANSFERASE, SERINE/THREONINE-PROTEIN KINASE, ATP-BINDING, MULTIGENE FAMILY, PHOSPHORYLATION, DEVELOPMENTAL PROTEIN, ANTI-ONCOGENE, APOPTOSIS, TRANSFERASE- TRANSFERASE SUBSTRATE COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 61  ? ARG A 68  ? ASN A 95  ARG A 102 1 ? 8  
HELX_P HELX_P2  2  VAL A 105 ? ALA A 115 ? VAL A 139 ALA A 149 1 ? 11 
HELX_P HELX_P3  3  PRO A 120 ? PHE A 141 ? PRO A 154 PHE A 175 1 ? 22 
HELX_P HELX_P4  4  LYS A 149 ? GLN A 151 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 185 ? ARG A 189 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 190 ? PHE A 195 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 202 ? GLY A 219 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P8  8  SER A 227 ? GLY A 240 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 243 ? ASN A 251 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P10 10 PRO A 252 ? THR A 255 ? PRO A 286 THR A 289 5 ? 4  
HELX_P HELX_P11 11 PRO A 266 ? PHE A 271 ? PRO A 300 PHE A 305 1 ? 6  
HELX_P HELX_P12 12 PRO A 276 ? ARG A 285 ? PRO A 310 ARG A 319 1 ? 10 
HELX_P HELX_P13 13 THR A 290 ? ARG A 294 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P14 14 THR A 296 ? HIS A 303 ? THR A 330 HIS A 337 1 ? 8  
HELX_P HELX_P15 15 SER A 304 ? ASP A 311 ? SER A 338 ASP A 345 5 ? 8  
HELX_P HELX_P16 16 THR A 329 ? SER A 334 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P17 17 ASN A 336 ? PRO A 338 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P18 18 LEU A 339 ? ILE A 344 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P19 19 PRO A 345 ? ILE A 350 ? PRO A 379 ILE A 384 1 ? 6  
HELX_P HELX_P20 20 VAL B 1   ? GLN B 18  ? VAL B 383 GLN B 400 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 181 C ? ? ? 1_555 A PTR 182 N ? ? A SER 215 A PTR 216 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale2 covale ? ? A PTR 182 C ? ? ? 1_555 A ILE 183 N ? ? A PTR 216 A ILE 217 1_555 ? ? ? ? ? ? ? 1.325 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 3 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AA 2 GLN A 18  ? ASN A 30  ? GLN A 52  ASN A 64  
AA 3 GLY A 34  ? LEU A 41  ? GLY A 68  LEU A 75  
AA 4 LEU A 47  ? GLN A 55  ? LEU A 81  GLN A 89  
AA 5 VAL A 92  ? ASP A 99  ? VAL A 126 ASP A 133 
AA 6 LEU A 78  ? SER A 84  ? LEU A 112 SER A 118 
AA 7 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AA 8 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AB 1 ALA A 103 ? THR A 104 ? ALA A 137 THR A 138 
AB 2 LEU A 153 ? LEU A 155 ? LEU A 187 LEU A 189 
AB 3 LEU A 162 ? LEU A 164 ? LEU A 196 LEU A 198 
AC 1 ILE A 143 ? CYS A 144 ? ILE A 177 CYS A 178 
AC 2 LYS A 171 ? GLN A 172 ? LYS A 205 GLN A 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 8   ? N ALA A 42  O GLN A 18  ? O GLN A 52  
AA 2 3 N ILE A 28  ? N ILE A 62  O VAL A 36  ? O VAL A 70  
AA 3 4 N ALA A 39  ? N ALA A 73  O VAL A 48  ? O VAL A 82  
AA 4 5 N GLN A 55  ? N GLN A 89  O VAL A 92  ? O VAL A 126 
AA 5 6 O VAL A 97  ? O VAL A 131 N ARG A 79  ? N ARG A 113 
AA 6 7 N PHE A 81  ? N PHE A 115 O THR A 9   ? O THR A 43  
AB 1 2 N ALA A 103 ? N ALA A 137 O LEU A 155 ? O LEU A 189 
AB 2 3 N LEU A 154 ? N LEU A 188 O LYS A 163 ? O LYS A 197 
AC 1 2 N CYS A 144 ? N CYS A 178 O LYS A 171 ? O LYS A 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ADZ A 1386'      
AC2 Software ? ? ? ? 23 'BINDING SITE FOR CHAIN B OF AXIN PEPTIDE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  VAL A 76  ? VAL A 110  . ? 1_555  ? 
2  AC1 4  ASP A 99  ? ASP A 133  . ? 1_555  ? 
3  AC1 4  VAL A 101 ? VAL A 135  . ? 1_555  ? 
4  AC1 4  LEU A 154 ? LEU A 188  . ? 1_555  ? 
5  AC2 23 VAL A 27  ? VAL A 61   . ? 10_665 ? 
6  AC2 23 ILE A 28  ? ILE A 62   . ? 10_665 ? 
7  AC2 23 GLY A 29  ? GLY A 63   . ? 10_665 ? 
8  AC2 23 ASN A 30  ? ASN A 64   . ? 10_665 ? 
9  AC2 23 VAL A 35  ? VAL A 69   . ? 10_665 ? 
10 AC2 23 TYR A 100 ? TYR A 134  . ? 10_665 ? 
11 AC2 23 ARG A 107 ? ARG A 141  . ? 10_665 ? 
12 AC2 23 ILE A 194 ? ILE A 228  . ? 1_555  ? 
13 AC2 23 VAL A 229 ? VAL A 263  . ? 1_555  ? 
14 AC2 23 ASP A 230 ? ASP A 264  . ? 1_555  ? 
15 AC2 23 LYS A 237 ? LYS A 271  . ? 1_555  ? 
16 AC2 23 TYR A 254 ? TYR A 288  . ? 1_555  ? 
17 AC2 23 PHE A 257 ? PHE A 291  . ? 1_555  ? 
18 AC2 23 ALA A 258 ? ALA A 292  . ? 1_555  ? 
19 AC2 23 PRO A 260 ? PRO A 294  . ? 1_555  ? 
20 AC2 23 GLN A 261 ? GLN A 295  . ? 1_555  ? 
21 AC2 23 ILE A 262 ? ILE A 296  . ? 1_555  ? 
22 AC2 23 HOH E .   ? HOH B 2001 . ? 1_555  ? 
23 AC2 23 HOH E .   ? HOH B 2003 . ? 1_555  ? 
24 AC2 23 HOH E .   ? HOH B 2004 . ? 1_555  ? 
25 AC2 23 HOH E .   ? HOH B 2005 . ? 1_555  ? 
26 AC2 23 HOH E .   ? HOH B 2006 . ? 1_555  ? 
27 AC2 23 HOH E .   ? HOH B 2007 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1O9U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1O9U 
_atom_sites.fract_transf_matrix[1][1]   0.012202 
_atom_sites.fract_transf_matrix[1][2]   0.007045 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014090 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003540 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . SER A 1 1   ? -8.871  52.070 157.647 1.00 88.90  ? 35   SER A N     1 
ATOM   2    C CA    . SER A 1 1   ? -9.053  52.710 156.311 1.00 88.25  ? 35   SER A CA    1 
ATOM   3    C C     . SER A 1 1   ? -10.525 53.010 156.034 1.00 87.49  ? 35   SER A C     1 
ATOM   4    O O     . SER A 1 1   ? -11.398 52.697 156.846 1.00 87.59  ? 35   SER A O     1 
ATOM   5    C CB    . SER A 1 1   ? -8.498  51.798 155.214 1.00 88.07  ? 35   SER A CB    1 
ATOM   6    O OG    . SER A 1 1   ? -7.121  51.544 155.422 1.00 88.23  ? 35   SER A OG    1 
ATOM   7    N N     . LYS A 1 2   ? -10.792 53.619 154.884 1.00 86.09  ? 36   LYS A N     1 
ATOM   8    C CA    . LYS A 1 2   ? -12.155 53.966 154.500 1.00 84.75  ? 36   LYS A CA    1 
ATOM   9    C C     . LYS A 1 2   ? -12.878 52.722 153.983 1.00 82.88  ? 36   LYS A C     1 
ATOM   10   O O     . LYS A 1 2   ? -12.648 52.289 152.853 1.00 82.88  ? 36   LYS A O     1 
ATOM   11   C CB    . LYS A 1 2   ? -12.121 55.059 153.424 1.00 86.14  ? 36   LYS A CB    1 
ATOM   12   C CG    . LYS A 1 2   ? -13.471 55.678 153.075 1.00 87.39  ? 36   LYS A CG    1 
ATOM   13   C CD    . LYS A 1 2   ? -14.213 54.880 152.012 1.00 88.21  ? 36   LYS A CD    1 
ATOM   14   C CE    . LYS A 1 2   ? -15.506 55.578 151.605 1.00 88.60  ? 36   LYS A CE    1 
ATOM   15   N NZ    . LYS A 1 2   ? -16.202 54.885 150.483 1.00 88.43  ? 36   LYS A NZ    1 
ATOM   16   N N     . VAL A 1 3   ? -13.741 52.150 154.823 1.00 79.54  ? 37   VAL A N     1 
ATOM   17   C CA    . VAL A 1 3   ? -14.497 50.950 154.464 1.00 75.63  ? 37   VAL A CA    1 
ATOM   18   C C     . VAL A 1 3   ? -15.756 51.253 153.654 1.00 72.45  ? 37   VAL A C     1 
ATOM   19   O O     . VAL A 1 3   ? -16.565 52.095 154.039 1.00 72.39  ? 37   VAL A O     1 
ATOM   20   C CB    . VAL A 1 3   ? -14.914 50.138 155.718 1.00 76.63  ? 37   VAL A CB    1 
ATOM   21   C CG1   . VAL A 1 3   ? -13.697 49.469 156.338 1.00 76.45  ? 37   VAL A CG1   1 
ATOM   22   C CG2   . VAL A 1 3   ? -15.589 51.055 156.739 1.00 78.11  ? 37   VAL A CG2   1 
ATOM   23   N N     . THR A 1 4   ? -15.910 50.561 152.528 1.00 68.23  ? 38   THR A N     1 
ATOM   24   C CA    . THR A 1 4   ? -17.075 50.728 151.664 1.00 64.88  ? 38   THR A CA    1 
ATOM   25   C C     . THR A 1 4   ? -17.935 49.462 151.739 1.00 61.67  ? 38   THR A C     1 
ATOM   26   O O     . THR A 1 4   ? -17.423 48.346 151.617 1.00 61.29  ? 38   THR A O     1 
ATOM   27   C CB    . THR A 1 4   ? -16.661 50.964 150.185 1.00 65.79  ? 38   THR A CB    1 
ATOM   28   O OG1   . THR A 1 4   ? -15.869 52.156 150.087 1.00 67.99  ? 38   THR A OG1   1 
ATOM   29   C CG2   . THR A 1 4   ? -17.892 51.118 149.296 1.00 64.52  ? 38   THR A CG2   1 
ATOM   30   N N     . THR A 1 5   ? -19.237 49.640 151.944 1.00 58.20  ? 39   THR A N     1 
ATOM   31   C CA    . THR A 1 5   ? -20.170 48.518 152.040 1.00 55.27  ? 39   THR A CA    1 
ATOM   32   C C     . THR A 1 5   ? -21.263 48.635 150.979 1.00 52.60  ? 39   THR A C     1 
ATOM   33   O O     . THR A 1 5   ? -21.738 49.734 150.688 1.00 50.13  ? 39   THR A O     1 
ATOM   34   C CB    . THR A 1 5   ? -20.835 48.464 153.446 1.00 56.39  ? 39   THR A CB    1 
ATOM   35   O OG1   . THR A 1 5   ? -19.820 48.328 154.452 1.00 56.92  ? 39   THR A OG1   1 
ATOM   36   C CG2   . THR A 1 5   ? -21.793 47.283 153.547 1.00 54.49  ? 39   THR A CG2   1 
ATOM   37   N N     . VAL A 1 6   ? -21.647 47.506 150.388 1.00 49.35  ? 40   VAL A N     1 
ATOM   38   C CA    . VAL A 1 6   ? -22.698 47.502 149.367 1.00 47.72  ? 40   VAL A CA    1 
ATOM   39   C C     . VAL A 1 6   ? -23.473 46.194 149.393 1.00 46.08  ? 40   VAL A C     1 
ATOM   40   O O     . VAL A 1 6   ? -23.037 45.228 150.014 1.00 46.05  ? 40   VAL A O     1 
ATOM   41   C CB    . VAL A 1 6   ? -22.119 47.668 147.939 1.00 48.12  ? 40   VAL A CB    1 
ATOM   42   C CG1   . VAL A 1 6   ? -21.367 48.985 147.823 1.00 49.19  ? 40   VAL A CG1   1 
ATOM   43   C CG2   . VAL A 1 6   ? -21.201 46.492 147.605 1.00 45.63  ? 40   VAL A CG2   1 
ATOM   44   N N     . VAL A 1 7   ? -24.621 46.162 148.723 1.00 44.41  ? 41   VAL A N     1 
ATOM   45   C CA    . VAL A 1 7   ? -25.401 44.934 148.661 1.00 44.27  ? 41   VAL A CA    1 
ATOM   46   C C     . VAL A 1 7   ? -25.142 44.321 147.291 1.00 44.05  ? 41   VAL A C     1 
ATOM   47   O O     . VAL A 1 7   ? -25.753 44.689 146.295 1.00 45.34  ? 41   VAL A O     1 
ATOM   48   C CB    . VAL A 1 7   ? -26.932 45.178 148.849 1.00 43.91  ? 41   VAL A CB    1 
ATOM   49   C CG1   . VAL A 1 7   ? -27.677 43.827 148.852 1.00 39.62  ? 41   VAL A CG1   1 
ATOM   50   C CG2   . VAL A 1 7   ? -27.192 45.918 150.162 1.00 38.96  ? 41   VAL A CG2   1 
ATOM   51   N N     . ALA A 1 8   ? -24.223 43.371 147.254 1.00 45.02  ? 42   ALA A N     1 
ATOM   52   C CA    . ALA A 1 8   ? -23.854 42.727 146.013 1.00 43.86  ? 42   ALA A CA    1 
ATOM   53   C C     . ALA A 1 8   ? -24.502 41.364 145.852 1.00 44.68  ? 42   ALA A C     1 
ATOM   54   O O     . ALA A 1 8   ? -24.829 40.692 146.832 1.00 44.50  ? 42   ALA A O     1 
ATOM   55   C CB    . ALA A 1 8   ? -22.342 42.591 145.947 1.00 42.67  ? 42   ALA A CB    1 
ATOM   56   N N     . THR A 1 9   ? -24.667 40.956 144.601 1.00 44.77  ? 43   THR A N     1 
ATOM   57   C CA    . THR A 1 9   ? -25.252 39.668 144.286 1.00 47.32  ? 43   THR A CA    1 
ATOM   58   C C     . THR A 1 9   ? -24.140 38.709 143.892 1.00 49.66  ? 43   THR A C     1 
ATOM   59   O O     . THR A 1 9   ? -23.322 39.033 143.032 1.00 49.14  ? 43   THR A O     1 
ATOM   60   C CB    . THR A 1 9   ? -26.215 39.765 143.096 1.00 47.14  ? 43   THR A CB    1 
ATOM   61   O OG1   . THR A 1 9   ? -27.185 40.783 143.346 1.00 46.64  ? 43   THR A OG1   1 
ATOM   62   C CG2   . THR A 1 9   ? -26.905 38.435 142.870 1.00 45.77  ? 43   THR A CG2   1 
ATOM   63   N N     . PRO A 1 10  ? -24.094 37.522 144.524 1.00 52.41  ? 44   PRO A N     1 
ATOM   64   C CA    . PRO A 1 10  ? -23.083 36.503 144.240 1.00 54.12  ? 44   PRO A CA    1 
ATOM   65   C C     . PRO A 1 10  ? -23.135 36.078 142.782 1.00 56.72  ? 44   PRO A C     1 
ATOM   66   O O     . PRO A 1 10  ? -24.212 35.967 142.196 1.00 54.68  ? 44   PRO A O     1 
ATOM   67   C CB    . PRO A 1 10  ? -23.462 35.370 145.186 1.00 54.60  ? 44   PRO A CB    1 
ATOM   68   C CG    . PRO A 1 10  ? -23.974 36.110 146.370 1.00 54.25  ? 44   PRO A CG    1 
ATOM   69   C CD    . PRO A 1 10  ? -24.875 37.146 145.716 1.00 52.94  ? 44   PRO A CD    1 
ATOM   70   N N     . GLY A 1 11  ? -21.961 35.849 142.204 1.00 59.91  ? 45   GLY A N     1 
ATOM   71   C CA    . GLY A 1 11  ? -21.875 35.449 140.813 1.00 66.08  ? 45   GLY A CA    1 
ATOM   72   C C     . GLY A 1 11  ? -22.591 34.151 140.511 1.00 70.43  ? 45   GLY A C     1 
ATOM   73   O O     . GLY A 1 11  ? -23.647 34.155 139.883 1.00 72.05  ? 45   GLY A O     1 
ATOM   74   N N     . GLN A 1 12  ? -22.013 33.037 140.950 1.00 74.89  ? 46   GLN A N     1 
ATOM   75   C CA    . GLN A 1 12  ? -22.604 31.721 140.721 1.00 79.12  ? 46   GLN A CA    1 
ATOM   76   C C     . GLN A 1 12  ? -23.541 31.374 141.876 1.00 80.00  ? 46   GLN A C     1 
ATOM   77   O O     . GLN A 1 12  ? -23.269 30.455 142.647 1.00 81.06  ? 46   GLN A O     1 
ATOM   78   C CB    . GLN A 1 12  ? -21.500 30.660 140.613 1.00 81.22  ? 46   GLN A CB    1 
ATOM   79   C CG    . GLN A 1 12  ? -21.974 29.277 140.154 1.00 85.33  ? 46   GLN A CG    1 
ATOM   80   C CD    . GLN A 1 12  ? -22.422 29.254 138.695 1.00 87.41  ? 46   GLN A CD    1 
ATOM   81   O OE1   . GLN A 1 12  ? -21.645 29.567 137.788 1.00 87.46  ? 46   GLN A OE1   1 
ATOM   82   N NE2   . GLN A 1 12  ? -23.680 28.878 138.465 1.00 87.72  ? 46   GLN A NE2   1 
ATOM   83   N N     . GLY A 1 13  ? -24.640 32.110 141.998 1.00 80.77  ? 47   GLY A N     1 
ATOM   84   C CA    . GLY A 1 13  ? -25.573 31.845 143.077 1.00 81.83  ? 47   GLY A CA    1 
ATOM   85   C C     . GLY A 1 13  ? -27.026 31.971 142.662 1.00 82.41  ? 47   GLY A C     1 
ATOM   86   O O     . GLY A 1 13  ? -27.311 32.364 141.530 1.00 82.49  ? 47   GLY A O     1 
ATOM   87   N N     . PRO A 1 14  ? -27.972 31.647 143.562 1.00 82.01  ? 48   PRO A N     1 
ATOM   88   C CA    . PRO A 1 14  ? -29.411 31.725 143.285 1.00 80.31  ? 48   PRO A CA    1 
ATOM   89   C C     . PRO A 1 14  ? -29.967 33.150 143.281 1.00 77.68  ? 48   PRO A C     1 
ATOM   90   O O     . PRO A 1 14  ? -31.167 33.354 143.442 1.00 80.27  ? 48   PRO A O     1 
ATOM   91   C CB    . PRO A 1 14  ? -30.015 30.873 144.395 1.00 81.30  ? 48   PRO A CB    1 
ATOM   92   C CG    . PRO A 1 14  ? -29.095 31.162 145.547 1.00 82.52  ? 48   PRO A CG    1 
ATOM   93   C CD    . PRO A 1 14  ? -27.725 31.083 144.904 1.00 82.34  ? 48   PRO A CD    1 
ATOM   94   N N     . ASP A 1 15  ? -29.090 34.129 143.095 1.00 73.51  ? 49   ASP A N     1 
ATOM   95   C CA    . ASP A 1 15  ? -29.483 35.536 143.061 1.00 68.84  ? 49   ASP A CA    1 
ATOM   96   C C     . ASP A 1 15  ? -29.990 36.006 144.419 1.00 64.32  ? 49   ASP A C     1 
ATOM   97   O O     . ASP A 1 15  ? -31.135 36.428 144.565 1.00 62.98  ? 49   ASP A O     1 
ATOM   98   C CB    . ASP A 1 15  ? -30.559 35.763 142.000 1.00 70.56  ? 49   ASP A CB    1 
ATOM   99   C CG    . ASP A 1 15  ? -30.656 37.215 141.579 1.00 72.90  ? 49   ASP A CG    1 
ATOM   100  O OD1   . ASP A 1 15  ? -30.702 38.092 142.472 1.00 74.04  ? 49   ASP A OD1   1 
ATOM   101  O OD2   . ASP A 1 15  ? -30.688 37.480 140.357 1.00 74.07  ? 49   ASP A OD2   1 
ATOM   102  N N     . ARG A 1 16  ? -29.116 35.936 145.412 1.00 59.14  ? 50   ARG A N     1 
ATOM   103  C CA    . ARG A 1 16  ? -29.455 36.338 146.769 1.00 55.14  ? 50   ARG A CA    1 
ATOM   104  C C     . ARG A 1 16  ? -28.455 37.378 147.281 1.00 50.93  ? 50   ARG A C     1 
ATOM   105  O O     . ARG A 1 16  ? -27.433 37.045 147.879 1.00 47.90  ? 50   ARG A O     1 
ATOM   106  C CB    . ARG A 1 16  ? -29.461 35.103 147.672 1.00 56.62  ? 50   ARG A CB    1 
ATOM   107  C CG    . ARG A 1 16  ? -30.511 34.074 147.279 1.00 57.98  ? 50   ARG A CG    1 
ATOM   108  C CD    . ARG A 1 16  ? -31.818 34.293 148.022 1.00 60.55  ? 50   ARG A CD    1 
ATOM   109  N NE    . ARG A 1 16  ? -32.853 33.371 147.566 1.00 61.92  ? 50   ARG A NE    1 
ATOM   110  C CZ    . ARG A 1 16  ? -33.667 33.606 146.543 1.00 63.87  ? 50   ARG A CZ    1 
ATOM   111  N NH1   . ARG A 1 16  ? -33.580 34.744 145.866 1.00 63.79  ? 50   ARG A NH1   1 
ATOM   112  N NH2   . ARG A 1 16  ? -34.554 32.691 146.179 1.00 64.59  ? 50   ARG A NH2   1 
ATOM   113  N N     . PRO A 1 17  ? -28.748 38.661 147.041 1.00 49.61  ? 51   PRO A N     1 
ATOM   114  C CA    . PRO A 1 17  ? -27.904 39.783 147.452 1.00 47.86  ? 51   PRO A CA    1 
ATOM   115  C C     . PRO A 1 17  ? -27.492 39.747 148.907 1.00 46.30  ? 51   PRO A C     1 
ATOM   116  O O     . PRO A 1 17  ? -28.221 39.260 149.757 1.00 48.13  ? 51   PRO A O     1 
ATOM   117  C CB    . PRO A 1 17  ? -28.770 40.993 147.120 1.00 47.56  ? 51   PRO A CB    1 
ATOM   118  C CG    . PRO A 1 17  ? -29.453 40.546 145.871 1.00 49.97  ? 51   PRO A CG    1 
ATOM   119  C CD    . PRO A 1 17  ? -29.892 39.143 146.245 1.00 49.92  ? 51   PRO A CD    1 
ATOM   120  N N     . GLN A 1 18  ? -26.306 40.255 149.196 1.00 45.96  ? 52   GLN A N     1 
ATOM   121  C CA    . GLN A 1 18  ? -25.842 40.289 150.563 1.00 47.05  ? 52   GLN A CA    1 
ATOM   122  C C     . GLN A 1 18  ? -24.896 41.451 150.734 1.00 48.46  ? 52   GLN A C     1 
ATOM   123  O O     . GLN A 1 18  ? -24.456 42.061 149.753 1.00 49.05  ? 52   GLN A O     1 
ATOM   124  C CB    . GLN A 1 18  ? -25.160 38.971 150.940 1.00 47.85  ? 52   GLN A CB    1 
ATOM   125  C CG    . GLN A 1 18  ? -23.995 38.579 150.056 1.00 51.56  ? 52   GLN A CG    1 
ATOM   126  C CD    . GLN A 1 18  ? -23.396 37.227 150.436 1.00 54.20  ? 52   GLN A CD    1 
ATOM   127  O OE1   . GLN A 1 18  ? -24.016 36.176 150.236 1.00 56.38  ? 52   GLN A OE1   1 
ATOM   128  N NE2   . GLN A 1 18  ? -22.187 37.251 150.991 1.00 52.69  ? 52   GLN A NE2   1 
ATOM   129  N N     . GLU A 1 19  ? -24.607 41.775 151.985 1.00 48.37  ? 53   GLU A N     1 
ATOM   130  C CA    . GLU A 1 19  ? -23.708 42.864 152.301 1.00 50.70  ? 53   GLU A CA    1 
ATOM   131  C C     . GLU A 1 19  ? -22.269 42.443 152.074 1.00 49.98  ? 53   GLU A C     1 
ATOM   132  O O     . GLU A 1 19  ? -21.863 41.349 152.467 1.00 49.17  ? 53   GLU A O     1 
ATOM   133  C CB    . GLU A 1 19  ? -23.884 43.285 153.755 1.00 53.73  ? 53   GLU A CB    1 
ATOM   134  C CG    . GLU A 1 19  ? -25.094 44.158 154.008 1.00 60.95  ? 53   GLU A CG    1 
ATOM   135  C CD    . GLU A 1 19  ? -25.256 44.499 155.482 1.00 65.91  ? 53   GLU A CD    1 
ATOM   136  O OE1   . GLU A 1 19  ? -25.651 43.599 156.264 1.00 65.38  ? 53   GLU A OE1   1 
ATOM   137  O OE2   . GLU A 1 19  ? -24.971 45.663 155.859 1.00 68.19  ? 53   GLU A OE2   1 
ATOM   138  N N     . VAL A 1 20  ? -21.504 43.320 151.429 1.00 50.69  ? 54   VAL A N     1 
ATOM   139  C CA    . VAL A 1 20  ? -20.086 43.075 151.151 1.00 50.06  ? 54   VAL A CA    1 
ATOM   140  C C     . VAL A 1 20  ? -19.292 44.345 151.436 1.00 50.64  ? 54   VAL A C     1 
ATOM   141  O O     . VAL A 1 20  ? -19.643 45.435 150.971 1.00 51.61  ? 54   VAL A O     1 
ATOM   142  C CB    . VAL A 1 20  ? -19.858 42.648 149.677 1.00 50.07  ? 54   VAL A CB    1 
ATOM   143  C CG1   . VAL A 1 20  ? -18.374 42.396 149.429 1.00 48.84  ? 54   VAL A CG1   1 
ATOM   144  C CG2   . VAL A 1 20  ? -20.658 41.385 149.369 1.00 49.61  ? 54   VAL A CG2   1 
ATOM   145  N N     . SER A 1 21  ? -18.229 44.205 152.217 1.00 51.64  ? 55   SER A N     1 
ATOM   146  C CA    . SER A 1 21  ? -17.385 45.343 152.563 1.00 52.73  ? 55   SER A CA    1 
ATOM   147  C C     . SER A 1 21  ? -15.986 45.176 151.990 1.00 51.88  ? 55   SER A C     1 
ATOM   148  O O     . SER A 1 21  ? -15.489 44.057 151.880 1.00 49.21  ? 55   SER A O     1 
ATOM   149  C CB    . SER A 1 21  ? -17.303 45.494 154.086 1.00 53.11  ? 55   SER A CB    1 
ATOM   150  O OG    . SER A 1 21  ? -18.558 45.876 154.618 1.00 57.61  ? 55   SER A OG    1 
ATOM   151  N N     . TYR A 1 22  ? -15.354 46.292 151.634 1.00 53.21  ? 56   TYR A N     1 
ATOM   152  C CA    . TYR A 1 22  ? -14.001 46.253 151.083 1.00 55.30  ? 56   TYR A CA    1 
ATOM   153  C C     . TYR A 1 22  ? -13.263 47.582 151.235 1.00 57.09  ? 56   TYR A C     1 
ATOM   154  O O     . TYR A 1 22  ? -13.886 48.643 151.340 1.00 55.61  ? 56   TYR A O     1 
ATOM   155  C CB    . TYR A 1 22  ? -14.048 45.843 149.608 1.00 52.05  ? 56   TYR A CB    1 
ATOM   156  C CG    . TYR A 1 22  ? -14.814 46.789 148.723 1.00 49.15  ? 56   TYR A CG    1 
ATOM   157  C CD1   . TYR A 1 22  ? -14.236 47.971 148.273 1.00 49.62  ? 56   TYR A CD1   1 
ATOM   158  C CD2   . TYR A 1 22  ? -16.112 46.494 148.321 1.00 50.17  ? 56   TYR A CD2   1 
ATOM   159  C CE1   . TYR A 1 22  ? -14.928 48.835 147.438 1.00 48.49  ? 56   TYR A CE1   1 
ATOM   160  C CE2   . TYR A 1 22  ? -16.818 47.352 147.484 1.00 50.06  ? 56   TYR A CE2   1 
ATOM   161  C CZ    . TYR A 1 22  ? -16.216 48.521 147.044 1.00 51.09  ? 56   TYR A CZ    1 
ATOM   162  O OH    . TYR A 1 22  ? -16.897 49.366 146.195 1.00 51.88  ? 56   TYR A OH    1 
ATOM   163  N N     . THR A 1 23  ? -11.934 47.505 151.243 1.00 58.90  ? 57   THR A N     1 
ATOM   164  C CA    . THR A 1 23  ? -11.074 48.679 151.387 1.00 61.97  ? 57   THR A CA    1 
ATOM   165  C C     . THR A 1 23  ? -9.873  48.613 150.451 1.00 62.14  ? 57   THR A C     1 
ATOM   166  O O     . THR A 1 23  ? -9.879  47.864 149.475 1.00 61.98  ? 57   THR A O     1 
ATOM   167  C CB    . THR A 1 23  ? -10.530 48.796 152.825 1.00 63.04  ? 57   THR A CB    1 
ATOM   168  O OG1   . THR A 1 23  ? -10.164 47.492 153.301 1.00 62.52  ? 57   THR A OG1   1 
ATOM   169  C CG2   . THR A 1 23  ? -11.567 49.414 153.748 1.00 64.77  ? 57   THR A CG2   1 
ATOM   170  N N     . ASP A 1 24  ? -8.838  49.388 150.780 1.00 63.48  ? 58   ASP A N     1 
ATOM   171  C CA    . ASP A 1 24  ? -7.608  49.446 149.992 1.00 64.01  ? 58   ASP A CA    1 
ATOM   172  C C     . ASP A 1 24  ? -7.931  49.679 148.530 1.00 62.87  ? 58   ASP A C     1 
ATOM   173  O O     . ASP A 1 24  ? -7.340  49.058 147.650 1.00 62.95  ? 58   ASP A O     1 
ATOM   174  C CB    . ASP A 1 24  ? -6.813  48.142 150.126 1.00 66.91  ? 58   ASP A CB    1 
ATOM   175  C CG    . ASP A 1 24  ? -6.108  48.014 151.467 1.00 70.51  ? 58   ASP A CG    1 
ATOM   176  O OD1   . ASP A 1 24  ? -6.794  48.031 152.512 1.00 71.91  ? 58   ASP A OD1   1 
ATOM   177  O OD2   . ASP A 1 24  ? -4.858  47.893 151.473 1.00 72.27  ? 58   ASP A OD2   1 
ATOM   178  N N     . THR A 1 25  ? -8.874  50.575 148.278 1.00 62.14  ? 59   THR A N     1 
ATOM   179  C CA    . THR A 1 25  ? -9.287  50.879 146.919 1.00 64.31  ? 59   THR A CA    1 
ATOM   180  C C     . THR A 1 25  ? -8.223  51.686 146.174 1.00 64.82  ? 59   THR A C     1 
ATOM   181  O O     . THR A 1 25  ? -7.633  52.616 146.729 1.00 65.34  ? 59   THR A O     1 
ATOM   182  C CB    . THR A 1 25  ? -10.614 51.660 146.929 1.00 64.89  ? 59   THR A CB    1 
ATOM   183  O OG1   . THR A 1 25  ? -11.580 50.936 147.698 1.00 66.34  ? 59   THR A OG1   1 
ATOM   184  C CG2   . THR A 1 25  ? -11.148 51.841 145.517 1.00 66.29  ? 59   THR A CG2   1 
ATOM   185  N N     . LYS A 1 26  ? -7.974  51.315 144.920 1.00 65.01  ? 60   LYS A N     1 
ATOM   186  C CA    . LYS A 1 26  ? -6.990  52.006 144.080 1.00 64.26  ? 60   LYS A CA    1 
ATOM   187  C C     . LYS A 1 26  ? -7.189  51.634 142.617 1.00 63.15  ? 60   LYS A C     1 
ATOM   188  O O     . LYS A 1 26  ? -7.428  50.471 142.288 1.00 64.38  ? 60   LYS A O     1 
ATOM   189  C CB    . LYS A 1 26  ? -5.562  51.643 144.502 1.00 64.50  ? 60   LYS A CB    1 
ATOM   190  C CG    . LYS A 1 26  ? -5.182  50.192 144.254 1.00 66.03  ? 60   LYS A CG    1 
ATOM   191  C CD    . LYS A 1 26  ? -3.746  49.897 144.685 1.00 65.94  ? 60   LYS A CD    1 
ATOM   192  C CE    . LYS A 1 26  ? -3.570  50.044 146.191 1.00 68.14  ? 60   LYS A CE    1 
ATOM   193  N NZ    . LYS A 1 26  ? -2.176  49.741 146.633 1.00 67.93  ? 60   LYS A NZ    1 
ATOM   194  N N     . VAL A 1 27  ? -7.092  52.621 141.736 1.00 61.30  ? 61   VAL A N     1 
ATOM   195  C CA    . VAL A 1 27  ? -7.259  52.366 140.311 1.00 59.27  ? 61   VAL A CA    1 
ATOM   196  C C     . VAL A 1 27  ? -6.093  51.553 139.762 1.00 58.54  ? 61   VAL A C     1 
ATOM   197  O O     . VAL A 1 27  ? -4.932  51.860 140.032 1.00 58.30  ? 61   VAL A O     1 
ATOM   198  C CB    . VAL A 1 27  ? -7.359  53.680 139.530 1.00 57.95  ? 61   VAL A CB    1 
ATOM   199  C CG1   . VAL A 1 27  ? -7.547  53.396 138.048 1.00 56.16  ? 61   VAL A CG1   1 
ATOM   200  C CG2   . VAL A 1 27  ? -8.510  54.501 140.076 1.00 58.38  ? 61   VAL A CG2   1 
ATOM   201  N N     . ILE A 1 28  ? -6.403  50.505 139.005 1.00 56.25  ? 62   ILE A N     1 
ATOM   202  C CA    . ILE A 1 28  ? -5.367  49.668 138.419 1.00 54.92  ? 62   ILE A CA    1 
ATOM   203  C C     . ILE A 1 28  ? -5.611  49.461 136.935 1.00 55.52  ? 62   ILE A C     1 
ATOM   204  O O     . ILE A 1 28  ? -5.001  48.596 136.313 1.00 54.11  ? 62   ILE A O     1 
ATOM   205  C CB    . ILE A 1 28  ? -5.288  48.283 139.093 1.00 54.16  ? 62   ILE A CB    1 
ATOM   206  C CG1   . ILE A 1 28  ? -6.618  47.538 138.931 1.00 53.50  ? 62   ILE A CG1   1 
ATOM   207  C CG2   . ILE A 1 28  ? -4.922  48.448 140.560 1.00 53.84  ? 62   ILE A CG2   1 
ATOM   208  C CD1   . ILE A 1 28  ? -6.527  46.051 139.241 1.00 51.96  ? 62   ILE A CD1   1 
ATOM   209  N N     . GLY A 1 29  ? -6.511  50.259 136.375 1.00 57.60  ? 63   GLY A N     1 
ATOM   210  C CA    . GLY A 1 29  ? -6.827  50.144 134.966 1.00 61.13  ? 63   GLY A CA    1 
ATOM   211  C C     . GLY A 1 29  ? -7.914  51.125 134.587 1.00 64.69  ? 63   GLY A C     1 
ATOM   212  O O     . GLY A 1 29  ? -8.803  51.406 135.390 1.00 64.40  ? 63   GLY A O     1 
ATOM   213  N N     . ASN A 1 30  ? -7.842  51.656 133.369 1.00 69.05  ? 64   ASN A N     1 
ATOM   214  C CA    . ASN A 1 30  ? -8.834  52.616 132.894 1.00 74.09  ? 64   ASN A CA    1 
ATOM   215  C C     . ASN A 1 30  ? -8.950  52.540 131.376 1.00 75.39  ? 64   ASN A C     1 
ATOM   216  O O     . ASN A 1 30  ? -7.945  52.588 130.671 1.00 76.17  ? 64   ASN A O     1 
ATOM   217  C CB    . ASN A 1 30  ? -8.434  54.035 133.310 1.00 76.07  ? 64   ASN A CB    1 
ATOM   218  C CG    . ASN A 1 30  ? -9.634  54.912 133.625 1.00 79.21  ? 64   ASN A CG    1 
ATOM   219  O OD1   . ASN A 1 30  ? -10.536 55.078 132.799 1.00 80.35  ? 64   ASN A OD1   1 
ATOM   220  N ND2   . ASN A 1 30  ? -9.648  55.482 134.832 1.00 80.83  ? 64   ASN A ND2   1 
ATOM   221  N N     . GLY A 1 31  ? -10.178 52.419 130.879 1.00 78.29  ? 65   GLY A N     1 
ATOM   222  C CA    . GLY A 1 31  ? -10.393 52.334 129.443 1.00 80.66  ? 65   GLY A CA    1 
ATOM   223  C C     . GLY A 1 31  ? -11.703 52.944 128.975 1.00 82.65  ? 65   GLY A C     1 
ATOM   224  O O     . GLY A 1 31  ? -12.511 53.416 129.781 1.00 82.96  ? 65   GLY A O     1 
ATOM   225  N N     . SER A 1 32  ? -11.915 52.932 127.662 1.00 84.20  ? 66   SER A N     1 
ATOM   226  C CA    . SER A 1 32  ? -13.130 53.487 127.072 1.00 85.56  ? 66   SER A CA    1 
ATOM   227  C C     . SER A 1 32  ? -14.362 52.732 127.570 1.00 85.76  ? 66   SER A C     1 
ATOM   228  O O     . SER A 1 32  ? -15.482 53.248 127.534 1.00 86.04  ? 66   SER A O     1 
ATOM   229  C CB    . SER A 1 32  ? -13.049 53.413 125.541 1.00 86.20  ? 66   SER A CB    1 
ATOM   230  O OG    . SER A 1 32  ? -11.931 54.141 125.054 1.00 87.32  ? 66   SER A OG    1 
ATOM   231  N N     . PHE A 1 33  ? -14.143 51.509 128.040 1.00 85.85  ? 67   PHE A N     1 
ATOM   232  C CA    . PHE A 1 33  ? -15.224 50.678 128.554 1.00 85.99  ? 67   PHE A CA    1 
ATOM   233  C C     . PHE A 1 33  ? -15.581 51.081 129.986 1.00 83.96  ? 67   PHE A C     1 
ATOM   234  O O     . PHE A 1 33  ? -16.745 51.024 130.387 1.00 85.00  ? 67   PHE A O     1 
ATOM   235  C CB    . PHE A 1 33  ? -14.804 49.203 128.509 1.00 88.21  ? 67   PHE A CB    1 
ATOM   236  C CG    . PHE A 1 33  ? -13.594 48.893 129.344 1.00 90.26  ? 67   PHE A CG    1 
ATOM   237  C CD1   . PHE A 1 33  ? -13.722 48.606 130.700 1.00 90.78  ? 67   PHE A CD1   1 
ATOM   238  C CD2   . PHE A 1 33  ? -12.321 48.918 128.781 1.00 91.40  ? 67   PHE A CD2   1 
ATOM   239  C CE1   . PHE A 1 33  ? -12.600 48.350 131.487 1.00 91.60  ? 67   PHE A CE1   1 
ATOM   240  C CE2   . PHE A 1 33  ? -11.191 48.664 129.560 1.00 91.87  ? 67   PHE A CE2   1 
ATOM   241  C CZ    . PHE A 1 33  ? -11.332 48.379 130.915 1.00 91.65  ? 67   PHE A CZ    1 
ATOM   242  N N     . GLY A 1 34  ? -14.571 51.499 130.745 1.00 81.29  ? 68   GLY A N     1 
ATOM   243  C CA    . GLY A 1 34  ? -14.783 51.902 132.124 1.00 77.02  ? 68   GLY A CA    1 
ATOM   244  C C     . GLY A 1 34  ? -13.502 51.823 132.937 1.00 74.04  ? 68   GLY A C     1 
ATOM   245  O O     . GLY A 1 34  ? -12.430 51.573 132.387 1.00 75.05  ? 68   GLY A O     1 
ATOM   246  N N     . VAL A 1 35  ? -13.613 52.027 134.247 1.00 70.21  ? 69   VAL A N     1 
ATOM   247  C CA    . VAL A 1 35  ? -12.462 51.995 135.145 1.00 66.39  ? 69   VAL A CA    1 
ATOM   248  C C     . VAL A 1 35  ? -12.398 50.677 135.914 1.00 64.31  ? 69   VAL A C     1 
ATOM   249  O O     . VAL A 1 35  ? -13.426 50.054 136.174 1.00 64.85  ? 69   VAL A O     1 
ATOM   250  C CB    . VAL A 1 35  ? -12.530 53.150 136.164 1.00 65.91  ? 69   VAL A CB    1 
ATOM   251  C CG1   . VAL A 1 35  ? -11.254 53.211 136.988 1.00 64.79  ? 69   VAL A CG1   1 
ATOM   252  C CG2   . VAL A 1 35  ? -12.772 54.460 135.438 1.00 68.35  ? 69   VAL A CG2   1 
ATOM   253  N N     . VAL A 1 36  ? -11.191 50.253 136.276 1.00 59.62  ? 70   VAL A N     1 
ATOM   254  C CA    . VAL A 1 36  ? -11.026 49.017 137.022 1.00 55.95  ? 70   VAL A CA    1 
ATOM   255  C C     . VAL A 1 36  ? -10.281 49.328 138.308 1.00 54.49  ? 70   VAL A C     1 
ATOM   256  O O     . VAL A 1 36  ? -9.208  49.919 138.269 1.00 54.56  ? 70   VAL A O     1 
ATOM   257  C CB    . VAL A 1 36  ? -10.226 47.969 136.224 1.00 55.04  ? 70   VAL A CB    1 
ATOM   258  C CG1   . VAL A 1 36  ? -10.178 46.662 136.997 1.00 53.49  ? 70   VAL A CG1   1 
ATOM   259  C CG2   . VAL A 1 36  ? -10.851 47.762 134.852 1.00 52.17  ? 70   VAL A CG2   1 
ATOM   260  N N     . TYR A 1 37  ? -10.857 48.943 139.447 1.00 52.89  ? 71   TYR A N     1 
ATOM   261  C CA    . TYR A 1 37  ? -10.229 49.193 140.741 1.00 51.93  ? 71   TYR A CA    1 
ATOM   262  C C     . TYR A 1 37  ? -9.786  47.890 141.381 1.00 51.20  ? 71   TYR A C     1 
ATOM   263  O O     . TYR A 1 37  ? -10.214 46.809 140.986 1.00 51.40  ? 71   TYR A O     1 
ATOM   264  C CB    . TYR A 1 37  ? -11.193 49.876 141.725 1.00 53.36  ? 71   TYR A CB    1 
ATOM   265  C CG    . TYR A 1 37  ? -11.808 51.182 141.271 1.00 56.00  ? 71   TYR A CG    1 
ATOM   266  C CD1   . TYR A 1 37  ? -12.777 51.212 140.270 1.00 57.36  ? 71   TYR A CD1   1 
ATOM   267  C CD2   . TYR A 1 37  ? -11.433 52.393 141.856 1.00 58.34  ? 71   TYR A CD2   1 
ATOM   268  C CE1   . TYR A 1 37  ? -13.357 52.415 139.862 1.00 58.91  ? 71   TYR A CE1   1 
ATOM   269  C CE2   . TYR A 1 37  ? -12.006 53.601 141.456 1.00 58.51  ? 71   TYR A CE2   1 
ATOM   270  C CZ    . TYR A 1 37  ? -12.965 53.603 140.457 1.00 59.56  ? 71   TYR A CZ    1 
ATOM   271  O OH    . TYR A 1 37  ? -13.516 54.792 140.030 1.00 63.21  ? 71   TYR A OH    1 
ATOM   272  N N     . GLN A 1 38  ? -8.917  48.004 142.375 1.00 50.00  ? 72   GLN A N     1 
ATOM   273  C CA    . GLN A 1 38  ? -8.464  46.848 143.115 1.00 48.92  ? 72   GLN A CA    1 
ATOM   274  C C     . GLN A 1 38  ? -8.979  47.105 144.521 1.00 48.48  ? 72   GLN A C     1 
ATOM   275  O O     . GLN A 1 38  ? -9.064  48.259 144.950 1.00 48.73  ? 72   GLN A O     1 
ATOM   276  C CB    . GLN A 1 38  ? -6.947  46.766 143.148 1.00 49.87  ? 72   GLN A CB    1 
ATOM   277  C CG    . GLN A 1 38  ? -6.434  45.405 143.595 1.00 52.40  ? 72   GLN A CG    1 
ATOM   278  C CD    . GLN A 1 38  ? -5.167  45.483 144.436 1.00 55.53  ? 72   GLN A CD    1 
ATOM   279  O OE1   . GLN A 1 38  ? -4.358  44.553 144.446 1.00 56.17  ? 72   GLN A OE1   1 
ATOM   280  N NE2   . GLN A 1 38  ? -5.001  46.583 145.159 1.00 57.26  ? 72   GLN A NE2   1 
ATOM   281  N N     . ALA A 1 39  ? -9.349  46.047 145.232 1.00 47.03  ? 73   ALA A N     1 
ATOM   282  C CA    . ALA A 1 39  ? -9.833  46.206 146.596 1.00 46.82  ? 73   ALA A CA    1 
ATOM   283  C C     . ALA A 1 39  ? -9.574  44.946 147.391 1.00 45.74  ? 73   ALA A C     1 
ATOM   284  O O     . ALA A 1 39  ? -9.250  43.903 146.830 1.00 44.75  ? 73   ALA A O     1 
ATOM   285  C CB    . ALA A 1 39  ? -11.333 46.540 146.607 1.00 45.70  ? 73   ALA A CB    1 
ATOM   286  N N     . LYS A 1 40  ? -9.701  45.062 148.705 1.00 47.03  ? 74   LYS A N     1 
ATOM   287  C CA    . LYS A 1 40  ? -9.486  43.941 149.602 1.00 49.76  ? 74   LYS A CA    1 
ATOM   288  C C     . LYS A 1 40  ? -10.801 43.683 150.340 1.00 50.23  ? 74   LYS A C     1 
ATOM   289  O O     . LYS A 1 40  ? -11.349 44.588 150.966 1.00 49.99  ? 74   LYS A O     1 
ATOM   290  C CB    . LYS A 1 40  ? -8.372  44.289 150.594 1.00 50.69  ? 74   LYS A CB    1 
ATOM   291  C CG    . LYS A 1 40  ? -7.853  43.113 151.387 1.00 53.76  ? 74   LYS A CG    1 
ATOM   292  C CD    . LYS A 1 40  ? -6.730  43.535 152.315 1.00 58.60  ? 74   LYS A CD    1 
ATOM   293  C CE    . LYS A 1 40  ? -6.237  42.354 153.137 1.00 62.26  ? 74   LYS A CE    1 
ATOM   294  N NZ    . LYS A 1 40  ? -5.201  42.749 154.136 1.00 66.16  ? 74   LYS A NZ    1 
ATOM   295  N N     . LEU A 1 41  ? -11.317 42.460 150.243 1.00 51.72  ? 75   LEU A N     1 
ATOM   296  C CA    . LEU A 1 41  ? -12.570 42.110 150.914 1.00 53.16  ? 75   LEU A CA    1 
ATOM   297  C C     . LEU A 1 41  ? -12.350 42.123 152.419 1.00 55.72  ? 75   LEU A C     1 
ATOM   298  O O     . LEU A 1 41  ? -11.467 41.430 152.920 1.00 55.70  ? 75   LEU A O     1 
ATOM   299  C CB    . LEU A 1 41  ? -13.050 40.728 150.473 1.00 49.83  ? 75   LEU A CB    1 
ATOM   300  C CG    . LEU A 1 41  ? -13.430 40.595 148.993 1.00 50.27  ? 75   LEU A CG    1 
ATOM   301  C CD1   . LEU A 1 41  ? -13.872 39.169 148.698 1.00 47.60  ? 75   LEU A CD1   1 
ATOM   302  C CD2   . LEU A 1 41  ? -14.533 41.588 148.646 1.00 48.00  ? 75   LEU A CD2   1 
ATOM   303  N N     . CYS A 1 42  ? -13.147 42.915 153.135 1.00 58.86  ? 76   CYS A N     1 
ATOM   304  C CA    . CYS A 1 42  ? -13.021 43.019 154.587 1.00 62.89  ? 76   CYS A CA    1 
ATOM   305  C C     . CYS A 1 42  ? -13.147 41.665 155.266 1.00 64.64  ? 76   CYS A C     1 
ATOM   306  O O     . CYS A 1 42  ? -12.506 41.411 156.282 1.00 65.78  ? 76   CYS A O     1 
ATOM   307  C CB    . CYS A 1 42  ? -14.069 43.976 155.148 1.00 62.83  ? 76   CYS A CB    1 
ATOM   308  S SG    . CYS A 1 42  ? -13.828 45.707 154.671 1.00 70.81  ? 76   CYS A SG    1 
ATOM   309  N N     . ASP A 1 43  ? -13.964 40.791 154.695 1.00 68.28  ? 77   ASP A N     1 
ATOM   310  C CA    . ASP A 1 43  ? -14.165 39.462 155.258 1.00 71.13  ? 77   ASP A CA    1 
ATOM   311  C C     . ASP A 1 43  ? -12.953 38.550 155.104 1.00 71.50  ? 77   ASP A C     1 
ATOM   312  O O     . ASP A 1 43  ? -12.185 38.371 156.051 1.00 72.71  ? 77   ASP A O     1 
ATOM   313  C CB    . ASP A 1 43  ? -15.391 38.806 154.622 1.00 74.42  ? 77   ASP A CB    1 
ATOM   314  C CG    . ASP A 1 43  ? -16.687 39.466 155.053 1.00 78.07  ? 77   ASP A CG    1 
ATOM   315  O OD1   . ASP A 1 43  ? -17.037 39.362 156.251 1.00 79.92  ? 77   ASP A OD1   1 
ATOM   316  O OD2   . ASP A 1 43  ? -17.352 40.098 154.202 1.00 80.86  ? 77   ASP A OD2   1 
ATOM   317  N N     . SER A 1 44  ? -12.781 37.981 153.914 1.00 70.33  ? 78   SER A N     1 
ATOM   318  C CA    . SER A 1 44  ? -11.670 37.068 153.647 1.00 69.68  ? 78   SER A CA    1 
ATOM   319  C C     . SER A 1 44  ? -10.310 37.747 153.515 1.00 68.42  ? 78   SER A C     1 
ATOM   320  O O     . SER A 1 44  ? -9.274  37.087 153.589 1.00 69.23  ? 78   SER A O     1 
ATOM   321  C CB    . SER A 1 44  ? -11.949 36.264 152.376 1.00 70.26  ? 78   SER A CB    1 
ATOM   322  O OG    . SER A 1 44  ? -12.122 37.126 151.264 1.00 71.51  ? 78   SER A OG    1 
ATOM   323  N N     . GLY A 1 45  ? -10.310 39.059 153.313 1.00 66.51  ? 79   GLY A N     1 
ATOM   324  C CA    . GLY A 1 45  ? -9.055  39.771 153.161 1.00 62.50  ? 79   GLY A CA    1 
ATOM   325  C C     . GLY A 1 45  ? -8.460  39.558 151.777 1.00 60.08  ? 79   GLY A C     1 
ATOM   326  O O     . GLY A 1 45  ? -7.379  40.056 151.474 1.00 59.66  ? 79   GLY A O     1 
ATOM   327  N N     . GLU A 1 46  ? -9.170  38.819 150.931 1.00 56.72  ? 80   GLU A N     1 
ATOM   328  C CA    . GLU A 1 46  ? -8.703  38.544 149.578 1.00 54.10  ? 80   GLU A CA    1 
ATOM   329  C C     . GLU A 1 46  ? -8.765  39.769 148.662 1.00 51.59  ? 80   GLU A C     1 
ATOM   330  O O     . GLU A 1 46  ? -9.620  40.648 148.827 1.00 50.89  ? 80   GLU A O     1 
ATOM   331  C CB    . GLU A 1 46  ? -9.526  37.412 148.969 1.00 56.07  ? 80   GLU A CB    1 
ATOM   332  C CG    . GLU A 1 46  ? -9.336  36.070 149.646 1.00 62.53  ? 80   GLU A CG    1 
ATOM   333  C CD    . GLU A 1 46  ? -10.328 35.029 149.154 1.00 66.23  ? 80   GLU A CD    1 
ATOM   334  O OE1   . GLU A 1 46  ? -11.541 35.198 149.414 1.00 68.17  ? 80   GLU A OE1   1 
ATOM   335  O OE2   . GLU A 1 46  ? -9.902  34.050 148.503 1.00 68.28  ? 80   GLU A OE2   1 
ATOM   336  N N     . LEU A 1 47  ? -7.853  39.827 147.697 1.00 47.01  ? 81   LEU A N     1 
ATOM   337  C CA    . LEU A 1 47  ? -7.821  40.939 146.749 1.00 44.74  ? 81   LEU A CA    1 
ATOM   338  C C     . LEU A 1 47  ? -8.799  40.679 145.605 1.00 41.52  ? 81   LEU A C     1 
ATOM   339  O O     . LEU A 1 47  ? -8.972  39.540 145.168 1.00 40.25  ? 81   LEU A O     1 
ATOM   340  C CB    . LEU A 1 47  ? -6.404  41.114 146.182 1.00 44.78  ? 81   LEU A CB    1 
ATOM   341  C CG    . LEU A 1 47  ? -5.336  41.514 147.202 1.00 47.79  ? 81   LEU A CG    1 
ATOM   342  C CD1   . LEU A 1 47  ? -3.945  41.316 146.627 1.00 46.19  ? 81   LEU A CD1   1 
ATOM   343  C CD2   . LEU A 1 47  ? -5.564  42.960 147.630 1.00 46.20  ? 81   LEU A CD2   1 
ATOM   344  N N     . VAL A 1 48  ? -9.449  41.733 145.132 1.00 39.26  ? 82   VAL A N     1 
ATOM   345  C CA    . VAL A 1 48  ? -10.388 41.603 144.026 1.00 37.80  ? 82   VAL A CA    1 
ATOM   346  C C     . VAL A 1 48  ? -10.234 42.784 143.075 1.00 38.16  ? 82   VAL A C     1 
ATOM   347  O O     . VAL A 1 48  ? -9.679  43.821 143.445 1.00 35.64  ? 82   VAL A O     1 
ATOM   348  C CB    . VAL A 1 48  ? -11.876 41.571 144.511 1.00 36.39  ? 82   VAL A CB    1 
ATOM   349  C CG1   . VAL A 1 48  ? -12.095 40.408 145.472 1.00 35.59  ? 82   VAL A CG1   1 
ATOM   350  C CG2   . VAL A 1 48  ? -12.242 42.892 145.166 1.00 32.20  ? 82   VAL A CG2   1 
ATOM   351  N N     . ALA A 1 49  ? -10.731 42.613 141.852 1.00 38.33  ? 83   ALA A N     1 
ATOM   352  C CA    . ALA A 1 49  ? -10.698 43.662 140.839 1.00 40.93  ? 83   ALA A CA    1 
ATOM   353  C C     . ALA A 1 49  ? -12.136 44.077 140.575 1.00 41.65  ? 83   ALA A C     1 
ATOM   354  O O     . ALA A 1 49  ? -12.991 43.232 140.290 1.00 42.86  ? 83   ALA A O     1 
ATOM   355  C CB    . ALA A 1 49  ? -10.058 43.144 139.543 1.00 37.78  ? 83   ALA A CB    1 
ATOM   356  N N     . ILE A 1 50  ? -12.412 45.370 140.678 1.00 42.19  ? 84   ILE A N     1 
ATOM   357  C CA    . ILE A 1 50  ? -13.761 45.848 140.439 1.00 43.68  ? 84   ILE A CA    1 
ATOM   358  C C     . ILE A 1 50  ? -13.824 46.565 139.106 1.00 43.82  ? 84   ILE A C     1 
ATOM   359  O O     . ILE A 1 50  ? -13.291 47.656 138.954 1.00 43.81  ? 84   ILE A O     1 
ATOM   360  C CB    . ILE A 1 50  ? -14.234 46.803 141.559 1.00 44.20  ? 84   ILE A CB    1 
ATOM   361  C CG1   . ILE A 1 50  ? -14.128 46.102 142.918 1.00 44.32  ? 84   ILE A CG1   1 
ATOM   362  C CG2   . ILE A 1 50  ? -15.673 47.225 141.296 1.00 42.86  ? 84   ILE A CG2   1 
ATOM   363  C CD1   . ILE A 1 50  ? -14.522 46.973 144.097 1.00 47.07  ? 84   ILE A CD1   1 
ATOM   364  N N     . LYS A 1 51  ? -14.473 45.938 138.138 1.00 46.21  ? 85   LYS A N     1 
ATOM   365  C CA    . LYS A 1 51  ? -14.616 46.520 136.817 1.00 49.61  ? 85   LYS A CA    1 
ATOM   366  C C     . LYS A 1 51  ? -15.942 47.280 136.745 1.00 52.77  ? 85   LYS A C     1 
ATOM   367  O O     . LYS A 1 51  ? -17.011 46.675 136.745 1.00 52.93  ? 85   LYS A O     1 
ATOM   368  C CB    . LYS A 1 51  ? -14.572 45.414 135.761 1.00 48.14  ? 85   LYS A CB    1 
ATOM   369  C CG    . LYS A 1 51  ? -14.800 45.887 134.339 1.00 50.01  ? 85   LYS A CG    1 
ATOM   370  C CD    . LYS A 1 51  ? -14.582 44.755 133.340 1.00 50.81  ? 85   LYS A CD    1 
ATOM   371  C CE    . LYS A 1 51  ? -14.752 45.241 131.908 1.00 53.16  ? 85   LYS A CE    1 
ATOM   372  N NZ    . LYS A 1 51  ? -14.462 44.165 130.910 1.00 55.15  ? 85   LYS A NZ    1 
ATOM   373  N N     . LYS A 1 52  ? -15.869 48.608 136.707 1.00 56.00  ? 86   LYS A N     1 
ATOM   374  C CA    . LYS A 1 52  ? -17.068 49.439 136.634 1.00 60.09  ? 86   LYS A CA    1 
ATOM   375  C C     . LYS A 1 52  ? -17.315 49.945 135.208 1.00 63.22  ? 86   LYS A C     1 
ATOM   376  O O     . LYS A 1 52  ? -16.493 50.664 134.647 1.00 64.95  ? 86   LYS A O     1 
ATOM   377  C CB    . LYS A 1 52  ? -16.951 50.639 137.591 1.00 59.94  ? 86   LYS A CB    1 
ATOM   378  C CG    . LYS A 1 52  ? -18.182 51.549 137.594 1.00 61.08  ? 86   LYS A CG    1 
ATOM   379  C CD    . LYS A 1 52  ? -18.012 52.812 138.440 1.00 60.77  ? 86   LYS A CD    1 
ATOM   380  C CE    . LYS A 1 52  ? -17.913 52.513 139.920 1.00 62.08  ? 86   LYS A CE    1 
ATOM   381  N NZ    . LYS A 1 52  ? -17.958 53.763 140.741 1.00 60.85  ? 86   LYS A NZ    1 
ATOM   382  N N     . VAL A 1 53  ? -18.443 49.560 134.622 1.00 66.32  ? 87   VAL A N     1 
ATOM   383  C CA    . VAL A 1 53  ? -18.791 49.992 133.273 1.00 69.54  ? 87   VAL A CA    1 
ATOM   384  C C     . VAL A 1 53  ? -20.147 50.691 133.299 1.00 73.20  ? 87   VAL A C     1 
ATOM   385  O O     . VAL A 1 53  ? -20.924 50.510 134.231 1.00 73.90  ? 87   VAL A O     1 
ATOM   386  C CB    . VAL A 1 53  ? -18.856 48.800 132.303 1.00 68.74  ? 87   VAL A CB    1 
ATOM   387  C CG1   . VAL A 1 53  ? -17.512 48.088 132.270 1.00 68.33  ? 87   VAL A CG1   1 
ATOM   388  C CG2   . VAL A 1 53  ? -19.962 47.851 132.720 1.00 67.09  ? 87   VAL A CG2   1 
ATOM   389  N N     . LEU A 1 54  ? -20.436 51.485 132.277 1.00 77.22  ? 88   LEU A N     1 
ATOM   390  C CA    . LEU A 1 54  ? -21.701 52.204 132.231 1.00 80.83  ? 88   LEU A CA    1 
ATOM   391  C C     . LEU A 1 54  ? -22.817 51.303 131.702 1.00 83.64  ? 88   LEU A C     1 
ATOM   392  O O     . LEU A 1 54  ? -22.677 50.678 130.653 1.00 84.20  ? 88   LEU A O     1 
ATOM   393  C CB    . LEU A 1 54  ? -21.545 53.444 131.355 1.00 80.53  ? 88   LEU A CB    1 
ATOM   394  C CG    . LEU A 1 54  ? -22.451 54.633 131.654 1.00 80.90  ? 88   LEU A CG    1 
ATOM   395  C CD1   . LEU A 1 54  ? -22.015 55.807 130.794 1.00 81.51  ? 88   LEU A CD1   1 
ATOM   396  C CD2   . LEU A 1 54  ? -23.900 54.272 131.385 1.00 81.94  ? 88   LEU A CD2   1 
ATOM   397  N N     . GLN A 1 55  ? -23.921 51.235 132.440 1.00 87.01  ? 89   GLN A N     1 
ATOM   398  C CA    . GLN A 1 55  ? -25.061 50.406 132.056 1.00 91.03  ? 89   GLN A CA    1 
ATOM   399  C C     . GLN A 1 55  ? -26.297 51.258 131.792 1.00 93.25  ? 89   GLN A C     1 
ATOM   400  O O     . GLN A 1 55  ? -26.586 52.194 132.541 1.00 93.14  ? 89   GLN A O     1 
ATOM   401  C CB    . GLN A 1 55  ? -25.370 49.393 133.163 1.00 91.95  ? 89   GLN A CB    1 
ATOM   402  C CG    . GLN A 1 55  ? -26.616 48.544 132.923 1.00 93.82  ? 89   GLN A CG    1 
ATOM   403  C CD    . GLN A 1 55  ? -26.441 47.533 131.803 1.00 95.00  ? 89   GLN A CD    1 
ATOM   404  O OE1   . GLN A 1 55  ? -26.150 47.892 130.661 1.00 95.47  ? 89   GLN A OE1   1 
ATOM   405  N NE2   . GLN A 1 55  ? -26.623 46.257 132.128 1.00 95.83  ? 89   GLN A NE2   1 
ATOM   406  N N     . GLY A 1 56  ? -27.025 50.920 130.731 1.00 95.83  ? 90   GLY A N     1 
ATOM   407  C CA    . GLY A 1 56  ? -28.226 51.659 130.381 1.00 99.18  ? 90   GLY A CA    1 
ATOM   408  C C     . GLY A 1 56  ? -29.436 51.246 131.202 1.00 101.37 ? 90   GLY A C     1 
ATOM   409  O O     . GLY A 1 56  ? -30.438 51.967 131.246 1.00 102.46 ? 90   GLY A O     1 
ATOM   410  N N     . LYS A 1 57  ? -29.340 50.085 131.850 1.00 102.29 ? 91   LYS A N     1 
ATOM   411  C CA    . LYS A 1 57  ? -30.419 49.549 132.682 1.00 102.94 ? 91   LYS A CA    1 
ATOM   412  C C     . LYS A 1 57  ? -31.620 49.099 131.859 1.00 102.93 ? 91   LYS A C     1 
ATOM   413  O O     . LYS A 1 57  ? -32.399 48.246 132.291 1.00 102.69 ? 91   LYS A O     1 
ATOM   414  C CB    . LYS A 1 57  ? -30.868 50.585 133.721 1.00 103.07 ? 91   LYS A CB    1 
ATOM   415  C CG    . LYS A 1 57  ? -29.986 50.676 134.965 1.00 104.06 ? 91   LYS A CG    1 
ATOM   416  C CD    . LYS A 1 57  ? -30.267 49.552 135.969 1.00 104.45 ? 91   LYS A CD    1 
ATOM   417  C CE    . LYS A 1 57  ? -29.758 48.198 135.490 1.00 104.89 ? 91   LYS A CE    1 
ATOM   418  N NZ    . LYS A 1 57  ? -30.098 47.112 136.452 1.00 105.25 ? 91   LYS A NZ    1 
ATOM   419  N N     . ALA A 1 58  ? -31.762 49.677 130.671 1.00 102.84 ? 92   ALA A N     1 
ATOM   420  C CA    . ALA A 1 58  ? -32.863 49.339 129.782 1.00 102.18 ? 92   ALA A CA    1 
ATOM   421  C C     . ALA A 1 58  ? -32.488 48.131 128.933 1.00 101.44 ? 92   ALA A C     1 
ATOM   422  O O     . ALA A 1 58  ? -33.334 47.548 128.256 1.00 101.77 ? 92   ALA A O     1 
ATOM   423  C CB    . ALA A 1 58  ? -33.192 50.528 128.890 1.00 102.60 ? 92   ALA A CB    1 
ATOM   424  N N     . PHE A 1 59  ? -31.212 47.758 128.976 1.00 100.49 ? 93   PHE A N     1 
ATOM   425  C CA    . PHE A 1 59  ? -30.720 46.617 128.208 1.00 98.66  ? 93   PHE A CA    1 
ATOM   426  C C     . PHE A 1 59  ? -29.869 45.726 129.116 1.00 96.37  ? 93   PHE A C     1 
ATOM   427  O O     . PHE A 1 59  ? -29.076 46.223 129.917 1.00 96.41  ? 93   PHE A O     1 
ATOM   428  C CB    . PHE A 1 59  ? -29.884 47.112 127.017 1.00 99.93  ? 93   PHE A CB    1 
ATOM   429  C CG    . PHE A 1 59  ? -29.698 46.083 125.928 1.00 101.60 ? 93   PHE A CG    1 
ATOM   430  C CD1   . PHE A 1 59  ? -28.458 45.919 125.315 1.00 101.92 ? 93   PHE A CD1   1 
ATOM   431  C CD2   . PHE A 1 59  ? -30.765 45.294 125.501 1.00 102.12 ? 93   PHE A CD2   1 
ATOM   432  C CE1   . PHE A 1 59  ? -28.279 44.980 124.296 1.00 102.40 ? 93   PHE A CE1   1 
ATOM   433  C CE2   . PHE A 1 59  ? -30.597 44.353 124.483 1.00 102.46 ? 93   PHE A CE2   1 
ATOM   434  C CZ    . PHE A 1 59  ? -29.350 44.198 123.878 1.00 102.60 ? 93   PHE A CZ    1 
ATOM   435  N N     . LYS A 1 60  ? -30.048 44.412 128.993 1.00 93.35  ? 94   LYS A N     1 
ATOM   436  C CA    . LYS A 1 60  ? -29.293 43.444 129.791 1.00 89.92  ? 94   LYS A CA    1 
ATOM   437  C C     . LYS A 1 60  ? -27.826 43.454 129.364 1.00 85.92  ? 94   LYS A C     1 
ATOM   438  O O     . LYS A 1 60  ? -27.521 43.637 128.186 1.00 86.08  ? 94   LYS A O     1 
ATOM   439  C CB    . LYS A 1 60  ? -29.861 42.029 129.595 1.00 91.81  ? 94   LYS A CB    1 
ATOM   440  C CG    . LYS A 1 60  ? -31.334 41.867 129.959 1.00 94.08  ? 94   LYS A CG    1 
ATOM   441  C CD    . LYS A 1 60  ? -31.578 42.111 131.445 1.00 95.97  ? 94   LYS A CD    1 
ATOM   442  C CE    . LYS A 1 60  ? -33.060 41.991 131.792 1.00 97.14  ? 94   LYS A CE    1 
ATOM   443  N NZ    . LYS A 1 60  ? -33.345 42.290 133.228 1.00 97.13  ? 94   LYS A NZ    1 
ATOM   444  N N     . ASN A 1 61  ? -26.922 43.257 130.321 1.00 80.76  ? 95   ASN A N     1 
ATOM   445  C CA    . ASN A 1 61  ? -25.491 43.233 130.025 1.00 75.21  ? 95   ASN A CA    1 
ATOM   446  C C     . ASN A 1 61  ? -25.066 41.821 129.635 1.00 72.27  ? 95   ASN A C     1 
ATOM   447  O O     . ASN A 1 61  ? -25.161 40.888 130.438 1.00 72.29  ? 95   ASN A O     1 
ATOM   448  C CB    . ASN A 1 61  ? -24.684 43.704 131.237 1.00 73.29  ? 95   ASN A CB    1 
ATOM   449  C CG    . ASN A 1 61  ? -23.193 43.757 130.960 1.00 71.04  ? 95   ASN A CG    1 
ATOM   450  O OD1   . ASN A 1 61  ? -22.542 42.726 130.798 1.00 69.59  ? 95   ASN A OD1   1 
ATOM   451  N ND2   . ASN A 1 61  ? -22.647 44.965 130.898 1.00 68.68  ? 95   ASN A ND2   1 
ATOM   452  N N     . ARG A 1 62  ? -24.594 41.676 128.399 1.00 68.74  ? 96   ARG A N     1 
ATOM   453  C CA    . ARG A 1 62  ? -24.169 40.383 127.871 1.00 65.62  ? 96   ARG A CA    1 
ATOM   454  C C     . ARG A 1 62  ? -23.022 39.767 128.669 1.00 62.68  ? 96   ARG A C     1 
ATOM   455  O O     . ARG A 1 62  ? -23.050 38.578 129.000 1.00 62.11  ? 96   ARG A O     1 
ATOM   456  C CB    . ARG A 1 62  ? -23.763 40.532 126.400 1.00 67.17  ? 96   ARG A CB    1 
ATOM   457  C CG    . ARG A 1 62  ? -23.451 39.215 125.694 1.00 69.76  ? 96   ARG A CG    1 
ATOM   458  C CD    . ARG A 1 62  ? -23.111 39.449 124.232 1.00 70.94  ? 96   ARG A CD    1 
ATOM   459  N NE    . ARG A 1 62  ? -24.203 40.118 123.533 1.00 73.65  ? 96   ARG A NE    1 
ATOM   460  C CZ    . ARG A 1 62  ? -24.119 40.602 122.298 1.00 75.25  ? 96   ARG A CZ    1 
ATOM   461  N NH1   . ARG A 1 62  ? -22.988 40.493 121.612 1.00 74.71  ? 96   ARG A NH1   1 
ATOM   462  N NH2   . ARG A 1 62  ? -25.167 41.205 121.751 1.00 76.38  ? 96   ARG A NH2   1 
ATOM   463  N N     . GLU A 1 63  ? -22.015 40.575 128.976 1.00 58.52  ? 97   GLU A N     1 
ATOM   464  C CA    . GLU A 1 63  ? -20.873 40.088 129.733 1.00 55.89  ? 97   GLU A CA    1 
ATOM   465  C C     . GLU A 1 63  ? -21.303 39.475 131.075 1.00 53.44  ? 97   GLU A C     1 
ATOM   466  O O     . GLU A 1 63  ? -20.929 38.344 131.392 1.00 49.57  ? 97   GLU A O     1 
ATOM   467  C CB    . GLU A 1 63  ? -19.876 41.224 129.943 1.00 55.26  ? 97   GLU A CB    1 
ATOM   468  C CG    . GLU A 1 63  ? -18.711 40.871 130.840 1.00 56.24  ? 97   GLU A CG    1 
ATOM   469  C CD    . GLU A 1 63  ? -17.669 41.963 130.876 1.00 57.17  ? 97   GLU A CD    1 
ATOM   470  O OE1   . GLU A 1 63  ? -18.004 43.129 130.575 1.00 58.53  ? 97   GLU A OE1   1 
ATOM   471  O OE2   . GLU A 1 63  ? -16.508 41.655 131.213 1.00 59.45  ? 97   GLU A OE2   1 
ATOM   472  N N     . LEU A 1 64  ? -22.095 40.216 131.849 1.00 52.28  ? 98   LEU A N     1 
ATOM   473  C CA    . LEU A 1 64  ? -22.584 39.727 133.145 1.00 53.10  ? 98   LEU A CA    1 
ATOM   474  C C     . LEU A 1 64  ? -23.315 38.394 133.003 1.00 52.70  ? 98   LEU A C     1 
ATOM   475  O O     . LEU A 1 64  ? -23.060 37.453 133.759 1.00 52.09  ? 98   LEU A O     1 
ATOM   476  C CB    . LEU A 1 64  ? -23.529 40.746 133.797 1.00 51.96  ? 98   LEU A CB    1 
ATOM   477  C CG    . LEU A 1 64  ? -24.178 40.318 135.123 1.00 52.31  ? 98   LEU A CG    1 
ATOM   478  C CD1   . LEU A 1 64  ? -23.091 39.996 136.138 1.00 51.84  ? 98   LEU A CD1   1 
ATOM   479  C CD2   . LEU A 1 64  ? -25.085 41.428 135.658 1.00 49.03  ? 98   LEU A CD2   1 
ATOM   480  N N     . GLN A 1 65  ? -24.218 38.315 132.030 1.00 53.32  ? 99   GLN A N     1 
ATOM   481  C CA    . GLN A 1 65  ? -24.981 37.090 131.807 1.00 54.23  ? 99   GLN A CA    1 
ATOM   482  C C     . GLN A 1 65  ? -24.075 35.920 131.472 1.00 53.06  ? 99   GLN A C     1 
ATOM   483  O O     . GLN A 1 65  ? -24.268 34.819 131.988 1.00 53.48  ? 99   GLN A O     1 
ATOM   484  C CB    . GLN A 1 65  ? -26.008 37.283 130.683 1.00 56.95  ? 99   GLN A CB    1 
ATOM   485  C CG    . GLN A 1 65  ? -26.994 38.425 130.923 1.00 62.57  ? 99   GLN A CG    1 
ATOM   486  C CD    . GLN A 1 65  ? -27.499 38.478 132.363 1.00 66.32  ? 99   GLN A CD    1 
ATOM   487  O OE1   . GLN A 1 65  ? -27.981 37.476 132.912 1.00 67.37  ? 99   GLN A OE1   1 
ATOM   488  N NE2   . GLN A 1 65  ? -27.390 39.654 132.981 1.00 66.73  ? 99   GLN A NE2   1 
ATOM   489  N N     . ILE A 1 66  ? -23.090 36.152 130.608 1.00 50.66  ? 100  ILE A N     1 
ATOM   490  C CA    . ILE A 1 66  ? -22.163 35.094 130.239 1.00 51.02  ? 100  ILE A CA    1 
ATOM   491  C C     . ILE A 1 66  ? -21.342 34.643 131.440 1.00 50.69  ? 100  ILE A C     1 
ATOM   492  O O     . ILE A 1 66  ? -21.191 33.446 131.688 1.00 50.26  ? 100  ILE A O     1 
ATOM   493  C CB    . ILE A 1 66  ? -21.201 35.548 129.114 1.00 53.78  ? 100  ILE A CB    1 
ATOM   494  C CG1   . ILE A 1 66  ? -21.978 35.645 127.796 1.00 55.20  ? 100  ILE A CG1   1 
ATOM   495  C CG2   . ILE A 1 66  ? -20.023 34.572 128.992 1.00 50.84  ? 100  ILE A CG2   1 
ATOM   496  C CD1   . ILE A 1 66  ? -21.144 36.059 126.597 1.00 55.65  ? 100  ILE A CD1   1 
ATOM   497  N N     . MET A 1 67  ? -20.828 35.603 132.196 1.00 50.62  ? 101  MET A N     1 
ATOM   498  C CA    . MET A 1 67  ? -20.008 35.288 133.354 1.00 53.03  ? 101  MET A CA    1 
ATOM   499  C C     . MET A 1 67  ? -20.726 34.527 134.449 1.00 54.82  ? 101  MET A C     1 
ATOM   500  O O     . MET A 1 67  ? -20.185 33.566 135.000 1.00 53.80  ? 101  MET A O     1 
ATOM   501  C CB    . MET A 1 67  ? -19.414 36.565 133.918 1.00 53.18  ? 101  MET A CB    1 
ATOM   502  C CG    . MET A 1 67  ? -18.502 37.243 132.938 1.00 55.90  ? 101  MET A CG    1 
ATOM   503  S SD    . MET A 1 67  ? -17.074 37.851 133.777 1.00 62.53  ? 101  MET A SD    1 
ATOM   504  C CE    . MET A 1 67  ? -16.113 36.299 133.936 1.00 59.46  ? 101  MET A CE    1 
ATOM   505  N N     . ARG A 1 68  ? -21.942 34.964 134.765 1.00 57.01  ? 102  ARG A N     1 
ATOM   506  C CA    . ARG A 1 68  ? -22.748 34.321 135.795 1.00 58.83  ? 102  ARG A CA    1 
ATOM   507  C C     . ARG A 1 68  ? -23.020 32.863 135.452 1.00 58.84  ? 102  ARG A C     1 
ATOM   508  O O     . ARG A 1 68  ? -23.448 32.090 136.302 1.00 61.28  ? 102  ARG A O     1 
ATOM   509  C CB    . ARG A 1 68  ? -24.076 35.056 135.960 1.00 59.95  ? 102  ARG A CB    1 
ATOM   510  C CG    . ARG A 1 68  ? -23.935 36.478 136.457 1.00 62.90  ? 102  ARG A CG    1 
ATOM   511  C CD    . ARG A 1 68  ? -25.283 37.045 136.837 1.00 65.54  ? 102  ARG A CD    1 
ATOM   512  N NE    . ARG A 1 68  ? -25.900 36.286 137.924 1.00 68.88  ? 102  ARG A NE    1 
ATOM   513  C CZ    . ARG A 1 68  ? -27.116 36.526 138.404 1.00 69.25  ? 102  ARG A CZ    1 
ATOM   514  N NH1   . ARG A 1 68  ? -27.847 37.504 137.889 1.00 68.98  ? 102  ARG A NH1   1 
ATOM   515  N NH2   . ARG A 1 68  ? -27.601 35.793 139.400 1.00 70.32  ? 102  ARG A NH2   1 
ATOM   516  N N     . LYS A 1 69  ? -22.762 32.493 134.206 1.00 59.64  ? 103  LYS A N     1 
ATOM   517  C CA    . LYS A 1 69  ? -22.994 31.133 133.739 1.00 61.10  ? 103  LYS A CA    1 
ATOM   518  C C     . LYS A 1 69  ? -21.714 30.299 133.727 1.00 61.26  ? 103  LYS A C     1 
ATOM   519  O O     . LYS A 1 69  ? -21.764 29.075 133.612 1.00 61.86  ? 103  LYS A O     1 
ATOM   520  C CB    . LYS A 1 69  ? -23.590 31.177 132.325 1.00 64.00  ? 103  LYS A CB    1 
ATOM   521  C CG    . LYS A 1 69  ? -23.824 29.812 131.677 1.00 68.20  ? 103  LYS A CG    1 
ATOM   522  C CD    . LYS A 1 69  ? -24.121 29.935 130.173 1.00 71.19  ? 103  LYS A CD    1 
ATOM   523  C CE    . LYS A 1 69  ? -25.316 30.837 129.869 1.00 71.14  ? 103  LYS A CE    1 
ATOM   524  N NZ    . LYS A 1 69  ? -25.533 30.946 128.398 1.00 72.95  ? 103  LYS A NZ    1 
ATOM   525  N N     . LEU A 1 70  ? -20.568 30.962 133.855 1.00 60.04  ? 104  LEU A N     1 
ATOM   526  C CA    . LEU A 1 70  ? -19.280 30.274 133.821 1.00 57.24  ? 104  LEU A CA    1 
ATOM   527  C C     . LEU A 1 70  ? -18.741 29.891 135.199 1.00 56.11  ? 104  LEU A C     1 
ATOM   528  O O     . LEU A 1 70  ? -18.896 30.628 136.166 1.00 57.12  ? 104  LEU A O     1 
ATOM   529  C CB    . LEU A 1 70  ? -18.260 31.154 133.092 1.00 55.83  ? 104  LEU A CB    1 
ATOM   530  C CG    . LEU A 1 70  ? -18.684 31.629 131.700 1.00 54.26  ? 104  LEU A CG    1 
ATOM   531  C CD1   . LEU A 1 70  ? -17.658 32.607 131.147 1.00 54.07  ? 104  LEU A CD1   1 
ATOM   532  C CD2   . LEU A 1 70  ? -18.837 30.432 130.782 1.00 54.22  ? 104  LEU A CD2   1 
ATOM   533  N N     . ASP A 1 71  ? -18.104 28.729 135.276 1.00 55.06  ? 105  ASP A N     1 
ATOM   534  C CA    . ASP A 1 71  ? -17.522 28.241 136.524 1.00 54.10  ? 105  ASP A CA    1 
ATOM   535  C C     . ASP A 1 71  ? -16.439 27.219 136.171 1.00 52.10  ? 105  ASP A C     1 
ATOM   536  O O     . ASP A 1 71  ? -16.705 26.020 136.083 1.00 51.04  ? 105  ASP A O     1 
ATOM   537  C CB    . ASP A 1 71  ? -18.601 27.575 137.381 1.00 57.95  ? 105  ASP A CB    1 
ATOM   538  C CG    . ASP A 1 71  ? -18.064 27.078 138.713 1.00 60.85  ? 105  ASP A CG    1 
ATOM   539  O OD1   . ASP A 1 71  ? -18.745 26.253 139.360 1.00 62.55  ? 105  ASP A OD1   1 
ATOM   540  O OD2   . ASP A 1 71  ? -16.961 27.516 139.116 1.00 63.71  ? 105  ASP A OD2   1 
ATOM   541  N N     . HIS A 1 72  ? -15.220 27.701 135.961 1.00 50.80  ? 106  HIS A N     1 
ATOM   542  C CA    . HIS A 1 72  ? -14.106 26.839 135.578 1.00 48.29  ? 106  HIS A CA    1 
ATOM   543  C C     . HIS A 1 72  ? -12.799 27.312 136.242 1.00 47.81  ? 106  HIS A C     1 
ATOM   544  O O     . HIS A 1 72  ? -12.641 28.494 136.545 1.00 47.22  ? 106  HIS A O     1 
ATOM   545  C CB    . HIS A 1 72  ? -13.958 26.864 134.059 1.00 45.27  ? 106  HIS A CB    1 
ATOM   546  C CG    . HIS A 1 72  ? -13.055 25.802 133.523 1.00 44.41  ? 106  HIS A CG    1 
ATOM   547  N ND1   . HIS A 1 72  ? -13.489 24.519 133.278 1.00 43.72  ? 106  HIS A ND1   1 
ATOM   548  C CD2   . HIS A 1 72  ? -11.740 25.826 133.194 1.00 42.24  ? 106  HIS A CD2   1 
ATOM   549  C CE1   . HIS A 1 72  ? -12.480 23.798 132.820 1.00 43.77  ? 106  HIS A CE1   1 
ATOM   550  N NE2   . HIS A 1 72  ? -11.408 24.567 132.760 1.00 44.62  ? 106  HIS A NE2   1 
ATOM   551  N N     . CYS A 1 73  ? -11.868 26.386 136.449 1.00 47.02  ? 107  CYS A N     1 
ATOM   552  C CA    . CYS A 1 73  ? -10.595 26.699 137.092 1.00 47.97  ? 107  CYS A CA    1 
ATOM   553  C C     . CYS A 1 73  ? -9.656  27.547 136.230 1.00 45.28  ? 107  CYS A C     1 
ATOM   554  O O     . CYS A 1 73  ? -8.659  28.071 136.719 1.00 45.31  ? 107  CYS A O     1 
ATOM   555  C CB    . CYS A 1 73  ? -9.874  25.406 137.497 1.00 50.23  ? 107  CYS A CB    1 
ATOM   556  S SG    . CYS A 1 73  ? -9.421  24.315 136.098 1.00 60.70  ? 107  CYS A SG    1 
ATOM   557  N N     . ASN A 1 74  ? -9.981  27.678 134.952 1.00 41.72  ? 108  ASN A N     1 
ATOM   558  C CA    . ASN A 1 74  ? -9.163  28.452 134.044 1.00 38.58  ? 108  ASN A CA    1 
ATOM   559  C C     . ASN A 1 74  ? -9.924  29.667 133.492 1.00 37.78  ? 108  ASN A C     1 
ATOM   560  O O     . ASN A 1 74  ? -9.648  30.160 132.400 1.00 36.68  ? 108  ASN A O     1 
ATOM   561  C CB    . ASN A 1 74  ? -8.640  27.546 132.921 1.00 37.76  ? 108  ASN A CB    1 
ATOM   562  C CG    . ASN A 1 74  ? -7.640  26.490 133.433 1.00 39.93  ? 108  ASN A CG    1 
ATOM   563  O OD1   . ASN A 1 74  ? -6.684  26.814 134.146 1.00 39.89  ? 108  ASN A OD1   1 
ATOM   564  N ND2   . ASN A 1 74  ? -7.850  25.234 133.056 1.00 40.36  ? 108  ASN A ND2   1 
ATOM   565  N N     . ILE A 1 75  ? -10.875 30.163 134.273 1.00 37.42  ? 109  ILE A N     1 
ATOM   566  C CA    . ILE A 1 75  ? -11.656 31.321 133.882 1.00 36.93  ? 109  ILE A CA    1 
ATOM   567  C C     . ILE A 1 75  ? -11.743 32.229 135.087 1.00 37.30  ? 109  ILE A C     1 
ATOM   568  O O     . ILE A 1 75  ? -11.953 31.752 136.189 1.00 36.78  ? 109  ILE A O     1 
ATOM   569  C CB    . ILE A 1 75  ? -13.062 30.898 133.422 1.00 37.01  ? 109  ILE A CB    1 
ATOM   570  C CG1   . ILE A 1 75  ? -12.918 30.078 132.141 1.00 36.74  ? 109  ILE A CG1   1 
ATOM   571  C CG2   . ILE A 1 75  ? -13.955 32.118 133.226 1.00 33.55  ? 109  ILE A CG2   1 
ATOM   572  C CD1   . ILE A 1 75  ? -14.201 29.681 131.520 1.00 39.52  ? 109  ILE A CD1   1 
ATOM   573  N N     . VAL A 1 76  ? -11.553 33.530 134.890 1.00 37.80  ? 110  VAL A N     1 
ATOM   574  C CA    . VAL A 1 76  ? -11.617 34.460 136.007 1.00 40.95  ? 110  VAL A CA    1 
ATOM   575  C C     . VAL A 1 76  ? -12.998 34.336 136.661 1.00 42.41  ? 110  VAL A C     1 
ATOM   576  O O     . VAL A 1 76  ? -14.023 34.466 135.990 1.00 41.19  ? 110  VAL A O     1 
ATOM   577  C CB    . VAL A 1 76  ? -11.371 35.924 135.533 1.00 42.60  ? 110  VAL A CB    1 
ATOM   578  C CG1   . VAL A 1 76  ? -12.403 36.324 134.489 1.00 44.20  ? 110  VAL A CG1   1 
ATOM   579  C CG2   . VAL A 1 76  ? -11.430 36.877 136.721 1.00 45.56  ? 110  VAL A CG2   1 
ATOM   580  N N     . ARG A 1 77  ? -13.025 34.080 137.967 1.00 44.22  ? 111  ARG A N     1 
ATOM   581  C CA    . ARG A 1 77  ? -14.295 33.929 138.685 1.00 46.99  ? 111  ARG A CA    1 
ATOM   582  C C     . ARG A 1 77  ? -14.978 35.250 139.035 1.00 45.12  ? 111  ARG A C     1 
ATOM   583  O O     . ARG A 1 77  ? -14.335 36.199 139.485 1.00 44.63  ? 111  ARG A O     1 
ATOM   584  C CB    . ARG A 1 77  ? -14.089 33.136 139.986 1.00 50.21  ? 111  ARG A CB    1 
ATOM   585  C CG    . ARG A 1 77  ? -15.395 32.764 140.690 1.00 56.90  ? 111  ARG A CG    1 
ATOM   586  C CD    . ARG A 1 77  ? -15.142 32.084 142.025 1.00 63.30  ? 111  ARG A CD    1 
ATOM   587  N NE    . ARG A 1 77  ? -14.526 32.994 142.990 1.00 68.77  ? 111  ARG A NE    1 
ATOM   588  C CZ    . ARG A 1 77  ? -14.136 32.639 144.212 1.00 71.43  ? 111  ARG A CZ    1 
ATOM   589  N NH1   . ARG A 1 77  ? -14.297 31.387 144.624 1.00 72.61  ? 111  ARG A NH1   1 
ATOM   590  N NH2   . ARG A 1 77  ? -13.587 33.535 145.022 1.00 72.69  ? 111  ARG A NH2   1 
ATOM   591  N N     . LEU A 1 78  ? -16.288 35.304 138.841 1.00 45.42  ? 112  LEU A N     1 
ATOM   592  C CA    . LEU A 1 78  ? -17.047 36.500 139.183 1.00 46.51  ? 112  LEU A CA    1 
ATOM   593  C C     . LEU A 1 78  ? -17.574 36.345 140.625 1.00 46.95  ? 112  LEU A C     1 
ATOM   594  O O     . LEU A 1 78  ? -18.511 35.592 140.866 1.00 47.84  ? 112  LEU A O     1 
ATOM   595  C CB    . LEU A 1 78  ? -18.214 36.677 138.205 1.00 45.39  ? 112  LEU A CB    1 
ATOM   596  C CG    . LEU A 1 78  ? -19.186 37.818 138.519 1.00 46.33  ? 112  LEU A CG    1 
ATOM   597  C CD1   . LEU A 1 78  ? -18.510 39.154 138.303 1.00 46.53  ? 112  LEU A CD1   1 
ATOM   598  C CD2   . LEU A 1 78  ? -20.402 37.704 137.637 1.00 47.33  ? 112  LEU A CD2   1 
ATOM   599  N N     . ARG A 1 79  ? -16.950 37.042 141.572 1.00 48.46  ? 113  ARG A N     1 
ATOM   600  C CA    . ARG A 1 79  ? -17.337 36.997 142.988 1.00 48.14  ? 113  ARG A CA    1 
ATOM   601  C C     . ARG A 1 79  ? -18.752 37.528 143.203 1.00 47.36  ? 113  ARG A C     1 
ATOM   602  O O     . ARG A 1 79  ? -19.649 36.787 143.596 1.00 46.96  ? 113  ARG A O     1 
ATOM   603  C CB    . ARG A 1 79  ? -16.381 37.848 143.818 1.00 51.79  ? 113  ARG A CB    1 
ATOM   604  C CG    . ARG A 1 79  ? -14.944 37.393 143.818 1.00 54.86  ? 113  ARG A CG    1 
ATOM   605  C CD    . ARG A 1 79  ? -14.744 36.426 144.934 1.00 59.14  ? 113  ARG A CD    1 
ATOM   606  N NE    . ARG A 1 79  ? -13.364 36.423 145.388 1.00 63.12  ? 113  ARG A NE    1 
ATOM   607  C CZ    . ARG A 1 79  ? -12.991 36.011 146.592 1.00 63.33  ? 113  ARG A CZ    1 
ATOM   608  N NH1   . ARG A 1 79  ? -13.906 35.576 147.451 1.00 62.43  ? 113  ARG A NH1   1 
ATOM   609  N NH2   . ARG A 1 79  ? -11.711 36.031 146.930 1.00 64.59  ? 113  ARG A NH2   1 
ATOM   610  N N     . TYR A 1 80  ? -18.929 38.827 142.974 1.00 47.08  ? 114  TYR A N     1 
ATOM   611  C CA    . TYR A 1 80  ? -20.227 39.483 143.125 1.00 46.35  ? 114  TYR A CA    1 
ATOM   612  C C     . TYR A 1 80  ? -20.389 40.544 142.047 1.00 46.60  ? 114  TYR A C     1 
ATOM   613  O O     . TYR A 1 80  ? -19.484 40.776 141.244 1.00 46.13  ? 114  TYR A O     1 
ATOM   614  C CB    . TYR A 1 80  ? -20.354 40.199 144.475 1.00 48.06  ? 114  TYR A CB    1 
ATOM   615  C CG    . TYR A 1 80  ? -19.845 39.439 145.670 1.00 50.29  ? 114  TYR A CG    1 
ATOM   616  C CD1   . TYR A 1 80  ? -18.497 39.477 146.014 1.00 50.40  ? 114  TYR A CD1   1 
ATOM   617  C CD2   . TYR A 1 80  ? -20.707 38.664 146.446 1.00 51.57  ? 114  TYR A CD2   1 
ATOM   618  C CE1   . TYR A 1 80  ? -18.012 38.762 147.096 1.00 54.17  ? 114  TYR A CE1   1 
ATOM   619  C CE2   . TYR A 1 80  ? -20.234 37.941 147.536 1.00 54.16  ? 114  TYR A CE2   1 
ATOM   620  C CZ    . TYR A 1 80  ? -18.885 37.993 147.855 1.00 55.38  ? 114  TYR A CZ    1 
ATOM   621  O OH    . TYR A 1 80  ? -18.404 37.268 148.924 1.00 59.60  ? 114  TYR A OH    1 
ATOM   622  N N     . PHE A 1 81  ? -21.550 41.188 142.035 1.00 45.49  ? 115  PHE A N     1 
ATOM   623  C CA    . PHE A 1 81  ? -21.817 42.264 141.099 1.00 44.26  ? 115  PHE A CA    1 
ATOM   624  C C     . PHE A 1 81  ? -22.886 43.150 141.719 1.00 45.03  ? 115  PHE A C     1 
ATOM   625  O O     . PHE A 1 81  ? -23.739 42.665 142.453 1.00 45.54  ? 115  PHE A O     1 
ATOM   626  C CB    . PHE A 1 81  ? -22.239 41.708 139.723 1.00 44.59  ? 115  PHE A CB    1 
ATOM   627  C CG    . PHE A 1 81  ? -23.638 41.153 139.667 1.00 45.10  ? 115  PHE A CG    1 
ATOM   628  C CD1   . PHE A 1 81  ? -24.727 41.993 139.458 1.00 45.88  ? 115  PHE A CD1   1 
ATOM   629  C CD2   . PHE A 1 81  ? -23.864 39.787 139.805 1.00 44.75  ? 115  PHE A CD2   1 
ATOM   630  C CE1   . PHE A 1 81  ? -26.029 41.479 139.386 1.00 48.05  ? 115  PHE A CE1   1 
ATOM   631  C CE2   . PHE A 1 81  ? -25.154 39.262 139.737 1.00 46.17  ? 115  PHE A CE2   1 
ATOM   632  C CZ    . PHE A 1 81  ? -26.242 40.108 139.526 1.00 45.88  ? 115  PHE A CZ    1 
ATOM   633  N N     . PHE A 1 82  ? -22.820 44.451 141.457 1.00 46.05  ? 116  PHE A N     1 
ATOM   634  C CA    . PHE A 1 82  ? -23.799 45.377 142.008 1.00 48.29  ? 116  PHE A CA    1 
ATOM   635  C C     . PHE A 1 82  ? -23.883 46.655 141.186 1.00 51.21  ? 116  PHE A C     1 
ATOM   636  O O     . PHE A 1 82  ? -23.083 46.862 140.273 1.00 52.24  ? 116  PHE A O     1 
ATOM   637  C CB    . PHE A 1 82  ? -23.439 45.703 143.457 1.00 46.63  ? 116  PHE A CB    1 
ATOM   638  C CG    . PHE A 1 82  ? -22.107 46.389 143.618 1.00 47.50  ? 116  PHE A CG    1 
ATOM   639  C CD1   . PHE A 1 82  ? -22.014 47.780 143.594 1.00 47.15  ? 116  PHE A CD1   1 
ATOM   640  C CD2   . PHE A 1 82  ? -20.949 45.643 143.819 1.00 44.11  ? 116  PHE A CD2   1 
ATOM   641  C CE1   . PHE A 1 82  ? -20.784 48.420 143.775 1.00 46.22  ? 116  PHE A CE1   1 
ATOM   642  C CE2   . PHE A 1 82  ? -19.726 46.268 144.000 1.00 44.49  ? 116  PHE A CE2   1 
ATOM   643  C CZ    . PHE A 1 82  ? -19.641 47.662 143.980 1.00 45.79  ? 116  PHE A CZ    1 
ATOM   644  N N     . TYR A 1 83  ? -24.853 47.511 141.501 1.00 52.71  ? 117  TYR A N     1 
ATOM   645  C CA    . TYR A 1 83  ? -25.011 48.766 140.775 1.00 54.86  ? 117  TYR A CA    1 
ATOM   646  C C     . TYR A 1 83  ? -24.743 49.969 141.662 1.00 57.85  ? 117  TYR A C     1 
ATOM   647  O O     . TYR A 1 83  ? -24.897 49.900 142.878 1.00 58.44  ? 117  TYR A O     1 
ATOM   648  C CB    . TYR A 1 83  ? -26.405 48.857 140.161 1.00 51.26  ? 117  TYR A CB    1 
ATOM   649  C CG    . TYR A 1 83  ? -26.740 47.673 139.286 1.00 50.47  ? 117  TYR A CG    1 
ATOM   650  C CD1   . TYR A 1 83  ? -27.172 46.469 139.849 1.00 50.19  ? 117  TYR A CD1   1 
ATOM   651  C CD2   . TYR A 1 83  ? -26.609 47.742 137.900 1.00 49.04  ? 117  TYR A CD2   1 
ATOM   652  C CE1   . TYR A 1 83  ? -27.469 45.370 139.058 1.00 49.43  ? 117  TYR A CE1   1 
ATOM   653  C CE2   . TYR A 1 83  ? -26.901 46.643 137.095 1.00 49.77  ? 117  TYR A CE2   1 
ATOM   654  C CZ    . TYR A 1 83  ? -27.335 45.462 137.682 1.00 50.59  ? 117  TYR A CZ    1 
ATOM   655  O OH    . TYR A 1 83  ? -27.668 44.378 136.900 1.00 52.47  ? 117  TYR A OH    1 
ATOM   656  N N     . SER A 1 84  ? -24.324 51.069 141.047 1.00 62.87  ? 118  SER A N     1 
ATOM   657  C CA    . SER A 1 84  ? -24.013 52.285 141.788 1.00 68.71  ? 118  SER A CA    1 
ATOM   658  C C     . SER A 1 84  ? -23.902 53.484 140.853 1.00 72.76  ? 118  SER A C     1 
ATOM   659  O O     . SER A 1 84  ? -24.570 53.548 139.823 1.00 72.09  ? 118  SER A O     1 
ATOM   660  C CB    . SER A 1 84  ? -22.693 52.109 142.543 1.00 68.17  ? 118  SER A CB    1 
ATOM   661  O OG    . SER A 1 84  ? -21.622 51.879 141.641 1.00 68.52  ? 118  SER A OG    1 
ATOM   662  N N     . SER A 1 85  ? -23.044 54.427 141.227 1.00 79.34  ? 119  SER A N     1 
ATOM   663  C CA    . SER A 1 85  ? -22.816 55.633 140.443 1.00 85.93  ? 119  SER A CA    1 
ATOM   664  C C     . SER A 1 85  ? -21.347 56.037 140.529 1.00 89.67  ? 119  SER A C     1 
ATOM   665  O O     . SER A 1 85  ? -20.562 55.391 141.227 1.00 90.33  ? 119  SER A O     1 
ATOM   666  C CB    . SER A 1 85  ? -23.700 56.763 140.963 1.00 86.25  ? 119  SER A CB    1 
ATOM   667  O OG    . SER A 1 85  ? -25.063 56.382 140.912 1.00 88.34  ? 119  SER A OG    1 
ATOM   668  N N     . GLY A 1 86  ? -20.980 57.104 139.817 1.00 93.73  ? 120  GLY A N     1 
ATOM   669  C CA    . GLY A 1 86  ? -19.601 57.568 139.829 1.00 98.15  ? 120  GLY A CA    1 
ATOM   670  C C     . GLY A 1 86  ? -19.290 58.738 138.907 1.00 101.16 ? 120  GLY A C     1 
ATOM   671  O O     . GLY A 1 86  ? -19.074 59.860 139.373 1.00 101.39 ? 120  GLY A O     1 
ATOM   672  N N     . GLU A 1 87  ? -19.263 58.480 137.600 1.00 103.90 ? 121  GLU A N     1 
ATOM   673  C CA    . GLU A 1 87  ? -18.964 59.515 136.607 1.00 106.21 ? 121  GLU A CA    1 
ATOM   674  C C     . GLU A 1 87  ? -20.217 60.002 135.877 1.00 107.44 ? 121  GLU A C     1 
ATOM   675  O O     . GLU A 1 87  ? -20.970 59.209 135.307 1.00 107.77 ? 121  GLU A O     1 
ATOM   676  C CB    . GLU A 1 87  ? -17.954 58.980 135.587 1.00 106.91 ? 121  GLU A CB    1 
ATOM   677  C CG    . GLU A 1 87  ? -16.707 58.364 136.208 1.00 108.59 ? 121  GLU A CG    1 
ATOM   678  C CD    . GLU A 1 87  ? -15.906 59.356 137.031 1.00 108.94 ? 121  GLU A CD    1 
ATOM   679  O OE1   . GLU A 1 87  ? -15.409 60.344 136.451 1.00 109.61 ? 121  GLU A OE1   1 
ATOM   680  O OE2   . GLU A 1 87  ? -15.773 59.148 138.256 1.00 108.99 ? 121  GLU A OE2   1 
ATOM   681  N N     . LYS A 1 88  ? -20.429 61.315 135.900 1.00 108.21 ? 122  LYS A N     1 
ATOM   682  C CA    . LYS A 1 88  ? -21.579 61.938 135.250 1.00 108.82 ? 122  LYS A CA    1 
ATOM   683  C C     . LYS A 1 88  ? -22.903 61.485 135.877 1.00 108.43 ? 122  LYS A C     1 
ATOM   684  O O     . LYS A 1 88  ? -23.338 60.345 135.701 1.00 108.31 ? 122  LYS A O     1 
ATOM   685  C CB    . LYS A 1 88  ? -21.567 61.634 133.746 1.00 109.30 ? 122  LYS A CB    1 
ATOM   686  C CG    . LYS A 1 88  ? -21.847 62.851 132.865 1.00 109.85 ? 122  LYS A CG    1 
ATOM   687  C CD    . LYS A 1 88  ? -20.782 63.936 133.040 1.00 110.11 ? 122  LYS A CD    1 
ATOM   688  C CE    . LYS A 1 88  ? -21.047 65.132 132.129 1.00 110.39 ? 122  LYS A CE    1 
ATOM   689  N NZ    . LYS A 1 88  ? -19.981 66.171 132.221 1.00 110.04 ? 122  LYS A NZ    1 
ATOM   690  N N     . LYS A 1 89  ? -23.527 62.405 136.608 1.00 107.90 ? 123  LYS A N     1 
ATOM   691  C CA    . LYS A 1 89  ? -24.793 62.183 137.303 1.00 107.31 ? 123  LYS A CA    1 
ATOM   692  C C     . LYS A 1 89  ? -25.888 61.459 136.523 1.00 106.71 ? 123  LYS A C     1 
ATOM   693  O O     . LYS A 1 89  ? -25.793 61.261 135.309 1.00 106.75 ? 123  LYS A O     1 
ATOM   694  C CB    . LYS A 1 89  ? -25.355 63.526 137.780 1.00 107.64 ? 123  LYS A CB    1 
ATOM   695  C CG    . LYS A 1 89  ? -24.734 64.069 139.053 1.00 108.16 ? 123  LYS A CG    1 
ATOM   696  C CD    . LYS A 1 89  ? -25.242 63.315 140.275 1.00 108.27 ? 123  LYS A CD    1 
ATOM   697  C CE    . LYS A 1 89  ? -24.723 63.936 141.565 1.00 108.33 ? 123  LYS A CE    1 
ATOM   698  N NZ    . LYS A 1 89  ? -25.275 63.283 142.788 1.00 108.21 ? 123  LYS A NZ    1 
ATOM   699  N N     . ASP A 1 90  ? -26.933 61.081 137.259 1.00 105.34 ? 124  ASP A N     1 
ATOM   700  C CA    . ASP A 1 90  ? -28.116 60.406 136.729 1.00 104.07 ? 124  ASP A CA    1 
ATOM   701  C C     . ASP A 1 90  ? -27.879 59.202 135.816 1.00 102.33 ? 124  ASP A C     1 
ATOM   702  O O     . ASP A 1 90  ? -28.606 59.002 134.838 1.00 102.26 ? 124  ASP A O     1 
ATOM   703  C CB    . ASP A 1 90  ? -29.009 61.427 136.010 1.00 105.15 ? 124  ASP A CB    1 
ATOM   704  C CG    . ASP A 1 90  ? -29.505 62.528 136.940 1.00 106.19 ? 124  ASP A CG    1 
ATOM   705  O OD1   . ASP A 1 90  ? -30.228 62.212 137.911 1.00 106.92 ? 124  ASP A OD1   1 
ATOM   706  O OD2   . ASP A 1 90  ? -29.169 63.709 136.701 1.00 106.18 ? 124  ASP A OD2   1 
ATOM   707  N N     . GLU A 1 91  ? -26.874 58.396 136.140 1.00 99.79  ? 125  GLU A N     1 
ATOM   708  C CA    . GLU A 1 91  ? -26.574 57.210 135.349 1.00 96.99  ? 125  GLU A CA    1 
ATOM   709  C C     . GLU A 1 91  ? -26.177 56.041 136.235 1.00 93.35  ? 125  GLU A C     1 
ATOM   710  O O     . GLU A 1 91  ? -25.481 56.214 137.237 1.00 92.60  ? 125  GLU A O     1 
ATOM   711  C CB    . GLU A 1 91  ? -25.463 57.506 134.347 1.00 99.32  ? 125  GLU A CB    1 
ATOM   712  C CG    . GLU A 1 91  ? -25.881 58.465 133.254 1.00 102.10 ? 125  GLU A CG    1 
ATOM   713  C CD    . GLU A 1 91  ? -24.798 58.655 132.220 1.00 104.04 ? 125  GLU A CD    1 
ATOM   714  O OE1   . GLU A 1 91  ? -23.685 59.079 132.605 1.00 105.58 ? 125  GLU A OE1   1 
ATOM   715  O OE2   . GLU A 1 91  ? -25.057 58.376 131.027 1.00 104.33 ? 125  GLU A OE2   1 
ATOM   716  N N     . VAL A 1 92  ? -26.628 54.850 135.855 1.00 88.96  ? 126  VAL A N     1 
ATOM   717  C CA    . VAL A 1 92  ? -26.340 53.642 136.616 1.00 84.35  ? 126  VAL A CA    1 
ATOM   718  C C     . VAL A 1 92  ? -25.067 52.960 136.139 1.00 81.16  ? 126  VAL A C     1 
ATOM   719  O O     . VAL A 1 92  ? -24.829 52.837 134.939 1.00 80.82  ? 126  VAL A O     1 
ATOM   720  C CB    . VAL A 1 92  ? -27.497 52.630 136.507 1.00 84.11  ? 126  VAL A CB    1 
ATOM   721  C CG1   . VAL A 1 92  ? -27.211 51.418 137.376 1.00 83.44  ? 126  VAL A CG1   1 
ATOM   722  C CG2   . VAL A 1 92  ? -28.799 53.287 136.917 1.00 83.72  ? 126  VAL A CG2   1 
ATOM   723  N N     . TYR A 1 93  ? -24.256 52.509 137.091 1.00 77.67  ? 127  TYR A N     1 
ATOM   724  C CA    . TYR A 1 93  ? -23.009 51.819 136.781 1.00 73.59  ? 127  TYR A CA    1 
ATOM   725  C C     . TYR A 1 93  ? -22.996 50.381 137.313 1.00 69.74  ? 127  TYR A C     1 
ATOM   726  O O     . TYR A 1 93  ? -23.308 50.142 138.480 1.00 69.88  ? 127  TYR A O     1 
ATOM   727  C CB    . TYR A 1 93  ? -21.818 52.590 137.369 1.00 75.41  ? 127  TYR A CB    1 
ATOM   728  C CG    . TYR A 1 93  ? -21.374 53.779 136.542 1.00 78.79  ? 127  TYR A CG    1 
ATOM   729  C CD1   . TYR A 1 93  ? -21.449 55.077 137.049 1.00 79.89  ? 127  TYR A CD1   1 
ATOM   730  C CD2   . TYR A 1 93  ? -20.876 53.606 135.247 1.00 80.08  ? 127  TYR A CD2   1 
ATOM   731  C CE1   . TYR A 1 93  ? -21.041 56.173 136.291 1.00 81.20  ? 127  TYR A CE1   1 
ATOM   732  C CE2   . TYR A 1 93  ? -20.465 54.695 134.480 1.00 81.37  ? 127  TYR A CE2   1 
ATOM   733  C CZ    . TYR A 1 93  ? -20.552 55.976 135.008 1.00 82.30  ? 127  TYR A CZ    1 
ATOM   734  O OH    . TYR A 1 93  ? -20.159 57.059 134.255 1.00 83.58  ? 127  TYR A OH    1 
ATOM   735  N N     . LEU A 1 94  ? -22.644 49.428 136.450 1.00 63.81  ? 128  LEU A N     1 
ATOM   736  C CA    . LEU A 1 94  ? -22.559 48.019 136.839 1.00 58.08  ? 128  LEU A CA    1 
ATOM   737  C C     . LEU A 1 94  ? -21.140 47.724 137.317 1.00 56.00  ? 128  LEU A C     1 
ATOM   738  O O     . LEU A 1 94  ? -20.172 48.039 136.633 1.00 55.52  ? 128  LEU A O     1 
ATOM   739  C CB    . LEU A 1 94  ? -22.885 47.100 135.654 1.00 55.40  ? 128  LEU A CB    1 
ATOM   740  C CG    . LEU A 1 94  ? -22.571 45.604 135.815 1.00 54.41  ? 128  LEU A CG    1 
ATOM   741  C CD1   . LEU A 1 94  ? -23.428 44.985 136.919 1.00 53.26  ? 128  LEU A CD1   1 
ATOM   742  C CD2   . LEU A 1 94  ? -22.828 44.890 134.499 1.00 52.79  ? 128  LEU A CD2   1 
ATOM   743  N N     . ASN A 1 95  ? -21.012 47.132 138.497 1.00 52.71  ? 129  ASN A N     1 
ATOM   744  C CA    . ASN A 1 95  ? -19.695 46.815 139.020 1.00 49.51  ? 129  ASN A CA    1 
ATOM   745  C C     . ASN A 1 95  ? -19.507 45.304 139.065 1.00 48.81  ? 129  ASN A C     1 
ATOM   746  O O     . ASN A 1 95  ? -20.326 44.584 139.628 1.00 47.82  ? 129  ASN A O     1 
ATOM   747  C CB    . ASN A 1 95  ? -19.512 47.410 140.416 1.00 48.91  ? 129  ASN A CB    1 
ATOM   748  C CG    . ASN A 1 95  ? -19.727 48.921 140.443 1.00 50.54  ? 129  ASN A CG    1 
ATOM   749  O OD1   . ASN A 1 95  ? -20.785 49.411 140.049 1.00 52.74  ? 129  ASN A OD1   1 
ATOM   750  N ND2   . ASN A 1 95  ? -18.729 49.661 140.916 1.00 49.02  ? 129  ASN A ND2   1 
ATOM   751  N N     . LEU A 1 96  ? -18.429 44.830 138.446 1.00 47.40  ? 130  LEU A N     1 
ATOM   752  C CA    . LEU A 1 96  ? -18.117 43.407 138.421 1.00 45.67  ? 130  LEU A CA    1 
ATOM   753  C C     . LEU A 1 96  ? -16.943 43.130 139.367 1.00 44.13  ? 130  LEU A C     1 
ATOM   754  O O     . LEU A 1 96  ? -15.835 43.637 139.174 1.00 44.77  ? 130  LEU A O     1 
ATOM   755  C CB    . LEU A 1 96  ? -17.779 42.962 136.988 1.00 46.91  ? 130  LEU A CB    1 
ATOM   756  C CG    . LEU A 1 96  ? -18.896 43.016 135.928 1.00 49.14  ? 130  LEU A CG    1 
ATOM   757  C CD1   . LEU A 1 96  ? -18.342 42.615 134.557 1.00 51.26  ? 130  LEU A CD1   1 
ATOM   758  C CD2   . LEU A 1 96  ? -20.026 42.076 136.308 1.00 49.88  ? 130  LEU A CD2   1 
ATOM   759  N N     . VAL A 1 97  ? -17.201 42.348 140.409 1.00 42.58  ? 131  VAL A N     1 
ATOM   760  C CA    . VAL A 1 97  ? -16.177 41.999 141.385 1.00 40.70  ? 131  VAL A CA    1 
ATOM   761  C C     . VAL A 1 97  ? -15.585 40.661 140.969 1.00 41.66  ? 131  VAL A C     1 
ATOM   762  O O     . VAL A 1 97  ? -16.220 39.615 141.113 1.00 42.94  ? 131  VAL A O     1 
ATOM   763  C CB    . VAL A 1 97  ? -16.782 41.872 142.801 1.00 41.92  ? 131  VAL A CB    1 
ATOM   764  C CG1   . VAL A 1 97  ? -15.674 41.751 143.838 1.00 41.04  ? 131  VAL A CG1   1 
ATOM   765  C CG2   . VAL A 1 97  ? -17.675 43.076 143.091 1.00 39.45  ? 131  VAL A CG2   1 
ATOM   766  N N     . LEU A 1 98  ? -14.370 40.699 140.441 1.00 40.84  ? 132  LEU A N     1 
ATOM   767  C CA    . LEU A 1 98  ? -13.705 39.492 139.977 1.00 40.51  ? 132  LEU A CA    1 
ATOM   768  C C     . LEU A 1 98  ? -12.479 39.235 140.825 1.00 41.34  ? 132  LEU A C     1 
ATOM   769  O O     . LEU A 1 98  ? -11.983 40.142 141.483 1.00 40.65  ? 132  LEU A O     1 
ATOM   770  C CB    . LEU A 1 98  ? -13.272 39.678 138.534 1.00 41.95  ? 132  LEU A CB    1 
ATOM   771  C CG    . LEU A 1 98  ? -14.351 40.168 137.573 1.00 42.25  ? 132  LEU A CG    1 
ATOM   772  C CD1   . LEU A 1 98  ? -13.704 41.025 136.492 1.00 42.38  ? 132  LEU A CD1   1 
ATOM   773  C CD2   . LEU A 1 98  ? -15.092 38.971 136.985 1.00 41.34  ? 132  LEU A CD2   1 
ATOM   774  N N     . ASP A 1 99  ? -11.989 38.000 140.817 1.00 42.72  ? 133  ASP A N     1 
ATOM   775  C CA    . ASP A 1 99  ? -10.782 37.678 141.573 1.00 44.16  ? 133  ASP A CA    1 
ATOM   776  C C     . ASP A 1 99  ? -9.632  38.457 140.948 1.00 43.70  ? 133  ASP A C     1 
ATOM   777  O O     . ASP A 1 99  ? -9.561  38.584 139.728 1.00 43.29  ? 133  ASP A O     1 
ATOM   778  C CB    . ASP A 1 99  ? -10.450 36.180 141.496 1.00 45.47  ? 133  ASP A CB    1 
ATOM   779  C CG    . ASP A 1 99  ? -11.261 35.341 142.470 1.00 50.40  ? 133  ASP A CG    1 
ATOM   780  O OD1   . ASP A 1 99  ? -11.551 35.821 143.597 1.00 52.56  ? 133  ASP A OD1   1 
ATOM   781  O OD2   . ASP A 1 99  ? -11.593 34.189 142.114 1.00 51.62  ? 133  ASP A OD2   1 
ATOM   782  N N     . TYR A 1 100 ? -8.736  38.973 141.782 1.00 44.30  ? 134  TYR A N     1 
ATOM   783  C CA    . TYR A 1 100 ? -7.584  39.730 141.299 1.00 43.06  ? 134  TYR A CA    1 
ATOM   784  C C     . TYR A 1 100 ? -6.429  38.794 140.965 1.00 42.10  ? 134  TYR A C     1 
ATOM   785  O O     . TYR A 1 100 ? -6.064  37.943 141.773 1.00 43.86  ? 134  TYR A O     1 
ATOM   786  C CB    . TYR A 1 100 ? -7.107  40.722 142.359 1.00 43.75  ? 134  TYR A CB    1 
ATOM   787  C CG    . TYR A 1 100 ? -5.829  41.435 141.969 1.00 45.71  ? 134  TYR A CG    1 
ATOM   788  C CD1   . TYR A 1 100 ? -5.828  42.386 140.949 1.00 44.36  ? 134  TYR A CD1   1 
ATOM   789  C CD2   . TYR A 1 100 ? -4.614  41.140 142.604 1.00 45.74  ? 134  TYR A CD2   1 
ATOM   790  C CE1   . TYR A 1 100 ? -4.662  43.028 140.567 1.00 47.44  ? 134  TYR A CE1   1 
ATOM   791  C CE2   . TYR A 1 100 ? -3.436  41.778 142.229 1.00 47.43  ? 134  TYR A CE2   1 
ATOM   792  C CZ    . TYR A 1 100 ? -3.469  42.722 141.208 1.00 49.05  ? 134  TYR A CZ    1 
ATOM   793  O OH    . TYR A 1 100 ? -2.315  43.364 140.820 1.00 50.28  ? 134  TYR A OH    1 
ATOM   794  N N     . VAL A 1 101 ? -5.854  38.947 139.778 1.00 40.72  ? 135  VAL A N     1 
ATOM   795  C CA    . VAL A 1 101 ? -4.719  38.117 139.396 1.00 40.32  ? 135  VAL A CA    1 
ATOM   796  C C     . VAL A 1 101 ? -3.560  39.070 139.067 1.00 41.78  ? 135  VAL A C     1 
ATOM   797  O O     . VAL A 1 101 ? -3.704  39.986 138.262 1.00 41.15  ? 135  VAL A O     1 
ATOM   798  C CB    . VAL A 1 101 ? -5.076  37.198 138.206 1.00 40.08  ? 135  VAL A CB    1 
ATOM   799  C CG1   . VAL A 1 101 ? -4.005  36.143 138.011 1.00 36.69  ? 135  VAL A CG1   1 
ATOM   800  C CG2   . VAL A 1 101 ? -6.416  36.507 138.472 1.00 40.57  ? 135  VAL A CG2   1 
ATOM   801  N N     . PRO A 1 102 ? -2.399  38.865 139.711 1.00 42.33  ? 136  PRO A N     1 
ATOM   802  C CA    . PRO A 1 102 ? -1.184  39.675 139.542 1.00 43.18  ? 136  PRO A CA    1 
ATOM   803  C C     . PRO A 1 102 ? -0.691  39.978 138.119 1.00 41.88  ? 136  PRO A C     1 
ATOM   804  O O     . PRO A 1 102 ? -0.558  41.137 137.746 1.00 44.58  ? 136  PRO A O     1 
ATOM   805  C CB    . PRO A 1 102 ? -0.127  38.891 140.338 1.00 43.10  ? 136  PRO A CB    1 
ATOM   806  C CG    . PRO A 1 102 ? -0.920  38.183 141.376 1.00 44.18  ? 136  PRO A CG    1 
ATOM   807  C CD    . PRO A 1 102 ? -2.139  37.720 140.608 1.00 44.43  ? 136  PRO A CD    1 
ATOM   808  N N     . ALA A 1 103 ? -0.424  38.942 137.331 1.00 40.27  ? 137  ALA A N     1 
ATOM   809  C CA    . ALA A 1 103 ? 0.129   39.128 135.995 1.00 37.77  ? 137  ALA A CA    1 
ATOM   810  C C     . ALA A 1 103 ? -0.652  38.577 134.795 1.00 35.87  ? 137  ALA A C     1 
ATOM   811  O O     . ALA A 1 103 ? -1.745  38.033 134.927 1.00 36.91  ? 137  ALA A O     1 
ATOM   812  C CB    . ALA A 1 103 ? 1.560   38.553 135.979 1.00 38.89  ? 137  ALA A CB    1 
ATOM   813  N N     . THR A 1 104 ? -0.073  38.731 133.610 1.00 32.81  ? 138  THR A N     1 
ATOM   814  C CA    . THR A 1 104 ? -0.706  38.243 132.396 1.00 31.21  ? 138  THR A CA    1 
ATOM   815  C C     . THR A 1 104 ? 0.352   37.608 131.527 1.00 30.41  ? 138  THR A C     1 
ATOM   816  O O     . THR A 1 104 ? 1.538   37.853 131.706 1.00 30.55  ? 138  THR A O     1 
ATOM   817  C CB    . THR A 1 104 ? -1.362  39.375 131.572 1.00 33.09  ? 138  THR A CB    1 
ATOM   818  O OG1   . THR A 1 104 ? -0.348  40.269 131.103 1.00 32.11  ? 138  THR A OG1   1 
ATOM   819  C CG2   . THR A 1 104 ? -2.371  40.165 132.422 1.00 32.32  ? 138  THR A CG2   1 
ATOM   820  N N     . VAL A 1 105 ? -0.079  36.787 130.584 1.00 30.47  ? 139  VAL A N     1 
ATOM   821  C CA    . VAL A 1 105 ? 0.854   36.147 129.686 1.00 28.10  ? 139  VAL A CA    1 
ATOM   822  C C     . VAL A 1 105 ? 1.619   37.223 128.947 1.00 28.50  ? 139  VAL A C     1 
ATOM   823  O O     . VAL A 1 105 ? 2.827   37.112 128.756 1.00 28.27  ? 139  VAL A O     1 
ATOM   824  C CB    . VAL A 1 105 ? 0.118   35.229 128.671 1.00 24.67  ? 139  VAL A CB    1 
ATOM   825  C CG1   . VAL A 1 105 ? 1.021   34.927 127.478 1.00 21.98  ? 139  VAL A CG1   1 
ATOM   826  C CG2   . VAL A 1 105 ? -0.260  33.914 129.354 1.00 22.41  ? 139  VAL A CG2   1 
ATOM   827  N N     . TYR A 1 106 ? 0.911   38.272 128.544 1.00 29.23  ? 140  TYR A N     1 
ATOM   828  C CA    . TYR A 1 106 ? 1.535   39.369 127.819 1.00 29.09  ? 140  TYR A CA    1 
ATOM   829  C C     . TYR A 1 106 ? 2.710   39.985 128.591 1.00 29.89  ? 140  TYR A C     1 
ATOM   830  O O     . TYR A 1 106 ? 3.791   40.165 128.029 1.00 29.57  ? 140  TYR A O     1 
ATOM   831  C CB    . TYR A 1 106 ? 0.507   40.465 127.513 1.00 30.54  ? 140  TYR A CB    1 
ATOM   832  C CG    . TYR A 1 106 ? 1.126   41.662 126.816 1.00 33.25  ? 140  TYR A CG    1 
ATOM   833  C CD1   . TYR A 1 106 ? 1.532   41.578 125.487 1.00 35.72  ? 140  TYR A CD1   1 
ATOM   834  C CD2   . TYR A 1 106 ? 1.344   42.860 127.495 1.00 32.87  ? 140  TYR A CD2   1 
ATOM   835  C CE1   . TYR A 1 106 ? 2.137   42.645 124.849 1.00 38.18  ? 140  TYR A CE1   1 
ATOM   836  C CE2   . TYR A 1 106 ? 1.957   43.945 126.857 1.00 35.11  ? 140  TYR A CE2   1 
ATOM   837  C CZ    . TYR A 1 106 ? 2.347   43.823 125.538 1.00 37.85  ? 140  TYR A CZ    1 
ATOM   838  O OH    . TYR A 1 106 ? 2.957   44.864 124.876 1.00 43.03  ? 140  TYR A OH    1 
ATOM   839  N N     . ARG A 1 107 ? 2.496   40.315 129.864 1.00 29.45  ? 141  ARG A N     1 
ATOM   840  C CA    . ARG A 1 107 ? 3.554   40.915 130.680 1.00 33.32  ? 141  ARG A CA    1 
ATOM   841  C C     . ARG A 1 107 ? 4.748   40.003 130.887 1.00 34.29  ? 141  ARG A C     1 
ATOM   842  O O     . ARG A 1 107 ? 5.893   40.460 130.901 1.00 33.78  ? 141  ARG A O     1 
ATOM   843  C CB    . ARG A 1 107 ? 3.004   41.366 132.031 1.00 33.42  ? 141  ARG A CB    1 
ATOM   844  C CG    . ARG A 1 107 ? 2.205   42.633 131.902 1.00 37.27  ? 141  ARG A CG    1 
ATOM   845  C CD    . ARG A 1 107 ? 1.449   42.969 133.160 1.00 40.86  ? 141  ARG A CD    1 
ATOM   846  N NE    . ARG A 1 107 ? 0.270   43.750 132.818 1.00 44.56  ? 141  ARG A NE    1 
ATOM   847  C CZ    . ARG A 1 107 ? -0.716  44.011 133.663 1.00 45.86  ? 141  ARG A CZ    1 
ATOM   848  N NH1   . ARG A 1 107 ? -0.655  43.556 134.905 1.00 47.91  ? 141  ARG A NH1   1 
ATOM   849  N NH2   . ARG A 1 107 ? -1.768  44.709 133.255 1.00 47.92  ? 141  ARG A NH2   1 
ATOM   850  N N     . VAL A 1 108 ? 4.485   38.712 131.032 1.00 33.02  ? 142  VAL A N     1 
ATOM   851  C CA    . VAL A 1 108 ? 5.573   37.769 131.199 1.00 31.28  ? 142  VAL A CA    1 
ATOM   852  C C     . VAL A 1 108 ? 6.335   37.684 129.882 1.00 32.45  ? 142  VAL A C     1 
ATOM   853  O O     . VAL A 1 108 ? 7.568   37.749 129.865 1.00 31.55  ? 142  VAL A O     1 
ATOM   854  C CB    . VAL A 1 108 ? 5.029   36.398 131.596 1.00 31.14  ? 142  VAL A CB    1 
ATOM   855  C CG1   . VAL A 1 108 ? 6.122   35.341 131.512 1.00 32.76  ? 142  VAL A CG1   1 
ATOM   856  C CG2   . VAL A 1 108 ? 4.473   36.485 133.017 1.00 30.38  ? 142  VAL A CG2   1 
ATOM   857  N N     . ALA A 1 109 ? 5.612   37.548 128.771 1.00 30.05  ? 143  ALA A N     1 
ATOM   858  C CA    . ALA A 1 109 ? 6.292   37.460 127.479 1.00 28.78  ? 143  ALA A CA    1 
ATOM   859  C C     . ALA A 1 109 ? 7.167   38.712 127.265 1.00 29.34  ? 143  ALA A C     1 
ATOM   860  O O     . ALA A 1 109 ? 8.284   38.626 126.755 1.00 27.18  ? 143  ALA A O     1 
ATOM   861  C CB    . ALA A 1 109 ? 5.292   37.321 126.369 1.00 26.68  ? 143  ALA A CB    1 
ATOM   862  N N     . ARG A 1 110 ? 6.654   39.862 127.683 1.00 29.88  ? 144  ARG A N     1 
ATOM   863  C CA    . ARG A 1 110 ? 7.357   41.133 127.555 1.00 32.74  ? 144  ARG A CA    1 
ATOM   864  C C     . ARG A 1 110 ? 8.689   41.098 128.308 1.00 32.95  ? 144  ARG A C     1 
ATOM   865  O O     . ARG A 1 110 ? 9.719   41.573 127.819 1.00 32.31  ? 144  ARG A O     1 
ATOM   866  C CB    . ARG A 1 110 ? 6.507   42.238 128.157 1.00 33.21  ? 144  ARG A CB    1 
ATOM   867  C CG    . ARG A 1 110 ? 6.397   43.452 127.345 1.00 35.10  ? 144  ARG A CG    1 
ATOM   868  C CD    . ARG A 1 110 ? 5.655   43.166 126.065 1.00 34.87  ? 144  ARG A CD    1 
ATOM   869  N NE    . ARG A 1 110 ? 6.598   43.092 124.968 1.00 38.21  ? 144  ARG A NE    1 
ATOM   870  C CZ    . ARG A 1 110 ? 7.609   43.941 124.813 1.00 35.50  ? 144  ARG A CZ    1 
ATOM   871  N NH1   . ARG A 1 110 ? 7.785   44.908 125.692 1.00 33.88  ? 144  ARG A NH1   1 
ATOM   872  N NH2   . ARG A 1 110 ? 8.438   43.825 123.784 1.00 32.08  ? 144  ARG A NH2   1 
ATOM   873  N N     . HIS A 1 111 ? 8.655   40.551 129.519 1.00 32.58  ? 145  HIS A N     1 
ATOM   874  C CA    . HIS A 1 111 ? 9.865   40.452 130.314 1.00 33.78  ? 145  HIS A CA    1 
ATOM   875  C C     . HIS A 1 111 ? 10.940  39.696 129.535 1.00 33.12  ? 145  HIS A C     1 
ATOM   876  O O     . HIS A 1 111 ? 12.099  40.100 129.501 1.00 34.13  ? 145  HIS A O     1 
ATOM   877  C CB    . HIS A 1 111 ? 9.619   39.716 131.626 1.00 35.34  ? 145  HIS A CB    1 
ATOM   878  C CG    . HIS A 1 111 ? 10.887  39.315 132.312 1.00 43.80  ? 145  HIS A CG    1 
ATOM   879  N ND1   . HIS A 1 111 ? 11.611  40.182 133.105 1.00 43.37  ? 145  HIS A ND1   1 
ATOM   880  C CD2   . HIS A 1 111 ? 11.613  38.173 132.238 1.00 43.41  ? 145  HIS A CD2   1 
ATOM   881  C CE1   . HIS A 1 111 ? 12.729  39.592 133.488 1.00 45.13  ? 145  HIS A CE1   1 
ATOM   882  N NE2   . HIS A 1 111 ? 12.755  38.373 132.974 1.00 49.13  ? 145  HIS A NE2   1 
ATOM   883  N N     . TYR A 1 112 ? 10.556  38.597 128.907 1.00 31.81  ? 146  TYR A N     1 
ATOM   884  C CA    . TYR A 1 112 ? 11.518  37.821 128.160 1.00 34.08  ? 146  TYR A CA    1 
ATOM   885  C C     . TYR A 1 112 ? 11.974  38.503 126.897 1.00 36.20  ? 146  TYR A C     1 
ATOM   886  O O     . TYR A 1 112 ? 13.127  38.369 126.496 1.00 36.82  ? 146  TYR A O     1 
ATOM   887  C CB    . TYR A 1 112 ? 10.958  36.440 127.808 1.00 32.09  ? 146  TYR A CB    1 
ATOM   888  C CG    . TYR A 1 112 ? 10.836  35.531 129.013 1.00 32.82  ? 146  TYR A CG    1 
ATOM   889  C CD1   . TYR A 1 112 ? 9.704   35.581 129.833 1.00 31.36  ? 146  TYR A CD1   1 
ATOM   890  C CD2   . TYR A 1 112 ? 11.871  34.663 129.368 1.00 32.24  ? 146  TYR A CD2   1 
ATOM   891  C CE1   . TYR A 1 112 ? 9.604   34.803 130.969 1.00 27.76  ? 146  TYR A CE1   1 
ATOM   892  C CE2   . TYR A 1 112 ? 11.781  33.874 130.516 1.00 32.94  ? 146  TYR A CE2   1 
ATOM   893  C CZ    . TYR A 1 112 ? 10.646  33.954 131.311 1.00 30.03  ? 146  TYR A CZ    1 
ATOM   894  O OH    . TYR A 1 112 ? 10.562  33.215 132.462 1.00 30.18  ? 146  TYR A OH    1 
ATOM   895  N N     . SER A 1 113 ? 11.079  39.243 126.264 1.00 38.07  ? 147  SER A N     1 
ATOM   896  C CA    . SER A 1 113 ? 11.448  39.892 125.030 1.00 39.01  ? 147  SER A CA    1 
ATOM   897  C C     . SER A 1 113 ? 12.523  40.961 125.244 1.00 39.17  ? 147  SER A C     1 
ATOM   898  O O     . SER A 1 113 ? 13.466  41.066 124.458 1.00 39.11  ? 147  SER A O     1 
ATOM   899  C CB    . SER A 1 113 ? 10.211  40.476 124.356 1.00 41.14  ? 147  SER A CB    1 
ATOM   900  O OG    . SER A 1 113 ? 10.548  41.122 123.140 1.00 47.44  ? 147  SER A OG    1 
ATOM   901  N N     . ARG A 1 114 ? 12.398  41.756 126.294 1.00 42.04  ? 148  ARG A N     1 
ATOM   902  C CA    . ARG A 1 114 ? 13.396  42.781 126.523 1.00 47.56  ? 148  ARG A CA    1 
ATOM   903  C C     . ARG A 1 114 ? 14.611  42.206 127.246 1.00 49.68  ? 148  ARG A C     1 
ATOM   904  O O     . ARG A 1 114 ? 15.622  42.881 127.412 1.00 51.50  ? 148  ARG A O     1 
ATOM   905  C CB    . ARG A 1 114 ? 12.797  43.973 127.296 1.00 48.50  ? 148  ARG A CB    1 
ATOM   906  C CG    . ARG A 1 114 ? 12.040  43.622 128.548 1.00 51.44  ? 148  ARG A CG    1 
ATOM   907  C CD    . ARG A 1 114 ? 11.381  44.857 129.187 1.00 49.50  ? 148  ARG A CD    1 
ATOM   908  N NE    . ARG A 1 114 ? 10.607  44.456 130.361 1.00 50.64  ? 148  ARG A NE    1 
ATOM   909  C CZ    . ARG A 1 114 ? 9.293   44.608 130.484 1.00 49.60  ? 148  ARG A CZ    1 
ATOM   910  N NH1   . ARG A 1 114 ? 8.592   45.168 129.508 1.00 50.92  ? 148  ARG A NH1   1 
ATOM   911  N NH2   . ARG A 1 114 ? 8.676   44.171 131.570 1.00 49.07  ? 148  ARG A NH2   1 
ATOM   912  N N     . ALA A 1 115 ? 14.514  40.952 127.668 1.00 49.92  ? 149  ALA A N     1 
ATOM   913  C CA    . ALA A 1 115 ? 15.629  40.299 128.338 1.00 49.98  ? 149  ALA A CA    1 
ATOM   914  C C     . ALA A 1 115 ? 16.394  39.470 127.310 1.00 48.94  ? 149  ALA A C     1 
ATOM   915  O O     . ALA A 1 115 ? 17.340  38.769 127.653 1.00 48.86  ? 149  ALA A O     1 
ATOM   916  C CB    . ALA A 1 115 ? 15.124  39.400 129.474 1.00 48.51  ? 149  ALA A CB    1 
ATOM   917  N N     . LYS A 1 116 ? 15.982  39.564 126.049 1.00 49.64  ? 150  LYS A N     1 
ATOM   918  C CA    . LYS A 1 116 ? 16.629  38.822 124.971 1.00 51.03  ? 150  LYS A CA    1 
ATOM   919  C C     . LYS A 1 116 ? 16.572  37.321 125.257 1.00 50.88  ? 150  LYS A C     1 
ATOM   920  O O     . LYS A 1 116 ? 17.430  36.575 124.807 1.00 52.74  ? 150  LYS A O     1 
ATOM   921  C CB    . LYS A 1 116 ? 18.096  39.232 124.844 1.00 53.59  ? 150  LYS A CB    1 
ATOM   922  C CG    . LYS A 1 116 ? 18.354  40.724 124.722 1.00 58.08  ? 150  LYS A CG    1 
ATOM   923  C CD    . LYS A 1 116 ? 18.102  41.237 123.323 1.00 58.41  ? 150  LYS A CD    1 
ATOM   924  C CE    . LYS A 1 116 ? 18.647  42.651 123.182 1.00 59.71  ? 150  LYS A CE    1 
ATOM   925  N NZ    . LYS A 1 116 ? 18.630  43.109 121.763 1.00 61.12  ? 150  LYS A NZ    1 
ATOM   926  N N     . GLN A 1 117 ? 15.575  36.879 126.014 1.00 50.81  ? 151  GLN A N     1 
ATOM   927  C CA    . GLN A 1 117 ? 15.453  35.463 126.346 1.00 50.76  ? 151  GLN A CA    1 
ATOM   928  C C     . GLN A 1 117 ? 14.193  34.849 125.726 1.00 51.63  ? 151  GLN A C     1 
ATOM   929  O O     . GLN A 1 117 ? 13.295  35.560 125.276 1.00 50.47  ? 151  GLN A O     1 
ATOM   930  C CB    . GLN A 1 117 ? 15.419  35.283 127.868 1.00 52.59  ? 151  GLN A CB    1 
ATOM   931  C CG    . GLN A 1 117 ? 16.695  35.698 128.590 1.00 53.62  ? 151  GLN A CG    1 
ATOM   932  C CD    . GLN A 1 117 ? 17.824  34.700 128.391 1.00 57.52  ? 151  GLN A CD    1 
ATOM   933  O OE1   . GLN A 1 117 ? 18.957  34.945 128.797 1.00 60.49  ? 151  GLN A OE1   1 
ATOM   934  N NE2   . GLN A 1 117 ? 17.517  33.565 127.770 1.00 57.44  ? 151  GLN A NE2   1 
ATOM   935  N N     . THR A 1 118 ? 14.136  33.524 125.697 1.00 51.20  ? 152  THR A N     1 
ATOM   936  C CA    . THR A 1 118 ? 12.972  32.832 125.157 1.00 49.66  ? 152  THR A CA    1 
ATOM   937  C C     . THR A 1 118 ? 12.234  32.222 126.346 1.00 47.64  ? 152  THR A C     1 
ATOM   938  O O     . THR A 1 118 ? 12.864  31.647 127.227 1.00 46.65  ? 152  THR A O     1 
ATOM   939  C CB    . THR A 1 118 ? 13.379  31.685 124.194 1.00 51.14  ? 152  THR A CB    1 
ATOM   940  O OG1   . THR A 1 118 ? 14.437  32.124 123.330 1.00 55.91  ? 152  THR A OG1   1 
ATOM   941  C CG2   . THR A 1 118 ? 12.197  31.278 123.332 1.00 53.04  ? 152  THR A CG2   1 
ATOM   942  N N     . LEU A 1 119 ? 10.912  32.366 126.388 1.00 45.77  ? 153  LEU A N     1 
ATOM   943  C CA    . LEU A 1 119 ? 10.127  31.795 127.477 1.00 44.94  ? 153  LEU A CA    1 
ATOM   944  C C     . LEU A 1 119 ? 10.332  30.274 127.466 1.00 43.66  ? 153  LEU A C     1 
ATOM   945  O O     . LEU A 1 119 ? 10.123  29.634 126.440 1.00 43.29  ? 153  LEU A O     1 
ATOM   946  C CB    . LEU A 1 119 ? 8.642   32.115 127.281 1.00 44.05  ? 153  LEU A CB    1 
ATOM   947  C CG    . LEU A 1 119 ? 7.687   31.459 128.285 1.00 47.19  ? 153  LEU A CG    1 
ATOM   948  C CD1   . LEU A 1 119 ? 7.772   32.197 129.604 1.00 45.24  ? 153  LEU A CD1   1 
ATOM   949  C CD2   . LEU A 1 119 ? 6.253   31.477 127.770 1.00 46.89  ? 153  LEU A CD2   1 
ATOM   950  N N     . PRO A 1 120 ? 10.759  29.678 128.601 1.00 43.77  ? 154  PRO A N     1 
ATOM   951  C CA    . PRO A 1 120 ? 10.982  28.222 128.683 1.00 43.04  ? 154  PRO A CA    1 
ATOM   952  C C     . PRO A 1 120 ? 9.807   27.408 128.135 1.00 43.15  ? 154  PRO A C     1 
ATOM   953  O O     . PRO A 1 120 ? 8.653   27.620 128.517 1.00 43.48  ? 154  PRO A O     1 
ATOM   954  C CB    . PRO A 1 120 ? 11.200  27.986 130.173 1.00 42.08  ? 154  PRO A CB    1 
ATOM   955  C CG    . PRO A 1 120 ? 11.900  29.243 130.594 1.00 44.24  ? 154  PRO A CG    1 
ATOM   956  C CD    . PRO A 1 120 ? 11.121  30.337 129.869 1.00 41.59  ? 154  PRO A CD    1 
ATOM   957  N N     . VAL A 1 121 ? 10.109  26.467 127.250 1.00 42.22  ? 155  VAL A N     1 
ATOM   958  C CA    . VAL A 1 121 ? 9.083   25.646 126.635 1.00 43.69  ? 155  VAL A CA    1 
ATOM   959  C C     . VAL A 1 121 ? 8.087   25.088 127.641 1.00 42.05  ? 155  VAL A C     1 
ATOM   960  O O     . VAL A 1 121 ? 6.905   24.940 127.318 1.00 43.05  ? 155  VAL A O     1 
ATOM   961  C CB    . VAL A 1 121 ? 9.713   24.486 125.824 1.00 46.66  ? 155  VAL A CB    1 
ATOM   962  C CG1   . VAL A 1 121 ? 8.637   23.749 125.029 1.00 50.65  ? 155  VAL A CG1   1 
ATOM   963  C CG2   . VAL A 1 121 ? 10.751  25.043 124.862 1.00 50.79  ? 155  VAL A CG2   1 
ATOM   964  N N     . ILE A 1 122 ? 8.543   24.799 128.858 1.00 40.53  ? 156  ILE A N     1 
ATOM   965  C CA    . ILE A 1 122 ? 7.655   24.248 129.886 1.00 39.66  ? 156  ILE A CA    1 
ATOM   966  C C     . ILE A 1 122 ? 6.463   25.161 130.157 1.00 38.06  ? 156  ILE A C     1 
ATOM   967  O O     . ILE A 1 122 ? 5.333   24.695 130.299 1.00 38.82  ? 156  ILE A O     1 
ATOM   968  C CB    . ILE A 1 122 ? 8.404   23.969 131.253 1.00 39.58  ? 156  ILE A CB    1 
ATOM   969  C CG1   . ILE A 1 122 ? 7.398   23.489 132.304 1.00 39.34  ? 156  ILE A CG1   1 
ATOM   970  C CG2   . ILE A 1 122 ? 9.105   25.219 131.767 1.00 37.72  ? 156  ILE A CG2   1 
ATOM   971  C CD1   . ILE A 1 122 ? 6.661   22.206 131.908 1.00 38.03  ? 156  ILE A CD1   1 
ATOM   972  N N     . TYR A 1 123 ? 6.717   26.458 130.233 1.00 37.22  ? 157  TYR A N     1 
ATOM   973  C CA    . TYR A 1 123 ? 5.646   27.404 130.477 1.00 38.35  ? 157  TYR A CA    1 
ATOM   974  C C     . TYR A 1 123 ? 4.714   27.539 129.269 1.00 37.41  ? 157  TYR A C     1 
ATOM   975  O O     . TYR A 1 123 ? 3.499   27.656 129.433 1.00 35.08  ? 157  TYR A O     1 
ATOM   976  C CB    . TYR A 1 123 ? 6.236   28.761 130.846 1.00 41.62  ? 157  TYR A CB    1 
ATOM   977  C CG    . TYR A 1 123 ? 6.964   28.742 132.168 1.00 47.38  ? 157  TYR A CG    1 
ATOM   978  C CD1   . TYR A 1 123 ? 6.288   28.427 133.351 1.00 48.46  ? 157  TYR A CD1   1 
ATOM   979  C CD2   . TYR A 1 123 ? 8.316   29.073 132.246 1.00 49.34  ? 157  TYR A CD2   1 
ATOM   980  C CE1   . TYR A 1 123 ? 6.937   28.452 134.576 1.00 50.69  ? 157  TYR A CE1   1 
ATOM   981  C CE2   . TYR A 1 123 ? 8.978   29.101 133.469 1.00 51.91  ? 157  TYR A CE2   1 
ATOM   982  C CZ    . TYR A 1 123 ? 8.278   28.793 134.630 1.00 52.69  ? 157  TYR A CZ    1 
ATOM   983  O OH    . TYR A 1 123 ? 8.909   28.862 135.848 1.00 54.86  ? 157  TYR A OH    1 
ATOM   984  N N     . VAL A 1 124 ? 5.283   27.509 128.066 1.00 34.18  ? 158  VAL A N     1 
ATOM   985  C CA    . VAL A 1 124 ? 4.484   27.611 126.853 1.00 35.45  ? 158  VAL A CA    1 
ATOM   986  C C     . VAL A 1 124 ? 3.429   26.498 126.861 1.00 38.08  ? 158  VAL A C     1 
ATOM   987  O O     . VAL A 1 124 ? 2.250   26.726 126.534 1.00 36.84  ? 158  VAL A O     1 
ATOM   988  C CB    . VAL A 1 124 ? 5.377   27.495 125.585 1.00 34.99  ? 158  VAL A CB    1 
ATOM   989  C CG1   . VAL A 1 124 ? 4.519   27.450 124.343 1.00 30.34  ? 158  VAL A CG1   1 
ATOM   990  C CG2   . VAL A 1 124 ? 6.341   28.674 125.526 1.00 30.62  ? 158  VAL A CG2   1 
ATOM   991  N N     . LYS A 1 125 ? 3.856   25.304 127.269 1.00 37.78  ? 159  LYS A N     1 
ATOM   992  C CA    . LYS A 1 125 ? 2.963   24.155 127.350 1.00 38.41  ? 159  LYS A CA    1 
ATOM   993  C C     . LYS A 1 125 ? 1.898   24.361 128.429 1.00 38.97  ? 159  LYS A C     1 
ATOM   994  O O     . LYS A 1 125 ? 0.705   24.179 128.180 1.00 36.59  ? 159  LYS A O     1 
ATOM   995  C CB    . LYS A 1 125 ? 3.768   22.887 127.650 1.00 39.34  ? 159  LYS A CB    1 
ATOM   996  C CG    . LYS A 1 125 ? 4.717   22.502 126.533 1.00 40.89  ? 159  LYS A CG    1 
ATOM   997  C CD    . LYS A 1 125 ? 5.559   21.300 126.915 1.00 43.65  ? 159  LYS A CD    1 
ATOM   998  C CE    . LYS A 1 125 ? 6.615   21.025 125.864 1.00 43.76  ? 159  LYS A CE    1 
ATOM   999  N NZ    . LYS A 1 125 ? 7.434   19.849 126.234 1.00 48.12  ? 159  LYS A NZ    1 
ATOM   1000 N N     . LEU A 1 126 ? 2.338   24.742 129.625 1.00 38.50  ? 160  LEU A N     1 
ATOM   1001 C CA    . LEU A 1 126 ? 1.414   24.984 130.725 1.00 40.16  ? 160  LEU A CA    1 
ATOM   1002 C C     . LEU A 1 126 ? 0.359   26.024 130.399 1.00 39.30  ? 160  LEU A C     1 
ATOM   1003 O O     . LEU A 1 126 ? -0.819  25.833 130.684 1.00 40.52  ? 160  LEU A O     1 
ATOM   1004 C CB    . LEU A 1 126 ? 2.169   25.442 131.970 1.00 39.93  ? 160  LEU A CB    1 
ATOM   1005 C CG    . LEU A 1 126 ? 2.742   24.323 132.828 1.00 45.40  ? 160  LEU A CG    1 
ATOM   1006 C CD1   . LEU A 1 126 ? 3.686   24.925 133.860 1.00 46.96  ? 160  LEU A CD1   1 
ATOM   1007 C CD2   . LEU A 1 126 ? 1.601   23.555 133.495 1.00 45.99  ? 160  LEU A CD2   1 
ATOM   1008 N N     . TYR A 1 127 ? 0.788   27.137 129.816 1.00 38.79  ? 161  TYR A N     1 
ATOM   1009 C CA    . TYR A 1 127 ? -0.150  28.195 129.487 1.00 37.02  ? 161  TYR A CA    1 
ATOM   1010 C C     . TYR A 1 127 ? -1.071  27.822 128.327 1.00 35.10  ? 161  TYR A C     1 
ATOM   1011 O O     . TYR A 1 127 ? -2.272  28.007 128.424 1.00 32.54  ? 161  TYR A O     1 
ATOM   1012 C CB    . TYR A 1 127 ? 0.588   29.498 129.172 1.00 36.58  ? 161  TYR A CB    1 
ATOM   1013 C CG    . TYR A 1 127 ? 1.478   29.997 130.294 1.00 39.68  ? 161  TYR A CG    1 
ATOM   1014 C CD1   . TYR A 1 127 ? 1.227   29.643 131.615 1.00 40.70  ? 161  TYR A CD1   1 
ATOM   1015 C CD2   . TYR A 1 127 ? 2.564   30.836 130.030 1.00 38.84  ? 161  TYR A CD2   1 
ATOM   1016 C CE1   . TYR A 1 127 ? 2.028   30.103 132.646 1.00 42.61  ? 161  TYR A CE1   1 
ATOM   1017 C CE2   . TYR A 1 127 ? 3.372   31.308 131.058 1.00 41.11  ? 161  TYR A CE2   1 
ATOM   1018 C CZ    . TYR A 1 127 ? 3.098   30.937 132.367 1.00 42.71  ? 161  TYR A CZ    1 
ATOM   1019 O OH    . TYR A 1 127 ? 3.872   31.407 133.407 1.00 45.18  ? 161  TYR A OH    1 
ATOM   1020 N N     . MET A 1 128 ? -0.512  27.299 127.238 1.00 34.98  ? 162  MET A N     1 
ATOM   1021 C CA    . MET A 1 128 ? -1.326  26.934 126.085 1.00 34.93  ? 162  MET A CA    1 
ATOM   1022 C C     . MET A 1 128 ? -2.327  25.841 126.421 1.00 36.12  ? 162  MET A C     1 
ATOM   1023 O O     . MET A 1 128 ? -3.488  25.884 125.993 1.00 35.63  ? 162  MET A O     1 
ATOM   1024 C CB    . MET A 1 128 ? -0.442  26.499 124.920 1.00 33.35  ? 162  MET A CB    1 
ATOM   1025 C CG    . MET A 1 128 ? 0.374   27.646 124.331 1.00 36.20  ? 162  MET A CG    1 
ATOM   1026 S SD    . MET A 1 128 ? -0.679  29.047 123.833 1.00 38.41  ? 162  MET A SD    1 
ATOM   1027 C CE    . MET A 1 128 ? -1.818  28.233 122.638 1.00 37.18  ? 162  MET A CE    1 
ATOM   1028 N N     . TYR A 1 129 ? -1.879  24.871 127.205 1.00 36.12  ? 163  TYR A N     1 
ATOM   1029 C CA    . TYR A 1 129 ? -2.734  23.778 127.609 1.00 35.39  ? 163  TYR A CA    1 
ATOM   1030 C C     . TYR A 1 129 ? -3.924  24.296 128.401 1.00 35.38  ? 163  TYR A C     1 
ATOM   1031 O O     . TYR A 1 129 ? -5.062  23.859 128.188 1.00 35.60  ? 163  TYR A O     1 
ATOM   1032 C CB    . TYR A 1 129 ? -1.957  22.781 128.456 1.00 37.52  ? 163  TYR A CB    1 
ATOM   1033 C CG    . TYR A 1 129 ? -2.809  21.634 128.921 1.00 42.50  ? 163  TYR A CG    1 
ATOM   1034 C CD1   . TYR A 1 129 ? -3.014  20.517 128.112 1.00 41.79  ? 163  TYR A CD1   1 
ATOM   1035 C CD2   . TYR A 1 129 ? -3.445  21.680 130.157 1.00 41.77  ? 163  TYR A CD2   1 
ATOM   1036 C CE1   . TYR A 1 129 ? -3.825  19.481 128.529 1.00 43.41  ? 163  TYR A CE1   1 
ATOM   1037 C CE2   . TYR A 1 129 ? -4.254  20.655 130.579 1.00 45.15  ? 163  TYR A CE2   1 
ATOM   1038 C CZ    . TYR A 1 129 ? -4.438  19.555 129.766 1.00 44.31  ? 163  TYR A CZ    1 
ATOM   1039 O OH    . TYR A 1 129 ? -5.205  18.516 130.225 1.00 48.23  ? 163  TYR A OH    1 
ATOM   1040 N N     . GLN A 1 130 ? -3.685  25.227 129.321 1.00 35.26  ? 164  GLN A N     1 
ATOM   1041 C CA    . GLN A 1 130 ? -4.792  25.757 130.105 1.00 33.84  ? 164  GLN A CA    1 
ATOM   1042 C C     . GLN A 1 130 ? -5.704  26.660 129.279 1.00 33.94  ? 164  GLN A C     1 
ATOM   1043 O O     . GLN A 1 130 ? -6.919  26.716 129.528 1.00 32.03  ? 164  GLN A O     1 
ATOM   1044 C CB    . GLN A 1 130 ? -4.268  26.495 131.341 1.00 34.05  ? 164  GLN A CB    1 
ATOM   1045 C CG    . GLN A 1 130 ? -3.611  25.541 132.356 1.00 35.39  ? 164  GLN A CG    1 
ATOM   1046 C CD    . GLN A 1 130 ? -2.915  26.270 133.488 1.00 33.55  ? 164  GLN A CD    1 
ATOM   1047 O OE1   . GLN A 1 130 ? -3.535  26.667 134.470 1.00 34.80  ? 164  GLN A OE1   1 
ATOM   1048 N NE2   . GLN A 1 130 ? -1.612  26.464 133.341 1.00 34.72  ? 164  GLN A NE2   1 
ATOM   1049 N N     . LEU A 1 131 ? -5.126  27.363 128.304 1.00 31.00  ? 165  LEU A N     1 
ATOM   1050 C CA    . LEU A 1 131 ? -5.923  28.236 127.451 1.00 32.05  ? 165  LEU A CA    1 
ATOM   1051 C C     . LEU A 1 131 ? -6.915  27.369 126.659 1.00 31.49  ? 165  LEU A C     1 
ATOM   1052 O O     . LEU A 1 131 ? -8.102  27.671 126.608 1.00 28.43  ? 165  LEU A O     1 
ATOM   1053 C CB    . LEU A 1 131 ? -5.029  29.047 126.481 1.00 28.26  ? 165  LEU A CB    1 
ATOM   1054 C CG    . LEU A 1 131 ? -5.750  29.677 125.273 1.00 28.90  ? 165  LEU A CG    1 
ATOM   1055 C CD1   . LEU A 1 131 ? -6.888  30.557 125.782 1.00 26.52  ? 165  LEU A CD1   1 
ATOM   1056 C CD2   . LEU A 1 131 ? -4.791  30.505 124.419 1.00 27.13  ? 165  LEU A CD2   1 
ATOM   1057 N N     . PHE A 1 132 ? -6.427  26.286 126.063 1.00 32.07  ? 166  PHE A N     1 
ATOM   1058 C CA    . PHE A 1 132 ? -7.308  25.414 125.292 1.00 36.36  ? 166  PHE A CA    1 
ATOM   1059 C C     . PHE A 1 132 ? -8.412  24.810 126.152 1.00 38.64  ? 166  PHE A C     1 
ATOM   1060 O O     . PHE A 1 132 ? -9.562  24.690 125.716 1.00 38.44  ? 166  PHE A O     1 
ATOM   1061 C CB    . PHE A 1 132 ? -6.508  24.309 124.609 1.00 34.31  ? 166  PHE A CB    1 
ATOM   1062 C CG    . PHE A 1 132 ? -5.716  24.788 123.431 1.00 37.42  ? 166  PHE A CG    1 
ATOM   1063 C CD1   . PHE A 1 132 ? -6.323  25.557 122.437 1.00 35.92  ? 166  PHE A CD1   1 
ATOM   1064 C CD2   . PHE A 1 132 ? -4.364  24.492 123.311 1.00 37.95  ? 166  PHE A CD2   1 
ATOM   1065 C CE1   . PHE A 1 132 ? -5.600  26.023 121.352 1.00 33.07  ? 166  PHE A CE1   1 
ATOM   1066 C CE2   . PHE A 1 132 ? -3.629  24.958 122.218 1.00 37.57  ? 166  PHE A CE2   1 
ATOM   1067 C CZ    . PHE A 1 132 ? -4.253  25.727 121.238 1.00 33.19  ? 166  PHE A CZ    1 
ATOM   1068 N N     . ARG A 1 133 ? -8.066  24.461 127.384 1.00 39.16  ? 167  ARG A N     1 
ATOM   1069 C CA    . ARG A 1 133 ? -9.043  23.877 128.279 1.00 40.38  ? 167  ARG A CA    1 
ATOM   1070 C C     . ARG A 1 133 ? -10.154 24.873 128.575 1.00 40.56  ? 167  ARG A C     1 
ATOM   1071 O O     . ARG A 1 133 ? -11.324 24.501 128.623 1.00 42.44  ? 167  ARG A O     1 
ATOM   1072 C CB    . ARG A 1 133 ? -8.363  23.410 129.566 1.00 42.83  ? 167  ARG A CB    1 
ATOM   1073 C CG    . ARG A 1 133 ? -9.257  22.559 130.427 1.00 47.75  ? 167  ARG A CG    1 
ATOM   1074 C CD    . ARG A 1 133 ? -8.517  21.888 131.563 1.00 49.33  ? 167  ARG A CD    1 
ATOM   1075 N NE    . ARG A 1 133 ? -9.478  21.412 132.550 1.00 53.82  ? 167  ARG A NE    1 
ATOM   1076 C CZ    . ARG A 1 133 ? -9.163  20.893 133.731 1.00 55.70  ? 167  ARG A CZ    1 
ATOM   1077 N NH1   . ARG A 1 133 ? -7.889  20.769 134.089 1.00 55.66  ? 167  ARG A NH1   1 
ATOM   1078 N NH2   . ARG A 1 133 ? -10.134 20.512 134.559 1.00 55.43  ? 167  ARG A NH2   1 
ATOM   1079 N N     . SER A 1 134 ? -9.809  26.146 128.753 1.00 40.58  ? 168  SER A N     1 
ATOM   1080 C CA    . SER A 1 134 ? -10.836 27.154 129.028 1.00 39.38  ? 168  SER A CA    1 
ATOM   1081 C C     . SER A 1 134 ? -11.698 27.342 127.780 1.00 39.29  ? 168  SER A C     1 
ATOM   1082 O O     . SER A 1 134 ? -12.874 27.696 127.871 1.00 39.99  ? 168  SER A O     1 
ATOM   1083 C CB    . SER A 1 134 ? -10.210 28.494 129.415 1.00 38.82  ? 168  SER A CB    1 
ATOM   1084 O OG    . SER A 1 134 ? -9.554  29.086 128.304 1.00 39.89  ? 168  SER A OG    1 
ATOM   1085 N N     . LEU A 1 135 ? -11.099 27.104 126.618 1.00 38.33  ? 169  LEU A N     1 
ATOM   1086 C CA    . LEU A 1 135 ? -11.796 27.247 125.348 1.00 39.26  ? 169  LEU A CA    1 
ATOM   1087 C C     . LEU A 1 135 ? -12.768 26.077 125.150 1.00 40.24  ? 169  LEU A C     1 
ATOM   1088 O O     . LEU A 1 135 ? -13.896 26.259 124.681 1.00 39.88  ? 169  LEU A O     1 
ATOM   1089 C CB    . LEU A 1 135 ? -10.776 27.319 124.204 1.00 37.99  ? 169  LEU A CB    1 
ATOM   1090 C CG    . LEU A 1 135 ? -10.543 28.658 123.478 1.00 42.39  ? 169  LEU A CG    1 
ATOM   1091 C CD1   . LEU A 1 135 ? -11.081 29.839 124.284 1.00 37.29  ? 169  LEU A CD1   1 
ATOM   1092 C CD2   . LEU A 1 135 ? -9.042  28.821 123.197 1.00 36.72  ? 169  LEU A CD2   1 
ATOM   1093 N N     . ALA A 1 136 ? -12.329 24.876 125.513 1.00 39.63  ? 170  ALA A N     1 
ATOM   1094 C CA    . ALA A 1 136 ? -13.172 23.693 125.399 1.00 39.97  ? 170  ALA A CA    1 
ATOM   1095 C C     . ALA A 1 136 ? -14.411 23.906 126.253 1.00 43.04  ? 170  ALA A C     1 
ATOM   1096 O O     . ALA A 1 136 ? -15.523 23.552 125.858 1.00 45.39  ? 170  ALA A O     1 
ATOM   1097 C CB    . ALA A 1 136 ? -12.425 22.466 125.878 1.00 37.73  ? 170  ALA A CB    1 
ATOM   1098 N N     . TYR A 1 137 ? -14.223 24.522 127.416 1.00 42.80  ? 171  TYR A N     1 
ATOM   1099 C CA    . TYR A 1 137 ? -15.341 24.763 128.314 1.00 42.73  ? 171  TYR A CA    1 
ATOM   1100 C C     . TYR A 1 137 ? -16.328 25.820 127.812 1.00 44.13  ? 171  TYR A C     1 
ATOM   1101 O O     . TYR A 1 137 ? -17.520 25.541 127.717 1.00 46.38  ? 171  TYR A O     1 
ATOM   1102 C CB    . TYR A 1 137 ? -14.810 25.119 129.710 1.00 43.43  ? 171  TYR A CB    1 
ATOM   1103 C CG    . TYR A 1 137 ? -15.871 25.452 130.735 1.00 42.97  ? 171  TYR A CG    1 
ATOM   1104 C CD1   . TYR A 1 137 ? -16.173 26.773 131.048 1.00 43.30  ? 171  TYR A CD1   1 
ATOM   1105 C CD2   . TYR A 1 137 ? -16.574 24.443 131.399 1.00 45.27  ? 171  TYR A CD2   1 
ATOM   1106 C CE1   . TYR A 1 137 ? -17.148 27.084 131.998 1.00 44.77  ? 171  TYR A CE1   1 
ATOM   1107 C CE2   . TYR A 1 137 ? -17.551 24.743 132.351 1.00 42.45  ? 171  TYR A CE2   1 
ATOM   1108 C CZ    . TYR A 1 137 ? -17.829 26.062 132.642 1.00 43.42  ? 171  TYR A CZ    1 
ATOM   1109 O OH    . TYR A 1 137 ? -18.788 26.367 133.572 1.00 45.68  ? 171  TYR A OH    1 
ATOM   1110 N N     . ILE A 1 138 ? -15.860 27.020 127.480 1.00 43.83  ? 172  ILE A N     1 
ATOM   1111 C CA    . ILE A 1 138 ? -16.782 28.055 127.008 1.00 43.35  ? 172  ILE A CA    1 
ATOM   1112 C C     . ILE A 1 138 ? -17.449 27.668 125.686 1.00 43.85  ? 172  ILE A C     1 
ATOM   1113 O O     . ILE A 1 138 ? -18.596 28.029 125.424 1.00 43.33  ? 172  ILE A O     1 
ATOM   1114 C CB    . ILE A 1 138 ? -16.078 29.403 126.822 1.00 42.72  ? 172  ILE A CB    1 
ATOM   1115 C CG1   . ILE A 1 138 ? -14.987 29.270 125.755 1.00 42.96  ? 172  ILE A CG1   1 
ATOM   1116 C CG2   . ILE A 1 138 ? -15.518 29.872 128.155 1.00 43.16  ? 172  ILE A CG2   1 
ATOM   1117 C CD1   . ILE A 1 138 ? -14.322 30.573 125.388 1.00 40.88  ? 172  ILE A CD1   1 
ATOM   1118 N N     . HIS A 1 139 ? -16.728 26.936 124.849 1.00 43.35  ? 173  HIS A N     1 
ATOM   1119 C CA    . HIS A 1 139 ? -17.291 26.512 123.579 1.00 44.31  ? 173  HIS A CA    1 
ATOM   1120 C C     . HIS A 1 139 ? -18.362 25.442 123.808 1.00 46.09  ? 173  HIS A C     1 
ATOM   1121 O O     . HIS A 1 139 ? -19.326 25.354 123.053 1.00 44.54  ? 173  HIS A O     1 
ATOM   1122 C CB    . HIS A 1 139 ? -16.200 25.964 122.650 1.00 40.90  ? 173  HIS A CB    1 
ATOM   1123 C CG    . HIS A 1 139 ? -15.282 27.013 122.097 1.00 41.13  ? 173  HIS A CG    1 
ATOM   1124 N ND1   . HIS A 1 139 ? -14.265 26.719 121.213 1.00 39.95  ? 173  HIS A ND1   1 
ATOM   1125 C CD2   . HIS A 1 139 ? -15.221 28.350 122.308 1.00 40.58  ? 173  HIS A CD2   1 
ATOM   1126 C CE1   . HIS A 1 139 ? -13.617 27.828 120.903 1.00 35.67  ? 173  HIS A CE1   1 
ATOM   1127 N NE2   . HIS A 1 139 ? -14.175 28.831 121.554 1.00 37.08  ? 173  HIS A NE2   1 
ATOM   1128 N N     . SER A 1 140 ? -18.202 24.630 124.849 1.00 48.16  ? 174  SER A N     1 
ATOM   1129 C CA    . SER A 1 140 ? -19.184 23.586 125.121 1.00 49.66  ? 174  SER A CA    1 
ATOM   1130 C C     . SER A 1 140 ? -20.543 24.225 125.388 1.00 51.71  ? 174  SER A C     1 
ATOM   1131 O O     . SER A 1 140 ? -21.579 23.576 125.245 1.00 53.30  ? 174  SER A O     1 
ATOM   1132 C CB    . SER A 1 140 ? -18.781 22.760 126.332 1.00 47.94  ? 174  SER A CB    1 
ATOM   1133 O OG    . SER A 1 140 ? -19.111 23.463 127.512 1.00 49.18  ? 174  SER A OG    1 
ATOM   1134 N N     . PHE A 1 141 ? -20.529 25.489 125.802 1.00 51.99  ? 175  PHE A N     1 
ATOM   1135 C CA    . PHE A 1 141 ? -21.759 26.232 126.069 1.00 52.68  ? 175  PHE A CA    1 
ATOM   1136 C C     . PHE A 1 141 ? -22.123 27.046 124.841 1.00 52.03  ? 175  PHE A C     1 
ATOM   1137 O O     . PHE A 1 141 ? -22.977 27.933 124.911 1.00 51.89  ? 175  PHE A O     1 
ATOM   1138 C CB    . PHE A 1 141 ? -21.585 27.210 127.230 1.00 55.98  ? 175  PHE A CB    1 
ATOM   1139 C CG    . PHE A 1 141 ? -21.665 26.579 128.579 1.00 60.74  ? 175  PHE A CG    1 
ATOM   1140 C CD1   . PHE A 1 141 ? -20.547 25.982 129.152 1.00 62.11  ? 175  PHE A CD1   1 
ATOM   1141 C CD2   . PHE A 1 141 ? -22.861 26.590 129.287 1.00 62.69  ? 175  PHE A CD2   1 
ATOM   1142 C CE1   . PHE A 1 141 ? -20.618 25.406 130.415 1.00 63.08  ? 175  PHE A CE1   1 
ATOM   1143 C CE2   . PHE A 1 141 ? -22.945 26.015 130.554 1.00 65.07  ? 175  PHE A CE2   1 
ATOM   1144 C CZ    . PHE A 1 141 ? -21.820 25.423 131.120 1.00 64.04  ? 175  PHE A CZ    1 
ATOM   1145 N N     . GLY A 1 142 ? -21.456 26.756 123.727 1.00 50.72  ? 176  GLY A N     1 
ATOM   1146 C CA    . GLY A 1 142 ? -21.701 27.487 122.498 1.00 48.60  ? 176  GLY A CA    1 
ATOM   1147 C C     . GLY A 1 142 ? -21.275 28.943 122.590 1.00 48.08  ? 176  GLY A C     1 
ATOM   1148 O O     . GLY A 1 142 ? -21.710 29.771 121.781 1.00 46.75  ? 176  GLY A O     1 
ATOM   1149 N N     . ILE A 1 143 ? -20.426 29.261 123.568 1.00 46.25  ? 177  ILE A N     1 
ATOM   1150 C CA    . ILE A 1 143 ? -19.946 30.633 123.766 1.00 44.86  ? 177  ILE A CA    1 
ATOM   1151 C C     . ILE A 1 143 ? -18.571 30.846 123.140 1.00 42.76  ? 177  ILE A C     1 
ATOM   1152 O O     . ILE A 1 143 ? -17.662 30.028 123.301 1.00 43.46  ? 177  ILE A O     1 
ATOM   1153 C CB    . ILE A 1 143 ? -19.865 30.994 125.271 1.00 47.36  ? 177  ILE A CB    1 
ATOM   1154 C CG1   . ILE A 1 143 ? -21.260 30.963 125.888 1.00 46.55  ? 177  ILE A CG1   1 
ATOM   1155 C CG2   . ILE A 1 143 ? -19.266 32.395 125.457 1.00 46.95  ? 177  ILE A CG2   1 
ATOM   1156 C CD1   . ILE A 1 143 ? -21.240 30.915 127.398 1.00 49.57  ? 177  ILE A CD1   1 
ATOM   1157 N N     . CYS A 1 144 ? -18.439 31.958 122.423 1.00 40.32  ? 178  CYS A N     1 
ATOM   1158 C CA    . CYS A 1 144 ? -17.197 32.325 121.751 1.00 37.83  ? 178  CYS A CA    1 
ATOM   1159 C C     . CYS A 1 144 ? -16.647 33.613 122.374 1.00 35.10  ? 178  CYS A C     1 
ATOM   1160 O O     . CYS A 1 144 ? -17.337 34.633 122.401 1.00 33.77  ? 178  CYS A O     1 
ATOM   1161 C CB    . CYS A 1 144 ? -17.476 32.529 120.268 1.00 40.41  ? 178  CYS A CB    1 
ATOM   1162 S SG    . CYS A 1 144 ? -16.053 32.936 119.284 1.00 41.85  ? 178  CYS A SG    1 
ATOM   1163 N N     . HIS A 1 145 ? -15.409 33.554 122.871 1.00 33.02  ? 179  HIS A N     1 
ATOM   1164 C CA    . HIS A 1 145 ? -14.737 34.696 123.518 1.00 31.89  ? 179  HIS A CA    1 
ATOM   1165 C C     . HIS A 1 145 ? -14.588 35.884 122.562 1.00 34.37  ? 179  HIS A C     1 
ATOM   1166 O O     . HIS A 1 145 ? -14.901 37.036 122.905 1.00 31.61  ? 179  HIS A O     1 
ATOM   1167 C CB    . HIS A 1 145 ? -13.359 34.254 124.039 1.00 29.95  ? 179  HIS A CB    1 
ATOM   1168 C CG    . HIS A 1 145 ? -12.684 35.272 124.909 1.00 31.56  ? 179  HIS A CG    1 
ATOM   1169 N ND1   . HIS A 1 145 ? -12.038 36.381 124.398 1.00 30.46  ? 179  HIS A ND1   1 
ATOM   1170 C CD2   . HIS A 1 145 ? -12.623 35.387 126.259 1.00 27.03  ? 179  HIS A CD2   1 
ATOM   1171 C CE1   . HIS A 1 145 ? -11.615 37.137 125.398 1.00 30.66  ? 179  HIS A CE1   1 
ATOM   1172 N NE2   . HIS A 1 145 ? -11.958 36.557 126.536 1.00 29.56  ? 179  HIS A NE2   1 
ATOM   1173 N N     . ARG A 1 146 ? -14.100 35.588 121.362 1.00 35.02  ? 180  ARG A N     1 
ATOM   1174 C CA    . ARG A 1 146 ? -13.914 36.594 120.325 1.00 38.15  ? 180  ARG A CA    1 
ATOM   1175 C C     . ARG A 1 146 ? -12.860 37.640 120.651 1.00 37.56  ? 180  ARG A C     1 
ATOM   1176 O O     . ARG A 1 146 ? -12.755 38.652 119.970 1.00 39.70  ? 180  ARG A O     1 
ATOM   1177 C CB    . ARG A 1 146 ? -15.243 37.275 119.991 1.00 38.25  ? 180  ARG A CB    1 
ATOM   1178 C CG    . ARG A 1 146 ? -16.285 36.318 119.431 1.00 39.44  ? 180  ARG A CG    1 
ATOM   1179 C CD    . ARG A 1 146 ? -17.334 37.065 118.637 1.00 39.27  ? 180  ARG A CD    1 
ATOM   1180 N NE    . ARG A 1 146 ? -18.007 38.058 119.465 1.00 41.05  ? 180  ARG A NE    1 
ATOM   1181 C CZ    . ARG A 1 146 ? -18.874 38.962 119.014 1.00 41.17  ? 180  ARG A CZ    1 
ATOM   1182 N NH1   . ARG A 1 146 ? -19.185 39.016 117.720 1.00 38.43  ? 180  ARG A NH1   1 
ATOM   1183 N NH2   . ARG A 1 146 ? -19.438 39.807 119.868 1.00 37.82  ? 180  ARG A NH2   1 
ATOM   1184 N N     . ASP A 1 147 ? -12.071 37.410 121.691 1.00 36.62  ? 181  ASP A N     1 
ATOM   1185 C CA    . ASP A 1 147 ? -11.031 38.376 121.988 1.00 36.27  ? 181  ASP A CA    1 
ATOM   1186 C C     . ASP A 1 147 ? -9.796  37.768 122.640 1.00 33.04  ? 181  ASP A C     1 
ATOM   1187 O O     . ASP A 1 147 ? -9.165  38.381 123.496 1.00 32.62  ? 181  ASP A O     1 
ATOM   1188 C CB    . ASP A 1 147 ? -11.599 39.512 122.845 1.00 37.24  ? 181  ASP A CB    1 
ATOM   1189 C CG    . ASP A 1 147 ? -10.667 40.708 122.906 1.00 39.54  ? 181  ASP A CG    1 
ATOM   1190 O OD1   . ASP A 1 147 ? -9.885  40.901 121.945 1.00 39.14  ? 181  ASP A OD1   1 
ATOM   1191 O OD2   . ASP A 1 147 ? -10.724 41.458 123.909 1.00 41.42  ? 181  ASP A OD2   1 
ATOM   1192 N N     . ILE A 1 148 ? -9.461  36.552 122.234 1.00 28.98  ? 182  ILE A N     1 
ATOM   1193 C CA    . ILE A 1 148 ? -8.301  35.866 122.766 1.00 27.81  ? 182  ILE A CA    1 
ATOM   1194 C C     . ILE A 1 148 ? -7.016  36.601 122.362 1.00 28.77  ? 182  ILE A C     1 
ATOM   1195 O O     . ILE A 1 148 ? -6.811  36.901 121.183 1.00 28.27  ? 182  ILE A O     1 
ATOM   1196 C CB    . ILE A 1 148 ? -8.208  34.418 122.220 1.00 29.11  ? 182  ILE A CB    1 
ATOM   1197 C CG1   . ILE A 1 148 ? -9.478  33.633 122.582 1.00 29.22  ? 182  ILE A CG1   1 
ATOM   1198 C CG2   . ILE A 1 148 ? -6.938  33.731 122.768 1.00 27.52  ? 182  ILE A CG2   1 
ATOM   1199 C CD1   . ILE A 1 148 ? -9.754  33.534 124.072 1.00 29.52  ? 182  ILE A CD1   1 
ATOM   1200 N N     . LYS A 1 149 ? -6.165  36.874 123.350 1.00 27.56  ? 183  LYS A N     1 
ATOM   1201 C CA    . LYS A 1 149 ? -4.871  37.540 123.166 1.00 28.66  ? 183  LYS A CA    1 
ATOM   1202 C C     . LYS A 1 149 ? -4.116  37.493 124.515 1.00 27.25  ? 183  LYS A C     1 
ATOM   1203 O O     . LYS A 1 149 ? -4.721  37.395 125.573 1.00 26.64  ? 183  LYS A O     1 
ATOM   1204 C CB    . LYS A 1 149 ? -5.050  38.989 122.709 1.00 28.07  ? 183  LYS A CB    1 
ATOM   1205 C CG    . LYS A 1 149 ? -5.767  39.857 123.691 1.00 27.51  ? 183  LYS A CG    1 
ATOM   1206 C CD    . LYS A 1 149 ? -5.886  41.243 123.117 1.00 34.27  ? 183  LYS A CD    1 
ATOM   1207 C CE    . LYS A 1 149 ? -6.682  42.130 124.038 1.00 35.07  ? 183  LYS A CE    1 
ATOM   1208 N NZ    . LYS A 1 149 ? -6.773  43.471 123.436 1.00 39.87  ? 183  LYS A NZ    1 
ATOM   1209 N N     . PRO A 1 150 ? -2.780  37.581 124.480 1.00 27.57  ? 184  PRO A N     1 
ATOM   1210 C CA    . PRO A 1 150 ? -1.955  37.527 125.697 1.00 26.43  ? 184  PRO A CA    1 
ATOM   1211 C C     . PRO A 1 150 ? -2.433  38.388 126.865 1.00 26.94  ? 184  PRO A C     1 
ATOM   1212 O O     . PRO A 1 150 ? -2.416  37.945 128.021 1.00 24.95  ? 184  PRO A O     1 
ATOM   1213 C CB    . PRO A 1 150 ? -0.570  37.943 125.192 1.00 28.72  ? 184  PRO A CB    1 
ATOM   1214 C CG    . PRO A 1 150 ? -0.574  37.512 123.740 1.00 29.73  ? 184  PRO A CG    1 
ATOM   1215 C CD    . PRO A 1 150 ? -1.962  37.926 123.295 1.00 28.18  ? 184  PRO A CD    1 
ATOM   1216 N N     . GLN A 1 151 ? -2.848  39.617 126.570 1.00 25.32  ? 185  GLN A N     1 
ATOM   1217 C CA    . GLN A 1 151 ? -3.324  40.531 127.600 1.00 28.22  ? 185  GLN A CA    1 
ATOM   1218 C C     . GLN A 1 151 ? -4.557  40.014 128.330 1.00 31.41  ? 185  GLN A C     1 
ATOM   1219 O O     . GLN A 1 151 ? -4.867  40.491 129.428 1.00 31.59  ? 185  GLN A O     1 
ATOM   1220 C CB    . GLN A 1 151 ? -3.677  41.909 127.015 1.00 29.11  ? 185  GLN A CB    1 
ATOM   1221 C CG    . GLN A 1 151 ? -2.552  42.682 126.311 1.00 31.52  ? 185  GLN A CG    1 
ATOM   1222 C CD    . GLN A 1 151 ? -2.265  42.166 124.906 1.00 36.28  ? 185  GLN A CD    1 
ATOM   1223 O OE1   . GLN A 1 151 ? -1.501  42.780 124.156 1.00 44.17  ? 185  GLN A OE1   1 
ATOM   1224 N NE2   . GLN A 1 151 ? -2.867  41.044 124.544 1.00 35.31  ? 185  GLN A NE2   1 
ATOM   1225 N N     . ASN A 1 152 ? -5.279  39.062 127.741 1.00 29.58  ? 186  ASN A N     1 
ATOM   1226 C CA    . ASN A 1 152 ? -6.472  38.570 128.416 1.00 31.86  ? 186  ASN A CA    1 
ATOM   1227 C C     . ASN A 1 152 ? -6.251  37.226 129.092 1.00 31.80  ? 186  ASN A C     1 
ATOM   1228 O O     . ASN A 1 152 ? -7.200  36.541 129.490 1.00 30.55  ? 186  ASN A O     1 
ATOM   1229 C CB    . ASN A 1 152 ? -7.667  38.518 127.444 1.00 32.25  ? 186  ASN A CB    1 
ATOM   1230 C CG    . ASN A 1 152 ? -8.145  39.912 127.032 1.00 32.70  ? 186  ASN A CG    1 
ATOM   1231 O OD1   . ASN A 1 152 ? -7.912  40.893 127.743 1.00 33.05  ? 186  ASN A OD1   1 
ATOM   1232 N ND2   . ASN A 1 152 ? -8.826  40.000 125.892 1.00 27.99  ? 186  ASN A ND2   1 
ATOM   1233 N N     . LEU A 1 153 ? -4.986  36.853 129.226 1.00 31.49  ? 187  LEU A N     1 
ATOM   1234 C CA    . LEU A 1 153 ? -4.632  35.608 129.886 1.00 31.93  ? 187  LEU A CA    1 
ATOM   1235 C C     . LEU A 1 153 ? -3.924  35.966 131.196 1.00 32.90  ? 187  LEU A C     1 
ATOM   1236 O O     . LEU A 1 153 ? -2.741  36.335 131.199 1.00 33.63  ? 187  LEU A O     1 
ATOM   1237 C CB    . LEU A 1 153 ? -3.730  34.753 128.980 1.00 28.25  ? 187  LEU A CB    1 
ATOM   1238 C CG    . LEU A 1 153 ? -4.228  34.532 127.535 1.00 31.99  ? 187  LEU A CG    1 
ATOM   1239 C CD1   . LEU A 1 153 ? -3.246  33.640 126.784 1.00 28.57  ? 187  LEU A CD1   1 
ATOM   1240 C CD2   . LEU A 1 153 ? -5.616  33.896 127.532 1.00 31.05  ? 187  LEU A CD2   1 
ATOM   1241 N N     . LEU A 1 154 ? -4.676  35.892 132.296 1.00 33.93  ? 188  LEU A N     1 
ATOM   1242 C CA    . LEU A 1 154 ? -4.170  36.190 133.637 1.00 35.80  ? 188  LEU A CA    1 
ATOM   1243 C C     . LEU A 1 154 ? -3.394  34.987 134.172 1.00 37.28  ? 188  LEU A C     1 
ATOM   1244 O O     . LEU A 1 154 ? -3.751  33.838 133.909 1.00 36.11  ? 188  LEU A O     1 
ATOM   1245 C CB    . LEU A 1 154 ? -5.333  36.521 134.581 1.00 35.17  ? 188  LEU A CB    1 
ATOM   1246 C CG    . LEU A 1 154 ? -6.313  37.602 134.101 1.00 39.41  ? 188  LEU A CG    1 
ATOM   1247 C CD1   . LEU A 1 154 ? -7.399  37.812 135.154 1.00 39.67  ? 188  LEU A CD1   1 
ATOM   1248 C CD2   . LEU A 1 154 ? -5.580  38.899 133.830 1.00 38.26  ? 188  LEU A CD2   1 
ATOM   1249 N N     . LEU A 1 155 ? -2.334  35.258 134.923 1.00 39.50  ? 189  LEU A N     1 
ATOM   1250 C CA    . LEU A 1 155 ? -1.491  34.195 135.460 1.00 43.08  ? 189  LEU A CA    1 
ATOM   1251 C C     . LEU A 1 155 ? -1.184  34.354 136.934 1.00 44.32  ? 189  LEU A C     1 
ATOM   1252 O O     . LEU A 1 155 ? -1.067  35.461 137.438 1.00 43.85  ? 189  LEU A O     1 
ATOM   1253 C CB    . LEU A 1 155 ? -0.153  34.152 134.715 1.00 42.97  ? 189  LEU A CB    1 
ATOM   1254 C CG    . LEU A 1 155 ? -0.088  33.685 133.271 1.00 45.06  ? 189  LEU A CG    1 
ATOM   1255 C CD1   . LEU A 1 155 ? 1.363   33.764 132.793 1.00 44.83  ? 189  LEU A CD1   1 
ATOM   1256 C CD2   . LEU A 1 155 ? -0.607  32.257 133.169 1.00 44.50  ? 189  LEU A CD2   1 
ATOM   1257 N N     . ASP A 1 156 ? -1.037  33.230 137.615 1.00 49.63  ? 190  ASP A N     1 
ATOM   1258 C CA    . ASP A 1 156 ? -0.685  33.237 139.026 1.00 55.60  ? 190  ASP A CA    1 
ATOM   1259 C C     . ASP A 1 156 ? 0.818   32.913 139.058 1.00 57.71  ? 190  ASP A C     1 
ATOM   1260 O O     . ASP A 1 156 ? 1.234   31.816 138.673 1.00 57.31  ? 190  ASP A O     1 
ATOM   1261 C CB    . ASP A 1 156 ? -1.463  32.158 139.778 1.00 57.71  ? 190  ASP A CB    1 
ATOM   1262 C CG    . ASP A 1 156 ? -1.272  32.244 141.286 1.00 62.74  ? 190  ASP A CG    1 
ATOM   1263 O OD1   . ASP A 1 156 ? -0.209  32.740 141.728 1.00 63.84  ? 190  ASP A OD1   1 
ATOM   1264 O OD2   . ASP A 1 156 ? -2.182  31.805 142.032 1.00 65.09  ? 190  ASP A OD2   1 
ATOM   1265 N N     . PRO A 1 157 ? 1.646   33.871 139.499 1.00 60.26  ? 191  PRO A N     1 
ATOM   1266 C CA    . PRO A 1 157 ? 3.102   33.707 139.582 1.00 62.42  ? 191  PRO A CA    1 
ATOM   1267 C C     . PRO A 1 157 ? 3.558   32.376 140.174 1.00 63.22  ? 191  PRO A C     1 
ATOM   1268 O O     . PRO A 1 157 ? 4.332   31.640 139.556 1.00 63.75  ? 191  PRO A O     1 
ATOM   1269 C CB    . PRO A 1 157 ? 3.526   34.890 140.452 1.00 63.52  ? 191  PRO A CB    1 
ATOM   1270 C CG    . PRO A 1 157 ? 2.556   35.952 140.040 1.00 63.44  ? 191  PRO A CG    1 
ATOM   1271 C CD    . PRO A 1 157 ? 1.242   35.188 140.027 1.00 62.40  ? 191  PRO A CD    1 
ATOM   1272 N N     . ASP A 1 158 ? 3.062   32.079 141.370 1.00 63.01  ? 192  ASP A N     1 
ATOM   1273 C CA    . ASP A 1 158 ? 3.420   30.867 142.093 1.00 63.79  ? 192  ASP A CA    1 
ATOM   1274 C C     . ASP A 1 158 ? 2.887   29.566 141.488 1.00 61.57  ? 192  ASP A C     1 
ATOM   1275 O O     . ASP A 1 158 ? 3.657   28.715 141.039 1.00 62.80  ? 192  ASP A O     1 
ATOM   1276 C CB    . ASP A 1 158 ? 2.937   30.986 143.545 1.00 67.40  ? 192  ASP A CB    1 
ATOM   1277 C CG    . ASP A 1 158 ? 2.965   32.427 144.059 1.00 70.85  ? 192  ASP A CG    1 
ATOM   1278 O OD1   . ASP A 1 158 ? 4.006   33.111 143.898 1.00 72.61  ? 192  ASP A OD1   1 
ATOM   1279 O OD2   . ASP A 1 158 ? 1.944   32.874 144.630 1.00 71.69  ? 192  ASP A OD2   1 
ATOM   1280 N N     . THR A 1 159 ? 1.565   29.426 141.488 1.00 58.09  ? 193  THR A N     1 
ATOM   1281 C CA    . THR A 1 159 ? 0.889   28.239 140.978 1.00 53.02  ? 193  THR A CA    1 
ATOM   1282 C C     . THR A 1 159 ? 0.997   28.019 139.467 1.00 50.28  ? 193  THR A C     1 
ATOM   1283 O O     . THR A 1 159 ? 0.833   26.900 138.983 1.00 48.91  ? 193  THR A O     1 
ATOM   1284 C CB    . THR A 1 159 ? -0.591  28.289 141.340 1.00 53.43  ? 193  THR A CB    1 
ATOM   1285 O OG1   . THR A 1 159 ? -1.214  29.361 140.624 1.00 54.12  ? 193  THR A OG1   1 
ATOM   1286 C CG2   . THR A 1 159 ? -0.757  28.539 142.831 1.00 53.52  ? 193  THR A CG2   1 
ATOM   1287 N N     . ALA A 1 160 ? 1.272   29.079 138.719 1.00 46.94  ? 194  ALA A N     1 
ATOM   1288 C CA    . ALA A 1 160 ? 1.369   28.968 137.272 1.00 43.26  ? 194  ALA A CA    1 
ATOM   1289 C C     . ALA A 1 160 ? -0.005  28.608 136.690 1.00 41.42  ? 194  ALA A C     1 
ATOM   1290 O O     . ALA A 1 160 ? -0.118  27.961 135.645 1.00 39.66  ? 194  ALA A O     1 
ATOM   1291 C CB    . ALA A 1 160 ? 2.414   27.910 136.887 1.00 42.16  ? 194  ALA A CB    1 
ATOM   1292 N N     . VAL A 1 161 ? -1.053  29.022 137.383 1.00 39.56  ? 195  VAL A N     1 
ATOM   1293 C CA    . VAL A 1 161 ? -2.401  28.769 136.909 1.00 39.20  ? 195  VAL A CA    1 
ATOM   1294 C C     . VAL A 1 161 ? -2.803  29.917 135.981 1.00 37.71  ? 195  VAL A C     1 
ATOM   1295 O O     . VAL A 1 161 ? -2.511  31.085 136.252 1.00 36.01  ? 195  VAL A O     1 
ATOM   1296 C CB    . VAL A 1 161 ? -3.402  28.668 138.090 1.00 40.49  ? 195  VAL A CB    1 
ATOM   1297 C CG1   . VAL A 1 161 ? -4.829  28.580 137.562 1.00 40.65  ? 195  VAL A CG1   1 
ATOM   1298 C CG2   . VAL A 1 161 ? -3.079  27.430 138.927 1.00 39.38  ? 195  VAL A CG2   1 
ATOM   1299 N N     . LEU A 1 162 ? -3.459  29.576 134.878 1.00 36.25  ? 196  LEU A N     1 
ATOM   1300 C CA    . LEU A 1 162 ? -3.886  30.566 133.898 1.00 34.42  ? 196  LEU A CA    1 
ATOM   1301 C C     . LEU A 1 162 ? -5.398  30.680 133.898 1.00 36.36  ? 196  LEU A C     1 
ATOM   1302 O O     . LEU A 1 162 ? -6.121  29.672 133.943 1.00 37.12  ? 196  LEU A O     1 
ATOM   1303 C CB    . LEU A 1 162 ? -3.388  30.177 132.485 1.00 34.22  ? 196  LEU A CB    1 
ATOM   1304 C CG    . LEU A 1 162 ? -3.743  31.035 131.245 1.00 35.16  ? 196  LEU A CG    1 
ATOM   1305 C CD1   . LEU A 1 162 ? -2.876  30.622 130.059 1.00 33.90  ? 196  LEU A CD1   1 
ATOM   1306 C CD2   . LEU A 1 162 ? -5.215  30.874 130.885 1.00 34.73  ? 196  LEU A CD2   1 
ATOM   1307 N N     . LYS A 1 163 ? -5.881  31.913 133.855 1.00 35.42  ? 197  LYS A N     1 
ATOM   1308 C CA    . LYS A 1 163 ? -7.315  32.145 133.820 1.00 38.77  ? 197  LYS A CA    1 
ATOM   1309 C C     . LYS A 1 163 ? -7.686  33.089 132.675 1.00 37.77  ? 197  LYS A C     1 
ATOM   1310 O O     . LYS A 1 163 ? -7.085  34.155 132.508 1.00 35.69  ? 197  LYS A O     1 
ATOM   1311 C CB    . LYS A 1 163 ? -7.796  32.715 135.159 1.00 38.50  ? 197  LYS A CB    1 
ATOM   1312 C CG    . LYS A 1 163 ? -7.743  31.714 136.308 1.00 44.12  ? 197  LYS A CG    1 
ATOM   1313 C CD    . LYS A 1 163 ? -8.027  32.383 137.643 1.00 46.61  ? 197  LYS A CD    1 
ATOM   1314 C CE    . LYS A 1 163 ? -7.897  31.408 138.805 1.00 49.95  ? 197  LYS A CE    1 
ATOM   1315 N NZ    . LYS A 1 163 ? -8.855  30.269 138.663 1.00 54.17  ? 197  LYS A NZ    1 
ATOM   1316 N N     . LEU A 1 164 ? -8.662  32.686 131.869 1.00 36.63  ? 198  LEU A N     1 
ATOM   1317 C CA    . LEU A 1 164 ? -9.101  33.540 130.772 1.00 35.28  ? 198  LEU A CA    1 
ATOM   1318 C C     . LEU A 1 164 ? -9.993  34.619 131.378 1.00 34.76  ? 198  LEU A C     1 
ATOM   1319 O O     . LEU A 1 164 ? -10.761 34.349 132.291 1.00 35.69  ? 198  LEU A O     1 
ATOM   1320 C CB    . LEU A 1 164 ? -9.869  32.720 129.733 1.00 34.46  ? 198  LEU A CB    1 
ATOM   1321 C CG    . LEU A 1 164 ? -10.527 33.473 128.581 1.00 34.42  ? 198  LEU A CG    1 
ATOM   1322 C CD1   . LEU A 1 164 ? -9.469  34.202 127.738 1.00 31.75  ? 198  LEU A CD1   1 
ATOM   1323 C CD2   . LEU A 1 164 ? -11.311 32.485 127.732 1.00 32.93  ? 198  LEU A CD2   1 
ATOM   1324 N N     . CYS A 1 165 ? -9.851  35.856 130.917 1.00 36.03  ? 199  CYS A N     1 
ATOM   1325 C CA    . CYS A 1 165 ? -10.681 36.942 131.427 1.00 36.34  ? 199  CYS A CA    1 
ATOM   1326 C C     . CYS A 1 165 ? -11.195 37.811 130.282 1.00 34.46  ? 199  CYS A C     1 
ATOM   1327 O O     . CYS A 1 165 ? -11.065 37.455 129.113 1.00 35.24  ? 199  CYS A O     1 
ATOM   1328 C CB    . CYS A 1 165 ? -9.902  37.799 132.424 1.00 39.86  ? 199  CYS A CB    1 
ATOM   1329 S SG    . CYS A 1 165 ? -8.711  38.959 131.703 1.00 49.95  ? 199  CYS A SG    1 
ATOM   1330 N N     . ASP A 1 166 ? -11.802 38.937 130.638 1.00 37.14  ? 200  ASP A N     1 
ATOM   1331 C CA    . ASP A 1 166 ? -12.352 39.903 129.683 1.00 39.64  ? 200  ASP A CA    1 
ATOM   1332 C C     . ASP A 1 166 ? -13.402 39.317 128.730 1.00 38.87  ? 200  ASP A C     1 
ATOM   1333 O O     . ASP A 1 166 ? -13.094 39.004 127.577 1.00 37.47  ? 200  ASP A O     1 
ATOM   1334 C CB    . ASP A 1 166 ? -11.213 40.546 128.864 1.00 44.90  ? 200  ASP A CB    1 
ATOM   1335 C CG    . ASP A 1 166 ? -11.642 41.836 128.164 1.00 51.79  ? 200  ASP A CG    1 
ATOM   1336 O OD1   . ASP A 1 166 ? -12.774 41.890 127.631 1.00 54.36  ? 200  ASP A OD1   1 
ATOM   1337 O OD2   . ASP A 1 166 ? -10.840 42.798 128.133 1.00 55.85  ? 200  ASP A OD2   1 
ATOM   1338 N N     . PHE A 1 167 ? -14.640 39.181 129.208 1.00 38.19  ? 201  PHE A N     1 
ATOM   1339 C CA    . PHE A 1 167 ? -15.717 38.654 128.369 1.00 39.17  ? 201  PHE A CA    1 
ATOM   1340 C C     . PHE A 1 167 ? -16.584 39.748 127.731 1.00 39.88  ? 201  PHE A C     1 
ATOM   1341 O O     . PHE A 1 167 ? -17.695 39.482 127.275 1.00 39.47  ? 201  PHE A O     1 
ATOM   1342 C CB    . PHE A 1 167 ? -16.598 37.678 129.164 1.00 37.68  ? 201  PHE A CB    1 
ATOM   1343 C CG    . PHE A 1 167 ? -15.936 36.362 129.417 1.00 35.34  ? 201  PHE A CG    1 
ATOM   1344 C CD1   . PHE A 1 167 ? -14.907 36.263 130.351 1.00 35.59  ? 201  PHE A CD1   1 
ATOM   1345 C CD2   . PHE A 1 167 ? -16.262 35.247 128.658 1.00 34.36  ? 201  PHE A CD2   1 
ATOM   1346 C CE1   . PHE A 1 167 ? -14.204 35.076 130.518 1.00 33.16  ? 201  PHE A CE1   1 
ATOM   1347 C CE2   . PHE A 1 167 ? -15.564 34.045 128.815 1.00 36.04  ? 201  PHE A CE2   1 
ATOM   1348 C CZ    . PHE A 1 167 ? -14.529 33.963 129.751 1.00 35.68  ? 201  PHE A CZ    1 
ATOM   1349 N N     . GLY A 1 168 ? -16.057 40.969 127.687 1.00 40.61  ? 202  GLY A N     1 
ATOM   1350 C CA    . GLY A 1 168 ? -16.786 42.081 127.103 1.00 42.03  ? 202  GLY A CA    1 
ATOM   1351 C C     . GLY A 1 168 ? -17.090 41.973 125.612 1.00 42.57  ? 202  GLY A C     1 
ATOM   1352 O O     . GLY A 1 168 ? -17.772 42.832 125.062 1.00 45.27  ? 202  GLY A O     1 
ATOM   1353 N N     . SER A 1 169 ? -16.596 40.937 124.946 1.00 42.19  ? 203  SER A N     1 
ATOM   1354 C CA    . SER A 1 169 ? -16.854 40.769 123.516 1.00 41.53  ? 203  SER A CA    1 
ATOM   1355 C C     . SER A 1 169 ? -17.398 39.384 123.254 1.00 40.82  ? 203  SER A C     1 
ATOM   1356 O O     . SER A 1 169 ? -17.670 39.018 122.110 1.00 40.84  ? 203  SER A O     1 
ATOM   1357 C CB    . SER A 1 169 ? -15.571 40.948 122.702 1.00 41.49  ? 203  SER A CB    1 
ATOM   1358 O OG    . SER A 1 169 ? -15.060 42.259 122.847 1.00 46.34  ? 203  SER A OG    1 
ATOM   1359 N N     . ALA A 1 170 ? -17.549 38.608 124.317 1.00 39.60  ? 204  ALA A N     1 
ATOM   1360 C CA    . ALA A 1 170 ? -18.049 37.256 124.177 1.00 41.25  ? 204  ALA A CA    1 
ATOM   1361 C C     . ALA A 1 170 ? -19.505 37.245 123.699 1.00 43.58  ? 204  ALA A C     1 
ATOM   1362 O O     . ALA A 1 170 ? -20.282 38.167 123.970 1.00 41.80  ? 204  ALA A O     1 
ATOM   1363 C CB    . ALA A 1 170 ? -17.911 36.520 125.497 1.00 37.88  ? 204  ALA A CB    1 
ATOM   1364 N N     . LYS A 1 171 ? -19.863 36.198 122.974 1.00 45.72  ? 205  LYS A N     1 
ATOM   1365 C CA    . LYS A 1 171 ? -21.211 36.070 122.472 1.00 50.30  ? 205  LYS A CA    1 
ATOM   1366 C C     . LYS A 1 171 ? -21.530 34.625 122.146 1.00 53.50  ? 205  LYS A C     1 
ATOM   1367 O O     . LYS A 1 171 ? -20.647 33.836 121.800 1.00 51.76  ? 205  LYS A O     1 
ATOM   1368 C CB    . LYS A 1 171 ? -21.409 36.931 121.225 1.00 52.01  ? 205  LYS A CB    1 
ATOM   1369 C CG    . LYS A 1 171 ? -22.790 36.789 120.622 1.00 53.18  ? 205  LYS A CG    1 
ATOM   1370 C CD    . LYS A 1 171 ? -23.016 37.751 119.475 1.00 54.49  ? 205  LYS A CD    1 
ATOM   1371 C CE    . LYS A 1 171 ? -24.422 37.582 118.917 1.00 53.65  ? 205  LYS A CE    1 
ATOM   1372 N NZ    . LYS A 1 171 ? -24.682 38.554 117.825 1.00 54.92  ? 205  LYS A NZ    1 
ATOM   1373 N N     . GLN A 1 172 ? -22.805 34.282 122.274 1.00 57.70  ? 206  GLN A N     1 
ATOM   1374 C CA    . GLN A 1 172 ? -23.262 32.938 121.985 1.00 61.96  ? 206  GLN A CA    1 
ATOM   1375 C C     . GLN A 1 172 ? -23.560 32.912 120.488 1.00 62.47  ? 206  GLN A C     1 
ATOM   1376 O O     . GLN A 1 172 ? -24.469 33.592 120.020 1.00 63.15  ? 206  GLN A O     1 
ATOM   1377 C CB    . GLN A 1 172 ? -24.514 32.643 122.814 1.00 64.60  ? 206  GLN A CB    1 
ATOM   1378 C CG    . GLN A 1 172 ? -24.928 31.189 122.849 1.00 69.94  ? 206  GLN A CG    1 
ATOM   1379 C CD    . GLN A 1 172 ? -25.720 30.857 124.103 1.00 74.31  ? 206  GLN A CD    1 
ATOM   1380 O OE1   . GLN A 1 172 ? -25.200 30.948 125.224 1.00 75.31  ? 206  GLN A OE1   1 
ATOM   1381 N NE2   . GLN A 1 172 ? -26.985 30.475 123.925 1.00 75.13  ? 206  GLN A NE2   1 
ATOM   1382 N N     . LEU A 1 173 ? -22.773 32.148 119.739 1.00 63.54  ? 207  LEU A N     1 
ATOM   1383 C CA    . LEU A 1 173 ? -22.956 32.067 118.298 1.00 66.43  ? 207  LEU A CA    1 
ATOM   1384 C C     . LEU A 1 173 ? -23.974 31.005 117.899 1.00 70.01  ? 207  LEU A C     1 
ATOM   1385 O O     . LEU A 1 173 ? -23.722 29.804 118.034 1.00 70.41  ? 207  LEU A O     1 
ATOM   1386 C CB    . LEU A 1 173 ? -21.620 31.783 117.604 1.00 63.80  ? 207  LEU A CB    1 
ATOM   1387 C CG    . LEU A 1 173 ? -20.470 32.773 117.824 1.00 61.60  ? 207  LEU A CG    1 
ATOM   1388 C CD1   . LEU A 1 173 ? -19.291 32.353 116.962 1.00 60.80  ? 207  LEU A CD1   1 
ATOM   1389 C CD2   . LEU A 1 173 ? -20.896 34.185 117.476 1.00 58.87  ? 207  LEU A CD2   1 
ATOM   1390 N N     . VAL A 1 174 ? -25.129 31.458 117.417 1.00 73.31  ? 208  VAL A N     1 
ATOM   1391 C CA    . VAL A 1 174 ? -26.180 30.550 116.975 1.00 76.69  ? 208  VAL A CA    1 
ATOM   1392 C C     . VAL A 1 174 ? -26.010 30.260 115.487 1.00 77.74  ? 208  VAL A C     1 
ATOM   1393 O O     . VAL A 1 174 ? -26.033 31.172 114.654 1.00 76.86  ? 208  VAL A O     1 
ATOM   1394 C CB    . VAL A 1 174 ? -27.600 31.131 117.236 1.00 77.49  ? 208  VAL A CB    1 
ATOM   1395 C CG1   . VAL A 1 174 ? -28.007 30.874 118.681 1.00 78.29  ? 208  VAL A CG1   1 
ATOM   1396 C CG2   . VAL A 1 174 ? -27.623 32.626 116.948 1.00 78.19  ? 208  VAL A CG2   1 
ATOM   1397 N N     . ARG A 1 175 ? -25.822 28.981 115.171 1.00 80.06  ? 209  ARG A N     1 
ATOM   1398 C CA    . ARG A 1 175 ? -25.629 28.527 113.797 1.00 82.11  ? 209  ARG A CA    1 
ATOM   1399 C C     . ARG A 1 175 ? -26.744 29.027 112.892 1.00 82.29  ? 209  ARG A C     1 
ATOM   1400 O O     . ARG A 1 175 ? -27.870 28.536 112.947 1.00 82.51  ? 209  ARG A O     1 
ATOM   1401 C CB    . ARG A 1 175 ? -25.569 26.996 113.760 1.00 84.02  ? 209  ARG A CB    1 
ATOM   1402 C CG    . ARG A 1 175 ? -25.230 26.396 112.401 1.00 86.72  ? 209  ARG A CG    1 
ATOM   1403 C CD    . ARG A 1 175 ? -25.097 24.878 112.509 1.00 90.22  ? 209  ARG A CD    1 
ATOM   1404 N NE    . ARG A 1 175 ? -24.763 24.243 111.233 1.00 92.82  ? 209  ARG A NE    1 
ATOM   1405 C CZ    . ARG A 1 175 ? -24.657 22.928 111.056 1.00 93.54  ? 209  ARG A CZ    1 
ATOM   1406 N NH1   . ARG A 1 175 ? -24.859 22.099 112.074 1.00 93.73  ? 209  ARG A NH1   1 
ATOM   1407 N NH2   . ARG A 1 175 ? -24.350 22.440 109.860 1.00 93.63  ? 209  ARG A NH2   1 
ATOM   1408 N N     . GLY A 1 176 ? -26.423 30.014 112.064 1.00 82.62  ? 210  GLY A N     1 
ATOM   1409 C CA    . GLY A 1 176 ? -27.409 30.563 111.156 1.00 83.28  ? 210  GLY A CA    1 
ATOM   1410 C C     . GLY A 1 176 ? -27.870 31.955 111.542 1.00 84.05  ? 210  GLY A C     1 
ATOM   1411 O O     . GLY A 1 176 ? -28.998 32.345 111.241 1.00 84.71  ? 210  GLY A O     1 
ATOM   1412 N N     . GLU A 1 177 ? -27.003 32.713 112.205 1.00 83.69  ? 211  GLU A N     1 
ATOM   1413 C CA    . GLU A 1 177 ? -27.359 34.064 112.619 1.00 83.30  ? 211  GLU A CA    1 
ATOM   1414 C C     . GLU A 1 177 ? -26.143 34.996 112.493 1.00 81.26  ? 211  GLU A C     1 
ATOM   1415 O O     . GLU A 1 177 ? -25.111 34.773 113.124 1.00 81.94  ? 211  GLU A O     1 
ATOM   1416 C CB    . GLU A 1 177 ? -27.896 34.025 114.057 1.00 84.59  ? 211  GLU A CB    1 
ATOM   1417 C CG    . GLU A 1 177 ? -28.668 35.259 114.497 1.00 87.06  ? 211  GLU A CG    1 
ATOM   1418 C CD    . GLU A 1 177 ? -27.777 36.323 115.113 1.00 89.16  ? 211  GLU A CD    1 
ATOM   1419 O OE1   . GLU A 1 177 ? -27.186 36.055 116.186 1.00 89.62  ? 211  GLU A OE1   1 
ATOM   1420 O OE2   . GLU A 1 177 ? -27.667 37.423 114.524 1.00 89.11  ? 211  GLU A OE2   1 
ATOM   1421 N N     . PRO A 1 178 ? -26.257 36.050 111.662 1.00 78.86  ? 212  PRO A N     1 
ATOM   1422 C CA    . PRO A 1 178 ? -25.211 37.045 111.403 1.00 76.46  ? 212  PRO A CA    1 
ATOM   1423 C C     . PRO A 1 178 ? -24.469 37.556 112.632 1.00 74.34  ? 212  PRO A C     1 
ATOM   1424 O O     . PRO A 1 178 ? -24.969 37.473 113.753 1.00 72.97  ? 212  PRO A O     1 
ATOM   1425 C CB    . PRO A 1 178 ? -25.973 38.163 110.702 1.00 77.60  ? 212  PRO A CB    1 
ATOM   1426 C CG    . PRO A 1 178 ? -26.995 37.421 109.930 1.00 77.67  ? 212  PRO A CG    1 
ATOM   1427 C CD    . PRO A 1 178 ? -27.492 36.411 110.940 1.00 78.53  ? 212  PRO A CD    1 
ATOM   1428 N N     . ASN A 1 179 ? -23.276 38.096 112.400 1.00 72.04  ? 213  ASN A N     1 
ATOM   1429 C CA    . ASN A 1 179 ? -22.437 38.645 113.460 1.00 70.03  ? 213  ASN A CA    1 
ATOM   1430 C C     . ASN A 1 179 ? -21.418 39.612 112.891 1.00 69.17  ? 213  ASN A C     1 
ATOM   1431 O O     . ASN A 1 179 ? -20.947 39.427 111.773 1.00 69.09  ? 213  ASN A O     1 
ATOM   1432 C CB    . ASN A 1 179 ? -21.709 37.527 114.201 1.00 69.35  ? 213  ASN A CB    1 
ATOM   1433 C CG    . ASN A 1 179 ? -22.574 36.877 115.253 1.00 68.97  ? 213  ASN A CG    1 
ATOM   1434 O OD1   . ASN A 1 179 ? -23.019 37.532 116.194 1.00 68.77  ? 213  ASN A OD1   1 
ATOM   1435 N ND2   . ASN A 1 179 ? -22.824 35.585 115.100 1.00 68.08  ? 213  ASN A ND2   1 
ATOM   1436 N N     . VAL A 1 180 ? -21.077 40.639 113.666 1.00 68.93  ? 214  VAL A N     1 
ATOM   1437 C CA    . VAL A 1 180 ? -20.106 41.648 113.240 1.00 68.96  ? 214  VAL A CA    1 
ATOM   1438 C C     . VAL A 1 180 ? -18.758 41.030 112.876 1.00 67.63  ? 214  VAL A C     1 
ATOM   1439 O O     . VAL A 1 180 ? -18.218 40.195 113.609 1.00 66.44  ? 214  VAL A O     1 
ATOM   1440 C CB    . VAL A 1 180 ? -19.872 42.712 114.346 1.00 70.04  ? 214  VAL A CB    1 
ATOM   1441 C CG1   . VAL A 1 180 ? -18.801 43.705 113.904 1.00 70.32  ? 214  VAL A CG1   1 
ATOM   1442 C CG2   . VAL A 1 180 ? -21.165 43.443 114.641 1.00 71.25  ? 214  VAL A CG2   1 
ATOM   1443 N N     . SER A 1 181 ? -18.220 41.452 111.737 1.00 66.47  ? 215  SER A N     1 
ATOM   1444 C CA    . SER A 1 181 ? -16.936 40.947 111.266 1.00 65.62  ? 215  SER A CA    1 
ATOM   1445 C C     . SER A 1 181 ? -15.764 41.614 111.996 1.00 64.58  ? 215  SER A C     1 
ATOM   1446 O O     . SER A 1 181 ? -14.763 40.961 112.293 1.00 63.41  ? 215  SER A O     1 
ATOM   1447 C CB    . SER A 1 181 ? -16.802 41.171 109.760 1.00 64.83  ? 215  SER A CB    1 
ATOM   1448 O OG    . SER A 1 181 ? -16.712 42.554 109.469 1.00 67.35  ? 215  SER A OG    1 
HETATM 1449 N N     . PTR A 1 182 ? -15.886 42.912 112.281 1.00 63.59  ? 216  PTR A N     1 
HETATM 1450 C CA    . PTR A 1 182 ? -14.823 43.641 112.973 1.00 62.22  ? 216  PTR A CA    1 
HETATM 1451 C C     . PTR A 1 182 ? -14.852 43.275 114.447 1.00 61.06  ? 216  PTR A C     1 
HETATM 1452 O O     . PTR A 1 182 ? -15.298 44.051 115.290 1.00 61.12  ? 216  PTR A O     1 
HETATM 1453 C CB    . PTR A 1 182 ? -15.003 45.152 112.821 1.00 63.58  ? 216  PTR A CB    1 
HETATM 1454 C CG    . PTR A 1 182 ? -13.708 45.928 112.956 1.00 65.55  ? 216  PTR A CG    1 
HETATM 1455 C CD1   . PTR A 1 182 ? -12.730 45.863 111.955 1.00 66.13  ? 216  PTR A CD1   1 
HETATM 1456 C CD2   . PTR A 1 182 ? -13.441 46.695 114.094 1.00 65.59  ? 216  PTR A CD2   1 
HETATM 1457 C CE1   . PTR A 1 182 ? -11.517 46.537 112.082 1.00 64.97  ? 216  PTR A CE1   1 
HETATM 1458 C CE2   . PTR A 1 182 ? -12.226 47.377 114.236 1.00 66.54  ? 216  PTR A CE2   1 
HETATM 1459 C CZ    . PTR A 1 182 ? -11.287 47.280 113.220 1.00 67.79  ? 216  PTR A CZ    1 
HETATM 1460 O OH    . PTR A 1 182 ? -10.015 47.962 113.354 1.00 71.51  ? 216  PTR A OH    1 
HETATM 1461 P P     . PTR A 1 182 ? -8.908  47.693 114.540 1.00 73.35  ? 216  PTR A P     1 
HETATM 1462 O O1P   . PTR A 1 182 ? -8.177  46.471 114.196 1.00 73.14  ? 216  PTR A O1P   1 
HETATM 1463 O O2P   . PTR A 1 182 ? -9.577  47.506 115.854 1.00 75.04  ? 216  PTR A O2P   1 
HETATM 1464 O O3P   . PTR A 1 182 ? -7.925  48.813 114.620 1.00 73.85  ? 216  PTR A O3P   1 
ATOM   1465 N N     . ILE A 1 183 ? -14.372 42.077 114.747 1.00 59.82  ? 217  ILE A N     1 
ATOM   1466 C CA    . ILE A 1 183 ? -14.349 41.585 116.109 1.00 58.29  ? 217  ILE A CA    1 
ATOM   1467 C C     . ILE A 1 183 ? -12.946 41.035 116.382 1.00 57.41  ? 217  ILE A C     1 
ATOM   1468 O O     . ILE A 1 183 ? -12.160 40.857 115.449 1.00 56.29  ? 217  ILE A O     1 
ATOM   1469 C CB    . ILE A 1 183 ? -15.436 40.479 116.298 1.00 56.91  ? 217  ILE A CB    1 
ATOM   1470 C CG1   . ILE A 1 183 ? -15.711 40.254 117.783 1.00 57.40  ? 217  ILE A CG1   1 
ATOM   1471 C CG2   . ILE A 1 183 ? -14.995 39.191 115.644 1.00 55.99  ? 217  ILE A CG2   1 
ATOM   1472 C CD1   . ILE A 1 183 ? -16.256 41.474 118.496 1.00 55.50  ? 217  ILE A CD1   1 
ATOM   1473 N N     . CYS A 1 184 ? -12.645 40.772 117.654 1.00 57.04  ? 218  CYS A N     1 
ATOM   1474 C CA    . CYS A 1 184 ? -11.334 40.273 118.087 1.00 57.66  ? 218  CYS A CA    1 
ATOM   1475 C C     . CYS A 1 184 ? -10.317 41.404 118.029 1.00 56.97  ? 218  CYS A C     1 
ATOM   1476 O O     . CYS A 1 184 ? -10.642 42.542 117.670 1.00 57.43  ? 218  CYS A O     1 
ATOM   1477 C CB    . CYS A 1 184 ? -10.819 39.124 117.198 1.00 58.09  ? 218  CYS A CB    1 
ATOM   1478 S SG    . CYS A 1 184 ? -11.618 37.522 117.382 1.00 61.45  ? 218  CYS A SG    1 
ATOM   1479 N N     . SER A 1 185 ? -9.078  41.080 118.374 1.00 54.92  ? 219  SER A N     1 
ATOM   1480 C CA    . SER A 1 185 ? -8.010  42.065 118.348 1.00 52.79  ? 219  SER A CA    1 
ATOM   1481 C C     . SER A 1 185 ? -7.101  41.887 117.139 1.00 49.86  ? 219  SER A C     1 
ATOM   1482 O O     . SER A 1 185 ? -6.802  40.759 116.725 1.00 49.92  ? 219  SER A O     1 
ATOM   1483 C CB    . SER A 1 185 ? -7.188  41.978 119.638 1.00 53.61  ? 219  SER A CB    1 
ATOM   1484 O OG    . SER A 1 185 ? -6.128  42.916 119.642 1.00 54.14  ? 219  SER A OG    1 
ATOM   1485 N N     . ARG A 1 186 ? -6.698  43.024 116.578 1.00 48.78  ? 220  ARG A N     1 
ATOM   1486 C CA    . ARG A 1 186 ? -5.793  43.130 115.425 1.00 50.12  ? 220  ARG A CA    1 
ATOM   1487 C C     . ARG A 1 186 ? -4.973  41.881 115.052 1.00 48.18  ? 220  ARG A C     1 
ATOM   1488 O O     . ARG A 1 186 ? -5.373  41.068 114.201 1.00 48.50  ? 220  ARG A O     1 
ATOM   1489 C CB    . ARG A 1 186 ? -4.783  44.277 115.670 1.00 55.73  ? 220  ARG A CB    1 
ATOM   1490 C CG    . ARG A 1 186 ? -5.298  45.708 115.534 1.00 59.83  ? 220  ARG A CG    1 
ATOM   1491 C CD    . ARG A 1 186 ? -4.393  46.493 114.572 1.00 65.22  ? 220  ARG A CD    1 
ATOM   1492 N NE    . ARG A 1 186 ? -4.110  45.676 113.389 1.00 67.41  ? 220  ARG A NE    1 
ATOM   1493 C CZ    . ARG A 1 186 ? -5.035  45.278 112.524 1.00 66.76  ? 220  ARG A CZ    1 
ATOM   1494 N NH1   . ARG A 1 186 ? -4.693  44.520 111.490 1.00 65.25  ? 220  ARG A NH1   1 
ATOM   1495 N NH2   . ARG A 1 186 ? -6.296  45.669 112.681 1.00 66.83  ? 220  ARG A NH2   1 
ATOM   1496 N N     . TYR A 1 187 ? -3.808  41.781 115.690 1.00 39.56  ? 221  TYR A N     1 
ATOM   1497 C CA    . TYR A 1 187 ? -2.841  40.706 115.481 1.00 36.30  ? 221  TYR A CA    1 
ATOM   1498 C C     . TYR A 1 187 ? -3.384  39.282 115.614 1.00 33.58  ? 221  TYR A C     1 
ATOM   1499 O O     . TYR A 1 187 ? -2.799  38.347 115.069 1.00 31.42  ? 221  TYR A O     1 
ATOM   1500 C CB    . TYR A 1 187 ? -1.686  40.846 116.488 1.00 38.21  ? 221  TYR A CB    1 
ATOM   1501 C CG    . TYR A 1 187 ? -0.980  42.178 116.468 1.00 42.57  ? 221  TYR A CG    1 
ATOM   1502 C CD1   . TYR A 1 187 ? -0.163  42.566 117.523 1.00 44.93  ? 221  TYR A CD1   1 
ATOM   1503 C CD2   . TYR A 1 187 ? -1.136  43.057 115.398 1.00 46.12  ? 221  TYR A CD2   1 
ATOM   1504 C CE1   . TYR A 1 187 ? 0.480   43.793 117.521 1.00 48.72  ? 221  TYR A CE1   1 
ATOM   1505 C CE2   . TYR A 1 187 ? -0.499  44.288 115.385 1.00 48.38  ? 221  TYR A CE2   1 
ATOM   1506 C CZ    . TYR A 1 187 ? 0.307   44.650 116.448 1.00 49.90  ? 221  TYR A CZ    1 
ATOM   1507 O OH    . TYR A 1 187 ? 0.935   45.876 116.442 1.00 51.85  ? 221  TYR A OH    1 
ATOM   1508 N N     . TYR A 1 188 ? -4.494  39.129 116.334 1.00 27.59  ? 222  TYR A N     1 
ATOM   1509 C CA    . TYR A 1 188 ? -5.085  37.824 116.606 1.00 29.18  ? 222  TYR A CA    1 
ATOM   1510 C C     . TYR A 1 188 ? -6.394  37.480 115.875 1.00 30.00  ? 222  TYR A C     1 
ATOM   1511 O O     . TYR A 1 188 ? -7.020  36.468 116.188 1.00 26.27  ? 222  TYR A O     1 
ATOM   1512 C CB    . TYR A 1 188 ? -5.306  37.697 118.118 1.00 29.05  ? 222  TYR A CB    1 
ATOM   1513 C CG    . TYR A 1 188 ? -4.077  38.102 118.903 1.00 31.59  ? 222  TYR A CG    1 
ATOM   1514 C CD1   . TYR A 1 188 ? -3.019  37.207 119.099 1.00 29.44  ? 222  TYR A CD1   1 
ATOM   1515 C CD2   . TYR A 1 188 ? -3.912  39.422 119.332 1.00 33.73  ? 222  TYR A CD2   1 
ATOM   1516 C CE1   . TYR A 1 188 ? -1.830  37.623 119.690 1.00 31.17  ? 222  TYR A CE1   1 
ATOM   1517 C CE2   . TYR A 1 188 ? -2.724  39.850 119.921 1.00 33.01  ? 222  TYR A CE2   1 
ATOM   1518 C CZ    . TYR A 1 188 ? -1.690  38.951 120.094 1.00 33.52  ? 222  TYR A CZ    1 
ATOM   1519 O OH    . TYR A 1 188 ? -0.515  39.398 120.645 1.00 34.76  ? 222  TYR A OH    1 
ATOM   1520 N N     . ARG A 1 189 ? -6.777  38.312 114.908 1.00 29.01  ? 223  ARG A N     1 
ATOM   1521 C CA    . ARG A 1 189 ? -8.020  38.153 114.128 1.00 32.26  ? 223  ARG A CA    1 
ATOM   1522 C C     . ARG A 1 189 ? -7.930  37.086 113.021 1.00 31.44  ? 223  ARG A C     1 
ATOM   1523 O O     . ARG A 1 189 ? -7.084  37.171 112.130 1.00 30.12  ? 223  ARG A O     1 
ATOM   1524 C CB    . ARG A 1 189 ? -8.388  39.515 113.495 1.00 35.67  ? 223  ARG A CB    1 
ATOM   1525 C CG    . ARG A 1 189 ? -9.840  39.973 113.617 1.00 42.64  ? 223  ARG A CG    1 
ATOM   1526 C CD    . ARG A 1 189 ? -10.052 41.434 113.129 1.00 45.74  ? 223  ARG A CD    1 
ATOM   1527 N NE    . ARG A 1 189 ? -9.300  42.400 113.936 1.00 51.34  ? 223  ARG A NE    1 
ATOM   1528 C CZ    . ARG A 1 189 ? -9.826  43.417 114.624 1.00 53.53  ? 223  ARG A CZ    1 
ATOM   1529 N NH1   . ARG A 1 189 ? -11.133 43.645 114.619 1.00 58.52  ? 223  ARG A NH1   1 
ATOM   1530 N NH2   . ARG A 1 189 ? -9.039  44.197 115.353 1.00 54.27  ? 223  ARG A NH2   1 
ATOM   1531 N N     . ALA A 1 190 ? -8.803  36.084 113.075 1.00 31.60  ? 224  ALA A N     1 
ATOM   1532 C CA    . ALA A 1 190 ? -8.805  35.040 112.048 1.00 31.22  ? 224  ALA A CA    1 
ATOM   1533 C C     . ALA A 1 190 ? -9.001  35.622 110.659 1.00 30.63  ? 224  ALA A C     1 
ATOM   1534 O O     . ALA A 1 190 ? -9.626  36.681 110.491 1.00 27.90  ? 224  ALA A O     1 
ATOM   1535 C CB    . ALA A 1 190 ? -9.899  34.014 112.326 1.00 28.71  ? 224  ALA A CB    1 
ATOM   1536 N N     . PRO A 1 191 ? -8.472  34.930 109.641 1.00 30.38  ? 225  PRO A N     1 
ATOM   1537 C CA    . PRO A 1 191 ? -8.539  35.299 108.222 1.00 30.84  ? 225  PRO A CA    1 
ATOM   1538 C C     . PRO A 1 191 ? -9.987  35.509 107.760 1.00 31.94  ? 225  PRO A C     1 
ATOM   1539 O O     . PRO A 1 191 ? -10.277 36.443 107.013 1.00 30.24  ? 225  PRO A O     1 
ATOM   1540 C CB    . PRO A 1 191 ? -7.899  34.104 107.506 1.00 29.90  ? 225  PRO A CB    1 
ATOM   1541 C CG    . PRO A 1 191 ? -7.122  33.396 108.546 1.00 32.35  ? 225  PRO A CG    1 
ATOM   1542 C CD    . PRO A 1 191 ? -7.852  33.609 109.828 1.00 31.87  ? 225  PRO A CD    1 
ATOM   1543 N N     . GLU A 1 192 ? -10.893 34.639 108.202 1.00 31.99  ? 226  GLU A N     1 
ATOM   1544 C CA    . GLU A 1 192 ? -12.290 34.771 107.789 1.00 34.78  ? 226  GLU A CA    1 
ATOM   1545 C C     . GLU A 1 192 ? -12.859 36.113 108.238 1.00 35.02  ? 226  GLU A C     1 
ATOM   1546 O O     . GLU A 1 192 ? -13.634 36.740 107.513 1.00 35.06  ? 226  GLU A O     1 
ATOM   1547 C CB    . GLU A 1 192 ? -13.148 33.620 108.342 1.00 35.00  ? 226  GLU A CB    1 
ATOM   1548 C CG    . GLU A 1 192 ? -13.054 33.415 109.846 1.00 35.58  ? 226  GLU A CG    1 
ATOM   1549 C CD    . GLU A 1 192 ? -12.121 32.280 110.230 1.00 35.82  ? 226  GLU A CD    1 
ATOM   1550 O OE1   . GLU A 1 192 ? -11.033 32.171 109.629 1.00 36.51  ? 226  GLU A OE1   1 
ATOM   1551 O OE2   . GLU A 1 192 ? -12.476 31.499 111.146 1.00 36.80  ? 226  GLU A OE2   1 
ATOM   1552 N N     . LEU A 1 193 ? -12.461 36.556 109.428 1.00 33.81  ? 227  LEU A N     1 
ATOM   1553 C CA    . LEU A 1 193 ? -12.939 37.826 109.956 1.00 33.09  ? 227  LEU A CA    1 
ATOM   1554 C C     . LEU A 1 193 ? -12.354 39.012 109.183 1.00 34.15  ? 227  LEU A C     1 
ATOM   1555 O O     . LEU A 1 193 ? -13.019 40.036 109.019 1.00 35.05  ? 227  LEU A O     1 
ATOM   1556 C CB    . LEU A 1 193 ? -12.591 37.955 111.441 1.00 32.31  ? 227  LEU A CB    1 
ATOM   1557 C CG    . LEU A 1 193 ? -13.158 36.944 112.442 1.00 33.62  ? 227  LEU A CG    1 
ATOM   1558 C CD1   . LEU A 1 193 ? -12.644 37.312 113.825 1.00 31.32  ? 227  LEU A CD1   1 
ATOM   1559 C CD2   . LEU A 1 193 ? -14.693 36.952 112.429 1.00 31.02  ? 227  LEU A CD2   1 
ATOM   1560 N N     . ILE A 1 194 ? -11.116 38.877 108.709 1.00 34.65  ? 228  ILE A N     1 
ATOM   1561 C CA    . ILE A 1 194 ? -10.466 39.950 107.951 1.00 35.30  ? 228  ILE A CA    1 
ATOM   1562 C C     . ILE A 1 194 ? -11.131 40.065 106.577 1.00 37.82  ? 228  ILE A C     1 
ATOM   1563 O O     . ILE A 1 194 ? -11.139 41.125 105.963 1.00 39.81  ? 228  ILE A O     1 
ATOM   1564 C CB    . ILE A 1 194 ? -8.951  39.680 107.772 1.00 33.73  ? 228  ILE A CB    1 
ATOM   1565 C CG1   . ILE A 1 194 ? -8.292  39.506 109.141 1.00 32.61  ? 228  ILE A CG1   1 
ATOM   1566 C CG2   . ILE A 1 194 ? -8.294  40.848 107.042 1.00 31.81  ? 228  ILE A CG2   1 
ATOM   1567 C CD1   . ILE A 1 194 ? -6.898  38.924 109.092 1.00 32.81  ? 228  ILE A CD1   1 
ATOM   1568 N N     . PHE A 1 195 ? -11.685 38.957 106.102 1.00 39.49  ? 229  PHE A N     1 
ATOM   1569 C CA    . PHE A 1 195 ? -12.383 38.938 104.825 1.00 39.51  ? 229  PHE A CA    1 
ATOM   1570 C C     . PHE A 1 195 ? -13.830 39.392 105.014 1.00 40.90  ? 229  PHE A C     1 
ATOM   1571 O O     . PHE A 1 195 ? -14.624 39.342 104.081 1.00 42.15  ? 229  PHE A O     1 
ATOM   1572 C CB    . PHE A 1 195 ? -12.350 37.532 104.229 1.00 38.11  ? 229  PHE A CB    1 
ATOM   1573 C CG    . PHE A 1 195 ? -11.150 37.266 103.382 1.00 39.52  ? 229  PHE A CG    1 
ATOM   1574 C CD1   . PHE A 1 195 ? -10.972 37.950 102.177 1.00 39.76  ? 229  PHE A CD1   1 
ATOM   1575 C CD2   . PHE A 1 195 ? -10.204 36.316 103.767 1.00 39.12  ? 229  PHE A CD2   1 
ATOM   1576 C CE1   . PHE A 1 195 ? -9.871  37.691 101.363 1.00 40.94  ? 229  PHE A CE1   1 
ATOM   1577 C CE2   . PHE A 1 195 ? -9.096  36.046 102.963 1.00 41.63  ? 229  PHE A CE2   1 
ATOM   1578 C CZ    . PHE A 1 195 ? -8.928  36.736 101.753 1.00 41.37  ? 229  PHE A CZ    1 
ATOM   1579 N N     . GLY A 1 196 ? -14.173 39.827 106.226 1.00 41.46  ? 230  GLY A N     1 
ATOM   1580 C CA    . GLY A 1 196 ? -15.525 40.306 106.483 1.00 42.13  ? 230  GLY A CA    1 
ATOM   1581 C C     . GLY A 1 196 ? -16.621 39.259 106.607 1.00 42.96  ? 230  GLY A C     1 
ATOM   1582 O O     . GLY A 1 196 ? -17.797 39.571 106.431 1.00 46.56  ? 230  GLY A O     1 
ATOM   1583 N N     . ALA A 1 197 ? -16.254 38.021 106.915 1.00 43.03  ? 231  ALA A N     1 
ATOM   1584 C CA    . ALA A 1 197 ? -17.235 36.947 107.072 1.00 42.90  ? 231  ALA A CA    1 
ATOM   1585 C C     . ALA A 1 197 ? -18.220 37.294 108.184 1.00 44.12  ? 231  ALA A C     1 
ATOM   1586 O O     . ALA A 1 197 ? -17.865 37.958 109.153 1.00 42.91  ? 231  ALA A O     1 
ATOM   1587 C CB    . ALA A 1 197 ? -16.523 35.638 107.397 1.00 40.39  ? 231  ALA A CB    1 
ATOM   1588 N N     . THR A 1 198 ? -19.458 36.836 108.052 1.00 46.81  ? 232  THR A N     1 
ATOM   1589 C CA    . THR A 1 198 ? -20.468 37.132 109.060 1.00 48.75  ? 232  THR A CA    1 
ATOM   1590 C C     . THR A 1 198 ? -21.012 35.853 109.666 1.00 48.99  ? 232  THR A C     1 
ATOM   1591 O O     . THR A 1 198 ? -21.728 35.870 110.668 1.00 47.70  ? 232  THR A O     1 
ATOM   1592 C CB    . THR A 1 198 ? -21.625 37.943 108.439 1.00 51.37  ? 232  THR A CB    1 
ATOM   1593 O OG1   . THR A 1 198 ? -21.103 39.142 107.856 1.00 53.24  ? 232  THR A OG1   1 
ATOM   1594 C CG2   . THR A 1 198 ? -22.639 38.326 109.502 1.00 54.68  ? 232  THR A CG2   1 
ATOM   1595 N N     . ASP A 1 199 ? -20.660 34.731 109.057 1.00 50.67  ? 233  ASP A N     1 
ATOM   1596 C CA    . ASP A 1 199 ? -21.132 33.449 109.547 1.00 52.91  ? 233  ASP A CA    1 
ATOM   1597 C C     . ASP A 1 199 ? -19.983 32.609 110.097 1.00 51.36  ? 233  ASP A C     1 
ATOM   1598 O O     . ASP A 1 199 ? -19.900 31.401 109.853 1.00 52.79  ? 233  ASP A O     1 
ATOM   1599 C CB    . ASP A 1 199 ? -21.835 32.707 108.417 1.00 56.79  ? 233  ASP A CB    1 
ATOM   1600 C CG    . ASP A 1 199 ? -20.926 32.465 107.237 1.00 62.11  ? 233  ASP A CG    1 
ATOM   1601 O OD1   . ASP A 1 199 ? -21.384 31.845 106.251 1.00 66.78  ? 233  ASP A OD1   1 
ATOM   1602 O OD2   . ASP A 1 199 ? -19.750 32.895 107.295 1.00 65.29  ? 233  ASP A OD2   1 
ATOM   1603 N N     . TYR A 1 200 ? -19.097 33.255 110.843 1.00 48.38  ? 234  TYR A N     1 
ATOM   1604 C CA    . TYR A 1 200 ? -17.954 32.567 111.430 1.00 44.63  ? 234  TYR A CA    1 
ATOM   1605 C C     . TYR A 1 200 ? -18.366 31.753 112.652 1.00 43.42  ? 234  TYR A C     1 
ATOM   1606 O O     . TYR A 1 200 ? -19.428 31.972 113.231 1.00 40.54  ? 234  TYR A O     1 
ATOM   1607 C CB    . TYR A 1 200 ? -16.883 33.586 111.804 1.00 41.44  ? 234  TYR A CB    1 
ATOM   1608 C CG    . TYR A 1 200 ? -17.367 34.688 112.720 1.00 40.02  ? 234  TYR A CG    1 
ATOM   1609 C CD1   . TYR A 1 200 ? -17.420 34.505 114.104 1.00 38.05  ? 234  TYR A CD1   1 
ATOM   1610 C CD2   . TYR A 1 200 ? -17.740 35.928 112.204 1.00 39.48  ? 234  TYR A CD2   1 
ATOM   1611 C CE1   . TYR A 1 200 ? -17.825 35.533 114.952 1.00 37.08  ? 234  TYR A CE1   1 
ATOM   1612 C CE2   . TYR A 1 200 ? -18.144 36.964 113.041 1.00 40.34  ? 234  TYR A CE2   1 
ATOM   1613 C CZ    . TYR A 1 200 ? -18.183 36.763 114.413 1.00 39.34  ? 234  TYR A CZ    1 
ATOM   1614 O OH    . TYR A 1 200 ? -18.578 37.799 115.230 1.00 39.41  ? 234  TYR A OH    1 
ATOM   1615 N N     . THR A 1 201 ? -17.515 30.812 113.039 1.00 42.80  ? 235  THR A N     1 
ATOM   1616 C CA    . THR A 1 201 ? -17.791 29.951 114.181 1.00 42.83  ? 235  THR A CA    1 
ATOM   1617 C C     . THR A 1 201 ? -16.783 30.199 115.299 1.00 43.88  ? 235  THR A C     1 
ATOM   1618 O O     . THR A 1 201 ? -15.884 31.032 115.171 1.00 45.47  ? 235  THR A O     1 
ATOM   1619 C CB    . THR A 1 201 ? -17.655 28.475 113.795 1.00 43.40  ? 235  THR A CB    1 
ATOM   1620 O OG1   . THR A 1 201 ? -16.267 28.177 113.605 1.00 40.26  ? 235  THR A OG1   1 
ATOM   1621 C CG2   . THR A 1 201 ? -18.415 28.175 112.496 1.00 41.73  ? 235  THR A CG2   1 
ATOM   1622 N N     . SER A 1 202 ? -16.920 29.441 116.378 1.00 40.75  ? 236  SER A N     1 
ATOM   1623 C CA    . SER A 1 202 ? -16.015 29.551 117.509 1.00 39.71  ? 236  SER A CA    1 
ATOM   1624 C C     . SER A 1 202 ? -14.568 29.225 117.124 1.00 38.22  ? 236  SER A C     1 
ATOM   1625 O O     . SER A 1 202 ? -13.655 29.485 117.901 1.00 38.71  ? 236  SER A O     1 
ATOM   1626 C CB    . SER A 1 202 ? -16.460 28.618 118.640 1.00 37.38  ? 236  SER A CB    1 
ATOM   1627 O OG    . SER A 1 202 ? -17.620 29.127 119.269 1.00 44.33  ? 236  SER A OG    1 
ATOM   1628 N N     . SER A 1 203 ? -14.360 28.659 115.934 1.00 35.73  ? 237  SER A N     1 
ATOM   1629 C CA    . SER A 1 203 ? -13.010 28.324 115.481 1.00 34.10  ? 237  SER A CA    1 
ATOM   1630 C C     . SER A 1 203 ? -12.124 29.582 115.346 1.00 34.04  ? 237  SER A C     1 
ATOM   1631 O O     . SER A 1 203 ? -10.916 29.463 115.117 1.00 34.28  ? 237  SER A O     1 
ATOM   1632 C CB    . SER A 1 203 ? -13.049 27.569 114.148 1.00 32.03  ? 237  SER A CB    1 
ATOM   1633 O OG    . SER A 1 203 ? -13.590 28.380 113.117 1.00 38.18  ? 237  SER A OG    1 
ATOM   1634 N N     . ILE A 1 204 ? -12.715 30.773 115.475 1.00 30.10  ? 238  ILE A N     1 
ATOM   1635 C CA    . ILE A 1 204 ? -11.915 31.988 115.382 1.00 31.68  ? 238  ILE A CA    1 
ATOM   1636 C C     . ILE A 1 204 ? -11.041 32.141 116.637 1.00 31.47  ? 238  ILE A C     1 
ATOM   1637 O O     . ILE A 1 204 ? -9.987  32.776 116.585 1.00 29.69  ? 238  ILE A O     1 
ATOM   1638 C CB    . ILE A 1 204 ? -12.777 33.293 115.218 1.00 30.40  ? 238  ILE A CB    1 
ATOM   1639 C CG1   . ILE A 1 204 ? -13.682 33.489 116.430 1.00 26.73  ? 238  ILE A CG1   1 
ATOM   1640 C CG2   . ILE A 1 204 ? -13.591 33.228 113.902 1.00 29.86  ? 238  ILE A CG2   1 
ATOM   1641 C CD1   . ILE A 1 204 ? -14.295 34.883 116.496 1.00 27.33  ? 238  ILE A CD1   1 
ATOM   1642 N N     . ASP A 1 205 ? -11.486 31.548 117.749 1.00 31.40  ? 239  ASP A N     1 
ATOM   1643 C CA    . ASP A 1 205 ? -10.754 31.578 119.029 1.00 31.39  ? 239  ASP A CA    1 
ATOM   1644 C C     . ASP A 1 205 ? -9.543  30.639 118.950 1.00 32.51  ? 239  ASP A C     1 
ATOM   1645 O O     . ASP A 1 205 ? -8.515  30.862 119.592 1.00 31.50  ? 239  ASP A O     1 
ATOM   1646 C CB    . ASP A 1 205 ? -11.628 31.111 120.204 1.00 26.99  ? 239  ASP A CB    1 
ATOM   1647 C CG    . ASP A 1 205 ? -12.672 32.143 120.642 1.00 31.79  ? 239  ASP A CG    1 
ATOM   1648 O OD1   . ASP A 1 205 ? -12.503 33.353 120.371 1.00 33.42  ? 239  ASP A OD1   1 
ATOM   1649 O OD2   . ASP A 1 205 ? -13.668 31.729 121.301 1.00 34.23  ? 239  ASP A OD2   1 
ATOM   1650 N N     . VAL A 1 206 ? -9.680  29.570 118.182 1.00 32.04  ? 240  VAL A N     1 
ATOM   1651 C CA    . VAL A 1 206 ? -8.582  28.623 118.048 1.00 29.74  ? 240  VAL A CA    1 
ATOM   1652 C C     . VAL A 1 206 ? -7.487  29.267 117.211 1.00 30.22  ? 240  VAL A C     1 
ATOM   1653 O O     . VAL A 1 206 ? -6.301  29.024 117.439 1.00 28.75  ? 240  VAL A O     1 
ATOM   1654 C CB    . VAL A 1 206 ? -9.077  27.302 117.412 1.00 26.34  ? 240  VAL A CB    1 
ATOM   1655 C CG1   . VAL A 1 206 ? -7.914  26.461 116.936 1.00 22.85  ? 240  VAL A CG1   1 
ATOM   1656 C CG2   . VAL A 1 206 ? -9.875  26.546 118.439 1.00 28.70  ? 240  VAL A CG2   1 
ATOM   1657 N N     . TRP A 1 207 ? -7.883  30.093 116.242 1.00 28.99  ? 241  TRP A N     1 
ATOM   1658 C CA    . TRP A 1 207 ? -6.884  30.794 115.422 1.00 27.95  ? 241  TRP A CA    1 
ATOM   1659 C C     . TRP A 1 207 ? -6.110  31.772 116.329 1.00 27.78  ? 241  TRP A C     1 
ATOM   1660 O O     . TRP A 1 207 ? -4.888  31.906 116.219 1.00 26.22  ? 241  TRP A O     1 
ATOM   1661 C CB    . TRP A 1 207 ? -7.551  31.570 114.284 1.00 25.02  ? 241  TRP A CB    1 
ATOM   1662 C CG    . TRP A 1 207 ? -6.592  32.482 113.560 1.00 25.98  ? 241  TRP A CG    1 
ATOM   1663 C CD1   . TRP A 1 207 ? -6.170  33.731 113.960 1.00 22.22  ? 241  TRP A CD1   1 
ATOM   1664 C CD2   . TRP A 1 207 ? -5.854  32.174 112.375 1.00 24.29  ? 241  TRP A CD2   1 
ATOM   1665 N NE1   . TRP A 1 207 ? -5.210  34.204 113.097 1.00 18.84  ? 241  TRP A NE1   1 
ATOM   1666 C CE2   . TRP A 1 207 ? -4.995  33.275 112.117 1.00 22.01  ? 241  TRP A CE2   1 
ATOM   1667 C CE3   . TRP A 1 207 ? -5.833  31.081 111.506 1.00 21.43  ? 241  TRP A CE3   1 
ATOM   1668 C CZ2   . TRP A 1 207 ? -4.119  33.309 111.028 1.00 24.03  ? 241  TRP A CZ2   1 
ATOM   1669 C CZ3   . TRP A 1 207 ? -4.957  31.114 110.410 1.00 26.49  ? 241  TRP A CZ3   1 
ATOM   1670 C CH2   . TRP A 1 207 ? -4.112  32.228 110.185 1.00 25.32  ? 241  TRP A CH2   1 
ATOM   1671 N N     . SER A 1 208 ? -6.846  32.454 117.202 1.00 27.56  ? 242  SER A N     1 
ATOM   1672 C CA    . SER A 1 208 ? -6.279  33.413 118.136 1.00 28.32  ? 242  SER A CA    1 
ATOM   1673 C C     . SER A 1 208 ? -5.319  32.715 119.100 1.00 29.83  ? 242  SER A C     1 
ATOM   1674 O O     . SER A 1 208 ? -4.287  33.267 119.462 1.00 29.25  ? 242  SER A O     1 
ATOM   1675 C CB    . SER A 1 208 ? -7.409  34.109 118.916 1.00 29.25  ? 242  SER A CB    1 
ATOM   1676 O OG    . SER A 1 208 ? -8.096  35.024 118.071 1.00 28.71  ? 242  SER A OG    1 
ATOM   1677 N N     . ALA A 1 209 ? -5.657  31.494 119.498 1.00 31.09  ? 243  ALA A N     1 
ATOM   1678 C CA    . ALA A 1 209 ? -4.808  30.728 120.399 1.00 32.33  ? 243  ALA A CA    1 
ATOM   1679 C C     . ALA A 1 209 ? -3.527  30.346 119.652 1.00 31.27  ? 243  ALA A C     1 
ATOM   1680 O O     . ALA A 1 209 ? -2.440  30.310 120.234 1.00 34.91  ? 243  ALA A O     1 
ATOM   1681 C CB    . ALA A 1 209 ? -5.554  29.476 120.898 1.00 28.52  ? 243  ALA A CB    1 
ATOM   1682 N N     . GLY A 1 210 ? -3.651  30.081 118.358 1.00 30.74  ? 244  GLY A N     1 
ATOM   1683 C CA    . GLY A 1 210 ? -2.482  29.729 117.567 1.00 29.20  ? 244  GLY A CA    1 
ATOM   1684 C C     . GLY A 1 210 ? -1.551  30.927 117.424 1.00 28.79  ? 244  GLY A C     1 
ATOM   1685 O O     . GLY A 1 210 ? -0.325  30.778 117.432 1.00 26.77  ? 244  GLY A O     1 
ATOM   1686 N N     . CYS A 1 211 ? -2.122  32.120 117.277 1.00 27.55  ? 245  CYS A N     1 
ATOM   1687 C CA    . CYS A 1 211 ? -1.281  33.313 117.175 1.00 28.69  ? 245  CYS A CA    1 
ATOM   1688 C C     . CYS A 1 211 ? -0.577  33.490 118.522 1.00 27.13  ? 245  CYS A C     1 
ATOM   1689 O O     . CYS A 1 211 ? 0.587   33.861 118.568 1.00 25.94  ? 245  CYS A O     1 
ATOM   1690 C CB    . CYS A 1 211 ? -2.104  34.564 116.830 1.00 25.45  ? 245  CYS A CB    1 
ATOM   1691 S SG    . CYS A 1 211 ? -2.898  34.489 115.159 1.00 27.06  ? 245  CYS A SG    1 
ATOM   1692 N N     . VAL A 1 212 ? -1.286  33.208 119.609 1.00 28.37  ? 246  VAL A N     1 
ATOM   1693 C CA    . VAL A 1 212 ? -0.702  33.334 120.942 1.00 30.38  ? 246  VAL A CA    1 
ATOM   1694 C C     . VAL A 1 212 ? 0.508   32.412 121.071 1.00 32.14  ? 246  VAL A C     1 
ATOM   1695 O O     . VAL A 1 212 ? 1.587   32.846 121.470 1.00 30.80  ? 246  VAL A O     1 
ATOM   1696 C CB    . VAL A 1 212 ? -1.707  32.977 122.052 1.00 29.55  ? 246  VAL A CB    1 
ATOM   1697 C CG1   . VAL A 1 212 ? -0.966  32.777 123.392 1.00 28.02  ? 246  VAL A CG1   1 
ATOM   1698 C CG2   . VAL A 1 212 ? -2.720  34.094 122.193 1.00 29.85  ? 246  VAL A CG2   1 
ATOM   1699 N N     . LEU A 1 213 ? 0.308   31.140 120.744 1.00 32.65  ? 247  LEU A N     1 
ATOM   1700 C CA    . LEU A 1 213 ? 1.380   30.157 120.802 1.00 33.02  ? 247  LEU A CA    1 
ATOM   1701 C C     . LEU A 1 213 ? 2.600   30.620 119.991 1.00 32.86  ? 247  LEU A C     1 
ATOM   1702 O O     . LEU A 1 213 ? 3.724   30.629 120.497 1.00 33.00  ? 247  LEU A O     1 
ATOM   1703 C CB    . LEU A 1 213 ? 0.894   28.813 120.259 1.00 30.65  ? 247  LEU A CB    1 
ATOM   1704 C CG    . LEU A 1 213 ? 1.958   27.751 119.958 1.00 35.96  ? 247  LEU A CG    1 
ATOM   1705 C CD1   . LEU A 1 213 ? 2.751   27.397 121.234 1.00 34.38  ? 247  LEU A CD1   1 
ATOM   1706 C CD2   . LEU A 1 213 ? 1.257   26.509 119.403 1.00 32.61  ? 247  LEU A CD2   1 
ATOM   1707 N N     . ALA A 1 214 ? 2.361   31.015 118.744 1.00 31.93  ? 248  ALA A N     1 
ATOM   1708 C CA    . ALA A 1 214 ? 3.421   31.448 117.852 1.00 30.95  ? 248  ALA A CA    1 
ATOM   1709 C C     . ALA A 1 214 ? 4.206   32.642 118.405 1.00 31.18  ? 248  ALA A C     1 
ATOM   1710 O O     . ALA A 1 214 ? 5.427   32.719 118.236 1.00 31.26  ? 248  ALA A O     1 
ATOM   1711 C CB    . ALA A 1 214 ? 2.834   31.784 116.461 1.00 31.27  ? 248  ALA A CB    1 
ATOM   1712 N N     . GLU A 1 215 ? 3.501   33.559 119.066 1.00 30.99  ? 249  GLU A N     1 
ATOM   1713 C CA    . GLU A 1 215 ? 4.110   34.746 119.671 1.00 32.34  ? 249  GLU A CA    1 
ATOM   1714 C C     . GLU A 1 215 ? 5.029   34.329 120.832 1.00 30.98  ? 249  GLU A C     1 
ATOM   1715 O O     . GLU A 1 215 ? 6.107   34.898 121.024 1.00 27.72  ? 249  GLU A O     1 
ATOM   1716 C CB    . GLU A 1 215 ? 3.021   35.690 120.196 1.00 30.71  ? 249  GLU A CB    1 
ATOM   1717 C CG    . GLU A 1 215 ? 3.512   37.070 120.542 1.00 37.13  ? 249  GLU A CG    1 
ATOM   1718 C CD    . GLU A 1 215 ? 2.376   38.031 120.880 1.00 44.45  ? 249  GLU A CD    1 
ATOM   1719 O OE1   . GLU A 1 215 ? 1.282   37.897 120.278 1.00 46.91  ? 249  GLU A OE1   1 
ATOM   1720 O OE2   . GLU A 1 215 ? 2.580   38.928 121.736 1.00 46.31  ? 249  GLU A OE2   1 
ATOM   1721 N N     . LEU A 1 216 ? 4.586   33.350 121.611 1.00 28.86  ? 250  LEU A N     1 
ATOM   1722 C CA    . LEU A 1 216 ? 5.386   32.865 122.726 1.00 32.77  ? 250  LEU A CA    1 
ATOM   1723 C C     . LEU A 1 216 ? 6.668   32.173 122.221 1.00 33.00  ? 250  LEU A C     1 
ATOM   1724 O O     . LEU A 1 216 ? 7.706   32.267 122.859 1.00 33.50  ? 250  LEU A O     1 
ATOM   1725 C CB    . LEU A 1 216 ? 4.564   31.901 123.600 1.00 31.71  ? 250  LEU A CB    1 
ATOM   1726 C CG    . LEU A 1 216 ? 3.435   32.554 124.401 1.00 34.28  ? 250  LEU A CG    1 
ATOM   1727 C CD1   . LEU A 1 216 ? 2.668   31.482 125.155 1.00 31.71  ? 250  LEU A CD1   1 
ATOM   1728 C CD2   . LEU A 1 216 ? 4.005   33.608 125.360 1.00 33.36  ? 250  LEU A CD2   1 
ATOM   1729 N N     . LEU A 1 217 ? 6.598   31.506 121.069 1.00 33.38  ? 251  LEU A N     1 
ATOM   1730 C CA    . LEU A 1 217 ? 7.777   30.826 120.502 1.00 34.33  ? 251  LEU A CA    1 
ATOM   1731 C C     . LEU A 1 217 ? 8.695   31.777 119.730 1.00 34.18  ? 251  LEU A C     1 
ATOM   1732 O O     . LEU A 1 217 ? 9.895   31.569 119.667 1.00 35.63  ? 251  LEU A O     1 
ATOM   1733 C CB    . LEU A 1 217 ? 7.361   29.708 119.543 1.00 29.43  ? 251  LEU A CB    1 
ATOM   1734 C CG    . LEU A 1 217 ? 6.438   28.610 120.051 1.00 29.61  ? 251  LEU A CG    1 
ATOM   1735 C CD1   . LEU A 1 217 ? 5.940   27.776 118.869 1.00 26.66  ? 251  LEU A CD1   1 
ATOM   1736 C CD2   . LEU A 1 217 ? 7.187   27.740 121.064 1.00 34.20  ? 251  LEU A CD2   1 
ATOM   1737 N N     . LEU A 1 218 ? 8.109   32.811 119.136 1.00 36.29  ? 252  LEU A N     1 
ATOM   1738 C CA    . LEU A 1 218 ? 8.846   33.776 118.329 1.00 35.74  ? 252  LEU A CA    1 
ATOM   1739 C C     . LEU A 1 218 ? 9.483   34.903 119.155 1.00 37.39  ? 252  LEU A C     1 
ATOM   1740 O O     . LEU A 1 218 ? 10.610  35.327 118.894 1.00 38.81  ? 252  LEU A O     1 
ATOM   1741 C CB    . LEU A 1 218 ? 7.894   34.369 117.292 1.00 37.80  ? 252  LEU A CB    1 
ATOM   1742 C CG    . LEU A 1 218 ? 8.477   34.876 115.980 1.00 43.85  ? 252  LEU A CG    1 
ATOM   1743 C CD1   . LEU A 1 218 ? 9.104   33.685 115.262 1.00 45.64  ? 252  LEU A CD1   1 
ATOM   1744 C CD2   . LEU A 1 218 ? 7.390   35.515 115.109 1.00 46.83  ? 252  LEU A CD2   1 
ATOM   1745 N N     . GLY A 1 219 ? 8.754   35.389 120.150 1.00 38.06  ? 253  GLY A N     1 
ATOM   1746 C CA    . GLY A 1 219 ? 9.242   36.483 120.966 1.00 38.47  ? 253  GLY A CA    1 
ATOM   1747 C C     . GLY A 1 219 ? 8.549   37.769 120.546 1.00 39.23  ? 253  GLY A C     1 
ATOM   1748 O O     . GLY A 1 219 ? 8.776   38.833 121.127 1.00 40.04  ? 253  GLY A O     1 
ATOM   1749 N N     . GLN A 1 220 ? 7.699   37.673 119.526 1.00 36.54  ? 254  GLN A N     1 
ATOM   1750 C CA    . GLN A 1 220 ? 6.960   38.836 119.031 1.00 39.20  ? 254  GLN A CA    1 
ATOM   1751 C C     . GLN A 1 220 ? 5.727   38.368 118.232 1.00 37.68  ? 254  GLN A C     1 
ATOM   1752 O O     . GLN A 1 220 ? 5.677   37.225 117.783 1.00 37.60  ? 254  GLN A O     1 
ATOM   1753 C CB    . GLN A 1 220 ? 7.896   39.694 118.172 1.00 39.20  ? 254  GLN A CB    1 
ATOM   1754 C CG    . GLN A 1 220 ? 8.480   38.941 116.994 1.00 39.48  ? 254  GLN A CG    1 
ATOM   1755 C CD    . GLN A 1 220 ? 9.487   39.757 116.209 1.00 44.53  ? 254  GLN A CD    1 
ATOM   1756 O OE1   . GLN A 1 220 ? 9.182   40.847 115.707 1.00 43.33  ? 254  GLN A OE1   1 
ATOM   1757 N NE2   . GLN A 1 220 ? 10.702  39.226 116.091 1.00 47.39  ? 254  GLN A NE2   1 
ATOM   1758 N N     . PRO A 1 221 ? 4.713   39.239 118.060 1.00 39.17  ? 255  PRO A N     1 
ATOM   1759 C CA    . PRO A 1 221 ? 3.509   38.837 117.309 1.00 37.74  ? 255  PRO A CA    1 
ATOM   1760 C C     . PRO A 1 221 ? 3.854   38.321 115.916 1.00 36.71  ? 255  PRO A C     1 
ATOM   1761 O O     . PRO A 1 221 ? 4.624   38.957 115.194 1.00 37.46  ? 255  PRO A O     1 
ATOM   1762 C CB    . PRO A 1 221 ? 2.692   40.131 117.249 1.00 37.60  ? 255  PRO A CB    1 
ATOM   1763 C CG    . PRO A 1 221 ? 3.107   40.848 118.508 1.00 39.09  ? 255  PRO A CG    1 
ATOM   1764 C CD    . PRO A 1 221 ? 4.602   40.642 118.505 1.00 38.39  ? 255  PRO A CD    1 
ATOM   1765 N N     . ILE A 1 222 ? 3.275   37.187 115.531 1.00 34.57  ? 256  ILE A N     1 
ATOM   1766 C CA    . ILE A 1 222 ? 3.569   36.616 114.220 1.00 32.53  ? 256  ILE A CA    1 
ATOM   1767 C C     . ILE A 1 222 ? 2.907   37.336 113.044 1.00 33.63  ? 256  ILE A C     1 
ATOM   1768 O O     . ILE A 1 222 ? 3.457   37.347 111.950 1.00 35.44  ? 256  ILE A O     1 
ATOM   1769 C CB    . ILE A 1 222 ? 3.204   35.107 114.157 1.00 33.02  ? 256  ILE A CB    1 
ATOM   1770 C CG1   . ILE A 1 222 ? 3.800   34.503 112.886 1.00 30.43  ? 256  ILE A CG1   1 
ATOM   1771 C CG2   . ILE A 1 222 ? 1.701   34.905 114.192 1.00 27.05  ? 256  ILE A CG2   1 
ATOM   1772 C CD1   . ILE A 1 222 ? 3.707   33.015 112.847 1.00 33.67  ? 256  ILE A CD1   1 
ATOM   1773 N N     . PHE A 1 223 ? 1.745   37.948 113.258 1.00 32.72  ? 257  PHE A N     1 
ATOM   1774 C CA    . PHE A 1 223 ? 1.077   38.658 112.168 1.00 33.55  ? 257  PHE A CA    1 
ATOM   1775 C C     . PHE A 1 223 ? 0.787   40.140 112.468 1.00 35.56  ? 257  PHE A C     1 
ATOM   1776 O O     . PHE A 1 223 ? -0.359  40.513 112.677 1.00 33.01  ? 257  PHE A O     1 
ATOM   1777 C CB    . PHE A 1 223 ? -0.236  37.959 111.809 1.00 28.85  ? 257  PHE A CB    1 
ATOM   1778 C CG    . PHE A 1 223 ? -0.079  36.510 111.458 1.00 28.38  ? 257  PHE A CG    1 
ATOM   1779 C CD1   . PHE A 1 223 ? 0.864   36.107 110.518 1.00 25.88  ? 257  PHE A CD1   1 
ATOM   1780 C CD2   . PHE A 1 223 ? -0.898  35.545 112.048 1.00 25.61  ? 257  PHE A CD2   1 
ATOM   1781 C CE1   . PHE A 1 223 ? 0.992   34.768 110.167 1.00 28.17  ? 257  PHE A CE1   1 
ATOM   1782 C CE2   . PHE A 1 223 ? -0.781  34.208 111.708 1.00 24.39  ? 257  PHE A CE2   1 
ATOM   1783 C CZ    . PHE A 1 223 ? 0.164   33.809 110.764 1.00 25.91  ? 257  PHE A CZ    1 
ATOM   1784 N N     . PRO A 1 224 ? 1.823   41.000 112.487 1.00 37.50  ? 258  PRO A N     1 
ATOM   1785 C CA    . PRO A 1 224 ? 1.643   42.437 112.763 1.00 40.31  ? 258  PRO A CA    1 
ATOM   1786 C C     . PRO A 1 224 ? 0.907   43.120 111.607 1.00 41.69  ? 258  PRO A C     1 
ATOM   1787 O O     . PRO A 1 224 ? 0.656   42.503 110.575 1.00 44.31  ? 258  PRO A O     1 
ATOM   1788 C CB    . PRO A 1 224 ? 3.079   42.960 112.885 1.00 41.32  ? 258  PRO A CB    1 
ATOM   1789 C CG    . PRO A 1 224 ? 3.933   41.724 113.053 1.00 40.12  ? 258  PRO A CG    1 
ATOM   1790 C CD    . PRO A 1 224 ? 3.235   40.702 112.197 1.00 37.74  ? 258  PRO A CD    1 
ATOM   1791 N N     . GLY A 1 225 ? 0.570   44.393 111.757 1.00 45.68  ? 259  GLY A N     1 
ATOM   1792 C CA    . GLY A 1 225 ? -0.126  45.091 110.677 1.00 47.61  ? 259  GLY A CA    1 
ATOM   1793 C C     . GLY A 1 225 ? -1.119  46.098 111.215 1.00 50.56  ? 259  GLY A C     1 
ATOM   1794 O O     . GLY A 1 225 ? -1.773  45.835 112.224 1.00 50.63  ? 259  GLY A O     1 
ATOM   1795 N N     . ASP A 1 226 ? -1.248  47.246 110.559 1.00 52.80  ? 260  ASP A N     1 
ATOM   1796 C CA    . ASP A 1 226 ? -2.181  48.266 111.039 1.00 55.95  ? 260  ASP A CA    1 
ATOM   1797 C C     . ASP A 1 226 ? -3.611  48.017 110.626 1.00 54.03  ? 260  ASP A C     1 
ATOM   1798 O O     . ASP A 1 226 ? -4.539  48.185 111.414 1.00 57.01  ? 260  ASP A O     1 
ATOM   1799 C CB    . ASP A 1 226 ? -1.775  49.658 110.548 1.00 60.48  ? 260  ASP A CB    1 
ATOM   1800 C CG    . ASP A 1 226 ? -0.719  50.299 111.426 1.00 66.44  ? 260  ASP A CG    1 
ATOM   1801 O OD1   . ASP A 1 226 ? -0.860  50.235 112.669 1.00 68.33  ? 260  ASP A OD1   1 
ATOM   1802 O OD2   . ASP A 1 226 ? 0.247   50.875 110.874 1.00 70.24  ? 260  ASP A OD2   1 
ATOM   1803 N N     . SER A 1 227 ? -3.780  47.623 109.376 1.00 50.99  ? 261  SER A N     1 
ATOM   1804 C CA    . SER A 1 227 ? -5.095  47.366 108.829 1.00 47.78  ? 261  SER A CA    1 
ATOM   1805 C C     . SER A 1 227 ? -5.263  45.879 108.544 1.00 46.50  ? 261  SER A C     1 
ATOM   1806 O O     . SER A 1 227 ? -4.316  45.098 108.678 1.00 44.71  ? 261  SER A O     1 
ATOM   1807 C CB    . SER A 1 227 ? -5.259  48.136 107.526 1.00 47.24  ? 261  SER A CB    1 
ATOM   1808 O OG    . SER A 1 227 ? -4.323  47.666 106.566 1.00 46.55  ? 261  SER A OG    1 
ATOM   1809 N N     . GLY A 1 228 ? -6.474  45.519 108.124 1.00 44.77  ? 262  GLY A N     1 
ATOM   1810 C CA    . GLY A 1 228 ? -6.792  44.149 107.792 1.00 43.23  ? 262  GLY A CA    1 
ATOM   1811 C C     . GLY A 1 228 ? -5.921  43.659 106.660 1.00 44.12  ? 262  GLY A C     1 
ATOM   1812 O O     . GLY A 1 228 ? -5.308  42.596 106.764 1.00 43.88  ? 262  GLY A O     1 
ATOM   1813 N N     . VAL A 1 229 ? -5.855  44.428 105.579 1.00 43.05  ? 263  VAL A N     1 
ATOM   1814 C CA    . VAL A 1 229 ? -5.031  44.049 104.440 1.00 42.33  ? 263  VAL A CA    1 
ATOM   1815 C C     . VAL A 1 229 ? -3.599  43.754 104.873 1.00 42.67  ? 263  VAL A C     1 
ATOM   1816 O O     . VAL A 1 229 ? -3.017  42.749 104.446 1.00 44.29  ? 263  VAL A O     1 
ATOM   1817 C CB    . VAL A 1 229 ? -5.046  45.155 103.351 1.00 41.60  ? 263  VAL A CB    1 
ATOM   1818 C CG1   . VAL A 1 229 ? -3.998  44.876 102.285 1.00 40.06  ? 263  VAL A CG1   1 
ATOM   1819 C CG2   . VAL A 1 229 ? -6.418  45.199 102.702 1.00 42.88  ? 263  VAL A CG2   1 
ATOM   1820 N N     . ASP A 1 230 ? -3.023  44.618 105.708 1.00 41.30  ? 264  ASP A N     1 
ATOM   1821 C CA    . ASP A 1 230 ? -1.659  44.390 106.190 1.00 42.77  ? 264  ASP A CA    1 
ATOM   1822 C C     . ASP A 1 230 ? -1.582  43.038 106.900 1.00 40.85  ? 264  ASP A C     1 
ATOM   1823 O O     . ASP A 1 230 ? -0.653  42.271 106.684 1.00 39.18  ? 264  ASP A O     1 
ATOM   1824 C CB    . ASP A 1 230 ? -1.227  45.469 107.191 1.00 48.23  ? 264  ASP A CB    1 
ATOM   1825 C CG    . ASP A 1 230 ? -0.829  46.774 106.524 1.00 54.11  ? 264  ASP A CG    1 
ATOM   1826 O OD1   . ASP A 1 230 ? 0.107   46.766 105.688 1.00 56.44  ? 264  ASP A OD1   1 
ATOM   1827 O OD2   . ASP A 1 230 ? -1.452  47.813 106.850 1.00 57.43  ? 264  ASP A OD2   1 
ATOM   1828 N N     . GLN A 1 231 ? -2.562  42.779 107.761 1.00 40.72  ? 265  GLN A N     1 
ATOM   1829 C CA    . GLN A 1 231 ? -2.645  41.537 108.524 1.00 42.29  ? 265  GLN A CA    1 
ATOM   1830 C C     . GLN A 1 231 ? -2.641  40.335 107.583 1.00 40.62  ? 265  GLN A C     1 
ATOM   1831 O O     . GLN A 1 231 ? -1.858  39.400 107.742 1.00 40.31  ? 265  GLN A O     1 
ATOM   1832 C CB    . GLN A 1 231 ? -3.933  41.528 109.357 1.00 44.09  ? 265  GLN A CB    1 
ATOM   1833 C CG    . GLN A 1 231 ? -3.757  41.749 110.855 1.00 51.44  ? 265  GLN A CG    1 
ATOM   1834 C CD    . GLN A 1 231 ? -3.643  40.435 111.628 1.00 55.62  ? 265  GLN A CD    1 
ATOM   1835 O OE1   . GLN A 1 231 ? -2.589  39.805 111.661 1.00 57.00  ? 265  GLN A OE1   1 
ATOM   1836 N NE2   . GLN A 1 231 ? -4.748  40.011 112.240 1.00 57.15  ? 265  GLN A NE2   1 
ATOM   1837 N N     . LEU A 1 232 ? -3.524  40.390 106.594 1.00 38.08  ? 266  LEU A N     1 
ATOM   1838 C CA    . LEU A 1 232 ? -3.679  39.333 105.614 1.00 37.23  ? 266  LEU A CA    1 
ATOM   1839 C C     . LEU A 1 232 ? -2.398  39.075 104.823 1.00 36.93  ? 266  LEU A C     1 
ATOM   1840 O O     . LEU A 1 232 ? -2.091  37.929 104.484 1.00 35.50  ? 266  LEU A O     1 
ATOM   1841 C CB    . LEU A 1 232 ? -4.827  39.692 104.689 1.00 37.49  ? 266  LEU A CB    1 
ATOM   1842 C CG    . LEU A 1 232 ? -5.653  38.535 104.152 1.00 42.67  ? 266  LEU A CG    1 
ATOM   1843 C CD1   . LEU A 1 232 ? -5.991  37.555 105.265 1.00 40.49  ? 266  LEU A CD1   1 
ATOM   1844 C CD2   . LEU A 1 232 ? -6.920  39.103 103.517 1.00 43.89  ? 266  LEU A CD2   1 
ATOM   1845 N N     . VAL A 1 233 ? -1.649  40.138 104.537 1.00 36.53  ? 267  VAL A N     1 
ATOM   1846 C CA    . VAL A 1 233 ? -0.391  40.011 103.811 1.00 35.52  ? 267  VAL A CA    1 
ATOM   1847 C C     . VAL A 1 233 ? 0.623   39.305 104.699 1.00 33.73  ? 267  VAL A C     1 
ATOM   1848 O O     . VAL A 1 233 ? 1.427   38.514 104.211 1.00 33.94  ? 267  VAL A O     1 
ATOM   1849 C CB    . VAL A 1 233 ? 0.182   41.403 103.377 1.00 37.48  ? 267  VAL A CB    1 
ATOM   1850 C CG1   . VAL A 1 233 ? 1.625   41.266 102.906 1.00 37.65  ? 267  VAL A CG1   1 
ATOM   1851 C CG2   . VAL A 1 233 ? -0.660  41.975 102.235 1.00 39.34  ? 267  VAL A CG2   1 
ATOM   1852 N N     . GLU A 1 234 ? 0.591   39.580 106.001 1.00 33.96  ? 268  GLU A N     1 
ATOM   1853 C CA    . GLU A 1 234 ? 1.526   38.925 106.917 1.00 33.52  ? 268  GLU A CA    1 
ATOM   1854 C C     . GLU A 1 234 ? 1.189   37.444 106.982 1.00 32.18  ? 268  GLU A C     1 
ATOM   1855 O O     . GLU A 1 234 ? 2.076   36.587 106.975 1.00 33.01  ? 268  GLU A O     1 
ATOM   1856 C CB    . GLU A 1 234 ? 1.432   39.519 108.325 1.00 34.25  ? 268  GLU A CB    1 
ATOM   1857 C CG    . GLU A 1 234 ? 2.037   40.899 108.490 1.00 38.03  ? 268  GLU A CG    1 
ATOM   1858 C CD    . GLU A 1 234 ? 3.537   40.952 108.199 1.00 42.27  ? 268  GLU A CD    1 
ATOM   1859 O OE1   . GLU A 1 234 ? 4.226   39.907 108.274 1.00 42.20  ? 268  GLU A OE1   1 
ATOM   1860 O OE2   . GLU A 1 234 ? 4.033   42.061 107.907 1.00 42.89  ? 268  GLU A OE2   1 
ATOM   1861 N N     . ILE A 1 235 ? -0.105  37.155 107.040 1.00 28.84  ? 269  ILE A N     1 
ATOM   1862 C CA    . ILE A 1 235 ? -0.567  35.782 107.096 1.00 30.92  ? 269  ILE A CA    1 
ATOM   1863 C C     . ILE A 1 235 ? -0.212  35.052 105.797 1.00 31.38  ? 269  ILE A C     1 
ATOM   1864 O O     . ILE A 1 235 ? 0.287   33.934 105.827 1.00 32.45  ? 269  ILE A O     1 
ATOM   1865 C CB    . ILE A 1 235 ? -2.085  35.724 107.342 1.00 27.36  ? 269  ILE A CB    1 
ATOM   1866 C CG1   . ILE A 1 235 ? -2.399  36.230 108.749 1.00 26.60  ? 269  ILE A CG1   1 
ATOM   1867 C CG2   . ILE A 1 235 ? -2.579  34.300 107.193 1.00 28.52  ? 269  ILE A CG2   1 
ATOM   1868 C CD1   . ILE A 1 235 ? -3.880  36.441 109.040 1.00 24.90  ? 269  ILE A CD1   1 
ATOM   1869 N N     . ILE A 1 236 ? -0.442  35.697 104.662 1.00 31.70  ? 270  ILE A N     1 
ATOM   1870 C CA    . ILE A 1 236 ? -0.141  35.068 103.381 1.00 32.80  ? 270  ILE A CA    1 
ATOM   1871 C C     . ILE A 1 236 ? 1.355   34.823 103.210 1.00 35.26  ? 270  ILE A C     1 
ATOM   1872 O O     . ILE A 1 236 ? 1.749   33.825 102.608 1.00 35.93  ? 270  ILE A O     1 
ATOM   1873 C CB    . ILE A 1 236 ? -0.696  35.917 102.216 1.00 32.21  ? 270  ILE A CB    1 
ATOM   1874 C CG1   . ILE A 1 236 ? -2.217  35.789 102.193 1.00 30.74  ? 270  ILE A CG1   1 
ATOM   1875 C CG2   . ILE A 1 236 ? -0.104  35.468 100.872 1.00 30.36  ? 270  ILE A CG2   1 
ATOM   1876 C CD1   . ILE A 1 236 ? -2.875  36.725 101.232 1.00 32.86  ? 270  ILE A CD1   1 
ATOM   1877 N N     . LYS A 1 237 ? 2.185   35.725 103.736 1.00 35.12  ? 271  LYS A N     1 
ATOM   1878 C CA    . LYS A 1 237 ? 3.637   35.555 103.648 1.00 36.10  ? 271  LYS A CA    1 
ATOM   1879 C C     . LYS A 1 237 ? 4.045   34.270 104.369 1.00 34.73  ? 271  LYS A C     1 
ATOM   1880 O O     . LYS A 1 237 ? 5.043   33.653 104.023 1.00 35.22  ? 271  LYS A O     1 
ATOM   1881 C CB    . LYS A 1 237 ? 4.375   36.742 104.288 1.00 39.25  ? 271  LYS A CB    1 
ATOM   1882 C CG    . LYS A 1 237 ? 4.385   38.020 103.461 1.00 45.28  ? 271  LYS A CG    1 
ATOM   1883 C CD    . LYS A 1 237 ? 5.713   38.216 102.754 1.00 50.67  ? 271  LYS A CD    1 
ATOM   1884 C CE    . LYS A 1 237 ? 5.993   37.108 101.763 1.00 53.34  ? 271  LYS A CE    1 
ATOM   1885 N NZ    . LYS A 1 237 ? 7.370   37.232 101.190 1.00 56.07  ? 271  LYS A NZ    1 
ATOM   1886 N N     . VAL A 1 238 ? 3.282   33.861 105.375 1.00 33.26  ? 272  VAL A N     1 
ATOM   1887 C CA    . VAL A 1 238 ? 3.637   32.634 106.068 1.00 35.27  ? 272  VAL A CA    1 
ATOM   1888 C C     . VAL A 1 238 ? 2.908   31.409 105.509 1.00 36.52  ? 272  VAL A C     1 
ATOM   1889 O O     . VAL A 1 238 ? 3.551   30.465 105.065 1.00 36.37  ? 272  VAL A O     1 
ATOM   1890 C CB    . VAL A 1 238 ? 3.371   32.718 107.595 1.00 34.88  ? 272  VAL A CB    1 
ATOM   1891 C CG1   . VAL A 1 238 ? 3.544   31.330 108.231 1.00 34.51  ? 272  VAL A CG1   1 
ATOM   1892 C CG2   . VAL A 1 238 ? 4.349   33.697 108.235 1.00 31.20  ? 272  VAL A CG2   1 
ATOM   1893 N N     . LEU A 1 239 ? 1.576   31.441 105.510 1.00 36.17  ? 273  LEU A N     1 
ATOM   1894 C CA    . LEU A 1 239 ? 0.769   30.318 105.036 1.00 36.46  ? 273  LEU A CA    1 
ATOM   1895 C C     . LEU A 1 239 ? 0.639   30.185 103.528 1.00 37.56  ? 273  LEU A C     1 
ATOM   1896 O O     . LEU A 1 239 ? 0.130   29.171 103.035 1.00 38.07  ? 273  LEU A O     1 
ATOM   1897 C CB    . LEU A 1 239 ? -0.642  30.402 105.612 1.00 36.23  ? 273  LEU A CB    1 
ATOM   1898 C CG    . LEU A 1 239 ? -0.832  30.297 107.111 1.00 38.99  ? 273  LEU A CG    1 
ATOM   1899 C CD1   . LEU A 1 239 ? -2.345  30.247 107.400 1.00 37.90  ? 273  LEU A CD1   1 
ATOM   1900 C CD2   . LEU A 1 239 ? -0.136  29.042 107.637 1.00 39.29  ? 273  LEU A CD2   1 
ATOM   1901 N N     . GLY A 1 240 ? 1.074   31.211 102.801 1.00 36.69  ? 274  GLY A N     1 
ATOM   1902 C CA    . GLY A 1 240 ? 0.966   31.195 101.356 1.00 32.63  ? 274  GLY A CA    1 
ATOM   1903 C C     . GLY A 1 240 ? -0.415  31.653 100.927 1.00 33.58  ? 274  GLY A C     1 
ATOM   1904 O O     . GLY A 1 240 ? -1.342  31.704 101.739 1.00 31.88  ? 274  GLY A O     1 
ATOM   1905 N N     . THR A 1 241 ? -0.561  32.007 99.654  1.00 34.13  ? 275  THR A N     1 
ATOM   1906 C CA    . THR A 1 241 ? -1.856  32.438 99.145  1.00 34.75  ? 275  THR A CA    1 
ATOM   1907 C C     . THR A 1 241 ? -2.843  31.293 99.334  1.00 34.38  ? 275  THR A C     1 
ATOM   1908 O O     . THR A 1 241 ? -2.545  30.161 98.984  1.00 36.94  ? 275  THR A O     1 
ATOM   1909 C CB    . THR A 1 241 ? -1.809  32.746 97.640  1.00 33.92  ? 275  THR A CB    1 
ATOM   1910 O OG1   . THR A 1 241 ? -0.848  33.772 97.384  1.00 35.54  ? 275  THR A OG1   1 
ATOM   1911 C CG2   . THR A 1 241 ? -3.180  33.197 97.155  1.00 33.49  ? 275  THR A CG2   1 
ATOM   1912 N N     . PRO A 1 242 ? -4.026  31.575 99.896  1.00 35.73  ? 276  PRO A N     1 
ATOM   1913 C CA    . PRO A 1 242 ? -5.044  30.541 100.112 1.00 37.14  ? 276  PRO A CA    1 
ATOM   1914 C C     . PRO A 1 242 ? -5.647  30.062 98.780  1.00 39.53  ? 276  PRO A C     1 
ATOM   1915 O O     . PRO A 1 242 ? -5.724  30.828 97.823  1.00 41.31  ? 276  PRO A O     1 
ATOM   1916 C CB    . PRO A 1 242 ? -6.067  31.250 101.000 1.00 35.15  ? 276  PRO A CB    1 
ATOM   1917 C CG    . PRO A 1 242 ? -5.962  32.677 100.562 1.00 35.23  ? 276  PRO A CG    1 
ATOM   1918 C CD    . PRO A 1 242 ? -4.473  32.880 100.420 1.00 34.03  ? 276  PRO A CD    1 
ATOM   1919 N N     . THR A 1 243 ? -6.061  28.798 98.715  1.00 41.34  ? 277  THR A N     1 
ATOM   1920 C CA    . THR A 1 243 ? -6.650  28.260 97.487  1.00 40.80  ? 277  THR A CA    1 
ATOM   1921 C C     . THR A 1 243 ? -8.089  28.737 97.379  1.00 42.52  ? 277  THR A C     1 
ATOM   1922 O O     . THR A 1 243 ? -8.655  29.246 98.355  1.00 42.70  ? 277  THR A O     1 
ATOM   1923 C CB    . THR A 1 243 ? -6.663  26.718 97.482  1.00 39.75  ? 277  THR A CB    1 
ATOM   1924 O OG1   . THR A 1 243 ? -7.458  26.247 98.577  1.00 38.69  ? 277  THR A OG1   1 
ATOM   1925 C CG2   . THR A 1 243 ? -5.258  26.166 97.599  1.00 35.97  ? 277  THR A CG2   1 
ATOM   1926 N N     . ARG A 1 244 ? -8.680  28.578 96.197  1.00 43.10  ? 278  ARG A N     1 
ATOM   1927 C CA    . ARG A 1 244 ? -10.068 28.986 95.993  1.00 45.45  ? 278  ARG A CA    1 
ATOM   1928 C C     . ARG A 1 244 ? -10.975 28.306 97.020  1.00 43.77  ? 278  ARG A C     1 
ATOM   1929 O O     . ARG A 1 244 ? -11.843 28.945 97.605  1.00 42.29  ? 278  ARG A O     1 
ATOM   1930 C CB    . ARG A 1 244 ? -10.545 28.629 94.577  1.00 47.58  ? 278  ARG A CB    1 
ATOM   1931 C CG    . ARG A 1 244 ? -12.031 28.904 94.384  1.00 52.22  ? 278  ARG A CG    1 
ATOM   1932 C CD    . ARG A 1 244 ? -12.533 28.565 92.988  1.00 57.13  ? 278  ARG A CD    1 
ATOM   1933 N NE    . ARG A 1 244 ? -11.913 29.414 91.976  1.00 61.68  ? 278  ARG A NE    1 
ATOM   1934 C CZ    . ARG A 1 244 ? -10.828 29.079 91.287  1.00 62.86  ? 278  ARG A CZ    1 
ATOM   1935 N NH1   . ARG A 1 244 ? -10.245 27.904 91.492  1.00 64.47  ? 278  ARG A NH1   1 
ATOM   1936 N NH2   . ARG A 1 244 ? -10.316 29.926 90.408  1.00 64.07  ? 278  ARG A NH2   1 
ATOM   1937 N N     . GLU A 1 245 ? -10.771 27.010 97.236  1.00 43.32  ? 279  GLU A N     1 
ATOM   1938 C CA    . GLU A 1 245 ? -11.576 26.281 98.207  1.00 46.17  ? 279  GLU A CA    1 
ATOM   1939 C C     . GLU A 1 245 ? -11.402 26.865 99.615  1.00 44.66  ? 279  GLU A C     1 
ATOM   1940 O O     . GLU A 1 245 ? -12.380 27.060 100.331 1.00 43.32  ? 279  GLU A O     1 
ATOM   1941 C CB    . GLU A 1 245 ? -11.219 24.785 98.188  1.00 50.71  ? 279  GLU A CB    1 
ATOM   1942 C CG    . GLU A 1 245 ? -9.866  24.437 97.559  1.00 59.91  ? 279  GLU A CG    1 
ATOM   1943 C CD    . GLU A 1 245 ? -9.785  24.755 96.059  1.00 65.12  ? 279  GLU A CD    1 
ATOM   1944 O OE1   . GLU A 1 245 ? -10.693 24.330 95.298  1.00 67.90  ? 279  GLU A OE1   1 
ATOM   1945 O OE2   . GLU A 1 245 ? -8.810  25.426 95.639  1.00 66.25  ? 279  GLU A OE2   1 
ATOM   1946 N N     . GLN A 1 246 ? -10.166 27.164 100.012 1.00 44.32  ? 280  GLN A N     1 
ATOM   1947 C CA    . GLN A 1 246 ? -9.948  27.747 101.341 1.00 43.60  ? 280  GLN A CA    1 
ATOM   1948 C C     . GLN A 1 246 ? -10.620 29.111 101.385 1.00 42.00  ? 280  GLN A C     1 
ATOM   1949 O O     . GLN A 1 246 ? -11.241 29.484 102.387 1.00 42.23  ? 280  GLN A O     1 
ATOM   1950 C CB    . GLN A 1 246 ? -8.451  27.881 101.647 1.00 42.24  ? 280  GLN A CB    1 
ATOM   1951 C CG    . GLN A 1 246 ? -7.740  26.542 101.765 1.00 41.42  ? 280  GLN A CG    1 
ATOM   1952 C CD    . GLN A 1 246 ? -6.231  26.663 101.888 1.00 42.55  ? 280  GLN A CD    1 
ATOM   1953 O OE1   . GLN A 1 246 ? -5.564  27.300 101.058 1.00 40.51  ? 280  GLN A OE1   1 
ATOM   1954 N NE2   . GLN A 1 246 ? -5.681  26.043 102.925 1.00 43.40  ? 280  GLN A NE2   1 
ATOM   1955 N N     . ILE A 1 247 ? -10.508 29.856 100.293 1.00 39.23  ? 281  ILE A N     1 
ATOM   1956 C CA    . ILE A 1 247 ? -11.143 31.157 100.252 1.00 40.08  ? 281  ILE A CA    1 
ATOM   1957 C C     . ILE A 1 247 ? -12.655 30.998 100.364 1.00 41.29  ? 281  ILE A C     1 
ATOM   1958 O O     . ILE A 1 247 ? -13.318 31.814 101.002 1.00 40.88  ? 281  ILE A O     1 
ATOM   1959 C CB    . ILE A 1 247 ? -10.810 31.895 98.964  1.00 41.27  ? 281  ILE A CB    1 
ATOM   1960 C CG1   . ILE A 1 247 ? -9.313  32.204 98.926  1.00 40.47  ? 281  ILE A CG1   1 
ATOM   1961 C CG2   . ILE A 1 247 ? -11.650 33.164 98.865  1.00 41.04  ? 281  ILE A CG2   1 
ATOM   1962 C CD1   . ILE A 1 247 ? -8.859  32.794 97.616  1.00 37.33  ? 281  ILE A CD1   1 
ATOM   1963 N N     . ARG A 1 248 ? -13.202 29.947 99.754  1.00 43.16  ? 282  ARG A N     1 
ATOM   1964 C CA    . ARG A 1 248 ? -14.644 29.713 99.810  1.00 46.13  ? 282  ARG A CA    1 
ATOM   1965 C C     . ARG A 1 248 ? -15.064 29.402 101.244 1.00 46.53  ? 282  ARG A C     1 
ATOM   1966 O O     . ARG A 1 248 ? -16.125 29.839 101.704 1.00 47.10  ? 282  ARG A O     1 
ATOM   1967 C CB    . ARG A 1 248 ? -15.047 28.553 98.889  1.00 49.19  ? 282  ARG A CB    1 
ATOM   1968 C CG    . ARG A 1 248 ? -16.539 28.520 98.528  1.00 52.56  ? 282  ARG A CG    1 
ATOM   1969 C CD    . ARG A 1 248 ? -17.111 27.125 98.714  1.00 58.53  ? 282  ARG A CD    1 
ATOM   1970 N NE    . ARG A 1 248 ? -16.283 26.117 98.058  1.00 63.57  ? 282  ARG A NE    1 
ATOM   1971 C CZ    . ARG A 1 248 ? -16.211 24.844 98.435  1.00 66.84  ? 282  ARG A CZ    1 
ATOM   1972 N NH1   . ARG A 1 248 ? -16.920 24.415 99.473  1.00 67.31  ? 282  ARG A NH1   1 
ATOM   1973 N NH2   . ARG A 1 248 ? -15.422 24.001 97.778  1.00 68.68  ? 282  ARG A NH2   1 
ATOM   1974 N N     . GLU A 1 249 ? -14.227 28.649 101.947 1.00 45.51  ? 283  GLU A N     1 
ATOM   1975 C CA    . GLU A 1 249 ? -14.502 28.304 103.338 1.00 47.19  ? 283  GLU A CA    1 
ATOM   1976 C C     . GLU A 1 249 ? -14.535 29.564 104.230 1.00 45.99  ? 283  GLU A C     1 
ATOM   1977 O O     . GLU A 1 249 ? -15.313 29.636 105.181 1.00 46.20  ? 283  GLU A O     1 
ATOM   1978 C CB    . GLU A 1 249 ? -13.432 27.332 103.853 1.00 50.46  ? 283  GLU A CB    1 
ATOM   1979 C CG    . GLU A 1 249 ? -13.418 25.961 103.181 1.00 54.70  ? 283  GLU A CG    1 
ATOM   1980 C CD    . GLU A 1 249 ? -14.651 25.138 103.510 1.00 59.65  ? 283  GLU A CD    1 
ATOM   1981 O OE1   . GLU A 1 249 ? -15.082 25.161 104.685 1.00 61.28  ? 283  GLU A OE1   1 
ATOM   1982 O OE2   . GLU A 1 249 ? -15.187 24.463 102.602 1.00 63.06  ? 283  GLU A OE2   1 
ATOM   1983 N N     . MET A 1 250 ? -13.702 30.555 103.916 1.00 43.65  ? 284  MET A N     1 
ATOM   1984 C CA    . MET A 1 250 ? -13.652 31.791 104.706 1.00 42.83  ? 284  MET A CA    1 
ATOM   1985 C C     . MET A 1 250 ? -14.747 32.799 104.338 1.00 41.67  ? 284  MET A C     1 
ATOM   1986 O O     . MET A 1 250 ? -15.433 33.324 105.213 1.00 39.89  ? 284  MET A O     1 
ATOM   1987 C CB    . MET A 1 250 ? -12.268 32.443 104.568 1.00 41.11  ? 284  MET A CB    1 
ATOM   1988 C CG    . MET A 1 250 ? -11.131 31.546 105.074 1.00 41.80  ? 284  MET A CG    1 
ATOM   1989 S SD    . MET A 1 250 ? -9.479  32.314 105.066 1.00 42.78  ? 284  MET A SD    1 
ATOM   1990 C CE    . MET A 1 250 ? -9.028  32.230 103.279 1.00 39.70  ? 284  MET A CE    1 
ATOM   1991 N N     . ASN A 1 251 ? -14.889 33.068 103.042 1.00 40.89  ? 285  ASN A N     1 
ATOM   1992 C CA    . ASN A 1 251 ? -15.902 33.996 102.535 1.00 42.82  ? 285  ASN A CA    1 
ATOM   1993 C C     . ASN A 1 251 ? -16.064 33.818 101.021 1.00 43.15  ? 285  ASN A C     1 
ATOM   1994 O O     . ASN A 1 251 ? -15.281 34.361 100.236 1.00 42.84  ? 285  ASN A O     1 
ATOM   1995 C CB    . ASN A 1 251 ? -15.508 35.442 102.823 1.00 42.80  ? 285  ASN A CB    1 
ATOM   1996 C CG    . ASN A 1 251 ? -16.640 36.416 102.536 1.00 45.15  ? 285  ASN A CG    1 
ATOM   1997 O OD1   . ASN A 1 251 ? -17.446 36.203 101.620 1.00 46.47  ? 285  ASN A OD1   1 
ATOM   1998 N ND2   . ASN A 1 251 ? -16.708 37.489 103.312 1.00 43.49  ? 285  ASN A ND2   1 
ATOM   1999 N N     . PRO A 1 252 ? -17.098 33.073 100.594 1.00 43.92  ? 286  PRO A N     1 
ATOM   2000 C CA    . PRO A 1 252 ? -17.354 32.824 99.167  1.00 44.52  ? 286  PRO A CA    1 
ATOM   2001 C C     . PRO A 1 252 ? -17.392 34.057 98.272  1.00 41.52  ? 286  PRO A C     1 
ATOM   2002 O O     . PRO A 1 252 ? -17.136 33.948 97.081  1.00 43.01  ? 286  PRO A O     1 
ATOM   2003 C CB    . PRO A 1 252 ? -18.673 32.045 99.177  1.00 45.07  ? 286  PRO A CB    1 
ATOM   2004 C CG    . PRO A 1 252 ? -19.357 32.548 100.395 1.00 46.04  ? 286  PRO A CG    1 
ATOM   2005 C CD    . PRO A 1 252 ? -18.229 32.607 101.414 1.00 44.90  ? 286  PRO A CD    1 
ATOM   2006 N N     . ASN A 1 253 ? -17.677 35.228 98.835  1.00 41.26  ? 287  ASN A N     1 
ATOM   2007 C CA    . ASN A 1 253 ? -17.698 36.450 98.027  1.00 41.94  ? 287  ASN A CA    1 
ATOM   2008 C C     . ASN A 1 253 ? -16.328 36.859 97.466  1.00 41.76  ? 287  ASN A C     1 
ATOM   2009 O O     . ASN A 1 253 ? -16.219 37.886 96.805  1.00 43.73  ? 287  ASN A O     1 
ATOM   2010 C CB    . ASN A 1 253 ? -18.264 37.634 98.821  1.00 43.90  ? 287  ASN A CB    1 
ATOM   2011 C CG    . ASN A 1 253 ? -19.739 37.467 99.160  1.00 46.94  ? 287  ASN A CG    1 
ATOM   2012 O OD1   . ASN A 1 253 ? -20.515 36.928 98.369  1.00 49.33  ? 287  ASN A OD1   1 
ATOM   2013 N ND2   . ASN A 1 253 ? -20.136 37.948 100.337 1.00 47.78  ? 287  ASN A ND2   1 
ATOM   2014 N N     . TYR A 1 254 ? -15.286 36.070 97.713  1.00 42.22  ? 288  TYR A N     1 
ATOM   2015 C CA    . TYR A 1 254 ? -13.950 36.406 97.220  1.00 41.94  ? 288  TYR A CA    1 
ATOM   2016 C C     . TYR A 1 254 ? -13.381 35.316 96.324  1.00 43.41  ? 288  TYR A C     1 
ATOM   2017 O O     . TYR A 1 254 ? -12.224 35.382 95.893  1.00 41.01  ? 288  TYR A O     1 
ATOM   2018 C CB    . TYR A 1 254 ? -13.009 36.633 98.405  1.00 40.49  ? 288  TYR A CB    1 
ATOM   2019 C CG    . TYR A 1 254 ? -13.240 37.936 99.123  1.00 38.50  ? 288  TYR A CG    1 
ATOM   2020 C CD1   . TYR A 1 254 ? -12.565 39.090 98.733  1.00 40.31  ? 288  TYR A CD1   1 
ATOM   2021 C CD2   . TYR A 1 254 ? -14.165 38.030 100.160 1.00 37.80  ? 288  TYR A CD2   1 
ATOM   2022 C CE1   . TYR A 1 254 ? -12.806 40.314 99.354  1.00 40.60  ? 288  TYR A CE1   1 
ATOM   2023 C CE2   . TYR A 1 254 ? -14.420 39.247 100.792 1.00 39.46  ? 288  TYR A CE2   1 
ATOM   2024 C CZ    . TYR A 1 254 ? -13.735 40.389 100.378 1.00 42.19  ? 288  TYR A CZ    1 
ATOM   2025 O OH    . TYR A 1 254 ? -13.989 41.617 100.955 1.00 44.25  ? 288  TYR A OH    1 
ATOM   2026 N N     . THR A 1 255 ? -14.215 34.320 96.046  1.00 47.50  ? 289  THR A N     1 
ATOM   2027 C CA    . THR A 1 255 ? -13.846 33.163 95.226  1.00 52.86  ? 289  THR A CA    1 
ATOM   2028 C C     . THR A 1 255 ? -13.243 33.515 93.872  1.00 53.48  ? 289  THR A C     1 
ATOM   2029 O O     . THR A 1 255 ? -12.240 32.940 93.461  1.00 52.14  ? 289  THR A O     1 
ATOM   2030 C CB    . THR A 1 255 ? -15.079 32.261 94.974  1.00 54.04  ? 289  THR A CB    1 
ATOM   2031 O OG1   . THR A 1 255 ? -15.703 31.939 96.224  1.00 57.97  ? 289  THR A OG1   1 
ATOM   2032 C CG2   . THR A 1 255 ? -14.659 30.972 94.296  1.00 58.75  ? 289  THR A CG2   1 
ATOM   2033 N N     . GLU A 1 256 ? -13.860 34.463 93.183  1.00 56.63  ? 290  GLU A N     1 
ATOM   2034 C CA    . GLU A 1 256 ? -13.388 34.854 91.866  1.00 60.52  ? 290  GLU A CA    1 
ATOM   2035 C C     . GLU A 1 256 ? -12.690 36.209 91.891  1.00 61.96  ? 290  GLU A C     1 
ATOM   2036 O O     . GLU A 1 256 ? -13.303 37.229 91.566  1.00 65.12  ? 290  GLU A O     1 
ATOM   2037 C CB    . GLU A 1 256 ? -14.570 34.913 90.889  1.00 61.61  ? 290  GLU A CB    1 
ATOM   2038 C CG    . GLU A 1 256 ? -15.561 33.742 90.988  1.00 63.43  ? 290  GLU A CG    1 
ATOM   2039 C CD    . GLU A 1 256 ? -14.963 32.392 90.605  1.00 63.95  ? 290  GLU A CD    1 
ATOM   2040 O OE1   . GLU A 1 256 ? -14.430 32.266 89.481  1.00 66.11  ? 290  GLU A OE1   1 
ATOM   2041 O OE2   . GLU A 1 256 ? -15.039 31.453 91.428  1.00 64.07  ? 290  GLU A OE2   1 
ATOM   2042 N N     . PHE A 1 257 ? -11.421 36.230 92.285  1.00 60.72  ? 291  PHE A N     1 
ATOM   2043 C CA    . PHE A 1 257 ? -10.681 37.484 92.310  1.00 59.38  ? 291  PHE A CA    1 
ATOM   2044 C C     . PHE A 1 257 ? -9.245  37.367 91.811  1.00 59.26  ? 291  PHE A C     1 
ATOM   2045 O O     . PHE A 1 257 ? -8.619  38.372 91.475  1.00 61.43  ? 291  PHE A O     1 
ATOM   2046 C CB    . PHE A 1 257 ? -10.707 38.103 93.707  1.00 57.74  ? 291  PHE A CB    1 
ATOM   2047 C CG    . PHE A 1 257 ? -11.865 39.034 93.935  1.00 56.40  ? 291  PHE A CG    1 
ATOM   2048 C CD1   . PHE A 1 257 ? -12.701 38.870 95.034  1.00 56.52  ? 291  PHE A CD1   1 
ATOM   2049 C CD2   . PHE A 1 257 ? -12.112 40.087 93.061  1.00 55.75  ? 291  PHE A CD2   1 
ATOM   2050 C CE1   . PHE A 1 257 ? -13.768 39.742 95.258  1.00 56.39  ? 291  PHE A CE1   1 
ATOM   2051 C CE2   . PHE A 1 257 ? -13.174 40.962 93.276  1.00 55.59  ? 291  PHE A CE2   1 
ATOM   2052 C CZ    . PHE A 1 257 ? -14.004 40.790 94.377  1.00 54.82  ? 291  PHE A CZ    1 
ATOM   2053 N N     . ALA A 1 258 ? -8.721  36.151 91.753  1.00 56.60  ? 292  ALA A N     1 
ATOM   2054 C CA    . ALA A 1 258 ? -7.360  35.946 91.261  1.00 54.46  ? 292  ALA A CA    1 
ATOM   2055 C C     . ALA A 1 258 ? -6.299  36.732 92.038  1.00 52.12  ? 292  ALA A C     1 
ATOM   2056 O O     . ALA A 1 258 ? -5.875  37.812 91.625  1.00 50.59  ? 292  ALA A O     1 
ATOM   2057 C CB    . ALA A 1 258 ? -7.279  36.296 89.762  1.00 53.83  ? 292  ALA A CB    1 
ATOM   2058 N N     . PHE A 1 259 ? -5.875  36.176 93.168  1.00 50.50  ? 293  PHE A N     1 
ATOM   2059 C CA    . PHE A 1 259 ? -4.856  36.800 93.985  1.00 48.42  ? 293  PHE A CA    1 
ATOM   2060 C C     . PHE A 1 259 ? -3.509  36.224 93.568  1.00 48.50  ? 293  PHE A C     1 
ATOM   2061 O O     . PHE A 1 259 ? -3.411  35.049 93.221  1.00 47.31  ? 293  PHE A O     1 
ATOM   2062 C CB    . PHE A 1 259 ? -5.104  36.503 95.468  1.00 47.38  ? 293  PHE A CB    1 
ATOM   2063 C CG    . PHE A 1 259 ? -6.447  36.976 95.973  1.00 47.57  ? 293  PHE A CG    1 
ATOM   2064 C CD1   . PHE A 1 259 ? -7.508  36.086 96.117  1.00 43.85  ? 293  PHE A CD1   1 
ATOM   2065 C CD2   . PHE A 1 259 ? -6.655  38.323 96.283  1.00 45.84  ? 293  PHE A CD2   1 
ATOM   2066 C CE1   . PHE A 1 259 ? -8.755  36.528 96.558  1.00 44.47  ? 293  PHE A CE1   1 
ATOM   2067 C CE2   . PHE A 1 259 ? -7.900  38.772 96.725  1.00 45.35  ? 293  PHE A CE2   1 
ATOM   2068 C CZ    . PHE A 1 259 ? -8.952  37.875 96.861  1.00 44.35  ? 293  PHE A CZ    1 
ATOM   2069 N N     . PRO A 1 260 ? -2.454  37.051 93.570  1.00 48.57  ? 294  PRO A N     1 
ATOM   2070 C CA    . PRO A 1 260 ? -1.121  36.569 93.189  1.00 48.53  ? 294  PRO A CA    1 
ATOM   2071 C C     . PRO A 1 260 ? -0.788  35.330 94.017  1.00 49.55  ? 294  PRO A C     1 
ATOM   2072 O O     . PRO A 1 260 ? -1.100  35.274 95.206  1.00 48.86  ? 294  PRO A O     1 
ATOM   2073 C CB    . PRO A 1 260 ? -0.220  37.750 93.526  1.00 48.14  ? 294  PRO A CB    1 
ATOM   2074 C CG    . PRO A 1 260 ? -1.105  38.929 93.200  1.00 49.49  ? 294  PRO A CG    1 
ATOM   2075 C CD    . PRO A 1 260 ? -2.463  38.513 93.763  1.00 48.54  ? 294  PRO A CD    1 
ATOM   2076 N N     . GLN A 1 261 ? -0.161  34.339 93.390  1.00 50.06  ? 295  GLN A N     1 
ATOM   2077 C CA    . GLN A 1 261 ? 0.183   33.097 94.082  1.00 51.27  ? 295  GLN A CA    1 
ATOM   2078 C C     . GLN A 1 261 ? 1.541   33.172 94.779  1.00 50.28  ? 295  GLN A C     1 
ATOM   2079 O O     . GLN A 1 261 ? 2.586   33.115 94.135  1.00 50.47  ? 295  GLN A O     1 
ATOM   2080 C CB    . GLN A 1 261 ? 0.171   31.930 93.088  1.00 52.21  ? 295  GLN A CB    1 
ATOM   2081 C CG    . GLN A 1 261 ? -0.666  30.712 93.500  1.00 55.32  ? 295  GLN A CG    1 
ATOM   2082 C CD    . GLN A 1 261 ? -2.138  31.031 93.769  1.00 56.85  ? 295  GLN A CD    1 
ATOM   2083 O OE1   . GLN A 1 261 ? -2.700  31.984 93.225  1.00 56.29  ? 295  GLN A OE1   1 
ATOM   2084 N NE2   . GLN A 1 261 ? -2.770  30.211 94.605  1.00 58.12  ? 295  GLN A NE2   1 
ATOM   2085 N N     . ILE A 1 262 ? 1.517   33.303 96.101  1.00 49.22  ? 296  ILE A N     1 
ATOM   2086 C CA    . ILE A 1 262 ? 2.749   33.371 96.872  1.00 48.18  ? 296  ILE A CA    1 
ATOM   2087 C C     . ILE A 1 262 ? 3.028   32.026 97.546  1.00 48.84  ? 296  ILE A C     1 
ATOM   2088 O O     . ILE A 1 262 ? 2.128   31.418 98.124  1.00 49.03  ? 296  ILE A O     1 
ATOM   2089 C CB    . ILE A 1 262 ? 2.674   34.474 97.961  1.00 47.14  ? 296  ILE A CB    1 
ATOM   2090 C CG1   . ILE A 1 262 ? 2.797   35.867 97.334  1.00 45.36  ? 296  ILE A CG1   1 
ATOM   2091 C CG2   . ILE A 1 262 ? 3.793   34.278 98.972  1.00 46.90  ? 296  ILE A CG2   1 
ATOM   2092 C CD1   . ILE A 1 262 ? 1.536   36.380 96.697  1.00 47.79  ? 296  ILE A CD1   1 
ATOM   2093 N N     . LYS A 1 263 ? 4.275   31.570 97.467  1.00 50.18  ? 297  LYS A N     1 
ATOM   2094 C CA    . LYS A 1 263 ? 4.683   30.304 98.073  1.00 52.18  ? 297  LYS A CA    1 
ATOM   2095 C C     . LYS A 1 263 ? 4.682   30.409 99.594  1.00 52.61  ? 297  LYS A C     1 
ATOM   2096 O O     . LYS A 1 263 ? 5.106   31.417 100.156 1.00 52.75  ? 297  LYS A O     1 
ATOM   2097 C CB    . LYS A 1 263 ? 6.102   29.913 97.622  1.00 55.90  ? 297  LYS A CB    1 
ATOM   2098 C CG    . LYS A 1 263 ? 6.238   29.519 96.155  1.00 61.45  ? 297  LYS A CG    1 
ATOM   2099 C CD    . LYS A 1 263 ? 5.559   28.183 95.881  1.00 65.45  ? 297  LYS A CD    1 
ATOM   2100 C CE    . LYS A 1 263 ? 5.701   27.753 94.424  1.00 68.27  ? 297  LYS A CE    1 
ATOM   2101 N NZ    . LYS A 1 263 ? 5.156   26.374 94.208  1.00 69.65  ? 297  LYS A NZ    1 
ATOM   2102 N N     . ALA A 1 264 ? 4.215   29.354 100.253 1.00 51.52  ? 298  ALA A N     1 
ATOM   2103 C CA    . ALA A 1 264 ? 4.175   29.311 101.701 1.00 49.97  ? 298  ALA A CA    1 
ATOM   2104 C C     . ALA A 1 264 ? 5.598   29.305 102.259 1.00 50.86  ? 298  ALA A C     1 
ATOM   2105 O O     . ALA A 1 264 ? 6.530   28.862 101.598 1.00 50.81  ? 298  ALA A O     1 
ATOM   2106 C CB    . ALA A 1 264 ? 3.432   28.075 102.164 1.00 48.15  ? 298  ALA A CB    1 
ATOM   2107 N N     . HIS A 1 265 ? 5.757   29.813 103.475 1.00 50.71  ? 299  HIS A N     1 
ATOM   2108 C CA    . HIS A 1 265 ? 7.056   29.857 104.121 1.00 50.68  ? 299  HIS A CA    1 
ATOM   2109 C C     . HIS A 1 265 ? 7.087   28.741 105.162 1.00 52.84  ? 299  HIS A C     1 
ATOM   2110 O O     . HIS A 1 265 ? 6.295   28.732 106.106 1.00 52.35  ? 299  HIS A O     1 
ATOM   2111 C CB    . HIS A 1 265 ? 7.258   31.220 104.784 1.00 49.57  ? 299  HIS A CB    1 
ATOM   2112 C CG    . HIS A 1 265 ? 8.649   31.456 105.284 1.00 49.22  ? 299  HIS A CG    1 
ATOM   2113 N ND1   . HIS A 1 265 ? 9.764   31.278 104.494 1.00 50.77  ? 299  HIS A ND1   1 
ATOM   2114 C CD2   . HIS A 1 265 ? 9.104   31.890 106.484 1.00 48.29  ? 299  HIS A CD2   1 
ATOM   2115 C CE1   . HIS A 1 265 ? 10.846  31.590 105.186 1.00 50.43  ? 299  HIS A CE1   1 
ATOM   2116 N NE2   . HIS A 1 265 ? 10.473  31.965 106.397 1.00 49.20  ? 299  HIS A NE2   1 
ATOM   2117 N N     . PRO A 1 266 ? 8.003   27.773 104.995 1.00 54.37  ? 300  PRO A N     1 
ATOM   2118 C CA    . PRO A 1 266 ? 8.152   26.634 105.911 1.00 54.20  ? 300  PRO A CA    1 
ATOM   2119 C C     . PRO A 1 266 ? 8.131   27.038 107.387 1.00 52.95  ? 300  PRO A C     1 
ATOM   2120 O O     . PRO A 1 266 ? 8.887   27.914 107.810 1.00 51.97  ? 300  PRO A O     1 
ATOM   2121 C CB    . PRO A 1 266 ? 9.500   26.041 105.501 1.00 55.12  ? 300  PRO A CB    1 
ATOM   2122 C CG    . PRO A 1 266 ? 9.575   26.351 104.040 1.00 54.73  ? 300  PRO A CG    1 
ATOM   2123 C CD    . PRO A 1 266 ? 9.065   27.770 103.970 1.00 54.39  ? 300  PRO A CD    1 
ATOM   2124 N N     . TRP A 1 267 ? 7.266   26.396 108.166 1.00 52.03  ? 301  TRP A N     1 
ATOM   2125 C CA    . TRP A 1 267 ? 7.170   26.688 109.593 1.00 52.95  ? 301  TRP A CA    1 
ATOM   2126 C C     . TRP A 1 267 ? 8.513   26.541 110.300 1.00 54.61  ? 301  TRP A C     1 
ATOM   2127 O O     . TRP A 1 267 ? 8.772   27.210 111.303 1.00 55.44  ? 301  TRP A O     1 
ATOM   2128 C CB    . TRP A 1 267 ? 6.150   25.765 110.256 1.00 52.95  ? 301  TRP A CB    1 
ATOM   2129 C CG    . TRP A 1 267 ? 4.739   26.170 110.010 1.00 52.83  ? 301  TRP A CG    1 
ATOM   2130 C CD1   . TRP A 1 267 ? 3.818   25.527 109.231 1.00 52.89  ? 301  TRP A CD1   1 
ATOM   2131 C CD2   . TRP A 1 267 ? 4.080   27.319 110.550 1.00 52.09  ? 301  TRP A CD2   1 
ATOM   2132 N NE1   . TRP A 1 267 ? 2.622   26.209 109.254 1.00 52.68  ? 301  TRP A NE1   1 
ATOM   2133 C CE2   . TRP A 1 267 ? 2.758   27.315 110.053 1.00 52.87  ? 301  TRP A CE2   1 
ATOM   2134 C CE3   . TRP A 1 267 ? 4.482   28.360 111.399 1.00 52.60  ? 301  TRP A CE3   1 
ATOM   2135 C CZ2   . TRP A 1 267 ? 1.830   28.307 110.388 1.00 53.50  ? 301  TRP A CZ2   1 
ATOM   2136 C CZ3   . TRP A 1 267 ? 3.563   29.347 111.730 1.00 54.77  ? 301  TRP A CZ3   1 
ATOM   2137 C CH2   . TRP A 1 267 ? 2.250   29.315 111.221 1.00 54.21  ? 301  TRP A CH2   1 
ATOM   2138 N N     . THR A 1 268 ? 9.365   25.670 109.772 1.00 54.54  ? 302  THR A N     1 
ATOM   2139 C CA    . THR A 1 268 ? 10.677  25.437 110.357 1.00 56.73  ? 302  THR A CA    1 
ATOM   2140 C C     . THR A 1 268 ? 11.551  26.672 110.253 1.00 56.07  ? 302  THR A C     1 
ATOM   2141 O O     . THR A 1 268 ? 12.330  26.967 111.155 1.00 57.36  ? 302  THR A O     1 
ATOM   2142 C CB    . THR A 1 268 ? 11.400  24.279 109.657 1.00 58.67  ? 302  THR A CB    1 
ATOM   2143 O OG1   . THR A 1 268 ? 10.508  23.161 109.551 1.00 60.70  ? 302  THR A OG1   1 
ATOM   2144 C CG2   . THR A 1 268 ? 12.632  23.865 110.459 1.00 58.67  ? 302  THR A CG2   1 
ATOM   2145 N N     . LYS A 1 269 ? 11.431  27.392 109.144 1.00 56.61  ? 303  LYS A N     1 
ATOM   2146 C CA    . LYS A 1 269 ? 12.213  28.605 108.953 1.00 56.61  ? 303  LYS A CA    1 
ATOM   2147 C C     . LYS A 1 269 ? 11.572  29.785 109.675 1.00 55.14  ? 303  LYS A C     1 
ATOM   2148 O O     . LYS A 1 269 ? 12.244  30.773 109.953 1.00 56.39  ? 303  LYS A O     1 
ATOM   2149 C CB    . LYS A 1 269 ? 12.351  28.939 107.462 1.00 59.29  ? 303  LYS A CB    1 
ATOM   2150 C CG    . LYS A 1 269 ? 13.365  28.094 106.697 1.00 61.93  ? 303  LYS A CG    1 
ATOM   2151 C CD    . LYS A 1 269 ? 12.921  26.644 106.566 1.00 65.92  ? 303  LYS A CD    1 
ATOM   2152 C CE    . LYS A 1 269 ? 13.933  25.804 105.772 1.00 67.17  ? 303  LYS A CE    1 
ATOM   2153 N NZ    . LYS A 1 269 ? 15.287  25.719 106.408 1.00 68.43  ? 303  LYS A NZ    1 
ATOM   2154 N N     . VAL A 1 270 ? 10.279  29.681 109.978 1.00 53.37  ? 304  VAL A N     1 
ATOM   2155 C CA    . VAL A 1 270 ? 9.563   30.752 110.671 1.00 53.34  ? 304  VAL A CA    1 
ATOM   2156 C C     . VAL A 1 270 ? 10.088  30.934 112.099 1.00 52.44  ? 304  VAL A C     1 
ATOM   2157 O O     . VAL A 1 270 ? 10.437  32.039 112.512 1.00 51.12  ? 304  VAL A O     1 
ATOM   2158 C CB    . VAL A 1 270 ? 8.032   30.466 110.718 1.00 54.16  ? 304  VAL A CB    1 
ATOM   2159 C CG1   . VAL A 1 270 ? 7.311   31.540 111.526 1.00 54.25  ? 304  VAL A CG1   1 
ATOM   2160 C CG2   . VAL A 1 270 ? 7.474   30.425 109.307 1.00 54.83  ? 304  VAL A CG2   1 
ATOM   2161 N N     . PHE A 1 271 ? 10.146  29.844 112.851 1.00 51.80  ? 305  PHE A N     1 
ATOM   2162 C CA    . PHE A 1 271 ? 10.638  29.901 114.217 1.00 52.49  ? 305  PHE A CA    1 
ATOM   2163 C C     . PHE A 1 271 ? 12.146  29.673 114.241 1.00 55.23  ? 305  PHE A C     1 
ATOM   2164 O O     . PHE A 1 271 ? 12.772  29.521 113.189 1.00 55.15  ? 305  PHE A O     1 
ATOM   2165 C CB    . PHE A 1 271 ? 9.931   28.842 115.053 1.00 49.74  ? 305  PHE A CB    1 
ATOM   2166 C CG    . PHE A 1 271 ? 8.438   28.989 115.063 1.00 47.84  ? 305  PHE A CG    1 
ATOM   2167 C CD1   . PHE A 1 271 ? 7.839   30.071 115.705 1.00 45.41  ? 305  PHE A CD1   1 
ATOM   2168 C CD2   . PHE A 1 271 ? 7.630   28.060 114.412 1.00 47.03  ? 305  PHE A CD2   1 
ATOM   2169 C CE1   . PHE A 1 271 ? 6.461   30.226 115.701 1.00 43.52  ? 305  PHE A CE1   1 
ATOM   2170 C CE2   . PHE A 1 271 ? 6.246   28.205 114.401 1.00 45.84  ? 305  PHE A CE2   1 
ATOM   2171 C CZ    . PHE A 1 271 ? 5.660   29.293 115.048 1.00 46.33  ? 305  PHE A CZ    1 
ATOM   2172 N N     . ARG A 1 272 ? 12.729  29.660 115.438 1.00 57.71  ? 306  ARG A N     1 
ATOM   2173 C CA    . ARG A 1 272 ? 14.163  29.435 115.582 1.00 60.92  ? 306  ARG A CA    1 
ATOM   2174 C C     . ARG A 1 272 ? 14.488  27.944 115.535 1.00 62.68  ? 306  ARG A C     1 
ATOM   2175 O O     . ARG A 1 272 ? 13.643  27.098 115.820 1.00 61.02  ? 306  ARG A O     1 
ATOM   2176 C CB    . ARG A 1 272 ? 14.681  30.042 116.892 1.00 63.27  ? 306  ARG A CB    1 
ATOM   2177 C CG    . ARG A 1 272 ? 14.019  29.510 118.156 1.00 69.54  ? 306  ARG A CG    1 
ATOM   2178 C CD    . ARG A 1 272 ? 14.674  30.097 119.400 1.00 74.10  ? 306  ARG A CD    1 
ATOM   2179 N NE    . ARG A 1 272 ? 14.774  31.554 119.316 1.00 79.80  ? 306  ARG A NE    1 
ATOM   2180 C CZ    . ARG A 1 272 ? 15.491  32.309 120.147 1.00 82.29  ? 306  ARG A CZ    1 
ATOM   2181 N NH1   . ARG A 1 272 ? 16.178  31.751 121.137 1.00 83.15  ? 306  ARG A NH1   1 
ATOM   2182 N NH2   . ARG A 1 272 ? 15.529  33.625 119.980 1.00 82.82  ? 306  ARG A NH2   1 
ATOM   2183 N N     . PRO A 1 273 ? 15.733  27.605 115.177 1.00 65.35  ? 307  PRO A N     1 
ATOM   2184 C CA    . PRO A 1 273 ? 16.198  26.216 115.079 1.00 66.89  ? 307  PRO A CA    1 
ATOM   2185 C C     . PRO A 1 273 ? 15.875  25.335 116.287 1.00 68.20  ? 307  PRO A C     1 
ATOM   2186 O O     . PRO A 1 273 ? 15.492  24.171 116.131 1.00 67.94  ? 307  PRO A O     1 
ATOM   2187 C CB    . PRO A 1 273 ? 17.701  26.377 114.868 1.00 67.40  ? 307  PRO A CB    1 
ATOM   2188 C CG    . PRO A 1 273 ? 17.789  27.669 114.101 1.00 67.55  ? 307  PRO A CG    1 
ATOM   2189 C CD    . PRO A 1 273 ? 16.826  28.546 114.861 1.00 66.44  ? 307  PRO A CD    1 
ATOM   2190 N N     . ARG A 1 274 ? 16.030  25.897 117.484 1.00 69.06  ? 308  ARG A N     1 
ATOM   2191 C CA    . ARG A 1 274 ? 15.779  25.167 118.724 1.00 70.26  ? 308  ARG A CA    1 
ATOM   2192 C C     . ARG A 1 274 ? 14.299  25.100 119.098 1.00 68.79  ? 308  ARG A C     1 
ATOM   2193 O O     . ARG A 1 274 ? 13.960  24.999 120.279 1.00 70.21  ? 308  ARG A O     1 
ATOM   2194 C CB    . ARG A 1 274 ? 16.570  25.810 119.877 1.00 74.66  ? 308  ARG A CB    1 
ATOM   2195 C CG    . ARG A 1 274 ? 18.074  25.926 119.621 1.00 80.12  ? 308  ARG A CG    1 
ATOM   2196 C CD    . ARG A 1 274 ? 18.696  24.561 119.321 1.00 84.32  ? 308  ARG A CD    1 
ATOM   2197 N NE    . ARG A 1 274 ? 19.874  24.666 118.459 1.00 88.86  ? 308  ARG A NE    1 
ATOM   2198 C CZ    . ARG A 1 274 ? 20.496  23.627 117.907 1.00 91.47  ? 308  ARG A CZ    1 
ATOM   2199 N NH1   . ARG A 1 274 ? 20.056  22.392 118.127 1.00 92.83  ? 308  ARG A NH1   1 
ATOM   2200 N NH2   . ARG A 1 274 ? 21.550  23.823 117.120 1.00 92.33  ? 308  ARG A NH2   1 
ATOM   2201 N N     . THR A 1 275 ? 13.418  25.156 118.104 1.00 65.20  ? 309  THR A N     1 
ATOM   2202 C CA    . THR A 1 275 ? 11.985  25.098 118.378 1.00 62.18  ? 309  THR A CA    1 
ATOM   2203 C C     . THR A 1 275 ? 11.473  23.664 118.312 1.00 60.54  ? 309  THR A C     1 
ATOM   2204 O O     . THR A 1 275 ? 11.648  22.975 117.310 1.00 60.92  ? 309  THR A O     1 
ATOM   2205 C CB    . THR A 1 275 ? 11.187  25.973 117.386 1.00 61.12  ? 309  THR A CB    1 
ATOM   2206 O OG1   . THR A 1 275 ? 11.572  27.340 117.542 1.00 59.60  ? 309  THR A OG1   1 
ATOM   2207 C CG2   . THR A 1 275 ? 9.692   25.850 117.643 1.00 60.17  ? 309  THR A CG2   1 
ATOM   2208 N N     . PRO A 1 276 ? 10.838  23.195 119.393 1.00 59.10  ? 310  PRO A N     1 
ATOM   2209 C CA    . PRO A 1 276 ? 10.303  21.831 119.450 1.00 59.27  ? 310  PRO A CA    1 
ATOM   2210 C C     . PRO A 1 276 ? 9.424   21.492 118.247 1.00 59.72  ? 310  PRO A C     1 
ATOM   2211 O O     . PRO A 1 276 ? 8.485   22.223 117.923 1.00 60.84  ? 310  PRO A O     1 
ATOM   2212 C CB    . PRO A 1 276 ? 9.516   21.826 120.759 1.00 57.16  ? 310  PRO A CB    1 
ATOM   2213 C CG    . PRO A 1 276 ? 10.297  22.771 121.611 1.00 56.83  ? 310  PRO A CG    1 
ATOM   2214 C CD    . PRO A 1 276 ? 10.582  23.911 120.654 1.00 57.13  ? 310  PRO A CD    1 
ATOM   2215 N N     . PRO A 1 277 ? 9.721   20.374 117.570 1.00 59.78  ? 311  PRO A N     1 
ATOM   2216 C CA    . PRO A 1 277 ? 8.959   19.932 116.400 1.00 58.85  ? 311  PRO A CA    1 
ATOM   2217 C C     . PRO A 1 277 ? 7.464   19.803 116.676 1.00 57.53  ? 311  PRO A C     1 
ATOM   2218 O O     . PRO A 1 277 ? 6.639   20.097 115.808 1.00 57.38  ? 311  PRO A O     1 
ATOM   2219 C CB    . PRO A 1 277 ? 9.603   18.588 116.059 1.00 59.37  ? 311  PRO A CB    1 
ATOM   2220 C CG    . PRO A 1 277 ? 11.028  18.800 116.450 1.00 60.16  ? 311  PRO A CG    1 
ATOM   2221 C CD    . PRO A 1 277 ? 10.891  19.503 117.790 1.00 60.57  ? 311  PRO A CD    1 
ATOM   2222 N N     . GLU A 1 278 ? 7.115   19.357 117.880 1.00 56.28  ? 312  GLU A N     1 
ATOM   2223 C CA    . GLU A 1 278 ? 5.707   19.195 118.239 1.00 55.45  ? 312  GLU A CA    1 
ATOM   2224 C C     . GLU A 1 278 ? 4.983   20.532 118.347 1.00 52.35  ? 312  GLU A C     1 
ATOM   2225 O O     . GLU A 1 278 ? 3.778   20.615 118.112 1.00 51.50  ? 312  GLU A O     1 
ATOM   2226 C CB    . GLU A 1 278 ? 5.567   18.432 119.560 1.00 57.68  ? 312  GLU A CB    1 
ATOM   2227 C CG    . GLU A 1 278 ? 5.902   16.962 119.449 1.00 62.35  ? 312  GLU A CG    1 
ATOM   2228 C CD    . GLU A 1 278 ? 5.178   16.292 118.290 1.00 66.31  ? 312  GLU A CD    1 
ATOM   2229 O OE1   . GLU A 1 278 ? 3.936   16.404 118.212 1.00 67.51  ? 312  GLU A OE1   1 
ATOM   2230 O OE2   . GLU A 1 278 ? 5.856   15.652 117.452 1.00 69.37  ? 312  GLU A OE2   1 
ATOM   2231 N N     . ALA A 1 279 ? 5.722   21.570 118.719 1.00 50.06  ? 313  ALA A N     1 
ATOM   2232 C CA    . ALA A 1 279 ? 5.149   22.902 118.842 1.00 48.65  ? 313  ALA A CA    1 
ATOM   2233 C C     . ALA A 1 279 ? 4.793   23.387 117.440 1.00 47.33  ? 313  ALA A C     1 
ATOM   2234 O O     . ALA A 1 279 ? 3.692   23.892 117.204 1.00 44.64  ? 313  ALA A O     1 
ATOM   2235 C CB    . ALA A 1 279 ? 6.153   23.850 119.493 1.00 47.53  ? 313  ALA A CB    1 
ATOM   2236 N N     . ILE A 1 280 ? 5.732   23.213 116.513 1.00 45.51  ? 314  ILE A N     1 
ATOM   2237 C CA    . ILE A 1 280 ? 5.531   23.621 115.132 1.00 45.47  ? 314  ILE A CA    1 
ATOM   2238 C C     . ILE A 1 280 ? 4.349   22.866 114.536 1.00 46.32  ? 314  ILE A C     1 
ATOM   2239 O O     . ILE A 1 280 ? 3.507   23.450 113.846 1.00 45.97  ? 314  ILE A O     1 
ATOM   2240 C CB    . ILE A 1 280 ? 6.812   23.375 114.293 1.00 45.60  ? 314  ILE A CB    1 
ATOM   2241 C CG1   . ILE A 1 280 ? 7.902   24.348 114.745 1.00 44.25  ? 314  ILE A CG1   1 
ATOM   2242 C CG2   . ILE A 1 280 ? 6.527   23.555 112.807 1.00 44.24  ? 314  ILE A CG2   1 
ATOM   2243 C CD1   . ILE A 1 280 ? 9.186   24.244 113.963 1.00 45.93  ? 314  ILE A CD1   1 
ATOM   2244 N N     . ALA A 1 281 ? 4.274   21.571 114.825 1.00 45.06  ? 315  ALA A N     1 
ATOM   2245 C CA    . ALA A 1 281 ? 3.181   20.752 114.320 1.00 43.92  ? 315  ALA A CA    1 
ATOM   2246 C C     . ALA A 1 281 ? 1.860   21.255 114.882 1.00 43.00  ? 315  ALA A C     1 
ATOM   2247 O O     . ALA A 1 281 ? 0.883   21.417 114.153 1.00 44.50  ? 315  ALA A O     1 
ATOM   2248 C CB    . ALA A 1 281 ? 3.391   19.288 114.712 1.00 44.99  ? 315  ALA A CB    1 
ATOM   2249 N N     . LEU A 1 282 ? 1.827   21.507 116.181 1.00 39.71  ? 316  LEU A N     1 
ATOM   2250 C CA    . LEU A 1 282 ? 0.606   21.988 116.801 1.00 40.91  ? 316  LEU A CA    1 
ATOM   2251 C C     . LEU A 1 282 ? 0.187   23.327 116.171 1.00 41.80  ? 316  LEU A C     1 
ATOM   2252 O O     . LEU A 1 282 ? -0.993  23.573 115.909 1.00 41.63  ? 316  LEU A O     1 
ATOM   2253 C CB    . LEU A 1 282 ? 0.845   22.179 118.289 1.00 39.32  ? 316  LEU A CB    1 
ATOM   2254 C CG    . LEU A 1 282 ? -0.322  22.104 119.260 1.00 39.29  ? 316  LEU A CG    1 
ATOM   2255 C CD1   . LEU A 1 282 ? 0.064   22.964 120.455 1.00 34.87  ? 316  LEU A CD1   1 
ATOM   2256 C CD2   . LEU A 1 282 ? -1.628  22.577 118.634 1.00 39.33  ? 316  LEU A CD2   1 
ATOM   2257 N N     . CYS A 1 283 ? 1.170   24.189 115.937 1.00 42.16  ? 317  CYS A N     1 
ATOM   2258 C CA    . CYS A 1 283 ? 0.919   25.497 115.363 1.00 44.14  ? 317  CYS A CA    1 
ATOM   2259 C C     . CYS A 1 283 ? 0.290   25.430 113.961 1.00 44.10  ? 317  CYS A C     1 
ATOM   2260 O O     . CYS A 1 283 ? -0.674  26.151 113.673 1.00 42.83  ? 317  CYS A O     1 
ATOM   2261 C CB    . CYS A 1 283 ? 2.220   26.296 115.333 1.00 47.71  ? 317  CYS A CB    1 
ATOM   2262 S SG    . CYS A 1 283 ? 1.970   28.053 115.514 1.00 54.98  ? 317  CYS A SG    1 
ATOM   2263 N N     . SER A 1 284 ? 0.814   24.558 113.104 1.00 43.46  ? 318  SER A N     1 
ATOM   2264 C CA    . SER A 1 284 ? 0.277   24.399 111.755 1.00 45.57  ? 318  SER A CA    1 
ATOM   2265 C C     . SER A 1 284 ? -1.155  23.819 111.747 1.00 44.88  ? 318  SER A C     1 
ATOM   2266 O O     . SER A 1 284 ? -1.899  24.020 110.788 1.00 46.40  ? 318  SER A O     1 
ATOM   2267 C CB    . SER A 1 284 ? 1.194   23.500 110.923 1.00 47.25  ? 318  SER A CB    1 
ATOM   2268 O OG    . SER A 1 284 ? 1.129   22.167 111.392 1.00 52.73  ? 318  SER A OG    1 
ATOM   2269 N N     . ARG A 1 285 ? -1.544  23.112 112.806 1.00 43.41  ? 319  ARG A N     1 
ATOM   2270 C CA    . ARG A 1 285 ? -2.895  22.539 112.893 1.00 43.38  ? 319  ARG A CA    1 
ATOM   2271 C C     . ARG A 1 285 ? -3.879  23.536 113.511 1.00 43.34  ? 319  ARG A C     1 
ATOM   2272 O O     . ARG A 1 285 ? -5.083  23.272 113.581 1.00 41.80  ? 319  ARG A O     1 
ATOM   2273 C CB    . ARG A 1 285 ? -2.906  21.256 113.748 1.00 44.67  ? 319  ARG A CB    1 
ATOM   2274 C CG    . ARG A 1 285 ? -1.930  20.184 113.303 1.00 49.29  ? 319  ARG A CG    1 
ATOM   2275 C CD    . ARG A 1 285 ? -2.232  19.715 111.893 1.00 52.95  ? 319  ARG A CD    1 
ATOM   2276 N NE    . ARG A 1 285 ? -3.587  19.185 111.807 1.00 57.50  ? 319  ARG A NE    1 
ATOM   2277 C CZ    . ARG A 1 285 ? -4.046  18.196 112.569 1.00 61.92  ? 319  ARG A CZ    1 
ATOM   2278 N NH1   . ARG A 1 285 ? -3.256  17.630 113.477 1.00 64.03  ? 319  ARG A NH1   1 
ATOM   2279 N NH2   . ARG A 1 285 ? -5.295  17.773 112.426 1.00 63.14  ? 319  ARG A NH2   1 
ATOM   2280 N N     . LEU A 1 286 ? -3.354  24.668 113.980 1.00 41.41  ? 320  LEU A N     1 
ATOM   2281 C CA    . LEU A 1 286 ? -4.172  25.716 114.591 1.00 38.72  ? 320  LEU A CA    1 
ATOM   2282 C C     . LEU A 1 286 ? -4.361  26.860 113.601 1.00 39.08  ? 320  LEU A C     1 
ATOM   2283 O O     . LEU A 1 286 ? -5.464  27.384 113.439 1.00 38.59  ? 320  LEU A O     1 
ATOM   2284 C CB    . LEU A 1 286 ? -3.492  26.249 115.851 1.00 37.05  ? 320  LEU A CB    1 
ATOM   2285 C CG    . LEU A 1 286 ? -3.847  25.749 117.261 1.00 37.27  ? 320  LEU A CG    1 
ATOM   2286 C CD1   . LEU A 1 286 ? -4.338  24.322 117.247 1.00 35.35  ? 320  LEU A CD1   1 
ATOM   2287 C CD2   . LEU A 1 286 ? -2.616  25.909 118.149 1.00 36.10  ? 320  LEU A CD2   1 
ATOM   2288 N N     . LEU A 1 287 ? -3.266  27.236 112.946 1.00 38.30  ? 321  LEU A N     1 
ATOM   2289 C CA    . LEU A 1 287 ? -3.271  28.321 111.984 1.00 35.97  ? 321  LEU A CA    1 
ATOM   2290 C C     . LEU A 1 287 ? -3.567  27.794 110.589 1.00 36.48  ? 321  LEU A C     1 
ATOM   2291 O O     . LEU A 1 287 ? -2.691  27.711 109.737 1.00 35.81  ? 321  LEU A O     1 
ATOM   2292 C CB    . LEU A 1 287 ? -1.927  29.063 112.025 1.00 34.73  ? 321  LEU A CB    1 
ATOM   2293 C CG    . LEU A 1 287 ? -1.634  29.719 113.388 1.00 34.63  ? 321  LEU A CG    1 
ATOM   2294 C CD1   . LEU A 1 287 ? -0.272  30.390 113.387 1.00 31.72  ? 321  LEU A CD1   1 
ATOM   2295 C CD2   . LEU A 1 287 ? -2.734  30.729 113.699 1.00 32.21  ? 321  LEU A CD2   1 
ATOM   2296 N N     . GLU A 1 288 ? -4.829  27.433 110.381 1.00 38.41  ? 322  GLU A N     1 
ATOM   2297 C CA    . GLU A 1 288 ? -5.315  26.905 109.113 1.00 39.33  ? 322  GLU A CA    1 
ATOM   2298 C C     . GLU A 1 288 ? -6.320  27.881 108.507 1.00 37.70  ? 322  GLU A C     1 
ATOM   2299 O O     . GLU A 1 288 ? -7.171  28.431 109.209 1.00 34.09  ? 322  GLU A O     1 
ATOM   2300 C CB    . GLU A 1 288 ? -6.033  25.567 109.335 1.00 43.68  ? 322  GLU A CB    1 
ATOM   2301 C CG    . GLU A 1 288 ? -5.167  24.418 109.838 1.00 49.48  ? 322  GLU A CG    1 
ATOM   2302 C CD    . GLU A 1 288 ? -4.492  23.651 108.714 1.00 53.00  ? 322  GLU A CD    1 
ATOM   2303 O OE1   . GLU A 1 288 ? -3.828  22.626 109.003 1.00 56.32  ? 322  GLU A OE1   1 
ATOM   2304 O OE2   . GLU A 1 288 ? -4.626  24.068 107.545 1.00 54.95  ? 322  GLU A OE2   1 
ATOM   2305 N N     . TYR A 1 289 ? -6.232  28.087 107.200 1.00 37.41  ? 323  TYR A N     1 
ATOM   2306 C CA    . TYR A 1 289 ? -7.175  28.970 106.537 1.00 37.03  ? 323  TYR A CA    1 
ATOM   2307 C C     . TYR A 1 289 ? -8.596  28.458 106.774 1.00 38.15  ? 323  TYR A C     1 
ATOM   2308 O O     . TYR A 1 289 ? -9.440  29.178 107.311 1.00 40.28  ? 323  TYR A O     1 
ATOM   2309 C CB    . TYR A 1 289 ? -6.877  29.023 105.043 1.00 36.33  ? 323  TYR A CB    1 
ATOM   2310 C CG    . TYR A 1 289 ? -5.766  29.973 104.689 1.00 35.33  ? 323  TYR A CG    1 
ATOM   2311 C CD1   . TYR A 1 289 ? -4.668  29.555 103.933 1.00 31.60  ? 323  TYR A CD1   1 
ATOM   2312 C CD2   . TYR A 1 289 ? -5.827  31.310 105.088 1.00 35.29  ? 323  TYR A CD2   1 
ATOM   2313 C CE1   . TYR A 1 289 ? -3.662  30.450 103.583 1.00 30.34  ? 323  TYR A CE1   1 
ATOM   2314 C CE2   . TYR A 1 289 ? -4.832  32.214 104.745 1.00 30.83  ? 323  TYR A CE2   1 
ATOM   2315 C CZ    . TYR A 1 289 ? -3.757  31.786 103.995 1.00 31.47  ? 323  TYR A CZ    1 
ATOM   2316 O OH    . TYR A 1 289 ? -2.785  32.703 103.653 1.00 31.05  ? 323  TYR A OH    1 
ATOM   2317 N N     . THR A 1 290 ? -8.855  27.210 106.391 1.00 39.11  ? 324  THR A N     1 
ATOM   2318 C CA    . THR A 1 290 ? -10.179 26.613 106.558 1.00 39.07  ? 324  THR A CA    1 
ATOM   2319 C C     . THR A 1 290 ? -10.510 26.463 108.028 1.00 37.49  ? 324  THR A C     1 
ATOM   2320 O O     . THR A 1 290 ? -9.931  25.645 108.743 1.00 37.11  ? 324  THR A O     1 
ATOM   2321 C CB    . THR A 1 290 ? -10.267 25.239 105.857 1.00 41.79  ? 324  THR A CB    1 
ATOM   2322 O OG1   . THR A 1 290 ? -9.979  25.409 104.468 1.00 45.97  ? 324  THR A OG1   1 
ATOM   2323 C CG2   . THR A 1 290 ? -11.685 24.648 105.992 1.00 42.62  ? 324  THR A CG2   1 
ATOM   2324 N N     . PRO A 1 291 ? -11.470 27.254 108.502 1.00 40.01  ? 325  PRO A N     1 
ATOM   2325 C CA    . PRO A 1 291 ? -11.833 27.170 109.915 1.00 40.54  ? 325  PRO A CA    1 
ATOM   2326 C C     . PRO A 1 291 ? -12.242 25.783 110.412 1.00 44.26  ? 325  PRO A C     1 
ATOM   2327 O O     . PRO A 1 291 ? -11.961 25.441 111.561 1.00 46.26  ? 325  PRO A O     1 
ATOM   2328 C CB    . PRO A 1 291 ? -12.928 28.230 110.052 1.00 39.87  ? 325  PRO A CB    1 
ATOM   2329 C CG    . PRO A 1 291 ? -13.503 28.338 108.684 1.00 40.04  ? 325  PRO A CG    1 
ATOM   2330 C CD    . PRO A 1 291 ? -12.324 28.213 107.775 1.00 38.88  ? 325  PRO A CD    1 
ATOM   2331 N N     . THR A 1 292 ? -12.877 24.970 109.565 1.00 43.62  ? 326  THR A N     1 
ATOM   2332 C CA    . THR A 1 292 ? -13.278 23.631 109.999 1.00 43.16  ? 326  THR A CA    1 
ATOM   2333 C C     . THR A 1 292 ? -12.091 22.675 110.080 1.00 42.53  ? 326  THR A C     1 
ATOM   2334 O O     . THR A 1 292 ? -12.182 21.626 110.711 1.00 41.64  ? 326  THR A O     1 
ATOM   2335 C CB    . THR A 1 292 ? -14.373 22.994 109.078 1.00 44.03  ? 326  THR A CB    1 
ATOM   2336 O OG1   . THR A 1 292 ? -13.905 22.923 107.721 1.00 47.27  ? 326  THR A OG1   1 
ATOM   2337 C CG2   . THR A 1 292 ? -15.661 23.812 109.139 1.00 44.26  ? 326  THR A CG2   1 
ATOM   2338 N N     . ALA A 1 293 ? -10.979 23.039 109.445 1.00 42.13  ? 327  ALA A N     1 
ATOM   2339 C CA    . ALA A 1 293 ? -9.776  22.211 109.472 1.00 40.44  ? 327  ALA A CA    1 
ATOM   2340 C C     . ALA A 1 293 ? -8.930  22.471 110.726 1.00 41.57  ? 327  ALA A C     1 
ATOM   2341 O O     . ALA A 1 293 ? -7.970  21.745 110.990 1.00 40.91  ? 327  ALA A O     1 
ATOM   2342 C CB    . ALA A 1 293 ? -8.923  22.460 108.218 1.00 39.31  ? 327  ALA A CB    1 
ATOM   2343 N N     . ARG A 1 294 ? -9.264  23.503 111.495 1.00 40.61  ? 328  ARG A N     1 
ATOM   2344 C CA    . ARG A 1 294 ? -8.484  23.776 112.700 1.00 41.80  ? 328  ARG A CA    1 
ATOM   2345 C C     . ARG A 1 294 ? -8.852  22.776 113.782 1.00 43.32  ? 328  ARG A C     1 
ATOM   2346 O O     . ARG A 1 294 ? -9.998  22.324 113.881 1.00 45.55  ? 328  ARG A O     1 
ATOM   2347 C CB    . ARG A 1 294 ? -8.731  25.199 113.225 1.00 36.02  ? 328  ARG A CB    1 
ATOM   2348 C CG    . ARG A 1 294 ? -8.284  26.286 112.271 1.00 34.99  ? 328  ARG A CG    1 
ATOM   2349 C CD    . ARG A 1 294 ? -8.923  27.624 112.580 1.00 31.78  ? 328  ARG A CD    1 
ATOM   2350 N NE    . ARG A 1 294 ? -8.844  28.482 111.405 1.00 34.06  ? 328  ARG A NE    1 
ATOM   2351 C CZ    . ARG A 1 294 ? -9.600  29.553 111.191 1.00 33.25  ? 328  ARG A CZ    1 
ATOM   2352 N NH1   . ARG A 1 294 ? -10.506 29.925 112.084 1.00 30.86  ? 328  ARG A NH1   1 
ATOM   2353 N NH2   . ARG A 1 294 ? -9.469  30.228 110.058 1.00 32.89  ? 328  ARG A NH2   1 
ATOM   2354 N N     . LEU A 1 295 ? -7.866  22.442 114.598 1.00 42.08  ? 329  LEU A N     1 
ATOM   2355 C CA    . LEU A 1 295 ? -8.059  21.528 115.698 1.00 41.91  ? 329  LEU A CA    1 
ATOM   2356 C C     . LEU A 1 295 ? -9.075  22.146 116.653 1.00 42.43  ? 329  LEU A C     1 
ATOM   2357 O O     . LEU A 1 295 ? -9.176  23.376 116.757 1.00 41.46  ? 329  LEU A O     1 
ATOM   2358 C CB    . LEU A 1 295 ? -6.725  21.341 116.414 1.00 44.25  ? 329  LEU A CB    1 
ATOM   2359 C CG    . LEU A 1 295 ? -6.247  19.915 116.646 1.00 48.43  ? 329  LEU A CG    1 
ATOM   2360 C CD1   . LEU A 1 295 ? -6.356  19.102 115.362 1.00 48.89  ? 329  LEU A CD1   1 
ATOM   2361 C CD2   . LEU A 1 295 ? -4.808  19.965 117.145 1.00 49.58  ? 329  LEU A CD2   1 
ATOM   2362 N N     . THR A 1 296 ? -9.846  21.303 117.335 1.00 41.17  ? 330  THR A N     1 
ATOM   2363 C CA    . THR A 1 296 ? -10.807 21.794 118.311 1.00 41.09  ? 330  THR A CA    1 
ATOM   2364 C C     . THR A 1 296 ? -9.967  22.033 119.566 1.00 40.72  ? 330  THR A C     1 
ATOM   2365 O O     . THR A 1 296 ? -8.877  21.477 119.697 1.00 38.29  ? 330  THR A O     1 
ATOM   2366 C CB    . THR A 1 296 ? -11.907 20.745 118.632 1.00 44.25  ? 330  THR A CB    1 
ATOM   2367 O OG1   . THR A 1 296 ? -11.293 19.516 119.040 1.00 46.22  ? 330  THR A OG1   1 
ATOM   2368 C CG2   . THR A 1 296 ? -12.788 20.493 117.409 1.00 43.36  ? 330  THR A CG2   1 
ATOM   2369 N N     . PRO A 1 297 ? -10.450 22.867 120.499 1.00 41.30  ? 331  PRO A N     1 
ATOM   2370 C CA    . PRO A 1 297 ? -9.657  23.109 121.708 1.00 43.63  ? 331  PRO A CA    1 
ATOM   2371 C C     . PRO A 1 297 ? -9.387  21.840 122.505 1.00 46.25  ? 331  PRO A C     1 
ATOM   2372 O O     . PRO A 1 297 ? -8.292  21.639 123.048 1.00 46.16  ? 331  PRO A O     1 
ATOM   2373 C CB    . PRO A 1 297 ? -10.481 24.149 122.478 1.00 42.89  ? 331  PRO A CB    1 
ATOM   2374 C CG    . PRO A 1 297 ? -11.865 24.024 121.927 1.00 42.73  ? 331  PRO A CG    1 
ATOM   2375 C CD    . PRO A 1 297 ? -11.655 23.710 120.468 1.00 41.19  ? 331  PRO A CD    1 
ATOM   2376 N N     . LEU A 1 298 ? -10.376 20.964 122.554 1.00 46.64  ? 332  LEU A N     1 
ATOM   2377 C CA    . LEU A 1 298 ? -10.215 19.721 123.284 1.00 47.52  ? 332  LEU A CA    1 
ATOM   2378 C C     . LEU A 1 298 ? -9.177  18.836 122.591 1.00 46.71  ? 332  LEU A C     1 
ATOM   2379 O O     . LEU A 1 298 ? -8.389  18.158 123.250 1.00 45.52  ? 332  LEU A O     1 
ATOM   2380 C CB    . LEU A 1 298 ? -11.561 19.010 123.377 1.00 48.76  ? 332  LEU A CB    1 
ATOM   2381 C CG    . LEU A 1 298 ? -11.690 17.961 124.469 1.00 49.38  ? 332  LEU A CG    1 
ATOM   2382 C CD1   . LEU A 1 298 ? -11.388 18.561 125.828 1.00 48.55  ? 332  LEU A CD1   1 
ATOM   2383 C CD2   . LEU A 1 298 ? -13.108 17.417 124.427 1.00 52.61  ? 332  LEU A CD2   1 
ATOM   2384 N N     . GLU A 1 299 ? -9.173  18.850 121.260 1.00 47.09  ? 333  GLU A N     1 
ATOM   2385 C CA    . GLU A 1 299 ? -8.213  18.058 120.483 1.00 48.87  ? 333  GLU A CA    1 
ATOM   2386 C C     . GLU A 1 299 ? -6.795  18.594 120.646 1.00 47.81  ? 333  GLU A C     1 
ATOM   2387 O O     . GLU A 1 299 ? -5.825  17.835 120.648 1.00 48.02  ? 333  GLU A O     1 
ATOM   2388 C CB    . GLU A 1 299 ? -8.587  18.069 118.999 1.00 51.78  ? 333  GLU A CB    1 
ATOM   2389 C CG    . GLU A 1 299 ? -9.636  17.045 118.602 1.00 58.66  ? 333  GLU A CG    1 
ATOM   2390 C CD    . GLU A 1 299 ? -10.254 17.336 117.240 1.00 63.48  ? 333  GLU A CD    1 
ATOM   2391 O OE1   . GLU A 1 299 ? -10.938 16.437 116.696 1.00 66.91  ? 333  GLU A OE1   1 
ATOM   2392 O OE2   . GLU A 1 299 ? -10.065 18.460 116.719 1.00 63.86  ? 333  GLU A OE2   1 
ATOM   2393 N N     . ALA A 1 300 ? -6.675  19.911 120.768 1.00 46.32  ? 334  ALA A N     1 
ATOM   2394 C CA    . ALA A 1 300 ? -5.370  20.528 120.934 1.00 42.95  ? 334  ALA A CA    1 
ATOM   2395 C C     . ALA A 1 300 ? -4.754  20.046 122.258 1.00 41.77  ? 334  ALA A C     1 
ATOM   2396 O O     . ALA A 1 300 ? -3.566  19.742 122.310 1.00 41.33  ? 334  ALA A O     1 
ATOM   2397 C CB    . ALA A 1 300 ? -5.504  22.059 120.908 1.00 40.60  ? 334  ALA A CB    1 
ATOM   2398 N N     . CYS A 1 301 ? -5.568  19.964 123.312 1.00 41.62  ? 335  CYS A N     1 
ATOM   2399 C CA    . CYS A 1 301 ? -5.109  19.490 124.623 1.00 43.49  ? 335  CYS A CA    1 
ATOM   2400 C C     . CYS A 1 301 ? -4.485  18.090 124.552 1.00 43.45  ? 335  CYS A C     1 
ATOM   2401 O O     . CYS A 1 301 ? -3.588  17.773 125.331 1.00 44.18  ? 335  CYS A O     1 
ATOM   2402 C CB    . CYS A 1 301 ? -6.271  19.437 125.624 1.00 43.25  ? 335  CYS A CB    1 
ATOM   2403 S SG    . CYS A 1 301 ? -6.868  21.015 126.287 1.00 47.46  ? 335  CYS A SG    1 
ATOM   2404 N N     . ALA A 1 302 ? -4.974  17.264 123.623 1.00 44.45  ? 336  ALA A N     1 
ATOM   2405 C CA    . ALA A 1 302 ? -4.494  15.889 123.434 1.00 45.41  ? 336  ALA A CA    1 
ATOM   2406 C C     . ALA A 1 302 ? -3.257  15.798 122.552 1.00 46.24  ? 336  ALA A C     1 
ATOM   2407 O O     . ALA A 1 302 ? -2.623  14.742 122.460 1.00 48.45  ? 336  ALA A O     1 
ATOM   2408 C CB    . ALA A 1 302 ? -5.607  15.028 122.827 1.00 43.45  ? 336  ALA A CB    1 
ATOM   2409 N N     . HIS A 1 303 ? -2.915  16.898 121.899 1.00 45.47  ? 337  HIS A N     1 
ATOM   2410 C CA    . HIS A 1 303 ? -1.758  16.918 121.010 1.00 44.39  ? 337  HIS A CA    1 
ATOM   2411 C C     . HIS A 1 303 ? -0.480  16.493 121.733 1.00 43.91  ? 337  HIS A C     1 
ATOM   2412 O O     . HIS A 1 303 ? -0.345  16.692 122.936 1.00 42.96  ? 337  HIS A O     1 
ATOM   2413 C CB    . HIS A 1 303 ? -1.597  18.323 120.422 1.00 39.89  ? 337  HIS A CB    1 
ATOM   2414 C CG    . HIS A 1 303 ? -0.610  18.392 119.302 1.00 35.33  ? 337  HIS A CG    1 
ATOM   2415 N ND1   . HIS A 1 303 ? 0.753   18.431 119.510 1.00 35.01  ? 337  HIS A ND1   1 
ATOM   2416 C CD2   . HIS A 1 303 ? -0.788  18.393 117.959 1.00 32.15  ? 337  HIS A CD2   1 
ATOM   2417 C CE1   . HIS A 1 303 ? 1.372   18.456 118.341 1.00 34.75  ? 337  HIS A CE1   1 
ATOM   2418 N NE2   . HIS A 1 303 ? 0.459   18.434 117.384 1.00 31.67  ? 337  HIS A NE2   1 
ATOM   2419 N N     . SER A 1 304 ? 0.458   15.915 120.991 1.00 44.96  ? 338  SER A N     1 
ATOM   2420 C CA    . SER A 1 304 ? 1.719   15.454 121.569 1.00 46.53  ? 338  SER A CA    1 
ATOM   2421 C C     . SER A 1 304 ? 2.544   16.539 122.256 1.00 46.25  ? 338  SER A C     1 
ATOM   2422 O O     . SER A 1 304 ? 3.297   16.251 123.189 1.00 45.55  ? 338  SER A O     1 
ATOM   2423 C CB    . SER A 1 304 ? 2.580   14.795 120.493 1.00 49.14  ? 338  SER A CB    1 
ATOM   2424 O OG    . SER A 1 304 ? 1.934   13.646 119.973 1.00 56.64  ? 338  SER A OG    1 
ATOM   2425 N N     . PHE A 1 305 ? 2.415   17.780 121.795 1.00 43.58  ? 339  PHE A N     1 
ATOM   2426 C CA    . PHE A 1 305 ? 3.169   18.875 122.384 1.00 41.96  ? 339  PHE A CA    1 
ATOM   2427 C C     . PHE A 1 305 ? 2.953   18.932 123.892 1.00 43.07  ? 339  PHE A C     1 
ATOM   2428 O O     . PHE A 1 305 ? 3.821   19.385 124.631 1.00 42.97  ? 339  PHE A O     1 
ATOM   2429 C CB    . PHE A 1 305 ? 2.756   20.208 121.754 1.00 41.51  ? 339  PHE A CB    1 
ATOM   2430 C CG    . PHE A 1 305 ? 3.489   21.405 122.307 1.00 39.44  ? 339  PHE A CG    1 
ATOM   2431 C CD1   . PHE A 1 305 ? 4.876   21.486 122.244 1.00 37.88  ? 339  PHE A CD1   1 
ATOM   2432 C CD2   . PHE A 1 305 ? 2.785   22.468 122.856 1.00 39.05  ? 339  PHE A CD2   1 
ATOM   2433 C CE1   . PHE A 1 305 ? 5.551   22.609 122.716 1.00 39.10  ? 339  PHE A CE1   1 
ATOM   2434 C CE2   . PHE A 1 305 ? 3.452   23.604 123.331 1.00 37.75  ? 339  PHE A CE2   1 
ATOM   2435 C CZ    . PHE A 1 305 ? 4.837   23.673 123.261 1.00 37.63  ? 339  PHE A CZ    1 
ATOM   2436 N N     . PHE A 1 306 ? 1.801   18.461 124.349 1.00 43.89  ? 340  PHE A N     1 
ATOM   2437 C CA    . PHE A 1 306 ? 1.510   18.488 125.772 1.00 47.82  ? 340  PHE A CA    1 
ATOM   2438 C C     . PHE A 1 306 ? 1.786   17.172 126.513 1.00 50.38  ? 340  PHE A C     1 
ATOM   2439 O O     . PHE A 1 306 ? 1.329   16.988 127.639 1.00 49.19  ? 340  PHE A O     1 
ATOM   2440 C CB    . PHE A 1 306 ? 0.057   18.910 125.977 1.00 46.83  ? 340  PHE A CB    1 
ATOM   2441 C CG    . PHE A 1 306 ? -0.268  20.259 125.395 1.00 49.03  ? 340  PHE A CG    1 
ATOM   2442 C CD1   . PHE A 1 306 ? 0.298   21.416 125.924 1.00 46.50  ? 340  PHE A CD1   1 
ATOM   2443 C CD2   . PHE A 1 306 ? -1.150  20.374 124.322 1.00 47.05  ? 340  PHE A CD2   1 
ATOM   2444 C CE1   . PHE A 1 306 ? -0.011  22.663 125.396 1.00 48.77  ? 340  PHE A CE1   1 
ATOM   2445 C CE2   . PHE A 1 306 ? -1.465  21.618 123.789 1.00 48.59  ? 340  PHE A CE2   1 
ATOM   2446 C CZ    . PHE A 1 306 ? -0.895  22.766 124.327 1.00 48.68  ? 340  PHE A CZ    1 
ATOM   2447 N N     . ASP A 1 307 ? 2.539   16.262 125.902 1.00 53.05  ? 341  ASP A N     1 
ATOM   2448 C CA    . ASP A 1 307 ? 2.823   14.992 126.566 1.00 56.71  ? 341  ASP A CA    1 
ATOM   2449 C C     . ASP A 1 307 ? 3.590   15.157 127.869 1.00 56.69  ? 341  ASP A C     1 
ATOM   2450 O O     . ASP A 1 307 ? 3.291   14.490 128.854 1.00 57.41  ? 341  ASP A O     1 
ATOM   2451 C CB    . ASP A 1 307 ? 3.593   14.051 125.640 1.00 58.18  ? 341  ASP A CB    1 
ATOM   2452 C CG    . ASP A 1 307 ? 2.729   13.510 124.519 1.00 61.45  ? 341  ASP A CG    1 
ATOM   2453 O OD1   . ASP A 1 307 ? 1.495   13.413 124.718 1.00 62.79  ? 341  ASP A OD1   1 
ATOM   2454 O OD2   . ASP A 1 307 ? 3.280   13.172 123.449 1.00 63.60  ? 341  ASP A OD2   1 
ATOM   2455 N N     . GLU A 1 308 ? 4.574   16.049 127.871 1.00 57.97  ? 342  GLU A N     1 
ATOM   2456 C CA    . GLU A 1 308 ? 5.380   16.300 129.059 1.00 58.80  ? 342  GLU A CA    1 
ATOM   2457 C C     . GLU A 1 308 ? 4.523   16.676 130.269 1.00 58.55  ? 342  GLU A C     1 
ATOM   2458 O O     . GLU A 1 308 ? 4.860   16.341 131.400 1.00 58.00  ? 342  GLU A O     1 
ATOM   2459 C CB    . GLU A 1 308 ? 6.389   17.414 128.780 1.00 61.06  ? 342  GLU A CB    1 
ATOM   2460 C CG    . GLU A 1 308 ? 7.377   17.654 129.906 1.00 66.19  ? 342  GLU A CG    1 
ATOM   2461 C CD    . GLU A 1 308 ? 8.412   18.718 129.569 1.00 69.48  ? 342  GLU A CD    1 
ATOM   2462 O OE1   . GLU A 1 308 ? 9.053   18.616 128.498 1.00 71.39  ? 342  GLU A OE1   1 
ATOM   2463 O OE2   . GLU A 1 308 ? 8.590   19.652 130.378 1.00 70.64  ? 342  GLU A OE2   1 
ATOM   2464 N N     . LEU A 1 309 ? 3.415   17.372 130.043 1.00 57.84  ? 343  LEU A N     1 
ATOM   2465 C CA    . LEU A 1 309 ? 2.570   17.764 131.162 1.00 59.01  ? 343  LEU A CA    1 
ATOM   2466 C C     . LEU A 1 309 ? 1.815   16.569 131.723 1.00 60.28  ? 343  LEU A C     1 
ATOM   2467 O O     . LEU A 1 309 ? 1.298   16.622 132.837 1.00 58.50  ? 343  LEU A O     1 
ATOM   2468 C CB    . LEU A 1 309 ? 1.574   18.844 130.743 1.00 57.36  ? 343  LEU A CB    1 
ATOM   2469 C CG    . LEU A 1 309 ? 2.174   20.166 130.263 1.00 56.97  ? 343  LEU A CG    1 
ATOM   2470 C CD1   . LEU A 1 309 ? 1.047   21.161 130.039 1.00 57.12  ? 343  LEU A CD1   1 
ATOM   2471 C CD2   . LEU A 1 309 ? 3.165   20.699 131.277 1.00 54.71  ? 343  LEU A CD2   1 
ATOM   2472 N N     . ARG A 1 310 ? 1.750   15.495 130.943 1.00 61.84  ? 344  ARG A N     1 
ATOM   2473 C CA    . ARG A 1 310 ? 1.058   14.286 131.368 1.00 64.95  ? 344  ARG A CA    1 
ATOM   2474 C C     . ARG A 1 310 ? 2.018   13.310 132.039 1.00 67.45  ? 344  ARG A C     1 
ATOM   2475 O O     . ARG A 1 310 ? 1.653   12.180 132.357 1.00 67.70  ? 344  ARG A O     1 
ATOM   2476 C CB    . ARG A 1 310 ? 0.384   13.611 130.172 1.00 63.99  ? 344  ARG A CB    1 
ATOM   2477 C CG    . ARG A 1 310 ? -0.954  14.228 129.773 1.00 63.23  ? 344  ARG A CG    1 
ATOM   2478 C CD    . ARG A 1 310 ? -1.580  13.462 128.618 1.00 60.09  ? 344  ARG A CD    1 
ATOM   2479 N NE    . ARG A 1 310 ? -1.019  13.836 127.326 1.00 58.26  ? 344  ARG A NE    1 
ATOM   2480 C CZ    . ARG A 1 310 ? -1.426  14.884 126.618 1.00 58.41  ? 344  ARG A CZ    1 
ATOM   2481 N NH1   . ARG A 1 310 ? -2.400  15.660 127.074 1.00 56.86  ? 344  ARG A NH1   1 
ATOM   2482 N NH2   . ARG A 1 310 ? -0.861  15.157 125.454 1.00 57.04  ? 344  ARG A NH2   1 
ATOM   2483 N N     . ASP A 1 311 ? 3.249   13.758 132.250 1.00 70.18  ? 345  ASP A N     1 
ATOM   2484 C CA    . ASP A 1 311 ? 4.271   12.940 132.886 1.00 72.83  ? 345  ASP A CA    1 
ATOM   2485 C C     . ASP A 1 311 ? 4.144   13.058 134.404 1.00 73.69  ? 345  ASP A C     1 
ATOM   2486 O O     . ASP A 1 311 ? 4.186   14.156 134.956 1.00 74.18  ? 345  ASP A O     1 
ATOM   2487 C CB    . ASP A 1 311 ? 5.654   13.410 132.444 1.00 74.60  ? 345  ASP A CB    1 
ATOM   2488 C CG    . ASP A 1 311 ? 6.753   12.499 132.918 1.00 76.73  ? 345  ASP A CG    1 
ATOM   2489 O OD1   . ASP A 1 311 ? 6.887   12.306 134.147 1.00 79.07  ? 345  ASP A OD1   1 
ATOM   2490 O OD2   . ASP A 1 311 ? 7.486   11.974 132.056 1.00 78.80  ? 345  ASP A OD2   1 
ATOM   2491 N N     . PRO A 1 312 ? 3.996   11.921 135.100 1.00 74.60  ? 346  PRO A N     1 
ATOM   2492 C CA    . PRO A 1 312 ? 3.858   11.877 136.561 1.00 74.63  ? 346  PRO A CA    1 
ATOM   2493 C C     . PRO A 1 312 ? 4.957   12.612 137.333 1.00 74.57  ? 346  PRO A C     1 
ATOM   2494 O O     . PRO A 1 312 ? 4.712   13.156 138.409 1.00 73.63  ? 346  PRO A O     1 
ATOM   2495 C CB    . PRO A 1 312 ? 3.850   10.380 136.855 1.00 74.73  ? 346  PRO A CB    1 
ATOM   2496 C CG    . PRO A 1 312 ? 3.213   9.803  135.624 1.00 75.69  ? 346  PRO A CG    1 
ATOM   2497 C CD    . PRO A 1 312 ? 3.912   10.567 134.526 1.00 75.03  ? 346  PRO A CD    1 
ATOM   2498 N N     . ASN A 1 313 ? 6.162   12.634 136.774 1.00 74.91  ? 347  ASN A N     1 
ATOM   2499 C CA    . ASN A 1 313 ? 7.291   13.281 137.433 1.00 75.43  ? 347  ASN A CA    1 
ATOM   2500 C C     . ASN A 1 313 ? 7.560   14.711 136.951 1.00 75.32  ? 347  ASN A C     1 
ATOM   2501 O O     . ASN A 1 313 ? 8.690   15.199 137.033 1.00 74.69  ? 347  ASN A O     1 
ATOM   2502 C CB    . ASN A 1 313 ? 8.553   12.428 137.252 1.00 76.51  ? 347  ASN A CB    1 
ATOM   2503 C CG    . ASN A 1 313 ? 8.344   10.975 137.664 1.00 78.09  ? 347  ASN A CG    1 
ATOM   2504 O OD1   . ASN A 1 313 ? 7.878   10.691 138.772 1.00 78.23  ? 347  ASN A OD1   1 
ATOM   2505 N ND2   . ASN A 1 313 ? 8.695   10.049 136.774 1.00 77.15  ? 347  ASN A ND2   1 
ATOM   2506 N N     . VAL A 1 314 ? 6.526   15.388 136.459 1.00 73.34  ? 348  VAL A N     1 
ATOM   2507 C CA    . VAL A 1 314 ? 6.697   16.752 135.980 1.00 71.50  ? 348  VAL A CA    1 
ATOM   2508 C C     . VAL A 1 314 ? 6.603   17.746 137.131 1.00 70.57  ? 348  VAL A C     1 
ATOM   2509 O O     . VAL A 1 314 ? 5.759   17.610 138.016 1.00 69.87  ? 348  VAL A O     1 
ATOM   2510 C CB    . VAL A 1 314 ? 5.631   17.118 134.926 1.00 71.43  ? 348  VAL A CB    1 
ATOM   2511 C CG1   . VAL A 1 314 ? 4.258   17.184 135.579 1.00 70.66  ? 348  VAL A CG1   1 
ATOM   2512 C CG2   . VAL A 1 314 ? 5.990   18.441 134.263 1.00 69.21  ? 348  VAL A CG2   1 
ATOM   2513 N N     . LYS A 1 315 ? 7.477   18.745 137.109 1.00 69.50  ? 349  LYS A N     1 
ATOM   2514 C CA    . LYS A 1 315 ? 7.498   19.768 138.145 1.00 69.88  ? 349  LYS A CA    1 
ATOM   2515 C C     . LYS A 1 315 ? 7.784   21.140 137.536 1.00 68.71  ? 349  LYS A C     1 
ATOM   2516 O O     . LYS A 1 315 ? 8.304   21.241 136.424 1.00 68.28  ? 349  LYS A O     1 
ATOM   2517 C CB    . LYS A 1 315 ? 8.572   19.444 139.198 1.00 71.67  ? 349  LYS A CB    1 
ATOM   2518 C CG    . LYS A 1 315 ? 8.306   18.188 140.031 1.00 73.36  ? 349  LYS A CG    1 
ATOM   2519 C CD    . LYS A 1 315 ? 7.158   18.391 141.007 1.00 76.36  ? 349  LYS A CD    1 
ATOM   2520 C CE    . LYS A 1 315 ? 6.780   17.090 141.707 1.00 78.10  ? 349  LYS A CE    1 
ATOM   2521 N NZ    . LYS A 1 315 ? 6.249   16.078 140.744 1.00 79.93  ? 349  LYS A NZ    1 
ATOM   2522 N N     . LEU A 1 316 ? 7.434   22.189 138.273 1.00 67.95  ? 350  LEU A N     1 
ATOM   2523 C CA    . LEU A 1 316 ? 7.665   23.558 137.833 1.00 66.33  ? 350  LEU A CA    1 
ATOM   2524 C C     . LEU A 1 316 ? 9.098   23.949 138.168 1.00 66.11  ? 350  LEU A C     1 
ATOM   2525 O O     . LEU A 1 316 ? 9.684   23.425 139.111 1.00 65.87  ? 350  LEU A O     1 
ATOM   2526 C CB    . LEU A 1 316 ? 6.722   24.521 138.550 1.00 65.89  ? 350  LEU A CB    1 
ATOM   2527 C CG    . LEU A 1 316 ? 5.220   24.337 138.363 1.00 65.66  ? 350  LEU A CG    1 
ATOM   2528 C CD1   . LEU A 1 316 ? 4.485   25.441 139.115 1.00 64.01  ? 350  LEU A CD1   1 
ATOM   2529 C CD2   . LEU A 1 316 ? 4.881   24.366 136.879 1.00 64.89  ? 350  LEU A CD2   1 
ATOM   2530 N N     . PRO A 1 317 ? 9.677   24.882 137.397 1.00 66.12  ? 351  PRO A N     1 
ATOM   2531 C CA    . PRO A 1 317 ? 11.049  25.346 137.618 1.00 64.27  ? 351  PRO A CA    1 
ATOM   2532 C C     . PRO A 1 317 ? 11.284  25.818 139.056 1.00 63.37  ? 351  PRO A C     1 
ATOM   2533 O O     . PRO A 1 317 ? 12.417  25.812 139.541 1.00 63.37  ? 351  PRO A O     1 
ATOM   2534 C CB    . PRO A 1 317 ? 11.188  26.471 136.599 1.00 64.92  ? 351  PRO A CB    1 
ATOM   2535 C CG    . PRO A 1 317 ? 10.349  25.971 135.461 1.00 64.84  ? 351  PRO A CG    1 
ATOM   2536 C CD    . PRO A 1 317 ? 9.112   25.488 136.177 1.00 65.39  ? 351  PRO A CD    1 
ATOM   2537 N N     . ASN A 1 318 ? 10.210  26.218 139.733 1.00 62.17  ? 352  ASN A N     1 
ATOM   2538 C CA    . ASN A 1 318 ? 10.313  26.682 141.111 1.00 61.87  ? 352  ASN A CA    1 
ATOM   2539 C C     . ASN A 1 318 ? 10.202  25.540 142.128 1.00 61.04  ? 352  ASN A C     1 
ATOM   2540 O O     . ASN A 1 318 ? 10.188  25.778 143.331 1.00 60.24  ? 352  ASN A O     1 
ATOM   2541 C CB    . ASN A 1 318 ? 9.246   27.753 141.413 1.00 60.78  ? 352  ASN A CB    1 
ATOM   2542 C CG    . ASN A 1 318 ? 7.818   27.253 141.208 1.00 61.65  ? 352  ASN A CG    1 
ATOM   2543 O OD1   . ASN A 1 318 ? 7.537   26.055 141.305 1.00 60.01  ? 352  ASN A OD1   1 
ATOM   2544 N ND2   . ASN A 1 318 ? 6.904   28.183 140.944 1.00 62.30  ? 352  ASN A ND2   1 
ATOM   2545 N N     . GLY A 1 319 ? 10.126  24.304 141.645 1.00 62.27  ? 353  GLY A N     1 
ATOM   2546 C CA    . GLY A 1 319 ? 10.022  23.169 142.547 1.00 64.41  ? 353  GLY A CA    1 
ATOM   2547 C C     . GLY A 1 319 ? 8.603   22.692 142.812 1.00 65.54  ? 353  GLY A C     1 
ATOM   2548 O O     . GLY A 1 319 ? 8.367   21.493 142.958 1.00 65.57  ? 353  GLY A O     1 
ATOM   2549 N N     . ARG A 1 320 ? 7.654   23.623 142.877 1.00 66.63  ? 354  ARG A N     1 
ATOM   2550 C CA    . ARG A 1 320 ? 6.259   23.272 143.128 1.00 67.69  ? 354  ARG A CA    1 
ATOM   2551 C C     . ARG A 1 320 ? 5.711   22.298 142.092 1.00 67.57  ? 354  ARG A C     1 
ATOM   2552 O O     . ARG A 1 320 ? 6.342   22.031 141.071 1.00 66.50  ? 354  ARG A O     1 
ATOM   2553 C CB    . ARG A 1 320 ? 5.375   24.522 143.133 1.00 69.97  ? 354  ARG A CB    1 
ATOM   2554 C CG    . ARG A 1 320 ? 5.681   25.524 144.229 1.00 73.38  ? 354  ARG A CG    1 
ATOM   2555 C CD    . ARG A 1 320 ? 4.560   26.545 144.329 1.00 77.59  ? 354  ARG A CD    1 
ATOM   2556 N NE    . ARG A 1 320 ? 4.824   27.574 145.328 1.00 81.26  ? 354  ARG A NE    1 
ATOM   2557 C CZ    . ARG A 1 320 ? 3.904   28.413 145.796 1.00 83.60  ? 354  ARG A CZ    1 
ATOM   2558 N NH1   . ARG A 1 320 ? 2.655   28.343 145.355 1.00 84.65  ? 354  ARG A NH1   1 
ATOM   2559 N NH2   . ARG A 1 320 ? 4.232   29.323 146.707 1.00 85.33  ? 354  ARG A NH2   1 
ATOM   2560 N N     . ASP A 1 321 ? 4.521   21.774 142.367 1.00 68.38  ? 355  ASP A N     1 
ATOM   2561 C CA    . ASP A 1 321 ? 3.863   20.837 141.467 1.00 68.69  ? 355  ASP A CA    1 
ATOM   2562 C C     . ASP A 1 321 ? 2.970   21.586 140.481 1.00 67.10  ? 355  ASP A C     1 
ATOM   2563 O O     . ASP A 1 321 ? 2.557   22.718 140.740 1.00 64.95  ? 355  ASP A O     1 
ATOM   2564 C CB    . ASP A 1 321 ? 3.014   19.847 142.264 1.00 72.22  ? 355  ASP A CB    1 
ATOM   2565 C CG    . ASP A 1 321 ? 3.312   18.405 141.903 1.00 76.39  ? 355  ASP A CG    1 
ATOM   2566 O OD1   . ASP A 1 321 ? 3.318   18.085 140.690 1.00 78.61  ? 355  ASP A OD1   1 
ATOM   2567 O OD2   . ASP A 1 321 ? 3.534   17.594 142.830 1.00 77.31  ? 355  ASP A OD2   1 
ATOM   2568 N N     . THR A 1 322 ? 2.679   20.946 139.352 1.00 64.94  ? 356  THR A N     1 
ATOM   2569 C CA    . THR A 1 322 ? 1.835   21.543 138.324 1.00 64.12  ? 356  THR A CA    1 
ATOM   2570 C C     . THR A 1 322 ? 0.379   21.579 138.779 1.00 62.71  ? 356  THR A C     1 
ATOM   2571 O O     . THR A 1 322 ? -0.061  20.716 139.535 1.00 63.93  ? 356  THR A O     1 
ATOM   2572 C CB    . THR A 1 322 ? 1.919   20.747 136.997 1.00 63.26  ? 356  THR A CB    1 
ATOM   2573 O OG1   . THR A 1 322 ? 1.492   19.398 137.219 1.00 62.52  ? 356  THR A OG1   1 
ATOM   2574 C CG2   . THR A 1 322 ? 3.349   20.738 136.467 1.00 63.02  ? 356  THR A CG2   1 
ATOM   2575 N N     . PRO A 1 323 ? -0.384  22.588 138.331 1.00 61.68  ? 357  PRO A N     1 
ATOM   2576 C CA    . PRO A 1 323 ? -1.800  22.739 138.687 1.00 60.43  ? 357  PRO A CA    1 
ATOM   2577 C C     . PRO A 1 323 ? -2.590  21.530 138.213 1.00 59.25  ? 357  PRO A C     1 
ATOM   2578 O O     . PRO A 1 323 ? -2.090  20.739 137.416 1.00 58.86  ? 357  PRO A O     1 
ATOM   2579 C CB    . PRO A 1 323 ? -2.215  23.996 137.931 1.00 61.35  ? 357  PRO A CB    1 
ATOM   2580 C CG    . PRO A 1 323 ? -0.963  24.777 137.845 1.00 62.08  ? 357  PRO A CG    1 
ATOM   2581 C CD    . PRO A 1 323 ? 0.064   23.723 137.508 1.00 61.27  ? 357  PRO A CD    1 
ATOM   2582 N N     . ALA A 1 324 ? -3.821  21.395 138.698 1.00 59.97  ? 358  ALA A N     1 
ATOM   2583 C CA    . ALA A 1 324 ? -4.694  20.284 138.300 1.00 59.32  ? 358  ALA A CA    1 
ATOM   2584 C C     . ALA A 1 324 ? -5.037  20.457 136.820 1.00 58.72  ? 358  ALA A C     1 
ATOM   2585 O O     . ALA A 1 324 ? -5.768  21.373 136.450 1.00 57.89  ? 358  ALA A O     1 
ATOM   2586 C CB    . ALA A 1 324 ? -5.969  20.290 139.142 1.00 58.44  ? 358  ALA A CB    1 
ATOM   2587 N N     . LEU A 1 325 ? -4.506  19.570 135.983 1.00 58.53  ? 359  LEU A N     1 
ATOM   2588 C CA    . LEU A 1 325 ? -4.726  19.642 134.541 1.00 59.03  ? 359  LEU A CA    1 
ATOM   2589 C C     . LEU A 1 325 ? -5.499  18.443 133.997 1.00 60.87  ? 359  LEU A C     1 
ATOM   2590 O O     . LEU A 1 325 ? -5.678  18.311 132.786 1.00 60.33  ? 359  LEU A O     1 
ATOM   2591 C CB    . LEU A 1 325 ? -3.377  19.722 133.827 1.00 57.45  ? 359  LEU A CB    1 
ATOM   2592 C CG    . LEU A 1 325 ? -2.365  20.766 134.307 1.00 57.03  ? 359  LEU A CG    1 
ATOM   2593 C CD1   . LEU A 1 325 ? -1.045  20.532 133.598 1.00 56.81  ? 359  LEU A CD1   1 
ATOM   2594 C CD2   . LEU A 1 325 ? -2.879  22.172 134.046 1.00 55.37  ? 359  LEU A CD2   1 
ATOM   2595 N N     . PHE A 1 326 ? -5.967  17.576 134.889 1.00 61.86  ? 360  PHE A N     1 
ATOM   2596 C CA    . PHE A 1 326 ? -6.674  16.386 134.449 1.00 62.30  ? 360  PHE A CA    1 
ATOM   2597 C C     . PHE A 1 326 ? -8.066  16.205 135.040 1.00 62.27  ? 360  PHE A C     1 
ATOM   2598 O O     . PHE A 1 326 ? -8.747  15.229 134.735 1.00 63.04  ? 360  PHE A O     1 
ATOM   2599 C CB    . PHE A 1 326 ? -5.813  15.166 134.756 1.00 63.09  ? 360  PHE A CB    1 
ATOM   2600 C CG    . PHE A 1 326 ? -4.393  15.306 134.292 1.00 64.33  ? 360  PHE A CG    1 
ATOM   2601 C CD1   . PHE A 1 326 ? -3.338  14.997 135.144 1.00 65.43  ? 360  PHE A CD1   1 
ATOM   2602 C CD2   . PHE A 1 326 ? -4.106  15.738 133.002 1.00 64.82  ? 360  PHE A CD2   1 
ATOM   2603 C CE1   . PHE A 1 326 ? -2.016  15.115 134.718 1.00 66.45  ? 360  PHE A CE1   1 
ATOM   2604 C CE2   . PHE A 1 326 ? -2.789  15.859 132.565 1.00 65.97  ? 360  PHE A CE2   1 
ATOM   2605 C CZ    . PHE A 1 326 ? -1.740  15.546 133.426 1.00 66.49  ? 360  PHE A CZ    1 
ATOM   2606 N N     . ASN A 1 327 ? -8.501  17.145 135.869 1.00 62.03  ? 361  ASN A N     1 
ATOM   2607 C CA    . ASN A 1 327 ? -9.821  17.043 136.485 1.00 62.42  ? 361  ASN A CA    1 
ATOM   2608 C C     . ASN A 1 327 ? -10.953 17.372 135.513 1.00 62.58  ? 361  ASN A C     1 
ATOM   2609 O O     . ASN A 1 327 ? -11.858 18.147 135.836 1.00 61.61  ? 361  ASN A O     1 
ATOM   2610 C CB    . ASN A 1 327 ? -9.897  17.967 137.699 1.00 62.01  ? 361  ASN A CB    1 
ATOM   2611 C CG    . ASN A 1 327 ? -9.545  19.393 137.355 1.00 63.20  ? 361  ASN A CG    1 
ATOM   2612 O OD1   . ASN A 1 327 ? -8.494  19.655 136.774 1.00 64.22  ? 361  ASN A OD1   1 
ATOM   2613 N ND2   . ASN A 1 327 ? -10.419 20.325 137.712 1.00 64.16  ? 361  ASN A ND2   1 
ATOM   2614 N N     . PHE A 1 328 ? -10.903 16.777 134.326 1.00 63.52  ? 362  PHE A N     1 
ATOM   2615 C CA    . PHE A 1 328 ? -11.929 17.012 133.314 1.00 65.93  ? 362  PHE A CA    1 
ATOM   2616 C C     . PHE A 1 328 ? -13.286 16.467 133.723 1.00 67.63  ? 362  PHE A C     1 
ATOM   2617 O O     . PHE A 1 328 ? -13.402 15.321 134.146 1.00 67.87  ? 362  PHE A O     1 
ATOM   2618 C CB    . PHE A 1 328 ? -11.541 16.371 131.982 1.00 65.18  ? 362  PHE A CB    1 
ATOM   2619 C CG    . PHE A 1 328 ? -10.430 17.071 131.271 1.00 65.78  ? 362  PHE A CG    1 
ATOM   2620 C CD1   . PHE A 1 328 ? -9.111  16.646 131.418 1.00 66.16  ? 362  PHE A CD1   1 
ATOM   2621 C CD2   . PHE A 1 328 ? -10.700 18.156 130.442 1.00 64.49  ? 362  PHE A CD2   1 
ATOM   2622 C CE1   . PHE A 1 328 ? -8.077  17.294 130.742 1.00 65.41  ? 362  PHE A CE1   1 
ATOM   2623 C CE2   . PHE A 1 328 ? -9.678  18.807 129.765 1.00 63.50  ? 362  PHE A CE2   1 
ATOM   2624 C CZ    . PHE A 1 328 ? -8.363  18.376 129.914 1.00 64.64  ? 362  PHE A CZ    1 
ATOM   2625 N N     . THR A 1 329 ? -14.315 17.292 133.587 1.00 70.42  ? 363  THR A N     1 
ATOM   2626 C CA    . THR A 1 329 ? -15.665 16.870 133.928 1.00 72.58  ? 363  THR A CA    1 
ATOM   2627 C C     . THR A 1 329 ? -16.348 16.363 132.662 1.00 75.13  ? 363  THR A C     1 
ATOM   2628 O O     . THR A 1 329 ? -15.781 16.436 131.570 1.00 76.04  ? 363  THR A O     1 
ATOM   2629 C CB    . THR A 1 329 ? -16.483 18.032 134.504 1.00 71.71  ? 363  THR A CB    1 
ATOM   2630 O OG1   . THR A 1 329 ? -16.723 19.004 133.481 1.00 71.21  ? 363  THR A OG1   1 
ATOM   2631 C CG2   . THR A 1 329 ? -15.728 18.683 135.646 1.00 70.91  ? 363  THR A CG2   1 
ATOM   2632 N N     . THR A 1 330 ? -17.562 15.845 132.813 1.00 77.54  ? 364  THR A N     1 
ATOM   2633 C CA    . THR A 1 330 ? -18.321 15.331 131.679 1.00 78.79  ? 364  THR A CA    1 
ATOM   2634 C C     . THR A 1 330 ? -18.591 16.451 130.679 1.00 78.91  ? 364  THR A C     1 
ATOM   2635 O O     . THR A 1 330 ? -18.398 16.282 129.473 1.00 78.93  ? 364  THR A O     1 
ATOM   2636 C CB    . THR A 1 330 ? -19.668 14.730 132.144 1.00 80.04  ? 364  THR A CB    1 
ATOM   2637 O OG1   . THR A 1 330 ? -19.419 13.675 133.084 1.00 80.23  ? 364  THR A OG1   1 
ATOM   2638 C CG2   . THR A 1 330 ? -20.449 14.174 130.956 1.00 79.90  ? 364  THR A CG2   1 
ATOM   2639 N N     . GLN A 1 331 ? -19.030 17.597 131.192 1.00 78.76  ? 365  GLN A N     1 
ATOM   2640 C CA    . GLN A 1 331 ? -19.332 18.758 130.360 1.00 79.24  ? 365  GLN A CA    1 
ATOM   2641 C C     . GLN A 1 331 ? -18.147 19.155 129.484 1.00 79.38  ? 365  GLN A C     1 
ATOM   2642 O O     . GLN A 1 331 ? -18.322 19.544 128.327 1.00 79.35  ? 365  GLN A O     1 
ATOM   2643 C CB    . GLN A 1 331 ? -19.731 19.945 131.243 1.00 79.40  ? 365  GLN A CB    1 
ATOM   2644 C CG    . GLN A 1 331 ? -20.041 21.231 130.483 1.00 81.02  ? 365  GLN A CG    1 
ATOM   2645 C CD    . GLN A 1 331 ? -21.300 21.138 129.636 1.00 82.02  ? 365  GLN A CD    1 
ATOM   2646 O OE1   . GLN A 1 331 ? -22.393 20.895 130.151 1.00 82.62  ? 365  GLN A OE1   1 
ATOM   2647 N NE2   . GLN A 1 331 ? -21.153 21.337 128.330 1.00 81.57  ? 365  GLN A NE2   1 
ATOM   2648 N N     . GLU A 1 332 ? -16.943 19.054 130.038 1.00 78.46  ? 366  GLU A N     1 
ATOM   2649 C CA    . GLU A 1 332 ? -15.735 19.416 129.307 1.00 77.54  ? 366  GLU A CA    1 
ATOM   2650 C C     . GLU A 1 332 ? -15.409 18.442 128.184 1.00 76.73  ? 366  GLU A C     1 
ATOM   2651 O O     . GLU A 1 332 ? -14.907 18.843 127.134 1.00 76.94  ? 366  GLU A O     1 
ATOM   2652 C CB    . GLU A 1 332 ? -14.540 19.495 130.263 1.00 77.77  ? 366  GLU A CB    1 
ATOM   2653 C CG    . GLU A 1 332 ? -14.679 20.535 131.367 1.00 78.36  ? 366  GLU A CG    1 
ATOM   2654 C CD    . GLU A 1 332 ? -13.450 20.610 132.260 1.00 78.13  ? 366  GLU A CD    1 
ATOM   2655 O OE1   . GLU A 1 332 ? -12.350 20.897 131.738 1.00 78.80  ? 366  GLU A OE1   1 
ATOM   2656 O OE2   . GLU A 1 332 ? -13.585 20.385 133.483 1.00 77.41  ? 366  GLU A OE2   1 
ATOM   2657 N N     . LEU A 1 333 ? -15.698 17.164 128.407 1.00 75.86  ? 367  LEU A N     1 
ATOM   2658 C CA    . LEU A 1 333 ? -15.407 16.129 127.418 1.00 75.34  ? 367  LEU A CA    1 
ATOM   2659 C C     . LEU A 1 333 ? -16.534 15.885 126.422 1.00 75.20  ? 367  LEU A C     1 
ATOM   2660 O O     . LEU A 1 333 ? -16.346 15.182 125.433 1.00 73.90  ? 367  LEU A O     1 
ATOM   2661 C CB    . LEU A 1 333 ? -15.070 14.824 128.135 1.00 74.41  ? 367  LEU A CB    1 
ATOM   2662 C CG    . LEU A 1 333 ? -13.911 14.912 129.127 1.00 74.25  ? 367  LEU A CG    1 
ATOM   2663 C CD1   . LEU A 1 333 ? -13.876 13.660 129.977 1.00 73.42  ? 367  LEU A CD1   1 
ATOM   2664 C CD2   . LEU A 1 333 ? -12.602 15.100 128.375 1.00 73.66  ? 367  LEU A CD2   1 
ATOM   2665 N N     . SER A 1 334 ? -17.699 16.473 126.687 1.00 76.30  ? 368  SER A N     1 
ATOM   2666 C CA    . SER A 1 334 ? -18.871 16.312 125.828 1.00 77.25  ? 368  SER A CA    1 
ATOM   2667 C C     . SER A 1 334 ? -18.540 16.343 124.340 1.00 77.53  ? 368  SER A C     1 
ATOM   2668 O O     . SER A 1 334 ? -18.947 15.459 123.589 1.00 78.16  ? 368  SER A O     1 
ATOM   2669 C CB    . SER A 1 334 ? -19.906 17.394 126.142 1.00 77.59  ? 368  SER A CB    1 
ATOM   2670 O OG    . SER A 1 334 ? -19.379 18.690 125.911 1.00 79.74  ? 368  SER A OG    1 
ATOM   2671 N N     . SER A 1 335 ? -17.803 17.366 123.924 1.00 77.59  ? 369  SER A N     1 
ATOM   2672 C CA    . SER A 1 335 ? -17.415 17.526 122.527 1.00 76.74  ? 369  SER A CA    1 
ATOM   2673 C C     . SER A 1 335 ? -16.850 16.248 121.906 1.00 76.38  ? 369  SER A C     1 
ATOM   2674 O O     . SER A 1 335 ? -17.154 15.923 120.756 1.00 76.07  ? 369  SER A O     1 
ATOM   2675 C CB    . SER A 1 335 ? -16.382 18.649 122.408 1.00 76.88  ? 369  SER A CB    1 
ATOM   2676 O OG    . SER A 1 335 ? -15.890 18.759 121.085 1.00 77.84  ? 369  SER A OG    1 
ATOM   2677 N N     . ASN A 1 336 ? -16.030 15.528 122.670 1.00 75.42  ? 370  ASN A N     1 
ATOM   2678 C CA    . ASN A 1 336 ? -15.411 14.298 122.182 1.00 74.34  ? 370  ASN A CA    1 
ATOM   2679 C C     . ASN A 1 336 ? -14.938 13.414 123.340 1.00 74.15  ? 370  ASN A C     1 
ATOM   2680 O O     . ASN A 1 336 ? -13.741 13.330 123.620 1.00 74.49  ? 370  ASN A O     1 
ATOM   2681 C CB    . ASN A 1 336 ? -14.229 14.654 121.280 1.00 74.35  ? 370  ASN A CB    1 
ATOM   2682 C CG    . ASN A 1 336 ? -13.730 13.476 120.485 1.00 75.33  ? 370  ASN A CG    1 
ATOM   2683 O OD1   . ASN A 1 336 ? -12.801 13.603 119.688 1.00 75.51  ? 370  ASN A OD1   1 
ATOM   2684 N ND2   . ASN A 1 336 ? -14.346 12.318 120.689 1.00 76.63  ? 370  ASN A ND2   1 
ATOM   2685 N N     . PRO A 1 337 ? -15.877 12.727 124.016 1.00 73.73  ? 371  PRO A N     1 
ATOM   2686 C CA    . PRO A 1 337 ? -15.611 11.837 125.155 1.00 73.23  ? 371  PRO A CA    1 
ATOM   2687 C C     . PRO A 1 337 ? -14.441 10.864 125.004 1.00 72.62  ? 371  PRO A C     1 
ATOM   2688 O O     . PRO A 1 337 ? -13.616 10.731 125.909 1.00 72.31  ? 371  PRO A O     1 
ATOM   2689 C CB    . PRO A 1 337 ? -16.942 11.120 125.343 1.00 72.94  ? 371  PRO A CB    1 
ATOM   2690 C CG    . PRO A 1 337 ? -17.926 12.182 124.968 1.00 73.54  ? 371  PRO A CG    1 
ATOM   2691 C CD    . PRO A 1 337 ? -17.317 12.734 123.699 1.00 73.48  ? 371  PRO A CD    1 
ATOM   2692 N N     . PRO A 1 338 ? -14.357 10.164 123.862 1.00 71.91  ? 372  PRO A N     1 
ATOM   2693 C CA    . PRO A 1 338 ? -13.267 9.209  123.635 1.00 71.70  ? 372  PRO A CA    1 
ATOM   2694 C C     . PRO A 1 338 ? -11.869 9.752  123.943 1.00 72.27  ? 372  PRO A C     1 
ATOM   2695 O O     . PRO A 1 338 ? -10.975 8.993  124.329 1.00 72.70  ? 372  PRO A O     1 
ATOM   2696 C CB    . PRO A 1 338 ? -13.434 8.848  122.165 1.00 71.00  ? 372  PRO A CB    1 
ATOM   2697 C CG    . PRO A 1 338 ? -14.916 8.905  121.989 1.00 71.64  ? 372  PRO A CG    1 
ATOM   2698 C CD    . PRO A 1 338 ? -15.287 10.176 122.718 1.00 71.52  ? 372  PRO A CD    1 
ATOM   2699 N N     . LEU A 1 339 ? -11.681 11.060 123.775 1.00 71.97  ? 373  LEU A N     1 
ATOM   2700 C CA    . LEU A 1 339 ? -10.380 11.682 124.022 1.00 71.69  ? 373  LEU A CA    1 
ATOM   2701 C C     . LEU A 1 339 ? -9.919  11.564 125.475 1.00 71.62  ? 373  LEU A C     1 
ATOM   2702 O O     . LEU A 1 339 ? -8.742  11.767 125.778 1.00 70.53  ? 373  LEU A O     1 
ATOM   2703 C CB    . LEU A 1 339 ? -10.407 13.157 123.605 1.00 71.65  ? 373  LEU A CB    1 
ATOM   2704 C CG    . LEU A 1 339 ? -10.481 13.455 122.106 1.00 71.10  ? 373  LEU A CG    1 
ATOM   2705 C CD1   . LEU A 1 339 ? -10.686 14.946 121.910 1.00 71.21  ? 373  LEU A CD1   1 
ATOM   2706 C CD2   . LEU A 1 339 ? -9.206  12.989 121.404 1.00 70.44  ? 373  LEU A CD2   1 
ATOM   2707 N N     . ALA A 1 340 ? -10.849 11.229 126.367 1.00 71.58  ? 374  ALA A N     1 
ATOM   2708 C CA    . ALA A 1 340 ? -10.535 11.073 127.784 1.00 71.44  ? 374  ALA A CA    1 
ATOM   2709 C C     . ALA A 1 340 ? -9.439  10.029 127.980 1.00 71.20  ? 374  ALA A C     1 
ATOM   2710 O O     . ALA A 1 340 ? -8.759  10.019 129.002 1.00 71.25  ? 374  ALA A O     1 
ATOM   2711 C CB    . ALA A 1 340 ? -11.787 10.670 128.556 1.00 71.12  ? 374  ALA A CB    1 
ATOM   2712 N N     . THR A 1 341 ? -9.271  9.158  126.991 1.00 71.79  ? 375  THR A N     1 
ATOM   2713 C CA    . THR A 1 341 ? -8.261  8.108  127.049 1.00 72.64  ? 375  THR A CA    1 
ATOM   2714 C C     . THR A 1 341 ? -6.874  8.725  127.048 1.00 72.80  ? 375  THR A C     1 
ATOM   2715 O O     . THR A 1 341 ? -5.926  8.160  127.592 1.00 72.99  ? 375  THR A O     1 
ATOM   2716 C CB    . THR A 1 341 ? -8.358  7.162  125.833 1.00 73.08  ? 375  THR A CB    1 
ATOM   2717 O OG1   . THR A 1 341 ? -9.688  6.643  125.730 1.00 74.16  ? 375  THR A OG1   1 
ATOM   2718 C CG2   . THR A 1 341 ? -7.382  6.006  125.983 1.00 72.69  ? 375  THR A CG2   1 
ATOM   2719 N N     . ILE A 1 342 ? -6.759  9.889  126.423 1.00 72.67  ? 376  ILE A N     1 
ATOM   2720 C CA    . ILE A 1 342 ? -5.482  10.571 126.354 1.00 72.22  ? 376  ILE A CA    1 
ATOM   2721 C C     . ILE A 1 342 ? -5.412  11.744 127.322 1.00 71.27  ? 376  ILE A C     1 
ATOM   2722 O O     . ILE A 1 342 ? -4.399  11.947 127.983 1.00 71.51  ? 376  ILE A O     1 
ATOM   2723 C CB    . ILE A 1 342 ? -5.213  11.084 124.935 1.00 73.17  ? 376  ILE A CB    1 
ATOM   2724 C CG1   . ILE A 1 342 ? -5.314  9.929  123.941 1.00 72.04  ? 376  ILE A CG1   1 
ATOM   2725 C CG2   . ILE A 1 342 ? -3.829  11.715 124.867 1.00 73.64  ? 376  ILE A CG2   1 
ATOM   2726 C CD1   . ILE A 1 342 ? -5.104  10.354 122.513 1.00 72.24  ? 376  ILE A CD1   1 
ATOM   2727 N N     . LEU A 1 343 ? -6.494  12.508 127.413 1.00 70.78  ? 377  LEU A N     1 
ATOM   2728 C CA    . LEU A 1 343 ? -6.525  13.667 128.295 1.00 71.41  ? 377  LEU A CA    1 
ATOM   2729 C C     . LEU A 1 343 ? -6.258  13.337 129.759 1.00 72.96  ? 377  LEU A C     1 
ATOM   2730 O O     . LEU A 1 343 ? -5.597  14.100 130.462 1.00 72.20  ? 377  LEU A O     1 
ATOM   2731 C CB    . LEU A 1 343 ? -7.864  14.402 128.162 1.00 69.72  ? 377  LEU A CB    1 
ATOM   2732 C CG    . LEU A 1 343 ? -8.110  15.087 126.809 1.00 68.16  ? 377  LEU A CG    1 
ATOM   2733 C CD1   . LEU A 1 343 ? -9.474  15.746 126.793 1.00 67.56  ? 377  LEU A CD1   1 
ATOM   2734 C CD2   . LEU A 1 343 ? -7.026  16.116 126.560 1.00 67.37  ? 377  LEU A CD2   1 
ATOM   2735 N N     . ILE A 1 344 ? -6.763  12.202 130.224 1.00 75.69  ? 378  ILE A N     1 
ATOM   2736 C CA    . ILE A 1 344 ? -6.560  11.821 131.613 1.00 78.07  ? 378  ILE A CA    1 
ATOM   2737 C C     . ILE A 1 344 ? -5.592  10.654 131.739 1.00 79.80  ? 378  ILE A C     1 
ATOM   2738 O O     . ILE A 1 344 ? -5.956  9.507  131.493 1.00 79.24  ? 378  ILE A O     1 
ATOM   2739 C CB    . ILE A 1 344 ? -7.891  11.443 132.274 1.00 78.06  ? 378  ILE A CB    1 
ATOM   2740 C CG1   . ILE A 1 344 ? -8.879  12.604 132.138 1.00 77.76  ? 378  ILE A CG1   1 
ATOM   2741 C CG2   . ILE A 1 344 ? -7.661  11.103 133.740 1.00 77.94  ? 378  ILE A CG2   1 
ATOM   2742 C CD1   . ILE A 1 344 ? -10.249 12.318 132.705 1.00 78.34  ? 378  ILE A CD1   1 
ATOM   2743 N N     . PRO A 1 345 ? -4.335  10.938 132.124 1.00 82.92  ? 379  PRO A N     1 
ATOM   2744 C CA    . PRO A 1 345 ? -3.291  9.920  132.290 1.00 85.14  ? 379  PRO A CA    1 
ATOM   2745 C C     . PRO A 1 345 ? -3.664  8.881  133.344 1.00 87.68  ? 379  PRO A C     1 
ATOM   2746 O O     . PRO A 1 345 ? -4.516  9.127  134.198 1.00 87.84  ? 379  PRO A O     1 
ATOM   2747 C CB    . PRO A 1 345 ? -2.073  10.737 132.714 1.00 84.64  ? 379  PRO A CB    1 
ATOM   2748 C CG    . PRO A 1 345 ? -2.312  12.062 132.085 1.00 84.04  ? 379  PRO A CG    1 
ATOM   2749 C CD    . PRO A 1 345 ? -3.779  12.283 132.353 1.00 83.19  ? 379  PRO A CD    1 
ATOM   2750 N N     . PRO A 1 346 ? -3.017  7.709  133.300 1.00 90.17  ? 380  PRO A N     1 
ATOM   2751 C CA    . PRO A 1 346 ? -3.259  6.609  134.240 1.00 92.04  ? 380  PRO A CA    1 
ATOM   2752 C C     . PRO A 1 346 ? -3.094  6.987  135.714 1.00 93.29  ? 380  PRO A C     1 
ATOM   2753 O O     . PRO A 1 346 ? -3.903  6.599  136.559 1.00 93.34  ? 380  PRO A O     1 
ATOM   2754 C CB    . PRO A 1 346 ? -2.243  5.558  133.801 1.00 92.03  ? 380  PRO A CB    1 
ATOM   2755 C CG    . PRO A 1 346 ? -2.151  5.792  132.323 1.00 92.53  ? 380  PRO A CG    1 
ATOM   2756 C CD    . PRO A 1 346 ? -2.065  7.298  132.253 1.00 91.01  ? 380  PRO A CD    1 
ATOM   2757 N N     . HIS A 1 347 ? -2.047  7.747  136.017 1.00 94.56  ? 381  HIS A N     1 
ATOM   2758 C CA    . HIS A 1 347 ? -1.781  8.152  137.389 1.00 96.14  ? 381  HIS A CA    1 
ATOM   2759 C C     . HIS A 1 347 ? -2.725  9.240  137.891 1.00 97.52  ? 381  HIS A C     1 
ATOM   2760 O O     . HIS A 1 347 ? -2.381  9.990  138.801 1.00 97.58  ? 381  HIS A O     1 
ATOM   2761 C CB    . HIS A 1 347 ? -0.335  8.634  137.521 1.00 96.17  ? 381  HIS A CB    1 
ATOM   2762 C CG    . HIS A 1 347 ? -0.062  9.924  136.812 1.00 96.56  ? 381  HIS A CG    1 
ATOM   2763 N ND1   . HIS A 1 347 ? -0.031  10.031 135.439 1.00 96.33  ? 381  HIS A ND1   1 
ATOM   2764 C CD2   . HIS A 1 347 ? 0.177   11.168 137.292 1.00 96.93  ? 381  HIS A CD2   1 
ATOM   2765 C CE1   . HIS A 1 347 ? 0.215   11.285 135.104 1.00 96.58  ? 381  HIS A CE1   1 
ATOM   2766 N NE2   . HIS A 1 347 ? 0.344   11.996 136.210 1.00 96.63  ? 381  HIS A NE2   1 
ATOM   2767 N N     . ALA A 1 348 ? -3.916  9.326  137.307 1.00 99.85  ? 382  ALA A N     1 
ATOM   2768 C CA    . ALA A 1 348 ? -4.886  10.336 137.722 1.00 102.18 ? 382  ALA A CA    1 
ATOM   2769 C C     . ALA A 1 348 ? -6.310  9.794  137.730 1.00 104.01 ? 382  ALA A C     1 
ATOM   2770 O O     . ALA A 1 348 ? -7.130  10.192 138.558 1.00 103.67 ? 382  ALA A O     1 
ATOM   2771 C CB    . ALA A 1 348 ? -4.799  11.547 136.804 1.00 102.07 ? 382  ALA A CB    1 
ATOM   2772 N N     . ARG A 1 349 ? -6.594  8.885  136.802 1.00 106.47 ? 383  ARG A N     1 
ATOM   2773 C CA    . ARG A 1 349 ? -7.919  8.285  136.688 1.00 109.13 ? 383  ARG A CA    1 
ATOM   2774 C C     . ARG A 1 349 ? -8.322  7.525  137.950 1.00 110.47 ? 383  ARG A C     1 
ATOM   2775 O O     . ARG A 1 349 ? -9.468  7.618  138.401 1.00 110.47 ? 383  ARG A O     1 
ATOM   2776 C CB    . ARG A 1 349 ? -7.966  7.355  135.470 1.00 109.40 ? 383  ARG A CB    1 
ATOM   2777 C CG    . ARG A 1 349 ? -6.900  6.271  135.449 1.00 110.51 ? 383  ARG A CG    1 
ATOM   2778 C CD    . ARG A 1 349 ? -6.963  5.472  134.152 1.00 111.26 ? 383  ARG A CD    1 
ATOM   2779 N NE    . ARG A 1 349 ? -6.652  6.292  132.983 1.00 111.59 ? 383  ARG A NE    1 
ATOM   2780 C CZ    . ARG A 1 349 ? -6.686  5.854  131.726 1.00 111.77 ? 383  ARG A CZ    1 
ATOM   2781 N NH1   . ARG A 1 349 ? -7.023  4.597  131.466 1.00 111.20 ? 383  ARG A NH1   1 
ATOM   2782 N NH2   . ARG A 1 349 ? -6.377  6.672  130.727 1.00 111.48 ? 383  ARG A NH2   1 
ATOM   2783 N N     . ILE A 1 350 ? -7.376  6.780  138.517 1.00 111.97 ? 384  ILE A N     1 
ATOM   2784 C CA    . ILE A 1 350 ? -7.629  6.011  139.733 1.00 113.05 ? 384  ILE A CA    1 
ATOM   2785 C C     . ILE A 1 350 ? -7.206  6.796  140.976 1.00 113.67 ? 384  ILE A C     1 
ATOM   2786 O O     . ILE A 1 350 ? -6.614  7.889  140.821 1.00 113.46 ? 384  ILE A O     1 
ATOM   2787 C CB    . ILE A 1 350 ? -6.868  4.656  139.719 1.00 113.09 ? 384  ILE A CB    1 
ATOM   2788 C CG1   . ILE A 1 350 ? -5.368  4.898  139.527 1.00 113.15 ? 384  ILE A CG1   1 
ATOM   2789 C CG2   . ILE A 1 350 ? -7.421  3.756  138.619 1.00 112.97 ? 384  ILE A CG2   1 
ATOM   2790 C CD1   . ILE A 1 350 ? -4.513  3.652  139.680 1.00 112.70 ? 384  ILE A CD1   1 
ATOM   2791 O OXT   . ILE A 1 350 ? -7.469  6.303  142.095 1.00 114.34 ? 384  ILE A OXT   1 
ATOM   2792 N N     . VAL B 2 1   ? -19.493 46.411 96.355  1.00 78.95  ? 383  VAL B N     1 
ATOM   2793 C CA    . VAL B 2 1   ? -18.340 47.345 96.178  1.00 78.13  ? 383  VAL B CA    1 
ATOM   2794 C C     . VAL B 2 1   ? -17.245 47.032 97.197  1.00 76.82  ? 383  VAL B C     1 
ATOM   2795 O O     . VAL B 2 1   ? -16.055 47.184 96.916  1.00 77.69  ? 383  VAL B O     1 
ATOM   2796 C CB    . VAL B 2 1   ? -18.790 48.822 96.351  1.00 78.56  ? 383  VAL B CB    1 
ATOM   2797 C CG1   . VAL B 2 1   ? -17.605 49.765 96.139  1.00 78.25  ? 383  VAL B CG1   1 
ATOM   2798 C CG2   . VAL B 2 1   ? -19.915 49.143 95.367  1.00 78.92  ? 383  VAL B CG2   1 
ATOM   2799 N N     . GLU B 2 2   ? -17.655 46.581 98.376  1.00 74.35  ? 384  GLU B N     1 
ATOM   2800 C CA    . GLU B 2 2   ? -16.713 46.243 99.434  1.00 72.38  ? 384  GLU B CA    1 
ATOM   2801 C C     . GLU B 2 2   ? -15.696 45.193 98.987  1.00 68.86  ? 384  GLU B C     1 
ATOM   2802 O O     . GLU B 2 2   ? -14.491 45.460 98.972  1.00 69.32  ? 384  GLU B O     1 
ATOM   2803 C CB    . GLU B 2 2   ? -17.471 45.754 100.677 1.00 73.87  ? 384  GLU B CB    1 
ATOM   2804 C CG    . GLU B 2 2   ? -16.583 45.413 101.853 1.00 76.41  ? 384  GLU B CG    1 
ATOM   2805 C CD    . GLU B 2 2   ? -15.613 46.527 102.178 1.00 78.70  ? 384  GLU B CD    1 
ATOM   2806 O OE1   . GLU B 2 2   ? -16.059 47.688 102.283 1.00 80.09  ? 384  GLU B OE1   1 
ATOM   2807 O OE2   . GLU B 2 2   ? -14.406 46.243 102.329 1.00 79.98  ? 384  GLU B OE2   1 
ATOM   2808 N N     . PRO B 2 3   ? -16.161 43.988 98.605  1.00 65.46  ? 385  PRO B N     1 
ATOM   2809 C CA    . PRO B 2 3   ? -15.224 42.945 98.171  1.00 62.97  ? 385  PRO B CA    1 
ATOM   2810 C C     . PRO B 2 3   ? -14.291 43.407 97.057  1.00 60.80  ? 385  PRO B C     1 
ATOM   2811 O O     . PRO B 2 3   ? -13.073 43.252 97.148  1.00 58.87  ? 385  PRO B O     1 
ATOM   2812 C CB    . PRO B 2 3   ? -16.151 41.818 97.718  1.00 61.85  ? 385  PRO B CB    1 
ATOM   2813 C CG    . PRO B 2 3   ? -17.336 41.993 98.615  1.00 62.49  ? 385  PRO B CG    1 
ATOM   2814 C CD    . PRO B 2 3   ? -17.545 43.484 98.566  1.00 63.95  ? 385  PRO B CD    1 
ATOM   2815 N N     . GLN B 2 4   ? -14.881 43.978 96.014  1.00 60.03  ? 386  GLN B N     1 
ATOM   2816 C CA    . GLN B 2 4   ? -14.134 44.464 94.865  1.00 59.22  ? 386  GLN B CA    1 
ATOM   2817 C C     . GLN B 2 4   ? -12.972 45.378 95.288  1.00 57.86  ? 386  GLN B C     1 
ATOM   2818 O O     . GLN B 2 4   ? -11.838 45.201 94.837  1.00 56.60  ? 386  GLN B O     1 
ATOM   2819 C CB    . GLN B 2 4   ? -15.082 45.218 93.931  1.00 61.25  ? 386  GLN B CB    1 
ATOM   2820 C CG    . GLN B 2 4   ? -14.855 44.988 92.438  1.00 66.27  ? 386  GLN B CG    1 
ATOM   2821 C CD    . GLN B 2 4   ? -13.432 45.285 91.991  1.00 69.44  ? 386  GLN B CD    1 
ATOM   2822 O OE1   . GLN B 2 4   ? -12.571 44.400 91.992  1.00 71.90  ? 386  GLN B OE1   1 
ATOM   2823 N NE2   . GLN B 2 4   ? -13.176 46.535 91.614  1.00 69.49  ? 386  GLN B NE2   1 
ATOM   2824 N N     . LYS B 2 5   ? -13.255 46.348 96.155  1.00 56.01  ? 387  LYS B N     1 
ATOM   2825 C CA    . LYS B 2 5   ? -12.230 47.287 96.608  1.00 55.92  ? 387  LYS B CA    1 
ATOM   2826 C C     . LYS B 2 5   ? -11.187 46.656 97.541  1.00 53.04  ? 387  LYS B C     1 
ATOM   2827 O O     . LYS B 2 5   ? -9.984  46.921 97.413  1.00 51.01  ? 387  LYS B O     1 
ATOM   2828 C CB    . LYS B 2 5   ? -12.888 48.507 97.274  1.00 58.92  ? 387  LYS B CB    1 
ATOM   2829 C CG    . LYS B 2 5   ? -13.810 49.284 96.326  1.00 63.35  ? 387  LYS B CG    1 
ATOM   2830 C CD    . LYS B 2 5   ? -13.926 50.766 96.682  1.00 66.16  ? 387  LYS B CD    1 
ATOM   2831 C CE    . LYS B 2 5   ? -14.579 51.000 98.027  1.00 68.67  ? 387  LYS B CE    1 
ATOM   2832 N NZ    . LYS B 2 5   ? -14.714 52.467 98.261  1.00 70.63  ? 387  LYS B NZ    1 
ATOM   2833 N N     . PHE B 2 6   ? -11.650 45.817 98.467  1.00 49.14  ? 388  PHE B N     1 
ATOM   2834 C CA    . PHE B 2 6   ? -10.752 45.129 99.390  1.00 44.33  ? 388  PHE B CA    1 
ATOM   2835 C C     . PHE B 2 6   ? -9.801  44.259 98.559  1.00 43.23  ? 388  PHE B C     1 
ATOM   2836 O O     . PHE B 2 6   ? -8.580  44.273 98.761  1.00 38.54  ? 388  PHE B O     1 
ATOM   2837 C CB    . PHE B 2 6   ? -11.558 44.245 100.351 1.00 44.39  ? 388  PHE B CB    1 
ATOM   2838 C CG    . PHE B 2 6   ? -10.735 43.636 101.449 1.00 43.70  ? 388  PHE B CG    1 
ATOM   2839 C CD1   . PHE B 2 6   ? -10.468 44.347 102.613 1.00 44.49  ? 388  PHE B CD1   1 
ATOM   2840 C CD2   . PHE B 2 6   ? -10.181 42.368 101.298 1.00 44.17  ? 388  PHE B CD2   1 
ATOM   2841 C CE1   . PHE B 2 6   ? -9.656  43.807 103.610 1.00 44.47  ? 388  PHE B CE1   1 
ATOM   2842 C CE2   . PHE B 2 6   ? -9.370  41.817 102.285 1.00 43.34  ? 388  PHE B CE2   1 
ATOM   2843 C CZ    . PHE B 2 6   ? -9.105  42.540 103.444 1.00 45.52  ? 388  PHE B CZ    1 
ATOM   2844 N N     . ALA B 2 7   ? -10.372 43.515 97.612  1.00 41.88  ? 389  ALA B N     1 
ATOM   2845 C CA    . ALA B 2 7   ? -9.597  42.628 96.747  1.00 43.28  ? 389  ALA B CA    1 
ATOM   2846 C C     . ALA B 2 7   ? -8.524  43.384 95.984  1.00 43.64  ? 389  ALA B C     1 
ATOM   2847 O O     . ALA B 2 7   ? -7.371  42.940 95.902  1.00 44.52  ? 389  ALA B O     1 
ATOM   2848 C CB    . ALA B 2 7   ? -10.519 41.917 95.767  1.00 43.80  ? 389  ALA B CB    1 
ATOM   2849 N N     . GLU B 2 8   ? -8.910  44.525 95.425  1.00 42.72  ? 390  GLU B N     1 
ATOM   2850 C CA    . GLU B 2 8   ? -7.987  45.361 94.673  1.00 43.63  ? 390  GLU B CA    1 
ATOM   2851 C C     . GLU B 2 8   ? -6.809  45.763 95.540  1.00 39.90  ? 390  GLU B C     1 
ATOM   2852 O O     . GLU B 2 8   ? -5.661  45.686 95.120  1.00 40.37  ? 390  GLU B O     1 
ATOM   2853 C CB    . GLU B 2 8   ? -8.702  46.627 94.171  1.00 47.71  ? 390  GLU B CB    1 
ATOM   2854 C CG    . GLU B 2 8   ? -9.246  46.522 92.757  1.00 54.01  ? 390  GLU B CG    1 
ATOM   2855 C CD    . GLU B 2 8   ? -10.028 47.757 92.322  1.00 58.30  ? 390  GLU B CD    1 
ATOM   2856 O OE1   . GLU B 2 8   ? -10.321 47.867 91.114  1.00 62.09  ? 390  GLU B OE1   1 
ATOM   2857 O OE2   . GLU B 2 8   ? -10.354 48.612 93.174  1.00 59.17  ? 390  GLU B OE2   1 
ATOM   2858 N N     . GLU B 2 9   ? -7.084  46.192 96.760  1.00 40.41  ? 391  GLU B N     1 
ATOM   2859 C CA    . GLU B 2 9   ? -6.001  46.600 97.633  1.00 40.59  ? 391  GLU B CA    1 
ATOM   2860 C C     . GLU B 2 9   ? -5.068  45.425 97.938  1.00 39.11  ? 391  GLU B C     1 
ATOM   2861 O O     . GLU B 2 9   ? -3.841  45.537 97.792  1.00 38.54  ? 391  GLU B O     1 
ATOM   2862 C CB    . GLU B 2 9   ? -6.572  47.178 98.921  1.00 43.11  ? 391  GLU B CB    1 
ATOM   2863 C CG    . GLU B 2 9   ? -5.618  48.101 99.628  1.00 45.93  ? 391  GLU B CG    1 
ATOM   2864 C CD    . GLU B 2 9   ? -6.043  48.379 101.048 1.00 49.44  ? 391  GLU B CD    1 
ATOM   2865 O OE1   . GLU B 2 9   ? -7.263  48.551 101.287 1.00 51.24  ? 391  GLU B OE1   1 
ATOM   2866 O OE2   . GLU B 2 9   ? -5.153  48.431 101.925 1.00 52.41  ? 391  GLU B OE2   1 
ATOM   2867 N N     . LEU B 2 10  ? -5.650  44.299 98.349  1.00 37.01  ? 392  LEU B N     1 
ATOM   2868 C CA    . LEU B 2 10  ? -4.867  43.110 98.671  1.00 36.18  ? 392  LEU B CA    1 
ATOM   2869 C C     . LEU B 2 10  ? -4.005  42.640 97.498  1.00 37.52  ? 392  LEU B C     1 
ATOM   2870 O O     . LEU B 2 10  ? -2.832  42.287 97.683  1.00 36.99  ? 392  LEU B O     1 
ATOM   2871 C CB    . LEU B 2 10  ? -5.795  41.982 99.122  1.00 36.63  ? 392  LEU B CB    1 
ATOM   2872 C CG    . LEU B 2 10  ? -5.104  40.655 99.433  1.00 36.65  ? 392  LEU B CG    1 
ATOM   2873 C CD1   . LEU B 2 10  ? -3.980  40.843 100.464 1.00 32.56  ? 392  LEU B CD1   1 
ATOM   2874 C CD2   . LEU B 2 10  ? -6.164  39.696 99.939  1.00 35.27  ? 392  LEU B CD2   1 
ATOM   2875 N N     . ILE B 2 11  ? -4.588  42.643 96.297  1.00 39.29  ? 393  ILE B N     1 
ATOM   2876 C CA    . ILE B 2 11  ? -3.885  42.247 95.072  1.00 40.77  ? 393  ILE B CA    1 
ATOM   2877 C C     . ILE B 2 11  ? -2.695  43.182 94.838  1.00 42.95  ? 393  ILE B C     1 
ATOM   2878 O O     . ILE B 2 11  ? -1.579  42.734 94.541  1.00 40.72  ? 393  ILE B O     1 
ATOM   2879 C CB    . ILE B 2 11  ? -4.841  42.311 93.834  1.00 42.84  ? 393  ILE B CB    1 
ATOM   2880 C CG1   . ILE B 2 11  ? -5.864  41.169 93.919  1.00 43.74  ? 393  ILE B CG1   1 
ATOM   2881 C CG2   . ILE B 2 11  ? -4.036  42.235 92.521  1.00 39.75  ? 393  ILE B CG2   1 
ATOM   2882 C CD1   . ILE B 2 11  ? -6.854  41.135 92.775  1.00 45.48  ? 393  ILE B CD1   1 
ATOM   2883 N N     . HIS B 2 12  ? -2.941  44.483 94.985  1.00 45.13  ? 394  HIS B N     1 
ATOM   2884 C CA    . HIS B 2 12  ? -1.898  45.487 94.807  1.00 46.77  ? 394  HIS B CA    1 
ATOM   2885 C C     . HIS B 2 12  ? -0.727  45.234 95.769  1.00 47.64  ? 394  HIS B C     1 
ATOM   2886 O O     . HIS B 2 12  ? 0.437   45.265 95.361  1.00 49.15  ? 394  HIS B O     1 
ATOM   2887 C CB    . HIS B 2 12  ? -2.475  46.895 95.026  1.00 48.39  ? 394  HIS B CB    1 
ATOM   2888 C CG    . HIS B 2 12  ? -1.464  47.985 94.863  1.00 51.09  ? 394  HIS B CG    1 
ATOM   2889 N ND1   . HIS B 2 12  ? -0.845  48.250 93.659  1.00 51.46  ? 394  HIS B ND1   1 
ATOM   2890 C CD2   . HIS B 2 12  ? -0.910  48.828 95.766  1.00 52.01  ? 394  HIS B CD2   1 
ATOM   2891 C CE1   . HIS B 2 12  ? 0.051   49.207 93.829  1.00 53.23  ? 394  HIS B CE1   1 
ATOM   2892 N NE2   . HIS B 2 12  ? 0.032   49.575 95.098  1.00 53.99  ? 394  HIS B NE2   1 
ATOM   2893 N N     . ARG B 2 13  ? -1.040  44.984 97.041  1.00 46.75  ? 395  ARG B N     1 
ATOM   2894 C CA    . ARG B 2 13  ? -0.014  44.710 98.047  1.00 46.92  ? 395  ARG B CA    1 
ATOM   2895 C C     . ARG B 2 13  ? 0.728   43.395 97.765  1.00 48.06  ? 395  ARG B C     1 
ATOM   2896 O O     . ARG B 2 13  ? 1.954   43.350 97.805  1.00 47.06  ? 395  ARG B O     1 
ATOM   2897 C CB    . ARG B 2 13  ? -0.635  44.644 99.449  1.00 44.80  ? 395  ARG B CB    1 
ATOM   2898 C CG    . ARG B 2 13  ? -1.095  45.977 100.019 1.00 45.50  ? 395  ARG B CG    1 
ATOM   2899 C CD    . ARG B 2 13  ? 0.083   46.901 100.293 1.00 47.36  ? 395  ARG B CD    1 
ATOM   2900 N NE    . ARG B 2 13  ? 1.058   46.283 101.189 1.00 50.17  ? 395  ARG B NE    1 
ATOM   2901 C CZ    . ARG B 2 13  ? 0.840   46.024 102.476 1.00 51.74  ? 395  ARG B CZ    1 
ATOM   2902 N NH1   . ARG B 2 13  ? -0.325  46.337 103.029 1.00 52.88  ? 395  ARG B NH1   1 
ATOM   2903 N NH2   . ARG B 2 13  ? 1.782   45.443 103.208 1.00 50.75  ? 395  ARG B NH2   1 
ATOM   2904 N N     . LEU B 2 14  ? -0.008  42.323 97.486  1.00 49.24  ? 396  LEU B N     1 
ATOM   2905 C CA    . LEU B 2 14  ? 0.636   41.043 97.222  1.00 51.20  ? 396  LEU B CA    1 
ATOM   2906 C C     . LEU B 2 14  ? 1.567   41.086 96.019  1.00 53.93  ? 396  LEU B C     1 
ATOM   2907 O O     . LEU B 2 14  ? 2.639   40.487 96.055  1.00 52.65  ? 396  LEU B O     1 
ATOM   2908 C CB    . LEU B 2 14  ? -0.406  39.939 97.032  1.00 48.60  ? 396  LEU B CB    1 
ATOM   2909 C CG    . LEU B 2 14  ? -1.178  39.609 98.309  1.00 48.92  ? 396  LEU B CG    1 
ATOM   2910 C CD1   . LEU B 2 14  ? -2.316  38.635 98.006  1.00 47.15  ? 396  LEU B CD1   1 
ATOM   2911 C CD2   . LEU B 2 14  ? -0.218  39.041 99.335  1.00 43.50  ? 396  LEU B CD2   1 
ATOM   2912 N N     . GLU B 2 15  ? 1.170   41.790 94.958  1.00 58.03  ? 397  GLU B N     1 
ATOM   2913 C CA    . GLU B 2 15  ? 2.016   41.885 93.769  1.00 63.93  ? 397  GLU B CA    1 
ATOM   2914 C C     . GLU B 2 15  ? 3.347   42.550 94.098  1.00 66.60  ? 397  GLU B C     1 
ATOM   2915 O O     . GLU B 2 15  ? 4.368   42.254 93.476  1.00 67.47  ? 397  GLU B O     1 
ATOM   2916 C CB    . GLU B 2 15  ? 1.319   42.662 92.650  1.00 64.83  ? 397  GLU B CB    1 
ATOM   2917 C CG    . GLU B 2 15  ? 0.142   41.930 92.038  1.00 70.02  ? 397  GLU B CG    1 
ATOM   2918 C CD    . GLU B 2 15  ? -0.460  42.654 90.845  1.00 73.13  ? 397  GLU B CD    1 
ATOM   2919 O OE1   . GLU B 2 15  ? -0.790  43.856 90.976  1.00 74.87  ? 397  GLU B OE1   1 
ATOM   2920 O OE2   . GLU B 2 15  ? -0.610  42.015 89.778  1.00 74.30  ? 397  GLU B OE2   1 
ATOM   2921 N N     . ALA B 2 16  ? 3.333   43.446 95.078  1.00 69.16  ? 398  ALA B N     1 
ATOM   2922 C CA    . ALA B 2 16  ? 4.548   44.136 95.485  1.00 73.43  ? 398  ALA B CA    1 
ATOM   2923 C C     . ALA B 2 16  ? 5.471   43.186 96.243  1.00 76.36  ? 398  ALA B C     1 
ATOM   2924 O O     . ALA B 2 16  ? 6.667   43.119 95.970  1.00 77.34  ? 398  ALA B O     1 
ATOM   2925 C CB    . ALA B 2 16  ? 4.202   45.331 96.355  1.00 72.95  ? 398  ALA B CB    1 
ATOM   2926 N N     . VAL B 2 17  ? 4.909   42.450 97.195  1.00 79.41  ? 399  VAL B N     1 
ATOM   2927 C CA    . VAL B 2 17  ? 5.686   41.508 97.988  1.00 83.02  ? 399  VAL B CA    1 
ATOM   2928 C C     . VAL B 2 17  ? 6.293   40.409 97.112  1.00 85.29  ? 399  VAL B C     1 
ATOM   2929 O O     . VAL B 2 17  ? 7.515   40.300 97.000  1.00 85.46  ? 399  VAL B O     1 
ATOM   2930 C CB    . VAL B 2 17  ? 4.810   40.854 99.073  1.00 83.06  ? 399  VAL B CB    1 
ATOM   2931 C CG1   . VAL B 2 17  ? 5.671   40.013 99.994  1.00 84.14  ? 399  VAL B CG1   1 
ATOM   2932 C CG2   . VAL B 2 17  ? 4.077   41.924 99.859  1.00 82.67  ? 399  VAL B CG2   1 
ATOM   2933 N N     . GLN B 2 18  ? 5.433   39.603 96.493  1.00 87.80  ? 400  GLN B N     1 
ATOM   2934 C CA    . GLN B 2 18  ? 5.874   38.514 95.623  1.00 90.01  ? 400  GLN B CA    1 
ATOM   2935 C C     . GLN B 2 18  ? 6.891   39.005 94.594  1.00 91.22  ? 400  GLN B C     1 
ATOM   2936 O O     . GLN B 2 18  ? 8.030   38.484 94.593  1.00 91.36  ? 400  GLN B O     1 
ATOM   2937 C CB    . GLN B 2 18  ? 4.674   37.898 94.892  1.00 90.94  ? 400  GLN B CB    1 
ATOM   2938 C CG    . GLN B 2 18  ? 5.041   36.750 93.951  1.00 92.36  ? 400  GLN B CG    1 
ATOM   2939 C CD    . GLN B 2 18  ? 3.852   36.226 93.161  1.00 92.98  ? 400  GLN B CD    1 
ATOM   2940 O OE1   . GLN B 2 18  ? 2.883   35.720 93.728  1.00 94.00  ? 400  GLN B OE1   1 
ATOM   2941 N NE2   . GLN B 2 18  ? 3.923   36.348 91.844  1.00 93.70  ? 400  GLN B NE2   1 
ATOM   2942 O OXT   . GLN B 2 18  ? 6.530   39.903 93.798  1.00 92.24  ? 400  GLN B OXT   1 
HETATM 2943 N N9    . ADZ C 3 .   ? -8.659  43.359 134.635 1.00 72.44  ? 1386 ADZ A N9    1 
HETATM 2944 C C8    . ADZ C 3 .   ? -9.825  42.723 134.338 1.00 72.30  ? 1386 ADZ A C8    1 
HETATM 2945 N N7    . ADZ C 3 .   ? -9.965  41.638 135.146 1.00 69.78  ? 1386 ADZ A N7    1 
HETATM 2946 C C5    . ADZ C 3 .   ? -8.903  41.578 135.953 1.00 71.32  ? 1386 ADZ A C5    1 
HETATM 2947 C C6    . ADZ C 3 .   ? -8.422  40.713 137.007 1.00 69.23  ? 1386 ADZ A C6    1 
HETATM 2948 N N6    . ADZ C 3 .   ? -9.142  39.635 137.393 1.00 65.73  ? 1386 ADZ A N6    1 
HETATM 2949 N N1    . ADZ C 3 .   ? -7.210  40.983 137.646 1.00 66.42  ? 1386 ADZ A N1    1 
HETATM 2950 C C2    . ADZ C 3 .   ? -6.426  42.060 137.305 1.00 68.04  ? 1386 ADZ A C2    1 
HETATM 2951 N N3    . ADZ C 3 .   ? -6.865  42.895 136.301 1.00 69.07  ? 1386 ADZ A N3    1 
HETATM 2952 C C4    . ADZ C 3 .   ? -8.058  42.694 135.613 1.00 71.69  ? 1386 ADZ A C4    1 
HETATM 2953 C "C1'" . ADZ C 3 .   ? -8.097  44.604 133.987 1.00 73.00  ? 1386 ADZ A "C1'" 1 
HETATM 2954 O O     . HOH D 4 .   ? -10.586 50.358 159.548 1.00 78.67  ? 2001 HOH A O     1 
HETATM 2955 O O     . HOH D 4 .   ? -26.637 43.338 143.786 1.00 53.32  ? 2002 HOH A O     1 
HETATM 2956 O O     . HOH D 4 .   ? -32.490 40.174 142.921 1.00 55.80  ? 2003 HOH A O     1 
HETATM 2957 O O     . HOH D 4 .   ? -26.420 35.270 149.345 1.00 58.32  ? 2004 HOH A O     1 
HETATM 2958 O O     . HOH D 4 .   ? -15.895 51.600 143.133 1.00 51.80  ? 2005 HOH A O     1 
HETATM 2959 O O     . HOH D 4 .   ? -14.703 52.142 145.078 1.00 69.14  ? 2006 HOH A O     1 
HETATM 2960 O O     . HOH D 4 .   ? -9.604  52.815 126.449 1.00 79.66  ? 2007 HOH A O     1 
HETATM 2961 O O     . HOH D 4 .   ? -10.233 42.409 157.397 1.00 85.15  ? 2008 HOH A O     1 
HETATM 2962 O O     . HOH D 4 .   ? -5.765  38.181 147.652 1.00 69.20  ? 2009 HOH A O     1 
HETATM 2963 O O     . HOH D 4 .   ? -8.935  36.817 144.937 1.00 71.57  ? 2010 HOH A O     1 
HETATM 2964 O O     . HOH D 4 .   ? -16.495 53.815 135.026 1.00 63.76  ? 2011 HOH A O     1 
HETATM 2965 O O     . HOH D 4 .   ? 5.066   43.148 121.587 1.00 54.83  ? 2012 HOH A O     1 
HETATM 2966 O O     . HOH D 4 .   ? -27.440 43.790 133.465 1.00 58.97  ? 2013 HOH A O     1 
HETATM 2967 O O     . HOH D 4 .   ? -27.687 42.135 125.621 1.00 83.03  ? 2014 HOH A O     1 
HETATM 2968 O O     . HOH D 4 .   ? -5.743  24.724 138.415 1.00 65.44  ? 2015 HOH A O     1 
HETATM 2969 O O     . HOH D 4 .   ? -24.051 44.357 127.062 1.00 57.66  ? 2016 HOH A O     1 
HETATM 2970 O O     . HOH D 4 .   ? -15.287 39.641 131.992 1.00 51.03  ? 2017 HOH A O     1 
HETATM 2971 O O     . HOH D 4 .   ? -19.750 45.003 129.341 1.00 47.81  ? 2018 HOH A O     1 
HETATM 2972 O O     . HOH D 4 .   ? -21.394 43.300 127.727 1.00 50.17  ? 2019 HOH A O     1 
HETATM 2973 O O     . HOH D 4 .   ? -28.028 38.569 135.414 1.00 52.23  ? 2020 HOH A O     1 
HETATM 2974 O O     . HOH D 4 .   ? -14.353 25.329 139.630 1.00 62.94  ? 2021 HOH A O     1 
HETATM 2975 O O     . HOH D 4 .   ? -14.888 30.543 136.640 1.00 44.45  ? 2022 HOH A O     1 
HETATM 2976 O O     . HOH D 4 .   ? -6.214  23.221 133.939 1.00 43.32  ? 2023 HOH A O     1 
HETATM 2977 O O     . HOH D 4 .   ? -18.340 34.772 145.630 1.00 54.73  ? 2024 HOH A O     1 
HETATM 2978 O O     . HOH D 4 .   ? -16.545 35.405 147.259 1.00 66.82  ? 2025 HOH A O     1 
HETATM 2979 O O     . HOH D 4 .   ? -16.442 29.981 109.546 1.00 46.84  ? 2026 HOH A O     1 
HETATM 2980 O O     . HOH D 4 .   ? -19.317 25.747 110.036 1.00 58.87  ? 2027 HOH A O     1 
HETATM 2981 O O     . HOH D 4 .   ? -16.533 27.458 109.557 1.00 48.87  ? 2028 HOH A O     1 
HETATM 2982 O O     . HOH D 4 .   ? -15.291 23.781 113.465 1.00 49.48  ? 2029 HOH A O     1 
HETATM 2983 O O     . HOH D 4 .   ? -10.795 33.562 139.659 1.00 57.32  ? 2030 HOH A O     1 
HETATM 2984 O O     . HOH D 4 .   ? -4.179  37.721 144.348 1.00 67.93  ? 2031 HOH A O     1 
HETATM 2985 O O     . HOH D 4 .   ? -1.206  43.790 137.874 1.00 90.61  ? 2032 HOH A O     1 
HETATM 2986 O O     . HOH D 4 .   ? -1.414  42.749 130.015 1.00 32.91  ? 2033 HOH A O     1 
HETATM 2987 O O     . HOH D 4 .   ? 6.242   42.847 131.882 1.00 47.38  ? 2034 HOH A O     1 
HETATM 2988 O O     . HOH D 4 .   ? -3.277  44.829 136.920 1.00 75.97  ? 2035 HOH A O     1 
HETATM 2989 O O     . HOH D 4 .   ? 8.626   36.989 124.670 1.00 34.96  ? 2036 HOH A O     1 
HETATM 2990 O O     . HOH D 4 .   ? 9.665   45.537 125.013 1.00 33.10  ? 2037 HOH A O     1 
HETATM 2991 O O     . HOH D 4 .   ? 6.858   41.496 122.763 1.00 70.11  ? 2038 HOH A O     1 
HETATM 2992 O O     . HOH D 4 .   ? 7.408   32.380 134.390 1.00 55.94  ? 2039 HOH A O     1 
HETATM 2993 O O     . HOH D 4 .   ? 11.902  43.129 132.460 1.00 79.25  ? 2040 HOH A O     1 
HETATM 2994 O O     . HOH D 4 .   ? 11.301  36.379 123.786 1.00 38.00  ? 2041 HOH A O     1 
HETATM 2995 O O     . HOH D 4 .   ? 15.742  31.394 128.464 1.00 47.78  ? 2042 HOH A O     1 
HETATM 2996 O O     . HOH D 4 .   ? 14.354  29.560 128.377 1.00 67.63  ? 2043 HOH A O     1 
HETATM 2997 O O     . HOH D 4 .   ? 9.416   30.148 124.065 1.00 38.74  ? 2044 HOH A O     1 
HETATM 2998 O O     . HOH D 4 .   ? 12.697  25.061 127.111 1.00 58.14  ? 2045 HOH A O     1 
HETATM 2999 O O     . HOH D 4 .   ? 8.062   28.544 138.093 1.00 40.54  ? 2046 HOH A O     1 
HETATM 3000 O O     . HOH D 4 .   ? -4.031  16.443 129.508 1.00 51.55  ? 2047 HOH A O     1 
HETATM 3001 O O     . HOH D 4 .   ? -4.887  24.656 136.080 1.00 49.10  ? 2048 HOH A O     1 
HETATM 3002 O O     . HOH D 4 .   ? -20.228 24.215 134.630 1.00 50.46  ? 2049 HOH A O     1 
HETATM 3003 O O     . HOH D 4 .   ? -25.595 27.301 126.285 1.00 60.21  ? 2050 HOH A O     1 
HETATM 3004 O O     . HOH D 4 .   ? -14.488 38.632 125.016 1.00 37.63  ? 2051 HOH A O     1 
HETATM 3005 O O     . HOH D 4 .   ? -8.183  39.417 120.470 1.00 47.20  ? 2052 HOH A O     1 
HETATM 3006 O O     . HOH D 4 .   ? -4.128  43.039 130.743 1.00 46.81  ? 2053 HOH A O     1 
HETATM 3007 O O     . HOH D 4 .   ? 0.656   24.951 140.556 1.00 62.86  ? 2054 HOH A O     1 
HETATM 3008 O O     . HOH D 4 .   ? -8.146  30.400 141.853 1.00 60.63  ? 2055 HOH A O     1 
HETATM 3009 O O     . HOH D 4 .   ? -11.655 39.615 133.504 1.00 66.74  ? 2056 HOH A O     1 
HETATM 3010 O O     . HOH D 4 .   ? -17.913 43.791 121.967 1.00 68.08  ? 2057 HOH A O     1 
HETATM 3011 O O     . HOH D 4 .   ? -13.443 42.376 124.886 1.00 53.26  ? 2058 HOH A O     1 
HETATM 3012 O O     . HOH D 4 .   ? -20.344 40.047 125.931 1.00 55.14  ? 2059 HOH A O     1 
HETATM 3013 O O     . HOH D 4 .   ? -24.473 36.397 123.401 1.00 54.89  ? 2060 HOH A O     1 
HETATM 3014 O O     . HOH D 4 .   ? -21.407 34.224 113.472 1.00 74.26  ? 2061 HOH A O     1 
HETATM 3015 O O     . HOH D 4 .   ? -23.665 40.968 111.508 1.00 62.17  ? 2062 HOH A O     1 
HETATM 3016 O O     . HOH D 4 .   ? -21.835 40.183 116.658 1.00 46.75  ? 2063 HOH A O     1 
HETATM 3017 O O     . HOH D 4 .   ? -24.853 34.230 116.460 1.00 58.21  ? 2064 HOH A O     1 
HETATM 3018 O O     . HOH D 4 .   ? -18.651 42.104 107.453 1.00 44.99  ? 2065 HOH A O     1 
HETATM 3019 O O     . HOH D 4 .   ? -17.756 44.742 111.144 1.00 58.26  ? 2066 HOH A O     1 
HETATM 3020 O O     . HOH D 4 .   ? -13.067 42.178 120.339 1.00 49.03  ? 2067 HOH A O     1 
HETATM 3021 O O     . HOH D 4 .   ? -12.468 45.399 117.862 1.00 71.78  ? 2068 HOH A O     1 
HETATM 3022 O O     . HOH D 4 .   ? -7.503  45.547 117.313 1.00 47.72  ? 2069 HOH A O     1 
HETATM 3023 O O     . HOH D 4 .   ? -0.067  37.765 115.464 1.00 27.59  ? 2070 HOH A O     1 
HETATM 3024 O O     . HOH D 4 .   ? 1.214   47.119 114.030 1.00 67.06  ? 2071 HOH A O     1 
HETATM 3025 O O     . HOH D 4 .   ? 0.347   42.017 121.703 1.00 52.28  ? 2072 HOH A O     1 
HETATM 3026 O O     . HOH D 4 .   ? -10.037 35.660 115.645 1.00 28.69  ? 2073 HOH A O     1 
HETATM 3027 O O     . HOH D 4 .   ? -14.816 30.606 111.862 1.00 51.50  ? 2074 HOH A O     1 
HETATM 3028 O O     . HOH D 4 .   ? -13.550 42.808 104.438 1.00 70.30  ? 2075 HOH A O     1 
HETATM 3029 O O     . HOH D 4 .   ? -20.499 36.256 105.653 1.00 58.30  ? 2076 HOH A O     1 
HETATM 3030 O O     . HOH D 4 .   ? -19.162 29.096 108.838 1.00 64.00  ? 2077 HOH A O     1 
HETATM 3031 O O     . HOH D 4 .   ? -15.200 26.096 112.021 1.00 57.20  ? 2078 HOH A O     1 
HETATM 3032 O O     . HOH D 4 .   ? -19.540 28.273 117.048 1.00 43.92  ? 2079 HOH A O     1 
HETATM 3033 O O     . HOH D 4 .   ? -10.522 35.398 119.753 1.00 29.37  ? 2080 HOH A O     1 
HETATM 3034 O O     . HOH D 4 .   ? -4.211  36.961 112.880 1.00 25.59  ? 2081 HOH A O     1 
HETATM 3035 O O     . HOH D 4 .   ? 1.046   36.531 117.619 1.00 32.56  ? 2082 HOH A O     1 
HETATM 3036 O O     . HOH D 4 .   ? 6.286   36.808 123.195 1.00 36.89  ? 2083 HOH A O     1 
HETATM 3037 O O     . HOH D 4 .   ? 5.488   39.205 122.425 1.00 41.08  ? 2084 HOH A O     1 
HETATM 3038 O O     . HOH D 4 .   ? 10.897  28.654 120.529 1.00 57.12  ? 2085 HOH A O     1 
HETATM 3039 O O     . HOH D 4 .   ? 11.047  30.898 117.440 1.00 51.05  ? 2086 HOH A O     1 
HETATM 3040 O O     . HOH D 4 .   ? 7.909   39.868 113.807 1.00 66.69  ? 2087 HOH A O     1 
HETATM 3041 O O     . HOH D 4 .   ? 6.181   41.250 115.230 1.00 43.15  ? 2088 HOH A O     1 
HETATM 3042 O O     . HOH D 4 .   ? 6.747   38.412 112.499 1.00 42.55  ? 2089 HOH A O     1 
HETATM 3043 O O     . HOH D 4 .   ? 5.996   36.856 110.353 1.00 42.51  ? 2090 HOH A O     1 
HETATM 3044 O O     . HOH D 4 .   ? 2.707   44.052 108.662 1.00 44.94  ? 2091 HOH A O     1 
HETATM 3045 O O     . HOH D 4 .   ? 4.733   37.351 107.850 1.00 32.75  ? 2092 HOH A O     1 
HETATM 3046 O O     . HOH D 4 .   ? -0.482  26.640 104.164 1.00 55.14  ? 2093 HOH A O     1 
HETATM 3047 O O     . HOH D 4 .   ? -1.923  28.087 100.570 1.00 51.99  ? 2094 HOH A O     1 
HETATM 3048 O O     . HOH D 4 .   ? -5.602  31.223 95.139  1.00 43.40  ? 2095 HOH A O     1 
HETATM 3049 O O     . HOH D 4 .   ? -6.865  27.856 93.764  1.00 54.30  ? 2096 HOH A O     1 
HETATM 3050 O O     . HOH D 4 .   ? -16.431 31.858 107.785 1.00 46.62  ? 2097 HOH A O     1 
HETATM 3051 O O     . HOH D 4 .   ? -18.243 40.069 102.148 1.00 47.13  ? 2098 HOH A O     1 
HETATM 3052 O O     . HOH D 4 .   ? -18.405 32.083 95.436  1.00 57.52  ? 2099 HOH A O     1 
HETATM 3053 O O     . HOH D 4 .   ? -15.806 41.915 102.869 1.00 62.28  ? 2100 HOH A O     1 
HETATM 3054 O O     . HOH D 4 .   ? -9.522  39.917 89.851  1.00 46.37  ? 2101 HOH A O     1 
HETATM 3055 O O     . HOH D 4 .   ? -3.504  38.933 90.179  1.00 62.96  ? 2102 HOH A O     1 
HETATM 3056 O O     . HOH D 4 .   ? 0.515   34.402 90.639  1.00 45.46  ? 2103 HOH A O     1 
HETATM 3057 O O     . HOH D 4 .   ? 6.360   33.727 96.538  1.00 61.28  ? 2104 HOH A O     1 
HETATM 3058 O O     . HOH D 4 .   ? 15.326  30.584 109.432 1.00 59.46  ? 2105 HOH A O     1 
HETATM 3059 O O     . HOH D 4 .   ? 12.420  25.736 113.791 1.00 56.51  ? 2106 HOH A O     1 
HETATM 3060 O O     . HOH D 4 .   ? 13.121  23.264 115.044 1.00 74.76  ? 2107 HOH A O     1 
HETATM 3061 O O     . HOH D 4 .   ? 7.549   19.615 113.070 1.00 55.88  ? 2108 HOH A O     1 
HETATM 3062 O O     . HOH D 4 .   ? 5.169   15.447 114.968 1.00 72.92  ? 2109 HOH A O     1 
HETATM 3063 O O     . HOH D 4 .   ? -1.149  25.683 109.014 1.00 51.74  ? 2110 HOH A O     1 
HETATM 3064 O O     . HOH D 4 .   ? -3.951  26.912 105.994 1.00 40.77  ? 2111 HOH A O     1 
HETATM 3065 O O     . HOH D 4 .   ? -6.698  25.357 105.614 1.00 49.72  ? 2112 HOH A O     1 
HETATM 3066 O O     . HOH D 4 .   ? -5.614  20.781 111.421 1.00 65.60  ? 2113 HOH A O     1 
HETATM 3067 O O     . HOH D 4 .   ? -12.375 23.637 113.833 1.00 43.80  ? 2114 HOH A O     1 
HETATM 3068 O O     . HOH D 4 .   ? -11.610 24.822 116.236 1.00 46.50  ? 2115 HOH A O     1 
HETATM 3069 O O     . HOH D 4 .   ? -13.250 21.260 122.032 1.00 33.97  ? 2116 HOH A O     1 
HETATM 3070 O O     . HOH D 4 .   ? -11.373 18.626 113.704 1.00 59.65  ? 2117 HOH A O     1 
HETATM 3071 O O     . HOH D 4 .   ? 0.409   15.087 118.163 1.00 59.29  ? 2118 HOH A O     1 
HETATM 3072 O O     . HOH D 4 .   ? 5.708   17.601 125.367 1.00 47.45  ? 2119 HOH A O     1 
HETATM 3073 O O     . HOH D 4 .   ? 1.658   14.794 135.278 1.00 58.61  ? 2120 HOH A O     1 
HETATM 3074 O O     . HOH D 4 .   ? -4.532  23.311 140.322 1.00 57.12  ? 2121 HOH A O     1 
HETATM 3075 O O     . HOH D 4 .   ? -7.482  22.742 137.855 1.00 52.93  ? 2122 HOH A O     1 
HETATM 3076 O O     . HOH D 4 .   ? -5.508  16.579 137.720 1.00 52.40  ? 2123 HOH A O     1 
HETATM 3077 O O     . HOH D 4 .   ? -19.413 17.347 133.797 1.00 63.83  ? 2124 HOH A O     1 
HETATM 3078 O O     . HOH D 4 .   ? -15.536 20.078 124.780 1.00 62.53  ? 2125 HOH A O     1 
HETATM 3079 O O     . HOH D 4 .   ? -13.460 17.592 119.987 1.00 59.53  ? 2126 HOH A O     1 
HETATM 3080 O O     . HOH E 4 .   ? -17.684 43.660 95.319  1.00 53.09  ? 2001 HOH B O     1 
HETATM 3081 O O     . HOH E 4 .   ? -4.950  45.822 92.013  1.00 43.67  ? 2002 HOH B O     1 
HETATM 3082 O O     . HOH E 4 .   ? -9.893  48.893 100.261 1.00 54.87  ? 2003 HOH B O     1 
HETATM 3083 O O     . HOH E 4 .   ? 1.818   46.683 93.408  1.00 51.32  ? 2004 HOH B O     1 
HETATM 3084 O O     . HOH E 4 .   ? -2.055  46.699 91.515  1.00 70.63  ? 2005 HOH B O     1 
HETATM 3085 O O     . HOH E 4 .   ? 2.929   44.664 100.170 1.00 58.24  ? 2006 HOH B O     1 
HETATM 3086 O O     . HOH E 4 .   ? 4.375   44.274 102.322 1.00 46.19  ? 2007 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   35  35  SER SER A . n 
A 1 2   LYS 2   36  36  LYS LYS A . n 
A 1 3   VAL 3   37  37  VAL VAL A . n 
A 1 4   THR 4   38  38  THR THR A . n 
A 1 5   THR 5   39  39  THR THR A . n 
A 1 6   VAL 6   40  40  VAL VAL A . n 
A 1 7   VAL 7   41  41  VAL VAL A . n 
A 1 8   ALA 8   42  42  ALA ALA A . n 
A 1 9   THR 9   43  43  THR THR A . n 
A 1 10  PRO 10  44  44  PRO PRO A . n 
A 1 11  GLY 11  45  45  GLY GLY A . n 
A 1 12  GLN 12  46  46  GLN GLN A . n 
A 1 13  GLY 13  47  47  GLY GLY A . n 
A 1 14  PRO 14  48  48  PRO PRO A . n 
A 1 15  ASP 15  49  49  ASP ASP A . n 
A 1 16  ARG 16  50  50  ARG ARG A . n 
A 1 17  PRO 17  51  51  PRO PRO A . n 
A 1 18  GLN 18  52  52  GLN GLN A . n 
A 1 19  GLU 19  53  53  GLU GLU A . n 
A 1 20  VAL 20  54  54  VAL VAL A . n 
A 1 21  SER 21  55  55  SER SER A . n 
A 1 22  TYR 22  56  56  TYR TYR A . n 
A 1 23  THR 23  57  57  THR THR A . n 
A 1 24  ASP 24  58  58  ASP ASP A . n 
A 1 25  THR 25  59  59  THR THR A . n 
A 1 26  LYS 26  60  60  LYS LYS A . n 
A 1 27  VAL 27  61  61  VAL VAL A . n 
A 1 28  ILE 28  62  62  ILE ILE A . n 
A 1 29  GLY 29  63  63  GLY GLY A . n 
A 1 30  ASN 30  64  64  ASN ASN A . n 
A 1 31  GLY 31  65  65  GLY GLY A . n 
A 1 32  SER 32  66  66  SER SER A . n 
A 1 33  PHE 33  67  67  PHE PHE A . n 
A 1 34  GLY 34  68  68  GLY GLY A . n 
A 1 35  VAL 35  69  69  VAL VAL A . n 
A 1 36  VAL 36  70  70  VAL VAL A . n 
A 1 37  TYR 37  71  71  TYR TYR A . n 
A 1 38  GLN 38  72  72  GLN GLN A . n 
A 1 39  ALA 39  73  73  ALA ALA A . n 
A 1 40  LYS 40  74  74  LYS LYS A . n 
A 1 41  LEU 41  75  75  LEU LEU A . n 
A 1 42  CYS 42  76  76  CYS CYS A . n 
A 1 43  ASP 43  77  77  ASP ASP A . n 
A 1 44  SER 44  78  78  SER SER A . n 
A 1 45  GLY 45  79  79  GLY GLY A . n 
A 1 46  GLU 46  80  80  GLU GLU A . n 
A 1 47  LEU 47  81  81  LEU LEU A . n 
A 1 48  VAL 48  82  82  VAL VAL A . n 
A 1 49  ALA 49  83  83  ALA ALA A . n 
A 1 50  ILE 50  84  84  ILE ILE A . n 
A 1 51  LYS 51  85  85  LYS LYS A . n 
A 1 52  LYS 52  86  86  LYS LYS A . n 
A 1 53  VAL 53  87  87  VAL VAL A . n 
A 1 54  LEU 54  88  88  LEU LEU A . n 
A 1 55  GLN 55  89  89  GLN GLN A . n 
A 1 56  GLY 56  90  90  GLY GLY A . n 
A 1 57  LYS 57  91  91  LYS LYS A . n 
A 1 58  ALA 58  92  92  ALA ALA A . n 
A 1 59  PHE 59  93  93  PHE PHE A . n 
A 1 60  LYS 60  94  94  LYS LYS A . n 
A 1 61  ASN 61  95  95  ASN ASN A . n 
A 1 62  ARG 62  96  96  ARG ARG A . n 
A 1 63  GLU 63  97  97  GLU GLU A . n 
A 1 64  LEU 64  98  98  LEU LEU A . n 
A 1 65  GLN 65  99  99  GLN GLN A . n 
A 1 66  ILE 66  100 100 ILE ILE A . n 
A 1 67  MET 67  101 101 MET MET A . n 
A 1 68  ARG 68  102 102 ARG ARG A . n 
A 1 69  LYS 69  103 103 LYS LYS A . n 
A 1 70  LEU 70  104 104 LEU LEU A . n 
A 1 71  ASP 71  105 105 ASP ASP A . n 
A 1 72  HIS 72  106 106 HIS HIS A . n 
A 1 73  CYS 73  107 107 CYS CYS A . n 
A 1 74  ASN 74  108 108 ASN ASN A . n 
A 1 75  ILE 75  109 109 ILE ILE A . n 
A 1 76  VAL 76  110 110 VAL VAL A . n 
A 1 77  ARG 77  111 111 ARG ARG A . n 
A 1 78  LEU 78  112 112 LEU LEU A . n 
A 1 79  ARG 79  113 113 ARG ARG A . n 
A 1 80  TYR 80  114 114 TYR TYR A . n 
A 1 81  PHE 81  115 115 PHE PHE A . n 
A 1 82  PHE 82  116 116 PHE PHE A . n 
A 1 83  TYR 83  117 117 TYR TYR A . n 
A 1 84  SER 84  118 118 SER SER A . n 
A 1 85  SER 85  119 119 SER SER A . n 
A 1 86  GLY 86  120 120 GLY GLY A . n 
A 1 87  GLU 87  121 121 GLU GLU A . n 
A 1 88  LYS 88  122 122 LYS LYS A . n 
A 1 89  LYS 89  123 123 LYS LYS A . n 
A 1 90  ASP 90  124 124 ASP ASP A . n 
A 1 91  GLU 91  125 125 GLU GLU A . n 
A 1 92  VAL 92  126 126 VAL VAL A . n 
A 1 93  TYR 93  127 127 TYR TYR A . n 
A 1 94  LEU 94  128 128 LEU LEU A . n 
A 1 95  ASN 95  129 129 ASN ASN A . n 
A 1 96  LEU 96  130 130 LEU LEU A . n 
A 1 97  VAL 97  131 131 VAL VAL A . n 
A 1 98  LEU 98  132 132 LEU LEU A . n 
A 1 99  ASP 99  133 133 ASP ASP A . n 
A 1 100 TYR 100 134 134 TYR TYR A . n 
A 1 101 VAL 101 135 135 VAL VAL A . n 
A 1 102 PRO 102 136 136 PRO PRO A . n 
A 1 103 ALA 103 137 137 ALA ALA A . n 
A 1 104 THR 104 138 138 THR THR A . n 
A 1 105 VAL 105 139 139 VAL VAL A . n 
A 1 106 TYR 106 140 140 TYR TYR A . n 
A 1 107 ARG 107 141 141 ARG ARG A . n 
A 1 108 VAL 108 142 142 VAL VAL A . n 
A 1 109 ALA 109 143 143 ALA ALA A . n 
A 1 110 ARG 110 144 144 ARG ARG A . n 
A 1 111 HIS 111 145 145 HIS HIS A . n 
A 1 112 TYR 112 146 146 TYR TYR A . n 
A 1 113 SER 113 147 147 SER SER A . n 
A 1 114 ARG 114 148 148 ARG ARG A . n 
A 1 115 ALA 115 149 149 ALA ALA A . n 
A 1 116 LYS 116 150 150 LYS LYS A . n 
A 1 117 GLN 117 151 151 GLN GLN A . n 
A 1 118 THR 118 152 152 THR THR A . n 
A 1 119 LEU 119 153 153 LEU LEU A . n 
A 1 120 PRO 120 154 154 PRO PRO A . n 
A 1 121 VAL 121 155 155 VAL VAL A . n 
A 1 122 ILE 122 156 156 ILE ILE A . n 
A 1 123 TYR 123 157 157 TYR TYR A . n 
A 1 124 VAL 124 158 158 VAL VAL A . n 
A 1 125 LYS 125 159 159 LYS LYS A . n 
A 1 126 LEU 126 160 160 LEU LEU A . n 
A 1 127 TYR 127 161 161 TYR TYR A . n 
A 1 128 MET 128 162 162 MET MET A . n 
A 1 129 TYR 129 163 163 TYR TYR A . n 
A 1 130 GLN 130 164 164 GLN GLN A . n 
A 1 131 LEU 131 165 165 LEU LEU A . n 
A 1 132 PHE 132 166 166 PHE PHE A . n 
A 1 133 ARG 133 167 167 ARG ARG A . n 
A 1 134 SER 134 168 168 SER SER A . n 
A 1 135 LEU 135 169 169 LEU LEU A . n 
A 1 136 ALA 136 170 170 ALA ALA A . n 
A 1 137 TYR 137 171 171 TYR TYR A . n 
A 1 138 ILE 138 172 172 ILE ILE A . n 
A 1 139 HIS 139 173 173 HIS HIS A . n 
A 1 140 SER 140 174 174 SER SER A . n 
A 1 141 PHE 141 175 175 PHE PHE A . n 
A 1 142 GLY 142 176 176 GLY GLY A . n 
A 1 143 ILE 143 177 177 ILE ILE A . n 
A 1 144 CYS 144 178 178 CYS CYS A . n 
A 1 145 HIS 145 179 179 HIS HIS A . n 
A 1 146 ARG 146 180 180 ARG ARG A . n 
A 1 147 ASP 147 181 181 ASP ASP A . n 
A 1 148 ILE 148 182 182 ILE ILE A . n 
A 1 149 LYS 149 183 183 LYS LYS A . n 
A 1 150 PRO 150 184 184 PRO PRO A . n 
A 1 151 GLN 151 185 185 GLN GLN A . n 
A 1 152 ASN 152 186 186 ASN ASN A . n 
A 1 153 LEU 153 187 187 LEU LEU A . n 
A 1 154 LEU 154 188 188 LEU LEU A . n 
A 1 155 LEU 155 189 189 LEU LEU A . n 
A 1 156 ASP 156 190 190 ASP ASP A . n 
A 1 157 PRO 157 191 191 PRO PRO A . n 
A 1 158 ASP 158 192 192 ASP ASP A . n 
A 1 159 THR 159 193 193 THR THR A . n 
A 1 160 ALA 160 194 194 ALA ALA A . n 
A 1 161 VAL 161 195 195 VAL VAL A . n 
A 1 162 LEU 162 196 196 LEU LEU A . n 
A 1 163 LYS 163 197 197 LYS LYS A . n 
A 1 164 LEU 164 198 198 LEU LEU A . n 
A 1 165 CYS 165 199 199 CYS CYS A . n 
A 1 166 ASP 166 200 200 ASP ASP A . n 
A 1 167 PHE 167 201 201 PHE PHE A . n 
A 1 168 GLY 168 202 202 GLY GLY A . n 
A 1 169 SER 169 203 203 SER SER A . n 
A 1 170 ALA 170 204 204 ALA ALA A . n 
A 1 171 LYS 171 205 205 LYS LYS A . n 
A 1 172 GLN 172 206 206 GLN GLN A . n 
A 1 173 LEU 173 207 207 LEU LEU A . n 
A 1 174 VAL 174 208 208 VAL VAL A . n 
A 1 175 ARG 175 209 209 ARG ARG A . n 
A 1 176 GLY 176 210 210 GLY GLY A . n 
A 1 177 GLU 177 211 211 GLU GLU A . n 
A 1 178 PRO 178 212 212 PRO PRO A . n 
A 1 179 ASN 179 213 213 ASN ASN A . n 
A 1 180 VAL 180 214 214 VAL VAL A . n 
A 1 181 SER 181 215 215 SER SER A . n 
A 1 182 PTR 182 216 216 PTR PTR A . n 
A 1 183 ILE 183 217 217 ILE ILE A . n 
A 1 184 CYS 184 218 218 CYS CYS A . n 
A 1 185 SER 185 219 219 SER SER A . n 
A 1 186 ARG 186 220 220 ARG ARG A . n 
A 1 187 TYR 187 221 221 TYR TYR A . n 
A 1 188 TYR 188 222 222 TYR TYR A . n 
A 1 189 ARG 189 223 223 ARG ARG A . n 
A 1 190 ALA 190 224 224 ALA ALA A . n 
A 1 191 PRO 191 225 225 PRO PRO A . n 
A 1 192 GLU 192 226 226 GLU GLU A . n 
A 1 193 LEU 193 227 227 LEU LEU A . n 
A 1 194 ILE 194 228 228 ILE ILE A . n 
A 1 195 PHE 195 229 229 PHE PHE A . n 
A 1 196 GLY 196 230 230 GLY GLY A . n 
A 1 197 ALA 197 231 231 ALA ALA A . n 
A 1 198 THR 198 232 232 THR THR A . n 
A 1 199 ASP 199 233 233 ASP ASP A . n 
A 1 200 TYR 200 234 234 TYR TYR A . n 
A 1 201 THR 201 235 235 THR THR A . n 
A 1 202 SER 202 236 236 SER SER A . n 
A 1 203 SER 203 237 237 SER SER A . n 
A 1 204 ILE 204 238 238 ILE ILE A . n 
A 1 205 ASP 205 239 239 ASP ASP A . n 
A 1 206 VAL 206 240 240 VAL VAL A . n 
A 1 207 TRP 207 241 241 TRP TRP A . n 
A 1 208 SER 208 242 242 SER SER A . n 
A 1 209 ALA 209 243 243 ALA ALA A . n 
A 1 210 GLY 210 244 244 GLY GLY A . n 
A 1 211 CYS 211 245 245 CYS CYS A . n 
A 1 212 VAL 212 246 246 VAL VAL A . n 
A 1 213 LEU 213 247 247 LEU LEU A . n 
A 1 214 ALA 214 248 248 ALA ALA A . n 
A 1 215 GLU 215 249 249 GLU GLU A . n 
A 1 216 LEU 216 250 250 LEU LEU A . n 
A 1 217 LEU 217 251 251 LEU LEU A . n 
A 1 218 LEU 218 252 252 LEU LEU A . n 
A 1 219 GLY 219 253 253 GLY GLY A . n 
A 1 220 GLN 220 254 254 GLN GLN A . n 
A 1 221 PRO 221 255 255 PRO PRO A . n 
A 1 222 ILE 222 256 256 ILE ILE A . n 
A 1 223 PHE 223 257 257 PHE PHE A . n 
A 1 224 PRO 224 258 258 PRO PRO A . n 
A 1 225 GLY 225 259 259 GLY GLY A . n 
A 1 226 ASP 226 260 260 ASP ASP A . n 
A 1 227 SER 227 261 261 SER SER A . n 
A 1 228 GLY 228 262 262 GLY GLY A . n 
A 1 229 VAL 229 263 263 VAL VAL A . n 
A 1 230 ASP 230 264 264 ASP ASP A . n 
A 1 231 GLN 231 265 265 GLN GLN A . n 
A 1 232 LEU 232 266 266 LEU LEU A . n 
A 1 233 VAL 233 267 267 VAL VAL A . n 
A 1 234 GLU 234 268 268 GLU GLU A . n 
A 1 235 ILE 235 269 269 ILE ILE A . n 
A 1 236 ILE 236 270 270 ILE ILE A . n 
A 1 237 LYS 237 271 271 LYS LYS A . n 
A 1 238 VAL 238 272 272 VAL VAL A . n 
A 1 239 LEU 239 273 273 LEU LEU A . n 
A 1 240 GLY 240 274 274 GLY GLY A . n 
A 1 241 THR 241 275 275 THR THR A . n 
A 1 242 PRO 242 276 276 PRO PRO A . n 
A 1 243 THR 243 277 277 THR THR A . n 
A 1 244 ARG 244 278 278 ARG ARG A . n 
A 1 245 GLU 245 279 279 GLU GLU A . n 
A 1 246 GLN 246 280 280 GLN GLN A . n 
A 1 247 ILE 247 281 281 ILE ILE A . n 
A 1 248 ARG 248 282 282 ARG ARG A . n 
A 1 249 GLU 249 283 283 GLU GLU A . n 
A 1 250 MET 250 284 284 MET MET A . n 
A 1 251 ASN 251 285 285 ASN ASN A . n 
A 1 252 PRO 252 286 286 PRO PRO A . n 
A 1 253 ASN 253 287 287 ASN ASN A . n 
A 1 254 TYR 254 288 288 TYR TYR A . n 
A 1 255 THR 255 289 289 THR THR A . n 
A 1 256 GLU 256 290 290 GLU GLU A . n 
A 1 257 PHE 257 291 291 PHE PHE A . n 
A 1 258 ALA 258 292 292 ALA ALA A . n 
A 1 259 PHE 259 293 293 PHE PHE A . n 
A 1 260 PRO 260 294 294 PRO PRO A . n 
A 1 261 GLN 261 295 295 GLN GLN A . n 
A 1 262 ILE 262 296 296 ILE ILE A . n 
A 1 263 LYS 263 297 297 LYS LYS A . n 
A 1 264 ALA 264 298 298 ALA ALA A . n 
A 1 265 HIS 265 299 299 HIS HIS A . n 
A 1 266 PRO 266 300 300 PRO PRO A . n 
A 1 267 TRP 267 301 301 TRP TRP A . n 
A 1 268 THR 268 302 302 THR THR A . n 
A 1 269 LYS 269 303 303 LYS LYS A . n 
A 1 270 VAL 270 304 304 VAL VAL A . n 
A 1 271 PHE 271 305 305 PHE PHE A . n 
A 1 272 ARG 272 306 306 ARG ARG A . n 
A 1 273 PRO 273 307 307 PRO PRO A . n 
A 1 274 ARG 274 308 308 ARG ARG A . n 
A 1 275 THR 275 309 309 THR THR A . n 
A 1 276 PRO 276 310 310 PRO PRO A . n 
A 1 277 PRO 277 311 311 PRO PRO A . n 
A 1 278 GLU 278 312 312 GLU GLU A . n 
A 1 279 ALA 279 313 313 ALA ALA A . n 
A 1 280 ILE 280 314 314 ILE ILE A . n 
A 1 281 ALA 281 315 315 ALA ALA A . n 
A 1 282 LEU 282 316 316 LEU LEU A . n 
A 1 283 CYS 283 317 317 CYS CYS A . n 
A 1 284 SER 284 318 318 SER SER A . n 
A 1 285 ARG 285 319 319 ARG ARG A . n 
A 1 286 LEU 286 320 320 LEU LEU A . n 
A 1 287 LEU 287 321 321 LEU LEU A . n 
A 1 288 GLU 288 322 322 GLU GLU A . n 
A 1 289 TYR 289 323 323 TYR TYR A . n 
A 1 290 THR 290 324 324 THR THR A . n 
A 1 291 PRO 291 325 325 PRO PRO A . n 
A 1 292 THR 292 326 326 THR THR A . n 
A 1 293 ALA 293 327 327 ALA ALA A . n 
A 1 294 ARG 294 328 328 ARG ARG A . n 
A 1 295 LEU 295 329 329 LEU LEU A . n 
A 1 296 THR 296 330 330 THR THR A . n 
A 1 297 PRO 297 331 331 PRO PRO A . n 
A 1 298 LEU 298 332 332 LEU LEU A . n 
A 1 299 GLU 299 333 333 GLU GLU A . n 
A 1 300 ALA 300 334 334 ALA ALA A . n 
A 1 301 CYS 301 335 335 CYS CYS A . n 
A 1 302 ALA 302 336 336 ALA ALA A . n 
A 1 303 HIS 303 337 337 HIS HIS A . n 
A 1 304 SER 304 338 338 SER SER A . n 
A 1 305 PHE 305 339 339 PHE PHE A . n 
A 1 306 PHE 306 340 340 PHE PHE A . n 
A 1 307 ASP 307 341 341 ASP ASP A . n 
A 1 308 GLU 308 342 342 GLU GLU A . n 
A 1 309 LEU 309 343 343 LEU LEU A . n 
A 1 310 ARG 310 344 344 ARG ARG A . n 
A 1 311 ASP 311 345 345 ASP ASP A . n 
A 1 312 PRO 312 346 346 PRO PRO A . n 
A 1 313 ASN 313 347 347 ASN ASN A . n 
A 1 314 VAL 314 348 348 VAL VAL A . n 
A 1 315 LYS 315 349 349 LYS LYS A . n 
A 1 316 LEU 316 350 350 LEU LEU A . n 
A 1 317 PRO 317 351 351 PRO PRO A . n 
A 1 318 ASN 318 352 352 ASN ASN A . n 
A 1 319 GLY 319 353 353 GLY GLY A . n 
A 1 320 ARG 320 354 354 ARG ARG A . n 
A 1 321 ASP 321 355 355 ASP ASP A . n 
A 1 322 THR 322 356 356 THR THR A . n 
A 1 323 PRO 323 357 357 PRO PRO A . n 
A 1 324 ALA 324 358 358 ALA ALA A . n 
A 1 325 LEU 325 359 359 LEU LEU A . n 
A 1 326 PHE 326 360 360 PHE PHE A . n 
A 1 327 ASN 327 361 361 ASN ASN A . n 
A 1 328 PHE 328 362 362 PHE PHE A . n 
A 1 329 THR 329 363 363 THR THR A . n 
A 1 330 THR 330 364 364 THR THR A . n 
A 1 331 GLN 331 365 365 GLN GLN A . n 
A 1 332 GLU 332 366 366 GLU GLU A . n 
A 1 333 LEU 333 367 367 LEU LEU A . n 
A 1 334 SER 334 368 368 SER SER A . n 
A 1 335 SER 335 369 369 SER SER A . n 
A 1 336 ASN 336 370 370 ASN ASN A . n 
A 1 337 PRO 337 371 371 PRO PRO A . n 
A 1 338 PRO 338 372 372 PRO PRO A . n 
A 1 339 LEU 339 373 373 LEU LEU A . n 
A 1 340 ALA 340 374 374 ALA ALA A . n 
A 1 341 THR 341 375 375 THR THR A . n 
A 1 342 ILE 342 376 376 ILE ILE A . n 
A 1 343 LEU 343 377 377 LEU LEU A . n 
A 1 344 ILE 344 378 378 ILE ILE A . n 
A 1 345 PRO 345 379 379 PRO PRO A . n 
A 1 346 PRO 346 380 380 PRO PRO A . n 
A 1 347 HIS 347 381 381 HIS HIS A . n 
A 1 348 ALA 348 382 382 ALA ALA A . n 
A 1 349 ARG 349 383 383 ARG ARG A . n 
A 1 350 ILE 350 384 384 ILE ILE A . n 
B 2 1   VAL 1   383 383 VAL VAL B . n 
B 2 2   GLU 2   384 384 GLU GLU B . n 
B 2 3   PRO 3   385 385 PRO PRO B . n 
B 2 4   GLN 4   386 386 GLN GLN B . n 
B 2 5   LYS 5   387 387 LYS LYS B . n 
B 2 6   PHE 6   388 388 PHE PHE B . n 
B 2 7   ALA 7   389 389 ALA ALA B . n 
B 2 8   GLU 8   390 390 GLU GLU B . n 
B 2 9   GLU 9   391 391 GLU GLU B . n 
B 2 10  LEU 10  392 392 LEU LEU B . n 
B 2 11  ILE 11  393 393 ILE ILE B . n 
B 2 12  HIS 12  394 394 HIS HIS B . n 
B 2 13  ARG 13  395 395 ARG ARG B . n 
B 2 14  LEU 14  396 396 LEU LEU B . n 
B 2 15  GLU 15  397 397 GLU GLU B . n 
B 2 16  ALA 16  398 398 ALA ALA B . n 
B 2 17  VAL 17  399 399 VAL VAL B . n 
B 2 18  GLN 18  400 400 GLN GLN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ADZ 1   1386 1386 ADZ ADZ A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 1   2001 2001 HOH HOH B . 
E 4 HOH 2   2002 2002 HOH HOH B . 
E 4 HOH 3   2003 2003 HOH HOH B . 
E 4 HOH 4   2004 2004 HOH HOH B . 
E 4 HOH 5   2005 2005 HOH HOH B . 
E 4 HOH 6   2006 2006 HOH HOH B . 
E 4 HOH 7   2007 2007 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PTR 
_pdbx_struct_mod_residue.label_seq_id     182 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     PTR 
_pdbx_struct_mod_residue.auth_seq_id      216 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   TYR 
_pdbx_struct_mod_residue.details          O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 40.9750000000 -0.8660254038 
-0.5000000000 0.0000000000 70.9707818401 0.0000000000 0.0000000000 -1.0000000000 235.3666666667 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'              
2 2 'Structure model' 'Database references'       
3 2 'Structure model' 'Derived calculations'      
4 2 'Structure model' 'Non-polymer description'   
5 2 'Structure model' 'Structure summary'         
6 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
DETERMINATION METHOD: DSSP
THE SHEETS PRESENTED AS "AA" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  7-STRANDED BARREL THIS IS REPRESENTED BY
A  8-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    144 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2037 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.10 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 48  ? ? -75.25  20.79   
2  1 ASP A 49  ? ? 66.52   61.24   
3  1 THR A 57  ? ? -138.58 -159.99 
4  1 ASP A 77  ? ? -70.76  -79.35  
5  1 LYS A 91  ? ? 69.72   -24.44  
6  1 ASP A 105 ? ? -158.07 88.17   
7  1 SER A 118 ? ? -165.58 -148.51 
8  1 LYS A 122 ? ? 63.63   108.14  
9  1 LYS A 123 ? ? -44.60  169.27  
10 1 ASP A 181 ? ? -149.82 35.34   
11 1 ASP A 200 ? ? 57.68   80.28   
12 1 ARG A 209 ? ? -52.86  105.89  
13 1 PRO A 212 ? ? -44.20  159.00  
14 1 CYS A 218 ? ? 74.14   -178.83 
15 1 ARG A 220 ? ? -16.10  -87.79  
16 1 ASN A 285 ? ? -165.14 99.24   
17 1 ASN A 287 ? ? -66.16  2.31    
18 1 ALA A 292 ? ? 57.32   82.57   
19 1 ARG A 354 ? ? -57.66  170.04  
20 1 ASN A 361 ? ? -75.45  48.17   
21 1 ASN A 370 ? ? -159.88 75.96   
22 1 HIS A 381 ? ? -74.51  25.04   
23 1 ALA A 382 ? ? -141.12 -33.47  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 9-METHYL-9H-PURIN-6-AMINE ADZ 
4 water                     HOH 
#