data_1OBZ
# 
_entry.id   1OBZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OBZ         
PDBE  EBI-12085    
WWPDB D_1290012085 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1NTE unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE SECOND PDZ DOMAIN OF SYNTENIN'                                    
PDB 1OBX unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF PDZ2 OF SYNTENIN WITH AN INTERLEUKIN 5 RECEPTOR ALPHA PEPTIDE.' 
PDB 1OBY unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF PDZ2 OF SYNTENIN WITH AN INTERLEUKIN 5 RECEPTOR ALPHA PEPTIDE.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OBZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-01-31 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kang, B.S.'      1 
'Cooper, D.R.'    2 
'Devedjiev, Y.'   3 
'Derewenda, U.'   4 
'Derewenda, Z.S.' 5 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Roots of Degenerate Specificity in Syntenin'S Pdz2 Domain: Reassessment of the Pdz Recognition Paradigm
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                845 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12842047 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00125-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kang, B.S.'      1 ? 
primary 'Cooper, D.R.'    2 ? 
primary 'Devedjiev, Y.'   3 ? 
primary 'Derewenda, U.'   4 ? 
primary 'Derewenda, Z.S.' 5 ? 
# 
_cell.entry_id           1OBZ 
_cell.length_a           101.485 
_cell.length_b           48.172 
_cell.length_c           74.996 
_cell.angle_alpha        90.00 
_cell.angle_beta         120.24 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OBZ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SYNTENIN 1'                   18018.688 2   ? ? 'PDZ2, RESIDUES 113-273'            ? 
2 polymer     syn 'INTERLEUKIN 5 RECEPTOR ALPHA' 938.975   1   ? ? 'LAST 8 RESIDUES, RESIDUES 413-420' ? 
3 non-polymer syn 'ACETATE ION'                  59.044    4   ? ? ?                                   ? 
4 water       nat water                          18.015    658 ? ? ?                                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;SYNDECAN BINDING PROTEIN 1, MELANOMA DIFFERENTIATION ASSOCIATED PROTEIN-9, MDA-9, SCAFFOLD PROTEIN PBP1, TACIP18, PRO-TGF-ALPHA CYTOPLASMIC DOMAIN-INTERACTING PROTEIN 18
;
2 'IL-5R-ALPHA, CD125 ANTIGEN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKIT
MTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTI
TIMPAF
;
;GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKIT
MTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTI
TIMPAF
;
A,B ? 
2 'polypeptide(L)' no no ETLEDSVF ETLEDSVF P   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ASP n 
1 5   PRO n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   ILE n 
1 10  LEU n 
1 11  CYS n 
1 12  LYS n 
1 13  ASP n 
1 14  GLN n 
1 15  ASP n 
1 16  GLY n 
1 17  LYS n 
1 18  ILE n 
1 19  GLY n 
1 20  LEU n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  SER n 
1 25  ILE n 
1 26  ASP n 
1 27  ASN n 
1 28  GLY n 
1 29  ILE n 
1 30  PHE n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  VAL n 
1 35  GLN n 
1 36  ALA n 
1 37  ASN n 
1 38  SER n 
1 39  PRO n 
1 40  ALA n 
1 41  SER n 
1 42  LEU n 
1 43  VAL n 
1 44  GLY n 
1 45  LEU n 
1 46  ARG n 
1 47  PHE n 
1 48  GLY n 
1 49  ASP n 
1 50  GLN n 
1 51  VAL n 
1 52  LEU n 
1 53  GLN n 
1 54  ILE n 
1 55  ASN n 
1 56  GLY n 
1 57  GLU n 
1 58  ASN n 
1 59  CYS n 
1 60  ALA n 
1 61  GLY n 
1 62  TRP n 
1 63  SER n 
1 64  SER n 
1 65  ASP n 
1 66  LYS n 
1 67  ALA n 
1 68  HIS n 
1 69  LYS n 
1 70  VAL n 
1 71  LEU n 
1 72  LYS n 
1 73  GLN n 
1 74  ALA n 
1 75  PHE n 
1 76  GLY n 
1 77  GLU n 
1 78  LYS n 
1 79  ILE n 
1 80  THR n 
1 81  MET n 
1 82  THR n 
1 83  ILE n 
1 84  ARG n 
1 85  ASP n 
1 86  ARG n 
1 87  PRO n 
1 88  PHE n 
1 89  GLU n 
1 90  ARG n 
1 91  THR n 
1 92  ILE n 
1 93  THR n 
1 94  MET n 
1 95  HIS n 
1 96  LYS n 
1 97  ASP n 
1 98  SER n 
1 99  THR n 
1 100 GLY n 
1 101 HIS n 
1 102 VAL n 
1 103 GLY n 
1 104 PHE n 
1 105 ILE n 
1 106 PHE n 
1 107 LYS n 
1 108 ASN n 
1 109 GLY n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 SER n 
1 114 ILE n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 SER n 
1 119 SER n 
1 120 ALA n 
1 121 ALA n 
1 122 ARG n 
1 123 ASN n 
1 124 GLY n 
1 125 LEU n 
1 126 LEU n 
1 127 THR n 
1 128 GLU n 
1 129 HIS n 
1 130 ASN n 
1 131 ILE n 
1 132 CYS n 
1 133 GLU n 
1 134 ILE n 
1 135 ASN n 
1 136 GLY n 
1 137 GLN n 
1 138 ASN n 
1 139 VAL n 
1 140 ILE n 
1 141 GLY n 
1 142 LEU n 
1 143 LYS n 
1 144 ASP n 
1 145 SER n 
1 146 GLN n 
1 147 ILE n 
1 148 ALA n 
1 149 ASP n 
1 150 ILE n 
1 151 LEU n 
1 152 SER n 
1 153 THR n 
1 154 SER n 
1 155 GLY n 
1 156 THR n 
1 157 VAL n 
1 158 VAL n 
1 159 THR n 
1 160 ILE n 
1 161 THR n 
1 162 ILE n 
1 163 MET n 
1 164 PRO n 
1 165 ALA n 
1 166 PHE n 
2 1   GLU n 
2 2   THR n 
2 3   LEU n 
2 4   GLU n 
2 5   ASP n 
2 6   SER n 
2 7   VAL n 
2 8   PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 72537 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PGST-PARALLEL1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1OBZ       1 ? ? 1OBZ   ? 
2 UNP SDB1_HUMAN 1 ? ? O00560 ? 
3 UNP IL5R_HUMAN 2 ? ? Q01344 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OBZ A 1 ? 5   ? 1OBZ   108 ? 112 ? 108 112 
2 2 1OBZ A 6 ? 166 ? O00560 113 ? 273 ? 113 273 
3 1 1OBZ B 1 ? 5   ? 1OBZ   108 ? 112 ? 108 112 
4 2 1OBZ B 6 ? 166 ? O00560 113 ? 273 ? 113 273 
5 3 1OBZ P 1 ? 8   ? Q01344 413 ? 420 ? 1   8   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OBZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   43.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'SITTING DROP WITH 0.2 M SODIUM ACETATE, PH 4.6 28% PEG4000, 0.2 M AMMONIUM ACETATE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-01-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97946 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             0.97946 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OBZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   112090 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.7 
_reflns.pdbx_Rmerge_I_obs            0.04400 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   72.4 
_reflns_shell.Rmerge_I_obs           0.28700 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.130 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OBZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     32205 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             64.55 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    95.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.148 
_refine.ls_R_factor_R_free                       0.213 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.200 
_refine.ls_number_reflns_R_free                  1048 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               12.64 
_refine.aniso_B[1][1]                            -0.00000 
_refine.aniso_B[2][2]                            0.02000 
_refine.aniso_B[3][3]                            -0.03000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.01000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL PLUS MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1N99' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.172 
_refine.pdbx_overall_ESU_R_Free                  0.117 
_refine.overall_SU_ML                            0.073 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.207 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2522 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             658 
_refine_hist.number_atoms_total               3196 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        64.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016 0.021 ? 2547 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 2373 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.507 1.952 ? 3428 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.807 3.000 ? 5527 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.059 5.000 ? 329  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089 0.200 ? 406  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006 0.020 ? 2828 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.003 0.020 ? 468  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.226 0.200 ? 461  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.254 0.200 ? 2864 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.082 0.200 ? 1554 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.203 0.200 ? 437  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.151 0.200 ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.308 0.200 ? 67   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.170 0.200 ? 77   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.153 1.500 ? 1647 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.932 2.000 ? 2647 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.720 3.000 ? 900  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.302 4.500 ? 781  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             1739 
_refine_ls_shell.R_factor_R_work                  0.2120 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1OBZ 
_struct.title                     
'Crystal structure of the complex of the PDZ tandem of syntenin with an interleukin 5 receptor alpha peptide.' 
_struct.pdbx_descriptor           'SYNTENIN 1, INTERLEUKIN 5 RECEPTOR ALPHA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OBZ 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'CELL ADHESION, ADHESION-COMPLEX, PDZ DOMAIN, SIGNAL TRANSDUCTION, NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;THE TRIMER IS FORMED BY THE COMPLEX OF                       
 CHAINS A AND BWITH ONE MOLECULE OF CHAIN P
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 38  ? VAL A 43  ? SER A 145 VAL A 150 1 ? 6  
HELX_P HELX_P2 2 SER A 63  ? ALA A 74  ? SER A 170 ALA A 181 1 ? 12 
HELX_P HELX_P3 3 SER A 118 ? ASN A 123 ? SER A 225 ASN A 230 1 ? 6  
HELX_P HELX_P4 4 LYS A 143 ? SER A 154 ? LYS A 250 SER A 261 1 ? 12 
HELX_P HELX_P5 5 ALA B 40  ? GLY B 44  ? ALA B 147 GLY B 151 5 ? 5  
HELX_P HELX_P6 6 SER B 63  ? ALA B 74  ? SER B 170 ALA B 181 1 ? 12 
HELX_P HELX_P7 7 SER B 118 ? ASN B 123 ? SER B 225 ASN B 230 1 ? 6  
HELX_P HELX_P8 8 LYS B 143 ? SER B 154 ? LYS B 250 SER B 261 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 4 ? 
AC ? 5 ? 
AD ? 4 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 5 ? 
BD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
AA 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
AA 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
AA 4 GLY A 28  ? VAL A 34  ? GLY A 135 VAL A 141 
AA 5 LEU A 20  ? ILE A 25  ? LEU A 127 ILE A 132 
AB 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
AB 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
AB 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
AB 4 GLU A 57  ? ASN A 58  ? GLU A 164 ASN A 165 
AC 1 ARG A 90  ? HIS A 95  ? ARG A 197 HIS A 202 
AC 2 VAL A 157 ? PRO A 164 ? VAL A 264 PRO A 271 
AC 3 HIS A 129 ? ILE A 134 ? HIS A 236 ILE A 241 
AC 4 LYS A 110 ? ILE A 114 ? LYS A 217 ILE A 221 
AC 5 PHE A 104 ? LYS A 107 ? PHE A 211 LYS A 214 
AD 1 ARG A 90  ? HIS A 95  ? ARG A 197 HIS A 202 
AD 2 VAL A 157 ? PRO A 164 ? VAL A 264 PRO A 271 
AD 3 HIS A 129 ? ILE A 134 ? HIS A 236 ILE A 241 
AD 4 GLN A 137 ? ASN A 138 ? GLN A 244 ASN A 245 
BA 1 ARG B 6   ? LEU B 10  ? ARG B 113 LEU B 117 
BA 2 ILE B 79  ? ARG B 84  ? ILE B 186 ARG B 191 
BA 3 GLN B 50  ? ILE B 54  ? GLN B 157 ILE B 161 
BA 4 GLU B 57  ? ASN B 58  ? GLU B 164 ASN B 165 
BB 1 LEU B 20  ? ILE B 25  ? LEU B 127 ILE B 132 
BB 2 GLY B 28  ? VAL B 34  ? GLY B 135 VAL B 141 
BC 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
BC 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
BC 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
BC 4 LYS B 110 ? ILE B 114 ? LYS B 217 ILE B 221 
BC 5 PHE B 104 ? LYS B 107 ? PHE B 211 LYS B 214 
BD 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
BD 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
BD 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
BD 4 GLN B 137 ? ASN B 138 ? GLN B 244 ASN B 245 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
AA 2 3 N ARG A 84  ? N ARG A 191 O GLN A 50  ? O GLN A 157 
AA 3 4 N VAL A 51  ? N VAL A 158 O ILE A 29  ? O ILE A 136 
AA 4 5 N GLN A 32  ? N GLN A 139 O ARG A 21  ? O ARG A 128 
AB 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
AB 2 3 N ARG A 84  ? N ARG A 191 O GLN A 50  ? O GLN A 157 
AB 3 4 N ILE A 54  ? N ILE A 161 O GLU A 57  ? O GLU A 164 
AC 1 2 N MET A 94  ? N MET A 201 O VAL A 158 ? O VAL A 265 
AC 2 3 N MET A 163 ? N MET A 270 O ASN A 130 ? O ASN A 237 
AC 3 4 O HIS A 129 ? O HIS A 236 N ILE A 111 ? N ILE A 218 
AC 4 5 N THR A 112 ? N THR A 219 O ILE A 105 ? O ILE A 212 
AD 1 2 N MET A 94  ? N MET A 201 O VAL A 158 ? O VAL A 265 
AD 2 3 N MET A 163 ? N MET A 270 O ASN A 130 ? O ASN A 237 
AD 3 4 N ILE A 134 ? N ILE A 241 O GLN A 137 ? O GLN A 244 
BA 1 2 N LEU B 10  ? N LEU B 117 O ILE B 79  ? O ILE B 186 
BA 2 3 N ARG B 84  ? N ARG B 191 O GLN B 50  ? O GLN B 157 
BA 3 4 N ILE B 54  ? N ILE B 161 O GLU B 57  ? O GLU B 164 
BB 1 2 N ILE B 25  ? N ILE B 132 O GLY B 28  ? O GLY B 135 
BC 1 2 N MET B 94  ? N MET B 201 O VAL B 158 ? O VAL B 265 
BC 2 3 N MET B 163 ? N MET B 270 O ASN B 130 ? O ASN B 237 
BC 3 4 O HIS B 129 ? O HIS B 236 N ILE B 111 ? N ILE B 218 
BC 4 5 N THR B 112 ? N THR B 219 O ILE B 105 ? O ILE B 212 
BD 1 2 N MET B 94  ? N MET B 201 O VAL B 158 ? O VAL B 265 
BD 2 3 N MET B 163 ? N MET B 270 O ASN B 130 ? O ASN B 237 
BD 3 4 N ILE B 134 ? N ILE B 241 O GLN B 137 ? O GLN B 244 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE ACT A1274' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACT A1275' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ACT B1273' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE ACT B1274' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ILE A 25  ? ILE A 132  . ? 1_555 ? 
2  AC1 7 PHE A 30  ? PHE A 137  . ? 1_555 ? 
3  AC1 7 PHE A 47  ? PHE A 154  . ? 1_555 ? 
4  AC1 7 GLY A 48  ? GLY A 155  . ? 1_555 ? 
5  AC1 7 HOH H .   ? HOH A 2044 . ? 1_555 ? 
6  AC1 7 HOH H .   ? HOH A 2045 . ? 1_555 ? 
7  AC1 7 HOH H .   ? HOH A 2296 . ? 1_555 ? 
8  AC2 5 LYS A 17  ? LYS A 124  . ? 1_555 ? 
9  AC2 5 ILE A 18  ? ILE A 125  . ? 1_555 ? 
10 AC2 5 GLY A 19  ? GLY A 126  . ? 1_555 ? 
11 AC2 5 LEU A 20  ? LEU A 127  . ? 1_555 ? 
12 AC2 5 HOH H .   ? HOH A 2300 . ? 1_555 ? 
13 AC3 6 HIS B 101 ? HIS B 208  . ? 1_555 ? 
14 AC3 6 VAL B 102 ? VAL B 209  . ? 1_555 ? 
15 AC3 6 GLY B 103 ? GLY B 210  . ? 1_555 ? 
16 AC3 6 PHE B 104 ? PHE B 211  . ? 1_555 ? 
17 AC3 6 HOH I .   ? HOH B 2348 . ? 1_555 ? 
18 AC3 6 HOH I .   ? HOH B 2349 . ? 1_555 ? 
19 AC4 7 LYS B 17  ? LYS B 124  . ? 1_555 ? 
20 AC4 7 ILE B 18  ? ILE B 125  . ? 1_555 ? 
21 AC4 7 GLY B 19  ? GLY B 126  . ? 1_555 ? 
22 AC4 7 LEU B 20  ? LEU B 127  . ? 1_555 ? 
23 AC4 7 HOH I .   ? HOH B 2174 . ? 1_555 ? 
24 AC4 7 HOH I .   ? HOH B 2350 . ? 1_555 ? 
25 AC4 7 HOH I .   ? HOH B 2351 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OBZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OBZ 
_atom_sites.fract_transf_matrix[1][1]   0.009854 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005745 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020759 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015435 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 4   ? 29.995  -6.743  25.926 1.00   24.69 ? 111  ASP A N   1 
ATOM   2    C CA  . ASP A 1 4   ? 31.017  -7.791  25.710 1.00   23.51 ? 111  ASP A CA  1 
ATOM   3    C C   . ASP A 1 4   ? 30.582  -8.610  24.540 1.00   22.09 ? 111  ASP A C   1 
ATOM   4    O O   . ASP A 1 4   ? 29.420  -8.995  24.486 1.00   22.00 ? 111  ASP A O   1 
ATOM   5    C CB  . ASP A 1 4   ? 31.083  -8.681  26.923 1.00   24.88 ? 111  ASP A CB  1 
ATOM   6    N N   . PRO A 1 5   ? 31.467  -8.908  23.596 1.00   20.10 ? 112  PRO A N   1 
ATOM   7    C CA  . PRO A 1 5   ? 31.049  -9.763  22.483 1.00   18.93 ? 112  PRO A CA  1 
ATOM   8    C C   . PRO A 1 5   ? 30.928  -11.204 22.896 1.00   17.59 ? 112  PRO A C   1 
ATOM   9    O O   . PRO A 1 5   ? 31.361  -11.607 23.977 1.00   16.92 ? 112  PRO A O   1 
ATOM   10   C CB  . PRO A 1 5   ? 32.153  -9.591  21.446 1.00   18.97 ? 112  PRO A CB  1 
ATOM   11   C CG  . PRO A 1 5   ? 33.299  -8.990  22.142 1.00   20.52 ? 112  PRO A CG  1 
ATOM   12   C CD  . PRO A 1 5   ? 32.866  -8.461  23.454 1.00   20.69 ? 112  PRO A CD  1 
ATOM   13   N N   . ARG A 1 6   ? 30.309  -11.980 22.030 1.00   16.46 ? 113  ARG A N   1 
ATOM   14   C CA  . ARG A 1 6   ? 30.123  -13.402 22.282 1.00   16.17 ? 113  ARG A CA  1 
ATOM   15   C C   . ARG A 1 6   ? 30.668  -14.179 21.105 1.00   15.98 ? 113  ARG A C   1 
ATOM   16   O O   . ARG A 1 6   ? 30.717  -13.662 19.980 1.00   14.87 ? 113  ARG A O   1 
ATOM   17   C CB  . ARG A 1 6   ? 28.641  -13.727 22.557 1.00   16.21 ? 113  ARG A CB  1 
ATOM   18   C CG  . ARG A 1 6   ? 27.691  -13.693 21.348 1.00   15.83 ? 113  ARG A CG  1 
ATOM   19   C CD  . ARG A 1 6   ? 26.224  -13.771 21.751 1.00   15.84 ? 113  ARG A CD  1 
ATOM   20   N NE  . ARG A 1 6   ? 25.318  -13.905 20.625 1.00   13.89 ? 113  ARG A NE  1 
ATOM   21   C CZ  . ARG A 1 6   ? 24.874  -15.044 20.080 1.00   15.71 ? 113  ARG A CZ  1 
ATOM   22   N NH1 . ARG A 1 6   ? 25.244  -16.241 20.523 1.00   16.10 ? 113  ARG A NH1 1 
ATOM   23   N NH2 . ARG A 1 6   ? 24.023  -14.979 19.046 1.00   14.98 ? 113  ARG A NH2 1 
ATOM   24   N N   . GLU A 1 7   ? 31.082  -15.422 21.372 1.00   16.16 ? 114  GLU A N   1 
ATOM   25   C CA  . GLU A 1 7   ? 31.565  -16.320 20.353 1.00   16.49 ? 114  GLU A CA  1 
ATOM   26   C C   . GLU A 1 7   ? 30.443  -17.269 19.871 1.00   15.76 ? 114  GLU A C   1 
ATOM   27   O O   . GLU A 1 7   ? 29.671  -17.844 20.661 1.00   15.06 ? 114  GLU A O   1 
ATOM   28   C CB  . GLU A 1 7   ? 32.773  -17.136 20.855 1.00   17.99 ? 114  GLU A CB  1 
ATOM   29   C CG  . GLU A 1 7   ? 33.355  -18.020 19.766 1.00   22.21 ? 114  GLU A CG  1 
ATOM   30   C CD  . GLU A 1 7   ? 34.775  -18.479 20.013 1.00   27.69 ? 114  GLU A CD  1 
ATOM   31   O OE1 . GLU A 1 7   ? 34.976  -19.710 20.135 1.00   28.05 ? 114  GLU A OE1 1 
ATOM   32   O OE2 . GLU A 1 7   ? 35.686  -17.607 20.025 1.00   32.32 ? 114  GLU A OE2 1 
ATOM   33   N N   . VAL A 1 8   ? 30.343  -17.415 18.566 1.00   15.23 ? 115  VAL A N   1 
ATOM   34   C CA  . VAL A 1 8   ? 29.486  -18.441 17.991 1.00   15.10 ? 115  VAL A CA  1 
ATOM   35   C C   . VAL A 1 8   ? 30.274  -19.297 17.028 1.00   15.00 ? 115  VAL A C   1 
ATOM   36   O O   . VAL A 1 8   ? 31.174  -18.814 16.344 1.00   14.74 ? 115  VAL A O   1 
ATOM   37   C CB  . VAL A 1 8   ? 28.222  -17.884 17.290 1.00   15.36 ? 115  VAL A CB  1 
ATOM   38   C CG1 . VAL A 1 8   ? 27.337  -17.170 18.295 1.00   16.52 ? 115  VAL A CG1 1 
ATOM   39   C CG2 . VAL A 1 8   ? 28.573  -16.979 16.104 1.00   14.33 ? 115  VAL A CG2 1 
ATOM   40   N N   . ILE A 1 9   ? 29.888  -20.570 16.953 1.00   14.39 ? 116  ILE A N   1 
ATOM   41   C CA  . ILE A 1 9   ? 30.490  -21.488 15.999 1.00   14.62 ? 116  ILE A CA  1 
ATOM   42   C C   . ILE A 1 9   ? 29.396  -22.052 15.123 1.00   14.53 ? 116  ILE A C   1 
ATOM   43   O O   . ILE A 1 9   ? 28.486  -22.754 15.626 1.00   14.38 ? 116  ILE A O   1 
ATOM   44   C CB  . ILE A 1 9   ? 31.229  -22.609 16.741 1.00   15.14 ? 116  ILE A CB  1 
ATOM   45   C CG1 . ILE A 1 9   ? 32.315  -21.989 17.638 1.00   16.30 ? 116  ILE A CG1 1 
ATOM   46   C CG2 . ILE A 1 9   ? 31.865  -23.576 15.760 1.00   14.61 ? 116  ILE A CG2 1 
ATOM   47   C CD1 . ILE A 1 9   ? 32.988  -22.943 18.646 1.00   19.75 ? 116  ILE A CD1 1 
ATOM   48   N N   . LEU A 1 10  ? 29.474  -21.740 13.839 1.00   14.46 ? 117  LEU A N   1 
ATOM   49   C CA  . LEU A 1 10  ? 28.482  -22.173 12.862 1.00   14.96 ? 117  LEU A CA  1 
ATOM   50   C C   . LEU A 1 10  ? 28.965  -23.384 12.112 1.00   15.73 ? 117  LEU A C   1 
ATOM   51   O O   . LEU A 1 10  ? 30.155  -23.496 11.800 1.00   16.02 ? 117  LEU A O   1 
ATOM   52   C CB  . LEU A 1 10  ? 28.163  -21.076 11.836 1.00   14.08 ? 117  LEU A CB  1 
ATOM   53   C CG  . LEU A 1 10  ? 27.444  -19.820 12.354 1.00   13.25 ? 117  LEU A CG  1 
ATOM   54   C CD1 . LEU A 1 10  ? 28.358  -18.934 13.154 1.00   13.77 ? 117  LEU A CD1 1 
ATOM   55   C CD2 . LEU A 1 10  ? 26.890  -19.110 11.168 1.00   13.25 ? 117  LEU A CD2 1 
ATOM   56   N N   . CYS A 1 11  ? 28.038  -24.280 11.801 1.00   17.41 ? 118  CYS A N   1 
ATOM   57   C CA  . CYS A 1 11  ? 28.352  -25.465 11.024 1.00   19.42 ? 118  CYS A CA  1 
ATOM   58   C C   . CYS A 1 11  ? 27.699  -25.325 9.665  1.00   19.12 ? 118  CYS A C   1 
ATOM   59   O O   . CYS A 1 11  ? 26.472  -25.217 9.563  1.00   19.14 ? 118  CYS A O   1 
ATOM   60   C CB  . CYS A 1 11  ? 27.853  -26.719 11.713 1.00   20.69 ? 118  CYS A CB  1 
ATOM   61   S SG  . CYS A 1 11  ? 28.454  -28.210 10.865 1.00   27.88 ? 118  CYS A SG  1 
ATOM   62   N N   . LYS A 1 12  ? 28.519  -25.278 8.622  1.00   19.22 ? 119  LYS A N   1 
ATOM   63   C CA  . LYS A 1 12  ? 28.016  -25.185 7.247  1.00   19.77 ? 119  LYS A CA  1 
ATOM   64   C C   . LYS A 1 12  ? 27.011  -26.291 6.962  1.00   20.20 ? 119  LYS A C   1 
ATOM   65   O O   . LYS A 1 12  ? 27.120  -27.389 7.502  1.00   20.01 ? 119  LYS A O   1 
ATOM   66   C CB  . LYS A 1 12  ? 29.163  -25.300 6.247  1.00   20.20 ? 119  LYS A CB  1 
ATOM   67   C CG  . LYS A 1 12  ? 30.190  -24.177 6.289  1.00   21.30 ? 119  LYS A CG  1 
ATOM   68   C CD  . LYS A 1 12  ? 31.183  -24.346 5.146  1.00   24.26 ? 119  LYS A CD  1 
ATOM   69   C CE  . LYS A 1 12  ? 32.399  -23.440 5.285  1.00   27.08 ? 119  LYS A CE  1 
ATOM   70   N NZ  . LYS A 1 12  ? 33.482  -23.856 4.350  1.00   29.25 ? 119  LYS A NZ  1 
ATOM   71   N N   . ASP A 1 13  ? 26.034  -26.012 6.108  1.00   21.09 ? 120  ASP A N   1 
ATOM   72   C CA  . ASP A 1 13  ? 25.127  -27.059 5.642  1.00   22.05 ? 120  ASP A CA  1 
ATOM   73   C C   . ASP A 1 13  ? 25.794  -27.911 4.553  1.00   23.61 ? 120  ASP A C   1 
ATOM   74   O O   . ASP A 1 13  ? 26.986  -27.748 4.262  1.00   23.03 ? 120  ASP A O   1 
ATOM   75   C CB  . ASP A 1 13  ? 23.749  -26.501 5.230  1.00   22.03 ? 120  ASP A CB  1 
ATOM   76   C CG  . ASP A 1 13  ? 23.779  -25.615 4.003  1.00   21.33 ? 120  ASP A CG  1 
ATOM   77   O OD1 . ASP A 1 13  ? 24.738  -25.638 3.206  1.00   19.79 ? 120  ASP A OD1 1 
ATOM   78   O OD2 . ASP A 1 13  ? 22.848  -24.823 3.760  1.00   21.14 ? 120  ASP A OD2 1 
ATOM   79   N N   . GLN A 1 14  ? 25.007  -28.849 4.017  1.00   25.51 ? 121  GLN A N   1 
ATOM   80   C CA  . GLN A 1 14  ? 25.360  -29.709 2.886  1.00   27.24 ? 121  GLN A CA  1 
ATOM   81   C C   . GLN A 1 14  ? 25.954  -28.939 1.722  1.00   26.97 ? 121  GLN A C   1 
ATOM   82   O O   . GLN A 1 14  ? 26.982  -29.339 1.144  1.00   28.14 ? 121  GLN A O   1 
ATOM   83   C CB  . GLN A 1 14  ? 24.089  -30.429 2.385  1.00   28.10 ? 121  GLN A CB  1 
ATOM   84   C CG  . GLN A 1 14  ? 24.235  -31.931 2.284  1.00   31.84 ? 121  GLN A CG  1 
ATOM   85   C CD  . GLN A 1 14  ? 23.372  -32.528 1.174  1.00   34.35 ? 121  GLN A CD  1 
ATOM   86   O OE1 . GLN A 1 14  ? 22.139  -32.574 1.298  1.00   35.85 ? 121  GLN A OE1 1 
ATOM   87   N NE2 . GLN A 1 14  ? 24.016  -32.998 0.098  1.00   36.04 ? 121  GLN A NE2 1 
ATOM   88   N N   . ASP A 1 15  ? 25.293  -27.834 1.377  1.00   25.93 ? 122  ASP A N   1 
ATOM   89   C CA  . ASP A 1 15  ? 25.686  -27.033 0.230  1.00   25.07 ? 122  ASP A CA  1 
ATOM   90   C C   . ASP A 1 15  ? 26.866  -26.110 0.506  1.00   24.03 ? 122  ASP A C   1 
ATOM   91   O O   . ASP A 1 15  ? 27.214  -25.331 -0.347 1.00   24.21 ? 122  ASP A O   1 
ATOM   92   C CB  . ASP A 1 15  ? 24.506  -26.189 -0.251 1.00   25.39 ? 122  ASP A CB  1 
ATOM   93   C CG  . ASP A 1 15  ? 23.269  -27.008 -0.520 1.00   25.33 ? 122  ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 15  ? 23.408  -28.182 -0.947 1.00   24.43 ? 122  ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 15  ? 22.115  -26.550 -0.312 1.00   25.29 ? 122  ASP A OD2 1 
ATOM   96   N N   . GLY A 1 16  ? 27.446  -26.179 1.708  1.00   23.26 ? 123  GLY A N   1 
ATOM   97   C CA  . GLY A 1 16  ? 28.576  -25.345 2.105  1.00   22.12 ? 123  GLY A CA  1 
ATOM   98   C C   . GLY A 1 16  ? 28.191  -23.950 2.589  1.00   21.07 ? 123  GLY A C   1 
ATOM   99   O O   . GLY A 1 16  ? 29.044  -23.062 2.698  1.00   21.59 ? 123  GLY A O   1 
ATOM   100  N N   . LYS A 1 17  ? 26.909  -23.764 2.889  1.00   19.39 ? 124  LYS A N   1 
ATOM   101  C CA  . LYS A 1 17  ? 26.353  -22.440 3.178  1.00   18.12 ? 124  LYS A CA  1 
ATOM   102  C C   . LYS A 1 17  ? 25.948  -22.310 4.630  1.00   16.08 ? 124  LYS A C   1 
ATOM   103  O O   . LYS A 1 17  ? 25.753  -23.314 5.309  1.00   15.43 ? 124  LYS A O   1 
ATOM   104  C CB  . LYS A 1 17  ? 25.146  -22.186 2.313  1.00   18.81 ? 124  LYS A CB  1 
ATOM   105  C CG  . LYS A 1 17  ? 25.518  -22.094 0.852  1.00   22.76 ? 124  LYS A CG  1 
ATOM   106  C CD  . LYS A 1 17  ? 24.304  -21.980 -0.007 1.00   27.48 ? 124  LYS A CD  1 
ATOM   107  C CE  . LYS A 1 17  ? 24.626  -22.348 -1.458 1.00   30.72 ? 124  LYS A CE  1 
ATOM   108  N NZ  . LYS A 1 17  ? 23.390  -22.786 -2.161 1.00   33.78 ? 124  LYS A NZ  1 
ATOM   109  N N   . ILE A 1 18  ? 25.837  -21.069 5.104  1.00   14.39 ? 125  ILE A N   1 
ATOM   110  C CA  . ILE A 1 18  ? 25.402  -20.812 6.483  1.00   13.41 ? 125  ILE A CA  1 
ATOM   111  C C   . ILE A 1 18  ? 24.121  -19.993 6.609  1.00   12.65 ? 125  ILE A C   1 
ATOM   112  O O   . ILE A 1 18  ? 23.637  -19.792 7.725  1.00   11.91 ? 125  ILE A O   1 
ATOM   113  C CB  . ILE A 1 18  ? 26.525  -20.152 7.320  1.00   13.86 ? 125  ILE A CB  1 
ATOM   114  C CG1 . ILE A 1 18  ? 27.016  -18.875 6.645  1.00   13.94 ? 125  ILE A CG1 1 
ATOM   115  C CG2 . ILE A 1 18  ? 27.703  -21.179 7.553  1.00   14.00 ? 125  ILE A CG2 1 
ATOM   116  C CD1 . ILE A 1 18  ? 27.767  -17.958 7.568  1.00   12.83 ? 125  ILE A CD1 1 
ATOM   117  N N   . GLY A 1 19  ? 23.596  -19.498 5.496  1.00   12.33 ? 126  GLY A N   1 
ATOM   118  C CA  . GLY A 1 19  ? 22.310  -18.819 5.467  1.00   11.89 ? 126  GLY A CA  1 
ATOM   119  C C   . GLY A 1 19  ? 22.385  -17.377 5.944  1.00   11.94 ? 126  GLY A C   1 
ATOM   120  O O   . GLY A 1 19  ? 21.494  -16.876 6.610  1.00   10.24 ? 126  GLY A O   1 
ATOM   121  N N   . LEU A 1 20  ? 23.478  -16.721 5.587  1.00   12.38 ? 127  LEU A N   1 
ATOM   122  C CA  . LEU A 1 20  ? 23.811  -15.409 6.095  1.00   13.11 ? 127  LEU A CA  1 
ATOM   123  C C   . LEU A 1 20  ? 24.226  -14.501 4.954  1.00   12.77 ? 127  LEU A C   1 
ATOM   124  O O   . LEU A 1 20  ? 25.016  -14.923 4.126  1.00   12.86 ? 127  LEU A O   1 
ATOM   125  C CB  . LEU A 1 20  ? 24.997  -15.619 7.051  1.00   13.92 ? 127  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 20  ? 25.519  -14.506 7.920  1.00   16.93 ? 127  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 20  ? 24.406  -13.868 8.686  1.00   18.55 ? 127  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 20  ? 26.559  -15.033 8.861  1.00   17.55 ? 127  LEU A CD2 1 
ATOM   129  N N   . ARG A 1 21  ? 23.757  -13.259 4.940  1.00   12.22 ? 128  ARG A N   1 
ATOM   130  C CA  . ARG A 1 21  ? 24.366  -12.212 4.133  1.00   12.87 ? 128  ARG A CA  1 
ATOM   131  C C   . ARG A 1 21  ? 24.909  -11.139 5.074  1.00   11.88 ? 128  ARG A C   1 
ATOM   132  O O   . ARG A 1 21  ? 24.238  -10.760 6.045  1.00   10.66 ? 128  ARG A O   1 
ATOM   133  C CB  . ARG A 1 21  ? 23.342  -11.626 3.192  1.00   13.59 ? 128  ARG A CB  1 
ATOM   134  C CG  . ARG A 1 21  ? 23.810  -10.462 2.341  1.00   19.98 ? 128  ARG A CG  1 
ATOM   135  C CD  . ARG A 1 21  ? 22.665  -9.910  1.498  1.00   27.35 ? 128  ARG A CD  1 
ATOM   136  N NE  . ARG A 1 21  ? 23.114  -8.977  0.468  1.00   33.58 ? 128  ARG A NE  1 
ATOM   137  C CZ  . ARG A 1 21  ? 22.508  -8.791  -0.706 1.00   37.65 ? 128  ARG A CZ  1 
ATOM   138  N NH1 . ARG A 1 21  ? 21.421  -9.483  -1.044 1.00   39.84 ? 128  ARG A NH1 1 
ATOM   139  N NH2 . ARG A 1 21  ? 23.013  -7.920  -1.565 1.00   39.86 ? 128  ARG A NH2 1 
ATOM   140  N N   . LEU A 1 22  ? 26.130  -10.704 4.783  1.00   12.35 ? 129  LEU A N   1 
ATOM   141  C CA  . LEU A 1 22  ? 26.822  -9.646  5.516  1.00   12.82 ? 129  LEU A CA  1 
ATOM   142  C C   . LEU A 1 22  ? 26.917  -8.354  4.723  1.00   13.47 ? 129  LEU A C   1 
ATOM   143  O O   . LEU A 1 22  ? 26.910  -8.360  3.476  1.00   15.06 ? 129  LEU A O   1 
ATOM   144  C CB  . LEU A 1 22  ? 28.219  -10.114 5.876  1.00   13.05 ? 129  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 22  ? 28.298  -11.390 6.724  1.00   14.99 ? 129  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 22  ? 29.722  -11.745 6.886  1.00   17.69 ? 129  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 22  ? 27.594  -11.238 8.050  1.00   15.17 ? 129  LEU A CD2 1 
ATOM   148  N N   . LYS A 1 23  ? 27.040  -7.234  5.434  1.00   12.26 ? 130  LYS A N   1 
ATOM   149  C CA  . LYS A 1 23  ? 27.113  -5.925  4.790  1.00   12.59 ? 130  LYS A CA  1 
ATOM   150  C C   . LYS A 1 23  ? 28.143  -5.021  5.498  1.00   12.36 ? 130  LYS A C   1 
ATOM   151  O O   . LYS A 1 23  ? 28.196  -4.953  6.723  1.00   11.66 ? 130  LYS A O   1 
ATOM   152  C CB  . LYS A 1 23  ? 25.733  -5.288  4.791  1.00   13.65 ? 130  LYS A CB  1 
ATOM   153  C CG  . LYS A 1 23  ? 25.664  -3.836  4.302  1.00   15.38 ? 130  LYS A CG  1 
ATOM   154  C CD  . LYS A 1 23  ? 24.264  -3.301  4.357  1.00   18.17 ? 130  LYS A CD  1 
ATOM   155  C CE  . LYS A 1 23  ? 24.144  -1.903  3.790  1.00   20.78 ? 130  LYS A CE  1 
ATOM   156  N NZ  . LYS A 1 23  ? 22.778  -1.323  4.042  1.00   21.18 ? 130  LYS A NZ  1 
ATOM   157  N N   . SER A 1 24  ? 28.954  -4.322  4.710  1.00   11.52 ? 131  SER A N   1 
ATOM   158  C CA  . SER A 1 24  ? 29.862  -3.304  5.251  1.00   11.85 ? 131  SER A CA  1 
ATOM   159  C C   . SER A 1 24  ? 29.082  -2.025  5.591  1.00   11.23 ? 131  SER A C   1 
ATOM   160  O O   . SER A 1 24  ? 28.427  -1.427  4.730  1.00   11.75 ? 131  SER A O   1 
ATOM   161  C CB  . SER A 1 24  ? 30.912  -2.974  4.204  1.00   12.56 ? 131  SER A CB  1 
ATOM   162  O OG  . SER A 1 24  ? 31.699  -1.879  4.618  1.00   12.64 ? 131  SER A OG  1 
ATOM   163  N N   . ILE A 1 25  ? 29.159  -1.593  6.843  1.00   10.37 ? 132  ILE A N   1 
ATOM   164  C CA  . ILE A 1 25  ? 28.571  -0.352  7.310  1.00   10.38 ? 132  ILE A CA  1 
ATOM   165  C C   . ILE A 1 25  ? 29.589  0.297   8.255  1.00   9.54  ? 132  ILE A C   1 
ATOM   166  O O   . ILE A 1 25  ? 30.043  -0.352  9.205  1.00   8.93  ? 132  ILE A O   1 
ATOM   167  C CB  . ILE A 1 25  ? 27.272  -0.595  8.121  1.00   10.24 ? 132  ILE A CB  1 
ATOM   168  C CG1 . ILE A 1 25  ? 26.262  -1.428  7.319  1.00   10.99 ? 132  ILE A CG1 1 
ATOM   169  C CG2 . ILE A 1 25  ? 26.700  0.715   8.531  1.00   11.72 ? 132  ILE A CG2 1 
ATOM   170  C CD1 . ILE A 1 25  ? 24.999  -1.682  8.052  1.00   12.76 ? 132  ILE A CD1 1 
ATOM   171  N N   . ASP A 1 26  ? 29.944  1.552   7.982  1.00   9.56  ? 133  ASP A N   1 
ATOM   172  C CA  . ASP A 1 26  ? 30.814  2.323   8.874  1.00   9.19  ? 133  ASP A CA  1 
ATOM   173  C C   . ASP A 1 26  ? 32.105  1.571   9.210  1.00   8.87  ? 133  ASP A C   1 
ATOM   174  O O   . ASP A 1 26  ? 32.585  1.599   10.343 1.00   8.41  ? 133  ASP A O   1 
ATOM   175  C CB  . ASP A 1 26  ? 30.070  2.642   10.164 1.00   9.84  ? 133  ASP A CB  1 
ATOM   176  C CG  . ASP A 1 26  ? 28.887  3.598   9.966  1.00   9.51  ? 133  ASP A CG  1 
ATOM   177  O OD1 . ASP A 1 26  ? 28.702  4.197   8.876  1.00   9.81  ? 133  ASP A OD1 1 
ATOM   178  O OD2 . ASP A 1 26  ? 28.106  3.860   10.920 1.00   12.54 ? 133  ASP A OD2 1 
ATOM   179  N N   . ASN A 1 27  ? 32.678  0.905   8.209  1.00   8.48  ? 134  ASN A N   1 
ATOM   180  C CA  . ASN A 1 27  ? 33.905  0.147   8.363  1.00   8.93  ? 134  ASN A CA  1 
ATOM   181  C C   . ASN A 1 27  ? 33.855  -1.009  9.370  1.00   8.89  ? 134  ASN A C   1 
ATOM   182  O O   . ASN A 1 27  ? 34.873  -1.470  9.878  1.00   9.78  ? 134  ASN A O   1 
ATOM   183  C CB  . ASN A 1 27  ? 35.097  1.097   8.575  1.00   9.14  ? 134  ASN A CB  1 
ATOM   184  C CG  . ASN A 1 27  ? 35.510  1.777   7.267  1.00   11.21 ? 134  ASN A CG  1 
ATOM   185  O OD1 . ASN A 1 27  ? 36.122  1.133   6.382  1.00   15.61 ? 134  ASN A OD1 1 
ATOM   186  N ND2 . ASN A 1 27  ? 35.136  3.030   7.104  1.00   10.32 ? 134  ASN A ND2 1 
ATOM   187  N N   . GLY A 1 28  ? 32.640  -1.474  9.653  1.00   8.86  ? 135  GLY A N   1 
ATOM   188  C CA  . GLY A 1 28  ? 32.446  -2.752  10.323 1.00   8.75  ? 135  GLY A CA  1 
ATOM   189  C C   . GLY A 1 28  ? 31.655  -3.653  9.387  1.00   8.58  ? 135  GLY A C   1 
ATOM   190  O O   . GLY A 1 28  ? 31.348  -3.280  8.249  1.00   9.69  ? 135  GLY A O   1 
ATOM   191  N N   . ILE A 1 29  ? 31.337  -4.838  9.894  1.00   8.11  ? 136  ILE A N   1 
ATOM   192  C CA  . ILE A 1 29  ? 30.544  -5.837  9.170  1.00   7.89  ? 136  ILE A CA  1 
ATOM   193  C C   . ILE A 1 29  ? 29.348  -6.189  10.036 1.00   7.75  ? 136  ILE A C   1 
ATOM   194  O O   . ILE A 1 29  ? 29.482  -6.430  11.256 1.00   8.51  ? 136  ILE A O   1 
ATOM   195  C CB  . ILE A 1 29  ? 31.388  -7.056  8.855  1.00   8.07  ? 136  ILE A CB  1 
ATOM   196  C CG1 . ILE A 1 29  ? 32.469  -6.733  7.802  1.00   8.70  ? 136  ILE A CG1 1 
ATOM   197  C CG2 . ILE A 1 29  ? 30.538  -8.221  8.394  1.00   7.45  ? 136  ILE A CG2 1 
ATOM   198  C CD1 . ILE A 1 29  ? 31.957  -6.387  6.409  1.00   11.21 ? 136  ILE A CD1 1 
ATOM   199  N N   . PHE A 1 30  ? 28.185  -6.193  9.388  1.00   7.81  ? 137  PHE A N   1 
ATOM   200  C CA  . PHE A 1 30  ? 26.906  -6.432  10.014 1.00   7.71  ? 137  PHE A CA  1 
ATOM   201  C C   . PHE A 1 30  ? 26.129  -7.531  9.302  1.00   7.69  ? 137  PHE A C   1 
ATOM   202  O O   . PHE A 1 30  ? 26.176  -7.693  8.081  1.00   8.08  ? 137  PHE A O   1 
ATOM   203  C CB  . PHE A 1 30  ? 26.079  -5.134  10.044 1.00   7.64  ? 137  PHE A CB  1 
ATOM   204  C CG  . PHE A 1 30  ? 26.661  -4.089  10.957 1.00   8.23  ? 137  PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 30  ? 27.771  -3.325  10.545 1.00   8.92  ? 137  PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 30  ? 26.148  -3.891  12.230 1.00   10.54 ? 137  PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 30  ? 28.335  -2.417  11.372 1.00   9.32  ? 137  PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 30  ? 26.712  -2.975  13.076 1.00   9.08  ? 137  PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 30  ? 27.812  -2.228  12.661 1.00   8.80  ? 137  PHE A CZ  1 
ATOM   210  N N   . VAL A 1 31  ? 25.360  -8.255  10.095 1.00   8.64  ? 138  VAL A N   1 
ATOM   211  C CA  . VAL A 1 31  ? 24.446  -9.255  9.602  1.00   9.90  ? 138  VAL A CA  1 
ATOM   212  C C   . VAL A 1 31  ? 23.302  -8.503  8.935  1.00   10.70 ? 138  VAL A C   1 
ATOM   213  O O   . VAL A 1 31  ? 22.685  -7.616  9.525  1.00   12.07 ? 138  VAL A O   1 
ATOM   214  C CB  . VAL A 1 31  ? 23.940  -10.144 10.795 1.00   9.48  ? 138  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 31  ? 22.794  -11.071 10.383 1.00   11.26 ? 138  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 31  ? 25.091  -10.912 11.400 1.00   9.08  ? 138  VAL A CG2 1 
ATOM   217  N N   . GLN A 1 32  ? 23.023  -8.853  7.697  1.00   11.19 ? 139  GLN A N   1 
ATOM   218  C CA  . GLN A 1 32  ? 22.027  -8.157  6.850  1.00   12.94 ? 139  GLN A CA  1 
ATOM   219  C C   . GLN A 1 32  ? 20.801  -9.027  6.477  1.00   13.14 ? 139  GLN A C   1 
ATOM   220  O O   . GLN A 1 32  ? 19.704  -8.508  6.215  1.00   13.72 ? 139  GLN A O   1 
ATOM   221  C CB  . GLN A 1 32  ? 22.741  -7.673  5.578  1.00   14.17 ? 139  GLN A CB  1 
ATOM   222  C CG  . GLN A 1 32  ? 21.902  -6.985  4.514  1.00   17.83 ? 139  GLN A CG  1 
ATOM   223  C CD  . GLN A 1 32  ? 21.326  -5.666  4.961  1.00   20.52 ? 139  GLN A CD  1 
ATOM   224  O OE1 . GLN A 1 32  ? 21.782  -5.062  5.957  1.00   22.82 ? 139  GLN A OE1 1 
ATOM   225  N NE2 . GLN A 1 32  ? 20.288  -5.198  4.226  1.00   23.91 ? 139  GLN A NE2 1 
ATOM   226  N N   . LEU A 1 33  ? 20.972  -10.336 6.465  1.00   11.93 ? 140  LEU A N   1 
ATOM   227  C CA  . LEU A 1 33  ? 19.826  -11.249 6.234  1.00   11.71 ? 140  LEU A CA  1 
ATOM   228  C C   . LEU A 1 33  ? 20.180  -12.595 6.770  1.00   10.82 ? 140  LEU A C   1 
ATOM   229  O O   . LEU A 1 33  ? 21.249  -13.137 6.445  1.00   11.96 ? 140  LEU A O   1 
ATOM   230  C CB  . LEU A 1 33  ? 19.501  -11.393 4.743  1.00   13.10 ? 140  LEU A CB  1 
ATOM   231  C CG  . LEU A 1 33  ? 18.305  -12.244 4.402  1.00   13.86 ? 140  LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 33  ? 17.065  -11.695 5.105  1.00   14.03 ? 140  LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 33  ? 18.108  -12.284 2.881  1.00   15.86 ? 140  LEU A CD2 1 
ATOM   234  N N   . VAL A 1 34  ? 19.315  -13.142 7.615  1.00   9.06  ? 141  VAL A N   1 
ATOM   235  C CA  . VAL A 1 34  ? 19.523  -14.459 8.204  1.00   8.86  ? 141  VAL A CA  1 
ATOM   236  C C   . VAL A 1 34  ? 18.396  -15.380 7.699  1.00   8.69  ? 141  VAL A C   1 
ATOM   237  O O   . VAL A 1 34  ? 17.240  -15.128 7.977  1.00   9.31  ? 141  VAL A O   1 
ATOM   238  C CB  . VAL A 1 34  ? 19.493  -14.440 9.759  1.00   7.91  ? 141  VAL A CB  1 
ATOM   239  C CG1 . VAL A 1 34  ? 19.640  -15.834 10.314 1.00   8.40  ? 141  VAL A CG1 1 
ATOM   240  C CG2 . VAL A 1 34  ? 20.587  -13.543 10.302 1.00   9.17  ? 141  VAL A CG2 1 
ATOM   241  N N   . GLN A 1 35  ? 18.751  -16.408 6.938  1.00   8.63  ? 142  GLN A N   1 
ATOM   242  C CA  . GLN A 1 35  ? 17.786  -17.354 6.420  1.00   10.22 ? 142  GLN A CA  1 
ATOM   243  C C   . GLN A 1 35  ? 17.104  -18.147 7.552  1.00   9.26  ? 142  GLN A C   1 
ATOM   244  O O   . GLN A 1 35  ? 17.720  -18.472 8.590  1.00   8.60  ? 142  GLN A O   1 
ATOM   245  C CB  . GLN A 1 35  ? 18.477  -18.322 5.479  1.00   11.27 ? 142  GLN A CB  1 
ATOM   246  C CG  . GLN A 1 35  ? 19.032  -17.703 4.187  1.00   15.15 ? 142  GLN A CG  1 
ATOM   247  C CD  . GLN A 1 35  ? 17.961  -17.000 3.356  1.00   18.47 ? 142  GLN A CD  1 
ATOM   248  O OE1 . GLN A 1 35  ? 16.986  -17.629 2.926  1.00   22.09 ? 142  GLN A OE1 1 
ATOM   249  N NE2 . GLN A 1 35  ? 18.146  -15.716 3.117  1.00   17.80 ? 142  GLN A NE2 1 
ATOM   250  N N   . ALA A 1 36  ? 15.834  -18.488 7.332  1.00   9.75  ? 143  ALA A N   1 
ATOM   251  C CA  . ALA A 1 36  ? 15.106  -19.313 8.290  1.00   9.73  ? 143  ALA A CA  1 
ATOM   252  C C   . ALA A 1 36  ? 15.738  -20.683 8.405  1.00   8.94  ? 143  ALA A C   1 
ATOM   253  O O   . ALA A 1 36  ? 16.203  -21.241 7.430  1.00   8.59  ? 143  ALA A O   1 
ATOM   254  C CB  . ALA A 1 36  ? 13.639  -19.429 7.909  1.00   11.10 ? 143  ALA A CB  1 
ATOM   255  N N   . ASN A 1 37  ? 15.766  -21.220 9.619  1.00   8.62  ? 144  ASN A N   1 
ATOM   256  C CA  . ASN A 1 37  ? 16.185  -22.594 9.891  1.00   9.27  ? 144  ASN A CA  1 
ATOM   257  C C   . ASN A 1 37  ? 17.530  -22.937 9.292  1.00   9.72  ? 144  ASN A C   1 
ATOM   258  O O   . ASN A 1 37  ? 17.697  -23.952 8.593  1.00   9.39  ? 144  ASN A O   1 
ATOM   259  C CB  . ASN A 1 37  ? 15.105  -23.571 9.474  1.00   9.83  ? 144  ASN A CB  1 
ATOM   260  C CG  . ASN A 1 37  ? 13.849  -23.357 10.237 1.00   10.20 ? 144  ASN A CG  1 
ATOM   261  O OD1 . ASN A 1 37  ? 13.886  -23.285 11.463 1.00   9.05  ? 144  ASN A OD1 1 
ATOM   262  N ND2 . ASN A 1 37  ? 12.743  -23.202 9.542  1.00   11.52 ? 144  ASN A ND2 1 
ATOM   263  N N   . SER A 1 38  ? 18.452  -21.997 9.506  1.00   9.71  ? 145  SER A N   1 
ATOM   264  C CA  . SER A 1 38  ? 19.773  -22.012 8.895  1.00   9.41  ? 145  SER A CA  1 
ATOM   265  C C   . SER A 1 38  ? 20.868  -22.199 9.934  1.00   9.61  ? 145  SER A C   1 
ATOM   266  O O   . SER A 1 38  ? 20.636  -22.027 11.126 1.00   8.94  ? 145  SER A O   1 
ATOM   267  C CB  . SER A 1 38  ? 20.016  -20.687 8.136  1.00   9.29  ? 145  SER A CB  1 
ATOM   268  O OG  . SER A 1 38  ? 20.024  -19.573 9.022  1.00   8.79  ? 145  SER A OG  1 
ATOM   269  N N   . PRO A 1 39  ? 22.086  -22.518 9.507  1.00   9.13  ? 146  PRO A N   1 
ATOM   270  C CA  . PRO A 1 39  ? 23.201  -22.517 10.457 1.00   9.54  ? 146  PRO A CA  1 
ATOM   271  C C   . PRO A 1 39  ? 23.340  -21.204 11.232 1.00   9.01  ? 146  PRO A C   1 
ATOM   272  O O   . PRO A 1 39  ? 23.618  -21.217 12.429 1.00   9.17  ? 146  PRO A O   1 
ATOM   273  C CB  . PRO A 1 39  ? 24.415  -22.832 9.594  1.00   9.59  ? 146  PRO A CB  1 
ATOM   274  C CG  . PRO A 1 39  ? 23.828  -23.624 8.461  1.00   10.12 ? 146  PRO A CG  1 
ATOM   275  C CD  . PRO A 1 39  ? 22.471  -23.025 8.171  1.00   10.33 ? 146  PRO A CD  1 
ATOM   276  N N   . ALA A 1 40  ? 23.093  -20.088 10.568 1.00   8.65  ? 147  ALA A N   1 
ATOM   277  C CA  . ALA A 1 40  ? 23.135  -18.774 11.202 1.00   8.78  ? 147  ALA A CA  1 
ATOM   278  C C   . ALA A 1 40  ? 22.004  -18.538 12.189 1.00   8.50  ? 147  ALA A C   1 
ATOM   279  O O   . ALA A 1 40  ? 22.230  -18.036 13.299 1.00   8.54  ? 147  ALA A O   1 
ATOM   280  C CB  . ALA A 1 40  ? 23.115  -17.695 10.127 1.00   8.52  ? 147  ALA A CB  1 
ATOM   281  N N   . SER A 1 41  ? 20.777  -18.922 11.840 1.00   8.02  ? 148  SER A N   1 
ATOM   282  C CA  . SER A 1 41  ? 19.678  -18.764 12.795 1.00   7.67  ? 148  SER A CA  1 
ATOM   283  C C   . SER A 1 41  ? 19.854  -19.714 14.011 1.00   8.55  ? 148  SER A C   1 
ATOM   284  O O   . SER A 1 41  ? 19.452  -19.387 15.118 1.00   8.96  ? 148  SER A O   1 
ATOM   285  C CB  . SER A 1 41  ? 18.291  -18.927 12.136 1.00   7.97  ? 148  SER A CB  1 
ATOM   286  O OG  . SER A 1 41  ? 17.980  -20.267 11.802 1.00   7.79  ? 148  SER A OG  1 
ATOM   287  N N   . LEU A 1 42  ? 20.467  -20.871 13.795 1.00   8.91  ? 149  LEU A N   1 
ATOM   288  C CA  . LEU A 1 42  ? 20.652  -21.835 14.885 1.00   9.79  ? 149  LEU A CA  1 
ATOM   289  C C   . LEU A 1 42  ? 21.455  -21.220 16.042 1.00   10.41 ? 149  LEU A C   1 
ATOM   290  O O   . LEU A 1 42  ? 21.140  -21.457 17.213 1.00   11.02 ? 149  LEU A O   1 
ATOM   291  C CB  . LEU A 1 42  ? 21.341  -23.104 14.379 1.00   9.97  ? 149  LEU A CB  1 
ATOM   292  C CG  . LEU A 1 42  ? 21.518  -24.250 15.389 1.00   10.04 ? 149  LEU A CG  1 
ATOM   293  C CD1 . LEU A 1 42  ? 20.208  -24.834 15.880 1.00   11.47 ? 149  LEU A CD1 1 
ATOM   294  C CD2 . LEU A 1 42  ? 22.368  -25.316 14.817 1.00   10.75 ? 149  LEU A CD2 1 
ATOM   295  N N   . VAL A 1 43  ? 22.486  -20.448 15.704 1.00   10.09 ? 150  VAL A N   1 
ATOM   296  C CA  . VAL A 1 43  ? 23.330  -19.800 16.708 1.00   9.80  ? 150  VAL A CA  1 
ATOM   297  C C   . VAL A 1 43  ? 22.819  -18.420 17.163 1.00   10.08 ? 150  VAL A C   1 
ATOM   298  O O   . VAL A 1 43  ? 23.472  -17.744 17.962 1.00   11.27 ? 150  VAL A O   1 
ATOM   299  C CB  . VAL A 1 43  ? 24.818  -19.709 16.268 1.00   9.69  ? 150  VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 43  ? 25.398  -21.086 15.863 1.00   10.45 ? 150  VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 43  ? 25.011  -18.674 15.162 1.00   9.97  ? 150  VAL A CG2 1 
ATOM   302  N N   . GLY A 1 44  ? 21.662  -18.001 16.646 1.00   9.88  ? 151  GLY A N   1 
ATOM   303  C CA  . GLY A 1 44  ? 20.925  -16.849 17.150 1.00   9.58  ? 151  GLY A CA  1 
ATOM   304  C C   . GLY A 1 44  ? 21.315  -15.534 16.501 1.00   9.04  ? 151  GLY A C   1 
ATOM   305  O O   . GLY A 1 44  ? 21.007  -14.465 17.024 1.00   9.40  ? 151  GLY A O   1 
ATOM   306  N N   . LEU A 1 45  ? 21.998  -15.594 15.366 1.00   8.26  ? 152  LEU A N   1 
ATOM   307  C CA  . LEU A 1 45  ? 22.309  -14.382 14.599 1.00   8.04  ? 152  LEU A CA  1 
ATOM   308  C C   . LEU A 1 45  ? 21.036  -13.696 14.140 1.00   8.81  ? 152  LEU A C   1 
ATOM   309  O O   . LEU A 1 45  ? 20.056  -14.348 13.719 1.00   8.18  ? 152  LEU A O   1 
ATOM   310  C CB  . LEU A 1 45  ? 23.267  -14.663 13.417 1.00   8.35  ? 152  LEU A CB  1 
ATOM   311  C CG  . LEU A 1 45  ? 24.681  -15.181 13.720 1.00   9.11  ? 152  LEU A CG  1 
ATOM   312  C CD1 . LEU A 1 45  ? 25.456  -15.310 12.452 1.00   9.67  ? 152  LEU A CD1 1 
ATOM   313  C CD2 . LEU A 1 45  ? 25.390  -14.293 14.732 1.00   11.80 ? 152  LEU A CD2 1 
ATOM   314  N N   . ARG A 1 46  ? 21.065  -12.353 14.207 1.00   8.44  ? 153  ARG A N   1 
ATOM   315  C CA  . ARG A 1 46  ? 19.956  -11.508 13.793 1.00   9.15  ? 153  ARG A CA  1 
ATOM   316  C C   . ARG A 1 46  ? 20.446  -10.323 12.976 1.00   8.42  ? 153  ARG A C   1 
ATOM   317  O O   . ARG A 1 46  ? 21.554  -9.818  13.156 1.00   8.53  ? 153  ARG A O   1 
ATOM   318  C CB  . ARG A 1 46  ? 19.208  -10.971 15.024 1.00   9.51  ? 153  ARG A CB  1 
ATOM   319  C CG  . ARG A 1 46  ? 18.498  -12.010 15.837 1.00   11.93 ? 153  ARG A CG  1 
ATOM   320  C CD  . ARG A 1 46  ? 17.691  -11.404 16.955 1.00   15.42 ? 153  ARG A CD  1 
ATOM   321  N NE  . ARG A 1 46  ? 18.552  -11.032 18.056 1.00   17.79 ? 153  ARG A NE  1 
ATOM   322  C CZ  . ARG A 1 46  ? 18.099  -10.617 19.236 1.00   22.23 ? 153  ARG A CZ  1 
ATOM   323  N NH1 . ARG A 1 46  ? 16.787  -10.518 19.471 1.00   24.92 ? 153  ARG A NH1 1 
ATOM   324  N NH2 . ARG A 1 46  ? 18.957  -10.300 20.186 1.00   23.01 ? 153  ARG A NH2 1 
ATOM   325  N N   . PHE A 1 47  ? 19.548  -9.829  12.133 1.00   7.81  ? 154  PHE A N   1 
ATOM   326  C CA  . PHE A 1 47  ? 19.739  -8.583  11.429 1.00   8.02  ? 154  PHE A CA  1 
ATOM   327  C C   . PHE A 1 47  ? 20.231  -7.501  12.400 1.00   7.49  ? 154  PHE A C   1 
ATOM   328  O O   . PHE A 1 47  ? 19.648  -7.295  13.485 1.00   7.43  ? 154  PHE A O   1 
ATOM   329  C CB  . PHE A 1 47  ? 18.417  -8.130  10.779 1.00   7.60  ? 154  PHE A CB  1 
ATOM   330  C CG  . PHE A 1 47  ? 18.532  -6.817  10.037 1.00   7.72  ? 154  PHE A CG  1 
ATOM   331  C CD1 . PHE A 1 47  ? 18.786  -6.792  8.670  1.00   10.24 ? 154  PHE A CD1 1 
ATOM   332  C CD2 . PHE A 1 47  ? 18.406  -5.612  10.712 1.00   9.16  ? 154  PHE A CD2 1 
ATOM   333  C CE1 . PHE A 1 47  ? 18.922  -5.583  8.005  1.00   10.85 ? 154  PHE A CE1 1 
ATOM   334  C CE2 . PHE A 1 47  ? 18.512  -4.401  10.050 1.00   10.72 ? 154  PHE A CE2 1 
ATOM   335  C CZ  . PHE A 1 47  ? 18.773  -4.395  8.696  1.00   11.41 ? 154  PHE A CZ  1 
ATOM   336  N N   . GLY A 1 48  ? 21.331  -6.860  12.018 1.00   8.13  ? 155  GLY A N   1 
ATOM   337  C CA  . GLY A 1 48  ? 21.952  -5.818  12.794 1.00   8.10  ? 155  GLY A CA  1 
ATOM   338  C C   . GLY A 1 48  ? 23.037  -6.198  13.774 1.00   7.94  ? 155  GLY A C   1 
ATOM   339  O O   . GLY A 1 48  ? 23.675  -5.303  14.340 1.00   8.36  ? 155  GLY A O   1 
ATOM   340  N N   . ASP A 1 49  ? 23.265  -7.490  13.989 1.00   7.23  ? 156  ASP A N   1 
ATOM   341  C CA  . ASP A 1 49  ? 24.410  -7.948  14.760 1.00   7.82  ? 156  ASP A CA  1 
ATOM   342  C C   . ASP A 1 49  ? 25.693  -7.515  14.078 1.00   7.90  ? 156  ASP A C   1 
ATOM   343  O O   . ASP A 1 49  ? 25.793  -7.500  12.834 1.00   7.54  ? 156  ASP A O   1 
ATOM   344  C CB  . ASP A 1 49  ? 24.432  -9.459  14.869 1.00   7.62  ? 156  ASP A CB  1 
ATOM   345  C CG  . ASP A 1 49  ? 23.439  -10.010 15.859 1.00   8.87  ? 156  ASP A CG  1 
ATOM   346  O OD1 . ASP A 1 49  ? 22.868  -9.265  16.723 1.00   8.96  ? 156  ASP A OD1 1 
ATOM   347  O OD2 . ASP A 1 49  ? 23.163  -11.237 15.784 1.00   10.21 ? 156  ASP A OD2 1 
ATOM   348  N N   . GLN A 1 50  ? 26.663  -7.099  14.878 1.00   7.90  ? 157  GLN A N   1 
ATOM   349  C CA  . GLN A 1 50  ? 27.957  -6.707  14.337 1.00   7.72  ? 157  GLN A CA  1 
ATOM   350  C C   . GLN A 1 50  ? 28.948  -7.855  14.468 1.00   8.34  ? 157  GLN A C   1 
ATOM   351  O O   . GLN A 1 50  ? 29.046  -8.470  15.517 1.00   8.58  ? 157  GLN A O   1 
ATOM   352  C CB  . GLN A 1 50  ? 28.487  -5.464  15.055 1.00   8.69  ? 157  GLN A CB  1 
ATOM   353  C CG  . GLN A 1 50  ? 29.737  -4.896  14.374 1.00   8.68  ? 157  GLN A CG  1 
ATOM   354  C CD  . GLN A 1 50  ? 30.326  -3.708  15.122 1.00   9.93  ? 157  GLN A CD  1 
ATOM   355  O OE1 . GLN A 1 50  ? 29.650  -3.128  15.961 1.00   11.13 ? 157  GLN A OE1 1 
ATOM   356  N NE2 . GLN A 1 50  ? 31.599  -3.342  14.816 1.00   8.07  ? 157  GLN A NE2 1 
ATOM   357  N N   . VAL A 1 51  ? 29.666  -8.158  13.390 1.00   8.81  ? 158  VAL A N   1 
ATOM   358  C CA  . VAL A 1 51  ? 30.639  -9.249  13.386 1.00   9.19  ? 158  VAL A CA  1 
ATOM   359  C C   . VAL A 1 51  ? 32.039  -8.636  13.556 1.00   9.21  ? 158  VAL A C   1 
ATOM   360  O O   . VAL A 1 51  ? 32.505  -7.942  12.676 1.00   9.34  ? 158  VAL A O   1 
ATOM   361  C CB  . VAL A 1 51  ? 30.578  -10.040 12.090 1.00   9.42  ? 158  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 51  ? 31.469  -11.254 12.179 1.00   11.03 ? 158  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 51  ? 29.152  -10.448 11.755 1.00   8.48  ? 158  VAL A CG2 1 
ATOM   364  N N   . LEU A 1 52  ? 32.664  -8.852  14.710 1.00   9.09  ? 159  LEU A N   1 
ATOM   365  C CA  . LEU A 1 52  ? 33.945  -8.230  15.002 1.00   10.00 ? 159  LEU A CA  1 
ATOM   366  C C   . LEU A 1 52  ? 35.093  -9.023  14.390 1.00   9.73  ? 159  LEU A C   1 
ATOM   367  O O   . LEU A 1 52  ? 36.068  -8.439  13.897 1.00   9.01  ? 159  LEU A O   1 
ATOM   368  C CB  . LEU A 1 52  ? 34.146  -8.098  16.515 1.00   11.03 ? 159  LEU A CB  1 
ATOM   369  C CG  . LEU A 1 52  ? 33.132  -7.301  17.327 1.00   13.88 ? 159  LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 52  ? 33.670  -7.086  18.780 1.00   15.02 ? 159  LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 52  ? 32.777  -6.019  16.664 1.00   16.31 ? 159  LEU A CD2 1 
ATOM   372  N N   . GLN A 1 53  ? 34.973  -10.347 14.439 1.00   9.85  ? 160  GLN A N   1 
ATOM   373  C CA  . GLN A 1 53  ? 35.980  -11.260 13.881 1.00   10.03 ? 160  GLN A CA  1 
ATOM   374  C C   . GLN A 1 53  ? 35.290  -12.457 13.217 1.00   10.57 ? 160  GLN A C   1 
ATOM   375  O O   . GLN A 1 53  ? 34.232  -12.935 13.683 1.00   11.12 ? 160  GLN A O   1 
ATOM   376  C CB  . GLN A 1 53  ? 36.946  -11.788 14.960 1.00   10.23 ? 160  GLN A CB  1 
ATOM   377  C CG  . GLN A 1 53  ? 38.018  -10.775 15.412 1.00   11.41 ? 160  GLN A CG  1 
ATOM   378  C CD  . GLN A 1 53  ? 37.543  -9.864  16.541 1.00   12.73 ? 160  GLN A CD  1 
ATOM   379  O OE1 . GLN A 1 53  ? 36.701  -10.261 17.358 1.00   12.90 ? 160  GLN A OE1 1 
ATOM   380  N NE2 . GLN A 1 53  ? 38.074  -8.624  16.582 1.00   11.94 ? 160  GLN A NE2 1 
ATOM   381  N N   . ILE A 1 54  ? 35.918  -12.948 12.163 1.00   11.43 ? 161  ILE A N   1 
ATOM   382  C CA  . ILE A 1 54  ? 35.587  -14.246 11.568 1.00   11.84 ? 161  ILE A CA  1 
ATOM   383  C C   . ILE A 1 54  ? 36.838  -15.111 11.611 1.00   12.83 ? 161  ILE A C   1 
ATOM   384  O O   . ILE A 1 54  ? 37.863  -14.702 11.082 1.00   12.63 ? 161  ILE A O   1 
ATOM   385  C CB  . ILE A 1 54  ? 35.077  -14.107 10.146 1.00   11.61 ? 161  ILE A CB  1 
ATOM   386  C CG1 . ILE A 1 54  ? 33.725  -13.390 10.149 1.00   10.72 ? 161  ILE A CG1 1 
ATOM   387  C CG2 . ILE A 1 54  ? 34.929  -15.509 9.499  1.00   11.14 ? 161  ILE A CG2 1 
ATOM   388  C CD1 . ILE A 1 54  ? 33.242  -13.001 8.809  1.00   11.70 ? 161  ILE A CD1 1 
ATOM   389  N N   . ASN A 1 55  ? 36.732  -16.273 12.251 1.00   14.10 ? 162  ASN A N   1 
ATOM   390  C CA  . ASN A 1 55  ? 37.885  -17.164 12.514 1.00   15.35 ? 162  ASN A CA  1 
ATOM   391  C C   . ASN A 1 55  ? 39.089  -16.386 13.069 1.00   16.59 ? 162  ASN A C   1 
ATOM   392  O O   . ASN A 1 55  ? 40.222  -16.537 12.601 1.00   17.22 ? 162  ASN A O   1 
ATOM   393  C CB  . ASN A 1 55  ? 38.270  -17.898 11.240 1.00   16.16 ? 162  ASN A CB  1 
ATOM   394  C CG  . ASN A 1 55  ? 37.254  -18.955 10.846 1.00   16.61 ? 162  ASN A CG  1 
ATOM   395  O OD1 . ASN A 1 55  ? 36.625  -19.574 11.720 1.00   17.53 ? 162  ASN A OD1 1 
ATOM   396  N ND2 . ASN A 1 55  ? 37.073  -19.153 9.525  1.00   15.32 ? 162  ASN A ND2 1 
ATOM   397  N N   . GLY A 1 56  ? 38.814  -15.527 14.039 1.00   17.36 ? 163  GLY A N   1 
ATOM   398  C CA  . GLY A 1 56  ? 39.836  -14.712 14.693 1.00   17.60 ? 163  GLY A CA  1 
ATOM   399  C C   . GLY A 1 56  ? 40.416  -13.546 13.923 1.00   17.72 ? 163  GLY A C   1 
ATOM   400  O O   . GLY A 1 56  ? 41.287  -12.831 14.474 1.00   19.27 ? 163  GLY A O   1 
ATOM   401  N N   . GLU A 1 57  ? 39.999  -13.353 12.676 1.00   16.44 ? 164  GLU A N   1 
ATOM   402  C CA  . GLU A 1 57  ? 40.466  -12.263 11.817 1.00   16.34 ? 164  GLU A CA  1 
ATOM   403  C C   . GLU A 1 57  ? 39.567  -11.047 12.008 1.00   14.52 ? 164  GLU A C   1 
ATOM   404  O O   . GLU A 1 57  ? 38.359  -11.164 11.846 1.00   12.40 ? 164  GLU A O   1 
ATOM   405  C CB  . GLU A 1 57  ? 40.349  -12.637 10.341 1.00   17.15 ? 164  GLU A CB  1 
ATOM   406  C CG  . GLU A 1 57  ? 41.581  -13.149 9.641  1.00   22.25 ? 164  GLU A CG  1 
ATOM   407  C CD  . GLU A 1 57  ? 41.453  -13.022 8.120  1.00   26.87 ? 164  GLU A CD  1 
ATOM   408  O OE1 . GLU A 1 57  ? 40.695  -13.810 7.510  1.00   28.35 ? 164  GLU A OE1 1 
ATOM   409  O OE2 . GLU A 1 57  ? 42.104  -12.122 7.525  1.00   29.45 ? 164  GLU A OE2 1 
ATOM   410  N N   . ASN A 1 58  ? 40.153  -9.869  12.218 1.00   13.52 ? 165  ASN A N   1 
ATOM   411  C CA  . ASN A 1 58  ? 39.346  -8.648  12.342 1.00   12.81 ? 165  ASN A CA  1 
ATOM   412  C C   . ASN A 1 58  ? 38.589  -8.337  11.063 1.00   12.42 ? 165  ASN A C   1 
ATOM   413  O O   . ASN A 1 58  ? 39.178  -8.360  9.954  1.00   12.96 ? 165  ASN A O   1 
ATOM   414  C CB  . ASN A 1 58  ? 40.215  -7.435  12.663 1.00   12.62 ? 165  ASN A CB  1 
ATOM   415  C CG  . ASN A 1 58  ? 40.920  -7.518  14.018 1.00   13.78 ? 165  ASN A CG  1 
ATOM   416  O OD1 . ASN A 1 58  ? 40.424  -8.131  14.974 1.00   13.25 ? 165  ASN A OD1 1 
ATOM   417  N ND2 . ASN A 1 58  ? 42.104  -6.843  14.114 1.00   15.99 ? 165  ASN A ND2 1 
ATOM   418  N N   . CYS A 1 59  ? 37.301  -8.008  11.204 1.00   11.25 ? 166  CYS A N   1 
ATOM   419  C CA  . CYS A 1 59  ? 36.473  -7.607  10.070 1.00   10.50 ? 166  CYS A CA  1 
ATOM   420  C C   . CYS A 1 59  ? 36.591  -6.126  9.744  1.00   10.01 ? 166  CYS A C   1 
ATOM   421  O O   . CYS A 1 59  ? 36.063  -5.678  8.733  1.00   9.62  ? 166  CYS A O   1 
ATOM   422  C CB  . CYS A 1 59  ? 35.001  -7.919  10.353 1.00   10.67 ? 166  CYS A CB  1 
ATOM   423  S SG  . CYS A 1 59  ? 34.680  -9.672  10.546 1.00   11.94 ? 166  CYS A SG  1 
ATOM   424  N N   . ALA A 1 60  ? 37.277  -5.360  10.593 1.00   10.30 ? 167  ALA A N   1 
ATOM   425  C CA  . ALA A 1 60  ? 37.337  -3.915  10.398 1.00   10.77 ? 167  ALA A CA  1 
ATOM   426  C C   . ALA A 1 60  ? 37.783  -3.582  8.972  1.00   11.37 ? 167  ALA A C   1 
ATOM   427  O O   . ALA A 1 60  ? 38.813  -4.100  8.471  1.00   12.19 ? 167  ALA A O   1 
ATOM   428  C CB  . ALA A 1 60  ? 38.268  -3.262  11.418 1.00   11.14 ? 167  ALA A CB  1 
ATOM   429  N N   . GLY A 1 61  ? 36.989  -2.744  8.316  1.00   11.65 ? 168  GLY A N   1 
ATOM   430  C CA  . GLY A 1 61  ? 37.323  -2.235  6.993  1.00   12.24 ? 168  GLY A CA  1 
ATOM   431  C C   . GLY A 1 61  ? 37.032  -3.154  5.829  1.00   12.41 ? 168  GLY A C   1 
ATOM   432  O O   . GLY A 1 61  ? 37.183  -2.741  4.656  1.00   13.20 ? 168  GLY A O   1 
ATOM   433  N N   . TRP A 1 62  ? 36.557  -4.365  6.109  1.00   11.85 ? 169  TRP A N   1 
ATOM   434  C CA  . TRP A 1 62  ? 36.249  -5.323  5.036  1.00   12.87 ? 169  TRP A CA  1 
ATOM   435  C C   . TRP A 1 62  ? 35.045  -4.866  4.226  1.00   13.12 ? 169  TRP A C   1 
ATOM   436  O O   . TRP A 1 62  ? 34.050  -4.365  4.748  1.00   12.00 ? 169  TRP A O   1 
ATOM   437  C CB  . TRP A 1 62  ? 35.941  -6.742  5.568  1.00   13.09 ? 169  TRP A CB  1 
ATOM   438  C CG  . TRP A 1 62  ? 37.034  -7.488  6.097  1.00   13.66 ? 169  TRP A CG  1 
ATOM   439  C CD1 . TRP A 1 62  ? 38.327  -7.067  6.276  1.00   15.41 ? 169  TRP A CD1 1 
ATOM   440  C CD2 . TRP A 1 62  ? 36.981  -8.837  6.572  1.00   14.58 ? 169  TRP A CD2 1 
ATOM   441  N NE1 . TRP A 1 62  ? 39.067  -8.079  6.840  1.00   16.52 ? 169  TRP A NE1 1 
ATOM   442  C CE2 . TRP A 1 62  ? 38.269  -9.169  7.039  1.00   14.82 ? 169  TRP A CE2 1 
ATOM   443  C CE3 . TRP A 1 62  ? 35.969  -9.809  6.650  1.00   14.69 ? 169  TRP A CE3 1 
ATOM   444  C CZ2 . TRP A 1 62  ? 38.583  -10.439 7.577  1.00   15.89 ? 169  TRP A CZ2 1 
ATOM   445  C CZ3 . TRP A 1 62  ? 36.280  -11.069 7.203  1.00   16.34 ? 169  TRP A CZ3 1 
ATOM   446  C CH2 . TRP A 1 62  ? 37.572  -11.361 7.659  1.00   17.15 ? 169  TRP A CH2 1 
ATOM   447  N N   . SER A 1 63  ? 35.144  -5.027  2.914  1.00   13.97 ? 170  SER A N   1 
ATOM   448  C CA  . SER A 1 63  ? 34.003  -4.852  2.049  1.00   14.10 ? 170  SER A CA  1 
ATOM   449  C C   . SER A 1 63  ? 33.050  -6.010  2.219  1.00   14.49 ? 170  SER A C   1 
ATOM   450  O O   . SER A 1 63  ? 33.426  -7.051  2.751  1.00   13.39 ? 170  SER A O   1 
ATOM   451  C CB  . SER A 1 63  ? 34.460  -4.753  0.590  1.00   14.03 ? 170  SER A CB  1 
ATOM   452  O OG  . SER A 1 63  ? 34.924  -6.001  0.134  1.00   14.36 ? 170  SER A OG  1 
ATOM   453  N N   . SER A 1 64  ? 31.803  -5.810  1.794  1.00   15.38 ? 171  SER A N   1 
ATOM   454  C CA  . SER A 1 64  ? 30.791  -6.877  1.800  1.00   17.00 ? 171  SER A CA  1 
ATOM   455  C C   . SER A 1 64  ? 31.288  -8.062  0.951  1.00   17.65 ? 171  SER A C   1 
ATOM   456  O O   . SER A 1 64  ? 31.181  -9.201  1.351  1.00   18.47 ? 171  SER A O   1 
ATOM   457  C CB  . SER A 1 64  ? 29.457  -6.364  1.261  1.00   16.60 ? 171  SER A CB  1 
ATOM   458  O OG  . SER A 1 64  ? 28.965  -5.295  2.045  1.00   17.39 ? 171  SER A OG  1 
ATOM   459  N N   . ASP A 1 65  ? 31.924  -7.758  -0.168 1.00   18.69 ? 172  ASP A N   1 
ATOM   460  C CA  . ASP A 1 65  ? 32.488  -8.789  -1.038 1.00   19.15 ? 172  ASP A CA  1 
ATOM   461  C C   . ASP A 1 65  ? 33.558  -9.616  -0.346 1.00   18.70 ? 172  ASP A C   1 
ATOM   462  O O   . ASP A 1 65  ? 33.530  -10.852 -0.409 1.00   18.68 ? 172  ASP A O   1 
ATOM   463  C CB  . ASP A 1 65  ? 33.033  -8.151  -2.326 1.00   20.72 ? 172  ASP A CB  1 
ATOM   464  C CG  . ASP A 1 65  ? 33.536  -9.194  -3.326 1.00   23.91 ? 172  ASP A CG  1 
ATOM   465  O OD1 . ASP A 1 65  ? 32.736  -10.050 -3.721 1.00   26.05 ? 172  ASP A OD1 1 
ATOM   466  O OD2 . ASP A 1 65  ? 34.717  -9.250  -3.723 1.00   29.07 ? 172  ASP A OD2 1 
ATOM   467  N N   . LYS A 1 66  ? 34.494  -8.950  0.333  1.00   17.64 ? 173  LYS A N   1 
ATOM   468  C CA  . LYS A 1 66  ? 35.560  -9.639  1.022  1.00   17.78 ? 173  LYS A CA  1 
ATOM   469  C C   . LYS A 1 66  ? 34.953  -10.557 2.069  1.00   17.57 ? 173  LYS A C   1 
ATOM   470  O O   . LYS A 1 66  ? 35.365  -11.687 2.230  1.00   16.82 ? 173  LYS A O   1 
ATOM   471  C CB  . LYS A 1 66  ? 36.537  -8.657  1.679  1.00   17.99 ? 173  LYS A CB  1 
ATOM   472  C CG  . LYS A 1 66  ? 37.646  -9.358  2.496  1.00   20.10 ? 173  LYS A CG  1 
ATOM   473  C CD  . LYS A 1 66  ? 38.748  -8.413  2.881  1.00   22.57 ? 173  LYS A CD  1 
ATOM   474  C CE  . LYS A 1 66  ? 39.865  -9.099  3.636  1.00   25.26 ? 173  LYS A CE  1 
ATOM   475  N NZ  . LYS A 1 66  ? 41.032  -8.167  3.839  1.00   26.91 ? 173  LYS A NZ  1 
ATOM   476  N N   . ALA A 1 67  ? 33.974  -10.047 2.811  1.00   17.63 ? 174  ALA A N   1 
ATOM   477  C CA  . ALA A 1 67  ? 33.394  -10.837 3.890  1.00   17.91 ? 174  ALA A CA  1 
ATOM   478  C C   . ALA A 1 67  ? 32.763  -12.110 3.314  1.00   18.16 ? 174  ALA A C   1 
ATOM   479  O O   . ALA A 1 67  ? 32.976  -13.171 3.851  1.00   18.50 ? 174  ALA A O   1 
ATOM   480  C CB  . ALA A 1 67  ? 32.382  -10.021 4.638  1.00   18.03 ? 174  ALA A CB  1 
ATOM   481  N N   . HIS A 1 68  ? 32.031  -11.975 2.214  1.00   19.87 ? 175  HIS A N   1 
ATOM   482  C CA  . HIS A 1 68  ? 31.336  -13.090 1.514  1.00   21.74 ? 175  HIS A CA  1 
ATOM   483  C C   . HIS A 1 68  ? 32.375  -14.136 1.084  1.00   21.68 ? 175  HIS A C   1 
ATOM   484  O O   . HIS A 1 68  ? 32.201  -15.346 1.293  1.00   21.62 ? 175  HIS A O   1 
ATOM   485  C CB  . HIS A 1 68  ? 30.581  -12.479 0.302  1.00   23.36 ? 175  HIS A CB  1 
ATOM   486  C CG  . HIS A 1 68  ? 29.759  -13.441 -0.516 1.00   28.39 ? 175  HIS A CG  1 
ATOM   487  N ND1 . HIS A 1 68  ? 29.887  -13.543 -1.887 1.00   33.15 ? 175  HIS A ND1 1 
ATOM   488  C CD2 . HIS A 1 68  ? 28.742  -14.269 -0.177 1.00   32.89 ? 175  HIS A CD2 1 
ATOM   489  C CE1 . HIS A 1 68  ? 29.019  -14.428 -2.348 1.00   34.34 ? 175  HIS A CE1 1 
ATOM   490  N NE2 . HIS A 1 68  ? 28.317  -14.891 -1.328 1.00   34.78 ? 175  HIS A NE2 1 
ATOM   491  N N   . LYS A 1 69  ? 33.483  -13.659 0.529  1.00   21.81 ? 176  LYS A N   1 
ATOM   492  C CA  . LYS A 1 69  ? 34.560  -14.526 0.061  1.00   22.01 ? 176  LYS A CA  1 
ATOM   493  C C   . LYS A 1 69  ? 35.207  -15.267 1.230  1.00   21.45 ? 176  LYS A C   1 
ATOM   494  O O   . LYS A 1 69  ? 35.468  -16.455 1.139  1.00   21.49 ? 176  LYS A O   1 
ATOM   495  C CB  . LYS A 1 69  ? 35.609  -13.731 -0.745 1.00   22.33 ? 176  LYS A CB  1 
ATOM   496  C CG  . LYS A 1 69  ? 35.221  -13.449 -2.206 1.00   24.41 ? 176  LYS A CG  1 
ATOM   497  C CD  . LYS A 1 69  ? 36.303  -12.562 -2.890 1.00   25.96 ? 176  LYS A CD  1 
ATOM   498  C CE  . LYS A 1 69  ? 35.966  -12.072 -4.314 1.00   27.12 ? 176  LYS A CE  1 
ATOM   499  N NZ  . LYS A 1 69  ? 34.533  -12.126 -4.761 1.00   27.66 ? 176  LYS A NZ  1 
ATOM   500  N N   . VAL A 1 70  ? 35.424  -14.581 2.356  1.00   20.64 ? 177  VAL A N   1 
ATOM   501  C CA  . VAL A 1 70  ? 35.990  -15.224 3.519  1.00   21.21 ? 177  VAL A CA  1 
ATOM   502  C C   . VAL A 1 70  ? 35.113  -16.383 4.003  1.00   21.95 ? 177  VAL A C   1 
ATOM   503  O O   . VAL A 1 70  ? 35.620  -17.446 4.414  1.00   23.39 ? 177  VAL A O   1 
ATOM   504  C CB  . VAL A 1 70  ? 36.199  -14.211 4.677  1.00   21.10 ? 177  VAL A CB  1 
ATOM   505  C CG1 . VAL A 1 70  ? 36.535  -14.938 5.980  1.00   21.28 ? 177  VAL A CG1 1 
ATOM   506  C CG2 . VAL A 1 70  ? 37.299  -13.227 4.302  1.00   21.41 ? 177  VAL A CG2 1 
ATOM   507  N N   . LEU A 1 71  ? 33.806  -16.188 3.984  1.00   22.97 ? 178  LEU A N   1 
ATOM   508  C CA  . LEU A 1 71  ? 32.895  -17.246 4.425  1.00   24.14 ? 178  LEU A CA  1 
ATOM   509  C C   . LEU A 1 71  ? 32.968  -18.453 3.478  1.00   25.59 ? 178  LEU A C   1 
ATOM   510  O O   . LEU A 1 71  ? 32.929  -19.614 3.917  1.00   25.96 ? 178  LEU A O   1 
ATOM   511  C CB  . LEU A 1 71  ? 31.476  -16.725 4.482  1.00   24.36 ? 178  LEU A CB  1 
ATOM   512  C CG  . LEU A 1 71  ? 31.200  -15.676 5.561  1.00   23.62 ? 178  LEU A CG  1 
ATOM   513  C CD1 . LEU A 1 71  ? 29.776  -15.206 5.395  1.00   22.71 ? 178  LEU A CD1 1 
ATOM   514  C CD2 . LEU A 1 71  ? 31.474  -16.238 6.956  1.00   24.15 ? 178  LEU A CD2 1 
ATOM   515  N N   . LYS A 1 72  ? 33.064  -18.154 2.192  1.00   26.71 ? 179  LYS A N   1 
ATOM   516  C CA  . LYS A 1 72  ? 33.156  -19.170 1.153  1.00   28.62 ? 179  LYS A CA  1 
ATOM   517  C C   . LYS A 1 72  ? 34.479  -19.941 1.210  1.00   28.75 ? 179  LYS A C   1 
ATOM   518  O O   . LYS A 1 72  ? 34.509  -21.131 0.895  1.00   29.61 ? 179  LYS A O   1 
ATOM   519  C CB  . LYS A 1 72  ? 32.979  -18.513 -0.222 1.00   29.24 ? 179  LYS A CB  1 
ATOM   520  C CG  . LYS A 1 72  ? 31.537  -18.141 -0.537 1.00   32.12 ? 179  LYS A CG  1 
ATOM   521  C CD  . LYS A 1 72  ? 31.362  -17.664 -1.981 1.00   35.93 ? 179  LYS A CD  1 
ATOM   522  C CE  . LYS A 1 72  ? 31.302  -18.848 -2.963 1.00   37.72 ? 179  LYS A CE  1 
ATOM   523  N NZ  . LYS A 1 72  ? 32.082  -18.619 -4.207 1.00   39.40 ? 179  LYS A NZ  1 
ATOM   524  N N   . GLN A 1 73  ? 35.548  -19.272 1.632  1.00   29.09 ? 180  GLN A N   1 
ATOM   525  C CA  . GLN A 1 73  ? 36.905  -19.823 1.649  1.00   29.91 ? 180  GLN A CA  1 
ATOM   526  C C   . GLN A 1 73  ? 37.270  -20.501 2.968  1.00   30.29 ? 180  GLN A C   1 
ATOM   527  O O   . GLN A 1 73  ? 38.289  -21.174 3.042  1.00   30.93 ? 180  GLN A O   1 
ATOM   528  C CB  . GLN A 1 73  ? 37.948  -18.723 1.384  1.00   29.75 ? 180  GLN A CB  1 
ATOM   529  C CG  . GLN A 1 73  ? 37.902  -18.070 0.007  1.00   30.60 ? 180  GLN A CG  1 
ATOM   530  C CD  . GLN A 1 73  ? 38.919  -17.253 -0.384 0.0000 46.18 ? 180  GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 73  ? 40.119  -17.492 -0.262 0.0000 52.25 ? 180  GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 73  ? 38.679  -16.010 -0.782 0.0000 47.89 ? 180  GLN A NE2 1 
ATOM   533  N N   . ALA A 1 74  ? 36.433  -20.355 3.997  1.00   30.53 ? 181  ALA A N   1 
ATOM   534  C CA  . ALA A 1 74  ? 36.771  -20.845 5.329  1.00   30.40 ? 181  ALA A CA  1 
ATOM   535  C C   . ALA A 1 74  ? 37.045  -22.358 5.289  1.00   30.58 ? 181  ALA A C   1 
ATOM   536  O O   . ALA A 1 74  ? 36.265  -23.145 4.730  1.00   30.06 ? 181  ALA A O   1 
ATOM   537  C CB  . ALA A 1 74  ? 35.662  -20.512 6.320  1.00   30.45 ? 181  ALA A CB  1 
ATOM   538  N N   . PHE A 1 75  ? 38.182  -22.742 5.859  1.00   30.77 ? 182  PHE A N   1 
ATOM   539  C CA  . PHE A 1 75  ? 38.597  -24.142 5.868  1.00   30.29 ? 182  PHE A CA  1 
ATOM   540  C C   . PHE A 1 75  ? 37.672  -24.928 6.760  1.00   29.73 ? 182  PHE A C   1 
ATOM   541  O O   . PHE A 1 75  ? 37.309  -24.502 7.863  1.00   28.63 ? 182  PHE A O   1 
ATOM   542  C CB  . PHE A 1 75  ? 40.036  -24.292 6.349  1.00   30.66 ? 182  PHE A CB  1 
ATOM   543  C CG  . PHE A 1 75  ? 40.644  -25.555 6.384  0.0000 46.24 ? 182  PHE A CG  1 
ATOM   544  C CD1 . PHE A 1 75  ? 41.110  -26.097 5.200  0.0000 47.40 ? 182  PHE A CD1 1 
ATOM   545  C CD2 . PHE A 1 75  ? 40.705  -26.323 7.547  0.0000 49.29 ? 182  PHE A CD2 1 
ATOM   546  C CE1 . PHE A 1 75  ? 41.629  -27.377 5.166  0.0000 50.26 ? 182  PHE A CE1 1 
ATOM   547  C CE2 . PHE A 1 75  ? 41.223  -27.603 7.513  0.0000 48.93 ? 182  PHE A CE2 1 
ATOM   548  C CZ  . PHE A 1 75  ? 41.685  -28.130 6.323  0.0000 50.67 ? 182  PHE A CZ  1 
ATOM   549  N N   . GLY A 1 76  ? 37.250  -26.079 6.266  1.00   29.60 ? 183  GLY A N   1 
ATOM   550  C CA  . GLY A 1 76  ? 36.505  -26.999 7.094  1.00   29.12 ? 183  GLY A CA  1 
ATOM   551  C C   . GLY A 1 76  ? 35.027  -26.695 7.083  1.00   28.48 ? 183  GLY A C   1 
ATOM   552  O O   . GLY A 1 76  ? 34.515  -26.008 6.183  1.00   28.33 ? 183  GLY A O   1 
ATOM   553  N N   . GLU A 1 77  ? 34.341  -27.234 8.086  1.00   27.16 ? 184  GLU A N   1 
ATOM   554  C CA  . GLU A 1 77  ? 32.886  -27.199 8.122  1.00   26.76 ? 184  GLU A CA  1 
ATOM   555  C C   . GLU A 1 77  ? 32.379  -26.228 9.175  1.00   25.29 ? 184  GLU A C   1 
ATOM   556  O O   . GLU A 1 77  ? 31.205  -25.909 9.178  1.00   25.21 ? 184  GLU A O   1 
ATOM   557  C CB  . GLU A 1 77  ? 32.303  -28.594 8.400  1.00   27.21 ? 184  GLU A CB  1 
ATOM   558  C CG  . GLU A 1 77  ? 32.314  -29.578 7.231  1.00   29.71 ? 184  GLU A CG  1 
ATOM   559  C CD  . GLU A 1 77  ? 31.959  -28.957 5.881  1.00   32.45 ? 184  GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 77  ? 30.855  -28.381 5.734  1.00   34.27 ? 184  GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 77  ? 32.795  -29.047 4.949  1.00   33.65 ? 184  GLU A OE2 1 
ATOM   562  N N   . LYS A 1 78  ? 33.242  -25.769 10.072 1.00   24.28 ? 185  LYS A N   1 
ATOM   563  C CA  . LYS A 1 78  ? 32.796  -24.859 11.118 1.00   22.77 ? 185  LYS A CA  1 
ATOM   564  C C   . LYS A 1 78  ? 33.445  -23.492 10.913 1.00   21.82 ? 185  LYS A C   1 
ATOM   565  O O   . LYS A 1 78  ? 34.551  -23.381 10.369 1.00   22.88 ? 185  LYS A O   1 
ATOM   566  C CB  . LYS A 1 78  ? 33.002  -25.469 12.511 1.00   22.63 ? 185  LYS A CB  1 
ATOM   567  C CG  . LYS A 1 78  ? 32.149  -26.753 12.646 1.00   23.49 ? 185  LYS A CG  1 
ATOM   568  C CD  . LYS A 1 78  ? 32.267  -27.532 13.939 1.00   26.57 ? 185  LYS A CD  1 
ATOM   569  C CE  . LYS A 1 78  ? 31.380  -28.785 13.840 1.00   27.56 ? 185  LYS A CE  1 
ATOM   570  N NZ  . LYS A 1 78  ? 31.436  -29.617 15.073 1.00   29.64 ? 185  LYS A NZ  1 
ATOM   571  N N   . ILE A 1 79  ? 32.694  -22.452 11.257 1.00   19.34 ? 186  ILE A N   1 
ATOM   572  C CA  . ILE A 1 79  ? 33.164  -21.076 11.183 1.00   17.91 ? 186  ILE A CA  1 
ATOM   573  C C   . ILE A 1 79  ? 32.892  -20.430 12.501 1.00   16.43 ? 186  ILE A C   1 
ATOM   574  O O   . ILE A 1 79  ? 31.773  -20.487 12.997 1.00   15.16 ? 186  ILE A O   1 
ATOM   575  C CB  . ILE A 1 79  ? 32.403  -20.302 10.097 1.00   17.91 ? 186  ILE A CB  1 
ATOM   576  C CG1 . ILE A 1 79  ? 32.577  -20.980 8.739  1.00   18.38 ? 186  ILE A CG1 1 
ATOM   577  C CG2 . ILE A 1 79  ? 32.901  -18.846 10.048 1.00   18.15 ? 186  ILE A CG2 1 
ATOM   578  C CD1 . ILE A 1 79  ? 31.642  -20.512 7.683  1.00   17.32 ? 186  ILE A CD1 1 
ATOM   579  N N   . THR A 1 80  ? 33.905  -19.778 13.055 1.00   15.13 ? 187  THR A N   1 
ATOM   580  C CA  . THR A 1 80  ? 33.780  -19.086 14.311 1.00   14.64 ? 187  THR A CA  1 
ATOM   581  C C   . THR A 1 80  ? 33.612  -17.624 13.968 1.00   13.77 ? 187  THR A C   1 
ATOM   582  O O   . THR A 1 80  ? 34.251  -17.109 13.036 1.00   14.01 ? 187  THR A O   1 
ATOM   583  C CB  . THR A 1 80  ? 35.038  -19.271 15.174 1.00   14.43 ? 187  THR A CB  1 
ATOM   584  O OG1 . THR A 1 80  ? 35.260  -20.678 15.439 1.00   17.31 ? 187  THR A OG1 1 
ATOM   585  C CG2 . THR A 1 80  ? 34.834  -18.675 16.523 1.00   15.08 ? 187  THR A CG2 1 
ATOM   586  N N   . MET A 1 81  ? 32.740  -16.978 14.711 1.00   13.43 ? 188  MET A N   1 
ATOM   587  C CA  . MET A 1 81  ? 32.526  -15.537 14.613 1.00   13.46 ? 188  MET A CA  1 
ATOM   588  C C   . MET A 1 81  ? 32.450  -14.959 16.021 1.00   12.54 ? 188  MET A C   1 
ATOM   589  O O   . MET A 1 81  ? 31.945  -15.586 16.960 1.00   12.76 ? 188  MET A O   1 
ATOM   590  C CB  . MET A 1 81  ? 31.228  -15.234 13.855 1.00   13.95 ? 188  MET A CB  1 
ATOM   591  C CG  . MET A 1 81  ? 31.190  -15.727 12.441 1.00   15.99 ? 188  MET A CG  1 
ATOM   592  S SD  . MET A 1 81  ? 29.621  -15.369 11.630 1.00   17.68 ? 188  MET A SD  1 
ATOM   593  C CE  . MET A 1 81  ? 29.674  -13.942 11.269 1.00   20.21 ? 188  MET A CE  1 
ATOM   594  N N   . THR A 1 82  ? 32.954  -13.736 16.166 1.00   11.15 ? 189  THR A N   1 
ATOM   595  C CA  . THR A 1 82  ? 32.831  -12.977 17.375 1.00   11.47 ? 189  THR A CA  1 
ATOM   596  C C   . THR A 1 82  ? 31.838  -11.882 17.083 1.00   10.67 ? 189  THR A C   1 
ATOM   597  O O   . THR A 1 82  ? 32.056  -11.108 16.164 1.00   11.36 ? 189  THR A O   1 
ATOM   598  C CB  . THR A 1 82  ? 34.177  -12.378 17.716 1.00   11.90 ? 189  THR A CB  1 
ATOM   599  O OG1 . THR A 1 82  ? 35.140  -13.439 17.879 1.00   13.84 ? 189  THR A OG1 1 
ATOM   600  C CG2 . THR A 1 82  ? 34.094  -11.658 19.057 1.00   11.67 ? 189  THR A CG2 1 
ATOM   601  N N   . ILE A 1 83  ? 30.775  -11.823 17.876 1.00   10.12 ? 190  ILE A N   1 
ATOM   602  C CA  . ILE A 1 83  ? 29.573  -11.051 17.620 1.00   10.22 ? 190  ILE A CA  1 
ATOM   603  C C   . ILE A 1 83  ? 29.282  -10.073 18.743 1.00   10.34 ? 190  ILE A C   1 
ATOM   604  O O   . ILE A 1 83  ? 29.281  -10.436 19.925 1.00   10.93 ? 190  ILE A O   1 
ATOM   605  C CB  . ILE A 1 83  ? 28.325  -11.981 17.528 1.00   9.75  ? 190  ILE A CB  1 
ATOM   606  C CG1 . ILE A 1 83  ? 28.518  -13.051 16.456 1.00   10.83 ? 190  ILE A CG1 1 
ATOM   607  C CG2 . ILE A 1 83  ? 27.033  -11.131 17.263 1.00   11.21 ? 190  ILE A CG2 1 
ATOM   608  C CD1 . ILE A 1 83  ? 28.694  -12.511 15.063 1.00   12.05 ? 190  ILE A CD1 1 
ATOM   609  N N   . ARG A 1 84  ? 28.969  -8.855  18.347 1.00   10.42 ? 191  ARG A N   1 
ATOM   610  C CA  . ARG A 1 84  ? 28.414  -7.834  19.217 1.00   10.32 ? 191  ARG A CA  1 
ATOM   611  C C   . ARG A 1 84  ? 26.932  -7.782  18.861 1.00   10.28 ? 191  ARG A C   1 
ATOM   612  O O   . ARG A 1 84  ? 26.535  -7.365  17.749 1.00   8.99  ? 191  ARG A O   1 
ATOM   613  C CB  . ARG A 1 84  ? 29.144  -6.496  18.961 1.00   10.46 ? 191  ARG A CB  1 
ATOM   614  C CG  . ARG A 1 84  ? 28.499  -5.273  19.561 1.00   11.68 ? 191  ARG A CG  1 
ATOM   615  C CD  . ARG A 1 84  ? 29.279  -3.976  19.360 1.00   12.84 ? 191  ARG A CD  1 
ATOM   616  N NE  . ARG A 1 84  ? 30.619  -4.045  19.938 1.00   14.11 ? 191  ARG A NE  1 
ATOM   617  C CZ  . ARG A 1 84  ? 31.659  -3.346  19.482 1.00   16.34 ? 191  ARG A CZ  1 
ATOM   618  N NH1 . ARG A 1 84  ? 31.544  -2.528  18.436 1.00   18.18 ? 191  ARG A NH1 1 
ATOM   619  N NH2 . ARG A 1 84  ? 32.826  -3.490  20.076 1.00   17.01 ? 191  ARG A NH2 1 
ATOM   620  N N   . ASP A 1 85  ? 26.101  -8.226  19.795 1.00   11.01 ? 192  ASP A N   1 
ATOM   621  C CA  . ASP A 1 85  ? 24.666  -8.279  19.544 1.00   12.32 ? 192  ASP A CA  1 
ATOM   622  C C   . ASP A 1 85  ? 24.067  -6.883  19.235 1.00   13.18 ? 192  ASP A C   1 
ATOM   623  O O   . ASP A 1 85  ? 24.323  -5.915  19.961 1.00   13.72 ? 192  ASP A O   1 
ATOM   624  C CB  . ASP A 1 85  ? 23.935  -8.847  20.757 1.00   13.64 ? 192  ASP A CB  1 
ATOM   625  C CG  . ASP A 1 85  ? 24.077  -10.347 20.928 1.00   14.40 ? 192  ASP A CG  1 
ATOM   626  O OD1 . ASP A 1 85  ? 24.697  -11.068 20.119 1.00   13.00 ? 192  ASP A OD1 1 
ATOM   627  O OD2 . ASP A 1 85  ? 23.566  -10.909 21.934 1.00   18.15 ? 192  ASP A OD2 1 
ATOM   628  N N   . ARG A 1 86  ? 23.287  -6.814  18.155 1.00   13.43 ? 193  ARG A N   1 
ATOM   629  C CA  . ARG A 1 86  ? 22.545  -5.644  17.681 1.00   14.31 ? 193  ARG A CA  1 
ATOM   630  C C   . ARG A 1 86  ? 22.873  -4.331  18.367 1.00   13.90 ? 193  ARG A C   1 
ATOM   631  O O   . ARG A 1 86  ? 22.092  -3.858  19.203 1.00   15.36 ? 193  ARG A O   1 
ATOM   632  C CB  . ARG A 1 86  ? 21.032  -5.916  17.794 1.00   15.18 ? 193  ARG A CB  1 
ATOM   633  C CG  . ARG A 1 86  ? 20.599  -7.132  17.023 1.00   18.38 ? 193  ARG A CG  1 
ATOM   634  C CD  . ARG A 1 86  ? 19.106  -7.300  16.880 1.00   21.98 ? 193  ARG A CD  1 
ATOM   635  N NE  . ARG A 1 86  ? 18.423  -7.239  18.174 1.00   24.80 ? 193  ARG A NE  1 
ATOM   636  C CZ  . ARG A 1 86  ? 17.086  -7.249  18.319 1.00   29.30 ? 193  ARG A CZ  1 
ATOM   637  N NH1 . ARG A 1 86  ? 16.279  -7.329  17.254 1.00   30.38 ? 193  ARG A NH1 1 
ATOM   638  N NH2 . ARG A 1 86  ? 16.553  -7.167  19.531 1.00   30.38 ? 193  ARG A NH2 1 
ATOM   639  N N   . PRO A 1 87  ? 24.022  -3.736  18.067 1.00   12.84 ? 194  PRO A N   1 
ATOM   640  C CA  . PRO A 1 87  ? 24.423  -2.522  18.794 1.00   13.80 ? 194  PRO A CA  1 
ATOM   641  C C   . PRO A 1 87  ? 23.522  -1.288  18.583 1.00   14.61 ? 194  PRO A C   1 
ATOM   642  O O   . PRO A 1 87  ? 23.601  -0.384  19.434 1.00   15.22 ? 194  PRO A O   1 
ATOM   643  C CB  . PRO A 1 87  ? 25.854  -2.277  18.292 1.00   12.33 ? 194  PRO A CB  1 
ATOM   644  C CG  . PRO A 1 87  ? 25.928  -2.952  17.002 1.00   13.76 ? 194  PRO A CG  1 
ATOM   645  C CD  . PRO A 1 87  ? 25.070  -4.160  17.106 1.00   12.54 ? 194  PRO A CD  1 
ATOM   646  N N   . PHE A 1 88  ? 22.680  -1.278  17.538 1.00   15.76 ? 195  PHE A N   1 
ATOM   647  C CA  . PHE A 1 88  ? 21.824  -0.125  17.179 1.00   17.39 ? 195  PHE A CA  1 
ATOM   648  C C   . PHE A 1 88  ? 20.307  -0.339  17.374 1.00   17.84 ? 195  PHE A C   1 
ATOM   649  O O   . PHE A 1 88  ? 19.484  0.404   16.814 1.00   18.96 ? 195  PHE A O   1 
ATOM   650  C CB  . PHE A 1 88  ? 21.998  0.211   15.704 1.00   17.90 ? 195  PHE A CB  1 
ATOM   651  C CG  . PHE A 1 88  ? 23.393  0.490   15.305 1.00   19.84 ? 195  PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 88  ? 24.116  1.463   15.948 1.00   22.67 ? 195  PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 88  ? 23.964  -0.191  14.251 1.00   22.08 ? 195  PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 88  ? 25.450  1.727   15.562 1.00   23.86 ? 195  PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 88  ? 25.266  0.067   13.865 1.00   23.72 ? 195  PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 88  ? 26.001  1.028   14.522 1.00   22.98 ? 195  PHE A CZ  1 
ATOM   657  N N   . GLU A 1 89  ? 19.948  -1.328  18.160 1.00   17.92 ? 196  GLU A N   1 
ATOM   658  C CA  . GLU A 1 89  ? 18.538  -1.696  18.455 1.00   18.28 ? 196  GLU A CA  1 
ATOM   659  C C   . GLU A 1 89  ? 17.807  -0.634  19.319 1.00   16.50 ? 196  GLU A C   1 
ATOM   660  O O   . GLU A 1 89  ? 18.298  -0.239  20.361 1.00   17.14 ? 196  GLU A O   1 
ATOM   661  C CB  . GLU A 1 89  ? 18.622  -3.027  19.219 1.00   18.72 ? 196  GLU A CB  1 
ATOM   662  C CG  . GLU A 1 89  ? 17.366  -3.772  19.526 1.00   23.44 ? 196  GLU A CG  1 
ATOM   663  C CD  . GLU A 1 89  ? 16.740  -3.245  20.787 1.00   26.18 ? 196  GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 89  ? 17.276  -3.471  21.913 1.00   28.72 ? 196  GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 89  ? 15.750  -2.554  20.628 1.00   29.04 ? 196  GLU A OE2 1 
ATOM   666  N N   . ARG A 1 90  ? 16.605  -0.220  18.939 1.00   14.16 ? 197  ARG A N   1 
ATOM   667  C CA  . ARG A 1 90  ? 15.744  0.523   19.858 1.00   12.67 ? 197  ARG A CA  1 
ATOM   668  C C   . ARG A 1 90  ? 14.361  -0.121  19.788 1.00   11.57 ? 197  ARG A C   1 
ATOM   669  O O   . ARG A 1 90  ? 13.788  -0.204  18.719 1.00   11.34 ? 197  ARG A O   1 
ATOM   670  C CB  . ARG A 1 90  ? 15.701  2.001   19.451 1.00   12.65 ? 197  ARG A CB  1 
ATOM   671  C CG  . ARG A 1 90  ? 14.627  2.904   20.103 1.00   12.21 ? 197  ARG A CG  1 
ATOM   672  C CD  . ARG A 1 90  ? 14.520  2.843   21.619 1.00   12.64 ? 197  ARG A CD  1 
ATOM   673  N NE  . ARG A 1 90  ? 15.794  3.229   22.257 1.00   13.84 ? 197  ARG A NE  1 
ATOM   674  C CZ  . ARG A 1 90  ? 15.913  3.620   23.522 1.00   14.74 ? 197  ARG A CZ  1 
ATOM   675  N NH1 . ARG A 1 90  ? 14.869  3.686   24.329 1.00   13.77 ? 197  ARG A NH1 1 
ATOM   676  N NH2 . ARG A 1 90  ? 17.105  3.960   23.989 1.00   15.86 ? 197  ARG A NH2 1 
ATOM   677  N N   . THR A 1 91  ? 13.826  -0.553  20.921 1.00   10.11 ? 198  THR A N   1 
ATOM   678  C CA  . THR A 1 91  ? 12.511  -1.174  20.954 1.00   9.50  ? 198  THR A CA  1 
ATOM   679  C C   . THR A 1 91  ? 11.550  -0.228  21.654 1.00   9.02  ? 198  THR A C   1 
ATOM   680  O O   . THR A 1 91  ? 11.842  0.278   22.748 1.00   9.82  ? 198  THR A O   1 
ATOM   681  C CB  . THR A 1 91  ? 12.625  -2.515  21.700 1.00   10.61 ? 198  THR A CB  1 
ATOM   682  O OG1 . THR A 1 91  ? 13.537  -3.375  20.989 1.00   10.79 ? 198  THR A OG1 1 
ATOM   683  C CG2 . THR A 1 91  ? 11.284  -3.249  21.739 1.00   11.37 ? 198  THR A CG2 1 
ATOM   684  N N   . ILE A 1 92  ? 10.410  0.005   21.008 1.00   7.74  ? 199  ILE A N   1 
ATOM   685  C CA  . ILE A 1 92  ? 9.440   0.985   21.432 1.00   7.78  ? 199  ILE A CA  1 
ATOM   686  C C   . ILE A 1 92  ? 8.075   0.369   21.426 1.00   8.26  ? 199  ILE A C   1 
ATOM   687  O O   . ILE A 1 92  ? 7.626   -0.166  20.418 1.00   8.79  ? 199  ILE A O   1 
ATOM   688  C CB  . ILE A 1 92  ? 9.433   2.226   20.470 1.00   7.29  ? 199  ILE A CB  1 
ATOM   689  C CG1 . ILE A 1 92  ? 10.796  2.936   20.469 1.00   7.21  ? 199  ILE A CG1 1 
ATOM   690  C CG2 . ILE A 1 92  ? 8.291   3.186   20.865 1.00   8.63  ? 199  ILE A CG2 1 
ATOM   691  C CD1 . ILE A 1 92  ? 10.943  3.931   19.386 1.00   8.33  ? 199  ILE A CD1 1 
ATOM   692  N N   . THR A 1 93  ? 7.381   0.527   22.542 1.00   8.84  ? 200  THR A N   1 
ATOM   693  C CA  . THR A 1 93  ? 6.028   0.017   22.691 1.00   9.53  ? 200  THR A CA  1 
ATOM   694  C C   . THR A 1 93  ? 5.054   1.164   22.506 1.00   9.10  ? 200  THR A C   1 
ATOM   695  O O   . THR A 1 93  ? 5.116   2.164   23.224 1.00   9.27  ? 200  THR A O   1 
ATOM   696  C CB  . THR A 1 93  ? 5.877   -0.597  24.082 1.00   9.68  ? 200  THR A CB  1 
ATOM   697  O OG1 . THR A 1 93  ? 6.668   -1.788  24.163 1.00   9.90  ? 200  THR A OG1 1 
ATOM   698  C CG2 . THR A 1 93  ? 4.415   -0.988  24.376 1.00   9.68  ? 200  THR A CG2 1 
ATOM   699  N N   . MET A 1 94  ? 4.164   0.990   21.529 1.00   8.41  ? 201  MET A N   1 
ATOM   700  C CA  . MET A 1 94  ? 3.083   1.890   21.239 1.00   8.12  ? 201  MET A CA  1 
ATOM   701  C C   . MET A 1 94  ? 1.752   1.189   21.510 1.00   8.23  ? 201  MET A C   1 
ATOM   702  O O   . MET A 1 94  ? 1.703   -0.037  21.737 1.00   7.25  ? 201  MET A O   1 
ATOM   703  C CB  . MET A 1 94  ? 3.182   2.284   19.774 1.00   7.52  ? 201  MET A CB  1 
ATOM   704  C CG  . MET A 1 94  ? 4.334   3.245   19.446 1.00   7.82  ? 201  MET A CG  1 
ATOM   705  S SD  . MET A 1 94  ? 4.885   3.203   17.713 1.00   11.02 ? 201  MET A SD  1 
ATOM   706  C CE  . MET A 1 94  ? 5.635   1.592   17.649 1.00   12.75 ? 201  MET A CE  1 
ATOM   707  N N   . HIS A 1 95  ? 0.680   1.960   21.471 1.00   8.83  ? 202  HIS A N   1 
ATOM   708  C CA  . HIS A 1 95  ? -0.671  1.417   21.704 1.00   10.49 ? 202  HIS A CA  1 
ATOM   709  C C   . HIS A 1 95  ? -1.625  2.047   20.679 1.00   9.72  ? 202  HIS A C   1 
ATOM   710  O O   . HIS A 1 95  ? -1.687  3.282   20.505 1.00   9.43  ? 202  HIS A O   1 
ATOM   711  C CB  . HIS A 1 95  ? -1.219  1.717   23.102 1.00   12.69 ? 202  HIS A CB  1 
ATOM   712  C CG  . HIS A 1 95  ? -0.572  1.008   24.258 1.00   20.19 ? 202  HIS A CG  1 
ATOM   713  N ND1 . HIS A 1 95  ? 0.627   1.413   24.810 1.00   25.95 ? 202  HIS A ND1 1 
ATOM   714  C CD2 . HIS A 1 95  ? -1.063  0.058   25.097 1.00   24.88 ? 202  HIS A CD2 1 
ATOM   715  C CE1 . HIS A 1 95  ? 0.869   0.709   25.905 1.00   27.39 ? 202  HIS A CE1 1 
ATOM   716  N NE2 . HIS A 1 95  ? -0.142  -0.117  26.106 1.00   28.32 ? 202  HIS A NE2 1 
ATOM   717  N N   . LYS A 1 96  ? -2.353  1.209   19.956 1.00   9.67  ? 203  LYS A N   1 
ATOM   718  C CA  . LYS A 1 96  ? -3.333  1.710   19.007 1.00   10.10 ? 203  LYS A CA  1 
ATOM   719  C C   . LYS A 1 96  ? -4.383  2.569   19.702 1.00   12.02 ? 203  LYS A C   1 
ATOM   720  O O   . LYS A 1 96  ? -4.774  2.303   20.841 1.00   11.61 ? 203  LYS A O   1 
ATOM   721  C CB  . LYS A 1 96  ? -4.007  0.570   18.291 1.00   9.30  ? 203  LYS A CB  1 
ATOM   722  C CG  . LYS A 1 96  ? -3.093  -0.248  17.377 1.00   7.61  ? 203  LYS A CG  1 
ATOM   723  C CD  . LYS A 1 96  ? -3.806  -1.473  16.776 1.00   8.51  ? 203  LYS A CD  1 
ATOM   724  C CE  . LYS A 1 96  ? -2.990  -2.147  15.727 1.00   8.71  ? 203  LYS A CE  1 
ATOM   725  N NZ  . LYS A 1 96  ? -3.759  -3.188  14.945 1.00   7.17  ? 203  LYS A NZ  1 
ATOM   726  N N   . ASP A 1 97  ? -4.824  3.611   19.021 1.00   14.46 ? 204  ASP A N   1 
ATOM   727  C CA  . ASP A 1 97  ? -5.824  4.490   19.590 1.00   18.45 ? 204  ASP A CA  1 
ATOM   728  C C   . ASP A 1 97  ? -7.195  3.834   19.391 1.00   21.43 ? 204  ASP A C   1 
ATOM   729  O O   . ASP A 1 97  ? -7.295  2.714   18.838 1.00   21.82 ? 204  ASP A O   1 
ATOM   730  C CB  . ASP A 1 97  ? -5.721  5.889   18.987 1.00   19.76 ? 204  ASP A CB  1 
ATOM   731  C CG  . ASP A 1 97  ? -6.045  5.929   17.512 1.00   21.73 ? 204  ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 97  ? -6.551  4.941   16.922 1.00   26.86 ? 204  ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 97  ? -5.805  6.924   16.823 1.00   26.26 ? 204  ASP A OD2 1 
ATOM   734  N N   . SER A 1 98  ? -8.239  4.500   19.870 1.00   24.22 ? 205  SER A N   1 
ATOM   735  C CA  . SER A 1 98  ? -9.557  3.865   20.032 1.00   26.30 ? 205  SER A CA  1 
ATOM   736  C C   . SER A 1 98  ? -10.124 3.430   18.685 1.00   26.80 ? 205  SER A C   1 
ATOM   737  O O   . SER A 1 98  ? -11.047 2.594   18.621 1.00   28.38 ? 205  SER A O   1 
ATOM   738  C CB  . SER A 1 98  ? -10.531 4.832   20.717 1.00   26.62 ? 205  SER A CB  1 
ATOM   739  O OG  . SER A 1 98  ? -10.665 6.019   19.953 1.00   29.88 ? 205  SER A OG  1 
ATOM   740  N N   . THR A 1 99  ? -9.580  4.028   17.619 1.00   26.67 ? 206  THR A N   1 
ATOM   741  C CA  . THR A 1 99  ? -9.947  3.715   16.245 1.00   26.17 ? 206  THR A CA  1 
ATOM   742  C C   . THR A 1 99  ? -8.825  3.011   15.428 1.00   24.87 ? 206  THR A C   1 
ATOM   743  O O   . THR A 1 99  ? -8.888  2.961   14.213 1.00   25.53 ? 206  THR A O   1 
ATOM   744  C CB  . THR A 1 99  ? -10.444 4.994   15.523 1.00   26.57 ? 206  THR A CB  1 
ATOM   745  O OG1 . THR A 1 99  ? -9.547  6.084   15.775 1.00   29.24 ? 206  THR A OG1 1 
ATOM   746  C CG2 . THR A 1 99  ? -11.814 5.473   16.083 1.00   26.75 ? 206  THR A CG2 1 
ATOM   747  N N   . GLY A 1 100 ? -7.831  2.405   16.080 1.00   23.23 ? 207  GLY A N   1 
ATOM   748  C CA  . GLY A 1 100 ? -6.984  1.427   15.401 1.00   20.80 ? 207  GLY A CA  1 
ATOM   749  C C   . GLY A 1 100 ? -5.580  1.727   14.869 1.00   18.94 ? 207  GLY A C   1 
ATOM   750  O O   . GLY A 1 100 ? -4.961  0.812   14.384 1.00   17.92 ? 207  GLY A O   1 
ATOM   751  N N   . HIS A 1 101 ? -5.049  2.949   14.932 1.00   18.14 ? 208  HIS A N   1 
ATOM   752  C CA  . HIS A 1 101 ? -3.703  3.145   14.368 1.00   17.91 ? 208  HIS A CA  1 
ATOM   753  C C   . HIS A 1 101 ? -2.713  3.505   15.452 1.00   15.42 ? 208  HIS A C   1 
ATOM   754  O O   . HIS A 1 101 ? -3.099  4.079   16.471 1.00   11.71 ? 208  HIS A O   1 
ATOM   755  C CB  . HIS A 1 101 ? -3.651  4.222   13.287 1.00   19.20 ? 208  HIS A CB  1 
ATOM   756  C CG  . HIS A 1 101 ? -4.501  3.923   12.090 1.00   23.93 ? 208  HIS A CG  1 
ATOM   757  N ND1 . HIS A 1 101 ? -5.304  4.877   11.498 1.00   29.01 ? 208  HIS A ND1 1 
ATOM   758  C CD2 . HIS A 1 101 ? -4.686  2.778   11.387 1.00   26.49 ? 208  HIS A CD2 1 
ATOM   759  C CE1 . HIS A 1 101 ? -5.943  4.329   10.475 1.00   29.42 ? 208  HIS A CE1 1 
ATOM   760  N NE2 . HIS A 1 101 ? -5.581  3.060   10.383 1.00   28.10 ? 208  HIS A NE2 1 
ATOM   761  N N   . VAL A 1 102 ? -1.447  3.182   15.212 1.00   15.08 ? 209  VAL A N   1 
ATOM   762  C CA  . VAL A 1 102 ? -0.373  3.563   16.114 1.00   15.21 ? 209  VAL A CA  1 
ATOM   763  C C   . VAL A 1 102 ? 0.283   4.830   15.673 1.00   13.02 ? 209  VAL A C   1 
ATOM   764  O O   . VAL A 1 102 ? 0.832   5.516   16.503 1.00   13.29 ? 209  VAL A O   1 
ATOM   765  C CB  . VAL A 1 102 ? 0.765   2.512   16.304 1.00   16.95 ? 209  VAL A CB  1 
ATOM   766  C CG1 . VAL A 1 102 ? 0.338   1.465   17.305 1.00   18.29 ? 209  VAL A CG1 1 
ATOM   767  C CG2 . VAL A 1 102 ? 1.171   1.940   14.992 1.00   18.82 ? 209  VAL A CG2 1 
ATOM   768  N N   . GLY A 1 103 ? 0.191   5.158   14.380 1.00   10.84 ? 210  GLY A N   1 
ATOM   769  C CA  . GLY A 1 103 ? 0.526   6.479   13.882 1.00   9.85  ? 210  GLY A CA  1 
ATOM   770  C C   . GLY A 1 103 ? 1.798   6.637   13.050 1.00   9.65  ? 210  GLY A C   1 
ATOM   771  O O   . GLY A 1 103 ? 2.523   7.629   13.229 1.00   9.09  ? 210  GLY A O   1 
ATOM   772  N N   . PHE A 1 104 ? 2.079   5.694   12.153 1.00   9.19  ? 211  PHE A N   1 
ATOM   773  C CA  . PHE A 1 104 ? 3.159   5.914   11.192 1.00   9.37  ? 211  PHE A CA  1 
ATOM   774  C C   . PHE A 1 104 ? 2.864   5.353   9.813  1.00   10.30 ? 211  PHE A C   1 
ATOM   775  O O   . PHE A 1 104 ? 1.962   4.508   9.628  1.00   10.89 ? 211  PHE A O   1 
ATOM   776  C CB  . PHE A 1 104 ? 4.511   5.378   11.711 1.00   9.10  ? 211  PHE A CB  1 
ATOM   777  C CG  . PHE A 1 104 ? 4.572   3.878   11.822 1.00   8.27  ? 211  PHE A CG  1 
ATOM   778  C CD1 . PHE A 1 104 ? 4.191   3.230   12.993 1.00   7.70  ? 211  PHE A CD1 1 
ATOM   779  C CD2 . PHE A 1 104 ? 5.054   3.109   10.773 1.00   9.19  ? 211  PHE A CD2 1 
ATOM   780  C CE1 . PHE A 1 104 ? 4.264   1.836   13.097 1.00   9.29  ? 211  PHE A CE1 1 
ATOM   781  C CE2 . PHE A 1 104 ? 5.150   1.746   10.884 1.00   8.88  ? 211  PHE A CE2 1 
ATOM   782  C CZ  . PHE A 1 104 ? 4.716   1.103   12.012 1.00   8.40  ? 211  PHE A CZ  1 
ATOM   783  N N   . ILE A 1 105 ? 3.639   5.842   8.849  1.00   10.49 ? 212  ILE A N   1 
ATOM   784  C CA  . ILE A 1 105 ? 3.649   5.322   7.503  1.00   10.88 ? 212  ILE A CA  1 
ATOM   785  C C   . ILE A 1 105 ? 5.020   4.756   7.249  1.00   10.09 ? 212  ILE A C   1 
ATOM   786  O O   . ILE A 1 105 ? 6.001   5.270   7.768  1.00   9.16  ? 212  ILE A O   1 
ATOM   787  C CB  . ILE A 1 105 ? 3.319   6.452   6.484  1.00   12.51 ? 212  ILE A CB  1 
ATOM   788  C CG1 . ILE A 1 105 ? 1.924   6.992   6.772  1.00   14.92 ? 212  ILE A CG1 1 
ATOM   789  C CG2 . ILE A 1 105 ? 3.519   5.941   5.051  1.00   12.85 ? 212  ILE A CG2 1 
ATOM   790  C CD1 . ILE A 1 105 ? 1.429   8.039   5.744  1.00   19.90 ? 212  ILE A CD1 1 
ATOM   791  N N   . PHE A 1 106 ? 5.095   3.687   6.455  1.00   10.47 ? 213  PHE A N   1 
ATOM   792  C CA  . PHE A 1 106 ? 6.375   3.095   6.099  1.00   10.75 ? 213  PHE A CA  1 
ATOM   793  C C   . PHE A 1 106 ? 6.395   2.696   4.637  1.00   11.95 ? 213  PHE A C   1 
ATOM   794  O O   . PHE A 1 106 ? 5.338   2.546   4.003  1.00   11.60 ? 213  PHE A O   1 
ATOM   795  C CB  . PHE A 1 106 ? 6.712   1.879   7.007  1.00   10.47 ? 213  PHE A CB  1 
ATOM   796  C CG  . PHE A 1 106 ? 5.930   0.655   6.674  1.00   10.10 ? 213  PHE A CG  1 
ATOM   797  C CD1 . PHE A 1 106 ? 6.446   -0.332  5.828  1.00   10.05 ? 213  PHE A CD1 1 
ATOM   798  C CD2 . PHE A 1 106 ? 4.661   0.497   7.166  1.00   8.35  ? 213  PHE A CD2 1 
ATOM   799  C CE1 . PHE A 1 106 ? 5.664   -1.439  5.501  1.00   9.90  ? 213  PHE A CE1 1 
ATOM   800  C CE2 . PHE A 1 106 ? 3.890   -0.651  6.847  1.00   9.91  ? 213  PHE A CE2 1 
ATOM   801  C CZ  . PHE A 1 106 ? 4.386   -1.576  6.019  1.00   8.76  ? 213  PHE A CZ  1 
ATOM   802  N N   . LYS A 1 107 ? 7.600   2.509   4.111  1.00   12.03 ? 214  LYS A N   1 
ATOM   803  C CA  . LYS A 1 107 ? 7.753   1.960   2.772  1.00   13.56 ? 214  LYS A CA  1 
ATOM   804  C C   . LYS A 1 107 ? 9.077   1.261   2.637  1.00   12.32 ? 214  LYS A C   1 
ATOM   805  O O   . LYS A 1 107 ? 10.088  1.708   3.175  1.00   11.74 ? 214  LYS A O   1 
ATOM   806  C CB  . LYS A 1 107 ? 7.569   3.047   1.688  1.00   14.92 ? 214  LYS A CB  1 
ATOM   807  C CG  . LYS A 1 107 ? 7.088   2.441   0.299  1.00   19.29 ? 214  LYS A CG  1 
ATOM   808  C CD  . LYS A 1 107 ? 6.923   3.520   -0.777 1.00   23.42 ? 214  LYS A CD  1 
ATOM   809  C CE  . LYS A 1 107 ? 6.493   2.894   -2.127 1.00   26.53 ? 214  LYS A CE  1 
ATOM   810  N NZ  . LYS A 1 107 ? 5.200   2.169   -2.019 1.00   28.04 ? 214  LYS A NZ  1 
ATOM   811  N N   . ASN A 1 108 ? 9.082   0.144   1.923  1.00   12.55 ? 215  ASN A N   1 
ATOM   812  C CA  . ASN A 1 108 ? 10.258  -0.688  1.827  1.00   13.42 ? 215  ASN A CA  1 
ATOM   813  C C   . ASN A 1 108 ? 10.857  -1.010  3.202  1.00   12.45 ? 215  ASN A C   1 
ATOM   814  O O   . ASN A 1 108 ? 12.079  -0.989  3.419  1.00   12.56 ? 215  ASN A O   1 
ATOM   815  C CB  . ASN A 1 108 ? 11.275  -0.061  0.871  1.00   14.69 ? 215  ASN A CB  1 
ATOM   816  C CG  . ASN A 1 108 ? 10.670  0.259   -0.502 1.00   19.00 ? 215  ASN A CG  1 
ATOM   817  O OD1 . ASN A 1 108 ? 10.081  -0.602  -1.160 1.00   24.48 ? 215  ASN A OD1 1 
ATOM   818  N ND2 . ASN A 1 108 ? 10.802  1.498   -0.923 1.00   23.27 ? 215  ASN A ND2 1 
ATOM   819  N N   . GLY A 1 109 ? 9.959   -1.306  4.144  1.00   10.98 ? 216  GLY A N   1 
ATOM   820  C CA  . GLY A 1 109 ? 10.353  -1.767  5.453  1.00   11.09 ? 216  GLY A CA  1 
ATOM   821  C C   . GLY A 1 109 ? 10.946  -0.675  6.309  1.00   10.99 ? 216  GLY A C   1 
ATOM   822  O O   . GLY A 1 109 ? 11.492  -0.976  7.377  1.00   11.46 ? 216  GLY A O   1 
ATOM   823  N N   . LYS A 1 110 ? 10.832  0.575   5.848  1.00   11.18 ? 217  LYS A N   1 
ATOM   824  C CA  . LYS A 1 110 ? 11.422  1.735   6.516  1.00   10.81 ? 217  LYS A CA  1 
ATOM   825  C C   . LYS A 1 110 ? 10.360  2.771   6.902  1.00   10.20 ? 217  LYS A C   1 
ATOM   826  O O   . LYS A 1 110 ? 9.594   3.183   6.078  1.00   10.57 ? 217  LYS A O   1 
ATOM   827  C CB  . LYS A 1 110 ? 12.456  2.372   5.572  1.00   11.61 ? 217  LYS A CB  1 
ATOM   828  C CG  . LYS A 1 110 ? 13.245  3.475   6.169  1.00   15.31 ? 217  LYS A CG  1 
ATOM   829  C CD  . LYS A 1 110 ? 14.411  3.905   5.278  1.00   20.40 ? 217  LYS A CD  1 
ATOM   830  C CE  . LYS A 1 110 ? 14.025  5.013   4.361  1.00   23.88 ? 217  LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 110 ? 15.074  5.132   3.298  1.00   26.20 ? 217  LYS A NZ  1 
ATOM   832  N N   . ILE A 1 111 ? 10.370  3.241   8.134  1.00   9.09  ? 218  ILE A N   1 
ATOM   833  C CA  . ILE A 1 111 ? 9.425   4.282   8.567  1.00   8.37  ? 218  ILE A CA  1 
ATOM   834  C C   . ILE A 1 111 ? 9.731   5.600   7.853  1.00   9.00  ? 218  ILE A C   1 
ATOM   835  O O   . ILE A 1 111 ? 10.866  6.073   7.855  1.00   9.31  ? 218  ILE A O   1 
ATOM   836  C CB  . ILE A 1 111 ? 9.520   4.473   10.097 1.00   7.34  ? 218  ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 111 ? 9.206   3.141   10.820 1.00   8.07  ? 218  ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 111 ? 8.558   5.563   10.548 1.00   7.67  ? 218  ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 111 ? 9.779   3.021   12.216 1.00   7.49  ? 218  ILE A CD1 1 
ATOM   840  N N   . THR A 1 112 ? 8.715   6.196   7.258  1.00   10.34 ? 219  THR A N   1 
ATOM   841  C CA  . THR A 1 112 ? 8.879   7.447   6.483  1.00   11.32 ? 219  THR A CA  1 
ATOM   842  C C   . THR A 1 112 ? 8.107   8.641   7.040  1.00   11.48 ? 219  THR A C   1 
ATOM   843  O O   . THR A 1 112 ? 8.464   9.768   6.759  1.00   12.93 ? 219  THR A O   1 
ATOM   844  C CB  . THR A 1 112 ? 8.481   7.213   5.011  1.00   11.90 ? 219  THR A CB  1 
ATOM   845  O OG1 . THR A 1 112 ? 7.132   6.723   4.931  1.00   12.96 ? 219  THR A OG1 1 
ATOM   846  C CG2 . THR A 1 112 ? 9.332   6.131   4.405  1.00   13.70 ? 219  THR A CG2 1 
ATOM   847  N N   . SER A 1 113 ? 7.070   8.440   7.847  1.00   11.24 ? 220  SER A N   1 
ATOM   848  C CA  . SER A 1 113 ? 6.459   9.586   8.517  1.00   11.09 ? 220  SER A CA  1 
ATOM   849  C C   . SER A 1 113 ? 5.734   9.196   9.801  1.00   10.64 ? 220  SER A C   1 
ATOM   850  O O   . SER A 1 113 ? 5.356   8.046   9.986  1.00   10.90 ? 220  SER A O   1 
ATOM   851  C CB  . SER A 1 113 ? 5.528   10.358  7.585  1.00   11.87 ? 220  SER A CB  1 
ATOM   852  O OG  . SER A 1 113 ? 4.391   9.617   7.243  1.00   14.19 ? 220  SER A OG  1 
ATOM   853  N N   . ILE A 1 114 ? 5.580   10.177  10.670 1.00   10.49 ? 221  ILE A N   1 
ATOM   854  C CA  . ILE A 1 114 ? 4.945   10.013  11.974 1.00   10.45 ? 221  ILE A CA  1 
ATOM   855  C C   . ILE A 1 114 ? 3.745   10.946  12.031 1.00   11.15 ? 221  ILE A C   1 
ATOM   856  O O   . ILE A 1 114 ? 3.855   12.167  11.753 1.00   11.68 ? 221  ILE A O   1 
ATOM   857  C CB  . ILE A 1 114 ? 5.912   10.418  13.119 1.00   10.55 ? 221  ILE A CB  1 
ATOM   858  C CG1 . ILE A 1 114 ? 7.275   9.693   13.039 1.00   10.67 ? 221  ILE A CG1 1 
ATOM   859  C CG2 . ILE A 1 114 ? 5.278   10.186  14.471 1.00   10.21 ? 221  ILE A CG2 1 
ATOM   860  C CD1 . ILE A 1 114 ? 7.225   8.192   13.040 1.00   12.17 ? 221  ILE A CD1 1 
ATOM   861  N N   . VAL A 1 115 ? 2.604   10.392  12.409 1.00   11.38 ? 222  VAL A N   1 
ATOM   862  C CA  . VAL A 1 115 ? 1.364   11.141  12.481 1.00   11.87 ? 222  VAL A CA  1 
ATOM   863  C C   . VAL A 1 115 ? 1.279   11.952  13.784 1.00   11.41 ? 222  VAL A C   1 
ATOM   864  O O   . VAL A 1 115 ? 1.527   11.446  14.878 1.00   9.96  ? 222  VAL A O   1 
ATOM   865  C CB  . VAL A 1 115 ? 0.147   10.208  12.366 1.00   12.28 ? 222  VAL A CB  1 
ATOM   866  C CG1 . VAL A 1 115 ? -1.151  10.995  12.493 1.00   14.48 ? 222  VAL A CG1 1 
ATOM   867  C CG2 . VAL A 1 115 ? 0.203   9.381   11.057 1.00   12.93 ? 222  VAL A CG2 1 
ATOM   868  N N   . LYS A 1 116 ? 0.922   13.225  13.663 1.00   12.44 ? 223  LYS A N   1 
ATOM   869  C CA  . LYS A 1 116 ? 0.691   14.088  14.829 1.00   14.26 ? 223  LYS A CA  1 
ATOM   870  C C   . LYS A 1 116 ? -0.303  13.509  15.819 1.00   14.22 ? 223  LYS A C   1 
ATOM   871  O O   . LYS A 1 116 ? -1.315  12.928  15.421 1.00   14.11 ? 223  LYS A O   1 
ATOM   872  C CB  . LYS A 1 116 ? 0.158   15.456  14.383 1.00   15.07 ? 223  LYS A CB  1 
ATOM   873  C CG  . LYS A 1 116 ? 0.325   16.550  15.423 1.00   19.66 ? 223  LYS A CG  1 
ATOM   874  C CD  . LYS A 1 116 ? -0.154  17.897  14.865 1.00   22.95 ? 223  LYS A CD  1 
ATOM   875  C CE  . LYS A 1 116 ? -0.764  18.819  15.946 1.00   25.31 ? 223  LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 116 ? -0.915  20.244  15.452 1.00   27.38 ? 223  LYS A NZ  1 
ATOM   877  N N   . ASP A 1 117 ? -0.012  13.664  17.105 1.00   16.38 ? 224  ASP A N   1 
ATOM   878  C CA  . ASP A 1 117 ? -0.944  13.313  18.192 1.00   17.27 ? 224  ASP A CA  1 
ATOM   879  C C   . ASP A 1 117 ? -1.221  11.802  18.239 1.00   16.11 ? 224  ASP A C   1 
ATOM   880  O O   . ASP A 1 117 ? -2.320  11.358  18.659 1.00   16.58 ? 224  ASP A O   1 
ATOM   881  C CB  . ASP A 1 117 ? -2.297  14.047  18.054 1.00   19.03 ? 224  ASP A CB  1 
ATOM   882  C CG  . ASP A 1 117 ? -2.195  15.557  18.258 1.00   23.34 ? 224  ASP A CG  1 
ATOM   883  O OD1 . ASP A 1 117 ? -1.324  16.022  19.048 1.00   28.87 ? 224  ASP A OD1 1 
ATOM   884  O OD2 . ASP A 1 117 ? -2.944  16.359  17.636 1.00   27.00 ? 224  ASP A OD2 1 
ATOM   885  N N   . SER A 1 118 ? -0.260  11.021  17.765 1.00   13.25 ? 225  SER A N   1 
ATOM   886  C CA  . SER A 1 118 ? -0.419  9.568   17.712 1.00   11.19 ? 225  SER A CA  1 
ATOM   887  C C   . SER A 1 118 ? 0.445   8.910   18.757 1.00   10.62 ? 225  SER A C   1 
ATOM   888  O O   . SER A 1 118 ? 1.256   9.577   19.381 1.00   10.37 ? 225  SER A O   1 
ATOM   889  C CB  . SER A 1 118 ? -0.037  9.043   16.332 1.00   10.86 ? 225  SER A CB  1 
ATOM   890  O OG  . SER A 1 118 ? 1.362   9.113   16.101 1.00   9.18  ? 225  SER A OG  1 
ATOM   891  N N   . SER A 1 119 ? 0.284   7.599   18.934 1.00   9.44  ? 226  SER A N   1 
ATOM   892  C CA  . SER A 1 119 ? 1.107   6.866   19.893 1.00   8.34  ? 226  SER A CA  1 
ATOM   893  C C   . SER A 1 119 ? 2.551   6.789   19.405 1.00   8.13  ? 226  SER A C   1 
ATOM   894  O O   . SER A 1 119 ? 3.485   6.871   20.223 1.00   7.43  ? 226  SER A O   1 
ATOM   895  C CB  . SER A 1 119 ? 0.551   5.478   20.109 1.00   8.59  ? 226  SER A CB  1 
ATOM   896  O OG  . SER A 1 119 ? 1.256   4.796   21.117 1.00   7.92  ? 226  SER A OG  1 
ATOM   897  N N   . ALA A 1 120 ? 2.753   6.715   18.092 1.00   7.58  ? 227  ALA A N   1 
ATOM   898  C CA  . ALA A 1 120 ? 4.107   6.752   17.532 1.00   7.21  ? 227  ALA A CA  1 
ATOM   899  C C   . ALA A 1 120 ? 4.756   8.080   17.903 1.00   7.44  ? 227  ALA A C   1 
ATOM   900  O O   . ALA A 1 120 ? 5.934   8.139   18.237 1.00   7.22  ? 227  ALA A O   1 
ATOM   901  C CB  . ALA A 1 120 ? 4.093   6.583   16.001 1.00   7.83  ? 227  ALA A CB  1 
ATOM   902  N N   . ALA A 1 121 ? 3.976   9.154   17.825 1.00   7.52  ? 228  ALA A N   1 
ATOM   903  C CA  . ALA A 1 121 ? 4.497   10.487  18.172 1.00   7.29  ? 228  ALA A CA  1 
ATOM   904  C C   . ALA A 1 121 ? 4.815   10.549  19.673 1.00   7.71  ? 228  ALA A C   1 
ATOM   905  O O   . ALA A 1 121 ? 5.906   10.978  20.067 1.00   8.13  ? 228  ALA A O   1 
ATOM   906  C CB  . ALA A 1 121 ? 3.555   11.556  17.787 1.00   7.47  ? 228  ALA A CB  1 
ATOM   907  N N   . ARG A 1 122 ? 3.882   10.100  20.499 1.00   7.79  ? 229  ARG A N   1 
ATOM   908  C CA  . ARG A 1 122 ? 4.075   10.099  21.948 1.00   8.95  ? 229  ARG A CA  1 
ATOM   909  C C   . ARG A 1 122 ? 5.318   9.328   22.385 1.00   8.51  ? 229  ARG A C   1 
ATOM   910  O O   . ARG A 1 122 ? 6.010   9.753   23.327 1.00   7.26  ? 229  ARG A O   1 
ATOM   911  C CB  . ARG A 1 122 ? 2.847   9.534   22.671 1.00   10.33 ? 229  ARG A CB  1 
ATOM   912  C CG  . ARG A 1 122 ? 1.642   10.433  22.620 1.00   14.12 ? 229  ARG A CG  1 
ATOM   913  C CD  . ARG A 1 122 ? 0.522   9.987   23.571 1.00   19.28 ? 229  ARG A CD  1 
ATOM   914  N NE  . ARG A 1 122 ? -0.237  8.842   23.058 1.00   23.72 ? 229  ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 122 ? -1.182  8.889   22.108 1.00   27.01 ? 229  ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 122 ? -1.552  10.038  21.510 1.00   27.23 ? 229  ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 122 ? -1.803  7.771   21.774 1.00   28.87 ? 229  ARG A NH2 1 
ATOM   918  N N   . ASN A 1 123 ? 5.623   8.246   21.661 1.00   7.98  ? 230  ASN A N   1 
ATOM   919  C CA  . ASN A 1 123 ? 6.665   7.318   22.047 1.00   6.84  ? 230  ASN A CA  1 
ATOM   920  C C   . ASN A 1 123 ? 7.911   7.474   21.183 1.00   6.55  ? 230  ASN A C   1 
ATOM   921  O O   . ASN A 1 123 ? 8.734   6.611   21.190 1.00   6.59  ? 230  ASN A O   1 
ATOM   922  C CB  . ASN A 1 123 ? 6.120   5.892   22.062 1.00   7.00  ? 230  ASN A CB  1 
ATOM   923  C CG  . ASN A 1 123 ? 5.164   5.674   23.213 1.00   7.31  ? 230  ASN A CG  1 
ATOM   924  O OD1 . ASN A 1 123 ? 5.596   5.648   24.382 1.00   7.44  ? 230  ASN A OD1 1 
ATOM   925  N ND2 . ASN A 1 123 ? 3.851   5.584   22.920 1.00   7.49  ? 230  ASN A ND2 1 
ATOM   926  N N   . GLY A 1 124 ? 8.046   8.595   20.476 1.00   6.81  ? 231  GLY A N   1 
ATOM   927  C CA  . GLY A 1 124 ? 9.336   8.951   19.904 1.00   7.38  ? 231  GLY A CA  1 
ATOM   928  C C   . GLY A 1 124 ? 9.827   8.056   18.785 1.00   7.65  ? 231  GLY A C   1 
ATOM   929  O O   . GLY A 1 124 ? 11.034  7.832   18.650 1.00   8.33  ? 231  GLY A O   1 
ATOM   930  N N   . LEU A 1 125 ? 8.904   7.510   17.998 1.00   7.90  ? 232  LEU A N   1 
ATOM   931  C CA  . LEU A 1 125 ? 9.283   6.698   16.857 1.00   7.42  ? 232  LEU A CA  1 
ATOM   932  C C   . LEU A 1 125 ? 10.013  7.596   15.878 1.00   7.74  ? 232  LEU A C   1 
ATOM   933  O O   . LEU A 1 125 ? 9.676   8.769   15.734 1.00   8.30  ? 232  LEU A O   1 
ATOM   934  C CB  . LEU A 1 125 ? 8.055   6.083   16.171 1.00   7.23  ? 232  LEU A CB  1 
ATOM   935  C CG  . LEU A 1 125 ? 8.355   4.935   15.222 1.00   6.67  ? 232  LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 125 ? 8.940   3.752   15.937 1.00   7.59  ? 232  LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 125 ? 7.052   4.525   14.516 1.00   8.10  ? 232  LEU A CD2 1 
ATOM   938  N N   . LEU A 1 126 ? 11.004  7.041   15.196 1.00   8.22  ? 233  LEU A N   1 
ATOM   939  C CA  . LEU A 1 126 ? 11.848  7.818   14.287 1.00   7.30  ? 233  LEU A CA  1 
ATOM   940  C C   . LEU A 1 126 ? 11.691  7.346   12.862 1.00   8.10  ? 233  LEU A C   1 
ATOM   941  O O   . LEU A 1 126 ? 11.573  6.158   12.614 1.00   7.49  ? 233  LEU A O   1 
ATOM   942  C CB  . LEU A 1 126 ? 13.331  7.743   14.667 1.00   8.19  ? 233  LEU A CB  1 
ATOM   943  C CG  . LEU A 1 126 ? 13.656  8.252   16.064 1.00   7.30  ? 233  LEU A CG  1 
ATOM   944  C CD1 . LEU A 1 126 ? 15.051  7.756   16.526 1.00   8.97  ? 233  LEU A CD1 1 
ATOM   945  C CD2 . LEU A 1 126 ? 13.556  9.780   16.161 1.00   7.43  ? 233  LEU A CD2 1 
ATOM   946  N N   . THR A 1 127 ? 11.778  8.293   11.942 1.00   7.81  ? 234  THR A N   1 
ATOM   947  C CA  . THR A 1 127 ? 11.807  7.999   10.497 1.00   8.58  ? 234  THR A CA  1 
ATOM   948  C C   . THR A 1 127 ? 13.204  7.622   10.016 1.00   9.71  ? 234  THR A C   1 
ATOM   949  O O   . THR A 1 127 ? 14.190  7.779   10.734 1.00   9.93  ? 234  THR A O   1 
ATOM   950  C CB  . THR A 1 127 ? 11.295  9.197   9.672  1.00   9.21  ? 234  THR A CB  1 
ATOM   951  O OG1 . THR A 1 127 ? 12.051  10.390  9.988  1.00   8.67  ? 234  THR A OG1 1 
ATOM   952  C CG2 . THR A 1 127 ? 9.826   9.498   9.982  1.00   10.00 ? 234  THR A CG2 1 
ATOM   953  N N   . GLU A 1 128 ? 13.289  7.139   8.780  1.00   10.67 ? 235  GLU A N   1 
ATOM   954  C CA  . GLU A 1 128 ? 14.543  6.641   8.247  1.00   10.76 ? 235  GLU A CA  1 
ATOM   955  C C   . GLU A 1 128 ? 15.167  5.586   9.179  1.00   10.39 ? 235  GLU A C   1 
ATOM   956  O O   . GLU A 1 128 ? 16.411  5.483   9.374  1.00   9.83  ? 235  GLU A O   1 
ATOM   957  C CB  . GLU A 1 128 ? 15.483  7.835   7.995  1.00   12.11 ? 235  GLU A CB  1 
ATOM   958  C CG  . GLU A 1 128 ? 15.070  8.630   6.781  1.00   16.69 ? 235  GLU A CG  1 
ATOM   959  C CD  . GLU A 1 128 ? 13.821  9.432   6.938  1.00   20.55 ? 235  GLU A CD  1 
ATOM   960  O OE1 . GLU A 1 128 ? 13.805  10.330  7.828  1.00   25.51 ? 235  GLU A OE1 1 
ATOM   961  O OE2 . GLU A 1 128 ? 12.879  9.206   6.114  1.00   24.79 ? 235  GLU A OE2 1 
ATOM   962  N N   . HIS A 1 129 ? 14.275  4.773   9.744  1.00   10.30 ? 236  HIS A N   1 
ATOM   963  C CA  . HIS A 1 129 ? 14.630  3.612   10.519 1.00   9.91  ? 236  HIS A CA  1 
ATOM   964  C C   . HIS A 1 129 ? 13.956  2.388   9.957  1.00   9.29  ? 236  HIS A C   1 
ATOM   965  O O   . HIS A 1 129 ? 12.777  2.415   9.623  1.00   9.02  ? 236  HIS A O   1 
ATOM   966  C CB  . HIS A 1 129 ? 14.236  3.815   11.984 1.00   9.80  ? 236  HIS A CB  1 
ATOM   967  C CG  . HIS A 1 129 ? 15.232  4.603   12.770 1.00   10.31 ? 236  HIS A CG  1 
ATOM   968  N ND1 . HIS A 1 129 ? 15.547  5.911   12.483 1.00   10.61 ? 236  HIS A ND1 1 
ATOM   969  C CD2 . HIS A 1 129 ? 15.967  4.270   13.863 1.00   13.22 ? 236  HIS A CD2 1 
ATOM   970  C CE1 . HIS A 1 129 ? 16.480  6.331   13.329 1.00   12.53 ? 236  HIS A CE1 1 
ATOM   971  N NE2 . HIS A 1 129 ? 16.735  5.363   14.187 1.00   13.07 ? 236  HIS A NE2 1 
ATOM   972  N N   . ASN A 1 130 ? 14.715  1.306   9.873  1.00   9.20  ? 237  ASN A N   1 
ATOM   973  C CA  . ASN A 1 130 ? 14.191  0.024   9.477  1.00   10.44 ? 237  ASN A CA  1 
ATOM   974  C C   . ASN A 1 130 ? 13.401  -0.652  10.584 1.00   9.22  ? 237  ASN A C   1 
ATOM   975  O O   . ASN A 1 130 ? 13.813  -0.670  11.736 1.00   8.36  ? 237  ASN A O   1 
ATOM   976  C CB  . ASN A 1 130 ? 15.323  -0.911  9.059  1.00   11.38 ? 237  ASN A CB  1 
ATOM   977  C CG  . ASN A 1 130 ? 15.973  -0.489  7.737  1.00   14.44 ? 237  ASN A CG  1 
ATOM   978  O OD1 . ASN A 1 130 ? 17.203  -0.557  7.592  1.00   20.09 ? 237  ASN A OD1 1 
ATOM   979  N ND2 . ASN A 1 130 ? 15.166  -0.018  6.787  1.00   14.37 ? 237  ASN A ND2 1 
ATOM   980  N N   . ILE A 1 131 ? 12.297  -1.258  10.175 1.00   8.78  ? 238  ILE A N   1 
ATOM   981  C CA  . ILE A 1 131 ? 11.444  -2.075  11.037 1.00   8.65  ? 238  ILE A CA  1 
ATOM   982  C C   . ILE A 1 131 ? 11.987  -3.508  11.062 1.00   9.47  ? 238  ILE A C   1 
ATOM   983  O O   . ILE A 1 131 ? 12.003  -4.186  10.034 1.00   8.97  ? 238  ILE A O   1 
ATOM   984  C CB  . ILE A 1 131 ? 10.005  -2.087  10.527 1.00   9.56  ? 238  ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 131 ? 9.473   -0.654  10.304 1.00   10.31 ? 238  ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 131 ? 9.136   -2.868  11.500 1.00   10.88 ? 238  ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 131 ? 8.122   -0.559  9.677  1.00   12.06 ? 238  ILE A CD1 1 
ATOM   988  N N   . CYS A 1 132 ? 12.428  -3.955  12.234 1.00   9.19  ? 239  CYS A N   1 
ATOM   989  C CA  . CYS A 1 132 ? 13.147  -5.216  12.330 1.00   9.70  ? 239  CYS A CA  1 
ATOM   990  C C   . CYS A 1 132 ? 12.246  -6.291  12.920 1.00   9.73  ? 239  CYS A C   1 
ATOM   991  O O   . CYS A 1 132 ? 12.216  -7.409  12.421 1.00   8.48  ? 239  CYS A O   1 
ATOM   992  C CB  . CYS A 1 132 ? 14.398  -5.058  13.205 1.00   9.25  ? 239  CYS A CB  1 
ATOM   993  S SG  . CYS A 1 132 ? 15.563  -3.850  12.600 1.00   11.35 ? 239  CYS A SG  1 
ATOM   994  N N   . GLU A 1 133 ? 11.563  -5.968  14.017 1.00   10.33 ? 240  GLU A N   1 
ATOM   995  C CA  . GLU A 1 133 ? 10.649  -6.901  14.640 1.00   11.04 ? 240  GLU A CA  1 
ATOM   996  C C   . GLU A 1 133 ? 9.395   -6.199  15.063 1.00   9.98  ? 240  GLU A C   1 
ATOM   997  O O   . GLU A 1 133 ? 9.456   -5.055  15.504 1.00   9.60  ? 240  GLU A O   1 
ATOM   998  C CB  . GLU A 1 133 ? 11.254  -7.489  15.921 1.00   11.60 ? 240  GLU A CB  1 
ATOM   999  C CG  . GLU A 1 133 ? 12.015  -8.770  15.804 1.00   17.31 ? 240  GLU A CG  1 
ATOM   1000 C CD  . GLU A 1 133 ? 12.667  -9.159  17.125 1.00   21.43 ? 240  GLU A CD  1 
ATOM   1001 O OE1 . GLU A 1 133 ? 11.996  -9.049  18.193 1.00   23.27 ? 240  GLU A OE1 1 
ATOM   1002 O OE2 . GLU A 1 133 ? 13.852  -9.569  17.109 1.00   24.69 ? 240  GLU A OE2 1 
ATOM   1003 N N   . ILE A 1 134 ? 8.278   -6.909  15.020 1.00   9.41  ? 241  ILE A N   1 
ATOM   1004 C CA  . ILE A 1 134 ? 7.008   -6.400  15.562 1.00   9.33  ? 241  ILE A CA  1 
ATOM   1005 C C   . ILE A 1 134 ? 6.409   -7.497  16.451 1.00   9.08  ? 241  ILE A C   1 
ATOM   1006 O O   . ILE A 1 134 ? 6.128   -8.595  15.974 1.00   9.89  ? 241  ILE A O   1 
ATOM   1007 C CB  . ILE A 1 134 ? 6.019   -6.084  14.430 1.00   8.54  ? 241  ILE A CB  1 
ATOM   1008 C CG1 . ILE A 1 134 ? 6.588   -5.004  13.481 1.00   9.22  ? 241  ILE A CG1 1 
ATOM   1009 C CG2 . ILE A 1 134 ? 4.665   -5.670  14.994 1.00   8.53  ? 241  ILE A CG2 1 
ATOM   1010 C CD1 . ILE A 1 134 ? 5.733   -4.812  12.221 1.00   12.08 ? 241  ILE A CD1 1 
ATOM   1011 N N   . ASN A 1 135 ? 6.178   -7.186  17.705 1.00   9.94  ? 242  ASN A N   1 
ATOM   1012 C CA  . ASN A 1 135 ? 5.586   -8.114  18.665 1.00   11.12 ? 242  ASN A CA  1 
ATOM   1013 C C   . ASN A 1 135 ? 6.229   -9.501  18.629 1.00   13.13 ? 242  ASN A C   1 
ATOM   1014 O O   . ASN A 1 135 ? 5.537   -10.518 18.595 1.00   14.61 ? 242  ASN A O   1 
ATOM   1015 C CB  . ASN A 1 135 ? 4.073   -8.192  18.437 1.00   10.89 ? 242  ASN A CB  1 
ATOM   1016 C CG  . ASN A 1 135 ? 3.356   -6.929  18.842 1.00   9.48  ? 242  ASN A CG  1 
ATOM   1017 O OD1 . ASN A 1 135 ? 3.852   -6.148  19.682 1.00   8.28  ? 242  ASN A OD1 1 
ATOM   1018 N ND2 . ASN A 1 135 ? 2.148   -6.735  18.297 1.00   9.31  ? 242  ASN A ND2 1 
ATOM   1019 N N   . GLY A 1 136 ? 7.548   -9.510  18.548 1.00   14.76 ? 243  GLY A N   1 
ATOM   1020 C CA  . GLY A 1 136 ? 8.347   -10.728 18.600 1.00   16.22 ? 243  GLY A CA  1 
ATOM   1021 C C   . GLY A 1 136 ? 8.537   -11.431 17.263 1.00   16.63 ? 243  GLY A C   1 
ATOM   1022 O O   . GLY A 1 136 ? 9.178   -12.493 17.199 1.00   18.87 ? 243  GLY A O   1 
ATOM   1023 N N   . GLN A 1 137 ? 7.963   -10.880 16.201 1.00   16.42 ? 244  GLN A N   1 
ATOM   1024 C CA  . GLN A 1 137 ? 8.007   -11.474 14.875 1.00   16.43 ? 244  GLN A CA  1 
ATOM   1025 C C   . GLN A 1 137 ? 9.058   -10.723 14.056 1.00   15.27 ? 244  GLN A C   1 
ATOM   1026 O O   . GLN A 1 137 ? 8.989   -9.510  13.907 1.00   13.31 ? 244  GLN A O   1 
ATOM   1027 C CB  . GLN A 1 137 ? 6.654   -11.372 14.204 1.00   17.53 ? 244  GLN A CB  1 
ATOM   1028 C CG  . GLN A 1 137 ? 6.490   -12.205 12.949 1.00   21.91 ? 244  GLN A CG  1 
ATOM   1029 C CD  . GLN A 1 137 ? 5.010   -12.409 12.551 1.00   25.99 ? 244  GLN A CD  1 
ATOM   1030 O OE1 . GLN A 1 137 ? 4.095   -11.807 13.131 1.00   26.99 ? 244  GLN A OE1 1 
ATOM   1031 N NE2 . GLN A 1 137 ? 4.789   -13.279 11.571 1.00   30.15 ? 244  GLN A NE2 1 
ATOM   1032 N N   . ASN A 1 138 ? 10.041  -11.467 13.556 1.00   14.63 ? 245  ASN A N   1 
ATOM   1033 C CA  . ASN A 1 138 ? 10.998  -10.944 12.582 1.00   14.37 ? 245  ASN A CA  1 
ATOM   1034 C C   . ASN A 1 138 ? 10.268  -10.566 11.291 1.00   13.71 ? 245  ASN A C   1 
ATOM   1035 O O   . ASN A 1 138 ? 9.563   -11.397 10.696 1.00   14.61 ? 245  ASN A O   1 
ATOM   1036 C CB  . ASN A 1 138 ? 12.070  -12.004 12.291 1.00   14.44 ? 245  ASN A CB  1 
ATOM   1037 C CG  . ASN A 1 138 ? 13.013  -11.611 11.165 1.00   14.90 ? 245  ASN A CG  1 
ATOM   1038 O OD1 . ASN A 1 138 ? 13.247  -10.438 10.894 1.00   12.35 ? 245  ASN A OD1 1 
ATOM   1039 N ND2 . ASN A 1 138 ? 13.565  -12.629 10.489 1.00   16.44 ? 245  ASN A ND2 1 
ATOM   1040 N N   . VAL A 1 139 ? 10.439  -9.317  10.865 1.00   11.96 ? 246  VAL A N   1 
ATOM   1041 C CA  . VAL A 1 139 ? 9.878   -8.839  9.607  1.00   11.95 ? 246  VAL A CA  1 
ATOM   1042 C C   . VAL A 1 139 ? 10.913  -8.456  8.546  1.00   11.63 ? 246  VAL A C   1 
ATOM   1043 O O   . VAL A 1 139 ? 10.579  -7.978  7.453  1.00   12.00 ? 246  VAL A O   1 
ATOM   1044 C CB  . VAL A 1 139 ? 8.851   -7.727  9.856  1.00   11.85 ? 246  VAL A CB  1 
ATOM   1045 C CG1 . VAL A 1 139 ? 7.729   -8.247  10.778 1.00   13.68 ? 246  VAL A CG1 1 
ATOM   1046 C CG2 . VAL A 1 139 ? 9.485   -6.496  10.441 1.00   11.44 ? 246  VAL A CG2 1 
ATOM   1047 N N   . ILE A 1 140 ? 12.199  -8.659  8.835  1.00   10.95 ? 247  ILE A N   1 
ATOM   1048 C CA  . ILE A 1 140 ? 13.220  -8.397  7.829  1.00   10.37 ? 247  ILE A CA  1 
ATOM   1049 C C   . ILE A 1 140 ? 12.999  -9.357  6.661  1.00   11.51 ? 247  ILE A C   1 
ATOM   1050 O O   . ILE A 1 140 ? 12.897  -10.574 6.852  1.00   11.54 ? 247  ILE A O   1 
ATOM   1051 C CB  . ILE A 1 140 ? 14.647  -8.600  8.419  1.00   9.39  ? 247  ILE A CB  1 
ATOM   1052 C CG1 . ILE A 1 140 ? 14.905  -7.574  9.529  1.00   8.77  ? 247  ILE A CG1 1 
ATOM   1053 C CG2 . ILE A 1 140 ? 15.696  -8.539  7.339  1.00   10.53 ? 247  ILE A CG2 1 
ATOM   1054 C CD1 . ILE A 1 140 ? 15.049  -6.111  9.082  1.00   8.97  ? 247  ILE A CD1 1 
ATOM   1055 N N   . GLY A 1 141 ? 12.946  -8.802  5.463  1.00   13.38 ? 248  GLY A N   1 
ATOM   1056 C CA  . GLY A 1 141 ? 12.816  -9.605  4.266  1.00   13.82 ? 248  GLY A CA  1 
ATOM   1057 C C   . GLY A 1 141 ? 11.372  -9.761  3.846  1.00   14.21 ? 248  GLY A C   1 
ATOM   1058 O O   . GLY A 1 141 ? 11.114  -10.257 2.740  1.00   15.23 ? 248  GLY A O   1 
ATOM   1059 N N   . LEU A 1 142 ? 10.439  -9.315  4.679  1.00   13.62 ? 249  LEU A N   1 
ATOM   1060 C CA  . LEU A 1 142 ? 9.018   -9.390  4.319  1.00   12.76 ? 249  LEU A CA  1 
ATOM   1061 C C   . LEU A 1 142 ? 8.631   -8.291  3.353  1.00   13.12 ? 249  LEU A C   1 
ATOM   1062 O O   . LEU A 1 142 ? 9.252   -7.212  3.302  1.00   12.83 ? 249  LEU A O   1 
ATOM   1063 C CB  . LEU A 1 142 ? 8.132   -9.347  5.562  1.00   12.86 ? 249  LEU A CB  1 
ATOM   1064 C CG  . LEU A 1 142 ? 8.165   -10.521 6.536  1.00   14.16 ? 249  LEU A CG  1 
ATOM   1065 C CD1 . LEU A 1 142 ? 7.117   -10.395 7.607  1.00   15.40 ? 249  LEU A CD1 1 
ATOM   1066 C CD2 . LEU A 1 142 ? 8.034   -11.842 5.805  1.00   16.95 ? 249  LEU A CD2 1 
ATOM   1067 N N   . LYS A 1 143 ? 7.594   -8.576  2.556  1.00   12.39 ? 250  LYS A N   1 
ATOM   1068 C CA  . LYS A 1 143 ? 6.986   -7.574  1.691  1.00   12.78 ? 250  LYS A CA  1 
ATOM   1069 C C   . LYS A 1 143 ? 6.259   -6.521  2.539  1.00   11.11 ? 250  LYS A C   1 
ATOM   1070 O O   . LYS A 1 143 ? 5.706   -6.852  3.560  1.00   10.76 ? 250  LYS A O   1 
ATOM   1071 C CB  . LYS A 1 143 ? 5.949   -8.239  0.798  1.00   13.62 ? 250  LYS A CB  1 
ATOM   1072 C CG  . LYS A 1 143 ? 6.473   -9.376  -0.058 1.00   16.98 ? 250  LYS A CG  1 
ATOM   1073 C CD  . LYS A 1 143 ? 5.368   -9.890  -0.955 1.00   18.71 ? 250  LYS A CD  1 
ATOM   1074 C CE  . LYS A 1 143 ? 4.455   -10.723 -0.613 0.0000 37.24 ? 250  LYS A CE  1 
ATOM   1075 N NZ  . LYS A 1 143 ? 3.660   -11.421 -1.682 0.0000 37.73 ? 250  LYS A NZ  1 
ATOM   1076 N N   . ASP A 1 144 ? 6.195   -5.283  2.086  1.00   10.43 ? 251  ASP A N   1 
ATOM   1077 C CA  . ASP A 1 144 ? 5.431   -4.258  2.809  1.00   9.58  ? 251  ASP A CA  1 
ATOM   1078 C C   . ASP A 1 144 ? 4.020   -4.726  3.124  1.00   9.84  ? 251  ASP A C   1 
ATOM   1079 O O   . ASP A 1 144 ? 3.515   -4.475  4.222  1.00   9.50  ? 251  ASP A O   1 
ATOM   1080 C CB  . ASP A 1 144 ? 5.337   -2.953  2.019  1.00   9.23  ? 251  ASP A CB  1 
ATOM   1081 C CG  . ASP A 1 144 ? 6.628   -2.165  1.988  1.00   11.65 ? 251  ASP A CG  1 
ATOM   1082 O OD1 . ASP A 1 144 ? 7.568   -2.465  2.774  1.00   10.89 ? 251  ASP A OD1 1 
ATOM   1083 O OD2 . ASP A 1 144 ? 6.766   -1.186  1.213  1.00   12.26 ? 251  ASP A OD2 1 
ATOM   1084 N N   . SER A 1 145 ? 3.370   -5.411  2.169  1.00   10.77 ? 252  SER A N   1 
ATOM   1085 C CA  . SER A 1 145 ? 2.003   -5.813  2.388  1.00   11.35 ? 252  SER A CA  1 
ATOM   1086 C C   . SER A 1 145 ? 1.904   -6.795  3.555  1.00   11.56 ? 252  SER A C   1 
ATOM   1087 O O   . SER A 1 145 ? 0.925   -6.749  4.289  1.00   11.64 ? 252  SER A O   1 
ATOM   1088 C CB  . SER A 1 145 ? 1.365   -6.393  1.116  1.00   11.59 ? 252  SER A CB  1 
ATOM   1089 O OG  . SER A 1 145 ? 2.065   -7.542  0.714  1.00   13.50 ? 252  SER A OG  1 
ATOM   1090 N N   . GLN A 1 146 ? 2.923   -7.658  3.735  1.00   11.58 ? 253  GLN A N   1 
ATOM   1091 C CA  . GLN A 1 146 ? 2.984   -8.574  4.879  1.00   11.74 ? 253  GLN A CA  1 
ATOM   1092 C C   . GLN A 1 146 ? 3.211   -7.849  6.202  1.00   10.67 ? 253  GLN A C   1 
ATOM   1093 O O   . GLN A 1 146 ? 2.596   -8.169  7.219  1.00   10.51 ? 253  GLN A O   1 
ATOM   1094 C CB  . GLN A 1 146 ? 4.050   -9.635  4.681  1.00   11.99 ? 253  GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 146 ? 3.848   -10.518 3.464  1.00   15.51 ? 253  GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 146 ? 4.988   -11.477 3.241  1.00   17.17 ? 253  GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 146 ? 6.103   -11.076 2.893  1.00   16.41 ? 253  GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 146 ? 4.705   -12.762 3.395  1.00   20.31 ? 253  GLN A NE2 1 
ATOM   1099 N N   . ILE A 1 147 ? 4.063   -6.840  6.172  1.00   10.34 ? 254  ILE A N   1 
ATOM   1100 C CA  . ILE A 1 147 ? 4.290   -5.994  7.350  1.00   9.83  ? 254  ILE A CA  1 
ATOM   1101 C C   . ILE A 1 147 ? 3.008   -5.254  7.713  1.00   9.93  ? 254  ILE A C   1 
ATOM   1102 O O   . ILE A 1 147 ? 2.618   -5.219  8.865  1.00   9.98  ? 254  ILE A O   1 
ATOM   1103 C CB  . ILE A 1 147 ? 5.443   -5.027  7.096  1.00   9.58  ? 254  ILE A CB  1 
ATOM   1104 C CG1 . ILE A 1 147 ? 6.720   -5.841  6.877  1.00   10.00 ? 254  ILE A CG1 1 
ATOM   1105 C CG2 . ILE A 1 147 ? 5.615   -4.059  8.277  1.00   10.45 ? 254  ILE A CG2 1 
ATOM   1106 C CD1 . ILE A 1 147 ? 7.941   -5.043  6.456  1.00   9.63  ? 254  ILE A CD1 1 
ATOM   1107 N N   . ALA A 1 148 ? 2.335   -4.704  6.713  1.00   10.19 ? 255  ALA A N   1 
ATOM   1108 C CA  . ALA A 1 148 ? 1.080   -3.989  6.882  1.00   11.94 ? 255  ALA A CA  1 
ATOM   1109 C C   . ALA A 1 148 ? 0.032   -4.862  7.537  1.00   12.25 ? 255  ALA A C   1 
ATOM   1110 O O   . ALA A 1 148 ? -0.675  -4.431  8.462  1.00   12.51 ? 255  ALA A O   1 
ATOM   1111 C CB  . ALA A 1 148 ? 0.588   -3.480  5.545  1.00   12.74 ? 255  ALA A CB  1 
ATOM   1112 N N   . ASP A 1 149 ? -0.031  -6.105  7.091  1.00   12.13 ? 256  ASP A N   1 
ATOM   1113 C CA  . ASP A 1 149 ? -0.987  -7.042  7.618  1.00   13.54 ? 256  ASP A CA  1 
ATOM   1114 C C   . ASP A 1 149 ? -0.723  -7.381  9.071  1.00   12.45 ? 256  ASP A C   1 
ATOM   1115 O O   . ASP A 1 149 ? -1.657  -7.490  9.849  1.00   12.46 ? 256  ASP A O   1 
ATOM   1116 C CB  . ASP A 1 149 ? -1.001  -8.314  6.792  1.00   14.66 ? 256  ASP A CB  1 
ATOM   1117 C CG  . ASP A 1 149 ? -1.688  -8.141  5.432  1.00   19.06 ? 256  ASP A CG  1 
ATOM   1118 O OD1 . ASP A 1 149 ? -2.261  -7.069  5.101  1.00   21.93 ? 256  ASP A OD1 1 
ATOM   1119 O OD2 . ASP A 1 149 ? -1.655  -9.079  4.604  1.00   23.37 ? 256  ASP A OD2 1 
ATOM   1120 N N   . ILE A 1 150 ? 0.551   -7.516  9.442  1.00   11.35 ? 257  ILE A N   1 
ATOM   1121 C CA  . ILE A 1 150 ? 0.929   -7.786  10.826 1.00   10.63 ? 257  ILE A CA  1 
ATOM   1122 C C   . ILE A 1 150 ? 0.491   -6.603  11.684 1.00   9.72  ? 257  ILE A C   1 
ATOM   1123 O O   . ILE A 1 150 ? -0.075  -6.794  12.755 1.00   10.26 ? 257  ILE A O   1 
ATOM   1124 C CB  . ILE A 1 150 ? 2.435   -8.048  10.954 1.00   10.89 ? 257  ILE A CB  1 
ATOM   1125 C CG1 . ILE A 1 150 ? 2.821   -9.432  10.404 1.00   12.15 ? 257  ILE A CG1 1 
ATOM   1126 C CG2 . ILE A 1 150 ? 2.876   -7.982  12.405 1.00   12.19 ? 257  ILE A CG2 1 
ATOM   1127 C CD1 . ILE A 1 150 ? 4.301   -9.575  10.145 1.00   11.75 ? 257  ILE A CD1 1 
ATOM   1128 N N   . LEU A 1 151 ? 0.749   -5.384  11.220 1.00   9.22  ? 258  LEU A N   1 
ATOM   1129 C CA  . LEU A 1 151 ? 0.386   -4.175  11.976 1.00   8.84  ? 258  LEU A CA  1 
ATOM   1130 C C   . LEU A 1 151 ? -1.111  -4.035  12.137 1.00   10.38 ? 258  LEU A C   1 
ATOM   1131 O O   . LEU A 1 151 ? -1.575  -3.681  13.214 1.00   10.77 ? 258  LEU A O   1 
ATOM   1132 C CB  . LEU A 1 151 ? 0.954   -2.922  11.349 1.00   8.92  ? 258  LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 151 ? 2.484   -2.853  11.387 1.00   7.39  ? 258  LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 151 ? 3.010   -1.872  10.316 1.00   9.04  ? 258  LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 151 ? 2.868   -2.421  12.799 1.00   8.21  ? 258  LEU A CD2 1 
ATOM   1136 N N   . SER A 1 152 ? -1.844  -4.300  11.061 1.00   11.64 ? 259  SER A N   1 
ATOM   1137 C CA  . SER A 1 152 ? -3.285  -4.140  11.055 1.00   13.38 ? 259  SER A CA  1 
ATOM   1138 C C   . SER A 1 152 ? -3.948  -5.164  11.994 1.00   13.05 ? 259  SER A C   1 
ATOM   1139 O O   . SER A 1 152 ? -4.840  -4.804  12.782 1.00   13.01 ? 259  SER A O   1 
ATOM   1140 C CB  . SER A 1 152 ? -3.790  -4.292  9.622  1.00   14.87 ? 259  SER A CB  1 
ATOM   1141 O OG  . SER A 1 152 ? -5.194  -4.328  9.605  1.00   20.21 ? 259  SER A OG  1 
ATOM   1142 N N   . THR A 1 153 ? -3.520  -6.422  11.924 1.00   12.55 ? 260  THR A N   1 
ATOM   1143 C CA  . THR A 1 153 ? -4.114  -7.478  12.758 1.00   13.05 ? 260  THR A CA  1 
ATOM   1144 C C   . THR A 1 153 ? -3.625  -7.491  14.219 1.00   12.56 ? 260  THR A C   1 
ATOM   1145 O O   . THR A 1 153 ? -4.225  -8.149  15.072 1.00   11.41 ? 260  THR A O   1 
ATOM   1146 C CB  . THR A 1 153 ? -3.899  -8.910  12.129 1.00   13.87 ? 260  THR A CB  1 
ATOM   1147 O OG1 . THR A 1 153 ? -2.524  -9.246  12.080 1.00   15.72 ? 260  THR A OG1 1 
ATOM   1148 C CG2 . THR A 1 153 ? -4.337  -8.986  10.721 1.00   14.78 ? 260  THR A CG2 1 
ATOM   1149 N N   . SER A 1 154 ? -2.548  -6.744  14.517 1.00   11.28 ? 261  SER A N   1 
ATOM   1150 C CA  . SER A 1 154 ? -2.054  -6.681  15.887 1.00   10.97 ? 261  SER A CA  1 
ATOM   1151 C C   . SER A 1 154 ? -3.120  -6.253  16.891 1.00   10.16 ? 261  SER A C   1 
ATOM   1152 O O   . SER A 1 154 ? -3.993  -5.428  16.604 1.00   10.82 ? 261  SER A O   1 
ATOM   1153 C CB  . SER A 1 154 ? -0.885  -5.690  16.001 1.00   10.39 ? 261  SER A CB  1 
ATOM   1154 O OG  . SER A 1 154 ? -0.317  -5.696  17.317 1.00   10.23 ? 261  SER A OG  1 
ATOM   1155 N N   . GLY A 1 155 ? -3.003  -6.802  18.086 1.00   10.12 ? 262  GLY A N   1 
ATOM   1156 C CA  . GLY A 1 155 ? -3.635  -6.249  19.257 1.00   9.56  ? 262  GLY A CA  1 
ATOM   1157 C C   . GLY A 1 155 ? -3.198  -4.821  19.488 1.00   8.93  ? 262  GLY A C   1 
ATOM   1158 O O   . GLY A 1 155 ? -2.278  -4.312  18.837 1.00   8.37  ? 262  GLY A O   1 
ATOM   1159 N N   . THR A 1 156 ? -3.864  -4.178  20.428 1.00   9.20  ? 263  THR A N   1 
ATOM   1160 C CA  . THR A 1 156 ? -3.646  -2.790  20.759 1.00   8.49  ? 263  THR A CA  1 
ATOM   1161 C C   . THR A 1 156 ? -2.169  -2.475  20.957 1.00   8.51  ? 263  THR A C   1 
ATOM   1162 O O   . THR A 1 156 ? -1.675  -1.474  20.470 1.00   8.32  ? 263  THR A O   1 
ATOM   1163 C CB  . THR A 1 156 ? -4.431  -2.489  22.036 1.00   9.37  ? 263  THR A CB  1 
ATOM   1164 O OG1 . THR A 1 156 ? -5.851  -2.689  21.764 1.00   9.47  ? 263  THR A OG1 1 
ATOM   1165 C CG2 . THR A 1 156 ? -4.265  -1.082  22.446 1.00   8.83  ? 263  THR A CG2 1 
ATOM   1166 N N   . VAL A 1 157 ? -1.481  -3.337  21.702 1.00   7.95  ? 264  VAL A N   1 
ATOM   1167 C CA  . VAL A 1 157 ? -0.061  -3.135  21.965 1.00   8.57  ? 264  VAL A CA  1 
ATOM   1168 C C   . VAL A 1 157 ? 0.773   -3.543  20.769 1.00   8.10  ? 264  VAL A C   1 
ATOM   1169 O O   . VAL A 1 157 ? 0.662   -4.661  20.287 1.00   9.08  ? 264  VAL A O   1 
ATOM   1170 C CB  . VAL A 1 157 ? 0.387   -3.916  23.236 1.00   8.77  ? 264  VAL A CB  1 
ATOM   1171 C CG1 . VAL A 1 157 ? 1.829   -3.592  23.551 1.00   10.51 ? 264  VAL A CG1 1 
ATOM   1172 C CG2 . VAL A 1 157 ? -0.433  -3.536  24.441 1.00   10.86 ? 264  VAL A CG2 1 
ATOM   1173 N N   . VAL A 1 158 ? 1.545   -2.585  20.262 1.00   7.73  ? 265  VAL A N   1 
ATOM   1174 C CA  . VAL A 1 158 ? 2.436   -2.766  19.116 1.00   7.66  ? 265  VAL A CA  1 
ATOM   1175 C C   . VAL A 1 158 ? 3.848   -2.380  19.538 1.00   7.43  ? 265  VAL A C   1 
ATOM   1176 O O   . VAL A 1 158 ? 4.172   -1.211  19.741 1.00   7.75  ? 265  VAL A O   1 
ATOM   1177 C CB  . VAL A 1 158 ? 1.979   -1.940  17.921 1.00   7.95  ? 265  VAL A CB  1 
ATOM   1178 C CG1 . VAL A 1 158 ? 2.848   -2.189  16.749 1.00   7.69  ? 265  VAL A CG1 1 
ATOM   1179 C CG2 . VAL A 1 158 ? 0.532   -2.272  17.577 1.00   7.97  ? 265  VAL A CG2 1 
ATOM   1180 N N   . THR A 1 159 ? 4.649   -3.390  19.772 1.00   7.43  ? 266  THR A N   1 
ATOM   1181 C CA  . THR A 1 159 ? 6.049   -3.192  20.153 1.00   7.81  ? 266  THR A CA  1 
ATOM   1182 C C   . THR A 1 159 ? 6.937   -3.436  18.923 1.00   7.87  ? 266  THR A C   1 
ATOM   1183 O O   . THR A 1 159 ? 6.955   -4.518  18.353 1.00   8.17  ? 266  THR A O   1 
ATOM   1184 C CB  . THR A 1 159 ? 6.418   -4.113  21.278 1.00   7.84  ? 266  THR A CB  1 
ATOM   1185 O OG1 . THR A 1 159 ? 5.631   -3.794  22.450 1.00   8.42  ? 266  THR A OG1 1 
ATOM   1186 C CG2 . THR A 1 159 ? 7.880   -3.915  21.693 1.00   7.99  ? 266  THR A CG2 1 
ATOM   1187 N N   . ILE A 1 160 ? 7.691   -2.419  18.525 1.00   7.94  ? 267  ILE A N   1 
ATOM   1188 C CA  . ILE A 1 160 ? 8.530   -2.484  17.344 1.00   8.47  ? 267  ILE A CA  1 
ATOM   1189 C C   . ILE A 1 160 ? 9.989   -2.229  17.695 1.00   8.56  ? 267  ILE A C   1 
ATOM   1190 O O   . ILE A 1 160 ? 10.311  -1.313  18.461 1.00   8.47  ? 267  ILE A O   1 
ATOM   1191 C CB  . ILE A 1 160 ? 8.068   -1.442  16.281 1.00   9.43  ? 267  ILE A CB  1 
ATOM   1192 C CG1 . ILE A 1 160 ? 6.565   -1.540  16.060 1.00   10.62 ? 267  ILE A CG1 1 
ATOM   1193 C CG2 . ILE A 1 160 ? 8.833   -1.643  14.999 1.00   10.54 ? 267  ILE A CG2 1 
ATOM   1194 C CD1 . ILE A 1 160 ? 6.069   -0.748  14.811 1.00   13.33 ? 267  ILE A CD1 1 
ATOM   1195 N N   . THR A 1 161 ? 10.862  -3.051  17.125 1.00   8.34  ? 268  THR A N   1 
ATOM   1196 C CA  . THR A 1 161 ? 12.285  -2.829  17.173 1.00   8.82  ? 268  THR A CA  1 
ATOM   1197 C C   . THR A 1 161 ? 12.732  -2.199  15.869 1.00   8.26  ? 268  THR A C   1 
ATOM   1198 O O   . THR A 1 161 ? 12.439  -2.729  14.779 1.00   8.55  ? 268  THR A O   1 
ATOM   1199 C CB  . THR A 1 161 ? 13.025  -4.141  17.382 1.00   9.51  ? 268  THR A CB  1 
ATOM   1200 O OG1 . THR A 1 161 ? 12.614  -4.720  18.614 1.00   11.25 ? 268  THR A OG1 1 
ATOM   1201 C CG2 . THR A 1 161 ? 14.539  -3.866  17.554 1.00   10.70 ? 268  THR A CG2 1 
ATOM   1202 N N   . ILE A 1 162 ? 13.405  -1.056  15.979 1.00   8.59  ? 269  ILE A N   1 
ATOM   1203 C CA  . ILE A 1 162 ? 13.891  -0.294  14.837 1.00   8.24  ? 269  ILE A CA  1 
ATOM   1204 C C   . ILE A 1 162 ? 15.428  -0.119  14.914 1.00   8.65  ? 269  ILE A C   1 
ATOM   1205 O O   . ILE A 1 162 ? 16.047  -0.223  15.986 1.00   8.48  ? 269  ILE A O   1 
ATOM   1206 C CB  . ILE A 1 162 ? 13.163  1.086   14.722 1.00   7.96  ? 269  ILE A CB  1 
ATOM   1207 C CG1 . ILE A 1 162 ? 13.523  1.993   15.885 1.00   7.30  ? 269  ILE A CG1 1 
ATOM   1208 C CG2 . ILE A 1 162 ? 11.630  0.879   14.613 1.00   7.88  ? 269  ILE A CG2 1 
ATOM   1209 C CD1 . ILE A 1 162 ? 13.023  3.439   15.822 1.00   9.08  ? 269  ILE A CD1 1 
ATOM   1210 N N   . MET A 1 163 ? 16.028  0.146   13.770 1.00   8.63  ? 270  MET A N   1 
ATOM   1211 C CA  . MET A 1 163 ? 17.453  0.453   13.692 1.00   9.40  ? 270  MET A CA  1 
ATOM   1212 C C   . MET A 1 163 ? 17.614  1.513   12.635 1.00   9.48  ? 270  MET A C   1 
ATOM   1213 O O   . MET A 1 163 ? 16.861  1.556   11.653 1.00   8.56  ? 270  MET A O   1 
ATOM   1214 C CB  . MET A 1 163 ? 18.273  -0.775  13.283 1.00   9.39  ? 270  MET A CB  1 
ATOM   1215 C CG  . MET A 1 163 ? 18.365  -1.808  14.331 1.00   12.24 ? 270  MET A CG  1 
ATOM   1216 S SD  . MET A 1 163 ? 19.267  -3.192  13.679 1.00   14.37 ? 270  MET A SD  1 
ATOM   1217 C CE  . MET A 1 163 ? 18.801  -4.334  14.853 1.00   17.02 ? 270  MET A CE  1 
ATOM   1218 N N   . PRO A 1 164 ? 18.596  2.378   12.783 1.00   10.94 ? 271  PRO A N   1 
ATOM   1219 C CA  . PRO A 1 164 ? 18.831  3.364   11.723 1.00   12.01 ? 271  PRO A CA  1 
ATOM   1220 C C   . PRO A 1 164 ? 19.070  2.678   10.378 1.00   13.66 ? 271  PRO A C   1 
ATOM   1221 O O   . PRO A 1 164 ? 19.712  1.620   10.359 1.00   13.50 ? 271  PRO A O   1 
ATOM   1222 C CB  . PRO A 1 164 ? 20.093  4.091   12.187 1.00   12.14 ? 271  PRO A CB  1 
ATOM   1223 C CG  . PRO A 1 164 ? 20.159  3.839   13.652 1.00   12.67 ? 271  PRO A CG  1 
ATOM   1224 C CD  . PRO A 1 164 ? 19.528  2.531   13.907 1.00   11.45 ? 271  PRO A CD  1 
ATOM   1225 N N   . ALA A 1 165 ? 18.547  3.276   9.305  1.00   15.24 ? 272  ALA A N   1 
ATOM   1226 C CA  . ALA A 1 165 ? 18.711  2.794   7.941  1.00   18.47 ? 272  ALA A CA  1 
ATOM   1227 C C   . ALA A 1 165 ? 20.004  3.437   7.407  1.00   21.33 ? 272  ALA A C   1 
ATOM   1228 O O   . ALA A 1 165 ? 20.044  4.624   7.058  1.00   22.73 ? 272  ALA A O   1 
ATOM   1229 C CB  . ALA A 1 165 ? 17.523  3.178   7.091  1.00   18.15 ? 272  ALA A CB  1 
ATOM   1230 N N   . PHE A 1 166 ? 21.054  2.652   7.426  1.00   23.60 ? 273  PHE A N   1 
ATOM   1231 C CA  . PHE A 1 166 ? 22.374  3.085   7.014  1.00   24.99 ? 273  PHE A CA  1 
ATOM   1232 C C   . PHE A 1 166 ? 22.461  2.913   5.502  1.00   26.08 ? 273  PHE A C   1 
ATOM   1233 O O   . PHE A 1 166 ? 22.759  3.886   4.821  1.00   27.92 ? 273  PHE A O   1 
ATOM   1234 C CB  . PHE A 1 166 ? 23.444  2.243   7.699  1.00   25.06 ? 273  PHE A CB  1 
ATOM   1235 C CG  . PHE A 1 166 ? 23.552  2.483   9.180  1.00   25.73 ? 273  PHE A CG  1 
ATOM   1236 C CD1 . PHE A 1 166 ? 24.232  3.586   9.660  1.00   26.20 ? 273  PHE A CD1 1 
ATOM   1237 C CD2 . PHE A 1 166 ? 22.992  1.601   10.095 1.00   25.26 ? 273  PHE A CD2 1 
ATOM   1238 C CE1 . PHE A 1 166 ? 24.335  3.822   11.024 1.00   25.95 ? 273  PHE A CE1 1 
ATOM   1239 C CE2 . PHE A 1 166 ? 23.120  1.840   11.474 1.00   24.95 ? 273  PHE A CE2 1 
ATOM   1240 C CZ  . PHE A 1 166 ? 23.783  2.949   11.921 1.00   25.64 ? 273  PHE A CZ  1 
ATOM   1241 N N   . GLY B 1 1   ? 12.076  1.104   33.164 1.00   18.25 ? 108  GLY B N   1 
ATOM   1242 C CA  . GLY B 1 1   ? 13.418  0.483   33.087 1.00   17.73 ? 108  GLY B CA  1 
ATOM   1243 C C   . GLY B 1 1   ? 14.425  1.325   32.325 1.00   17.36 ? 108  GLY B C   1 
ATOM   1244 O O   . GLY B 1 1   ? 14.152  2.477   31.971 1.00   16.16 ? 108  GLY B O   1 
ATOM   1245 N N   . ALA B 1 2   ? 15.597  0.755   32.084 1.00   17.78 ? 109  ALA B N   1 
ATOM   1246 C CA  . ALA B 1 2   ? 16.704  1.480   31.452 1.00   17.80 ? 109  ALA B CA  1 
ATOM   1247 C C   . ALA B 1 2   ? 16.351  2.166   30.129 1.00   18.07 ? 109  ALA B C   1 
ATOM   1248 O O   . ALA B 1 2   ? 16.781  3.295   29.877 1.00   17.69 ? 109  ALA B O   1 
ATOM   1249 C CB  . ALA B 1 2   ? 17.886  0.557   31.237 1.00   18.77 ? 109  ALA B CB  1 
ATOM   1250 N N   . MET B 1 3   ? 15.562  1.489   29.297 1.00   17.24 ? 110  MET B N   1 
ATOM   1251 C CA  . MET B 1 3   ? 15.212  2.038   27.983 1.00   17.95 ? 110  MET B CA  1 
ATOM   1252 C C   . MET B 1 3   ? 14.106  3.073   28.042 1.00   15.30 ? 110  MET B C   1 
ATOM   1253 O O   . MET B 1 3   ? 13.928  3.826   27.094 1.00   14.72 ? 110  MET B O   1 
ATOM   1254 C CB  . MET B 1 3   ? 14.810  0.910   27.042 1.00   19.50 ? 110  MET B CB  1 
ATOM   1255 C CG  . MET B 1 3   ? 15.928  -0.042  26.797 1.00   25.05 ? 110  MET B CG  1 
ATOM   1256 S SD  . MET B 1 3   ? 17.098  0.631   25.626 1.00   34.24 ? 110  MET B SD  1 
ATOM   1257 C CE  . MET B 1 3   ? 18.413  1.244   26.775 1.00   33.79 ? 110  MET B CE  1 
ATOM   1258 N N   . ASP B 1 4   ? 13.359  3.101   29.143 1.00   12.73 ? 111  ASP B N   1 
ATOM   1259 C CA  . ASP B 1 4   ? 12.235  4.012   29.282 1.00   11.93 ? 111  ASP B CA  1 
ATOM   1260 C C   . ASP B 1 4   ? 12.682  5.442   29.582 1.00   11.03 ? 111  ASP B C   1 
ATOM   1261 O O   . ASP B 1 4   ? 13.832  5.661   29.972 1.00   10.19 ? 111  ASP B O   1 
ATOM   1262 C CB  . ASP B 1 4   ? 11.289  3.458   30.319 1.00   12.29 ? 111  ASP B CB  1 
ATOM   1263 C CG  . ASP B 1 4   ? 10.828  2.063   29.954 1.00   16.32 ? 111  ASP B CG  1 
ATOM   1264 O OD1 . ASP B 1 4   ? 10.334  1.869   28.792 1.00   17.28 ? 111  ASP B OD1 1 
ATOM   1265 O OD2 . ASP B 1 4   ? 11.023  1.091   30.728 1.00   21.78 ? 111  ASP B OD2 1 
ATOM   1266 N N   . PRO B 1 5   ? 11.817  6.427   29.326 1.00   10.20 ? 112  PRO B N   1 
ATOM   1267 C CA  . PRO B 1 5   ? 12.191  7.808   29.555 1.00   9.97  ? 112  PRO B CA  1 
ATOM   1268 C C   . PRO B 1 5   ? 12.245  8.147   31.032 1.00   9.92  ? 112  PRO B C   1 
ATOM   1269 O O   . PRO B 1 5   ? 11.738  7.404   31.935 1.00   10.76 ? 112  PRO B O   1 
ATOM   1270 C CB  . PRO B 1 5   ? 11.062  8.627   28.863 1.00   10.79 ? 112  PRO B CB  1 
ATOM   1271 C CG  . PRO B 1 5   ? 10.191  7.632   28.202 1.00   11.14 ? 112  PRO B CG  1 
ATOM   1272 C CD  . PRO B 1 5   ? 10.464  6.319   28.760 1.00   11.03 ? 112  PRO B CD  1 
ATOM   1273 N N   . ARG B 1 6   ? 12.933  9.261   31.262 1.00   9.88  ? 113  ARG B N   1 
ATOM   1274 C CA  . ARG B 1 6   ? 13.024  9.900   32.563 1.00   9.49  ? 113  ARG B CA  1 
ATOM   1275 C C   . ARG B 1 6   ? 12.476  11.328  32.472 1.00   10.68 ? 113  ARG B C   1 
ATOM   1276 O O   . ARG B 1 6   ? 12.530  11.984  31.421 1.00   10.07 ? 113  ARG B O   1 
ATOM   1277 C CB  . ARG B 1 6   ? 14.466  9.882   33.036 1.00   8.98  ? 113  ARG B CB  1 
ATOM   1278 C CG  . ARG B 1 6   ? 15.460  10.716  32.219 1.00   7.86  ? 113  ARG B CG  1 
ATOM   1279 C CD  . ARG B 1 6   ? 16.932  10.422  32.644 1.00   7.07  ? 113  ARG B CD  1 
ATOM   1280 N NE  . ARG B 1 6   ? 17.901  11.325  32.046 1.00   9.03  ? 113  ARG B NE  1 
ATOM   1281 C CZ  . ARG B 1 6   ? 18.277  12.489  32.560 1.00   8.53  ? 113  ARG B CZ  1 
ATOM   1282 N NH1 . ARG B 1 6   ? 17.785  12.887  33.703 1.00   9.54  ? 113  ARG B NH1 1 
ATOM   1283 N NH2 . ARG B 1 6   ? 19.167  13.247  31.941 1.00   9.69  ? 113  ARG B NH2 1 
ATOM   1284 N N   . GLU B 1 7   ? 11.965  11.829  33.589 1.00   11.93 ? 114  GLU B N   1 
ATOM   1285 C CA  . GLU B 1 7   ? 11.378  13.158  33.646 1.00   13.30 ? 114  GLU B CA  1 
ATOM   1286 C C   . GLU B 1 7   ? 12.290  14.126  34.343 1.00   12.66 ? 114  GLU B C   1 
ATOM   1287 O O   . GLU B 1 7   ? 12.832  13.820  35.428 1.00   13.85 ? 114  GLU B O   1 
ATOM   1288 C CB  . GLU B 1 7   ? 10.080  13.114  34.438 1.00   15.23 ? 114  GLU B CB  1 
ATOM   1289 C CG  . GLU B 1 7   ? 8.970   12.421  33.733 1.00   18.33 ? 114  GLU B CG  1 
ATOM   1290 C CD  . GLU B 1 7   ? 8.369   13.310  32.655 1.00   23.16 ? 114  GLU B CD  1 
ATOM   1291 O OE1 . GLU B 1 7   ? 7.755   14.350  32.983 1.00   27.61 ? 114  GLU B OE1 1 
ATOM   1292 O OE2 . GLU B 1 7   ? 8.503   12.965  31.483 1.00   25.81 ? 114  GLU B OE2 1 
ATOM   1293 N N   . VAL B 1 8   ? 12.459  15.297  33.756 1.00   11.84 ? 115  VAL B N   1 
ATOM   1294 C CA  . VAL B 1 8   ? 13.230  16.360  34.369 1.00   12.18 ? 115  VAL B CA  1 
ATOM   1295 C C   . VAL B 1 8   ? 12.325  17.599  34.514 1.00   12.98 ? 115  VAL B C   1 
ATOM   1296 O O   . VAL B 1 8   ? 11.362  17.792  33.763 1.00   12.82 ? 115  VAL B O   1 
ATOM   1297 C CB  . VAL B 1 8   ? 14.521  16.723  33.586 1.00   11.62 ? 115  VAL B CB  1 
ATOM   1298 C CG1 . VAL B 1 8   ? 15.474  15.542  33.504 1.00   13.43 ? 115  VAL B CG1 1 
ATOM   1299 C CG2 . VAL B 1 8   ? 14.218  17.245  32.171 1.00   11.65 ? 115  VAL B CG2 1 
ATOM   1300 N N   . ILE B 1 9   ? 12.596  18.394  35.532 1.00   13.26 ? 116  ILE B N   1 
ATOM   1301 C CA  . ILE B 1 9   ? 11.958  19.686  35.668 1.00   14.68 ? 116  ILE B CA  1 
ATOM   1302 C C   . ILE B 1 9   ? 13.080  20.694  35.785 1.00   16.09 ? 116  ILE B C   1 
ATOM   1303 O O   . ILE B 1 9   ? 13.952  20.590  36.681 1.00   18.38 ? 116  ILE B O   1 
ATOM   1304 C CB  . ILE B 1 9   ? 11.026  19.759  36.895 1.00   14.39 ? 116  ILE B CB  1 
ATOM   1305 C CG1 . ILE B 1 9   ? 9.888   18.742  36.796 1.00   15.71 ? 116  ILE B CG1 1 
ATOM   1306 C CG2 . ILE B 1 9   ? 10.561  21.212  37.096 1.00   15.32 ? 116  ILE B CG2 1 
ATOM   1307 C CD1 . ILE B 1 9   ? 9.220   18.461  38.061 1.00   17.80 ? 116  ILE B CD1 1 
ATOM   1308 N N   . LEU B 1 10  ? 13.087  21.622  34.852 1.00   16.10 ? 117  LEU B N   1 
ATOM   1309 C CA  . LEU B 1 10  ? 14.096  22.659  34.777 1.00   17.17 ? 117  LEU B CA  1 
ATOM   1310 C C   . LEU B 1 10  ? 13.517  24.004  35.064 1.00   16.95 ? 117  LEU B C   1 
ATOM   1311 O O   . LEU B 1 10  ? 12.327  24.234  34.863 1.00   16.36 ? 117  LEU B O   1 
ATOM   1312 C CB  . LEU B 1 10  ? 14.682  22.706  33.364 1.00   17.64 ? 117  LEU B CB  1 
ATOM   1313 C CG  . LEU B 1 10  ? 15.314  21.423  32.884 1.00   20.55 ? 117  LEU B CG  1 
ATOM   1314 C CD1 . LEU B 1 10  ? 15.799  21.562  31.466 1.00   23.35 ? 117  LEU B CD1 1 
ATOM   1315 C CD2 . LEU B 1 10  ? 16.473  21.111  33.806 1.00   23.77 ? 117  LEU B CD2 1 
ATOM   1316 N N   . CYS B 1 11  ? 14.392  24.903  35.487 1.00   17.29 ? 118  CYS B N   1 
ATOM   1317 C CA  . CYS B 1 11  ? 14.089  26.299  35.716 1.00   19.10 ? 118  CYS B CA  1 
ATOM   1318 C C   . CYS B 1 11  ? 15.130  27.129  34.985 1.00   17.68 ? 118  CYS B C   1 
ATOM   1319 O O   . CYS B 1 11  ? 16.308  26.879  35.155 1.00   16.77 ? 118  CYS B O   1 
ATOM   1320 C CB  . CYS B 1 11  ? 14.243  26.615  37.205 1.00   20.19 ? 118  CYS B CB  1 
ATOM   1321 S SG  . CYS B 1 11  ? 13.706  28.253  37.753 1.00   27.58 ? 118  CYS B SG  1 
ATOM   1322 N N   . LYS B 1 12  ? 14.687  28.111  34.208 1.00   17.22 ? 119  LYS B N   1 
ATOM   1323 C CA  . LYS B 1 12  ? 15.571  29.057  33.556 1.00   17.81 ? 119  LYS B CA  1 
ATOM   1324 C C   . LYS B 1 12  ? 16.385  29.811  34.598 1.00   19.48 ? 119  LYS B C   1 
ATOM   1325 O O   . LYS B 1 12  ? 15.872  30.118  35.696 1.00   18.89 ? 119  LYS B O   1 
ATOM   1326 C CB  . LYS B 1 12  ? 14.769  30.013  32.695 1.00   17.66 ? 119  LYS B CB  1 
ATOM   1327 C CG  . LYS B 1 12  ? 14.448  29.448  31.306 1.00   17.49 ? 119  LYS B CG  1 
ATOM   1328 C CD  . LYS B 1 12  ? 13.516  30.331  30.535 1.00   16.79 ? 119  LYS B CD  1 
ATOM   1329 C CE  . LYS B 1 12  ? 13.037  29.674  29.215 1.00   17.43 ? 119  LYS B CE  1 
ATOM   1330 N NZ  . LYS B 1 12  ? 12.348  30.575  28.280 1.00   16.10 ? 119  LYS B NZ  1 
ATOM   1331 N N   . ASP B 1 13  ? 17.661  30.039  34.288 1.00   21.15 ? 120  ASP B N   1 
ATOM   1332 C CA  . ASP B 1 13  ? 18.567  30.722  35.214 1.00   22.81 ? 120  ASP B CA  1 
ATOM   1333 C C   . ASP B 1 13  ? 18.338  32.234  35.182 1.00   24.99 ? 120  ASP B C   1 
ATOM   1334 O O   . ASP B 1 13  ? 17.404  32.727  34.533 1.00   25.19 ? 120  ASP B O   1 
ATOM   1335 C CB  . ASP B 1 13  ? 20.029  30.359  34.912 1.00   22.83 ? 120  ASP B CB  1 
ATOM   1336 C CG  . ASP B 1 13  ? 20.527  30.895  33.566 1.00   22.37 ? 120  ASP B CG  1 
ATOM   1337 O OD1 . ASP B 1 13  ? 19.853  31.725  32.931 1.00   19.17 ? 120  ASP B OD1 1 
ATOM   1338 O OD2 . ASP B 1 13  ? 21.605  30.506  33.058 1.00   25.80 ? 120  ASP B OD2 1 
ATOM   1339 N N   . GLN B 1 14  ? 19.204  32.987  35.862 1.00   27.15 ? 121  GLN B N   1 
ATOM   1340 C CA  . GLN B 1 14  ? 18.994  34.432  35.961 1.00   29.00 ? 121  GLN B CA  1 
ATOM   1341 C C   . GLN B 1 14  ? 19.068  35.157  34.610 1.00   29.24 ? 121  GLN B C   1 
ATOM   1342 O O   . GLN B 1 14  ? 18.533  36.251  34.471 1.00   30.10 ? 121  GLN B O   1 
ATOM   1343 C CB  . GLN B 1 14  ? 19.951  35.062  36.988 1.00   30.02 ? 121  GLN B CB  1 
ATOM   1344 C CG  . GLN B 1 14  ? 21.431  34.787  36.753 1.00   33.52 ? 121  GLN B CG  1 
ATOM   1345 C CD  . GLN B 1 14  ? 22.322  35.737  37.547 1.00   37.86 ? 121  GLN B CD  1 
ATOM   1346 O OE1 . GLN B 1 14  ? 21.925  36.205  38.622 1.00   41.23 ? 121  GLN B OE1 1 
ATOM   1347 N NE2 . GLN B 1 14  ? 23.522  36.021  37.027 1.00   39.27 ? 121  GLN B NE2 1 
ATOM   1348 N N   . ASP B 1 15  ? 19.690  34.517  33.617 1.00   28.78 ? 122  ASP B N   1 
ATOM   1349 C CA  . ASP B 1 15  ? 19.766  35.029  32.250 1.00   28.29 ? 122  ASP B CA  1 
ATOM   1350 C C   . ASP B 1 15  ? 18.639  34.549  31.333 1.00   26.39 ? 122  ASP B C   1 
ATOM   1351 O O   . ASP B 1 15  ? 18.631  34.850  30.139 1.00   26.40 ? 122  ASP B O   1 
ATOM   1352 C CB  . ASP B 1 15  ? 21.132  34.646  31.668 1.00   29.11 ? 122  ASP B CB  1 
ATOM   1353 C CG  . ASP B 1 15  ? 22.283  35.190  32.503 1.00   31.48 ? 122  ASP B CG  1 
ATOM   1354 O OD1 . ASP B 1 15  ? 22.326  36.421  32.706 1.00   34.00 ? 122  ASP B OD1 1 
ATOM   1355 O OD2 . ASP B 1 15  ? 23.168  34.480  33.030 1.00   33.95 ? 122  ASP B OD2 1 
ATOM   1356 N N   . GLY B 1 16  ? 17.665  33.828  31.895 1.00   24.38 ? 123  GLY B N   1 
ATOM   1357 C CA  . GLY B 1 16  ? 16.538  33.333  31.130 1.00   22.31 ? 123  GLY B CA  1 
ATOM   1358 C C   . GLY B 1 16  ? 16.895  32.108  30.292 1.00   21.05 ? 123  GLY B C   1 
ATOM   1359 O O   . GLY B 1 16  ? 16.212  31.802  29.337 1.00   20.80 ? 123  GLY B O   1 
ATOM   1360 N N   . LYS B 1 17  ? 17.965  31.414  30.664 1.00   19.38 ? 124  LYS B N   1 
ATOM   1361 C CA  . LYS B 1 17  ? 18.464  30.272  29.861 1.00   18.60 ? 124  LYS B CA  1 
ATOM   1362 C C   . LYS B 1 17  ? 18.378  28.969  30.598 1.00   17.01 ? 124  LYS B C   1 
ATOM   1363 O O   . LYS B 1 17  ? 18.502  28.954  31.804 1.00   17.67 ? 124  LYS B O   1 
ATOM   1364 C CB  . LYS B 1 17  ? 19.938  30.493  29.519 1.00   18.96 ? 124  LYS B CB  1 
ATOM   1365 C CG  . LYS B 1 17  ? 20.208  31.790  28.777 1.00   20.90 ? 124  LYS B CG  1 
ATOM   1366 C CD  . LYS B 1 17  ? 19.618  31.781  27.412 1.00   23.60 ? 124  LYS B CD  1 
ATOM   1367 C CE  . LYS B 1 17  ? 20.063  32.982  26.616 1.00   25.91 ? 124  LYS B CE  1 
ATOM   1368 N NZ  . LYS B 1 17  ? 19.190  33.080  25.467 1.00   27.58 ? 124  LYS B NZ  1 
ATOM   1369 N N   . ILE B 1 18  ? 18.234  27.854  29.876 1.00   16.61 ? 125  ILE B N   1 
ATOM   1370 C CA  . ILE B 1 18  ? 18.477  26.519  30.458 1.00   15.43 ? 125  ILE B CA  1 
ATOM   1371 C C   . ILE B 1 18  ? 19.789  25.877  29.968 1.00   14.47 ? 125  ILE B C   1 
ATOM   1372 O O   . ILE B 1 18  ? 20.233  24.894  30.525 1.00   12.78 ? 125  ILE B O   1 
ATOM   1373 C CB  . ILE B 1 18  ? 17.280  25.548  30.274 1.00   15.44 ? 125  ILE B CB  1 
ATOM   1374 C CG1 . ILE B 1 18  ? 16.897  25.358  28.810 1.00   15.97 ? 125  ILE B CG1 1 
ATOM   1375 C CG2 . ILE B 1 18  ? 16.059  26.035  31.121 1.00   15.93 ? 125  ILE B CG2 1 
ATOM   1376 C CD1 . ILE B 1 18  ? 16.060  24.106  28.556 1.00   15.36 ? 125  ILE B CD1 1 
ATOM   1377 N N   . GLY B 1 19  ? 20.421  26.466  28.952 1.00   13.91 ? 126  GLY B N   1 
ATOM   1378 C CA  . GLY B 1 19  ? 21.705  25.989  28.475 1.00   12.31 ? 126  GLY B CA  1 
ATOM   1379 C C   . GLY B 1 19  ? 21.566  24.815  27.533 1.00   11.29 ? 126  GLY B C   1 
ATOM   1380 O O   . GLY B 1 19  ? 22.382  23.915  27.565 1.00   10.52 ? 126  GLY B O   1 
ATOM   1381 N N   . LEU B 1 20  ? 20.556  24.863  26.680 1.00   11.62 ? 127  LEU B N   1 
ATOM   1382 C CA  . LEU B 1 20  ? 20.210  23.752  25.815 1.00   11.77 ? 127  LEU B CA  1 
ATOM   1383 C C   . LEU B 1 20  ? 19.946  24.185  24.378 1.00   11.64 ? 127  LEU B C   1 
ATOM   1384 O O   . LEU B 1 20  ? 19.202  25.131  24.127 1.00   12.15 ? 127  LEU B O   1 
ATOM   1385 C CB  . LEU B 1 20  ? 18.965  23.056  26.405 1.00   13.20 ? 127  LEU B CB  1 
ATOM   1386 C CG  . LEU B 1 20  ? 18.609  21.687  25.884 1.00   11.58 ? 127  LEU B CG  1 
ATOM   1387 C CD1 . LEU B 1 20  ? 19.764  20.718  26.156 1.00   10.03 ? 127  LEU B CD1 1 
ATOM   1388 C CD2 . LEU B 1 20  ? 17.297  21.168  26.529 1.00   11.56 ? 127  LEU B CD2 1 
ATOM   1389 N N   . ARG B 1 21  ? 20.533  23.440  23.442 1.00   11.70 ? 128  ARG B N   1 
ATOM   1390 C CA  . ARG B 1 21  ? 20.286  23.547  22.014 1.00   11.32 ? 128  ARG B CA  1 
ATOM   1391 C C   . ARG B 1 21  ? 19.772  22.204  21.498 1.00   10.65 ? 128  ARG B C   1 
ATOM   1392 O O   . ARG B 1 21  ? 20.396  21.162  21.753 1.00   10.77 ? 128  ARG B O   1 
ATOM   1393 C CB  . ARG B 1 21  ? 21.591  23.868  21.305 1.00   11.81 ? 128  ARG B CB  1 
ATOM   1394 C CG  . ARG B 1 21  ? 21.414  24.093  19.840 1.00   14.27 ? 128  ARG B CG  1 
ATOM   1395 C CD  . ARG B 1 21  ? 22.730  24.223  19.151 1.00   15.18 ? 128  ARG B CD  1 
ATOM   1396 N NE  . ARG B 1 21  ? 23.412  25.444  19.558 1.00   15.31 ? 128  ARG B NE  1 
ATOM   1397 C CZ  . ARG B 1 21  ? 24.706  25.691  19.341 1.00   16.10 ? 128  ARG B CZ  1 
ATOM   1398 N NH1 . ARG B 1 21  ? 25.486  24.791  18.774 1.00   17.28 ? 128  ARG B NH1 1 
ATOM   1399 N NH2 . ARG B 1 21  ? 25.220  26.835  19.740 1.00   17.27 ? 128  ARG B NH2 1 
ATOM   1400 N N   . LEU B 1 22  ? 18.650  22.240  20.779 1.00   10.26 ? 129  LEU B N   1 
ATOM   1401 C CA  . LEU B 1 22  ? 18.029  21.036  20.217 1.00   9.81  ? 129  LEU B CA  1 
ATOM   1402 C C   . LEU B 1 22  ? 18.033  21.062  18.681 1.00   9.58  ? 129  LEU B C   1 
ATOM   1403 O O   . LEU B 1 22  ? 18.049  22.126  18.090 1.00   10.75 ? 129  LEU B O   1 
ATOM   1404 C CB  . LEU B 1 22  ? 16.578  20.955  20.691 1.00   9.38  ? 129  LEU B CB  1 
ATOM   1405 C CG  . LEU B 1 22  ? 16.396  21.016  22.215 1.00   10.06 ? 129  LEU B CG  1 
ATOM   1406 C CD1 . LEU B 1 22  ? 14.900  21.099  22.609 1.00   11.29 ? 129  LEU B CD1 1 
ATOM   1407 C CD2 . LEU B 1 22  ? 17.063  19.800  22.835 1.00   9.84  ? 129  LEU B CD2 1 
ATOM   1408 N N   . LYS B 1 23  ? 17.917  19.883  18.065 1.00   8.84  ? 130  LYS B N   1 
ATOM   1409 C CA  . LYS B 1 23  ? 17.888  19.743  16.603 1.00   8.77  ? 130  LYS B CA  1 
ATOM   1410 C C   . LYS B 1 23  ? 16.905  18.645  16.200 1.00   9.17  ? 130  LYS B C   1 
ATOM   1411 O O   . LYS B 1 23  ? 16.828  17.602  16.850 1.00   8.37  ? 130  LYS B O   1 
ATOM   1412 C CB  . LYS B 1 23  ? 19.269  19.352  16.076 1.00   10.15 ? 130  LYS B CB  1 
ATOM   1413 C CG  . LYS B 1 23  ? 19.390  19.206  14.576 1.00   10.64 ? 130  LYS B CG  1 
ATOM   1414 C CD  . LYS B 1 23  ? 20.815  18.863  14.133 1.00   13.62 ? 130  LYS B CD  1 
ATOM   1415 C CE  . LYS B 1 23  ? 20.892  18.914  12.577 1.00   16.04 ? 130  LYS B CE  1 
ATOM   1416 N NZ  . LYS B 1 23  ? 22.230  18.443  12.042 1.00   17.77 ? 130  LYS B NZ  1 
ATOM   1417 N N   . SER B 1 24  ? 16.195  18.868  15.095 1.00   9.74  ? 131  SER B N   1 
ATOM   1418 C CA  . SER B 1 24  ? 15.342  17.842  14.503 1.00   9.49  ? 131  SER B CA  1 
ATOM   1419 C C   . SER B 1 24  ? 16.172  16.862  13.716 1.00   9.69  ? 131  SER B C   1 
ATOM   1420 O O   . SER B 1 24  ? 16.940  17.269  12.832 1.00   9.66  ? 131  SER B O   1 
ATOM   1421 C CB  . SER B 1 24  ? 14.295  18.534  13.628 1.00   10.95 ? 131  SER B CB  1 
ATOM   1422 O OG  . SER B 1 24  ? 13.511  17.649  12.865 1.00   11.96 ? 131  SER B OG  1 
ATOM   1423 N N   . ILE B 1 25  ? 16.024  15.568  14.028 1.00   9.51  ? 132  ILE B N   1 
ATOM   1424 C CA  . ILE B 1 25  ? 16.667  14.485  13.290 1.00   9.89  ? 132  ILE B CA  1 
ATOM   1425 C C   . ILE B 1 25  ? 15.644  13.368  13.189 1.00   9.36  ? 132  ILE B C   1 
ATOM   1426 O O   . ILE B 1 25  ? 15.092  12.949  14.193 1.00   8.99  ? 132  ILE B O   1 
ATOM   1427 C CB  . ILE B 1 25  ? 17.912  13.934  13.990 1.00   11.15 ? 132  ILE B CB  1 
ATOM   1428 C CG1 . ILE B 1 25  ? 18.874  15.055  14.372 1.00   11.91 ? 132  ILE B CG1 1 
ATOM   1429 C CG2 . ILE B 1 25  ? 18.604  12.942  13.077 1.00   12.22 ? 132  ILE B CG2 1 
ATOM   1430 C CD1 . ILE B 1 25  ? 19.975  14.597  15.234 1.00   14.74 ? 132  ILE B CD1 1 
ATOM   1431 N N   . ASP B 1 26  ? 15.372  12.925  11.967 1.00   9.61  ? 133  ASP B N   1 
ATOM   1432 C CA  . ASP B 1 26  ? 14.498  11.761  11.745 1.00   9.32  ? 133  ASP B CA  1 
ATOM   1433 C C   . ASP B 1 26  ? 13.146  11.904  12.456 1.00   8.42  ? 133  ASP B C   1 
ATOM   1434 O O   . ASP B 1 26  ? 12.619  10.948  13.026 1.00   7.32  ? 133  ASP B O   1 
ATOM   1435 C CB  . ASP B 1 26  ? 15.179  10.487  12.216 1.00   9.97  ? 133  ASP B CB  1 
ATOM   1436 C CG  . ASP B 1 26  ? 16.366  10.092  11.359 1.00   12.33 ? 133  ASP B CG  1 
ATOM   1437 O OD1 . ASP B 1 26  ? 16.534  10.614  10.251 1.00   14.85 ? 133  ASP B OD1 1 
ATOM   1438 O OD2 . ASP B 1 26  ? 17.163  9.235   11.751 1.00   15.26 ? 133  ASP B OD2 1 
ATOM   1439 N N   . ASN B 1 27  ? 12.603  13.112  12.410 1.00   8.10  ? 134  ASN B N   1 
ATOM   1440 C CA  . ASN B 1 27  ? 11.319  13.448  12.987 1.00   9.54  ? 134  ASN B CA  1 
ATOM   1441 C C   . ASN B 1 27  ? 11.205  13.314  14.509 1.00   7.90  ? 134  ASN B C   1 
ATOM   1442 O O   . ASN B 1 27  ? 10.115  13.288  15.057 1.00   8.57  ? 134  ASN B O   1 
ATOM   1443 C CB  . ASN B 1 27  ? 10.213  12.743  12.210 1.00   10.22 ? 134  ASN B CB  1 
ATOM   1444 C CG  . ASN B 1 27  ? 9.989   13.454  10.853 1.00   15.72 ? 134  ASN B CG  1 
ATOM   1445 O OD1 . ASN B 1 27  ? 9.432   14.558  10.836 1.00   20.21 ? 134  ASN B OD1 1 
ATOM   1446 N ND2 . ASN B 1 27  ? 10.522  12.885  9.748  1.00   19.46 ? 134  ASN B ND2 1 
ATOM   1447 N N   . GLY B 1 28  ? 12.361  13.305  15.158 1.00   7.30  ? 135  GLY B N   1 
ATOM   1448 C CA  . GLY B 1 28  ? 12.470  13.457  16.588 1.00   7.17  ? 135  GLY B CA  1 
ATOM   1449 C C   . GLY B 1 28  ? 13.270  14.722  16.901 1.00   6.85  ? 135  GLY B C   1 
ATOM   1450 O O   . GLY B 1 28  ? 13.662  15.475  15.998 1.00   6.85  ? 135  GLY B O   1 
ATOM   1451 N N   . ILE B 1 29  ? 13.455  14.991  18.187 1.00   6.57  ? 136  ILE B N   1 
ATOM   1452 C CA  . ILE B 1 29  ? 14.238  16.149  18.650 1.00   7.08  ? 136  ILE B CA  1 
ATOM   1453 C C   . ILE B 1 29  ? 15.331  15.624  19.583 1.00   7.03  ? 136  ILE B C   1 
ATOM   1454 O O   . ILE B 1 29  ? 15.046  14.816  20.483 1.00   6.23  ? 136  ILE B O   1 
ATOM   1455 C CB  . ILE B 1 29  ? 13.333  17.165  19.358 1.00   7.07  ? 136  ILE B CB  1 
ATOM   1456 C CG1 . ILE B 1 29  ? 12.436  17.905  18.359 1.00   8.16  ? 136  ILE B CG1 1 
ATOM   1457 C CG2 . ILE B 1 29  ? 14.141  18.182  20.201 1.00   7.84  ? 136  ILE B CG2 1 
ATOM   1458 C CD1 . ILE B 1 29  ? 13.238  18.879  17.413 1.00   9.07  ? 136  ILE B CD1 1 
ATOM   1459 N N   . PHE B 1 30  ? 16.581  16.022  19.302 1.00   6.93  ? 137  PHE B N   1 
ATOM   1460 C CA  . PHE B 1 30  ? 17.770  15.534  19.992 1.00   6.83  ? 137  PHE B CA  1 
ATOM   1461 C C   . PHE B 1 30  ? 18.589  16.678  20.530 1.00   7.94  ? 137  PHE B C   1 
ATOM   1462 O O   . PHE B 1 30  ? 18.658  17.762  19.918 1.00   9.07  ? 137  PHE B O   1 
ATOM   1463 C CB  . PHE B 1 30  ? 18.625  14.710  19.030 1.00   7.44  ? 137  PHE B CB  1 
ATOM   1464 C CG  . PHE B 1 30  ? 17.980  13.405  18.658 1.00   6.42  ? 137  PHE B CG  1 
ATOM   1465 C CD1 . PHE B 1 30  ? 17.069  13.350  17.613 1.00   7.19  ? 137  PHE B CD1 1 
ATOM   1466 C CD2 . PHE B 1 30  ? 18.284  12.251  19.362 1.00   6.86  ? 137  PHE B CD2 1 
ATOM   1467 C CE1 . PHE B 1 30  ? 16.438  12.163  17.279 1.00   7.57  ? 137  PHE B CE1 1 
ATOM   1468 C CE2 . PHE B 1 30  ? 17.670  11.030  19.022 1.00   9.24  ? 137  PHE B CE2 1 
ATOM   1469 C CZ  . PHE B 1 30  ? 16.740  10.987  17.985 1.00   9.42  ? 137  PHE B CZ  1 
ATOM   1470 N N   . VAL B 1 31  ? 19.182  16.438  21.683 1.00   8.59  ? 138  VAL B N   1 
ATOM   1471 C CA  . VAL B 1 31  ? 20.085  17.399  22.314 1.00   8.84  ? 138  VAL B CA  1 
ATOM   1472 C C   . VAL B 1 31  ? 21.359  17.538  21.464 1.00   9.93  ? 138  VAL B C   1 
ATOM   1473 O O   . VAL B 1 31  ? 22.006  16.555  21.144 1.00   9.54  ? 138  VAL B O   1 
ATOM   1474 C CB  . VAL B 1 31  ? 20.411  16.943  23.744 1.00   9.08  ? 138  VAL B CB  1 
ATOM   1475 C CG1 . VAL B 1 31  ? 21.488  17.822  24.356 1.00   9.33  ? 138  VAL B CG1 1 
ATOM   1476 C CG2 . VAL B 1 31  ? 19.150  16.924  24.595 1.00   9.36  ? 138  VAL B CG2 1 
ATOM   1477 N N   . GLN B 1 32  ? 21.686  18.771  21.082 1.00   10.73 ? 139  GLN B N   1 
ATOM   1478 C CA  . GLN B 1 32  ? 22.866  19.073  20.267 1.00   11.88 ? 139  GLN B CA  1 
ATOM   1479 C C   . GLN B 1 32  ? 23.996  19.741  21.029 1.00   12.17 ? 139  GLN B C   1 
ATOM   1480 O O   . GLN B 1 32  ? 25.170  19.625  20.635 1.00   13.65 ? 139  GLN B O   1 
ATOM   1481 C CB  . GLN B 1 32  ? 22.496  20.002  19.112 1.00   13.55 ? 139  GLN B CB  1 
ATOM   1482 C CG  . GLN B 1 32  ? 21.643  19.353  18.098 1.00   16.17 ? 139  GLN B CG  1 
ATOM   1483 C CD  . GLN B 1 32  ? 22.154  17.983  17.694 1.00   16.49 ? 139  GLN B CD  1 
ATOM   1484 O OE1 . GLN B 1 32  ? 23.209  17.892  17.072 1.00   14.95 ? 139  GLN B OE1 1 
ATOM   1485 N NE2 . GLN B 1 32  ? 21.423  16.900  18.087 1.00   16.83 ? 139  GLN B NE2 1 
ATOM   1486 N N   . LEU B 1 33  ? 23.659  20.467  22.084 1.00   10.96 ? 140  LEU B N   1 
ATOM   1487 C CA  . LEU B 1 33  ? 24.664  21.160  22.875 1.00   10.78 ? 140  LEU B CA  1 
ATOM   1488 C C   . LEU B 1 33  ? 24.112  21.458  24.240 1.00   10.97 ? 140  LEU B C   1 
ATOM   1489 O O   . LEU B 1 33  ? 23.024  21.981  24.343 1.00   11.16 ? 140  LEU B O   1 
ATOM   1490 C CB  . LEU B 1 33  ? 25.098  22.477  22.213 1.00   10.58 ? 140  LEU B CB  1 
ATOM   1491 C CG  . LEU B 1 33  ? 26.415  23.004  22.812 1.00   11.36 ? 140  LEU B CG  1 
ATOM   1492 C CD1 . LEU B 1 33  ? 27.582  22.075  22.601 1.00   12.26 ? 140  LEU B CD1 1 
ATOM   1493 C CD2 . LEU B 1 33  ? 26.668  24.356  22.229 1.00   11.68 ? 140  LEU B CD2 1 
ATOM   1494 N N   . VAL B 1 34  ? 24.885  21.125  25.282 1.00   10.65 ? 141  VAL B N   1 
ATOM   1495 C CA  . VAL B 1 34  ? 24.514  21.429  26.650 1.00   10.91 ? 141  VAL B CA  1 
ATOM   1496 C C   . VAL B 1 34  ? 25.615  22.311  27.221 1.00   11.20 ? 141  VAL B C   1 
ATOM   1497 O O   . VAL B 1 34  ? 26.773  21.910  27.253 1.00   11.38 ? 141  VAL B O   1 
ATOM   1498 C CB  . VAL B 1 34  ? 24.388  20.143  27.524 1.00   11.13 ? 141  VAL B CB  1 
ATOM   1499 C CG1 . VAL B 1 34  ? 23.938  20.492  28.931 1.00   11.80 ? 141  VAL B CG1 1 
ATOM   1500 C CG2 . VAL B 1 34  ? 23.439  19.161  26.867 1.00   10.91 ? 141  VAL B CG2 1 
ATOM   1501 N N   . GLN B 1 35  ? 25.230  23.482  27.681 1.00   12.25 ? 142  GLN B N   1 
ATOM   1502 C CA  . GLN B 1 35  ? 26.152  24.418  28.309 1.00   13.22 ? 142  GLN B CA  1 
ATOM   1503 C C   . GLN B 1 35  ? 26.635  23.861  29.645 1.00   13.87 ? 142  GLN B C   1 
ATOM   1504 O O   . GLN B 1 35  ? 25.878  23.257  30.402 1.00   13.18 ? 142  GLN B O   1 
ATOM   1505 C CB  . GLN B 1 35  ? 25.460  25.764  28.504 1.00   13.33 ? 142  GLN B CB  1 
ATOM   1506 C CG  . GLN B 1 35  ? 25.017  26.439  27.220 1.00   14.96 ? 142  GLN B CG  1 
ATOM   1507 C CD  . GLN B 1 35  ? 26.176  26.657  26.264 1.00   18.99 ? 142  GLN B CD  1 
ATOM   1508 O OE1 . GLN B 1 35  ? 26.158  26.185  25.102 1.00   21.16 ? 142  GLN B OE1 1 
ATOM   1509 N NE2 . GLN B 1 35  ? 27.198  27.366  26.746 1.00   19.01 ? 142  GLN B NE2 1 
ATOM   1510 N N   . ALA B 1 36  ? 27.926  24.035  29.913 1.00   14.69 ? 143  ALA B N   1 
ATOM   1511 C CA  . ALA B 1 36  ? 28.476  23.708  31.221 1.00   15.77 ? 143  ALA B CA  1 
ATOM   1512 C C   . ALA B 1 36  ? 27.773  24.512  32.320 1.00   16.48 ? 143  ALA B C   1 
ATOM   1513 O O   . ALA B 1 36  ? 27.386  25.685  32.131 1.00   16.33 ? 143  ALA B O   1 
ATOM   1514 C CB  . ALA B 1 36  ? 30.019  23.973  31.229 1.00   16.07 ? 143  ALA B CB  1 
ATOM   1515 N N   . ASN B 1 37  ? 27.517  23.821  33.426 1.00   17.03 ? 144  ASN B N   1 
ATOM   1516 C CA  . ASN B 1 37  ? 27.017  24.430  34.660 1.00   18.54 ? 144  ASN B CA  1 
ATOM   1517 C C   . ASN B 1 37  ? 25.685  25.149  34.443 1.00   17.58 ? 144  ASN B C   1 
ATOM   1518 O O   . ASN B 1 37  ? 25.412  26.210  34.994 1.00   19.67 ? 144  ASN B O   1 
ATOM   1519 C CB  . ASN B 1 37  ? 28.147  25.288  35.302 1.00   19.74 ? 144  ASN B CB  1 
ATOM   1520 C CG  . ASN B 1 37  ? 29.345  24.413  35.786 1.00   22.78 ? 144  ASN B CG  1 
ATOM   1521 O OD1 . ASN B 1 37  ? 30.521  24.675  35.464 1.00   27.03 ? 144  ASN B OD1 1 
ATOM   1522 N ND2 . ASN B 1 37  ? 29.032  23.333  36.508 1.00   25.77 ? 144  ASN B ND2 1 
ATOM   1523 N N   . SER B 1 38  ? 24.835  24.524  33.640 1.00   16.26 ? 145  SER B N   1 
ATOM   1524 C CA  . SER B 1 38  ? 23.542  25.065  33.286 1.00   15.20 ? 145  SER B CA  1 
ATOM   1525 C C   . SER B 1 38  ? 22.431  24.216  33.902 1.00   14.47 ? 145  SER B C   1 
ATOM   1526 O O   . SER B 1 38  ? 22.684  23.104  34.385 1.00   13.61 ? 145  SER B O   1 
ATOM   1527 C CB  . SER B 1 38  ? 23.373  25.079  31.773 1.00   14.99 ? 145  SER B CB  1 
ATOM   1528 O OG  . SER B 1 38  ? 23.455  23.739  31.287 1.00   13.15 ? 145  SER B OG  1 
ATOM   1529 N N   . PRO B 1 39  ? 21.208  24.749  33.935 1.00   13.46 ? 146  PRO B N   1 
ATOM   1530 C CA  . PRO B 1 39  ? 20.050  23.950  34.366 1.00   13.87 ? 146  PRO B CA  1 
ATOM   1531 C C   . PRO B 1 39  ? 19.946  22.631  33.645 1.00   12.63 ? 146  PRO B C   1 
ATOM   1532 O O   . PRO B 1 39  ? 19.655  21.616  34.288 1.00   12.50 ? 146  PRO B O   1 
ATOM   1533 C CB  . PRO B 1 39  ? 18.868  24.875  34.104 1.00   13.50 ? 146  PRO B CB  1 
ATOM   1534 C CG  . PRO B 1 39  ? 19.468  26.270  34.357 1.00   13.78 ? 146  PRO B CG  1 
ATOM   1535 C CD  . PRO B 1 39  ? 20.851  26.169  33.755 1.00   14.90 ? 146  PRO B CD  1 
ATOM   1536 N N   . ALA B 1 40  ? 20.263  22.634  32.344 1.00   11.41 ? 147  ALA B N   1 
ATOM   1537 C CA  . ALA B 1 40  ? 20.227  21.419  31.544 1.00   10.21 ? 147  ALA B CA  1 
ATOM   1538 C C   . ALA B 1 40  ? 21.338  20.446  31.953 1.00   9.46  ? 147  ALA B C   1 
ATOM   1539 O O   . ALA B 1 40  ? 21.094  19.264  32.104 1.00   8.89  ? 147  ALA B O   1 
ATOM   1540 C CB  . ALA B 1 40  ? 20.314  21.748  30.087 1.00   9.90  ? 147  ALA B CB  1 
ATOM   1541 N N   . SER B 1 41  ? 22.557  20.926  32.147 1.00   10.10 ? 148  SER B N   1 
ATOM   1542 C CA  . SER B 1 41  ? 23.637  20.024  32.574 1.00   11.85 ? 148  SER B CA  1 
ATOM   1543 C C   . SER B 1 41  ? 23.330  19.419  33.947 1.00   11.92 ? 148  SER B C   1 
ATOM   1544 O O   . SER B 1 41  ? 23.686  18.281  34.215 1.00   11.61 ? 148  SER B O   1 
ATOM   1545 C CB  . SER B 1 41  ? 25.037  20.687  32.561 1.00   12.28 ? 148  SER B CB  1 
ATOM   1546 O OG  . SER B 1 41  ? 25.263  21.547  33.653 1.00   16.20 ? 148  SER B OG  1 
ATOM   1547 N N   . LEU B 1 42  ? 22.654  20.185  34.789 1.00   12.12 ? 149  LEU B N   1 
ATOM   1548 C CA  . LEU B 1 42  ? 22.402  19.787  36.163 1.00   12.84 ? 149  LEU B CA  1 
ATOM   1549 C C   . LEU B 1 42  ? 21.272  18.751  36.310 1.00   13.14 ? 149  LEU B C   1 
ATOM   1550 O O   . LEU B 1 42  ? 21.035  18.249  37.408 1.00   13.35 ? 149  LEU B O   1 
ATOM   1551 C CB  . LEU B 1 42  ? 22.126  21.030  37.007 1.00   13.44 ? 149  LEU B CB  1 
ATOM   1552 C CG  . LEU B 1 42  ? 23.364  21.868  37.309 1.00   15.57 ? 149  LEU B CG  1 
ATOM   1553 C CD1 . LEU B 1 42  ? 22.908  23.219  37.840 1.00   17.75 ? 149  LEU B CD1 1 
ATOM   1554 C CD2 . LEU B 1 42  ? 24.283  21.160  38.314 1.00   16.79 ? 149  LEU B CD2 1 
ATOM   1555 N N   . VAL B 1 43  ? 20.577  18.405  35.218 1.00   11.96 ? 150  VAL B N   1 
ATOM   1556 C CA  . VAL B 1 43  ? 19.692  17.240  35.252 1.00   12.32 ? 150  VAL B CA  1 
ATOM   1557 C C   . VAL B 1 43  ? 20.275  16.109  34.390 1.00   11.68 ? 150  VAL B C   1 
ATOM   1558 O O   . VAL B 1 43  ? 19.607  15.151  34.095 1.00   12.16 ? 150  VAL B O   1 
ATOM   1559 C CB  . VAL B 1 43  ? 18.242  17.605  34.849 1.00   12.14 ? 150  VAL B CB  1 
ATOM   1560 C CG1 . VAL B 1 43  ? 17.659  18.614  35.868 1.00   14.26 ? 150  VAL B CG1 1 
ATOM   1561 C CG2 . VAL B 1 43  ? 18.174  18.149  33.430 1.00   12.85 ? 150  VAL B CG2 1 
ATOM   1562 N N   . GLY B 1 44  ? 21.547  16.221  34.032 1.00   10.27 ? 151  GLY B N   1 
ATOM   1563 C CA  . GLY B 1 44  ? 22.245  15.155  33.337 1.00   9.37  ? 151  GLY B CA  1 
ATOM   1564 C C   . GLY B 1 44  ? 22.066  15.055  31.826 1.00   8.54  ? 151  GLY B C   1 
ATOM   1565 O O   . GLY B 1 44  ? 22.472  14.055  31.216 1.00   8.75  ? 151  GLY B O   1 
ATOM   1566 N N   . LEU B 1 45  ? 21.500  16.090  31.211 1.00   8.32  ? 152  LEU B N   1 
ATOM   1567 C CA  . LEU B 1 45  ? 21.333  16.088  29.769 1.00   8.40  ? 152  LEU B CA  1 
ATOM   1568 C C   . LEU B 1 45  ? 22.666  16.136  29.072 1.00   8.46  ? 152  LEU B C   1 
ATOM   1569 O O   . LEU B 1 45  ? 23.628  16.820  29.524 1.00   8.41  ? 152  LEU B O   1 
ATOM   1570 C CB  . LEU B 1 45  ? 20.469  17.237  29.273 1.00   8.54  ? 152  LEU B CB  1 
ATOM   1571 C CG  . LEU B 1 45  ? 19.010  17.045  29.700 1.00   11.20 ? 152  LEU B CG  1 
ATOM   1572 C CD1 . LEU B 1 45  ? 18.264  18.335  29.484 1.00   12.38 ? 152  LEU B CD1 1 
ATOM   1573 C CD2 . LEU B 1 45  ? 18.388  15.927  28.901 1.00   13.70 ? 152  LEU B CD2 1 
ATOM   1574 N N   . ARG B 1 46  ? 22.694  15.443  27.953 1.00   8.78  ? 153  ARG B N   1 
ATOM   1575 C CA  . ARG B 1 46  ? 23.867  15.433  27.090 1.00   9.69  ? 153  ARG B CA  1 
ATOM   1576 C C   . ARG B 1 46  ? 23.544  15.246  25.620 1.00   9.28  ? 153  ARG B C   1 
ATOM   1577 O O   . ARG B 1 46  ? 22.490  14.752  25.245 1.00   8.14  ? 153  ARG B O   1 
ATOM   1578 C CB  . ARG B 1 46  ? 24.848  14.358  27.536 1.00   11.83 ? 153  ARG B CB  1 
ATOM   1579 C CG  . ARG B 1 46  ? 24.464  12.963  27.391 1.00   14.80 ? 153  ARG B CG  1 
ATOM   1580 C CD  . ARG B 1 46  ? 25.226  12.045  28.409 1.00   18.30 ? 153  ARG B CD  1 
ATOM   1581 N NE  . ARG B 1 46  ? 24.743  12.262  29.764 1.00   22.63 ? 153  ARG B NE  1 
ATOM   1582 C CZ  . ARG B 1 46  ? 25.371  11.864  30.877 1.00   23.19 ? 153  ARG B CZ  1 
ATOM   1583 N NH1 . ARG B 1 46  ? 26.522  11.211  30.799 1.00   26.15 ? 153  ARG B NH1 1 
ATOM   1584 N NH2 . ARG B 1 46  ? 24.853  12.136  32.077 1.00   21.72 ? 153  ARG B NH2 1 
ATOM   1585 N N   . PHE B 1 47  ? 24.526  15.602  24.795 1.00   8.49  ? 154  PHE B N   1 
ATOM   1586 C CA  . PHE B 1 47  ? 24.464  15.400  23.359 1.00   8.13  ? 154  PHE B CA  1 
ATOM   1587 C C   . PHE B 1 47  ? 23.933  14.026  23.017 1.00   8.02  ? 154  PHE B C   1 
ATOM   1588 O O   . PHE B 1 47  ? 24.399  13.010  23.539 1.00   8.82  ? 154  PHE B O   1 
ATOM   1589 C CB  . PHE B 1 47  ? 25.861  15.595  22.735 1.00   7.50  ? 154  PHE B CB  1 
ATOM   1590 C CG  . PHE B 1 47  ? 25.908  15.329  21.260 1.00   9.48  ? 154  PHE B CG  1 
ATOM   1591 C CD1 . PHE B 1 47  ? 25.677  16.344  20.366 1.00   10.69 ? 154  PHE B CD1 1 
ATOM   1592 C CD2 . PHE B 1 47  ? 26.127  14.050  20.772 1.00   10.00 ? 154  PHE B CD2 1 
ATOM   1593 C CE1 . PHE B 1 47  ? 25.705  16.078  18.991 1.00   12.20 ? 154  PHE B CE1 1 
ATOM   1594 C CE2 . PHE B 1 47  ? 26.133  13.816  19.420 1.00   10.01 ? 154  PHE B CE2 1 
ATOM   1595 C CZ  . PHE B 1 47  ? 25.951  14.839  18.556 1.00   8.77  ? 154  PHE B CZ  1 
ATOM   1596 N N   . GLY B 1 48  ? 22.954  14.010  22.121 1.00   7.31  ? 155  GLY B N   1 
ATOM   1597 C CA  . GLY B 1 48  ? 22.359  12.784  21.645 1.00   7.22  ? 155  GLY B CA  1 
ATOM   1598 C C   . GLY B 1 48  ? 21.164  12.234  22.413 1.00   6.89  ? 155  GLY B C   1 
ATOM   1599 O O   . GLY B 1 48  ? 20.455  11.336  21.899 1.00   8.28  ? 155  GLY B O   1 
ATOM   1600 N N   . ASP B 1 49  ? 20.900  12.767  23.595 1.00   6.30  ? 156  ASP B N   1 
ATOM   1601 C CA  . ASP B 1 49  ? 19.655  12.446  24.318 1.00   5.80  ? 156  ASP B CA  1 
ATOM   1602 C C   . ASP B 1 49  ? 18.470  12.885  23.447 1.00   7.18  ? 156  ASP B C   1 
ATOM   1603 O O   . ASP B 1 49  ? 18.540  13.907  22.723 1.00   6.00  ? 156  ASP B O   1 
ATOM   1604 C CB  . ASP B 1 49  ? 19.559  13.183  25.641 1.00   6.38  ? 156  ASP B CB  1 
ATOM   1605 C CG  . ASP B 1 49  ? 20.447  12.617  26.725 1.00   6.92  ? 156  ASP B CG  1 
ATOM   1606 O OD1 . ASP B 1 49  ? 20.872  11.427  26.686 1.00   6.20  ? 156  ASP B OD1 1 
ATOM   1607 O OD2 . ASP B 1 49  ? 20.743  13.346  27.700 1.00   6.34  ? 156  ASP B OD2 1 
ATOM   1608 N N   . GLN B 1 50  ? 17.400  12.107  23.519 1.00   6.53  ? 157  GLN B N   1 
ATOM   1609 C CA  . GLN B 1 50  ? 16.198  12.380  22.716 1.00   6.81  ? 157  GLN B CA  1 
ATOM   1610 C C   . GLN B 1 50  ? 15.085  12.984  23.548 1.00   6.79  ? 157  GLN B C   1 
ATOM   1611 O O   . GLN B 1 50  ? 14.779  12.502  24.652 1.00   8.83  ? 157  GLN B O   1 
ATOM   1612 C CB  . GLN B 1 50  ? 15.714  11.132  21.987 1.00   7.41  ? 157  GLN B CB  1 
ATOM   1613 C CG  . GLN B 1 50  ? 14.606  11.410  20.955 1.00   7.29  ? 157  GLN B CG  1 
ATOM   1614 C CD  . GLN B 1 50  ? 14.024  10.163  20.371 1.00   6.33  ? 157  GLN B CD  1 
ATOM   1615 O OE1 . GLN B 1 50  ? 14.607  9.097   20.485 1.00   8.70  ? 157  GLN B OE1 1 
ATOM   1616 N NE2 . GLN B 1 50  ? 12.843  10.280  19.762 1.00   5.36  ? 157  GLN B NE2 1 
ATOM   1617 N N   . VAL B 1 51  ? 14.524  14.092  23.076 1.00   6.30  ? 158  VAL B N   1 
ATOM   1618 C CA  . VAL B 1 51  ? 13.511  14.783  23.868 1.00   6.41  ? 158  VAL B CA  1 
ATOM   1619 C C   . VAL B 1 51  ? 12.148  14.389  23.306 1.00   6.46  ? 158  VAL B C   1 
ATOM   1620 O O   . VAL B 1 51  ? 11.802  14.773  22.208 1.00   7.23  ? 158  VAL B O   1 
ATOM   1621 C CB  . VAL B 1 51  ? 13.710  16.320  23.876 1.00   6.68  ? 158  VAL B CB  1 
ATOM   1622 C CG1 . VAL B 1 51  ? 12.656  17.031  24.762 1.00   8.45  ? 158  VAL B CG1 1 
ATOM   1623 C CG2 . VAL B 1 51  ? 15.127  16.678  24.259 1.00   7.72  ? 158  VAL B CG2 1 
ATOM   1624 N N   . LEU B 1 52  ? 11.375  13.651  24.083 1.00   6.54  ? 159  LEU B N   1 
ATOM   1625 C CA  . LEU B 1 52  ? 10.065  13.163  23.656 1.00   6.25  ? 159  LEU B CA  1 
ATOM   1626 C C   . LEU B 1 52  ? 8.939   14.154  23.862 1.00   6.06  ? 159  LEU B C   1 
ATOM   1627 O O   . LEU B 1 52  ? 7.999   14.259  23.039 1.00   6.40  ? 159  LEU B O   1 
ATOM   1628 C CB  . LEU B 1 52  ? 9.715   11.860  24.390 1.00   6.67  ? 159  LEU B CB  1 
ATOM   1629 C CG  . LEU B 1 52  ? 10.766  10.753  24.323 1.00   9.49  ? 159  LEU B CG  1 
ATOM   1630 C CD1 . LEU B 1 52  ? 10.224  9.471   24.912 1.00   10.70 ? 159  LEU B CD1 1 
ATOM   1631 C CD2 . LEU B 1 52  ? 11.222  10.515  22.917 1.00   10.99 ? 159  LEU B CD2 1 
ATOM   1632 N N   . GLN B 1 53  ? 8.987   14.849  24.978 1.00   6.06  ? 160  GLN B N   1 
ATOM   1633 C CA  . GLN B 1 53  ? 7.993   15.871  25.320 1.00   6.99  ? 160  GLN B CA  1 
ATOM   1634 C C   . GLN B 1 53  ? 8.653   17.047  26.018 1.00   7.37  ? 160  GLN B C   1 
ATOM   1635 O O   . GLN B 1 53  ? 9.603   16.871  26.806 1.00   7.90  ? 160  GLN B O   1 
ATOM   1636 C CB  . GLN B 1 53  ? 6.885   15.349  26.247 1.00   6.45  ? 160  GLN B CB  1 
ATOM   1637 C CG  . GLN B 1 53  ? 5.813   14.459  25.575 1.00   7.00  ? 160  GLN B CG  1 
ATOM   1638 C CD  . GLN B 1 53  ? 6.245   13.010  25.380 1.00   7.22  ? 160  GLN B CD  1 
ATOM   1639 O OE1 . GLN B 1 53  ? 6.976   12.442  26.221 1.00   8.00  ? 160  GLN B OE1 1 
ATOM   1640 N NE2 . GLN B 1 53  ? 5.753   12.382  24.302 1.00   8.75  ? 160  GLN B NE2 1 
ATOM   1641 N N   . ILE B 1 54  ? 8.084   18.232  25.784 1.00   8.00  ? 161  ILE B N   1 
ATOM   1642 C CA  . ILE B 1 54  ? 8.365   19.409  26.570 1.00   7.73  ? 161  ILE B CA  1 
ATOM   1643 C C   . ILE B 1 54  ? 7.035   19.955  27.056 1.00   7.62  ? 161  ILE B C   1 
ATOM   1644 O O   . ILE B 1 54  ? 6.128   20.184  26.270 1.00   6.66  ? 161  ILE B O   1 
ATOM   1645 C CB  . ILE B 1 54  ? 9.115   20.462  25.759 1.00   7.79  ? 161  ILE B CB  1 
ATOM   1646 C CG1 . ILE B 1 54  ? 10.452  19.914  25.276 1.00   8.48  ? 161  ILE B CG1 1 
ATOM   1647 C CG2 . ILE B 1 54  ? 9.300   21.778  26.574 1.00   7.37  ? 161  ILE B CG2 1 
ATOM   1648 C CD1 . ILE B 1 54  ? 11.174  20.852  24.394 1.00   10.41 ? 161  ILE B CD1 1 
ATOM   1649 N N   . ASN B 1 55  ? 6.922   20.153  28.354 1.00   7.59  ? 162  ASN B N   1 
ATOM   1650 C CA  . ASN B 1 55  ? 5.669   20.626  28.954 1.00   9.38  ? 162  ASN B CA  1 
ATOM   1651 C C   . ASN B 1 55  ? 4.445   19.824  28.491 1.00   10.94 ? 162  ASN B C   1 
ATOM   1652 O O   . ASN B 1 55  ? 3.344   20.349  28.320 1.00   12.49 ? 162  ASN B O   1 
ATOM   1653 C CB  . ASN B 1 55  ? 5.528   22.114  28.682 1.00   10.07 ? 162  ASN B CB  1 
ATOM   1654 C CG  . ASN B 1 55  ? 6.509   22.947  29.483 1.00   9.95  ? 162  ASN B CG  1 
ATOM   1655 O OD1 . ASN B 1 55  ? 6.904   22.566  30.597 1.00   9.17  ? 162  ASN B OD1 1 
ATOM   1656 N ND2 . ASN B 1 55  ? 6.859   24.104  28.963 1.00   11.06 ? 162  ASN B ND2 1 
ATOM   1657 N N   . GLY B 1 56  ? 4.645   18.521  28.328 1.00   12.14 ? 163  GLY B N   1 
ATOM   1658 C CA  . GLY B 1 56  ? 3.561   17.596  28.036 1.00   12.42 ? 163  GLY B CA  1 
ATOM   1659 C C   . GLY B 1 56  ? 3.230   17.464  26.571 1.00   11.67 ? 163  GLY B C   1 
ATOM   1660 O O   . GLY B 1 56  ? 2.397   16.643  26.223 1.00   13.66 ? 163  GLY B O   1 
ATOM   1661 N N   . GLU B 1 57  ? 3.861   18.282  25.727 1.00   10.54 ? 164  GLU B N   1 
ATOM   1662 C CA  . GLU B 1 57  ? 3.566   18.317  24.309 1.00   10.35 ? 164  GLU B CA  1 
ATOM   1663 C C   . GLU B 1 57  ? 4.601   17.498  23.552 1.00   8.34  ? 164  GLU B C   1 
ATOM   1664 O O   . GLU B 1 57  ? 5.802   17.555  23.862 1.00   7.90  ? 164  GLU B O   1 
ATOM   1665 C CB  . GLU B 1 57  ? 3.512   19.742  23.830 1.00   12.11 ? 164  GLU B CB  1 
ATOM   1666 C CG  . GLU B 1 57  ? 2.526   20.621  24.617 1.00   17.10 ? 164  GLU B CG  1 
ATOM   1667 C CD  . GLU B 1 57  ? 1.045   20.237  24.438 1.00   24.21 ? 164  GLU B CD  1 
ATOM   1668 O OE1 . GLU B 1 57  ? 0.572   20.190  23.286 1.00   29.26 ? 164  GLU B OE1 1 
ATOM   1669 O OE2 . GLU B 1 57  ? 0.330   20.018  25.461 1.00   27.62 ? 164  GLU B OE2 1 
ATOM   1670 N N   . ASN B 1 58  ? 4.147   16.675  22.611 1.00   7.26  ? 165  ASN B N   1 
ATOM   1671 C CA  . ASN B 1 58  ? 5.054   15.842  21.817 1.00   7.39  ? 165  ASN B CA  1 
ATOM   1672 C C   . ASN B 1 58  ? 5.983   16.680  20.937 1.00   7.54  ? 165  ASN B C   1 
ATOM   1673 O O   . ASN B 1 58  ? 5.514   17.557  20.209 1.00   7.69  ? 165  ASN B O   1 
ATOM   1674 C CB  . ASN B 1 58  ? 4.280   14.889  20.901 1.00   7.59  ? 165  ASN B CB  1 
ATOM   1675 C CG  . ASN B 1 58  ? 3.290   13.989  21.661 1.00   9.46  ? 165  ASN B CG  1 
ATOM   1676 O OD1 . ASN B 1 58  ? 3.563   13.569  22.769 1.00   9.79  ? 165  ASN B OD1 1 
ATOM   1677 N ND2 . ASN B 1 58  ? 2.140   13.692  21.035 1.00   11.93 ? 165  ASN B ND2 1 
ATOM   1678 N N   . CYS B 1 59  ? 7.269   16.354  20.951 1.00   6.72  ? 166  CYS B N   1 
ATOM   1679 C CA  . CYS B 1 59  ? 8.249   17.008  20.101 1.00   7.63  ? 166  CYS B CA  1 
ATOM   1680 C C   . CYS B 1 59  ? 8.292   16.456  18.695 1.00   6.95  ? 166  CYS B C   1 
ATOM   1681 O O   . CYS B 1 59  ? 8.903   17.049  17.829 1.00   7.57  ? 166  CYS B O   1 
ATOM   1682 C CB  . CYS B 1 59  ? 9.644   16.881  20.696 1.00   7.05  ? 166  CYS B CB  1 
ATOM   1683 S SG  . CYS B 1 59  ? 9.851   17.628  22.337 1.00   8.88  ? 166  CYS B SG  1 
ATOM   1684 N N   . ALA B 1 60  ? 7.679   15.308  18.468 1.00   7.26  ? 167  ALA B N   1 
ATOM   1685 C CA  . ALA B 1 60  ? 7.725   14.639  17.164 1.00   7.95  ? 167  ALA B CA  1 
ATOM   1686 C C   . ALA B 1 60  ? 7.377   15.592  16.023 1.00   7.34  ? 167  ALA B C   1 
ATOM   1687 O O   . ALA B 1 60  ? 6.324   16.265  16.048 1.00   7.10  ? 167  ALA B O   1 
ATOM   1688 C CB  . ALA B 1 60  ? 6.752   13.462  17.160 1.00   9.14  ? 167  ALA B CB  1 
ATOM   1689 N N   . GLY B 1 61  ? 8.273   15.631  15.039 1.00   7.39  ? 168  GLY B N   1 
ATOM   1690 C CA  . GLY B 1 61  ? 8.102   16.407  13.831 1.00   7.94  ? 168  GLY B CA  1 
ATOM   1691 C C   . GLY B 1 61  ? 8.389   17.897  13.953 1.00   8.56  ? 168  GLY B C   1 
ATOM   1692 O O   . GLY B 1 61  ? 8.271   18.631  12.944 1.00   9.86  ? 168  GLY B O   1 
ATOM   1693 N N   . TRP B 1 62  ? 8.731   18.381  15.142 1.00   7.81  ? 169  TRP B N   1 
ATOM   1694 C CA  . TRP B 1 62  ? 9.063   19.810  15.296 1.00   8.15  ? 169  TRP B CA  1 
ATOM   1695 C C   . TRP B 1 62  ? 10.354  20.080  14.517 1.00   7.59  ? 169  TRP B C   1 
ATOM   1696 O O   . TRP B 1 62  ? 11.244  19.248  14.483 1.00   6.83  ? 169  TRP B O   1 
ATOM   1697 C CB  . TRP B 1 62  ? 9.324   20.195  16.748 1.00   8.41  ? 169  TRP B CB  1 
ATOM   1698 C CG  . TRP B 1 62  ? 8.176   20.270  17.651 1.00   9.32  ? 169  TRP B CG  1 
ATOM   1699 C CD1 . TRP B 1 62  ? 6.867   20.008  17.373 1.00   10.26 ? 169  TRP B CD1 1 
ATOM   1700 C CD2 . TRP B 1 62  ? 8.236   20.618  19.027 1.00   9.97  ? 169  TRP B CD2 1 
ATOM   1701 N NE1 . TRP B 1 62  ? 6.109   20.148  18.511 1.00   10.05 ? 169  TRP B NE1 1 
ATOM   1702 C CE2 . TRP B 1 62  ? 6.926   20.536  19.542 1.00   11.10 ? 169  TRP B CE2 1 
ATOM   1703 C CE3 . TRP B 1 62  ? 9.271   21.006  19.879 1.00   11.77 ? 169  TRP B CE3 1 
ATOM   1704 C CZ2 . TRP B 1 62  ? 6.629   20.811  20.893 1.00   12.10 ? 169  TRP B CZ2 1 
ATOM   1705 C CZ3 . TRP B 1 62  ? 8.989   21.237  21.223 1.00   13.28 ? 169  TRP B CZ3 1 
ATOM   1706 C CH2 . TRP B 1 62  ? 7.681   21.153  21.706 1.00   12.95 ? 169  TRP B CH2 1 
ATOM   1707 N N   . SER B 1 63  ? 10.436  21.245  13.879 1.00   7.73  ? 170  SER B N   1 
ATOM   1708 C CA  . SER B 1 63  ? 11.657  21.670  13.226 1.00   7.86  ? 170  SER B CA  1 
ATOM   1709 C C   . SER B 1 63  ? 12.629  22.125  14.297 1.00   8.07  ? 170  SER B C   1 
ATOM   1710 O O   . SER B 1 63  ? 12.232  22.381  15.427 1.00   8.64  ? 170  SER B O   1 
ATOM   1711 C CB  . SER B 1 63  ? 11.367  22.823  12.270 1.00   7.83  ? 170  SER B CB  1 
ATOM   1712 O OG  . SER B 1 63  ? 10.948  23.996  12.982 1.00   8.69  ? 170  SER B OG  1 
ATOM   1713 N N   . SER B 1 64  ? 13.896  22.296  13.937 1.00   8.14  ? 171  SER B N   1 
ATOM   1714 C CA  . SER B 1 64  ? 14.869  22.853  14.877 1.00   7.96  ? 171  SER B CA  1 
ATOM   1715 C C   . SER B 1 64  ? 14.466  24.256  15.313 1.00   7.42  ? 171  SER B C   1 
ATOM   1716 O O   . SER B 1 64  ? 14.599  24.601  16.490 1.00   7.18  ? 171  SER B O   1 
ATOM   1717 C CB  . SER B 1 64  ? 16.267  22.871  14.269 1.00   7.98  ? 171  SER B CB  1 
ATOM   1718 O OG  . SER B 1 64  ? 16.681  21.564  13.913 1.00   8.40  ? 171  SER B OG  1 
ATOM   1719 N N   . ASP B 1 65  ? 13.954  25.077  14.396 1.00   7.20  ? 172  ASP B N   1 
ATOM   1720 C CA  . ASP B 1 65  ? 13.566  26.465  14.766 1.00   8.20  ? 172  ASP B CA  1 
ATOM   1721 C C   . ASP B 1 65  ? 12.375  26.451  15.709 1.00   8.32  ? 172  ASP B C   1 
ATOM   1722 O O   . ASP B 1 65  ? 12.271  27.301  16.590 1.00   8.23  ? 172  ASP B O   1 
ATOM   1723 C CB  . ASP B 1 65  ? 13.165  27.312  13.570 1.00   8.05  ? 172  ASP B CB  1 
ATOM   1724 C CG  . ASP B 1 65  ? 14.334  27.666  12.650 1.00   9.27  ? 172  ASP B CG  1 
ATOM   1725 O OD1 . ASP B 1 65  ? 15.530  27.394  12.956 1.00   8.61  ? 172  ASP B OD1 1 
ATOM   1726 O OD2 . ASP B 1 65  ? 14.101  28.266  11.579 1.00   9.09  ? 172  ASP B OD2 1 
ATOM   1727 N N   . LYS B 1 66  ? 11.436  25.531  15.485 1.00   8.74  ? 173  LYS B N   1 
ATOM   1728 C CA  . LYS B 1 66  ? 10.291  25.424  16.394 1.00   9.32  ? 173  LYS B CA  1 
ATOM   1729 C C   . LYS B 1 66  ? 10.745  25.054  17.807 1.00   9.69  ? 173  LYS B C   1 
ATOM   1730 O O   . LYS B 1 66  ? 10.272  25.627  18.781 1.00   10.41 ? 173  LYS B O   1 
ATOM   1731 C CB  . LYS B 1 66  ? 9.261   24.410  15.909 1.00   10.34 ? 173  LYS B CB  1 
ATOM   1732 C CG  . LYS B 1 66  ? 8.005   24.279  16.853 1.00   10.44 ? 173  LYS B CG  1 
ATOM   1733 C CD  . LYS B 1 66  ? 6.790   23.567  16.158 1.00   13.33 ? 173  LYS B CD  1 
ATOM   1734 C CE  . LYS B 1 66  ? 5.568   23.448  17.122 1.00   14.80 ? 173  LYS B CE  1 
ATOM   1735 N NZ  . LYS B 1 66  ? 4.435   22.712  16.469 1.00   15.97 ? 173  LYS B NZ  1 
ATOM   1736 N N   . ALA B 1 67  ? 11.653  24.099  17.927 1.00   9.49  ? 174  ALA B N   1 
ATOM   1737 C CA  . ALA B 1 67  ? 12.142  23.713  19.246 1.00   10.07 ? 174  ALA B CA  1 
ATOM   1738 C C   . ALA B 1 67  ? 12.825  24.875  19.957 1.00   10.85 ? 174  ALA B C   1 
ATOM   1739 O O   . ALA B 1 67  ? 12.602  25.101  21.153 1.00   11.52 ? 174  ALA B O   1 
ATOM   1740 C CB  . ALA B 1 67  ? 13.057  22.503  19.147 1.00   10.41 ? 174  ALA B CB  1 
ATOM   1741 N N   . HIS B 1 68  ? 13.608  25.655  19.206 1.00   11.74 ? 175  HIS B N   1 
ATOM   1742 C CA  . HIS B 1 68  ? 14.262  26.863  19.754 1.00   12.48 ? 175  HIS B CA  1 
ATOM   1743 C C   . HIS B 1 68  ? 13.218  27.839  20.287 1.00   12.78 ? 175  HIS B C   1 
ATOM   1744 O O   . HIS B 1 68  ? 13.353  28.381  21.385 1.00   12.50 ? 175  HIS B O   1 
ATOM   1745 C CB  . HIS B 1 68  ? 15.110  27.510  18.652 1.00   12.55 ? 175  HIS B CB  1 
ATOM   1746 C CG  . HIS B 1 68  ? 15.952  28.688  19.082 1.00   16.65 ? 175  HIS B CG  1 
ATOM   1747 N ND1 . HIS B 1 68  ? 15.427  29.944  19.285 1.00   22.43 ? 175  HIS B ND1 1 
ATOM   1748 C CD2 . HIS B 1 68  ? 17.295  28.815  19.238 1.00   20.01 ? 175  HIS B CD2 1 
ATOM   1749 C CE1 . HIS B 1 68  ? 16.402  30.783  19.612 1.00   23.28 ? 175  HIS B CE1 1 
ATOM   1750 N NE2 . HIS B 1 68  ? 17.548  30.120  19.598 1.00   21.82 ? 175  HIS B NE2 1 
ATOM   1751 N N   . LYS B 1 69  ? 12.170  28.051  19.512 1.00   12.92 ? 176  LYS B N   1 
ATOM   1752 C CA  . LYS B 1 69  ? 11.114  28.968  19.876 1.00   15.01 ? 176  LYS B CA  1 
ATOM   1753 C C   . LYS B 1 69  ? 10.375  28.519  21.147 1.00   14.60 ? 176  LYS B C   1 
ATOM   1754 O O   . LYS B 1 69  ? 10.053  29.335  22.003 1.00   15.34 ? 176  LYS B O   1 
ATOM   1755 C CB  . LYS B 1 69  ? 10.115  29.098  18.746 1.00   15.51 ? 176  LYS B CB  1 
ATOM   1756 C CG  . LYS B 1 69  ? 9.169   30.269  18.952 1.00   19.10 ? 176  LYS B CG  1 
ATOM   1757 C CD  . LYS B 1 69  ? 8.260   30.476  17.772 1.00   24.03 ? 176  LYS B CD  1 
ATOM   1758 C CE  . LYS B 1 69  ? 7.481   31.764  17.949 1.00   27.02 ? 176  LYS B CE  1 
ATOM   1759 N NZ  . LYS B 1 69  ? 6.043   31.566  17.610 1.00   29.98 ? 176  LYS B NZ  1 
ATOM   1760 N N   . VAL B 1 70  ? 10.096  27.224  21.233 1.00   14.29 ? 177  VAL B N   1 
ATOM   1761 C CA  . VAL B 1 70  ? 9.369   26.669  22.359 1.00   14.01 ? 177  VAL B CA  1 
ATOM   1762 C C   . VAL B 1 70  ? 10.195  26.910  23.614 1.00   14.51 ? 177  VAL B C   1 
ATOM   1763 O O   . VAL B 1 70  ? 9.615   27.335  24.604 1.00   16.29 ? 177  VAL B O   1 
ATOM   1764 C CB  . VAL B 1 70  ? 9.017   25.173  22.138 1.00   13.30 ? 177  VAL B CB  1 
ATOM   1765 C CG1 . VAL B 1 70  ? 8.480   24.515  23.422 1.00   13.75 ? 177  VAL B CG1 1 
ATOM   1766 C CG2 . VAL B 1 70  ? 8.010   25.032  21.043 1.00   14.02 ? 177  VAL B CG2 1 
ATOM   1767 N N   . LEU B 1 71  ? 11.517  26.672  23.574 1.00   14.77 ? 178  LEU B N   1 
ATOM   1768 C CA  . LEU B 1 71  ? 12.398  26.858  24.752 1.00   15.58 ? 178  LEU B CA  1 
ATOM   1769 C C   . LEU B 1 71  ? 12.518  28.335  25.111 1.00   16.76 ? 178  LEU B C   1 
ATOM   1770 O O   . LEU B 1 71  ? 12.365  28.726  26.273 1.00   17.59 ? 178  LEU B O   1 
ATOM   1771 C CB  . LEU B 1 71  ? 13.805  26.306  24.526 1.00   15.55 ? 178  LEU B CB  1 
ATOM   1772 C CG  . LEU B 1 71  ? 13.982  24.795  24.383 1.00   14.35 ? 178  LEU B CG  1 
ATOM   1773 C CD1 . LEU B 1 71  ? 15.406  24.452  24.171 1.00   16.12 ? 178  LEU B CD1 1 
ATOM   1774 C CD2 . LEU B 1 71  ? 13.404  24.082  25.613 1.00   14.48 ? 178  LEU B CD2 1 
ATOM   1775 N N   . LYS B 1 72  ? 12.773  29.167  24.109 1.00   17.26 ? 179  LYS B N   1 
ATOM   1776 C CA  . LYS B 1 72  ? 12.841  30.618  24.356 1.00   18.57 ? 179  LYS B CA  1 
ATOM   1777 C C   . LYS B 1 72  ? 11.591  31.178  25.044 1.00   18.98 ? 179  LYS B C   1 
ATOM   1778 O O   . LYS B 1 72  ? 11.691  32.042  25.950 1.00   19.41 ? 179  LYS B O   1 
ATOM   1779 C CB  . LYS B 1 72  ? 13.075  31.353  23.033 1.00   18.96 ? 179  LYS B CB  1 
ATOM   1780 C CG  . LYS B 1 72  ? 13.245  32.875  23.179 1.00   20.19 ? 179  LYS B CG  1 
ATOM   1781 C CD  . LYS B 1 72  ? 13.297  33.500  21.822 1.00   20.80 ? 179  LYS B CD  1 
ATOM   1782 C CE  . LYS B 1 72  ? 13.634  34.972  21.914 1.00   23.09 ? 179  LYS B CE  1 
ATOM   1783 N NZ  . LYS B 1 72  ? 14.116  35.393  20.602 1.00   23.89 ? 179  LYS B NZ  1 
ATOM   1784 N N   . GLN B 1 73  ? 10.432  30.712  24.617 1.00   18.77 ? 180  GLN B N   1 
ATOM   1785 C CA  . GLN B 1 73  ? 9.149   31.211  25.073 1.00   20.53 ? 180  GLN B CA  1 
ATOM   1786 C C   . GLN B 1 73  ? 8.592   30.558  26.332 1.00   19.66 ? 180  GLN B C   1 
ATOM   1787 O O   . GLN B 1 73  ? 7.631   31.043  26.937 1.00   20.71 ? 180  GLN B O   1 
ATOM   1788 C CB  . GLN B 1 73  ? 8.134   31.033  23.966 1.00   21.70 ? 180  GLN B CB  1 
ATOM   1789 C CG  . GLN B 1 73  ? 8.477   31.901  22.730 1.00   24.36 ? 180  GLN B CG  1 
ATOM   1790 C CD  . GLN B 1 73  ? 7.352   31.988  21.706 1.00   28.31 ? 180  GLN B CD  1 
ATOM   1791 O OE1 . GLN B 1 73  ? 7.256   32.994  20.976 1.00   31.88 ? 180  GLN B OE1 1 
ATOM   1792 N NE2 . GLN B 1 73  ? 6.506   30.962  21.639 1.00   28.76 ? 180  GLN B NE2 1 
ATOM   1793 N N   . ALA B 1 74  ? 9.175   29.445  26.708 1.00   18.53 ? 181  ALA B N   1 
ATOM   1794 C CA  . ALA B 1 74  ? 8.631   28.640  27.789 1.00   17.58 ? 181  ALA B CA  1 
ATOM   1795 C C   . ALA B 1 74  ? 8.707   29.413  29.111 1.00   16.50 ? 181  ALA B C   1 
ATOM   1796 O O   . ALA B 1 74  ? 9.726   30.017  29.404 1.00   16.94 ? 181  ALA B O   1 
ATOM   1797 C CB  . ALA B 1 74  ? 9.392   27.345  27.893 1.00   17.80 ? 181  ALA B CB  1 
ATOM   1798 N N   . PHE B 1 75  ? 7.618   29.379  29.867 1.00   15.82 ? 182  PHE B N   1 
ATOM   1799 C CA  . PHE B 1 75  ? 7.559   29.862  31.265 1.00   15.32 ? 182  PHE B CA  1 
ATOM   1800 C C   . PHE B 1 75  ? 8.751   29.319  32.055 1.00   15.08 ? 182  PHE B C   1 
ATOM   1801 O O   . PHE B 1 75  ? 8.985   28.110  32.103 1.00   16.50 ? 182  PHE B O   1 
ATOM   1802 C CB  . PHE B 1 75  ? 6.224   29.421  31.881 1.00   14.73 ? 182  PHE B CB  1 
ATOM   1803 C CG  . PHE B 1 75  ? 6.159   29.559  33.389 1.00   15.66 ? 182  PHE B CG  1 
ATOM   1804 C CD1 . PHE B 1 75  ? 6.330   30.788  33.969 1.00   15.52 ? 182  PHE B CD1 1 
ATOM   1805 C CD2 . PHE B 1 75  ? 5.871   28.452  34.203 1.00   15.09 ? 182  PHE B CD2 1 
ATOM   1806 C CE1 . PHE B 1 75  ? 6.238   30.930  35.355 1.00   14.67 ? 182  PHE B CE1 1 
ATOM   1807 C CE2 . PHE B 1 75  ? 5.804   28.580  35.584 1.00   14.53 ? 182  PHE B CE2 1 
ATOM   1808 C CZ  . PHE B 1 75  ? 5.984   29.841  36.152 1.00   12.97 ? 182  PHE B CZ  1 
ATOM   1809 N N   . GLY B 1 76  ? 9.524   30.200  32.669 1.00   14.99 ? 183  GLY B N   1 
ATOM   1810 C CA  . GLY B 1 76  ? 10.833  29.840  33.168 1.00   15.32 ? 183  GLY B CA  1 
ATOM   1811 C C   . GLY B 1 76  ? 10.881  28.993  34.425 1.00   14.36 ? 183  GLY B C   1 
ATOM   1812 O O   . GLY B 1 76  ? 11.841  28.253  34.650 1.00   14.94 ? 183  GLY B O   1 
ATOM   1813 N N   . GLU B 1 77  ? 9.878   29.121  35.290 1.00   13.40 ? 184  GLU B N   1 
ATOM   1814 C CA  . GLU B 1 77  ? 9.983   28.520  36.626 1.00   12.90 ? 184  GLU B CA  1 
ATOM   1815 C C   . GLU B 1 77  ? 9.744   27.026  36.629 1.00   13.24 ? 184  GLU B C   1 
ATOM   1816 O O   . GLU B 1 77  ? 10.078  26.363  37.579 1.00   13.87 ? 184  GLU B O   1 
ATOM   1817 C CB  . GLU B 1 77  ? 9.014   29.193  37.618 1.00   13.74 ? 184  GLU B CB  1 
ATOM   1818 C CG  . GLU B 1 77  ? 9.321   30.637  37.860 1.00   13.54 ? 184  GLU B CG  1 
ATOM   1819 C CD  . GLU B 1 77  ? 10.564  30.867  38.686 1.00   16.53 ? 184  GLU B CD  1 
ATOM   1820 O OE1 . GLU B 1 77  ? 10.929  30.008  39.525 1.00   12.98 ? 184  GLU B OE1 1 
ATOM   1821 O OE2 . GLU B 1 77  ? 11.167  31.947  38.496 1.00   22.44 ? 184  GLU B OE2 1 
ATOM   1822 N N   . LYS B 1 78  ? 9.121   26.487  35.597 1.00   12.44 ? 185  LYS B N   1 
ATOM   1823 C CA  . LYS B 1 78  ? 8.853   25.044  35.582 1.00   13.27 ? 185  LYS B CA  1 
ATOM   1824 C C   . LYS B 1 78  ? 8.736   24.616  34.136 1.00   12.62 ? 185  LYS B C   1 
ATOM   1825 O O   . LYS B 1 78  ? 7.729   24.886  33.510 1.00   12.43 ? 185  LYS B O   1 
ATOM   1826 C CB  . LYS B 1 78  ? 7.571   24.708  36.362 1.00   13.63 ? 185  LYS B CB  1 
ATOM   1827 C CG  . LYS B 1 78  ? 7.219   23.231  36.426 1.00   16.61 ? 185  LYS B CG  1 
ATOM   1828 C CD  . LYS B 1 78  ? 5.817   23.006  36.951 1.00   19.25 ? 185  LYS B CD  1 
ATOM   1829 C CE  . LYS B 1 78  ? 5.466   21.516  37.027 1.00   21.64 ? 185  LYS B CE  1 
ATOM   1830 N NZ  . LYS B 1 78  ? 3.976   21.284  37.024 1.00   22.46 ? 185  LYS B NZ  1 
ATOM   1831 N N   . ILE B 1 79  ? 9.795   23.985  33.626 1.00   12.26 ? 186  ILE B N   1 
ATOM   1832 C CA  . ILE B 1 79  ? 9.757   23.386  32.298 1.00   12.00 ? 186  ILE B CA  1 
ATOM   1833 C C   . ILE B 1 79  ? 9.970   21.907  32.503 1.00   11.43 ? 186  ILE B C   1 
ATOM   1834 O O   . ILE B 1 79  ? 11.024  21.474  32.984 1.00   13.17 ? 186  ILE B O   1 
ATOM   1835 C CB  . ILE B 1 79  ? 10.864  23.952  31.403 1.00   11.92 ? 186  ILE B CB  1 
ATOM   1836 C CG1 . ILE B 1 79  ? 10.741  25.465  31.254 1.00   11.69 ? 186  ILE B CG1 1 
ATOM   1837 C CG2 . ILE B 1 79  ? 10.803  23.270  30.033 1.00   13.12 ? 186  ILE B CG2 1 
ATOM   1838 C CD1 . ILE B 1 79  ? 11.995  26.105  30.858 1.00   13.74 ? 186  ILE B CD1 1 
ATOM   1839 N N   . THR B 1 80  ? 8.975   21.121  32.155 1.00   10.81 ? 187  THR B N   1 
ATOM   1840 C CA  . THR B 1 80  ? 9.102   19.684  32.215 1.00   10.72 ? 187  THR B CA  1 
ATOM   1841 C C   . THR B 1 80  ? 9.534   19.111  30.881 1.00   9.81  ? 187  THR B C   1 
ATOM   1842 O O   . THR B 1 80  ? 9.180   19.607  29.827 1.00   8.54  ? 187  THR B O   1 
ATOM   1843 C CB  . THR B 1 80  ? 7.812   19.038  32.643 1.00   11.29 ? 187  THR B CB  1 
ATOM   1844 O OG1 . THR B 1 80  ? 6.805   19.234  31.641 1.00   16.06 ? 187  THR B OG1 1 
ATOM   1845 C CG2 . THR B 1 80  ? 7.267   19.714  33.899 1.00   10.24 ? 187  THR B CG2 1 
ATOM   1846 N N   . MET B 1 81  ? 10.375  18.087  30.945 1.00   9.99  ? 188  MET B N   1 
ATOM   1847 C CA  . MET B 1 81  ? 10.785  17.387  29.739 1.00   9.51  ? 188  MET B CA  1 
ATOM   1848 C C   . MET B 1 81  ? 10.821  15.919  30.009 1.00   8.45  ? 188  MET B C   1 
ATOM   1849 O O   . MET B 1 81  ? 11.152  15.484  31.133 1.00   9.95  ? 188  MET B O   1 
ATOM   1850 C CB  . MET B 1 81  ? 12.161  17.840  29.249 1.00   10.04 ? 188  MET B CB  1 
ATOM   1851 C CG  . MET B 1 81  ? 12.284  19.316  28.943 1.00   12.16 ? 188  MET B CG  1 
ATOM   1852 S SD  . MET B 1 81  ? 13.938  19.695  28.233 1.00   16.15 ? 188  MET B SD  1 
ATOM   1853 C CE  . MET B 1 81  ? 13.779  21.341  27.975 1.00   19.53 ? 188  MET B CE  1 
ATOM   1854 N N   . THR B 1 82  ? 10.481  15.145  28.994 1.00   7.35  ? 189  THR B N   1 
ATOM   1855 C CA  . THR B 1 82  ? 10.520  13.693  29.061 1.00   7.55  ? 189  THR B CA  1 
ATOM   1856 C C   . THR B 1 82  ? 11.653  13.309  28.156 1.00   6.91  ? 189  THR B C   1 
ATOM   1857 O O   . THR B 1 82  ? 11.589  13.633  26.968 1.00   6.84  ? 189  THR B O   1 
ATOM   1858 C CB  . THR B 1 82  ? 9.187   13.112  28.541 1.00   7.47  ? 189  THR B CB  1 
ATOM   1859 O OG1 . THR B 1 82  ? 8.107   13.578  29.388 1.00   9.32  ? 189  THR B OG1 1 
ATOM   1860 C CG2 . THR B 1 82  ? 9.182   11.590  28.594 1.00   9.70  ? 189  THR B CG2 1 
ATOM   1861 N N   . ILE B 1 83  ? 12.655  12.613  28.706 1.00   6.44  ? 190  ILE B N   1 
ATOM   1862 C CA  . ILE B 1 83  ? 13.939  12.376  28.055 1.00   6.56  ? 190  ILE B CA  1 
ATOM   1863 C C   . ILE B 1 83  ? 14.191  10.879  27.861 1.00   7.17  ? 190  ILE B C   1 
ATOM   1864 O O   . ILE B 1 83  ? 14.118  10.089  28.793 1.00   7.84  ? 190  ILE B O   1 
ATOM   1865 C CB  . ILE B 1 83  ? 15.082  12.975  28.907 1.00   6.29  ? 190  ILE B CB  1 
ATOM   1866 C CG1 . ILE B 1 83  ? 14.870  14.489  29.155 1.00   7.03  ? 190  ILE B CG1 1 
ATOM   1867 C CG2 . ILE B 1 83  ? 16.445  12.651  28.300 1.00   6.17  ? 190  ILE B CG2 1 
ATOM   1868 C CD1 . ILE B 1 83  ? 14.922  15.377  27.942 1.00   8.91  ? 190  ILE B CD1 1 
ATOM   1869 N N   . ARG B 1 84  ? 14.534  10.502  26.647 1.00   6.86  ? 191  ARG B N   1 
ATOM   1870 C CA  . ARG B 1 84  ? 15.087  9.198   26.364 1.00   7.37  ? 191  ARG B CA  1 
ATOM   1871 C C   . ARG B 1 84  ? 16.592  9.316   26.260 1.00   7.34  ? 191  ARG B C   1 
ATOM   1872 O O   . ARG B 1 84  ? 17.124  10.045  25.407 1.00   7.11  ? 191  ARG B O   1 
ATOM   1873 C CB  . ARG B 1 84  ? 14.454  8.615   25.089 1.00   7.51  ? 191  ARG B CB  1 
ATOM   1874 C CG  . ARG B 1 84  ? 15.198  7.379   24.496 1.00   9.24  ? 191  ARG B CG  1 
ATOM   1875 C CD  . ARG B 1 84  ? 14.674  6.963   23.139 1.00   7.44  ? 191  ARG B CD  1 
ATOM   1876 N NE  . ARG B 1 84  ? 13.268  6.573   23.263 1.00   9.13  ? 191  ARG B NE  1 
ATOM   1877 C CZ  . ARG B 1 84  ? 12.370  6.587   22.261 1.00   10.06 ? 191  ARG B CZ  1 
ATOM   1878 N NH1 . ARG B 1 84  ? 12.684  7.006   21.052 1.00   9.31  ? 191  ARG B NH1 1 
ATOM   1879 N NH2 . ARG B 1 84  ? 11.146  6.162   22.497 1.00   11.69 ? 191  ARG B NH2 1 
ATOM   1880 N N   . ASP B 1 85  ? 17.282  8.633   27.165 1.00   7.78  ? 192  ASP B N   1 
ATOM   1881 C CA  . ASP B 1 85  ? 18.742  8.745   27.234 1.00   7.64  ? 192  ASP B CA  1 
ATOM   1882 C C   . ASP B 1 85  ? 19.310  8.217   25.919 1.00   7.88  ? 192  ASP B C   1 
ATOM   1883 O O   . ASP B 1 85  ? 18.878  7.183   25.412 1.00   7.02  ? 192  ASP B O   1 
ATOM   1884 C CB  . ASP B 1 85  ? 19.296  7.936   28.418 1.00   8.12  ? 192  ASP B CB  1 
ATOM   1885 C CG  . ASP B 1 85  ? 18.935  8.537   29.761 1.00   8.64  ? 192  ASP B CG  1 
ATOM   1886 O OD1 . ASP B 1 85  ? 18.849  9.764   29.846 1.00   8.74  ? 192  ASP B OD1 1 
ATOM   1887 O OD2 . ASP B 1 85  ? 18.716  7.856   30.790 1.00   11.23 ? 192  ASP B OD2 1 
ATOM   1888 N N   . ARG B 1 86  ? 20.310  8.938   25.433 1.00   8.33  ? 193  ARG B N   1 
ATOM   1889 C CA  . ARG B 1 86  ? 20.986  8.738   24.171 1.00   8.32  ? 193  ARG B CA  1 
ATOM   1890 C C   . ARG B 1 86  ? 20.752  7.341   23.542 1.00   9.67  ? 193  ARG B C   1 
ATOM   1891 O O   . ARG B 1 86  ? 21.351  6.334   23.941 1.00   9.90  ? 193  ARG B O   1 
ATOM   1892 C CB  . ARG B 1 86  ? 22.489  9.022   24.403 1.00   7.84  ? 193  ARG B CB  1 
ATOM   1893 C CG  . ARG B 1 86  ? 23.312  8.975   23.135 1.00   10.31 ? 193  ARG B CG  1 
ATOM   1894 C CD  . ARG B 1 86  ? 24.806  9.027   23.456 1.00   11.08 ? 193  ARG B CD  1 
ATOM   1895 N NE  . ARG B 1 86  ? 25.230  10.354  23.913 1.00   12.47 ? 193  ARG B NE  1 
ATOM   1896 C CZ  . ARG B 1 86  ? 26.318  10.606  24.654 1.00   10.94 ? 193  ARG B CZ  1 
ATOM   1897 N NH1 . ARG B 1 86  ? 27.067  9.614   25.102 1.00   10.99 ? 193  ARG B NH1 1 
ATOM   1898 N NH2 . ARG B 1 86  ? 26.661  11.871  24.935 1.00   10.13 ? 193  ARG B NH2 1 
ATOM   1899 N N   . PRO B 1 87  ? 19.844  7.252   22.580 1.00   10.46 ? 194  PRO B N   1 
ATOM   1900 C CA  . PRO B 1 87  ? 19.632  5.959   21.908 1.00   12.34 ? 194  PRO B CA  1 
ATOM   1901 C C   . PRO B 1 87  ? 20.845  5.626   21.006 1.00   14.00 ? 194  PRO B C   1 
ATOM   1902 O O   . PRO B 1 87  ? 21.501  6.535   20.535 1.00   15.79 ? 194  PRO B O   1 
ATOM   1903 C CB  . PRO B 1 87  ? 18.302  6.149   21.145 1.00   12.74 ? 194  PRO B CB  1 
ATOM   1904 C CG  . PRO B 1 87  ? 18.069  7.640   21.071 1.00   11.95 ? 194  PRO B CG  1 
ATOM   1905 C CD  . PRO B 1 87  ? 18.883  8.282   22.172 1.00   10.40 ? 194  PRO B CD  1 
ATOM   1906 N N   . PHE B 1 88  ? 21.196  4.364   20.837 1.00   15.73 ? 195  PHE B N   1 
ATOM   1907 C CA  . PHE B 1 88  ? 22.301  4.028   19.893 1.00   15.08 ? 195  PHE B CA  1 
ATOM   1908 C C   . PHE B 1 88  ? 23.726  4.310   20.384 1.00   15.81 ? 195  PHE B C   1 
ATOM   1909 O O   . PHE B 1 88  ? 24.679  4.281   19.594 1.00   17.02 ? 195  PHE B O   1 
ATOM   1910 C CB  . PHE B 1 88  ? 22.099  4.739   18.534 1.00   15.08 ? 195  PHE B CB  1 
ATOM   1911 C CG  . PHE B 1 88  ? 20.681  4.631   18.006 1.00   15.22 ? 195  PHE B CG  1 
ATOM   1912 C CD1 . PHE B 1 88  ? 20.024  3.414   18.014 1.00   15.93 ? 195  PHE B CD1 1 
ATOM   1913 C CD2 . PHE B 1 88  ? 20.000  5.759   17.555 1.00   17.42 ? 195  PHE B CD2 1 
ATOM   1914 C CE1 . PHE B 1 88  ? 18.698  3.301   17.558 1.00   14.99 ? 195  PHE B CE1 1 
ATOM   1915 C CE2 . PHE B 1 88  ? 18.668  5.649   17.085 1.00   17.93 ? 195  PHE B CE2 1 
ATOM   1916 C CZ  . PHE B 1 88  ? 18.029  4.410   17.097 1.00   16.83 ? 195  PHE B CZ  1 
ATOM   1917 N N   . GLU B 1 89  ? 23.876  4.591   21.663 1.00   16.12 ? 196  GLU B N   1 
ATOM   1918 C CA  . GLU B 1 89  ? 25.189  4.808   22.253 1.00   15.72 ? 196  GLU B CA  1 
ATOM   1919 C C   . GLU B 1 89  ? 25.964  3.500   22.280 1.00   14.86 ? 196  GLU B C   1 
ATOM   1920 O O   . GLU B 1 89  ? 25.406  2.450   22.513 1.00   14.82 ? 196  GLU B O   1 
ATOM   1921 C CB  . GLU B 1 89  ? 25.023  5.338   23.678 1.00   15.50 ? 196  GLU B CB  1 
ATOM   1922 C CG  . GLU B 1 89  ? 26.330  5.691   24.379 1.00   17.49 ? 196  GLU B CG  1 
ATOM   1923 C CD  . GLU B 1 89  ? 26.097  6.095   25.798 1.00   19.35 ? 196  GLU B CD  1 
ATOM   1924 O OE1 . GLU B 1 89  ? 25.938  7.311   26.058 1.00   19.76 ? 196  GLU B OE1 1 
ATOM   1925 O OE2 . GLU B 1 89  ? 26.048  5.187   26.659 1.00   21.69 ? 196  GLU B OE2 1 
ATOM   1926 N N   . ARG B 1 90  ? 27.269  3.592   22.052 1.00   14.31 ? 197  ARG B N   1 
ATOM   1927 C CA  . ARG B 1 90  ? 28.175  2.468   22.255 1.00   14.71 ? 197  ARG B CA  1 
ATOM   1928 C C   . ARG B 1 90  ? 29.418  2.950   22.988 1.00   13.78 ? 197  ARG B C   1 
ATOM   1929 O O   . ARG B 1 90  ? 29.949  3.994   22.644 1.00   14.57 ? 197  ARG B O   1 
ATOM   1930 C CB  . ARG B 1 90  ? 28.563  1.911   20.902 1.00   15.66 ? 197  ARG B CB  1 
ATOM   1931 C CG  . ARG B 1 90  ? 29.199  0.571   20.969 1.00   18.83 ? 197  ARG B CG  1 
ATOM   1932 C CD  . ARG B 1 90  ? 28.152  -0.534  21.215 1.00   21.48 ? 197  ARG B CD  1 
ATOM   1933 N NE  . ARG B 1 90  ? 28.721  -1.568  21.988 1.00   23.95 ? 197  ARG B NE  1 
ATOM   1934 C CZ  . ARG B 1 90  ? 28.090  -2.635  22.406 1.00   23.86 ? 197  ARG B CZ  1 
ATOM   1935 N NH1 . ARG B 1 90  ? 26.800  -2.847  22.152 1.00   22.82 ? 197  ARG B NH1 1 
ATOM   1936 N NH2 . ARG B 1 90  ? 28.776  -3.511  23.090 1.00   25.90 ? 197  ARG B NH2 1 
ATOM   1937 N N   . THR B 1 91  ? 29.862  2.218   24.005 1.00   12.95 ? 198  THR B N   1 
ATOM   1938 C CA  . THR B 1 91  ? 31.117  2.533   24.711 1.00   13.70 ? 198  THR B CA  1 
ATOM   1939 C C   . THR B 1 91  ? 32.123  1.469   24.378 1.00   13.87 ? 198  THR B C   1 
ATOM   1940 O O   . THR B 1 91  ? 31.820  0.276   24.519 1.00   13.72 ? 198  THR B O   1 
ATOM   1941 C CB  . THR B 1 91  ? 30.868  2.604   26.187 1.00   14.38 ? 198  THR B CB  1 
ATOM   1942 O OG1 . THR B 1 91  ? 29.929  3.654   26.431 1.00   13.90 ? 198  THR B OG1 1 
ATOM   1943 C CG2 . THR B 1 91  ? 32.141  2.985   26.964 1.00   15.62 ? 198  THR B CG2 1 
ATOM   1944 N N   . ILE B 1 92  ? 33.294  1.889   23.885 1.00   13.63 ? 199  ILE B N   1 
ATOM   1945 C CA  . ILE B 1 92  ? 34.338  0.959   23.479 1.00   14.52 ? 199  ILE B CA  1 
ATOM   1946 C C   . ILE B 1 92  ? 35.599  1.258   24.266 1.00   13.59 ? 199  ILE B C   1 
ATOM   1947 O O   . ILE B 1 92  ? 36.010  2.416   24.353 1.00   13.32 ? 199  ILE B O   1 
ATOM   1948 C CB  . ILE B 1 92  ? 34.571  0.994   21.976 1.00   15.70 ? 199  ILE B CB  1 
ATOM   1949 C CG1 . ILE B 1 92  ? 33.353  0.369   21.267 1.00   17.32 ? 199  ILE B CG1 1 
ATOM   1950 C CG2 . ILE B 1 92  ? 35.829  0.183   21.617 1.00   16.03 ? 199  ILE B CG2 1 
ATOM   1951 C CD1 . ILE B 1 92  ? 33.342  0.469   19.784 1.00   19.24 ? 199  ILE B CD1 1 
ATOM   1952 N N   . THR B 1 93  ? 36.150  0.219   24.888 1.00   13.07 ? 200  THR B N   1 
ATOM   1953 C CA  . THR B 1 93  ? 37.399  0.306   25.632 1.00   12.81 ? 200  THR B CA  1 
ATOM   1954 C C   . THR B 1 93  ? 38.557  -0.251  24.792 1.00   11.91 ? 200  THR B C   1 
ATOM   1955 O O   . THR B 1 93  ? 38.518  -1.401  24.321 1.00   11.49 ? 200  THR B O   1 
ATOM   1956 C CB  . THR B 1 93  ? 37.266  -0.456  26.938 1.00   13.99 ? 200  THR B CB  1 
ATOM   1957 O OG1 . THR B 1 93  ? 36.181  0.121   27.685 1.00   17.27 ? 200  THR B OG1 1 
ATOM   1958 C CG2 . THR B 1 93  ? 38.517  -0.288  27.768 1.00   14.13 ? 200  THR B CG2 1 
ATOM   1959 N N   . MET B 1 94  ? 39.568  0.585   24.593 1.00   10.05 ? 201  MET B N   1 
ATOM   1960 C CA  . MET B 1 94  ? 40.756  0.234   23.822 1.00   9.97  ? 201  MET B CA  1 
ATOM   1961 C C   . MET B 1 94  ? 41.992  0.414   24.688 1.00   10.53 ? 201  MET B C   1 
ATOM   1962 O O   . MET B 1 94  ? 41.926  1.005   25.777 1.00   9.60  ? 201  MET B O   1 
ATOM   1963 C CB  . MET B 1 94  ? 40.858  1.125   22.572 1.00   10.02 ? 201  MET B CB  1 
ATOM   1964 C CG  . MET B 1 94  ? 39.794  0.831   21.503 1.00   10.45 ? 201  MET B CG  1 
ATOM   1965 S SD  . MET B 1 94  ? 39.497  2.179   20.329 1.00   11.39 ? 201  MET B SD  1 
ATOM   1966 C CE  . MET B 1 94  ? 38.708  3.432   21.381 1.00   12.34 ? 201  MET B CE  1 
ATOM   1967 N N   . HIS B 1 95  ? 43.129  -0.054  24.169 1.00   12.01 ? 202  HIS B N   1 
ATOM   1968 C CA  . HIS B 1 95  ? 44.411  -0.025  24.884 1.00   12.65 ? 202  HIS B CA  1 
ATOM   1969 C C   . HIS B 1 95  ? 45.510  0.477   23.975 1.00   12.70 ? 202  HIS B C   1 
ATOM   1970 O O   . HIS B 1 95  ? 45.657  0.016   22.856 1.00   13.57 ? 202  HIS B O   1 
ATOM   1971 C CB  . HIS B 1 95  ? 44.736  -1.429  25.453 1.00   13.92 ? 202  HIS B CB  1 
ATOM   1972 C CG  . HIS B 1 95  ? 43.734  -1.899  26.469 1.00   17.17 ? 202  HIS B CG  1 
ATOM   1973 N ND1 . HIS B 1 95  ? 42.515  -2.451  26.119 1.00   21.39 ? 202  HIS B ND1 1 
ATOM   1974 C CD2 . HIS B 1 95  ? 43.753  -1.857  27.819 1.00   19.85 ? 202  HIS B CD2 1 
ATOM   1975 C CE1 . HIS B 1 95  ? 41.831  -2.731  27.216 1.00   22.24 ? 202  HIS B CE1 1 
ATOM   1976 N NE2 . HIS B 1 95  ? 42.562  -2.387  28.261 1.00   22.13 ? 202  HIS B NE2 1 
ATOM   1977 N N   . LYS B 1 96  ? 46.236  1.491   24.424 1.00   12.84 ? 203  LYS B N   1 
ATOM   1978 C CA  . LYS B 1 96  ? 47.385  2.041   23.681 1.00   12.97 ? 203  LYS B CA  1 
ATOM   1979 C C   . LYS B 1 96  ? 48.488  1.016   23.520 1.00   13.77 ? 203  LYS B C   1 
ATOM   1980 O O   . LYS B 1 96  ? 48.760  0.196   24.429 1.00   14.12 ? 203  LYS B O   1 
ATOM   1981 C CB  . LYS B 1 96  ? 47.961  3.249   24.405 1.00   13.30 ? 203  LYS B CB  1 
ATOM   1982 C CG  . LYS B 1 96  ? 47.076  4.443   24.353 1.00   11.45 ? 203  LYS B CG  1 
ATOM   1983 C CD  . LYS B 1 96  ? 47.740  5.683   24.952 1.00   12.57 ? 203  LYS B CD  1 
ATOM   1984 C CE  . LYS B 1 96  ? 46.871  6.904   24.703 1.00   11.71 ? 203  LYS B CE  1 
ATOM   1985 N NZ  . LYS B 1 96  ? 47.588  8.169   25.135 1.00   11.81 ? 203  LYS B NZ  1 
ATOM   1986 N N   . ASP B 1 97  ? 49.124  1.048   22.358 1.00   14.20 ? 204  ASP B N   1 
ATOM   1987 C CA  . ASP B 1 97  ? 50.256  0.151   22.089 1.00   15.94 ? 204  ASP B CA  1 
ATOM   1988 C C   . ASP B 1 97  ? 51.567  0.844   22.447 1.00   17.07 ? 204  ASP B C   1 
ATOM   1989 O O   . ASP B 1 97  ? 51.564  1.904   23.046 1.00   16.14 ? 204  ASP B O   1 
ATOM   1990 C CB  . ASP B 1 97  ? 50.251  -0.349  20.636 1.00   16.39 ? 204  ASP B CB  1 
ATOM   1991 C CG  . ASP B 1 97  ? 50.431  0.752   19.639 1.00   17.36 ? 204  ASP B CG  1 
ATOM   1992 O OD1 . ASP B 1 97  ? 50.750  1.878   20.059 1.00   15.73 ? 204  ASP B OD1 1 
ATOM   1993 O OD2 . ASP B 1 97  ? 50.268  0.599   18.406 1.00   22.07 ? 204  ASP B OD2 1 
ATOM   1994 N N   . SER B 1 98  ? 52.664  0.198   22.043 1.00   18.38 ? 205  SER B N   1 
ATOM   1995 C CA  . SER B 1 98  ? 54.027  0.599   22.360 1.00   20.07 ? 205  SER B CA  1 
ATOM   1996 C C   . SER B 1 98  ? 54.356  1.984   21.874 1.00   22.01 ? 205  SER B C   1 
ATOM   1997 O O   . SER B 1 98  ? 55.329  2.566   22.388 1.00   24.25 ? 205  SER B O   1 
ATOM   1998 C CB  . SER B 1 98  ? 55.008  -0.419  21.754 1.00   19.72 ? 205  SER B CB  1 
ATOM   1999 O OG  . SER B 1 98  ? 55.009  -1.613  22.522 1.00   17.86 ? 205  SER B OG  1 
ATOM   2000 N N   . THR B 1 99  ? 53.558  2.470   20.895 1.00   22.46 ? 206  THR B N   1 
ATOM   2001 C CA  . THR B 1 99  ? 53.586  3.808   20.257 1.00   23.55 ? 206  THR B CA  1 
ATOM   2002 C C   . THR B 1 99  ? 52.645  4.845   20.812 1.00   22.59 ? 206  THR B C   1 
ATOM   2003 O O   . THR B 1 99  ? 52.646  5.970   20.320 1.00   23.04 ? 206  THR B O   1 
ATOM   2004 C CB  . THR B 1 99  ? 53.160  3.762   18.731 1.00   24.37 ? 206  THR B CB  1 
ATOM   2005 O OG1 . THR B 1 99  ? 51.725  3.625   18.602 1.00   28.53 ? 206  THR B OG1 1 
ATOM   2006 C CG2 . THR B 1 99  ? 53.681  2.613   17.992 1.00   25.30 ? 206  THR B CG2 1 
ATOM   2007 N N   . GLY B 1 100 ? 51.782  4.475   21.760 1.00   20.28 ? 207  GLY B N   1 
ATOM   2008 C CA  . GLY B 1 100 ? 50.790  5.394   22.268 1.00   19.40 ? 207  GLY B CA  1 
ATOM   2009 C C   . GLY B 1 100 ? 49.508  5.501   21.448 1.00   19.19 ? 207  GLY B C   1 
ATOM   2010 O O   . GLY B 1 100 ? 48.713  6.395   21.688 1.00   17.83 ? 207  GLY B O   1 
ATOM   2011 N N   . HIS B 1 101 ? 49.287  4.600   20.499 1.00   19.04 ? 208  HIS B N   1 
ATOM   2012 C CA  . HIS B 1 101 ? 48.108  4.744   19.637 1.00   18.90 ? 208  HIS B CA  1 
ATOM   2013 C C   . HIS B 1 101 ? 47.093  3.656   19.909 1.00   16.62 ? 208  HIS B C   1 
ATOM   2014 O O   . HIS B 1 101 ? 47.478  2.539   20.204 1.00   15.56 ? 208  HIS B O   1 
ATOM   2015 C CB  . HIS B 1 101 ? 48.527  4.750   18.176 1.00   20.54 ? 208  HIS B CB  1 
ATOM   2016 C CG  . HIS B 1 101 ? 49.354  5.939   17.806 1.00   24.76 ? 208  HIS B CG  1 
ATOM   2017 N ND1 . HIS B 1 101 ? 49.012  7.223   18.174 1.00   29.19 ? 208  HIS B ND1 1 
ATOM   2018 C CD2 . HIS B 1 101 ? 50.504  6.040   17.105 1.00   28.19 ? 208  HIS B CD2 1 
ATOM   2019 C CE1 . HIS B 1 101 ? 49.929  8.063   17.726 1.00   30.30 ? 208  HIS B CE1 1 
ATOM   2020 N NE2 . HIS B 1 101 ? 50.839  7.370   17.065 1.00   30.26 ? 208  HIS B NE2 1 
ATOM   2021 N N   . VAL B 1 102 ? 45.799  3.991   19.842 1.00   14.80 ? 209  VAL B N   1 
ATOM   2022 C CA  . VAL B 1 102 ? 44.753  2.943   19.856 1.00   13.61 ? 209  VAL B CA  1 
ATOM   2023 C C   . VAL B 1 102 ? 44.283  2.495   18.471 1.00   12.08 ? 209  VAL B C   1 
ATOM   2024 O O   . VAL B 1 102 ? 43.812  1.375   18.333 1.00   11.51 ? 209  VAL B O   1 
ATOM   2025 C CB  . VAL B 1 102 ? 43.527  3.281   20.730 1.00   13.46 ? 209  VAL B CB  1 
ATOM   2026 C CG1 . VAL B 1 102 ? 43.925  3.353   22.201 1.00   13.14 ? 209  VAL B CG1 1 
ATOM   2027 C CG2 . VAL B 1 102 ? 42.832  4.538   20.272 1.00   14.36 ? 209  VAL B CG2 1 
ATOM   2028 N N   . GLY B 1 103 ? 44.363  3.368   17.471 1.00   11.11 ? 210  GLY B N   1 
ATOM   2029 C CA  . GLY B 1 103 ? 44.257  2.982   16.069 1.00   10.68 ? 210  GLY B CA  1 
ATOM   2030 C C   . GLY B 1 103 ? 43.111  3.574   15.263 1.00   10.24 ? 210  GLY B C   1 
ATOM   2031 O O   . GLY B 1 103 ? 42.415  2.858   14.524 1.00   10.22 ? 210  GLY B O   1 
ATOM   2032 N N   . PHE B 1 104 ? 42.894  4.878   15.359 1.00   9.98  ? 211  PHE B N   1 
ATOM   2033 C CA  . PHE B 1 104 ? 41.919  5.515   14.479 1.00   10.00 ? 211  PHE B CA  1 
ATOM   2034 C C   . PHE B 1 104 ? 42.279  6.924   14.131 1.00   11.71 ? 211  PHE B C   1 
ATOM   2035 O O   . PHE B 1 104 ? 43.097  7.546   14.808 1.00   11.52 ? 211  PHE B O   1 
ATOM   2036 C CB  . PHE B 1 104 ? 40.487  5.463   15.049 1.00   10.25 ? 211  PHE B CB  1 
ATOM   2037 C CG  . PHE B 1 104 ? 40.267  6.294   16.267 1.00   9.46  ? 211  PHE B CG  1 
ATOM   2038 C CD1 . PHE B 1 104 ? 39.815  7.608   16.165 1.00   10.34 ? 211  PHE B CD1 1 
ATOM   2039 C CD2 . PHE B 1 104 ? 40.496  5.769   17.535 1.00   10.71 ? 211  PHE B CD2 1 
ATOM   2040 C CE1 . PHE B 1 104 ? 39.621  8.397   17.342 1.00   10.97 ? 211  PHE B CE1 1 
ATOM   2041 C CE2 . PHE B 1 104 ? 40.301  6.561   18.697 1.00   11.71 ? 211  PHE B CE2 1 
ATOM   2042 C CZ  . PHE B 1 104 ? 39.841  7.863   18.581 1.00   11.28 ? 211  PHE B CZ  1 
ATOM   2043 N N   . ILE B 1 105 ? 41.672  7.368   13.033 1.00   12.07 ? 212  ILE B N   1 
ATOM   2044 C CA  . ILE B 1 105 ? 41.721  8.729   12.532 1.00   12.73 ? 212  ILE B CA  1 
ATOM   2045 C C   . ILE B 1 105 ? 40.333  9.318   12.687 1.00   12.54 ? 212  ILE B C   1 
ATOM   2046 O O   . ILE B 1 105 ? 39.344  8.608   12.580 1.00   12.80 ? 212  ILE B O   1 
ATOM   2047 C CB  . ILE B 1 105 ? 42.104  8.710   11.048 1.00   13.29 ? 212  ILE B CB  1 
ATOM   2048 C CG1 . ILE B 1 105 ? 43.454  7.977   10.846 1.00   15.64 ? 212  ILE B CG1 1 
ATOM   2049 C CG2 . ILE B 1 105 ? 42.130  10.114  10.478 1.00   15.21 ? 212  ILE B CG2 1 
ATOM   2050 C CD1 . ILE B 1 105 ? 44.585  8.551   11.607 1.00   19.17 ? 212  ILE B CD1 1 
ATOM   2051 N N   . PHE B 1 106 ? 40.265  10.624  12.920 1.00   12.36 ? 213  PHE B N   1 
ATOM   2052 C CA  . PHE B 1 106 ? 39.004  11.339  13.021 1.00   11.57 ? 213  PHE B CA  1 
ATOM   2053 C C   . PHE B 1 106 ? 39.137  12.750  12.444 1.00   12.28 ? 213  PHE B C   1 
ATOM   2054 O O   . PHE B 1 106 ? 40.247  13.318  12.356 1.00   12.45 ? 213  PHE B O   1 
ATOM   2055 C CB  . PHE B 1 106 ? 38.507  11.391  14.486 1.00   11.46 ? 213  PHE B CB  1 
ATOM   2056 C CG  . PHE B 1 106 ? 39.366  12.249  15.374 1.00   10.01 ? 213  PHE B CG  1 
ATOM   2057 C CD1 . PHE B 1 106 ? 39.044  13.572  15.592 1.00   9.77  ? 213  PHE B CD1 1 
ATOM   2058 C CD2 . PHE B 1 106 ? 40.504  11.740  15.954 1.00   12.00 ? 213  PHE B CD2 1 
ATOM   2059 C CE1 . PHE B 1 106 ? 39.840  14.356  16.400 1.00   11.54 ? 213  PHE B CE1 1 
ATOM   2060 C CE2 . PHE B 1 106 ? 41.324  12.542  16.753 1.00   13.09 ? 213  PHE B CE2 1 
ATOM   2061 C CZ  . PHE B 1 106 ? 40.987  13.833  16.972 1.00   12.44 ? 213  PHE B CZ  1 
ATOM   2062 N N   . LYS B 1 107 ? 38.001  13.312  12.057 1.00   12.85 ? 214  LYS B N   1 
ATOM   2063 C CA  . LYS B 1 107 ? 37.936  14.665  11.493 1.00   13.92 ? 214  LYS B CA  1 
ATOM   2064 C C   . LYS B 1 107 ? 36.583  15.242  11.842 1.00   13.76 ? 214  LYS B C   1 
ATOM   2065 O O   . LYS B 1 107 ? 35.564  14.540  11.762 1.00   13.67 ? 214  LYS B O   1 
ATOM   2066 C CB  . LYS B 1 107 ? 38.156  14.634  9.971  1.00   15.29 ? 214  LYS B CB  1 
ATOM   2067 C CG  . LYS B 1 107 ? 38.373  16.007  9.315  1.00   17.66 ? 214  LYS B CG  1 
ATOM   2068 C CD  . LYS B 1 107 ? 38.632  15.895  7.861  0.0000 28.73 ? 214  LYS B CD  1 
ATOM   2069 C CE  . LYS B 1 107 ? 38.671  17.265  7.206  0.0000 31.39 ? 214  LYS B CE  1 
ATOM   2070 N NZ  . LYS B 1 107 ? 37.339  17.928  7.229  0.0000 33.74 ? 214  LYS B NZ  1 
ATOM   2071 N N   . ASN B 1 108 ? 36.590  16.519  12.225 1.00   13.77 ? 215  ASN B N   1 
ATOM   2072 C CA  . ASN B 1 108 ? 35.472  17.233  12.832 1.00   14.76 ? 215  ASN B CA  1 
ATOM   2073 C C   . ASN B 1 108 ? 34.684  16.395  13.833 1.00   13.85 ? 215  ASN B C   1 
ATOM   2074 O O   . ASN B 1 108 ? 33.452  16.285  13.750 1.00   14.30 ? 215  ASN B O   1 
ATOM   2075 C CB  . ASN B 1 108 ? 34.564  17.848  11.778 1.00   16.15 ? 215  ASN B CB  1 
ATOM   2076 C CG  . ASN B 1 108 ? 35.279  18.919  10.975 1.00   17.86 ? 215  ASN B CG  1 
ATOM   2077 O OD1 . ASN B 1 108 ? 35.497  18.715  9.810  1.00   20.22 ? 215  ASN B OD1 1 
ATOM   2078 N ND2 . ASN B 1 108 ? 35.707  20.036  11.627 1.00   20.69 ? 215  ASN B ND2 1 
ATOM   2079 N N   . GLY B 1 109 ? 35.432  15.787  14.748 1.00   12.07 ? 216  GLY B N   1 
ATOM   2080 C CA  . GLY B 1 109 ? 34.879  15.111  15.894 1.00   12.00 ? 216  GLY B CA  1 
ATOM   2081 C C   . GLY B 1 109 ? 34.197  13.791  15.535 1.00   12.56 ? 216  GLY B C   1 
ATOM   2082 O O   . GLY B 1 109 ? 33.474  13.240  16.382 1.00   12.01 ? 216  GLY B O   1 
ATOM   2083 N N   . LYS B 1 110 ? 34.411  13.300  14.309 1.00   12.35 ? 217  LYS B N   1 
ATOM   2084 C CA  . LYS B 1 110 ? 33.777  12.063  13.831 1.00   13.63 ? 217  LYS B CA  1 
ATOM   2085 C C   . LYS B 1 110 ? 34.854  11.086  13.338 1.00   12.86 ? 217  LYS B C   1 
ATOM   2086 O O   . LYS B 1 110 ? 35.738  11.471  12.608 1.00   11.57 ? 217  LYS B O   1 
ATOM   2087 C CB  . LYS B 1 110 ? 32.805  12.427  12.699 1.00   15.34 ? 217  LYS B CB  1 
ATOM   2088 C CG  . LYS B 1 110 ? 32.176  11.348  11.960 1.00   19.81 ? 217  LYS B CG  1 
ATOM   2089 C CD  . LYS B 1 110 ? 31.125  11.930  10.987 1.00   23.22 ? 217  LYS B CD  1 
ATOM   2090 C CE  . LYS B 1 110 ? 31.687  12.124  9.603  1.00   26.16 ? 217  LYS B CE  1 
ATOM   2091 N NZ  . LYS B 1 110 ? 30.617  12.661  8.699  1.00   29.80 ? 217  LYS B NZ  1 
ATOM   2092 N N   . ILE B 1 111 ? 34.765  9.827   13.763 1.00   11.82 ? 218  ILE B N   1 
ATOM   2093 C CA  . ILE B 1 111 ? 35.741  8.817   13.383 1.00   12.00 ? 218  ILE B CA  1 
ATOM   2094 C C   . ILE B 1 111 ? 35.652  8.586   11.880 1.00   11.90 ? 218  ILE B C   1 
ATOM   2095 O O   . ILE B 1 111 ? 34.553  8.429   11.352 1.00   12.03 ? 218  ILE B O   1 
ATOM   2096 C CB  . ILE B 1 111 ? 35.482  7.520   14.168 1.00   11.66 ? 218  ILE B CB  1 
ATOM   2097 C CG1 . ILE B 1 111 ? 35.660  7.766   15.660 1.00   12.55 ? 218  ILE B CG1 1 
ATOM   2098 C CG2 . ILE B 1 111 ? 36.427  6.386   13.734 1.00   11.92 ? 218  ILE B CG2 1 
ATOM   2099 C CD1 . ILE B 1 111 ? 34.901  6.783   16.541 1.00   11.70 ? 218  ILE B CD1 1 
ATOM   2100 N N   . THR B 1 112 ? 36.801  8.564   11.204 1.00   11.54 ? 219  THR B N   1 
ATOM   2101 C CA  . THR B 1 112 ? 36.845  8.408   9.742  1.00   12.18 ? 219  THR B CA  1 
ATOM   2102 C C   . THR B 1 112 ? 37.590  7.186   9.223  1.00   12.30 ? 219  THR B C   1 
ATOM   2103 O O   . THR B 1 112 ? 37.354  6.788   8.100  1.00   12.64 ? 219  THR B O   1 
ATOM   2104 C CB  . THR B 1 112 ? 37.446  9.628   9.081  1.00   12.52 ? 219  THR B CB  1 
ATOM   2105 O OG1 . THR B 1 112 ? 38.701  9.934   9.706  1.00   12.42 ? 219  THR B OG1 1 
ATOM   2106 C CG2 . THR B 1 112 ? 36.571  10.843  9.290  1.00   13.00 ? 219  THR B CG2 1 
ATOM   2107 N N   . SER B 1 113 ? 38.530  6.640   9.983  1.00   12.09 ? 220  SER B N   1 
ATOM   2108 C CA  . SER B 1 113 ? 39.175  5.402   9.573  1.00   12.78 ? 220  SER B CA  1 
ATOM   2109 C C   . SER B 1 113 ? 39.737  4.653   10.751 1.00   12.16 ? 220  SER B C   1 
ATOM   2110 O O   . SER B 1 113 ? 39.982  5.217   11.807 1.00   11.11 ? 220  SER B O   1 
ATOM   2111 C CB  . SER B 1 113 ? 40.240  5.616   8.488  1.00   14.35 ? 220  SER B CB  1 
ATOM   2112 O OG  . SER B 1 113 ? 41.327  6.361   8.967  1.00   16.47 ? 220  SER B OG  1 
ATOM   2113 N N   . ILE B 1 114 ? 39.867  3.345   10.563 1.00   11.92 ? 221  ILE B N   1 
ATOM   2114 C CA  . ILE B 1 114 ? 40.310  2.426   11.605 1.00   11.85 ? 221  ILE B CA  1 
ATOM   2115 C C   . ILE B 1 114 ? 41.590  1.790   11.096 1.00   12.21 ? 221  ILE B C   1 
ATOM   2116 O O   . ILE B 1 114 ? 41.606  1.203   9.999  1.00   13.05 ? 221  ILE B O   1 
ATOM   2117 C CB  . ILE B 1 114 ? 39.273  1.296   11.821 1.00   12.07 ? 221  ILE B CB  1 
ATOM   2118 C CG1 . ILE B 1 114 ? 37.855  1.843   12.040 1.00   11.55 ? 221  ILE B CG1 1 
ATOM   2119 C CG2 . ILE B 1 114 ? 39.718  0.369   12.951 1.00   13.41 ? 221  ILE B CG2 1 
ATOM   2120 C CD1 . ILE B 1 114 ? 37.730  2.809   13.203 1.00   11.21 ? 221  ILE B CD1 1 
ATOM   2121 N N   . VAL B 1 115 ? 42.630  1.843   11.906 1.00   12.25 ? 222  VAL B N   1 
ATOM   2122 C CA  . VAL B 1 115 ? 43.936  1.275   11.553 1.00   13.06 ? 222  VAL B CA  1 
ATOM   2123 C C   . VAL B 1 115 ? 43.964  -0.252  11.668 1.00   13.84 ? 222  VAL B C   1 
ATOM   2124 O O   . VAL B 1 115 ? 43.556  -0.824  12.657 1.00   12.61 ? 222  VAL B O   1 
ATOM   2125 C CB  . VAL B 1 115 ? 45.021  1.872   12.447 1.00   12.89 ? 222  VAL B CB  1 
ATOM   2126 C CG1 . VAL B 1 115 ? 46.408  1.297   12.093 1.00   13.18 ? 222  VAL B CG1 1 
ATOM   2127 C CG2 . VAL B 1 115 ? 45.017  3.375   12.296 1.00   14.09 ? 222  VAL B CG2 1 
ATOM   2128 N N   . LYS B 1 116 ? 44.463  -0.911  10.627 1.00   15.66 ? 223  LYS B N   1 
ATOM   2129 C CA  . LYS B 1 116 ? 44.580  -2.360  10.631 1.00   17.32 ? 223  LYS B CA  1 
ATOM   2130 C C   . LYS B 1 116 ? 45.391  -2.880  11.806 1.00   17.04 ? 223  LYS B C   1 
ATOM   2131 O O   . LYS B 1 116 ? 46.376  -2.291  12.185 1.00   16.24 ? 223  LYS B O   1 
ATOM   2132 C CB  . LYS B 1 116 ? 45.227  -2.814  9.303  1.00   19.18 ? 223  LYS B CB  1 
ATOM   2133 C CG  . LYS B 1 116 ? 45.194  -4.295  9.087  1.00   21.55 ? 223  LYS B CG  1 
ATOM   2134 C CD  . LYS B 1 116 ? 46.235  -4.712  8.048  1.00   26.14 ? 223  LYS B CD  1 
ATOM   2135 C CE  . LYS B 1 116 ? 46.242  -6.213  7.858  1.00   28.26 ? 223  LYS B CE  1 
ATOM   2136 N NZ  . LYS B 1 116 ? 44.908  -6.728  7.413  1.00   29.67 ? 223  LYS B NZ  1 
ATOM   2137 N N   . ASP B 1 117 ? 44.915  -3.964  12.412 1.00   17.99 ? 224  ASP B N   1 
ATOM   2138 C CA  . ASP B 1 117 ? 45.586  -4.707  13.484 1.00   18.93 ? 224  ASP B CA  1 
ATOM   2139 C C   . ASP B 1 117 ? 45.783  -3.879  14.757 1.00   17.15 ? 224  ASP B C   1 
ATOM   2140 O O   . ASP B 1 117 ? 46.687  -4.155  15.557 1.00   17.69 ? 224  ASP B O   1 
ATOM   2141 C CB  . ASP B 1 117 ? 46.944  -5.300  13.049 1.00   20.22 ? 224  ASP B CB  1 
ATOM   2142 C CG  . ASP B 1 117 ? 46.822  -6.395  11.981 1.00   24.69 ? 224  ASP B CG  1 
ATOM   2143 O OD1 . ASP B 1 117 ? 45.698  -6.850  11.589 1.00   29.02 ? 224  ASP B OD1 1 
ATOM   2144 O OD2 . ASP B 1 117 ? 47.845  -6.828  11.434 1.00   28.04 ? 224  ASP B OD2 1 
ATOM   2145 N N   . SER B 1 118 ? 44.930  -2.864  14.935 1.00   14.43 ? 225  SER B N   1 
ATOM   2146 C CA  . SER B 1 118 ? 45.008  -2.019  16.105 1.00   12.50 ? 225  SER B CA  1 
ATOM   2147 C C   . SER B 1 118 ? 43.977  -2.433  17.156 1.00   11.63 ? 225  SER B C   1 
ATOM   2148 O O   . SER B 1 118 ? 43.088  -3.251  16.882 1.00   11.31 ? 225  SER B O   1 
ATOM   2149 C CB  . SER B 1 118 ? 44.763  -0.571  15.712 1.00   11.75 ? 225  SER B CB  1 
ATOM   2150 O OG  . SER B 1 118 ? 43.394  -0.397  15.360 1.00   10.58 ? 225  SER B OG  1 
ATOM   2151 N N   . SER B 1 119 ? 44.073  -1.834  18.337 1.00   10.42 ? 226  SER B N   1 
ATOM   2152 C CA  . SER B 1 119 ? 43.049  -2.020  19.361 1.00   9.97  ? 226  SER B CA  1 
ATOM   2153 C C   . SER B 1 119 ? 41.660  -1.588  18.857 1.00   9.43  ? 226  SER B C   1 
ATOM   2154 O O   . SER B 1 119 ? 40.660  -2.225  19.178 1.00   9.70  ? 226  SER B O   1 
ATOM   2155 C CB  . SER B 1 119 ? 43.396  -1.257  20.636 1.00   10.20 ? 226  SER B CB  1 
ATOM   2156 O OG  . SER B 1 119 ? 42.548  -1.620  21.695 1.00   10.64 ? 226  SER B OG  1 
ATOM   2157 N N   . ALA B 1 120 ? 41.586  -0.507  18.087 1.00   9.42  ? 227  ALA B N   1 
ATOM   2158 C CA  . ALA B 1 120 ? 40.305  -0.023  17.584 1.00   9.04  ? 227  ALA B CA  1 
ATOM   2159 C C   . ALA B 1 120 ? 39.693  -1.069  16.661 1.00   9.66  ? 227  ALA B C   1 
ATOM   2160 O O   . ALA B 1 120 ? 38.483  -1.317  16.695 1.00   9.47  ? 227  ALA B O   1 
ATOM   2161 C CB  . ALA B 1 120 ? 40.461  1.303   16.834 1.00   8.65  ? 227  ALA B CB  1 
ATOM   2162 N N   . ALA B 1 121 ? 40.546  -1.673  15.840 1.00   9.77  ? 228  ALA B N   1 
ATOM   2163 C CA  . ALA B 1 121 ? 40.112  -2.755  14.932 1.00   9.96  ? 228  ALA B CA  1 
ATOM   2164 C C   . ALA B 1 121 ? 39.600  -3.969  15.722 1.00   10.85 ? 228  ALA B C   1 
ATOM   2165 O O   . ALA B 1 121 ? 38.506  -4.520  15.440 1.00   11.72 ? 228  ALA B O   1 
ATOM   2166 C CB  . ALA B 1 121 ? 41.239  -3.158  14.027 1.00   10.91 ? 228  ALA B CB  1 
ATOM   2167 N N   . ARG B 1 122 ? 40.356  -4.380  16.723 1.00   10.99 ? 229  ARG B N   1 
ATOM   2168 C CA  . ARG B 1 122 ? 40.004  -5.551  17.517 1.00   11.77 ? 229  ARG B CA  1 
ATOM   2169 C C   . ARG B 1 122 ? 38.658  -5.337  18.211 1.00   11.19 ? 229  ARG B C   1 
ATOM   2170 O O   . ARG B 1 122 ? 37.853  -6.259  18.320 1.00   11.62 ? 229  ARG B O   1 
ATOM   2171 C CB  . ARG B 1 122 ? 41.087  -5.841  18.564 1.00   12.63 ? 229  ARG B CB  1 
ATOM   2172 C CG  . ARG B 1 122 ? 42.346  -6.393  18.006 1.00   17.86 ? 229  ARG B CG  1 
ATOM   2173 C CD  . ARG B 1 122 ? 43.340  -6.973  19.046 1.00   22.25 ? 229  ARG B CD  1 
ATOM   2174 N NE  . ARG B 1 122 ? 43.994  -5.948  19.888 1.00   25.35 ? 229  ARG B NE  1 
ATOM   2175 C CZ  . ARG B 1 122 ? 45.004  -5.140  19.518 1.00   28.24 ? 229  ARG B CZ  1 
ATOM   2176 N NH1 . ARG B 1 122 ? 45.529  -5.182  18.289 1.00   29.34 ? 229  ARG B NH1 1 
ATOM   2177 N NH2 . ARG B 1 122 ? 45.497  -4.277  20.400 1.00   29.71 ? 229  ARG B NH2 1 
ATOM   2178 N N   . ASN B 1 123 ? 38.419  -4.102  18.659 1.00   11.39 ? 230  ASN B N   1 
ATOM   2179 C CA  . ASN B 1 123 ? 37.248  -3.761  19.448 1.00   12.17 ? 230  ASN B CA  1 
ATOM   2180 C C   . ASN B 1 123 ? 36.112  -3.168  18.594 1.00   12.01 ? 230  ASN B C   1 
ATOM   2181 O O   . ASN B 1 123 ? 35.174  -2.598  19.139 1.00   13.05 ? 230  ASN B O   1 
ATOM   2182 C CB  . ASN B 1 123 ? 37.676  -2.811  20.566 1.00   12.80 ? 230  ASN B CB  1 
ATOM   2183 C CG  . ASN B 1 123 ? 38.456  -3.500  21.638 1.00   14.83 ? 230  ASN B CG  1 
ATOM   2184 O OD1 . ASN B 1 123 ? 37.874  -4.262  22.446 1.00   19.58 ? 230  ASN B OD1 1 
ATOM   2185 N ND2 . ASN B 1 123 ? 39.779  -3.289  21.669 1.00   13.46 ? 230  ASN B ND2 1 
ATOM   2186 N N   . GLY B 1 124 ? 36.195  -3.310  17.258 1.00   10.77 ? 231  GLY B N   1 
ATOM   2187 C CA  . GLY B 1 124 ? 35.096  -2.963  16.369 1.00   10.05 ? 231  GLY B CA  1 
ATOM   2188 C C   . GLY B 1 124 ? 34.671  -1.506  16.370 1.00   9.75  ? 231  GLY B C   1 
ATOM   2189 O O   . GLY B 1 124 ? 33.488  -1.206  16.301 1.00   11.04 ? 231  GLY B O   1 
ATOM   2190 N N   . LEU B 1 125 ? 35.628  -0.596  16.505 1.00   9.26  ? 232  LEU B N   1 
ATOM   2191 C CA  . LEU B 1 125 ? 35.325  0.817   16.437 1.00   9.44  ? 232  LEU B CA  1 
ATOM   2192 C C   . LEU B 1 125 ? 34.791  1.129   15.042 1.00   9.51  ? 232  LEU B C   1 
ATOM   2193 O O   . LEU B 1 125 ? 35.316  0.626   14.030 1.00   9.72  ? 232  LEU B O   1 
ATOM   2194 C CB  . LEU B 1 125 ? 36.562  1.664   16.773 1.00   9.43  ? 232  LEU B CB  1 
ATOM   2195 C CG  . LEU B 1 125 ? 36.261  3.147   16.972 1.00   8.49  ? 232  LEU B CG  1 
ATOM   2196 C CD1 . LEU B 1 125 ? 35.464  3.370   18.264 1.00   10.57 ? 232  LEU B CD1 1 
ATOM   2197 C CD2 . LEU B 1 125 ? 37.559  3.922   17.011 1.00   8.78  ? 232  LEU B CD2 1 
ATOM   2198 N N   . LEU B 1 126 ? 33.752  1.963   14.992 1.00   9.59  ? 233  LEU B N   1 
ATOM   2199 C CA  . LEU B 1 126 ? 33.082  2.297   13.749 1.00   9.38  ? 233  LEU B CA  1 
ATOM   2200 C C   . LEU B 1 126 ? 33.303  3.740   13.298 1.00   9.17  ? 233  LEU B C   1 
ATOM   2201 O O   . LEU B 1 126 ? 33.459  4.639   14.122 1.00   8.61  ? 233  LEU B O   1 
ATOM   2202 C CB  . LEU B 1 126 ? 31.575  2.064   13.912 1.00   9.13  ? 233  LEU B CB  1 
ATOM   2203 C CG  . LEU B 1 126 ? 31.145  0.628   14.208 1.00   10.93 ? 233  LEU B CG  1 
ATOM   2204 C CD1 . LEU B 1 126 ? 29.649  0.613   14.498 1.00   11.46 ? 233  LEU B CD1 1 
ATOM   2205 C CD2 . LEU B 1 126 ? 31.482  -0.268  13.053 1.00   12.42 ? 233  LEU B CD2 1 
ATOM   2206 N N   . THR B 1 127 ? 33.280  3.951   11.977 1.00   10.13 ? 234  THR B N   1 
ATOM   2207 C CA  . THR B 1 127 ? 33.434  5.280   11.381 1.00   9.92  ? 234  THR B CA  1 
ATOM   2208 C C   . THR B 1 127 ? 32.080  5.954   11.207 1.00   10.16 ? 234  THR B C   1 
ATOM   2209 O O   . THR B 1 127 ? 31.032  5.357   11.499 1.00   9.14  ? 234  THR B O   1 
ATOM   2210 C CB  . THR B 1 127 ? 34.211  5.198   10.036 1.00   10.53 ? 234  THR B CB  1 
ATOM   2211 O OG1 . THR B 1 127 ? 33.487  4.430   9.060  1.00   10.11 ? 234  THR B OG1 1 
ATOM   2212 C CG2 . THR B 1 127 ? 35.593  4.478   10.213 1.00   12.87 ? 234  THR B CG2 1 
ATOM   2213 N N   . GLU B 1 128 ? 32.088  7.220   10.747 1.00   11.23 ? 235  GLU B N   1 
ATOM   2214 C CA  . GLU B 1 128 ? 30.858  8.009   10.633 1.00   11.53 ? 235  GLU B CA  1 
ATOM   2215 C C   . GLU B 1 128 ? 30.084  7.977   11.969 1.00   11.21 ? 235  GLU B C   1 
ATOM   2216 O O   . GLU B 1 128 ? 28.839  7.870   12.017 1.00   10.35 ? 235  GLU B O   1 
ATOM   2217 C CB  . GLU B 1 128 ? 30.024  7.504   9.453  1.00   12.87 ? 235  GLU B CB  1 
ATOM   2218 C CG  . GLU B 1 128 ? 30.665  7.860   8.112  1.00   15.88 ? 235  GLU B CG  1 
ATOM   2219 C CD  . GLU B 1 128 ? 32.014  7.203   7.836  1.00   20.35 ? 235  GLU B CD  1 
ATOM   2220 O OE1 . GLU B 1 128 ? 32.054  5.966   7.555  1.00   21.66 ? 235  GLU B OE1 1 
ATOM   2221 O OE2 . GLU B 1 128 ? 33.054  7.935   7.892  1.00   21.90 ? 235  GLU B OE2 1 
ATOM   2222 N N   . HIS B 1 129 ? 30.868  7.998   13.058 1.00   10.57 ? 236  HIS B N   1 
ATOM   2223 C CA  . HIS B 1 129 ? 30.356  8.018   14.413 1.00   9.73  ? 236  HIS B CA  1 
ATOM   2224 C C   . HIS B 1 129 ? 30.932  9.238   15.118 1.00   9.92  ? 236  HIS B C   1 
ATOM   2225 O O   . HIS B 1 129 ? 32.155  9.512   15.012 1.00   9.13  ? 236  HIS B O   1 
ATOM   2226 C CB  . HIS B 1 129 ? 30.737  6.760   15.203 1.00   9.55  ? 236  HIS B CB  1 
ATOM   2227 C CG  . HIS B 1 129 ? 29.753  5.638   15.068 1.00   9.80  ? 236  HIS B CG  1 
ATOM   2228 N ND1 . HIS B 1 129 ? 29.373  5.112   13.840 1.00   10.81 ? 236  HIS B ND1 1 
ATOM   2229 C CD2 . HIS B 1 129 ? 29.009  5.003   15.996 1.00   10.87 ? 236  HIS B CD2 1 
ATOM   2230 C CE1 . HIS B 1 129 ? 28.470  4.166   14.042 1.00   9.65  ? 236  HIS B CE1 1 
ATOM   2231 N NE2 . HIS B 1 129 ? 28.243  4.069   15.337 1.00   10.88 ? 236  HIS B NE2 1 
ATOM   2232 N N   . ASN B 1 130 ? 30.065  9.980   15.800 1.00   9.79  ? 237  ASN B N   1 
ATOM   2233 C CA  . ASN B 1 130 ? 30.515  11.120  16.629 1.00   10.88 ? 237  ASN B CA  1 
ATOM   2234 C C   . ASN B 1 130 ? 31.150  10.615  17.909 1.00   10.70 ? 237  ASN B C   1 
ATOM   2235 O O   . ASN B 1 130 ? 30.622  9.727   18.548 1.00   10.32 ? 237  ASN B O   1 
ATOM   2236 C CB  . ASN B 1 130 ? 29.348  12.062  16.955 1.00   13.04 ? 237  ASN B CB  1 
ATOM   2237 C CG  . ASN B 1 130 ? 28.838  12.791  15.738 1.00   17.22 ? 237  ASN B CG  1 
ATOM   2238 O OD1 . ASN B 1 130 ? 29.621  13.330  14.948 1.00   21.78 ? 237  ASN B OD1 1 
ATOM   2239 N ND2 . ASN B 1 130 ? 27.541  12.747  15.535 1.00   20.82 ? 237  ASN B ND2 1 
ATOM   2240 N N   . ILE B 1 131 ? 32.300  11.193  18.256 1.00   9.78  ? 238  ILE B N   1 
ATOM   2241 C CA  . ILE B 1 131 ? 32.942  10.974  19.534 1.00   9.60  ? 238  ILE B CA  1 
ATOM   2242 C C   . ILE B 1 131 ? 32.242  11.854  20.548 1.00   9.39  ? 238  ILE B C   1 
ATOM   2243 O O   . ILE B 1 131 ? 32.276  13.079  20.418 1.00   10.13 ? 238  ILE B O   1 
ATOM   2244 C CB  . ILE B 1 131 ? 34.431  11.364  19.428 1.00   9.89  ? 238  ILE B CB  1 
ATOM   2245 C CG1 . ILE B 1 131 ? 35.116  10.568  18.326 1.00   11.07 ? 238  ILE B CG1 1 
ATOM   2246 C CG2 . ILE B 1 131 ? 35.157  11.166  20.771 1.00   10.74 ? 238  ILE B CG2 1 
ATOM   2247 C CD1 . ILE B 1 131 ? 36.511  11.084  17.969 1.00   10.64 ? 238  ILE B CD1 1 
ATOM   2248 N N   . CYS B 1 132 ? 31.622  11.235  21.547 1.00   9.14  ? 239  CYS B N   1 
ATOM   2249 C CA  . CYS B 1 132 ? 30.857  11.958  22.558 1.00   9.40  ? 239  CYS B CA  1 
ATOM   2250 C C   . CYS B 1 132 ? 31.692  12.255  23.811 1.00   8.79  ? 239  CYS B C   1 
ATOM   2251 O O   . CYS B 1 132 ? 31.745  13.412  24.252 1.00   8.80  ? 239  CYS B O   1 
ATOM   2252 C CB  . CYS B 1 132 ? 29.579  11.200  22.910 1.00   9.12  ? 239  CYS B CB  1 
ATOM   2253 S SG  . CYS B 1 132 ? 28.453  11.002  21.482 1.00   11.78 ? 239  CYS B SG  1 
ATOM   2254 N N   . GLU B 1 133 ? 32.255  11.200  24.404 1.00   8.75  ? 240  GLU B N   1 
ATOM   2255 C CA  . GLU B 1 133 ? 33.071  11.286  25.607 1.00   9.71  ? 240  GLU B CA  1 
ATOM   2256 C C   . GLU B 1 133 ? 34.309  10.437  25.417 1.00   9.73  ? 240  GLU B C   1 
ATOM   2257 O O   . GLU B 1 133 ? 34.265  9.366   24.800 1.00   10.20 ? 240  GLU B O   1 
ATOM   2258 C CB  . GLU B 1 133 ? 32.329  10.751  26.831 1.00   9.60  ? 240  GLU B CB  1 
ATOM   2259 C CG  . GLU B 1 133 ? 31.187  11.601  27.347 1.00   10.74 ? 240  GLU B CG  1 
ATOM   2260 C CD  . GLU B 1 133 ? 29.839  11.294  26.712 1.00   12.66 ? 240  GLU B CD  1 
ATOM   2261 O OE1 . GLU B 1 133 ? 29.540  10.105  26.438 1.00   13.10 ? 240  GLU B OE1 1 
ATOM   2262 O OE2 . GLU B 1 133 ? 29.077  12.264  26.482 1.00   12.43 ? 240  GLU B OE2 1 
ATOM   2263 N N   . ILE B 1 134 ? 35.433  10.913  25.948 1.00   10.06 ? 241  ILE B N   1 
ATOM   2264 C CA  . ILE B 1 134 ? 36.645  10.105  26.071 1.00   10.04 ? 241  ILE B CA  1 
ATOM   2265 C C   . ILE B 1 134 ? 37.018  10.066  27.545 1.00   9.96  ? 241  ILE B C   1 
ATOM   2266 O O   . ILE B 1 134 ? 37.191  11.101  28.155 1.00   9.58  ? 241  ILE B O   1 
ATOM   2267 C CB  . ILE B 1 134 ? 37.784  10.684  25.255 1.00   10.24 ? 241  ILE B CB  1 
ATOM   2268 C CG1 . ILE B 1 134 ? 37.402  10.731  23.773 1.00   10.55 ? 241  ILE B CG1 1 
ATOM   2269 C CG2 . ILE B 1 134 ? 39.084  9.898   25.509 1.00   13.23 ? 241  ILE B CG2 1 
ATOM   2270 C CD1 . ILE B 1 134 ? 38.409  11.566  22.882 1.00   11.60 ? 241  ILE B CD1 1 
ATOM   2271 N N   . ASN B 1 135 ? 37.139  8.867   28.088 1.00   10.96 ? 242  ASN B N   1 
ATOM   2272 C CA  . ASN B 1 135 ? 37.413  8.649   29.497 1.00   12.37 ? 242  ASN B CA  1 
ATOM   2273 C C   . ASN B 1 135 ? 36.476  9.452   30.373 1.00   13.44 ? 242  ASN B C   1 
ATOM   2274 O O   . ASN B 1 135 ? 36.899  10.042  31.365 1.00   15.26 ? 242  ASN B O   1 
ATOM   2275 C CB  . ASN B 1 135 ? 38.857  8.992   29.840 1.00   12.21 ? 242  ASN B CB  1 
ATOM   2276 C CG  . ASN B 1 135 ? 39.830  8.134   29.107 1.00   11.65 ? 242  ASN B CG  1 
ATOM   2277 O OD1 . ASN B 1 135 ? 39.482  7.055   28.688 1.00   13.15 ? 242  ASN B OD1 1 
ATOM   2278 N ND2 . ASN B 1 135 ? 41.077  8.589   28.989 1.00   10.72 ? 242  ASN B ND2 1 
ATOM   2279 N N   . GLY B 1 136 ? 35.202  9.504   29.982 1.00   14.07 ? 243  GLY B N   1 
ATOM   2280 C CA  . GLY B 1 136 ? 34.190  10.203  30.757 1.00   15.35 ? 243  GLY B CA  1 
ATOM   2281 C C   . GLY B 1 136 ? 34.029  11.691  30.473 1.00   15.92 ? 243  GLY B C   1 
ATOM   2282 O O   . GLY B 1 136 ? 33.054  12.306  30.926 1.00   18.21 ? 243  GLY B O   1 
ATOM   2283 N N   . GLN B 1 137 ? 34.947  12.274  29.719 1.00   15.23 ? 244  GLN B N   1 
ATOM   2284 C CA  . GLN B 1 137 ? 34.953  13.695  29.456 1.00   15.19 ? 244  GLN B CA  1 
ATOM   2285 C C   . GLN B 1 137 ? 34.221  14.021  28.163 1.00   14.14 ? 244  GLN B C   1 
ATOM   2286 O O   . GLN B 1 137 ? 34.542  13.477  27.105 1.00   12.02 ? 244  GLN B O   1 
ATOM   2287 C CB  . GLN B 1 137 ? 36.366  14.204  29.323 1.00   16.40 ? 244  GLN B CB  1 
ATOM   2288 C CG  . GLN B 1 137 ? 36.434  15.698  29.175 1.00   19.17 ? 244  GLN B CG  1 
ATOM   2289 C CD  . GLN B 1 137 ? 37.842  16.190  29.063 1.00   22.18 ? 244  GLN B CD  1 
ATOM   2290 O OE1 . GLN B 1 137 ? 38.805  15.406  29.130 1.00   22.19 ? 244  GLN B OE1 1 
ATOM   2291 N NE2 . GLN B 1 137 ? 37.980  17.489  28.882 1.00   23.94 ? 244  GLN B NE2 1 
ATOM   2292 N N   . ASN B 1 138 ? 33.262  14.942  28.254 1.00   13.77 ? 245  ASN B N   1 
ATOM   2293 C CA  . ASN B 1 138 ? 32.530  15.418  27.097 1.00   13.83 ? 245  ASN B CA  1 
ATOM   2294 C C   . ASN B 1 138 ? 33.481  16.144  26.158 1.00   13.62 ? 245  ASN B C   1 
ATOM   2295 O O   . ASN B 1 138 ? 34.149  17.108  26.558 1.00   14.37 ? 245  ASN B O   1 
ATOM   2296 C CB  . ASN B 1 138 ? 31.400  16.356  27.579 1.00   13.35 ? 245  ASN B CB  1 
ATOM   2297 C CG  . ASN B 1 138 ? 30.751  17.140  26.460 1.00   14.02 ? 245  ASN B CG  1 
ATOM   2298 O OD1 . ASN B 1 138 ? 30.619  16.672  25.339 1.00   12.63 ? 245  ASN B OD1 1 
ATOM   2299 N ND2 . ASN B 1 138 ? 30.281  18.343  26.786 1.00   17.21 ? 245  ASN B ND2 1 
ATOM   2300 N N   . VAL B 1 139 ? 33.522  15.700  24.910 1.00   13.17 ? 246  VAL B N   1 
ATOM   2301 C CA  . VAL B 1 139 ? 34.289  16.347  23.862 1.00   12.82 ? 246  VAL B CA  1 
ATOM   2302 C C   . VAL B 1 139 ? 33.459  17.014  22.773 1.00   12.47 ? 246  VAL B C   1 
ATOM   2303 O O   . VAL B 1 139 ? 33.992  17.562  21.804 1.00   11.52 ? 246  VAL B O   1 
ATOM   2304 C CB  . VAL B 1 139 ? 35.327  15.395  23.247 1.00   12.76 ? 246  VAL B CB  1 
ATOM   2305 C CG1 . VAL B 1 139 ? 36.197  14.842  24.309 1.00   13.38 ? 246  VAL B CG1 1 
ATOM   2306 C CG2 . VAL B 1 139 ? 34.666  14.273  22.468 1.00   13.97 ? 246  VAL B CG2 1 
ATOM   2307 N N   . ILE B 1 140 ? 32.125  16.961  22.906 1.00   12.65 ? 247  ILE B N   1 
ATOM   2308 C CA  . ILE B 1 140 ? 31.284  17.691  21.975 1.00   12.47 ? 247  ILE B CA  1 
ATOM   2309 C C   . ILE B 1 140 ? 31.596  19.195  22.014 1.00   12.44 ? 247  ILE B C   1 
ATOM   2310 O O   . ILE B 1 140 ? 31.676  19.780  23.091 1.00   12.82 ? 247  ILE B O   1 
ATOM   2311 C CB  . ILE B 1 140 ? 29.783  17.404  22.272 1.00   12.21 ? 247  ILE B CB  1 
ATOM   2312 C CG1 . ILE B 1 140 ? 29.509  15.911  22.052 1.00   12.98 ? 247  ILE B CG1 1 
ATOM   2313 C CG2 . ILE B 1 140 ? 28.905  18.289  21.443 1.00   13.16 ? 247  ILE B CG2 1 
ATOM   2314 C CD1 . ILE B 1 140 ? 29.638  15.428  20.612 1.00   12.17 ? 247  ILE B CD1 1 
ATOM   2315 N N   . GLY B 1 141 ? 31.808  19.789  20.849 1.00   13.09 ? 248  GLY B N   1 
ATOM   2316 C CA  . GLY B 1 141 ? 32.174  21.193  20.727 1.00   14.23 ? 248  GLY B CA  1 
ATOM   2317 C C   . GLY B 1 141 ? 33.667  21.517  20.776 1.00   14.23 ? 248  GLY B C   1 
ATOM   2318 O O   . GLY B 1 141 ? 34.045  22.688  20.661 1.00   15.81 ? 248  GLY B O   1 
ATOM   2319 N N   . LEU B 1 142 ? 34.503  20.509  21.011 1.00   12.84 ? 249  LEU B N   1 
ATOM   2320 C CA  . LEU B 1 142 ? 35.957  20.714  21.046 1.00   11.96 ? 249  LEU B CA  1 
ATOM   2321 C C   . LEU B 1 142 ? 36.516  20.612  19.648 1.00   11.91 ? 249  LEU B C   1 
ATOM   2322 O O   . LEU B 1 142 ? 35.958  19.932  18.784 1.00   12.55 ? 249  LEU B O   1 
ATOM   2323 C CB  . LEU B 1 142 ? 36.634  19.678  21.947 1.00   11.83 ? 249  LEU B CB  1 
ATOM   2324 C CG  . LEU B 1 142 ? 36.303  19.710  23.423 1.00   12.16 ? 249  LEU B CG  1 
ATOM   2325 C CD1 . LEU B 1 142 ? 37.250  18.750  24.197 1.00   12.80 ? 249  LEU B CD1 1 
ATOM   2326 C CD2 . LEU B 1 142 ? 36.385  21.132  23.978 1.00   14.61 ? 249  LEU B CD2 1 
ATOM   2327 N N   . LYS B 1 143 ? 37.613  21.329  19.399 1.00   11.78 ? 250  LYS B N   1 
ATOM   2328 C CA  . LYS B 1 143 ? 38.322  21.230  18.155 1.00   12.29 ? 250  LYS B CA  1 
ATOM   2329 C C   . LYS B 1 143 ? 39.027  19.879  18.028 1.00   11.11 ? 250  LYS B C   1 
ATOM   2330 O O   . LYS B 1 143 ? 39.355  19.247  19.021 1.00   10.42 ? 250  LYS B O   1 
ATOM   2331 C CB  . LYS B 1 143 ? 39.358  22.379  18.059 1.00   12.98 ? 250  LYS B CB  1 
ATOM   2332 C CG  . LYS B 1 143 ? 38.703  23.761  17.938 1.00   15.89 ? 250  LYS B CG  1 
ATOM   2333 C CD  . LYS B 1 143 ? 37.744  24.285  18.223 0.0000 34.49 ? 250  LYS B CD  1 
ATOM   2334 C CE  . LYS B 1 143 ? 37.206  25.532  17.544 0.0000 43.77 ? 250  LYS B CE  1 
ATOM   2335 N NZ  . LYS B 1 143 ? 36.189  26.225  18.381 0.0000 46.32 ? 250  LYS B NZ  1 
ATOM   2336 N N   . ASP B 1 144 ? 39.284  19.443  16.804 1.00   10.30 ? 251  ASP B N   1 
ATOM   2337 C CA  . ASP B 1 144 ? 39.979  18.183  16.612 1.00   9.93  ? 251  ASP B CA  1 
ATOM   2338 C C   . ASP B 1 144 ? 41.310  18.168  17.359 1.00   9.44  ? 251  ASP B C   1 
ATOM   2339 O O   . ASP B 1 144 ? 41.666  17.164  17.975 1.00   8.60  ? 251  ASP B O   1 
ATOM   2340 C CB  . ASP B 1 144 ? 40.234  17.905  15.145 1.00   9.44  ? 251  ASP B CB  1 
ATOM   2341 C CG  . ASP B 1 144 ? 38.979  17.534  14.394 1.00   10.23 ? 251  ASP B CG  1 
ATOM   2342 O OD1 . ASP B 1 144 ? 37.951  17.148  15.041 1.00   8.46  ? 251  ASP B OD1 1 
ATOM   2343 O OD2 . ASP B 1 144 ? 38.974  17.579  13.141 1.00   9.44  ? 251  ASP B OD2 1 
ATOM   2344 N N   . SER B 1 145 ? 42.034  19.282  17.348 1.00   9.39  ? 252  SER B N   1 
ATOM   2345 C CA  . SER B 1 145 ? 43.346  19.273  18.021 1.00   9.68  ? 252  SER B CA  1 
ATOM   2346 C C   . SER B 1 145 ? 43.179  19.111  19.547 1.00   9.56  ? 252  SER B C   1 
ATOM   2347 O O   . SER B 1 145 ? 44.033  18.514  20.246 1.00   8.92  ? 252  SER B O   1 
ATOM   2348 C CB  . SER B 1 145 ? 44.138  20.524  17.673 1.00   11.42 ? 252  SER B CB  1 
ATOM   2349 O OG  . SER B 1 145 ? 43.374  21.681  17.924 1.00   15.01 ? 252  SER B OG  1 
ATOM   2350 N N   . GLN B 1 146 ? 42.062  19.603  20.080 1.00   9.13  ? 253  GLN B N   1 
ATOM   2351 C CA  . GLN B 1 146 ? 41.752  19.388  21.490 1.00   8.44  ? 253  GLN B CA  1 
ATOM   2352 C C   . GLN B 1 146 ? 41.430  17.918  21.779 1.00   8.75  ? 253  GLN B C   1 
ATOM   2353 O O   . GLN B 1 146 ? 41.883  17.354  22.756 1.00   8.57  ? 253  GLN B O   1 
ATOM   2354 C CB  . GLN B 1 146 ? 40.626  20.332  21.943 1.00   8.48  ? 253  GLN B CB  1 
ATOM   2355 C CG  . GLN B 1 146 ? 41.027  21.801  21.934 1.00   10.03 ? 253  GLN B CG  1 
ATOM   2356 C CD  . GLN B 1 146 ? 39.876  22.730  22.271 1.00   11.71 ? 253  GLN B CD  1 
ATOM   2357 O OE1 . GLN B 1 146 ? 38.826  22.708  21.613 1.00   12.77 ? 253  GLN B OE1 1 
ATOM   2358 N NE2 . GLN B 1 146 ? 40.076  23.579  23.268 1.00   13.71 ? 253  GLN B NE2 1 
ATOM   2359 N N   . ILE B 1 147 ? 40.608  17.309  20.928 1.00   8.09  ? 254  ILE B N   1 
ATOM   2360 C CA  . ILE B 1 147 ? 40.329  15.886  21.038 1.00   8.32  ? 254  ILE B CA  1 
ATOM   2361 C C   . ILE B 1 147 ? 41.639  15.055  20.969 1.00   7.68  ? 254  ILE B C   1 
ATOM   2362 O O   . ILE B 1 147 ? 41.876  14.117  21.776 1.00   7.81  ? 254  ILE B O   1 
ATOM   2363 C CB  . ILE B 1 147 ? 39.312  15.492  19.963 1.00   8.37  ? 254  ILE B CB  1 
ATOM   2364 C CG1 . ILE B 1 147 ? 37.978  16.187  20.262 1.00   11.82 ? 254  ILE B CG1 1 
ATOM   2365 C CG2 . ILE B 1 147 ? 39.104  13.959  19.944 1.00   10.06 ? 254  ILE B CG2 1 
ATOM   2366 C CD1 . ILE B 1 147 ? 36.902  15.907  19.166 1.00   12.34 ? 254  ILE B CD1 1 
ATOM   2367 N N   . ALA B 1 148 ? 42.508  15.413  20.027 1.00   7.45  ? 255  ALA B N   1 
ATOM   2368 C CA  . ALA B 1 148 ? 43.796  14.769  19.886 1.00   8.57  ? 255  ALA B CA  1 
ATOM   2369 C C   . ALA B 1 148 ? 44.646  14.841  21.152 1.00   8.79  ? 255  ALA B C   1 
ATOM   2370 O O   . ALA B 1 148 ? 45.305  13.856  21.484 1.00   9.50  ? 255  ALA B O   1 
ATOM   2371 C CB  . ALA B 1 148 ? 44.578  15.367  18.721 1.00   8.40  ? 255  ALA B CB  1 
ATOM   2372 N N   . ASP B 1 149 ? 44.662  16.006  21.806 1.00   9.35  ? 256  ASP B N   1 
ATOM   2373 C CA  . ASP B 1 149 ? 45.388  16.221  23.094 1.00   10.19 ? 256  ASP B CA  1 
ATOM   2374 C C   . ASP B 1 149 ? 44.817  15.292  24.199 1.00   9.20  ? 256  ASP B C   1 
ATOM   2375 O O   . ASP B 1 149 ? 45.585  14.725  24.984 1.00   8.73  ? 256  ASP B O   1 
ATOM   2376 C CB  . ASP B 1 149 ? 45.278  17.698  23.523 1.00   11.33 ? 256  ASP B CB  1 
ATOM   2377 C CG  . ASP B 1 149 ? 46.312  18.146  24.588 1.00   17.45 ? 256  ASP B CG  1 
ATOM   2378 O OD1 . ASP B 1 149 ? 47.229  17.350  24.923 1.00   22.06 ? 256  ASP B OD1 1 
ATOM   2379 O OD2 . ASP B 1 149 ? 46.314  19.337  25.089 1.00   21.41 ? 256  ASP B OD2 1 
ATOM   2380 N N   . ILE B 1 150 ? 43.497  15.121  24.250 1.00   8.08  ? 257  ILE B N   1 
ATOM   2381 C CA  . ILE B 1 150 ? 42.883  14.221  25.249 1.00   8.26  ? 257  ILE B CA  1 
ATOM   2382 C C   . ILE B 1 150 ? 43.314  12.787  24.979 1.00   7.93  ? 257  ILE B C   1 
ATOM   2383 O O   . ILE B 1 150 ? 43.713  12.050  25.900 1.00   8.38  ? 257  ILE B O   1 
ATOM   2384 C CB  . ILE B 1 150 ? 41.344  14.406  25.273 1.00   7.84  ? 257  ILE B CB  1 
ATOM   2385 C CG1 . ILE B 1 150 ? 41.028  15.790  25.890 1.00   9.74  ? 257  ILE B CG1 1 
ATOM   2386 C CG2 . ILE B 1 150 ? 40.669  13.285  26.043 1.00   9.00  ? 257  ILE B CG2 1 
ATOM   2387 C CD1 . ILE B 1 150 ? 39.589  16.266  25.717 1.00   11.20 ? 257  ILE B CD1 1 
ATOM   2388 N N   . LEU B 1 151 ? 43.305  12.395  23.714 1.00   8.70  ? 258  LEU B N   1 
ATOM   2389 C CA  . LEU B 1 151 ? 43.762  11.040  23.356 1.00   8.89  ? 258  LEU B CA  1 
ATOM   2390 C C   . LEU B 1 151 ? 45.260  10.832  23.640 1.00   9.33  ? 258  LEU B C   1 
ATOM   2391 O O   . LEU B 1 151 ? 45.649  9.812   24.193 1.00   9.96  ? 258  LEU B O   1 
ATOM   2392 C CB  . LEU B 1 151 ? 43.484  10.734  21.898 1.00   8.88  ? 258  LEU B CB  1 
ATOM   2393 C CG  . LEU B 1 151 ? 42.002  10.535  21.577 1.00   10.05 ? 258  LEU B CG  1 
ATOM   2394 C CD1 . LEU B 1 151 ? 41.718  10.813  20.147 1.00   11.61 ? 258  LEU B CD1 1 
ATOM   2395 C CD2 . LEU B 1 151 ? 41.518  9.138   21.999 1.00   9.87  ? 258  LEU B CD2 1 
ATOM   2396 N N   . SER B 1 152 ? 46.071  11.817  23.298 1.00   9.72  ? 259  SER B N   1 
ATOM   2397 C CA  . SER B 1 152 ? 47.520  11.702  23.379 1.00   11.06 ? 259  SER B CA  1 
ATOM   2398 C C   . SER B 1 152 ? 47.953  11.639  24.833 1.00   9.71  ? 259  SER B C   1 
ATOM   2399 O O   . SER B 1 152 ? 48.845  10.879  25.167 1.00   10.42 ? 259  SER B O   1 
ATOM   2400 C CB  . SER B 1 152 ? 48.211  12.910  22.726 1.00   12.00 ? 259  SER B CB  1 
ATOM   2401 O OG  . SER B 1 152 ? 48.091  12.774  21.315 1.00   20.23 ? 259  SER B OG  1 
ATOM   2402 N N   . THR B 1 153 ? 47.309  12.437  25.682 1.00   8.88  ? 260  THR B N   1 
ATOM   2403 C CA  . THR B 1 153 ? 47.654  12.466  27.117 1.00   8.78  ? 260  THR B CA  1 
ATOM   2404 C C   . THR B 1 153 ? 46.990  11.387  27.957 1.00   9.13  ? 260  THR B C   1 
ATOM   2405 O O   . THR B 1 153 ? 47.324  11.240  29.143 1.00   9.28  ? 260  THR B O   1 
ATOM   2406 C CB  . THR B 1 153 ? 47.358  13.817  27.773 1.00   9.34  ? 260  THR B CB  1 
ATOM   2407 O OG1 . THR B 1 153 ? 45.946  14.111  27.730 1.00   8.46  ? 260  THR B OG1 1 
ATOM   2408 C CG2 . THR B 1 153 ? 48.086  14.971  27.059 1.00   10.36 ? 260  THR B CG2 1 
ATOM   2409 N N   . SER B 1 154 ? 46.084  10.620  27.360 1.00   8.88  ? 261  SER B N   1 
ATOM   2410 C CA  . SER B 1 154 ? 45.380  9.589   28.098 1.00   9.03  ? 261  SER B CA  1 
ATOM   2411 C C   . SER B 1 154 ? 46.341  8.547   28.608 1.00   9.30  ? 261  SER B C   1 
ATOM   2412 O O   . SER B 1 154 ? 47.375  8.252   27.981 1.00   8.69  ? 261  SER B O   1 
ATOM   2413 C CB  . SER B 1 154 ? 44.333  8.908   27.218 1.00   10.16 ? 261  SER B CB  1 
ATOM   2414 O OG  . SER B 1 154 ? 43.695  7.861   27.921 1.00   10.16 ? 261  SER B OG  1 
ATOM   2415 N N   . GLY B 1 155 ? 45.972  7.943   29.740 1.00   9.23  ? 262  GLY B N   1 
ATOM   2416 C CA  . GLY B 1 155 ? 46.602  6.714   30.142 1.00   9.81  ? 262  GLY B CA  1 
ATOM   2417 C C   . GLY B 1 155 ? 46.327  5.626   29.133 1.00   10.69 ? 262  GLY B C   1 
ATOM   2418 O O   . GLY B 1 155 ? 45.543  5.818   28.190 1.00   10.62 ? 262  GLY B O   1 
ATOM   2419 N N   . THR B 1 156 ? 46.890  4.444   29.395 1.00   11.56 ? 263  THR B N   1 
ATOM   2420 C CA  . THR B 1 156 ? 46.850  3.286   28.492 1.00   12.73 ? 263  THR B CA  1 
ATOM   2421 C C   . THR B 1 156 ? 45.434  2.883   28.076 1.00   11.25 ? 263  THR B C   1 
ATOM   2422 O O   . THR B 1 156 ? 45.174  2.541   26.901 1.00   11.34 ? 263  THR B O   1 
ATOM   2423 C CB  . THR B 1 156 ? 47.527  2.102   29.242 1.00   13.41 ? 263  THR B CB  1 
ATOM   2424 O OG1 . THR B 1 156 ? 48.916  2.414   29.404 1.00   18.50 ? 263  THR B OG1 1 
ATOM   2425 C CG2 . THR B 1 156 ? 47.469  0.832   28.417 1.00   17.68 ? 263  THR B CG2 1 
ATOM   2426 N N   . VAL B 1 157 ? 44.508  2.954   29.013 1.00   11.45 ? 264  VAL B N   1 
ATOM   2427 C CA  . VAL B 1 157 ? 43.135  2.565   28.730 1.00   11.31 ? 264  VAL B CA  1 
ATOM   2428 C C   . VAL B 1 157 ? 42.357  3.779   28.232 1.00   11.41 ? 264  VAL B C   1 
ATOM   2429 O O   . VAL B 1 157 ? 42.198  4.783   28.957 1.00   11.57 ? 264  VAL B O   1 
ATOM   2430 C CB  . VAL B 1 157 ? 42.441  1.965   29.965 1.00   11.30 ? 264  VAL B CB  1 
ATOM   2431 C CG1 . VAL B 1 157 ? 41.026  1.545   29.616 1.00   12.75 ? 264  VAL B CG1 1 
ATOM   2432 C CG2 . VAL B 1 157 ? 43.273  0.794   30.500 1.00   12.46 ? 264  VAL B CG2 1 
ATOM   2433 N N   . VAL B 1 158 ? 41.877  3.676   26.999 1.00   10.80 ? 265  VAL B N   1 
ATOM   2434 C CA  . VAL B 1 158 ? 41.094  4.719   26.360 1.00   10.16 ? 265  VAL B CA  1 
ATOM   2435 C C   . VAL B 1 158 ? 39.655  4.263   26.170 1.00   10.71 ? 265  VAL B C   1 
ATOM   2436 O O   . VAL B 1 158 ? 39.385  3.334   25.395 1.00   10.77 ? 265  VAL B O   1 
ATOM   2437 C CB  . VAL B 1 158 ? 41.700  5.107   25.017 1.00   9.77  ? 265  VAL B CB  1 
ATOM   2438 C CG1 . VAL B 1 158 ? 40.930  6.247   24.390 1.00   10.85 ? 265  VAL B CG1 1 
ATOM   2439 C CG2 . VAL B 1 158 ? 43.211  5.477   25.191 1.00   9.14  ? 265  VAL B CG2 1 
ATOM   2440 N N   . THR B 1 159 ? 38.741  4.886   26.897 1.00   9.83  ? 266  THR B N   1 
ATOM   2441 C CA  . THR B 1 159 ? 37.340  4.537   26.805 1.00   11.01 ? 266  THR B CA  1 
ATOM   2442 C C   . THR B 1 159 ? 36.598  5.589   26.017 1.00   11.46 ? 266  THR B C   1 
ATOM   2443 O O   . THR B 1 159 ? 36.569  6.737   26.416 1.00   13.65 ? 266  THR B O   1 
ATOM   2444 C CB  . THR B 1 159 ? 36.741  4.432   28.192 1.00   11.70 ? 266  THR B CB  1 
ATOM   2445 O OG1 . THR B 1 159 ? 37.401  3.390   28.916 1.00   13.11 ? 266  THR B OG1 1 
ATOM   2446 C CG2 . THR B 1 159 ? 35.296  4.010   28.137 1.00   13.05 ? 266  THR B CG2 1 
ATOM   2447 N N   . ILE B 1 160 ? 35.966  5.200   24.916 1.00   10.59 ? 267  ILE B N   1 
ATOM   2448 C CA  . ILE B 1 160 ? 35.279  6.178   24.071 1.00   11.29 ? 267  ILE B CA  1 
ATOM   2449 C C   . ILE B 1 160 ? 33.791  5.836   23.945 1.00   11.27 ? 267  ILE B C   1 
ATOM   2450 O O   . ILE B 1 160 ? 33.418  4.700   23.648 1.00   10.69 ? 267  ILE B O   1 
ATOM   2451 C CB  . ILE B 1 160 ? 35.965  6.302   22.658 1.00   12.26 ? 267  ILE B CB  1 
ATOM   2452 C CG1 . ILE B 1 160 ? 37.449  6.569   22.834 1.00   15.65 ? 267  ILE B CG1 1 
ATOM   2453 C CG2 . ILE B 1 160 ? 35.338  7.409   21.838 1.00   13.60 ? 267  ILE B CG2 1 
ATOM   2454 C CD1 . ILE B 1 160 ? 38.210  6.782   21.504 1.00   17.16 ? 267  ILE B CD1 1 
ATOM   2455 N N   . THR B 1 161 ? 32.957  6.842   24.139 1.00   10.92 ? 268  THR B N   1 
ATOM   2456 C CA  . THR B 1 161 ? 31.514  6.714   23.927 1.00   11.34 ? 268  THR B CA  1 
ATOM   2457 C C   . THR B 1 161 ? 31.180  7.388   22.606 1.00   10.98 ? 268  THR B C   1 
ATOM   2458 O O   . THR B 1 161 ? 31.546  8.518   22.362 1.00   9.20  ? 268  THR B O   1 
ATOM   2459 C CB  . THR B 1 161 ? 30.777  7.320   25.082 1.00   12.47 ? 268  THR B CB  1 
ATOM   2460 O OG1 . THR B 1 161 ? 31.191  6.670   26.282 1.00   14.20 ? 268  THR B OG1 1 
ATOM   2461 C CG2 . THR B 1 161 ? 29.301  7.009   25.050 1.00   15.13 ? 268  THR B CG2 1 
ATOM   2462 N N   . ILE B 1 162 ? 30.532  6.637   21.721 1.00   11.29 ? 269  ILE B N   1 
ATOM   2463 C CA  . ILE B 1 162 ? 30.247  7.066   20.346 1.00   11.89 ? 269  ILE B CA  1 
ATOM   2464 C C   . ILE B 1 162 ? 28.780  6.869   20.021 1.00   12.31 ? 269  ILE B C   1 
ATOM   2465 O O   . ILE B 1 162 ? 28.066  6.132   20.704 1.00   12.98 ? 269  ILE B O   1 
ATOM   2466 C CB  . ILE B 1 162 ? 31.106  6.283   19.308 1.00   12.17 ? 269  ILE B CB  1 
ATOM   2467 C CG1 . ILE B 1 162 ? 30.748  4.792   19.301 1.00   11.71 ? 269  ILE B CG1 1 
ATOM   2468 C CG2 . ILE B 1 162 ? 32.583  6.505   19.594 1.00   12.53 ? 269  ILE B CG2 1 
ATOM   2469 C CD1 . ILE B 1 162 ? 31.490  3.958   18.265 1.00   13.71 ? 269  ILE B CD1 1 
ATOM   2470 N N   . MET B 1 163 ? 28.359  7.562   18.976 1.00   12.25 ? 270  MET B N   1 
ATOM   2471 C CA  . MET B 1 163 ? 27.011  7.492   18.476 1.00   12.93 ? 270  MET B CA  1 
ATOM   2472 C C   . MET B 1 163 ? 27.042  7.692   16.969 1.00   13.01 ? 270  MET B C   1 
ATOM   2473 O O   . MET B 1 163 ? 27.741  8.584   16.462 1.00   11.57 ? 270  MET B O   1 
ATOM   2474 C CB  . MET B 1 163 ? 26.223  8.633   19.160 1.00   13.12 ? 270  MET B CB  1 
ATOM   2475 C CG  . MET B 1 163 ? 24.759  8.637   18.921 1.00   17.01 ? 270  MET B CG  1 
ATOM   2476 S SD  . MET B 1 163 ? 24.151  10.209  19.632 1.00   20.02 ? 270  MET B SD  1 
ATOM   2477 C CE  . MET B 1 163 ? 22.369  9.965   19.465 1.00   23.46 ? 270  MET B CE  1 
ATOM   2478 N N   . PRO B 1 164 ? 26.265  6.905   16.210 1.00   14.27 ? 271  PRO B N   1 
ATOM   2479 C CA  . PRO B 1 164 ? 26.232  7.104   14.766 1.00   15.56 ? 271  PRO B CA  1 
ATOM   2480 C C   . PRO B 1 164 ? 25.815  8.530   14.412 1.00   17.53 ? 271  PRO B C   1 
ATOM   2481 O O   . PRO B 1 164 ? 24.943  9.104   15.085 1.00   17.69 ? 271  PRO B O   1 
ATOM   2482 C CB  . PRO B 1 164 ? 25.207  6.046   14.268 1.00   15.50 ? 271  PRO B CB  1 
ATOM   2483 C CG  . PRO B 1 164 ? 24.543  5.508   15.481 1.00   14.55 ? 271  PRO B CG  1 
ATOM   2484 C CD  . PRO B 1 164 ? 25.369  5.829   16.657 1.00   13.62 ? 271  PRO B CD  1 
ATOM   2485 N N   . ALA B 1 165 ? 26.458  9.117   13.410 1.00   19.64 ? 272  ALA B N   1 
ATOM   2486 C CA  . ALA B 1 165 ? 26.263  10.529  13.094 1.00   22.47 ? 272  ALA B CA  1 
ATOM   2487 C C   . ALA B 1 165 ? 25.078  10.678  12.157 1.00   24.18 ? 272  ALA B C   1 
ATOM   2488 O O   . ALA B 1 165 ? 25.101  10.087  11.080 1.00   26.10 ? 272  ALA B O   1 
ATOM   2489 C CB  . ALA B 1 165 ? 27.507  11.119  12.465 1.00   23.41 ? 272  ALA B CB  1 
ATOM   2490 N N   . ASP C 2 5   ? 3.014   3.254   2.501  1.00   31.92 ? 5    ASP P N   1 
ATOM   2491 C CA  . ASP C 2 5   ? 1.643   2.631   2.454  1.00   32.51 ? 5    ASP P CA  1 
ATOM   2492 C C   . ASP C 2 5   ? 0.631   3.700   2.872  1.00   32.26 ? 5    ASP P C   1 
ATOM   2493 O O   . ASP C 2 5   ? 0.860   4.895   2.629  1.00   33.33 ? 5    ASP P O   1 
ATOM   2494 C CB  . ASP C 2 5   ? 1.556   1.344   3.311  1.00   31.74 ? 5    ASP P CB  1 
ATOM   2495 C CG  . ASP C 2 5   ? 2.407   0.187   2.753  1.00   33.37 ? 5    ASP P CG  1 
ATOM   2496 O OD1 . ASP C 2 5   ? 1.826   -0.885  2.419  1.00   33.72 ? 5    ASP P OD1 1 
ATOM   2497 O OD2 . ASP C 2 5   ? 3.663   0.246   2.610  1.00   29.82 ? 5    ASP P OD2 1 
ATOM   2498 N N   . SER C 2 6   ? -0.510  3.271   3.407  1.00   32.16 ? 6    SER P N   1 
ATOM   2499 C CA  . SER C 2 6   ? -1.394  4.141   4.198  1.00   31.39 ? 6    SER P CA  1 
ATOM   2500 C C   . SER C 2 6   ? -0.800  4.242   5.617  1.00   30.00 ? 6    SER P C   1 
ATOM   2501 O O   . SER C 2 6   ? 0.321   3.750   5.855  1.00   30.13 ? 6    SER P O   1 
ATOM   2502 C CB  . SER C 2 6   ? -2.836  3.586   4.239  1.00   32.22 ? 6    SER P CB  1 
ATOM   2503 O OG  . SER C 2 6   ? -2.901  2.152   4.161  1.00   35.50 ? 6    SER P OG  1 
ATOM   2504 N N   . VAL C 2 7   ? -1.539  4.877   6.534  1.00   27.30 ? 7    VAL P N   1 
ATOM   2505 C CA  . VAL C 2 7   ? -1.168  4.943   7.958  1.00   26.10 ? 7    VAL P CA  1 
ATOM   2506 C C   . VAL C 2 7   ? -1.514  3.645   8.671  1.00   24.27 ? 7    VAL P C   1 
ATOM   2507 O O   . VAL C 2 7   ? -2.587  3.090   8.450  1.00   24.36 ? 7    VAL P O   1 
ATOM   2508 C CB  . VAL C 2 7   ? -1.895  6.102   8.693  1.00   25.92 ? 7    VAL P CB  1 
ATOM   2509 C CG1 . VAL C 2 7   ? -1.612  6.065   10.218 1.00   24.78 ? 7    VAL P CG1 1 
ATOM   2510 C CG2 . VAL C 2 7   ? -1.507  7.462   8.114  1.00   25.91 ? 7    VAL P CG2 1 
ATOM   2511 N N   . PHE C 2 8   ? -0.574  3.197   9.518  1.00   23.44 ? 8    PHE P N   1 
ATOM   2512 C CA  . PHE C 2 8   ? -0.687  2.037   10.405 1.00   22.28 ? 8    PHE P CA  1 
ATOM   2513 C C   . PHE C 2 8   ? -0.499  2.447   11.846 1.00   22.41 ? 8    PHE P C   1 
ATOM   2514 O O   . PHE C 2 8   ? -0.827  1.627   12.702 1.00   23.29 ? 8    PHE P O   1 
ATOM   2515 C CB  . PHE C 2 8   ? 0.355   0.974   10.053 1.00   21.82 ? 8    PHE P CB  1 
ATOM   2516 C CG  . PHE C 2 8   ? -0.023  0.203   8.850  1.00   22.14 ? 8    PHE P CG  1 
ATOM   2517 C CD1 . PHE C 2 8   ? -0.974  -0.819  8.945  1.00   20.15 ? 8    PHE P CD1 1 
ATOM   2518 C CD2 . PHE C 2 8   ? 0.468   0.565   7.627  1.00   22.87 ? 8    PHE P CD2 1 
ATOM   2519 C CE1 . PHE C 2 8   ? -1.388  -1.467  7.894  1.00   18.93 ? 8    PHE P CE1 1 
ATOM   2520 C CE2 . PHE C 2 8   ? 0.034   -0.069  6.489  1.00   24.51 ? 8    PHE P CE2 1 
ATOM   2521 C CZ  . PHE C 2 8   ? -0.901  -1.105  6.612  1.00   24.98 ? 8    PHE P CZ  1 
ATOM   2522 O OXT . PHE C 2 8   ? -0.032  3.558   12.075 1.00   22.20 ? 8    PHE P OXT 1 
HETATM 2523 C C   . ACT D 3 .   ? 22.133  -2.664  10.058 1.00   21.79 ? 1274 ACT A C   1 
HETATM 2524 O O   . ACT D 3 .   ? 22.724  -3.757  9.843  1.00   21.63 ? 1274 ACT A O   1 
HETATM 2525 O OXT . ACT D 3 .   ? 21.525  -2.160  9.077  1.00   21.97 ? 1274 ACT A OXT 1 
HETATM 2526 C CH3 . ACT D 3 .   ? 22.155  -2.010  11.403 1.00   22.56 ? 1274 ACT A CH3 1 
HETATM 2527 C C   . ACT E 3 .   ? 25.382  -18.345 2.650  1.00   26.49 ? 1275 ACT A C   1 
HETATM 2528 O O   . ACT E 3 .   ? 24.145  -18.587 2.865  1.00   26.45 ? 1275 ACT A O   1 
HETATM 2529 O OXT . ACT E 3 .   ? 26.271  -19.010 3.244  1.00   24.70 ? 1275 ACT A OXT 1 
HETATM 2530 C CH3 . ACT E 3 .   ? 25.818  -17.309 1.640  1.00   26.91 ? 1275 ACT A CH3 1 
HETATM 2531 C C   . ACT F 3 .   ? 45.039  7.002   18.072 1.00   20.61 ? 1273 ACT B C   1 
HETATM 2532 O O   . ACT F 3 .   ? 45.426  6.777   19.246 1.00   20.47 ? 1273 ACT B O   1 
HETATM 2533 O OXT . ACT F 3 .   ? 45.101  6.071   17.194 1.00   18.73 ? 1273 ACT B OXT 1 
HETATM 2534 C CH3 . ACT F 3 .   ? 44.513  8.363   17.757 1.00   20.64 ? 1273 ACT B CH3 1 
HETATM 2535 C C   . ACT G 3 .   ? 18.108  28.208  26.431 1.00   20.35 ? 1274 ACT B C   1 
HETATM 2536 O O   . ACT G 3 .   ? 19.256  27.777  26.699 1.00   19.93 ? 1274 ACT B O   1 
HETATM 2537 O OXT . ACT G 3 .   ? 17.282  28.334  27.383 1.00   20.38 ? 1274 ACT B OXT 1 
HETATM 2538 C CH3 . ACT G 3 .   ? 17.739  28.559  25.025 1.00   21.29 ? 1274 ACT B CH3 1 
HETATM 2539 O O   . HOH H 4 .   ? 33.452  -6.263  26.932 1.00   38.35 ? 2001 HOH A O   1 
HETATM 2540 O O   . HOH H 4 .   ? 29.842  -7.502  29.187 1.00   40.02 ? 2002 HOH A O   1 
HETATM 2541 O O   . HOH H 4 .   ? 28.288  -4.625  26.397 1.00   45.75 ? 2003 HOH A O   1 
HETATM 2542 O O   . HOH H 4 .   ? 28.266  -10.737 25.920 1.00   42.40 ? 2004 HOH A O   1 
HETATM 2543 O O   . HOH H 4 .   ? 26.554  -6.721  26.777 1.00   45.92 ? 2005 HOH A O   1 
HETATM 2544 O O   . HOH H 4 .   ? 33.445  -11.230 25.524 1.00   41.41 ? 2006 HOH A O   1 
HETATM 2545 O O   . HOH H 4 .   ? 29.886  -12.505 26.467 1.00   40.25 ? 2007 HOH A O   1 
HETATM 2546 O O   . HOH H 4 .   ? 23.417  -18.387 20.726 1.00   32.25 ? 2008 HOH A O   1 
HETATM 2547 O O   . HOH H 4 .   ? 27.501  -17.210 22.152 1.00   25.04 ? 2009 HOH A O   1 
HETATM 2548 O O   . HOH H 4 .   ? 37.316  -16.336 17.578 1.00   37.03 ? 2010 HOH A O   1 
HETATM 2549 O O   . HOH H 4 .   ? 31.103  -16.478 24.027 1.00   26.13 ? 2011 HOH A O   1 
HETATM 2550 O O   . HOH H 4 .   ? 32.937  -20.828 21.481 1.00   31.83 ? 2012 HOH A O   1 
HETATM 2551 O O   . HOH H 4 .   ? 30.279  -20.498 21.044 1.00   36.40 ? 2013 HOH A O   1 
HETATM 2552 O O   . HOH H 4 .   ? 26.420  -24.424 15.189 1.00   14.66 ? 2014 HOH A O   1 
HETATM 2553 O O   . HOH H 4 .   ? 28.198  -21.572 19.233 1.00   26.57 ? 2015 HOH A O   1 
HETATM 2554 O O   . HOH H 4 .   ? 24.734  -27.207 9.353  1.00   25.00 ? 2016 HOH A O   1 
HETATM 2555 O O   . HOH H 4 .   ? 24.025  -25.854 11.631 1.00   13.14 ? 2017 HOH A O   1 
HETATM 2556 O O   . HOH H 4 .   ? 32.096  -23.130 2.138  1.00   33.16 ? 2018 HOH A O   1 
HETATM 2557 O O   . HOH H 4 .   ? 22.180  -22.384 4.600  1.00   30.16 ? 2019 HOH A O   1 
HETATM 2558 O O   . HOH H 4 .   ? 21.518  -24.477 1.414  1.00   27.88 ? 2020 HOH A O   1 
HETATM 2559 O O   . HOH H 4 .   ? 22.704  -29.930 5.750  1.00   32.30 ? 2021 HOH A O   1 
HETATM 2560 O O   . HOH H 4 .   ? 26.405  -30.997 6.432  1.00   56.60 ? 2022 HOH A O   1 
HETATM 2561 O O   . HOH H 4 .   ? 25.143  -31.242 -1.470 1.00   30.05 ? 2023 HOH A O   1 
HETATM 2562 O O   . HOH H 4 .   ? 29.166  -22.694 -1.304 1.00   41.11 ? 2024 HOH A O   1 
HETATM 2563 O O   . HOH H 4 .   ? 19.625  -27.384 -0.560 1.00   16.40 ? 2025 HOH A O   1 
HETATM 2564 O O   . HOH H 4 .   ? 29.886  -20.628 4.090  1.00   22.71 ? 2026 HOH A O   1 
HETATM 2565 O O   . HOH H 4 .   ? 24.704  -22.952 -4.566 1.00   46.99 ? 2027 HOH A O   1 
HETATM 2566 O O   . HOH H 4 .   ? 22.062  -24.665 -2.216 1.00   32.07 ? 2028 HOH A O   1 
HETATM 2567 O O   . HOH H 4 .   ? 19.494  -11.697 -0.376 1.00   37.02 ? 2029 HOH A O   1 
HETATM 2568 O O   . HOH H 4 .   ? 21.888  -7.304  -4.610 1.00   50.05 ? 2030 HOH A O   1 
HETATM 2569 O O   . HOH H 4 .   ? 27.809  -12.105 2.918  1.00   21.37 ? 2031 HOH A O   1 
HETATM 2570 O O   . HOH H 4 .   ? 21.452  -3.273  1.860  1.00   36.16 ? 2032 HOH A O   1 
HETATM 2571 O O   . HOH H 4 .   ? 23.424  1.082   3.036  1.00   39.39 ? 2033 HOH A O   1 
HETATM 2572 O O   . HOH H 4 .   ? 29.814  1.035   3.826  1.00   40.02 ? 2034 HOH A O   1 
HETATM 2573 O O   . HOH H 4 .   ? 32.888  -1.174  1.931  1.00   34.03 ? 2035 HOH A O   1 
HETATM 2574 O O   . HOH H 4 .   ? 27.019  5.936   7.538  1.00   32.56 ? 2036 HOH A O   1 
HETATM 2575 O O   . HOH H 4 .   ? 28.784  2.804   5.609  1.00   20.32 ? 2037 HOH A O   1 
HETATM 2576 O O   . HOH H 4 .   ? 38.232  1.488   4.540  1.00   41.68 ? 2038 HOH A O   1 
HETATM 2577 O O   . HOH H 4 .   ? 34.656  0.566   4.057  1.00   39.47 ? 2039 HOH A O   1 
HETATM 2578 O O   . HOH H 4 .   ? 32.003  0.928   5.418  1.00   18.95 ? 2040 HOH A O   1 
HETATM 2579 O O   . HOH H 4 .   ? 35.530  4.444   4.871  1.00   28.74 ? 2041 HOH A O   1 
HETATM 2580 O O   . HOH H 4 .   ? 18.428  -2.960  5.000  1.00   37.94 ? 2042 HOH A O   1 
HETATM 2581 O O   . HOH H 4 .   ? 17.948  -7.531  4.441  1.00   23.22 ? 2043 HOH A O   1 
HETATM 2582 O O   . HOH H 4 .   ? 23.048  -5.181  7.737  1.00   20.31 ? 2044 HOH A O   1 
HETATM 2583 O O   . HOH H 4 .   ? 21.229  -2.436  6.264  1.00   33.02 ? 2045 HOH A O   1 
HETATM 2584 O O   . HOH H 4 .   ? 16.046  -15.226 10.554 1.00   22.29 ? 2046 HOH A O   1 
HETATM 2585 O O   . HOH H 4 .   ? 14.944  -14.598 6.491  1.00   16.69 ? 2047 HOH A O   1 
HETATM 2586 O O   . HOH H 4 .   ? 17.341  -11.485 8.829  1.00   11.10 ? 2048 HOH A O   1 
HETATM 2587 O O   . HOH H 4 .   ? 16.455  -14.654 0.746  1.00   41.39 ? 2049 HOH A O   1 
HETATM 2588 O O   . HOH H 4 .   ? 17.664  -20.606 2.716  1.00   32.22 ? 2050 HOH A O   1 
HETATM 2589 O O   . HOH H 4 .   ? 20.665  -14.753 3.949  1.00   18.26 ? 2051 HOH A O   1 
HETATM 2590 O O   . HOH H 4 .   ? 14.519  -17.732 4.783  1.00   17.47 ? 2052 HOH A O   1 
HETATM 2591 O O   . HOH H 4 .   ? 15.344  -21.176 5.025  1.00   40.25 ? 2053 HOH A O   1 
HETATM 2592 O O   . HOH H 4 .   ? 17.035  -26.816 10.303 1.00   24.39 ? 2054 HOH A O   1 
HETATM 2593 O O   . HOH H 4 .   ? 10.478  -25.551 8.621  1.00   43.42 ? 2055 HOH A O   1 
HETATM 2594 O O   . HOH H 4 .   ? 12.481  -23.210 6.776  1.00   25.85 ? 2056 HOH A O   1 
HETATM 2595 O O   . HOH H 4 .   ? 20.427  -25.703 8.763  1.00   27.63 ? 2057 HOH A O   1 
HETATM 2596 O O   . HOH H 4 .   ? 16.768  -26.383 7.410  1.00   25.79 ? 2058 HOH A O   1 
HETATM 2597 O O   . HOH H 4 .   ? 18.329  -23.195 12.496 1.00   6.45  ? 2059 HOH A O   1 
HETATM 2598 O O   . HOH H 4 .   ? 25.237  -23.664 12.893 1.00   11.91 ? 2060 HOH A O   1 
HETATM 2599 O O   . HOH H 4 .   ? 16.897  -18.869 16.149 1.00   31.19 ? 2061 HOH A O   1 
HETATM 2600 O O   . HOH H 4 .   ? 18.595  -21.507 17.883 1.00   17.53 ? 2062 HOH A O   1 
HETATM 2601 O O   . HOH H 4 .   ? 20.337  -14.068 19.665 1.00   32.94 ? 2063 HOH A O   1 
HETATM 2602 O O   . HOH H 4 .   ? 33.732  -8.281  28.080 1.00   38.18 ? 2064 HOH A O   1 
HETATM 2603 O O   . HOH H 4 .   ? 26.963  -9.268  28.521 1.00   54.69 ? 2065 HOH A O   1 
HETATM 2604 O O   . HOH H 4 .   ? 30.830  -5.174  29.623 1.00   59.67 ? 2066 HOH A O   1 
HETATM 2605 O O   . HOH H 4 .   ? 25.571  -3.261  25.926 1.00   46.51 ? 2067 HOH A O   1 
HETATM 2606 O O   . HOH H 4 .   ? 36.176  -10.253 24.580 1.00   39.77 ? 2068 HOH A O   1 
HETATM 2607 O O   . HOH H 4 .   ? 17.060  -13.905 12.704 1.00   18.39 ? 2069 HOH A O   1 
HETATM 2608 O O   . HOH H 4 .   ? 18.216  -15.927 14.461 1.00   30.14 ? 2070 HOH A O   1 
HETATM 2609 O O   . HOH H 4 .   ? 20.668  -7.549  21.220 1.00   31.69 ? 2071 HOH A O   1 
HETATM 2610 O O   . HOH H 4 .   ? 15.143  -9.996  21.954 1.00   34.53 ? 2072 HOH A O   1 
HETATM 2611 O O   . HOH H 4 .   ? 28.955  -26.502 14.699 1.00   40.48 ? 2073 HOH A O   1 
HETATM 2612 O O   . HOH H 4 .   ? 22.613  -28.068 7.646  1.00   28.47 ? 2074 HOH A O   1 
HETATM 2613 O O   . HOH H 4 .   ? 16.963  -7.577  14.277 1.00   13.46 ? 2075 HOH A O   1 
HETATM 2614 O O   . HOH H 4 .   ? 17.082  -11.324 11.709 1.00   8.58  ? 2076 HOH A O   1 
HETATM 2615 O O   . HOH H 4 .   ? 19.816  -21.408 4.886  1.00   37.72 ? 2077 HOH A O   1 
HETATM 2616 O O   . HOH H 4 .   ? 20.599  -22.283 0.702  1.00   39.74 ? 2078 HOH A O   1 
HETATM 2617 O O   . HOH H 4 .   ? 22.396  -3.131  15.251 1.00   14.13 ? 2079 HOH A O   1 
HETATM 2618 O O   . HOH H 4 .   ? 23.448  -12.426 18.082 1.00   11.22 ? 2080 HOH A O   1 
HETATM 2619 O O   . HOH H 4 .   ? 21.290  -10.415 18.437 1.00   19.92 ? 2081 HOH A O   1 
HETATM 2620 O O   . HOH H 4 .   ? 29.150  -0.920  17.757 1.00   24.33 ? 2082 HOH A O   1 
HETATM 2621 O O   . HOH H 4 .   ? 17.267  -9.762  -0.147 1.00   34.90 ? 2083 HOH A O   1 
HETATM 2622 O O   . HOH H 4 .   ? 32.573  -5.133  12.536 1.00   9.05  ? 2084 HOH A O   1 
HETATM 2623 O O   . HOH H 4 .   ? 36.868  -9.304  20.094 1.00   21.61 ? 2085 HOH A O   1 
HETATM 2624 O O   . HOH H 4 .   ? 15.866  -5.173  5.150  1.00   51.53 ? 2086 HOH A O   1 
HETATM 2625 O O   . HOH H 4 .   ? 15.881  -7.925  3.093  1.00   38.77 ? 2087 HOH A O   1 
HETATM 2626 O O   . HOH H 4 .   ? 12.487  -15.232 8.082  1.00   28.10 ? 2088 HOH A O   1 
HETATM 2627 O O   . HOH H 4 .   ? 37.948  -20.969 13.917 1.00   41.15 ? 2089 HOH A O   1 
HETATM 2628 O O   . HOH H 4 .   ? 38.618  -17.684 7.603  1.00   21.86 ? 2090 HOH A O   1 
HETATM 2629 O O   . HOH H 4 .   ? 42.714  -15.498 12.575 1.00   32.00 ? 2091 HOH A O   1 
HETATM 2630 O O   . HOH H 4 .   ? 14.503  -12.002 1.906  1.00   36.95 ? 2092 HOH A O   1 
HETATM 2631 O O   . HOH H 4 .   ? 11.052  -21.252 5.807  1.00   35.83 ? 2093 HOH A O   1 
HETATM 2632 O O   . HOH H 4 .   ? 14.077  -26.540 7.422  1.00   43.52 ? 2094 HOH A O   1 
HETATM 2633 O O   . HOH H 4 .   ? 9.033   -28.036 6.228  1.00   34.50 ? 2095 HOH A O   1 
HETATM 2634 O O   . HOH H 4 .   ? 36.286  -15.251 15.557 1.00   14.06 ? 2096 HOH A O   1 
HETATM 2635 O O   . HOH H 4 .   ? 38.857  -15.156 8.574  1.00   29.83 ? 2097 HOH A O   1 
HETATM 2636 O O   . HOH H 4 .   ? 45.090  -13.814 7.289  1.00   53.72 ? 2098 HOH A O   1 
HETATM 2637 O O   . HOH H 4 .   ? 41.764  -10.868 5.542  1.00   49.73 ? 2099 HOH A O   1 
HETATM 2638 O O   . HOH H 4 .   ? 26.477  -12.111 29.270 1.00   64.43 ? 2100 HOH A O   1 
HETATM 2639 O O   . HOH H 4 .   ? 43.770  -6.032  15.913 1.00   27.58 ? 2101 HOH A O   1 
HETATM 2640 O O   . HOH H 4 .   ? 41.721  -8.914  8.787  1.00   28.00 ? 2102 HOH A O   1 
HETATM 2641 O O   . HOH H 4 .   ? 43.079  -9.922  12.491 1.00   22.81 ? 2103 HOH A O   1 
HETATM 2642 O O   . HOH H 4 .   ? 41.699  -9.776  16.460 1.00   34.57 ? 2104 HOH A O   1 
HETATM 2643 O O   . HOH H 4 .   ? 15.344  -13.126 14.487 1.00   45.94 ? 2105 HOH A O   1 
HETATM 2644 O O   . HOH H 4 .   ? 17.640  -7.803  -1.824 1.00   53.97 ? 2106 HOH A O   1 
HETATM 2645 O O   . HOH H 4 .   ? 15.472  -10.121 1.796  1.00   37.70 ? 2107 HOH A O   1 
HETATM 2646 O O   . HOH H 4 .   ? 41.476  -4.147  10.510 1.00   29.47 ? 2108 HOH A O   1 
HETATM 2647 O O   . HOH H 4 .   ? 34.960  -4.180  13.163 1.00   14.65 ? 2109 HOH A O   1 
HETATM 2648 O O   . HOH H 4 .   ? 40.320  -4.009  6.292  1.00   24.25 ? 2110 HOH A O   1 
HETATM 2649 O O   . HOH H 4 .   ? 40.479  -5.801  9.185  1.00   24.02 ? 2111 HOH A O   1 
HETATM 2650 O O   . HOH H 4 .   ? 38.849  -0.818  4.110  1.00   30.41 ? 2112 HOH A O   1 
HETATM 2651 O O   . HOH H 4 .   ? 35.173  -1.403  2.701  1.00   30.42 ? 2113 HOH A O   1 
HETATM 2652 O O   . HOH H 4 .   ? 36.525  -11.210 21.957 1.00   39.16 ? 2114 HOH A O   1 
HETATM 2653 O O   . HOH H 4 .   ? 39.479  -9.059  20.354 1.00   43.64 ? 2115 HOH A O   1 
HETATM 2654 O O   . HOH H 4 .   ? 33.399  -2.572  6.610  1.00   14.87 ? 2116 HOH A O   1 
HETATM 2655 O O   . HOH H 4 .   ? 43.854  -13.590 11.480 1.00   47.39 ? 2117 HOH A O   1 
HETATM 2656 O O   . HOH H 4 .   ? 47.936  -13.165 9.066  1.00   28.00 ? 2118 HOH A O   1 
HETATM 2657 O O   . HOH H 4 .   ? 42.884  -12.366 3.809  1.00   53.64 ? 2119 HOH A O   1 
HETATM 2658 O O   . HOH H 4 .   ? 12.755  -14.225 1.832  1.00   58.03 ? 2120 HOH A O   1 
HETATM 2659 O O   . HOH H 4 .   ? 36.245  -5.965  -2.057 1.00   38.41 ? 2121 HOH A O   1 
HETATM 2660 O O   . HOH H 4 .   ? 38.011  -5.125  1.946  1.00   18.11 ? 2122 HOH A O   1 
HETATM 2661 O O   . HOH H 4 .   ? 28.562  -10.256 1.756  1.00   33.17 ? 2123 HOH A O   1 
HETATM 2662 O O   . HOH H 4 .   ? 37.447  -2.415  0.921  1.00   39.48 ? 2124 HOH A O   1 
HETATM 2663 O O   . HOH H 4 .   ? 38.942  -6.505  -0.370 1.00   33.83 ? 2125 HOH A O   1 
HETATM 2664 O O   . HOH H 4 .   ? 33.526  -4.592  -3.311 1.00   36.55 ? 2126 HOH A O   1 
HETATM 2665 O O   . HOH H 4 .   ? 37.332  -9.035  -1.858 1.00   52.31 ? 2127 HOH A O   1 
HETATM 2666 O O   . HOH H 4 .   ? 32.102  -12.169 -2.449 1.00   41.56 ? 2128 HOH A O   1 
HETATM 2667 O O   . HOH H 4 .   ? 31.663  -4.963  -1.550 1.00   19.91 ? 2129 HOH A O   1 
HETATM 2668 O O   . HOH H 4 .   ? 42.166  -4.393  2.491  1.00   43.16 ? 2130 HOH A O   1 
HETATM 2669 O O   . HOH H 4 .   ? 36.275  -2.161  -1.648 1.00   39.08 ? 2131 HOH A O   1 
HETATM 2670 O O   . HOH H 4 .   ? 39.258  -0.746  -0.806 1.00   56.63 ? 2132 HOH A O   1 
HETATM 2671 O O   . HOH H 4 .   ? 39.762  -1.554  -3.416 1.00   56.36 ? 2133 HOH A O   1 
HETATM 2672 O O   . HOH H 4 .   ? 42.249  -8.304  1.533  1.00   42.84 ? 2134 HOH A O   1 
HETATM 2673 O O   . HOH H 4 .   ? 39.996  -4.984  3.678  1.00   27.30 ? 2135 HOH A O   1 
HETATM 2674 O O   . HOH H 4 .   ? 29.028  -11.023 -2.173 1.00   34.55 ? 2136 HOH A O   1 
HETATM 2675 O O   . HOH H 4 .   ? 25.213  -14.168 0.120  1.00   37.44 ? 2137 HOH A O   1 
HETATM 2676 O O   . HOH H 4 .   ? 29.393  -16.323 1.477  1.00   28.34 ? 2138 HOH A O   1 
HETATM 2677 O O   . HOH H 4 .   ? 31.037  -27.232 0.699  1.00   50.47 ? 2139 HOH A O   1 
HETATM 2678 O O   . HOH H 4 .   ? 27.580  -28.587 14.917 1.00   46.73 ? 2140 HOH A O   1 
HETATM 2679 O O   . HOH H 4 .   ? 38.176  -17.896 4.863  1.00   23.11 ? 2141 HOH A O   1 
HETATM 2680 O O   . HOH H 4 .   ? 35.180  -25.174 16.086 1.00   27.71 ? 2142 HOH A O   1 
HETATM 2681 O O   . HOH H 4 .   ? 34.227  -13.433 22.085 1.00   34.81 ? 2143 HOH A O   1 
HETATM 2682 O O   . HOH H 4 .   ? 6.783   6.675   -2.782 1.00   41.83 ? 2144 HOH A O   1 
HETATM 2683 O O   . HOH H 4 .   ? 24.866  -13.935 24.780 1.00   53.75 ? 2145 HOH A O   1 
HETATM 2684 O O   . HOH H 4 .   ? 22.561  -12.054 26.864 1.00   49.01 ? 2146 HOH A O   1 
HETATM 2685 O O   . HOH H 4 .   ? 23.043  -15.138 23.499 1.00   29.39 ? 2147 HOH A O   1 
HETATM 2686 O O   . HOH H 4 .   ? 40.791  -20.692 2.689  1.00   46.56 ? 2148 HOH A O   1 
HETATM 2687 O O   . HOH H 4 .   ? 41.843  -17.236 -0.868 1.00   43.14 ? 2149 HOH A O   1 
HETATM 2688 O O   . HOH H 4 .   ? 39.637  -16.263 3.096  1.00   30.83 ? 2150 HOH A O   1 
HETATM 2689 O O   . HOH H 4 .   ? 36.154  -24.722 2.720  1.00   50.04 ? 2151 HOH A O   1 
HETATM 2690 O O   . HOH H 4 .   ? 38.985  -22.204 9.669  1.00   50.61 ? 2152 HOH A O   1 
HETATM 2691 O O   . HOH H 4 .   ? 39.719  -20.421 7.354  1.00   38.15 ? 2153 HOH A O   1 
HETATM 2692 O O   . HOH H 4 .   ? 9.673   -5.077  24.742 1.00   31.49 ? 2154 HOH A O   1 
HETATM 2693 O O   . HOH H 4 .   ? -4.479  -0.673  5.948  1.00   43.02 ? 2155 HOH A O   1 
HETATM 2694 O O   . HOH H 4 .   ? -4.530  1.609   25.774 1.00   25.86 ? 2156 HOH A O   1 
HETATM 2695 O O   . HOH H 4 .   ? 28.881  -29.469 6.888  1.00   41.62 ? 2157 HOH A O   1 
HETATM 2696 O O   . HOH H 4 .   ? 33.336  -26.846 3.363  1.00   34.60 ? 2158 HOH A O   1 
HETATM 2697 O O   . HOH H 4 .   ? -7.837  9.955   17.779 1.00   44.88 ? 2159 HOH A O   1 
HETATM 2698 O O   . HOH H 4 .   ? -5.596  8.456   22.459 1.00   43.10 ? 2160 HOH A O   1 
HETATM 2699 O O   . HOH H 4 .   ? 28.835  -31.269 14.814 1.00   47.17 ? 2161 HOH A O   1 
HETATM 2700 O O   . HOH H 4 .   ? 36.377  -22.257 9.179  1.00   25.79 ? 2162 HOH A O   1 
HETATM 2701 O O   . HOH H 4 .   ? 35.278  -23.042 14.177 1.00   36.41 ? 2163 HOH A O   1 
HETATM 2702 O O   . HOH H 4 .   ? 34.794  -14.974 19.909 1.00   30.58 ? 2164 HOH A O   1 
HETATM 2703 O O   . HOH H 4 .   ? 38.005  -13.119 18.223 1.00   26.45 ? 2165 HOH A O   1 
HETATM 2704 O O   . HOH H 4 .   ? 10.041  10.857  3.442  1.00   37.06 ? 2166 HOH A O   1 
HETATM 2705 O O   . HOH H 4 .   ? 4.524   8.563   2.114  1.00   51.68 ? 2167 HOH A O   1 
HETATM 2706 O O   . HOH H 4 .   ? 5.917   7.057   -0.321 1.00   53.86 ? 2168 HOH A O   1 
HETATM 2707 O O   . HOH H 4 .   ? 6.551   13.940  7.186  1.00   52.53 ? 2169 HOH A O   1 
HETATM 2708 O O   . HOH H 4 .   ? -0.363  10.750  7.278  1.00   50.06 ? 2170 HOH A O   1 
HETATM 2709 O O   . HOH H 4 .   ? 4.163   14.231  7.584  1.00   34.56 ? 2171 HOH A O   1 
HETATM 2710 O O   . HOH H 4 .   ? 30.928  -5.965  22.100 1.00   25.17 ? 2172 HOH A O   1 
HETATM 2711 O O   . HOH H 4 .   ? 33.832  -5.278  21.905 1.00   35.09 ? 2173 HOH A O   1 
HETATM 2712 O O   . HOH H 4 .   ? -4.349  11.184  11.318 1.00   38.44 ? 2174 HOH A O   1 
HETATM 2713 O O   . HOH H 4 .   ? 1.817   17.122  11.251 1.00   27.91 ? 2175 HOH A O   1 
HETATM 2714 O O   . HOH H 4 .   ? 23.989  -11.537 24.726 1.00   42.03 ? 2176 HOH A O   1 
HETATM 2715 O O   . HOH H 4 .   ? 26.345  -11.338 24.035 1.00   41.86 ? 2177 HOH A O   1 
HETATM 2716 O O   . HOH H 4 .   ? 23.143  -5.292  23.322 1.00   44.93 ? 2178 HOH A O   1 
HETATM 2717 O O   . HOH H 4 .   ? 21.693  -9.128  23.117 1.00   35.12 ? 2179 HOH A O   1 
HETATM 2718 O O   . HOH H 4 .   ? 22.150  -13.172 21.912 1.00   25.05 ? 2180 HOH A O   1 
HETATM 2719 O O   . HOH H 4 .   ? 27.157  -9.048  22.290 1.00   30.78 ? 2181 HOH A O   1 
HETATM 2720 O O   . HOH H 4 .   ? 25.711  -5.697  22.183 1.00   19.25 ? 2182 HOH A O   1 
HETATM 2721 O O   . HOH H 4 .   ? 21.412  -5.013  21.501 1.00   28.68 ? 2183 HOH A O   1 
HETATM 2722 O O   . HOH H 4 .   ? 25.524  -0.123  21.287 1.00   27.94 ? 2184 HOH A O   1 
HETATM 2723 O O   . HOH H 4 .   ? 21.317  0.477   20.653 1.00   22.19 ? 2185 HOH A O   1 
HETATM 2724 O O   . HOH H 4 .   ? 20.082  -2.104  22.413 1.00   44.31 ? 2186 HOH A O   1 
HETATM 2725 O O   . HOH H 4 .   ? 1.993   -7.390  23.464 1.00   30.38 ? 2187 HOH A O   1 
HETATM 2726 O O   . HOH H 4 .   ? 6.965   -8.053  21.961 1.00   32.32 ? 2188 HOH A O   1 
HETATM 2727 O O   . HOH H 4 .   ? 18.415  2.490   21.587 1.00   15.99 ? 2189 HOH A O   1 
HETATM 2728 O O   . HOH H 4 .   ? 10.004  -15.390 11.551 1.00   41.80 ? 2190 HOH A O   1 
HETATM 2729 O O   . HOH H 4 .   ? 14.083  -6.085  21.933 1.00   49.31 ? 2191 HOH A O   1 
HETATM 2730 O O   . HOH H 4 .   ? 12.039  2.794   24.085 1.00   15.68 ? 2192 HOH A O   1 
HETATM 2731 O O   . HOH H 4 .   ? 10.448  -0.141  25.875 1.00   30.58 ? 2193 HOH A O   1 
HETATM 2732 O O   . HOH H 4 .   ? 13.573  -0.984  25.501 1.00   27.28 ? 2194 HOH A O   1 
HETATM 2733 O O   . HOH H 4 .   ? 15.431  -0.203  23.392 1.00   18.98 ? 2195 HOH A O   1 
HETATM 2734 O O   . HOH H 4 .   ? 5.469   -9.435  -7.294 1.00   47.47 ? 2196 HOH A O   1 
HETATM 2735 O O   . HOH H 4 .   ? 6.129   -3.916  -2.043 1.00   46.36 ? 2197 HOH A O   1 
HETATM 2736 O O   . HOH H 4 .   ? 6.311   -15.421 6.276  1.00   47.12 ? 2198 HOH A O   1 
HETATM 2737 O O   . HOH H 4 .   ? 9.348   -2.294  24.757 1.00   18.97 ? 2199 HOH A O   1 
HETATM 2738 O O   . HOH H 4 .   ? 8.663   1.583   25.028 1.00   12.88 ? 2200 HOH A O   1 
HETATM 2739 O O   . HOH H 4 .   ? -1.138  -3.529  1.786  1.00   35.89 ? 2201 HOH A O   1 
HETATM 2740 O O   . HOH H 4 .   ? -3.348  -2.519  4.462  1.00   34.34 ? 2202 HOH A O   1 
HETATM 2741 O O   . HOH H 4 .   ? 0.387   -11.452 13.061 1.00   36.79 ? 2203 HOH A O   1 
HETATM 2742 O O   . HOH H 4 .   ? -8.036  -7.670  11.126 1.00   39.01 ? 2204 HOH A O   1 
HETATM 2743 O O   . HOH H 4 .   ? 2.473   2.828   24.368 1.00   11.26 ? 2205 HOH A O   1 
HETATM 2744 O O   . HOH H 4 .   ? -4.983  2.868   23.569 1.00   40.04 ? 2206 HOH A O   1 
HETATM 2745 O O   . HOH H 4 .   ? -7.439  1.148   21.553 1.00   37.22 ? 2207 HOH A O   1 
HETATM 2746 O O   . HOH H 4 .   ? 7.504   -5.833  25.946 1.00   31.80 ? 2208 HOH A O   1 
HETATM 2747 O O   . HOH H 4 .   ? -6.773  8.511   14.981 1.00   30.98 ? 2209 HOH A O   1 
HETATM 2748 O O   . HOH H 4 .   ? -6.000  5.876   14.370 1.00   49.97 ? 2210 HOH A O   1 
HETATM 2749 O O   . HOH H 4 .   ? -4.139  8.370   17.657 1.00   35.22 ? 2211 HOH A O   1 
HETATM 2750 O O   . HOH H 4 .   ? -7.849  7.019   21.393 1.00   35.38 ? 2212 HOH A O   1 
HETATM 2751 O O   . HOH H 4 .   ? -9.902  7.447   18.031 1.00   27.86 ? 2213 HOH A O   1 
HETATM 2752 O O   . HOH H 4 .   ? 22.892  7.324   8.363  1.00   23.56 ? 2214 HOH A O   1 
HETATM 2753 O O   . HOH H 4 .   ? -11.665 1.222   14.224 1.00   47.29 ? 2215 HOH A O   1 
HETATM 2754 O O   . HOH H 4 .   ? -11.104 2.917   11.968 1.00   48.34 ? 2216 HOH A O   1 
HETATM 2755 O O   . HOH H 4 .   ? -7.850  5.407   13.763 1.00   38.39 ? 2217 HOH A O   1 
HETATM 2756 O O   . HOH H 4 .   ? -5.972  -1.745  13.846 1.00   18.99 ? 2218 HOH A O   1 
HETATM 2757 O O   . HOH H 4 .   ? -7.248  1.097   11.289 1.00   53.58 ? 2219 HOH A O   1 
HETATM 2758 O O   . HOH H 4 .   ? -2.199  6.515   17.750 1.00   14.80 ? 2220 HOH A O   1 
HETATM 2759 O O   . HOH H 4 .   ? -2.929  7.615   12.694 1.00   35.82 ? 2221 HOH A O   1 
HETATM 2760 O O   . HOH H 4 .   ? 11.201  3.904   2.153  1.00   32.91 ? 2222 HOH A O   1 
HETATM 2761 O O   . HOH H 4 .   ? 10.085  -3.891  -0.119 1.00   39.40 ? 2223 HOH A O   1 
HETATM 2762 O O   . HOH H 4 .   ? 13.391  3.503   1.523  1.00   41.25 ? 2224 HOH A O   1 
HETATM 2763 O O   . HOH H 4 .   ? 7.094   10.994  3.770  1.00   46.03 ? 2225 HOH A O   1 
HETATM 2764 O O   . HOH H 4 .   ? 6.319   6.452   2.269  1.00   25.65 ? 2226 HOH A O   1 
HETATM 2765 O O   . HOH H 4 .   ? 5.430   8.927   4.618  1.00   23.69 ? 2227 HOH A O   1 
HETATM 2766 O O   . HOH H 4 .   ? 8.288   12.389  7.086  1.00   24.86 ? 2228 HOH A O   1 
HETATM 2767 O O   . HOH H 4 .   ? 2.068   11.009  8.109  1.00   35.15 ? 2229 HOH A O   1 
HETATM 2768 O O   . HOH H 4 .   ? 5.631   14.197  12.684 1.00   21.43 ? 2230 HOH A O   1 
HETATM 2769 O O   . HOH H 4 .   ? 2.927   13.202  9.449  1.00   26.93 ? 2231 HOH A O   1 
HETATM 2770 O O   . HOH H 4 .   ? 6.578   12.773  9.665  1.00   18.34 ? 2232 HOH A O   1 
HETATM 2771 O O   . HOH H 4 .   ? -3.224  13.616  13.509 1.00   29.00 ? 2233 HOH A O   1 
HETATM 2772 O O   . HOH H 4 .   ? -0.590  21.509  17.705 1.00   36.27 ? 2234 HOH A O   1 
HETATM 2773 O O   . HOH H 4 .   ? 0.635   14.245  10.896 1.00   20.13 ? 2235 HOH A O   1 
HETATM 2774 O O   . HOH H 4 .   ? -3.286  10.727  15.623 1.00   24.58 ? 2236 HOH A O   1 
HETATM 2775 O O   . HOH H 4 .   ? -4.940  11.641  17.698 1.00   40.66 ? 2237 HOH A O   1 
HETATM 2776 O O   . HOH H 4 .   ? -2.340  17.970  21.538 1.00   44.31 ? 2238 HOH A O   1 
HETATM 2777 O O   . HOH H 4 .   ? -4.249  9.239   19.941 1.00   37.21 ? 2239 HOH A O   1 
HETATM 2778 O O   . HOH H 4 .   ? 2.035   15.118  18.225 1.00   16.55 ? 2240 HOH A O   1 
HETATM 2779 O O   . HOH H 4 .   ? -4.895  16.427  15.915 1.00   52.82 ? 2241 HOH A O   1 
HETATM 2780 O O   . HOH H 4 .   ? 0.473   6.040   23.128 1.00   18.44 ? 2242 HOH A O   1 
HETATM 2781 O O   . HOH H 4 .   ? 7.344   13.125  20.596 1.00   7.15  ? 2243 HOH A O   1 
HETATM 2782 O O   . HOH H 4 .   ? -3.087  5.682   20.976 1.00   28.39 ? 2244 HOH A O   1 
HETATM 2783 O O   . HOH H 4 .   ? 7.525   7.165   25.622 1.00   10.16 ? 2245 HOH A O   1 
HETATM 2784 O O   . HOH H 4 .   ? 15.111  12.642  7.908  1.00   30.10 ? 2246 HOH A O   1 
HETATM 2785 O O   . HOH H 4 .   ? 18.530  7.023   10.349 1.00   31.97 ? 2247 HOH A O   1 
HETATM 2786 O O   . HOH H 4 .   ? 10.909  10.519  5.738  1.00   31.79 ? 2248 HOH A O   1 
HETATM 2787 O O   . HOH H 4 .   ? 19.300  0.164   5.420  1.00   41.33 ? 2249 HOH A O   1 
HETATM 2788 O O   . HOH H 4 .   ? 15.858  0.753   4.245  1.00   26.75 ? 2250 HOH A O   1 
HETATM 2789 O O   . HOH H 4 .   ? 12.556  -3.657  7.440  1.00   22.75 ? 2251 HOH A O   1 
HETATM 2790 O O   . HOH H 4 .   ? 14.344  -11.712 18.251 1.00   25.07 ? 2252 HOH A O   1 
HETATM 2791 O O   . HOH H 4 .   ? 14.600  -8.342  14.904 1.00   27.86 ? 2253 HOH A O   1 
HETATM 2792 O O   . HOH H 4 .   ? 14.405  -11.047 14.864 1.00   23.40 ? 2254 HOH A O   1 
HETATM 2793 O O   . HOH H 4 .   ? 4.041   -10.077 15.335 1.00   26.85 ? 2255 HOH A O   1 
HETATM 2794 O O   . HOH H 4 .   ? 3.923   -6.089  22.420 1.00   22.65 ? 2256 HOH A O   1 
HETATM 2795 O O   . HOH H 4 .   ? 5.893   -13.230 18.207 1.00   27.48 ? 2257 HOH A O   1 
HETATM 2796 O O   . HOH H 4 .   ? 1.135   -9.002  16.712 1.00   13.03 ? 2258 HOH A O   1 
HETATM 2797 O O   . HOH H 4 .   ? 2.829   -11.186 17.275 1.00   33.40 ? 2259 HOH A O   1 
HETATM 2798 O O   . HOH H 4 .   ? 9.333   -7.574  19.078 1.00   30.30 ? 2260 HOH A O   1 
HETATM 2799 O O   . HOH H 4 .   ? 10.154  -14.287 14.096 1.00   28.41 ? 2261 HOH A O   1 
HETATM 2800 O O   . HOH H 4 .   ? 12.665  -15.424 11.082 1.00   26.22 ? 2262 HOH A O   1 
HETATM 2801 O O   . HOH H 4 .   ? 9.503   -13.589 9.195  1.00   31.41 ? 2263 HOH A O   1 
HETATM 2802 O O   . HOH H 4 .   ? 15.209  -9.642  12.758 1.00   14.29 ? 2264 HOH A O   1 
HETATM 2803 O O   . HOH H 4 .   ? 11.891  -5.673  5.626  1.00   35.31 ? 2265 HOH A O   1 
HETATM 2804 O O   . HOH H 4 .   ? 11.390  -12.625 6.313  1.00   38.86 ? 2266 HOH A O   1 
HETATM 2805 O O   . HOH H 4 .   ? 14.858  -12.199 7.980  1.00   15.03 ? 2267 HOH A O   1 
HETATM 2806 O O   . HOH H 4 .   ? 9.671   -11.342 0.571  1.00   37.12 ? 2268 HOH A O   1 
HETATM 2807 O O   . HOH H 4 .   ? 9.521   -4.614  3.012  1.00   17.06 ? 2269 HOH A O   1 
HETATM 2808 O O   . HOH H 4 .   ? 12.088  -7.002  2.172  1.00   43.12 ? 2270 HOH A O   1 
HETATM 2809 O O   . HOH H 4 .   ? 5.183   -10.053 -4.186 1.00   50.96 ? 2271 HOH A O   1 
HETATM 2810 O O   . HOH H 4 .   ? 7.492   -4.801  -0.404 1.00   18.21 ? 2272 HOH A O   1 
HETATM 2811 O O   . HOH H 4 .   ? 5.450   -0.863  -0.980 1.00   28.21 ? 2273 HOH A O   1 
HETATM 2812 O O   . HOH H 4 .   ? 3.015   -7.322  -1.968 1.00   35.41 ? 2274 HOH A O   1 
HETATM 2813 O O   . HOH H 4 .   ? 4.082   -5.216  -0.726 1.00   14.69 ? 2275 HOH A O   1 
HETATM 2814 O O   . HOH H 4 .   ? 0.778   -9.705  1.721  1.00   27.60 ? 2276 HOH A O   1 
HETATM 2815 O O   . HOH H 4 .   ? 7.857   -12.441 1.687  1.00   30.01 ? 2277 HOH A O   1 
HETATM 2816 O O   . HOH H 4 .   ? 1.921   -10.923 7.191  1.00   25.57 ? 2278 HOH A O   1 
HETATM 2817 O O   . HOH H 4 .   ? 6.798   -15.090 3.723  1.00   37.16 ? 2279 HOH A O   1 
HETATM 2818 O O   . HOH H 4 .   ? 1.945   -13.878 3.939  1.00   40.20 ? 2280 HOH A O   1 
HETATM 2819 O O   . HOH H 4 .   ? -5.316  -7.714  3.730  1.00   52.65 ? 2281 HOH A O   1 
HETATM 2820 O O   . HOH H 4 .   ? 0.463   -11.433 5.297  1.00   35.59 ? 2282 HOH A O   1 
HETATM 2821 O O   . HOH H 4 .   ? -1.448  -5.537  3.273  1.00   28.21 ? 2283 HOH A O   1 
HETATM 2822 O O   . HOH H 4 .   ? -3.496  -4.328  6.195  1.00   31.99 ? 2284 HOH A O   1 
HETATM 2823 O O   . HOH H 4 .   ? -0.058  -9.045  14.318 1.00   13.58 ? 2285 HOH A O   1 
HETATM 2824 O O   . HOH H 4 .   ? -6.625  -2.196  11.403 1.00   21.93 ? 2286 HOH A O   1 
HETATM 2825 O O   . HOH H 4 .   ? -6.643  -6.575  9.352  1.00   30.37 ? 2287 HOH A O   1 
HETATM 2826 O O   . HOH H 4 .   ? -7.075  -5.247  14.201 1.00   25.10 ? 2288 HOH A O   1 
HETATM 2827 O O   . HOH H 4 .   ? -7.015  -7.430  15.384 1.00   23.23 ? 2289 HOH A O   1 
HETATM 2828 O O   . HOH H 4 .   ? -6.173  -10.171 15.111 1.00   34.87 ? 2290 HOH A O   1 
HETATM 2829 O O   . HOH H 4 .   ? -0.990  -8.766  18.837 1.00   15.67 ? 2291 HOH A O   1 
HETATM 2830 O O   . HOH H 4 .   ? -6.878  -3.086  24.183 1.00   14.82 ? 2292 HOH A O   1 
HETATM 2831 O O   . HOH H 4 .   ? -0.316  -6.984  20.968 1.00   16.85 ? 2293 HOH A O   1 
HETATM 2832 O O   . HOH H 4 .   ? 5.895   -6.420  23.871 1.00   29.77 ? 2294 HOH A O   1 
HETATM 2833 O O   . HOH H 4 .   ? 9.530   -5.486  18.935 1.00   29.19 ? 2295 HOH A O   1 
HETATM 2834 O O   . HOH H 4 .   ? 19.152  -0.902  9.738  1.00   13.93 ? 2296 HOH A O   1 
HETATM 2835 O O   . HOH H 4 .   ? 22.657  6.432   5.859  1.00   46.21 ? 2297 HOH A O   1 
HETATM 2836 O O   . HOH H 4 .   ? 26.143  3.869   5.717  1.00   43.88 ? 2298 HOH A O   1 
HETATM 2837 O O   . HOH H 4 .   ? 21.677  -20.601 2.405  1.00   36.44 ? 2299 HOH A O   1 
HETATM 2838 O O   . HOH H 4 .   ? 28.876  -18.957 2.485  1.00   23.83 ? 2300 HOH A O   1 
HETATM 2839 O O   . HOH H 4 .   ? 22.201  -16.093 2.157  1.00   31.50 ? 2301 HOH A O   1 
HETATM 2840 O O   . HOH I 4 .   ? 9.874   0.293   35.112 1.00   36.33 ? 2001 HOH B O   1 
HETATM 2841 O O   . HOH I 4 .   ? 10.516  -1.582  33.691 1.00   33.30 ? 2002 HOH B O   1 
HETATM 2842 O O   . HOH I 4 .   ? 11.810  3.613   34.470 1.00   20.96 ? 2003 HOH B O   1 
HETATM 2843 O O   . HOH I 4 .   ? 15.488  4.672   32.787 1.00   9.35  ? 2004 HOH B O   1 
HETATM 2844 O O   . HOH I 4 .   ? 19.374  4.029   27.942 1.00   36.54 ? 2005 HOH B O   1 
HETATM 2845 O O   . HOH I 4 .   ? 12.444  5.799   25.870 1.00   10.16 ? 2006 HOH B O   1 
HETATM 2846 O O   . HOH I 4 .   ? 8.217   0.237   30.857 1.00   30.66 ? 2007 HOH B O   1 
HETATM 2847 O O   . HOH I 4 .   ? 16.005  6.290   28.451 1.00   10.15 ? 2008 HOH B O   1 
HETATM 2848 O O   . HOH I 4 .   ? 10.095  -1.315  30.447 1.00   29.21 ? 2009 HOH B O   1 
HETATM 2849 O O   . HOH I 4 .   ? 13.302  -0.722  29.919 1.00   31.70 ? 2010 HOH B O   1 
HETATM 2850 O O   . HOH I 4 .   ? 10.379  3.255   26.334 1.00   13.05 ? 2011 HOH B O   1 
HETATM 2851 O O   . HOH I 4 .   ? 10.862  -0.585  28.029 1.00   40.50 ? 2012 HOH B O   1 
HETATM 2852 O O   . HOH I 4 .   ? 13.147  5.922   33.780 1.00   16.84 ? 2013 HOH B O   1 
HETATM 2853 O O   . HOH I 4 .   ? 9.804   6.096   32.481 1.00   28.53 ? 2014 HOH B O   1 
HETATM 2854 O O   . HOH I 4 .   ? 7.492   15.396  35.755 1.00   40.78 ? 2015 HOH B O   1 
HETATM 2855 O O   . HOH I 4 .   ? 7.487   10.197  31.851 1.00   32.72 ? 2016 HOH B O   1 
HETATM 2856 O O   . HOH I 4 .   ? 5.229   15.225  31.598 1.00   41.31 ? 2017 HOH B O   1 
HETATM 2857 O O   . HOH I 4 .   ? 11.473  14.643  37.626 1.00   37.43 ? 2018 HOH B O   1 
HETATM 2858 O O   . HOH I 4 .   ? 8.816   16.016  34.094 1.00   31.21 ? 2019 HOH B O   1 
HETATM 2859 O O   . HOH I 4 .   ? 11.797  9.830   35.774 1.00   23.14 ? 2020 HOH B O   1 
HETATM 2860 O O   . HOH I 4 .   ? 12.594  11.544  37.343 1.00   38.28 ? 2021 HOH B O   1 
HETATM 2861 O O   . HOH I 4 .   ? 16.189  21.329  38.023 1.00   26.08 ? 2022 HOH B O   1 
HETATM 2862 O O   . HOH I 4 .   ? 14.387  18.022  37.908 1.00   17.43 ? 2023 HOH B O   1 
HETATM 2863 O O   . HOH I 4 .   ? 16.735  23.767  36.832 1.00   25.50 ? 2024 HOH B O   1 
HETATM 2864 O O   . HOH I 4 .   ? 17.737  27.868  37.226 1.00   22.68 ? 2025 HOH B O   1 
HETATM 2865 O O   . HOH I 4 .   ? 16.977  30.151  38.819 1.00   25.33 ? 2026 HOH B O   1 
HETATM 2866 O O   . HOH I 4 .   ? 12.770  31.530  35.490 1.00   29.43 ? 2027 HOH B O   1 
HETATM 2867 O O   . HOH I 4 .   ? 23.351  29.027  34.731 1.00   28.48 ? 2028 HOH B O   1 
HETATM 2868 O O   . HOH I 4 .   ? 23.222  31.979  31.943 1.00   35.12 ? 2029 HOH B O   1 
HETATM 2869 O O   . HOH I 4 .   ? 14.694  33.282  34.788 1.00   31.54 ? 2030 HOH B O   1 
HETATM 2870 O O   . HOH I 4 .   ? 22.486  28.285  31.103 1.00   21.52 ? 2031 HOH B O   1 
HETATM 2871 O O   . HOH I 4 .   ? 17.391  37.299  37.091 1.00   52.25 ? 2032 HOH B O   1 
HETATM 2872 O O   . HOH I 4 .   ? 21.327  38.143  30.897 1.00   46.00 ? 2033 HOH B O   1 
HETATM 2873 O O   . HOH I 4 .   ? 14.939  36.314  30.466 1.00   51.15 ? 2034 HOH B O   1 
HETATM 2874 O O   . HOH I 4 .   ? 13.745  33.030  28.965 1.00   32.67 ? 2035 HOH B O   1 
HETATM 2875 O O   . HOH I 4 .   ? 16.602  32.303  25.225 1.00   25.43 ? 2036 HOH B O   1 
HETATM 2876 O O   . HOH I 4 .   ? 20.236  30.586  23.110 1.00   35.71 ? 2037 HOH B O   1 
HETATM 2877 O O   . HOH I 4 .   ? 20.420  35.345  23.977 1.00   36.60 ? 2038 HOH B O   1 
HETATM 2878 O O   . HOH I 4 .   ? 17.960  26.590  22.264 1.00   17.06 ? 2039 HOH B O   1 
HETATM 2879 O O   . HOH I 4 .   ? 22.258  26.981  23.640 1.00   19.84 ? 2040 HOH B O   1 
HETATM 2880 O O   . HOH I 4 .   ? 25.672  28.863  22.000 1.00   57.81 ? 2041 HOH B O   1 
HETATM 2881 O O   . HOH I 4 .   ? 21.713  27.589  20.030 1.00   37.79 ? 2042 HOH B O   1 
HETATM 2882 O O   . HOH I 4 .   ? 28.118  24.693  18.204 1.00   30.22 ? 2043 HOH B O   1 
HETATM 2883 O O   . HOH I 4 .   ? 25.325  22.124  17.260 1.00   19.07 ? 2044 HOH B O   1 
HETATM 2884 O O   . HOH I 4 .   ? 16.912  24.558  20.771 1.00   12.55 ? 2045 HOH B O   1 
HETATM 2885 O O   . HOH I 4 .   ? 16.960  24.508  17.896 1.00   13.41 ? 2046 HOH B O   1 
HETATM 2886 O O   . HOH I 4 .   ? 21.501  18.381  9.225  1.00   49.73 ? 2047 HOH B O   1 
HETATM 2887 O O   . HOH I 4 .   ? 25.166  18.235  11.049 1.00   35.20 ? 2048 HOH B O   1 
HETATM 2888 O O   . HOH I 4 .   ? 22.779  15.823  13.000 1.00   26.97 ? 2049 HOH B O   1 
HETATM 2889 O O   . HOH I 4 .   ? 24.175  20.097  13.087 1.00   16.28 ? 2050 HOH B O   1 
HETATM 2890 O O   . HOH I 4 .   ? 17.541  18.997  11.060 1.00   46.78 ? 2051 HOH B O   1 
HETATM 2891 O O   . HOH I 4 .   ? 18.306  16.386  10.697 1.00   25.06 ? 2052 HOH B O   1 
HETATM 2892 O O   . HOH I 4 .   ? 12.317  18.897  10.859 1.00   45.03 ? 2053 HOH B O   1 
HETATM 2893 O O   . HOH I 4 .   ? 15.446  16.992  10.091 1.00   30.64 ? 2054 HOH B O   1 
HETATM 2894 O O   . HOH I 4 .   ? 18.780  9.922   8.988  1.00   30.89 ? 2055 HOH B O   1 
HETATM 2895 O O   . HOH I 4 .   ? 16.847  13.870  9.691  1.00   17.80 ? 2056 HOH B O   1 
HETATM 2896 O O   . HOH I 4 .   ? 10.923  16.656  11.545 1.00   50.88 ? 2057 HOH B O   1 
HETATM 2897 O O   . HOH I 4 .   ? 11.070  12.871  7.094  1.00   40.32 ? 2058 HOH B O   1 
HETATM 2898 O O   . HOH I 4 .   ? 9.113   11.306  16.649 1.00   9.77  ? 2059 HOH B O   1 
HETATM 2899 O O   . HOH I 4 .   ? 13.502  15.431  10.986 1.00   19.17 ? 2060 HOH B O   1 
HETATM 2900 O O   . HOH I 4 .   ? 24.427  19.842  16.018 1.00   24.96 ? 2061 HOH B O   1 
HETATM 2901 O O   . HOH I 4 .   ? 22.339  14.314  18.371 1.00   25.94 ? 2062 HOH B O   1 
HETATM 2902 O O   . HOH I 4 .   ? 27.022  20.815  19.054 1.00   22.83 ? 2063 HOH B O   1 
HETATM 2903 O O   . HOH I 4 .   ? 23.989  15.878  15.468 1.00   22.98 ? 2064 HOH B O   1 
HETATM 2904 O O   . HOH I 4 .   ? 26.914  19.177  24.683 1.00   12.17 ? 2065 HOH B O   1 
HETATM 2905 O O   . HOH I 4 .   ? 27.709  19.883  29.254 1.00   26.01 ? 2066 HOH B O   1 
HETATM 2906 O O   . HOH I 4 .   ? 29.108  22.581  26.141 1.00   20.34 ? 2067 HOH B O   1 
HETATM 2907 O O   . HOH I 4 .   ? 28.526  27.161  23.638 1.00   31.33 ? 2068 HOH B O   1 
HETATM 2908 O O   . HOH I 4 .   ? 26.678  29.133  28.986 1.00   34.15 ? 2069 HOH B O   1 
HETATM 2909 O O   . HOH I 4 .   ? 23.742  24.874  24.560 1.00   14.35 ? 2070 HOH B O   1 
HETATM 2910 O O   . HOH I 4 .   ? 28.132  27.585  30.664 1.00   40.82 ? 2071 HOH B O   1 
HETATM 2911 O O   . HOH I 4 .   ? 29.601  25.723  28.074 1.00   30.99 ? 2072 HOH B O   1 
HETATM 2912 O O   . HOH I 4 .   ? 25.468  27.938  31.955 1.00   31.09 ? 2073 HOH B O   1 
HETATM 2913 O O   . HOH I 4 .   ? 23.064  26.620  36.494 1.00   39.77 ? 2074 HOH B O   1 
HETATM 2914 O O   . HOH I 4 .   ? 26.964  24.408  37.932 1.00   48.89 ? 2075 HOH B O   1 
HETATM 2915 O O   . HOH I 4 .   ? 26.925  28.545  35.883 1.00   50.92 ? 2076 HOH B O   1 
HETATM 2916 O O   . HOH I 4 .   ? 32.391  22.399  36.842 1.00   35.68 ? 2077 HOH B O   1 
HETATM 2917 O O   . HOH I 4 .   ? 30.981  26.700  34.128 1.00   28.40 ? 2078 HOH B O   1 
HETATM 2918 O O   . HOH I 4 .   ? 28.734  21.118  33.503 1.00   31.00 ? 2079 HOH B O   1 
HETATM 2919 O O   . HOH I 4 .   ? 18.623  22.205  36.703 1.00   20.92 ? 2080 HOH B O   1 
HETATM 2920 O O   . HOH I 4 .   ? 26.775  20.519  35.552 1.00   39.06 ? 2081 HOH B O   1 
HETATM 2921 O O   . HOH I 4 .   ? 24.896  16.786  32.100 1.00   25.51 ? 2082 HOH B O   1 
HETATM 2922 O O   . HOH I 4 .   ? 21.561  19.119  39.827 1.00   13.44 ? 2083 HOH B O   1 
HETATM 2923 O O   . HOH I 4 .   ? 10.681  -0.425  37.864 1.00   40.02 ? 2084 HOH B O   1 
HETATM 2924 O O   . HOH I 4 .   ? 21.181  4.696   28.985 1.00   35.89 ? 2085 HOH B O   1 
HETATM 2925 O O   . HOH I 4 .   ? 26.513  17.244  28.703 1.00   19.35 ? 2086 HOH B O   1 
HETATM 2926 O O   . HOH I 4 .   ? 9.402   9.251   35.334 1.00   41.05 ? 2087 HOH B O   1 
HETATM 2927 O O   . HOH I 4 .   ? 9.134   14.567  37.524 1.00   35.27 ? 2088 HOH B O   1 
HETATM 2928 O O   . HOH I 4 .   ? 5.168   13.951  38.824 1.00   46.28 ? 2089 HOH B O   1 
HETATM 2929 O O   . HOH I 4 .   ? 27.468  9.482   28.569 1.00   34.09 ? 2090 HOH B O   1 
HETATM 2930 O O   . HOH I 4 .   ? 26.394  14.571  32.138 1.00   33.21 ? 2091 HOH B O   1 
HETATM 2931 O O   . HOH I 4 .   ? 21.761  10.742  32.273 1.00   23.34 ? 2092 HOH B O   1 
HETATM 2932 O O   . HOH I 4 .   ? 20.008  24.176  37.994 1.00   24.68 ? 2093 HOH B O   1 
HETATM 2933 O O   . HOH I 4 .   ? 20.312  28.590  37.671 1.00   35.80 ? 2094 HOH B O   1 
HETATM 2934 O O   . HOH I 4 .   ? 26.926  16.631  25.992 1.00   8.89  ? 2095 HOH B O   1 
HETATM 2935 O O   . HOH I 4 .   ? 23.368  29.251  28.443 1.00   32.23 ? 2096 HOH B O   1 
HETATM 2936 O O   . HOH I 4 .   ? 24.065  32.269  29.437 1.00   42.02 ? 2097 HOH B O   1 
HETATM 2937 O O   . HOH I 4 .   ? 24.139  38.909  28.956 1.00   60.04 ? 2098 HOH B O   1 
HETATM 2938 O O   . HOH I 4 .   ? 11.419  35.387  28.375 1.00   48.90 ? 2099 HOH B O   1 
HETATM 2939 O O   . HOH I 4 .   ? 22.644  9.768   28.014 1.00   15.34 ? 2100 HOH B O   1 
HETATM 2940 O O   . HOH I 4 .   ? 20.759  11.832  29.903 1.00   10.13 ? 2101 HOH B O   1 
HETATM 2941 O O   . HOH I 4 .   ? 15.820  34.743  25.198 1.00   30.69 ? 2102 HOH B O   1 
HETATM 2942 O O   . HOH I 4 .   ? 20.163  27.822  21.739 1.00   43.29 ? 2103 HOH B O   1 
HETATM 2943 O O   . HOH I 4 .   ? 29.128  22.885  19.234 1.00   31.94 ? 2104 HOH B O   1 
HETATM 2944 O O   . HOH I 4 .   ? 24.021  13.572  11.501 1.00   44.16 ? 2105 HOH B O   1 
HETATM 2945 O O   . HOH I 4 .   ? 19.092  17.286  8.407  1.00   45.89 ? 2106 HOH B O   1 
HETATM 2946 O O   . HOH I 4 .   ? 14.085  18.429  8.553  1.00   36.15 ? 2107 HOH B O   1 
HETATM 2947 O O   . HOH I 4 .   ? 12.523  21.045  9.388  1.00   28.83 ? 2108 HOH B O   1 
HETATM 2948 O O   . HOH I 4 .   ? 11.955  13.183  19.944 1.00   6.35  ? 2109 HOH B O   1 
HETATM 2949 O O   . HOH I 4 .   ? 19.524  12.651  9.117  1.00   43.80 ? 2110 HOH B O   1 
HETATM 2950 O O   . HOH I 4 .   ? 6.720   9.613   26.399 1.00   15.21 ? 2111 HOH B O   1 
HETATM 2951 O O   . HOH I 4 .   ? 23.415  13.245  16.133 1.00   25.25 ? 2112 HOH B O   1 
HETATM 2952 O O   . HOH I 4 .   ? 26.334  16.841  15.134 1.00   39.21 ? 2113 HOH B O   1 
HETATM 2953 O O   . HOH I 4 .   ? 29.733  24.693  24.527 1.00   28.69 ? 2114 HOH B O   1 
HETATM 2954 O O   . HOH I 4 .   ? 5.950   24.889  26.300 1.00   15.89 ? 2115 HOH B O   1 
HETATM 2955 O O   . HOH I 4 .   ? 4.595   25.983  30.734 1.00   32.59 ? 2116 HOH B O   1 
HETATM 2956 O O   . HOH I 4 .   ? 5.400   22.084  32.884 1.00   30.20 ? 2117 HOH B O   1 
HETATM 2957 O O   . HOH I 4 .   ? 28.493  31.502  29.308 1.00   58.22 ? 2118 HOH B O   1 
HETATM 2958 O O   . HOH I 4 .   ? 1.535   15.126  28.594 1.00   47.18 ? 2119 HOH B O   1 
HETATM 2959 O O   . HOH I 4 .   ? 7.078   16.976  29.305 1.00   14.37 ? 2120 HOH B O   1 
HETATM 2960 O O   . HOH I 4 .   ? -1.491  20.379  21.933 1.00   34.51 ? 2121 HOH B O   1 
HETATM 2961 O O   . HOH I 4 .   ? 0.748   19.869  27.940 1.00   33.71 ? 2122 HOH B O   1 
HETATM 2962 O O   . HOH I 4 .   ? 2.021   21.330  21.180 1.00   28.81 ? 2123 HOH B O   1 
HETATM 2963 O O   . HOH I 4 .   ? -0.411  17.481  24.084 1.00   46.59 ? 2124 HOH B O   1 
HETATM 2964 O O   . HOH I 4 .   ? 2.250   13.936  25.024 1.00   18.65 ? 2125 HOH B O   1 
HETATM 2965 O O   . HOH I 4 .   ? 3.073   19.498  19.830 1.00   31.82 ? 2126 HOH B O   1 
HETATM 2966 O O   . HOH I 4 .   ? 4.369   16.969  17.940 1.00   26.52 ? 2127 HOH B O   1 
HETATM 2967 O O   . HOH I 4 .   ? 1.403   16.893  22.149 1.00   17.16 ? 2128 HOH B O   1 
HETATM 2968 O O   . HOH I 4 .   ? -0.467  12.872  21.817 1.00   24.00 ? 2129 HOH B O   1 
HETATM 2969 O O   . HOH I 4 .   ? 27.898  15.458  30.086 1.00   34.97 ? 2130 HOH B O   1 
HETATM 2970 O O   . HOH I 4 .   ? 23.125  8.784   31.120 1.00   34.03 ? 2131 HOH B O   1 
HETATM 2971 O O   . HOH I 4 .   ? 30.245  9.309   30.817 1.00   35.63 ? 2132 HOH B O   1 
HETATM 2972 O O   . HOH I 4 .   ? 7.988   11.390  37.382 1.00   41.56 ? 2133 HOH B O   1 
HETATM 2973 O O   . HOH I 4 .   ? 23.097  33.766  27.677 1.00   58.51 ? 2134 HOH B O   1 
HETATM 2974 O O   . HOH I 4 .   ? 13.318  36.061  24.816 1.00   42.25 ? 2135 HOH B O   1 
HETATM 2975 O O   . HOH I 4 .   ? 9.616   12.300  19.140 1.00   8.53  ? 2136 HOH B O   1 
HETATM 2976 O O   . HOH I 4 .   ? 5.009   18.093  14.593 1.00   21.27 ? 2137 HOH B O   1 
HETATM 2977 O O   . HOH I 4 .   ? 10.096  19.099  10.877 1.00   25.91 ? 2138 HOH B O   1 
HETATM 2978 O O   . HOH I 4 .   ? 6.706   17.781  10.698 1.00   26.17 ? 2139 HOH B O   1 
HETATM 2979 O O   . HOH I 4 .   ? 11.465  16.577  14.471 1.00   11.68 ? 2140 HOH B O   1 
HETATM 2980 O O   . HOH I 4 .   ? 3.338   19.224  16.600 1.00   23.09 ? 2141 HOH B O   1 
HETATM 2981 O O   . HOH I 4 .   ? 3.605   27.944  31.282 1.00   31.55 ? 2142 HOH B O   1 
HETATM 2982 O O   . HOH I 4 .   ? 3.155   12.499  27.416 1.00   27.65 ? 2143 HOH B O   1 
HETATM 2983 O O   . HOH I 4 .   ? -0.780  19.804  19.783 1.00   39.77 ? 2144 HOH B O   1 
HETATM 2984 O O   . HOH I 4 .   ? 10.221  25.914  11.130 1.00   13.83 ? 2145 HOH B O   1 
HETATM 2985 O O   . HOH I 4 .   ? 7.782   22.353  13.080 1.00   11.09 ? 2146 HOH B O   1 
HETATM 2986 O O   . HOH I 4 .   ? -0.167  13.255  24.665 1.00   39.48 ? 2147 HOH B O   1 
HETATM 2987 O O   . HOH I 4 .   ? 4.301   16.937  12.286 1.00   24.66 ? 2148 HOH B O   1 
HETATM 2988 O O   . HOH I 4 .   ? 18.652  22.319  12.149 1.00   12.63 ? 2149 HOH B O   1 
HETATM 2989 O O   . HOH I 4 .   ? 14.501  21.393  11.204 1.00   9.42  ? 2150 HOH B O   1 
HETATM 2990 O O   . HOH I 4 .   ? 5.735   20.201  9.542  1.00   42.78 ? 2151 HOH B O   1 
HETATM 2991 O O   . HOH I 4 .   ? 8.095   21.330  10.470 1.00   23.63 ? 2152 HOH B O   1 
HETATM 2992 O O   . HOH I 4 .   ? 7.047   24.997  12.683 1.00   32.30 ? 2153 HOH B O   1 
HETATM 2993 O O   . HOH I 4 .   ? 15.195  30.595  14.585 1.00   28.99 ? 2154 HOH B O   1 
HETATM 2994 O O   . HOH I 4 .   ? 11.568  28.577  10.930 1.00   15.59 ? 2155 HOH B O   1 
HETATM 2995 O O   . HOH I 4 .   ? 14.698  30.894  11.801 1.00   15.14 ? 2156 HOH B O   1 
HETATM 2996 O O   . HOH I 4 .   ? 12.693  30.059  16.090 1.00   19.60 ? 2157 HOH B O   1 
HETATM 2997 O O   . HOH I 4 .   ? 17.148  26.151  14.894 1.00   8.40  ? 2158 HOH B O   1 
HETATM 2998 O O   . HOH I 4 .   ? 21.223  22.021  11.125 1.00   18.07 ? 2159 HOH B O   1 
HETATM 2999 O O   . HOH I 4 .   ? 10.376  29.376  8.646  1.00   35.88 ? 2160 HOH B O   1 
HETATM 3000 O O   . HOH I 4 .   ? 10.211  29.461  13.469 1.00   35.90 ? 2161 HOH B O   1 
HETATM 3001 O O   . HOH I 4 .   ? 3.450   21.266  12.382 1.00   38.57 ? 2162 HOH B O   1 
HETATM 3002 O O   . HOH I 4 .   ? 1.978   23.748  12.713 1.00   57.87 ? 2163 HOH B O   1 
HETATM 3003 O O   . HOH I 4 .   ? 5.436   24.877  10.641 1.00   45.87 ? 2164 HOH B O   1 
HETATM 3004 O O   . HOH I 4 .   ? 7.912   35.112  24.319 1.00   41.56 ? 2165 HOH B O   1 
HETATM 3005 O O   . HOH I 4 .   ? 3.431   27.420  10.205 1.00   55.46 ? 2166 HOH B O   1 
HETATM 3006 O O   . HOH I 4 .   ? 8.689   27.754  14.624 1.00   33.78 ? 2167 HOH B O   1 
HETATM 3007 O O   . HOH I 4 .   ? 3.444   24.740  14.671 1.00   38.37 ? 2168 HOH B O   1 
HETATM 3008 O O   . HOH I 4 .   ? 5.411   20.892  14.116 1.00   16.39 ? 2169 HOH B O   1 
HETATM 3009 O O   . HOH I 4 .   ? 9.586   35.799  22.069 1.00   38.51 ? 2170 HOH B O   1 
HETATM 3010 O O   . HOH I 4 .   ? 13.187  31.372  18.500 1.00   27.62 ? 2171 HOH B O   1 
HETATM 3011 O O   . HOH I 4 .   ? 20.731  30.782  20.587 1.00   43.09 ? 2172 HOH B O   1 
HETATM 3012 O O   . HOH I 4 .   ? 16.996  31.319  22.714 1.00   26.40 ? 2173 HOH B O   1 
HETATM 3013 O O   . HOH I 4 .   ? 16.007  28.643  22.626 1.00   26.65 ? 2174 HOH B O   1 
HETATM 3014 O O   . HOH I 4 .   ? 17.434  32.778  17.310 1.00   27.41 ? 2175 HOH B O   1 
HETATM 3015 O O   . HOH I 4 .   ? 7.086   34.263  35.276 1.00   21.21 ? 2176 HOH B O   1 
HETATM 3016 O O   . HOH I 4 .   ? 25.277  3.634   30.135 1.00   38.55 ? 2177 HOH B O   1 
HETATM 3017 O O   . HOH I 4 .   ? 45.488  -2.294  30.657 1.00   41.14 ? 2178 HOH B O   1 
HETATM 3018 O O   . HOH I 4 .   ? 7.987   32.734  15.013 1.00   47.09 ? 2179 HOH B O   1 
HETATM 3019 O O   . HOH I 4 .   ? 3.731   31.703  18.777 1.00   32.27 ? 2180 HOH B O   1 
HETATM 3020 O O   . HOH I 4 .   ? 11.817  35.756  35.565 1.00   45.33 ? 2181 HOH B O   1 
HETATM 3021 O O   . HOH I 4 .   ? 3.587   29.284  15.674 1.00   45.86 ? 2182 HOH B O   1 
HETATM 3022 O O   . HOH I 4 .   ? 19.941  10.403  16.751 1.00   36.08 ? 2183 HOH B O   1 
HETATM 3023 O O   . HOH I 4 .   ? 7.206   27.301  25.065 1.00   19.09 ? 2184 HOH B O   1 
HETATM 3024 O O   . HOH I 4 .   ? 46.136  11.214  9.698  1.00   29.84 ? 2185 HOH B O   1 
HETATM 3025 O O   . HOH I 4 .   ? 47.733  10.895  11.650 1.00   45.42 ? 2186 HOH B O   1 
HETATM 3026 O O   . HOH I 4 .   ? 11.712  36.266  19.541 1.00   42.07 ? 2187 HOH B O   1 
HETATM 3027 O O   . HOH I 4 .   ? 17.158  33.741  20.400 1.00   39.76 ? 2188 HOH B O   1 
HETATM 3028 O O   . HOH I 4 .   ? 9.741   34.287  20.050 1.00   43.16 ? 2189 HOH B O   1 
HETATM 3029 O O   . HOH I 4 .   ? 3.968   33.793  19.916 1.00   39.50 ? 2190 HOH B O   1 
HETATM 3030 O O   . HOH I 4 .   ? 27.465  2.127   28.867 1.00   35.31 ? 2191 HOH B O   1 
HETATM 3031 O O   . HOH I 4 .   ? 21.769  -0.255  24.965 1.00   40.69 ? 2192 HOH B O   1 
HETATM 3032 O O   . HOH I 4 .   ? 9.720   32.874  29.376 1.00   50.54 ? 2193 HOH B O   1 
HETATM 3033 O O   . HOH I 4 .   ? 33.284  -4.419  24.045 1.00   27.97 ? 2194 HOH B O   1 
HETATM 3034 O O   . HOH I 4 .   ? 31.747  3.996   30.447 1.00   35.16 ? 2195 HOH B O   1 
HETATM 3035 O O   . HOH I 4 .   ? 29.314  -1.428  26.685 1.00   40.11 ? 2196 HOH B O   1 
HETATM 3036 O O   . HOH I 4 .   ? 5.177   28.359  28.865 1.00   23.96 ? 2197 HOH B O   1 
HETATM 3037 O O   . HOH I 4 .   ? 38.514  0.363   32.028 1.00   28.97 ? 2198 HOH B O   1 
HETATM 3038 O O   . HOH I 4 .   ? 38.734  -4.198  28.027 1.00   47.26 ? 2199 HOH B O   1 
HETATM 3039 O O   . HOH I 4 .   ? 32.497  1.138   29.927 1.00   37.47 ? 2200 HOH B O   1 
HETATM 3040 O O   . HOH I 4 .   ? 9.525   32.845  34.981 1.00   26.60 ? 2201 HOH B O   1 
HETATM 3041 O O   . HOH I 4 .   ? 9.555   33.180  32.112 1.00   30.02 ? 2202 HOH B O   1 
HETATM 3042 O O   . HOH I 4 .   ? 43.731  -2.271  32.745 1.00   43.67 ? 2203 HOH B O   1 
HETATM 3043 O O   . HOH I 4 .   ? 42.438  -0.398  34.096 1.00   38.16 ? 2204 HOH B O   1 
HETATM 3044 O O   . HOH I 4 .   ? 50.444  -1.058  28.439 1.00   35.70 ? 2205 HOH B O   1 
HETATM 3045 O O   . HOH I 4 .   ? 12.826  34.702  37.895 1.00   60.91 ? 2206 HOH B O   1 
HETATM 3046 O O   . HOH I 4 .   ? 9.236   34.168  38.332 1.00   24.24 ? 2207 HOH B O   1 
HETATM 3047 O O   . HOH I 4 .   ? 13.978  31.915  38.947 1.00   29.41 ? 2208 HOH B O   1 
HETATM 3048 O O   . HOH I 4 .   ? 54.683  4.484   25.821 1.00   37.74 ? 2209 HOH B O   1 
HETATM 3049 O O   . HOH I 4 .   ? 21.154  7.947   14.152 1.00   36.04 ? 2210 HOH B O   1 
HETATM 3050 O O   . HOH I 4 .   ? 7.316   26.053  30.991 1.00   9.87  ? 2211 HOH B O   1 
HETATM 3051 O O   . HOH I 4 .   ? 46.944  7.196   13.610 1.00   40.44 ? 2212 HOH B O   1 
HETATM 3052 O O   . HOH I 4 .   ? 47.161  8.877   15.336 1.00   40.54 ? 2213 HOH B O   1 
HETATM 3053 O O   . HOH I 4 .   ? 48.724  10.946  15.792 1.00   41.87 ? 2214 HOH B O   1 
HETATM 3054 O O   . HOH I 4 .   ? 44.929  11.951  17.000 1.00   24.13 ? 2215 HOH B O   1 
HETATM 3055 O O   . HOH I 4 .   ? 4.048   19.289  31.932 1.00   27.31 ? 2216 HOH B O   1 
HETATM 3056 O O   . HOH I 4 .   ? 44.642  12.523  11.136 1.00   33.13 ? 2217 HOH B O   1 
HETATM 3057 O O   . HOH I 4 .   ? 44.245  12.305  8.691  1.00   28.98 ? 2218 HOH B O   1 
HETATM 3058 O O   . HOH I 4 .   ? 35.975  13.475  6.883  1.00   39.99 ? 2219 HOH B O   1 
HETATM 3059 O O   . HOH I 4 .   ? 7.483   15.360  30.803 1.00   35.85 ? 2220 HOH B O   1 
HETATM 3060 O O   . HOH I 4 .   ? 5.566   12.898  28.883 1.00   21.12 ? 2221 HOH B O   1 
HETATM 3061 O O   . HOH I 4 .   ? 37.927  11.754  6.255  1.00   49.54 ? 2222 HOH B O   1 
HETATM 3062 O O   . HOH I 4 .   ? 40.327  4.871   5.060  1.00   41.86 ? 2223 HOH B O   1 
HETATM 3063 O O   . HOH I 4 .   ? 45.928  5.553   9.045  1.00   32.14 ? 2224 HOH B O   1 
HETATM 3064 O O   . HOH I 4 .   ? 41.389  -1.494  6.415  1.00   31.21 ? 2225 HOH B O   1 
HETATM 3065 O O   . HOH I 4 .   ? 9.742   5.598   24.952 1.00   15.57 ? 2226 HOH B O   1 
HETATM 3066 O O   . HOH I 4 .   ? 44.816  -8.643  2.652  1.00   48.77 ? 2227 HOH B O   1 
HETATM 3067 O O   . HOH I 4 .   ? 17.485  5.114   26.543 1.00   10.37 ? 2228 HOH B O   1 
HETATM 3068 O O   . HOH I 4 .   ? 16.015  6.999   31.488 1.00   19.44 ? 2229 HOH B O   1 
HETATM 3069 O O   . HOH I 4 .   ? 19.813  8.540   33.168 1.00   8.93  ? 2230 HOH B O   1 
HETATM 3070 O O   . HOH I 4 .   ? 21.549  6.358   31.025 1.00   31.39 ? 2231 HOH B O   1 
HETATM 3071 O O   . HOH I 4 .   ? 18.883  5.108   30.417 1.00   22.16 ? 2232 HOH B O   1 
HETATM 3072 O O   . HOH I 4 .   ? 21.455  3.700   24.233 1.00   36.97 ? 2233 HOH B O   1 
HETATM 3073 O O   . HOH I 4 .   ? 22.014  5.768   26.644 1.00   24.17 ? 2234 HOH B O   1 
HETATM 3074 O O   . HOH I 4 .   ? 28.559  17.144  17.356 1.00   42.14 ? 2235 HOH B O   1 
HETATM 3075 O O   . HOH I 4 .   ? 27.609  15.105  10.796 1.00   61.88 ? 2236 HOH B O   1 
HETATM 3076 O O   . HOH I 4 .   ? 25.523  2.155   18.498 1.00   33.54 ? 2237 HOH B O   1 
HETATM 3077 O O   . HOH I 4 .   ? 22.441  2.030   22.887 1.00   36.75 ? 2238 HOH B O   1 
HETATM 3078 O O   . HOH I 4 .   ? 24.912  9.305   27.652 1.00   40.46 ? 2239 HOH B O   1 
HETATM 3079 O O   . HOH I 4 .   ? 27.635  6.838   28.716 1.00   40.38 ? 2240 HOH B O   1 
HETATM 3080 O O   . HOH I 4 .   ? 23.474  7.323   27.677 1.00   38.15 ? 2241 HOH B O   1 
HETATM 3081 O O   . HOH I 4 .   ? 23.405  3.204   26.118 1.00   34.19 ? 2242 HOH B O   1 
HETATM 3082 O O   . HOH I 4 .   ? 27.346  2.877   26.325 1.00   22.76 ? 2243 HOH B O   1 
HETATM 3083 O O   . HOH I 4 .   ? 25.791  0.730   25.071 1.00   31.90 ? 2244 HOH B O   1 
HETATM 3084 O O   . HOH I 4 .   ? 35.892  6.178   31.446 1.00   43.63 ? 2245 HOH B O   1 
HETATM 3085 O O   . HOH I 4 .   ? 32.062  7.814   32.262 0.50   26.70 ? 2246 HOH B O   1 
HETATM 3086 O O   . HOH I 4 .   ? 32.969  24.183  24.740 1.00   42.61 ? 2247 HOH B O   1 
HETATM 3087 O O   . HOH I 4 .   ? 30.150  24.077  21.339 1.00   30.69 ? 2248 HOH B O   1 
HETATM 3088 O O   . HOH I 4 .   ? 30.681  21.613  17.176 1.00   28.42 ? 2249 HOH B O   1 
HETATM 3089 O O   . HOH I 4 .   ? 28.002  0.060   24.898 1.00   19.06 ? 2250 HOH B O   1 
HETATM 3090 O O   . HOH I 4 .   ? 29.814  5.256   28.362 1.00   35.29 ? 2251 HOH B O   1 
HETATM 3091 O O   . HOH I 4 .   ? 31.691  -2.403  23.529 1.00   27.70 ? 2252 HOH B O   1 
HETATM 3092 O O   . HOH I 4 .   ? 40.141  22.953  14.211 1.00   37.91 ? 2253 HOH B O   1 
HETATM 3093 O O   . HOH I 4 .   ? 33.448  -0.522  27.128 1.00   34.36 ? 2254 HOH B O   1 
HETATM 3094 O O   . HOH I 4 .   ? 39.091  -3.751  25.472 1.00   35.09 ? 2255 HOH B O   1 
HETATM 3095 O O   . HOH I 4 .   ? 35.174  -2.413  24.308 1.00   21.61 ? 2256 HOH B O   1 
HETATM 3096 O O   . HOH I 4 .   ? 36.359  1.153   30.067 1.00   28.84 ? 2257 HOH B O   1 
HETATM 3097 O O   . HOH I 4 .   ? 51.287  16.606  25.743 1.00   20.27 ? 2258 HOH B O   1 
HETATM 3098 O O   . HOH I 4 .   ? 40.641  -1.861  31.276 1.00   41.57 ? 2259 HOH B O   1 
HETATM 3099 O O   . HOH I 4 .   ? 47.107  -1.928  21.493 1.00   24.14 ? 2260 HOH B O   1 
HETATM 3100 O O   . HOH I 4 .   ? 48.361  -1.412  26.722 1.00   33.67 ? 2261 HOH B O   1 
HETATM 3101 O O   . HOH I 4 .   ? 50.073  8.227   23.981 1.00   29.44 ? 2262 HOH B O   1 
HETATM 3102 O O   . HOH I 4 .   ? 42.487  2.444   33.519 1.00   22.61 ? 2263 HOH B O   1 
HETATM 3103 O O   . HOH I 4 .   ? 39.809  2.759   32.595 1.00   26.14 ? 2264 HOH B O   1 
HETATM 3104 O O   . HOH I 4 .   ? 51.941  3.093   25.451 1.00   35.53 ? 2265 HOH B O   1 
HETATM 3105 O O   . HOH I 4 .   ? 47.801  0.935   16.919 1.00   46.82 ? 2266 HOH B O   1 
HETATM 3106 O O   . HOH I 4 .   ? 56.600  -1.567  24.766 1.00   12.65 ? 2267 HOH B O   1 
HETATM 3107 O O   . HOH I 4 .   ? 21.379  9.254   12.227 1.00   42.29 ? 2268 HOH B O   1 
HETATM 3108 O O   . HOH I 4 .   ? 56.471  3.271   19.015 1.00   36.25 ? 2269 HOH B O   1 
HETATM 3109 O O   . HOH I 4 .   ? 50.238  8.531   14.243 1.00   54.85 ? 2270 HOH B O   1 
HETATM 3110 O O   . HOH I 4 .   ? 44.223  10.148  15.078 1.00   20.52 ? 2271 HOH B O   1 
HETATM 3111 O O   . HOH I 4 .   ? 42.679  14.691  13.549 1.00   23.85 ? 2272 HOH B O   1 
HETATM 3112 O O   . HOH I 4 .   ? 41.874  13.992  10.036 1.00   42.31 ? 2273 HOH B O   1 
HETATM 3113 O O   . HOH I 4 .   ? 43.169  11.959  13.339 1.00   22.20 ? 2274 HOH B O   1 
HETATM 3114 O O   . HOH I 4 .   ? 34.449  13.556  9.447  1.00   26.29 ? 2275 HOH B O   1 
HETATM 3115 O O   . HOH I 4 .   ? 36.066  20.901  14.423 1.00   24.21 ? 2276 HOH B O   1 
HETATM 3116 O O   . HOH I 4 .   ? 35.133  16.991  8.590  1.00   30.74 ? 2277 HOH B O   1 
HETATM 3117 O O   . HOH I 4 .   ? 32.611  14.880  18.263 1.00   19.87 ? 2278 HOH B O   1 
HETATM 3118 O O   . HOH I 4 .   ? 28.934  10.645  8.704  1.00   44.78 ? 2279 HOH B O   1 
HETATM 3119 O O   . HOH I 4 .   ? 37.976  4.791   6.330  1.00   35.67 ? 2280 HOH B O   1 
HETATM 3120 O O   . HOH I 4 .   ? 40.558  8.922   7.547  1.00   30.27 ? 2281 HOH B O   1 
HETATM 3121 O O   . HOH I 4 .   ? 40.084  11.493  7.925  1.00   39.46 ? 2282 HOH B O   1 
HETATM 3122 O O   . HOH I 4 .   ? 43.706  4.466   9.231  1.00   35.04 ? 2283 HOH B O   1 
HETATM 3123 O O   . HOH I 4 .   ? 38.767  2.373   8.141  1.00   17.23 ? 2284 HOH B O   1 
HETATM 3124 O O   . HOH I 4 .   ? 42.882  2.457   7.888  1.00   21.74 ? 2285 HOH B O   1 
HETATM 3125 O O   . HOH I 4 .   ? 40.050  -0.269  8.223  1.00   32.97 ? 2286 HOH B O   1 
HETATM 3126 O O   . HOH I 4 .   ? 48.195  -1.430  14.361 1.00   23.16 ? 2287 HOH B O   1 
HETATM 3127 O O   . HOH I 4 .   ? 48.507  -1.334  10.231 1.00   37.44 ? 2288 HOH B O   1 
HETATM 3128 O O   . HOH I 4 .   ? 42.319  -6.349  7.065  1.00   31.04 ? 2289 HOH B O   1 
HETATM 3129 O O   . HOH I 4 .   ? 46.245  -9.167  6.627  1.00   57.14 ? 2290 HOH B O   1 
HETATM 3130 O O   . HOH I 4 .   ? 45.300  0.665   8.231  1.00   19.10 ? 2291 HOH B O   1 
HETATM 3131 O O   . HOH I 4 .   ? 44.880  -5.928  4.925  1.00   50.59 ? 2292 HOH B O   1 
HETATM 3132 O O   . HOH I 4 .   ? 42.989  -5.634  11.443 1.00   16.65 ? 2293 HOH B O   1 
HETATM 3133 O O   . HOH I 4 .   ? 50.009  -5.041  11.059 1.00   43.59 ? 2294 HOH B O   1 
HETATM 3134 O O   . HOH I 4 .   ? 48.049  -3.901  17.996 1.00   46.60 ? 2295 HOH B O   1 
HETATM 3135 O O   . HOH I 4 .   ? 43.059  -4.053  22.512 1.00   20.16 ? 2296 HOH B O   1 
HETATM 3136 O O   . HOH I 4 .   ? 46.587  -0.397  18.960 1.00   21.13 ? 2297 HOH B O   1 
HETATM 3137 O O   . HOH I 4 .   ? 37.110  -5.942  13.689 1.00   9.81  ? 2298 HOH B O   1 
HETATM 3138 O O   . HOH I 4 .   ? 36.494  -7.009  21.087 1.00   24.80 ? 2299 HOH B O   1 
HETATM 3139 O O   . HOH I 4 .   ? 41.359  -4.556  23.843 1.00   37.97 ? 2300 HOH B O   1 
HETATM 3140 O O   . HOH I 4 .   ? 35.664  -1.611  12.550 1.00   9.10  ? 2301 HOH B O   1 
HETATM 3141 O O   . HOH I 4 .   ? 29.961  5.252   6.139  1.00   28.50 ? 2302 HOH B O   1 
HETATM 3142 O O   . HOH I 4 .   ? 26.869  6.351   10.935 1.00   12.53 ? 2303 HOH B O   1 
HETATM 3143 O O   . HOH I 4 .   ? 35.240  7.348   6.615  1.00   27.19 ? 2304 HOH B O   1 
HETATM 3144 O O   . HOH I 4 .   ? 32.414  3.890   5.092  1.00   42.85 ? 2305 HOH B O   1 
HETATM 3145 O O   . HOH I 4 .   ? 27.914  1.741   17.550 1.00   24.44 ? 2306 HOH B O   1 
HETATM 3146 O O   . HOH I 4 .   ? 26.350  14.059  12.976 1.00   39.85 ? 2307 HOH B O   1 
HETATM 3147 O O   . HOH I 4 .   ? 25.345  11.556  16.744 1.00   29.31 ? 2308 HOH B O   1 
HETATM 3148 O O   . HOH I 4 .   ? 30.702  15.835  16.873 1.00   41.25 ? 2309 HOH B O   1 
HETATM 3149 O O   . HOH I 4 .   ? 28.926  14.160  28.619 1.00   28.98 ? 2310 HOH B O   1 
HETATM 3150 O O   . HOH I 4 .   ? 29.859  8.361   28.539 1.00   35.33 ? 2311 HOH B O   1 
HETATM 3151 O O   . HOH I 4 .   ? 28.642  14.697  25.239 1.00   13.12 ? 2312 HOH B O   1 
HETATM 3152 O O   . HOH I 4 .   ? 41.508  11.482  29.923 1.00   15.43 ? 2313 HOH B O   1 
HETATM 3153 O O   . HOH I 4 .   ? 38.481  6.365   31.724 1.00   42.57 ? 2314 HOH B O   1 
HETATM 3154 O O   . HOH I 4 .   ? 33.371  6.369   30.273 1.00   32.93 ? 2315 HOH B O   1 
HETATM 3155 O O   . HOH I 4 .   ? 33.948  7.756   27.871 1.00   13.86 ? 2316 HOH B O   1 
HETATM 3156 O O   . HOH I 4 .   ? 30.394  12.046  30.917 1.00   27.11 ? 2317 HOH B O   1 
HETATM 3157 O O   . HOH I 4 .   ? 39.236  12.845  29.497 1.00   16.15 ? 2318 HOH B O   1 
HETATM 3158 O O   . HOH I 4 .   ? 30.855  19.918  29.445 1.00   39.01 ? 2319 HOH B O   1 
HETATM 3159 O O   . HOH I 4 .   ? 29.429  20.234  24.814 1.00   17.77 ? 2320 HOH B O   1 
HETATM 3160 O O   . HOH I 4 .   ? 32.375  16.032  30.876 1.00   30.37 ? 2321 HOH B O   1 
HETATM 3161 O O   . HOH I 4 .   ? 33.798  18.888  29.213 1.00   46.58 ? 2322 HOH B O   1 
HETATM 3162 O O   . HOH I 4 .   ? 33.245  17.475  18.848 1.00   22.53 ? 2323 HOH B O   1 
HETATM 3163 O O   . HOH I 4 .   ? 32.939  21.676  25.100 1.00   29.25 ? 2324 HOH B O   1 
HETATM 3164 O O   . HOH I 4 .   ? 33.225  24.781  22.105 1.00   40.83 ? 2325 HOH B O   1 
HETATM 3165 O O   . HOH I 4 .   ? 36.015  18.698  16.436 1.00   17.28 ? 2326 HOH B O   1 
HETATM 3166 O O   . HOH I 4 .   ? 33.532  21.399  17.281 1.00   21.64 ? 2327 HOH B O   1 
HETATM 3167 O O   . HOH I 4 .   ? 36.657  26.589  18.837 1.00   38.34 ? 2328 HOH B O   1 
HETATM 3168 O O   . HOH I 4 .   ? 40.787  18.249  11.693 1.00   25.40 ? 2329 HOH B O   1 
HETATM 3169 O O   . HOH I 4 .   ? 38.487  20.984  14.525 1.00   21.78 ? 2330 HOH B O   1 
HETATM 3170 O O   . HOH I 4 .   ? 41.919  21.667  15.404 1.00   24.42 ? 2331 HOH B O   1 
HETATM 3171 O O   . HOH I 4 .   ? 43.898  23.026  19.892 1.00   16.57 ? 2332 HOH B O   1 
HETATM 3172 O O   . HOH I 4 .   ? 37.993  25.091  24.571 1.00   36.46 ? 2333 HOH B O   1 
HETATM 3173 O O   . HOH I 4 .   ? 39.917  26.786  24.847 1.00   41.53 ? 2334 HOH B O   1 
HETATM 3174 O O   . HOH I 4 .   ? 37.012  24.719  21.061 1.00   33.93 ? 2335 HOH B O   1 
HETATM 3175 O O   . HOH I 4 .   ? 42.922  23.720  24.268 1.00   18.10 ? 2336 HOH B O   1 
HETATM 3176 O O   . HOH I 4 .   ? 48.131  17.538  22.370 1.00   27.47 ? 2337 HOH B O   1 
HETATM 3177 O O   . HOH I 4 .   ? 43.463  12.637  28.522 1.00   9.08  ? 2338 HOH B O   1 
HETATM 3178 O O   . HOH I 4 .   ? 48.120  13.466  18.173 1.00   41.57 ? 2339 HOH B O   1 
HETATM 3179 O O   . HOH I 4 .   ? 48.279  10.126  20.072 1.00   26.94 ? 2340 HOH B O   1 
HETATM 3180 O O   . HOH I 4 .   ? 46.078  11.841  19.425 1.00   20.37 ? 2341 HOH B O   1 
HETATM 3181 O O   . HOH I 4 .   ? 50.748  13.698  24.685 1.00   29.16 ? 2342 HOH B O   1 
HETATM 3182 O O   . HOH I 4 .   ? 50.098  7.880   28.565 1.00   28.04 ? 2343 HOH B O   1 
HETATM 3183 O O   . HOH I 4 .   ? 44.556  3.897   32.038 1.00   19.45 ? 2344 HOH B O   1 
HETATM 3184 O O   . HOH I 4 .   ? 42.911  6.145   31.007 1.00   17.18 ? 2345 HOH B O   1 
HETATM 3185 O O   . HOH I 4 .   ? 39.505  4.620   30.451 1.00   17.93 ? 2346 HOH B O   1 
HETATM 3186 O O   . HOH I 4 .   ? 22.021  11.726  11.752 1.00   37.29 ? 2347 HOH B O   1 
HETATM 3187 O O   . HOH I 4 .   ? 46.370  9.053   20.499 1.00   25.30 ? 2348 HOH B O   1 
HETATM 3188 O O   . HOH I 4 .   ? 46.509  5.738   15.113 1.00   27.43 ? 2349 HOH B O   1 
HETATM 3189 O O   . HOH I 4 .   ? 15.679  30.450  26.862 1.00   28.70 ? 2350 HOH B O   1 
HETATM 3190 O O   . HOH I 4 .   ? 21.194  28.429  25.847 1.00   22.39 ? 2351 HOH B O   1 
HETATM 3191 O O   . HOH J 4 .   ? 2.409   3.666   0.044  1.00   36.96 ? 2001 HOH P O   1 
HETATM 3192 O O   . HOH J 4 .   ? 0.000   4.177   0.000  0.50   28.91 ? 2002 HOH P O   1 
HETATM 3193 O O   . HOH J 4 .   ? -1.962  1.659   1.360  1.00   40.32 ? 2003 HOH P O   1 
HETATM 3194 O O   . HOH J 4 .   ? 2.235   2.619   6.127  1.00   25.26 ? 2004 HOH P O   1 
HETATM 3195 O O   . HOH J 4 .   ? -2.580  -0.374  12.429 1.00   20.19 ? 2005 HOH P O   1 
HETATM 3196 O O   . HOH J 4 .   ? -3.972  -0.820  10.045 1.00   28.34 ? 2006 HOH P O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 4   ? 0.3086 0.3164 0.3128 0.0032  0.0074  -0.0028 111 ASP A N   
2    C CA  . ASP A 4   ? 0.3014 0.2950 0.2967 -0.0005 -0.0018 0.0010  111 ASP A CA  
3    C C   . ASP A 4   ? 0.2791 0.2818 0.2781 -0.0004 0.0013  0.0015  111 ASP A C   
4    O O   . ASP A 4   ? 0.2660 0.2833 0.2864 0.0076  0.0093  0.0119  111 ASP A O   
5    C CB  . ASP A 4   ? 0.3187 0.3173 0.3091 0.0000  -0.0024 0.0008  111 ASP A CB  
6    N N   . PRO A 5   ? 0.2535 0.2548 0.2554 -0.0034 -0.0039 -0.0018 112 PRO A N   
7    C CA  . PRO A 5   ? 0.2445 0.2343 0.2405 -0.0012 -0.0023 -0.0009 112 PRO A CA  
8    C C   . PRO A 5   ? 0.2288 0.2189 0.2204 -0.0038 -0.0054 -0.0007 112 PRO A C   
9    O O   . PRO A 5   ? 0.2296 0.2051 0.2079 -0.0098 -0.0128 -0.0123 112 PRO A O   
10   C CB  . PRO A 5   ? 0.2444 0.2349 0.2411 -0.0024 0.0001  -0.0032 112 PRO A CB  
11   C CG  . PRO A 5   ? 0.2559 0.2672 0.2564 -0.0042 -0.0028 -0.0010 112 PRO A CG  
12   C CD  . PRO A 5   ? 0.2640 0.2651 0.2569 -0.0002 0.0027  -0.0053 112 PRO A CD  
13   N N   . ARG A 6   ? 0.2214 0.2018 0.2021 0.0013  -0.0043 -0.0010 113 ARG A N   
14   C CA  . ARG A 6   ? 0.2113 0.2013 0.2018 -0.0011 -0.0011 0.0015  113 ARG A CA  
15   C C   . ARG A 6   ? 0.2120 0.1944 0.2005 0.0002  -0.0002 0.0011  113 ARG A C   
16   O O   . ARG A 6   ? 0.1970 0.1725 0.1951 0.0049  -0.0045 0.0052  113 ARG A O   
17   C CB  . ARG A 6   ? 0.2105 0.2047 0.2003 -0.0004 -0.0047 -0.0014 113 ARG A CB  
18   C CG  . ARG A 6   ? 0.2006 0.1996 0.2011 0.0022  -0.0021 0.0013  113 ARG A CG  
19   C CD  . ARG A 6   ? 0.2000 0.1976 0.2040 0.0026  -0.0040 0.0136  113 ARG A CD  
20   N NE  . ARG A 6   ? 0.1579 0.1833 0.1863 -0.0056 -0.0003 0.0073  113 ARG A NE  
21   C CZ  . ARG A 6   ? 0.1926 0.1927 0.2113 -0.0001 -0.0021 0.0013  113 ARG A CZ  
22   N NH1 . ARG A 6   ? 0.1758 0.2206 0.2151 -0.0002 -0.0060 0.0166  113 ARG A NH1 
23   N NH2 . ARG A 6   ? 0.1910 0.1670 0.2110 -0.0108 -0.0063 0.0091  113 ARG A NH2 
24   N N   . GLU A 7   ? 0.2160 0.1987 0.1991 0.0035  -0.0046 0.0097  114 GLU A N   
25   C CA  . GLU A 7   ? 0.2129 0.2063 0.2074 -0.0013 -0.0027 0.0029  114 GLU A CA  
26   C C   . GLU A 7   ? 0.2037 0.1950 0.2001 -0.0016 0.0010  0.0031  114 GLU A C   
27   O O   . GLU A 7   ? 0.1995 0.1715 0.2010 -0.0091 -0.0025 0.0034  114 GLU A O   
28   C CB  . GLU A 7   ? 0.2278 0.2246 0.2309 0.0000  -0.0036 0.0054  114 GLU A CB  
29   C CG  . GLU A 7   ? 0.2882 0.2819 0.2737 -0.0024 0.0016  -0.0061 114 GLU A CG  
30   C CD  . GLU A 7   ? 0.3402 0.3513 0.3605 0.0133  -0.0022 -0.0010 114 GLU A CD  
31   O OE1 . GLU A 7   ? 0.3852 0.3408 0.3396 0.0123  -0.0140 0.0173  114 GLU A OE1 
32   O OE2 . GLU A 7   ? 0.3944 0.4085 0.4249 -0.0180 -0.0069 -0.0103 114 GLU A OE2 
33   N N   . VAL A 8   ? 0.1956 0.1851 0.1978 -0.0029 0.0010  0.0022  115 VAL A N   
34   C CA  . VAL A 8   ? 0.1953 0.1850 0.1935 0.0001  -0.0001 -0.0021 115 VAL A CA  
35   C C   . VAL A 8   ? 0.1902 0.1873 0.1921 -0.0021 0.0014  0.0002  115 VAL A C   
36   O O   . VAL A 8   ? 0.1826 0.1816 0.1959 -0.0030 -0.0073 0.0084  115 VAL A O   
37   C CB  . VAL A 8   ? 0.2008 0.1887 0.1941 0.0026  0.0008  -0.0033 115 VAL A CB  
38   C CG1 . VAL A 8   ? 0.2058 0.2039 0.2177 0.0044  0.0090  -0.0049 115 VAL A CG1 
39   C CG2 . VAL A 8   ? 0.1804 0.1763 0.1877 0.0081  -0.0004 -0.0020 115 VAL A CG2 
40   N N   . ILE A 9   ? 0.1895 0.1735 0.1835 0.0004  -0.0060 0.0080  116 ILE A N   
41   C CA  . ILE A 9   ? 0.1861 0.1786 0.1908 -0.0026 -0.0055 0.0043  116 ILE A CA  
42   C C   . ILE A 9   ? 0.1820 0.1815 0.1886 -0.0034 -0.0055 0.0064  116 ILE A C   
43   O O   . ILE A 9   ? 0.1726 0.1809 0.1927 -0.0145 -0.0159 0.0175  116 ILE A O   
44   C CB  . ILE A 9   ? 0.1968 0.1835 0.1947 0.0022  -0.0051 0.0067  116 ILE A CB  
45   C CG1 . ILE A 9   ? 0.2072 0.1996 0.2125 -0.0069 -0.0083 0.0048  116 ILE A CG1 
46   C CG2 . ILE A 9   ? 0.1969 0.1794 0.1787 -0.0035 -0.0135 0.0070  116 ILE A CG2 
47   C CD1 . ILE A 9   ? 0.2560 0.2421 0.2522 0.0080  -0.0097 0.0095  116 ILE A CD1 
48   N N   . LEU A 10  ? 0.1840 0.1720 0.1930 -0.0066 -0.0017 0.0024  117 LEU A N   
49   C CA  . LEU A 10  ? 0.1846 0.1861 0.1975 -0.0033 -0.0002 0.0052  117 LEU A CA  
50   C C   . LEU A 10  ? 0.1996 0.1924 0.2057 0.0011  0.0054  0.0026  117 LEU A C   
51   O O   . LEU A 10  ? 0.1992 0.1784 0.2309 -0.0057 0.0049  0.0003  117 LEU A O   
52   C CB  . LEU A 10  ? 0.1725 0.1784 0.1839 0.0007  0.0061  0.0048  117 LEU A CB  
53   C CG  . LEU A 10  ? 0.1634 0.1696 0.1703 -0.0032 0.0052  0.0061  117 LEU A CG  
54   C CD1 . LEU A 10  ? 0.1852 0.1688 0.1690 0.0016  0.0046  0.0015  117 LEU A CD1 
55   C CD2 . LEU A 10  ? 0.1634 0.1642 0.1757 0.0092  0.0002  0.0000  117 LEU A CD2 
56   N N   . CYS A 11  ? 0.2174 0.2217 0.2222 -0.0013 0.0004  -0.0006 118 CYS A N   
57   C CA  . CYS A 11  ? 0.2471 0.2408 0.2497 0.0008  0.0005  -0.0016 118 CYS A CA  
58   C C   . CYS A 11  ? 0.2424 0.2372 0.2466 -0.0027 -0.0007 -0.0043 118 CYS A C   
59   O O   . CYS A 11  ? 0.2337 0.2412 0.2523 -0.0070 0.0084  -0.0019 118 CYS A O   
60   C CB  . CYS A 11  ? 0.2633 0.2600 0.2626 -0.0031 -0.0062 0.0046  118 CYS A CB  
61   S SG  . CYS A 11  ? 0.3653 0.3141 0.3800 0.0237  -0.0063 -0.0041 118 CYS A SG  
62   N N   . LYS A 12  ? 0.2436 0.2388 0.2479 -0.0006 0.0014  -0.0020 119 LYS A N   
63   C CA  . LYS A 12  ? 0.2535 0.2449 0.2524 0.0019  -0.0006 0.0000  119 LYS A CA  
64   C C   . LYS A 12  ? 0.2632 0.2488 0.2554 0.0000  -0.0015 -0.0011 119 LYS A C   
65   O O   . LYS A 12  ? 0.2726 0.2436 0.2441 0.0025  -0.0078 0.0001  119 LYS A O   
66   C CB  . LYS A 12  ? 0.2583 0.2494 0.2598 0.0034  0.0031  0.0017  119 LYS A CB  
67   C CG  . LYS A 12  ? 0.2713 0.2606 0.2774 -0.0028 -0.0024 -0.0018 119 LYS A CG  
68   C CD  . LYS A 12  ? 0.3109 0.3071 0.3035 0.0002  0.0075  0.0003  119 LYS A CD  
69   C CE  . LYS A 12  ? 0.3372 0.3419 0.3495 -0.0088 -0.0016 -0.0045 119 LYS A CE  
70   N NZ  . LYS A 12  ? 0.3622 0.3725 0.3766 -0.0007 0.0120  -0.0016 119 LYS A NZ  
71   N N   . ASP A 13  ? 0.2717 0.2599 0.2697 -0.0002 -0.0006 0.0011  120 ASP A N   
72   C CA  . ASP A 13  ? 0.2831 0.2720 0.2824 -0.0040 -0.0020 -0.0023 120 ASP A CA  
73   C C   . ASP A 13  ? 0.3012 0.2942 0.3015 -0.0014 0.0037  -0.0034 120 ASP A C   
74   O O   . ASP A 13  ? 0.2984 0.2698 0.3066 0.0017  -0.0029 -0.0098 120 ASP A O   
75   C CB  . ASP A 13  ? 0.2833 0.2690 0.2844 -0.0059 0.0018  -0.0021 120 ASP A CB  
76   C CG  . ASP A 13  ? 0.2696 0.2756 0.2652 0.0004  -0.0008 -0.0084 120 ASP A CG  
77   O OD1 . ASP A 13  ? 0.2714 0.2366 0.2436 -0.0007 0.0018  -0.0218 120 ASP A OD1 
78   O OD2 . ASP A 13  ? 0.2757 0.2851 0.2422 0.0055  -0.0003 -0.0217 120 ASP A OD2 
79   N N   . GLN A 14  ? 0.3264 0.3179 0.3247 -0.0049 0.0012  -0.0053 121 GLN A N   
80   C CA  . GLN A 14  ? 0.3478 0.3432 0.3439 -0.0012 0.0019  -0.0025 121 GLN A CA  
81   C C   . GLN A 14  ? 0.3438 0.3416 0.3393 0.0012  0.0003  -0.0012 121 GLN A C   
82   O O   . GLN A 14  ? 0.3576 0.3567 0.3548 0.0064  0.0019  -0.0027 121 GLN A O   
83   C CB  . GLN A 14  ? 0.3543 0.3572 0.3560 -0.0050 0.0014  -0.0034 121 GLN A CB  
84   C CG  . GLN A 14  ? 0.4048 0.3919 0.4130 -0.0007 0.0047  0.0014  121 GLN A CG  
85   C CD  . GLN A 14  ? 0.4364 0.4375 0.4311 -0.0022 -0.0092 -0.0031 121 GLN A CD  
86   O OE1 . GLN A 14  ? 0.4392 0.4574 0.4655 -0.0001 0.0014  0.0020  121 GLN A OE1 
87   N NE2 . GLN A 14  ? 0.4561 0.4651 0.4479 0.0074  0.0036  -0.0001 121 GLN A NE2 
88   N N   . ASP A 15  ? 0.3324 0.3282 0.3244 0.0011  0.0000  -0.0047 122 ASP A N   
89   C CA  . ASP A 15  ? 0.3198 0.3141 0.3186 0.0019  -0.0008 -0.0039 122 ASP A CA  
90   C C   . ASP A 15  ? 0.3036 0.3043 0.3050 0.0044  0.0013  -0.0034 122 ASP A C   
91   O O   . ASP A 15  ? 0.3115 0.3058 0.3024 0.0063  0.0007  -0.0078 122 ASP A O   
92   C CB  . ASP A 15  ? 0.3198 0.3234 0.3212 0.0000  0.0014  -0.0010 122 ASP A CB  
93   C CG  . ASP A 15  ? 0.3221 0.3214 0.3189 -0.0005 -0.0017 -0.0030 122 ASP A CG  
94   O OD1 . ASP A 15  ? 0.3123 0.3218 0.2939 0.0123  0.0115  -0.0052 122 ASP A OD1 
95   O OD2 . ASP A 15  ? 0.3320 0.3206 0.3083 0.0124  0.0102  -0.0167 122 ASP A OD2 
96   N N   . GLY A 16  ? 0.2938 0.2891 0.3007 0.0042  0.0030  -0.0056 123 GLY A N   
97   C CA  . GLY A 16  ? 0.2777 0.2789 0.2836 0.0048  0.0056  -0.0069 123 GLY A CA  
98   C C   . GLY A 16  ? 0.2616 0.2651 0.2735 0.0025  0.0026  -0.0041 123 GLY A C   
99   O O   . GLY A 16  ? 0.2698 0.2642 0.2862 0.0083  0.0137  -0.0146 123 GLY A O   
100  N N   . LYS A 17  ? 0.2506 0.2452 0.2409 0.0000  0.0082  -0.0057 124 LYS A N   
101  C CA  . LYS A 17  ? 0.2331 0.2307 0.2246 0.0025  0.0046  -0.0024 124 LYS A CA  
102  C C   . LYS A 17  ? 0.2054 0.2021 0.2034 0.0011  0.0037  -0.0013 124 LYS A C   
103  O O   . LYS A 17  ? 0.2008 0.1917 0.1934 0.0044  0.0085  -0.0088 124 LYS A O   
104  C CB  . LYS A 17  ? 0.2397 0.2382 0.2367 -0.0003 0.0011  -0.0037 124 LYS A CB  
105  C CG  . LYS A 17  ? 0.2972 0.2955 0.2717 0.0028  0.0090  -0.0013 124 LYS A CG  
106  C CD  . LYS A 17  ? 0.3376 0.3604 0.3460 -0.0006 -0.0108 0.0010  124 LYS A CD  
107  C CE  . LYS A 17  ? 0.4021 0.3917 0.3732 0.0007  0.0016  -0.0036 124 LYS A CE  
108  N NZ  . LYS A 17  ? 0.4163 0.4384 0.4285 -0.0047 -0.0083 0.0008  124 LYS A NZ  
109  N N   . ILE A 18  ? 0.1812 0.1839 0.1813 0.0035  0.0062  0.0048  125 ILE A N   
110  C CA  . ILE A 18  ? 0.1706 0.1678 0.1712 0.0018  0.0041  0.0022  125 ILE A CA  
111  C C   . ILE A 18  ? 0.1598 0.1590 0.1619 -0.0013 0.0016  0.0023  125 ILE A C   
112  O O   . ILE A 18  ? 0.1338 0.1485 0.1699 0.0000  0.0152  0.0034  125 ILE A O   
113  C CB  . ILE A 18  ? 0.1687 0.1716 0.1861 0.0007  0.0080  0.0059  125 ILE A CB  
114  C CG1 . ILE A 18  ? 0.1810 0.1654 0.1832 0.0019  -0.0039 0.0089  125 ILE A CG1 
115  C CG2 . ILE A 18  ? 0.1700 0.1794 0.1824 0.0052  -0.0026 0.0162  125 ILE A CG2 
116  C CD1 . ILE A 18  ? 0.1508 0.1612 0.1752 0.0030  -0.0060 0.0091  125 ILE A CD1 
117  N N   . GLY A 19  ? 0.1591 0.1509 0.1584 0.0010  0.0051  0.0018  126 GLY A N   
118  C CA  . GLY A 19  ? 0.1465 0.1473 0.1580 -0.0053 0.0030  0.0005  126 GLY A CA  
119  C C   . GLY A 19  ? 0.1523 0.1469 0.1545 0.0007  0.0043  0.0011  126 GLY A C   
120  O O   . GLY A 19  ? 0.1268 0.1297 0.1324 -0.0040 0.0010  0.0073  126 GLY A O   
121  N N   . LEU A 20  ? 0.1581 0.1525 0.1596 -0.0020 0.0075  -0.0012 127 LEU A N   
122  C CA  . LEU A 20  ? 0.1649 0.1665 0.1668 -0.0071 0.0073  -0.0024 127 LEU A CA  
123  C C   . LEU A 20  ? 0.1603 0.1584 0.1663 -0.0087 0.0054  -0.0066 127 LEU A C   
124  O O   . LEU A 20  ? 0.1722 0.1533 0.1630 -0.0222 0.0273  -0.0130 127 LEU A O   
125  C CB  . LEU A 20  ? 0.1780 0.1770 0.1738 0.0011  0.0069  0.0023  127 LEU A CB  
126  C CG  . LEU A 20  ? 0.2110 0.2055 0.2268 -0.0088 -0.0044 -0.0027 127 LEU A CG  
127  C CD1 . LEU A 20  ? 0.2390 0.2333 0.2324 0.0007  0.0085  -0.0023 127 LEU A CD1 
128  C CD2 . LEU A 20  ? 0.2306 0.2218 0.2142 -0.0002 0.0006  0.0034  127 LEU A CD2 
129  N N   . ARG A 21  ? 0.1517 0.1569 0.1557 -0.0068 0.0083  -0.0025 128 ARG A N   
130  C CA  . ARG A 21  ? 0.1721 0.1550 0.1615 -0.0074 0.0049  -0.0093 128 ARG A CA  
131  C C   . ARG A 21  ? 0.1597 0.1429 0.1486 -0.0059 0.0028  -0.0053 128 ARG A C   
132  O O   . ARG A 21  ? 0.1553 0.1117 0.1380 -0.0218 0.0010  -0.0201 128 ARG A O   
133  C CB  . ARG A 21  ? 0.1743 0.1718 0.1703 -0.0029 0.0047  -0.0071 128 ARG A CB  
134  C CG  . ARG A 21  ? 0.2672 0.2407 0.2510 -0.0121 0.0120  0.0011  128 ARG A CG  
135  C CD  . ARG A 21  ? 0.3349 0.3580 0.3460 0.0120  -0.0120 0.0027  128 ARG A CD  
136  N NE  . ARG A 21  ? 0.4345 0.4191 0.4221 -0.0088 0.0098  0.0101  128 ARG A NE  
137  C CZ  . ARG A 21  ? 0.4772 0.4877 0.4655 0.0045  -0.0090 0.0055  128 ARG A CZ  
138  N NH1 . ARG A 21  ? 0.5035 0.5060 0.5042 -0.0075 -0.0053 0.0016  128 ARG A NH1 
139  N NH2 . ARG A 21  ? 0.5036 0.5038 0.5068 -0.0071 -0.0011 0.0100  128 ARG A NH2 
140  N N   . LEU A 22  ? 0.1728 0.1496 0.1466 -0.0091 0.0047  -0.0088 129 LEU A N   
141  C CA  . LEU A 22  ? 0.1795 0.1560 0.1515 -0.0074 0.0008  -0.0058 129 LEU A CA  
142  C C   . LEU A 22  ? 0.1950 0.1640 0.1528 -0.0108 -0.0002 -0.0041 129 LEU A C   
143  O O   . LEU A 22  ? 0.2364 0.1783 0.1574 -0.0147 0.0036  -0.0107 129 LEU A O   
144  C CB  . LEU A 22  ? 0.1819 0.1597 0.1542 -0.0084 0.0014  -0.0091 129 LEU A CB  
145  C CG  . LEU A 22  ? 0.2054 0.1747 0.1894 -0.0014 -0.0027 -0.0061 129 LEU A CG  
146  C CD1 . LEU A 22  ? 0.2195 0.2140 0.2384 -0.0051 -0.0015 -0.0070 129 LEU A CD1 
147  C CD2 . LEU A 22  ? 0.2069 0.1760 0.1932 -0.0026 -0.0047 -0.0046 129 LEU A CD2 
148  N N   . LYS A 23  ? 0.1805 0.1483 0.1368 -0.0085 0.0035  -0.0048 130 LYS A N   
149  C CA  . LYS A 23  ? 0.1739 0.1575 0.1468 -0.0094 0.0012  -0.0010 130 LYS A CA  
150  C C   . LYS A 23  ? 0.1690 0.1566 0.1438 -0.0172 0.0024  -0.0020 130 LYS A C   
151  O O   . LYS A 23  ? 0.1538 0.1543 0.1346 -0.0113 0.0076  0.0110  130 LYS A O   
152  C CB  . LYS A 23  ? 0.1812 0.1675 0.1699 -0.0069 -0.0031 0.0004  130 LYS A CB  
153  C CG  . LYS A 23  ? 0.2071 0.1823 0.1949 -0.0116 -0.0022 0.0104  130 LYS A CG  
154  C CD  . LYS A 23  ? 0.2304 0.2324 0.2272 -0.0030 -0.0039 0.0000  130 LYS A CD  
155  C CE  . LYS A 23  ? 0.2628 0.2517 0.2750 -0.0011 -0.0053 0.0047  130 LYS A CE  
156  N NZ  . LYS A 23  ? 0.2643 0.2623 0.2779 0.0059  0.0046  0.0090  130 LYS A NZ  
157  N N   . SER A 24  ? 0.1581 0.1416 0.1379 -0.0162 0.0029  -0.0084 131 SER A N   
158  C CA  . SER A 24  ? 0.1511 0.1529 0.1460 -0.0123 -0.0008 -0.0014 131 SER A CA  
159  C C   . SER A 24  ? 0.1449 0.1410 0.1405 -0.0150 -0.0032 0.0014  131 SER A C   
160  O O   . SER A 24  ? 0.1526 0.1484 0.1451 -0.0195 -0.0083 0.0105  131 SER A O   
161  C CB  . SER A 24  ? 0.1597 0.1574 0.1602 -0.0188 0.0017  0.0025  131 SER A CB  
162  O OG  . SER A 24  ? 0.1911 0.1479 0.1411 -0.0296 -0.0062 -0.0232 131 SER A OG  
163  N N   . ILE A 25  ? 0.1333 0.1322 0.1284 -0.0128 -0.0004 0.0057  132 ILE A N   
164  C CA  . ILE A 25  ? 0.1280 0.1344 0.1318 -0.0086 -0.0032 0.0045  132 ILE A CA  
165  C C   . ILE A 25  ? 0.1227 0.1236 0.1162 -0.0085 -0.0050 0.0003  132 ILE A C   
166  O O   . ILE A 25  ? 0.1110 0.1230 0.1053 -0.0046 0.0017  -0.0045 132 ILE A O   
167  C CB  . ILE A 25  ? 0.1319 0.1341 0.1228 -0.0063 -0.0023 0.0040  132 ILE A CB  
168  C CG1 . ILE A 25  ? 0.1497 0.1363 0.1315 -0.0119 -0.0080 0.0105  132 ILE A CG1 
169  C CG2 . ILE A 25  ? 0.1457 0.1482 0.1511 0.0004  0.0013  0.0087  132 ILE A CG2 
170  C CD1 . ILE A 25  ? 0.1540 0.1632 0.1674 0.0017  -0.0111 -0.0026 132 ILE A CD1 
171  N N   . ASP A 26  ? 0.1186 0.1282 0.1163 -0.0053 -0.0044 -0.0019 133 ASP A N   
172  C CA  . ASP A 26  ? 0.1191 0.1161 0.1137 -0.0102 0.0015  -0.0050 133 ASP A CA  
173  C C   . ASP A 26  ? 0.1146 0.1136 0.1088 -0.0122 0.0022  -0.0035 133 ASP A C   
174  O O   . ASP A 26  ? 0.1052 0.1174 0.0967 -0.0225 0.0051  0.0001  133 ASP A O   
175  C CB  . ASP A 26  ? 0.1236 0.1308 0.1193 -0.0060 0.0089  -0.0059 133 ASP A CB  
176  C CG  . ASP A 26  ? 0.1284 0.1229 0.1101 -0.0036 -0.0055 -0.0054 133 ASP A CG  
177  O OD1 . ASP A 26  ? 0.1395 0.1161 0.1169 -0.0057 -0.0107 -0.0341 133 ASP A OD1 
178  O OD2 . ASP A 26  ? 0.1286 0.1860 0.1616 0.0108  0.0119  -0.0035 133 ASP A OD2 
179  N N   . ASN A 27  ? 0.1113 0.1033 0.1074 -0.0160 0.0032  -0.0049 134 ASN A N   
180  C CA  . ASN A 27  ? 0.1154 0.1142 0.1095 -0.0082 0.0072  -0.0036 134 ASN A CA  
181  C C   . ASN A 27  ? 0.1153 0.1137 0.1086 -0.0044 0.0047  -0.0053 134 ASN A C   
182  O O   . ASN A 27  ? 0.1157 0.1415 0.1144 -0.0032 0.0163  -0.0055 134 ASN A O   
183  C CB  . ASN A 27  ? 0.1247 0.1140 0.1083 -0.0063 0.0034  -0.0095 134 ASN A CB  
184  C CG  . ASN A 27  ? 0.1581 0.1242 0.1434 -0.0128 0.0188  0.0092  134 ASN A CG  
185  O OD1 . ASN A 27  ? 0.2257 0.1626 0.2045 -0.0226 0.0470  0.0029  134 ASN A OD1 
186  N ND2 . ASN A 27  ? 0.1365 0.1290 0.1264 -0.0045 0.0134  -0.0057 134 ASN A ND2 
187  N N   . GLY A 28  ? 0.1104 0.1086 0.1173 -0.0007 0.0042  0.0007  135 GLY A N   
188  C CA  . GLY A 28  ? 0.1102 0.1073 0.1150 -0.0086 0.0046  -0.0022 135 GLY A CA  
189  C C   . GLY A 28  ? 0.1109 0.1060 0.1088 -0.0014 -0.0017 -0.0025 135 GLY A C   
190  O O   . GLY A 28  ? 0.1261 0.1087 0.1331 -0.0144 -0.0006 0.0047  135 GLY A O   
191  N N   . ILE A 29  ? 0.1029 0.0990 0.1063 -0.0133 -0.0057 -0.0022 136 ILE A N   
192  C CA  . ILE A 29  ? 0.1048 0.0963 0.0985 -0.0040 -0.0011 -0.0020 136 ILE A CA  
193  C C   . ILE A 29  ? 0.1022 0.0953 0.0970 0.0017  0.0002  -0.0058 136 ILE A C   
194  O O   . ILE A 29  ? 0.1086 0.1103 0.1041 0.0097  -0.0037 -0.0089 136 ILE A O   
195  C CB  . ILE A 29  ? 0.1093 0.0958 0.1013 -0.0018 -0.0001 -0.0009 136 ILE A CB  
196  C CG1 . ILE A 29  ? 0.1090 0.1021 0.1192 -0.0023 0.0072  -0.0118 136 ILE A CG1 
197  C CG2 . ILE A 29  ? 0.0815 0.0995 0.1018 -0.0047 0.0034  0.0044  136 ILE A CG2 
198  C CD1 . ILE A 29  ? 0.1528 0.1340 0.1391 -0.0082 0.0113  0.0039  136 ILE A CD1 
199  N N   . PHE A 30  ? 0.0992 0.1014 0.0961 0.0039  0.0043  -0.0027 137 PHE A N   
200  C CA  . PHE A 30  ? 0.0960 0.0958 0.1011 -0.0015 0.0038  0.0002  137 PHE A CA  
201  C C   . PHE A 30  ? 0.0917 0.1057 0.0948 0.0002  0.0028  -0.0026 137 PHE A C   
202  O O   . PHE A 30  ? 0.0910 0.1238 0.0919 -0.0121 0.0106  0.0041  137 PHE A O   
203  C CB  . PHE A 30  ? 0.0947 0.0958 0.0996 -0.0022 0.0001  0.0044  137 PHE A CB  
204  C CG  . PHE A 30  ? 0.1130 0.1052 0.0942 -0.0024 0.0024  -0.0055 137 PHE A CG  
205  C CD1 . PHE A 30  ? 0.1193 0.1087 0.1107 0.0036  -0.0048 -0.0108 137 PHE A CD1 
206  C CD2 . PHE A 30  ? 0.1270 0.1393 0.1338 -0.0073 0.0032  0.0009  137 PHE A CD2 
207  C CE1 . PHE A 30  ? 0.1114 0.1114 0.1311 -0.0184 0.0046  -0.0101 137 PHE A CE1 
208  C CE2 . PHE A 30  ? 0.1347 0.1030 0.1071 0.0077  0.0121  -0.0046 137 PHE A CE2 
209  C CZ  . PHE A 30  ? 0.0990 0.1269 0.1081 -0.0043 -0.0084 -0.0055 137 PHE A CZ  
210  N N   . VAL A 31  ? 0.1167 0.1078 0.1037 -0.0066 0.0040  0.0036  138 VAL A N   
211  C CA  . VAL A 31  ? 0.1276 0.1279 0.1204 -0.0100 0.0045  -0.0026 138 VAL A CA  
212  C C   . VAL A 31  ? 0.1327 0.1347 0.1390 -0.0075 0.0033  0.0010  138 VAL A C   
213  O O   . VAL A 31  ? 0.1573 0.1628 0.1381 -0.0121 0.0079  -0.0202 138 VAL A O   
214  C CB  . VAL A 31  ? 0.1292 0.1195 0.1112 -0.0079 0.0017  -0.0001 138 VAL A CB  
215  C CG1 . VAL A 31  ? 0.1484 0.1372 0.1423 -0.0129 0.0046  -0.0122 138 VAL A CG1 
216  C CG2 . VAL A 31  ? 0.1186 0.1060 0.1203 -0.0031 0.0022  -0.0208 138 VAL A CG2 
217  N N   . GLN A 32  ? 0.1411 0.1478 0.1362 -0.0096 0.0110  -0.0043 139 GLN A N   
218  C CA  . GLN A 32  ? 0.1597 0.1637 0.1683 -0.0003 0.0045  0.0006  139 GLN A CA  
219  C C   . GLN A 32  ? 0.1648 0.1708 0.1633 0.0013  0.0047  -0.0030 139 GLN A C   
220  O O   . GLN A 32  ? 0.1691 0.1776 0.1743 0.0086  -0.0046 -0.0080 139 GLN A O   
221  C CB  . GLN A 32  ? 0.1763 0.1846 0.1773 0.0039  0.0062  0.0047  139 GLN A CB  
222  C CG  . GLN A 32  ? 0.2126 0.2395 0.2254 -0.0058 -0.0025 0.0155  139 GLN A CG  
223  C CD  . GLN A 32  ? 0.2594 0.2508 0.2691 0.0018  0.0083  0.0047  139 GLN A CD  
224  O OE1 . GLN A 32  ? 0.2870 0.2974 0.2824 -0.0223 0.0070  0.0205  139 GLN A OE1 
225  N NE2 . GLN A 32  ? 0.3002 0.3137 0.2946 -0.0068 -0.0076 0.0143  139 GLN A NE2 
226  N N   . LEU A 33  ? 0.1527 0.1494 0.1511 -0.0056 0.0117  0.0039  140 LEU A N   
227  C CA  . LEU A 33  ? 0.1540 0.1520 0.1387 -0.0048 -0.0014 -0.0020 140 LEU A CA  
228  C C   . LEU A 33  ? 0.1371 0.1367 0.1371 -0.0060 0.0033  0.0000  140 LEU A C   
229  O O   . LEU A 33  ? 0.1600 0.1402 0.1541 -0.0090 0.0255  0.0038  140 LEU A O   
230  C CB  . LEU A 33  ? 0.1772 0.1611 0.1592 -0.0013 -0.0009 0.0042  140 LEU A CB  
231  C CG  . LEU A 33  ? 0.1789 0.1823 0.1650 -0.0012 -0.0049 0.0021  140 LEU A CG  
232  C CD1 . LEU A 33  ? 0.1839 0.1896 0.1595 0.0073  -0.0046 -0.0033 140 LEU A CD1 
233  C CD2 . LEU A 33  ? 0.2068 0.2144 0.1813 -0.0040 -0.0044 -0.0049 140 LEU A CD2 
234  N N   . VAL A 34  ? 0.1115 0.1196 0.1129 -0.0047 0.0002  -0.0066 141 VAL A N   
235  C CA  . VAL A 34  ? 0.1115 0.1098 0.1153 -0.0063 -0.0032 -0.0043 141 VAL A CA  
236  C C   . VAL A 34  ? 0.1013 0.1106 0.1180 -0.0038 -0.0012 0.0074  141 VAL A C   
237  O O   . VAL A 34  ? 0.1068 0.1150 0.1316 -0.0075 0.0123  0.0125  141 VAL A O   
238  C CB  . VAL A 34  ? 0.0936 0.0978 0.1091 -0.0050 -0.0033 0.0041  141 VAL A CB  
239  C CG1 . VAL A 34  ? 0.0978 0.1075 0.1137 -0.0038 0.0004  -0.0042 141 VAL A CG1 
240  C CG2 . VAL A 34  ? 0.1207 0.1212 0.1063 -0.0050 -0.0125 -0.0072 141 VAL A CG2 
241  N N   . GLN A 35  ? 0.1096 0.1105 0.1077 -0.0101 -0.0009 0.0077  142 GLN A N   
242  C CA  . GLN A 35  ? 0.1264 0.1290 0.1327 -0.0056 -0.0028 0.0072  142 GLN A CA  
243  C C   . GLN A 35  ? 0.1093 0.1249 0.1176 -0.0090 0.0012  0.0044  142 GLN A C   
244  O O   . GLN A 35  ? 0.0976 0.1141 0.1149 -0.0185 0.0164  0.0038  142 GLN A O   
245  C CB  . GLN A 35  ? 0.1461 0.1448 0.1371 -0.0056 0.0016  0.0000  142 GLN A CB  
246  C CG  . GLN A 35  ? 0.1995 0.1955 0.1804 -0.0113 0.0025  0.0098  142 GLN A CG  
247  C CD  . GLN A 35  ? 0.2340 0.2416 0.2259 0.0026  -0.0080 0.0064  142 GLN A CD  
248  O OE1 . GLN A 35  ? 0.2546 0.2997 0.2850 -0.0276 -0.0052 0.0097  142 GLN A OE1 
249  N NE2 . GLN A 35  ? 0.2317 0.2337 0.2109 -0.0006 0.0040  -0.0037 142 GLN A NE2 
250  N N   . ALA A 36  ? 0.1150 0.1333 0.1220 -0.0080 0.0020  0.0045  143 ALA A N   
251  C CA  . ALA A 36  ? 0.1219 0.1264 0.1213 -0.0083 -0.0013 0.0077  143 ALA A CA  
252  C C   . ALA A 36  ? 0.1064 0.1196 0.1134 -0.0097 0.0022  0.0005  143 ALA A C   
253  O O   . ALA A 36  ? 0.1097 0.1175 0.0993 -0.0199 0.0097  0.0183  143 ALA A O   
254  C CB  . ALA A 36  ? 0.1341 0.1431 0.1445 -0.0084 0.0061  0.0140  143 ALA A CB  
255  N N   . ASN A 37  ? 0.1015 0.1158 0.1100 -0.0116 0.0012  0.0039  144 ASN A N   
256  C CA  . ASN A 37  ? 0.1173 0.1180 0.1166 -0.0026 0.0019  0.0006  144 ASN A CA  
257  C C   . ASN A 37  ? 0.1262 0.1208 0.1223 -0.0061 0.0056  0.0006  144 ASN A C   
258  O O   . ASN A 37  ? 0.1304 0.0989 0.1272 -0.0069 0.0106  0.0047  144 ASN A O   
259  C CB  . ASN A 37  ? 0.1329 0.1248 0.1157 -0.0048 0.0050  0.0024  144 ASN A CB  
260  C CG  . ASN A 37  ? 0.1290 0.1265 0.1318 -0.0059 0.0048  0.0108  144 ASN A CG  
261  O OD1 . ASN A 37  ? 0.1223 0.1083 0.1131 -0.0264 0.0076  0.0003  144 ASN A OD1 
262  N ND2 . ASN A 37  ? 0.1614 0.1436 0.1327 -0.0277 -0.0106 0.0270  144 ASN A ND2 
263  N N   . SER A 38  ? 0.1250 0.1179 0.1259 -0.0088 0.0019  -0.0031 145 SER A N   
264  C CA  . SER A 38  ? 0.1221 0.1146 0.1205 -0.0033 0.0079  0.0005  145 SER A CA  
265  C C   . SER A 38  ? 0.1287 0.1164 0.1199 -0.0007 0.0070  0.0015  145 SER A C   
266  O O   . SER A 38  ? 0.1220 0.1219 0.0955 -0.0028 0.0125  0.0097  145 SER A O   
267  C CB  . SER A 38  ? 0.1178 0.1147 0.1204 -0.0049 0.0066  0.0046  145 SER A CB  
268  O OG  . SER A 38  ? 0.0990 0.1007 0.1340 -0.0379 0.0120  0.0041  145 SER A OG  
269  N N   . PRO A 39  ? 0.1230 0.1058 0.1178 -0.0028 0.0068  0.0001  146 PRO A N   
270  C CA  . PRO A 39  ? 0.1297 0.1164 0.1163 -0.0011 0.0039  0.0047  146 PRO A CA  
271  C C   . PRO A 39  ? 0.1201 0.1087 0.1132 -0.0056 -0.0036 0.0067  146 PRO A C   
272  O O   . PRO A 39  ? 0.1347 0.1074 0.1063 -0.0085 -0.0177 0.0116  146 PRO A O   
273  C CB  . PRO A 39  ? 0.1258 0.1175 0.1211 0.0023  0.0007  0.0079  146 PRO A CB  
274  C CG  . PRO A 39  ? 0.1345 0.1175 0.1324 0.0040  -0.0039 -0.0034 146 PRO A CG  
275  C CD  . PRO A 39  ? 0.1355 0.1242 0.1325 0.0017  0.0093  -0.0007 146 PRO A CD  
276  N N   . ALA A 40  ? 0.1119 0.1017 0.1146 -0.0039 -0.0066 0.0061  147 ALA A N   
277  C CA  . ALA A 40  ? 0.1150 0.1071 0.1114 -0.0034 -0.0059 0.0028  147 ALA A CA  
278  C C   . ALA A 40  ? 0.1070 0.1013 0.1146 -0.0013 -0.0054 0.0025  147 ALA A C   
279  O O   . ALA A 40  ? 0.1006 0.0990 0.1248 -0.0029 -0.0132 0.0011  147 ALA A O   
280  C CB  . ALA A 40  ? 0.1111 0.1015 0.1109 -0.0043 -0.0010 0.0068  147 ALA A CB  
281  N N   . SER A 41  ? 0.1057 0.0951 0.1038 -0.0048 -0.0100 -0.0026 148 SER A N   
282  C CA  . SER A 41  ? 0.1011 0.0897 0.1005 -0.0017 -0.0039 0.0010  148 SER A CA  
283  C C   . SER A 41  ? 0.1131 0.1078 0.1040 0.0010  -0.0029 -0.0012 148 SER A C   
284  O O   . SER A 41  ? 0.1188 0.1163 0.1052 0.0064  -0.0018 -0.0021 148 SER A O   
285  C CB  . SER A 41  ? 0.1057 0.0948 0.1022 -0.0035 0.0009  -0.0106 148 SER A CB  
286  O OG  . SER A 41  ? 0.1103 0.0585 0.1271 -0.0005 -0.0031 0.0057  148 SER A OG  
287  N N   . LEU A 42  ? 0.1143 0.1038 0.1201 -0.0023 -0.0058 0.0065  149 LEU A N   
288  C CA  . LEU A 42  ? 0.1293 0.1256 0.1169 -0.0035 -0.0045 0.0039  149 LEU A CA  
289  C C   . LEU A 42  ? 0.1339 0.1340 0.1274 -0.0043 -0.0059 0.0024  149 LEU A C   
290  O O   . LEU A 42  ? 0.1454 0.1420 0.1311 -0.0027 -0.0031 0.0076  149 LEU A O   
291  C CB  . LEU A 42  ? 0.1354 0.1220 0.1214 -0.0071 -0.0049 0.0013  149 LEU A CB  
292  C CG  . LEU A 42  ? 0.1274 0.1287 0.1252 -0.0070 -0.0087 0.0018  149 LEU A CG  
293  C CD1 . LEU A 42  ? 0.1522 0.1447 0.1387 -0.0107 0.0066  -0.0012 149 LEU A CD1 
294  C CD2 . LEU A 42  ? 0.1374 0.1423 0.1286 -0.0088 0.0083  0.0032  149 LEU A CD2 
295  N N   . VAL A 43  ? 0.1373 0.1252 0.1208 -0.0031 -0.0048 0.0116  150 VAL A N   
296  C CA  . VAL A 43  ? 0.1321 0.1194 0.1208 -0.0026 -0.0039 0.0060  150 VAL A CA  
297  C C   . VAL A 43  ? 0.1343 0.1245 0.1240 -0.0014 -0.0043 0.0045  150 VAL A C   
298  O O   . VAL A 43  ? 0.1596 0.1315 0.1369 -0.0080 -0.0075 0.0045  150 VAL A O   
299  C CB  . VAL A 43  ? 0.1324 0.1144 0.1213 -0.0016 0.0002  -0.0008 150 VAL A CB  
300  C CG1 . VAL A 43  ? 0.1350 0.1200 0.1420 0.0044  -0.0097 0.0022  150 VAL A CG1 
301  C CG2 . VAL A 43  ? 0.1248 0.1253 0.1287 -0.0010 0.0040  0.0071  150 VAL A CG2 
302  N N   . GLY A 44  ? 0.1321 0.1159 0.1273 -0.0029 -0.0055 0.0011  151 GLY A N   
303  C CA  . GLY A 44  ? 0.1306 0.1216 0.1116 -0.0006 0.0019  -0.0016 151 GLY A CA  
304  C C   . GLY A 44  ? 0.1187 0.1115 0.1132 -0.0036 0.0013  -0.0056 151 GLY A C   
305  O O   . GLY A 44  ? 0.1292 0.1240 0.1039 -0.0038 -0.0028 -0.0164 151 GLY A O   
306  N N   . LEU A 45  ? 0.1223 0.0984 0.0928 0.0002  0.0041  -0.0066 152 LEU A N   
307  C CA  . LEU A 45  ? 0.1129 0.0932 0.0994 -0.0034 0.0006  -0.0035 152 LEU A CA  
308  C C   . LEU A 45  ? 0.1177 0.1040 0.1128 -0.0076 0.0029  -0.0013 152 LEU A C   
309  O O   . LEU A 45  ? 0.1035 0.1017 0.1056 -0.0146 0.0068  0.0067  152 LEU A O   
310  C CB  . LEU A 45  ? 0.1193 0.0894 0.1083 -0.0007 -0.0008 0.0098  152 LEU A CB  
311  C CG  . LEU A 45  ? 0.1243 0.1039 0.1178 -0.0144 0.0028  0.0046  152 LEU A CG  
312  C CD1 . LEU A 45  ? 0.1214 0.1013 0.1446 -0.0043 0.0125  -0.0116 152 LEU A CD1 
313  C CD2 . LEU A 45  ? 0.1431 0.1459 0.1594 -0.0035 -0.0119 -0.0119 152 LEU A CD2 
314  N N   . ARG A 46  ? 0.1044 0.1006 0.1156 -0.0021 0.0041  -0.0085 153 ARG A N   
315  C CA  . ARG A 46  ? 0.1226 0.1116 0.1134 -0.0015 -0.0042 -0.0053 153 ARG A CA  
316  C C   . ARG A 46  ? 0.1068 0.1068 0.1061 -0.0007 -0.0028 -0.0052 153 ARG A C   
317  O O   . ARG A 46  ? 0.1008 0.1096 0.1136 0.0080  -0.0016 -0.0058 153 ARG A O   
318  C CB  . ARG A 46  ? 0.1111 0.1239 0.1261 0.0013  0.0021  -0.0035 153 ARG A CB  
319  C CG  . ARG A 46  ? 0.1555 0.1502 0.1475 0.0004  -0.0002 -0.0030 153 ARG A CG  
320  C CD  . ARG A 46  ? 0.1867 0.2074 0.1915 -0.0052 0.0116  -0.0067 153 ARG A CD  
321  N NE  . ARG A 46  ? 0.2172 0.2395 0.2192 0.0109  -0.0141 -0.0047 153 ARG A NE  
322  C CZ  . ARG A 46  ? 0.2878 0.2877 0.2691 0.0004  0.0013  -0.0071 153 ARG A CZ  
323  N NH1 . ARG A 46  ? 0.3151 0.3158 0.3157 0.0027  0.0204  -0.0177 153 ARG A NH1 
324  N NH2 . ARG A 46  ? 0.2967 0.3049 0.2727 -0.0107 -0.0057 0.0007  153 ARG A NH2 
325  N N   . PHE A 47  ? 0.1008 0.0921 0.1037 -0.0036 -0.0091 -0.0069 154 PHE A N   
326  C CA  . PHE A 47  ? 0.0996 0.1044 0.1007 0.0014  -0.0021 -0.0019 154 PHE A CA  
327  C C   . PHE A 47  ? 0.0882 0.0978 0.0986 -0.0040 -0.0040 -0.0052 154 PHE A C   
328  O O   . PHE A 47  ? 0.0861 0.0967 0.0993 -0.0061 -0.0087 -0.0075 154 PHE A O   
329  C CB  . PHE A 47  ? 0.0914 0.0985 0.0987 -0.0027 -0.0128 -0.0094 154 PHE A CB  
330  C CG  . PHE A 47  ? 0.0978 0.1076 0.0878 0.0054  -0.0051 0.0047  154 PHE A CG  
331  C CD1 . PHE A 47  ? 0.1260 0.1389 0.1239 -0.0016 -0.0031 0.0077  154 PHE A CD1 
332  C CD2 . PHE A 47  ? 0.1083 0.1268 0.1128 0.0030  -0.0064 0.0031  154 PHE A CD2 
333  C CE1 . PHE A 47  ? 0.1389 0.1392 0.1339 -0.0022 -0.0022 0.0074  154 PHE A CE1 
334  C CE2 . PHE A 47  ? 0.1290 0.1423 0.1359 -0.0010 0.0044  0.0001  154 PHE A CE2 
335  C CZ  . PHE A 47  ? 0.1543 0.1442 0.1348 -0.0031 -0.0020 0.0104  154 PHE A CZ  
336  N N   . GLY A 48  ? 0.1085 0.0985 0.1018 0.0013  0.0025  -0.0003 155 GLY A N   
337  C CA  . GLY A 48  ? 0.0979 0.1040 0.1056 -0.0005 0.0033  -0.0052 155 GLY A CA  
338  C C   . GLY A 48  ? 0.1004 0.1013 0.0998 0.0013  0.0060  -0.0004 155 GLY A C   
339  O O   . GLY A 48  ? 0.0997 0.0979 0.1197 -0.0003 0.0073  0.0066  155 GLY A O   
340  N N   . ASP A 49  ? 0.0882 0.0904 0.0958 -0.0039 0.0005  -0.0053 156 ASP A N   
341  C CA  . ASP A 49  ? 0.0989 0.1007 0.0974 -0.0034 0.0001  0.0000  156 ASP A CA  
342  C C   . ASP A 49  ? 0.0920 0.1049 0.1033 -0.0074 -0.0032 -0.0020 156 ASP A C   
343  O O   . ASP A 49  ? 0.0712 0.1076 0.1075 -0.0190 -0.0075 -0.0192 156 ASP A O   
344  C CB  . ASP A 49  ? 0.0915 0.1023 0.0956 -0.0002 -0.0021 -0.0075 156 ASP A CB  
345  C CG  . ASP A 49  ? 0.1074 0.1111 0.1185 -0.0098 -0.0019 0.0015  156 ASP A CG  
346  O OD1 . ASP A 49  ? 0.0918 0.1079 0.1406 -0.0064 -0.0076 0.0039  156 ASP A OD1 
347  O OD2 . ASP A 49  ? 0.1278 0.1031 0.1570 -0.0078 -0.0078 0.0134  156 ASP A OD2 
348  N N   . GLN A 50  ? 0.1029 0.0924 0.1047 -0.0035 -0.0060 -0.0004 157 GLN A N   
349  C CA  . GLN A 50  ? 0.0960 0.0961 0.1011 -0.0047 0.0027  -0.0027 157 GLN A CA  
350  C C   . GLN A 50  ? 0.0960 0.1095 0.1112 -0.0048 0.0014  0.0008  157 GLN A C   
351  O O   . GLN A 50  ? 0.1049 0.1073 0.1136 0.0124  0.0043  0.0044  157 GLN A O   
352  C CB  . GLN A 50  ? 0.1056 0.1041 0.1205 -0.0055 -0.0013 -0.0027 157 GLN A CB  
353  C CG  . GLN A 50  ? 0.0984 0.1021 0.1290 -0.0102 0.0109  -0.0035 157 GLN A CG  
354  C CD  . GLN A 50  ? 0.1223 0.1097 0.1450 -0.0108 0.0154  -0.0111 157 GLN A CD  
355  O OE1 . GLN A 50  ? 0.1212 0.1210 0.1806 -0.0021 0.0255  -0.0028 157 GLN A OE1 
356  N NE2 . GLN A 50  ? 0.0991 0.1059 0.1013 0.0024  0.0156  0.0225  157 GLN A NE2 
357  N N   . VAL A 51  ? 0.1035 0.1156 0.1157 0.0000  0.0005  -0.0039 158 VAL A N   
358  C CA  . VAL A 51  ? 0.1090 0.1156 0.1243 -0.0014 -0.0002 0.0014  158 VAL A CA  
359  C C   . VAL A 51  ? 0.1124 0.1148 0.1226 -0.0006 0.0038  -0.0029 158 VAL A C   
360  O O   . VAL A 51  ? 0.1098 0.1105 0.1345 0.0096  0.0128  -0.0036 158 VAL A O   
361  C CB  . VAL A 51  ? 0.1048 0.1193 0.1337 -0.0041 0.0023  -0.0035 158 VAL A CB  
362  C CG1 . VAL A 51  ? 0.1393 0.1261 0.1537 -0.0012 -0.0095 -0.0056 158 VAL A CG1 
363  C CG2 . VAL A 51  ? 0.1050 0.0964 0.1206 0.0062  -0.0105 -0.0066 158 VAL A CG2 
364  N N   . LEU A 52  ? 0.1108 0.1075 0.1270 0.0085  0.0001  -0.0032 159 LEU A N   
365  C CA  . LEU A 52  ? 0.1228 0.1280 0.1288 0.0024  0.0000  -0.0030 159 LEU A CA  
366  C C   . LEU A 52  ? 0.1182 0.1205 0.1308 0.0036  -0.0007 -0.0020 159 LEU A C   
367  O O   . LEU A 52  ? 0.1010 0.1128 0.1283 0.0075  -0.0037 -0.0110 159 LEU A O   
368  C CB  . LEU A 52  ? 0.1379 0.1428 0.1383 0.0018  -0.0045 0.0010  159 LEU A CB  
369  C CG  . LEU A 52  ? 0.1807 0.1836 0.1628 0.0092  -0.0003 0.0003  159 LEU A CG  
370  C CD1 . LEU A 52  ? 0.2042 0.1859 0.1804 0.0110  -0.0109 -0.0079 159 LEU A CD1 
371  C CD2 . LEU A 52  ? 0.2173 0.1862 0.2159 0.0064  -0.0005 -0.0019 159 LEU A CD2 
372  N N   . GLN A 53  ? 0.1178 0.1241 0.1323 0.0011  0.0006  0.0019  160 GLN A N   
373  C CA  . GLN A 53  ? 0.1270 0.1247 0.1290 0.0024  -0.0026 -0.0027 160 GLN A CA  
374  C C   . GLN A 53  ? 0.1321 0.1256 0.1440 -0.0032 -0.0005 -0.0023 160 GLN A C   
375  O O   . GLN A 53  ? 0.1351 0.1324 0.1548 0.0026  -0.0017 -0.0101 160 GLN A O   
376  C CB  . GLN A 53  ? 0.1273 0.1237 0.1376 -0.0023 -0.0024 -0.0035 160 GLN A CB  
377  C CG  . GLN A 53  ? 0.1366 0.1339 0.1629 -0.0039 -0.0034 -0.0049 160 GLN A CG  
378  C CD  . GLN A 53  ? 0.1619 0.1536 0.1683 0.0018  0.0057  -0.0050 160 GLN A CD  
379  O OE1 . GLN A 53  ? 0.1591 0.1587 0.1721 -0.0207 -0.0089 -0.0100 160 GLN A OE1 
380  N NE2 . GLN A 53  ? 0.1039 0.1589 0.1906 -0.0059 0.0063  -0.0213 160 GLN A NE2 
381  N N   . ILE A 54  ? 0.1406 0.1340 0.1595 -0.0089 0.0031  -0.0021 161 ILE A N   
382  C CA  . ILE A 54  ? 0.1426 0.1428 0.1642 0.0006  0.0036  -0.0072 161 ILE A CA  
383  C C   . ILE A 54  ? 0.1512 0.1604 0.1756 0.0049  0.0024  -0.0047 161 ILE A C   
384  O O   . ILE A 54  ? 0.1430 0.1509 0.1860 0.0156  0.0179  -0.0143 161 ILE A O   
385  C CB  . ILE A 54  ? 0.1394 0.1342 0.1674 -0.0031 0.0006  0.0000  161 ILE A CB  
386  C CG1 . ILE A 54  ? 0.1229 0.1286 0.1558 -0.0048 0.0101  -0.0065 161 ILE A CG1 
387  C CG2 . ILE A 54  ? 0.1381 0.1368 0.1480 0.0120  0.0019  -0.0105 161 ILE A CG2 
388  C CD1 . ILE A 54  ? 0.1330 0.1521 0.1593 -0.0035 0.0055  -0.0094 161 ILE A CD1 
389  N N   . ASN A 55  ? 0.1624 0.1753 0.1978 0.0016  -0.0018 -0.0038 162 ASN A N   
390  C CA  . ASN A 55  ? 0.1872 0.1886 0.2073 0.0050  -0.0038 -0.0011 162 ASN A CA  
391  C C   . ASN A 55  ? 0.1960 0.2089 0.2253 0.0031  -0.0019 -0.0009 162 ASN A C   
392  O O   . ASN A 55  ? 0.1899 0.2128 0.2514 0.0113  0.0040  0.0024  162 ASN A O   
393  C CB  . ASN A 55  ? 0.1891 0.2062 0.2186 0.0022  0.0002  -0.0028 162 ASN A CB  
394  C CG  . ASN A 55  ? 0.2150 0.1934 0.2224 -0.0001 0.0042  -0.0056 162 ASN A CG  
395  O OD1 . ASN A 55  ? 0.2185 0.1873 0.2603 -0.0015 0.0142  -0.0080 162 ASN A OD1 
396  N ND2 . ASN A 55  ? 0.1684 0.1956 0.2179 0.0019  -0.0138 -0.0134 162 ASN A ND2 
397  N N   . GLY A 56  ? 0.2128 0.2178 0.2289 0.0044  -0.0082 -0.0065 163 GLY A N   
398  C CA  . GLY A 56  ? 0.2148 0.2192 0.2345 -0.0015 -0.0053 -0.0070 163 GLY A CA  
399  C C   . GLY A 56  ? 0.2219 0.2179 0.2333 -0.0005 -0.0064 -0.0075 163 GLY A C   
400  O O   . GLY A 56  ? 0.2321 0.2351 0.2648 -0.0115 -0.0159 -0.0184 163 GLY A O   
401  N N   . GLU A 57  ? 0.2020 0.1959 0.2264 0.0004  -0.0055 -0.0125 164 GLU A N   
402  C CA  . GLU A 57  ? 0.2033 0.1998 0.2175 0.0069  -0.0036 -0.0053 164 GLU A CA  
403  C C   . GLU A 57  ? 0.1817 0.1734 0.1965 0.0020  0.0000  -0.0128 164 GLU A C   
404  O O   . GLU A 57  ? 0.1582 0.1260 0.1867 0.0075  0.0014  -0.0247 164 GLU A O   
405  C CB  . GLU A 57  ? 0.2240 0.2002 0.2272 0.0021  -0.0010 -0.0065 164 GLU A CB  
406  C CG  . GLU A 57  ? 0.2645 0.2906 0.2900 -0.0024 0.0070  -0.0019 164 GLU A CG  
407  C CD  . GLU A 57  ? 0.3549 0.3489 0.3171 -0.0080 0.0001  -0.0033 164 GLU A CD  
408  O OE1 . GLU A 57  ? 0.3431 0.3677 0.3663 -0.0184 0.0071  -0.0118 164 GLU A OE1 
409  O OE2 . GLU A 57  ? 0.3736 0.3715 0.3738 -0.0168 0.0197  0.0052  164 GLU A OE2 
410  N N   . ASN A 58  ? 0.1630 0.1616 0.1888 0.0027  0.0028  -0.0079 165 ASN A N   
411  C CA  . ASN A 58  ? 0.1602 0.1568 0.1695 0.0052  0.0012  -0.0045 165 ASN A CA  
412  C C   . ASN A 58  ? 0.1534 0.1547 0.1635 -0.0022 0.0056  -0.0056 165 ASN A C   
413  O O   . ASN A 58  ? 0.1610 0.1612 0.1701 -0.0013 0.0134  -0.0124 165 ASN A O   
414  C CB  . ASN A 58  ? 0.1530 0.1500 0.1765 0.0057  0.0067  -0.0068 165 ASN A CB  
415  C CG  . ASN A 58  ? 0.1737 0.1658 0.1841 0.0012  0.0048  -0.0060 165 ASN A CG  
416  O OD1 . ASN A 58  ? 0.1595 0.1645 0.1795 -0.0005 -0.0056 -0.0145 165 ASN A OD1 
417  N ND2 . ASN A 58  ? 0.1756 0.1892 0.2427 0.0050  -0.0001 -0.0160 165 ASN A ND2 
418  N N   . CYS A 59  ? 0.1423 0.1384 0.1467 0.0044  0.0036  -0.0020 166 CYS A N   
419  C CA  . CYS A 59  ? 0.1267 0.1325 0.1397 -0.0036 0.0019  -0.0082 166 CYS A CA  
420  C C   . CYS A 59  ? 0.1132 0.1347 0.1323 -0.0017 0.0064  -0.0034 166 CYS A C   
421  O O   . CYS A 59  ? 0.0956 0.1325 0.1371 -0.0165 0.0074  -0.0057 166 CYS A O   
422  C CB  . CYS A 59  ? 0.1251 0.1302 0.1498 0.0004  -0.0029 -0.0046 166 CYS A CB  
423  S SG  . CYS A 59  ? 0.1480 0.1307 0.1748 -0.0215 -0.0123 -0.0109 166 CYS A SG  
424  N N   . ALA A 60  ? 0.1165 0.1339 0.1406 0.0000  0.0048  -0.0106 167 ALA A N   
425  C CA  . ALA A 60  ? 0.1296 0.1399 0.1396 -0.0014 0.0014  -0.0005 167 ALA A CA  
426  C C   . ALA A 60  ? 0.1423 0.1477 0.1418 -0.0007 0.0018  -0.0086 167 ALA A C   
427  O O   . ALA A 60  ? 0.1526 0.1555 0.1548 -0.0072 0.0081  -0.0134 167 ALA A O   
428  C CB  . ALA A 60  ? 0.1339 0.1394 0.1496 0.0025  0.0090  -0.0156 167 ALA A CB  
429  N N   . GLY A 61  ? 0.1497 0.1511 0.1419 -0.0028 0.0035  -0.0029 168 GLY A N   
430  C CA  . GLY A 61  ? 0.1565 0.1580 0.1503 -0.0053 0.0050  0.0009  168 GLY A CA  
431  C C   . GLY A 61  ? 0.1592 0.1597 0.1526 -0.0075 0.0054  -0.0014 168 GLY A C   
432  O O   . GLY A 61  ? 0.1746 0.1723 0.1545 -0.0263 0.0151  0.0046  168 GLY A O   
433  N N   . TRP A 62  ? 0.1610 0.1464 0.1428 -0.0034 0.0100  0.0024  169 TRP A N   
434  C CA  . TRP A 62  ? 0.1731 0.1618 0.1539 -0.0088 0.0047  -0.0032 169 TRP A CA  
435  C C   . TRP A 62  ? 0.1728 0.1674 0.1581 -0.0065 0.0042  -0.0059 169 TRP A C   
436  O O   . TRP A 62  ? 0.1759 0.1541 0.1259 -0.0126 0.0067  -0.0269 169 TRP A O   
437  C CB  . TRP A 62  ? 0.1819 0.1600 0.1552 -0.0046 0.0008  -0.0086 169 TRP A CB  
438  C CG  . TRP A 62  ? 0.1847 0.1765 0.1578 0.0000  0.0014  -0.0160 169 TRP A CG  
439  C CD1 . TRP A 62  ? 0.1858 0.2087 0.1908 0.0043  0.0083  -0.0106 169 TRP A CD1 
440  C CD2 . TRP A 62  ? 0.1981 0.1888 0.1670 0.0031  0.0065  -0.0063 169 TRP A CD2 
441  N NE1 . TRP A 62  ? 0.2243 0.1968 0.2066 0.0045  -0.0001 -0.0100 169 TRP A NE1 
442  C CE2 . TRP A 62  ? 0.1929 0.1981 0.1718 0.0055  0.0018  -0.0072 169 TRP A CE2 
443  C CE3 . TRP A 62  ? 0.1982 0.1886 0.1711 0.0023  -0.0048 0.0000  169 TRP A CE3 
444  C CZ2 . TRP A 62  ? 0.2088 0.1901 0.2046 -0.0006 -0.0013 -0.0106 169 TRP A CZ2 
445  C CZ3 . TRP A 62  ? 0.2107 0.1975 0.2126 -0.0022 -0.0061 -0.0021 169 TRP A CZ3 
446  C CH2 . TRP A 62  ? 0.2125 0.2104 0.2287 0.0043  0.0019  0.0018  169 TRP A CH2 
447  N N   . SER A 63  ? 0.1881 0.1793 0.1632 -0.0042 0.0053  -0.0067 170 SER A N   
448  C CA  . SER A 63  ? 0.1839 0.1838 0.1677 0.0036  0.0042  -0.0026 170 SER A CA  
449  C C   . SER A 63  ? 0.1939 0.1878 0.1689 0.0030  0.0068  -0.0039 170 SER A C   
450  O O   . SER A 63  ? 0.1894 0.1771 0.1420 0.0056  0.0096  -0.0168 170 SER A O   
451  C CB  . SER A 63  ? 0.1868 0.1815 0.1647 0.0029  0.0066  -0.0001 170 SER A CB  
452  O OG  . SER A 63  ? 0.1981 0.1934 0.1539 0.0026  0.0213  0.0004  170 SER A OG  
453  N N   . SER A 64  ? 0.1996 0.2036 0.1812 0.0001  0.0010  -0.0036 171 SER A N   
454  C CA  . SER A 64  ? 0.2192 0.2167 0.2098 -0.0011 0.0018  -0.0077 171 SER A CA  
455  C C   . SER A 64  ? 0.2305 0.2200 0.2199 -0.0017 0.0036  -0.0091 171 SER A C   
456  O O   . SER A 64  ? 0.2426 0.2323 0.2266 -0.0116 0.0065  -0.0180 171 SER A O   
457  C CB  . SER A 64  ? 0.2090 0.2116 0.2099 -0.0015 0.0046  -0.0085 171 SER A CB  
458  O OG  . SER A 64  ? 0.2083 0.2301 0.2220 -0.0129 -0.0063 -0.0101 171 SER A OG  
459  N N   . ASP A 65  ? 0.2466 0.2357 0.2277 -0.0072 0.0044  -0.0084 172 ASP A N   
460  C CA  . ASP A 65  ? 0.2472 0.2405 0.2400 -0.0008 0.0050  -0.0053 172 ASP A CA  
461  C C   . ASP A 65  ? 0.2442 0.2391 0.2271 -0.0064 0.0047  -0.0046 172 ASP A C   
462  O O   . ASP A 65  ? 0.2450 0.2461 0.2185 0.0010  0.0018  -0.0079 172 ASP A O   
463  C CB  . ASP A 65  ? 0.2695 0.2596 0.2579 -0.0004 0.0063  -0.0040 172 ASP A CB  
464  C CG  . ASP A 65  ? 0.3162 0.3055 0.2865 0.0020  0.0043  -0.0150 172 ASP A CG  
465  O OD1 . ASP A 65  ? 0.3625 0.3236 0.3037 -0.0093 -0.0014 -0.0187 172 ASP A OD1 
466  O OD2 . ASP A 65  ? 0.3651 0.3918 0.3476 0.0059  0.0198  -0.0147 172 ASP A OD2 
467  N N   . LYS A 66  ? 0.2306 0.2263 0.2130 -0.0039 0.0090  -0.0026 173 LYS A N   
468  C CA  . LYS A 66  ? 0.2271 0.2298 0.2185 -0.0003 0.0086  -0.0059 173 LYS A CA  
469  C C   . LYS A 66  ? 0.2243 0.2240 0.2192 0.0007  0.0075  -0.0040 173 LYS A C   
470  O O   . LYS A 66  ? 0.2092 0.2233 0.2065 -0.0019 0.0215  -0.0167 173 LYS A O   
471  C CB  . LYS A 66  ? 0.2279 0.2290 0.2266 0.0022  0.0081  -0.0034 173 LYS A CB  
472  C CG  . LYS A 66  ? 0.2598 0.2594 0.2443 0.0064  0.0001  0.0004  173 LYS A CG  
473  C CD  . LYS A 66  ? 0.2888 0.2816 0.2870 -0.0051 0.0052  0.0013  173 LYS A CD  
474  C CE  . LYS A 66  ? 0.3176 0.3256 0.3165 0.0028  -0.0010 0.0019  173 LYS A CE  
475  N NZ  . LYS A 66  ? 0.3390 0.3471 0.3363 -0.0076 0.0021  -0.0105 173 LYS A NZ  
476  N N   . ALA A 67  ? 0.2200 0.2269 0.2227 -0.0032 0.0091  -0.0053 174 ALA A N   
477  C CA  . ALA A 67  ? 0.2263 0.2283 0.2258 -0.0027 0.0057  -0.0046 174 ALA A CA  
478  C C   . ALA A 67  ? 0.2304 0.2262 0.2332 0.0001  0.0114  -0.0088 174 ALA A C   
479  O O   . ALA A 67  ? 0.2535 0.2351 0.2143 -0.0099 0.0209  -0.0135 174 ALA A O   
480  C CB  . ALA A 67  ? 0.2259 0.2267 0.2325 -0.0029 0.0084  -0.0048 174 ALA A CB  
481  N N   . HIS A 68  ? 0.2546 0.2503 0.2500 0.0001  0.0119  -0.0104 175 HIS A N   
482  C CA  . HIS A 68  ? 0.2741 0.2732 0.2788 -0.0037 0.0039  -0.0072 175 HIS A CA  
483  C C   . HIS A 68  ? 0.2746 0.2713 0.2777 -0.0028 0.0026  -0.0054 175 HIS A C   
484  O O   . HIS A 68  ? 0.2643 0.2732 0.2836 0.0017  0.0049  -0.0061 175 HIS A O   
485  C CB  . HIS A 68  ? 0.2942 0.2967 0.2964 0.0015  0.0065  -0.0028 175 HIS A CB  
486  C CG  . HIS A 68  ? 0.3603 0.3592 0.3592 -0.0070 -0.0044 -0.0115 175 HIS A CG  
487  N ND1 . HIS A 68  ? 0.4323 0.4320 0.3951 -0.0086 0.0007  -0.0023 175 HIS A ND1 
488  C CD2 . HIS A 68  ? 0.4117 0.4229 0.4151 -0.0191 0.0051  0.0006  175 HIS A CD2 
489  C CE1 . HIS A 68  ? 0.4373 0.4392 0.4282 -0.0124 -0.0017 -0.0034 175 HIS A CE1 
490  N NE2 . HIS A 68  ? 0.4418 0.4567 0.4230 -0.0082 -0.0001 -0.0085 175 HIS A NE2 
491  N N   . LYS A 69  ? 0.2757 0.2734 0.2796 -0.0022 0.0040  -0.0081 176 LYS A N   
492  C CA  . LYS A 69  ? 0.2814 0.2784 0.2763 0.0000  0.0031  -0.0072 176 LYS A CA  
493  C C   . LYS A 69  ? 0.2750 0.2712 0.2687 -0.0002 0.0031  -0.0080 176 LYS A C   
494  O O   . LYS A 69  ? 0.2915 0.2771 0.2478 0.0029  0.0103  -0.0216 176 LYS A O   
495  C CB  . LYS A 69  ? 0.2836 0.2817 0.2830 -0.0023 0.0040  -0.0062 176 LYS A CB  
496  C CG  . LYS A 69  ? 0.3059 0.3152 0.3060 0.0033  0.0035  -0.0036 176 LYS A CG  
497  C CD  . LYS A 69  ? 0.3300 0.3245 0.3317 -0.0055 0.0066  -0.0003 176 LYS A CD  
498  C CE  . LYS A 69  ? 0.3434 0.3441 0.3427 0.0040  0.0025  -0.0032 176 LYS A CE  
499  N NZ  . LYS A 69  ? 0.3556 0.3518 0.3434 0.0081  -0.0011 -0.0043 176 LYS A NZ  
500  N N   . VAL A 70  ? 0.2648 0.2611 0.2581 0.0004  0.0076  -0.0099 177 VAL A N   
501  C CA  . VAL A 70  ? 0.2714 0.2697 0.2649 0.0026  0.0041  -0.0094 177 VAL A CA  
502  C C   . VAL A 70  ? 0.2833 0.2754 0.2753 -0.0020 0.0010  -0.0069 177 VAL A C   
503  O O   . VAL A 70  ? 0.2984 0.2993 0.2909 -0.0003 0.0119  -0.0104 177 VAL A O   
504  C CB  . VAL A 70  ? 0.2698 0.2645 0.2672 0.0021  0.0004  -0.0064 177 VAL A CB  
505  C CG1 . VAL A 70  ? 0.2735 0.2709 0.2640 0.0039  0.0060  -0.0092 177 VAL A CG1 
506  C CG2 . VAL A 70  ? 0.2751 0.2665 0.2717 0.0006  0.0042  -0.0082 177 VAL A CG2 
507  N N   . LEU A 71  ? 0.3000 0.2856 0.2871 -0.0021 0.0046  -0.0103 178 LEU A N   
508  C CA  . LEU A 71  ? 0.3116 0.3009 0.3044 -0.0024 0.0028  -0.0042 178 LEU A CA  
509  C C   . LEU A 71  ? 0.3340 0.3143 0.3239 -0.0016 0.0011  -0.0069 178 LEU A C   
510  O O   . LEU A 71  ? 0.3502 0.3194 0.3164 0.0017  0.0009  -0.0084 178 LEU A O   
511  C CB  . LEU A 71  ? 0.3150 0.3019 0.3085 -0.0028 0.0031  -0.0065 178 LEU A CB  
512  C CG  . LEU A 71  ? 0.3024 0.2937 0.3012 -0.0048 0.0000  -0.0042 178 LEU A CG  
513  C CD1 . LEU A 71  ? 0.2992 0.2709 0.2926 0.0009  0.0084  -0.0049 178 LEU A CD1 
514  C CD2 . LEU A 71  ? 0.3060 0.3031 0.3083 -0.0061 0.0063  0.0015  178 LEU A CD2 
515  N N   . LYS A 72  ? 0.3458 0.3352 0.3339 0.0002  0.0032  -0.0054 179 LYS A N   
516  C CA  . LYS A 72  ? 0.3690 0.3569 0.3614 -0.0011 0.0006  -0.0048 179 LYS A CA  
517  C C   . LYS A 72  ? 0.3688 0.3608 0.3627 0.0016  0.0005  -0.0031 179 LYS A C   
518  O O   . LYS A 72  ? 0.3767 0.3641 0.3843 0.0003  -0.0037 -0.0043 179 LYS A O   
519  C CB  . LYS A 72  ? 0.3798 0.3683 0.3628 -0.0018 -0.0010 -0.0047 179 LYS A CB  
520  C CG  . LYS A 72  ? 0.4003 0.4059 0.4142 0.0022  0.0028  -0.0060 179 LYS A CG  
521  C CD  . LYS A 72  ? 0.4614 0.4587 0.4449 -0.0014 -0.0031 0.0033  179 LYS A CD  
522  C CE  . LYS A 72  ? 0.4810 0.4756 0.4765 0.0012  -0.0010 -0.0054 179 LYS A CE  
523  N NZ  . LYS A 72  ? 0.4984 0.5072 0.4912 -0.0005 0.0010  0.0022  179 LYS A NZ  
524  N N   . GLN A 73  ? 0.3734 0.3641 0.3676 -0.0001 0.0015  -0.0056 180 GLN A N   
525  C CA  . GLN A 73  ? 0.3806 0.3770 0.3787 0.0006  0.0007  -0.0013 180 GLN A CA  
526  C C   . GLN A 73  ? 0.3823 0.3850 0.3834 0.0006  0.0005  -0.0015 180 GLN A C   
527  O O   . GLN A 73  ? 0.3802 0.3977 0.3972 0.0004  0.0022  0.0022  180 GLN A O   
528  C CB  . GLN A 73  ? 0.3789 0.3758 0.3757 -0.0007 0.0026  -0.0053 180 GLN A CB  
529  C CG  . GLN A 73  ? 0.3907 0.3852 0.3864 0.0037  -0.0029 -0.0024 180 GLN A CG  
533  N N   . ALA A 74  ? 0.3879 0.3864 0.3855 0.0014  0.0003  -0.0008 181 ALA A N   
534  C CA  . ALA A 74  ? 0.3863 0.3815 0.3872 0.0009  0.0004  0.0001  181 ALA A CA  
535  C C   . ALA A 74  ? 0.3867 0.3830 0.3919 0.0028  -0.0010 0.0002  181 ALA A C   
536  O O   . ALA A 74  ? 0.3818 0.3718 0.3883 0.0051  0.0037  -0.0024 181 ALA A O   
537  C CB  . ALA A 74  ? 0.3886 0.3817 0.3865 -0.0006 0.0011  0.0011  181 ALA A CB  
538  N N   . PHE A 75  ? 0.3897 0.3830 0.3962 0.0011  -0.0004 0.0009  182 PHE A N   
539  C CA  . PHE A 75  ? 0.3849 0.3780 0.3878 0.0009  0.0001  -0.0019 182 PHE A CA  
540  C C   . PHE A 75  ? 0.3805 0.3688 0.3802 -0.0017 0.0009  -0.0024 182 PHE A C   
541  O O   . PHE A 75  ? 0.3691 0.3453 0.3731 -0.0066 -0.0009 -0.0071 182 PHE A O   
542  C CB  . PHE A 75  ? 0.3875 0.3853 0.3922 -0.0012 -0.0015 -0.0020 182 PHE A CB  
549  N N   . GLY A 76  ? 0.3768 0.3709 0.3770 -0.0012 0.0029  -0.0026 183 GLY A N   
550  C CA  . GLY A 76  ? 0.3658 0.3689 0.3716 -0.0006 0.0022  0.0006  183 GLY A CA  
551  C C   . GLY A 76  ? 0.3586 0.3617 0.3616 0.0019  0.0042  0.0020  183 GLY A C   
552  O O   . GLY A 76  ? 0.3534 0.3590 0.3639 0.0058  0.0095  0.0075  183 GLY A O   
553  N N   . GLU A 77  ? 0.3435 0.3437 0.3446 0.0019  0.0026  0.0002  184 GLU A N   
554  C CA  . GLU A 77  ? 0.3377 0.3402 0.3388 0.0025  0.0038  -0.0021 184 GLU A CA  
555  C C   . GLU A 77  ? 0.3178 0.3235 0.3196 0.0006  0.0002  -0.0012 184 GLU A C   
556  O O   . GLU A 77  ? 0.3164 0.3287 0.3126 0.0111  0.0053  -0.0035 184 GLU A O   
557  C CB  . GLU A 77  ? 0.3419 0.3441 0.3478 0.0015  0.0023  0.0002  184 GLU A CB  
558  C CG  . GLU A 77  ? 0.3763 0.3769 0.3754 -0.0014 0.0019  -0.0083 184 GLU A CG  
559  C CD  . GLU A 77  ? 0.4140 0.4149 0.4039 0.0010  -0.0023 0.0045  184 GLU A CD  
560  O OE1 . GLU A 77  ? 0.4190 0.4417 0.4411 0.0067  0.0026  -0.0070 184 GLU A OE1 
561  O OE2 . GLU A 77  ? 0.4286 0.4344 0.4153 0.0008  0.0055  -0.0070 184 GLU A OE2 
562  N N   . LYS A 78  ? 0.3032 0.3073 0.3118 0.0045  0.0060  -0.0048 185 LYS A N   
563  C CA  . LYS A 78  ? 0.2848 0.2816 0.2988 -0.0008 0.0018  -0.0022 185 LYS A CA  
564  C C   . LYS A 78  ? 0.2702 0.2679 0.2910 0.0019  0.0061  -0.0034 185 LYS A C   
565  O O   . LYS A 78  ? 0.2761 0.2724 0.3207 0.0045  0.0114  -0.0143 185 LYS A O   
566  C CB  . LYS A 78  ? 0.2815 0.2847 0.2936 0.0003  0.0013  -0.0053 185 LYS A CB  
567  C CG  . LYS A 78  ? 0.2942 0.2931 0.3052 -0.0014 0.0015  -0.0001 185 LYS A CG  
568  C CD  . LYS A 78  ? 0.3402 0.3354 0.3339 0.0021  0.0006  0.0017  185 LYS A CD  
569  C CE  . LYS A 78  ? 0.3446 0.3453 0.3571 -0.0010 0.0013  0.0039  185 LYS A CE  
570  N NZ  . LYS A 78  ? 0.3641 0.3858 0.3761 0.0061  0.0003  0.0105  185 LYS A NZ  
571  N N   . ILE A 79  ? 0.2375 0.2382 0.2590 -0.0002 -0.0013 0.0029  186 ILE A N   
572  C CA  . ILE A 79  ? 0.2217 0.2244 0.2342 0.0008  0.0005  0.0036  186 ILE A CA  
573  C C   . ILE A 79  ? 0.2041 0.1963 0.2239 0.0032  -0.0027 0.0074  186 ILE A C   
574  O O   . ILE A 79  ? 0.1852 0.1733 0.2174 -0.0024 -0.0121 0.0180  186 ILE A O   
575  C CB  . ILE A 79  ? 0.2283 0.2184 0.2338 0.0002  0.0026  0.0045  186 ILE A CB  
576  C CG1 . ILE A 79  ? 0.2278 0.2301 0.2402 -0.0028 0.0027  0.0000  186 ILE A CG1 
577  C CG2 . ILE A 79  ? 0.2270 0.2275 0.2349 -0.0107 0.0036  0.0001  186 ILE A CG2 
578  C CD1 . ILE A 79  ? 0.2198 0.2229 0.2152 -0.0015 0.0069  0.0034  186 ILE A CD1 
579  N N   . THR A 80  ? 0.1836 0.1857 0.2055 0.0058  -0.0005 -0.0008 187 THR A N   
580  C CA  . THR A 80  ? 0.1867 0.1696 0.1998 0.0006  -0.0004 0.0065  187 THR A CA  
581  C C   . THR A 80  ? 0.1752 0.1625 0.1853 0.0059  -0.0001 0.0058  187 THR A C   
582  O O   . THR A 80  ? 0.1774 0.1554 0.1992 0.0028  0.0086  -0.0022 187 THR A O   
583  C CB  . THR A 80  ? 0.1868 0.1588 0.2025 0.0039  -0.0014 0.0021  187 THR A CB  
584  O OG1 . THR A 80  ? 0.2283 0.1784 0.2510 0.0107  -0.0172 0.0286  187 THR A OG1 
585  C CG2 . THR A 80  ? 0.1905 0.1822 0.2001 0.0004  -0.0036 0.0099  187 THR A CG2 
586  N N   . MET A 81  ? 0.1728 0.1596 0.1776 -0.0034 -0.0004 0.0075  188 MET A N   
587  C CA  . MET A 81  ? 0.1692 0.1614 0.1808 0.0005  -0.0040 0.0018  188 MET A CA  
588  C C   . MET A 81  ? 0.1591 0.1521 0.1653 0.0000  0.0012  0.0074  188 MET A C   
589  O O   . MET A 81  ? 0.1676 0.1374 0.1796 -0.0018 -0.0171 0.0136  188 MET A O   
590  C CB  . MET A 81  ? 0.1795 0.1693 0.1812 -0.0022 -0.0008 0.0086  188 MET A CB  
591  C CG  . MET A 81  ? 0.1832 0.2154 0.2086 -0.0033 -0.0022 -0.0010 188 MET A CG  
592  S SD  . MET A 81  ? 0.1838 0.2529 0.2349 0.0243  -0.0199 0.0027  188 MET A SD  
593  C CE  . MET A 81  ? 0.2446 0.2606 0.2625 -0.0091 0.0002  -0.0041 188 MET A CE  
594  N N   . THR A 82  ? 0.1315 0.1469 0.1450 -0.0016 -0.0024 0.0040  189 THR A N   
595  C CA  . THR A 82  ? 0.1397 0.1442 0.1519 -0.0024 -0.0036 0.0076  189 THR A CA  
596  C C   . THR A 82  ? 0.1364 0.1304 0.1384 -0.0028 -0.0007 0.0022  189 THR A C   
597  O O   . THR A 82  ? 0.1508 0.1357 0.1451 -0.0060 -0.0076 0.0068  189 THR A O   
598  C CB  . THR A 82  ? 0.1436 0.1485 0.1599 -0.0016 -0.0067 0.0037  189 THR A CB  
599  O OG1 . THR A 82  ? 0.1480 0.1797 0.1982 0.0013  -0.0120 0.0167  189 THR A OG1 
600  C CG2 . THR A 82  ? 0.1406 0.1523 0.1502 -0.0067 0.0034  0.0113  189 THR A CG2 
601  N N   . ILE A 83  ? 0.1301 0.1251 0.1292 -0.0048 -0.0012 0.0057  190 ILE A N   
602  C CA  . ILE A 83  ? 0.1360 0.1257 0.1263 -0.0009 0.0003  0.0019  190 ILE A CA  
603  C C   . ILE A 83  ? 0.1377 0.1298 0.1253 -0.0001 0.0032  0.0018  190 ILE A C   
604  O O   . ILE A 83  ? 0.1561 0.1385 0.1206 0.0003  0.0070  0.0043  190 ILE A O   
605  C CB  . ILE A 83  ? 0.1253 0.1228 0.1220 0.0017  -0.0045 0.0000  190 ILE A CB  
606  C CG1 . ILE A 83  ? 0.1404 0.1376 0.1335 -0.0017 -0.0069 -0.0057 190 ILE A CG1 
607  C CG2 . ILE A 83  ? 0.1374 0.1366 0.1518 0.0014  -0.0008 -0.0104 190 ILE A CG2 
608  C CD1 . ILE A 83  ? 0.1578 0.1457 0.1542 0.0060  0.0042  -0.0009 190 ILE A CD1 
609  N N   . ARG A 84  ? 0.1416 0.1256 0.1287 -0.0018 0.0088  0.0024  191 ARG A N   
610  C CA  . ARG A 84  ? 0.1330 0.1288 0.1302 -0.0008 0.0038  -0.0015 191 ARG A CA  
611  C C   . ARG A 84  ? 0.1323 0.1245 0.1335 -0.0018 0.0065  -0.0033 191 ARG A C   
612  O O   . ARG A 84  ? 0.0903 0.1348 0.1161 -0.0062 0.0127  -0.0056 191 ARG A O   
613  C CB  . ARG A 84  ? 0.1443 0.1279 0.1249 -0.0031 0.0070  -0.0006 191 ARG A CB  
614  C CG  . ARG A 84  ? 0.1431 0.1490 0.1515 0.0026  0.0048  -0.0007 191 ARG A CG  
615  C CD  . ARG A 84  ? 0.1683 0.1621 0.1575 -0.0064 -0.0015 -0.0070 191 ARG A CD  
616  N NE  . ARG A 84  ? 0.1730 0.1853 0.1778 0.0025  0.0091  -0.0155 191 ARG A NE  
617  C CZ  . ARG A 84  ? 0.1975 0.2078 0.2153 -0.0036 0.0027  -0.0054 191 ARG A CZ  
618  N NH1 . ARG A 84  ? 0.2263 0.2240 0.2404 -0.0228 0.0025  -0.0056 191 ARG A NH1 
619  N NH2 . ARG A 84  ? 0.2102 0.2144 0.2214 -0.0113 -0.0050 -0.0192 191 ARG A NH2 
620  N N   . ASP A 85  ? 0.1496 0.1302 0.1384 -0.0021 0.0100  -0.0053 192 ASP A N   
621  C CA  . ASP A 85  ? 0.1573 0.1563 0.1543 -0.0012 0.0047  -0.0032 192 ASP A CA  
622  C C   . ASP A 85  ? 0.1703 0.1616 0.1686 -0.0059 0.0058  -0.0068 192 ASP A C   
623  O O   . ASP A 85  ? 0.1853 0.1683 0.1677 -0.0086 0.0142  -0.0174 192 ASP A O   
624  C CB  . ASP A 85  ? 0.1823 0.1735 0.1624 -0.0052 0.0075  0.0014  192 ASP A CB  
625  C CG  . ASP A 85  ? 0.1929 0.1751 0.1791 0.0020  0.0101  -0.0062 192 ASP A CG  
626  O OD1 . ASP A 85  ? 0.1703 0.1816 0.1420 -0.0240 0.0068  -0.0045 192 ASP A OD1 
627  O OD2 . ASP A 85  ? 0.2580 0.2203 0.2112 -0.0034 0.0200  0.0000  192 ASP A OD2 
628  N N   . ARG A 86  ? 0.1737 0.1646 0.1718 0.0001  0.0010  -0.0016 193 ARG A N   
629  C CA  . ARG A 86  ? 0.1787 0.1759 0.1888 0.0001  0.0017  -0.0025 193 ARG A CA  
630  C C   . ARG A 86  ? 0.1762 0.1679 0.1839 0.0022  0.0078  -0.0033 193 ARG A C   
631  O O   . ARG A 86  ? 0.1933 0.1812 0.2088 -0.0052 0.0337  -0.0023 193 ARG A O   
632  C CB  . ARG A 86  ? 0.1826 0.1891 0.2047 0.0033  0.0044  0.0018  193 ARG A CB  
633  C CG  . ARG A 86  ? 0.2314 0.2225 0.2446 0.0029  -0.0057 -0.0062 193 ARG A CG  
634  C CD  . ARG A 86  ? 0.2574 0.2728 0.3049 0.0005  -0.0045 -0.0011 193 ARG A CD  
635  N NE  . ARG A 86  ? 0.3140 0.3170 0.3111 0.0109  0.0029  -0.0040 193 ARG A NE  
636  C CZ  . ARG A 86  ? 0.3551 0.3797 0.3783 -0.0016 0.0039  0.0009  193 ARG A CZ  
637  N NH1 . ARG A 86  ? 0.3757 0.3916 0.3869 0.0046  -0.0029 -0.0001 193 ARG A NH1 
638  N NH2 . ARG A 86  ? 0.3830 0.3979 0.3732 0.0095  0.0096  -0.0001 193 ARG A NH2 
639  N N   . PRO A 87  ? 0.1590 0.1562 0.1724 0.0022  0.0102  -0.0065 194 PRO A N   
640  C CA  . PRO A 87  ? 0.1684 0.1770 0.1788 -0.0012 0.0019  -0.0049 194 PRO A CA  
641  C C   . PRO A 87  ? 0.1794 0.1812 0.1943 0.0010  0.0034  -0.0040 194 PRO A C   
642  O O   . PRO A 87  ? 0.1724 0.1921 0.2138 -0.0069 -0.0011 -0.0168 194 PRO A O   
643  C CB  . PRO A 87  ? 0.1505 0.1548 0.1630 -0.0058 -0.0014 -0.0007 194 PRO A CB  
644  C CG  . PRO A 87  ? 0.1667 0.1781 0.1777 0.0004  0.0107  -0.0062 194 PRO A CG  
645  C CD  . PRO A 87  ? 0.1551 0.1644 0.1568 -0.0008 0.0035  -0.0051 194 PRO A CD  
646  N N   . PHE A 88  ? 0.1876 0.1981 0.2128 -0.0032 -0.0006 -0.0036 195 PHE A N   
647  C CA  . PHE A 88  ? 0.2087 0.2205 0.2315 0.0008  -0.0027 0.0021  195 PHE A CA  
648  C C   . PHE A 88  ? 0.2090 0.2302 0.2385 0.0013  0.0021  0.0038  195 PHE A C   
649  O O   . PHE A 88  ? 0.2299 0.2528 0.2376 0.0024  -0.0010 0.0074  195 PHE A O   
650  C CB  . PHE A 88  ? 0.2205 0.2217 0.2377 0.0014  0.0028  0.0049  195 PHE A CB  
651  C CG  . PHE A 88  ? 0.2354 0.2512 0.2670 -0.0008 0.0002  0.0079  195 PHE A CG  
652  C CD1 . PHE A 88  ? 0.2724 0.2906 0.2980 -0.0067 -0.0018 -0.0070 195 PHE A CD1 
653  C CD2 . PHE A 88  ? 0.2678 0.2757 0.2952 0.0018  0.0064  0.0046  195 PHE A CD2 
654  C CE1 . PHE A 88  ? 0.2910 0.3041 0.3115 -0.0069 0.0162  0.0014  195 PHE A CE1 
655  C CE2 . PHE A 88  ? 0.2850 0.3035 0.3126 -0.0019 0.0043  0.0063  195 PHE A CE2 
656  C CZ  . PHE A 88  ? 0.2823 0.2852 0.3055 -0.0003 0.0047  0.0026  195 PHE A CZ  
657  N N   . GLU A 89  ? 0.2053 0.2320 0.2434 0.0045  -0.0011 0.0101  196 GLU A N   
658  C CA  . GLU A 89  ? 0.2158 0.2374 0.2412 0.0063  0.0025  -0.0021 196 GLU A CA  
659  C C   . GLU A 89  ? 0.1980 0.2099 0.2188 0.0062  -0.0079 -0.0047 196 GLU A C   
660  O O   . GLU A 89  ? 0.1880 0.2215 0.2415 0.0101  -0.0196 -0.0148 196 GLU A O   
661  C CB  . GLU A 89  ? 0.2205 0.2401 0.2503 0.0096  0.0063  0.0004  196 GLU A CB  
662  C CG  . GLU A 89  ? 0.2919 0.2924 0.3061 -0.0048 -0.0002 0.0039  196 GLU A CG  
663  C CD  . GLU A 89  ? 0.3344 0.3325 0.3278 -0.0003 0.0117  -0.0046 196 GLU A CD  
664  O OE1 . GLU A 89  ? 0.3687 0.3768 0.3456 -0.0049 -0.0034 0.0089  196 GLU A OE1 
665  O OE2 . GLU A 89  ? 0.3508 0.3694 0.3832 0.0023  -0.0138 -0.0029 196 GLU A OE2 
666  N N   . ARG A 90  ? 0.1673 0.1837 0.1867 -0.0020 -0.0019 -0.0152 197 ARG A N   
667  C CA  . ARG A 90  ? 0.1512 0.1663 0.1637 -0.0043 -0.0005 -0.0053 197 ARG A CA  
668  C C   . ARG A 90  ? 0.1396 0.1546 0.1452 -0.0036 0.0044  -0.0043 197 ARG A C   
669  O O   . ARG A 90  ? 0.1302 0.1652 0.1353 -0.0041 0.0179  -0.0119 197 ARG A O   
670  C CB  . ARG A 90  ? 0.1610 0.1679 0.1514 -0.0010 -0.0010 -0.0106 197 ARG A CB  
671  C CG  . ARG A 90  ? 0.1480 0.1555 0.1601 0.0065  -0.0041 0.0051  197 ARG A CG  
672  C CD  . ARG A 90  ? 0.1661 0.1535 0.1605 -0.0038 -0.0079 -0.0016 197 ARG A CD  
673  N NE  . ARG A 90  ? 0.1689 0.1874 0.1695 -0.0142 -0.0104 0.0044  197 ARG A NE  
674  C CZ  . ARG A 90  ? 0.1785 0.1895 0.1919 -0.0032 -0.0010 -0.0032 197 ARG A CZ  
675  N NH1 . ARG A 90  ? 0.1782 0.1718 0.1731 0.0069  0.0051  0.0094  197 ARG A NH1 
676  N NH2 . ARG A 90  ? 0.1815 0.2125 0.2084 -0.0051 -0.0293 -0.0047 197 ARG A NH2 
677  N N   . THR A 91  ? 0.1283 0.1329 0.1228 -0.0048 -0.0050 -0.0067 198 THR A N   
678  C CA  . THR A 91  ? 0.1222 0.1226 0.1160 0.0036  0.0008  -0.0002 198 THR A CA  
679  C C   . THR A 91  ? 0.1146 0.1162 0.1117 0.0035  -0.0056 0.0010  198 THR A C   
680  O O   . THR A 91  ? 0.1131 0.1332 0.1267 0.0064  -0.0148 -0.0086 198 THR A O   
681  C CB  . THR A 91  ? 0.1394 0.1290 0.1346 -0.0004 0.0020  0.0011  198 THR A CB  
682  O OG1 . THR A 91  ? 0.1242 0.1316 0.1542 0.0052  -0.0108 -0.0041 198 THR A OG1 
683  C CG2 . THR A 91  ? 0.1418 0.1425 0.1477 -0.0006 -0.0074 -0.0001 198 THR A CG2 
684  N N   . ILE A 92  ? 0.0940 0.0988 0.1012 -0.0044 -0.0059 -0.0076 199 ILE A N   
685  C CA  . ILE A 92  ? 0.0986 0.1001 0.0969 -0.0013 -0.0040 0.0027  199 ILE A CA  
686  C C   . ILE A 92  ? 0.1024 0.1105 0.1010 0.0026  -0.0033 0.0037  199 ILE A C   
687  O O   . ILE A 92  ? 0.1125 0.1188 0.1025 -0.0101 0.0031  -0.0139 199 ILE A O   
688  C CB  . ILE A 92  ? 0.0973 0.0830 0.0966 -0.0006 -0.0007 0.0022  199 ILE A CB  
689  C CG1 . ILE A 92  ? 0.0873 0.0909 0.0954 0.0118  0.0006  -0.0018 199 ILE A CG1 
690  C CG2 . ILE A 92  ? 0.0931 0.1150 0.1198 0.0030  0.0034  0.0108  199 ILE A CG2 
691  C CD1 . ILE A 92  ? 0.1033 0.1030 0.1101 -0.0072 0.0013  0.0035  199 ILE A CD1 
692  N N   . THR A 93  ? 0.1126 0.1180 0.1051 0.0012  0.0002  -0.0052 200 THR A N   
693  C CA  . THR A 93  ? 0.1220 0.1251 0.1150 0.0021  -0.0004 0.0004  200 THR A CA  
694  C C   . THR A 93  ? 0.1084 0.1212 0.1161 -0.0009 0.0005  -0.0029 200 THR A C   
695  O O   . THR A 93  ? 0.1017 0.1257 0.1245 0.0003  -0.0041 -0.0056 200 THR A O   
696  C CB  . THR A 93  ? 0.1252 0.1271 0.1155 0.0035  0.0022  0.0026  200 THR A CB  
697  O OG1 . THR A 93  ? 0.1393 0.1215 0.1153 0.0032  0.0024  0.0214  200 THR A OG1 
698  C CG2 . THR A 93  ? 0.1359 0.1278 0.1038 -0.0076 0.0004  -0.0028 200 THR A CG2 
699  N N   . MET A 94  ? 0.1098 0.1052 0.1045 0.0007  -0.0009 -0.0030 201 MET A N   
700  C CA  . MET A 94  ? 0.1041 0.1018 0.1024 -0.0054 0.0000  -0.0038 201 MET A CA  
701  C C   . MET A 94  ? 0.1052 0.1074 0.1000 -0.0050 0.0023  -0.0062 201 MET A C   
702  O O   . MET A 94  ? 0.0885 0.1020 0.0849 -0.0137 -0.0058 -0.0039 201 MET A O   
703  C CB  . MET A 94  ? 0.0999 0.0903 0.0954 0.0021  -0.0003 0.0005  201 MET A CB  
704  C CG  . MET A 94  ? 0.0941 0.1073 0.0957 -0.0024 -0.0106 0.0085  201 MET A CG  
705  S SD  . MET A 94  ? 0.1682 0.1052 0.1451 0.0217  0.0521  0.0204  201 MET A SD  
706  C CE  . MET A 94  ? 0.1790 0.1300 0.1756 0.0094  0.0247  -0.0003 201 MET A CE  
707  N N   . HIS A 95  ? 0.1137 0.1130 0.1087 -0.0056 -0.0032 -0.0043 202 HIS A N   
708  C CA  . HIS A 95  ? 0.1264 0.1319 0.1400 -0.0073 -0.0049 -0.0038 202 HIS A CA  
709  C C   . HIS A 95  ? 0.1172 0.1184 0.1336 -0.0049 -0.0020 -0.0020 202 HIS A C   
710  O O   . HIS A 95  ? 0.1082 0.1142 0.1359 -0.0007 -0.0231 -0.0062 202 HIS A O   
711  C CB  . HIS A 95  ? 0.1463 0.1729 0.1629 -0.0025 0.0030  0.0041  202 HIS A CB  
712  C CG  . HIS A 95  ? 0.2605 0.2689 0.2376 0.0011  -0.0087 0.0056  202 HIS A CG  
713  N ND1 . HIS A 95  ? 0.3059 0.3474 0.3323 -0.0086 -0.0144 -0.0019 202 HIS A ND1 
714  C CD2 . HIS A 95  ? 0.3224 0.3099 0.3130 -0.0084 -0.0018 0.0187  202 HIS A CD2 
715  C CE1 . HIS A 95  ? 0.3487 0.3378 0.3540 -0.0065 -0.0184 0.0107  202 HIS A CE1 
716  N NE2 . HIS A 95  ? 0.3292 0.3937 0.3530 -0.0056 -0.0100 0.0195  202 HIS A NE2 
717  N N   . LYS A 96  ? 0.1156 0.1207 0.1307 -0.0079 -0.0044 0.0031  203 LYS A N   
718  C CA  . LYS A 96  ? 0.1269 0.1276 0.1290 -0.0022 0.0005  0.0023  203 LYS A CA  
719  C C   . LYS A 96  ? 0.1462 0.1564 0.1540 -0.0057 0.0034  -0.0074 203 LYS A C   
720  O O   . LYS A 96  ? 0.1365 0.1468 0.1577 -0.0031 0.0045  -0.0107 203 LYS A O   
721  C CB  . LYS A 96  ? 0.1001 0.1296 0.1234 -0.0047 -0.0014 0.0006  203 LYS A CB  
722  C CG  . LYS A 96  ? 0.0981 0.0975 0.0932 -0.0012 -0.0029 0.0012  203 LYS A CG  
723  C CD  . LYS A 96  ? 0.0909 0.1168 0.1155 -0.0027 -0.0041 0.0040  203 LYS A CD  
724  C CE  . LYS A 96  ? 0.1167 0.1080 0.1062 -0.0087 -0.0098 -0.0109 203 LYS A CE  
725  N NZ  . LYS A 96  ? 0.0773 0.1040 0.0910 -0.0175 -0.0308 -0.0140 203 LYS A NZ  
726  N N   . ASP A 97  ? 0.1760 0.1807 0.1926 -0.0076 -0.0002 -0.0012 204 ASP A N   
727  C CA  . ASP A 97  ? 0.2244 0.2311 0.2451 0.0012  0.0006  -0.0044 204 ASP A CA  
728  C C   . ASP A 97  ? 0.2501 0.2710 0.2929 -0.0024 -0.0029 -0.0089 204 ASP A C   
729  O O   . ASP A 97  ? 0.2286 0.2904 0.3098 0.0020  -0.0117 -0.0224 204 ASP A O   
730  C CB  . ASP A 97  ? 0.2416 0.2397 0.2695 0.0039  -0.0003 -0.0018 204 ASP A CB  
731  C CG  . ASP A 97  ? 0.2724 0.2792 0.2737 0.0042  -0.0011 0.0022  204 ASP A CG  
732  O OD1 . ASP A 97  ? 0.3470 0.3184 0.3549 -0.0079 -0.0185 -0.0044 204 ASP A OD1 
733  O OD2 . ASP A 97  ? 0.3271 0.3029 0.3674 -0.0127 -0.0099 0.0110  204 ASP A OD2 
734  N N   . SER A 98  ? 0.2910 0.3105 0.3186 0.0027  0.0006  -0.0108 205 SER A N   
735  C CA  . SER A 98  ? 0.3219 0.3360 0.3411 -0.0026 0.0023  -0.0030 205 SER A CA  
736  C C   . SER A 98  ? 0.3345 0.3436 0.3398 -0.0032 -0.0006 -0.0012 205 SER A C   
737  O O   . SER A 98  ? 0.3527 0.3620 0.3635 -0.0089 0.0068  0.0035  205 SER A O   
738  C CB  . SER A 98  ? 0.3259 0.3406 0.3449 0.0004  0.0030  -0.0067 205 SER A CB  
739  O OG  . SER A 98  ? 0.3576 0.3814 0.3964 0.0049  -0.0001 0.0097  205 SER A OG  
740  N N   . THR A 99  ? 0.3295 0.3422 0.3414 0.0000  0.0019  -0.0007 206 THR A N   
741  C CA  . THR A 99  ? 0.3300 0.3327 0.3315 0.0034  -0.0012 -0.0007 206 THR A CA  
742  C C   . THR A 99  ? 0.3094 0.3228 0.3125 0.0041  -0.0053 0.0048  206 THR A C   
743  O O   . THR A 99  ? 0.3196 0.3431 0.3071 0.0066  -0.0088 0.0054  206 THR A O   
744  C CB  . THR A 99  ? 0.3325 0.3374 0.3397 0.0036  0.0003  0.0022  206 THR A CB  
745  O OG1 . THR A 99  ? 0.3774 0.3468 0.3865 -0.0005 -0.0024 -0.0060 206 THR A OG1 
746  C CG2 . THR A 99  ? 0.3384 0.3362 0.3416 0.0021  0.0028  -0.0003 206 THR A CG2 
747  N N   . GLY A 100 ? 0.2850 0.2993 0.2980 0.0010  -0.0059 -0.0040 207 GLY A N   
748  C CA  . GLY A 100 ? 0.2562 0.2710 0.2631 -0.0032 -0.0057 -0.0016 207 GLY A CA  
749  C C   . GLY A 100 ? 0.2384 0.2432 0.2379 -0.0017 -0.0072 0.0048  207 GLY A C   
750  O O   . GLY A 100 ? 0.2078 0.2480 0.2248 -0.0104 -0.0111 0.0055  207 GLY A O   
751  N N   . HIS A 101 ? 0.2133 0.2435 0.2322 0.0035  -0.0145 0.0003  208 HIS A N   
752  C CA  . HIS A 101 ? 0.2229 0.2334 0.2241 -0.0059 -0.0072 -0.0004 208 HIS A CA  
753  C C   . HIS A 101 ? 0.1874 0.2016 0.1968 0.0025  -0.0100 0.0053  208 HIS A C   
754  O O   . HIS A 101 ? 0.1104 0.1754 0.1591 -0.0025 -0.0263 0.0088  208 HIS A O   
755  C CB  . HIS A 101 ? 0.2345 0.2492 0.2457 0.0042  -0.0108 0.0041  208 HIS A CB  
756  C CG  . HIS A 101 ? 0.2971 0.3252 0.2866 0.0023  -0.0152 -0.0087 208 HIS A CG  
757  N ND1 . HIS A 101 ? 0.3745 0.3656 0.3619 0.0129  -0.0213 0.0096  208 HIS A ND1 
758  C CD2 . HIS A 101 ? 0.3339 0.3335 0.3391 -0.0014 -0.0116 -0.0049 208 HIS A CD2 
759  C CE1 . HIS A 101 ? 0.3736 0.3756 0.3685 0.0012  -0.0171 -0.0048 208 HIS A CE1 
760  N NE2 . HIS A 101 ? 0.3510 0.3687 0.3478 0.0022  -0.0183 -0.0015 208 HIS A NE2 
761  N N   . VAL A 102 ? 0.1980 0.1886 0.1861 -0.0098 0.0065  0.0023  209 VAL A N   
762  C CA  . VAL A 102 ? 0.1912 0.1991 0.1873 -0.0021 -0.0012 0.0060  209 VAL A CA  
763  C C   . VAL A 102 ? 0.1672 0.1715 0.1560 -0.0062 -0.0011 0.0005  209 VAL A C   
764  O O   . VAL A 102 ? 0.1448 0.2110 0.1492 -0.0099 -0.0158 0.0104  209 VAL A O   
765  C CB  . VAL A 102 ? 0.2213 0.2050 0.2174 -0.0001 0.0051  0.0019  209 VAL A CB  
766  C CG1 . VAL A 102 ? 0.2317 0.2337 0.2295 -0.0030 -0.0056 0.0110  209 VAL A CG1 
767  C CG2 . VAL A 102 ? 0.2466 0.2316 0.2367 0.0026  0.0090  -0.0098 209 VAL A CG2 
768  N N   . GLY A 103 ? 0.1397 0.1382 0.1338 -0.0045 -0.0053 -0.0004 210 GLY A N   
769  C CA  . GLY A 103 ? 0.1236 0.1293 0.1213 -0.0029 0.0003  0.0018  210 GLY A CA  
770  C C   . GLY A 103 ? 0.1208 0.1229 0.1229 0.0052  -0.0010 0.0011  210 GLY A C   
771  O O   . GLY A 103 ? 0.1016 0.1190 0.1247 0.0019  0.0075  0.0116  210 GLY A O   
772  N N   . PHE A 104 ? 0.1201 0.1170 0.1120 0.0020  -0.0067 0.0033  211 PHE A N   
773  C CA  . PHE A 104 ? 0.1203 0.1131 0.1224 0.0034  -0.0009 0.0004  211 PHE A CA  
774  C C   . PHE A 104 ? 0.1349 0.1282 0.1280 -0.0002 -0.0039 0.0055  211 PHE A C   
775  O O   . PHE A 104 ? 0.1368 0.1415 0.1352 -0.0041 -0.0067 0.0038  211 PHE A O   
776  C CB  . PHE A 104 ? 0.1133 0.1151 0.1172 -0.0009 -0.0015 0.0033  211 PHE A CB  
777  C CG  . PHE A 104 ? 0.0963 0.1100 0.1079 0.0035  -0.0042 -0.0029 211 PHE A CG  
778  C CD1 . PHE A 104 ? 0.0872 0.1045 0.1005 -0.0072 0.0028  -0.0110 211 PHE A CD1 
779  C CD2 . PHE A 104 ? 0.1327 0.1210 0.0956 -0.0087 -0.0167 -0.0031 211 PHE A CD2 
780  C CE1 . PHE A 104 ? 0.1174 0.1165 0.1191 0.0033  0.0009  -0.0029 211 PHE A CE1 
781  C CE2 . PHE A 104 ? 0.1060 0.1150 0.1162 0.0015  -0.0096 -0.0063 211 PHE A CE2 
782  C CZ  . PHE A 104 ? 0.1008 0.1074 0.1109 0.0199  -0.0039 0.0042  211 PHE A CZ  
783  N N   . ILE A 105 ? 0.1295 0.1270 0.1418 0.0034  0.0040  0.0024  212 ILE A N   
784  C CA  . ILE A 105 ? 0.1415 0.1369 0.1350 0.0043  -0.0048 0.0072  212 ILE A CA  
785  C C   . ILE A 105 ? 0.1365 0.1269 0.1200 -0.0038 0.0015  0.0045  212 ILE A C   
786  O O   . ILE A 105 ? 0.1312 0.1110 0.1059 -0.0061 -0.0012 0.0007  212 ILE A O   
787  C CB  . ILE A 105 ? 0.1703 0.1468 0.1580 -0.0001 0.0027  0.0094  212 ILE A CB  
788  C CG1 . ILE A 105 ? 0.1862 0.1865 0.1942 0.0050  -0.0082 0.0086  212 ILE A CG1 
789  C CG2 . ILE A 105 ? 0.1648 0.1633 0.1599 0.0104  -0.0124 0.0103  212 ILE A CG2 
790  C CD1 . ILE A 105 ? 0.2688 0.2420 0.2451 0.0119  -0.0075 0.0183  212 ILE A CD1 
791  N N   . PHE A 106 ? 0.1392 0.1276 0.1310 -0.0044 -0.0053 0.0008  213 PHE A N   
792  C CA  . PHE A 106 ? 0.1430 0.1352 0.1300 -0.0022 -0.0001 -0.0008 213 PHE A CA  
793  C C   . PHE A 106 ? 0.1573 0.1533 0.1432 -0.0041 -0.0053 0.0001  213 PHE A C   
794  O O   . PHE A 106 ? 0.1547 0.1691 0.1167 0.0010  -0.0119 -0.0022 213 PHE A O   
795  C CB  . PHE A 106 ? 0.1434 0.1270 0.1272 -0.0049 0.0001  0.0008  213 PHE A CB  
796  C CG  . PHE A 106 ? 0.1317 0.1284 0.1235 0.0004  0.0012  -0.0049 213 PHE A CG  
797  C CD1 . PHE A 106 ? 0.1482 0.1177 0.1158 -0.0057 -0.0009 -0.0065 213 PHE A CD1 
798  C CD2 . PHE A 106 ? 0.1212 0.1123 0.0835 -0.0043 -0.0065 -0.0112 213 PHE A CD2 
799  C CE1 . PHE A 106 ? 0.1305 0.1265 0.1192 -0.0092 0.0055  0.0002  213 PHE A CE1 
800  C CE2 . PHE A 106 ? 0.1249 0.1172 0.1342 -0.0017 -0.0031 0.0058  213 PHE A CE2 
801  C CZ  . PHE A 106 ? 0.1192 0.1137 0.0997 -0.0051 -0.0189 -0.0014 213 PHE A CZ  
802  N N   . LYS A 107 ? 0.1572 0.1571 0.1426 -0.0030 0.0014  0.0022  214 LYS A N   
803  C CA  . LYS A 107 ? 0.1817 0.1723 0.1610 -0.0044 0.0016  0.0016  214 LYS A CA  
804  C C   . LYS A 107 ? 0.1695 0.1580 0.1404 -0.0057 0.0036  0.0075  214 LYS A C   
805  O O   . LYS A 107 ? 0.1740 0.1552 0.1169 -0.0049 0.0126  0.0082  214 LYS A O   
806  C CB  . LYS A 107 ? 0.2002 0.1879 0.1787 0.0041  -0.0016 0.0073  214 LYS A CB  
807  C CG  . LYS A 107 ? 0.2583 0.2441 0.2305 0.0020  -0.0064 -0.0096 214 LYS A CG  
808  C CD  . LYS A 107 ? 0.3060 0.2981 0.2855 0.0027  -0.0032 0.0085  214 LYS A CD  
809  C CE  . LYS A 107 ? 0.3439 0.3426 0.3215 -0.0018 -0.0051 -0.0088 214 LYS A CE  
810  N NZ  . LYS A 107 ? 0.3557 0.3644 0.3454 -0.0062 -0.0020 -0.0045 214 LYS A NZ  
811  N N   . ASN A 108 ? 0.1692 0.1694 0.1381 -0.0040 0.0019  0.0008  215 ASN A N   
812  C CA  . ASN A 108 ? 0.1741 0.1777 0.1580 -0.0036 0.0011  -0.0004 215 ASN A CA  
813  C C   . ASN A 108 ? 0.1525 0.1707 0.1499 -0.0051 0.0034  -0.0040 215 ASN A C   
814  O O   . ASN A 108 ? 0.1468 0.1894 0.1411 -0.0050 0.0143  -0.0183 215 ASN A O   
815  C CB  . ASN A 108 ? 0.1907 0.1868 0.1805 -0.0066 0.0050  0.0062  215 ASN A CB  
816  C CG  . ASN A 108 ? 0.2486 0.2554 0.2179 -0.0025 -0.0025 0.0013  215 ASN A CG  
817  O OD1 . ASN A 108 ? 0.3217 0.3075 0.3007 -0.0176 -0.0091 -0.0149 215 ASN A OD1 
818  N ND2 . ASN A 108 ? 0.3281 0.2770 0.2789 0.0028  -0.0030 0.0061  215 ASN A ND2 
819  N N   . GLY A 109 ? 0.1405 0.1464 0.1301 -0.0047 0.0051  -0.0048 216 GLY A N   
820  C CA  . GLY A 109 ? 0.1376 0.1469 0.1369 -0.0025 0.0013  -0.0044 216 GLY A CA  
821  C C   . GLY A 109 ? 0.1427 0.1373 0.1377 -0.0033 -0.0027 -0.0021 216 GLY A C   
822  O O   . GLY A 109 ? 0.1379 0.1589 0.1383 -0.0074 -0.0045 -0.0075 216 GLY A O   
823  N N   . LYS A 110 ? 0.1457 0.1466 0.1324 -0.0004 -0.0107 -0.0017 217 LYS A N   
824  C CA  . LYS A 110 ? 0.1378 0.1347 0.1382 -0.0017 -0.0014 0.0008  217 LYS A CA  
825  C C   . LYS A 110 ? 0.1286 0.1323 0.1266 -0.0041 -0.0032 0.0012  217 LYS A C   
826  O O   . LYS A 110 ? 0.1214 0.1420 0.1383 -0.0033 -0.0064 0.0104  217 LYS A O   
827  C CB  . LYS A 110 ? 0.1526 0.1526 0.1359 0.0006  0.0027  0.0056  217 LYS A CB  
828  C CG  . LYS A 110 ? 0.2003 0.1830 0.1984 0.0003  -0.0070 -0.0037 217 LYS A CG  
829  C CD  . LYS A 110 ? 0.2528 0.2617 0.2603 -0.0073 0.0104  0.0016  217 LYS A CD  
830  C CE  . LYS A 110 ? 0.3072 0.3011 0.2990 -0.0001 -0.0046 0.0109  217 LYS A CE  
831  N NZ  . LYS A 110 ? 0.3388 0.3349 0.3217 -0.0020 0.0113  -0.0020 217 LYS A NZ  
832  N N   . ILE A 111 ? 0.1153 0.1192 0.1107 0.0017  0.0063  -0.0015 218 ILE A N   
833  C CA  . ILE A 111 ? 0.1095 0.1036 0.1048 -0.0016 -0.0034 -0.0029 218 ILE A CA  
834  C C   . ILE A 111 ? 0.1186 0.1167 0.1064 -0.0027 0.0021  -0.0030 218 ILE A C   
835  O O   . ILE A 111 ? 0.1292 0.1071 0.1173 -0.0153 0.0112  -0.0072 218 ILE A O   
836  C CB  . ILE A 111 ? 0.0875 0.0968 0.0944 -0.0022 0.0054  0.0017  218 ILE A CB  
837  C CG1 . ILE A 111 ? 0.1048 0.1019 0.0997 0.0050  0.0000  0.0014  218 ILE A CG1 
838  C CG2 . ILE A 111 ? 0.1033 0.0932 0.0946 0.0003  -0.0085 0.0015  218 ILE A CG2 
839  C CD1 . ILE A 111 ? 0.0936 0.1095 0.0814 -0.0067 0.0134  -0.0088 218 ILE A CD1 
840  N N   . THR A 112 ? 0.1374 0.1253 0.1301 0.0004  0.0006  -0.0015 219 THR A N   
841  C CA  . THR A 112 ? 0.1523 0.1378 0.1400 -0.0047 -0.0007 0.0036  219 THR A CA  
842  C C   . THR A 112 ? 0.1496 0.1410 0.1452 -0.0038 0.0049  0.0037  219 THR A C   
843  O O   . THR A 112 ? 0.1814 0.1385 0.1714 -0.0031 0.0176  0.0111  219 THR A O   
844  C CB  . THR A 112 ? 0.1586 0.1489 0.1444 -0.0008 0.0016  0.0053  219 THR A CB  
845  O OG1 . THR A 112 ? 0.1855 0.1560 0.1509 -0.0208 -0.0160 0.0113  219 THR A OG1 
846  C CG2 . THR A 112 ? 0.1850 0.1687 0.1668 -0.0006 0.0057  0.0021  219 THR A CG2 
847  N N   . SER A 113 ? 0.1492 0.1369 0.1408 -0.0046 0.0016  0.0035  220 SER A N   
848  C CA  . SER A 113 ? 0.1457 0.1399 0.1358 -0.0019 0.0047  0.0023  220 SER A CA  
849  C C   . SER A 113 ? 0.1467 0.1283 0.1292 -0.0027 0.0058  0.0045  220 SER A C   
850  O O   . SER A 113 ? 0.1565 0.1250 0.1325 -0.0041 0.0087  0.0073  220 SER A O   
851  C CB  . SER A 113 ? 0.1582 0.1393 0.1532 0.0006  0.0057  -0.0003 220 SER A CB  
852  O OG  . SER A 113 ? 0.1667 0.1972 0.1751 -0.0052 -0.0162 -0.0007 220 SER A OG  
853  N N   . ILE A 114 ? 0.1463 0.1273 0.1247 -0.0006 0.0066  0.0068  221 ILE A N   
854  C CA  . ILE A 114 ? 0.1397 0.1264 0.1308 -0.0024 0.0075  0.0047  221 ILE A CA  
855  C C   . ILE A 114 ? 0.1436 0.1315 0.1484 -0.0004 0.0040  0.0040  221 ILE A C   
856  O O   . ILE A 114 ? 0.1600 0.1120 0.1716 -0.0051 0.0087  0.0078  221 ILE A O   
857  C CB  . ILE A 114 ? 0.1300 0.1412 0.1293 -0.0036 0.0034  0.0065  221 ILE A CB  
858  C CG1 . ILE A 114 ? 0.1417 0.1420 0.1217 0.0083  0.0097  -0.0019 221 ILE A CG1 
859  C CG2 . ILE A 114 ? 0.1278 0.1446 0.1153 0.0037  0.0039  0.0015  221 ILE A CG2 
860  C CD1 . ILE A 114 ? 0.1689 0.1507 0.1429 -0.0039 0.0197  0.0003  221 ILE A CD1 
861  N N   . VAL A 115 ? 0.1530 0.1289 0.1503 -0.0002 0.0076  0.0041  222 VAL A N   
862  C CA  . VAL A 115 ? 0.1502 0.1468 0.1537 0.0046  0.0007  0.0043  222 VAL A CA  
863  C C   . VAL A 115 ? 0.1449 0.1413 0.1473 0.0001  -0.0014 0.0019  222 VAL A C   
864  O O   . VAL A 115 ? 0.1242 0.1101 0.1439 -0.0031 0.0011  0.0108  222 VAL A O   
865  C CB  . VAL A 115 ? 0.1562 0.1544 0.1557 0.0043  -0.0022 -0.0031 222 VAL A CB  
866  C CG1 . VAL A 115 ? 0.1744 0.1875 0.1882 0.0089  -0.0078 -0.0108 222 VAL A CG1 
867  C CG2 . VAL A 115 ? 0.1622 0.1657 0.1632 0.0003  -0.0008 -0.0043 222 VAL A CG2 
868  N N   . LYS A 116 ? 0.1664 0.1533 0.1528 0.0075  0.0010  0.0079  223 LYS A N   
869  C CA  . LYS A 116 ? 0.1895 0.1721 0.1801 0.0033  -0.0028 -0.0014 223 LYS A CA  
870  C C   . LYS A 116 ? 0.1929 0.1682 0.1789 0.0044  0.0015  0.0035  223 LYS A C   
871  O O   . LYS A 116 ? 0.1875 0.1813 0.1673 0.0158  0.0021  0.0178  223 LYS A O   
872  C CB  . LYS A 116 ? 0.2074 0.1801 0.1850 0.0069  -0.0017 0.0060  223 LYS A CB  
873  C CG  . LYS A 116 ? 0.2639 0.2426 0.2403 0.0012  0.0017  -0.0157 223 LYS A CG  
874  C CD  . LYS A 116 ? 0.3009 0.2820 0.2887 0.0064  -0.0039 0.0077  223 LYS A CD  
875  C CE  . LYS A 116 ? 0.3204 0.3199 0.3210 0.0087  0.0039  -0.0050 223 LYS A CE  
876  N NZ  . LYS A 116 ? 0.3465 0.3397 0.3538 0.0005  0.0017  -0.0013 223 LYS A NZ  
877  N N   . ASP A 117 ? 0.2193 0.1899 0.2131 0.0030  -0.0004 0.0039  224 ASP A N   
878  C CA  . ASP A 117 ? 0.2230 0.2111 0.2219 -0.0001 0.0052  0.0010  224 ASP A CA  
879  C C   . ASP A 117 ? 0.2021 0.1965 0.2135 0.0044  0.0058  0.0000  224 ASP A C   
880  O O   . ASP A 117 ? 0.2110 0.1970 0.2218 -0.0012 0.0060  0.0052  224 ASP A O   
881  C CB  . ASP A 117 ? 0.2386 0.2430 0.2412 0.0032  0.0013  0.0012  224 ASP A CB  
882  C CG  . ASP A 117 ? 0.3065 0.2753 0.3047 -0.0019 0.0091  -0.0009 224 ASP A CG  
883  O OD1 . ASP A 117 ? 0.3806 0.3767 0.3395 -0.0005 -0.0217 -0.0124 224 ASP A OD1 
884  O OD2 . ASP A 117 ? 0.3205 0.3440 0.3613 0.0195  -0.0090 -0.0035 224 ASP A OD2 
885  N N   . SER A 118 ? 0.1664 0.1636 0.1731 0.0050  -0.0022 -0.0012 225 SER A N   
886  C CA  . SER A 118 ? 0.1385 0.1432 0.1434 0.0004  -0.0048 0.0020  225 SER A CA  
887  C C   . SER A 118 ? 0.1406 0.1298 0.1330 -0.0012 -0.0034 0.0033  225 SER A C   
888  O O   . SER A 118 ? 0.1308 0.1318 0.1313 0.0071  -0.0156 0.0098  225 SER A O   
889  C CB  . SER A 118 ? 0.1330 0.1386 0.1411 0.0023  0.0033  -0.0027 225 SER A CB  
890  O OG  . SER A 118 ? 0.1230 0.1146 0.1112 0.0100  -0.0177 0.0017  225 SER A OG  
891  N N   . SER A 119 ? 0.1218 0.1189 0.1178 0.0037  -0.0013 0.0018  226 SER A N   
892  C CA  . SER A 119 ? 0.0994 0.1050 0.1121 0.0039  0.0008  0.0020  226 SER A CA  
893  C C   . SER A 119 ? 0.1012 0.1021 0.1055 0.0043  0.0028  0.0009  226 SER A C   
894  O O   . SER A 119 ? 0.0867 0.1018 0.0936 0.0121  0.0047  0.0061  226 SER A O   
895  C CB  . SER A 119 ? 0.0927 0.1108 0.1227 0.0099  0.0040  -0.0012 226 SER A CB  
896  O OG  . SER A 119 ? 0.1081 0.0965 0.0964 -0.0070 0.0031  0.0082  226 SER A OG  
897  N N   . ALA A 120 ? 0.0911 0.1003 0.0967 0.0028  -0.0088 -0.0001 227 ALA A N   
898  C CA  . ALA A 120 ? 0.0877 0.0922 0.0938 0.0006  -0.0039 -0.0036 227 ALA A CA  
899  C C   . ALA A 120 ? 0.0921 0.0949 0.0955 0.0004  -0.0056 -0.0016 227 ALA A C   
900  O O   . ALA A 120 ? 0.0858 0.0998 0.0886 0.0033  -0.0167 -0.0060 227 ALA A O   
901  C CB  . ALA A 120 ? 0.0931 0.1035 0.1006 -0.0021 0.0013  0.0053  227 ALA A CB  
902  N N   . ALA A 121 ? 0.0951 0.0969 0.0936 0.0030  -0.0072 -0.0076 228 ALA A N   
903  C CA  . ALA A 121 ? 0.0867 0.0960 0.0943 -0.0032 -0.0010 -0.0036 228 ALA A CA  
904  C C   . ALA A 121 ? 0.0944 0.1026 0.0957 -0.0022 -0.0078 0.0026  228 ALA A C   
905  O O   . ALA A 121 ? 0.0904 0.1222 0.0963 0.0004  -0.0165 0.0129  228 ALA A O   
906  C CB  . ALA A 121 ? 0.0956 0.1047 0.0833 -0.0103 -0.0119 -0.0042 228 ALA A CB  
907  N N   . ARG A 122 ? 0.0926 0.1043 0.0990 0.0057  -0.0033 0.0031  229 ARG A N   
908  C CA  . ARG A 122 ? 0.1104 0.1177 0.1120 0.0014  -0.0027 -0.0030 229 ARG A CA  
909  C C   . ARG A 122 ? 0.1052 0.1133 0.1046 0.0045  0.0001  -0.0060 229 ARG A C   
910  O O   . ARG A 122 ? 0.0737 0.1189 0.0832 0.0150  0.0077  -0.0074 229 ARG A O   
911  C CB  . ARG A 122 ? 0.1345 0.1317 0.1263 -0.0034 0.0049  -0.0067 229 ARG A CB  
912  C CG  . ARG A 122 ? 0.1755 0.1779 0.1828 0.0002  -0.0070 0.0000  229 ARG A CG  
913  C CD  . ARG A 122 ? 0.2354 0.2564 0.2404 -0.0033 0.0211  -0.0038 229 ARG A CD  
914  N NE  . ARG A 122 ? 0.2988 0.2858 0.3164 -0.0098 0.0085  0.0007  229 ARG A NE  
915  C CZ  . ARG A 122 ? 0.3372 0.3454 0.3433 -0.0005 -0.0008 -0.0019 229 ARG A CZ  
916  N NH1 . ARG A 122 ? 0.3403 0.3439 0.3501 -0.0070 0.0079  0.0125  229 ARG A NH1 
917  N NH2 . ARG A 122 ? 0.3685 0.3467 0.3816 -0.0034 0.0064  -0.0121 229 ARG A NH2 
918  N N   . ASN A 123 ? 0.1024 0.1009 0.0999 0.0026  -0.0093 0.0024  230 ASN A N   
919  C CA  . ASN A 123 ? 0.0814 0.0897 0.0884 -0.0025 -0.0007 -0.0053 230 ASN A CA  
920  C C   . ASN A 123 ? 0.0785 0.0868 0.0834 -0.0031 -0.0014 -0.0032 230 ASN A C   
921  O O   . ASN A 123 ? 0.0762 0.0915 0.0825 -0.0078 -0.0005 -0.0053 230 ASN A O   
922  C CB  . ASN A 123 ? 0.0795 0.0919 0.0944 0.0011  -0.0089 -0.0009 230 ASN A CB  
923  C CG  . ASN A 123 ? 0.0908 0.0948 0.0921 -0.0062 -0.0094 0.0069  230 ASN A CG  
924  O OD1 . ASN A 123 ? 0.0848 0.1197 0.0779 -0.0226 -0.0069 0.0038  230 ASN A OD1 
925  N ND2 . ASN A 123 ? 0.0742 0.0909 0.1195 -0.0002 -0.0053 0.0039  230 ASN A ND2 
926  N N   . GLY A 124 ? 0.0768 0.1038 0.0781 -0.0063 -0.0053 -0.0005 231 GLY A N   
927  C CA  . GLY A 124 ? 0.0944 0.0967 0.0892 -0.0043 0.0015  -0.0013 231 GLY A CA  
928  C C   . GLY A 124 ? 0.0912 0.1100 0.0895 -0.0051 0.0003  -0.0085 231 GLY A C   
929  O O   . GLY A 124 ? 0.0918 0.1343 0.0901 -0.0098 -0.0068 -0.0250 231 GLY A O   
930  N N   . LEU A 125 ? 0.0887 0.1162 0.0951 -0.0051 -0.0019 0.0005  232 LEU A N   
931  C CA  . LEU A 125 ? 0.0879 0.0982 0.0956 -0.0040 -0.0006 -0.0046 232 LEU A CA  
932  C C   . LEU A 125 ? 0.0930 0.1011 0.1000 -0.0004 0.0000  0.0009  232 LEU A C   
933  O O   . LEU A 125 ? 0.0954 0.1081 0.1117 0.0074  0.0057  -0.0134 232 LEU A O   
934  C CB  . LEU A 125 ? 0.0850 0.0970 0.0927 -0.0018 -0.0043 0.0037  232 LEU A CB  
935  C CG  . LEU A 125 ? 0.0702 0.1010 0.0821 -0.0179 0.0026  0.0052  232 LEU A CG  
936  C CD1 . LEU A 125 ? 0.0688 0.1070 0.1123 -0.0020 -0.0089 -0.0044 232 LEU A CD1 
937  C CD2 . LEU A 125 ? 0.0767 0.1258 0.1052 -0.0106 -0.0061 0.0012  232 LEU A CD2 
938  N N   . LEU A 126 ? 0.1072 0.1026 0.1025 0.0044  0.0035  -0.0059 233 LEU A N   
939  C CA  . LEU A 126 ? 0.0960 0.0889 0.0922 -0.0012 -0.0016 -0.0025 233 LEU A CA  
940  C C   . LEU A 126 ? 0.1057 0.1013 0.1007 -0.0022 -0.0036 -0.0034 233 LEU A C   
941  O O   . LEU A 126 ? 0.0950 0.0910 0.0985 -0.0192 -0.0039 -0.0045 233 LEU A O   
942  C CB  . LEU A 126 ? 0.1062 0.0993 0.1055 -0.0054 0.0034  -0.0026 233 LEU A CB  
943  C CG  . LEU A 126 ? 0.0832 0.0997 0.0943 -0.0057 -0.0062 0.0049  233 LEU A CG  
944  C CD1 . LEU A 126 ? 0.1059 0.1205 0.1144 0.0139  -0.0203 -0.0165 233 LEU A CD1 
945  C CD2 . LEU A 126 ? 0.0901 0.1031 0.0887 0.0046  0.0003  -0.0052 233 LEU A CD2 
946  N N   . THR A 127 ? 0.0973 0.0915 0.1076 -0.0093 -0.0040 0.0019  234 THR A N   
947  C CA  . THR A 127 ? 0.1116 0.1078 0.1063 -0.0055 0.0030  0.0000  234 THR A CA  
948  C C   . THR A 127 ? 0.1228 0.1246 0.1214 0.0008  -0.0022 -0.0029 234 THR A C   
949  O O   . THR A 127 ? 0.1222 0.1306 0.1244 -0.0077 0.0011  -0.0098 234 THR A O   
950  C CB  . THR A 127 ? 0.1149 0.1129 0.1219 -0.0013 0.0025  -0.0042 234 THR A CB  
951  O OG1 . THR A 127 ? 0.1155 0.1212 0.0927 -0.0026 -0.0002 -0.0066 234 THR A OG1 
952  C CG2 . THR A 127 ? 0.1245 0.1170 0.1382 -0.0055 -0.0045 0.0036  234 THR A CG2 
953  N N   . GLU A 128 ? 0.1368 0.1331 0.1352 -0.0049 0.0002  -0.0037 235 GLU A N   
954  C CA  . GLU A 128 ? 0.1362 0.1355 0.1368 -0.0060 0.0045  -0.0054 235 GLU A CA  
955  C C   . GLU A 128 ? 0.1314 0.1306 0.1325 -0.0070 0.0076  -0.0045 235 GLU A C   
956  O O   . GLU A 128 ? 0.1351 0.1147 0.1236 -0.0285 0.0006  0.0021  235 GLU A O   
957  C CB  . GLU A 128 ? 0.1587 0.1543 0.1470 -0.0073 0.0172  -0.0014 235 GLU A CB  
958  C CG  . GLU A 128 ? 0.2153 0.2145 0.2041 -0.0032 -0.0016 0.0192  235 GLU A CG  
959  C CD  . GLU A 128 ? 0.2513 0.2681 0.2611 -0.0027 0.0180  0.0130  235 GLU A CD  
960  O OE1 . GLU A 128 ? 0.3334 0.3343 0.3016 -0.0143 0.0162  -0.0090 235 GLU A OE1 
961  O OE2 . GLU A 128 ? 0.3127 0.3407 0.2885 -0.0277 -0.0054 0.0052  235 GLU A OE2 
962  N N   . HIS A 129 ? 0.1295 0.1312 0.1306 -0.0046 0.0015  0.0021  236 HIS A N   
963  C CA  . HIS A 129 ? 0.1204 0.1297 0.1262 -0.0005 0.0017  -0.0007 236 HIS A CA  
964  C C   . HIS A 129 ? 0.1130 0.1224 0.1175 -0.0031 0.0026  0.0051  236 HIS A C   
965  O O   . HIS A 129 ? 0.1171 0.1137 0.1119 -0.0118 -0.0066 -0.0023 236 HIS A O   
966  C CB  . HIS A 129 ? 0.1216 0.1289 0.1218 0.0007  0.0090  0.0026  236 HIS A CB  
967  C CG  . HIS A 129 ? 0.1271 0.1515 0.1130 0.0000  0.0111  -0.0032 236 HIS A CG  
968  N ND1 . HIS A 129 ? 0.1246 0.1569 0.1216 -0.0020 0.0106  -0.0192 236 HIS A ND1 
969  C CD2 . HIS A 129 ? 0.1629 0.1795 0.1596 0.0027  -0.0086 -0.0030 236 HIS A CD2 
970  C CE1 . HIS A 129 ? 0.1707 0.1585 0.1466 -0.0027 -0.0043 -0.0150 236 HIS A CE1 
971  N NE2 . HIS A 129 ? 0.1514 0.1830 0.1622 -0.0036 0.0023  -0.0068 236 HIS A NE2 
972  N N   . ASN A 130 ? 0.1061 0.1174 0.1258 -0.0084 0.0085  -0.0027 237 ASN A N   
973  C CA  . ASN A 130 ? 0.1324 0.1306 0.1337 -0.0054 0.0040  -0.0004 237 ASN A CA  
974  C C   . ASN A 130 ? 0.1215 0.1134 0.1152 -0.0017 0.0032  -0.0011 237 ASN A C   
975  O O   . ASN A 130 ? 0.1194 0.0943 0.1037 -0.0011 -0.0009 0.0003  237 ASN A O   
976  C CB  . ASN A 130 ? 0.1420 0.1327 0.1575 -0.0053 0.0083  -0.0033 237 ASN A CB  
977  C CG  . ASN A 130 ? 0.1867 0.1968 0.1651 -0.0023 0.0089  0.0058  237 ASN A CG  
978  O OD1 . ASN A 130 ? 0.2189 0.2643 0.2800 0.0267  0.0063  0.0115  237 ASN A OD1 
979  N ND2 . ASN A 130 ? 0.1784 0.2004 0.1671 0.0082  0.0181  0.0013  237 ASN A ND2 
980  N N   . ILE A 131 ? 0.1118 0.1149 0.1066 0.0012  -0.0028 -0.0037 238 ILE A N   
981  C CA  . ILE A 131 ? 0.1186 0.0976 0.1124 -0.0011 -0.0003 -0.0056 238 ILE A CA  
982  C C   . ILE A 131 ? 0.1196 0.1183 0.1219 0.0021  -0.0035 -0.0050 238 ILE A C   
983  O O   . ILE A 131 ? 0.1245 0.1102 0.1059 0.0069  -0.0124 -0.0203 238 ILE A O   
984  C CB  . ILE A 131 ? 0.1268 0.1129 0.1235 0.0079  0.0043  -0.0033 238 ILE A CB  
985  C CG1 . ILE A 131 ? 0.1330 0.1159 0.1427 -0.0020 -0.0071 0.0084  238 ILE A CG1 
986  C CG2 . ILE A 131 ? 0.1384 0.1207 0.1541 -0.0041 0.0056  -0.0024 238 ILE A CG2 
987  C CD1 . ILE A 131 ? 0.1434 0.1510 0.1636 0.0007  -0.0066 -0.0047 238 ILE A CD1 
988  N N   . CYS A 132 ? 0.1171 0.1134 0.1186 -0.0036 -0.0090 -0.0053 239 CYS A N   
989  C CA  . CYS A 132 ? 0.1197 0.1218 0.1270 0.0002  -0.0039 0.0017  239 CYS A CA  
990  C C   . CYS A 132 ? 0.1221 0.1234 0.1240 -0.0049 -0.0035 -0.0022 239 CYS A C   
991  O O   . CYS A 132 ? 0.1030 0.0989 0.1202 0.0057  -0.0005 0.0036  239 CYS A O   
992  C CB  . CYS A 132 ? 0.1105 0.1139 0.1269 0.0004  0.0006  0.0006  239 CYS A CB  
993  S SG  . CYS A 132 ? 0.1079 0.1447 0.1784 -0.0157 -0.0027 -0.0009 239 CYS A SG  
994  N N   . GLU A 133 ? 0.1262 0.1274 0.1387 0.0000  -0.0020 -0.0066 240 GLU A N   
995  C CA  . GLU A 133 ? 0.1423 0.1406 0.1366 0.0015  0.0035  -0.0057 240 GLU A CA  
996  C C   . GLU A 133 ? 0.1206 0.1258 0.1326 0.0036  -0.0037 -0.0007 240 GLU A C   
997  O O   . GLU A 133 ? 0.1141 0.1308 0.1197 -0.0036 0.0040  -0.0171 240 GLU A O   
998  C CB  . GLU A 133 ? 0.1389 0.1574 0.1443 0.0065  -0.0061 -0.0002 240 GLU A CB  
999  C CG  . GLU A 133 ? 0.2313 0.2069 0.2194 0.0093  -0.0034 -0.0088 240 GLU A CG  
1000 C CD  . GLU A 133 ? 0.2766 0.2792 0.2582 0.0080  -0.0134 0.0103  240 GLU A CD  
1001 O OE1 . GLU A 133 ? 0.2769 0.3058 0.3013 0.0230  0.0016  0.0013  240 GLU A OE1 
1002 O OE2 . GLU A 133 ? 0.2984 0.3144 0.3252 0.0073  0.0150  0.0073  240 GLU A OE2 
1003 N N   . ILE A 134 ? 0.1203 0.1159 0.1213 0.0020  0.0015  -0.0056 241 ILE A N   
1004 C CA  . ILE A 134 ? 0.1145 0.1162 0.1235 0.0000  -0.0034 0.0016  241 ILE A CA  
1005 C C   . ILE A 134 ? 0.1017 0.1181 0.1250 -0.0043 -0.0008 0.0018  241 ILE A C   
1006 O O   . ILE A 134 ? 0.1166 0.1136 0.1453 -0.0024 -0.0007 0.0043  241 ILE A O   
1007 C CB  . ILE A 134 ? 0.1150 0.1086 0.1006 -0.0052 -0.0056 -0.0019 241 ILE A CB  
1008 C CG1 . ILE A 134 ? 0.1187 0.1199 0.1116 -0.0085 -0.0058 -0.0026 241 ILE A CG1 
1009 C CG2 . ILE A 134 ? 0.1261 0.0955 0.1022 -0.0062 -0.0103 0.0059  241 ILE A CG2 
1010 C CD1 . ILE A 134 ? 0.1474 0.1661 0.1455 0.0074  -0.0115 0.0012  241 ILE A CD1 
1011 N N   . ASN A 135 ? 0.1156 0.1263 0.1356 -0.0114 -0.0080 -0.0018 242 ASN A N   
1012 C CA  . ASN A 135 ? 0.1395 0.1362 0.1468 -0.0035 0.0032  0.0012  242 ASN A CA  
1013 C C   . ASN A 135 ? 0.1689 0.1540 0.1759 -0.0006 0.0009  0.0015  242 ASN A C   
1014 O O   . ASN A 135 ? 0.2038 0.1450 0.2060 0.0004  0.0225  0.0080  242 ASN A O   
1015 C CB  . ASN A 135 ? 0.1352 0.1339 0.1445 -0.0056 -0.0001 -0.0034 242 ASN A CB  
1016 C CG  . ASN A 135 ? 0.1112 0.1296 0.1193 -0.0047 -0.0039 0.0070  242 ASN A CG  
1017 O OD1 . ASN A 135 ? 0.0780 0.0850 0.1514 -0.0012 0.0001  0.0046  242 ASN A OD1 
1018 N ND2 . ASN A 135 ? 0.0777 0.1150 0.1609 0.0058  0.0171  0.0090  242 ASN A ND2 
1019 N N   . GLY A 136 ? 0.1890 0.1808 0.1907 0.0022  0.0035  0.0023  243 GLY A N   
1020 C CA  . GLY A 136 ? 0.2068 0.2006 0.2086 0.0074  0.0005  0.0035  243 GLY A CA  
1021 C C   . GLY A 136 ? 0.2104 0.2071 0.2143 0.0103  0.0024  -0.0008 243 GLY A C   
1022 O O   . GLY A 136 ? 0.2455 0.2287 0.2428 0.0214  0.0007  0.0173  243 GLY A O   
1023 N N   . GLN A 137 ? 0.2148 0.2045 0.2044 0.0042  0.0112  0.0052  244 GLN A N   
1024 C CA  . GLN A 137 ? 0.2108 0.1992 0.2141 -0.0005 0.0052  -0.0002 244 GLN A CA  
1025 C C   . GLN A 137 ? 0.1942 0.1891 0.1968 0.0022  0.0037  -0.0015 244 GLN A C   
1026 O O   . GLN A 137 ? 0.1623 0.1555 0.1877 -0.0053 0.0028  -0.0152 244 GLN A O   
1027 C CB  . GLN A 137 ? 0.2222 0.2171 0.2265 0.0022  0.0050  0.0008  244 GLN A CB  
1028 C CG  . GLN A 137 ? 0.2825 0.2792 0.2707 -0.0009 0.0002  -0.0073 244 GLN A CG  
1029 C CD  . GLN A 137 ? 0.3101 0.3363 0.3410 -0.0071 -0.0047 0.0014  244 GLN A CD  
1030 O OE1 . GLN A 137 ? 0.3372 0.3300 0.3582 0.0050  0.0023  -0.0049 244 GLN A OE1 
1031 N NE2 . GLN A 137 ? 0.3961 0.3824 0.3671 -0.0039 -0.0054 -0.0076 244 GLN A NE2 
1032 N N   . ASN A 138 ? 0.1814 0.1786 0.1959 0.0044  0.0022  -0.0015 245 ASN A N   
1033 C CA  . ASN A 138 ? 0.1785 0.1778 0.1896 0.0031  0.0001  -0.0032 245 ASN A CA  
1034 C C   . ASN A 138 ? 0.1688 0.1669 0.1850 0.0021  -0.0029 -0.0054 245 ASN A C   
1035 O O   . ASN A 138 ? 0.1696 0.1656 0.2198 -0.0100 -0.0056 -0.0106 245 ASN A O   
1036 C CB  . ASN A 138 ? 0.1769 0.1808 0.1909 0.0053  -0.0011 -0.0005 245 ASN A CB  
1037 C CG  . ASN A 138 ? 0.1853 0.1786 0.2022 0.0001  0.0022  -0.0028 245 ASN A CG  
1038 O OD1 . ASN A 138 ? 0.1589 0.1516 0.1587 0.0165  0.0069  -0.0125 245 ASN A OD1 
1039 N ND2 . ASN A 138 ? 0.2050 0.2069 0.2124 -0.0015 0.0119  -0.0238 245 ASN A ND2 
1040 N N   . VAL A 139 ? 0.1439 0.1457 0.1647 -0.0039 -0.0032 -0.0050 246 VAL A N   
1041 C CA  . VAL A 139 ? 0.1445 0.1470 0.1624 -0.0029 -0.0076 -0.0084 246 VAL A CA  
1042 C C   . VAL A 139 ? 0.1356 0.1455 0.1608 0.0005  -0.0094 -0.0043 246 VAL A C   
1043 O O   . VAL A 139 ? 0.1057 0.1770 0.1730 0.0021  -0.0165 -0.0045 246 VAL A O   
1044 C CB  . VAL A 139 ? 0.1442 0.1508 0.1550 0.0000  -0.0093 -0.0063 246 VAL A CB  
1045 C CG1 . VAL A 139 ? 0.1691 0.1786 0.1720 -0.0015 -0.0032 -0.0035 246 VAL A CG1 
1046 C CG2 . VAL A 139 ? 0.1365 0.1392 0.1586 0.0027  -0.0067 -0.0053 246 VAL A CG2 
1047 N N   . ILE A 140 ? 0.1235 0.1466 0.1460 -0.0001 -0.0138 -0.0095 247 ILE A N   
1048 C CA  . ILE A 140 ? 0.1227 0.1321 0.1390 -0.0013 -0.0085 -0.0055 247 ILE A CA  
1049 C C   . ILE A 140 ? 0.1380 0.1497 0.1495 -0.0029 -0.0053 -0.0037 247 ILE A C   
1050 O O   . ILE A 140 ? 0.1327 0.1360 0.1694 -0.0141 -0.0089 -0.0241 247 ILE A O   
1051 C CB  . ILE A 140 ? 0.1142 0.1218 0.1204 0.0050  -0.0047 0.0019  247 ILE A CB  
1052 C CG1 . ILE A 140 ? 0.0919 0.1178 0.1234 -0.0035 -0.0108 0.0038  247 ILE A CG1 
1053 C CG2 . ILE A 140 ? 0.1281 0.1402 0.1316 0.0020  -0.0122 0.0045  247 ILE A CG2 
1054 C CD1 . ILE A 140 ? 0.0989 0.1142 0.1277 0.0059  0.0025  0.0008  247 ILE A CD1 
1055 N N   . GLY A 141 ? 0.1603 0.1743 0.1738 -0.0042 -0.0028 -0.0059 248 GLY A N   
1056 C CA  . GLY A 141 ? 0.1657 0.1885 0.1709 -0.0006 -0.0037 -0.0088 248 GLY A CA  
1057 C C   . GLY A 141 ? 0.1664 0.1953 0.1779 0.0004  -0.0056 -0.0115 248 GLY A C   
1058 O O   . GLY A 141 ? 0.1732 0.2291 0.1764 0.0027  -0.0131 -0.0231 248 GLY A O   
1059 N N   . LEU A 142 ? 0.1640 0.1859 0.1675 -0.0041 -0.0052 -0.0118 249 LEU A N   
1060 C CA  . LEU A 142 ? 0.1585 0.1611 0.1650 -0.0038 -0.0074 -0.0068 249 LEU A CA  
1061 C C   . LEU A 142 ? 0.1584 0.1665 0.1735 -0.0037 -0.0109 -0.0050 249 LEU A C   
1062 O O   . LEU A 142 ? 0.1529 0.1705 0.1640 -0.0104 -0.0181 0.0021  249 LEU A O   
1063 C CB  . LEU A 142 ? 0.1620 0.1571 0.1693 -0.0078 -0.0070 -0.0115 249 LEU A CB  
1064 C CG  . LEU A 142 ? 0.1854 0.1746 0.1779 -0.0014 -0.0082 -0.0071 249 LEU A CG  
1065 C CD1 . LEU A 142 ? 0.1857 0.1823 0.2169 0.0017  -0.0078 -0.0055 249 LEU A CD1 
1066 C CD2 . LEU A 142 ? 0.2271 0.1984 0.2183 -0.0078 -0.0128 -0.0098 249 LEU A CD2 
1067 N N   . LYS A 143 ? 0.1589 0.1516 0.1602 -0.0040 -0.0132 -0.0078 250 LYS A N   
1068 C CA  . LYS A 143 ? 0.1601 0.1659 0.1595 0.0002  -0.0089 -0.0061 250 LYS A CA  
1069 C C   . LYS A 143 ? 0.1400 0.1454 0.1365 -0.0058 -0.0129 -0.0072 250 LYS A C   
1070 O O   . LYS A 143 ? 0.1423 0.1537 0.1128 -0.0034 -0.0162 -0.0230 250 LYS A O   
1071 C CB  . LYS A 143 ? 0.1702 0.1756 0.1713 -0.0039 -0.0133 -0.0098 250 LYS A CB  
1072 C CG  . LYS A 143 ? 0.2121 0.2136 0.2195 0.0089  -0.0027 -0.0105 250 LYS A CG  
1073 C CD  . LYS A 143 ? 0.2430 0.2382 0.2295 -0.0060 -0.0152 -0.0144 250 LYS A CD  
1076 N N   . ASP A 144 ? 0.1292 0.1392 0.1276 -0.0012 -0.0156 -0.0091 251 ASP A N   
1077 C CA  . ASP A 144 ? 0.1198 0.1340 0.1101 -0.0008 -0.0080 -0.0065 251 ASP A CA  
1078 C C   . ASP A 144 ? 0.1265 0.1321 0.1150 0.0001  -0.0063 -0.0071 251 ASP A C   
1079 O O   . ASP A 144 ? 0.1128 0.1406 0.1073 0.0012  -0.0053 0.0002  251 ASP A O   
1080 C CB  . ASP A 144 ? 0.1146 0.1279 0.1079 0.0017  -0.0090 -0.0075 251 ASP A CB  
1081 C CG  . ASP A 144 ? 0.1402 0.1569 0.1455 -0.0005 -0.0063 0.0037  251 ASP A CG  
1082 O OD1 . ASP A 144 ? 0.1132 0.1739 0.1266 0.0131  0.0012  -0.0149 251 ASP A OD1 
1083 O OD2 . ASP A 144 ? 0.1481 0.1676 0.1500 -0.0191 -0.0237 0.0040  251 ASP A OD2 
1084 N N   . SER A 145 ? 0.1337 0.1485 0.1268 -0.0007 -0.0073 -0.0079 252 SER A N   
1085 C CA  . SER A 145 ? 0.1401 0.1496 0.1416 -0.0042 -0.0089 -0.0141 252 SER A CA  
1086 C C   . SER A 145 ? 0.1459 0.1514 0.1419 -0.0041 -0.0065 -0.0146 252 SER A C   
1087 O O   . SER A 145 ? 0.1388 0.1531 0.1502 -0.0038 -0.0030 -0.0281 252 SER A O   
1088 C CB  . SER A 145 ? 0.1424 0.1587 0.1391 -0.0032 -0.0090 -0.0158 252 SER A CB  
1089 O OG  . SER A 145 ? 0.1602 0.1645 0.1880 -0.0100 -0.0318 -0.0482 252 SER A OG  
1090 N N   . GLN A 146 ? 0.1518 0.1500 0.1380 -0.0018 -0.0067 -0.0118 253 GLN A N   
1091 C CA  . GLN A 146 ? 0.1495 0.1502 0.1461 -0.0057 -0.0070 -0.0050 253 GLN A CA  
1092 C C   . GLN A 146 ? 0.1323 0.1452 0.1277 -0.0087 -0.0114 0.0001  253 GLN A C   
1093 O O   . GLN A 146 ? 0.1305 0.1483 0.1204 -0.0083 -0.0269 -0.0051 253 GLN A O   
1094 C CB  . GLN A 146 ? 0.1590 0.1498 0.1466 -0.0019 0.0000  -0.0027 253 GLN A CB  
1095 C CG  . GLN A 146 ? 0.2099 0.1912 0.1879 -0.0069 -0.0104 -0.0097 253 GLN A CG  
1096 C CD  . GLN A 146 ? 0.2114 0.2210 0.2197 0.0005  0.0036  -0.0070 253 GLN A CD  
1097 O OE1 . GLN A 146 ? 0.2149 0.1970 0.2114 -0.0097 -0.0151 -0.0297 253 GLN A OE1 
1098 N NE2 . GLN A 146 ? 0.2468 0.2389 0.2857 0.0004  0.0044  -0.0052 253 GLN A NE2 
1099 N N   . ILE A 147 ? 0.1389 0.1341 0.1196 -0.0038 -0.0095 -0.0017 254 ILE A N   
1100 C CA  . ILE A 147 ? 0.1275 0.1301 0.1158 -0.0043 -0.0061 -0.0029 254 ILE A CA  
1101 C C   . ILE A 147 ? 0.1326 0.1260 0.1185 -0.0045 -0.0027 -0.0071 254 ILE A C   
1102 O O   . ILE A 147 ? 0.1188 0.1518 0.1084 -0.0130 -0.0151 0.0013  254 ILE A O   
1103 C CB  . ILE A 147 ? 0.1211 0.1301 0.1126 -0.0021 0.0005  -0.0057 254 ILE A CB  
1104 C CG1 . ILE A 147 ? 0.1272 0.1208 0.1317 -0.0009 -0.0075 -0.0066 254 ILE A CG1 
1105 C CG2 . ILE A 147 ? 0.1249 0.1428 0.1292 -0.0031 -0.0076 -0.0090 254 ILE A CG2 
1106 C CD1 . ILE A 147 ? 0.1124 0.1241 0.1292 -0.0051 -0.0041 -0.0014 254 ILE A CD1 
1107 N N   . ALA A 148 ? 0.1369 0.1320 0.1182 -0.0008 -0.0014 -0.0041 255 ALA A N   
1108 C CA  . ALA A 148 ? 0.1531 0.1555 0.1450 0.0013  -0.0009 -0.0018 255 ALA A CA  
1109 C C   . ALA A 148 ? 0.1488 0.1645 0.1522 0.0013  -0.0038 -0.0017 255 ALA A C   
1110 O O   . ALA A 148 ? 0.1528 0.1705 0.1517 0.0027  -0.0032 -0.0045 255 ALA A O   
1111 C CB  . ALA A 148 ? 0.1590 0.1757 0.1494 0.0044  -0.0053 -0.0034 255 ALA A CB  
1112 N N   . ASP A 149 ? 0.1474 0.1679 0.1456 0.0002  -0.0015 -0.0063 256 ASP A N   
1113 C CA  . ASP A 149 ? 0.1682 0.1776 0.1684 -0.0039 -0.0010 -0.0017 256 ASP A CA  
1114 C C   . ASP A 149 ? 0.1467 0.1711 0.1550 -0.0033 0.0003  -0.0034 256 ASP A C   
1115 O O   . ASP A 149 ? 0.1262 0.1724 0.1747 -0.0127 0.0039  -0.0113 256 ASP A O   
1116 C CB  . ASP A 149 ? 0.1828 0.1919 0.1824 -0.0030 0.0057  -0.0103 256 ASP A CB  
1117 C CG  . ASP A 149 ? 0.2441 0.2507 0.2292 -0.0008 -0.0099 -0.0008 256 ASP A CG  
1118 O OD1 . ASP A 149 ? 0.2707 0.2813 0.2810 0.0044  -0.0109 -0.0107 256 ASP A OD1 
1119 O OD2 . ASP A 149 ? 0.3271 0.2903 0.2702 -0.0170 -0.0167 -0.0328 256 ASP A OD2 
1120 N N   . ILE A 150 ? 0.1341 0.1625 0.1343 0.0019  0.0044  -0.0049 257 ILE A N   
1121 C CA  . ILE A 150 ? 0.1273 0.1405 0.1359 -0.0049 -0.0008 0.0009  257 ILE A CA  
1122 C C   . ILE A 150 ? 0.1109 0.1377 0.1204 -0.0071 -0.0057 -0.0021 257 ILE A C   
1123 O O   . ILE A 150 ? 0.1102 0.1558 0.1237 -0.0140 -0.0128 0.0013  257 ILE A O   
1124 C CB  . ILE A 150 ? 0.1343 0.1423 0.1370 0.0035  0.0000  0.0011  257 ILE A CB  
1125 C CG1 . ILE A 150 ? 0.1499 0.1619 0.1498 -0.0035 -0.0036 -0.0099 257 ILE A CG1 
1126 C CG2 . ILE A 150 ? 0.1530 0.1636 0.1466 0.0093  -0.0104 0.0002  257 ILE A CG2 
1127 C CD1 . ILE A 150 ? 0.1515 0.1609 0.1338 0.0015  -0.0017 -0.0058 257 ILE A CD1 
1128 N N   . LEU A 151 ? 0.1121 0.1314 0.1066 0.0006  -0.0064 -0.0017 258 LEU A N   
1129 C CA  . LEU A 151 ? 0.1033 0.1250 0.1073 0.0024  -0.0014 -0.0023 258 LEU A CA  
1130 C C   . LEU A 151 ? 0.1209 0.1427 0.1305 0.0064  -0.0011 -0.0044 258 LEU A C   
1131 O O   . LEU A 151 ? 0.1009 0.1659 0.1424 0.0038  0.0051  -0.0109 258 LEU A O   
1132 C CB  . LEU A 151 ? 0.1076 0.1204 0.1109 0.0089  -0.0046 -0.0115 258 LEU A CB  
1133 C CG  . LEU A 151 ? 0.0896 0.1021 0.0888 -0.0042 -0.0048 0.0000  258 LEU A CG  
1134 C CD1 . LEU A 151 ? 0.1151 0.1213 0.1068 0.0015  0.0000  0.0057  258 LEU A CD1 
1135 C CD2 . LEU A 151 ? 0.0944 0.1092 0.1082 -0.0060 -0.0075 0.0020  258 LEU A CD2 
1136 N N   . SER A 152 ? 0.1307 0.1567 0.1546 0.0038  -0.0038 -0.0083 259 SER A N   
1137 C CA  . SER A 152 ? 0.1541 0.1829 0.1711 -0.0027 0.0004  -0.0025 259 SER A CA  
1138 C C   . SER A 152 ? 0.1526 0.1756 0.1673 -0.0045 -0.0056 -0.0052 259 SER A C   
1139 O O   . SER A 152 ? 0.1271 0.1938 0.1731 -0.0144 -0.0024 -0.0066 259 SER A O   
1140 C CB  . SER A 152 ? 0.1699 0.2098 0.1850 0.0015  -0.0068 -0.0036 259 SER A CB  
1141 O OG  . SER A 152 ? 0.2212 0.2902 0.2564 -0.0112 0.0021  0.0023  259 SER A OG  
1142 N N   . THR A 153 ? 0.1392 0.1726 0.1648 -0.0034 -0.0134 0.0010  260 THR A N   
1143 C CA  . THR A 153 ? 0.1584 0.1669 0.1703 -0.0094 -0.0073 -0.0015 260 THR A CA  
1144 C C   . THR A 153 ? 0.1535 0.1581 0.1657 -0.0129 -0.0055 0.0015  260 THR A C   
1145 O O   . THR A 153 ? 0.1272 0.1502 0.1559 -0.0239 -0.0125 -0.0046 260 THR A O   
1146 C CB  . THR A 153 ? 0.1731 0.1707 0.1832 -0.0056 0.0002  -0.0015 260 THR A CB  
1147 O OG1 . THR A 153 ? 0.1958 0.1981 0.2033 -0.0057 0.0047  -0.0056 260 THR A OG1 
1148 C CG2 . THR A 153 ? 0.1976 0.1713 0.1924 -0.0044 0.0045  -0.0016 260 THR A CG2 
1149 N N   . SER A 154 ? 0.1273 0.1502 0.1508 -0.0099 -0.0114 -0.0046 261 SER A N   
1150 C CA  . SER A 154 ? 0.1337 0.1390 0.1441 -0.0088 -0.0016 -0.0024 261 SER A CA  
1151 C C   . SER A 154 ? 0.1167 0.1303 0.1388 -0.0109 -0.0053 -0.0027 261 SER A C   
1152 O O   . SER A 154 ? 0.1268 0.1294 0.1549 -0.0310 -0.0113 0.0083  261 SER A O   
1153 C CB  . SER A 154 ? 0.1175 0.1391 0.1379 -0.0093 -0.0020 -0.0049 261 SER A CB  
1154 O OG  . SER A 154 ? 0.1262 0.1221 0.1401 -0.0080 0.0064  -0.0090 261 SER A OG  
1155 N N   . GLY A 155 ? 0.1246 0.1196 0.1400 -0.0080 0.0024  -0.0010 262 GLY A N   
1156 C CA  . GLY A 155 ? 0.1066 0.1231 0.1333 -0.0062 0.0004  0.0004  262 GLY A CA  
1157 C C   . GLY A 155 ? 0.1049 0.1176 0.1165 -0.0057 0.0013  -0.0029 262 GLY A C   
1158 O O   . GLY A 155 ? 0.0978 0.1031 0.1171 -0.0167 0.0003  0.0001  262 GLY A O   
1159 N N   . THR A 156 ? 0.1022 0.1219 0.1255 -0.0101 0.0051  -0.0006 263 THR A N   
1160 C CA  . THR A 156 ? 0.0984 0.1138 0.1101 -0.0032 -0.0018 0.0010  263 THR A CA  
1161 C C   . THR A 156 ? 0.0972 0.1094 0.1167 0.0017  0.0027  0.0031  263 THR A C   
1162 O O   . THR A 156 ? 0.0914 0.1196 0.1049 0.0096  0.0130  0.0087  263 THR A O   
1163 C CB  . THR A 156 ? 0.1007 0.1174 0.1375 -0.0019 0.0035  -0.0003 263 THR A CB  
1164 O OG1 . THR A 156 ? 0.0856 0.1295 0.1445 -0.0228 -0.0031 -0.0076 263 THR A OG1 
1165 C CG2 . THR A 156 ? 0.0986 0.1218 0.1151 -0.0101 0.0048  0.0005  263 THR A CG2 
1166 N N   . VAL A 157 ? 0.0898 0.1149 0.0972 0.0011  -0.0093 0.0001  264 VAL A N   
1167 C CA  . VAL A 157 ? 0.0929 0.1258 0.1066 0.0006  -0.0047 0.0023  264 VAL A CA  
1168 C C   . VAL A 157 ? 0.0884 0.1088 0.1105 0.0056  -0.0110 0.0050  264 VAL A C   
1169 O O   . VAL A 157 ? 0.0943 0.1232 0.1274 0.0066  -0.0041 -0.0122 264 VAL A O   
1170 C CB  . VAL A 157 ? 0.0942 0.1247 0.1141 0.0006  -0.0025 0.0117  264 VAL A CB  
1171 C CG1 . VAL A 157 ? 0.1037 0.1582 0.1372 -0.0082 -0.0120 0.0001  264 VAL A CG1 
1172 C CG2 . VAL A 157 ? 0.1213 0.1615 0.1295 -0.0025 -0.0032 -0.0008 264 VAL A CG2 
1173 N N   . VAL A 158 ? 0.0853 0.1064 0.1020 -0.0045 -0.0053 -0.0007 265 VAL A N   
1174 C CA  . VAL A 158 ? 0.0874 0.1020 0.1015 -0.0050 -0.0054 0.0010  265 VAL A CA  
1175 C C   . VAL A 158 ? 0.0849 0.0991 0.0984 -0.0059 0.0000  0.0020  265 VAL A C   
1176 O O   . VAL A 158 ? 0.0958 0.1059 0.0926 -0.0069 0.0112  0.0032  265 VAL A O   
1177 C CB  . VAL A 158 ? 0.0891 0.1097 0.1031 -0.0087 -0.0019 0.0015  265 VAL A CB  
1178 C CG1 . VAL A 158 ? 0.0875 0.1102 0.0944 -0.0104 -0.0059 -0.0036 265 VAL A CG1 
1179 C CG2 . VAL A 158 ? 0.0953 0.1151 0.0923 -0.0047 -0.0100 0.0028  265 VAL A CG2 
1180 N N   . THR A 159 ? 0.0860 0.0928 0.1032 -0.0055 0.0005  0.0013  266 THR A N   
1181 C CA  . THR A 159 ? 0.0936 0.1000 0.1028 -0.0064 -0.0015 0.0010  266 THR A CA  
1182 C C   . THR A 159 ? 0.1010 0.0975 0.1003 -0.0035 0.0023  -0.0042 266 THR A C   
1183 O O   . THR A 159 ? 0.0981 0.0844 0.1278 -0.0098 -0.0016 0.0041  266 THR A O   
1184 C CB  . THR A 159 ? 0.0923 0.1113 0.0942 -0.0051 -0.0011 -0.0040 266 THR A CB  
1185 O OG1 . THR A 159 ? 0.1149 0.1277 0.0771 0.0041  0.0050  0.0141  266 THR A OG1 
1186 C CG2 . THR A 159 ? 0.0988 0.1212 0.0834 -0.0042 -0.0064 0.0009  266 THR A CG2 
1187 N N   . ILE A 160 ? 0.1036 0.0879 0.1101 0.0017  -0.0024 0.0006  267 ILE A N   
1188 C CA  . ILE A 160 ? 0.1088 0.1079 0.1049 -0.0003 -0.0037 0.0027  267 ILE A CA  
1189 C C   . ILE A 160 ? 0.1065 0.1080 0.1106 -0.0012 0.0018  -0.0009 267 ILE A C   
1190 O O   . ILE A 160 ? 0.0985 0.1208 0.1024 0.0024  -0.0049 -0.0104 267 ILE A O   
1191 C CB  . ILE A 160 ? 0.1155 0.1186 0.1239 0.0035  0.0000  0.0069  267 ILE A CB  
1192 C CG1 . ILE A 160 ? 0.1336 0.1339 0.1358 -0.0069 -0.0095 0.0001  267 ILE A CG1 
1193 C CG2 . ILE A 160 ? 0.1429 0.1309 0.1267 0.0001  -0.0054 -0.0033 267 ILE A CG2 
1194 C CD1 . ILE A 160 ? 0.1714 0.1682 0.1668 -0.0009 -0.0152 0.0126  267 ILE A CD1 
1195 N N   . THR A 161 ? 0.1088 0.1035 0.1044 0.0007  -0.0076 -0.0040 268 THR A N   
1196 C CA  . THR A 161 ? 0.1094 0.1085 0.1172 0.0002  0.0000  -0.0069 268 THR A CA  
1197 C C   . THR A 161 ? 0.0990 0.1083 0.1063 0.0047  -0.0053 -0.0033 268 THR A C   
1198 O O   . THR A 161 ? 0.1086 0.1099 0.1062 -0.0010 -0.0008 -0.0106 268 THR A O   
1199 C CB  . THR A 161 ? 0.1100 0.1253 0.1260 0.0026  -0.0085 0.0021  268 THR A CB  
1200 O OG1 . THR A 161 ? 0.1381 0.1402 0.1489 -0.0031 -0.0178 0.0057  268 THR A OG1 
1201 C CG2 . THR A 161 ? 0.1236 0.1303 0.1526 -0.0033 -0.0009 -0.0032 268 THR A CG2 
1202 N N   . ILE A 162 ? 0.1092 0.1109 0.1061 0.0018  0.0054  -0.0030 269 ILE A N   
1203 C CA  . ILE A 162 ? 0.0991 0.1100 0.1037 0.0028  -0.0017 0.0028  269 ILE A CA  
1204 C C   . ILE A 162 ? 0.1022 0.1171 0.1093 -0.0064 0.0000  -0.0024 269 ILE A C   
1205 O O   . ILE A 162 ? 0.0913 0.1136 0.1170 0.0038  -0.0057 0.0046  269 ILE A O   
1206 C CB  . ILE A 162 ? 0.0923 0.1086 0.1014 0.0000  0.0118  -0.0027 269 ILE A CB  
1207 C CG1 . ILE A 162 ? 0.0844 0.1039 0.0891 0.0059  0.0002  0.0062  269 ILE A CG1 
1208 C CG2 . ILE A 162 ? 0.0980 0.1067 0.0944 -0.0024 -0.0067 -0.0005 269 ILE A CG2 
1209 C CD1 . ILE A 162 ? 0.1178 0.1031 0.1241 0.0001  0.0022  -0.0131 269 ILE A CD1 
1210 N N   . MET A 163 ? 0.1040 0.1120 0.1118 -0.0027 0.0005  -0.0107 270 MET A N   
1211 C CA  . MET A 163 ? 0.1112 0.1166 0.1290 -0.0016 0.0047  -0.0064 270 MET A CA  
1212 C C   . MET A 163 ? 0.1151 0.1256 0.1193 0.0003  0.0061  0.0002  270 MET A C   
1213 O O   . MET A 163 ? 0.0692 0.1248 0.1311 -0.0067 0.0045  0.0114  270 MET A O   
1214 C CB  . MET A 163 ? 0.1139 0.1136 0.1292 0.0005  0.0046  -0.0044 270 MET A CB  
1215 C CG  . MET A 163 ? 0.1495 0.1525 0.1630 0.0049  0.0125  -0.0029 270 MET A CG  
1216 S SD  . MET A 163 ? 0.1728 0.1381 0.2350 0.0347  -0.0382 -0.0224 270 MET A SD  
1217 C CE  . MET A 163 ? 0.1994 0.2236 0.2235 0.0105  -0.0028 -0.0047 270 MET A CE  
1218 N N   . PRO A 164 ? 0.1286 0.1461 0.1408 -0.0004 -0.0034 -0.0010 271 PRO A N   
1219 C CA  . PRO A 164 ? 0.1468 0.1553 0.1541 -0.0057 0.0046  0.0020  271 PRO A CA  
1220 C C   . PRO A 164 ? 0.1688 0.1744 0.1756 -0.0031 0.0079  -0.0017 271 PRO A C   
1221 O O   . PRO A 164 ? 0.1573 0.1827 0.1729 0.0019  0.0111  0.0087  271 PRO A O   
1222 C CB  . PRO A 164 ? 0.1515 0.1581 0.1516 -0.0039 -0.0029 -0.0072 271 PRO A CB  
1223 C CG  . PRO A 164 ? 0.1546 0.1643 0.1624 -0.0046 -0.0026 0.0057  271 PRO A CG  
1224 C CD  . PRO A 164 ? 0.1387 0.1549 0.1412 -0.0038 -0.0015 0.0002  271 PRO A CD  
1225 N N   . ALA A 165 ? 0.1879 0.1957 0.1952 0.0021  0.0024  0.0011  272 ALA A N   
1226 C CA  . ALA A 165 ? 0.2360 0.2335 0.2323 -0.0009 0.0034  0.0018  272 ALA A CA  
1227 C C   . ALA A 165 ? 0.2733 0.2720 0.2648 -0.0033 0.0117  0.0047  272 ALA A C   
1228 O O   . ALA A 165 ? 0.2996 0.2844 0.2795 -0.0148 0.0197  0.0169  272 ALA A O   
1229 C CB  . ALA A 165 ? 0.2289 0.2375 0.2230 -0.0046 0.0061  -0.0031 272 ALA A CB  
1230 N N   . PHE A 166 ? 0.2947 0.3053 0.2964 0.0052  0.0029  0.0095  273 PHE A N   
1231 C CA  . PHE A 166 ? 0.3185 0.3217 0.3090 -0.0006 0.0064  0.0061  273 PHE A CA  
1232 C C   . PHE A 166 ? 0.3365 0.3393 0.3151 0.0028  0.0061  0.0046  273 PHE A C   
1233 O O   . PHE A 166 ? 0.3765 0.3579 0.3261 0.0037  0.0159  0.0126  273 PHE A O   
1234 C CB  . PHE A 166 ? 0.3099 0.3291 0.3133 0.0005  0.0019  0.0019  273 PHE A CB  
1235 C CG  . PHE A 166 ? 0.3268 0.3283 0.3225 0.0010  0.0033  0.0005  273 PHE A CG  
1236 C CD1 . PHE A 166 ? 0.3321 0.3299 0.3333 -0.0052 -0.0008 -0.0038 273 PHE A CD1 
1237 C CD2 . PHE A 166 ? 0.3160 0.3267 0.3169 0.0044  0.0084  -0.0013 273 PHE A CD2 
1238 C CE1 . PHE A 166 ? 0.3333 0.3256 0.3271 -0.0065 -0.0018 0.0033  273 PHE A CE1 
1239 C CE2 . PHE A 166 ? 0.3085 0.3199 0.3197 -0.0010 0.0005  -0.0019 273 PHE A CE2 
1240 C CZ  . PHE A 166 ? 0.3205 0.3270 0.3268 0.0000  0.0044  -0.0039 273 PHE A CZ  
1241 N N   . GLY B 1   ? 0.2290 0.2244 0.2398 -0.0111 0.0000  0.0106  108 GLY B N   
1242 C CA  . GLY B 1   ? 0.2304 0.2156 0.2274 -0.0039 -0.0040 0.0025  108 GLY B CA  
1243 C C   . GLY B 1   ? 0.2212 0.2202 0.2180 -0.0038 -0.0062 -0.0008 108 GLY B C   
1244 O O   . GLY B 1   ? 0.2143 0.1994 0.2001 -0.0016 -0.0106 0.0015  108 GLY B O   
1245 N N   . ALA B 2   ? 0.2353 0.2179 0.2221 0.0051  -0.0055 -0.0020 109 ALA B N   
1246 C CA  . ALA B 2   ? 0.2245 0.2278 0.2239 0.0011  -0.0047 -0.0024 109 ALA B CA  
1247 C C   . ALA B 2   ? 0.2276 0.2250 0.2339 0.0041  0.0012  -0.0017 109 ALA B C   
1248 O O   . ALA B 2   ? 0.2055 0.2271 0.2393 -0.0016 0.0140  0.0026  109 ALA B O   
1249 C CB  . ALA B 2   ? 0.2440 0.2370 0.2321 0.0056  -0.0059 -0.0047 109 ALA B CB  
1250 N N   . MET B 3   ? 0.2206 0.2160 0.2184 0.0002  -0.0031 -0.0005 110 MET B N   
1251 C CA  . MET B 3   ? 0.2278 0.2241 0.2300 0.0036  -0.0051 -0.0029 110 MET B CA  
1252 C C   . MET B 3   ? 0.1990 0.1898 0.1925 -0.0059 -0.0044 -0.0037 110 MET B C   
1253 O O   . MET B 3   ? 0.1932 0.1761 0.1897 -0.0045 -0.0080 -0.0066 110 MET B O   
1254 C CB  . MET B 3   ? 0.2545 0.2447 0.2416 -0.0027 -0.0064 -0.0020 110 MET B CB  
1255 C CG  . MET B 3   ? 0.3118 0.3155 0.3244 0.0149  -0.0095 -0.0121 110 MET B CG  
1256 S SD  . MET B 3   ? 0.4234 0.4430 0.4345 -0.0152 0.0149  0.0149  110 MET B SD  
1257 C CE  . MET B 3   ? 0.4269 0.4297 0.4270 0.0019  0.0008  -0.0033 110 MET B CE  
1258 N N   . ASP B 4   ? 0.1708 0.1501 0.1626 -0.0034 -0.0078 0.0016  111 ASP B N   
1259 C CA  . ASP B 4   ? 0.1516 0.1507 0.1508 -0.0078 -0.0065 -0.0020 111 ASP B CA  
1260 C C   . ASP B 4   ? 0.1378 0.1375 0.1435 0.0008  -0.0050 0.0001  111 ASP B C   
1261 O O   . ASP B 4   ? 0.1242 0.1133 0.1496 -0.0016 -0.0091 -0.0007 111 ASP B O   
1262 C CB  . ASP B 4   ? 0.1541 0.1597 0.1528 -0.0032 -0.0081 -0.0006 111 ASP B CB  
1263 C CG  . ASP B 4   ? 0.2161 0.1897 0.2139 -0.0202 -0.0185 -0.0016 111 ASP B CG  
1264 O OD1 . ASP B 4   ? 0.2438 0.2070 0.2055 -0.0290 -0.0134 0.0025  111 ASP B OD1 
1265 O OD2 . ASP B 4   ? 0.3036 0.2536 0.2702 -0.0385 -0.0198 0.0208  111 ASP B OD2 
1266 N N   . PRO B 5   ? 0.1238 0.1317 0.1318 -0.0012 -0.0013 -0.0014 112 PRO B N   
1267 C CA  . PRO B 5   ? 0.1198 0.1288 0.1300 0.0032  -0.0028 -0.0009 112 PRO B CA  
1268 C C   . PRO B 5   ? 0.1241 0.1301 0.1225 -0.0024 -0.0045 0.0038  112 PRO B C   
1269 O O   . PRO B 5   ? 0.1256 0.1537 0.1294 -0.0076 0.0024  -0.0025 112 PRO B O   
1270 C CB  . PRO B 5   ? 0.1449 0.1339 0.1310 0.0002  -0.0144 0.0051  112 PRO B CB  
1271 C CG  . PRO B 5   ? 0.1389 0.1416 0.1426 -0.0061 -0.0030 0.0019  112 PRO B CG  
1272 C CD  . PRO B 5   ? 0.1343 0.1421 0.1424 0.0039  -0.0051 0.0006  112 PRO B CD  
1273 N N   . ARG B 6   ? 0.1287 0.1274 0.1192 0.0059  -0.0002 -0.0025 113 ARG B N   
1274 C CA  . ARG B 6   ? 0.1253 0.1283 0.1068 -0.0016 -0.0007 -0.0009 113 ARG B CA  
1275 C C   . ARG B 6   ? 0.1441 0.1394 0.1221 0.0007  0.0010  0.0009  113 ARG B C   
1276 O O   . ARG B 6   ? 0.1572 0.1239 0.1012 0.0032  0.0107  0.0125  113 ARG B O   
1277 C CB  . ARG B 6   ? 0.1188 0.1220 0.1001 0.0011  0.0052  -0.0059 113 ARG B CB  
1278 C CG  . ARG B 6   ? 0.0952 0.1118 0.0914 -0.0015 -0.0147 0.0004  113 ARG B CG  
1279 C CD  . ARG B 6   ? 0.0789 0.1018 0.0876 0.0093  -0.0146 -0.0062 113 ARG B CD  
1280 N NE  . ARG B 6   ? 0.1223 0.1190 0.1015 0.0022  -0.0135 -0.0033 113 ARG B NE  
1281 C CZ  . ARG B 6   ? 0.1095 0.1085 0.1061 0.0069  -0.0080 -0.0049 113 ARG B CZ  
1282 N NH1 . ARG B 6   ? 0.1314 0.1213 0.1096 0.0077  0.0048  0.0025  113 ARG B NH1 
1283 N NH2 . ARG B 6   ? 0.1463 0.1275 0.0944 -0.0004 0.0007  -0.0049 113 ARG B NH2 
1284 N N   . GLU B 7   ? 0.1584 0.1610 0.1339 0.0018  0.0068  0.0008  114 GLU B N   
1285 C CA  . GLU B 7   ? 0.1723 0.1739 0.1590 0.0066  0.0048  0.0035  114 GLU B CA  
1286 C C   . GLU B 7   ? 0.1693 0.1636 0.1480 0.0099  0.0079  -0.0041 114 GLU B C   
1287 O O   . GLU B 7   ? 0.1803 0.1733 0.1726 0.0266  -0.0048 0.0004  114 GLU B O   
1288 C CB  . GLU B 7   ? 0.1927 0.1985 0.1874 0.0059  0.0107  0.0063  114 GLU B CB  
1289 C CG  . GLU B 7   ? 0.2256 0.2427 0.2278 -0.0028 -0.0019 -0.0030 114 GLU B CG  
1290 C CD  . GLU B 7   ? 0.3030 0.2940 0.2827 0.0072  -0.0082 0.0167  114 GLU B CD  
1291 O OE1 . GLU B 7   ? 0.3577 0.3348 0.3564 0.0097  -0.0036 -0.0088 114 GLU B OE1 
1292 O OE2 . GLU B 7   ? 0.3308 0.3412 0.3085 0.0007  0.0005  -0.0074 114 GLU B OE2 
1293 N N   . VAL B 8   ? 0.1566 0.1545 0.1386 0.0207  -0.0017 -0.0073 115 VAL B N   
1294 C CA  . VAL B 8   ? 0.1580 0.1532 0.1514 0.0099  -0.0042 0.0005  115 VAL B CA  
1295 C C   . VAL B 8   ? 0.1630 0.1693 0.1606 0.0135  -0.0051 -0.0063 115 VAL B C   
1296 O O   . VAL B 8   ? 0.1794 0.1754 0.1323 0.0271  -0.0136 0.0008  115 VAL B O   
1297 C CB  . VAL B 8   ? 0.1521 0.1447 0.1448 0.0106  -0.0023 -0.0030 115 VAL B CB  
1298 C CG1 . VAL B 8   ? 0.1685 0.1626 0.1789 0.0075  -0.0093 -0.0056 115 VAL B CG1 
1299 C CG2 . VAL B 8   ? 0.1455 0.1500 0.1471 0.0029  -0.0040 -0.0008 115 VAL B CG2 
1300 N N   . ILE B 9   ? 0.1661 0.1836 0.1540 0.0091  -0.0089 -0.0017 116 ILE B N   
1301 C CA  . ILE B 9   ? 0.1880 0.1918 0.1780 0.0028  -0.0049 -0.0006 116 ILE B CA  
1302 C C   . ILE B 9   ? 0.1945 0.2187 0.1980 -0.0001 -0.0040 0.0003  116 ILE B C   
1303 O O   . ILE B 9   ? 0.2196 0.2692 0.2094 -0.0066 -0.0153 -0.0020 116 ILE B O   
1304 C CB  . ILE B 9   ? 0.1769 0.1886 0.1809 0.0050  -0.0046 -0.0025 116 ILE B CB  
1305 C CG1 . ILE B 9   ? 0.1953 0.2090 0.1926 0.0060  -0.0088 -0.0056 116 ILE B CG1 
1306 C CG2 . ILE B 9   ? 0.1813 0.2005 0.2004 0.0022  0.0095  -0.0017 116 ILE B CG2 
1307 C CD1 . ILE B 9   ? 0.2195 0.2232 0.2334 -0.0033 0.0013  0.0069  116 ILE B CD1 
1308 N N   . LEU B 10  ? 0.1963 0.2147 0.2006 0.0017  -0.0012 0.0038  117 LEU B N   
1309 C CA  . LEU B 10  ? 0.2132 0.2246 0.2143 0.0003  -0.0024 0.0009  117 LEU B CA  
1310 C C   . LEU B 10  ? 0.2113 0.2221 0.2106 0.0013  0.0030  0.0008  117 LEU B C   
1311 O O   . LEU B 10  ? 0.2010 0.2122 0.2084 -0.0071 -0.0106 -0.0026 117 LEU B O   
1312 C CB  . LEU B 10  ? 0.2152 0.2421 0.2128 0.0001  -0.0030 0.0031  117 LEU B CB  
1313 C CG  . LEU B 10  ? 0.2680 0.2532 0.2594 0.0044  -0.0001 0.0010  117 LEU B CG  
1314 C CD1 . LEU B 10  ? 0.3018 0.2959 0.2893 0.0028  0.0087  0.0023  117 LEU B CD1 
1315 C CD2 . LEU B 10  ? 0.2958 0.3008 0.3064 0.0060  -0.0113 -0.0020 117 LEU B CD2 
1316 N N   . CYS B 11  ? 0.2104 0.2329 0.2136 0.0020  0.0003  -0.0036 118 CYS B N   
1317 C CA  . CYS B 11  ? 0.2424 0.2462 0.2368 -0.0003 0.0035  -0.0005 118 CYS B CA  
1318 C C   . CYS B 11  ? 0.2225 0.2346 0.2144 -0.0006 0.0039  -0.0058 118 CYS B C   
1319 O O   . CYS B 11  ? 0.2127 0.2324 0.1918 -0.0072 0.0104  -0.0186 118 CYS B O   
1320 C CB  . CYS B 11  ? 0.2535 0.2719 0.2415 -0.0035 0.0039  0.0045  118 CYS B CB  
1321 S SG  . CYS B 11  ? 0.3581 0.3578 0.3320 0.0118  0.0084  -0.0141 118 CYS B SG  
1322 N N   . LYS B 12  ? 0.2186 0.2273 0.2082 -0.0036 0.0030  -0.0103 119 LYS B N   
1323 C CA  . LYS B 12  ? 0.2284 0.2313 0.2169 -0.0016 0.0046  -0.0073 119 LYS B CA  
1324 C C   . LYS B 12  ? 0.2468 0.2501 0.2431 -0.0090 0.0047  -0.0125 119 LYS B C   
1325 O O   . LYS B 12  ? 0.2390 0.2514 0.2271 -0.0131 0.0093  -0.0234 119 LYS B O   
1326 C CB  . LYS B 12  ? 0.2232 0.2305 0.2173 -0.0025 0.0038  -0.0048 119 LYS B CB  
1327 C CG  . LYS B 12  ? 0.2287 0.2138 0.2219 -0.0015 0.0061  -0.0071 119 LYS B CG  
1328 C CD  . LYS B 12  ? 0.2124 0.2235 0.2019 -0.0054 0.0073  0.0001  119 LYS B CD  
1329 C CE  . LYS B 12  ? 0.2247 0.2173 0.2202 -0.0060 0.0006  -0.0063 119 LYS B CE  
1330 N NZ  . LYS B 12  ? 0.2191 0.1867 0.2059 0.0004  0.0113  -0.0155 119 LYS B NZ  
1331 N N   . ASP B 13  ? 0.2663 0.2707 0.2666 -0.0029 0.0073  -0.0083 120 ASP B N   
1332 C CA  . ASP B 13  ? 0.2858 0.2924 0.2884 -0.0048 -0.0005 -0.0033 120 ASP B CA  
1333 C C   . ASP B 13  ? 0.3170 0.3139 0.3183 -0.0006 0.0012  -0.0046 120 ASP B C   
1334 O O   . ASP B 13  ? 0.3212 0.3106 0.3252 -0.0018 -0.0016 -0.0099 120 ASP B O   
1335 C CB  . ASP B 13  ? 0.2863 0.2903 0.2906 -0.0044 0.0024  -0.0001 120 ASP B CB  
1336 C CG  . ASP B 13  ? 0.2818 0.2799 0.2882 -0.0013 -0.0044 0.0004  120 ASP B CG  
1337 O OD1 . ASP B 13  ? 0.2188 0.2242 0.2853 -0.0233 -0.0019 -0.0144 120 ASP B OD1 
1338 O OD2 . ASP B 13  ? 0.2940 0.3352 0.3509 -0.0102 0.0218  0.0006  120 ASP B OD2 
1339 N N   . GLN B 14  ? 0.3445 0.3454 0.3415 -0.0063 -0.0023 -0.0067 121 GLN B N   
1340 C CA  . GLN B 14  ? 0.3684 0.3634 0.3698 -0.0001 -0.0003 -0.0023 121 GLN B CA  
1341 C C   . GLN B 14  ? 0.3716 0.3663 0.3730 0.0000  0.0010  -0.0023 121 GLN B C   
1342 O O   . GLN B 14  ? 0.3849 0.3665 0.3920 -0.0002 -0.0010 -0.0002 121 GLN B O   
1343 C CB  . GLN B 14  ? 0.3842 0.3793 0.3772 -0.0044 -0.0035 -0.0039 121 GLN B CB  
1344 C CG  . GLN B 14  ? 0.4138 0.4318 0.4279 0.0052  0.0014  -0.0024 121 GLN B CG  
1345 C CD  . GLN B 14  ? 0.4753 0.4787 0.4842 -0.0094 -0.0089 -0.0089 121 GLN B CD  
1346 O OE1 . GLN B 14  ? 0.5266 0.5346 0.5053 0.0043  0.0020  -0.0097 121 GLN B OE1 
1347 N NE2 . GLN B 14  ? 0.4852 0.5096 0.4973 -0.0033 0.0046  -0.0016 121 GLN B NE2 
1348 N N   . ASP B 15  ? 0.3680 0.3592 0.3662 -0.0035 0.0021  -0.0019 122 ASP B N   
1349 C CA  . ASP B 15  ? 0.3589 0.3518 0.3639 -0.0026 0.0002  -0.0010 122 ASP B CA  
1350 C C   . ASP B 15  ? 0.3388 0.3239 0.3400 -0.0004 0.0066  -0.0014 122 ASP B C   
1351 O O   . ASP B 15  ? 0.3423 0.3097 0.3507 -0.0013 0.0138  0.0027  122 ASP B O   
1352 C CB  . ASP B 15  ? 0.3719 0.3598 0.3743 0.0001  0.0047  -0.0015 122 ASP B CB  
1353 C CG  . ASP B 15  ? 0.3953 0.3958 0.4049 -0.0030 -0.0041 -0.0016 122 ASP B CG  
1354 O OD1 . ASP B 15  ? 0.4392 0.4086 0.4439 -0.0083 0.0011  -0.0061 122 ASP B OD1 
1355 O OD2 . ASP B 15  ? 0.4129 0.4287 0.4482 0.0059  -0.0060 -0.0026 122 ASP B OD2 
1356 N N   . GLY B 16  ? 0.3132 0.2983 0.3146 0.0024  0.0032  -0.0074 123 GLY B N   
1357 C CA  . GLY B 16  ? 0.2858 0.2730 0.2886 0.0068  0.0058  -0.0038 123 GLY B CA  
1358 C C   . GLY B 16  ? 0.2683 0.2606 0.2708 0.0035  0.0033  -0.0033 123 GLY B C   
1359 O O   . GLY B 16  ? 0.2756 0.2395 0.2752 0.0087  0.0088  -0.0082 123 GLY B O   
1360 N N   . LYS B 17  ? 0.2511 0.2344 0.2505 0.0029  0.0092  -0.0074 124 LYS B N   
1361 C CA  . LYS B 17  ? 0.2373 0.2294 0.2397 0.0000  0.0070  -0.0065 124 LYS B CA  
1362 C C   . LYS B 17  ? 0.2138 0.2153 0.2173 -0.0007 0.0039  -0.0044 124 LYS B C   
1363 O O   . LYS B 17  ? 0.2152 0.2269 0.2293 -0.0106 0.0177  -0.0098 124 LYS B O   
1364 C CB  . LYS B 17  ? 0.2416 0.2331 0.2457 -0.0016 0.0050  -0.0116 124 LYS B CB  
1365 C CG  . LYS B 17  ? 0.2685 0.2563 0.2690 -0.0026 0.0037  0.0026  124 LYS B CG  
1366 C CD  . LYS B 17  ? 0.3037 0.2958 0.2972 0.0007  -0.0002 -0.0057 124 LYS B CD  
1367 C CE  . LYS B 17  ? 0.3392 0.3180 0.3269 -0.0033 0.0001  -0.0012 124 LYS B CE  
1368 N NZ  . LYS B 17  ? 0.3542 0.3515 0.3423 0.0073  -0.0097 0.0113  124 LYS B NZ  
1369 N N   . ILE B 18  ? 0.2138 0.2094 0.2078 0.0022  0.0011  0.0029  125 ILE B N   
1370 C CA  . ILE B 18  ? 0.1940 0.1984 0.1938 0.0039  0.0060  0.0022  125 ILE B CA  
1371 C C   . ILE B 18  ? 0.1849 0.1834 0.1812 0.0013  0.0072  0.0054  125 ILE B C   
1372 O O   . ILE B 18  ? 0.1577 0.1735 0.1543 0.0031  0.0085  0.0079  125 ILE B O   
1373 C CB  . ILE B 18  ? 0.1924 0.2007 0.1934 0.0067  0.0042  0.0017  125 ILE B CB  
1374 C CG1 . ILE B 18  ? 0.1995 0.2021 0.2048 0.0054  -0.0004 -0.0027 125 ILE B CG1 
1375 C CG2 . ILE B 18  ? 0.1952 0.2055 0.2044 0.0057  0.0053  0.0015  125 ILE B CG2 
1376 C CD1 . ILE B 18  ? 0.1821 0.2055 0.1959 0.0046  0.0073  -0.0048 125 ILE B CD1 
1377 N N   . GLY B 19  ? 0.1777 0.1784 0.1724 0.0029  0.0082  0.0027  126 GLY B N   
1378 C CA  . GLY B 19  ? 0.1575 0.1557 0.1544 0.0000  0.0021  0.0022  126 GLY B CA  
1379 C C   . GLY B 19  ? 0.1450 0.1342 0.1496 -0.0069 0.0043  0.0074  126 GLY B C   
1380 O O   . GLY B 19  ? 0.1501 0.1213 0.1280 -0.0138 0.0059  -0.0004 126 GLY B O   
1381 N N   . LEU B 20  ? 0.1565 0.1358 0.1493 -0.0096 0.0057  0.0034  127 LEU B N   
1382 C CA  . LEU B 20  ? 0.1452 0.1492 0.1528 -0.0040 0.0026  -0.0006 127 LEU B CA  
1383 C C   . LEU B 20  ? 0.1472 0.1436 0.1512 0.0008  -0.0023 -0.0026 127 LEU B C   
1384 O O   . LEU B 20  ? 0.1606 0.1448 0.1561 -0.0023 -0.0115 -0.0074 127 LEU B O   
1385 C CB  . LEU B 20  ? 0.1583 0.1641 0.1791 -0.0003 0.0037  0.0009  127 LEU B CB  
1386 C CG  . LEU B 20  ? 0.1346 0.1557 0.1495 -0.0026 -0.0042 -0.0034 127 LEU B CG  
1387 C CD1 . LEU B 20  ? 0.1304 0.1184 0.1323 0.0023  0.0019  -0.0039 127 LEU B CD1 
1388 C CD2 . LEU B 20  ? 0.1484 0.1496 0.1409 -0.0098 0.0009  0.0077  127 LEU B CD2 
1389 N N   . ARG B 21  ? 0.1425 0.1550 0.1470 -0.0037 -0.0048 0.0035  128 ARG B N   
1390 C CA  . ARG B 21  ? 0.1446 0.1425 0.1428 -0.0027 0.0017  -0.0024 128 ARG B CA  
1391 C C   . ARG B 21  ? 0.1359 0.1345 0.1341 -0.0038 -0.0027 -0.0016 128 ARG B C   
1392 O O   . ARG B 21  ? 0.1515 0.1300 0.1277 0.0000  -0.0043 -0.0126 128 ARG B O   
1393 C CB  . ARG B 21  ? 0.1467 0.1539 0.1479 -0.0062 -0.0015 0.0010  128 ARG B CB  
1394 C CG  . ARG B 21  ? 0.1810 0.1919 0.1690 -0.0036 -0.0019 0.0000  128 ARG B CG  
1395 C CD  . ARG B 21  ? 0.1945 0.1952 0.1867 0.0008  0.0071  0.0064  128 ARG B CD  
1396 N NE  . ARG B 21  ? 0.1934 0.2124 0.1757 -0.0063 -0.0064 -0.0036 128 ARG B NE  
1397 C CZ  . ARG B 21  ? 0.2073 0.2141 0.1900 -0.0005 -0.0041 0.0041  128 ARG B CZ  
1398 N NH1 . ARG B 21  ? 0.2304 0.2260 0.2000 0.0000  0.0086  0.0121  128 ARG B NH1 
1399 N NH2 . ARG B 21  ? 0.2292 0.2090 0.2180 -0.0141 0.0049  0.0231  128 ARG B NH2 
1400 N N   . LEU B 22  ? 0.1355 0.1213 0.1328 -0.0066 0.0005  -0.0027 129 LEU B N   
1401 C CA  . LEU B 22  ? 0.1288 0.1245 0.1195 -0.0058 -0.0019 -0.0038 129 LEU B CA  
1402 C C   . LEU B 22  ? 0.1306 0.1194 0.1138 -0.0043 0.0009  -0.0005 129 LEU B C   
1403 O O   . LEU B 22  ? 0.1707 0.1266 0.1111 -0.0182 -0.0026 -0.0002 129 LEU B O   
1404 C CB  . LEU B 22  ? 0.1211 0.1214 0.1137 -0.0047 -0.0010 -0.0010 129 LEU B CB  
1405 C CG  . LEU B 22  ? 0.1262 0.1386 0.1172 -0.0032 0.0007  -0.0018 129 LEU B CG  
1406 C CD1 . LEU B 22  ? 0.1348 0.1678 0.1262 -0.0053 0.0049  0.0046  129 LEU B CD1 
1407 C CD2 . LEU B 22  ? 0.1241 0.1251 0.1245 -0.0131 0.0000  -0.0071 129 LEU B CD2 
1408 N N   . LYS B 23  ? 0.1053 0.1211 0.1095 -0.0048 0.0011  -0.0033 130 LYS B N   
1409 C CA  . LYS B 23  ? 0.1113 0.1133 0.1084 0.0000  -0.0030 -0.0011 130 LYS B CA  
1410 C C   . LYS B 23  ? 0.1164 0.1204 0.1115 -0.0057 -0.0008 0.0003  130 LYS B C   
1411 O O   . LYS B 23  ? 0.0997 0.1104 0.1076 0.0011  0.0008  -0.0047 130 LYS B O   
1412 C CB  . LYS B 23  ? 0.1195 0.1399 0.1261 -0.0117 -0.0019 -0.0070 130 LYS B CB  
1413 C CG  . LYS B 23  ? 0.1392 0.1402 0.1245 -0.0080 0.0102  0.0072  130 LYS B CG  
1414 C CD  . LYS B 23  ? 0.1601 0.1714 0.1860 0.0032  0.0026  0.0054  130 LYS B CD  
1415 C CE  . LYS B 23  ? 0.2021 0.2012 0.2058 0.0039  0.0052  -0.0059 130 LYS B CE  
1416 N NZ  . LYS B 23  ? 0.2164 0.2412 0.2174 0.0001  0.0130  -0.0152 130 LYS B NZ  
1417 N N   . SER B 24  ? 0.1219 0.1278 0.1203 -0.0056 0.0017  0.0040  131 SER B N   
1418 C CA  . SER B 24  ? 0.1242 0.1230 0.1131 -0.0071 0.0046  0.0046  131 SER B CA  
1419 C C   . SER B 24  ? 0.1295 0.1249 0.1137 -0.0071 0.0044  0.0069  131 SER B C   
1420 O O   . SER B 24  ? 0.1203 0.1372 0.1093 -0.0122 0.0128  0.0000  131 SER B O   
1421 C CB  . SER B 24  ? 0.1381 0.1391 0.1386 -0.0068 -0.0006 0.0075  131 SER B CB  
1422 O OG  . SER B 24  ? 0.1537 0.1751 0.1256 -0.0215 -0.0030 0.0222  131 SER B OG  
1423 N N   . ILE B 25  ? 0.1347 0.1162 0.1101 -0.0039 0.0095  -0.0016 132 ILE B N   
1424 C CA  . ILE B 25  ? 0.1277 0.1207 0.1272 -0.0035 0.0006  0.0000  132 ILE B CA  
1425 C C   . ILE B 25  ? 0.1218 0.1104 0.1233 -0.0007 -0.0024 -0.0032 132 ILE B C   
1426 O O   . ILE B 25  ? 0.1154 0.1067 0.1194 -0.0033 -0.0131 -0.0095 132 ILE B O   
1427 C CB  . ILE B 25  ? 0.1387 0.1407 0.1442 -0.0032 0.0035  -0.0023 132 ILE B CB  
1428 C CG1 . ILE B 25  ? 0.1496 0.1501 0.1527 -0.0105 -0.0014 -0.0017 132 ILE B CG1 
1429 C CG2 . ILE B 25  ? 0.1504 0.1464 0.1675 0.0053  -0.0023 -0.0062 132 ILE B CG2 
1430 C CD1 . ILE B 25  ? 0.1858 0.1849 0.1893 -0.0025 -0.0066 0.0067  132 ILE B CD1 
1431 N N   . ASP B 26  ? 0.1195 0.1261 0.1195 -0.0045 0.0049  -0.0074 133 ASP B N   
1432 C CA  . ASP B 26  ? 0.1172 0.1187 0.1182 -0.0076 0.0016  -0.0055 133 ASP B CA  
1433 C C   . ASP B 26  ? 0.1085 0.1105 0.1009 -0.0068 -0.0008 -0.0025 133 ASP B C   
1434 O O   . ASP B 26  ? 0.0885 0.1030 0.0867 -0.0064 -0.0025 -0.0033 133 ASP B O   
1435 C CB  . ASP B 26  ? 0.1162 0.1313 0.1313 -0.0053 -0.0018 -0.0081 133 ASP B CB  
1436 C CG  . ASP B 26  ? 0.1551 0.1562 0.1569 -0.0059 0.0053  -0.0042 133 ASP B CG  
1437 O OD1 . ASP B 26  ? 0.1863 0.2015 0.1765 -0.0347 0.0279  -0.0039 133 ASP B OD1 
1438 O OD2 . ASP B 26  ? 0.1256 0.2239 0.2302 0.0196  0.0138  -0.0232 133 ASP B OD2 
1439 N N   . ASN B 27  ? 0.1070 0.1087 0.0920 -0.0071 0.0023  0.0039  134 ASN B N   
1440 C CA  . ASN B 27  ? 0.1267 0.1246 0.1112 -0.0015 -0.0035 -0.0010 134 ASN B CA  
1441 C C   . ASN B 27  ? 0.1039 0.1047 0.0915 -0.0062 0.0007  -0.0005 134 ASN B C   
1442 O O   . ASN B 27  ? 0.1144 0.1177 0.0932 0.0037  0.0004  -0.0091 134 ASN B O   
1443 C CB  . ASN B 27  ? 0.1319 0.1330 0.1233 -0.0004 -0.0057 -0.0068 134 ASN B CB  
1444 C CG  . ASN B 27  ? 0.2199 0.2038 0.1735 0.0014  -0.0154 0.0071  134 ASN B CG  
1445 O OD1 . ASN B 27  ? 0.2835 0.2462 0.2379 0.0321  -0.0334 -0.0045 134 ASN B OD1 
1446 N ND2 . ASN B 27  ? 0.2431 0.2656 0.2304 -0.0072 0.0120  -0.0163 134 ASN B ND2 
1447 N N   . GLY B 28  ? 0.0968 0.1014 0.0791 -0.0087 0.0009  0.0051  135 GLY B N   
1448 C CA  . GLY B 28  ? 0.0965 0.0948 0.0811 -0.0054 0.0060  -0.0077 135 GLY B CA  
1449 C C   . GLY B 28  ? 0.0883 0.0905 0.0812 -0.0087 0.0014  -0.0007 135 GLY B C   
1450 O O   . GLY B 28  ? 0.0971 0.0853 0.0776 -0.0106 -0.0018 -0.0019 135 GLY B O   
1451 N N   . ILE B 29  ? 0.0938 0.0824 0.0732 -0.0055 0.0018  0.0018  136 ILE B N   
1452 C CA  . ILE B 29  ? 0.0910 0.0931 0.0846 -0.0088 0.0002  0.0040  136 ILE B CA  
1453 C C   . ILE B 29  ? 0.0917 0.0968 0.0783 -0.0110 -0.0020 0.0053  136 ILE B C   
1454 O O   . ILE B 29  ? 0.0924 0.0802 0.0638 -0.0252 -0.0017 0.0066  136 ILE B O   
1455 C CB  . ILE B 29  ? 0.0895 0.0923 0.0865 -0.0042 -0.0011 0.0030  136 ILE B CB  
1456 C CG1 . ILE B 29  ? 0.0998 0.1133 0.0967 -0.0086 -0.0023 0.0109  136 ILE B CG1 
1457 C CG2 . ILE B 29  ? 0.1022 0.0986 0.0970 -0.0086 0.0058  -0.0002 136 ILE B CG2 
1458 C CD1 . ILE B 29  ? 0.1222 0.1102 0.1122 -0.0017 -0.0005 0.0212  136 ILE B CD1 
1459 N N   . PHE B 30  ? 0.0874 0.0876 0.0881 -0.0119 0.0002  0.0083  137 PHE B N   
1460 C CA  . PHE B 30  ? 0.0930 0.0791 0.0871 -0.0091 -0.0024 0.0029  137 PHE B CA  
1461 C C   . PHE B 30  ? 0.1006 0.0934 0.1076 -0.0139 -0.0064 0.0070  137 PHE B C   
1462 O O   . PHE B 30  ? 0.1113 0.0980 0.1353 -0.0245 -0.0157 0.0051  137 PHE B O   
1463 C CB  . PHE B 30  ? 0.0950 0.0786 0.1089 -0.0063 -0.0057 0.0037  137 PHE B CB  
1464 C CG  . PHE B 30  ? 0.0829 0.0678 0.0929 -0.0037 -0.0030 -0.0138 137 PHE B CG  
1465 C CD1 . PHE B 30  ? 0.0906 0.0979 0.0845 0.0022  0.0088  0.0033  137 PHE B CD1 
1466 C CD2 . PHE B 30  ? 0.0908 0.0900 0.0797 -0.0143 -0.0037 0.0056  137 PHE B CD2 
1467 C CE1 . PHE B 30  ? 0.1045 0.0970 0.0858 0.0033  -0.0003 -0.0091 137 PHE B CE1 
1468 C CE2 . PHE B 30  ? 0.1277 0.1014 0.1218 0.0035  -0.0146 -0.0038 137 PHE B CE2 
1469 C CZ  . PHE B 30  ? 0.1277 0.1249 0.1053 0.0020  -0.0042 0.0049  137 PHE B CZ  
1470 N N   . VAL B 31  ? 0.1091 0.1035 0.1135 -0.0126 -0.0076 -0.0016 138 VAL B N   
1471 C CA  . VAL B 31  ? 0.1119 0.1052 0.1186 -0.0041 -0.0028 -0.0021 138 VAL B CA  
1472 C C   . VAL B 31  ? 0.1276 0.1205 0.1289 -0.0037 0.0005  0.0002  138 VAL B C   
1473 O O   . VAL B 31  ? 0.1237 0.1063 0.1326 0.0016  0.0133  0.0194  138 VAL B O   
1474 C CB  . VAL B 31  ? 0.1156 0.1086 0.1206 -0.0014 -0.0008 -0.0042 138 VAL B CB  
1475 C CG1 . VAL B 31  ? 0.1149 0.1220 0.1174 0.0000  -0.0114 -0.0008 138 VAL B CG1 
1476 C CG2 . VAL B 31  ? 0.1194 0.1172 0.1188 0.0024  -0.0086 -0.0004 138 VAL B CG2 
1477 N N   . GLN B 32  ? 0.1428 0.1247 0.1400 -0.0030 -0.0052 0.0038  139 GLN B N   
1478 C CA  . GLN B 32  ? 0.1519 0.1485 0.1507 0.0002  0.0028  0.0011  139 GLN B CA  
1479 C C   . GLN B 32  ? 0.1536 0.1495 0.1593 -0.0027 0.0042  -0.0012 139 GLN B C   
1480 O O   . GLN B 32  ? 0.1668 0.1635 0.1881 -0.0102 0.0115  -0.0054 139 GLN B O   
1481 C CB  . GLN B 32  ? 0.1692 0.1660 0.1794 0.0049  -0.0041 0.0033  139 GLN B CB  
1482 C CG  . GLN B 32  ? 0.2155 0.2056 0.1932 -0.0071 -0.0042 0.0006  139 GLN B CG  
1483 C CD  . GLN B 32  ? 0.2060 0.2117 0.2086 0.0063  0.0057  0.0004  139 GLN B CD  
1484 O OE1 . GLN B 32  ? 0.1738 0.2328 0.1613 -0.0236 -0.0132 0.0204  139 GLN B OE1 
1485 N NE2 . GLN B 32  ? 0.2185 0.2372 0.1835 -0.0202 -0.0011 -0.0077 139 GLN B NE2 
1486 N N   . LEU B 33  ? 0.1409 0.1347 0.1407 -0.0063 -0.0001 0.0023  140 LEU B N   
1487 C CA  . LEU B 33  ? 0.1380 0.1377 0.1337 -0.0033 -0.0027 0.0005  140 LEU B CA  
1488 C C   . LEU B 33  ? 0.1395 0.1417 0.1355 -0.0033 -0.0030 -0.0018 140 LEU B C   
1489 O O   . LEU B 33  ? 0.1424 0.1564 0.1251 -0.0145 -0.0055 -0.0207 140 LEU B O   
1490 C CB  . LEU B 33  ? 0.1388 0.1379 0.1251 -0.0051 -0.0026 -0.0027 140 LEU B CB  
1491 C CG  . LEU B 33  ? 0.1402 0.1445 0.1467 -0.0087 0.0090  -0.0021 140 LEU B CG  
1492 C CD1 . LEU B 33  ? 0.1538 0.1437 0.1682 -0.0159 0.0016  0.0049  140 LEU B CD1 
1493 C CD2 . LEU B 33  ? 0.1483 0.1543 0.1413 -0.0050 0.0005  0.0081  140 LEU B CD2 
1494 N N   . VAL B 34  ? 0.1310 0.1413 0.1323 -0.0117 -0.0066 -0.0018 141 VAL B N   
1495 C CA  . VAL B 34  ? 0.1296 0.1426 0.1421 -0.0053 0.0000  -0.0005 141 VAL B CA  
1496 C C   . VAL B 34  ? 0.1376 0.1488 0.1390 -0.0054 -0.0011 0.0000  141 VAL B C   
1497 O O   . VAL B 34  ? 0.1147 0.1617 0.1559 -0.0175 -0.0001 -0.0026 141 VAL B O   
1498 C CB  . VAL B 34  ? 0.1362 0.1461 0.1406 -0.0018 -0.0001 0.0012  141 VAL B CB  
1499 C CG1 . VAL B 34  ? 0.1374 0.1496 0.1611 -0.0028 0.0028  -0.0025 141 VAL B CG1 
1500 C CG2 . VAL B 34  ? 0.1326 0.1307 0.1513 0.0004  0.0062  0.0035  141 VAL B CG2 
1501 N N   . GLN B 35  ? 0.1545 0.1569 0.1538 -0.0077 0.0021  0.0024  142 GLN B N   
1502 C CA  . GLN B 35  ? 0.1622 0.1726 0.1673 -0.0051 -0.0023 -0.0010 142 GLN B CA  
1503 C C   . GLN B 35  ? 0.1689 0.1823 0.1758 -0.0030 -0.0005 -0.0004 142 GLN B C   
1504 O O   . GLN B 35  ? 0.1448 0.1695 0.1865 -0.0054 -0.0007 -0.0008 142 GLN B O   
1505 C CB  . GLN B 35  ? 0.1642 0.1720 0.1702 -0.0094 0.0014  -0.0042 142 GLN B CB  
1506 C CG  . GLN B 35  ? 0.1992 0.1801 0.1891 -0.0062 -0.0017 -0.0089 142 GLN B CG  
1507 C CD  . GLN B 35  ? 0.2335 0.2546 0.2334 -0.0166 0.0112  -0.0055 142 GLN B CD  
1508 O OE1 . GLN B 35  ? 0.2862 0.2819 0.2358 -0.0177 -0.0005 -0.0138 142 GLN B OE1 
1509 N NE2 . GLN B 35  ? 0.2432 0.2489 0.2301 -0.0236 -0.0096 -0.0001 142 GLN B NE2 
1510 N N   . ALA B 36  ? 0.1697 0.2011 0.1872 -0.0061 -0.0048 0.0000  143 ALA B N   
1511 C CA  . ALA B 36  ? 0.1870 0.2129 0.1993 -0.0033 -0.0020 0.0005  143 ALA B CA  
1512 C C   . ALA B 36  ? 0.1988 0.2170 0.2103 -0.0076 -0.0080 -0.0053 143 ALA B C   
1513 O O   . ALA B 36  ? 0.1937 0.2161 0.2105 -0.0141 -0.0083 -0.0157 143 ALA B O   
1514 C CB  . ALA B 36  ? 0.1876 0.2213 0.2018 -0.0052 -0.0071 -0.0031 143 ALA B CB  
1515 N N   . ASN B 37  ? 0.2082 0.2300 0.2085 -0.0067 -0.0070 -0.0023 144 ASN B N   
1516 C CA  . ASN B 37  ? 0.2329 0.2397 0.2318 -0.0008 -0.0011 -0.0055 144 ASN B CA  
1517 C C   . ASN B 37  ? 0.2276 0.2242 0.2161 -0.0026 -0.0022 -0.0058 144 ASN B C   
1518 O O   . ASN B 37  ? 0.2545 0.2478 0.2447 0.0005  -0.0076 -0.0119 144 ASN B O   
1519 C CB  . ASN B 37  ? 0.2548 0.2530 0.2420 -0.0064 0.0008  -0.0078 144 ASN B CB  
1520 C CG  . ASN B 37  ? 0.2838 0.3007 0.2811 0.0036  -0.0047 -0.0001 144 ASN B CG  
1521 O OD1 . ASN B 37  ? 0.3169 0.3551 0.3549 -0.0075 -0.0056 -0.0096 144 ASN B OD1 
1522 N ND2 . ASN B 37  ? 0.3320 0.3180 0.3291 0.0111  -0.0103 0.0043  144 ASN B ND2 
1523 N N   . SER B 38  ? 0.2077 0.2076 0.2023 0.0015  0.0019  -0.0055 145 SER B N   
1524 C CA  . SER B 38  ? 0.1952 0.1932 0.1889 -0.0007 0.0001  -0.0078 145 SER B CA  
1525 C C   . SER B 38  ? 0.1895 0.1824 0.1776 -0.0006 -0.0009 -0.0063 145 SER B C   
1526 O O   . SER B 38  ? 0.1662 0.1819 0.1688 0.0027  -0.0168 -0.0148 145 SER B O   
1527 C CB  . SER B 38  ? 0.2007 0.1847 0.1840 -0.0005 0.0067  -0.0054 145 SER B CB  
1528 O OG  . SER B 38  ? 0.1816 0.1679 0.1499 -0.0022 -0.0109 -0.0217 145 SER B OG  
1529 N N   . PRO B 39  ? 0.1711 0.1755 0.1646 -0.0018 0.0028  -0.0013 146 PRO B N   
1530 C CA  . PRO B 39  ? 0.1778 0.1761 0.1732 0.0007  0.0007  -0.0028 146 PRO B CA  
1531 C C   . PRO B 39  ? 0.1620 0.1648 0.1528 -0.0035 0.0004  -0.0005 146 PRO B C   
1532 O O   . PRO B 39  ? 0.1524 0.1734 0.1492 0.0019  0.0103  0.0037  146 PRO B O   
1533 C CB  . PRO B 39  ? 0.1666 0.1753 0.1709 -0.0015 -0.0032 0.0000  146 PRO B CB  
1534 C CG  . PRO B 39  ? 0.1780 0.1774 0.1679 -0.0027 0.0024  -0.0063 146 PRO B CG  
1535 C CD  . PRO B 39  ? 0.1862 0.1907 0.1892 -0.0012 0.0038  0.0000  146 PRO B CD  
1536 N N   . ALA B 40  ? 0.1482 0.1447 0.1406 0.0009  0.0068  -0.0041 147 ALA B N   
1537 C CA  . ALA B 40  ? 0.1322 0.1288 0.1268 -0.0035 0.0034  -0.0022 147 ALA B CA  
1538 C C   . ALA B 40  ? 0.1262 0.1260 0.1070 -0.0002 0.0051  -0.0046 147 ALA B C   
1539 O O   . ALA B 40  ? 0.1024 0.1178 0.1176 0.0016  -0.0001 -0.0062 147 ALA B O   
1540 C CB  . ALA B 40  ? 0.1274 0.1237 0.1248 -0.0038 0.0016  -0.0016 147 ALA B CB  
1541 N N   . SER B 41  ? 0.1349 0.1283 0.1206 -0.0019 0.0011  -0.0036 148 SER B N   
1542 C CA  . SER B 41  ? 0.1526 0.1536 0.1438 0.0006  0.0005  0.0014  148 SER B CA  
1543 C C   . SER B 41  ? 0.1514 0.1543 0.1471 0.0030  0.0020  0.0038  148 SER B C   
1544 O O   . SER B 41  ? 0.1513 0.1372 0.1524 0.0041  0.0069  0.0008  148 SER B O   
1545 C CB  . SER B 41  ? 0.1649 0.1562 0.1453 -0.0043 0.0034  0.0011  148 SER B CB  
1546 O OG  . SER B 41  ? 0.2119 0.2128 0.1905 -0.0244 -0.0082 -0.0067 148 SER B OG  
1547 N N   . LEU B 42  ? 0.1519 0.1592 0.1492 0.0024  -0.0031 -0.0016 149 LEU B N   
1548 C CA  . LEU B 42  ? 0.1632 0.1666 0.1578 0.0034  0.0003  -0.0001 149 LEU B CA  
1549 C C   . LEU B 42  ? 0.1740 0.1698 0.1553 -0.0025 -0.0019 -0.0035 149 LEU B C   
1550 O O   . LEU B 42  ? 0.1927 0.1756 0.1387 -0.0088 -0.0081 -0.0036 149 LEU B O   
1551 C CB  . LEU B 42  ? 0.1786 0.1725 0.1592 -0.0007 -0.0031 0.0021  149 LEU B CB  
1552 C CG  . LEU B 42  ? 0.1995 0.1986 0.1932 -0.0036 -0.0113 0.0025  149 LEU B CG  
1553 C CD1 . LEU B 42  ? 0.2294 0.2251 0.2199 0.0018  -0.0023 -0.0017 149 LEU B CD1 
1554 C CD2 . LEU B 42  ? 0.2207 0.2069 0.2103 0.0014  -0.0100 0.0045  149 LEU B CD2 
1555 N N   . VAL B 43  ? 0.1565 0.1623 0.1354 -0.0025 0.0004  -0.0021 150 VAL B N   
1556 C CA  . VAL B 43  ? 0.1603 0.1595 0.1483 0.0014  -0.0007 -0.0084 150 VAL B CA  
1557 C C   . VAL B 43  ? 0.1496 0.1522 0.1416 -0.0017 0.0005  -0.0027 150 VAL B C   
1558 O O   . VAL B 43  ? 0.1666 0.1618 0.1334 -0.0111 -0.0084 -0.0045 150 VAL B O   
1559 C CB  . VAL B 43  ? 0.1532 0.1538 0.1543 -0.0001 0.0035  -0.0051 150 VAL B CB  
1560 C CG1 . VAL B 43  ? 0.1847 0.1721 0.1849 0.0005  0.0125  -0.0058 150 VAL B CG1 
1561 C CG2 . VAL B 43  ? 0.1516 0.1712 0.1653 -0.0002 0.0023  -0.0014 150 VAL B CG2 
1562 N N   . GLY B 44  ? 0.1313 0.1392 0.1196 0.0012  -0.0054 -0.0021 151 GLY B N   
1563 C CA  . GLY B 44  ? 0.1273 0.1149 0.1135 0.0052  -0.0003 0.0034  151 GLY B CA  
1564 C C   . GLY B 44  ? 0.1110 0.1065 0.1070 0.0062  -0.0031 -0.0022 151 GLY B C   
1565 O O   . GLY B 44  ? 0.1353 0.1121 0.0851 0.0068  -0.0042 0.0028  151 GLY B O   
1566 N N   . LEU B 45  ? 0.1095 0.1096 0.0971 0.0061  -0.0041 -0.0007 152 LEU B N   
1567 C CA  . LEU B 45  ? 0.1029 0.1099 0.1064 -0.0003 0.0027  -0.0030 152 LEU B CA  
1568 C C   . LEU B 45  ? 0.0978 0.1132 0.1102 -0.0040 0.0032  -0.0010 152 LEU B C   
1569 O O   . LEU B 45  ? 0.0823 0.1206 0.1167 -0.0105 0.0106  -0.0051 152 LEU B O   
1570 C CB  . LEU B 45  ? 0.1020 0.1104 0.1118 -0.0050 -0.0056 -0.0037 152 LEU B CB  
1571 C CG  . LEU B 45  ? 0.1308 0.1628 0.1319 0.0016  0.0086  -0.0026 152 LEU B CG  
1572 C CD1 . LEU B 45  ? 0.1483 0.1605 0.1614 -0.0033 -0.0029 -0.0036 152 LEU B CD1 
1573 C CD2 . LEU B 45  ? 0.1553 0.1670 0.1982 -0.0103 0.0000  0.0022  152 LEU B CD2 
1574 N N   . ARG B 46  ? 0.1074 0.1084 0.1178 -0.0057 0.0028  0.0003  153 ARG B N   
1575 C CA  . ARG B 46  ? 0.1145 0.1294 0.1241 0.0023  0.0047  -0.0020 153 ARG B CA  
1576 C C   . ARG B 46  ? 0.1070 0.1220 0.1236 0.0019  0.0057  -0.0005 153 ARG B C   
1577 O O   . ARG B 46  ? 0.0753 0.1187 0.1153 0.0110  0.0116  -0.0070 153 ARG B O   
1578 C CB  . ARG B 46  ? 0.1360 0.1606 0.1529 0.0049  0.0000  -0.0037 153 ARG B CB  
1579 C CG  . ARG B 46  ? 0.1702 0.1910 0.2009 -0.0035 0.0055  0.0071  153 ARG B CG  
1580 C CD  . ARG B 46  ? 0.2172 0.2481 0.2298 0.0038  -0.0076 0.0144  153 ARG B CD  
1581 N NE  . ARG B 46  ? 0.2849 0.3022 0.2724 0.0013  0.0008  -0.0058 153 ARG B NE  
1582 C CZ  . ARG B 46  ? 0.3005 0.2973 0.2831 0.0015  -0.0046 0.0045  153 ARG B CZ  
1583 N NH1 . ARG B 46  ? 0.3287 0.3459 0.3187 0.0085  0.0035  0.0051  153 ARG B NH1 
1584 N NH2 . ARG B 46  ? 0.2673 0.2720 0.2857 -0.0039 0.0008  0.0122  153 ARG B NH2 
1585 N N   . PHE B 47  ? 0.0931 0.1215 0.1079 -0.0017 0.0096  0.0029  154 PHE B N   
1586 C CA  . PHE B 47  ? 0.0903 0.1136 0.1047 -0.0019 0.0022  -0.0003 154 PHE B CA  
1587 C C   . PHE B 47  ? 0.0877 0.1101 0.1067 -0.0014 0.0053  0.0019  154 PHE B C   
1588 O O   . PHE B 47  ? 0.0881 0.1316 0.1152 -0.0080 0.0072  0.0141  154 PHE B O   
1589 C CB  . PHE B 47  ? 0.0809 0.1081 0.0959 -0.0046 0.0014  -0.0014 154 PHE B CB  
1590 C CG  . PHE B 47  ? 0.1048 0.1354 0.1198 0.0026  0.0106  0.0019  154 PHE B CG  
1591 C CD1 . PHE B 47  ? 0.1226 0.1569 0.1266 -0.0045 0.0028  0.0044  154 PHE B CD1 
1592 C CD2 . PHE B 47  ? 0.1130 0.1410 0.1259 -0.0163 0.0060  -0.0041 154 PHE B CD2 
1593 C CE1 . PHE B 47  ? 0.1613 0.1633 0.1387 -0.0046 0.0016  -0.0008 154 PHE B CE1 
1594 C CE2 . PHE B 47  ? 0.1049 0.1428 0.1325 -0.0071 0.0027  -0.0019 154 PHE B CE2 
1595 C CZ  . PHE B 47  ? 0.0970 0.1513 0.0848 -0.0001 0.0141  -0.0028 154 PHE B CZ  
1596 N N   . GLY B 48  ? 0.0906 0.0962 0.0908 0.0034  0.0052  -0.0003 155 GLY B N   
1597 C CA  . GLY B 48  ? 0.0898 0.0907 0.0938 -0.0018 0.0027  -0.0044 155 GLY B CA  
1598 C C   . GLY B 48  ? 0.0751 0.0890 0.0978 0.0011  0.0036  -0.0075 155 GLY B C   
1599 O O   . GLY B 48  ? 0.0894 0.1082 0.1169 -0.0003 -0.0035 -0.0195 155 GLY B O   
1600 N N   . ASP B 49  ? 0.0691 0.0965 0.0737 -0.0136 -0.0072 0.0009  156 ASP B N   
1601 C CA  . ASP B 49  ? 0.0625 0.0859 0.0720 0.0036  -0.0014 0.0042  156 ASP B CA  
1602 C C   . ASP B 49  ? 0.0773 0.1008 0.0944 0.0002  -0.0018 0.0017  156 ASP B C   
1603 O O   . ASP B 49  ? 0.0485 0.1064 0.0727 -0.0090 0.0106  0.0110  156 ASP B O   
1604 C CB  . ASP B 49  ? 0.0722 0.0881 0.0819 -0.0085 -0.0053 0.0048  156 ASP B CB  
1605 C CG  . ASP B 49  ? 0.0953 0.0849 0.0824 -0.0006 -0.0053 -0.0015 156 ASP B CG  
1606 O OD1 . ASP B 49  ? 0.0503 0.0895 0.0956 0.0051  -0.0032 0.0036  156 ASP B OD1 
1607 O OD2 . ASP B 49  ? 0.0694 0.1160 0.0553 -0.0192 0.0071  -0.0058 156 ASP B OD2 
1608 N N   . GLN B 50  ? 0.0691 0.0913 0.0874 0.0006  0.0127  0.0019  157 GLN B N   
1609 C CA  . GLN B 50  ? 0.0834 0.0917 0.0834 0.0017  -0.0015 0.0041  157 GLN B CA  
1610 C C   . GLN B 50  ? 0.0838 0.0920 0.0821 0.0022  0.0003  0.0038  157 GLN B C   
1611 O O   . GLN B 50  ? 0.1063 0.1176 0.1113 -0.0015 0.0157  0.0116  157 GLN B O   
1612 C CB  . GLN B 50  ? 0.0957 0.0920 0.0939 0.0088  -0.0014 0.0046  157 GLN B CB  
1613 C CG  . GLN B 50  ? 0.0850 0.1005 0.0913 -0.0027 -0.0060 -0.0018 157 GLN B CG  
1614 C CD  . GLN B 50  ? 0.0735 0.0946 0.0722 0.0001  -0.0056 0.0034  157 GLN B CD  
1615 O OE1 . GLN B 50  ? 0.0860 0.1269 0.1176 0.0099  -0.0116 -0.0052 157 GLN B OE1 
1616 N NE2 . GLN B 50  ? 0.0600 0.1080 0.0356 -0.0004 -0.0036 0.0021  157 GLN B NE2 
1617 N N   . VAL B 51  ? 0.0790 0.0868 0.0735 0.0006  -0.0002 0.0003  158 VAL B N   
1618 C CA  . VAL B 51  ? 0.0787 0.0877 0.0770 0.0062  -0.0010 0.0018  158 VAL B CA  
1619 C C   . VAL B 51  ? 0.0848 0.0801 0.0803 0.0034  0.0000  0.0009  158 VAL B C   
1620 O O   . VAL B 51  ? 0.1017 0.0938 0.0792 0.0069  -0.0075 0.0080  158 VAL B O   
1621 C CB  . VAL B 51  ? 0.0743 0.0969 0.0823 0.0009  0.0011  -0.0068 158 VAL B CB  
1622 C CG1 . VAL B 51  ? 0.1065 0.1150 0.0995 -0.0055 -0.0025 -0.0223 158 VAL B CG1 
1623 C CG2 . VAL B 51  ? 0.1015 0.0963 0.0954 -0.0072 0.0030  -0.0063 158 VAL B CG2 
1624 N N   . LEU B 52  ? 0.0816 0.0765 0.0902 0.0103  0.0076  0.0023  159 LEU B N   
1625 C CA  . LEU B 52  ? 0.0850 0.0763 0.0762 -0.0006 -0.0031 0.0003  159 LEU B CA  
1626 C C   . LEU B 52  ? 0.0780 0.0756 0.0767 -0.0034 -0.0024 0.0049  159 LEU B C   
1627 O O   . LEU B 52  ? 0.0925 0.0911 0.0596 -0.0199 -0.0128 -0.0028 159 LEU B O   
1628 C CB  . LEU B 52  ? 0.0867 0.0821 0.0845 0.0006  0.0082  0.0064  159 LEU B CB  
1629 C CG  . LEU B 52  ? 0.1219 0.1060 0.1326 0.0026  0.0035  0.0044  159 LEU B CG  
1630 C CD1 . LEU B 52  ? 0.1409 0.1057 0.1597 0.0017  0.0069  0.0137  159 LEU B CD1 
1631 C CD2 . LEU B 52  ? 0.1469 0.1314 0.1391 0.0019  0.0081  0.0061  159 LEU B CD2 
1632 N N   . GLN B 53  ? 0.0831 0.0835 0.0636 0.0029  -0.0123 0.0064  160 GLN B N   
1633 C CA  . GLN B 53  ? 0.0877 0.0968 0.0810 0.0022  -0.0005 0.0017  160 GLN B CA  
1634 C C   . GLN B 53  ? 0.0946 0.1024 0.0828 0.0022  0.0021  0.0021  160 GLN B C   
1635 O O   . GLN B 53  ? 0.0913 0.1236 0.0850 0.0073  0.0066  -0.0109 160 GLN B O   
1636 C CB  . GLN B 53  ? 0.0804 0.0858 0.0786 -0.0030 -0.0037 0.0026  160 GLN B CB  
1637 C CG  . GLN B 53  ? 0.0730 0.1048 0.0879 0.0053  -0.0018 -0.0043 160 GLN B CG  
1638 C CD  . GLN B 53  ? 0.0908 0.0879 0.0955 -0.0127 0.0019  0.0042  160 GLN B CD  
1639 O OE1 . GLN B 53  ? 0.0880 0.0924 0.1234 -0.0110 -0.0190 -0.0137 160 GLN B OE1 
1640 N NE2 . GLN B 53  ? 0.1225 0.1049 0.1049 -0.0085 -0.0072 0.0001  160 GLN B NE2 
1641 N N   . ILE B 54  ? 0.1022 0.1071 0.0944 0.0050  0.0002  0.0027  161 ILE B N   
1642 C CA  . ILE B 54  ? 0.0938 0.1072 0.0926 0.0083  0.0005  -0.0015 161 ILE B CA  
1643 C C   . ILE B 54  ? 0.0873 0.1072 0.0950 0.0093  -0.0005 -0.0008 161 ILE B C   
1644 O O   . ILE B 54  ? 0.0861 0.1113 0.0553 0.0182  -0.0002 -0.0205 161 ILE B O   
1645 C CB  . ILE B 54  ? 0.0979 0.0991 0.0989 0.0066  -0.0007 0.0000  161 ILE B CB  
1646 C CG1 . ILE B 54  ? 0.1009 0.1108 0.1102 0.0007  0.0018  -0.0046 161 ILE B CG1 
1647 C CG2 . ILE B 54  ? 0.1053 0.0996 0.0750 -0.0041 0.0001  -0.0019 161 ILE B CG2 
1648 C CD1 . ILE B 54  ? 0.1413 0.1293 0.1248 -0.0058 0.0063  -0.0059 161 ILE B CD1 
1649 N N   . ASN B 55  ? 0.0867 0.1143 0.0871 0.0083  -0.0074 -0.0040 162 ASN B N   
1650 C CA  . ASN B 55  ? 0.1201 0.1289 0.1073 0.0067  0.0031  -0.0048 162 ASN B CA  
1651 C C   . ASN B 55  ? 0.1351 0.1530 0.1274 0.0087  -0.0007 -0.0035 162 ASN B C   
1652 O O   . ASN B 55  ? 0.1485 0.1883 0.1377 0.0187  -0.0001 -0.0151 162 ASN B O   
1653 C CB  . ASN B 55  ? 0.1322 0.1320 0.1182 0.0110  -0.0029 -0.0078 162 ASN B CB  
1654 C CG  . ASN B 55  ? 0.1279 0.1319 0.1180 0.0119  -0.0048 -0.0017 162 ASN B CG  
1655 O OD1 . ASN B 55  ? 0.1386 0.1044 0.1052 0.0337  -0.0141 -0.0054 162 ASN B OD1 
1656 N ND2 . ASN B 55  ? 0.1418 0.1506 0.1277 -0.0021 0.0002  0.0039  162 ASN B ND2 
1657 N N   . GLY B 56  ? 0.1551 0.1585 0.1475 -0.0057 0.0005  -0.0093 163 GLY B N   
1658 C CA  . GLY B 56  ? 0.1516 0.1684 0.1518 -0.0023 0.0048  -0.0056 163 GLY B CA  
1659 C C   . GLY B 56  ? 0.1426 0.1575 0.1432 -0.0034 -0.0031 0.0005  163 GLY B C   
1660 O O   . GLY B 56  ? 0.1757 0.1871 0.1560 -0.0070 0.0076  -0.0091 163 GLY B O   
1661 N N   . GLU B 57  ? 0.1227 0.1453 0.1323 -0.0010 -0.0028 -0.0056 164 GLU B N   
1662 C CA  . GLU B 57  ? 0.1221 0.1426 0.1284 0.0035  0.0016  0.0015  164 GLU B CA  
1663 C C   . GLU B 57  ? 0.1016 0.1127 0.1023 -0.0032 0.0021  0.0026  164 GLU B C   
1664 O O   . GLU B 57  ? 0.0949 0.1171 0.0879 0.0120  -0.0138 0.0022  164 GLU B O   
1665 C CB  . GLU B 57  ? 0.1527 0.1559 0.1514 -0.0024 -0.0022 -0.0030 164 GLU B CB  
1666 C CG  . GLU B 57  ? 0.2193 0.2223 0.2080 0.0132  0.0080  -0.0083 164 GLU B CG  
1667 C CD  . GLU B 57  ? 0.2806 0.3207 0.3185 -0.0087 -0.0011 -0.0001 164 GLU B CD  
1668 O OE1 . GLU B 57  ? 0.3655 0.4012 0.3447 -0.0072 -0.0131 -0.0089 164 GLU B OE1 
1669 O OE2 . GLU B 57  ? 0.3391 0.3640 0.3461 0.0013  0.0200  -0.0010 164 GLU B OE2 
1670 N N   . ASN B 58  ? 0.0761 0.1090 0.0907 0.0009  -0.0008 0.0122  165 ASN B N   
1671 C CA  . ASN B 58  ? 0.0986 0.0910 0.0910 0.0009  0.0003  0.0088  165 ASN B CA  
1672 C C   . ASN B 58  ? 0.0959 0.0941 0.0965 0.0018  0.0007  0.0096  165 ASN B C   
1673 O O   . ASN B 58  ? 0.1011 0.0858 0.1052 0.0101  -0.0026 0.0289  165 ASN B O   
1674 C CB  . ASN B 58  ? 0.0939 0.0982 0.0961 0.0004  -0.0066 0.0104  165 ASN B CB  
1675 C CG  . ASN B 58  ? 0.1226 0.1242 0.1124 -0.0146 -0.0011 0.0108  165 ASN B CG  
1676 O OD1 . ASN B 58  ? 0.1278 0.1119 0.1322 -0.0241 -0.0050 0.0071  165 ASN B OD1 
1677 N ND2 . ASN B 58  ? 0.1328 0.1487 0.1718 -0.0302 0.0027  0.0167  165 ASN B ND2 
1678 N N   . CYS B 59  ? 0.0895 0.0841 0.0817 -0.0019 0.0012  0.0068  166 CYS B N   
1679 C CA  . CYS B 59  ? 0.1001 0.0980 0.0916 -0.0019 0.0019  0.0030  166 CYS B CA  
1680 C C   . CYS B 59  ? 0.0886 0.0926 0.0828 -0.0060 -0.0032 0.0039  166 CYS B C   
1681 O O   . CYS B 59  ? 0.0915 0.1085 0.0874 -0.0131 0.0032  0.0114  166 CYS B O   
1682 C CB  . CYS B 59  ? 0.0928 0.0924 0.0825 -0.0093 -0.0019 -0.0014 166 CYS B CB  
1683 S SG  . CYS B 59  ? 0.1239 0.1390 0.0742 -0.0130 -0.0214 -0.0069 166 CYS B SG  
1684 N N   . ALA B 60  ? 0.0963 0.0968 0.0824 -0.0088 0.0033  0.0007  167 ALA B N   
1685 C CA  . ALA B 60  ? 0.1038 0.1024 0.0959 -0.0066 -0.0010 0.0005  167 ALA B CA  
1686 C C   . ALA B 60  ? 0.0974 0.0955 0.0860 -0.0083 -0.0040 -0.0007 167 ALA B C   
1687 O O   . ALA B 60  ? 0.0923 0.1010 0.0764 -0.0227 0.0023  0.0025  167 ALA B O   
1688 C CB  . ALA B 60  ? 0.1255 0.1140 0.1076 -0.0132 0.0000  0.0010  167 ALA B CB  
1689 N N   . GLY B 61  ? 0.0926 0.0974 0.0906 -0.0122 -0.0070 -0.0020 168 GLY B N   
1690 C CA  . GLY B 61  ? 0.0999 0.1014 0.1001 -0.0019 -0.0025 0.0047  168 GLY B CA  
1691 C C   . GLY B 61  ? 0.1127 0.1079 0.1046 -0.0073 -0.0059 0.0060  168 GLY B C   
1692 O O   . GLY B 61  ? 0.1378 0.1286 0.1082 -0.0080 -0.0159 0.0162  168 GLY B O   
1693 N N   . TRP B 62  ? 0.1025 0.0980 0.0961 -0.0071 0.0017  0.0009  169 TRP B N   
1694 C CA  . TRP B 62  ? 0.1038 0.1024 0.1033 -0.0030 0.0002  -0.0003 169 TRP B CA  
1695 C C   . TRP B 62  ? 0.0933 0.0949 0.1001 0.0004  -0.0036 0.0012  169 TRP B C   
1696 O O   . TRP B 62  ? 0.0866 0.0864 0.0861 0.0077  -0.0102 -0.0034 169 TRP B O   
1697 C CB  . TRP B 62  ? 0.1059 0.1088 0.1049 0.0012  0.0006  0.0035  169 TRP B CB  
1698 C CG  . TRP B 62  ? 0.1205 0.1114 0.1222 -0.0018 0.0027  0.0089  169 TRP B CG  
1699 C CD1 . TRP B 62  ? 0.1262 0.1215 0.1421 0.0048  -0.0003 0.0006  169 TRP B CD1 
1700 C CD2 . TRP B 62  ? 0.1366 0.1182 0.1240 0.0092  0.0018  0.0146  169 TRP B CD2 
1701 N NE1 . TRP B 62  ? 0.1225 0.1239 0.1355 0.0019  0.0007  0.0080  169 TRP B NE1 
1702 C CE2 . TRP B 62  ? 0.1610 0.1219 0.1388 0.0027  0.0005  0.0086  169 TRP B CE2 
1703 C CE3 . TRP B 62  ? 0.1627 0.1414 0.1431 -0.0004 0.0064  0.0031  169 TRP B CE3 
1704 C CZ2 . TRP B 62  ? 0.1764 0.1349 0.1482 -0.0080 0.0076  0.0074  169 TRP B CZ2 
1705 C CZ3 . TRP B 62  ? 0.1918 0.1514 0.1613 0.0049  0.0003  -0.0109 169 TRP B CZ3 
1706 C CH2 . TRP B 62  ? 0.1882 0.1625 0.1412 -0.0001 0.0042  0.0030  169 TRP B CH2 
1707 N N   . SER B 63  ? 0.1041 0.0977 0.0916 -0.0038 -0.0024 0.0048  170 SER B N   
1708 C CA  . SER B 63  ? 0.1025 0.0961 0.0999 0.0011  0.0022  0.0013  170 SER B CA  
1709 C C   . SER B 63  ? 0.1067 0.0990 0.1008 0.0001  0.0011  0.0067  170 SER B C   
1710 O O   . SER B 63  ? 0.1187 0.1089 0.1007 -0.0124 0.0093  0.0198  170 SER B O   
1711 C CB  . SER B 63  ? 0.1050 0.1049 0.0874 0.0014  0.0046  0.0053  170 SER B CB  
1712 O OG  . SER B 63  ? 0.1135 0.0997 0.1168 -0.0159 0.0169  -0.0093 170 SER B OG  
1713 N N   . SER B 64  ? 0.1067 0.1102 0.0921 -0.0046 0.0048  0.0052  171 SER B N   
1714 C CA  . SER B 64  ? 0.1062 0.1026 0.0933 -0.0037 0.0028  0.0054  171 SER B CA  
1715 C C   . SER B 64  ? 0.1011 0.0936 0.0868 -0.0044 0.0044  0.0068  171 SER B C   
1716 O O   . SER B 64  ? 0.1176 0.0894 0.0658 -0.0056 -0.0003 0.0114  171 SER B O   
1717 C CB  . SER B 64  ? 0.1045 0.1016 0.0969 0.0034  0.0011  0.0076  171 SER B CB  
1718 O OG  . SER B 64  ? 0.1198 0.0882 0.1110 -0.0184 0.0108  -0.0087 171 SER B OG  
1719 N N   . ASP B 65  ? 0.1028 0.0947 0.0757 0.0030  0.0032  0.0032  172 ASP B N   
1720 C CA  . ASP B 65  ? 0.1144 0.1041 0.0927 -0.0012 -0.0027 0.0007  172 ASP B CA  
1721 C C   . ASP B 65  ? 0.1170 0.0992 0.0999 -0.0008 0.0026  0.0053  172 ASP B C   
1722 O O   . ASP B 65  ? 0.1398 0.0984 0.0745 -0.0133 -0.0001 0.0157  172 ASP B O   
1723 C CB  . ASP B 65  ? 0.1184 0.0837 0.1035 0.0003  0.0000  0.0064  172 ASP B CB  
1724 C CG  . ASP B 65  ? 0.1221 0.1230 0.1071 0.0031  0.0010  0.0041  172 ASP B CG  
1725 O OD1 . ASP B 65  ? 0.1183 0.1155 0.0933 -0.0009 0.0167  0.0000  172 ASP B OD1 
1726 O OD2 . ASP B 65  ? 0.1562 0.1033 0.0858 -0.0165 0.0009  -0.0036 172 ASP B OD2 
1727 N N   . LYS B 66  ? 0.1161 0.1098 0.1060 -0.0067 -0.0041 -0.0022 173 LYS B N   
1728 C CA  . LYS B 66  ? 0.1228 0.1166 0.1144 -0.0035 0.0025  0.0003  173 LYS B CA  
1729 C C   . LYS B 66  ? 0.1310 0.1173 0.1196 -0.0023 0.0001  -0.0005 173 LYS B C   
1730 O O   . LYS B 66  ? 0.1558 0.1131 0.1265 0.0034  0.0123  0.0038  173 LYS B O   
1731 C CB  . LYS B 66  ? 0.1301 0.1391 0.1235 -0.0069 -0.0004 -0.0081 173 LYS B CB  
1732 C CG  . LYS B 66  ? 0.1370 0.1398 0.1195 -0.0175 0.0006  0.0065  173 LYS B CG  
1733 C CD  . LYS B 66  ? 0.1619 0.1854 0.1591 -0.0013 -0.0092 0.0001  173 LYS B CD  
1734 C CE  . LYS B 66  ? 0.1739 0.1966 0.1918 0.0000  0.0040  0.0159  173 LYS B CE  
1735 N NZ  . LYS B 66  ? 0.1851 0.2211 0.2006 0.0072  0.0110  -0.0094 173 LYS B NZ  
1736 N N   . ALA B 67  ? 0.1257 0.1182 0.1164 -0.0053 -0.0017 -0.0040 174 ALA B N   
1737 C CA  . ALA B 67  ? 0.1367 0.1226 0.1231 -0.0028 -0.0028 0.0076  174 ALA B CA  
1738 C C   . ALA B 67  ? 0.1469 0.1347 0.1304 -0.0053 -0.0032 0.0048  174 ALA B C   
1739 O O   . ALA B 67  ? 0.1688 0.1391 0.1295 -0.0086 0.0060  0.0182  174 ALA B O   
1740 C CB  . ALA B 67  ? 0.1316 0.1388 0.1250 -0.0004 0.0044  0.0018  174 ALA B CB  
1741 N N   . HIS B 68  ? 0.1584 0.1440 0.1436 -0.0121 -0.0010 0.0071  175 HIS B N   
1742 C CA  . HIS B 68  ? 0.1664 0.1527 0.1550 -0.0069 -0.0079 -0.0009 175 HIS B CA  
1743 C C   . HIS B 68  ? 0.1736 0.1544 0.1575 -0.0081 -0.0008 0.0001  175 HIS B C   
1744 O O   . HIS B 68  ? 0.1877 0.1276 0.1595 0.0007  -0.0075 -0.0014 175 HIS B O   
1745 C CB  . HIS B 68  ? 0.1616 0.1590 0.1560 -0.0068 -0.0061 0.0080  175 HIS B CB  
1746 C CG  . HIS B 68  ? 0.2214 0.1988 0.2124 -0.0077 -0.0136 -0.0092 175 HIS B CG  
1747 N ND1 . HIS B 68  ? 0.2987 0.2581 0.2951 0.0009  -0.0072 -0.0008 175 HIS B ND1 
1748 C CD2 . HIS B 68  ? 0.2514 0.2501 0.2586 -0.0098 -0.0047 -0.0089 175 HIS B CD2 
1749 C CE1 . HIS B 68  ? 0.2916 0.2813 0.3116 -0.0028 -0.0084 -0.0019 175 HIS B CE1 
1750 N NE2 . HIS B 68  ? 0.2800 0.2553 0.2937 -0.0099 -0.0024 0.0021  175 HIS B NE2 
1751 N N   . LYS B 69  ? 0.1774 0.1535 0.1597 -0.0027 -0.0002 0.0023  176 LYS B N   
1752 C CA  . LYS B 69  ? 0.2025 0.1826 0.1849 0.0000  0.0075  0.0031  176 LYS B CA  
1753 C C   . LYS B 69  ? 0.2039 0.1756 0.1751 0.0005  0.0095  0.0000  176 LYS B C   
1754 O O   . LYS B 69  ? 0.2323 0.1808 0.1695 0.0103  0.0082  0.0008  176 LYS B O   
1755 C CB  . LYS B 69  ? 0.2003 0.1909 0.1980 -0.0047 0.0020  -0.0023 176 LYS B CB  
1756 C CG  . LYS B 69  ? 0.2473 0.2310 0.2474 0.0063  0.0073  -0.0048 176 LYS B CG  
1757 C CD  . LYS B 69  ? 0.3093 0.3112 0.2925 0.0076  -0.0108 0.0049  176 LYS B CD  
1758 C CE  . LYS B 69  ? 0.3473 0.3386 0.3406 0.0109  0.0064  -0.0020 176 LYS B CE  
1759 N NZ  . LYS B 69  ? 0.3712 0.3983 0.3695 -0.0001 -0.0073 0.0045  176 LYS B NZ  
1760 N N   . VAL B 70  ? 0.2028 0.1699 0.1702 0.0012  0.0118  0.0070  177 VAL B N   
1761 C CA  . VAL B 70  ? 0.1939 0.1615 0.1768 -0.0019 0.0116  0.0021  177 VAL B CA  
1762 C C   . VAL B 70  ? 0.2078 0.1613 0.1819 -0.0030 0.0069  0.0081  177 VAL B C   
1763 O O   . VAL B 70  ? 0.2551 0.1637 0.1999 -0.0002 0.0172  0.0048  177 VAL B O   
1764 C CB  . VAL B 70  ? 0.1843 0.1585 0.1624 -0.0019 0.0110  0.0072  177 VAL B CB  
1765 C CG1 . VAL B 70  ? 0.1996 0.1566 0.1662 -0.0101 0.0214  -0.0031 177 VAL B CG1 
1766 C CG2 . VAL B 70  ? 0.1885 0.1674 0.1768 -0.0072 0.0150  0.0072  177 VAL B CG2 
1767 N N   . LEU B 71  ? 0.2123 0.1618 0.1869 -0.0116 0.0032  0.0025  178 LEU B N   
1768 C CA  . LEU B 71  ? 0.2155 0.1839 0.1922 -0.0038 0.0003  0.0076  178 LEU B CA  
1769 C C   . LEU B 71  ? 0.2374 0.1965 0.2025 -0.0063 0.0003  -0.0008 178 LEU B C   
1770 O O   . LEU B 71  ? 0.2704 0.2082 0.1895 -0.0093 0.0055  0.0040  178 LEU B O   
1771 C CB  . LEU B 71  ? 0.2149 0.1877 0.1880 -0.0068 0.0040  0.0059  178 LEU B CB  
1772 C CG  . LEU B 71  ? 0.1894 0.1818 0.1741 -0.0044 -0.0064 0.0045  178 LEU B CG  
1773 C CD1 . LEU B 71  ? 0.2165 0.1787 0.2172 -0.0056 0.0022  0.0010  178 LEU B CD1 
1774 C CD2 . LEU B 71  ? 0.1937 0.1753 0.1810 -0.0128 -0.0061 0.0037  178 LEU B CD2 
1775 N N   . LYS B 72  ? 0.2425 0.2051 0.2081 -0.0040 0.0030  0.0041  179 LYS B N   
1776 C CA  . LYS B 72  ? 0.2554 0.2224 0.2275 -0.0033 -0.0007 0.0002  179 LYS B CA  
1777 C C   . LYS B 72  ? 0.2653 0.2244 0.2315 -0.0006 0.0019  0.0046  179 LYS B C   
1778 O O   . LYS B 72  ? 0.2924 0.2258 0.2192 0.0022  0.0077  -0.0089 179 LYS B O   
1779 C CB  . LYS B 72  ? 0.2569 0.2253 0.2379 -0.0053 -0.0011 0.0072  179 LYS B CB  
1780 C CG  . LYS B 72  ? 0.2614 0.2426 0.2629 -0.0056 -0.0071 -0.0015 179 LYS B CG  
1781 C CD  . LYS B 72  ? 0.2756 0.2554 0.2590 -0.0013 0.0001  -0.0022 179 LYS B CD  
1782 C CE  . LYS B 72  ? 0.2987 0.2812 0.2973 -0.0061 -0.0007 0.0053  179 LYS B CE  
1783 N NZ  . LYS B 72  ? 0.3072 0.3044 0.2959 -0.0026 0.0066  0.0021  179 LYS B NZ  
1784 N N   . GLN B 73  ? 0.2685 0.2162 0.2283 -0.0033 0.0030  0.0062  180 GLN B N   
1785 C CA  . GLN B 73  ? 0.2767 0.2459 0.2572 0.0024  0.0068  0.0072  180 GLN B CA  
1786 C C   . GLN B 73  ? 0.2634 0.2407 0.2430 0.0050  0.0056  0.0007  180 GLN B C   
1787 O O   . GLN B 73  ? 0.2865 0.2437 0.2567 0.0144  0.0093  -0.0039 180 GLN B O   
1788 C CB  . GLN B 73  ? 0.2914 0.2632 0.2696 -0.0013 0.0027  0.0010  180 GLN B CB  
1789 C CG  . GLN B 73  ? 0.3288 0.2954 0.3012 0.0015  0.0151  0.0092  180 GLN B CG  
1790 C CD  . GLN B 73  ? 0.3567 0.3634 0.3555 0.0030  -0.0028 -0.0032 180 GLN B CD  
1791 O OE1 . GLN B 73  ? 0.4248 0.3961 0.3904 0.0134  0.0007  0.0131  180 GLN B OE1 
1792 N NE2 . GLN B 73  ? 0.3781 0.3503 0.3642 0.0026  0.0135  -0.0102 180 GLN B NE2 
1793 N N   . ALA B 74  ? 0.2528 0.2271 0.2239 0.0039  0.0073  -0.0014 181 ALA B N   
1794 C CA  . ALA B 74  ? 0.2364 0.2180 0.2135 0.0021  0.0052  -0.0055 181 ALA B CA  
1795 C C   . ALA B 74  ? 0.2218 0.2049 0.2000 -0.0008 0.0042  -0.0066 181 ALA B C   
1796 O O   . ALA B 74  ? 0.2360 0.2122 0.1952 0.0108  0.0052  -0.0206 181 ALA B O   
1797 C CB  . ALA B 74  ? 0.2319 0.2253 0.2191 0.0053  -0.0002 0.0011  181 ALA B CB  
1798 N N   . PHE B 75  ? 0.2191 0.1927 0.1892 0.0046  0.0007  -0.0090 182 PHE B N   
1799 C CA  . PHE B 75  ? 0.2091 0.1869 0.1860 0.0020  0.0067  -0.0084 182 PHE B CA  
1800 C C   . PHE B 75  ? 0.2058 0.1892 0.1778 0.0001  0.0090  -0.0060 182 PHE B C   
1801 O O   . PHE B 75  ? 0.2270 0.2016 0.1984 0.0092  0.0128  -0.0050 182 PHE B O   
1802 C CB  . PHE B 75  ? 0.2057 0.1826 0.1714 0.0088  0.0035  -0.0103 182 PHE B CB  
1803 C CG  . PHE B 75  ? 0.2137 0.1935 0.1875 0.0057  0.0026  -0.0074 182 PHE B CG  
1804 C CD1 . PHE B 75  ? 0.2011 0.1977 0.1908 -0.0063 -0.0169 -0.0117 182 PHE B CD1 
1805 C CD2 . PHE B 75  ? 0.2023 0.1951 0.1759 0.0118  -0.0009 -0.0073 182 PHE B CD2 
1806 C CE1 . PHE B 75  ? 0.1746 0.2005 0.1820 0.0034  0.0123  0.0004  182 PHE B CE1 
1807 C CE2 . PHE B 75  ? 0.1860 0.1821 0.1839 0.0072  -0.0056 0.0015  182 PHE B CE2 
1808 C CZ  . PHE B 75  ? 0.1440 0.1772 0.1713 0.0097  -0.0137 -0.0042 182 PHE B CZ  
1809 N N   . GLY B 76  ? 0.1966 0.1880 0.1849 0.0032  0.0088  -0.0029 183 GLY B N   
1810 C CA  . GLY B 76  ? 0.2000 0.1957 0.1865 0.0017  0.0065  -0.0052 183 GLY B CA  
1811 C C   . GLY B 76  ? 0.1841 0.1833 0.1780 0.0037  0.0051  -0.0012 183 GLY B C   
1812 O O   . GLY B 76  ? 0.1880 0.1932 0.1861 0.0083  0.0221  -0.0055 183 GLY B O   
1813 N N   . GLU B 77  ? 0.1663 0.1744 0.1683 0.0068  0.0052  -0.0035 184 GLU B N   
1814 C CA  . GLU B 77  ? 0.1581 0.1687 0.1634 0.0065  0.0027  -0.0037 184 GLU B CA  
1815 C C   . GLU B 77  ? 0.1629 0.1738 0.1663 0.0042  -0.0003 -0.0026 184 GLU B C   
1816 O O   . GLU B 77  ? 0.1704 0.1845 0.1719 0.0064  -0.0056 0.0000  184 GLU B O   
1817 C CB  . GLU B 77  ? 0.1665 0.1881 0.1674 0.0040  -0.0002 -0.0025 184 GLU B CB  
1818 C CG  . GLU B 77  ? 0.1624 0.1770 0.1749 0.0133  0.0069  -0.0008 184 GLU B CG  
1819 C CD  . GLU B 77  ? 0.2001 0.2153 0.2124 0.0064  -0.0077 0.0010  184 GLU B CD  
1820 O OE1 . GLU B 77  ? 0.1356 0.1929 0.1645 0.0014  0.0239  -0.0052 184 GLU B OE1 
1821 O OE2 . GLU B 77  ? 0.2752 0.2742 0.3031 -0.0203 -0.0101 0.0181  184 GLU B OE2 
1822 N N   . LYS B 78  ? 0.1606 0.1608 0.1513 0.0096  -0.0027 -0.0055 185 LYS B N   
1823 C CA  . LYS B 78  ? 0.1697 0.1736 0.1606 0.0003  -0.0020 -0.0077 185 LYS B CA  
1824 C C   . LYS B 78  ? 0.1611 0.1681 0.1502 0.0067  0.0000  -0.0110 185 LYS B C   
1825 O O   . LYS B 78  ? 0.1746 0.1646 0.1331 0.0166  -0.0019 -0.0220 185 LYS B O   
1826 C CB  . LYS B 78  ? 0.1777 0.1782 0.1619 0.0016  0.0002  -0.0041 185 LYS B CB  
1827 C CG  . LYS B 78  ? 0.2232 0.1980 0.2097 -0.0014 -0.0013 -0.0031 185 LYS B CG  
1828 C CD  . LYS B 78  ? 0.2409 0.2421 0.2484 -0.0019 0.0067  -0.0012 185 LYS B CD  
1829 C CE  . LYS B 78  ? 0.2831 0.2630 0.2759 -0.0046 0.0000  -0.0011 185 LYS B CE  
1830 N NZ  . LYS B 78  ? 0.2821 0.2805 0.2907 -0.0028 0.0094  0.0059  185 LYS B NZ  
1831 N N   . ILE B 79  ? 0.1601 0.1583 0.1473 0.0034  0.0009  -0.0109 186 ILE B N   
1832 C CA  . ILE B 79  ? 0.1527 0.1553 0.1480 0.0058  0.0038  -0.0038 186 ILE B CA  
1833 C C   . ILE B 79  ? 0.1464 0.1495 0.1382 0.0029  0.0018  -0.0053 186 ILE B C   
1834 O O   . ILE B 79  ? 0.1544 0.1665 0.1792 0.0134  0.0012  -0.0019 186 ILE B O   
1835 C CB  . ILE B 79  ? 0.1546 0.1502 0.1481 0.0040  0.0028  0.0004  186 ILE B CB  
1836 C CG1 . ILE B 79  ? 0.1462 0.1511 0.1469 0.0050  -0.0003 -0.0094 186 ILE B CG1 
1837 C CG2 . ILE B 79  ? 0.1786 0.1629 0.1568 0.0061  0.0091  -0.0038 186 ILE B CG2 
1838 C CD1 . ILE B 79  ? 0.1832 0.1624 0.1764 -0.0029 0.0036  -0.0065 186 ILE B CD1 
1839 N N   . THR B 80  ? 0.1340 0.1463 0.1301 0.0054  0.0054  -0.0002 187 THR B N   
1840 C CA  . THR B 80  ? 0.1400 0.1382 0.1288 0.0089  0.0031  0.0003  187 THR B CA  
1841 C C   . THR B 80  ? 0.1287 0.1236 0.1201 0.0108  -0.0013 -0.0041 187 THR B C   
1842 O O   . THR B 80  ? 0.1038 0.1094 0.1110 0.0180  0.0001  -0.0191 187 THR B O   
1843 C CB  . THR B 80  ? 0.1401 0.1534 0.1353 0.0036  0.0047  -0.0020 187 THR B CB  
1844 O OG1 . THR B 80  ? 0.1966 0.2214 0.1921 0.0051  0.0033  0.0163  187 THR B OG1 
1845 C CG2 . THR B 80  ? 0.1322 0.1221 0.1345 0.0120  -0.0008 -0.0027 187 THR B CG2 
1846 N N   . MET B 81  ? 0.1357 0.1244 0.1191 0.0146  -0.0050 -0.0004 188 MET B N   
1847 C CA  . MET B 81  ? 0.1227 0.1246 0.1140 0.0085  -0.0042 -0.0006 188 MET B CA  
1848 C C   . MET B 81  ? 0.1092 0.1087 0.1029 0.0088  -0.0042 -0.0021 188 MET B C   
1849 O O   . MET B 81  ? 0.1356 0.1327 0.1096 0.0173  -0.0137 -0.0074 188 MET B O   
1850 C CB  . MET B 81  ? 0.1258 0.1307 0.1247 -0.0036 -0.0034 -0.0049 188 MET B CB  
1851 C CG  . MET B 81  ? 0.1410 0.1576 0.1632 -0.0026 -0.0025 0.0081  188 MET B CG  
1852 S SD  . MET B 81  ? 0.1365 0.2367 0.2403 0.0023  0.0133  0.0157  188 MET B SD  
1853 C CE  . MET B 81  ? 0.2424 0.2415 0.2581 -0.0032 0.0016  -0.0003 188 MET B CE  
1854 N N   . THR B 82  ? 0.0872 0.1031 0.0890 0.0150  -0.0072 0.0087  189 THR B N   
1855 C CA  . THR B 82  ? 0.0917 0.1036 0.0914 0.0034  0.0005  -0.0050 189 THR B CA  
1856 C C   . THR B 82  ? 0.0796 0.0938 0.0888 0.0016  0.0028  0.0021  189 THR B C   
1857 O O   . THR B 82  ? 0.0743 0.1016 0.0840 0.0110  -0.0001 -0.0037 189 THR B O   
1858 C CB  . THR B 82  ? 0.0810 0.1084 0.0942 0.0032  0.0057  -0.0008 189 THR B CB  
1859 O OG1 . THR B 82  ? 0.0963 0.1505 0.1071 -0.0026 0.0033  -0.0098 189 THR B OG1 
1860 C CG2 . THR B 82  ? 0.1090 0.1325 0.1270 -0.0049 0.0106  -0.0024 189 THR B CG2 
1861 N N   . ILE B 83  ? 0.0805 0.0909 0.0731 -0.0082 -0.0015 0.0056  190 ILE B N   
1862 C CA  . ILE B 83  ? 0.0849 0.0885 0.0756 0.0005  -0.0054 -0.0007 190 ILE B CA  
1863 C C   . ILE B 83  ? 0.0926 0.0940 0.0858 0.0008  -0.0053 0.0048  190 ILE B C   
1864 O O   . ILE B 83  ? 0.1018 0.1197 0.0761 -0.0095 0.0091  0.0052  190 ILE B O   
1865 C CB  . ILE B 83  ? 0.0808 0.0813 0.0768 -0.0094 0.0027  0.0001  190 ILE B CB  
1866 C CG1 . ILE B 83  ? 0.0706 0.0971 0.0990 0.0067  0.0056  -0.0054 190 ILE B CG1 
1867 C CG2 . ILE B 83  ? 0.0664 0.0700 0.0979 0.0036  -0.0112 0.0025  190 ILE B CG2 
1868 C CD1 . ILE B 83  ? 0.1147 0.1081 0.1155 0.0054  -0.0035 -0.0114 190 ILE B CD1 
1869 N N   . ARG B 84  ? 0.0903 0.0924 0.0778 -0.0037 -0.0081 0.0043  191 ARG B N   
1870 C CA  . ARG B 84  ? 0.0896 0.0998 0.0905 -0.0031 -0.0044 -0.0025 191 ARG B CA  
1871 C C   . ARG B 84  ? 0.0921 0.0993 0.0874 -0.0069 -0.0052 -0.0018 191 ARG B C   
1872 O O   . ARG B 84  ? 0.0893 0.1093 0.0712 -0.0062 -0.0063 -0.0072 191 ARG B O   
1873 C CB  . ARG B 84  ? 0.0962 0.1005 0.0886 -0.0076 -0.0058 -0.0064 191 ARG B CB  
1874 C CG  . ARG B 84  ? 0.1207 0.1199 0.1105 0.0034  -0.0091 -0.0078 191 ARG B CG  
1875 C CD  . ARG B 84  ? 0.0988 0.0823 0.1015 0.0004  -0.0143 -0.0037 191 ARG B CD  
1876 N NE  . ARG B 84  ? 0.1097 0.1145 0.1223 -0.0054 -0.0086 0.0046  191 ARG B NE  
1877 C CZ  . ARG B 84  ? 0.1288 0.1276 0.1257 -0.0041 -0.0036 0.0033  191 ARG B CZ  
1878 N NH1 . ARG B 84  ? 0.1220 0.1145 0.1168 -0.0179 -0.0204 -0.0040 191 ARG B NH1 
1879 N NH2 . ARG B 84  ? 0.1220 0.1615 0.1607 0.0124  -0.0271 0.0051  191 ARG B NH2 
1880 N N   . ASP B 85  ? 0.0896 0.0983 0.1074 0.0007  -0.0003 -0.0011 192 ASP B N   
1881 C CA  . ASP B 85  ? 0.0887 0.1013 0.1001 -0.0025 -0.0042 -0.0004 192 ASP B CA  
1882 C C   . ASP B 85  ? 0.0881 0.1012 0.1100 0.0020  0.0000  -0.0009 192 ASP B C   
1883 O O   . ASP B 85  ? 0.0580 0.1074 0.1013 0.0002  -0.0090 -0.0085 192 ASP B O   
1884 C CB  . ASP B 85  ? 0.0975 0.1020 0.1086 -0.0068 0.0002  0.0037  192 ASP B CB  
1885 C CG  . ASP B 85  ? 0.1068 0.1040 0.1174 -0.0046 -0.0002 -0.0047 192 ASP B CG  
1886 O OD1 . ASP B 85  ? 0.1153 0.0961 0.1204 -0.0082 -0.0079 -0.0066 192 ASP B OD1 
1887 O OD2 . ASP B 85  ? 0.1732 0.1309 0.1225 0.0094  -0.0111 0.0001  192 ASP B OD2 
1888 N N   . ARG B 86  ? 0.0919 0.1101 0.1142 -0.0004 -0.0036 -0.0019 193 ARG B N   
1889 C CA  . ARG B 86  ? 0.0919 0.1127 0.1114 0.0004  -0.0050 -0.0048 193 ARG B CA  
1890 C C   . ARG B 86  ? 0.1182 0.1213 0.1277 0.0048  -0.0049 -0.0043 193 ARG B C   
1891 O O   . ARG B 86  ? 0.1159 0.1359 0.1243 0.0107  -0.0167 -0.0007 193 ARG B O   
1892 C CB  . ARG B 86  ? 0.0815 0.1054 0.1109 0.0037  0.0008  0.0018  193 ARG B CB  
1893 C CG  . ARG B 86  ? 0.1212 0.1501 0.1202 -0.0026 -0.0091 -0.0031 193 ARG B CG  
1894 C CD  . ARG B 86  ? 0.1190 0.1549 0.1470 0.0046  0.0081  -0.0032 193 ARG B CD  
1895 N NE  . ARG B 86  ? 0.1315 0.1608 0.1813 -0.0131 0.0023  -0.0021 193 ARG B NE  
1896 C CZ  . ARG B 86  ? 0.1453 0.1360 0.1343 0.0000  -0.0117 -0.0006 193 ARG B CZ  
1897 N NH1 . ARG B 86  ? 0.1197 0.1418 0.1560 -0.0014 -0.0171 -0.0055 193 ARG B NH1 
1898 N NH2 . ARG B 86  ? 0.1099 0.1344 0.1406 0.0043  0.0057  -0.0041 193 ARG B NH2 
1899 N N   . PRO B 87  ? 0.1206 0.1409 0.1357 0.0054  -0.0033 -0.0034 194 PRO B N   
1900 C CA  . PRO B 87  ? 0.1503 0.1637 0.1549 0.0024  -0.0052 -0.0044 194 PRO B CA  
1901 C C   . PRO B 87  ? 0.1755 0.1846 0.1718 0.0060  0.0000  -0.0059 194 PRO B C   
1902 O O   . PRO B 87  ? 0.1922 0.2227 0.1850 0.0100  0.0096  -0.0032 194 PRO B O   
1903 C CB  . PRO B 87  ? 0.1552 0.1636 0.1653 0.0048  -0.0033 -0.0027 194 PRO B CB  
1904 C CG  . PRO B 87  ? 0.1445 0.1533 0.1562 0.0031  -0.0162 0.0002  194 PRO B CG  
1905 C CD  . PRO B 87  ? 0.1362 0.1290 0.1297 -0.0030 0.0040  0.0067  194 PRO B CD  
1906 N N   . PHE B 88  ? 0.1998 0.2073 0.1904 0.0093  -0.0042 -0.0072 195 PHE B N   
1907 C CA  . PHE B 88  ? 0.1800 0.2041 0.1888 0.0030  0.0008  -0.0048 195 PHE B CA  
1908 C C   . PHE B 88  ? 0.1912 0.2120 0.1976 -0.0010 0.0005  -0.0044 195 PHE B C   
1909 O O   . PHE B 88  ? 0.1884 0.2346 0.2234 -0.0012 0.0026  -0.0146 195 PHE B O   
1910 C CB  . PHE B 88  ? 0.1783 0.1971 0.1975 0.0003  0.0056  0.0012  195 PHE B CB  
1911 C CG  . PHE B 88  ? 0.1855 0.2041 0.1884 0.0006  -0.0036 -0.0041 195 PHE B CG  
1912 C CD1 . PHE B 88  ? 0.1950 0.2069 0.2034 0.0048  0.0023  -0.0001 195 PHE B CD1 
1913 C CD2 . PHE B 88  ? 0.2096 0.2277 0.2246 0.0065  -0.0042 0.0074  195 PHE B CD2 
1914 C CE1 . PHE B 88  ? 0.1827 0.1906 0.1959 -0.0018 0.0082  -0.0068 195 PHE B CE1 
1915 C CE2 . PHE B 88  ? 0.2216 0.2281 0.2313 0.0005  -0.0067 0.0000  195 PHE B CE2 
1916 C CZ  . PHE B 88  ? 0.2096 0.2248 0.2050 0.0005  -0.0072 0.0087  195 PHE B CZ  
1917 N N   . GLU B 89  ? 0.1924 0.2136 0.2064 -0.0030 -0.0020 -0.0006 196 GLU B N   
1918 C CA  . GLU B 89  ? 0.1903 0.2049 0.2020 0.0016  -0.0034 -0.0001 196 GLU B CA  
1919 C C   . GLU B 89  ? 0.1860 0.1880 0.1906 -0.0027 -0.0003 -0.0054 196 GLU B C   
1920 O O   . GLU B 89  ? 0.1826 0.1956 0.1848 -0.0033 -0.0011 -0.0080 196 GLU B O   
1921 C CB  . GLU B 89  ? 0.1944 0.1912 0.2031 0.0024  0.0008  -0.0061 196 GLU B CB  
1922 C CG  . GLU B 89  ? 0.2214 0.2181 0.2250 0.0003  -0.0024 -0.0026 196 GLU B CG  
1923 C CD  . GLU B 89  ? 0.2564 0.2414 0.2373 -0.0007 0.0020  -0.0031 196 GLU B CD  
1924 O OE1 . GLU B 89  ? 0.2639 0.2374 0.2494 0.0065  0.0074  0.0097  196 GLU B OE1 
1925 O OE2 . GLU B 89  ? 0.3008 0.2506 0.2727 0.0004  0.0075  0.0050  196 GLU B OE2 
1926 N N   . ARG B 90  ? 0.1741 0.1786 0.1909 -0.0013 -0.0076 -0.0066 197 ARG B N   
1927 C CA  . ARG B 90  ? 0.1808 0.1851 0.1927 -0.0020 -0.0043 -0.0006 197 ARG B CA  
1928 C C   . ARG B 90  ? 0.1665 0.1699 0.1868 -0.0006 -0.0022 0.0007  197 ARG B C   
1929 O O   . ARG B 90  ? 0.1705 0.1796 0.2031 -0.0036 -0.0027 0.0150  197 ARG B O   
1930 C CB  . ARG B 90  ? 0.1924 0.2020 0.2004 -0.0041 -0.0030 -0.0056 197 ARG B CB  
1931 C CG  . ARG B 90  ? 0.2347 0.2372 0.2435 0.0030  -0.0023 -0.0072 197 ARG B CG  
1932 C CD  . ARG B 90  ? 0.2784 0.2656 0.2721 -0.0053 0.0066  -0.0107 197 ARG B CD  
1933 N NE  . ARG B 90  ? 0.3174 0.2992 0.2932 0.0075  0.0025  -0.0079 197 ARG B NE  
1934 C CZ  . ARG B 90  ? 0.3034 0.3046 0.2987 -0.0052 0.0051  -0.0046 197 ARG B CZ  
1935 N NH1 . ARG B 90  ? 0.2948 0.2906 0.2816 0.0077  0.0017  -0.0093 197 ARG B NH1 
1936 N NH2 . ARG B 90  ? 0.3279 0.3287 0.3271 0.0069  -0.0125 -0.0017 197 ARG B NH2 
1937 N N   . THR B 91  ? 0.1606 0.1544 0.1767 -0.0114 -0.0015 0.0005  198 THR B N   
1938 C CA  . THR B 91  ? 0.1745 0.1694 0.1766 -0.0029 -0.0018 0.0029  198 THR B CA  
1939 C C   . THR B 91  ? 0.1769 0.1718 0.1781 -0.0036 0.0009  0.0008  198 THR B C   
1940 O O   . THR B 91  ? 0.1781 0.1560 0.1870 0.0002  0.0087  0.0086  198 THR B O   
1941 C CB  . THR B 91  ? 0.1803 0.1816 0.1842 -0.0027 -0.0038 -0.0019 198 THR B CB  
1942 O OG1 . THR B 91  ? 0.1759 0.1838 0.1683 0.0024  -0.0159 -0.0214 198 THR B OG1 
1943 C CG2 . THR B 91  ? 0.2043 0.2003 0.1886 -0.0082 -0.0085 0.0044  198 THR B CG2 
1944 N N   . ILE B 92  ? 0.1695 0.1700 0.1784 -0.0045 -0.0033 -0.0022 199 ILE B N   
1945 C CA  . ILE B 92  ? 0.1806 0.1808 0.1901 -0.0021 -0.0030 -0.0013 199 ILE B CA  
1946 C C   . ILE B 92  ? 0.1606 0.1726 0.1831 -0.0012 0.0028  0.0002  199 ILE B C   
1947 O O   . ILE B 92  ? 0.1456 0.1738 0.1865 -0.0014 -0.0012 -0.0058 199 ILE B O   
1948 C CB  . ILE B 92  ? 0.1968 0.1963 0.2034 0.0034  0.0024  -0.0002 199 ILE B CB  
1949 C CG1 . ILE B 92  ? 0.2124 0.2244 0.2211 -0.0017 -0.0007 0.0018  199 ILE B CG1 
1950 C CG2 . ILE B 92  ? 0.1931 0.2120 0.2038 0.0038  -0.0001 -0.0016 199 ILE B CG2 
1951 C CD1 . ILE B 92  ? 0.2442 0.2509 0.2358 0.0056  -0.0016 0.0042  199 ILE B CD1 
1952 N N   . THR B 93  ? 0.1574 0.1604 0.1788 -0.0056 0.0074  -0.0024 200 THR B N   
1953 C CA  . THR B 93  ? 0.1638 0.1582 0.1647 0.0026  0.0074  0.0006  200 THR B CA  
1954 C C   . THR B 93  ? 0.1453 0.1453 0.1618 -0.0022 0.0066  0.0001  200 THR B C   
1955 O O   . THR B 93  ? 0.1370 0.1428 0.1567 -0.0048 0.0141  -0.0050 200 THR B O   
1956 C CB  . THR B 93  ? 0.1775 0.1750 0.1791 0.0009  0.0094  -0.0039 200 THR B CB  
1957 O OG1 . THR B 93  ? 0.2171 0.2191 0.2199 0.0022  0.0209  -0.0044 200 THR B OG1 
1958 C CG2 . THR B 93  ? 0.1985 0.1719 0.1664 0.0061  0.0050  -0.0049 200 THR B CG2 
1959 N N   . MET B 94  ? 0.1316 0.1187 0.1314 -0.0036 0.0047  -0.0021 201 MET B N   
1960 C CA  . MET B 94  ? 0.1258 0.1203 0.1327 -0.0005 0.0024  0.0025  201 MET B CA  
1961 C C   . MET B 94  ? 0.1373 0.1301 0.1324 -0.0016 0.0009  0.0014  201 MET B C   
1962 O O   . MET B 94  ? 0.1238 0.1178 0.1230 0.0039  0.0083  -0.0006 201 MET B O   
1963 C CB  . MET B 94  ? 0.1174 0.1356 0.1275 -0.0042 0.0019  0.0059  201 MET B CB  
1964 C CG  . MET B 94  ? 0.1385 0.1306 0.1278 0.0009  -0.0054 -0.0004 201 MET B CG  
1965 S SD  . MET B 94  ? 0.1568 0.1264 0.1493 0.0149  -0.0026 -0.0054 201 MET B SD  
1966 C CE  . MET B 94  ? 0.1682 0.1494 0.1509 0.0029  0.0002  -0.0167 201 MET B CE  
1967 N N   . HIS B 95  ? 0.1500 0.1516 0.1545 0.0073  -0.0018 -0.0046 202 HIS B N   
1968 C CA  . HIS B 95  ? 0.1611 0.1564 0.1631 -0.0004 -0.0051 -0.0031 202 HIS B CA  
1969 C C   . HIS B 95  ? 0.1648 0.1577 0.1600 0.0032  -0.0045 -0.0030 202 HIS B C   
1970 O O   . HIS B 95  ? 0.1769 0.1712 0.1673 -0.0019 0.0049  -0.0176 202 HIS B O   
1971 C CB  . HIS B 95  ? 0.1780 0.1691 0.1817 0.0014  -0.0068 0.0051  202 HIS B CB  
1972 C CG  . HIS B 95  ? 0.2094 0.2190 0.2239 0.0050  0.0050  0.0081  202 HIS B CG  
1973 N ND1 . HIS B 95  ? 0.2667 0.2668 0.2792 -0.0112 -0.0024 0.0159  202 HIS B ND1 
1974 C CD2 . HIS B 95  ? 0.2519 0.2580 0.2442 -0.0034 0.0025  0.0029  202 HIS B CD2 
1975 C CE1 . HIS B 95  ? 0.2654 0.2952 0.2842 -0.0028 0.0061  0.0035  202 HIS B CE1 
1976 N NE2 . HIS B 95  ? 0.2676 0.2848 0.2882 -0.0033 0.0063  0.0029  202 HIS B NE2 
1977 N N   . LYS B 96  ? 0.1598 0.1695 0.1586 -0.0088 -0.0059 -0.0055 203 LYS B N   
1978 C CA  . LYS B 96  ? 0.1702 0.1677 0.1548 -0.0064 -0.0014 -0.0036 203 LYS B CA  
1979 C C   . LYS B 96  ? 0.1721 0.1774 0.1735 -0.0071 -0.0079 0.0002  203 LYS B C   
1980 O O   . LYS B 96  ? 0.1822 0.1729 0.1811 -0.0144 -0.0088 0.0069  203 LYS B O   
1981 C CB  . LYS B 96  ? 0.1725 0.1675 0.1654 -0.0074 0.0005  0.0032  203 LYS B CB  
1982 C CG  . LYS B 96  ? 0.1454 0.1520 0.1376 -0.0025 -0.0001 -0.0060 203 LYS B CG  
1983 C CD  . LYS B 96  ? 0.1638 0.1597 0.1540 0.0006  0.0015  -0.0025 203 LYS B CD  
1984 C CE  . LYS B 96  ? 0.1422 0.1399 0.1628 -0.0020 0.0094  -0.0011 203 LYS B CE  
1985 N NZ  . LYS B 96  ? 0.1466 0.1524 0.1496 -0.0062 -0.0115 0.0007  203 LYS B NZ  
1986 N N   . ASP B 97  ? 0.1768 0.1806 0.1818 -0.0098 0.0000  0.0001  204 ASP B N   
1987 C CA  . ASP B 97  ? 0.1949 0.2049 0.2058 -0.0028 -0.0014 0.0056  204 ASP B CA  
1988 C C   . ASP B 97  ? 0.2140 0.2177 0.2167 -0.0048 -0.0027 0.0028  204 ASP B C   
1989 O O   . ASP B 97  ? 0.1939 0.2154 0.2038 -0.0233 -0.0037 0.0032  204 ASP B O   
1990 C CB  . ASP B 97  ? 0.1977 0.2035 0.2214 0.0021  -0.0054 -0.0015 204 ASP B CB  
1991 C CG  . ASP B 97  ? 0.2029 0.2261 0.2305 0.0021  0.0011  0.0044  204 ASP B CG  
1992 O OD1 . ASP B 97  ? 0.1905 0.2100 0.1969 0.0111  -0.0105 -0.0036 204 ASP B OD1 
1993 O OD2 . ASP B 97  ? 0.2860 0.2846 0.2677 0.0107  0.0008  -0.0164 204 ASP B OD2 
1994 N N   . SER B 98  ? 0.2220 0.2418 0.2342 -0.0023 0.0008  0.0052  205 SER B N   
1995 C CA  . SER B 98  ? 0.2498 0.2632 0.2495 -0.0021 -0.0047 0.0003  205 SER B CA  
1996 C C   . SER B 98  ? 0.2743 0.2805 0.2812 -0.0120 -0.0027 -0.0005 205 SER B C   
1997 O O   . SER B 98  ? 0.2857 0.3366 0.2991 -0.0085 -0.0133 -0.0024 205 SER B O   
1998 C CB  . SER B 98  ? 0.2380 0.2543 0.2567 -0.0052 -0.0032 0.0048  205 SER B CB  
1999 O OG  . SER B 98  ? 0.2288 0.2403 0.2093 0.0049  -0.0073 -0.0012 205 SER B OG  
2000 N N   . THR B 99  ? 0.2821 0.2893 0.2817 -0.0063 -0.0032 0.0029  206 THR B N   
2001 C CA  . THR B 99  ? 0.2976 0.2983 0.2987 -0.0045 0.0031  0.0005  206 THR B CA  
2002 C C   . THR B 99  ? 0.2823 0.2869 0.2889 -0.0060 0.0001  0.0067  206 THR B C   
2003 O O   . THR B 99  ? 0.2971 0.2937 0.2844 -0.0112 0.0064  0.0166  206 THR B O   
2004 C CB  . THR B 99  ? 0.3103 0.3045 0.3109 -0.0026 -0.0049 0.0094  206 THR B CB  
2005 O OG1 . THR B 99  ? 0.3446 0.3737 0.3657 -0.0095 0.0045  0.0019  206 THR B OG1 
2006 C CG2 . THR B 99  ? 0.3204 0.3275 0.3134 0.0023  -0.0011 -0.0020 206 THR B CG2 
2007 N N   . GLY B 100 ? 0.2545 0.2621 0.2537 -0.0084 -0.0005 0.0017  207 GLY B N   
2008 C CA  . GLY B 100 ? 0.2366 0.2504 0.2500 -0.0084 -0.0080 0.0031  207 GLY B CA  
2009 C C   . GLY B 100 ? 0.2363 0.2479 0.2449 -0.0041 -0.0038 -0.0015 207 GLY B C   
2010 O O   . GLY B 100 ? 0.2075 0.2252 0.2444 -0.0079 -0.0198 0.0039  207 GLY B O   
2011 N N   . HIS B 101 ? 0.2290 0.2471 0.2471 -0.0065 -0.0048 -0.0003 208 HIS B N   
2012 C CA  . HIS B 101 ? 0.2324 0.2437 0.2420 -0.0049 -0.0037 0.0026  208 HIS B CA  
2013 C C   . HIS B 101 ? 0.2023 0.2155 0.2135 -0.0012 -0.0016 -0.0011 208 HIS B C   
2014 O O   . HIS B 101 ? 0.1832 0.2112 0.1967 -0.0150 0.0028  0.0028  208 HIS B O   
2015 C CB  . HIS B 101 ? 0.2521 0.2680 0.2599 0.0011  -0.0024 0.0005  208 HIS B CB  
2016 C CG  . HIS B 101 ? 0.3180 0.3066 0.3162 -0.0109 -0.0012 0.0069  208 HIS B CG  
2017 N ND1 . HIS B 101 ? 0.3896 0.3512 0.3682 0.0022  0.0078  0.0023  208 HIS B ND1 
2018 C CD2 . HIS B 101 ? 0.3469 0.3663 0.3578 -0.0016 0.0078  -0.0008 208 HIS B CD2 
2019 C CE1 . HIS B 101 ? 0.3813 0.3797 0.3902 -0.0069 0.0057  0.0010  208 HIS B CE1 
2020 N NE2 . HIS B 101 ? 0.3868 0.3734 0.3895 -0.0021 0.0018  0.0019  208 HIS B NE2 
2021 N N   . VAL B 102 ? 0.1871 0.1906 0.1843 -0.0066 0.0028  -0.0036 209 VAL B N   
2022 C CA  . VAL B 102 ? 0.1726 0.1716 0.1725 -0.0029 0.0021  -0.0036 209 VAL B CA  
2023 C C   . VAL B 102 ? 0.1532 0.1511 0.1546 -0.0018 0.0018  -0.0004 209 VAL B C   
2024 O O   . VAL B 102 ? 0.1477 0.1496 0.1398 -0.0019 0.0107  -0.0085 209 VAL B O   
2025 C CB  . VAL B 102 ? 0.1715 0.1715 0.1684 -0.0029 -0.0001 0.0007  209 VAL B CB  
2026 C CG1 . VAL B 102 ? 0.1604 0.1743 0.1645 -0.0089 0.0038  -0.0012 209 VAL B CG1 
2027 C CG2 . VAL B 102 ? 0.1854 0.1708 0.1894 0.0083  0.0064  -0.0074 209 VAL B CG2 
2028 N N   . GLY B 103 ? 0.1413 0.1399 0.1408 -0.0063 -0.0021 -0.0051 210 GLY B N   
2029 C CA  . GLY B 103 ? 0.1294 0.1329 0.1433 -0.0058 0.0018  -0.0061 210 GLY B CA  
2030 C C   . GLY B 103 ? 0.1251 0.1284 0.1356 -0.0029 0.0021  -0.0057 210 GLY B C   
2031 O O   . GLY B 103 ? 0.1172 0.1251 0.1459 -0.0118 0.0069  -0.0212 210 GLY B O   
2032 N N   . PHE B 104 ? 0.1219 0.1219 0.1354 -0.0116 -0.0006 -0.0108 211 PHE B N   
2033 C CA  . PHE B 104 ? 0.1262 0.1227 0.1307 -0.0086 0.0006  -0.0057 211 PHE B CA  
2034 C C   . PHE B 104 ? 0.1483 0.1446 0.1518 -0.0051 0.0009  -0.0040 211 PHE B C   
2035 O O   . PHE B 104 ? 0.1225 0.1549 0.1604 -0.0194 -0.0037 -0.0056 211 PHE B O   
2036 C CB  . PHE B 104 ? 0.1282 0.1227 0.1384 -0.0066 0.0010  -0.0056 211 PHE B CB  
2037 C CG  . PHE B 104 ? 0.1162 0.1207 0.1225 -0.0127 0.0026  -0.0014 211 PHE B CG  
2038 C CD1 . PHE B 104 ? 0.1327 0.1318 0.1283 0.0005  0.0187  -0.0034 211 PHE B CD1 
2039 C CD2 . PHE B 104 ? 0.1388 0.1297 0.1384 -0.0009 -0.0023 0.0073  211 PHE B CD2 
2040 C CE1 . PHE B 104 ? 0.1575 0.1208 0.1383 -0.0034 -0.0019 -0.0055 211 PHE B CE1 
2041 C CE2 . PHE B 104 ? 0.1588 0.1329 0.1529 -0.0013 -0.0072 0.0045  211 PHE B CE2 
2042 C CZ  . PHE B 104 ? 0.1489 0.1361 0.1434 0.0018  -0.0051 -0.0127 211 PHE B CZ  
2043 N N   . ILE B 105 ? 0.1509 0.1564 0.1510 -0.0015 -0.0041 -0.0025 212 ILE B N   
2044 C CA  . ILE B 105 ? 0.1628 0.1566 0.1643 -0.0015 0.0019  -0.0041 212 ILE B CA  
2045 C C   . ILE B 105 ? 0.1618 0.1569 0.1576 -0.0032 0.0008  -0.0049 212 ILE B C   
2046 O O   . ILE B 105 ? 0.1618 0.1589 0.1654 -0.0026 0.0093  -0.0042 212 ILE B O   
2047 C CB  . ILE B 105 ? 0.1690 0.1629 0.1728 0.0000  0.0006  0.0013  212 ILE B CB  
2048 C CG1 . ILE B 105 ? 0.1962 0.1846 0.2131 0.0025  0.0013  -0.0006 212 ILE B CG1 
2049 C CG2 . ILE B 105 ? 0.1922 0.1792 0.2062 0.0033  0.0012  0.0064  212 ILE B CG2 
2050 C CD1 . ILE B 105 ? 0.2255 0.2522 0.2506 0.0005  -0.0015 -0.0070 212 ILE B CD1 
2051 N N   . PHE B 106 ? 0.1573 0.1517 0.1604 -0.0079 0.0030  -0.0054 213 PHE B N   
2052 C CA  . PHE B 106 ? 0.1500 0.1484 0.1409 -0.0068 -0.0030 -0.0066 213 PHE B CA  
2053 C C   . PHE B 106 ? 0.1596 0.1552 0.1515 -0.0084 -0.0013 -0.0101 213 PHE B C   
2054 O O   . PHE B 106 ? 0.1553 0.1622 0.1552 -0.0134 0.0097  -0.0097 213 PHE B O   
2055 C CB  . PHE B 106 ? 0.1462 0.1473 0.1419 -0.0114 -0.0031 -0.0048 213 PHE B CB  
2056 C CG  . PHE B 106 ? 0.1338 0.1234 0.1229 -0.0067 0.0021  -0.0039 213 PHE B CG  
2057 C CD1 . PHE B 106 ? 0.1252 0.1282 0.1178 0.0015  -0.0051 -0.0009 213 PHE B CD1 
2058 C CD2 . PHE B 106 ? 0.1559 0.1431 0.1567 -0.0067 -0.0042 -0.0016 213 PHE B CD2 
2059 C CE1 . PHE B 106 ? 0.1593 0.1204 0.1585 -0.0038 -0.0084 -0.0008 213 PHE B CE1 
2060 C CE2 . PHE B 106 ? 0.1731 0.1599 0.1643 -0.0016 -0.0030 0.0004  213 PHE B CE2 
2061 C CZ  . PHE B 106 ? 0.1533 0.1556 0.1635 -0.0052 -0.0076 -0.0112 213 PHE B CZ  
2062 N N   . LYS B 107 ? 0.1623 0.1634 0.1622 -0.0061 -0.0030 -0.0059 214 LYS B N   
2063 C CA  . LYS B 107 ? 0.1791 0.1764 0.1733 -0.0024 -0.0009 0.0000  214 LYS B CA  
2064 C C   . LYS B 107 ? 0.1755 0.1787 0.1684 -0.0039 -0.0010 0.0050  214 LYS B C   
2065 O O   . LYS B 107 ? 0.1827 0.1766 0.1599 -0.0109 0.0029  -0.0028 214 LYS B O   
2066 C CB  . LYS B 107 ? 0.2003 0.1942 0.1862 -0.0043 0.0001  0.0052  214 LYS B CB  
2067 C CG  . LYS B 107 ? 0.2397 0.2051 0.2259 -0.0026 0.0017  0.0000  214 LYS B CG  
2068 C CD  . LYS B 107 ? 0.3537 0.3698 0.3680 -0.0087 -0.0038 0.0020  214 LYS B CD  
2069 C CE  . LYS B 107 ? 0.4077 0.3853 0.3998 0.0043  -0.0023 0.0092  214 LYS B CE  
2070 N NZ  . LYS B 107 ? 0.4268 0.4356 0.4194 0.0086  0.0024  0.0054  214 LYS B NZ  
2071 N N   . ASN B 108 ? 0.1705 0.1792 0.1733 -0.0063 0.0019  0.0064  215 ASN B N   
2072 C CA  . ASN B 108 ? 0.1834 0.1934 0.1837 -0.0024 0.0020  0.0104  215 ASN B CA  
2073 C C   . ASN B 108 ? 0.1660 0.1806 0.1795 -0.0059 0.0011  0.0133  215 ASN B C   
2074 O O   . ASN B 108 ? 0.1698 0.1853 0.1882 0.0036  -0.0003 0.0230  215 ASN B O   
2075 C CB  . ASN B 108 ? 0.1930 0.2168 0.2036 -0.0002 0.0037  0.0136  215 ASN B CB  
2076 C CG  . ASN B 108 ? 0.2326 0.2198 0.2263 0.0025  0.0066  0.0181  215 ASN B CG  
2077 O OD1 . ASN B 108 ? 0.2703 0.2725 0.2253 0.0057  0.0102  0.0083  215 ASN B OD1 
2078 N ND2 . ASN B 108 ? 0.2492 0.2790 0.2577 -0.0070 0.0014  0.0040  215 ASN B ND2 
2079 N N   . GLY B 109 ? 0.1436 0.1504 0.1645 -0.0076 -0.0005 0.0054  216 GLY B N   
2080 C CA  . GLY B 109 ? 0.1529 0.1468 0.1562 -0.0024 0.0027  -0.0015 216 GLY B CA  
2081 C C   . GLY B 109 ? 0.1544 0.1570 0.1658 -0.0073 0.0013  -0.0012 216 GLY B C   
2082 O O   . GLY B 109 ? 0.1570 0.1482 0.1509 -0.0094 0.0008  0.0116  216 GLY B O   
2083 N N   . LYS B 110 ? 0.1550 0.1542 0.1597 -0.0049 0.0011  0.0008  217 LYS B N   
2084 C CA  . LYS B 110 ? 0.1721 0.1629 0.1826 0.0016  -0.0029 -0.0007 217 LYS B CA  
2085 C C   . LYS B 110 ? 0.1625 0.1563 0.1699 -0.0011 -0.0016 -0.0018 217 LYS B C   
2086 O O   . LYS B 110 ? 0.1535 0.1288 0.1570 0.0075  -0.0088 -0.0103 217 LYS B O   
2087 C CB  . LYS B 110 ? 0.1965 0.1934 0.1929 -0.0059 -0.0084 -0.0003 217 LYS B CB  
2088 C CG  . LYS B 110 ? 0.2553 0.2419 0.2554 -0.0064 -0.0010 -0.0050 217 LYS B CG  
2089 C CD  . LYS B 110 ? 0.2897 0.2979 0.2943 0.0058  -0.0123 0.0063  217 LYS B CD  
2090 C CE  . LYS B 110 ? 0.3327 0.3351 0.3259 -0.0033 0.0037  0.0038  217 LYS B CE  
2091 N NZ  . LYS B 110 ? 0.3833 0.3863 0.3624 0.0092  -0.0106 0.0110  217 LYS B NZ  
2092 N N   . ILE B 111 ? 0.1469 0.1468 0.1551 0.0036  -0.0090 0.0000  218 ILE B N   
2093 C CA  . ILE B 111 ? 0.1516 0.1522 0.1521 0.0004  -0.0021 -0.0004 218 ILE B CA  
2094 C C   . ILE B 111 ? 0.1497 0.1488 0.1537 -0.0001 -0.0045 -0.0007 218 ILE B C   
2095 O O   . ILE B 111 ? 0.1462 0.1426 0.1680 -0.0048 -0.0036 -0.0016 218 ILE B O   
2096 C CB  . ILE B 111 ? 0.1441 0.1441 0.1547 0.0005  -0.0047 -0.0013 218 ILE B CB  
2097 C CG1 . ILE B 111 ? 0.1611 0.1545 0.1613 0.0016  0.0004  0.0011  218 ILE B CG1 
2098 C CG2 . ILE B 111 ? 0.1436 0.1460 0.1631 -0.0038 0.0044  -0.0087 218 ILE B CG2 
2099 C CD1 . ILE B 111 ? 0.1371 0.1464 0.1609 -0.0007 -0.0079 0.0011  218 ILE B CD1 
2100 N N   . THR B 112 ? 0.1468 0.1438 0.1479 -0.0013 0.0007  0.0024  219 THR B N   
2101 C CA  . THR B 112 ? 0.1526 0.1554 0.1547 -0.0032 0.0001  0.0004  219 THR B CA  
2102 C C   . THR B 112 ? 0.1553 0.1585 0.1533 -0.0036 0.0025  -0.0038 219 THR B C   
2103 O O   . THR B 112 ? 0.1713 0.1672 0.1417 -0.0143 0.0093  0.0008  219 THR B O   
2104 C CB  . THR B 112 ? 0.1581 0.1631 0.1543 -0.0046 0.0007  -0.0012 219 THR B CB  
2105 O OG1 . THR B 112 ? 0.1433 0.1802 0.1481 -0.0186 0.0015  0.0217  219 THR B OG1 
2106 C CG2 . THR B 112 ? 0.1683 0.1622 0.1632 -0.0037 0.0099  0.0048  219 THR B CG2 
2107 N N   . SER B 113 ? 0.1612 0.1531 0.1449 -0.0075 0.0046  0.0024  220 SER B N   
2108 C CA  . SER B 113 ? 0.1635 0.1614 0.1606 -0.0050 0.0058  0.0010  220 SER B CA  
2109 C C   . SER B 113 ? 0.1576 0.1509 0.1534 -0.0076 0.0090  0.0003  220 SER B C   
2110 O O   . SER B 113 ? 0.1499 0.1190 0.1531 -0.0278 0.0027  0.0097  220 SER B O   
2111 C CB  . SER B 113 ? 0.1826 0.1848 0.1774 -0.0063 0.0060  -0.0032 220 SER B CB  
2112 O OG  . SER B 113 ? 0.2090 0.2220 0.1945 -0.0169 0.0001  -0.0036 220 SER B OG  
2113 N N   . ILE B 114 ? 0.1567 0.1459 0.1501 -0.0030 0.0141  -0.0017 221 ILE B N   
2114 C CA  . ILE B 114 ? 0.1556 0.1492 0.1451 -0.0025 0.0011  -0.0073 221 ILE B CA  
2115 C C   . ILE B 114 ? 0.1567 0.1581 0.1490 -0.0047 0.0054  -0.0034 221 ILE B C   
2116 O O   . ILE B 114 ? 0.1732 0.1686 0.1540 -0.0135 0.0137  -0.0234 221 ILE B O   
2117 C CB  . ILE B 114 ? 0.1601 0.1491 0.1492 -0.0015 0.0094  -0.0039 221 ILE B CB  
2118 C CG1 . ILE B 114 ? 0.1546 0.1380 0.1460 -0.0083 0.0038  -0.0018 221 ILE B CG1 
2119 C CG2 . ILE B 114 ? 0.1789 0.1626 0.1678 0.0009  -0.0042 -0.0059 221 ILE B CG2 
2120 C CD1 . ILE B 114 ? 0.1458 0.1479 0.1321 -0.0112 -0.0052 -0.0005 221 ILE B CD1 
2121 N N   . VAL B 115 ? 0.1526 0.1605 0.1522 -0.0049 0.0036  -0.0063 222 VAL B N   
2122 C CA  . VAL B 115 ? 0.1614 0.1724 0.1623 0.0009  0.0027  -0.0041 222 VAL B CA  
2123 C C   . VAL B 115 ? 0.1753 0.1798 0.1705 -0.0007 0.0020  -0.0028 222 VAL B C   
2124 O O   . VAL B 115 ? 0.1497 0.1749 0.1542 -0.0041 0.0082  -0.0094 222 VAL B O   
2125 C CB  . VAL B 115 ? 0.1591 0.1721 0.1584 -0.0040 0.0089  -0.0033 222 VAL B CB  
2126 C CG1 . VAL B 115 ? 0.1590 0.1722 0.1693 0.0051  -0.0047 -0.0043 222 VAL B CG1 
2127 C CG2 . VAL B 115 ? 0.1811 0.1828 0.1712 0.0108  0.0038  0.0002  222 VAL B CG2 
2128 N N   . LYS B 116 ? 0.1961 0.2053 0.1935 0.0055  0.0094  -0.0068 223 LYS B N   
2129 C CA  . LYS B 116 ? 0.2230 0.2188 0.2160 0.0012  0.0106  -0.0085 223 LYS B CA  
2130 C C   . LYS B 116 ? 0.2178 0.2155 0.2140 0.0051  0.0133  -0.0136 223 LYS B C   
2131 O O   . LYS B 116 ? 0.1948 0.2212 0.2008 0.0130  0.0275  -0.0135 223 LYS B O   
2132 C CB  . LYS B 116 ? 0.2467 0.2475 0.2343 0.0057  0.0118  -0.0077 223 LYS B CB  
2133 C CG  . LYS B 116 ? 0.2858 0.2593 0.2735 -0.0061 0.0008  -0.0033 223 LYS B CG  
2134 C CD  . LYS B 116 ? 0.3243 0.3402 0.3285 0.0033  0.0113  -0.0065 223 LYS B CD  
2135 C CE  . LYS B 116 ? 0.3626 0.3495 0.3615 0.0007  0.0035  -0.0018 223 LYS B CE  
2136 N NZ  . LYS B 116 ? 0.3719 0.3845 0.3709 -0.0061 0.0004  0.0009  223 LYS B NZ  
2137 N N   . ASP B 117 ? 0.2318 0.2274 0.2241 0.0008  0.0108  -0.0103 224 ASP B N   
2138 C CA  . ASP B 117 ? 0.2419 0.2372 0.2398 0.0024  0.0047  -0.0053 224 ASP B CA  
2139 C C   . ASP B 117 ? 0.2149 0.2172 0.2193 0.0039  0.0036  -0.0014 224 ASP B C   
2140 O O   . ASP B 117 ? 0.2341 0.2089 0.2291 0.0100  0.0043  0.0009  224 ASP B O   
2141 C CB  . ASP B 117 ? 0.2485 0.2635 0.2563 0.0013  0.0061  0.0014  224 ASP B CB  
2142 C CG  . ASP B 117 ? 0.3201 0.3025 0.3154 0.0026  0.0027  -0.0123 224 ASP B CG  
2143 O OD1 . ASP B 117 ? 0.3625 0.3485 0.3914 -0.0140 -0.0067 -0.0080 224 ASP B OD1 
2144 O OD2 . ASP B 117 ? 0.3458 0.3573 0.3624 0.0168  0.0081  -0.0163 224 ASP B OD2 
2145 N N   . SER B 118 ? 0.1830 0.1807 0.1845 -0.0032 0.0099  -0.0048 225 SER B N   
2146 C CA  . SER B 118 ? 0.1514 0.1610 0.1624 0.0000  0.0049  -0.0026 225 SER B CA  
2147 C C   . SER B 118 ? 0.1467 0.1438 0.1514 0.0041  0.0025  -0.0015 225 SER B C   
2148 O O   . SER B 118 ? 0.1405 0.1285 0.1605 0.0038  0.0218  -0.0066 225 SER B O   
2149 C CB  . SER B 118 ? 0.1468 0.1588 0.1405 0.0027  0.0064  -0.0005 225 SER B CB  
2150 O OG  . SER B 118 ? 0.1181 0.1339 0.1500 -0.0066 0.0023  -0.0136 225 SER B OG  
2151 N N   . SER B 119 ? 0.1306 0.1227 0.1426 0.0073  0.0002  -0.0037 226 SER B N   
2152 C CA  . SER B 119 ? 0.1283 0.1159 0.1344 -0.0019 0.0000  -0.0004 226 SER B CA  
2153 C C   . SER B 119 ? 0.1269 0.1101 0.1213 0.0004  -0.0016 -0.0016 226 SER B C   
2154 O O   . SER B 119 ? 0.1230 0.1126 0.1330 -0.0019 -0.0058 0.0025  226 SER B O   
2155 C CB  . SER B 119 ? 0.1330 0.1195 0.1350 0.0072  -0.0029 0.0053  226 SER B CB  
2156 O OG  . SER B 119 ? 0.1417 0.1273 0.1350 -0.0027 -0.0011 -0.0032 226 SER B OG  
2157 N N   . ALA B 120 ? 0.1239 0.1123 0.1215 -0.0051 0.0000  -0.0046 227 ALA B N   
2158 C CA  . ALA B 120 ? 0.1184 0.1138 0.1111 -0.0013 -0.0006 -0.0059 227 ALA B CA  
2159 C C   . ALA B 120 ? 0.1216 0.1187 0.1268 -0.0033 -0.0010 -0.0100 227 ALA B C   
2160 O O   . ALA B 120 ? 0.1217 0.1211 0.1167 -0.0059 0.0031  -0.0059 227 ALA B O   
2161 C CB  . ALA B 120 ? 0.1075 0.1048 0.1163 -0.0053 -0.0093 -0.0094 227 ALA B CB  
2162 N N   . ALA B 121 ? 0.1175 0.1287 0.1247 -0.0042 0.0075  -0.0087 228 ALA B N   
2163 C CA  . ALA B 121 ? 0.1207 0.1279 0.1299 -0.0052 0.0011  -0.0112 228 ALA B CA  
2164 C C   . ALA B 121 ? 0.1371 0.1356 0.1395 -0.0021 -0.0011 -0.0047 228 ALA B C   
2165 O O   . ALA B 121 ? 0.1465 0.1419 0.1566 -0.0150 -0.0069 -0.0097 228 ALA B O   
2166 C CB  . ALA B 121 ? 0.1445 0.1338 0.1360 -0.0034 0.0099  -0.0088 228 ALA B CB  
2167 N N   . ARG B 122 ? 0.1397 0.1381 0.1397 -0.0054 0.0018  -0.0072 229 ARG B N   
2168 C CA  . ARG B 122 ? 0.1565 0.1445 0.1462 -0.0040 0.0035  -0.0003 229 ARG B CA  
2169 C C   . ARG B 122 ? 0.1449 0.1371 0.1431 -0.0019 0.0058  -0.0003 229 ARG B C   
2170 O O   . ARG B 122 ? 0.1671 0.1312 0.1429 0.0024  0.0210  -0.0112 229 ARG B O   
2171 C CB  . ARG B 122 ? 0.1542 0.1558 0.1696 -0.0031 -0.0001 0.0033  229 ARG B CB  
2172 C CG  . ARG B 122 ? 0.2252 0.2264 0.2267 -0.0018 0.0116  -0.0035 229 ARG B CG  
2173 C CD  . ARG B 122 ? 0.2782 0.2872 0.2800 0.0122  -0.0119 0.0068  229 ARG B CD  
2174 N NE  . ARG B 122 ? 0.3321 0.3125 0.3186 -0.0002 -0.0035 -0.0035 229 ARG B NE  
2175 C CZ  . ARG B 122 ? 0.3500 0.3590 0.3638 -0.0018 0.0016  0.0002  229 ARG B CZ  
2176 N NH1 . ARG B 122 ? 0.3791 0.3714 0.3642 0.0023  -0.0008 0.0091  229 ARG B NH1 
2177 N NH2 . ARG B 122 ? 0.3760 0.3671 0.3855 -0.0076 0.0000  -0.0014 229 ARG B NH2 
2178 N N   . ASN B 123 ? 0.1456 0.1437 0.1432 -0.0031 0.0109  0.0015  230 ASN B N   
2179 C CA  . ASN B 123 ? 0.1569 0.1512 0.1541 0.0002  0.0048  0.0007  230 ASN B CA  
2180 C C   . ASN B 123 ? 0.1557 0.1489 0.1516 0.0011  0.0061  0.0021  230 ASN B C   
2181 O O   . ASN B 123 ? 0.1671 0.1611 0.1674 0.0000  0.0068  0.0051  230 ASN B O   
2182 C CB  . ASN B 123 ? 0.1578 0.1628 0.1654 -0.0096 0.0148  -0.0006 230 ASN B CB  
2183 C CG  . ASN B 123 ? 0.1844 0.2012 0.1778 -0.0084 0.0021  -0.0031 230 ASN B CG  
2184 O OD1 . ASN B 123 ? 0.2633 0.2591 0.2216 -0.0436 -0.0068 0.0316  230 ASN B OD1 
2185 N ND2 . ASN B 123 ? 0.1820 0.1787 0.1506 -0.0325 0.0105  -0.0091 230 ASN B ND2 
2186 N N   . GLY B 124 ? 0.1396 0.1302 0.1394 0.0025  0.0014  0.0020  231 GLY B N   
2187 C CA  . GLY B 124 ? 0.1332 0.1178 0.1308 -0.0046 0.0013  -0.0026 231 GLY B CA  
2188 C C   . GLY B 124 ? 0.1222 0.1178 0.1303 -0.0010 -0.0020 -0.0002 231 GLY B C   
2189 O O   . GLY B 124 ? 0.1465 0.1118 0.1610 -0.0029 -0.0137 -0.0029 231 GLY B O   
2190 N N   . LEU B 125 ? 0.1091 0.1150 0.1274 0.0034  -0.0009 0.0016  232 LEU B N   
2191 C CA  . LEU B 125 ? 0.1158 0.1182 0.1243 -0.0050 -0.0005 -0.0021 232 LEU B CA  
2192 C C   . LEU B 125 ? 0.1165 0.1203 0.1245 -0.0008 -0.0014 -0.0031 232 LEU B C   
2193 O O   . LEU B 125 ? 0.1046 0.1306 0.1341 -0.0028 -0.0061 -0.0123 232 LEU B O   
2194 C CB  . LEU B 125 ? 0.1153 0.1227 0.1200 -0.0046 0.0023  -0.0027 232 LEU B CB  
2195 C CG  . LEU B 125 ? 0.1152 0.1120 0.0952 -0.0061 0.0048  0.0032  232 LEU B CG  
2196 C CD1 . LEU B 125 ? 0.1294 0.1350 0.1371 -0.0048 0.0172  -0.0080 232 LEU B CD1 
2197 C CD2 . LEU B 125 ? 0.1125 0.1234 0.0974 -0.0025 -0.0005 -0.0026 232 LEU B CD2 
2198 N N   . LEU B 126 ? 0.1134 0.1253 0.1256 -0.0014 0.0002  -0.0039 233 LEU B N   
2199 C CA  . LEU B 126 ? 0.1162 0.1177 0.1222 -0.0006 -0.0002 -0.0022 233 LEU B CA  
2200 C C   . LEU B 126 ? 0.1130 0.1162 0.1189 -0.0065 0.0049  -0.0040 233 LEU B C   
2201 O O   . LEU B 126 ? 0.0985 0.1107 0.1179 -0.0008 0.0107  -0.0097 233 LEU B O   
2202 C CB  . LEU B 126 ? 0.1122 0.1098 0.1246 -0.0010 0.0084  -0.0050 233 LEU B CB  
2203 C CG  . LEU B 126 ? 0.1377 0.1372 0.1402 -0.0060 0.0082  0.0007  233 LEU B CG  
2204 C CD1 . LEU B 126 ? 0.1384 0.1327 0.1642 -0.0038 0.0083  0.0006  233 LEU B CD1 
2205 C CD2 . LEU B 126 ? 0.1750 0.1309 0.1659 -0.0112 0.0045  -0.0063 233 LEU B CD2 
2206 N N   . THR B 127 ? 0.1329 0.1260 0.1258 -0.0044 -0.0029 -0.0042 234 THR B N   
2207 C CA  . THR B 127 ? 0.1318 0.1251 0.1200 -0.0080 -0.0064 -0.0021 234 THR B CA  
2208 C C   . THR B 127 ? 0.1374 0.1213 0.1274 -0.0048 -0.0022 -0.0043 234 THR B C   
2209 O O   . THR B 127 ? 0.1142 0.1276 0.1054 -0.0003 -0.0002 -0.0004 234 THR B O   
2210 C CB  . THR B 127 ? 0.1311 0.1339 0.1349 -0.0056 -0.0032 -0.0002 234 THR B CB  
2211 O OG1 . THR B 127 ? 0.1646 0.1077 0.1118 -0.0169 0.0071  0.0087  234 THR B OG1 
2212 C CG2 . THR B 127 ? 0.1621 0.1572 0.1697 0.0027  -0.0040 -0.0032 234 THR B CG2 
2213 N N   . GLU B 128 ? 0.1453 0.1372 0.1441 -0.0063 -0.0053 -0.0003 235 GLU B N   
2214 C CA  . GLU B 128 ? 0.1460 0.1482 0.1438 -0.0034 -0.0057 -0.0023 235 GLU B CA  
2215 C C   . GLU B 128 ? 0.1382 0.1535 0.1343 -0.0033 -0.0075 -0.0030 235 GLU B C   
2216 O O   . GLU B 128 ? 0.1286 0.1523 0.1121 0.0020  -0.0162 -0.0079 235 GLU B O   
2217 C CB  . GLU B 128 ? 0.1750 0.1540 0.1600 0.0026  -0.0090 -0.0052 235 GLU B CB  
2218 C CG  . GLU B 128 ? 0.2086 0.2085 0.1860 -0.0139 -0.0021 0.0000  235 GLU B CG  
2219 C CD  . GLU B 128 ? 0.2548 0.2598 0.2584 0.0020  -0.0080 -0.0022 235 GLU B CD  
2220 O OE1 . GLU B 128 ? 0.2972 0.2574 0.2682 -0.0064 -0.0151 0.0024  235 GLU B OE1 
2221 O OE2 . GLU B 128 ? 0.2524 0.3040 0.2755 -0.0175 0.0006  0.0191  235 GLU B OE2 
2222 N N   . HIS B 129 ? 0.1259 0.1386 0.1369 -0.0062 -0.0102 -0.0020 236 HIS B N   
2223 C CA  . HIS B 129 ? 0.1166 0.1257 0.1270 -0.0031 -0.0038 -0.0077 236 HIS B CA  
2224 C C   . HIS B 129 ? 0.1155 0.1279 0.1333 -0.0067 -0.0064 -0.0090 236 HIS B C   
2225 O O   . HIS B 129 ? 0.0974 0.1152 0.1342 -0.0240 -0.0059 -0.0174 236 HIS B O   
2226 C CB  . HIS B 129 ? 0.1137 0.1233 0.1257 -0.0036 -0.0044 -0.0088 236 HIS B CB  
2227 C CG  . HIS B 129 ? 0.1340 0.1163 0.1220 -0.0071 0.0016  -0.0127 236 HIS B CG  
2228 N ND1 . HIS B 129 ? 0.1398 0.1301 0.1408 -0.0157 -0.0171 -0.0146 236 HIS B ND1 
2229 C CD2 . HIS B 129 ? 0.1462 0.1298 0.1368 -0.0085 -0.0050 -0.0082 236 HIS B CD2 
2230 C CE1 . HIS B 129 ? 0.1273 0.1199 0.1191 0.0010  -0.0042 -0.0101 236 HIS B CE1 
2231 N NE2 . HIS B 129 ? 0.1429 0.1407 0.1296 -0.0133 -0.0080 -0.0129 236 HIS B NE2 
2232 N N   . ASN B 130 ? 0.1145 0.1309 0.1265 -0.0049 -0.0074 -0.0061 237 ASN B N   
2233 C CA  . ASN B 130 ? 0.1372 0.1360 0.1402 -0.0032 -0.0048 -0.0040 237 ASN B CA  
2234 C C   . ASN B 130 ? 0.1338 0.1337 0.1390 -0.0070 -0.0016 -0.0025 237 ASN B C   
2235 O O   . ASN B 130 ? 0.1207 0.1244 0.1468 -0.0093 -0.0119 0.0033  237 ASN B O   
2236 C CB  . ASN B 130 ? 0.1683 0.1619 0.1649 -0.0022 -0.0024 -0.0101 237 ASN B CB  
2237 C CG  . ASN B 130 ? 0.2268 0.2156 0.2118 0.0085  -0.0090 0.0024  237 ASN B CG  
2238 O OD1 . ASN B 130 ? 0.2972 0.2641 0.2661 -0.0080 -0.0072 0.0210  237 ASN B OD1 
2239 N ND2 . ASN B 130 ? 0.2520 0.2723 0.2665 0.0171  -0.0105 -0.0211 237 ASN B ND2 
2240 N N   . ILE B 131 ? 0.1183 0.1289 0.1243 0.0013  -0.0065 -0.0059 238 ILE B N   
2241 C CA  . ILE B 131 ? 0.1240 0.1141 0.1264 0.0046  -0.0006 -0.0016 238 ILE B CA  
2242 C C   . ILE B 131 ? 0.1229 0.1138 0.1197 -0.0012 -0.0017 -0.0022 238 ILE B C   
2243 O O   . ILE B 131 ? 0.1410 0.1079 0.1359 -0.0043 0.0102  0.0013  238 ILE B O   
2244 C CB  . ILE B 131 ? 0.1254 0.1226 0.1277 0.0036  -0.0040 -0.0003 238 ILE B CB  
2245 C CG1 . ILE B 131 ? 0.1320 0.1411 0.1475 -0.0021 0.0008  -0.0159 238 ILE B CG1 
2246 C CG2 . ILE B 131 ? 0.1380 0.1386 0.1314 0.0116  -0.0126 -0.0062 238 ILE B CG2 
2247 C CD1 . ILE B 131 ? 0.1213 0.1386 0.1442 -0.0003 -0.0006 -0.0051 238 ILE B CD1 
2248 N N   . CYS B 132 ? 0.1235 0.1081 0.1155 -0.0024 0.0028  -0.0117 239 CYS B N   
2249 C CA  . CYS B 132 ? 0.1163 0.1235 0.1174 0.0020  -0.0023 -0.0088 239 CYS B CA  
2250 C C   . CYS B 132 ? 0.1102 0.1162 0.1075 0.0015  -0.0030 -0.0088 239 CYS B C   
2251 O O   . CYS B 132 ? 0.0928 0.1164 0.1249 -0.0142 -0.0188 0.0013  239 CYS B O   
2252 C CB  . CYS B 132 ? 0.1182 0.1199 0.1080 0.0008  0.0007  -0.0173 239 CYS B CB  
2253 S SG  . CYS B 132 ? 0.1132 0.1673 0.1670 0.0014  -0.0298 -0.0268 239 CYS B SG  
2254 N N   . GLU B 133 ? 0.1089 0.1201 0.1032 -0.0062 -0.0045 -0.0124 240 GLU B N   
2255 C CA  . GLU B 133 ? 0.1211 0.1293 0.1184 -0.0048 -0.0062 0.0016  240 GLU B CA  
2256 C C   . GLU B 133 ? 0.1239 0.1279 0.1178 0.0009  -0.0024 -0.0063 240 GLU B C   
2257 O O   . GLU B 133 ? 0.1316 0.1177 0.1382 -0.0024 -0.0216 -0.0053 240 GLU B O   
2258 C CB  . GLU B 133 ? 0.1251 0.1351 0.1045 -0.0050 -0.0052 -0.0115 240 GLU B CB  
2259 C CG  . GLU B 133 ? 0.1287 0.1401 0.1393 0.0002  0.0025  0.0003  240 GLU B CG  
2260 C CD  . GLU B 133 ? 0.1535 0.1662 0.1610 -0.0020 -0.0073 -0.0069 240 GLU B CD  
2261 O OE1 . GLU B 133 ? 0.1508 0.1578 0.1890 -0.0004 0.0040  0.0048  240 GLU B OE1 
2262 O OE2 . GLU B 133 ? 0.1310 0.1845 0.1568 0.0014  0.0039  -0.0082 240 GLU B OE2 
2263 N N   . ILE B 134 ? 0.1263 0.1264 0.1294 -0.0030 0.0007  -0.0069 241 ILE B N   
2264 C CA  . ILE B 134 ? 0.1237 0.1309 0.1268 0.0034  0.0029  -0.0004 241 ILE B CA  
2265 C C   . ILE B 134 ? 0.1059 0.1364 0.1359 -0.0007 -0.0066 -0.0055 241 ILE B C   
2266 O O   . ILE B 134 ? 0.0930 0.1407 0.1301 0.0347  -0.0023 -0.0105 241 ILE B O   
2267 C CB  . ILE B 134 ? 0.1229 0.1313 0.1347 -0.0035 -0.0007 -0.0012 241 ILE B CB  
2268 C CG1 . ILE B 134 ? 0.1290 0.1446 0.1271 0.0007  0.0139  0.0092  241 ILE B CG1 
2269 C CG2 . ILE B 134 ? 0.1654 0.1619 0.1753 0.0085  0.0024  0.0007  241 ILE B CG2 
2270 C CD1 . ILE B 134 ? 0.1230 0.1535 0.1641 -0.0067 0.0098  0.0106  241 ILE B CD1 
2271 N N   . ASN B 135 ? 0.1256 0.1492 0.1413 0.0061  -0.0001 -0.0034 242 ASN B N   
2272 C CA  . ASN B 135 ? 0.1509 0.1633 0.1558 -0.0004 -0.0023 0.0029  242 ASN B CA  
2273 C C   . ASN B 135 ? 0.1656 0.1760 0.1688 0.0026  0.0010  -0.0052 242 ASN B C   
2274 O O   . ASN B 135 ? 0.1809 0.2179 0.1809 0.0039  -0.0066 -0.0076 242 ASN B O   
2275 C CB  . ASN B 135 ? 0.1490 0.1578 0.1571 0.0015  -0.0016 0.0021  242 ASN B CB  
2276 C CG  . ASN B 135 ? 0.1499 0.1478 0.1447 0.0003  -0.0010 0.0055  242 ASN B CG  
2277 O OD1 . ASN B 135 ? 0.1555 0.1684 0.1755 -0.0080 -0.0199 -0.0188 242 ASN B OD1 
2278 N ND2 . ASN B 135 ? 0.1358 0.1631 0.1084 -0.0084 -0.0095 0.0055  242 ASN B ND2 
2279 N N   . GLY B 136 ? 0.1713 0.1877 0.1754 0.0001  -0.0050 -0.0029 243 GLY B N   
2280 C CA  . GLY B 136 ? 0.1887 0.2000 0.1946 0.0057  0.0000  -0.0047 243 GLY B CA  
2281 C C   . GLY B 136 ? 0.1947 0.2052 0.2047 0.0025  -0.0024 -0.0051 243 GLY B C   
2282 O O   . GLY B 136 ? 0.2213 0.2288 0.2415 0.0098  0.0091  -0.0187 243 GLY B O   
2283 N N   . GLN B 137 ? 0.1871 0.2020 0.1895 0.0081  -0.0037 -0.0014 244 GLN B N   
2284 C CA  . GLN B 137 ? 0.1916 0.1970 0.1883 0.0058  -0.0017 -0.0073 244 GLN B CA  
2285 C C   . GLN B 137 ? 0.1765 0.1803 0.1803 0.0083  -0.0024 -0.0054 244 GLN B C   
2286 O O   . GLN B 137 ? 0.1377 0.1521 0.1669 0.0097  -0.0091 -0.0186 244 GLN B O   
2287 C CB  . GLN B 137 ? 0.2050 0.2126 0.2056 0.0052  -0.0118 -0.0041 244 GLN B CB  
2288 C CG  . GLN B 137 ? 0.2441 0.2381 0.2462 -0.0051 -0.0138 -0.0042 244 GLN B CG  
2289 C CD  . GLN B 137 ? 0.2579 0.2844 0.3004 -0.0065 0.0024  0.0023  244 GLN B CD  
2290 O OE1 . GLN B 137 ? 0.2908 0.2588 0.2932 0.0027  -0.0183 -0.0125 244 GLN B OE1 
2291 N NE2 . GLN B 137 ? 0.2768 0.2793 0.3534 0.0026  -0.0088 -0.0068 244 GLN B NE2 
2292 N N   . ASN B 138 ? 0.1721 0.1748 0.1759 0.0049  -0.0045 -0.0104 245 ASN B N   
2293 C CA  . ASN B 138 ? 0.1727 0.1696 0.1832 0.0049  -0.0039 -0.0042 245 ASN B CA  
2294 C C   . ASN B 138 ? 0.1664 0.1694 0.1818 0.0051  -0.0049 -0.0064 245 ASN B C   
2295 O O   . ASN B 138 ? 0.1745 0.1794 0.1918 -0.0037 -0.0232 -0.0042 245 ASN B O   
2296 C CB  . ASN B 138 ? 0.1628 0.1689 0.1755 0.0008  0.0009  -0.0100 245 ASN B CB  
2297 C CG  . ASN B 138 ? 0.1776 0.1692 0.1857 0.0011  -0.0034 -0.0070 245 ASN B CG  
2298 O OD1 . ASN B 138 ? 0.1331 0.1683 0.1782 0.0074  0.0164  -0.0114 245 ASN B OD1 
2299 N ND2 . ASN B 138 ? 0.2154 0.1969 0.2413 0.0080  -0.0027 -0.0209 245 ASN B ND2 
2300 N N   . VAL B 139 ? 0.1593 0.1634 0.1776 0.0053  -0.0065 -0.0081 246 VAL B N   
2301 C CA  . VAL B 139 ? 0.1524 0.1571 0.1775 -0.0028 0.0006  -0.0076 246 VAL B CA  
2302 C C   . VAL B 139 ? 0.1450 0.1603 0.1684 -0.0006 0.0053  -0.0095 246 VAL B C   
2303 O O   . VAL B 139 ? 0.1303 0.1331 0.1741 -0.0048 0.0085  -0.0065 246 VAL B O   
2304 C CB  . VAL B 139 ? 0.1530 0.1605 0.1713 -0.0046 0.0052  -0.0077 246 VAL B CB  
2305 C CG1 . VAL B 139 ? 0.1711 0.1636 0.1734 -0.0102 0.0077  0.0001  246 VAL B CG1 
2306 C CG2 . VAL B 139 ? 0.1770 0.1636 0.1899 -0.0041 0.0086  -0.0168 246 VAL B CG2 
2307 N N   . ILE B 140 ? 0.1419 0.1639 0.1748 -0.0045 0.0070  -0.0048 247 ILE B N   
2308 C CA  . ILE B 140 ? 0.1366 0.1713 0.1657 -0.0031 0.0026  -0.0040 247 ILE B CA  
2309 C C   . ILE B 140 ? 0.1315 0.1706 0.1706 0.0015  0.0019  -0.0041 247 ILE B C   
2310 O O   . ILE B 140 ? 0.1368 0.1490 0.2010 -0.0088 -0.0094 -0.0240 247 ILE B O   
2311 C CB  . ILE B 140 ? 0.1329 0.1664 0.1646 0.0027  0.0071  -0.0002 247 ILE B CB  
2312 C CG1 . ILE B 140 ? 0.1376 0.1804 0.1752 -0.0099 0.0089  -0.0043 247 ILE B CG1 
2313 C CG2 . ILE B 140 ? 0.1596 0.1853 0.1548 0.0047  0.0107  -0.0022 247 ILE B CG2 
2314 C CD1 . ILE B 140 ? 0.1180 0.1679 0.1763 -0.0051 -0.0019 -0.0040 247 ILE B CD1 
2315 N N   . GLY B 141 ? 0.1393 0.1763 0.1814 0.0038  -0.0071 -0.0030 248 GLY B N   
2316 C CA  . GLY B 141 ? 0.1647 0.1881 0.1877 0.0007  0.0007  0.0018  248 GLY B CA  
2317 C C   . GLY B 141 ? 0.1682 0.1787 0.1937 -0.0023 -0.0080 0.0015  248 GLY B C   
2318 O O   . GLY B 141 ? 0.1855 0.1903 0.2247 -0.0046 -0.0024 0.0087  248 GLY B O   
2319 N N   . LEU B 142 ? 0.1473 0.1633 0.1772 0.0019  -0.0025 -0.0094 249 LEU B N   
2320 C CA  . LEU B 142 ? 0.1443 0.1491 0.1608 -0.0044 -0.0042 -0.0009 249 LEU B CA  
2321 C C   . LEU B 142 ? 0.1364 0.1541 0.1618 -0.0040 -0.0022 -0.0023 249 LEU B C   
2322 O O   . LEU B 142 ? 0.1300 0.1688 0.1779 -0.0100 -0.0003 0.0036  249 LEU B O   
2323 C CB  . LEU B 142 ? 0.1336 0.1582 0.1576 -0.0059 -0.0066 -0.0023 249 LEU B CB  
2324 C CG  . LEU B 142 ? 0.1477 0.1555 0.1589 -0.0015 -0.0084 0.0023  249 LEU B CG  
2325 C CD1 . LEU B 142 ? 0.1536 0.1565 0.1760 -0.0011 -0.0034 -0.0021 249 LEU B CD1 
2326 C CD2 . LEU B 142 ? 0.1917 0.1759 0.1872 0.0040  -0.0055 0.0026  249 LEU B CD2 
2327 N N   . LYS B 143 ? 0.1429 0.1451 0.1593 -0.0032 -0.0065 0.0001  250 LYS B N   
2328 C CA  . LYS B 143 ? 0.1464 0.1533 0.1672 -0.0063 -0.0006 0.0029  250 LYS B CA  
2329 C C   . LYS B 143 ? 0.1301 0.1433 0.1484 -0.0109 -0.0024 0.0046  250 LYS B C   
2330 O O   . LYS B 143 ? 0.1069 0.1381 0.1506 -0.0153 -0.0024 0.0162  250 LYS B O   
2331 C CB  . LYS B 143 ? 0.1566 0.1541 0.1823 -0.0066 0.0017  -0.0007 250 LYS B CB  
2332 C CG  . LYS B 143 ? 0.2037 0.1717 0.2281 -0.0022 -0.0029 0.0054  250 LYS B CG  
2336 N N   . ASP B 144 ? 0.1121 0.1332 0.1458 -0.0103 -0.0018 0.0032  251 ASP B N   
2337 C CA  . ASP B 144 ? 0.1148 0.1307 0.1316 -0.0066 -0.0040 0.0053  251 ASP B CA  
2338 C C   . ASP B 144 ? 0.1053 0.1237 0.1294 -0.0071 -0.0062 0.0070  251 ASP B C   
2339 O O   . ASP B 144 ? 0.0841 0.1162 0.1264 -0.0176 -0.0013 0.0149  251 ASP B O   
2340 C CB  . ASP B 144 ? 0.1058 0.1280 0.1247 -0.0014 -0.0039 0.0081  251 ASP B CB  
2341 C CG  . ASP B 144 ? 0.1204 0.1478 0.1205 -0.0104 -0.0040 0.0008  251 ASP B CG  
2342 O OD1 . ASP B 144 ? 0.1038 0.1155 0.1018 -0.0110 -0.0236 0.0144  251 ASP B OD1 
2343 O OD2 . ASP B 144 ? 0.1097 0.1331 0.1156 -0.0029 -0.0083 0.0395  251 ASP B OD2 
2344 N N   . SER B 145 ? 0.1184 0.1192 0.1191 -0.0086 -0.0033 0.0112  252 SER B N   
2345 C CA  . SER B 145 ? 0.1146 0.1180 0.1350 -0.0022 -0.0033 0.0045  252 SER B CA  
2346 C C   . SER B 145 ? 0.1073 0.1221 0.1337 0.0019  0.0026  0.0032  252 SER B C   
2347 O O   . SER B 145 ? 0.0797 0.1232 0.1357 0.0079  -0.0010 0.0071  252 SER B O   
2348 C CB  . SER B 145 ? 0.1348 0.1357 0.1633 -0.0059 0.0030  -0.0011 252 SER B CB  
2349 O OG  . SER B 145 ? 0.1662 0.1706 0.2334 0.0086  -0.0046 0.0102  252 SER B OG  
2350 N N   . GLN B 146 ? 0.1098 0.1071 0.1297 0.0003  -0.0026 -0.0026 253 GLN B N   
2351 C CA  . GLN B 146 ? 0.1005 0.1027 0.1173 -0.0044 -0.0041 0.0007  253 GLN B CA  
2352 C C   . GLN B 146 ? 0.1053 0.1062 0.1207 -0.0067 -0.0102 -0.0012 253 GLN B C   
2353 O O   . GLN B 146 ? 0.1069 0.0927 0.1260 -0.0259 -0.0084 0.0034  253 GLN B O   
2354 C CB  . GLN B 146 ? 0.1051 0.1103 0.1068 -0.0014 -0.0015 0.0000  253 GLN B CB  
2355 C CG  . GLN B 146 ? 0.1296 0.1263 0.1249 -0.0014 -0.0005 0.0093  253 GLN B CG  
2356 C CD  . GLN B 146 ? 0.1511 0.1428 0.1509 0.0054  -0.0005 0.0034  253 GLN B CD  
2357 O OE1 . GLN B 146 ? 0.1602 0.1411 0.1838 -0.0212 -0.0229 -0.0167 253 GLN B OE1 
2358 N NE2 . GLN B 146 ? 0.1769 0.1779 0.1662 -0.0111 0.0035  -0.0158 253 GLN B NE2 
2359 N N   . ILE B 147 ? 0.1022 0.0970 0.1081 -0.0080 -0.0144 -0.0036 254 ILE B N   
2360 C CA  . ILE B 147 ? 0.1030 0.1033 0.1095 -0.0088 -0.0057 0.0027  254 ILE B CA  
2361 C C   . ILE B 147 ? 0.0969 0.0961 0.0987 -0.0107 -0.0032 -0.0016 254 ILE B C   
2362 O O   . ILE B 147 ? 0.0902 0.1020 0.1045 -0.0394 -0.0043 0.0005  254 ILE B O   
2363 C CB  . ILE B 147 ? 0.1081 0.0987 0.1110 -0.0032 -0.0043 0.0013  254 ILE B CB  
2364 C CG1 . ILE B 147 ? 0.1383 0.1603 0.1502 0.0015  -0.0101 0.0027  254 ILE B CG1 
2365 C CG2 . ILE B 147 ? 0.1274 0.1189 0.1360 -0.0094 -0.0021 -0.0089 254 ILE B CG2 
2366 C CD1 . ILE B 147 ? 0.1456 0.1681 0.1550 -0.0007 -0.0220 -0.0019 254 ILE B CD1 
2367 N N   . ALA B 148 ? 0.0987 0.0909 0.0933 -0.0159 -0.0050 0.0031  255 ALA B N   
2368 C CA  . ALA B 148 ? 0.1132 0.1070 0.1053 -0.0074 0.0038  0.0031  255 ALA B CA  
2369 C C   . ALA B 148 ? 0.1132 0.1180 0.1027 -0.0046 0.0026  0.0052  255 ALA B C   
2370 O O   . ALA B 148 ? 0.1166 0.1383 0.1058 -0.0068 0.0182  0.0079  255 ALA B O   
2371 C CB  . ALA B 148 ? 0.1172 0.1055 0.0963 -0.0049 0.0052  0.0070  255 ALA B CB  
2372 N N   . ASP B 149 ? 0.1146 0.1228 0.1176 -0.0111 0.0016  0.0054  256 ASP B N   
2373 C CA  . ASP B 149 ? 0.1298 0.1380 0.1192 -0.0011 -0.0004 0.0081  256 ASP B CA  
2374 C C   . ASP B 149 ? 0.1155 0.1184 0.1153 -0.0029 -0.0030 0.0104  256 ASP B C   
2375 O O   . ASP B 149 ? 0.1173 0.1145 0.0998 -0.0057 -0.0114 0.0134  256 ASP B O   
2376 C CB  . ASP B 149 ? 0.1423 0.1394 0.1487 -0.0108 -0.0047 0.0104  256 ASP B CB  
2377 C CG  . ASP B 149 ? 0.2182 0.2337 0.2109 -0.0038 -0.0162 0.0009  256 ASP B CG  
2378 O OD1 . ASP B 149 ? 0.2617 0.2728 0.3034 0.0083  -0.0130 0.0251  256 ASP B OD1 
2379 O OD2 . ASP B 149 ? 0.2841 0.2609 0.2683 -0.0009 -0.0098 -0.0058 256 ASP B OD2 
2380 N N   . ILE B 150 ? 0.1091 0.1011 0.0968 0.0027  -0.0030 0.0102  257 ILE B N   
2381 C CA  . ILE B 150 ? 0.0938 0.1064 0.1137 0.0003  0.0033  0.0016  257 ILE B CA  
2382 C C   . ILE B 150 ? 0.0946 0.0960 0.1104 -0.0109 0.0005  0.0036  257 ILE B C   
2383 O O   . ILE B 150 ? 0.0996 0.1057 0.1128 -0.0020 -0.0015 0.0074  257 ILE B O   
2384 C CB  . ILE B 150 ? 0.0889 0.1044 0.1045 0.0007  -0.0080 0.0049  257 ILE B CB  
2385 C CG1 . ILE B 150 ? 0.1149 0.1207 0.1343 0.0021  0.0042  0.0062  257 ILE B CG1 
2386 C CG2 . ILE B 150 ? 0.1007 0.1136 0.1276 0.0023  -0.0002 0.0039  257 ILE B CG2 
2387 C CD1 . ILE B 150 ? 0.1282 0.1456 0.1515 0.0050  0.0084  0.0111  257 ILE B CD1 
2388 N N   . LEU B 151 ? 0.1127 0.1069 0.1106 -0.0018 -0.0002 0.0064  258 LEU B N   
2389 C CA  . LEU B 151 ? 0.1141 0.1082 0.1153 0.0015  0.0028  -0.0018 258 LEU B CA  
2390 C C   . LEU B 151 ? 0.1213 0.1199 0.1129 0.0061  -0.0003 -0.0010 258 LEU B C   
2391 O O   . LEU B 151 ? 0.1338 0.1132 0.1312 0.0132  0.0019  -0.0025 258 LEU B O   
2392 C CB  . LEU B 151 ? 0.1127 0.1053 0.1192 0.0043  -0.0028 -0.0046 258 LEU B CB  
2393 C CG  . LEU B 151 ? 0.1211 0.1249 0.1356 -0.0013 0.0088  -0.0061 258 LEU B CG  
2394 C CD1 . LEU B 151 ? 0.1371 0.1548 0.1492 -0.0063 -0.0002 -0.0106 258 LEU B CD1 
2395 C CD2 . LEU B 151 ? 0.1313 0.1285 0.1150 -0.0008 0.0004  0.0030  258 LEU B CD2 
2396 N N   . SER B 152 ? 0.1249 0.1252 0.1191 0.0045  -0.0053 -0.0043 259 SER B N   
2397 C CA  . SER B 152 ? 0.1326 0.1534 0.1339 0.0012  -0.0031 -0.0032 259 SER B CA  
2398 C C   . SER B 152 ? 0.1172 0.1348 0.1168 0.0025  -0.0065 -0.0010 259 SER B C   
2399 O O   . SER B 152 ? 0.1071 0.1562 0.1325 -0.0001 -0.0095 0.0025  259 SER B O   
2400 C CB  . SER B 152 ? 0.1572 0.1613 0.1373 0.0006  0.0030  0.0061  259 SER B CB  
2401 O OG  . SER B 152 ? 0.2468 0.2954 0.2261 -0.0059 0.0012  -0.0051 259 SER B OG  
2402 N N   . THR B 153 ? 0.0903 0.1366 0.1103 0.0002  -0.0059 0.0014  260 THR B N   
2403 C CA  . THR B 153 ? 0.1037 0.1238 0.1059 -0.0018 -0.0026 0.0040  260 THR B CA  
2404 C C   . THR B 153 ? 0.1099 0.1298 0.1072 -0.0021 -0.0010 0.0034  260 THR B C   
2405 O O   . THR B 153 ? 0.1092 0.1406 0.1025 -0.0048 -0.0052 0.0070  260 THR B O   
2406 C CB  . THR B 153 ? 0.1116 0.1304 0.1125 0.0056  0.0001  0.0046  260 THR B CB  
2407 O OG1 . THR B 153 ? 0.0923 0.1197 0.1092 -0.0098 0.0024  0.0155  260 THR B OG1 
2408 C CG2 . THR B 153 ? 0.1143 0.1336 0.1457 0.0030  0.0033  0.0004  260 THR B CG2 
2409 N N   . SER B 154 ? 0.1107 0.1231 0.1036 -0.0052 -0.0004 0.0051  261 SER B N   
2410 C CA  . SER B 154 ? 0.1154 0.1203 0.1074 -0.0033 -0.0017 0.0029  261 SER B CA  
2411 C C   . SER B 154 ? 0.1179 0.1254 0.1099 -0.0035 -0.0010 0.0053  261 SER B C   
2412 O O   . SER B 154 ? 0.0944 0.1339 0.1017 -0.0006 -0.0137 0.0186  261 SER B O   
2413 C CB  . SER B 154 ? 0.1273 0.1316 0.1268 -0.0068 -0.0011 0.0051  261 SER B CB  
2414 O OG  . SER B 154 ? 0.1366 0.1231 0.1260 -0.0083 -0.0013 0.0174  261 SER B OG  
2415 N N   . GLY B 155 ? 0.1170 0.1269 0.1066 -0.0065 -0.0089 0.0051  262 GLY B N   
2416 C CA  . GLY B 155 ? 0.1229 0.1191 0.1307 0.0004  -0.0042 0.0004  262 GLY B CA  
2417 C C   . GLY B 155 ? 0.1422 0.1331 0.1308 -0.0020 -0.0113 0.0026  262 GLY B C   
2418 O O   . GLY B 155 ? 0.1588 0.1165 0.1280 0.0042  -0.0173 0.0219  262 GLY B O   
2419 N N   . THR B 156 ? 0.1435 0.1427 0.1528 0.0091  -0.0125 -0.0075 263 THR B N   
2420 C CA  . THR B 156 ? 0.1634 0.1566 0.1635 -0.0016 -0.0108 -0.0004 263 THR B CA  
2421 C C   . THR B 156 ? 0.1426 0.1425 0.1423 0.0059  -0.0070 0.0017  263 THR B C   
2422 O O   . THR B 156 ? 0.1502 0.1389 0.1418 0.0046  -0.0063 -0.0031 263 THR B O   
2423 C CB  . THR B 156 ? 0.1602 0.1628 0.1862 0.0122  -0.0118 -0.0059 263 THR B CB  
2424 O OG1 . THR B 156 ? 0.2155 0.2380 0.2492 0.0058  -0.0125 -0.0133 263 THR B OG1 
2425 C CG2 . THR B 156 ? 0.2260 0.2173 0.2283 0.0094  -0.0072 -0.0045 263 THR B CG2 
2426 N N   . VAL B 157 ? 0.1498 0.1451 0.1399 -0.0002 -0.0092 0.0025  264 VAL B N   
2427 C CA  . VAL B 157 ? 0.1448 0.1425 0.1422 -0.0008 -0.0020 0.0012  264 VAL B CA  
2428 C C   . VAL B 157 ? 0.1476 0.1412 0.1447 0.0021  -0.0052 -0.0026 264 VAL B C   
2429 O O   . VAL B 157 ? 0.1539 0.1521 0.1336 0.0066  -0.0051 -0.0113 264 VAL B O   
2430 C CB  . VAL B 157 ? 0.1484 0.1435 0.1374 -0.0015 -0.0008 -0.0057 264 VAL B CB  
2431 C CG1 . VAL B 157 ? 0.1642 0.1660 0.1539 -0.0057 0.0067  -0.0015 264 VAL B CG1 
2432 C CG2 . VAL B 157 ? 0.1500 0.1691 0.1543 -0.0054 0.0043  0.0091  264 VAL B CG2 
2433 N N   . VAL B 158 ? 0.1478 0.1228 0.1397 -0.0022 0.0000  -0.0093 265 VAL B N   
2434 C CA  . VAL B 158 ? 0.1290 0.1267 0.1302 -0.0028 -0.0036 -0.0068 265 VAL B CA  
2435 C C   . VAL B 158 ? 0.1365 0.1324 0.1377 -0.0047 0.0026  -0.0070 265 VAL B C   
2436 O O   . VAL B 158 ? 0.1259 0.1481 0.1351 -0.0177 -0.0109 -0.0194 265 VAL B O   
2437 C CB  . VAL B 158 ? 0.1197 0.1198 0.1314 -0.0026 0.0012  -0.0095 265 VAL B CB  
2438 C CG1 . VAL B 158 ? 0.1364 0.1385 0.1372 -0.0001 -0.0031 -0.0017 265 VAL B CG1 
2439 C CG2 . VAL B 158 ? 0.1136 0.1297 0.1039 -0.0025 0.0037  -0.0057 265 VAL B CG2 
2440 N N   . THR B 159 ? 0.1299 0.1182 0.1250 -0.0001 0.0035  0.0015  266 THR B N   
2441 C CA  . THR B 159 ? 0.1390 0.1403 0.1389 -0.0027 -0.0057 -0.0027 266 THR B CA  
2442 C C   . THR B 159 ? 0.1526 0.1397 0.1429 -0.0011 -0.0034 0.0013  266 THR B C   
2443 O O   . THR B 159 ? 0.1891 0.1633 0.1659 0.0000  -0.0152 -0.0068 266 THR B O   
2444 C CB  . THR B 159 ? 0.1365 0.1568 0.1510 -0.0004 0.0002  0.0034  266 THR B CB  
2445 O OG1 . THR B 159 ? 0.1578 0.1686 0.1716 -0.0021 0.0009  0.0234  266 THR B OG1 
2446 C CG2 . THR B 159 ? 0.1551 0.1552 0.1853 -0.0124 0.0005  -0.0011 266 THR B CG2 
2447 N N   . ILE B 160 ? 0.1356 0.1310 0.1357 -0.0125 0.0015  -0.0011 267 ILE B N   
2448 C CA  . ILE B 160 ? 0.1381 0.1436 0.1470 -0.0027 -0.0012 -0.0044 267 ILE B CA  
2449 C C   . ILE B 160 ? 0.1418 0.1390 0.1474 -0.0073 0.0021  -0.0027 267 ILE B C   
2450 O O   . ILE B 160 ? 0.1336 0.1202 0.1521 -0.0146 0.0025  0.0018  267 ILE B O   
2451 C CB  . ILE B 160 ? 0.1551 0.1535 0.1570 -0.0055 0.0005  -0.0009 267 ILE B CB  
2452 C CG1 . ILE B 160 ? 0.1889 0.2087 0.1971 -0.0016 0.0056  -0.0038 267 ILE B CG1 
2453 C CG2 . ILE B 160 ? 0.1790 0.1708 0.1668 -0.0052 -0.0001 -0.0066 267 ILE B CG2 
2454 C CD1 . ILE B 160 ? 0.2087 0.2308 0.2125 -0.0091 0.0116  0.0002  267 ILE B CD1 
2455 N N   . THR B 161 ? 0.1308 0.1332 0.1507 -0.0021 -0.0012 -0.0022 268 THR B N   
2456 C CA  . THR B 161 ? 0.1360 0.1401 0.1547 -0.0069 -0.0040 -0.0048 268 THR B CA  
2457 C C   . THR B 161 ? 0.1269 0.1355 0.1548 -0.0045 0.0014  -0.0042 268 THR B C   
2458 O O   . THR B 161 ? 0.0994 0.1007 0.1492 -0.0160 -0.0153 -0.0119 268 THR B O   
2459 C CB  . THR B 161 ? 0.1477 0.1613 0.1645 -0.0029 -0.0006 -0.0013 268 THR B CB  
2460 O OG1 . THR B 161 ? 0.1801 0.1834 0.1759 0.0184  0.0166  0.0077  268 THR B OG1 
2461 C CG2 . THR B 161 ? 0.1753 0.1846 0.2148 -0.0137 -0.0040 -0.0066 268 THR B CG2 
2462 N N   . ILE B 162 ? 0.1360 0.1442 0.1485 -0.0144 -0.0015 -0.0080 269 ILE B N   
2463 C CA  . ILE B 162 ? 0.1425 0.1517 0.1572 -0.0030 -0.0031 -0.0029 269 ILE B CA  
2464 C C   . ILE B 162 ? 0.1494 0.1603 0.1579 -0.0048 -0.0009 -0.0041 269 ILE B C   
2465 O O   . ILE B 162 ? 0.1636 0.1695 0.1600 -0.0112 -0.0119 -0.0033 269 ILE B O   
2466 C CB  . ILE B 162 ? 0.1429 0.1557 0.1635 -0.0027 -0.0045 -0.0007 269 ILE B CB  
2467 C CG1 . ILE B 162 ? 0.1444 0.1469 0.1535 0.0047  -0.0062 0.0029  269 ILE B CG1 
2468 C CG2 . ILE B 162 ? 0.1340 0.1543 0.1876 -0.0001 -0.0009 0.0024  269 ILE B CG2 
2469 C CD1 . ILE B 162 ? 0.1737 0.1721 0.1751 0.0080  -0.0049 -0.0080 269 ILE B CD1 
2470 N N   . MET B 163 ? 0.1526 0.1622 0.1504 0.0000  -0.0002 -0.0103 270 MET B N   
2471 C CA  . MET B 163 ? 0.1600 0.1645 0.1665 0.0037  -0.0005 -0.0057 270 MET B CA  
2472 C C   . MET B 163 ? 0.1616 0.1657 0.1669 -0.0007 -0.0019 -0.0116 270 MET B C   
2473 O O   . MET B 163 ? 0.1498 0.1344 0.1551 -0.0146 -0.0117 -0.0260 270 MET B O   
2474 C CB  . MET B 163 ? 0.1631 0.1755 0.1598 0.0053  0.0029  -0.0143 270 MET B CB  
2475 C CG  . MET B 163 ? 0.2146 0.2186 0.2129 0.0063  0.0035  -0.0116 270 MET B CG  
2476 S SD  . MET B 163 ? 0.2672 0.2520 0.2412 0.0587  0.0573  -0.0297 270 MET B SD  
2477 C CE  . MET B 163 ? 0.3029 0.2918 0.2965 0.0062  0.0084  -0.0022 270 MET B CE  
2478 N N   . PRO B 164 ? 0.1857 0.1750 0.1815 -0.0045 -0.0057 -0.0113 271 PRO B N   
2479 C CA  . PRO B 164 ? 0.1984 0.2010 0.1916 -0.0035 0.0002  -0.0084 271 PRO B CA  
2480 C C   . PRO B 164 ? 0.2180 0.2267 0.2210 0.0026  -0.0044 -0.0093 271 PRO B C   
2481 O O   . PRO B 164 ? 0.2187 0.2500 0.2033 0.0129  0.0037  -0.0116 271 PRO B O   
2482 C CB  . PRO B 164 ? 0.1879 0.2064 0.1944 -0.0061 -0.0013 -0.0064 271 PRO B CB  
2483 C CG  . PRO B 164 ? 0.1875 0.1790 0.1860 -0.0022 -0.0104 -0.0047 271 PRO B CG  
2484 C CD  . PRO B 164 ? 0.1807 0.1763 0.1604 -0.0067 -0.0021 -0.0148 271 PRO B CD  
2485 N N   . ALA B 165 ? 0.2539 0.2591 0.2332 0.0002  -0.0012 -0.0069 272 ALA B N   
2486 C CA  . ALA B 165 ? 0.2866 0.2862 0.2807 0.0018  -0.0011 -0.0054 272 ALA B CA  
2487 C C   . ALA B 165 ? 0.3142 0.3158 0.2886 -0.0009 -0.0092 -0.0062 272 ALA B C   
2488 O O   . ALA B 165 ? 0.3425 0.3334 0.3155 -0.0019 0.0014  -0.0177 272 ALA B O   
2489 C CB  . ALA B 165 ? 0.3026 0.2976 0.2892 -0.0018 0.0010  -0.0053 272 ALA B CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   108 ?   ?   ?   A . n 
A 1 2   ALA 2   109 ?   ?   ?   A . n 
A 1 3   MET 3   110 ?   ?   ?   A . n 
A 1 4   ASP 4   111 111 ASP ASP A . n 
A 1 5   PRO 5   112 112 PRO PRO A . n 
A 1 6   ARG 6   113 113 ARG ARG A . n 
A 1 7   GLU 7   114 114 GLU GLU A . n 
A 1 8   VAL 8   115 115 VAL VAL A . n 
A 1 9   ILE 9   116 116 ILE ILE A . n 
A 1 10  LEU 10  117 117 LEU LEU A . n 
A 1 11  CYS 11  118 118 CYS CYS A . n 
A 1 12  LYS 12  119 119 LYS LYS A . n 
A 1 13  ASP 13  120 120 ASP ASP A . n 
A 1 14  GLN 14  121 121 GLN GLN A . n 
A 1 15  ASP 15  122 122 ASP ASP A . n 
A 1 16  GLY 16  123 123 GLY GLY A . n 
A 1 17  LYS 17  124 124 LYS LYS A . n 
A 1 18  ILE 18  125 125 ILE ILE A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  LEU 20  127 127 LEU LEU A . n 
A 1 21  ARG 21  128 128 ARG ARG A . n 
A 1 22  LEU 22  129 129 LEU LEU A . n 
A 1 23  LYS 23  130 130 LYS LYS A . n 
A 1 24  SER 24  131 131 SER SER A . n 
A 1 25  ILE 25  132 132 ILE ILE A . n 
A 1 26  ASP 26  133 133 ASP ASP A . n 
A 1 27  ASN 27  134 134 ASN ASN A . n 
A 1 28  GLY 28  135 135 GLY GLY A . n 
A 1 29  ILE 29  136 136 ILE ILE A . n 
A 1 30  PHE 30  137 137 PHE PHE A . n 
A 1 31  VAL 31  138 138 VAL VAL A . n 
A 1 32  GLN 32  139 139 GLN GLN A . n 
A 1 33  LEU 33  140 140 LEU LEU A . n 
A 1 34  VAL 34  141 141 VAL VAL A . n 
A 1 35  GLN 35  142 142 GLN GLN A . n 
A 1 36  ALA 36  143 143 ALA ALA A . n 
A 1 37  ASN 37  144 144 ASN ASN A . n 
A 1 38  SER 38  145 145 SER SER A . n 
A 1 39  PRO 39  146 146 PRO PRO A . n 
A 1 40  ALA 40  147 147 ALA ALA A . n 
A 1 41  SER 41  148 148 SER SER A . n 
A 1 42  LEU 42  149 149 LEU LEU A . n 
A 1 43  VAL 43  150 150 VAL VAL A . n 
A 1 44  GLY 44  151 151 GLY GLY A . n 
A 1 45  LEU 45  152 152 LEU LEU A . n 
A 1 46  ARG 46  153 153 ARG ARG A . n 
A 1 47  PHE 47  154 154 PHE PHE A . n 
A 1 48  GLY 48  155 155 GLY GLY A . n 
A 1 49  ASP 49  156 156 ASP ASP A . n 
A 1 50  GLN 50  157 157 GLN GLN A . n 
A 1 51  VAL 51  158 158 VAL VAL A . n 
A 1 52  LEU 52  159 159 LEU LEU A . n 
A 1 53  GLN 53  160 160 GLN GLN A . n 
A 1 54  ILE 54  161 161 ILE ILE A . n 
A 1 55  ASN 55  162 162 ASN ASN A . n 
A 1 56  GLY 56  163 163 GLY GLY A . n 
A 1 57  GLU 57  164 164 GLU GLU A . n 
A 1 58  ASN 58  165 165 ASN ASN A . n 
A 1 59  CYS 59  166 166 CYS CYS A . n 
A 1 60  ALA 60  167 167 ALA ALA A . n 
A 1 61  GLY 61  168 168 GLY GLY A . n 
A 1 62  TRP 62  169 169 TRP TRP A . n 
A 1 63  SER 63  170 170 SER SER A . n 
A 1 64  SER 64  171 171 SER SER A . n 
A 1 65  ASP 65  172 172 ASP ASP A . n 
A 1 66  LYS 66  173 173 LYS LYS A . n 
A 1 67  ALA 67  174 174 ALA ALA A . n 
A 1 68  HIS 68  175 175 HIS HIS A . n 
A 1 69  LYS 69  176 176 LYS LYS A . n 
A 1 70  VAL 70  177 177 VAL VAL A . n 
A 1 71  LEU 71  178 178 LEU LEU A . n 
A 1 72  LYS 72  179 179 LYS LYS A . n 
A 1 73  GLN 73  180 180 GLN GLN A . n 
A 1 74  ALA 74  181 181 ALA ALA A . n 
A 1 75  PHE 75  182 182 PHE PHE A . n 
A 1 76  GLY 76  183 183 GLY GLY A . n 
A 1 77  GLU 77  184 184 GLU GLU A . n 
A 1 78  LYS 78  185 185 LYS LYS A . n 
A 1 79  ILE 79  186 186 ILE ILE A . n 
A 1 80  THR 80  187 187 THR THR A . n 
A 1 81  MET 81  188 188 MET MET A . n 
A 1 82  THR 82  189 189 THR THR A . n 
A 1 83  ILE 83  190 190 ILE ILE A . n 
A 1 84  ARG 84  191 191 ARG ARG A . n 
A 1 85  ASP 85  192 192 ASP ASP A . n 
A 1 86  ARG 86  193 193 ARG ARG A . n 
A 1 87  PRO 87  194 194 PRO PRO A . n 
A 1 88  PHE 88  195 195 PHE PHE A . n 
A 1 89  GLU 89  196 196 GLU GLU A . n 
A 1 90  ARG 90  197 197 ARG ARG A . n 
A 1 91  THR 91  198 198 THR THR A . n 
A 1 92  ILE 92  199 199 ILE ILE A . n 
A 1 93  THR 93  200 200 THR THR A . n 
A 1 94  MET 94  201 201 MET MET A . n 
A 1 95  HIS 95  202 202 HIS HIS A . n 
A 1 96  LYS 96  203 203 LYS LYS A . n 
A 1 97  ASP 97  204 204 ASP ASP A . n 
A 1 98  SER 98  205 205 SER SER A . n 
A 1 99  THR 99  206 206 THR THR A . n 
A 1 100 GLY 100 207 207 GLY GLY A . n 
A 1 101 HIS 101 208 208 HIS HIS A . n 
A 1 102 VAL 102 209 209 VAL VAL A . n 
A 1 103 GLY 103 210 210 GLY GLY A . n 
A 1 104 PHE 104 211 211 PHE PHE A . n 
A 1 105 ILE 105 212 212 ILE ILE A . n 
A 1 106 PHE 106 213 213 PHE PHE A . n 
A 1 107 LYS 107 214 214 LYS LYS A . n 
A 1 108 ASN 108 215 215 ASN ASN A . n 
A 1 109 GLY 109 216 216 GLY GLY A . n 
A 1 110 LYS 110 217 217 LYS LYS A . n 
A 1 111 ILE 111 218 218 ILE ILE A . n 
A 1 112 THR 112 219 219 THR THR A . n 
A 1 113 SER 113 220 220 SER SER A . n 
A 1 114 ILE 114 221 221 ILE ILE A . n 
A 1 115 VAL 115 222 222 VAL VAL A . n 
A 1 116 LYS 116 223 223 LYS LYS A . n 
A 1 117 ASP 117 224 224 ASP ASP A . n 
A 1 118 SER 118 225 225 SER SER A . n 
A 1 119 SER 119 226 226 SER SER A . n 
A 1 120 ALA 120 227 227 ALA ALA A . n 
A 1 121 ALA 121 228 228 ALA ALA A . n 
A 1 122 ARG 122 229 229 ARG ARG A . n 
A 1 123 ASN 123 230 230 ASN ASN A . n 
A 1 124 GLY 124 231 231 GLY GLY A . n 
A 1 125 LEU 125 232 232 LEU LEU A . n 
A 1 126 LEU 126 233 233 LEU LEU A . n 
A 1 127 THR 127 234 234 THR THR A . n 
A 1 128 GLU 128 235 235 GLU GLU A . n 
A 1 129 HIS 129 236 236 HIS HIS A . n 
A 1 130 ASN 130 237 237 ASN ASN A . n 
A 1 131 ILE 131 238 238 ILE ILE A . n 
A 1 132 CYS 132 239 239 CYS CYS A . n 
A 1 133 GLU 133 240 240 GLU GLU A . n 
A 1 134 ILE 134 241 241 ILE ILE A . n 
A 1 135 ASN 135 242 242 ASN ASN A . n 
A 1 136 GLY 136 243 243 GLY GLY A . n 
A 1 137 GLN 137 244 244 GLN GLN A . n 
A 1 138 ASN 138 245 245 ASN ASN A . n 
A 1 139 VAL 139 246 246 VAL VAL A . n 
A 1 140 ILE 140 247 247 ILE ILE A . n 
A 1 141 GLY 141 248 248 GLY GLY A . n 
A 1 142 LEU 142 249 249 LEU LEU A . n 
A 1 143 LYS 143 250 250 LYS LYS A . n 
A 1 144 ASP 144 251 251 ASP ASP A . n 
A 1 145 SER 145 252 252 SER SER A . n 
A 1 146 GLN 146 253 253 GLN GLN A . n 
A 1 147 ILE 147 254 254 ILE ILE A . n 
A 1 148 ALA 148 255 255 ALA ALA A . n 
A 1 149 ASP 149 256 256 ASP ASP A . n 
A 1 150 ILE 150 257 257 ILE ILE A . n 
A 1 151 LEU 151 258 258 LEU LEU A . n 
A 1 152 SER 152 259 259 SER SER A . n 
A 1 153 THR 153 260 260 THR THR A . n 
A 1 154 SER 154 261 261 SER SER A . n 
A 1 155 GLY 155 262 262 GLY GLY A . n 
A 1 156 THR 156 263 263 THR THR A . n 
A 1 157 VAL 157 264 264 VAL VAL A . n 
A 1 158 VAL 158 265 265 VAL VAL A . n 
A 1 159 THR 159 266 266 THR THR A . n 
A 1 160 ILE 160 267 267 ILE ILE A . n 
A 1 161 THR 161 268 268 THR THR A . n 
A 1 162 ILE 162 269 269 ILE ILE A . n 
A 1 163 MET 163 270 270 MET MET A . n 
A 1 164 PRO 164 271 271 PRO PRO A . n 
A 1 165 ALA 165 272 272 ALA ALA A . n 
A 1 166 PHE 166 273 273 PHE PHE A . n 
B 1 1   GLY 1   108 108 GLY GLY B . n 
B 1 2   ALA 2   109 109 ALA ALA B . n 
B 1 3   MET 3   110 110 MET MET B . n 
B 1 4   ASP 4   111 111 ASP ASP B . n 
B 1 5   PRO 5   112 112 PRO PRO B . n 
B 1 6   ARG 6   113 113 ARG ARG B . n 
B 1 7   GLU 7   114 114 GLU GLU B . n 
B 1 8   VAL 8   115 115 VAL VAL B . n 
B 1 9   ILE 9   116 116 ILE ILE B . n 
B 1 10  LEU 10  117 117 LEU LEU B . n 
B 1 11  CYS 11  118 118 CYS CYS B . n 
B 1 12  LYS 12  119 119 LYS LYS B . n 
B 1 13  ASP 13  120 120 ASP ASP B . n 
B 1 14  GLN 14  121 121 GLN GLN B . n 
B 1 15  ASP 15  122 122 ASP ASP B . n 
B 1 16  GLY 16  123 123 GLY GLY B . n 
B 1 17  LYS 17  124 124 LYS LYS B . n 
B 1 18  ILE 18  125 125 ILE ILE B . n 
B 1 19  GLY 19  126 126 GLY GLY B . n 
B 1 20  LEU 20  127 127 LEU LEU B . n 
B 1 21  ARG 21  128 128 ARG ARG B . n 
B 1 22  LEU 22  129 129 LEU LEU B . n 
B 1 23  LYS 23  130 130 LYS LYS B . n 
B 1 24  SER 24  131 131 SER SER B . n 
B 1 25  ILE 25  132 132 ILE ILE B . n 
B 1 26  ASP 26  133 133 ASP ASP B . n 
B 1 27  ASN 27  134 134 ASN ASN B . n 
B 1 28  GLY 28  135 135 GLY GLY B . n 
B 1 29  ILE 29  136 136 ILE ILE B . n 
B 1 30  PHE 30  137 137 PHE PHE B . n 
B 1 31  VAL 31  138 138 VAL VAL B . n 
B 1 32  GLN 32  139 139 GLN GLN B . n 
B 1 33  LEU 33  140 140 LEU LEU B . n 
B 1 34  VAL 34  141 141 VAL VAL B . n 
B 1 35  GLN 35  142 142 GLN GLN B . n 
B 1 36  ALA 36  143 143 ALA ALA B . n 
B 1 37  ASN 37  144 144 ASN ASN B . n 
B 1 38  SER 38  145 145 SER SER B . n 
B 1 39  PRO 39  146 146 PRO PRO B . n 
B 1 40  ALA 40  147 147 ALA ALA B . n 
B 1 41  SER 41  148 148 SER SER B . n 
B 1 42  LEU 42  149 149 LEU LEU B . n 
B 1 43  VAL 43  150 150 VAL VAL B . n 
B 1 44  GLY 44  151 151 GLY GLY B . n 
B 1 45  LEU 45  152 152 LEU LEU B . n 
B 1 46  ARG 46  153 153 ARG ARG B . n 
B 1 47  PHE 47  154 154 PHE PHE B . n 
B 1 48  GLY 48  155 155 GLY GLY B . n 
B 1 49  ASP 49  156 156 ASP ASP B . n 
B 1 50  GLN 50  157 157 GLN GLN B . n 
B 1 51  VAL 51  158 158 VAL VAL B . n 
B 1 52  LEU 52  159 159 LEU LEU B . n 
B 1 53  GLN 53  160 160 GLN GLN B . n 
B 1 54  ILE 54  161 161 ILE ILE B . n 
B 1 55  ASN 55  162 162 ASN ASN B . n 
B 1 56  GLY 56  163 163 GLY GLY B . n 
B 1 57  GLU 57  164 164 GLU GLU B . n 
B 1 58  ASN 58  165 165 ASN ASN B . n 
B 1 59  CYS 59  166 166 CYS CYS B . n 
B 1 60  ALA 60  167 167 ALA ALA B . n 
B 1 61  GLY 61  168 168 GLY GLY B . n 
B 1 62  TRP 62  169 169 TRP TRP B . n 
B 1 63  SER 63  170 170 SER SER B . n 
B 1 64  SER 64  171 171 SER SER B . n 
B 1 65  ASP 65  172 172 ASP ASP B . n 
B 1 66  LYS 66  173 173 LYS LYS B . n 
B 1 67  ALA 67  174 174 ALA ALA B . n 
B 1 68  HIS 68  175 175 HIS HIS B . n 
B 1 69  LYS 69  176 176 LYS LYS B . n 
B 1 70  VAL 70  177 177 VAL VAL B . n 
B 1 71  LEU 71  178 178 LEU LEU B . n 
B 1 72  LYS 72  179 179 LYS LYS B . n 
B 1 73  GLN 73  180 180 GLN GLN B . n 
B 1 74  ALA 74  181 181 ALA ALA B . n 
B 1 75  PHE 75  182 182 PHE PHE B . n 
B 1 76  GLY 76  183 183 GLY GLY B . n 
B 1 77  GLU 77  184 184 GLU GLU B . n 
B 1 78  LYS 78  185 185 LYS LYS B . n 
B 1 79  ILE 79  186 186 ILE ILE B . n 
B 1 80  THR 80  187 187 THR THR B . n 
B 1 81  MET 81  188 188 MET MET B . n 
B 1 82  THR 82  189 189 THR THR B . n 
B 1 83  ILE 83  190 190 ILE ILE B . n 
B 1 84  ARG 84  191 191 ARG ARG B . n 
B 1 85  ASP 85  192 192 ASP ASP B . n 
B 1 86  ARG 86  193 193 ARG ARG B . n 
B 1 87  PRO 87  194 194 PRO PRO B . n 
B 1 88  PHE 88  195 195 PHE PHE B . n 
B 1 89  GLU 89  196 196 GLU GLU B . n 
B 1 90  ARG 90  197 197 ARG ARG B . n 
B 1 91  THR 91  198 198 THR THR B . n 
B 1 92  ILE 92  199 199 ILE ILE B . n 
B 1 93  THR 93  200 200 THR THR B . n 
B 1 94  MET 94  201 201 MET MET B . n 
B 1 95  HIS 95  202 202 HIS HIS B . n 
B 1 96  LYS 96  203 203 LYS LYS B . n 
B 1 97  ASP 97  204 204 ASP ASP B . n 
B 1 98  SER 98  205 205 SER SER B . n 
B 1 99  THR 99  206 206 THR THR B . n 
B 1 100 GLY 100 207 207 GLY GLY B . n 
B 1 101 HIS 101 208 208 HIS HIS B . n 
B 1 102 VAL 102 209 209 VAL VAL B . n 
B 1 103 GLY 103 210 210 GLY GLY B . n 
B 1 104 PHE 104 211 211 PHE PHE B . n 
B 1 105 ILE 105 212 212 ILE ILE B . n 
B 1 106 PHE 106 213 213 PHE PHE B . n 
B 1 107 LYS 107 214 214 LYS LYS B . n 
B 1 108 ASN 108 215 215 ASN ASN B . n 
B 1 109 GLY 109 216 216 GLY GLY B . n 
B 1 110 LYS 110 217 217 LYS LYS B . n 
B 1 111 ILE 111 218 218 ILE ILE B . n 
B 1 112 THR 112 219 219 THR THR B . n 
B 1 113 SER 113 220 220 SER SER B . n 
B 1 114 ILE 114 221 221 ILE ILE B . n 
B 1 115 VAL 115 222 222 VAL VAL B . n 
B 1 116 LYS 116 223 223 LYS LYS B . n 
B 1 117 ASP 117 224 224 ASP ASP B . n 
B 1 118 SER 118 225 225 SER SER B . n 
B 1 119 SER 119 226 226 SER SER B . n 
B 1 120 ALA 120 227 227 ALA ALA B . n 
B 1 121 ALA 121 228 228 ALA ALA B . n 
B 1 122 ARG 122 229 229 ARG ARG B . n 
B 1 123 ASN 123 230 230 ASN ASN B . n 
B 1 124 GLY 124 231 231 GLY GLY B . n 
B 1 125 LEU 125 232 232 LEU LEU B . n 
B 1 126 LEU 126 233 233 LEU LEU B . n 
B 1 127 THR 127 234 234 THR THR B . n 
B 1 128 GLU 128 235 235 GLU GLU B . n 
B 1 129 HIS 129 236 236 HIS HIS B . n 
B 1 130 ASN 130 237 237 ASN ASN B . n 
B 1 131 ILE 131 238 238 ILE ILE B . n 
B 1 132 CYS 132 239 239 CYS CYS B . n 
B 1 133 GLU 133 240 240 GLU GLU B . n 
B 1 134 ILE 134 241 241 ILE ILE B . n 
B 1 135 ASN 135 242 242 ASN ASN B . n 
B 1 136 GLY 136 243 243 GLY GLY B . n 
B 1 137 GLN 137 244 244 GLN GLN B . n 
B 1 138 ASN 138 245 245 ASN ASN B . n 
B 1 139 VAL 139 246 246 VAL VAL B . n 
B 1 140 ILE 140 247 247 ILE ILE B . n 
B 1 141 GLY 141 248 248 GLY GLY B . n 
B 1 142 LEU 142 249 249 LEU LEU B . n 
B 1 143 LYS 143 250 250 LYS LYS B . n 
B 1 144 ASP 144 251 251 ASP ASP B . n 
B 1 145 SER 145 252 252 SER SER B . n 
B 1 146 GLN 146 253 253 GLN GLN B . n 
B 1 147 ILE 147 254 254 ILE ILE B . n 
B 1 148 ALA 148 255 255 ALA ALA B . n 
B 1 149 ASP 149 256 256 ASP ASP B . n 
B 1 150 ILE 150 257 257 ILE ILE B . n 
B 1 151 LEU 151 258 258 LEU LEU B . n 
B 1 152 SER 152 259 259 SER SER B . n 
B 1 153 THR 153 260 260 THR THR B . n 
B 1 154 SER 154 261 261 SER SER B . n 
B 1 155 GLY 155 262 262 GLY GLY B . n 
B 1 156 THR 156 263 263 THR THR B . n 
B 1 157 VAL 157 264 264 VAL VAL B . n 
B 1 158 VAL 158 265 265 VAL VAL B . n 
B 1 159 THR 159 266 266 THR THR B . n 
B 1 160 ILE 160 267 267 ILE ILE B . n 
B 1 161 THR 161 268 268 THR THR B . n 
B 1 162 ILE 162 269 269 ILE ILE B . n 
B 1 163 MET 163 270 270 MET MET B . n 
B 1 164 PRO 164 271 271 PRO PRO B . n 
B 1 165 ALA 165 272 272 ALA ALA B . n 
B 1 166 PHE 166 273 ?   ?   ?   B . n 
C 2 1   GLU 1   1   ?   ?   ?   P . n 
C 2 2   THR 2   2   ?   ?   ?   P . n 
C 2 3   LEU 3   3   ?   ?   ?   P . n 
C 2 4   GLU 4   4   ?   ?   ?   P . n 
C 2 5   ASP 5   5   5   ASP ASP P . n 
C 2 6   SER 6   6   6   SER SER P . n 
C 2 7   VAL 7   7   7   VAL VAL P . n 
C 2 8   PHE 8   8   8   PHE PHE P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 ACT 1   1274 1274 ACT ACT A . 
E 3 ACT 1   1275 1275 ACT ACT A . 
F 3 ACT 1   1273 1273 ACT ACT B . 
G 3 ACT 1   1274 1274 ACT ACT B . 
H 4 HOH 1   2001 2001 HOH HOH A . 
H 4 HOH 2   2002 2002 HOH HOH A . 
H 4 HOH 3   2003 2003 HOH HOH A . 
H 4 HOH 4   2004 2004 HOH HOH A . 
H 4 HOH 5   2005 2005 HOH HOH A . 
H 4 HOH 6   2006 2006 HOH HOH A . 
H 4 HOH 7   2007 2007 HOH HOH A . 
H 4 HOH 8   2008 2008 HOH HOH A . 
H 4 HOH 9   2009 2009 HOH HOH A . 
H 4 HOH 10  2010 2010 HOH HOH A . 
H 4 HOH 11  2011 2011 HOH HOH A . 
H 4 HOH 12  2012 2012 HOH HOH A . 
H 4 HOH 13  2013 2013 HOH HOH A . 
H 4 HOH 14  2014 2014 HOH HOH A . 
H 4 HOH 15  2015 2015 HOH HOH A . 
H 4 HOH 16  2016 2016 HOH HOH A . 
H 4 HOH 17  2017 2017 HOH HOH A . 
H 4 HOH 18  2018 2018 HOH HOH A . 
H 4 HOH 19  2019 2019 HOH HOH A . 
H 4 HOH 20  2020 2020 HOH HOH A . 
H 4 HOH 21  2021 2021 HOH HOH A . 
H 4 HOH 22  2022 2022 HOH HOH A . 
H 4 HOH 23  2023 2023 HOH HOH A . 
H 4 HOH 24  2024 2024 HOH HOH A . 
H 4 HOH 25  2025 2025 HOH HOH A . 
H 4 HOH 26  2026 2026 HOH HOH A . 
H 4 HOH 27  2027 2027 HOH HOH A . 
H 4 HOH 28  2028 2028 HOH HOH A . 
H 4 HOH 29  2029 2029 HOH HOH A . 
H 4 HOH 30  2030 2030 HOH HOH A . 
H 4 HOH 31  2031 2031 HOH HOH A . 
H 4 HOH 32  2032 2032 HOH HOH A . 
H 4 HOH 33  2033 2033 HOH HOH A . 
H 4 HOH 34  2034 2034 HOH HOH A . 
H 4 HOH 35  2035 2035 HOH HOH A . 
H 4 HOH 36  2036 2036 HOH HOH A . 
H 4 HOH 37  2037 2037 HOH HOH A . 
H 4 HOH 38  2038 2038 HOH HOH A . 
H 4 HOH 39  2039 2039 HOH HOH A . 
H 4 HOH 40  2040 2040 HOH HOH A . 
H 4 HOH 41  2041 2041 HOH HOH A . 
H 4 HOH 42  2042 2042 HOH HOH A . 
H 4 HOH 43  2043 2043 HOH HOH A . 
H 4 HOH 44  2044 2044 HOH HOH A . 
H 4 HOH 45  2045 2045 HOH HOH A . 
H 4 HOH 46  2046 2046 HOH HOH A . 
H 4 HOH 47  2047 2047 HOH HOH A . 
H 4 HOH 48  2048 2048 HOH HOH A . 
H 4 HOH 49  2049 2049 HOH HOH A . 
H 4 HOH 50  2050 2050 HOH HOH A . 
H 4 HOH 51  2051 2051 HOH HOH A . 
H 4 HOH 52  2052 2052 HOH HOH A . 
H 4 HOH 53  2053 2053 HOH HOH A . 
H 4 HOH 54  2054 2054 HOH HOH A . 
H 4 HOH 55  2055 2055 HOH HOH A . 
H 4 HOH 56  2056 2056 HOH HOH A . 
H 4 HOH 57  2057 2057 HOH HOH A . 
H 4 HOH 58  2058 2058 HOH HOH A . 
H 4 HOH 59  2059 2059 HOH HOH A . 
H 4 HOH 60  2060 2060 HOH HOH A . 
H 4 HOH 61  2061 2061 HOH HOH A . 
H 4 HOH 62  2062 2062 HOH HOH A . 
H 4 HOH 63  2063 2063 HOH HOH A . 
H 4 HOH 64  2064 2064 HOH HOH A . 
H 4 HOH 65  2065 2065 HOH HOH A . 
H 4 HOH 66  2066 2066 HOH HOH A . 
H 4 HOH 67  2067 2067 HOH HOH A . 
H 4 HOH 68  2068 2068 HOH HOH A . 
H 4 HOH 69  2069 2069 HOH HOH A . 
H 4 HOH 70  2070 2070 HOH HOH A . 
H 4 HOH 71  2071 2071 HOH HOH A . 
H 4 HOH 72  2072 2072 HOH HOH A . 
H 4 HOH 73  2073 2073 HOH HOH A . 
H 4 HOH 74  2074 2074 HOH HOH A . 
H 4 HOH 75  2075 2075 HOH HOH A . 
H 4 HOH 76  2076 2076 HOH HOH A . 
H 4 HOH 77  2077 2077 HOH HOH A . 
H 4 HOH 78  2078 2078 HOH HOH A . 
H 4 HOH 79  2079 2079 HOH HOH A . 
H 4 HOH 80  2080 2080 HOH HOH A . 
H 4 HOH 81  2081 2081 HOH HOH A . 
H 4 HOH 82  2082 2082 HOH HOH A . 
H 4 HOH 83  2083 2083 HOH HOH A . 
H 4 HOH 84  2084 2084 HOH HOH A . 
H 4 HOH 85  2085 2085 HOH HOH A . 
H 4 HOH 86  2086 2086 HOH HOH A . 
H 4 HOH 87  2087 2087 HOH HOH A . 
H 4 HOH 88  2088 2088 HOH HOH A . 
H 4 HOH 89  2089 2089 HOH HOH A . 
H 4 HOH 90  2090 2090 HOH HOH A . 
H 4 HOH 91  2091 2091 HOH HOH A . 
H 4 HOH 92  2092 2092 HOH HOH A . 
H 4 HOH 93  2093 2093 HOH HOH A . 
H 4 HOH 94  2094 2094 HOH HOH A . 
H 4 HOH 95  2095 2095 HOH HOH A . 
H 4 HOH 96  2096 2096 HOH HOH A . 
H 4 HOH 97  2097 2097 HOH HOH A . 
H 4 HOH 98  2098 2098 HOH HOH A . 
H 4 HOH 99  2099 2099 HOH HOH A . 
H 4 HOH 100 2100 2100 HOH HOH A . 
H 4 HOH 101 2101 2101 HOH HOH A . 
H 4 HOH 102 2102 2102 HOH HOH A . 
H 4 HOH 103 2103 2103 HOH HOH A . 
H 4 HOH 104 2104 2104 HOH HOH A . 
H 4 HOH 105 2105 2105 HOH HOH A . 
H 4 HOH 106 2106 2106 HOH HOH A . 
H 4 HOH 107 2107 2107 HOH HOH A . 
H 4 HOH 108 2108 2108 HOH HOH A . 
H 4 HOH 109 2109 2109 HOH HOH A . 
H 4 HOH 110 2110 2110 HOH HOH A . 
H 4 HOH 111 2111 2111 HOH HOH A . 
H 4 HOH 112 2112 2112 HOH HOH A . 
H 4 HOH 113 2113 2113 HOH HOH A . 
H 4 HOH 114 2114 2114 HOH HOH A . 
H 4 HOH 115 2115 2115 HOH HOH A . 
H 4 HOH 116 2116 2116 HOH HOH A . 
H 4 HOH 117 2117 2117 HOH HOH A . 
H 4 HOH 118 2118 2118 HOH HOH A . 
H 4 HOH 119 2119 2119 HOH HOH A . 
H 4 HOH 120 2120 2120 HOH HOH A . 
H 4 HOH 121 2121 2121 HOH HOH A . 
H 4 HOH 122 2122 2122 HOH HOH A . 
H 4 HOH 123 2123 2123 HOH HOH A . 
H 4 HOH 124 2124 2124 HOH HOH A . 
H 4 HOH 125 2125 2125 HOH HOH A . 
H 4 HOH 126 2126 2126 HOH HOH A . 
H 4 HOH 127 2127 2127 HOH HOH A . 
H 4 HOH 128 2128 2128 HOH HOH A . 
H 4 HOH 129 2129 2129 HOH HOH A . 
H 4 HOH 130 2130 2130 HOH HOH A . 
H 4 HOH 131 2131 2131 HOH HOH A . 
H 4 HOH 132 2132 2132 HOH HOH A . 
H 4 HOH 133 2133 2133 HOH HOH A . 
H 4 HOH 134 2134 2134 HOH HOH A . 
H 4 HOH 135 2135 2135 HOH HOH A . 
H 4 HOH 136 2136 2136 HOH HOH A . 
H 4 HOH 137 2137 2137 HOH HOH A . 
H 4 HOH 138 2138 2138 HOH HOH A . 
H 4 HOH 139 2139 2139 HOH HOH A . 
H 4 HOH 140 2140 2140 HOH HOH A . 
H 4 HOH 141 2141 2141 HOH HOH A . 
H 4 HOH 142 2142 2142 HOH HOH A . 
H 4 HOH 143 2143 2143 HOH HOH A . 
H 4 HOH 144 2144 2144 HOH HOH A . 
H 4 HOH 145 2145 2145 HOH HOH A . 
H 4 HOH 146 2146 2146 HOH HOH A . 
H 4 HOH 147 2147 2147 HOH HOH A . 
H 4 HOH 148 2148 2148 HOH HOH A . 
H 4 HOH 149 2149 2149 HOH HOH A . 
H 4 HOH 150 2150 2150 HOH HOH A . 
H 4 HOH 151 2151 2151 HOH HOH A . 
H 4 HOH 152 2152 2152 HOH HOH A . 
H 4 HOH 153 2153 2153 HOH HOH A . 
H 4 HOH 154 2154 2154 HOH HOH A . 
H 4 HOH 155 2155 2155 HOH HOH A . 
H 4 HOH 156 2156 2156 HOH HOH A . 
H 4 HOH 157 2157 2157 HOH HOH A . 
H 4 HOH 158 2158 2158 HOH HOH A . 
H 4 HOH 159 2159 2159 HOH HOH A . 
H 4 HOH 160 2160 2160 HOH HOH A . 
H 4 HOH 161 2161 2161 HOH HOH A . 
H 4 HOH 162 2162 2162 HOH HOH A . 
H 4 HOH 163 2163 2163 HOH HOH A . 
H 4 HOH 164 2164 2164 HOH HOH A . 
H 4 HOH 165 2165 2165 HOH HOH A . 
H 4 HOH 166 2166 2166 HOH HOH A . 
H 4 HOH 167 2167 2167 HOH HOH A . 
H 4 HOH 168 2168 2168 HOH HOH A . 
H 4 HOH 169 2169 2169 HOH HOH A . 
H 4 HOH 170 2170 2170 HOH HOH A . 
H 4 HOH 171 2171 2171 HOH HOH A . 
H 4 HOH 172 2172 2172 HOH HOH A . 
H 4 HOH 173 2173 2173 HOH HOH A . 
H 4 HOH 174 2174 2174 HOH HOH A . 
H 4 HOH 175 2175 2175 HOH HOH A . 
H 4 HOH 176 2176 2176 HOH HOH A . 
H 4 HOH 177 2177 2177 HOH HOH A . 
H 4 HOH 178 2178 2178 HOH HOH A . 
H 4 HOH 179 2179 2179 HOH HOH A . 
H 4 HOH 180 2180 2180 HOH HOH A . 
H 4 HOH 181 2181 2181 HOH HOH A . 
H 4 HOH 182 2182 2182 HOH HOH A . 
H 4 HOH 183 2183 2183 HOH HOH A . 
H 4 HOH 184 2184 2184 HOH HOH A . 
H 4 HOH 185 2185 2185 HOH HOH A . 
H 4 HOH 186 2186 2186 HOH HOH A . 
H 4 HOH 187 2187 2187 HOH HOH A . 
H 4 HOH 188 2188 2188 HOH HOH A . 
H 4 HOH 189 2189 2189 HOH HOH A . 
H 4 HOH 190 2190 2190 HOH HOH A . 
H 4 HOH 191 2191 2191 HOH HOH A . 
H 4 HOH 192 2192 2192 HOH HOH A . 
H 4 HOH 193 2193 2193 HOH HOH A . 
H 4 HOH 194 2194 2194 HOH HOH A . 
H 4 HOH 195 2195 2195 HOH HOH A . 
H 4 HOH 196 2196 2196 HOH HOH A . 
H 4 HOH 197 2197 2197 HOH HOH A . 
H 4 HOH 198 2198 2198 HOH HOH A . 
H 4 HOH 199 2199 2199 HOH HOH A . 
H 4 HOH 200 2200 2200 HOH HOH A . 
H 4 HOH 201 2201 2201 HOH HOH A . 
H 4 HOH 202 2202 2202 HOH HOH A . 
H 4 HOH 203 2203 2203 HOH HOH A . 
H 4 HOH 204 2204 2204 HOH HOH A . 
H 4 HOH 205 2205 2205 HOH HOH A . 
H 4 HOH 206 2206 2206 HOH HOH A . 
H 4 HOH 207 2207 2207 HOH HOH A . 
H 4 HOH 208 2208 2208 HOH HOH A . 
H 4 HOH 209 2209 2209 HOH HOH A . 
H 4 HOH 210 2210 2210 HOH HOH A . 
H 4 HOH 211 2211 2211 HOH HOH A . 
H 4 HOH 212 2212 2212 HOH HOH A . 
H 4 HOH 213 2213 2213 HOH HOH A . 
H 4 HOH 214 2214 2214 HOH HOH A . 
H 4 HOH 215 2215 2215 HOH HOH A . 
H 4 HOH 216 2216 2216 HOH HOH A . 
H 4 HOH 217 2217 2217 HOH HOH A . 
H 4 HOH 218 2218 2218 HOH HOH A . 
H 4 HOH 219 2219 2219 HOH HOH A . 
H 4 HOH 220 2220 2220 HOH HOH A . 
H 4 HOH 221 2221 2221 HOH HOH A . 
H 4 HOH 222 2222 2222 HOH HOH A . 
H 4 HOH 223 2223 2223 HOH HOH A . 
H 4 HOH 224 2224 2224 HOH HOH A . 
H 4 HOH 225 2225 2225 HOH HOH A . 
H 4 HOH 226 2226 2226 HOH HOH A . 
H 4 HOH 227 2227 2227 HOH HOH A . 
H 4 HOH 228 2228 2228 HOH HOH A . 
H 4 HOH 229 2229 2229 HOH HOH A . 
H 4 HOH 230 2230 2230 HOH HOH A . 
H 4 HOH 231 2231 2231 HOH HOH A . 
H 4 HOH 232 2232 2232 HOH HOH A . 
H 4 HOH 233 2233 2233 HOH HOH A . 
H 4 HOH 234 2234 2234 HOH HOH A . 
H 4 HOH 235 2235 2235 HOH HOH A . 
H 4 HOH 236 2236 2236 HOH HOH A . 
H 4 HOH 237 2237 2237 HOH HOH A . 
H 4 HOH 238 2238 2238 HOH HOH A . 
H 4 HOH 239 2239 2239 HOH HOH A . 
H 4 HOH 240 2240 2240 HOH HOH A . 
H 4 HOH 241 2241 2241 HOH HOH A . 
H 4 HOH 242 2242 2242 HOH HOH A . 
H 4 HOH 243 2243 2243 HOH HOH A . 
H 4 HOH 244 2244 2244 HOH HOH A . 
H 4 HOH 245 2245 2245 HOH HOH A . 
H 4 HOH 246 2246 2246 HOH HOH A . 
H 4 HOH 247 2247 2247 HOH HOH A . 
H 4 HOH 248 2248 2248 HOH HOH A . 
H 4 HOH 249 2249 2249 HOH HOH A . 
H 4 HOH 250 2250 2250 HOH HOH A . 
H 4 HOH 251 2251 2251 HOH HOH A . 
H 4 HOH 252 2252 2252 HOH HOH A . 
H 4 HOH 253 2253 2253 HOH HOH A . 
H 4 HOH 254 2254 2254 HOH HOH A . 
H 4 HOH 255 2255 2255 HOH HOH A . 
H 4 HOH 256 2256 2256 HOH HOH A . 
H 4 HOH 257 2257 2257 HOH HOH A . 
H 4 HOH 258 2258 2258 HOH HOH A . 
H 4 HOH 259 2259 2259 HOH HOH A . 
H 4 HOH 260 2260 2260 HOH HOH A . 
H 4 HOH 261 2261 2261 HOH HOH A . 
H 4 HOH 262 2262 2262 HOH HOH A . 
H 4 HOH 263 2263 2263 HOH HOH A . 
H 4 HOH 264 2264 2264 HOH HOH A . 
H 4 HOH 265 2265 2265 HOH HOH A . 
H 4 HOH 266 2266 2266 HOH HOH A . 
H 4 HOH 267 2267 2267 HOH HOH A . 
H 4 HOH 268 2268 2268 HOH HOH A . 
H 4 HOH 269 2269 2269 HOH HOH A . 
H 4 HOH 270 2270 2270 HOH HOH A . 
H 4 HOH 271 2271 2271 HOH HOH A . 
H 4 HOH 272 2272 2272 HOH HOH A . 
H 4 HOH 273 2273 2273 HOH HOH A . 
H 4 HOH 274 2274 2274 HOH HOH A . 
H 4 HOH 275 2275 2275 HOH HOH A . 
H 4 HOH 276 2276 2276 HOH HOH A . 
H 4 HOH 277 2277 2277 HOH HOH A . 
H 4 HOH 278 2278 2278 HOH HOH A . 
H 4 HOH 279 2279 2279 HOH HOH A . 
H 4 HOH 280 2280 2280 HOH HOH A . 
H 4 HOH 281 2281 2281 HOH HOH A . 
H 4 HOH 282 2282 2282 HOH HOH A . 
H 4 HOH 283 2283 2283 HOH HOH A . 
H 4 HOH 284 2284 2284 HOH HOH A . 
H 4 HOH 285 2285 2285 HOH HOH A . 
H 4 HOH 286 2286 2286 HOH HOH A . 
H 4 HOH 287 2287 2287 HOH HOH A . 
H 4 HOH 288 2288 2288 HOH HOH A . 
H 4 HOH 289 2289 2289 HOH HOH A . 
H 4 HOH 290 2290 2290 HOH HOH A . 
H 4 HOH 291 2291 2291 HOH HOH A . 
H 4 HOH 292 2292 2292 HOH HOH A . 
H 4 HOH 293 2293 2293 HOH HOH A . 
H 4 HOH 294 2294 2294 HOH HOH A . 
H 4 HOH 295 2295 2295 HOH HOH A . 
H 4 HOH 296 2296 2296 HOH HOH A . 
H 4 HOH 297 2297 2297 HOH HOH A . 
H 4 HOH 298 2298 2298 HOH HOH A . 
H 4 HOH 299 2299 2299 HOH HOH A . 
H 4 HOH 300 2300 2300 HOH HOH A . 
H 4 HOH 301 2301 2301 HOH HOH A . 
I 4 HOH 1   2001 2001 HOH HOH B . 
I 4 HOH 2   2002 2002 HOH HOH B . 
I 4 HOH 3   2003 2003 HOH HOH B . 
I 4 HOH 4   2004 2004 HOH HOH B . 
I 4 HOH 5   2005 2005 HOH HOH B . 
I 4 HOH 6   2006 2006 HOH HOH B . 
I 4 HOH 7   2007 2007 HOH HOH B . 
I 4 HOH 8   2008 2008 HOH HOH B . 
I 4 HOH 9   2009 2009 HOH HOH B . 
I 4 HOH 10  2010 2010 HOH HOH B . 
I 4 HOH 11  2011 2011 HOH HOH B . 
I 4 HOH 12  2012 2012 HOH HOH B . 
I 4 HOH 13  2013 2013 HOH HOH B . 
I 4 HOH 14  2014 2014 HOH HOH B . 
I 4 HOH 15  2015 2015 HOH HOH B . 
I 4 HOH 16  2016 2016 HOH HOH B . 
I 4 HOH 17  2017 2017 HOH HOH B . 
I 4 HOH 18  2018 2018 HOH HOH B . 
I 4 HOH 19  2019 2019 HOH HOH B . 
I 4 HOH 20  2020 2020 HOH HOH B . 
I 4 HOH 21  2021 2021 HOH HOH B . 
I 4 HOH 22  2022 2022 HOH HOH B . 
I 4 HOH 23  2023 2023 HOH HOH B . 
I 4 HOH 24  2024 2024 HOH HOH B . 
I 4 HOH 25  2025 2025 HOH HOH B . 
I 4 HOH 26  2026 2026 HOH HOH B . 
I 4 HOH 27  2027 2027 HOH HOH B . 
I 4 HOH 28  2028 2028 HOH HOH B . 
I 4 HOH 29  2029 2029 HOH HOH B . 
I 4 HOH 30  2030 2030 HOH HOH B . 
I 4 HOH 31  2031 2031 HOH HOH B . 
I 4 HOH 32  2032 2032 HOH HOH B . 
I 4 HOH 33  2033 2033 HOH HOH B . 
I 4 HOH 34  2034 2034 HOH HOH B . 
I 4 HOH 35  2035 2035 HOH HOH B . 
I 4 HOH 36  2036 2036 HOH HOH B . 
I 4 HOH 37  2037 2037 HOH HOH B . 
I 4 HOH 38  2038 2038 HOH HOH B . 
I 4 HOH 39  2039 2039 HOH HOH B . 
I 4 HOH 40  2040 2040 HOH HOH B . 
I 4 HOH 41  2041 2041 HOH HOH B . 
I 4 HOH 42  2042 2042 HOH HOH B . 
I 4 HOH 43  2043 2043 HOH HOH B . 
I 4 HOH 44  2044 2044 HOH HOH B . 
I 4 HOH 45  2045 2045 HOH HOH B . 
I 4 HOH 46  2046 2046 HOH HOH B . 
I 4 HOH 47  2047 2047 HOH HOH B . 
I 4 HOH 48  2048 2048 HOH HOH B . 
I 4 HOH 49  2049 2049 HOH HOH B . 
I 4 HOH 50  2050 2050 HOH HOH B . 
I 4 HOH 51  2051 2051 HOH HOH B . 
I 4 HOH 52  2052 2052 HOH HOH B . 
I 4 HOH 53  2053 2053 HOH HOH B . 
I 4 HOH 54  2054 2054 HOH HOH B . 
I 4 HOH 55  2055 2055 HOH HOH B . 
I 4 HOH 56  2056 2056 HOH HOH B . 
I 4 HOH 57  2057 2057 HOH HOH B . 
I 4 HOH 58  2058 2058 HOH HOH B . 
I 4 HOH 59  2059 2059 HOH HOH B . 
I 4 HOH 60  2060 2060 HOH HOH B . 
I 4 HOH 61  2061 2061 HOH HOH B . 
I 4 HOH 62  2062 2062 HOH HOH B . 
I 4 HOH 63  2063 2063 HOH HOH B . 
I 4 HOH 64  2064 2064 HOH HOH B . 
I 4 HOH 65  2065 2065 HOH HOH B . 
I 4 HOH 66  2066 2066 HOH HOH B . 
I 4 HOH 67  2067 2067 HOH HOH B . 
I 4 HOH 68  2068 2068 HOH HOH B . 
I 4 HOH 69  2069 2069 HOH HOH B . 
I 4 HOH 70  2070 2070 HOH HOH B . 
I 4 HOH 71  2071 2071 HOH HOH B . 
I 4 HOH 72  2072 2072 HOH HOH B . 
I 4 HOH 73  2073 2073 HOH HOH B . 
I 4 HOH 74  2074 2074 HOH HOH B . 
I 4 HOH 75  2075 2075 HOH HOH B . 
I 4 HOH 76  2076 2076 HOH HOH B . 
I 4 HOH 77  2077 2077 HOH HOH B . 
I 4 HOH 78  2078 2078 HOH HOH B . 
I 4 HOH 79  2079 2079 HOH HOH B . 
I 4 HOH 80  2080 2080 HOH HOH B . 
I 4 HOH 81  2081 2081 HOH HOH B . 
I 4 HOH 82  2082 2082 HOH HOH B . 
I 4 HOH 83  2083 2083 HOH HOH B . 
I 4 HOH 84  2084 2084 HOH HOH B . 
I 4 HOH 85  2085 2085 HOH HOH B . 
I 4 HOH 86  2086 2086 HOH HOH B . 
I 4 HOH 87  2087 2087 HOH HOH B . 
I 4 HOH 88  2088 2088 HOH HOH B . 
I 4 HOH 89  2089 2089 HOH HOH B . 
I 4 HOH 90  2090 2090 HOH HOH B . 
I 4 HOH 91  2091 2091 HOH HOH B . 
I 4 HOH 92  2092 2092 HOH HOH B . 
I 4 HOH 93  2093 2093 HOH HOH B . 
I 4 HOH 94  2094 2094 HOH HOH B . 
I 4 HOH 95  2095 2095 HOH HOH B . 
I 4 HOH 96  2096 2096 HOH HOH B . 
I 4 HOH 97  2097 2097 HOH HOH B . 
I 4 HOH 98  2098 2098 HOH HOH B . 
I 4 HOH 99  2099 2099 HOH HOH B . 
I 4 HOH 100 2100 2100 HOH HOH B . 
I 4 HOH 101 2101 2101 HOH HOH B . 
I 4 HOH 102 2102 2102 HOH HOH B . 
I 4 HOH 103 2103 2103 HOH HOH B . 
I 4 HOH 104 2104 2104 HOH HOH B . 
I 4 HOH 105 2105 2105 HOH HOH B . 
I 4 HOH 106 2106 2106 HOH HOH B . 
I 4 HOH 107 2107 2107 HOH HOH B . 
I 4 HOH 108 2108 2108 HOH HOH B . 
I 4 HOH 109 2109 2109 HOH HOH B . 
I 4 HOH 110 2110 2110 HOH HOH B . 
I 4 HOH 111 2111 2111 HOH HOH B . 
I 4 HOH 112 2112 2112 HOH HOH B . 
I 4 HOH 113 2113 2113 HOH HOH B . 
I 4 HOH 114 2114 2114 HOH HOH B . 
I 4 HOH 115 2115 2115 HOH HOH B . 
I 4 HOH 116 2116 2116 HOH HOH B . 
I 4 HOH 117 2117 2117 HOH HOH B . 
I 4 HOH 118 2118 2118 HOH HOH B . 
I 4 HOH 119 2119 2119 HOH HOH B . 
I 4 HOH 120 2120 2120 HOH HOH B . 
I 4 HOH 121 2121 2121 HOH HOH B . 
I 4 HOH 122 2122 2122 HOH HOH B . 
I 4 HOH 123 2123 2123 HOH HOH B . 
I 4 HOH 124 2124 2124 HOH HOH B . 
I 4 HOH 125 2125 2125 HOH HOH B . 
I 4 HOH 126 2126 2126 HOH HOH B . 
I 4 HOH 127 2127 2127 HOH HOH B . 
I 4 HOH 128 2128 2128 HOH HOH B . 
I 4 HOH 129 2129 2129 HOH HOH B . 
I 4 HOH 130 2130 2130 HOH HOH B . 
I 4 HOH 131 2131 2131 HOH HOH B . 
I 4 HOH 132 2132 2132 HOH HOH B . 
I 4 HOH 133 2133 2133 HOH HOH B . 
I 4 HOH 134 2134 2134 HOH HOH B . 
I 4 HOH 135 2135 2135 HOH HOH B . 
I 4 HOH 136 2136 2136 HOH HOH B . 
I 4 HOH 137 2137 2137 HOH HOH B . 
I 4 HOH 138 2138 2138 HOH HOH B . 
I 4 HOH 139 2139 2139 HOH HOH B . 
I 4 HOH 140 2140 2140 HOH HOH B . 
I 4 HOH 141 2141 2141 HOH HOH B . 
I 4 HOH 142 2142 2142 HOH HOH B . 
I 4 HOH 143 2143 2143 HOH HOH B . 
I 4 HOH 144 2144 2144 HOH HOH B . 
I 4 HOH 145 2145 2145 HOH HOH B . 
I 4 HOH 146 2146 2146 HOH HOH B . 
I 4 HOH 147 2147 2147 HOH HOH B . 
I 4 HOH 148 2148 2148 HOH HOH B . 
I 4 HOH 149 2149 2149 HOH HOH B . 
I 4 HOH 150 2150 2150 HOH HOH B . 
I 4 HOH 151 2151 2151 HOH HOH B . 
I 4 HOH 152 2152 2152 HOH HOH B . 
I 4 HOH 153 2153 2153 HOH HOH B . 
I 4 HOH 154 2154 2154 HOH HOH B . 
I 4 HOH 155 2155 2155 HOH HOH B . 
I 4 HOH 156 2156 2156 HOH HOH B . 
I 4 HOH 157 2157 2157 HOH HOH B . 
I 4 HOH 158 2158 2158 HOH HOH B . 
I 4 HOH 159 2159 2159 HOH HOH B . 
I 4 HOH 160 2160 2160 HOH HOH B . 
I 4 HOH 161 2161 2161 HOH HOH B . 
I 4 HOH 162 2162 2162 HOH HOH B . 
I 4 HOH 163 2163 2163 HOH HOH B . 
I 4 HOH 164 2164 2164 HOH HOH B . 
I 4 HOH 165 2165 2165 HOH HOH B . 
I 4 HOH 166 2166 2166 HOH HOH B . 
I 4 HOH 167 2167 2167 HOH HOH B . 
I 4 HOH 168 2168 2168 HOH HOH B . 
I 4 HOH 169 2169 2169 HOH HOH B . 
I 4 HOH 170 2170 2170 HOH HOH B . 
I 4 HOH 171 2171 2171 HOH HOH B . 
I 4 HOH 172 2172 2172 HOH HOH B . 
I 4 HOH 173 2173 2173 HOH HOH B . 
I 4 HOH 174 2174 2174 HOH HOH B . 
I 4 HOH 175 2175 2175 HOH HOH B . 
I 4 HOH 176 2176 2176 HOH HOH B . 
I 4 HOH 177 2177 2177 HOH HOH B . 
I 4 HOH 178 2178 2178 HOH HOH B . 
I 4 HOH 179 2179 2179 HOH HOH B . 
I 4 HOH 180 2180 2180 HOH HOH B . 
I 4 HOH 181 2181 2181 HOH HOH B . 
I 4 HOH 182 2182 2182 HOH HOH B . 
I 4 HOH 183 2183 2183 HOH HOH B . 
I 4 HOH 184 2184 2184 HOH HOH B . 
I 4 HOH 185 2185 2185 HOH HOH B . 
I 4 HOH 186 2186 2186 HOH HOH B . 
I 4 HOH 187 2187 2187 HOH HOH B . 
I 4 HOH 188 2188 2188 HOH HOH B . 
I 4 HOH 189 2189 2189 HOH HOH B . 
I 4 HOH 190 2190 2190 HOH HOH B . 
I 4 HOH 191 2191 2191 HOH HOH B . 
I 4 HOH 192 2192 2192 HOH HOH B . 
I 4 HOH 193 2193 2193 HOH HOH B . 
I 4 HOH 194 2194 2194 HOH HOH B . 
I 4 HOH 195 2195 2195 HOH HOH B . 
I 4 HOH 196 2196 2196 HOH HOH B . 
I 4 HOH 197 2197 2197 HOH HOH B . 
I 4 HOH 198 2198 2198 HOH HOH B . 
I 4 HOH 199 2199 2199 HOH HOH B . 
I 4 HOH 200 2200 2200 HOH HOH B . 
I 4 HOH 201 2201 2201 HOH HOH B . 
I 4 HOH 202 2202 2202 HOH HOH B . 
I 4 HOH 203 2203 2203 HOH HOH B . 
I 4 HOH 204 2204 2204 HOH HOH B . 
I 4 HOH 205 2205 2205 HOH HOH B . 
I 4 HOH 206 2206 2206 HOH HOH B . 
I 4 HOH 207 2207 2207 HOH HOH B . 
I 4 HOH 208 2208 2208 HOH HOH B . 
I 4 HOH 209 2209 2209 HOH HOH B . 
I 4 HOH 210 2210 2210 HOH HOH B . 
I 4 HOH 211 2211 2211 HOH HOH B . 
I 4 HOH 212 2212 2212 HOH HOH B . 
I 4 HOH 213 2213 2213 HOH HOH B . 
I 4 HOH 214 2214 2214 HOH HOH B . 
I 4 HOH 215 2215 2215 HOH HOH B . 
I 4 HOH 216 2216 2216 HOH HOH B . 
I 4 HOH 217 2217 2217 HOH HOH B . 
I 4 HOH 218 2218 2218 HOH HOH B . 
I 4 HOH 219 2219 2219 HOH HOH B . 
I 4 HOH 220 2220 2220 HOH HOH B . 
I 4 HOH 221 2221 2221 HOH HOH B . 
I 4 HOH 222 2222 2222 HOH HOH B . 
I 4 HOH 223 2223 2223 HOH HOH B . 
I 4 HOH 224 2224 2224 HOH HOH B . 
I 4 HOH 225 2225 2225 HOH HOH B . 
I 4 HOH 226 2226 2226 HOH HOH B . 
I 4 HOH 227 2227 2227 HOH HOH B . 
I 4 HOH 228 2228 2228 HOH HOH B . 
I 4 HOH 229 2229 2229 HOH HOH B . 
I 4 HOH 230 2230 2230 HOH HOH B . 
I 4 HOH 231 2231 2231 HOH HOH B . 
I 4 HOH 232 2232 2232 HOH HOH B . 
I 4 HOH 233 2233 2233 HOH HOH B . 
I 4 HOH 234 2234 2234 HOH HOH B . 
I 4 HOH 235 2235 2235 HOH HOH B . 
I 4 HOH 236 2236 2236 HOH HOH B . 
I 4 HOH 237 2237 2237 HOH HOH B . 
I 4 HOH 238 2238 2238 HOH HOH B . 
I 4 HOH 239 2239 2239 HOH HOH B . 
I 4 HOH 240 2240 2240 HOH HOH B . 
I 4 HOH 241 2241 2241 HOH HOH B . 
I 4 HOH 242 2242 2242 HOH HOH B . 
I 4 HOH 243 2243 2243 HOH HOH B . 
I 4 HOH 244 2244 2244 HOH HOH B . 
I 4 HOH 245 2245 2245 HOH HOH B . 
I 4 HOH 246 2246 2246 HOH HOH B . 
I 4 HOH 247 2247 2247 HOH HOH B . 
I 4 HOH 248 2248 2248 HOH HOH B . 
I 4 HOH 249 2249 2249 HOH HOH B . 
I 4 HOH 250 2250 2250 HOH HOH B . 
I 4 HOH 251 2251 2251 HOH HOH B . 
I 4 HOH 252 2252 2252 HOH HOH B . 
I 4 HOH 253 2253 2253 HOH HOH B . 
I 4 HOH 254 2254 2254 HOH HOH B . 
I 4 HOH 255 2255 2255 HOH HOH B . 
I 4 HOH 256 2256 2256 HOH HOH B . 
I 4 HOH 257 2257 2257 HOH HOH B . 
I 4 HOH 258 2258 2258 HOH HOH B . 
I 4 HOH 259 2259 2259 HOH HOH B . 
I 4 HOH 260 2260 2260 HOH HOH B . 
I 4 HOH 261 2261 2261 HOH HOH B . 
I 4 HOH 262 2262 2262 HOH HOH B . 
I 4 HOH 263 2263 2263 HOH HOH B . 
I 4 HOH 264 2264 2264 HOH HOH B . 
I 4 HOH 265 2265 2265 HOH HOH B . 
I 4 HOH 266 2266 2266 HOH HOH B . 
I 4 HOH 267 2267 2267 HOH HOH B . 
I 4 HOH 268 2268 2268 HOH HOH B . 
I 4 HOH 269 2269 2269 HOH HOH B . 
I 4 HOH 270 2270 2270 HOH HOH B . 
I 4 HOH 271 2271 2271 HOH HOH B . 
I 4 HOH 272 2272 2272 HOH HOH B . 
I 4 HOH 273 2273 2273 HOH HOH B . 
I 4 HOH 274 2274 2274 HOH HOH B . 
I 4 HOH 275 2275 2275 HOH HOH B . 
I 4 HOH 276 2276 2276 HOH HOH B . 
I 4 HOH 277 2277 2277 HOH HOH B . 
I 4 HOH 278 2278 2278 HOH HOH B . 
I 4 HOH 279 2279 2279 HOH HOH B . 
I 4 HOH 280 2280 2280 HOH HOH B . 
I 4 HOH 281 2281 2281 HOH HOH B . 
I 4 HOH 282 2282 2282 HOH HOH B . 
I 4 HOH 283 2283 2283 HOH HOH B . 
I 4 HOH 284 2284 2284 HOH HOH B . 
I 4 HOH 285 2285 2285 HOH HOH B . 
I 4 HOH 286 2286 2286 HOH HOH B . 
I 4 HOH 287 2287 2287 HOH HOH B . 
I 4 HOH 288 2288 2288 HOH HOH B . 
I 4 HOH 289 2289 2289 HOH HOH B . 
I 4 HOH 290 2290 2290 HOH HOH B . 
I 4 HOH 291 2291 2291 HOH HOH B . 
I 4 HOH 292 2292 2292 HOH HOH B . 
I 4 HOH 293 2293 2293 HOH HOH B . 
I 4 HOH 294 2294 2294 HOH HOH B . 
I 4 HOH 295 2295 2295 HOH HOH B . 
I 4 HOH 296 2296 2296 HOH HOH B . 
I 4 HOH 297 2297 2297 HOH HOH B . 
I 4 HOH 298 2298 2298 HOH HOH B . 
I 4 HOH 299 2299 2299 HOH HOH B . 
I 4 HOH 300 2300 2300 HOH HOH B . 
I 4 HOH 301 2301 2301 HOH HOH B . 
I 4 HOH 302 2302 2302 HOH HOH B . 
I 4 HOH 303 2303 2303 HOH HOH B . 
I 4 HOH 304 2304 2304 HOH HOH B . 
I 4 HOH 305 2305 2305 HOH HOH B . 
I 4 HOH 306 2306 2306 HOH HOH B . 
I 4 HOH 307 2307 2307 HOH HOH B . 
I 4 HOH 308 2308 2308 HOH HOH B . 
I 4 HOH 309 2309 2309 HOH HOH B . 
I 4 HOH 310 2310 2310 HOH HOH B . 
I 4 HOH 311 2311 2311 HOH HOH B . 
I 4 HOH 312 2312 2312 HOH HOH B . 
I 4 HOH 313 2313 2313 HOH HOH B . 
I 4 HOH 314 2314 2314 HOH HOH B . 
I 4 HOH 315 2315 2315 HOH HOH B . 
I 4 HOH 316 2316 2316 HOH HOH B . 
I 4 HOH 317 2317 2317 HOH HOH B . 
I 4 HOH 318 2318 2318 HOH HOH B . 
I 4 HOH 319 2319 2319 HOH HOH B . 
I 4 HOH 320 2320 2320 HOH HOH B . 
I 4 HOH 321 2321 2321 HOH HOH B . 
I 4 HOH 322 2322 2322 HOH HOH B . 
I 4 HOH 323 2323 2323 HOH HOH B . 
I 4 HOH 324 2324 2324 HOH HOH B . 
I 4 HOH 325 2325 2325 HOH HOH B . 
I 4 HOH 326 2326 2326 HOH HOH B . 
I 4 HOH 327 2327 2327 HOH HOH B . 
I 4 HOH 328 2328 2328 HOH HOH B . 
I 4 HOH 329 2329 2329 HOH HOH B . 
I 4 HOH 330 2330 2330 HOH HOH B . 
I 4 HOH 331 2331 2331 HOH HOH B . 
I 4 HOH 332 2332 2332 HOH HOH B . 
I 4 HOH 333 2333 2333 HOH HOH B . 
I 4 HOH 334 2334 2334 HOH HOH B . 
I 4 HOH 335 2335 2335 HOH HOH B . 
I 4 HOH 336 2336 2336 HOH HOH B . 
I 4 HOH 337 2337 2337 HOH HOH B . 
I 4 HOH 338 2338 2338 HOH HOH B . 
I 4 HOH 339 2339 2339 HOH HOH B . 
I 4 HOH 340 2340 2340 HOH HOH B . 
I 4 HOH 341 2341 2341 HOH HOH B . 
I 4 HOH 342 2342 2342 HOH HOH B . 
I 4 HOH 343 2343 2343 HOH HOH B . 
I 4 HOH 344 2344 2344 HOH HOH B . 
I 4 HOH 345 2345 2345 HOH HOH B . 
I 4 HOH 346 2346 2346 HOH HOH B . 
I 4 HOH 347 2347 2347 HOH HOH B . 
I 4 HOH 348 2348 2348 HOH HOH B . 
I 4 HOH 349 2349 2349 HOH HOH B . 
I 4 HOH 350 2350 2350 HOH HOH B . 
I 4 HOH 351 2351 2351 HOH HOH B . 
J 4 HOH 1   2001 2001 HOH HOH P . 
J 4 HOH 2   2002 2002 HOH HOH P . 
J 4 HOH 3   2003 2003 HOH HOH P . 
J 4 HOH 4   2004 2004 HOH HOH P . 
J 4 HOH 5   2005 2005 HOH HOH P . 
J 4 HOH 6   2006 2006 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 2246 ? I HOH . 
2 1 P HOH 2002 ? J HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-07-11 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Experimental preparation'  
7 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow           
2 4 'Structure model' pdbx_database_proc           
3 4 'Structure model' pdbx_database_status         
4 4 'Structure model' pdbx_struct_special_symmetry 
5 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.1.24 ? 1 
HKL-2000 'data reduction' .      ? 2 
HKL-2000 'data scaling'   .      ? 3 
AMoRE    phasing          .      ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_entry_details.entry_id             1OBZ 
_pdbx_entry_details.compound_details     
;MOL_ID 1: FUNCTIONS AS AN ADAPTER PROTEIN.
  MAY ALSO FUNCTION TO COUPLE SYNDECANS TO CYTOSKELETAL
  TRANSCRIPTION PROTEINS OR SIGNALING COMPONENTS. ALSO SEEMS
  TO COUPLE FACTOR SOX4 TO THE IL-5 RECEPTOR (IL5RA)
  (MOL_ID 2 IN THIS ENTRY)
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NZ  B LYS 250  ? ? O B HOH 2328 ? ? 0.75 
2  1 CE  B LYS 250  ? ? O B HOH 2328 ? ? 1.76 
3  1 OE1 A GLN 180  ? ? O A HOH 2149 ? ? 1.85 
4  1 O   A HOH 2210 ? ? O A HOH 2217 ? ? 2.00 
5  1 O   A HOH 2260 ? ? O A HOH 2295 ? ? 2.10 
6  1 O   A HOH 2092 ? ? O A HOH 2107 ? ? 2.12 
7  1 O   B HOH 2212 ? ? O B HOH 2349 ? ? 2.14 
8  1 OD1 B ASN 215  ? ? O B HOH 2277 ? ? 2.14 
9  1 OE1 A GLN 139  ? ? O A HOH 2044 ? ? 2.19 
10 1 O   B HOH 2005 ? ? O B HOH 2085 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2015 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2043 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_545 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A GLN 180 ? ? CD A GLN 180 ? ? 1.362 1.506 -0.144 0.023 N 
2 1 CB A PHE 182 ? ? CG A PHE 182 ? ? 1.402 1.509 -0.107 0.017 N 
3 1 CD A LYS 250 ? ? CE A LYS 250 ? ? 1.282 1.508 -0.226 0.025 N 
4 1 CG B LYS 250 ? ? CD B LYS 250 ? ? 1.129 1.520 -0.391 0.034 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B ASP 122 ? ? CG B ASP 122 ? ? OD2 B ASP 122 ? ? 124.27 118.30 5.97  0.90 N 
2 1 CB B LYS 250 ? ? CG B LYS 250 ? ? CD  B LYS 250 ? ? 139.52 111.60 27.92 2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 193 ? ? 10.24  74.42 
2 1 ARG B 193 ? ? -17.02 99.60 
3 1 ASN B 215 ? ? 39.44  50.25 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2095 ? 6.94 . 
2  1 O ? A HOH 2100 ? 6.42 . 
3  1 O ? A HOH 2118 ? 6.12 . 
4  1 O ? A HOH 2132 ? 6.17 . 
5  1 O ? A HOH 2133 ? 7.47 . 
6  1 O ? A HOH 2196 ? 6.22 . 
7  1 O ? B HOH 2089 ? 6.40 . 
8  1 O ? B HOH 2164 ? 6.05 . 
9  1 O ? B HOH 2166 ? 7.90 . 
10 1 O ? B HOH 2185 ? 6.72 . 
11 1 O ? B HOH 2186 ? 6.53 . 
12 1 O ? B HOH 2204 ? 6.17 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 111 ? CG  ? A ASP 4 CG  
2 1 Y 1 A ASP 111 ? OD1 ? A ASP 4 OD1 
3 1 Y 1 A ASP 111 ? OD2 ? A ASP 4 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 108 ? A GLY 1   
2 1 Y 1 A ALA 109 ? A ALA 2   
3 1 Y 1 A MET 110 ? A MET 3   
4 1 Y 1 B PHE 273 ? B PHE 166 
5 1 Y 1 P GLU 1   ? C GLU 1   
6 1 Y 1 P THR 2   ? C THR 2   
7 1 Y 1 P LEU 3   ? C LEU 3   
8 1 Y 1 P GLU 4   ? C GLU 4   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ACETATE ION' ACT 
4 water         HOH 
#