data_1OCE
# 
_entry.id   1OCE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OCE         
WWPDB D_1000175429 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OCE 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-12 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bartolucci, C.' 1 
'Perola, E.'     2 
'Cellai, L.'     3 
'Brufani, M.'    4 
'Lamba, D.'      5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;"Back door" opening implied by the crystal structure of a carbamoylated acetylcholinesterase.
;
Biochemistry          38   5714 5719 1999 BICHAW US 0006-2960 0033 ? 10231521 10.1021/bi982723p 
1       
;Long Chain Analogs of Physostigmine as Potential Drugs for Alzheimer'S Disease: New Insights Into the Mechanism of Action in the Inhibition of Acetylcholinesterase
;
Biochim.Biophys.Acta  1343 41   ?    1997 BBACAQ NE 0006-3002 0113 ? ?        ?                 
2       'Effects of Mf-268, a New Cholinesterase Inhibitor, on Acetylcholine and Biogenic Amines in Rat Cortex' J.Neurosci.Res. 43 
120  ?    1996 JNREDK US 0360-4012 2203 ? ?        ?                 
3       
;Synthesis and Structure-Activity Relationships of New Acetylcholinesterase Inhibitors: Morpholinoalkylcarbamoyloxyeseroline Derivatives
;
Bioorg.Med.Chem.Lett. 5    2077 ?    1995 BMCLE8 UK 0960-894X 1127 ? ?        ?                 
4       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253  872  ?    1991 SCIEAS US 0036-8075 0038 ? ?        ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bartolucci, C.' 1  ? 
primary 'Perola, E.'     2  ? 
primary 'Cellai, L.'     3  ? 
primary 'Brufani, M.'    4  ? 
primary 'Lamba, D.'      5  ? 
1       'Perola, E.'     6  ? 
1       'Cellai, L.'     7  ? 
1       'Lamba, D.'      8  ? 
1       'Filocamo, L.'   9  ? 
1       'Brufani, M.'    10 ? 
2       'Zhu, X.D.'      11 ? 
2       'Cuadra, G.'     12 ? 
2       'Brufani, M.'    13 ? 
2       'Maggi, T.'      14 ? 
2       'Pagella, P.G.'  15 ? 
2       'Williams, E.'   16 ? 
2       'Giacobini, E.'  17 ? 
3       'Alisi, M.A.'    18 ? 
3       'Brufani, M.'    19 ? 
3       'Filocamo, L.'   20 ? 
3       'Gostoli, G.'    21 ? 
3       'Licandro, E.'   22 ? 
3       'Cesta, M.C.'    23 ? 
3       'Lappa, S.'      24 ? 
3       'Marchesini, D.' 25 ? 
3       'Pagella, P.'    26 ? 
4       'Sussman, J.L.'  27 ? 
4       'Harel, M.'      28 ? 
4       'Frolow, F.'     29 ? 
4       'Oefner, C.'     30 ? 
4       'Goldman, A.'    31 ? 
4       'Toker, L.'      32 ? 
4       'Silman, I.'     33 ? 
# 
_cell.entry_id           1OCE 
_cell.length_a           111.496 
_cell.length_b           111.496 
_cell.length_c           137.390 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OCE 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                             60736.516 1   3.1.1.7 ? ? 'INTER-MONOMER DISULFIDE BRIDGE' 
2 non-polymer syn CIS-2,6-DIMETHYLMORPHOLINOOCTYLCARBAMYLESEROLINE 270.411   1   ?       ? ? ?                                
3 water       nat water                                            18.015    157 ?       ? ? ?                                
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OCE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                          ?     'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                         ?     'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ?     'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ?     'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                         ?     'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                        ?     'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ?     'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                          ?     'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                        ?     'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                            ?     'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ?     'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                          ?     'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                           ?     'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                       ?     'C5 H11 N O2 S'  149.211 
MF2 non-polymer         . CIS-2,6-DIMETHYLMORPHOLINOOCTYLCARBAMYLESEROLINE MF268 'C15 H30 N2 O2'  270.411 
PHE 'L-peptide linking' y PHENYLALANINE                                    ?     'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                          ?     'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                           ?     'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                        ?     'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ?     'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                         ?     'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                           ?     'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OCE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.98 
_exptl_crystal.density_percent_sol   68.8 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-06 
_diffrn_detector.details                'TOROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             0.920 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1OCE 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   24049 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.20 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.14 
_reflns.pdbx_netI_over_sigmaI        6.70 
_reflns.B_iso_Wilson_estimate        42.2 
_reflns.pdbx_redundancy              2.30 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   69.70 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.648 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        1.60 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OCE 
_refine.ls_number_reflns_obs                     22426 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.00100 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    84.7 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.208 
_refine.ls_R_factor_R_free                       0.291 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1096 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               29.3 
_refine.aniso_B[1][1]                            2.23 
_refine.aniso_B[2][2]                            2.23 
_refine.aniso_B[3][3]                            -4.47 
_refine.aniso_B[1][2]                            0.43 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1OCE 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.47 
_refine_analyze.Luzzati_sigma_a_free            0.73 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4205 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             157 
_refine_hist.number_atoms_total               4381 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      27.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.63  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.59  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.55  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.28  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            3.33  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.86 
_refine_ls_shell.number_reflns_R_work             2913 
_refine_ls_shell.R_factor_R_work                  0.327 
_refine_ls_shell.percent_reflns_obs               70.1 
_refine_ls_shell.R_factor_R_free                  0.414 
_refine_ls_shell.R_factor_R_free_error            0.034 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 ?                 ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1OCE 
_struct.title                     'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH MF268' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE, CIS-2,6-DIMETHYLMORPHOLINOOCTYLCARBAMYLESEROLINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OCE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CARBOXYLIC ESTERASE, NEUROTRANSMITTER CLEAVAGE, SERINE ESTERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 41  ? MET A 43  ? GLY A 41  MET A 43  5 ? 3  
HELX_P HELX_P2  2  SER A 79  ? TRP A 84  ? SER A 79  TRP A 84  1 ? 6  
HELX_P HELX_P3  3  ASP A 128 ? TYR A 130 ? ASP A 128 TYR A 130 5 ? 3  
HELX_P HELX_P4  4  LYS A 133 ? GLU A 139 ? LYS A 133 GLU A 139 1 ? 7  
HELX_P HELX_P5  5  ALA A 152 ? GLY A 154 ? ALA A 152 GLY A 154 5 ? 3  
HELX_P HELX_P6  6  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P7  7  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 5 ? 12 
HELX_P HELX_P8  8  ARG A 216 ? LEU A 218 ? ARG A 216 LEU A 218 5 ? 3  
HELX_P HELX_P9  9  VAL A 238 ? ASN A 251 ? VAL A 238 ASN A 251 1 ? 14 
HELX_P HELX_P10 10 ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P11 11 PRO A 271 ? ASP A 276 ? PRO A 271 ASP A 276 1 ? 6  
HELX_P HELX_P12 12 GLU A 278 ? VAL A 281 ? GLU A 278 VAL A 281 5 ? 4  
HELX_P HELX_P13 13 LEU A 305 ? ASN A 310 ? LEU A 305 ASN A 310 1 ? 6  
HELX_P HELX_P14 14 GLY A 328 ? LEU A 333 ? GLY A 328 LEU A 333 5 ? 6  
HELX_P HELX_P15 15 ARG A 349 ? SER A 359 ? ARG A 349 SER A 359 1 ? 11 
HELX_P HELX_P16 16 ASP A 365 ? TYR A 375 ? ASP A 365 TYR A 375 1 ? 11 
HELX_P HELX_P17 17 GLY A 384 ? ASN A 399 ? GLY A 384 ASN A 399 1 ? 16 
HELX_P HELX_P18 18 ILE A 401 ? TYR A 411 ? ILE A 401 TYR A 411 1 ? 11 
HELX_P HELX_P19 19 GLU A 434 ? MET A 436 ? GLU A 434 MET A 436 5 ? 3  
HELX_P HELX_P20 20 ILE A 444 ? VAL A 447 ? ILE A 444 VAL A 447 1 ? 4  
HELX_P HELX_P21 21 LEU A 450 ? LEU A 452 ? LEU A 450 LEU A 452 5 ? 3  
HELX_P HELX_P22 22 LYS A 454 ? LEU A 456 ? LYS A 454 LEU A 456 5 ? 3  
HELX_P HELX_P23 23 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P24 24 VAL A 518 ? TRP A 524 ? VAL A 518 TRP A 524 1 ? 7  
HELX_P HELX_P25 25 PHE A 527 ? LEU A 531 ? PHE A 527 LEU A 531 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG ? ? ? 1_555 A CYS 94  SG  ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.039 ? ? 
disulf2 disulf ?    ? A CYS 254 SG ? ? ? 1_555 A CYS 265 SG  ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3 disulf ?    ? A CYS 402 SG ? ? ? 1_555 A CYS 521 SG  ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale1 covale none ? A SER 200 OG ? ? ? 1_555 B MF2 .   C18 ? ? A SER 200 A MF2 700 1_555 ? ? ? ? ? ? ? 1.373 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
B 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
B 2  SER A 25  ? PHE A 30  ? SER A 25  PHE A 30  
B 3  ASN A 98  ? VAL A 101 ? ASN A 98  VAL A 101 
B 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
B 5  VAL A 111 ? ILE A 115 ? VAL A 111 ILE A 115 
B 6  VAL A 194 ? GLU A 199 ? VAL A 194 GLU A 199 
B 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
B 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  O THR A 18  ? O THR A 18  N ALA A 29  ? N ALA A 29  
B 2  3  O SER A 28  ? O SER A 28  N VAL A 101 ? N VAL A 101 
B 3  4  O ASN A 98  ? O ASN A 98  N SER A 145 ? N SER A 145 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  O VAL A 111 ? O VAL A 111 N THR A 195 ? N THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ARG A 221 ? N ARG A 221 
B 7  8  O ALA A 222 ? O ALA A 222 N LEU A 320 ? N LEU A 320 
B 8  9  O ILE A 319 ? O ILE A 319 N GLY A 417 ? N GLY A 417 
B 9  10 O PHE A 422 ? O PHE A 422 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ACT Unknown  ? ?   ?   ? 3  'ACTIVE-SITE CATALYTIC TRIAD.'       
AC1 Software A MF2 700 ? 10 'BINDING SITE FOR RESIDUE MF2 A 700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ACT 3  SER A 200 ? SER A 200 . ? 1_555 ? 
2  ACT 3  HIS A 440 ? HIS A 440 . ? 1_555 ? 
3  ACT 3  GLU A 327 ? GLU A 327 . ? 1_555 ? 
4  AC1 10 TYR A 70  ? TYR A 70  . ? 1_555 ? 
5  AC1 10 GLY A 118 ? GLY A 118 . ? 1_555 ? 
6  AC1 10 GLY A 119 ? GLY A 119 . ? 1_555 ? 
7  AC1 10 TYR A 121 ? TYR A 121 . ? 1_555 ? 
8  AC1 10 SER A 200 ? SER A 200 . ? 1_555 ? 
9  AC1 10 ALA A 201 ? ALA A 201 . ? 1_555 ? 
10 AC1 10 PHE A 330 ? PHE A 330 . ? 1_555 ? 
11 AC1 10 PHE A 331 ? PHE A 331 . ? 1_555 ? 
12 AC1 10 TYR A 334 ? TYR A 334 . ? 1_555 ? 
13 AC1 10 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OCE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OCE 
_atom_sites.fract_transf_matrix[1][1]   0.008969 
_atom_sites.fract_transf_matrix[1][2]   0.005178 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010356 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007279 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.080 87.581 34.750 1.00 36.65 ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.516 87.891 36.099 1.00 36.62 ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.355 86.974 36.418 1.00 35.01 ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.460 85.753 36.272 1.00 34.05 ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.587 87.726 37.186 1.00 41.49 ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.131 88.204 38.446 1.00 42.87 ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.254 87.570 36.865 1.00 33.69 ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.061  86.815 37.216 1.00 31.74 ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.357  85.780 38.292 1.00 31.91 ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.624  84.795 38.430 1.00 33.36 ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.970  87.752 37.721 1.00 30.39 ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.647  87.045 37.965 1.00 36.33 ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.543  87.984 38.430 1.00 38.93 ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.828  89.184 38.630 1.00 40.55 ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.391  87.517 38.598 1.00 39.95 ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.427 86.012 39.054 1.00 30.38 ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.825 85.117 40.132 1.00 29.07 ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.846 84.088 39.673 1.00 29.48 ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.104 83.105 40.363 1.00 31.23 ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.405 85.911 41.304 1.00 30.16 ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.580 86.986 42.034 1.00 30.64 ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.287 87.326 43.336 1.00 30.86 ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.168  86.510 42.325 1.00 29.58 ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.438 84.306 38.510 1.00 29.57 ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.415 83.355 38.007 1.00 31.21 ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.691 82.318 37.160 1.00 31.72 ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.071 82.667 36.156 1.00 33.33 ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.474 84.083 37.176 1.00 33.47 ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.802 83.376 36.893 1.00 34.56 ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -15.756 82.780 35.485 1.00 39.71 ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.063 82.281 37.930 1.00 37.50 ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.754 81.052 37.569 1.00 31.44 ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.085 79.982 36.832 1.00 30.09 ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.013 78.824 36.481 1.00 31.44 ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.889 78.445 37.252 1.00 33.57 ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.888 79.414 37.612 1.00 29.17 ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.149 78.411 36.750 1.00 31.04 ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.949  80.522 38.018 1.00 28.01 ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.797 78.244 35.311 1.00 32.94 ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.627 77.148 34.846 1.00 33.23 ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.894 75.827 34.846 1.00 34.41 ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.048 75.585 33.992 1.00 36.96 ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.101 77.443 33.443 1.00 33.12 ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.569 77.611 33.379 1.00 35.67 ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.314 76.758 33.858 1.00 38.63 ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.015 78.716 32.791 1.00 39.65 ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.225 74.961 35.793 1.00 33.74 ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.558 73.677 35.869 1.00 32.30 ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.430 72.615 35.245 1.00 30.32 ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.567 72.882 34.881 1.00 29.91 ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.248 73.301 37.325 1.00 34.05 ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.473 73.057 38.024 1.00 36.79 ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.483 74.435 38.018 1.00 33.57 ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -12.883 71.413 35.112 1.00 30.14 ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.611 70.298 34.532 1.00 27.72 ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.729 69.870 35.457 1.00 28.18 ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.587 69.082 35.076 1.00 29.44 ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.671 69.118 34.301 1.00 25.22 ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.924 69.199 32.994 1.00 26.41 ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.647 68.388 33.011 1.00 27.12 ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.657  68.939 31.996 1.00 26.13 ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.485  68.039 31.813 1.00 27.81 ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.718 70.392 36.677 1.00 29.74 ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.731 70.041 37.663 1.00 30.66 ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.750 71.152 37.874 1.00 31.12 ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.740 70.961 38.577 1.00 31.08 ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.058 69.702 38.995 1.00 33.33 ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.501 68.399 38.970 1.00 34.91 ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.496 72.311 37.271 1.00 31.92 ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.404 73.438 37.400 1.00 30.59 ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.689 74.766 37.558 1.00 30.83 ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.478 74.809 37.769 1.00 31.03 ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.437 75.858 37.442 1.00 30.91 ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.869 77.191 37.592 1.00 30.85 ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.529 77.381 39.071 1.00 31.34 ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.202 76.815 39.932 1.00 32.03 ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.898 78.239 37.162 1.00 32.77 ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.558 79.007 35.885 1.00 37.20 ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.673 78.886 34.836 1.00 39.26 ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.630 80.083 34.848 1.00 42.84 ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -19.142 81.256 34.047 1.00 44.90 ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.486 78.157 39.371 1.00 30.66 ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.092 78.416 40.760 1.00 29.76 ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.631 79.859 40.970 1.00 29.98 ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.805 80.374 40.210 1.00 31.65 ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.963 77.438 41.247 1.00 29.68 ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.828 76.274 40.291 1.00 31.53 ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -12.642 78.158 41.376 1.00 26.93 ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.170 80.499 42.009 1.00 29.48 ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.839 81.882 42.351 1.00 28.69 ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.735 81.955 43.399 1.00 27.73 ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.856 81.387 44.479 1.00 29.75 ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.074 82.594 42.889 1.00 30.58 ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.668 83.624 41.945 1.00 37.41 ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.696 85.140 41.883 1.00 42.80 ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -16.332 85.979 43.354 1.00 42.83 ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.661 82.664 43.083 1.00 24.86 ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.563 82.779 44.021 1.00 24.16 ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.639 84.042 44.847 1.00 24.75 ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.718 84.596 45.024 1.00 24.66 ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.489 84.492 45.347 1.00 26.42 ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.402 85.698 46.163 1.00 26.55 ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.008  86.315 46.154 1.00 27.77 ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.003  85.608 46.196 1.00 29.00 ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.755 85.412 47.609 1.00 27.34 ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.804 86.648 48.333 1.00 30.82 ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.705  84.507 48.239 1.00 28.61 ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.952  87.641 46.106 1.00 30.76 ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.682  88.358 46.093 1.00 34.17 ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.138  88.477 47.521 1.00 35.62 ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.864  88.880 48.437 1.00 36.64 ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.880  89.753 45.483 1.00 36.80 ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.611  90.409 44.927 1.00 42.92 ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.572  90.417 43.385 1.00 47.63 ? 19  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.197  90.397 42.871 1.00 52.43 ? 19  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.440  91.479 42.674 1.00 52.65 ? 19  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.914  92.691 42.943 1.00 52.42 ? 19  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.197  91.349 42.226 1.00 50.36 ? 19  ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.869  88.106 47.708 1.00 35.10 ? 20  VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.221  88.174 49.017 1.00 34.31 ? 20  VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.976  89.040 48.947 1.00 35.14 ? 20  VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.297  89.091 47.915 1.00 36.60 ? 20  VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.773  86.797 49.522 1.00 33.27 ? 20  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -5.963  85.860 49.629 1.00 36.76 ? 20  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.724  86.231 48.591 1.00 34.11 ? 20  VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.663  89.744 50.046 1.00 33.41 ? 21  PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.485  90.609 50.091 1.00 32.59 ? 21  PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.239  89.789 50.406 1.00 33.62 ? 21  PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.269  88.915 51.276 1.00 34.70 ? 21  PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.820  91.618 51.192 1.00 31.03 ? 21  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.198  91.204 51.734 1.00 30.22 ? 21  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.413  89.799 51.309 1.00 32.36 ? 21  PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.150  90.060 49.693 1.00 32.73 ? 22  VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.086   89.330 49.915 1.00 32.02 ? 22  VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.279   90.251 49.899 1.00 33.02 ? 22  VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.706   90.691 48.839 1.00 34.72 ? 22  VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.341   88.274 48.831 1.00 30.86 ? 22  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.440   87.342 49.285 1.00 31.27 ? 22  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.076   87.511 48.527 1.00 31.91 ? 22  VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.823   90.537 51.073 1.00 33.51 ? 23  LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.002   91.381 51.169 1.00 32.82 ? 23  LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.977   92.564 50.219 1.00 33.32 ? 23  LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.686   92.564 49.211 1.00 32.08 ? 23  LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.258   90.558 50.874 1.00 33.12 ? 23  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.494   89.253 51.635 1.00 33.94 ? 23  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.708   88.526 51.057 1.00 34.89 ? 23  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.716   89.566 53.102 1.00 35.99 ? 23  LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.151   93.559 50.528 1.00 34.78 ? 24  SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 3.069   94.769 49.714 1.00 37.17 ? 24  SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.450   94.615 48.324 1.00 37.80 ? 24  SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.511   95.542 47.515 1.00 39.60 ? 24  SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.470   95.369 49.565 1.00 38.43 ? 24  SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 5.242   94.641 48.618 1.00 40.53 ? 24  SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.861   93.457 48.043 1.00 37.24 ? 25  SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.244   93.202 46.745 1.00 35.26 ? 25  SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.005  92.374 46.977 1.00 33.64 ? 25  SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.498  92.306 48.097 1.00 33.64 ? 25  SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.220   92.436 45.844 1.00 37.12 ? 25  SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.964   92.663 44.467 1.00 39.51 ? 25  SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.519  91.750 45.923 1.00 33.99 ? 26  HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.712  90.911 46.038 1.00 35.63 ? 26  HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.711  89.798 44.986 1.00 36.89 ? 26  HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -1.084  89.923 43.928 1.00 37.98 ? 26  HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.986  91.754 45.885 1.00 35.69 ? 26  HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.261  92.665 47.046 1.00 36.32 ? 26  HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.529  93.808 47.285 0.00 35.04 ? 26  HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.192  92.603 48.027 0.00 34.97 ? 26  HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -2.996  94.411 48.364 0.00 34.73 ? 26  HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.006  93.700 48.833 0.00 34.83 ? 26  HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.404  88.704 45.296 1.00 35.08 ? 27  ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.522  87.569 44.393 1.00 31.70 ? 27  ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.872  86.940 44.654 1.00 30.02 ? 27  ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.568  87.346 45.573 1.00 30.98 ? 27  ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.439  86.524 44.646 1.00 33.38 ? 27  ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.611  85.933 46.036 1.00 32.67 ? 27  ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.064  87.156 44.516 1.00 35.37 ? 27  ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.767  84.713 46.255 1.00 35.97 ? 27  ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.248  85.950 43.855 1.00 29.86 ? 28  SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.545  85.304 44.032 1.00 29.70 ? 28  SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.395  83.934 44.654 1.00 29.44 ? 28  SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.399  83.244 44.427 1.00 29.94 ? 28  SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.281  85.171 42.689 1.00 29.13 ? 28  SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.383  85.102 41.589 1.00 32.28 ? 28  SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.391  83.546 45.442 1.00 28.34 ? 29  ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.392  82.245 46.098 1.00 25.99 ? 29  ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.760  81.605 45.915 1.00 25.18 ? 29  ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.787  82.263 46.059 1.00 25.97 ? 29  ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.078  82.405 47.585 1.00 24.57 ? 29  ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.772  80.325 45.574 1.00 24.87 ? 30  PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.020  79.597 45.382 1.00 26.58 ? 30  PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.056  78.561 46.489 1.00 27.08 ? 30  PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.566  77.446 46.323 1.00 31.28 ? 30  PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.032  78.935 43.998 1.00 27.88 ? 30  PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.880  79.917 42.866 1.00 30.50 ? 30  PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.627  80.419 42.524 1.00 29.08 ? 30  PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -9.999  80.398 42.187 1.00 31.72 ? 30  PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.492  81.391 41.528 1.00 30.31 ? 30  PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.870  81.372 41.188 1.00 30.91 ? 30  PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.615  81.868 40.863 1.00 28.62 ? 30  PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.640  78.934 47.621 1.00 23.99 ? 31  LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.678  78.049 48.770 1.00 24.40 ? 31  LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.887 77.142 48.886 1.00 26.01 ? 31  LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.991 77.519 48.533 1.00 29.08 ? 31  LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.551  78.869 50.062 1.00 22.58 ? 31  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.596  80.063 50.046 1.00 21.13 ? 31  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -9.056  81.077 51.049 1.00 19.67 ? 31  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.185  79.617 50.354 1.00 19.82 ? 31  LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.660 75.935 49.389 1.00 26.65 ? 32  GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.748 75.007 49.606 1.00 28.17 ? 32  GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.303 74.231 48.435 1.00 31.24 ? 32  GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.291 73.508 48.599 1.00 32.26 ? 32  GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.703 74.359 47.257 1.00 30.88 ? 33  ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.221 73.610 46.120 1.00 29.81 ? 33  ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.290 72.143 46.536 1.00 29.92 ? 33  ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.363 71.639 47.168 1.00 30.65 ? 33  ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.298 73.704 44.891 1.00 27.54 ? 33  ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -10.974 75.157 44.579 1.00 23.96 ? 33  ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.964 73.047 43.696 1.00 26.76 ? 33  ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -9.812  75.299 43.626 1.00 25.00 ? 33  ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.410 71.460 46.234 1.00 28.82 ? 34  PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.603 70.044 46.566 1.00 28.48 ? 34  PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.123 69.100 45.447 1.00 28.97 ? 34  PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.423 69.314 44.271 1.00 31.56 ? 34  PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.112 69.940 46.808 1.00 27.87 ? 34  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.721 71.122 46.103 1.00 24.69 ? 34  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.618 72.031 45.616 1.00 28.72 ? 34  PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.391 68.050 45.812 1.00 28.74 ? 35  PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -11.875 67.099 44.825 1.00 28.24 ? 35  PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.434 65.686 44.982 1.00 28.45 ? 35  PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.124 64.786 44.199 1.00 29.16 ? 35  PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.354 67.043 44.911 1.00 28.01 ? 35  PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.847  66.413 46.163 1.00 29.56 ? 35  PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.949  65.036 46.358 1.00 32.28 ? 35  PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.251  67.187 47.146 1.00 31.42 ? 35  PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.461  64.434 47.514 1.00 31.13 ? 35  PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.759  66.599 48.304 1.00 34.69 ? 35  PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.865  65.215 48.488 1.00 33.27 ? 35  PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.251 65.493 46.004 1.00 26.64 ? 36  ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.836 64.199 46.251 1.00 25.59 ? 36  ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.187 64.379 46.907 1.00 28.13 ? 36  ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.493 65.451 47.427 1.00 29.56 ? 36  ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -12.943 63.411 47.142 1.00 27.09 ? 36  ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -15.989 63.322 46.880 1.00 30.20 ? 37  GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.316 63.332 47.474 1.00 32.03 ? 37  GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.159 63.207 48.986 1.00 33.44 ? 37  GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.268 62.505 49.456 1.00 35.05 ? 37  GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.136 62.159 46.922 1.00 32.90 ? 37  GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.787 62.434 45.573 1.00 33.89 ? 37  GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.914 63.454 45.665 1.00 37.62 ? 37  GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.947 63.128 46.286 1.00 39.60 ? 37  GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.775 64.578 45.125 1.00 37.40 ? 37  GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.012 63.900 49.765 1.00 35.01 ? 38  PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.926 63.832 51.225 1.00 34.33 ? 38  PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.836 62.392 51.686 1.00 34.81 ? 38  PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.753 61.605 51.456 1.00 35.25 ? 38  PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.210 64.502 51.694 1.00 33.76 ? 38  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.535 65.459 50.613 1.00 34.73 ? 38  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.102 64.791 49.329 1.00 36.19 ? 38  PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.720 62.033 52.346 1.00 35.38 ? 39  PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.451 60.689 52.864 1.00 33.52 ? 39  PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.237 60.451 54.125 1.00 32.73 ? 39  PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.723 59.887 55.086 1.00 33.70 ? 39  PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -14.956 60.708 53.138 1.00 35.58 ? 39  PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.680 62.123 53.487 1.00 36.23 ? 39  PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.615 62.961 52.655 1.00 34.94 ? 39  PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.488 60.886 54.113 1.00 32.06 ? 40  VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.346 60.750 55.268 1.00 30.98 ? 40  VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.257 59.544 55.194 1.00 33.92 ? 40  VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.471 58.972 54.122 1.00 34.36 ? 40  VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.215 61.981 55.422 1.00 28.10 ? 40  VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.349 63.219 55.469 1.00 29.21 ? 40  VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.180 62.061 54.265 1.00 28.36 ? 40  VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -20.780 59.168 56.360 1.00 36.32 ? 41  GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -21.712 58.059 56.477 1.00 36.79 ? 41  GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.204 56.679 56.133 1.00 37.78 ? 41  GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.166 56.241 56.642 1.00 37.98 ? 41  GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -21.965 56.000 55.271 1.00 37.93 ? 42  ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.665 54.643 54.808 1.00 37.95 ? 42  ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.370 54.599 54.024 1.00 37.12 ? 42  ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.777 53.543 53.845 1.00 38.15 ? 42  ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.796 54.125 53.915 1.00 38.44 ? 42  ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.207 52.707 54.261 0.00 36.97 ? 42  ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.385 52.426 54.480 0.00 36.63 ? 42  ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -22.235 51.805 54.310 0.00 36.68 ? 42  ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -19.943 55.759 53.552 1.00 36.98 ? 43  MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.721 55.860 52.785 1.00 37.06 ? 43  MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.502 55.932 53.698 1.00 36.55 ? 43  MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.360 55.874 53.228 1.00 36.23 ? 43  MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.786 57.099 51.896 1.00 38.55 ? 43  MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.517 56.872 50.589 1.00 38.77 ? 43  MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.446 58.316 49.534 1.00 42.62 ? 43  MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -17.643 58.701 49.561 1.00 43.94 ? 43  MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.745 56.057 55.001 1.00 35.80 ? 44  ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.649 56.139 55.955 1.00 34.41 ? 44  ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.820 54.879 55.889 1.00 33.44 ? 44  ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.362 53.781 55.928 1.00 33.28 ? 44  ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.159 56.326 57.381 1.00 33.77 ? 44  ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -16.016 56.553 58.361 1.00 35.16 ? 44  ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.347 56.087 59.767 1.00 32.18 ? 44  ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -16.805 57.197 60.593 1.00 29.00 ? 44  ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.706 57.073 61.557 1.00 30.80 ? 44  ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -18.237 55.887 61.807 1.00 32.83 ? 44  ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.090 58.128 62.262 1.00 31.32 ? 44  ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.507 55.059 55.799 1.00 32.72 ? 45  PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.540 53.971 55.709 1.00 34.76 ? 45  PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.370 53.549 54.257 1.00 36.09 ? 45  PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.363 52.929 53.899 1.00 40.06 ? 45  PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.967 52.742 56.524 1.00 35.56 ? 45  PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.085 52.988 58.000 1.00 36.48 ? 45  PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.126 53.723 58.679 1.00 35.42 ? 45  PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.175 52.493 58.709 1.00 37.10 ? 45  PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.255 53.964 60.039 1.00 34.90 ? 45  PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.308 52.731 60.066 1.00 35.43 ? 45  PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.348 53.469 60.731 1.00 33.56 ? 45  PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.349 53.882 53.421 1.00 33.61 ? 46  ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.282 53.519 52.013 1.00 33.68 ? 46  ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.261 54.367 51.259 1.00 35.24 ? 46  ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -12.852 55.429 51.730 1.00 35.86 ? 46  ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.659 53.672 51.370 1.00 34.28 ? 46  ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.380 52.350 51.142 1.00 33.57 ? 46  ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.855 52.566 50.849 1.00 35.56 ? 46  ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.525 51.330 50.451 1.00 35.56 ? 46  ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.520 51.270 49.571 0.00 34.83 ? 46  ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -19.968 52.377 48.994 0.00 34.46 ? 46  ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.068 50.101 49.266 0.00 34.49 ? 46  ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -12.833 53.889 50.094 1.00 37.23 ? 47  ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -11.869 54.635 49.289 1.00 38.88 ? 47  ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.506 55.965 48.891 1.00 39.16 ? 47  ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -13.730 56.106 48.919 1.00 40.36 ? 47  ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.484 53.849 48.033 1.00 40.88 ? 47  ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -11.683 52.345 48.125 1.00 45.04 ? 47  ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -11.112 51.671 46.885 1.00 48.45 ? 47  ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -10.729 50.279 47.121 1.00 52.73 ? 47  ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.489  49.808 46.998 1.00 52.83 ? 47  ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -8.494  50.613 46.643 1.00 53.50 ? 47  ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -9.244  48.523 47.207 1.00 54.11 ? 47  ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -11.689 56.953 48.496 1.00 39.70 ? 48  PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.212 58.266 48.102 1.00 40.53 ? 48  PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.129 58.209 46.889 1.00 41.55 ? 48  PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.961 57.365 46.019 1.00 42.97 ? 48  PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -10.955 59.094 47.840 1.00 40.11 ? 48  PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -9.898  58.094 47.540 1.00 40.17 ? 48  PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.224 56.889 48.371 1.00 40.40 ? 48  PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.099 59.114 46.837 1.00 43.56 ? 49  GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.042 59.154 45.727 1.00 43.26 ? 49  GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -14.931 60.470 44.986 1.00 43.37 ? 49  GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -14.974 61.530 45.598 1.00 45.92 ? 49  GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.461 59.017 46.243 1.00 44.73 ? 49  GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.509 59.179 45.175 1.00 46.32 ? 49  GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -18.187 57.871 44.873 1.00 47.11 ? 49  GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -17.464 56.847 44.822 1.00 47.72 ? 49  GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -19.429 57.869 44.697 1.00 48.25 ? 49  GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.793 60.419 43.656 1.00 41.76 ? 50  PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.677 61.624 42.827 1.00 39.46 ? 50  PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.842 62.551 43.108 1.00 38.52 ? 50  PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.943 62.082 43.376 1.00 40.40 ? 50  PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.722 61.092 41.398 1.00 40.47 ? 50  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.318 59.667 41.499 1.00 43.57 ? 50  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.752 59.184 42.858 1.00 43.16 ? 50  PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.604 63.857 43.038 1.00 37.29 ? 51  LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.644 64.848 43.305 1.00 37.50 ? 51  LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.478 65.210 42.073 1.00 41.23 ? 51  LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -16.975 65.854 41.145 1.00 44.70 ? 51  LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -16.010 66.117 43.871 1.00 33.87 ? 51  LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -16.894 67.338 43.797 1.00 30.56 ? 51  LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -18.130 67.144 44.639 1.00 31.95 ? 51  LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.659 68.466 45.155 1.00 33.50 ? 51  LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.664 68.249 46.230 1.00 35.06 ? 51  LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.753 64.811 42.074 1.00 41.31 ? 52  LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.661 65.106 40.964 1.00 38.72 ? 52  LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.626 66.598 40.655 1.00 37.51 ? 52  LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.495 67.428 41.551 1.00 38.27 ? 52  LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.094 64.688 41.304 1.00 39.24 ? 52  LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.475 63.269 40.858 1.00 40.61 ? 52  LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -20.883 62.901 39.495 1.00 42.41 ? 52  LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -20.132 61.565 39.536 1.00 42.49 ? 52  LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -18.779 61.639 38.888 1.00 41.06 ? 52  LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.750 66.954 39.375 1.00 36.50 ? 53  PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.729 68.341 38.897 1.00 35.54 ? 53  PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.772 69.264 39.508 1.00 34.77 ? 53  PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.866 68.828 39.863 1.00 35.70 ? 53  PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.913 68.198 37.391 1.00 35.38 ? 53  PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -19.462 66.787 37.093 1.00 36.48 ? 53  PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.925 66.000 38.270 1.00 36.42 ? 53  PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.418 70.541 39.639 1.00 33.81 ? 54  TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.340 71.524 40.187 1.00 33.99 ? 54  TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -21.839 72.452 39.085 1.00 35.63 ? 54  TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -21.059 73.037 38.322 1.00 35.76 ? 54  TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -20.709 72.331 41.340 1.00 30.96 ? 54  TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.329 72.855 41.109 1.00 27.79 ? 54  TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -18.991 74.069 40.592 1.00 25.96 ? 54  TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.097 72.200 41.438 1.00 26.42 ? 54  TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -17.626 74.214 40.578 1.00 25.60 ? 54  TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.053 73.081 41.092 1.00 25.45 ? 54  TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -17.777 70.954 41.992 1.00 25.77 ? 54  TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -15.708 72.759 41.282 1.00 25.41 ? 54  TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.442 70.633 42.179 1.00 28.30 ? 54  TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.422 71.535 41.824 1.00 26.58 ? 54  TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -23.160 72.575 39.021 1.00 36.81 ? 55  SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.828 73.374 38.010 1.00 38.46 ? 55  SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.952 74.867 38.302 1.00 38.59 ? 55  SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -24.875 75.526 37.817 1.00 42.90 ? 55  SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -25.212 72.770 37.745 1.00 40.79 ? 55  SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.201 71.359 37.956 1.00 41.40 ? 55  SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.023 75.409 39.076 1.00 35.67 ? 56  GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -23.076 76.823 39.379 1.00 32.85 ? 56  GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.664 77.340 39.466 1.00 33.49 ? 56  GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -20.798 76.896 38.708 1.00 35.55 ? 56  GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.435 78.275 40.386 1.00 31.97 ? 57  VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -20.117 78.854 40.614 1.00 30.24 ? 57  VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.744 78.553 42.059 1.00 32.25 ? 57  VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.373 79.069 42.971 1.00 35.32 ? 57  VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -20.136 80.375 40.423 1.00 27.45 ? 57  VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -19.021 81.028 41.225 1.00 25.84 ? 57  VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -19.974 80.698 38.970 1.00 29.19 ? 57  VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.732 77.718 42.269 1.00 33.10 ? 58  TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.303 77.366 43.618 1.00 33.12 ? 58  TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.482 78.478 44.255 1.00 34.33 ? 58  TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.568 79.009 43.629 1.00 36.17 ? 58  TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.463 76.098 43.589 1.00 32.78 ? 58  TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -17.131 75.611 44.946 1.00 31.22 ? 58  TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -16.232 76.152 45.817 1.00 30.72 ? 58  TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.732 74.511 45.619 1.00 29.29 ? 58  TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -16.241 75.456 46.997 1.00 29.25 ? 58  TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -17.155 74.441 46.902 1.00 29.33 ? 58  TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.707 73.573 45.261 1.00 30.46 ? 58  TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.520 73.469 47.834 1.00 31.43 ? 58  TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -19.073 72.605 46.188 1.00 31.15 ? 58  TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.480 72.562 47.461 1.00 31.34 ? 58  TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -17.792 78.812 45.504 1.00 34.52 ? 59  ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.075 79.872 46.207 1.00 36.33 ? 59  ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -15.836 79.374 46.949 1.00 35.57 ? 59  ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -15.930 78.668 47.954 1.00 37.00 ? 59  ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -18.004 80.574 47.190 1.00 40.45 ? 59  ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.386 81.822 47.773 1.00 46.10 ? 59  ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.682 82.563 47.077 1.00 48.80 ? 59  ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -17.638 82.066 49.060 1.00 48.52 ? 59  ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.670 79.765 46.453 1.00 32.81 ? 60  ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.420 79.345 47.046 1.00 30.11 ? 60  ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.702 80.528 47.653 1.00 30.44 ? 60  ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.559 80.820 47.300 1.00 28.95 ? 60  ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.547 78.688 45.995 1.00 30.01 ? 60  ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.375 81.200 48.581 1.00 31.45 ? 61  SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.802 82.368 49.239 1.00 30.87 ? 61  SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.440 82.104 50.692 1.00 31.13 ? 61  SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.846 82.960 51.345 1.00 33.24 ? 61  SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.790 83.518 49.185 1.00 30.34 ? 61  SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -15.011 83.117 49.781 1.00 29.55 ? 61  SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -12.795 80.929 51.201 1.00 30.10 ? 62  THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.499 80.598 52.588 1.00 29.53 ? 62  THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -12.038 79.168 52.796 1.00 27.39 ? 62  THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.589 78.243 52.211 1.00 26.80 ? 62  THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.724 80.798 53.458 1.00 33.16 ? 62  THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.857 80.208 52.808 1.00 35.99 ? 62  THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -13.977 82.283 53.687 1.00 35.46 ? 62  THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -11.033 78.994 53.647 1.00 25.63 ? 63  TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.512 77.673 53.952 1.00 24.34 ? 63  TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.660 76.775 54.371 1.00 25.03 ? 63  TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.622 77.234 54.967 1.00 31.31 ? 63  TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.562  77.755 55.120 1.00 24.84 ? 63  TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.138  78.068 54.778 1.00 25.94 ? 63  TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.587  77.711 53.550 1.00 26.30 ? 63  TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.315  78.683 55.720 1.00 26.09 ? 63  TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.232  77.960 53.278 1.00 26.97 ? 63  TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -5.976  78.934 55.462 1.00 26.44 ? 63  TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.439  78.570 54.248 1.00 25.51 ? 63  TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.105  78.797 54.043 1.00 27.67 ? 63  TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.574 75.479 54.076 1.00 23.86 ? 64  PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.629 74.535 54.447 1.00 25.26 ? 64  PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.366 73.829 55.797 1.00 25.84 ? 64  PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.366 74.093 56.459 1.00 25.57 ? 64  PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -12.642 73.558 53.278 1.00 26.75 ? 64  PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -11.221 73.663 52.666 1.00 26.91 ? 64  PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.498 74.813 53.331 1.00 25.84 ? 64  PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -13.267 72.937 56.201 1.00 25.74 ? 65  ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -13.108 72.216 57.460 1.00 25.55 ? 65  ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.814 71.432 57.455 1.00 26.02 ? 65  ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -11.276 71.107 56.399 1.00 30.00 ? 65  ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.236 71.208 57.673 1.00 26.65 ? 65  ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.601 71.817 57.552 1.00 27.92 ? 65  ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -15.864 72.906 58.066 1.00 29.20 ? 65  ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -16.494 71.111 56.869 1.00 29.78 ? 65  ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.317 71.125 58.644 1.00 24.89 ? 66  ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.110 70.338 58.766 1.00 25.22 ? 66  ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.663 68.947 58.968 1.00 27.42 ? 66  ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.784 68.801 59.452 1.00 29.87 ? 66  ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.314  70.787 59.974 1.00 26.01 ? 66  ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.707  72.146 59.775 1.00 27.33 ? 66  ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -9.404  73.098 59.448 1.00 27.31 ? 66  ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -7.398  72.247 59.960 1.00 29.74 ? 66  ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -9.914  67.919 58.601 1.00 27.38 ? 67  CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.465 66.587 58.759 1.00 29.25 ? 67  CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.687 66.285 60.230 1.00 28.07 ? 67  CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -10.343 67.086 61.089 1.00 28.03 ? 67  CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.568  65.528 58.099 1.00 31.19 ? 67  CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.758  65.378 56.280 1.00 30.10 ? 67  CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.295 65.138 60.502 1.00 26.74 ? 68  GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.594 64.712 61.852 1.00 25.37 ? 68  GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.308 64.193 62.457 1.00 26.78 ? 68  GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.790  63.163 62.029 1.00 27.29 ? 68  GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.640 63.608 61.800 1.00 25.31 ? 68  GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -13.439 63.472 63.049 1.00 26.87 ? 68  GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.320 64.665 63.289 1.00 26.89 ? 68  GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -15.538 64.584 63.164 1.00 27.04 ? 68  GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -13.711 65.788 63.639 1.00 27.20 ? 68  GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.790  64.887 63.462 1.00 28.51 ? 69  GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.530  64.452 64.052 1.00 30.29 ? 69  GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.326  64.695 65.544 1.00 30.31 ? 69  GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -9.025  65.494 66.174 1.00 29.54 ? 69  GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.373  65.107 63.295 1.00 30.27 ? 69  GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.225  66.597 63.587 1.00 26.06 ? 69  GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.471  67.329 62.502 1.00 23.79 ? 69  GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.309  67.705 62.682 1.00 28.65 ? 69  GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -7.126  67.536 61.366 1.00 16.36 ? 69  GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.333  63.997 66.085 1.00 30.45 ? 70  TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.966  64.109 67.483 1.00 31.35 ? 70  TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.287  65.458 67.649 1.00 32.25 ? 70  TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.282  65.743 66.999 1.00 32.78 ? 70  TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -6.000  62.984 67.868 1.00 32.83 ? 70  TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.420  63.130 69.254 1.00 37.06 ? 70  TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -4.340  63.980 69.493 1.00 38.92 ? 70  TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -5.975  62.452 70.341 1.00 38.64 ? 70  TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -3.830  64.160 70.778 1.00 39.59 ? 70  TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -5.470  62.626 71.635 1.00 38.87 ? 70  TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -4.401  63.485 71.844 1.00 39.31 ? 70  TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.930  63.710 73.117 1.00 39.60 ? 70  TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.848  66.293 68.514 1.00 32.79 ? 71  VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.298  67.616 68.765 1.00 30.50 ? 71  VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.483  67.597 70.052 1.00 33.08 ? 71  VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.874  66.978 71.041 1.00 34.64 ? 71  VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.422  68.645 68.864 1.00 26.43 ? 71  VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -8.738  67.926 69.016 1.00 27.49 ? 71  VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -7.189  69.584 70.031 1.00 26.56 ? 71  VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -4.348  68.286 70.026 1.00 35.75 ? 72  ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -3.435  68.357 71.157 1.00 36.27 ? 72  ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.885  69.345 72.244 1.00 38.80 ? 72  ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -4.395  70.433 71.959 1.00 38.54 ? 72  ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -2.045  68.710 70.626 1.00 35.75 ? 72  ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -1.147  69.312 71.673 1.00 39.64 ? 72  ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -1.479  70.401 72.197 1.00 42.71 ? 72  ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? -0.097  68.700 71.964 1.00 39.07 ? 72  ASP A OD2 1 
ATOM   542  N N   . GLU A 1 73  ? -3.694  68.946 73.499 1.00 40.75 ? 73  GLU A N   1 
ATOM   543  C CA  . GLU A 1 73  ? -4.068  69.770 74.640 1.00 41.03 ? 73  GLU A CA  1 
ATOM   544  C C   . GLU A 1 73  ? -3.052  69.617 75.765 1.00 41.19 ? 73  GLU A C   1 
ATOM   545  O O   . GLU A 1 73  ? -3.383  69.796 76.938 1.00 41.66 ? 73  GLU A O   1 
ATOM   546  C CB  . GLU A 1 73  ? -5.452  69.368 75.151 1.00 43.57 ? 73  GLU A CB  1 
ATOM   547  C CG  . GLU A 1 73  ? -6.615  69.982 74.392 1.00 45.82 ? 73  GLU A CG  1 
ATOM   548  C CD  . GLU A 1 73  ? -7.839  69.085 74.397 1.00 46.60 ? 73  GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 73  ? -7.667  67.847 74.402 1.00 49.57 ? 73  GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 73  ? -8.971  69.613 74.394 1.00 46.78 ? 73  GLU A OE2 1 
ATOM   551  N N   . GLN A 1 74  ? -1.818  69.277 75.406 1.00 40.79 ? 74  GLN A N   1 
ATOM   552  C CA  . GLN A 1 74  ? -0.763  69.117 76.397 1.00 41.33 ? 74  GLN A CA  1 
ATOM   553  C C   . GLN A 1 74  ? -0.194  70.471 76.823 1.00 41.98 ? 74  GLN A C   1 
ATOM   554  O O   . GLN A 1 74  ? 0.452   70.585 77.868 1.00 44.40 ? 74  GLN A O   1 
ATOM   555  C CB  . GLN A 1 74  ? 0.361   68.245 75.846 1.00 39.67 ? 74  GLN A CB  1 
ATOM   556  C CG  . GLN A 1 74  ? 0.473   66.893 76.531 1.00 42.36 ? 74  GLN A CG  1 
ATOM   557  C CD  . GLN A 1 74  ? 1.364   66.917 77.764 1.00 43.82 ? 74  GLN A CD  1 
ATOM   558  O OE1 . GLN A 1 74  ? 2.200   66.030 77.957 1.00 44.63 ? 74  GLN A OE1 1 
ATOM   559  N NE2 . GLN A 1 74  ? 1.187   67.931 78.605 1.00 44.84 ? 74  GLN A NE2 1 
ATOM   560  N N   . PHE A 1 75  ? -0.429  71.500 76.016 1.00 40.05 ? 75  PHE A N   1 
ATOM   561  C CA  . PHE A 1 75  ? 0.075   72.826 76.339 1.00 37.01 ? 75  PHE A CA  1 
ATOM   562  C C   . PHE A 1 75  ? -0.898  73.907 75.912 1.00 36.00 ? 75  PHE A C   1 
ATOM   563  O O   . PHE A 1 75  ? -0.563  74.756 75.091 1.00 35.14 ? 75  PHE A O   1 
ATOM   564  C CB  . PHE A 1 75  ? 1.443   73.040 75.686 1.00 34.81 ? 75  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 75  ? 2.504   72.121 76.218 1.00 32.82 ? 75  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 75  ? 2.989   72.274 77.508 1.00 34.73 ? 75  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 75  ? 2.976   71.066 75.456 1.00 32.42 ? 75  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 75  ? 3.927   71.383 78.032 1.00 34.14 ? 75  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 75  ? 3.913   70.171 75.972 1.00 33.25 ? 75  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 75  ? 4.385   70.330 77.261 1.00 33.04 ? 75  PHE A CZ  1 
ATOM   571  N N   . PRO A 1 76  ? -2.128  73.877 76.469 1.00 35.68 ? 76  PRO A N   1 
ATOM   572  C CA  . PRO A 1 76  ? -3.211  74.824 76.198 1.00 33.71 ? 76  PRO A CA  1 
ATOM   573  C C   . PRO A 1 76  ? -2.720  76.256 76.137 1.00 34.06 ? 76  PRO A C   1 
ATOM   574  O O   . PRO A 1 76  ? -1.894  76.668 76.951 1.00 36.63 ? 76  PRO A O   1 
ATOM   575  C CB  . PRO A 1 76  ? -4.172  74.584 77.346 1.00 33.40 ? 76  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 76  ? -4.038  73.134 77.602 1.00 32.55 ? 76  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 76  ? -2.564  72.846 77.431 1.00 35.52 ? 76  PRO A CD  1 
ATOM   578  N N   . GLY A 1 77  ? -3.244  77.011 75.174 1.00 32.50 ? 77  GLY A N   1 
ATOM   579  C CA  . GLY A 1 77  ? -2.814  78.384 74.990 1.00 31.11 ? 77  GLY A CA  1 
ATOM   580  C C   . GLY A 1 77  ? -1.538  78.389 74.158 1.00 31.60 ? 77  GLY A C   1 
ATOM   581  O O   . GLY A 1 77  ? -1.536  78.799 72.995 1.00 33.43 ? 77  GLY A O   1 
ATOM   582  N N   . PHE A 1 78  ? -0.455  77.910 74.766 1.00 30.44 ? 78  PHE A N   1 
ATOM   583  C CA  . PHE A 1 78  ? 0.870   77.818 74.147 1.00 26.72 ? 78  PHE A CA  1 
ATOM   584  C C   . PHE A 1 78  ? 0.826   77.693 72.633 1.00 25.20 ? 78  PHE A C   1 
ATOM   585  O O   . PHE A 1 78  ? 0.346   76.692 72.103 1.00 23.56 ? 78  PHE A O   1 
ATOM   586  C CB  . PHE A 1 78  ? 1.613   76.617 74.736 1.00 24.59 ? 78  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 78  ? 3.042   76.512 74.310 1.00 22.94 ? 78  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 78  ? 3.858   77.637 74.262 1.00 23.69 ? 78  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 78  ? 3.583   75.278 73.972 1.00 22.98 ? 78  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 78  ? 5.200   77.536 73.884 1.00 21.41 ? 78  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 78  ? 4.913   75.167 73.596 1.00 22.16 ? 78  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 78  ? 5.724   76.303 73.552 1.00 23.35 ? 78  PHE A CZ  1 
ATOM   593  N N   . SER A 1 79  ? 1.341   78.706 71.944 1.00 24.05 ? 79  SER A N   1 
ATOM   594  C CA  . SER A 1 79  ? 1.355   78.706 70.484 1.00 26.33 ? 79  SER A CA  1 
ATOM   595  C C   . SER A 1 79  ? 2.141   77.523 69.908 1.00 28.96 ? 79  SER A C   1 
ATOM   596  O O   . SER A 1 79  ? 1.645   76.795 69.046 1.00 31.31 ? 79  SER A O   1 
ATOM   597  C CB  . SER A 1 79  ? 1.959   80.004 69.969 1.00 23.49 ? 79  SER A CB  1 
ATOM   598  O OG  . SER A 1 79  ? 3.374   79.926 69.988 1.00 25.26 ? 79  SER A OG  1 
ATOM   599  N N   . GLY A 1 80  ? 3.367   77.332 70.381 1.00 29.25 ? 80  GLY A N   1 
ATOM   600  C CA  . GLY A 1 80  ? 4.183   76.234 69.891 1.00 28.39 ? 80  GLY A CA  1 
ATOM   601  C C   . GLY A 1 80  ? 3.441   74.933 69.622 1.00 27.83 ? 80  GLY A C   1 
ATOM   602  O O   . GLY A 1 80  ? 3.797   74.209 68.693 1.00 29.01 ? 80  GLY A O   1 
ATOM   603  N N   . SER A 1 81  ? 2.421   74.633 70.431 1.00 27.53 ? 81  SER A N   1 
ATOM   604  C CA  . SER A 1 81  ? 1.630   73.406 70.289 1.00 26.33 ? 81  SER A CA  1 
ATOM   605  C C   . SER A 1 81  ? 0.330   73.654 69.526 1.00 26.54 ? 81  SER A C   1 
ATOM   606  O O   . SER A 1 81  ? 0.019   72.957 68.563 1.00 23.31 ? 81  SER A O   1 
ATOM   607  C CB  . SER A 1 81  ? 1.315   72.811 71.672 1.00 26.38 ? 81  SER A CB  1 
ATOM   608  O OG  . SER A 1 81  ? 0.100   73.313 72.220 1.00 24.52 ? 81  SER A OG  1 
ATOM   609  N N   . GLU A 1 82  ? -0.424  74.657 69.962 1.00 28.29 ? 82  GLU A N   1 
ATOM   610  C CA  . GLU A 1 82  ? -1.687  75.003 69.319 1.00 28.46 ? 82  GLU A CA  1 
ATOM   611  C C   . GLU A 1 82  ? -1.464  75.407 67.856 1.00 26.63 ? 82  GLU A C   1 
ATOM   612  O O   . GLU A 1 82  ? -2.387  75.400 67.047 1.00 27.81 ? 82  GLU A O   1 
ATOM   613  C CB  . GLU A 1 82  ? -2.375  76.158 70.075 1.00 28.49 ? 82  GLU A CB  1 
ATOM   614  C CG  . GLU A 1 82  ? -2.268  76.099 71.586 1.00 29.21 ? 82  GLU A CG  1 
ATOM   615  C CD  . GLU A 1 82  ? -3.199  75.068 72.214 1.00 35.58 ? 82  GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 82  ? -2.792  73.887 72.373 1.00 36.85 ? 82  GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 82  ? -4.342  75.444 72.558 1.00 35.73 ? 82  GLU A OE2 1 
ATOM   618  N N   . MET A 1 83  ? -0.230  75.750 67.521 1.00 24.50 ? 83  MET A N   1 
ATOM   619  C CA  . MET A 1 83  ? 0.102   76.179 66.169 1.00 26.08 ? 83  MET A CA  1 
ATOM   620  C C   . MET A 1 83  ? -0.073  75.113 65.099 1.00 25.97 ? 83  MET A C   1 
ATOM   621  O O   . MET A 1 83  ? -0.062  75.411 63.903 1.00 27.10 ? 83  MET A O   1 
ATOM   622  C CB  . MET A 1 83  ? 1.536   76.687 66.135 1.00 25.86 ? 83  MET A CB  1 
ATOM   623  C CG  . MET A 1 83  ? 2.496   75.767 65.448 1.00 25.83 ? 83  MET A CG  1 
ATOM   624  S SD  . MET A 1 83  ? 3.765   76.784 64.767 1.00 31.49 ? 83  MET A SD  1 
ATOM   625  C CE  . MET A 1 83  ? 5.017   76.635 66.024 1.00 29.86 ? 83  MET A CE  1 
ATOM   626  N N   . TRP A 1 84  ? -0.231  73.874 65.534 1.00 25.81 ? 84  TRP A N   1 
ATOM   627  C CA  . TRP A 1 84  ? -0.394  72.762 64.619 1.00 24.83 ? 84  TRP A CA  1 
ATOM   628  C C   . TRP A 1 84  ? -1.775  72.147 64.731 1.00 25.91 ? 84  TRP A C   1 
ATOM   629  O O   . TRP A 1 84  ? -2.154  71.292 63.927 1.00 28.70 ? 84  TRP A O   1 
ATOM   630  C CB  . TRP A 1 84  ? 0.641   71.697 64.930 1.00 24.75 ? 84  TRP A CB  1 
ATOM   631  C CG  . TRP A 1 84  ? 2.034   72.208 64.991 1.00 25.15 ? 84  TRP A CG  1 
ATOM   632  C CD1 . TRP A 1 84  ? 2.748   72.526 66.112 1.00 24.23 ? 84  TRP A CD1 1 
ATOM   633  C CD2 . TRP A 1 84  ? 2.923   72.378 63.883 1.00 24.26 ? 84  TRP A CD2 1 
ATOM   634  N NE1 . TRP A 1 84  ? 4.035   72.878 65.768 1.00 26.38 ? 84  TRP A NE1 1 
ATOM   635  C CE2 . TRP A 1 84  ? 4.167   72.793 64.404 1.00 25.15 ? 84  TRP A CE2 1 
ATOM   636  C CE3 . TRP A 1 84  ? 2.790   72.214 62.497 1.00 20.98 ? 84  TRP A CE3 1 
ATOM   637  C CZ2 . TRP A 1 84  ? 5.270   73.047 63.586 1.00 24.01 ? 84  TRP A CZ2 1 
ATOM   638  C CZ3 . TRP A 1 84  ? 3.883   72.464 61.689 1.00 20.64 ? 84  TRP A CZ3 1 
ATOM   639  C CH2 . TRP A 1 84  ? 5.107   72.876 62.234 1.00 21.57 ? 84  TRP A CH2 1 
ATOM   640  N N   . ASN A 1 85  ? -2.522  72.562 65.743 1.00 25.11 ? 85  ASN A N   1 
ATOM   641  C CA  . ASN A 1 85  ? -3.853  72.027 65.935 1.00 24.11 ? 85  ASN A CA  1 
ATOM   642  C C   . ASN A 1 85  ? -4.739  72.527 64.810 1.00 24.13 ? 85  ASN A C   1 
ATOM   643  O O   . ASN A 1 85  ? -4.440  73.550 64.192 1.00 23.73 ? 85  ASN A O   1 
ATOM   644  C CB  . ASN A 1 85  ? -4.407  72.464 67.290 1.00 24.52 ? 85  ASN A CB  1 
ATOM   645  C CG  . ASN A 1 85  ? -3.889  71.611 68.422 1.00 23.70 ? 85  ASN A CG  1 
ATOM   646  O OD1 . ASN A 1 85  ? -4.216  70.431 68.518 1.00 19.86 ? 85  ASN A OD1 1 
ATOM   647  N ND2 . ASN A 1 85  ? -3.067  72.200 69.281 1.00 23.33 ? 85  ASN A ND2 1 
ATOM   648  N N   . PRO A 1 86  ? -5.835  71.804 64.519 1.00 24.41 ? 86  PRO A N   1 
ATOM   649  C CA  . PRO A 1 86  ? -6.748  72.214 63.448 1.00 25.42 ? 86  PRO A CA  1 
ATOM   650  C C   . PRO A 1 86  ? -7.301  73.601 63.743 1.00 26.42 ? 86  PRO A C   1 
ATOM   651  O O   . PRO A 1 86  ? -7.539  73.936 64.902 1.00 28.20 ? 86  PRO A O   1 
ATOM   652  C CB  . PRO A 1 86  ? -7.830  71.132 63.455 1.00 24.15 ? 86  PRO A CB  1 
ATOM   653  C CG  . PRO A 1 86  ? -7.707  70.474 64.785 1.00 24.61 ? 86  PRO A CG  1 
ATOM   654  C CD  . PRO A 1 86  ? -6.280  70.568 65.184 1.00 22.84 ? 86  PRO A CD  1 
ATOM   655  N N   . ASN A 1 87  ? -7.497  74.413 62.708 1.00 26.88 ? 87  ASN A N   1 
ATOM   656  C CA  . ASN A 1 87  ? -8.004  75.756 62.928 1.00 26.84 ? 87  ASN A CA  1 
ATOM   657  C C   . ASN A 1 87  ? -9.333  76.080 62.260 1.00 27.55 ? 87  ASN A C   1 
ATOM   658  O O   . ASN A 1 87  ? -9.661  77.248 62.054 1.00 26.28 ? 87  ASN A O   1 
ATOM   659  C CB  . ASN A 1 87  ? -6.944  76.799 62.551 1.00 25.03 ? 87  ASN A CB  1 
ATOM   660  C CG  . ASN A 1 87  ? -6.569  76.762 61.092 1.00 25.04 ? 87  ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 87  ? -6.974  75.866 60.349 1.00 26.04 ? 87  ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 87  ? -5.785  77.746 60.669 1.00 21.98 ? 87  ASN A ND2 1 
ATOM   663  N N   . ARG A 1 88  ? -10.097 75.040 61.937 1.00 28.70 ? 88  ARG A N   1 
ATOM   664  C CA  . ARG A 1 88  ? -11.426 75.198 61.338 1.00 30.95 ? 88  ARG A CA  1 
ATOM   665  C C   . ARG A 1 88  ? -12.263 74.018 61.813 1.00 30.65 ? 88  ARG A C   1 
ATOM   666  O O   . ARG A 1 88  ? -11.724 72.963 62.117 1.00 32.50 ? 88  ARG A O   1 
ATOM   667  C CB  . ARG A 1 88  ? -11.382 75.194 59.800 1.00 30.33 ? 88  ARG A CB  1 
ATOM   668  C CG  . ARG A 1 88  ? -10.302 76.053 59.176 1.00 32.26 ? 88  ARG A CG  1 
ATOM   669  C CD  . ARG A 1 88  ? -10.852 77.388 58.707 1.00 34.17 ? 88  ARG A CD  1 
ATOM   670  N NE  . ARG A 1 88  ? -9.893  78.458 58.962 1.00 36.01 ? 88  ARG A NE  1 
ATOM   671  C CZ  . ARG A 1 88  ? -10.111 79.740 58.694 1.00 36.84 ? 88  ARG A CZ  1 
ATOM   672  N NH1 . ARG A 1 88  ? -11.270 80.113 58.158 1.00 38.24 ? 88  ARG A NH1 1 
ATOM   673  N NH2 . ARG A 1 88  ? -9.170  80.642 58.964 1.00 33.20 ? 88  ARG A NH2 1 
ATOM   674  N N   . GLU A 1 89  ? -13.575 74.200 61.883 1.00 31.15 ? 89  GLU A N   1 
ATOM   675  C CA  . GLU A 1 89  ? -14.463 73.134 62.327 1.00 30.94 ? 89  GLU A CA  1 
ATOM   676  C C   . GLU A 1 89  ? -14.046 71.801 61.705 1.00 29.21 ? 89  GLU A C   1 
ATOM   677  O O   . GLU A 1 89  ? -14.117 71.624 60.494 1.00 32.46 ? 89  GLU A O   1 
ATOM   678  C CB  . GLU A 1 89  ? -15.913 73.459 61.935 1.00 33.23 ? 89  GLU A CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -16.875 73.605 63.110 1.00 32.53 ? 89  GLU A CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -18.233 74.133 62.691 0.00 32.37 ? 89  GLU A CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -18.768 73.656 61.668 0.00 32.20 ? 89  GLU A OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -18.765 75.025 63.385 0.00 32.18 ? 89  GLU A OE2 1 
ATOM   683  N N   . MET A 1 90  ? -13.593 70.874 62.534 1.00 25.47 ? 90  MET A N   1 
ATOM   684  C CA  . MET A 1 90  ? -13.194 69.571 62.040 1.00 24.27 ? 90  MET A CA  1 
ATOM   685  C C   . MET A 1 90  ? -14.464 68.937 61.508 1.00 24.30 ? 90  MET A C   1 
ATOM   686  O O   . MET A 1 90  ? -15.542 69.195 62.036 1.00 25.97 ? 90  MET A O   1 
ATOM   687  C CB  . MET A 1 90  ? -12.654 68.712 63.181 1.00 25.85 ? 90  MET A CB  1 
ATOM   688  C CG  . MET A 1 90  ? -11.233 69.002 63.610 1.00 25.37 ? 90  MET A CG  1 
ATOM   689  S SD  . MET A 1 90  ? -10.755 67.800 64.861 1.00 31.14 ? 90  MET A SD  1 
ATOM   690  C CE  . MET A 1 90  ? -10.220 68.853 66.152 1.00 31.82 ? 90  MET A CE  1 
ATOM   691  N N   . SER A 1 91  ? -14.349 68.107 60.475 1.00 24.02 ? 91  SER A N   1 
ATOM   692  C CA  . SER A 1 91  ? -15.523 67.447 59.910 1.00 23.93 ? 91  SER A CA  1 
ATOM   693  C C   . SER A 1 91  ? -15.133 66.293 59.018 1.00 22.54 ? 91  SER A C   1 
ATOM   694  O O   . SER A 1 91  ? -14.038 66.292 58.469 1.00 22.28 ? 91  SER A O   1 
ATOM   695  C CB  . SER A 1 91  ? -16.348 68.431 59.085 1.00 27.41 ? 91  SER A CB  1 
ATOM   696  O OG  . SER A 1 91  ? -17.301 67.738 58.288 1.00 33.26 ? 91  SER A OG  1 
ATOM   697  N N   . GLU A 1 92  ? -16.035 65.323 58.866 1.00 22.64 ? 92  GLU A N   1 
ATOM   698  C CA  . GLU A 1 92  ? -15.780 64.166 58.005 1.00 24.81 ? 92  GLU A CA  1 
ATOM   699  C C   . GLU A 1 92  ? -15.798 64.605 56.540 1.00 26.91 ? 92  GLU A C   1 
ATOM   700  O O   . GLU A 1 92  ? -15.243 63.934 55.669 1.00 27.51 ? 92  GLU A O   1 
ATOM   701  C CB  . GLU A 1 92  ? -16.832 63.085 58.227 1.00 23.08 ? 92  GLU A CB  1 
ATOM   702  C CG  . GLU A 1 92  ? -16.717 62.375 59.555 1.00 21.68 ? 92  GLU A CG  1 
ATOM   703  C CD  . GLU A 1 92  ? -17.169 60.935 59.471 1.00 22.91 ? 92  GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 92  ? -16.338 60.077 59.092 1.00 23.05 ? 92  GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 92  ? -18.355 60.661 59.775 1.00 21.48 ? 92  GLU A OE2 1 
ATOM   706  N N   . ASP A 1 93  ? -16.461 65.731 56.280 1.00 29.26 ? 93  ASP A N   1 
ATOM   707  C CA  . ASP A 1 93  ? -16.537 66.320 54.942 1.00 29.00 ? 93  ASP A CA  1 
ATOM   708  C C   . ASP A 1 93  ? -15.349 67.273 54.890 1.00 27.53 ? 93  ASP A C   1 
ATOM   709  O O   . ASP A 1 93  ? -15.482 68.460 55.216 1.00 25.55 ? 93  ASP A O   1 
ATOM   710  C CB  . ASP A 1 93  ? -17.846 67.105 54.775 1.00 30.39 ? 93  ASP A CB  1 
ATOM   711  C CG  . ASP A 1 93  ? -17.910 67.870 53.456 1.00 32.96 ? 93  ASP A CG  1 
ATOM   712  O OD1 . ASP A 1 93  ? -16.836 68.228 52.927 1.00 31.04 ? 93  ASP A OD1 1 
ATOM   713  O OD2 . ASP A 1 93  ? -19.032 68.110 52.950 1.00 31.35 ? 93  ASP A OD2 1 
ATOM   714  N N   . CYS A 1 94  ? -14.192 66.755 54.488 1.00 25.70 ? 94  CYS A N   1 
ATOM   715  C CA  . CYS A 1 94  ? -12.994 67.573 54.467 1.00 27.58 ? 94  CYS A CA  1 
ATOM   716  C C   . CYS A 1 94  ? -12.135 67.522 53.222 1.00 28.19 ? 94  CYS A C   1 
ATOM   717  O O   . CYS A 1 94  ? -11.239 68.353 53.075 1.00 30.49 ? 94  CYS A O   1 
ATOM   718  C CB  . CYS A 1 94  ? -12.114 67.225 55.675 1.00 29.47 ? 94  CYS A CB  1 
ATOM   719  S SG  . CYS A 1 94  ? -11.762 65.447 55.908 1.00 29.37 ? 94  CYS A SG  1 
ATOM   720  N N   . LEU A 1 95  ? -12.378 66.556 52.339 1.00 26.52 ? 95  LEU A N   1 
ATOM   721  C CA  . LEU A 1 95  ? -11.580 66.436 51.119 1.00 22.69 ? 95  LEU A CA  1 
ATOM   722  C C   . LEU A 1 95  ? -11.739 67.619 50.143 1.00 21.78 ? 95  LEU A C   1 
ATOM   723  O O   . LEU A 1 95  ? -12.645 67.647 49.310 1.00 22.51 ? 95  LEU A O   1 
ATOM   724  C CB  . LEU A 1 95  ? -11.907 65.114 50.432 1.00 18.81 ? 95  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 95  ? -11.707 63.893 51.335 1.00 17.34 ? 95  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 95  ? -11.843 62.624 50.531 1.00 13.38 ? 95  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 95  ? -10.337 63.943 51.977 1.00 18.22 ? 95  LEU A CD2 1 
ATOM   728  N N   . TYR A 1 96  ? -10.832 68.588 50.271 1.00 20.10 ? 96  TYR A N   1 
ATOM   729  C CA  . TYR A 1 96  ? -10.803 69.802 49.464 1.00 18.65 ? 96  TYR A CA  1 
ATOM   730  C C   . TYR A 1 96  ? -9.352  70.201 49.234 1.00 18.16 ? 96  TYR A C   1 
ATOM   731  O O   . TYR A 1 96  ? -8.453  69.630 49.831 1.00 19.59 ? 96  TYR A O   1 
ATOM   732  C CB  . TYR A 1 96  ? -11.482 70.953 50.204 1.00 22.32 ? 96  TYR A CB  1 
ATOM   733  C CG  . TYR A 1 96  ? -12.918 70.717 50.585 1.00 22.47 ? 96  TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 96  ? -13.936 71.003 49.695 1.00 24.78 ? 96  TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 96  ? -13.256 70.214 51.834 1.00 22.66 ? 96  TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 96  ? -15.254 70.797 50.027 1.00 28.42 ? 96  TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 96  ? -14.571 70.004 52.181 1.00 26.39 ? 96  TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 96  ? -15.568 70.298 51.267 1.00 29.07 ? 96  TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 96  ? -16.891 70.092 51.575 1.00 36.84 ? 96  TYR A OH  1 
ATOM   740  N N   . LEU A 1 97  ? -9.133  71.201 48.387 1.00 17.47 ? 97  LEU A N   1 
ATOM   741  C CA  . LEU A 1 97  ? -7.790  71.685 48.098 1.00 16.71 ? 97  LEU A CA  1 
ATOM   742  C C   . LEU A 1 97  ? -7.824  73.200 47.908 1.00 20.32 ? 97  LEU A C   1 
ATOM   743  O O   . LEU A 1 97  ? -8.864  73.756 47.546 1.00 24.93 ? 97  LEU A O   1 
ATOM   744  C CB  . LEU A 1 97  ? -7.230  70.997 46.844 1.00 14.48 ? 97  LEU A CB  1 
ATOM   745  C CG  . LEU A 1 97  ? -7.952  71.103 45.494 1.00 15.20 ? 97  LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 97  ? -7.366  72.240 44.688 1.00 15.03 ? 97  LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 97  ? -7.802  69.800 44.712 1.00 12.84 ? 97  LEU A CD2 1 
ATOM   748  N N   . ASN A 1 98  ? -6.697  73.862 48.171 1.00 19.87 ? 98  ASN A N   1 
ATOM   749  C CA  . ASN A 1 98  ? -6.575  75.313 48.033 1.00 21.26 ? 98  ASN A CA  1 
ATOM   750  C C   . ASN A 1 98  ? -5.463  75.628 47.032 1.00 24.68 ? 98  ASN A C   1 
ATOM   751  O O   . ASN A 1 98  ? -4.407  74.984 47.052 1.00 28.14 ? 98  ASN A O   1 
ATOM   752  C CB  . ASN A 1 98  ? -6.232  75.962 49.385 1.00 20.66 ? 98  ASN A CB  1 
ATOM   753  C CG  . ASN A 1 98  ? -6.745  75.163 50.572 1.00 23.78 ? 98  ASN A CG  1 
ATOM   754  O OD1 . ASN A 1 98  ? -7.824  75.429 51.097 1.00 25.32 ? 98  ASN A OD1 1 
ATOM   755  N ND2 . ASN A 1 98  ? -5.966  74.182 51.006 1.00 25.59 ? 98  ASN A ND2 1 
ATOM   756  N N   . ILE A 1 99  ? -5.679  76.621 46.168 1.00 24.37 ? 99  ILE A N   1 
ATOM   757  C CA  . ILE A 1 99  ? -4.674  76.976 45.163 1.00 22.17 ? 99  ILE A CA  1 
ATOM   758  C C   . ILE A 1 99  ? -4.311  78.441 45.169 1.00 22.87 ? 99  ILE A C   1 
ATOM   759  O O   . ILE A 1 99  ? -5.170  79.295 45.010 1.00 27.22 ? 99  ILE A O   1 
ATOM   760  C CB  . ILE A 1 99  ? -5.143  76.645 43.725 1.00 19.86 ? 99  ILE A CB  1 
ATOM   761  C CG1 . ILE A 1 99  ? -5.624  75.189 43.642 1.00 18.71 ? 99  ILE A CG1 1 
ATOM   762  C CG2 . ILE A 1 99  ? -3.997  76.889 42.754 1.00 20.10 ? 99  ILE A CG2 1 
ATOM   763  C CD1 . ILE A 1 99  ? -6.714  74.931 42.619 1.00 14.44 ? 99  ILE A CD1 1 
ATOM   764  N N   . TRP A 1 100 ? -3.034  78.739 45.342 1.00 22.99 ? 100 TRP A N   1 
ATOM   765  C CA  . TRP A 1 100 ? -2.597  80.121 45.331 1.00 24.32 ? 100 TRP A CA  1 
ATOM   766  C C   . TRP A 1 100 ? -2.015  80.373 43.945 1.00 25.84 ? 100 TRP A C   1 
ATOM   767  O O   . TRP A 1 100 ? -1.013  79.771 43.564 1.00 27.43 ? 100 TRP A O   1 
ATOM   768  C CB  . TRP A 1 100 ? -1.546  80.367 46.423 1.00 24.09 ? 100 TRP A CB  1 
ATOM   769  C CG  . TRP A 1 100 ? -2.147  80.472 47.798 1.00 23.45 ? 100 TRP A CG  1 
ATOM   770  C CD1 . TRP A 1 100 ? -2.701  81.584 48.372 1.00 24.46 ? 100 TRP A CD1 1 
ATOM   771  C CD2 . TRP A 1 100 ? -2.293  79.416 48.754 1.00 23.41 ? 100 TRP A CD2 1 
ATOM   772  N NE1 . TRP A 1 100 ? -3.184  81.284 49.623 1.00 24.26 ? 100 TRP A NE1 1 
ATOM   773  C CE2 . TRP A 1 100 ? -2.947  79.959 49.882 1.00 24.38 ? 100 TRP A CE2 1 
ATOM   774  C CE3 . TRP A 1 100 ? -1.934  78.063 48.767 1.00 23.42 ? 100 TRP A CE3 1 
ATOM   775  C CZ2 . TRP A 1 100 ? -3.249  79.195 51.009 1.00 23.63 ? 100 TRP A CZ2 1 
ATOM   776  C CZ3 . TRP A 1 100 ? -2.234  77.303 49.891 1.00 24.27 ? 100 TRP A CZ3 1 
ATOM   777  C CH2 . TRP A 1 100 ? -2.886  77.872 50.995 1.00 25.32 ? 100 TRP A CH2 1 
ATOM   778  N N   . VAL A 1 101 ? -2.663  81.251 43.188 1.00 25.81 ? 101 VAL A N   1 
ATOM   779  C CA  . VAL A 1 101 ? -2.231  81.575 41.830 1.00 25.77 ? 101 VAL A CA  1 
ATOM   780  C C   . VAL A 1 101 ? -1.692  82.995 41.746 1.00 24.06 ? 101 VAL A C   1 
ATOM   781  O O   . VAL A 1 101 ? -2.288  83.921 42.298 1.00 25.48 ? 101 VAL A O   1 
ATOM   782  C CB  . VAL A 1 101 ? -3.414  81.472 40.822 1.00 27.90 ? 101 VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 101 ? -2.890  81.458 39.394 1.00 27.64 ? 101 VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 101 ? -4.253  80.232 41.112 1.00 27.40 ? 101 VAL A CG2 1 
ATOM   785  N N   . PRO A 1 102 ? -0.538  83.185 41.086 1.00 22.44 ? 102 PRO A N   1 
ATOM   786  C CA  . PRO A 1 102 ? 0.004   84.543 40.973 1.00 25.14 ? 102 PRO A CA  1 
ATOM   787  C C   . PRO A 1 102 ? -0.969  85.468 40.218 1.00 29.00 ? 102 PRO A C   1 
ATOM   788  O O   . PRO A 1 102 ? -1.994  85.022 39.676 1.00 31.28 ? 102 PRO A O   1 
ATOM   789  C CB  . PRO A 1 102 ? 1.316   84.346 40.216 1.00 20.21 ? 102 PRO A CB  1 
ATOM   790  C CG  . PRO A 1 102 ? 1.662   82.921 40.432 1.00 20.12 ? 102 PRO A CG  1 
ATOM   791  C CD  . PRO A 1 102 ? 0.356   82.196 40.469 1.00 21.68 ? 102 PRO A CD  1 
ATOM   792  N N   . SER A 1 103 ? -0.655  86.757 40.192 1.00 29.80 ? 103 SER A N   1 
ATOM   793  C CA  . SER A 1 103 ? -1.506  87.721 39.513 1.00 30.09 ? 103 SER A CA  1 
ATOM   794  C C   . SER A 1 103 ? -0.621  88.748 38.832 1.00 31.28 ? 103 SER A C   1 
ATOM   795  O O   . SER A 1 103 ? 0.272   89.323 39.460 1.00 31.18 ? 103 SER A O   1 
ATOM   796  C CB  . SER A 1 103 ? -2.435  88.408 40.519 1.00 30.26 ? 103 SER A CB  1 
ATOM   797  O OG  . SER A 1 103 ? -3.131  89.485 39.918 1.00 30.93 ? 103 SER A OG  1 
ATOM   798  N N   . PRO A 1 104 ? -0.842  88.982 37.529 1.00 32.32 ? 104 PRO A N   1 
ATOM   799  C CA  . PRO A 1 104 ? -1.866  88.336 36.700 1.00 31.63 ? 104 PRO A CA  1 
ATOM   800  C C   . PRO A 1 104 ? -1.646  86.832 36.545 1.00 32.27 ? 104 PRO A C   1 
ATOM   801  O O   . PRO A 1 104 ? -0.519  86.334 36.634 1.00 31.42 ? 104 PRO A O   1 
ATOM   802  C CB  . PRO A 1 104 ? -1.765  89.072 35.375 1.00 32.72 ? 104 PRO A CB  1 
ATOM   803  C CG  . PRO A 1 104 ? -0.334  89.550 35.336 1.00 32.52 ? 104 PRO A CG  1 
ATOM   804  C CD  . PRO A 1 104 ? -0.019  89.920 36.745 1.00 33.15 ? 104 PRO A CD  1 
ATOM   805  N N   . ARG A 1 105 ? -2.739  86.119 36.302 1.00 32.95 ? 105 ARG A N   1 
ATOM   806  C CA  . ARG A 1 105 ? -2.715  84.669 36.161 1.00 33.28 ? 105 ARG A CA  1 
ATOM   807  C C   . ARG A 1 105 ? -1.838  84.167 35.021 1.00 33.65 ? 105 ARG A C   1 
ATOM   808  O O   . ARG A 1 105 ? -1.976  84.607 33.878 1.00 35.13 ? 105 ARG A O   1 
ATOM   809  C CB  . ARG A 1 105 ? -4.139  84.152 35.972 1.00 32.45 ? 105 ARG A CB  1 
ATOM   810  C CG  . ARG A 1 105 ? -4.222  82.677 35.695 1.00 30.76 ? 105 ARG A CG  1 
ATOM   811  C CD  . ARG A 1 105 ? -5.546  82.343 35.051 1.00 30.62 ? 105 ARG A CD  1 
ATOM   812  N NE  . ARG A 1 105 ? -6.662  83.041 35.679 1.00 28.29 ? 105 ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 105 ? -7.937  82.806 35.385 1.00 30.03 ? 105 ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 105 ? -8.244  81.892 34.474 1.00 30.91 ? 105 ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 105 ? -8.906  83.483 35.989 1.00 30.30 ? 105 ARG A NH2 1 
ATOM   816  N N   . PRO A 1 106 ? -0.921  83.233 35.324 1.00 32.73 ? 106 PRO A N   1 
ATOM   817  C CA  . PRO A 1 106 ? -0.005  82.649 34.338 1.00 31.20 ? 106 PRO A CA  1 
ATOM   818  C C   . PRO A 1 106 ? -0.730  81.839 33.273 1.00 31.62 ? 106 PRO A C   1 
ATOM   819  O O   . PRO A 1 106 ? -1.956  81.670 33.319 1.00 29.78 ? 106 PRO A O   1 
ATOM   820  C CB  . PRO A 1 106 ? 0.923   81.766 35.171 1.00 29.94 ? 106 PRO A CB  1 
ATOM   821  C CG  . PRO A 1 106 ? 0.717   82.199 36.591 1.00 31.66 ? 106 PRO A CG  1 
ATOM   822  C CD  . PRO A 1 106 ? -0.694  82.683 36.669 1.00 32.77 ? 106 PRO A CD  1 
ATOM   823  N N   . LYS A 1 107 ? 0.044   81.340 32.315 1.00 33.31 ? 107 LYS A N   1 
ATOM   824  C CA  . LYS A 1 107 ? -0.490  80.540 31.216 1.00 34.31 ? 107 LYS A CA  1 
ATOM   825  C C   . LYS A 1 107 ? 0.008   79.102 31.338 1.00 32.92 ? 107 LYS A C   1 
ATOM   826  O O   . LYS A 1 107 ? -0.619  78.168 30.838 1.00 30.91 ? 107 LYS A O   1 
ATOM   827  C CB  . LYS A 1 107 ? -0.056  81.138 29.875 1.00 35.06 ? 107 LYS A CB  1 
ATOM   828  C CG  . LYS A 1 107 ? -0.400  82.619 29.722 1.00 35.44 ? 107 LYS A CG  1 
ATOM   829  C CD  . LYS A 1 107 ? -1.914  82.836 29.602 1.00 36.11 ? 107 LYS A CD  1 
ATOM   830  C CE  . LYS A 1 107 ? -2.277  84.326 29.530 1.00 35.67 ? 107 LYS A CE  1 
ATOM   831  N NZ  . LYS A 1 107 ? -3.615  84.627 30.139 1.00 36.81 ? 107 LYS A NZ  1 
ATOM   832  N N   . SER A 1 108 ? 1.138   78.938 32.018 1.00 31.87 ? 108 SER A N   1 
ATOM   833  C CA  . SER A 1 108 ? 1.723   77.626 32.229 1.00 31.56 ? 108 SER A CA  1 
ATOM   834  C C   . SER A 1 108 ? 2.999   77.736 33.032 1.00 31.50 ? 108 SER A C   1 
ATOM   835  O O   . SER A 1 108 ? 4.087   77.785 32.451 1.00 31.17 ? 108 SER A O   1 
ATOM   836  C CB  . SER A 1 108 ? 2.037   76.949 30.898 1.00 32.45 ? 108 SER A CB  1 
ATOM   837  O OG  . SER A 1 108 ? 1.687   75.574 30.938 1.00 39.08 ? 108 SER A OG  1 
ATOM   838  N N   . THR A 1 109 ? 2.861   77.776 34.361 1.00 31.06 ? 109 THR A N   1 
ATOM   839  C CA  . THR A 1 109 ? 4.008   77.862 35.270 1.00 29.21 ? 109 THR A CA  1 
ATOM   840  C C   . THR A 1 109 ? 4.117   76.653 36.181 1.00 29.17 ? 109 THR A C   1 
ATOM   841  O O   . THR A 1 109 ? 3.153   75.903 36.364 1.00 30.55 ? 109 THR A O   1 
ATOM   842  C CB  . THR A 1 109 ? 3.934   79.064 36.200 1.00 27.02 ? 109 THR A CB  1 
ATOM   843  O OG1 . THR A 1 109 ? 2.577   79.261 36.604 1.00 26.78 ? 109 THR A OG1 1 
ATOM   844  C CG2 . THR A 1 109 ? 4.474   80.301 35.519 1.00 29.82 ? 109 THR A CG2 1 
ATOM   845  N N   . THR A 1 110 ? 5.302   76.496 36.766 1.00 28.16 ? 110 THR A N   1 
ATOM   846  C CA  . THR A 1 110 ? 5.597   75.402 37.683 1.00 26.60 ? 110 THR A CA  1 
ATOM   847  C C   . THR A 1 110 ? 4.531   75.265 38.764 1.00 26.53 ? 110 THR A C   1 
ATOM   848  O O   . THR A 1 110 ? 4.126   76.256 39.373 1.00 25.95 ? 110 THR A O   1 
ATOM   849  C CB  . THR A 1 110 ? 6.934   75.640 38.372 1.00 26.74 ? 110 THR A CB  1 
ATOM   850  O OG1 . THR A 1 110 ? 7.919   75.984 37.390 1.00 28.03 ? 110 THR A OG1 1 
ATOM   851  C CG2 . THR A 1 110 ? 7.366   74.403 39.129 1.00 29.69 ? 110 THR A CG2 1 
ATOM   852  N N   . VAL A 1 111 ? 4.070   74.040 39.001 1.00 26.04 ? 111 VAL A N   1 
ATOM   853  C CA  . VAL A 1 111 ? 3.067   73.809 40.036 1.00 26.19 ? 111 VAL A CA  1 
ATOM   854  C C   . VAL A 1 111 ? 3.665   73.048 41.210 1.00 23.78 ? 111 VAL A C   1 
ATOM   855  O O   . VAL A 1 111 ? 4.513   72.176 41.032 1.00 21.41 ? 111 VAL A O   1 
ATOM   856  C CB  . VAL A 1 111 ? 1.853   73.005 39.516 1.00 25.71 ? 111 VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 111 ? 0.826   73.942 38.902 1.00 27.25 ? 111 VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 111 ? 2.303   71.994 38.505 1.00 29.06 ? 111 VAL A CG2 1 
ATOM   859  N N   . MET A 1 112 ? 3.226   73.400 42.413 1.00 23.41 ? 112 MET A N   1 
ATOM   860  C CA  . MET A 1 112 ? 3.696   72.738 43.620 1.00 23.51 ? 112 MET A CA  1 
ATOM   861  C C   . MET A 1 112 ? 2.485   72.285 44.428 1.00 24.72 ? 112 MET A C   1 
ATOM   862  O O   . MET A 1 112 ? 1.549   73.055 44.644 1.00 28.20 ? 112 MET A O   1 
ATOM   863  C CB  . MET A 1 112 ? 4.569   73.682 44.440 1.00 21.06 ? 112 MET A CB  1 
ATOM   864  C CG  . MET A 1 112 ? 6.026   73.690 44.006 1.00 17.76 ? 112 MET A CG  1 
ATOM   865  S SD  . MET A 1 112 ? 7.049   74.840 44.938 1.00 20.45 ? 112 MET A SD  1 
ATOM   866  C CE  . MET A 1 112 ? 8.494   73.815 45.238 1.00 19.17 ? 112 MET A CE  1 
ATOM   867  N N   . VAL A 1 113 ? 2.504   71.023 44.845 1.00 24.10 ? 113 VAL A N   1 
ATOM   868  C CA  . VAL A 1 113 ? 1.415   70.421 45.615 1.00 22.06 ? 113 VAL A CA  1 
ATOM   869  C C   . VAL A 1 113 ? 1.992   70.030 46.969 1.00 21.16 ? 113 VAL A C   1 
ATOM   870  O O   . VAL A 1 113 ? 2.965   69.287 47.032 1.00 19.85 ? 113 VAL A O   1 
ATOM   871  C CB  . VAL A 1 113 ? 0.872   69.171 44.880 1.00 20.13 ? 113 VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 113 ? -0.165  68.478 45.714 1.00 19.01 ? 113 VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 113 ? 0.287   69.584 43.538 1.00 16.16 ? 113 VAL A CG2 1 
ATOM   874  N N   . TRP A 1 114 ? 1.395   70.536 48.043 1.00 21.60 ? 114 TRP A N   1 
ATOM   875  C CA  . TRP A 1 114 ? 1.881   70.277 49.399 1.00 21.61 ? 114 TRP A CA  1 
ATOM   876  C C   . TRP A 1 114 ? 1.036   69.252 50.155 1.00 22.26 ? 114 TRP A C   1 
ATOM   877  O O   . TRP A 1 114 ? -0.191  69.347 50.163 1.00 23.70 ? 114 TRP A O   1 
ATOM   878  C CB  . TRP A 1 114 ? 1.943   71.611 50.177 1.00 19.33 ? 114 TRP A CB  1 
ATOM   879  C CG  . TRP A 1 114 ? 2.164   71.498 51.668 1.00 20.97 ? 114 TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 114 ? 1.208   71.568 52.653 1.00 23.11 ? 114 TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 114 ? 3.410   71.277 52.343 1.00 22.03 ? 114 TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 114 ? 1.783   71.402 53.892 1.00 20.79 ? 114 TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 114 ? 3.132   71.221 53.732 1.00 22.01 ? 114 TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 114 ? 4.734   71.121 51.912 1.00 21.03 ? 114 TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 114 ? 4.132   71.014 54.687 1.00 19.61 ? 114 TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 114 ? 5.731   70.917 52.867 1.00 18.54 ? 114 TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 114 ? 5.423   70.865 54.236 1.00 18.14 ? 114 TRP A CH2 1 
ATOM   888  N N   . ILE A 1 115 ? 1.705   68.268 50.770 1.00 24.01 ? 115 ILE A N   1 
ATOM   889  C CA  . ILE A 1 115 ? 1.047   67.217 51.568 1.00 24.72 ? 115 ILE A CA  1 
ATOM   890  C C   . ILE A 1 115 ? 1.525   67.290 53.026 1.00 24.97 ? 115 ILE A C   1 
ATOM   891  O O   . ILE A 1 115 ? 2.626   66.850 53.357 1.00 26.84 ? 115 ILE A O   1 
ATOM   892  C CB  . ILE A 1 115 ? 1.345   65.794 51.041 1.00 23.57 ? 115 ILE A CB  1 
ATOM   893  C CG1 . ILE A 1 115 ? 1.444   65.797 49.511 1.00 23.87 ? 115 ILE A CG1 1 
ATOM   894  C CG2 . ILE A 1 115 ? 0.246   64.859 51.499 1.00 26.36 ? 115 ILE A CG2 1 
ATOM   895  C CD1 . ILE A 1 115 ? 1.363   64.423 48.851 1.00 21.04 ? 115 ILE A CD1 1 
ATOM   896  N N   . TYR A 1 116 ? 0.678   67.851 53.884 1.00 24.28 ? 116 TYR A N   1 
ATOM   897  C CA  . TYR A 1 116 ? 0.977   68.037 55.291 1.00 23.30 ? 116 TYR A CA  1 
ATOM   898  C C   . TYR A 1 116 ? 1.226   66.757 56.076 1.00 25.76 ? 116 TYR A C   1 
ATOM   899  O O   . TYR A 1 116 ? 0.792   65.675 55.678 1.00 26.54 ? 116 TYR A O   1 
ATOM   900  C CB  . TYR A 1 116 ? -0.157  68.826 55.953 1.00 23.53 ? 116 TYR A CB  1 
ATOM   901  C CG  . TYR A 1 116 ? -1.509  68.132 55.962 1.00 23.00 ? 116 TYR A CG  1 
ATOM   902  C CD1 . TYR A 1 116 ? -1.698  66.924 56.629 1.00 23.96 ? 116 TYR A CD1 1 
ATOM   903  C CD2 . TYR A 1 116 ? -2.604  68.699 55.328 1.00 22.75 ? 116 TYR A CD2 1 
ATOM   904  C CE1 . TYR A 1 116 ? -2.943  66.300 56.664 1.00 21.55 ? 116 TYR A CE1 1 
ATOM   905  C CE2 . TYR A 1 116 ? -3.852  68.081 55.361 1.00 23.40 ? 116 TYR A CE2 1 
ATOM   906  C CZ  . TYR A 1 116 ? -4.013  66.884 56.031 1.00 21.34 ? 116 TYR A CZ  1 
ATOM   907  O OH  . TYR A 1 116 ? -5.251  66.280 56.064 1.00 22.90 ? 116 TYR A OH  1 
ATOM   908  N N   . GLY A 1 117 ? 1.924   66.901 57.203 1.00 25.74 ? 117 GLY A N   1 
ATOM   909  C CA  . GLY A 1 117 ? 2.219   65.770 58.064 1.00 24.84 ? 117 GLY A CA  1 
ATOM   910  C C   . GLY A 1 117 ? 1.222   65.669 59.209 1.00 24.00 ? 117 GLY A C   1 
ATOM   911  O O   . GLY A 1 117 ? 0.226   66.396 59.234 1.00 22.37 ? 117 GLY A O   1 
ATOM   912  N N   . GLY A 1 118 ? 1.487   64.766 60.151 1.00 22.22 ? 118 GLY A N   1 
ATOM   913  C CA  . GLY A 1 118 ? 0.601   64.586 61.286 1.00 19.96 ? 118 GLY A CA  1 
ATOM   914  C C   . GLY A 1 118 ? 0.653   63.188 61.872 1.00 20.81 ? 118 GLY A C   1 
ATOM   915  O O   . GLY A 1 118 ? -0.200  62.814 62.674 1.00 18.93 ? 118 GLY A O   1 
ATOM   916  N N   . GLY A 1 119 ? 1.664   62.417 61.485 1.00 21.72 ? 119 GLY A N   1 
ATOM   917  C CA  . GLY A 1 119 ? 1.784   61.054 61.971 1.00 23.90 ? 119 GLY A CA  1 
ATOM   918  C C   . GLY A 1 119 ? 0.639   60.225 61.418 1.00 25.73 ? 119 GLY A C   1 
ATOM   919  O O   . GLY A 1 119 ? 0.323   59.148 61.934 1.00 26.90 ? 119 GLY A O   1 
ATOM   920  N N   . PHE A 1 120 ? 0.022   60.744 60.357 1.00 26.59 ? 120 PHE A N   1 
ATOM   921  C CA  . PHE A 1 120 ? -1.117  60.113 59.692 1.00 24.93 ? 120 PHE A CA  1 
ATOM   922  C C   . PHE A 1 120 ? -2.339  60.113 60.596 1.00 24.28 ? 120 PHE A C   1 
ATOM   923  O O   . PHE A 1 120 ? -3.406  59.651 60.191 1.00 23.23 ? 120 PHE A O   1 
ATOM   924  C CB  . PHE A 1 120 ? -0.791  58.678 59.267 1.00 24.53 ? 120 PHE A CB  1 
ATOM   925  C CG  . PHE A 1 120 ? 0.152   58.593 58.105 1.00 23.74 ? 120 PHE A CG  1 
ATOM   926  C CD1 . PHE A 1 120 ? -0.220  59.066 56.857 1.00 24.26 ? 120 PHE A CD1 1 
ATOM   927  C CD2 . PHE A 1 120 ? 1.426   58.062 58.266 1.00 23.20 ? 120 PHE A CD2 1 
ATOM   928  C CE1 . PHE A 1 120 ? 0.671   59.015 55.777 1.00 25.79 ? 120 PHE A CE1 1 
ATOM   929  C CE2 . PHE A 1 120 ? 2.315   58.009 57.204 1.00 25.21 ? 120 PHE A CE2 1 
ATOM   930  C CZ  . PHE A 1 120 ? 1.936   58.488 55.954 1.00 24.49 ? 120 PHE A CZ  1 
ATOM   931  N N   . TYR A 1 121 ? -2.174  60.631 61.816 1.00 24.29 ? 121 TYR A N   1 
ATOM   932  C CA  . TYR A 1 121 ? -3.273  60.724 62.787 1.00 22.29 ? 121 TYR A CA  1 
ATOM   933  C C   . TYR A 1 121 ? -3.780  62.156 62.923 1.00 20.35 ? 121 TYR A C   1 
ATOM   934  O O   . TYR A 1 121 ? -4.823  62.388 63.524 1.00 18.20 ? 121 TYR A O   1 
ATOM   935  C CB  . TYR A 1 121 ? -2.836  60.227 64.164 1.00 20.59 ? 121 TYR A CB  1 
ATOM   936  C CG  . TYR A 1 121 ? -2.003  61.208 64.961 1.00 20.24 ? 121 TYR A CG  1 
ATOM   937  C CD1 . TYR A 1 121 ? -2.602  62.181 65.765 1.00 20.14 ? 121 TYR A CD1 1 
ATOM   938  C CD2 . TYR A 1 121 ? -0.606  61.130 64.945 1.00 23.74 ? 121 TYR A CD2 1 
ATOM   939  C CE1 . TYR A 1 121 ? -1.826  63.056 66.545 1.00 22.92 ? 121 TYR A CE1 1 
ATOM   940  C CE2 . TYR A 1 121 ? 0.182   61.990 65.713 1.00 24.05 ? 121 TYR A CE2 1 
ATOM   941  C CZ  . TYR A 1 121 ? -0.429  62.950 66.515 1.00 26.39 ? 121 TYR A CZ  1 
ATOM   942  O OH  . TYR A 1 121 ? 0.364   63.772 67.295 1.00 25.61 ? 121 TYR A OH  1 
ATOM   943  N N   . SER A 1 122 ? -3.033  63.102 62.359 1.00 20.67 ? 122 SER A N   1 
ATOM   944  C CA  . SER A 1 122 ? -3.377  64.514 62.418 1.00 21.99 ? 122 SER A CA  1 
ATOM   945  C C   . SER A 1 122 ? -2.870  65.263 61.187 1.00 24.04 ? 122 SER A C   1 
ATOM   946  O O   . SER A 1 122 ? -2.189  64.685 60.340 1.00 26.03 ? 122 SER A O   1 
ATOM   947  C CB  . SER A 1 122 ? -2.774  65.144 63.685 1.00 24.60 ? 122 SER A CB  1 
ATOM   948  O OG  . SER A 1 122 ? -1.356  65.269 63.607 1.00 21.09 ? 122 SER A OG  1 
ATOM   949  N N   . GLY A 1 123 ? -3.205  66.552 61.104 1.00 24.49 ? 123 GLY A N   1 
ATOM   950  C CA  . GLY A 1 123 ? -2.778  67.382 59.990 1.00 23.81 ? 123 GLY A CA  1 
ATOM   951  C C   . GLY A 1 123 ? -3.849  68.346 59.502 1.00 24.50 ? 123 GLY A C   1 
ATOM   952  O O   . GLY A 1 123 ? -5.036  68.149 59.756 1.00 25.96 ? 123 GLY A O   1 
ATOM   953  N N   . SER A 1 124 ? -3.435  69.395 58.797 1.00 22.51 ? 124 SER A N   1 
ATOM   954  C CA  . SER A 1 124 ? -4.367  70.380 58.265 1.00 19.92 ? 124 SER A CA  1 
ATOM   955  C C   . SER A 1 124 ? -3.703  71.148 57.134 1.00 21.46 ? 124 SER A C   1 
ATOM   956  O O   . SER A 1 124 ? -2.507  71.410 57.164 1.00 20.91 ? 124 SER A O   1 
ATOM   957  C CB  . SER A 1 124 ? -4.799  71.333 59.365 1.00 19.69 ? 124 SER A CB  1 
ATOM   958  O OG  . SER A 1 124 ? -5.219  70.608 60.507 1.00 23.87 ? 124 SER A OG  1 
ATOM   959  N N   . SER A 1 125 ? -4.481  71.495 56.121 1.00 23.04 ? 125 SER A N   1 
ATOM   960  C CA  . SER A 1 125 ? -3.949  72.214 54.970 1.00 24.11 ? 125 SER A CA  1 
ATOM   961  C C   . SER A 1 125 ? -4.093  73.695 55.207 1.00 24.24 ? 125 SER A C   1 
ATOM   962  O O   . SER A 1 125 ? -3.475  74.523 54.528 1.00 24.52 ? 125 SER A O   1 
ATOM   963  C CB  . SER A 1 125 ? -4.748  71.847 53.725 1.00 26.36 ? 125 SER A CB  1 
ATOM   964  O OG  . SER A 1 125 ? -6.106  72.247 53.875 1.00 30.59 ? 125 SER A OG  1 
ATOM   965  N N   . THR A 1 126 ? -4.935  74.002 56.184 1.00 24.06 ? 126 THR A N   1 
ATOM   966  C CA  . THR A 1 126 ? -5.266  75.358 56.553 1.00 24.06 ? 126 THR A CA  1 
ATOM   967  C C   . THR A 1 126 ? -4.438  75.909 57.694 1.00 26.54 ? 126 THR A C   1 
ATOM   968  O O   . THR A 1 126 ? -4.882  76.815 58.389 1.00 30.34 ? 126 THR A O   1 
ATOM   969  C CB  . THR A 1 126 ? -6.733  75.434 56.958 1.00 25.46 ? 126 THR A CB  1 
ATOM   970  O OG1 . THR A 1 126 ? -6.925  74.691 58.171 1.00 22.77 ? 126 THR A OG1 1 
ATOM   971  C CG2 . THR A 1 126 ? -7.619  74.853 55.856 1.00 22.66 ? 126 THR A CG2 1 
ATOM   972  N N   . LEU A 1 127 ? -3.239  75.379 57.902 1.00 28.29 ? 127 LEU A N   1 
ATOM   973  C CA  . LEU A 1 127 ? -2.402  75.870 58.994 1.00 27.49 ? 127 LEU A CA  1 
ATOM   974  C C   . LEU A 1 127 ? -1.699  77.147 58.590 1.00 29.29 ? 127 LEU A C   1 
ATOM   975  O O   . LEU A 1 127 ? -1.258  77.287 57.454 1.00 33.07 ? 127 LEU A O   1 
ATOM   976  C CB  . LEU A 1 127 ? -1.354  74.831 59.395 1.00 24.85 ? 127 LEU A CB  1 
ATOM   977  C CG  . LEU A 1 127 ? -1.797  73.510 60.019 1.00 19.15 ? 127 LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 127 ? -0.628  72.916 60.759 1.00 21.23 ? 127 LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 127 ? -2.965  73.718 60.949 1.00 20.64 ? 127 LEU A CD2 1 
ATOM   980  N N   . ASP A 1 128 ? -1.593  78.079 59.527 1.00 30.86 ? 128 ASP A N   1 
ATOM   981  C CA  . ASP A 1 128 ? -0.935  79.350 59.263 1.00 31.43 ? 128 ASP A CA  1 
ATOM   982  C C   . ASP A 1 128 ? 0.436   79.181 58.604 1.00 30.07 ? 128 ASP A C   1 
ATOM   983  O O   . ASP A 1 128 ? 0.793   79.943 57.703 1.00 29.07 ? 128 ASP A O   1 
ATOM   984  C CB  . ASP A 1 128 ? -0.791  80.128 60.570 1.00 35.44 ? 128 ASP A CB  1 
ATOM   985  C CG  . ASP A 1 128 ? -2.063  80.848 60.957 1.00 38.23 ? 128 ASP A CG  1 
ATOM   986  O OD1 . ASP A 1 128 ? -2.610  81.563 60.091 1.00 41.90 ? 128 ASP A OD1 1 
ATOM   987  O OD2 . ASP A 1 128 ? -2.517  80.700 62.116 1.00 40.75 ? 128 ASP A OD2 1 
ATOM   988  N N   . VAL A 1 129 ? 1.197   78.185 59.056 1.00 29.65 ? 129 VAL A N   1 
ATOM   989  C CA  . VAL A 1 129 ? 2.529   77.930 58.513 1.00 28.15 ? 129 VAL A CA  1 
ATOM   990  C C   . VAL A 1 129 ? 2.437   77.382 57.103 1.00 29.38 ? 129 VAL A C   1 
ATOM   991  O O   . VAL A 1 129 ? 3.372   77.521 56.313 1.00 30.82 ? 129 VAL A O   1 
ATOM   992  C CB  . VAL A 1 129 ? 3.321   76.912 59.354 1.00 25.82 ? 129 VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 129 ? 4.538   77.586 59.964 1.00 22.54 ? 129 VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 129 ? 2.425   76.299 60.416 1.00 24.90 ? 129 VAL A CG2 1 
ATOM   995  N N   . TYR A 1 130 ? 1.315   76.745 56.792 1.00 27.96 ? 130 TYR A N   1 
ATOM   996  C CA  . TYR A 1 130 ? 1.122   76.191 55.463 1.00 28.09 ? 130 TYR A CA  1 
ATOM   997  C C   . TYR A 1 130 ? 0.500   77.213 54.519 1.00 30.69 ? 130 TYR A C   1 
ATOM   998  O O   . TYR A 1 130 ? 0.159   76.875 53.389 1.00 31.71 ? 130 TYR A O   1 
ATOM   999  C CB  . TYR A 1 130 ? 0.223   74.963 55.512 1.00 24.44 ? 130 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 130 ? 0.721   73.834 56.386 1.00 22.49 ? 130 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 130 ? 2.081   73.669 56.676 1.00 18.70 ? 130 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 130 ? -0.178  72.911 56.907 1.00 21.18 ? 130 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 130 ? 2.514   72.602 57.464 1.00 17.17 ? 130 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 130 ? 0.244   71.855 57.686 1.00 17.42 ? 130 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 130 ? 1.576   71.702 57.960 1.00 16.83 ? 130 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 130 ? 1.933   70.622 58.719 1.00 17.25 ? 130 TYR A OH  1 
ATOM   1007 N N   . ASN A 1 131 ? 0.323   78.450 54.986 1.00 32.31 ? 131 ASN A N   1 
ATOM   1008 C CA  . ASN A 1 131 ? -0.243  79.490 54.134 1.00 34.07 ? 131 ASN A CA  1 
ATOM   1009 C C   . ASN A 1 131 ? 0.853   79.925 53.181 1.00 35.72 ? 131 ASN A C   1 
ATOM   1010 O O   . ASN A 1 131 ? 1.632   80.830 53.484 1.00 38.61 ? 131 ASN A O   1 
ATOM   1011 C CB  . ASN A 1 131 ? -0.705  80.699 54.948 1.00 34.23 ? 131 ASN A CB  1 
ATOM   1012 C CG  . ASN A 1 131 ? -1.266  81.815 54.067 1.00 35.21 ? 131 ASN A CG  1 
ATOM   1013 O OD1 . ASN A 1 131 ? -1.659  82.867 54.558 1.00 37.08 ? 131 ASN A OD1 1 
ATOM   1014 N ND2 . ASN A 1 131 ? -1.307  81.581 52.758 1.00 37.48 ? 131 ASN A ND2 1 
ATOM   1015 N N   . GLY A 1 132 ? 0.911   79.282 52.023 1.00 35.78 ? 132 GLY A N   1 
ATOM   1016 C CA  . GLY A 1 132 ? 1.942   79.615 51.062 1.00 34.83 ? 132 GLY A CA  1 
ATOM   1017 C C   . GLY A 1 132 ? 1.519   80.598 49.995 1.00 34.22 ? 132 GLY A C   1 
ATOM   1018 O O   . GLY A 1 132 ? 1.558   80.281 48.804 1.00 32.46 ? 132 GLY A O   1 
ATOM   1019 N N   . LYS A 1 133 ? 1.091   81.785 50.411 1.00 33.24 ? 133 LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.714   82.805 49.448 1.00 32.03 ? 133 LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 2.021   83.530 49.175 1.00 34.27 ? 133 LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 2.119   84.341 48.252 1.00 36.14 ? 133 LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? -0.332  83.759 50.030 1.00 27.73 ? 133 LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 0.230   84.875 50.879 1.00 28.36 ? 133 LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? -0.509  84.992 52.204 1.00 27.17 ? 133 LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? -0.504  86.426 52.713 1.00 28.68 ? 133 LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? -1.888  86.933 52.999 1.00 30.12 ? 133 LYS A NZ  1 
ATOM   1028 N N   . TYR A 1 134 ? 3.026   83.203 49.991 1.00 35.21 ? 134 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 134 ? 4.364   83.780 49.893 1.00 34.96 ? 134 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 134 ? 5.207   83.007 48.893 1.00 34.83 ? 134 TYR A C   1 
ATOM   1031 O O   . TYR A 1 134 ? 6.012   83.592 48.163 1.00 36.29 ? 134 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 134 ? 5.056   83.752 51.253 1.00 36.49 ? 134 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 134 ? 4.179   84.241 52.372 1.00 39.33 ? 134 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 134 ? 3.890   85.597 52.506 1.00 40.71 ? 134 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 134 ? 3.616   83.348 53.281 1.00 39.59 ? 134 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 134 ? 3.063   86.055 53.514 1.00 42.94 ? 134 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 134 ? 2.786   83.792 54.296 1.00 41.08 ? 134 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 134 ? 2.513   85.149 54.408 1.00 44.05 ? 134 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 134 ? 1.703   85.605 55.424 1.00 48.57 ? 134 TYR A OH  1 
ATOM   1040 N N   . LEU A 1 135 ? 5.034   81.690 48.867 1.00 31.49 ? 135 LEU A N   1 
ATOM   1041 C CA  . LEU A 1 135 ? 5.781   80.870 47.929 1.00 30.60 ? 135 LEU A CA  1 
ATOM   1042 C C   . LEU A 1 135 ? 5.294   81.192 46.517 1.00 31.99 ? 135 LEU A C   1 
ATOM   1043 O O   . LEU A 1 135 ? 6.080   81.586 45.652 1.00 34.45 ? 135 LEU A O   1 
ATOM   1044 C CB  . LEU A 1 135 ? 5.584   79.384 48.235 1.00 26.00 ? 135 LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 135 ? 6.660   78.428 47.714 1.00 23.98 ? 135 LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 135 ? 7.998   79.142 47.506 1.00 21.83 ? 135 LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 135 ? 6.811   77.303 48.697 1.00 23.11 ? 135 LEU A CD2 1 
ATOM   1048 N N   . ALA A 1 136 ? 3.993   81.036 46.291 1.00 31.71 ? 136 ALA A N   1 
ATOM   1049 C CA  . ALA A 1 136 ? 3.409   81.323 44.990 1.00 31.36 ? 136 ALA A CA  1 
ATOM   1050 C C   . ALA A 1 136 ? 3.852   82.721 44.592 1.00 33.94 ? 136 ALA A C   1 
ATOM   1051 O O   . ALA A 1 136 ? 4.324   82.948 43.477 1.00 35.06 ? 136 ALA A O   1 
ATOM   1052 C CB  . ALA A 1 136 ? 1.899   81.259 45.077 1.00 28.19 ? 136 ALA A CB  1 
ATOM   1053 N N   . TYR A 1 137 ? 3.708   83.651 45.534 1.00 35.73 ? 137 TYR A N   1 
ATOM   1054 C CA  . TYR A 1 137 ? 4.075   85.048 45.332 1.00 34.22 ? 137 TYR A CA  1 
ATOM   1055 C C   . TYR A 1 137 ? 5.542   85.222 44.991 1.00 32.62 ? 137 TYR A C   1 
ATOM   1056 O O   . TYR A 1 137 ? 5.898   85.462 43.843 1.00 34.28 ? 137 TYR A O   1 
ATOM   1057 C CB  . TYR A 1 137 ? 3.780   85.863 46.587 1.00 34.95 ? 137 TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 137 ? 4.195   87.301 46.446 1.00 38.05 ? 137 TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 137 ? 3.409   88.191 45.724 1.00 39.86 ? 137 TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 137 ? 5.391   87.772 47.004 1.00 39.05 ? 137 TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 137 ? 3.791   89.518 45.551 1.00 41.07 ? 137 TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 137 ? 5.786   89.101 46.838 1.00 38.91 ? 137 TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 137 ? 4.972   89.969 46.105 1.00 40.57 ? 137 TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 137 ? 5.313   91.289 45.918 1.00 41.12 ? 137 TYR A OH  1 
ATOM   1065 N N   . THR A 1 138 ? 6.385   85.111 46.010 1.00 30.81 ? 138 THR A N   1 
ATOM   1066 C CA  . THR A 1 138 ? 7.821   85.271 45.848 1.00 29.13 ? 138 THR A CA  1 
ATOM   1067 C C   . THR A 1 138 ? 8.387   84.461 44.699 1.00 28.90 ? 138 THR A C   1 
ATOM   1068 O O   . THR A 1 138 ? 8.925   85.022 43.747 1.00 29.58 ? 138 THR A O   1 
ATOM   1069 C CB  . THR A 1 138 ? 8.571   84.883 47.136 1.00 27.86 ? 138 THR A CB  1 
ATOM   1070 O OG1 . THR A 1 138 ? 8.084   85.678 48.219 1.00 29.77 ? 138 THR A OG1 1 
ATOM   1071 C CG2 . THR A 1 138 ? 10.059  85.120 46.985 1.00 24.19 ? 138 THR A CG2 1 
ATOM   1072 N N   . GLU A 1 139 ? 8.255   83.144 44.779 1.00 29.44 ? 139 GLU A N   1 
ATOM   1073 C CA  . GLU A 1 139 ? 8.796   82.270 43.744 1.00 31.49 ? 139 GLU A CA  1 
ATOM   1074 C C   . GLU A 1 139 ? 8.015   82.237 42.428 1.00 32.71 ? 139 GLU A C   1 
ATOM   1075 O O   . GLU A 1 139 ? 8.506   81.714 41.432 1.00 32.88 ? 139 GLU A O   1 
ATOM   1076 C CB  . GLU A 1 139 ? 8.967   80.850 44.302 1.00 30.62 ? 139 GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 139 ? 10.266  80.660 45.079 1.00 27.88 ? 139 GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 139 ? 11.446  81.394 44.442 1.00 28.84 ? 139 GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 139 ? 11.929  80.948 43.375 1.00 29.28 ? 139 GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 139 ? 11.895  82.415 45.007 1.00 25.87 ? 139 GLU A OE2 1 
ATOM   1081 N N   . GLU A 1 140 ? 6.804   82.784 42.423 1.00 33.42 ? 140 GLU A N   1 
ATOM   1082 C CA  . GLU A 1 140 ? 6.007   82.831 41.201 1.00 34.78 ? 140 GLU A CA  1 
ATOM   1083 C C   . GLU A 1 140 ? 5.456   81.489 40.740 1.00 32.94 ? 140 GLU A C   1 
ATOM   1084 O O   . GLU A 1 140 ? 5.293   81.260 39.543 1.00 31.11 ? 140 GLU A O   1 
ATOM   1085 C CB  . GLU A 1 140 ? 6.835   83.443 40.069 1.00 39.70 ? 140 GLU A CB  1 
ATOM   1086 C CG  . GLU A 1 140 ? 6.039   84.315 39.111 1.00 48.38 ? 140 GLU A CG  1 
ATOM   1087 C CD  . GLU A 1 140 ? 6.320   85.803 39.301 1.00 53.31 ? 140 GLU A CD  1 
ATOM   1088 O OE1 . GLU A 1 140 ? 7.511   86.201 39.226 1.00 54.24 ? 140 GLU A OE1 1 
ATOM   1089 O OE2 . GLU A 1 140 ? 5.347   86.569 39.525 1.00 54.43 ? 140 GLU A OE2 1 
ATOM   1090 N N   . VAL A 1 141 ? 5.173   80.599 41.684 1.00 32.44 ? 141 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 141 ? 4.621   79.291 41.348 1.00 28.94 ? 141 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 141 ? 3.145   79.270 41.703 1.00 27.95 ? 141 VAL A C   1 
ATOM   1093 O O   . VAL A 1 141 ? 2.634   80.205 42.312 1.00 27.62 ? 141 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 141 ? 5.305   78.160 42.145 1.00 27.66 ? 141 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 141 ? 6.821   78.272 42.032 1.00 27.26 ? 141 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 141 ? 4.875   78.221 43.601 1.00 25.63 ? 141 VAL A CG2 1 
ATOM   1097 N N   . VAL A 1 142 ? 2.464   78.203 41.309 1.00 28.33 ? 142 VAL A N   1 
ATOM   1098 C CA  . VAL A 1 142 ? 1.051   78.023 41.638 1.00 26.44 ? 142 VAL A CA  1 
ATOM   1099 C C   . VAL A 1 142 ? 1.056   76.974 42.749 1.00 25.60 ? 142 VAL A C   1 
ATOM   1100 O O   . VAL A 1 142 ? 1.219   75.787 42.472 1.00 27.27 ? 142 VAL A O   1 
ATOM   1101 C CB  . VAL A 1 142 ? 0.261   77.468 40.439 1.00 24.92 ? 142 VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 142 ? -1.172  77.189 40.842 1.00 25.88 ? 142 VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 142 ? 0.310   78.451 39.297 1.00 25.32 ? 142 VAL A CG2 1 
ATOM   1104 N N   . LEU A 1 143 ? 0.904   77.402 44.002 1.00 24.46 ? 143 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 143 ? 0.922   76.462 45.125 1.00 23.12 ? 143 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 143 ? -0.432  75.803 45.430 1.00 22.55 ? 143 LEU A C   1 
ATOM   1107 O O   . LEU A 1 143 ? -1.448  76.485 45.595 1.00 23.01 ? 143 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 143 ? 1.470   77.154 46.378 1.00 22.66 ? 143 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 143 ? 1.952   76.199 47.479 1.00 27.23 ? 143 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 143 ? 3.449   76.373 47.705 1.00 27.31 ? 143 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 143 ? 1.175   76.458 48.766 1.00 26.01 ? 143 LEU A CD2 1 
ATOM   1112 N N   . VAL A 1 144 ? -0.426  74.470 45.495 1.00 20.95 ? 144 VAL A N   1 
ATOM   1113 C CA  . VAL A 1 144 ? -1.622  73.665 45.764 1.00 19.97 ? 144 VAL A CA  1 
ATOM   1114 C C   . VAL A 1 144 ? -1.467  72.937 47.100 1.00 20.51 ? 144 VAL A C   1 
ATOM   1115 O O   . VAL A 1 144 ? -0.437  72.312 47.352 1.00 19.76 ? 144 VAL A O   1 
ATOM   1116 C CB  . VAL A 1 144 ? -1.837  72.588 44.651 1.00 19.49 ? 144 VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 144 ? -3.126  71.807 44.894 1.00 14.10 ? 144 VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 144 ? -1.871  73.246 43.291 1.00 21.47 ? 144 VAL A CG2 1 
ATOM   1119 N N   . SER A 1 145 ? -2.498  73.003 47.940 1.00 20.15 ? 145 SER A N   1 
ATOM   1120 C CA  . SER A 1 145 ? -2.482  72.357 49.253 1.00 21.63 ? 145 SER A CA  1 
ATOM   1121 C C   . SER A 1 145 ? -3.498  71.225 49.302 1.00 22.96 ? 145 SER A C   1 
ATOM   1122 O O   . SER A 1 145 ? -4.659  71.457 49.642 1.00 24.56 ? 145 SER A O   1 
ATOM   1123 C CB  . SER A 1 145 ? -2.851  73.366 50.355 1.00 24.14 ? 145 SER A CB  1 
ATOM   1124 O OG  . SER A 1 145 ? -1.745  74.139 50.801 1.00 29.16 ? 145 SER A OG  1 
ATOM   1125 N N   . LEU A 1 146 ? -3.097  70.001 48.976 1.00 22.45 ? 146 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 146 ? -4.071  68.914 49.042 1.00 21.38 ? 146 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 146 ? -4.346  68.557 50.502 1.00 21.85 ? 146 LEU A C   1 
ATOM   1128 O O   . LEU A 1 146 ? -3.602  68.949 51.400 1.00 24.43 ? 146 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 146 ? -3.581  67.679 48.263 1.00 17.65 ? 146 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 146 ? -2.407  66.855 48.774 1.00 14.61 ? 146 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 146 ? -2.917  65.789 49.694 1.00 15.73 ? 146 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 146 ? -1.673  66.223 47.618 1.00 11.64 ? 146 LEU A CD2 1 
ATOM   1133 N N   . SER A 1 147 ? -5.425  67.828 50.741 1.00 21.11 ? 147 SER A N   1 
ATOM   1134 C CA  . SER A 1 147 ? -5.776  67.416 52.088 1.00 19.84 ? 147 SER A CA  1 
ATOM   1135 C C   . SER A 1 147 ? -6.313  65.991 52.020 1.00 21.91 ? 147 SER A C   1 
ATOM   1136 O O   . SER A 1 147 ? -6.920  65.600 51.023 1.00 21.01 ? 147 SER A O   1 
ATOM   1137 C CB  . SER A 1 147 ? -6.843  68.331 52.645 1.00 18.17 ? 147 SER A CB  1 
ATOM   1138 O OG  . SER A 1 147 ? -8.109  67.712 52.519 1.00 21.24 ? 147 SER A OG  1 
ATOM   1139 N N   . TYR A 1 148 ? -6.104  65.212 53.075 1.00 22.42 ? 148 TYR A N   1 
ATOM   1140 C CA  . TYR A 1 148 ? -6.573  63.834 53.072 1.00 22.56 ? 148 TYR A CA  1 
ATOM   1141 C C   . TYR A 1 148 ? -7.119  63.395 54.418 1.00 23.66 ? 148 TYR A C   1 
ATOM   1142 O O   . TYR A 1 148 ? -7.145  64.171 55.371 1.00 25.10 ? 148 TYR A O   1 
ATOM   1143 C CB  . TYR A 1 148 ? -5.442  62.898 52.647 1.00 22.46 ? 148 TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 148 ? -4.188  62.999 53.487 1.00 19.94 ? 148 TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 148 ? -3.283  64.045 53.311 1.00 18.58 ? 148 TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 148 ? -3.899  62.038 54.448 1.00 19.90 ? 148 TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 148 ? -2.125  64.127 54.071 1.00 17.35 ? 148 TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 148 ? -2.742  62.111 55.216 1.00 18.47 ? 148 TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 148 ? -1.862  63.154 55.025 1.00 18.22 ? 148 TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 148 ? -0.723  63.213 55.798 1.00 17.46 ? 148 TYR A OH  1 
ATOM   1151 N N   . ARG A 1 149 ? -7.560  62.145 54.488 1.00 22.83 ? 149 ARG A N   1 
ATOM   1152 C CA  . ARG A 1 149 ? -8.106  61.609 55.720 1.00 24.17 ? 149 ARG A CA  1 
ATOM   1153 C C   . ARG A 1 149 ? -7.016  60.960 56.570 1.00 26.20 ? 149 ARG A C   1 
ATOM   1154 O O   . ARG A 1 149 ? -6.288  60.069 56.116 1.00 29.79 ? 149 ARG A O   1 
ATOM   1155 C CB  . ARG A 1 149 ? -9.211  60.591 55.415 1.00 22.01 ? 149 ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 149 ? -10.471 61.202 54.821 1.00 20.41 ? 149 ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 149 ? -11.537 60.156 54.532 1.00 20.84 ? 149 ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 149 ? -11.289 59.443 53.277 1.00 23.72 ? 149 ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 149 ? -11.875 58.297 52.933 1.00 23.50 ? 149 ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 149 ? -12.751 57.728 53.749 1.00 22.33 ? 149 ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 149 ? -11.577 57.714 51.777 1.00 20.59 ? 149 ARG A NH2 1 
ATOM   1162 N N   . VAL A 1 150 ? -6.906  61.436 57.805 1.00 25.42 ? 150 VAL A N   1 
ATOM   1163 C CA  . VAL A 1 150 ? -5.939  60.933 58.769 1.00 22.44 ? 150 VAL A CA  1 
ATOM   1164 C C   . VAL A 1 150 ? -6.745  60.104 59.774 1.00 23.94 ? 150 VAL A C   1 
ATOM   1165 O O   . VAL A 1 150 ? -7.974  60.128 59.749 1.00 27.49 ? 150 VAL A O   1 
ATOM   1166 C CB  . VAL A 1 150 ? -5.273  62.106 59.503 1.00 19.19 ? 150 VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 150 ? -4.183  62.701 58.650 1.00 17.70 ? 150 VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 150 ? -6.311  63.172 59.813 1.00 14.96 ? 150 VAL A CG2 1 
ATOM   1169 N N   . GLY A 1 151 ? -6.066  59.376 60.653 1.00 23.26 ? 151 GLY A N   1 
ATOM   1170 C CA  . GLY A 1 151 ? -6.763  58.578 61.647 1.00 21.59 ? 151 GLY A CA  1 
ATOM   1171 C C   . GLY A 1 151 ? -7.336  57.272 61.134 1.00 23.08 ? 151 GLY A C   1 
ATOM   1172 O O   . GLY A 1 151 ? -6.993  56.807 60.056 1.00 25.75 ? 151 GLY A O   1 
ATOM   1173 N N   . ALA A 1 152 ? -8.207  56.660 61.922 1.00 24.39 ? 152 ALA A N   1 
ATOM   1174 C CA  . ALA A 1 152 ? -8.833  55.413 61.526 1.00 24.84 ? 152 ALA A CA  1 
ATOM   1175 C C   . ALA A 1 152 ? -9.750  55.773 60.381 1.00 26.42 ? 152 ALA A C   1 
ATOM   1176 O O   . ALA A 1 152 ? -9.973  54.984 59.466 1.00 29.52 ? 152 ALA A O   1 
ATOM   1177 C CB  . ALA A 1 152 ? -9.646  54.854 62.676 1.00 26.55 ? 152 ALA A CB  1 
ATOM   1178 N N   . PHE A 1 153 ? -10.276 56.990 60.450 1.00 26.29 ? 153 PHE A N   1 
ATOM   1179 C CA  . PHE A 1 153 ? -11.192 57.506 59.442 1.00 24.73 ? 153 PHE A CA  1 
ATOM   1180 C C   . PHE A 1 153 ? -10.653 57.341 58.048 1.00 23.28 ? 153 PHE A C   1 
ATOM   1181 O O   . PHE A 1 153 ? -11.422 57.236 57.096 1.00 23.54 ? 153 PHE A O   1 
ATOM   1182 C CB  . PHE A 1 153 ? -11.474 58.980 59.699 1.00 23.55 ? 153 PHE A CB  1 
ATOM   1183 C CG  . PHE A 1 153 ? -12.082 59.241 61.036 1.00 26.46 ? 153 PHE A CG  1 
ATOM   1184 C CD1 . PHE A 1 153 ? -13.440 59.007 61.250 1.00 25.96 ? 153 PHE A CD1 1 
ATOM   1185 C CD2 . PHE A 1 153 ? -11.299 59.710 62.087 1.00 27.40 ? 153 PHE A CD2 1 
ATOM   1186 C CE1 . PHE A 1 153 ? -14.013 59.235 62.491 1.00 28.50 ? 153 PHE A CE1 1 
ATOM   1187 C CE2 . PHE A 1 153 ? -11.857 59.945 63.336 1.00 29.68 ? 153 PHE A CE2 1 
ATOM   1188 C CZ  . PHE A 1 153 ? -13.224 59.707 63.540 1.00 31.57 ? 153 PHE A CZ  1 
ATOM   1189 N N   . GLY A 1 154 ? -9.329  57.323 57.937 1.00 23.92 ? 154 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 154 ? -8.700  57.181 56.643 1.00 23.29 ? 154 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 154 ? -7.565  56.181 56.586 1.00 24.58 ? 154 GLY A C   1 
ATOM   1192 O O   . GLY A 1 154 ? -6.762  56.247 55.662 1.00 28.74 ? 154 GLY A O   1 
ATOM   1193 N N   . PHE A 1 155 ? -7.479  55.254 57.538 1.00 22.32 ? 155 PHE A N   1 
ATOM   1194 C CA  . PHE A 1 155 ? -6.389  54.278 57.514 1.00 20.72 ? 155 PHE A CA  1 
ATOM   1195 C C   . PHE A 1 155 ? -6.716  52.930 58.141 1.00 20.88 ? 155 PHE A C   1 
ATOM   1196 O O   . PHE A 1 155 ? -5.890  52.014 58.118 1.00 22.06 ? 155 PHE A O   1 
ATOM   1197 C CB  . PHE A 1 155 ? -5.141  54.870 58.166 1.00 21.10 ? 155 PHE A CB  1 
ATOM   1198 C CG  . PHE A 1 155 ? -4.424  55.850 57.291 1.00 21.75 ? 155 PHE A CG  1 
ATOM   1199 C CD1 . PHE A 1 155 ? -3.780  55.424 56.136 1.00 23.86 ? 155 PHE A CD1 1 
ATOM   1200 C CD2 . PHE A 1 155 ? -4.444  57.206 57.583 1.00 22.06 ? 155 PHE A CD2 1 
ATOM   1201 C CE1 . PHE A 1 155 ? -3.170  56.333 55.284 1.00 21.39 ? 155 PHE A CE1 1 
ATOM   1202 C CE2 . PHE A 1 155 ? -3.840  58.128 56.736 1.00 22.26 ? 155 PHE A CE2 1 
ATOM   1203 C CZ  . PHE A 1 155 ? -3.204  57.689 55.585 1.00 23.73 ? 155 PHE A CZ  1 
ATOM   1204 N N   . LEU A 1 156 ? -7.918  52.811 58.696 1.00 19.76 ? 156 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 156 ? -8.375  51.562 59.291 1.00 20.23 ? 156 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 156 ? -8.114  50.482 58.251 1.00 21.01 ? 156 LEU A C   1 
ATOM   1207 O O   . LEU A 1 156 ? -8.647  50.549 57.147 1.00 23.37 ? 156 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 156 ? -9.865  51.660 59.579 1.00 21.36 ? 156 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 156 ? -10.493 50.499 60.335 1.00 23.48 ? 156 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 156 ? -10.022 50.523 61.795 1.00 24.44 ? 156 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 156 ? -12.017 50.614 60.240 1.00 22.83 ? 156 LEU A CD2 1 
ATOM   1212 N N   . ALA A 1 157 ? -7.307  49.484 58.594 1.00 23.30 ? 157 ALA A N   1 
ATOM   1213 C CA  . ALA A 1 157 ? -6.960  48.445 57.627 1.00 23.30 ? 157 ALA A CA  1 
ATOM   1214 C C   . ALA A 1 157 ? -7.542  47.050 57.777 1.00 24.08 ? 157 ALA A C   1 
ATOM   1215 O O   . ALA A 1 157 ? -6.820  46.101 58.097 1.00 25.78 ? 157 ALA A O   1 
ATOM   1216 C CB  . ALA A 1 157 ? -5.441  48.336 57.520 1.00 24.19 ? 157 ALA A CB  1 
ATOM   1217 N N   . LEU A 1 158 ? -8.833  46.900 57.518 1.00 23.99 ? 158 LEU A N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -9.414  45.571 57.593 1.00 26.20 ? 158 LEU A CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -9.257  44.962 56.203 1.00 28.00 ? 158 LEU A C   1 
ATOM   1220 O O   . LEU A 1 158 ? -10.228 44.791 55.469 1.00 25.89 ? 158 LEU A O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -10.884 45.637 58.014 1.00 24.41 ? 158 LEU A CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -11.081 45.494 59.532 1.00 22.39 ? 158 LEU A CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -12.541 45.282 59.832 1.00 19.82 ? 158 LEU A CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -10.263 44.325 60.063 1.00 18.44 ? 158 LEU A CD2 1 
ATOM   1225 N N   . HIS A 1 159 ? -8.005  44.659 55.854 1.00 32.10 ? 159 HIS A N   1 
ATOM   1226 C CA  . HIS A 1 159 ? -7.667  44.085 54.557 1.00 35.58 ? 159 HIS A CA  1 
ATOM   1227 C C   . HIS A 1 159 ? -8.608  42.966 54.214 1.00 36.51 ? 159 HIS A C   1 
ATOM   1228 O O   . HIS A 1 159 ? -8.986  42.184 55.079 1.00 39.26 ? 159 HIS A O   1 
ATOM   1229 C CB  . HIS A 1 159 ? -6.237  43.542 54.535 1.00 38.31 ? 159 HIS A CB  1 
ATOM   1230 C CG  . HIS A 1 159 ? -5.711  43.288 53.152 1.00 42.47 ? 159 HIS A CG  1 
ATOM   1231 N ND1 . HIS A 1 159 ? -5.656  44.271 52.182 1.00 44.25 ? 159 HIS A ND1 1 
ATOM   1232 C CD2 . HIS A 1 159 ? -5.214  42.165 52.577 1.00 41.15 ? 159 HIS A CD2 1 
ATOM   1233 C CE1 . HIS A 1 159 ? -5.147  43.762 51.073 1.00 43.80 ? 159 HIS A CE1 1 
ATOM   1234 N NE2 . HIS A 1 159 ? -4.870  42.487 51.286 1.00 41.02 ? 159 HIS A NE2 1 
ATOM   1235 N N   . GLY A 1 160 ? -8.958  42.883 52.936 1.00 37.85 ? 160 GLY A N   1 
ATOM   1236 C CA  . GLY A 1 160 ? -9.883  41.866 52.480 1.00 37.58 ? 160 GLY A CA  1 
ATOM   1237 C C   . GLY A 1 160 ? -11.193 42.578 52.234 1.00 37.76 ? 160 GLY A C   1 
ATOM   1238 O O   . GLY A 1 160 ? -11.749 42.523 51.145 1.00 39.15 ? 160 GLY A O   1 
ATOM   1239 N N   . SER A 1 161 ? -11.676 43.267 53.261 1.00 38.74 ? 161 SER A N   1 
ATOM   1240 C CA  . SER A 1 161 ? -12.919 44.013 53.165 1.00 38.73 ? 161 SER A CA  1 
ATOM   1241 C C   . SER A 1 161 ? -12.739 45.060 52.087 1.00 36.81 ? 161 SER A C   1 
ATOM   1242 O O   . SER A 1 161 ? -11.622 45.496 51.823 1.00 35.99 ? 161 SER A O   1 
ATOM   1243 C CB  . SER A 1 161 ? -13.244 44.699 54.498 1.00 40.10 ? 161 SER A CB  1 
ATOM   1244 O OG  . SER A 1 161 ? -14.591 44.460 54.881 1.00 42.42 ? 161 SER A OG  1 
ATOM   1245 N N   . GLN A 1 162 ? -13.839 45.443 51.453 1.00 37.21 ? 162 GLN A N   1 
ATOM   1246 C CA  . GLN A 1 162 ? -13.797 46.455 50.410 1.00 36.81 ? 162 GLN A CA  1 
ATOM   1247 C C   . GLN A 1 162 ? -14.435 47.703 50.979 1.00 35.95 ? 162 GLN A C   1 
ATOM   1248 O O   . GLN A 1 162 ? -14.316 48.796 50.429 1.00 35.67 ? 162 GLN A O   1 
ATOM   1249 C CB  . GLN A 1 162 ? -14.552 45.982 49.171 1.00 37.47 ? 162 GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 162 ? -13.634 45.737 47.973 1.00 40.16 ? 162 GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 162 ? -12.563 46.811 47.815 1.00 38.87 ? 162 GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 162 ? -11.368 46.514 47.801 0.00 38.10 ? 162 GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 162 ? -12.992 48.062 47.696 0.00 38.10 ? 162 GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 163 ? -15.104 47.523 52.105 1.00 35.70 ? 163 GLU A N   1 
ATOM   1255 C CA  . GLU A 1 163 ? -15.745 48.622 52.778 1.00 36.50 ? 163 GLU A CA  1 
ATOM   1256 C C   . GLU A 1 163 ? -14.683 49.393 53.559 1.00 37.11 ? 163 GLU A C   1 
ATOM   1257 O O   . GLU A 1 163 ? -14.809 50.596 53.769 1.00 40.24 ? 163 GLU A O   1 
ATOM   1258 C CB  . GLU A 1 163 ? -16.836 48.080 53.696 1.00 40.03 ? 163 GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 163 ? -18.054 47.576 52.930 1.00 41.02 ? 163 GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 163 ? -18.422 48.492 51.777 1.00 43.78 ? 163 GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 163 ? -18.902 49.614 52.052 1.00 44.64 ? 163 GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 163 ? -18.224 48.095 50.603 1.00 44.23 ? 163 GLU A OE2 1 
ATOM   1263 N N   . ALA A 1 164 ? -13.633 48.698 53.982 1.00 35.46 ? 164 ALA A N   1 
ATOM   1264 C CA  . ALA A 1 164 ? -12.535 49.326 54.714 1.00 34.18 ? 164 ALA A CA  1 
ATOM   1265 C C   . ALA A 1 164 ? -11.267 48.519 54.419 1.00 34.37 ? 164 ALA A C   1 
ATOM   1266 O O   . ALA A 1 164 ? -10.842 47.673 55.218 1.00 36.62 ? 164 ALA A O   1 
ATOM   1267 C CB  . ALA A 1 164 ? -12.831 49.340 56.208 1.00 30.53 ? 164 ALA A CB  1 
ATOM   1268 N N   . PRO A 1 165 ? -10.648 48.781 53.257 1.00 31.70 ? 165 PRO A N   1 
ATOM   1269 C CA  . PRO A 1 165 ? -9.432  48.125 52.767 1.00 30.91 ? 165 PRO A CA  1 
ATOM   1270 C C   . PRO A 1 165 ? -8.126  48.749 53.245 1.00 30.94 ? 165 PRO A C   1 
ATOM   1271 O O   . PRO A 1 165 ? -7.069  48.109 53.216 1.00 28.89 ? 165 PRO A O   1 
ATOM   1272 C CB  . PRO A 1 165 ? -9.575  48.231 51.258 1.00 32.49 ? 165 PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 165 ? -10.287 49.569 51.064 1.00 31.88 ? 165 PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 165 ? -11.129 49.804 52.308 1.00 30.72 ? 165 PRO A CD  1 
ATOM   1275 N N   . GLY A 1 166 ? -8.202  50.009 53.660 1.00 32.03 ? 166 GLY A N   1 
ATOM   1276 C CA  . GLY A 1 166 ? -7.016  50.697 54.132 1.00 32.66 ? 166 GLY A CA  1 
ATOM   1277 C C   . GLY A 1 166 ? -6.370  51.609 53.105 1.00 30.67 ? 166 GLY A C   1 
ATOM   1278 O O   . GLY A 1 166 ? -6.679  51.540 51.918 1.00 31.90 ? 166 GLY A O   1 
ATOM   1279 N N   . ASN A 1 167 ? -5.473  52.470 53.570 1.00 28.90 ? 167 ASN A N   1 
ATOM   1280 C CA  . ASN A 1 167 ? -4.775  53.392 52.694 1.00 27.77 ? 167 ASN A CA  1 
ATOM   1281 C C   . ASN A 1 167 ? -5.699  54.362 51.985 1.00 27.37 ? 167 ASN A C   1 
ATOM   1282 O O   . ASN A 1 167 ? -5.252  55.111 51.121 1.00 27.86 ? 167 ASN A O   1 
ATOM   1283 C CB  . ASN A 1 167 ? -3.982  52.604 51.660 1.00 26.80 ? 167 ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 167 ? -2.985  51.680 52.297 1.00 28.26 ? 167 ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 167 ? -2.238  50.983 51.618 1.00 28.48 ? 167 ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 167 ? -2.965  51.669 53.623 1.00 31.94 ? 167 ASN A ND2 1 
ATOM   1287 N N   . VAL A 1 168 ? -6.980  54.363 52.345 1.00 27.07 ? 168 VAL A N   1 
ATOM   1288 C CA  . VAL A 1 168 ? -7.925  55.257 51.687 1.00 26.12 ? 168 VAL A CA  1 
ATOM   1289 C C   . VAL A 1 168 ? -7.398  56.675 51.762 1.00 25.40 ? 168 VAL A C   1 
ATOM   1290 O O   . VAL A 1 168 ? -7.571  57.462 50.834 1.00 28.39 ? 168 VAL A O   1 
ATOM   1291 C CB  . VAL A 1 168 ? -9.336  55.199 52.328 1.00 26.10 ? 168 VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 168 ? -9.883  53.779 52.272 1.00 23.08 ? 168 VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 168 ? -9.277  55.693 53.753 1.00 27.25 ? 168 VAL A CG2 1 
ATOM   1294 N N   . GLY A 1 169 ? -6.732  56.986 52.867 1.00 24.30 ? 169 GLY A N   1 
ATOM   1295 C CA  . GLY A 1 169 ? -6.178  58.314 53.054 1.00 24.31 ? 169 GLY A CA  1 
ATOM   1296 C C   . GLY A 1 169 ? -5.147  58.675 52.001 1.00 24.99 ? 169 GLY A C   1 
ATOM   1297 O O   . GLY A 1 169 ? -5.030  59.839 51.626 1.00 25.41 ? 169 GLY A O   1 
ATOM   1298 N N   . LEU A 1 170 ? -4.383  57.686 51.536 1.00 25.43 ? 170 LEU A N   1 
ATOM   1299 C CA  . LEU A 1 170 ? -3.372  57.917 50.504 1.00 24.15 ? 170 LEU A CA  1 
ATOM   1300 C C   . LEU A 1 170 ? -4.110  58.057 49.188 1.00 25.45 ? 170 LEU A C   1 
ATOM   1301 O O   . LEU A 1 170 ? -3.643  58.727 48.265 1.00 26.35 ? 170 LEU A O   1 
ATOM   1302 C CB  . LEU A 1 170 ? -2.405  56.739 50.409 1.00 20.21 ? 170 LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 170 ? -1.384  56.637 51.531 1.00 18.26 ? 170 LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 170 ? -0.528  55.419 51.322 1.00 20.46 ? 170 LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 170 ? -0.544  57.883 51.562 1.00 19.23 ? 170 LEU A CD2 1 
ATOM   1306 N N   . LEU A 1 171 ? -5.271  57.408 49.126 1.00 26.23 ? 171 LEU A N   1 
ATOM   1307 C CA  . LEU A 1 171 ? -6.131  57.427 47.954 1.00 27.64 ? 171 LEU A CA  1 
ATOM   1308 C C   . LEU A 1 171 ? -6.735  58.814 47.753 1.00 29.35 ? 171 LEU A C   1 
ATOM   1309 O O   . LEU A 1 171 ? -6.977  59.234 46.613 1.00 29.39 ? 171 LEU A O   1 
ATOM   1310 C CB  . LEU A 1 171 ? -7.242  56.400 48.119 1.00 27.40 ? 171 LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 171 ? -6.901  54.942 47.814 1.00 28.05 ? 171 LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 171 ? -8.205  54.170 47.671 1.00 30.41 ? 171 LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 171 ? -6.061  54.835 46.553 1.00 22.11 ? 171 LEU A CD2 1 
ATOM   1314 N N   . ASP A 1 172 ? -6.998  59.505 48.866 1.00 28.72 ? 172 ASP A N   1 
ATOM   1315 C CA  . ASP A 1 172 ? -7.529  60.865 48.828 1.00 26.86 ? 172 ASP A CA  1 
ATOM   1316 C C   . ASP A 1 172 ? -6.392  61.695 48.235 1.00 27.68 ? 172 ASP A C   1 
ATOM   1317 O O   . ASP A 1 172 ? -6.572  62.477 47.308 1.00 30.24 ? 172 ASP A O   1 
ATOM   1318 C CB  . ASP A 1 172 ? -7.822  61.369 50.239 1.00 25.53 ? 172 ASP A CB  1 
ATOM   1319 C CG  . ASP A 1 172 ? -8.830  60.515 50.972 1.00 26.35 ? 172 ASP A CG  1 
ATOM   1320 O OD1 . ASP A 1 172 ? -9.034  59.352 50.582 1.00 25.12 ? 172 ASP A OD1 1 
ATOM   1321 O OD2 . ASP A 1 172 ? -9.425  61.015 51.948 1.00 28.08 ? 172 ASP A OD2 1 
ATOM   1322 N N   . GLN A 1 173 ? -5.207  61.508 48.790 1.00 27.18 ? 173 GLN A N   1 
ATOM   1323 C CA  . GLN A 1 173 ? -4.033  62.206 48.317 1.00 26.73 ? 173 GLN A CA  1 
ATOM   1324 C C   . GLN A 1 173 ? -3.962  62.057 46.803 1.00 26.53 ? 173 GLN A C   1 
ATOM   1325 O O   . GLN A 1 173 ? -3.733  63.023 46.093 1.00 28.27 ? 173 GLN A O   1 
ATOM   1326 C CB  . GLN A 1 173 ? -2.777  61.595 48.943 1.00 25.68 ? 173 GLN A CB  1 
ATOM   1327 C CG  . GLN A 1 173 ? -2.134  62.408 50.041 1.00 23.43 ? 173 GLN A CG  1 
ATOM   1328 C CD  . GLN A 1 173 ? -0.974  61.675 50.672 1.00 24.99 ? 173 GLN A CD  1 
ATOM   1329 O OE1 . GLN A 1 173 ? -0.493  60.679 50.139 1.00 27.26 ? 173 GLN A OE1 1 
ATOM   1330 N NE2 . GLN A 1 173 ? -0.521  62.157 51.815 1.00 26.40 ? 173 GLN A NE2 1 
ATOM   1331 N N   . ARG A 1 174 ? -4.174  60.841 46.318 1.00 26.24 ? 174 ARG A N   1 
ATOM   1332 C CA  . ARG A 1 174 ? -4.095  60.555 44.887 1.00 26.89 ? 174 ARG A CA  1 
ATOM   1333 C C   . ARG A 1 174 ? -5.197  61.192 44.049 1.00 28.11 ? 174 ARG A C   1 
ATOM   1334 O O   . ARG A 1 174 ? -4.950  61.700 42.953 1.00 28.92 ? 174 ARG A O   1 
ATOM   1335 C CB  . ARG A 1 174 ? -4.104  59.048 44.671 1.00 27.24 ? 174 ARG A CB  1 
ATOM   1336 C CG  . ARG A 1 174 ? -3.540  58.613 43.345 1.00 27.07 ? 174 ARG A CG  1 
ATOM   1337 C CD  . ARG A 1 174 ? -3.911  57.174 43.080 1.00 25.20 ? 174 ARG A CD  1 
ATOM   1338 N NE  . ARG A 1 174 ? -2.785  56.278 43.296 1.00 25.25 ? 174 ARG A NE  1 
ATOM   1339 C CZ  . ARG A 1 174 ? -2.909  54.981 43.548 1.00 26.46 ? 174 ARG A CZ  1 
ATOM   1340 N NH1 . ARG A 1 174 ? -4.110  54.430 43.618 1.00 24.19 ? 174 ARG A NH1 1 
ATOM   1341 N NH2 . ARG A 1 174 ? -1.832  54.229 43.716 1.00 29.76 ? 174 ARG A NH2 1 
ATOM   1342 N N   . MET A 1 175 ? -6.419  61.149 44.559 1.00 28.55 ? 175 MET A N   1 
ATOM   1343 C CA  . MET A 1 175 ? -7.546  61.734 43.850 1.00 26.45 ? 175 MET A CA  1 
ATOM   1344 C C   . MET A 1 175 ? -7.404  63.244 43.814 1.00 23.96 ? 175 MET A C   1 
ATOM   1345 O O   . MET A 1 175 ? -8.071  63.914 43.040 1.00 25.03 ? 175 MET A O   1 
ATOM   1346 C CB  . MET A 1 175 ? -8.867  61.360 44.533 1.00 27.71 ? 175 MET A CB  1 
ATOM   1347 C CG  . MET A 1 175 ? -10.096 61.910 43.831 1.00 27.01 ? 175 MET A CG  1 
ATOM   1348 S SD  . MET A 1 175 ? -11.517 60.806 43.915 1.00 27.27 ? 175 MET A SD  1 
ATOM   1349 C CE  . MET A 1 175 ? -12.010 61.076 45.569 1.00 25.65 ? 175 MET A CE  1 
ATOM   1350 N N   . ALA A 1 176 ? -6.541  63.785 44.659 1.00 22.84 ? 176 ALA A N   1 
ATOM   1351 C CA  . ALA A 1 176 ? -6.342  65.222 44.679 1.00 23.84 ? 176 ALA A CA  1 
ATOM   1352 C C   . ALA A 1 176 ? -5.245  65.586 43.680 1.00 25.00 ? 176 ALA A C   1 
ATOM   1353 O O   . ALA A 1 176 ? -5.228  66.689 43.137 1.00 25.32 ? 176 ALA A O   1 
ATOM   1354 C CB  . ALA A 1 176 ? -5.967  65.678 46.077 1.00 23.44 ? 176 ALA A CB  1 
ATOM   1355 N N   . LEU A 1 177 ? -4.331  64.649 43.439 1.00 25.83 ? 177 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 177 ? -3.242  64.872 42.497 1.00 26.64 ? 177 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 177 ? -3.775  64.714 41.082 1.00 29.20 ? 177 LEU A C   1 
ATOM   1358 O O   . LEU A 1 177 ? -3.243  65.308 40.145 1.00 31.76 ? 177 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 177 ? -2.105  63.881 42.734 1.00 25.38 ? 177 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 177 ? -1.214  64.112 43.963 1.00 26.99 ? 177 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 177 ? -0.057  63.112 43.937 1.00 28.34 ? 177 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 177 ? -0.671  65.536 43.984 1.00 26.49 ? 177 LEU A CD2 1 
ATOM   1363 N N   . GLN A 1 178 ? -4.819  63.905 40.921 1.00 30.12 ? 178 GLN A N   1 
ATOM   1364 C CA  . GLN A 1 178 ? -5.419  63.727 39.605 1.00 31.26 ? 178 GLN A CA  1 
ATOM   1365 C C   . GLN A 1 178 ? -6.058  65.053 39.242 1.00 31.23 ? 178 GLN A C   1 
ATOM   1366 O O   . GLN A 1 178 ? -5.750  65.629 38.203 1.00 34.58 ? 178 GLN A O   1 
ATOM   1367 C CB  . GLN A 1 178 ? -6.504  62.651 39.619 1.00 32.70 ? 178 GLN A CB  1 
ATOM   1368 C CG  . GLN A 1 178 ? -6.140  61.365 38.872 1.00 37.16 ? 178 GLN A CG  1 
ATOM   1369 C CD  . GLN A 1 178 ? -6.049  61.532 37.361 1.00 36.63 ? 178 GLN A CD  1 
ATOM   1370 O OE1 . GLN A 1 178 ? -5.607  60.624 36.660 1.00 38.68 ? 178 GLN A OE1 1 
ATOM   1371 N NE2 . GLN A 1 178 ? -6.463  62.688 36.856 1.00 36.05 ? 178 GLN A NE2 1 
ATOM   1372 N N   . TRP A 1 179 ? -6.944  65.531 40.117 1.00 29.63 ? 179 TRP A N   1 
ATOM   1373 C CA  . TRP A 1 179 ? -7.652  66.795 39.916 1.00 26.63 ? 179 TRP A CA  1 
ATOM   1374 C C   . TRP A 1 179 ? -6.682  67.893 39.508 1.00 25.12 ? 179 TRP A C   1 
ATOM   1375 O O   . TRP A 1 179 ? -6.976  68.711 38.642 1.00 25.61 ? 179 TRP A O   1 
ATOM   1376 C CB  . TRP A 1 179 ? -8.385  67.198 41.201 1.00 25.61 ? 179 TRP A CB  1 
ATOM   1377 C CG  . TRP A 1 179 ? -9.477  68.233 41.006 1.00 27.86 ? 179 TRP A CG  1 
ATOM   1378 C CD1 . TRP A 1 179 ? -10.827 68.005 40.954 1.00 26.03 ? 179 TRP A CD1 1 
ATOM   1379 C CD2 . TRP A 1 179 ? -9.308  69.657 40.875 1.00 26.36 ? 179 TRP A CD2 1 
ATOM   1380 N NE1 . TRP A 1 179 ? -11.503 69.195 40.803 1.00 27.33 ? 179 TRP A NE1 1 
ATOM   1381 C CE2 . TRP A 1 179 ? -10.597 70.222 40.752 1.00 25.70 ? 179 TRP A CE2 1 
ATOM   1382 C CE3 . TRP A 1 179 ? -8.195  70.508 40.851 1.00 25.43 ? 179 TRP A CE3 1 
ATOM   1383 C CZ2 . TRP A 1 179 ? -10.800 71.596 40.609 1.00 23.61 ? 179 TRP A CZ2 1 
ATOM   1384 C CZ3 . TRP A 1 179 ? -8.400  71.876 40.709 1.00 22.28 ? 179 TRP A CZ3 1 
ATOM   1385 C CH2 . TRP A 1 179 ? -9.692  72.403 40.590 1.00 21.44 ? 179 TRP A CH2 1 
ATOM   1386 N N   . VAL A 1 180 ? -5.520  67.908 40.141 1.00 25.39 ? 180 VAL A N   1 
ATOM   1387 C CA  . VAL A 1 180 ? -4.503  68.900 39.831 1.00 25.77 ? 180 VAL A CA  1 
ATOM   1388 C C   . VAL A 1 180 ? -3.993  68.672 38.420 1.00 26.73 ? 180 VAL A C   1 
ATOM   1389 O O   . VAL A 1 180 ? -3.760  69.608 37.664 1.00 28.37 ? 180 VAL A O   1 
ATOM   1390 C CB  . VAL A 1 180 ? -3.322  68.770 40.773 1.00 23.47 ? 180 VAL A CB  1 
ATOM   1391 C CG1 . VAL A 1 180 ? -2.159  69.581 40.247 1.00 20.15 ? 180 VAL A CG1 1 
ATOM   1392 C CG2 . VAL A 1 180 ? -3.736  69.205 42.165 1.00 24.09 ? 180 VAL A CG2 1 
ATOM   1393 N N   . HIS A 1 181 ? -3.808  67.404 38.089 1.00 27.65 ? 181 HIS A N   1 
ATOM   1394 C CA  . HIS A 1 181 ? -3.325  66.996 36.787 1.00 27.77 ? 181 HIS A CA  1 
ATOM   1395 C C   . HIS A 1 181 ? -4.343  67.328 35.701 1.00 27.43 ? 181 HIS A C   1 
ATOM   1396 O O   . HIS A 1 181 ? -3.973  67.616 34.565 1.00 28.05 ? 181 HIS A O   1 
ATOM   1397 C CB  . HIS A 1 181 ? -3.055  65.492 36.807 1.00 29.58 ? 181 HIS A CB  1 
ATOM   1398 C CG  . HIS A 1 181 ? -2.593  64.941 35.496 1.00 33.82 ? 181 HIS A CG  1 
ATOM   1399 N ND1 . HIS A 1 181 ? -3.433  64.266 34.635 1.00 34.92 ? 181 HIS A ND1 1 
ATOM   1400 C CD2 . HIS A 1 181 ? -1.372  64.936 34.911 1.00 33.91 ? 181 HIS A CD2 1 
ATOM   1401 C CE1 . HIS A 1 181 ? -2.749  63.869 33.578 1.00 34.60 ? 181 HIS A CE1 1 
ATOM   1402 N NE2 . HIS A 1 181 ? -1.496  64.263 33.721 1.00 35.52 ? 181 HIS A NE2 1 
ATOM   1403 N N   . ASP A 1 182 ? -5.623  67.303 36.059 1.00 27.69 ? 182 ASP A N   1 
ATOM   1404 C CA  . ASP A 1 182 ? -6.703  67.574 35.111 1.00 29.30 ? 182 ASP A CA  1 
ATOM   1405 C C   . ASP A 1 182 ? -7.133  69.033 34.926 1.00 30.89 ? 182 ASP A C   1 
ATOM   1406 O O   . ASP A 1 182 ? -7.508  69.421 33.828 1.00 33.31 ? 182 ASP A O   1 
ATOM   1407 C CB  . ASP A 1 182 ? -7.946  66.763 35.486 1.00 29.73 ? 182 ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 182 ? -7.710  65.257 35.455 1.00 33.18 ? 182 ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 182 ? -6.551  64.826 35.224 1.00 35.42 ? 182 ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 182 ? -8.697  64.506 35.666 1.00 31.16 ? 182 ASP A OD2 1 
ATOM   1411 N N   . ASN A 1 183 ? -7.080  69.847 35.976 1.00 32.27 ? 183 ASN A N   1 
ATOM   1412 C CA  . ASN A 1 183 ? -7.531  71.233 35.858 1.00 30.82 ? 183 ASN A CA  1 
ATOM   1413 C C   . ASN A 1 183 ? -6.552  72.337 36.242 1.00 31.83 ? 183 ASN A C   1 
ATOM   1414 O O   . ASN A 1 183 ? -6.876  73.526 36.139 1.00 30.26 ? 183 ASN A O   1 
ATOM   1415 C CB  . ASN A 1 183 ? -8.801  71.408 36.677 1.00 30.84 ? 183 ASN A CB  1 
ATOM   1416 C CG  . ASN A 1 183 ? -9.766  70.268 36.488 1.00 32.14 ? 183 ASN A CG  1 
ATOM   1417 O OD1 . ASN A 1 183 ? -10.674 70.347 35.661 1.00 33.55 ? 183 ASN A OD1 1 
ATOM   1418 N ND2 . ASN A 1 183 ? -9.577  69.195 37.248 1.00 28.15 ? 183 ASN A ND2 1 
ATOM   1419 N N   . ILE A 1 184 ? -5.357  71.964 36.678 1.00 31.72 ? 184 ILE A N   1 
ATOM   1420 C CA  . ILE A 1 184 ? -4.391  72.975 37.079 1.00 30.87 ? 184 ILE A CA  1 
ATOM   1421 C C   . ILE A 1 184 ? -3.970  73.893 35.934 1.00 30.88 ? 184 ILE A C   1 
ATOM   1422 O O   . ILE A 1 184 ? -3.356  74.934 36.164 1.00 33.20 ? 184 ILE A O   1 
ATOM   1423 C CB  . ILE A 1 184 ? -3.145  72.327 37.744 1.00 28.26 ? 184 ILE A CB  1 
ATOM   1424 C CG1 . ILE A 1 184 ? -2.648  73.228 38.878 1.00 29.21 ? 184 ILE A CG1 1 
ATOM   1425 C CG2 . ILE A 1 184 ? -2.061  72.069 36.722 1.00 27.62 ? 184 ILE A CG2 1 
ATOM   1426 C CD1 . ILE A 1 184 ? -3.684  73.477 39.988 1.00 27.61 ? 184 ILE A CD1 1 
ATOM   1427 N N   . GLN A 1 185 ? -4.316  73.525 34.705 1.00 30.08 ? 185 GLN A N   1 
ATOM   1428 C CA  . GLN A 1 185 ? -3.949  74.344 33.558 1.00 27.19 ? 185 GLN A CA  1 
ATOM   1429 C C   . GLN A 1 185 ? -4.847  75.555 33.511 1.00 26.76 ? 185 GLN A C   1 
ATOM   1430 O O   . GLN A 1 185 ? -4.393  76.649 33.190 1.00 30.17 ? 185 GLN A O   1 
ATOM   1431 C CB  . GLN A 1 185 ? -4.064  73.555 32.250 1.00 24.73 ? 185 GLN A CB  1 
ATOM   1432 C CG  . GLN A 1 185 ? -5.480  73.250 31.809 1.00 28.67 ? 185 GLN A CG  1 
ATOM   1433 C CD  . GLN A 1 185 ? -5.666  71.787 31.462 1.00 32.21 ? 185 GLN A CD  1 
ATOM   1434 O OE1 . GLN A 1 185 ? -5.161  70.907 32.166 1.00 38.26 ? 185 GLN A OE1 1 
ATOM   1435 N NE2 . GLN A 1 185 ? -6.387  71.515 30.376 1.00 30.95 ? 185 GLN A NE2 1 
ATOM   1436 N N   . PHE A 1 186 ? -6.118  75.367 33.845 1.00 24.81 ? 186 PHE A N   1 
ATOM   1437 C CA  . PHE A 1 186 ? -7.068  76.474 33.828 1.00 25.38 ? 186 PHE A CA  1 
ATOM   1438 C C   . PHE A 1 186 ? -6.744  77.509 34.901 1.00 27.07 ? 186 PHE A C   1 
ATOM   1439 O O   . PHE A 1 186 ? -7.356  78.577 34.949 1.00 29.08 ? 186 PHE A O   1 
ATOM   1440 C CB  . PHE A 1 186 ? -8.491  75.950 34.030 1.00 23.29 ? 186 PHE A CB  1 
ATOM   1441 C CG  . PHE A 1 186 ? -8.848  74.821 33.113 1.00 22.24 ? 186 PHE A CG  1 
ATOM   1442 C CD1 . PHE A 1 186 ? -8.821  74.998 31.736 1.00 22.79 ? 186 PHE A CD1 1 
ATOM   1443 C CD2 . PHE A 1 186 ? -9.180  73.577 33.620 1.00 22.03 ? 186 PHE A CD2 1 
ATOM   1444 C CE1 . PHE A 1 186 ? -9.117  73.954 30.879 1.00 21.87 ? 186 PHE A CE1 1 
ATOM   1445 C CE2 . PHE A 1 186 ? -9.478  72.523 32.771 1.00 23.25 ? 186 PHE A CE2 1 
ATOM   1446 C CZ  . PHE A 1 186 ? -9.445  72.714 31.396 1.00 23.92 ? 186 PHE A CZ  1 
ATOM   1447 N N   . PHE A 1 187 ? -5.780  77.187 35.760 1.00 27.05 ? 187 PHE A N   1 
ATOM   1448 C CA  . PHE A 1 187 ? -5.388  78.082 36.838 1.00 23.57 ? 187 PHE A CA  1 
ATOM   1449 C C   . PHE A 1 187 ? -4.039  78.675 36.502 1.00 22.51 ? 187 PHE A C   1 
ATOM   1450 O O   . PHE A 1 187 ? -3.483  79.448 37.267 1.00 23.65 ? 187 PHE A O   1 
ATOM   1451 C CB  . PHE A 1 187 ? -5.312  77.319 38.165 1.00 22.09 ? 187 PHE A CB  1 
ATOM   1452 C CG  . PHE A 1 187 ? -6.662  76.995 38.767 1.00 21.25 ? 187 PHE A CG  1 
ATOM   1453 C CD1 . PHE A 1 187 ? -7.341  75.830 38.407 1.00 22.04 ? 187 PHE A CD1 1 
ATOM   1454 C CD2 . PHE A 1 187 ? -7.259  77.857 39.685 1.00 22.37 ? 187 PHE A CD2 1 
ATOM   1455 C CE1 . PHE A 1 187 ? -8.598  75.527 38.950 1.00 21.43 ? 187 PHE A CE1 1 
ATOM   1456 C CE2 . PHE A 1 187 ? -8.518  77.566 40.238 1.00 22.01 ? 187 PHE A CE2 1 
ATOM   1457 C CZ  . PHE A 1 187 ? -9.188  76.397 39.867 1.00 21.01 ? 187 PHE A CZ  1 
ATOM   1458 N N   . GLY A 1 188 ? -3.514  78.306 35.344 1.00 22.78 ? 188 GLY A N   1 
ATOM   1459 C CA  . GLY A 1 188 ? -2.223  78.819 34.923 1.00 22.71 ? 188 GLY A CA  1 
ATOM   1460 C C   . GLY A 1 188 ? -1.081  77.846 35.126 1.00 22.13 ? 188 GLY A C   1 
ATOM   1461 O O   . GLY A 1 188 ? -0.001  78.025 34.564 1.00 23.13 ? 188 GLY A O   1 
ATOM   1462 N N   . GLY A 1 189 ? -1.322  76.810 35.923 1.00 21.37 ? 189 GLY A N   1 
ATOM   1463 C CA  . GLY A 1 189 ? -0.291  75.831 36.200 1.00 21.49 ? 189 GLY A CA  1 
ATOM   1464 C C   . GLY A 1 189 ? 0.045   74.950 35.023 1.00 24.33 ? 189 GLY A C   1 
ATOM   1465 O O   . GLY A 1 189 ? -0.724  74.834 34.073 1.00 27.60 ? 189 GLY A O   1 
ATOM   1466 N N   . ASP A 1 190 ? 1.206   74.315 35.095 1.00 25.80 ? 190 ASP A N   1 
ATOM   1467 C CA  . ASP A 1 190 ? 1.671   73.428 34.040 1.00 24.81 ? 190 ASP A CA  1 
ATOM   1468 C C   . ASP A 1 190 ? 1.638   71.983 34.541 1.00 25.02 ? 190 ASP A C   1 
ATOM   1469 O O   . ASP A 1 190 ? 2.524   71.536 35.264 1.00 28.09 ? 190 ASP A O   1 
ATOM   1470 C CB  . ASP A 1 190 ? 3.092   73.817 33.629 1.00 24.89 ? 190 ASP A CB  1 
ATOM   1471 C CG  . ASP A 1 190 ? 3.768   72.754 32.797 1.00 27.03 ? 190 ASP A CG  1 
ATOM   1472 O OD1 . ASP A 1 190 ? 3.078   71.805 32.372 1.00 28.37 ? 190 ASP A OD1 1 
ATOM   1473 O OD2 . ASP A 1 190 ? 4.992   72.867 32.564 1.00 29.30 ? 190 ASP A OD2 1 
ATOM   1474 N N   . PRO A 1 191 ? 0.612   71.230 34.146 1.00 23.42 ? 191 PRO A N   1 
ATOM   1475 C CA  . PRO A 1 191 ? 0.440   69.836 34.545 1.00 21.10 ? 191 PRO A CA  1 
ATOM   1476 C C   . PRO A 1 191 ? 1.593   68.886 34.269 1.00 22.65 ? 191 PRO A C   1 
ATOM   1477 O O   . PRO A 1 191 ? 1.524   67.725 34.651 1.00 24.58 ? 191 PRO A O   1 
ATOM   1478 C CB  . PRO A 1 191 ? -0.829  69.403 33.810 1.00 23.24 ? 191 PRO A CB  1 
ATOM   1479 C CG  . PRO A 1 191 ? -1.031  70.410 32.736 1.00 22.51 ? 191 PRO A CG  1 
ATOM   1480 C CD  . PRO A 1 191 ? -0.473  71.687 33.263 1.00 24.84 ? 191 PRO A CD  1 
ATOM   1481 N N   . LYS A 1 192 ? 2.647   69.348 33.604 1.00 25.35 ? 192 LYS A N   1 
ATOM   1482 C CA  . LYS A 1 192 ? 3.775   68.461 33.311 1.00 26.71 ? 192 LYS A CA  1 
ATOM   1483 C C   . LYS A 1 192 ? 5.026   68.877 34.044 1.00 26.50 ? 192 LYS A C   1 
ATOM   1484 O O   . LYS A 1 192 ? 6.126   68.419 33.745 1.00 27.85 ? 192 LYS A O   1 
ATOM   1485 C CB  . LYS A 1 192 ? 4.056   68.392 31.810 1.00 28.18 ? 192 LYS A CB  1 
ATOM   1486 C CG  . LYS A 1 192 ? 4.019   66.964 31.257 1.00 34.82 ? 192 LYS A CG  1 
ATOM   1487 C CD  . LYS A 1 192 ? 2.916   66.110 31.915 1.00 39.33 ? 192 LYS A CD  1 
ATOM   1488 C CE  . LYS A 1 192 ? 1.756   65.814 30.953 1.00 43.23 ? 192 LYS A CE  1 
ATOM   1489 N NZ  . LYS A 1 192 ? 0.424   66.372 31.387 1.00 42.83 ? 192 LYS A NZ  1 
ATOM   1490 N N   . THR A 1 193 ? 4.834   69.754 35.015 1.00 26.62 ? 193 THR A N   1 
ATOM   1491 C CA  . THR A 1 193 ? 5.912   70.245 35.847 1.00 25.97 ? 193 THR A CA  1 
ATOM   1492 C C   . THR A 1 193 ? 5.272   70.523 37.202 1.00 25.79 ? 193 THR A C   1 
ATOM   1493 O O   . THR A 1 193 ? 5.199   71.657 37.670 1.00 27.75 ? 193 THR A O   1 
ATOM   1494 C CB  . THR A 1 193 ? 6.528   71.515 35.254 1.00 26.23 ? 193 THR A CB  1 
ATOM   1495 O OG1 . THR A 1 193 ? 7.161   71.186 34.011 1.00 29.70 ? 193 THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 193 ? 7.563   72.108 36.201 1.00 26.89 ? 193 THR A CG2 1 
ATOM   1497 N N   . VAL A 1 194 ? 4.781   69.453 37.810 1.00 24.77 ? 194 VAL A N   1 
ATOM   1498 C CA  . VAL A 1 194 ? 4.132   69.520 39.102 1.00 24.68 ? 194 VAL A CA  1 
ATOM   1499 C C   . VAL A 1 194 ? 4.958   68.772 40.136 1.00 26.16 ? 194 VAL A C   1 
ATOM   1500 O O   . VAL A 1 194 ? 5.132   67.555 40.047 1.00 26.06 ? 194 VAL A O   1 
ATOM   1501 C CB  . VAL A 1 194 ? 2.749   68.890 39.039 1.00 21.48 ? 194 VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 194 ? 2.753   67.784 38.021 1.00 26.30 ? 194 VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 194 ? 2.359   68.363 40.390 1.00 21.62 ? 194 VAL A CG2 1 
ATOM   1504 N N   . THR A 1 195 ? 5.464   69.515 41.115 1.00 26.71 ? 195 THR A N   1 
ATOM   1505 C CA  . THR A 1 195 ? 6.267   68.946 42.183 1.00 24.85 ? 195 THR A CA  1 
ATOM   1506 C C   . THR A 1 195 ? 5.402   68.715 43.418 1.00 25.76 ? 195 THR A C   1 
ATOM   1507 O O   . THR A 1 195 ? 4.595   69.568 43.769 1.00 27.46 ? 195 THR A O   1 
ATOM   1508 C CB  . THR A 1 195 ? 7.404   69.909 42.580 1.00 21.54 ? 195 THR A CB  1 
ATOM   1509 O OG1 . THR A 1 195 ? 8.345   70.011 41.508 1.00 23.18 ? 195 THR A OG1 1 
ATOM   1510 C CG2 . THR A 1 195 ? 8.123   69.407 43.811 1.00 22.68 ? 195 THR A CG2 1 
ATOM   1511 N N   . ILE A 1 196 ? 5.548   67.561 44.066 1.00 25.44 ? 196 ILE A N   1 
ATOM   1512 C CA  . ILE A 1 196 ? 4.812   67.307 45.304 1.00 24.10 ? 196 ILE A CA  1 
ATOM   1513 C C   . ILE A 1 196 ? 5.849   67.288 46.432 1.00 24.28 ? 196 ILE A C   1 
ATOM   1514 O O   . ILE A 1 196 ? 6.856   66.600 46.320 1.00 24.37 ? 196 ILE A O   1 
ATOM   1515 C CB  . ILE A 1 196 ? 4.040   65.957 45.266 1.00 21.44 ? 196 ILE A CB  1 
ATOM   1516 C CG1 . ILE A 1 196 ? 4.990   64.777 45.476 1.00 22.51 ? 196 ILE A CG1 1 
ATOM   1517 C CG2 . ILE A 1 196 ? 3.323   65.818 43.946 1.00 23.46 ? 196 ILE A CG2 1 
ATOM   1518 C CD1 . ILE A 1 196 ? 4.305   63.413 45.467 1.00 20.04 ? 196 ILE A CD1 1 
ATOM   1519 N N   . PHE A 1 197 ? 5.633   68.070 47.492 1.00 25.67 ? 197 PHE A N   1 
ATOM   1520 C CA  . PHE A 1 197 ? 6.571   68.102 48.630 1.00 27.09 ? 197 PHE A CA  1 
ATOM   1521 C C   . PHE A 1 197 ? 5.869   67.987 49.986 1.00 27.38 ? 197 PHE A C   1 
ATOM   1522 O O   . PHE A 1 197 ? 4.753   68.474 50.154 1.00 29.71 ? 197 PHE A O   1 
ATOM   1523 C CB  . PHE A 1 197 ? 7.448   69.368 48.585 1.00 26.55 ? 197 PHE A CB  1 
ATOM   1524 C CG  . PHE A 1 197 ? 6.706   70.659 48.817 1.00 24.62 ? 197 PHE A CG  1 
ATOM   1525 C CD1 . PHE A 1 197 ? 5.584   70.987 48.070 1.00 25.09 ? 197 PHE A CD1 1 
ATOM   1526 C CD2 . PHE A 1 197 ? 7.164   71.571 49.761 1.00 26.76 ? 197 PHE A CD2 1 
ATOM   1527 C CE1 . PHE A 1 197 ? 4.930   72.204 48.259 1.00 23.17 ? 197 PHE A CE1 1 
ATOM   1528 C CE2 . PHE A 1 197 ? 6.515   72.793 49.956 1.00 24.14 ? 197 PHE A CE2 1 
ATOM   1529 C CZ  . PHE A 1 197 ? 5.398   73.105 49.201 1.00 23.51 ? 197 PHE A CZ  1 
ATOM   1530 N N   . GLY A 1 198 ? 6.504   67.338 50.957 1.00 25.09 ? 198 GLY A N   1 
ATOM   1531 C CA  . GLY A 1 198 ? 5.841   67.198 52.241 1.00 27.10 ? 198 GLY A CA  1 
ATOM   1532 C C   . GLY A 1 198 ? 6.746   67.043 53.444 1.00 28.98 ? 198 GLY A C   1 
ATOM   1533 O O   . GLY A 1 198 ? 7.962   66.925 53.301 1.00 31.23 ? 198 GLY A O   1 
ATOM   1534 N N   . GLU A 1 199 ? 6.154   67.052 54.637 1.00 28.51 ? 199 GLU A N   1 
ATOM   1535 C CA  . GLU A 1 199 ? 6.917   66.904 55.872 1.00 28.73 ? 199 GLU A CA  1 
ATOM   1536 C C   . GLU A 1 199 ? 6.405   65.716 56.668 1.00 28.01 ? 199 GLU A C   1 
ATOM   1537 O O   . GLU A 1 199 ? 5.225   65.388 56.595 1.00 30.65 ? 199 GLU A O   1 
ATOM   1538 C CB  . GLU A 1 199 ? 6.806   68.165 56.722 1.00 29.26 ? 199 GLU A CB  1 
ATOM   1539 C CG  . GLU A 1 199 ? 8.053   68.463 57.533 1.00 29.85 ? 199 GLU A CG  1 
ATOM   1540 C CD  . GLU A 1 199 ? 8.023   67.821 58.910 1.00 32.01 ? 199 GLU A CD  1 
ATOM   1541 O OE1 . GLU A 1 199 ? 6.927   67.402 59.347 1.00 25.16 ? 199 GLU A OE1 1 
ATOM   1542 O OE2 . GLU A 1 199 ? 9.102   67.743 59.549 1.00 33.77 ? 199 GLU A OE2 1 
ATOM   1543 N N   . SER A 1 200 ? 7.294   65.078 57.423 1.00 26.50 ? 200 SER A N   1 
ATOM   1544 C CA  . SER A 1 200 ? 6.930   63.917 58.235 1.00 26.48 ? 200 SER A CA  1 
ATOM   1545 C C   . SER A 1 200 ? 6.096   62.918 57.437 1.00 24.07 ? 200 SER A C   1 
ATOM   1546 O O   . SER A 1 200 ? 6.561   62.383 56.440 1.00 24.33 ? 200 SER A O   1 
ATOM   1547 C CB  . SER A 1 200 ? 6.160   64.360 59.488 1.00 28.91 ? 200 SER A CB  1 
ATOM   1548 O OG  . SER A 1 200 ? 6.355   63.467 60.583 1.00 33.94 ? 200 SER A OG  1 
ATOM   1549 N N   . ALA A 1 201 ? 4.865   62.668 57.875 1.00 23.50 ? 201 ALA A N   1 
ATOM   1550 C CA  . ALA A 1 201 ? 3.993   61.718 57.189 1.00 21.21 ? 201 ALA A CA  1 
ATOM   1551 C C   . ALA A 1 201 ? 3.749   62.165 55.762 1.00 20.67 ? 201 ALA A C   1 
ATOM   1552 O O   . ALA A 1 201 ? 3.467   61.345 54.891 1.00 19.03 ? 201 ALA A O   1 
ATOM   1553 C CB  . ALA A 1 201 ? 2.671   61.583 57.928 1.00 18.76 ? 201 ALA A CB  1 
ATOM   1554 N N   . GLY A 1 202 ? 3.858   63.472 55.537 1.00 22.09 ? 202 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 202 ? 3.662   64.032 54.211 1.00 24.10 ? 202 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 202 ? 4.863   63.778 53.314 1.00 25.99 ? 202 GLY A C   1 
ATOM   1557 O O   . GLY A 1 202 ? 4.741   63.758 52.084 1.00 27.00 ? 202 GLY A O   1 
ATOM   1558 N N   . GLY A 1 203 ? 6.028   63.596 53.935 1.00 24.95 ? 203 GLY A N   1 
ATOM   1559 C CA  . GLY A 1 203 ? 7.244   63.316 53.193 1.00 22.52 ? 203 GLY A CA  1 
ATOM   1560 C C   . GLY A 1 203 ? 7.275   61.834 52.879 1.00 22.72 ? 203 GLY A C   1 
ATOM   1561 O O   . GLY A 1 203 ? 7.822   61.411 51.867 1.00 23.42 ? 203 GLY A O   1 
ATOM   1562 N N   . ALA A 1 204 ? 6.678   61.044 53.765 1.00 24.37 ? 204 ALA A N   1 
ATOM   1563 C CA  . ALA A 1 204 ? 6.589   59.598 53.600 1.00 26.21 ? 204 ALA A CA  1 
ATOM   1564 C C   . ALA A 1 204 ? 5.505   59.284 52.540 1.00 27.19 ? 204 ALA A C   1 
ATOM   1565 O O   . ALA A 1 204 ? 5.580   58.283 51.817 1.00 28.34 ? 204 ALA A O   1 
ATOM   1566 C CB  . ALA A 1 204 ? 6.240   58.938 54.954 1.00 20.98 ? 204 ALA A CB  1 
ATOM   1567 N N   . SER A 1 205 ? 4.494   60.147 52.467 1.00 27.52 ? 205 SER A N   1 
ATOM   1568 C CA  . SER A 1 205 ? 3.413   60.000 51.501 1.00 24.76 ? 205 SER A CA  1 
ATOM   1569 C C   . SER A 1 205 ? 3.983   60.349 50.128 1.00 24.98 ? 205 SER A C   1 
ATOM   1570 O O   . SER A 1 205 ? 3.716   59.676 49.141 1.00 27.51 ? 205 SER A O   1 
ATOM   1571 C CB  . SER A 1 205 ? 2.267   60.953 51.840 1.00 23.13 ? 205 SER A CB  1 
ATOM   1572 O OG  . SER A 1 205 ? 1.793   60.741 53.153 1.00 21.35 ? 205 SER A OG  1 
ATOM   1573 N N   . VAL A 1 206 ? 4.771   61.414 50.069 1.00 23.78 ? 206 VAL A N   1 
ATOM   1574 C CA  . VAL A 1 206 ? 5.382   61.821 48.817 1.00 23.14 ? 206 VAL A CA  1 
ATOM   1575 C C   . VAL A 1 206 ? 6.035   60.604 48.189 1.00 24.22 ? 206 VAL A C   1 
ATOM   1576 O O   . VAL A 1 206 ? 5.666   60.180 47.097 1.00 28.42 ? 206 VAL A O   1 
ATOM   1577 C CB  . VAL A 1 206 ? 6.467   62.875 49.044 1.00 20.79 ? 206 VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 206 ? 7.371   62.949 47.834 1.00 19.13 ? 206 VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 206 ? 5.830   64.218 49.338 1.00 18.80 ? 206 VAL A CG2 1 
ATOM   1580 N N   . GLY A 1 207 ? 7.001   60.040 48.903 1.00 23.76 ? 207 GLY A N   1 
ATOM   1581 C CA  . GLY A 1 207 ? 7.716   58.881 48.408 1.00 22.89 ? 207 GLY A CA  1 
ATOM   1582 C C   . GLY A 1 207 ? 6.864   57.642 48.256 1.00 23.65 ? 207 GLY A C   1 
ATOM   1583 O O   . GLY A 1 207 ? 7.269   56.697 47.584 1.00 26.66 ? 207 GLY A O   1 
ATOM   1584 N N   . MET A 1 208 ? 5.694   57.619 48.885 1.00 23.21 ? 208 MET A N   1 
ATOM   1585 C CA  . MET A 1 208 ? 4.820   56.458 48.762 1.00 21.45 ? 208 MET A CA  1 
ATOM   1586 C C   . MET A 1 208 ? 4.165   56.532 47.391 1.00 21.74 ? 208 MET A C   1 
ATOM   1587 O O   . MET A 1 208 ? 3.757   55.522 46.822 1.00 23.13 ? 208 MET A O   1 
ATOM   1588 C CB  . MET A 1 208 ? 3.766   56.456 49.871 1.00 17.39 ? 208 MET A CB  1 
ATOM   1589 C CG  . MET A 1 208 ? 4.206   55.675 51.092 1.00 19.23 ? 208 MET A CG  1 
ATOM   1590 S SD  . MET A 1 208 ? 3.188   55.921 52.554 1.00 19.61 ? 208 MET A SD  1 
ATOM   1591 C CE  . MET A 1 208 ? 3.873   54.692 53.586 1.00 23.89 ? 208 MET A CE  1 
ATOM   1592 N N   . HIS A 1 209 ? 4.097   57.748 46.859 1.00 22.06 ? 209 HIS A N   1 
ATOM   1593 C CA  . HIS A 1 209 ? 3.515   58.005 45.550 1.00 22.56 ? 209 HIS A CA  1 
ATOM   1594 C C   . HIS A 1 209 ? 4.543   57.757 44.454 1.00 24.27 ? 209 HIS A C   1 
ATOM   1595 O O   . HIS A 1 209 ? 4.205   57.687 43.275 1.00 27.14 ? 209 HIS A O   1 
ATOM   1596 C CB  . HIS A 1 209 ? 3.010   59.441 45.495 1.00 21.44 ? 209 HIS A CB  1 
ATOM   1597 C CG  . HIS A 1 209 ? 1.723   59.644 46.233 1.00 20.52 ? 209 HIS A CG  1 
ATOM   1598 N ND1 . HIS A 1 209 ? 0.609   58.865 46.004 1.00 18.92 ? 209 HIS A ND1 1 
ATOM   1599 C CD2 . HIS A 1 209 ? 1.388   60.499 47.228 1.00 19.90 ? 209 HIS A CD2 1 
ATOM   1600 C CE1 . HIS A 1 209 ? -0.357  59.229 46.829 1.00 21.10 ? 209 HIS A CE1 1 
ATOM   1601 N NE2 . HIS A 1 209 ? 0.090   60.219 47.582 1.00 22.11 ? 209 HIS A NE2 1 
ATOM   1602 N N   . ILE A 1 210 ? 5.802   57.628 44.862 1.00 23.66 ? 210 ILE A N   1 
ATOM   1603 C CA  . ILE A 1 210 ? 6.904   57.352 43.949 1.00 21.28 ? 210 ILE A CA  1 
ATOM   1604 C C   . ILE A 1 210 ? 6.972   55.838 43.810 1.00 22.68 ? 210 ILE A C   1 
ATOM   1605 O O   . ILE A 1 210 ? 7.370   55.318 42.774 1.00 23.92 ? 210 ILE A O   1 
ATOM   1606 C CB  . ILE A 1 210 ? 8.259   57.838 44.531 1.00 19.66 ? 210 ILE A CB  1 
ATOM   1607 C CG1 . ILE A 1 210 ? 8.408   59.342 44.363 1.00 14.90 ? 210 ILE A CG1 1 
ATOM   1608 C CG2 . ILE A 1 210 ? 9.419   57.126 43.848 1.00 16.90 ? 210 ILE A CG2 1 
ATOM   1609 C CD1 . ILE A 1 210 ? 9.607   59.872 45.112 1.00 17.56 ? 210 ILE A CD1 1 
ATOM   1610 N N   . LEU A 1 211 ? 6.593   55.140 44.877 1.00 24.57 ? 211 LEU A N   1 
ATOM   1611 C CA  . LEU A 1 211 ? 6.609   53.684 44.899 1.00 26.12 ? 211 LEU A CA  1 
ATOM   1612 C C   . LEU A 1 211 ? 5.338   53.139 44.282 1.00 28.45 ? 211 LEU A C   1 
ATOM   1613 O O   . LEU A 1 211 ? 5.382   52.251 43.437 1.00 31.23 ? 211 LEU A O   1 
ATOM   1614 C CB  . LEU A 1 211 ? 6.714   53.172 46.333 1.00 27.09 ? 211 LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 211 ? 8.011   53.385 47.110 1.00 23.58 ? 211 LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 211 ? 7.701   53.320 48.586 1.00 21.89 ? 211 LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 211 ? 9.018   52.323 46.745 1.00 22.59 ? 211 LEU A CD2 1 
ATOM   1618 N N   . SER A 1 212 ? 4.200   53.675 44.710 1.00 30.24 ? 212 SER A N   1 
ATOM   1619 C CA  . SER A 1 212 ? 2.909   53.233 44.197 1.00 29.62 ? 212 SER A CA  1 
ATOM   1620 C C   . SER A 1 212 ? 2.756   53.439 42.696 1.00 31.15 ? 212 SER A C   1 
ATOM   1621 O O   . SER A 1 212 ? 2.708   54.579 42.219 1.00 30.29 ? 212 SER A O   1 
ATOM   1622 C CB  . SER A 1 212 ? 1.783   53.966 44.904 1.00 29.23 ? 212 SER A CB  1 
ATOM   1623 O OG  . SER A 1 212 ? 0.622   53.159 44.934 1.00 31.30 ? 212 SER A OG  1 
ATOM   1624 N N   . PRO A 1 213 ? 2.672   52.329 41.935 1.00 31.15 ? 213 PRO A N   1 
ATOM   1625 C CA  . PRO A 1 213 ? 2.518   52.302 40.475 1.00 29.71 ? 213 PRO A CA  1 
ATOM   1626 C C   . PRO A 1 213 ? 1.356   53.160 39.988 1.00 28.04 ? 213 PRO A C   1 
ATOM   1627 O O   . PRO A 1 213 ? 1.441   53.819 38.957 1.00 28.01 ? 213 PRO A O   1 
ATOM   1628 C CB  . PRO A 1 213 ? 2.279   50.826 40.165 1.00 29.38 ? 213 PRO A CB  1 
ATOM   1629 C CG  . PRO A 1 213 ? 2.906   50.092 41.289 1.00 29.81 ? 213 PRO A CG  1 
ATOM   1630 C CD  . PRO A 1 213 ? 2.740   50.967 42.497 1.00 32.16 ? 213 PRO A CD  1 
ATOM   1631 N N   . GLY A 1 214 ? 0.271   53.146 40.747 1.00 27.89 ? 214 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 214 ? -0.904  53.902 40.365 1.00 29.41 ? 214 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 214 ? -0.844  55.413 40.465 1.00 31.09 ? 214 GLY A C   1 
ATOM   1634 O O   . GLY A 1 214 ? -1.809  56.074 40.083 1.00 34.65 ? 214 GLY A O   1 
ATOM   1635 N N   . SER A 1 215 ? 0.253   55.978 40.969 1.00 30.48 ? 215 SER A N   1 
ATOM   1636 C CA  . SER A 1 215 ? 0.343   57.433 41.078 1.00 27.75 ? 215 SER A CA  1 
ATOM   1637 C C   . SER A 1 215 ? 1.612   58.068 40.507 1.00 28.67 ? 215 SER A C   1 
ATOM   1638 O O   . SER A 1 215 ? 1.660   59.287 40.354 1.00 30.06 ? 215 SER A O   1 
ATOM   1639 C CB  . SER A 1 215 ? 0.187   57.868 42.536 1.00 25.25 ? 215 SER A CB  1 
ATOM   1640 O OG  . SER A 1 215 ? -0.227  56.789 43.348 1.00 26.66 ? 215 SER A OG  1 
ATOM   1641 N N   . ARG A 1 216 ? 2.634   57.272 40.187 1.00 27.48 ? 216 ARG A N   1 
ATOM   1642 C CA  . ARG A 1 216 ? 3.869   57.848 39.657 1.00 26.70 ? 216 ARG A CA  1 
ATOM   1643 C C   . ARG A 1 216 ? 3.636   58.770 38.452 1.00 27.53 ? 216 ARG A C   1 
ATOM   1644 O O   . ARG A 1 216 ? 4.300   59.806 38.305 1.00 28.45 ? 216 ARG A O   1 
ATOM   1645 C CB  . ARG A 1 216 ? 4.898   56.762 39.263 1.00 25.46 ? 216 ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 216 ? 4.511   55.305 39.480 1.00 25.01 ? 216 ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 216 ? 5.612   54.552 40.227 1.00 25.37 ? 216 ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 216 ? 6.302   53.537 39.430 1.00 25.73 ? 216 ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 216 ? 6.404   52.248 39.768 1.00 27.04 ? 216 ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 216 ? 5.860   51.797 40.890 1.00 23.76 ? 216 ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 216 ? 7.073   51.402 38.994 1.00 27.58 ? 216 ARG A NH2 1 
ATOM   1652 N N   . ASP A 1 217 ? 2.685   58.406 37.601 1.00 25.64 ? 217 ASP A N   1 
ATOM   1653 C CA  . ASP A 1 217 ? 2.414   59.195 36.408 1.00 25.56 ? 217 ASP A CA  1 
ATOM   1654 C C   . ASP A 1 217 ? 1.686   60.494 36.698 1.00 24.60 ? 217 ASP A C   1 
ATOM   1655 O O   . ASP A 1 217 ? 1.451   61.280 35.789 1.00 25.98 ? 217 ASP A O   1 
ATOM   1656 C CB  . ASP A 1 217 ? 1.596   58.369 35.409 1.00 28.61 ? 217 ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 217 ? 2.215   57.002 35.121 1.00 32.63 ? 217 ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 217 ? 3.454   56.869 35.218 1.00 36.19 ? 217 ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 217 ? 1.462   56.057 34.792 1.00 33.54 ? 217 ASP A OD2 1 
ATOM   1660 N N   . LEU A 1 218 ? 1.346   60.724 37.965 1.00 23.72 ? 218 LEU A N   1 
ATOM   1661 C CA  . LEU A 1 218 ? 0.603   61.917 38.375 1.00 20.51 ? 218 LEU A CA  1 
ATOM   1662 C C   . LEU A 1 218 ? 1.415   63.143 38.771 1.00 22.91 ? 218 LEU A C   1 
ATOM   1663 O O   . LEU A 1 218 ? 0.838   64.196 39.071 1.00 25.67 ? 218 LEU A O   1 
ATOM   1664 C CB  . LEU A 1 218 ? -0.330  61.570 39.526 1.00 17.50 ? 218 LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 218 ? -1.825  61.535 39.233 1.00 16.91 ? 218 LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 218 ? -2.061  61.179 37.785 1.00 14.95 ? 218 LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 218 ? -2.496  60.528 40.161 1.00 17.90 ? 218 LEU A CD2 1 
ATOM   1668 N N   . PHE A 1 219 ? 2.740   63.019 38.786 1.00 22.58 ? 219 PHE A N   1 
ATOM   1669 C CA  . PHE A 1 219 ? 3.609   64.146 39.128 1.00 21.30 ? 219 PHE A CA  1 
ATOM   1670 C C   . PHE A 1 219 ? 4.980   63.965 38.468 1.00 23.29 ? 219 PHE A C   1 
ATOM   1671 O O   . PHE A 1 219 ? 5.268   62.897 37.925 1.00 24.84 ? 219 PHE A O   1 
ATOM   1672 C CB  . PHE A 1 219 ? 3.754   64.260 40.648 1.00 16.82 ? 219 PHE A CB  1 
ATOM   1673 C CG  . PHE A 1 219 ? 4.288   63.023 41.296 1.00 13.29 ? 219 PHE A CG  1 
ATOM   1674 C CD1 . PHE A 1 219 ? 3.432   61.990 41.658 1.00 12.76 ? 219 PHE A CD1 1 
ATOM   1675 C CD2 . PHE A 1 219 ? 5.648   62.873 41.510 1.00 8.03  ? 219 PHE A CD2 1 
ATOM   1676 C CE1 . PHE A 1 219 ? 3.930   60.825 42.220 1.00 11.21 ? 219 PHE A CE1 1 
ATOM   1677 C CE2 . PHE A 1 219 ? 6.151   61.710 42.070 1.00 11.00 ? 219 PHE A CE2 1 
ATOM   1678 C CZ  . PHE A 1 219 ? 5.290   60.685 42.424 1.00 11.89 ? 219 PHE A CZ  1 
ATOM   1679 N N   . ARG A 1 220 ? 5.820   64.998 38.513 1.00 25.23 ? 220 ARG A N   1 
ATOM   1680 C CA  . ARG A 1 220 ? 7.145   64.929 37.893 1.00 26.95 ? 220 ARG A CA  1 
ATOM   1681 C C   . ARG A 1 220 ? 8.295   64.635 38.855 1.00 28.50 ? 220 ARG A C   1 
ATOM   1682 O O   . ARG A 1 220 ? 8.962   63.596 38.743 1.00 30.93 ? 220 ARG A O   1 
ATOM   1683 C CB  . ARG A 1 220 ? 7.449   66.230 37.141 1.00 27.78 ? 220 ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 220 ? 8.655   66.142 36.197 1.00 28.67 ? 220 ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 220 ? 8.295   66.589 34.778 1.00 31.61 ? 220 ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 220 ? 9.441   66.528 33.871 1.00 32.45 ? 220 ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 220 ? 9.588   67.288 32.787 1.00 31.67 ? 220 ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 220 ? 8.660   68.185 32.456 1.00 26.67 ? 220 ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 220 ? 10.672  67.148 32.032 1.00 31.83 ? 220 ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 221 ? 8.538   65.560 39.782 1.00 27.25 ? 221 ARG A N   1 
ATOM   1691 C CA  . ARG A 1 221 ? 9.612   65.410 40.759 1.00 25.53 ? 221 ARG A CA  1 
ATOM   1692 C C   . ARG A 1 221 ? 9.080   65.594 42.182 1.00 24.39 ? 221 ARG A C   1 
ATOM   1693 O O   . ARG A 1 221 ? 7.954   66.061 42.370 1.00 24.70 ? 221 ARG A O   1 
ATOM   1694 C CB  . ARG A 1 221 ? 10.731  66.414 40.464 1.00 25.01 ? 221 ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 221 ? 10.271  67.845 40.331 1.00 28.97 ? 221 ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 221 ? 11.415  68.739 39.885 1.00 32.73 ? 221 ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 221 ? 11.214  69.271 38.540 1.00 33.31 ? 221 ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 221 ? 11.800  68.791 37.450 1.00 31.12 ? 221 ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 221 ? 12.629  67.759 37.545 1.00 26.42 ? 221 ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 221 ? 11.558  69.348 36.269 1.00 30.49 ? 221 ARG A NH2 1 
ATOM   1701 N N   . ALA A 1 222 ? 9.889   65.227 43.179 1.00 23.37 ? 222 ALA A N   1 
ATOM   1702 C CA  . ALA A 1 222 ? 9.467   65.322 44.574 1.00 21.31 ? 222 ALA A CA  1 
ATOM   1703 C C   . ALA A 1 222 ? 10.485  65.868 45.563 1.00 21.83 ? 222 ALA A C   1 
ATOM   1704 O O   . ALA A 1 222 ? 11.700  65.755 45.365 1.00 23.24 ? 222 ALA A O   1 
ATOM   1705 C CB  . ALA A 1 222 ? 8.992   63.963 45.057 1.00 16.26 ? 222 ALA A CB  1 
ATOM   1706 N N   . ILE A 1 223 ? 9.949   66.462 46.633 1.00 21.59 ? 223 ILE A N   1 
ATOM   1707 C CA  . ILE A 1 223 ? 10.718  67.027 47.736 1.00 19.21 ? 223 ILE A CA  1 
ATOM   1708 C C   . ILE A 1 223 ? 10.187  66.321 48.985 1.00 20.60 ? 223 ILE A C   1 
ATOM   1709 O O   . ILE A 1 223 ? 8.984   66.335 49.250 1.00 21.69 ? 223 ILE A O   1 
ATOM   1710 C CB  . ILE A 1 223 ? 10.493  68.571 47.873 1.00 16.54 ? 223 ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 223 ? 11.250  69.321 46.770 1.00 16.85 ? 223 ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 223 ? 11.000  69.070 49.211 1.00 8.64  ? 223 ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 223 ? 10.553  70.581 46.267 1.00 7.67  ? 223 ILE A CD1 1 
ATOM   1714 N N   . LEU A 1 224 ? 11.079  65.673 49.724 1.00 20.54 ? 224 LEU A N   1 
ATOM   1715 C CA  . LEU A 1 224 ? 10.701  64.973 50.951 1.00 19.88 ? 224 LEU A CA  1 
ATOM   1716 C C   . LEU A 1 224 ? 11.409  65.614 52.141 1.00 19.94 ? 224 LEU A C   1 
ATOM   1717 O O   . LEU A 1 224 ? 12.637  65.690 52.175 1.00 19.88 ? 224 LEU A O   1 
ATOM   1718 C CB  . LEU A 1 224 ? 11.097  63.494 50.885 1.00 18.78 ? 224 LEU A CB  1 
ATOM   1719 C CG  . LEU A 1 224 ? 10.597  62.637 49.725 1.00 16.58 ? 224 LEU A CG  1 
ATOM   1720 C CD1 . LEU A 1 224 ? 11.493  62.853 48.522 1.00 12.78 ? 224 LEU A CD1 1 
ATOM   1721 C CD2 . LEU A 1 224 ? 10.601  61.171 50.137 1.00 10.10 ? 224 LEU A CD2 1 
ATOM   1722 N N   . GLN A 1 225 ? 10.632  66.070 53.117 1.00 19.93 ? 225 GLN A N   1 
ATOM   1723 C CA  . GLN A 1 225 ? 11.186  66.697 54.309 1.00 19.87 ? 225 GLN A CA  1 
ATOM   1724 C C   . GLN A 1 225 ? 10.905  65.880 55.581 1.00 18.20 ? 225 GLN A C   1 
ATOM   1725 O O   . GLN A 1 225 ? 9.755   65.595 55.914 1.00 15.63 ? 225 GLN A O   1 
ATOM   1726 C CB  . GLN A 1 225 ? 10.616  68.109 54.454 1.00 22.39 ? 225 GLN A CB  1 
ATOM   1727 C CG  . GLN A 1 225 ? 11.022  69.066 53.343 1.00 25.55 ? 225 GLN A CG  1 
ATOM   1728 C CD  . GLN A 1 225 ? 9.956   70.125 53.072 1.00 27.90 ? 225 GLN A CD  1 
ATOM   1729 O OE1 . GLN A 1 225 ? 9.634   70.428 51.918 1.00 29.22 ? 225 GLN A OE1 1 
ATOM   1730 N NE2 . GLN A 1 225 ? 9.405   70.690 54.138 1.00 28.28 ? 225 GLN A NE2 1 
ATOM   1731 N N   . SER A 1 226 ? 11.973  65.505 56.282 1.00 21.31 ? 226 SER A N   1 
ATOM   1732 C CA  . SER A 1 226 ? 11.881  64.729 57.527 1.00 23.69 ? 226 SER A CA  1 
ATOM   1733 C C   . SER A 1 226 ? 10.928  63.536 57.418 1.00 22.99 ? 226 SER A C   1 
ATOM   1734 O O   . SER A 1 226 ? 10.135  63.277 58.325 1.00 22.47 ? 226 SER A O   1 
ATOM   1735 C CB  . SER A 1 226 ? 11.431  65.633 58.692 1.00 24.73 ? 226 SER A CB  1 
ATOM   1736 O OG  . SER A 1 226 ? 12.293  66.745 58.876 1.00 23.46 ? 226 SER A OG  1 
ATOM   1737 N N   . GLY A 1 227 ? 11.013  62.805 56.312 1.00 22.76 ? 227 GLY A N   1 
ATOM   1738 C CA  . GLY A 1 227 ? 10.131  61.668 56.132 1.00 22.90 ? 227 GLY A CA  1 
ATOM   1739 C C   . GLY A 1 227 ? 10.548  60.753 55.007 1.00 22.89 ? 227 GLY A C   1 
ATOM   1740 O O   . GLY A 1 227 ? 11.234  61.162 54.078 1.00 22.52 ? 227 GLY A O   1 
ATOM   1741 N N   . SER A 1 228 ? 10.131  59.499 55.103 1.00 24.24 ? 228 SER A N   1 
ATOM   1742 C CA  . SER A 1 228 ? 10.447  58.488 54.103 1.00 24.18 ? 228 SER A CA  1 
ATOM   1743 C C   . SER A 1 228 ? 9.327   57.458 54.131 1.00 26.16 ? 228 SER A C   1 
ATOM   1744 O O   . SER A 1 228 ? 8.671   57.278 55.159 1.00 29.93 ? 228 SER A O   1 
ATOM   1745 C CB  . SER A 1 228 ? 11.768  57.819 54.437 1.00 21.66 ? 228 SER A CB  1 
ATOM   1746 O OG  . SER A 1 228 ? 12.530  57.650 53.266 1.00 25.57 ? 228 SER A OG  1 
ATOM   1747 N N   . PRO A 1 229 ? 9.106   56.743 53.019 1.00 23.78 ? 229 PRO A N   1 
ATOM   1748 C CA  . PRO A 1 229 ? 8.023   55.754 53.032 1.00 21.68 ? 229 PRO A CA  1 
ATOM   1749 C C   . PRO A 1 229 ? 8.452   54.532 53.828 1.00 20.39 ? 229 PRO A C   1 
ATOM   1750 O O   . PRO A 1 229 ? 7.638   53.828 54.420 1.00 19.58 ? 229 PRO A O   1 
ATOM   1751 C CB  . PRO A 1 229 ? 7.822   55.449 51.556 1.00 20.71 ? 229 PRO A CB  1 
ATOM   1752 C CG  . PRO A 1 229 ? 9.209   55.587 50.994 1.00 18.77 ? 229 PRO A CG  1 
ATOM   1753 C CD  . PRO A 1 229 ? 9.837   56.737 51.742 1.00 20.99 ? 229 PRO A CD  1 
ATOM   1754 N N   . ASN A 1 230 ? 9.756   54.297 53.836 1.00 20.77 ? 230 ASN A N   1 
ATOM   1755 C CA  . ASN A 1 230 ? 10.323  53.170 54.551 1.00 20.72 ? 230 ASN A CA  1 
ATOM   1756 C C   . ASN A 1 230 ? 10.629  53.548 55.991 1.00 21.09 ? 230 ASN A C   1 
ATOM   1757 O O   . ASN A 1 230 ? 11.566  53.031 56.584 1.00 22.28 ? 230 ASN A O   1 
ATOM   1758 C CB  . ASN A 1 230 ? 11.595  52.683 53.849 1.00 20.28 ? 230 ASN A CB  1 
ATOM   1759 C CG  . ASN A 1 230 ? 12.753  53.653 53.988 1.00 20.65 ? 230 ASN A CG  1 
ATOM   1760 O OD1 . ASN A 1 230 ? 12.644  54.828 53.642 1.00 18.65 ? 230 ASN A OD1 1 
ATOM   1761 N ND2 . ASN A 1 230 ? 13.877  53.159 54.495 1.00 25.37 ? 230 ASN A ND2 1 
ATOM   1762 N N   . CYS A 1 231 ? 9.845   54.470 56.540 1.00 21.43 ? 231 CYS A N   1 
ATOM   1763 C CA  . CYS A 1 231 ? 10.014  54.892 57.923 1.00 22.92 ? 231 CYS A CA  1 
ATOM   1764 C C   . CYS A 1 231 ? 9.204   53.894 58.781 1.00 25.19 ? 231 CYS A C   1 
ATOM   1765 O O   . CYS A 1 231 ? 8.066   53.534 58.429 1.00 30.10 ? 231 CYS A O   1 
ATOM   1766 C CB  . CYS A 1 231 ? 9.491   56.318 58.106 1.00 24.81 ? 231 CYS A CB  1 
ATOM   1767 S SG  . CYS A 1 231 ? 10.766  57.611 58.142 1.00 29.83 ? 231 CYS A SG  1 
ATOM   1768 N N   . PRO A 1 232 ? 9.776   53.443 59.918 1.00 21.11 ? 232 PRO A N   1 
ATOM   1769 C CA  . PRO A 1 232 ? 9.176   52.483 60.851 1.00 16.36 ? 232 PRO A CA  1 
ATOM   1770 C C   . PRO A 1 232 ? 7.770   52.753 61.348 1.00 15.65 ? 232 PRO A C   1 
ATOM   1771 O O   . PRO A 1 232 ? 7.044   51.834 61.711 1.00 15.52 ? 232 PRO A O   1 
ATOM   1772 C CB  . PRO A 1 232 ? 10.174  52.434 62.006 1.00 17.98 ? 232 PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 232 ? 11.044  53.625 61.837 1.00 15.83 ? 232 PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 232 ? 11.098  53.892 60.389 1.00 18.39 ? 232 PRO A CD  1 
ATOM   1775 N N   . TRP A 1 233 ? 7.382   54.013 61.368 1.00 17.42 ? 233 TRP A N   1 
ATOM   1776 C CA  . TRP A 1 233 ? 6.068   54.395 61.860 1.00 17.29 ? 233 TRP A CA  1 
ATOM   1777 C C   . TRP A 1 233 ? 5.179   54.776 60.705 1.00 21.06 ? 233 TRP A C   1 
ATOM   1778 O O   . TRP A 1 233 ? 4.023   55.138 60.900 1.00 25.41 ? 233 TRP A O   1 
ATOM   1779 C CB  . TRP A 1 233 ? 6.228   55.604 62.751 1.00 16.48 ? 233 TRP A CB  1 
ATOM   1780 C CG  . TRP A 1 233 ? 7.068   56.629 62.073 1.00 16.51 ? 233 TRP A CG  1 
ATOM   1781 C CD1 . TRP A 1 233 ? 8.417   56.802 62.196 1.00 17.02 ? 233 TRP A CD1 1 
ATOM   1782 C CD2 . TRP A 1 233 ? 6.618   57.614 61.132 1.00 17.65 ? 233 TRP A CD2 1 
ATOM   1783 N NE1 . TRP A 1 233 ? 8.838   57.838 61.389 1.00 19.78 ? 233 TRP A NE1 1 
ATOM   1784 C CE2 . TRP A 1 233 ? 7.752   58.352 60.727 1.00 17.59 ? 233 TRP A CE2 1 
ATOM   1785 C CE3 . TRP A 1 233 ? 5.367   57.943 60.594 1.00 15.44 ? 233 TRP A CE3 1 
ATOM   1786 C CZ2 . TRP A 1 233 ? 7.669   59.397 59.811 1.00 14.74 ? 233 TRP A CZ2 1 
ATOM   1787 C CZ3 . TRP A 1 233 ? 5.287   58.983 59.687 1.00 15.81 ? 233 TRP A CZ3 1 
ATOM   1788 C CH2 . TRP A 1 233 ? 6.431   59.698 59.305 1.00 14.81 ? 233 TRP A CH2 1 
ATOM   1789 N N   . ALA A 1 234 ? 5.723   54.721 59.498 1.00 22.11 ? 234 ALA A N   1 
ATOM   1790 C CA  . ALA A 1 234 ? 4.961   55.100 58.326 1.00 22.20 ? 234 ALA A CA  1 
ATOM   1791 C C   . ALA A 1 234 ? 4.035   54.010 57.805 1.00 23.24 ? 234 ALA A C   1 
ATOM   1792 O O   . ALA A 1 234 ? 3.157   54.290 57.003 1.00 24.91 ? 234 ALA A O   1 
ATOM   1793 C CB  . ALA A 1 234 ? 5.899   55.541 57.233 1.00 23.51 ? 234 ALA A CB  1 
ATOM   1794 N N   . SER A 1 235 ? 4.205   52.772 58.255 1.00 23.84 ? 235 SER A N   1 
ATOM   1795 C CA  . SER A 1 235 ? 3.340   51.703 57.769 1.00 23.15 ? 235 SER A CA  1 
ATOM   1796 C C   . SER A 1 235 ? 3.302   50.492 58.668 1.00 23.66 ? 235 SER A C   1 
ATOM   1797 O O   . SER A 1 235 ? 4.239   50.241 59.416 1.00 25.93 ? 235 SER A O   1 
ATOM   1798 C CB  . SER A 1 235 ? 3.806   51.245 56.398 1.00 25.69 ? 235 SER A CB  1 
ATOM   1799 O OG  . SER A 1 235 ? 4.975   50.453 56.523 1.00 29.37 ? 235 SER A OG  1 
ATOM   1800 N N   . VAL A 1 236 ? 2.213   49.737 58.579 1.00 23.20 ? 236 VAL A N   1 
ATOM   1801 C CA  . VAL A 1 236 ? 2.046   48.515 59.359 1.00 21.78 ? 236 VAL A CA  1 
ATOM   1802 C C   . VAL A 1 236 ? 1.650   47.436 58.373 1.00 24.97 ? 236 VAL A C   1 
ATOM   1803 O O   . VAL A 1 236 ? 1.264   47.741 57.247 1.00 25.42 ? 236 VAL A O   1 
ATOM   1804 C CB  . VAL A 1 236 ? 0.915   48.630 60.388 1.00 17.17 ? 236 VAL A CB  1 
ATOM   1805 C CG1 . VAL A 1 236 ? 0.876   50.013 60.961 1.00 18.50 ? 236 VAL A CG1 1 
ATOM   1806 C CG2 . VAL A 1 236 ? -0.408  48.305 59.741 1.00 14.69 ? 236 VAL A CG2 1 
ATOM   1807 N N   . SER A 1 237 ? 1.737   46.179 58.787 1.00 25.94 ? 237 SER A N   1 
ATOM   1808 C CA  . SER A 1 237 ? 1.347   45.099 57.902 1.00 25.37 ? 237 SER A CA  1 
ATOM   1809 C C   . SER A 1 237 ? -0.175  45.018 57.882 1.00 26.63 ? 237 SER A C   1 
ATOM   1810 O O   . SER A 1 237 ? -0.857  45.712 58.642 1.00 25.88 ? 237 SER A O   1 
ATOM   1811 C CB  . SER A 1 237 ? 1.926   43.779 58.388 1.00 26.81 ? 237 SER A CB  1 
ATOM   1812 O OG  . SER A 1 237 ? 1.207   43.300 59.509 1.00 31.85 ? 237 SER A OG  1 
ATOM   1813 N N   . VAL A 1 238 ? -0.704  44.168 57.008 1.00 27.58 ? 238 VAL A N   1 
ATOM   1814 C CA  . VAL A 1 238 ? -2.144  43.994 56.890 1.00 28.54 ? 238 VAL A CA  1 
ATOM   1815 C C   . VAL A 1 238 ? -2.661  43.222 58.092 1.00 30.35 ? 238 VAL A C   1 
ATOM   1816 O O   . VAL A 1 238 ? -3.830  43.333 58.473 1.00 32.31 ? 238 VAL A O   1 
ATOM   1817 C CB  . VAL A 1 238 ? -2.499  43.241 55.608 1.00 26.24 ? 238 VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 238 ? -2.863  44.236 54.528 1.00 27.60 ? 238 VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 238 ? -1.327  42.399 55.164 1.00 23.55 ? 238 VAL A CG2 1 
ATOM   1820 N N   . ALA A 1 239 ? -1.783  42.430 58.690 1.00 30.68 ? 239 ALA A N   1 
ATOM   1821 C CA  . ALA A 1 239 ? -2.158  41.669 59.867 1.00 31.98 ? 239 ALA A CA  1 
ATOM   1822 C C   . ALA A 1 239 ? -2.252  42.646 61.039 1.00 33.08 ? 239 ALA A C   1 
ATOM   1823 O O   . ALA A 1 239 ? -3.257  42.675 61.763 1.00 32.67 ? 239 ALA A O   1 
ATOM   1824 C CB  . ALA A 1 239 ? -1.119  40.611 60.148 1.00 32.35 ? 239 ALA A CB  1 
ATOM   1825 N N   . GLU A 1 240 ? -1.201  43.451 61.210 1.00 31.67 ? 240 GLU A N   1 
ATOM   1826 C CA  . GLU A 1 240 ? -1.150  44.437 62.278 1.00 29.81 ? 240 GLU A CA  1 
ATOM   1827 C C   . GLU A 1 240 ? -2.305  45.415 62.167 1.00 29.79 ? 240 GLU A C   1 
ATOM   1828 O O   . GLU A 1 240 ? -2.945  45.755 63.158 1.00 30.17 ? 240 GLU A O   1 
ATOM   1829 C CB  . GLU A 1 240 ? 0.162   45.206 62.229 1.00 29.46 ? 240 GLU A CB  1 
ATOM   1830 C CG  . GLU A 1 240 ? 0.290   46.249 63.324 1.00 30.09 ? 240 GLU A CG  1 
ATOM   1831 C CD  . GLU A 1 240 ? -0.111  45.717 64.688 1.00 30.92 ? 240 GLU A CD  1 
ATOM   1832 O OE1 . GLU A 1 240 ? -0.096  44.478 64.880 1.00 28.64 ? 240 GLU A OE1 1 
ATOM   1833 O OE2 . GLU A 1 240 ? -0.439  46.541 65.570 1.00 31.53 ? 240 GLU A OE2 1 
ATOM   1834 N N   . GLY A 1 241 ? -2.571  45.881 60.957 1.00 29.87 ? 241 GLY A N   1 
ATOM   1835 C CA  . GLY A 1 241 ? -3.671  46.808 60.784 1.00 32.56 ? 241 GLY A CA  1 
ATOM   1836 C C   . GLY A 1 241 ? -4.983  46.126 61.123 1.00 32.45 ? 241 GLY A C   1 
ATOM   1837 O O   . GLY A 1 241 ? -5.890  46.727 61.696 1.00 32.20 ? 241 GLY A O   1 
ATOM   1838 N N   . ARG A 1 242 ? -5.075  44.854 60.755 1.00 33.14 ? 242 ARG A N   1 
ATOM   1839 C CA  . ARG A 1 242 ? -6.266  44.061 61.011 1.00 34.58 ? 242 ARG A CA  1 
ATOM   1840 C C   . ARG A 1 242 ? -6.424  43.922 62.520 1.00 33.83 ? 242 ARG A C   1 
ATOM   1841 O O   . ARG A 1 242 ? -7.423  44.354 63.099 1.00 32.84 ? 242 ARG A O   1 
ATOM   1842 C CB  . ARG A 1 242 ? -6.113  42.678 60.355 1.00 36.83 ? 242 ARG A CB  1 
ATOM   1843 C CG  . ARG A 1 242 ? -7.390  41.838 60.294 1.00 38.32 ? 242 ARG A CG  1 
ATOM   1844 C CD  . ARG A 1 242 ? -7.350  40.830 59.135 1.00 39.92 ? 242 ARG A CD  1 
ATOM   1845 N NE  . ARG A 1 242 ? -8.308  41.158 58.076 1.00 39.46 ? 242 ARG A NE  1 
ATOM   1846 C CZ  . ARG A 1 242 ? -9.626  41.225 58.251 1.00 38.71 ? 242 ARG A CZ  1 
ATOM   1847 N NH1 . ARG A 1 242 ? -10.154 40.986 59.443 1.00 39.58 ? 242 ARG A NH1 1 
ATOM   1848 N NH2 . ARG A 1 242 ? -10.421 41.546 57.240 1.00 38.46 ? 242 ARG A NH2 1 
ATOM   1849 N N   . ARG A 1 243 ? -5.415  43.327 63.148 1.00 33.58 ? 243 ARG A N   1 
ATOM   1850 C CA  . ARG A 1 243 ? -5.412  43.117 64.590 1.00 32.80 ? 243 ARG A CA  1 
ATOM   1851 C C   . ARG A 1 243 ? -5.685  44.394 65.376 1.00 31.10 ? 243 ARG A C   1 
ATOM   1852 O O   . ARG A 1 243 ? -6.473  44.386 66.317 1.00 33.93 ? 243 ARG A O   1 
ATOM   1853 C CB  . ARG A 1 243 ? -4.071  42.526 65.028 1.00 33.34 ? 243 ARG A CB  1 
ATOM   1854 C CG  . ARG A 1 243 ? -3.853  42.493 66.529 1.00 32.27 ? 243 ARG A CG  1 
ATOM   1855 C CD  . ARG A 1 243 ? -2.751  43.459 66.966 1.00 30.03 ? 243 ARG A CD  1 
ATOM   1856 N NE  . ARG A 1 243 ? -3.123  44.160 68.192 1.00 28.07 ? 243 ARG A NE  1 
ATOM   1857 C CZ  . ARG A 1 243 ? -2.630  45.332 68.566 1.00 25.76 ? 243 ARG A CZ  1 
ATOM   1858 N NH1 . ARG A 1 243 ? -1.737  45.949 67.812 1.00 27.84 ? 243 ARG A NH1 1 
ATOM   1859 N NH2 . ARG A 1 243 ? -3.037  45.886 69.698 1.00 29.74 ? 243 ARG A NH2 1 
ATOM   1860 N N   . ARG A 1 244 ? -5.049  45.496 65.002 1.00 29.18 ? 244 ARG A N   1 
ATOM   1861 C CA  . ARG A 1 244 ? -5.282  46.721 65.743 1.00 29.47 ? 244 ARG A CA  1 
ATOM   1862 C C   . ARG A 1 244 ? -6.529  47.467 65.289 1.00 30.18 ? 244 ARG A C   1 
ATOM   1863 O O   . ARG A 1 244 ? -6.879  48.495 65.862 1.00 31.42 ? 244 ARG A O   1 
ATOM   1864 C CB  . ARG A 1 244 ? -4.044  47.632 65.704 1.00 27.20 ? 244 ARG A CB  1 
ATOM   1865 C CG  . ARG A 1 244 ? -3.673  48.182 64.363 1.00 23.24 ? 244 ARG A CG  1 
ATOM   1866 C CD  . ARG A 1 244 ? -2.687  49.320 64.534 1.00 23.43 ? 244 ARG A CD  1 
ATOM   1867 N NE  . ARG A 1 244 ? -1.332  48.847 64.797 1.00 21.33 ? 244 ARG A NE  1 
ATOM   1868 C CZ  . ARG A 1 244 ? -0.243  49.607 64.713 1.00 21.71 ? 244 ARG A CZ  1 
ATOM   1869 N NH1 . ARG A 1 244 ? -0.336  50.883 64.376 1.00 22.21 ? 244 ARG A NH1 1 
ATOM   1870 N NH2 . ARG A 1 244 ? 0.948   49.088 64.953 1.00 22.06 ? 244 ARG A NH2 1 
ATOM   1871 N N   . ALA A 1 245 ? -7.203  46.949 64.264 1.00 30.70 ? 245 ALA A N   1 
ATOM   1872 C CA  . ALA A 1 245 ? -8.438  47.565 63.782 1.00 31.14 ? 245 ALA A CA  1 
ATOM   1873 C C   . ALA A 1 245 ? -9.550  46.928 64.604 1.00 31.77 ? 245 ALA A C   1 
ATOM   1874 O O   . ALA A 1 245 ? -10.500 47.590 65.016 1.00 31.20 ? 245 ALA A O   1 
ATOM   1875 C CB  . ALA A 1 245 ? -8.643  47.275 62.314 1.00 35.18 ? 245 ALA A CB  1 
ATOM   1876 N N   . VAL A 1 246 ? -9.412  45.625 64.829 1.00 31.58 ? 246 VAL A N   1 
ATOM   1877 C CA  . VAL A 1 246 ? -10.355 44.870 65.635 1.00 31.95 ? 246 VAL A CA  1 
ATOM   1878 C C   . VAL A 1 246 ? -10.284 45.422 67.059 1.00 32.02 ? 246 VAL A C   1 
ATOM   1879 O O   . VAL A 1 246 ? -11.307 45.662 67.695 1.00 33.06 ? 246 VAL A O   1 
ATOM   1880 C CB  . VAL A 1 246 ? -9.973  43.383 65.666 1.00 33.80 ? 246 VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 246 ? -10.480 42.735 66.946 1.00 33.80 ? 246 VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 246 ? -10.535 42.681 64.445 1.00 35.45 ? 246 VAL A CG2 1 
ATOM   1883 N N   . GLU A 1 247 ? -9.064  45.618 67.555 1.00 31.62 ? 247 GLU A N   1 
ATOM   1884 C CA  . GLU A 1 247 ? -8.872  46.157 68.896 1.00 30.32 ? 247 GLU A CA  1 
ATOM   1885 C C   . GLU A 1 247 ? -9.566  47.505 69.054 1.00 28.64 ? 247 GLU A C   1 
ATOM   1886 O O   . GLU A 1 247 ? -9.760  47.975 70.170 1.00 29.42 ? 247 GLU A O   1 
ATOM   1887 C CB  . GLU A 1 247 ? -7.385  46.312 69.209 1.00 30.76 ? 247 GLU A CB  1 
ATOM   1888 C CG  . GLU A 1 247 ? -7.094  46.670 70.664 1.00 34.18 ? 247 GLU A CG  1 
ATOM   1889 C CD  . GLU A 1 247 ? -7.366  45.523 71.629 1.00 36.61 ? 247 GLU A CD  1 
ATOM   1890 O OE1 . GLU A 1 247 ? -7.071  44.359 71.285 1.00 39.31 ? 247 GLU A OE1 1 
ATOM   1891 O OE2 . GLU A 1 247 ? -7.878  45.784 72.737 1.00 38.94 ? 247 GLU A OE2 1 
ATOM   1892 N N   . LEU A 1 248 ? -9.928  48.135 67.943 1.00 25.25 ? 248 LEU A N   1 
ATOM   1893 C CA  . LEU A 1 248 ? -10.617 49.404 68.031 1.00 24.22 ? 248 LEU A CA  1 
ATOM   1894 C C   . LEU A 1 248 ? -12.083 49.074 68.272 1.00 24.57 ? 248 LEU A C   1 
ATOM   1895 O O   . LEU A 1 248 ? -12.741 49.683 69.104 1.00 26.33 ? 248 LEU A O   1 
ATOM   1896 C CB  . LEU A 1 248 ? -10.447 50.216 66.743 1.00 25.19 ? 248 LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 248 ? -11.004 51.649 66.773 1.00 24.37 ? 248 LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 248 ? -9.976  52.564 67.388 1.00 26.43 ? 248 LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 248 ? -11.367 52.128 65.373 1.00 23.35 ? 248 LEU A CD2 1 
ATOM   1900 N N   . GLY A 1 249 ? -12.601 48.096 67.549 1.00 26.22 ? 249 GLY A N   1 
ATOM   1901 C CA  . GLY A 1 249 ? -13.987 47.725 67.753 1.00 26.57 ? 249 GLY A CA  1 
ATOM   1902 C C   . GLY A 1 249 ? -14.146 47.273 69.188 1.00 27.72 ? 249 GLY A C   1 
ATOM   1903 O O   . GLY A 1 249 ? -15.061 47.697 69.888 1.00 28.93 ? 249 GLY A O   1 
ATOM   1904 N N   . ARG A 1 250 ? -13.229 46.415 69.620 1.00 28.17 ? 250 ARG A N   1 
ATOM   1905 C CA  . ARG A 1 250 ? -13.214 45.878 70.975 1.00 29.70 ? 250 ARG A CA  1 
ATOM   1906 C C   . ARG A 1 250 ? -13.242 46.992 72.016 1.00 31.81 ? 250 ARG A C   1 
ATOM   1907 O O   . ARG A 1 250 ? -13.829 46.841 73.092 1.00 32.35 ? 250 ARG A O   1 
ATOM   1908 C CB  . ARG A 1 250 ? -11.948 45.045 71.175 1.00 30.48 ? 250 ARG A CB  1 
ATOM   1909 C CG  . ARG A 1 250 ? -12.137 43.771 71.979 1.00 31.60 ? 250 ARG A CG  1 
ATOM   1910 C CD  . ARG A 1 250 ? -10.817 43.020 72.143 1.00 33.05 ? 250 ARG A CD  1 
ATOM   1911 N NE  . ARG A 1 250 ? -10.500 42.175 70.990 1.00 34.50 ? 250 ARG A NE  1 
ATOM   1912 C CZ  . ARG A 1 250 ? -9.777  41.061 71.055 0.00 33.40 ? 250 ARG A CZ  1 
ATOM   1913 N NH1 . ARG A 1 250 ? -9.292  40.650 72.219 0.00 33.41 ? 250 ARG A NH1 1 
ATOM   1914 N NH2 . ARG A 1 250 ? -9.539  40.359 69.956 0.00 33.38 ? 250 ARG A NH2 1 
ATOM   1915 N N   . ASN A 1 251 ? -12.592 48.106 71.687 1.00 33.57 ? 251 ASN A N   1 
ATOM   1916 C CA  . ASN A 1 251 ? -12.502 49.264 72.580 1.00 34.74 ? 251 ASN A CA  1 
ATOM   1917 C C   . ASN A 1 251 ? -13.790 50.095 72.612 1.00 34.97 ? 251 ASN A C   1 
ATOM   1918 O O   . ASN A 1 251 ? -14.091 50.738 73.614 1.00 37.02 ? 251 ASN A O   1 
ATOM   1919 C CB  . ASN A 1 251 ? -11.314 50.156 72.166 1.00 33.39 ? 251 ASN A CB  1 
ATOM   1920 C CG  . ASN A 1 251 ? -10.178 50.150 73.189 1.00 33.45 ? 251 ASN A CG  1 
ATOM   1921 O OD1 . ASN A 1 251 ? -10.140 50.986 74.099 1.00 33.85 ? 251 ASN A OD1 1 
ATOM   1922 N ND2 . ASN A 1 251 ? -9.242  49.214 73.036 1.00 29.23 ? 251 ASN A ND2 1 
ATOM   1923 N N   . LEU A 1 252 ? -14.544 50.095 71.517 1.00 35.64 ? 252 LEU A N   1 
ATOM   1924 C CA  . LEU A 1 252 ? -15.790 50.855 71.465 1.00 36.26 ? 252 LEU A CA  1 
ATOM   1925 C C   . LEU A 1 252 ? -16.965 49.916 71.608 1.00 38.24 ? 252 LEU A C   1 
ATOM   1926 O O   . LEU A 1 252 ? -18.103 50.269 71.300 1.00 37.47 ? 252 LEU A O   1 
ATOM   1927 C CB  . LEU A 1 252 ? -15.907 51.608 70.152 1.00 33.88 ? 252 LEU A CB  1 
ATOM   1928 C CG  . LEU A 1 252 ? -15.189 52.950 70.189 1.00 33.79 ? 252 LEU A CG  1 
ATOM   1929 C CD1 . LEU A 1 252 ? -14.786 53.340 68.772 1.00 34.32 ? 252 LEU A CD1 1 
ATOM   1930 C CD2 . LEU A 1 252 ? -16.094 53.998 70.828 1.00 33.07 ? 252 LEU A CD2 1 
ATOM   1931 N N   . ASN A 1 253 ? -16.657 48.712 72.078 1.00 40.58 ? 253 ASN A N   1 
ATOM   1932 C CA  . ASN A 1 253 ? -17.638 47.661 72.303 1.00 42.85 ? 253 ASN A CA  1 
ATOM   1933 C C   . ASN A 1 253 ? -18.482 47.361 71.078 1.00 41.60 ? 253 ASN A C   1 
ATOM   1934 O O   . ASN A 1 253 ? -19.706 47.498 71.090 1.00 41.29 ? 253 ASN A O   1 
ATOM   1935 C CB  . ASN A 1 253 ? -18.516 48.024 73.505 1.00 46.63 ? 253 ASN A CB  1 
ATOM   1936 C CG  . ASN A 1 253 ? -17.781 47.833 74.834 1.00 49.74 ? 253 ASN A CG  1 
ATOM   1937 O OD1 . ASN A 1 253 ? -17.026 46.865 75.000 1.00 48.88 ? 253 ASN A OD1 1 
ATOM   1938 N ND2 . ASN A 1 253 ? -17.993 48.755 75.779 1.00 47.06 ? 253 ASN A ND2 1 
ATOM   1939 N N   . CYS A 1 254 ? -17.798 46.945 70.018 1.00 40.71 ? 254 CYS A N   1 
ATOM   1940 C CA  . CYS A 1 254 ? -18.436 46.600 68.758 1.00 40.12 ? 254 CYS A CA  1 
ATOM   1941 C C   . CYS A 1 254 ? -18.605 45.097 68.690 1.00 40.04 ? 254 CYS A C   1 
ATOM   1942 O O   . CYS A 1 254 ? -18.109 44.367 69.546 1.00 37.94 ? 254 CYS A O   1 
ATOM   1943 C CB  . CYS A 1 254 ? -17.566 47.024 67.573 1.00 39.63 ? 254 CYS A CB  1 
ATOM   1944 S SG  . CYS A 1 254 ? -17.687 48.770 67.107 1.00 38.50 ? 254 CYS A SG  1 
ATOM   1945 N N   . ASN A 1 255 ? -19.307 44.647 67.655 1.00 41.60 ? 255 ASN A N   1 
ATOM   1946 C CA  . ASN A 1 255 ? -19.513 43.230 67.427 1.00 40.65 ? 255 ASN A CA  1 
ATOM   1947 C C   . ASN A 1 255 ? -18.391 42.842 66.489 1.00 38.55 ? 255 ASN A C   1 
ATOM   1948 O O   . ASN A 1 255 ? -18.237 43.438 65.426 1.00 38.29 ? 255 ASN A O   1 
ATOM   1949 C CB  . ASN A 1 255 ? -20.850 42.976 66.743 1.00 43.14 ? 255 ASN A CB  1 
ATOM   1950 C CG  . ASN A 1 255 ? -21.014 41.529 66.331 1.00 46.65 ? 255 ASN A CG  1 
ATOM   1951 O OD1 . ASN A 1 255 ? -20.237 40.999 65.525 1.00 46.80 ? 255 ASN A OD1 1 
ATOM   1952 N ND2 . ASN A 1 255 ? -22.022 40.873 66.890 1.00 47.59 ? 255 ASN A ND2 1 
ATOM   1953 N N   . LEU A 1 256 ? -17.600 41.854 66.876 1.00 37.34 ? 256 LEU A N   1 
ATOM   1954 C CA  . LEU A 1 256 ? -16.492 41.446 66.035 1.00 37.80 ? 256 LEU A CA  1 
ATOM   1955 C C   . LEU A 1 256 ? -16.698 40.070 65.469 1.00 38.73 ? 256 LEU A C   1 
ATOM   1956 O O   . LEU A 1 256 ? -15.731 39.368 65.179 1.00 40.71 ? 256 LEU A O   1 
ATOM   1957 C CB  . LEU A 1 256 ? -15.186 41.476 66.821 1.00 35.47 ? 256 LEU A CB  1 
ATOM   1958 C CG  . LEU A 1 256 ? -15.081 42.634 67.805 1.00 33.44 ? 256 LEU A CG  1 
ATOM   1959 C CD1 . LEU A 1 256 ? -13.852 42.454 68.680 1.00 32.88 ? 256 LEU A CD1 1 
ATOM   1960 C CD2 . LEU A 1 256 ? -15.026 43.936 67.033 1.00 32.48 ? 256 LEU A CD2 1 
ATOM   1961 N N   . ASN A 1 257 ? -17.956 39.677 65.316 1.00 40.26 ? 257 ASN A N   1 
ATOM   1962 C CA  . ASN A 1 257 ? -18.254 38.363 64.771 1.00 39.67 ? 257 ASN A CA  1 
ATOM   1963 C C   . ASN A 1 257 ? -17.681 38.285 63.352 1.00 40.27 ? 257 ASN A C   1 
ATOM   1964 O O   . ASN A 1 257 ? -17.106 37.269 62.960 1.00 40.38 ? 257 ASN A O   1 
ATOM   1965 C CB  . ASN A 1 257 ? -19.767 38.132 64.758 1.00 38.00 ? 257 ASN A CB  1 
ATOM   1966 C CG  . ASN A 1 257 ? -20.132 36.662 64.699 0.00 37.21 ? 257 ASN A CG  1 
ATOM   1967 O OD1 . ASN A 1 257 ? -19.261 35.792 64.717 0.00 36.69 ? 257 ASN A OD1 1 
ATOM   1968 N ND2 . ASN A 1 257 ? -21.427 36.376 64.627 0.00 36.67 ? 257 ASN A ND2 1 
ATOM   1969 N N   . SER A 1 258 ? -17.816 39.377 62.599 1.00 41.27 ? 258 SER A N   1 
ATOM   1970 C CA  . SER A 1 258 ? -17.321 39.444 61.227 1.00 40.49 ? 258 SER A CA  1 
ATOM   1971 C C   . SER A 1 258 ? -16.999 40.873 60.811 1.00 42.13 ? 258 SER A C   1 
ATOM   1972 O O   . SER A 1 258 ? -17.502 41.836 61.400 1.00 43.92 ? 258 SER A O   1 
ATOM   1973 C CB  . SER A 1 258 ? -18.366 38.884 60.281 1.00 41.09 ? 258 SER A CB  1 
ATOM   1974 O OG  . SER A 1 258 ? -19.658 39.295 60.690 1.00 40.68 ? 258 SER A OG  1 
ATOM   1975 N N   . ASP A 1 259 ? -16.162 41.002 59.785 1.00 42.22 ? 259 ASP A N   1 
ATOM   1976 C CA  . ASP A 1 259 ? -15.765 42.308 59.261 1.00 40.36 ? 259 ASP A CA  1 
ATOM   1977 C C   . ASP A 1 259 ? -16.979 43.224 59.139 1.00 40.16 ? 259 ASP A C   1 
ATOM   1978 O O   . ASP A 1 259 ? -17.008 44.323 59.700 1.00 38.26 ? 259 ASP A O   1 
ATOM   1979 C CB  . ASP A 1 259 ? -15.132 42.153 57.873 1.00 41.52 ? 259 ASP A CB  1 
ATOM   1980 C CG  . ASP A 1 259 ? -13.665 41.741 57.927 1.00 43.76 ? 259 ASP A CG  1 
ATOM   1981 O OD1 . ASP A 1 259 ? -13.120 41.591 59.043 1.00 44.32 ? 259 ASP A OD1 1 
ATOM   1982 O OD2 . ASP A 1 259 ? -13.059 41.567 56.844 1.00 42.45 ? 259 ASP A OD2 1 
ATOM   1983 N N   . GLU A 1 260 ? -17.976 42.745 58.398 1.00 39.97 ? 260 GLU A N   1 
ATOM   1984 C CA  . GLU A 1 260 ? -19.214 43.472 58.135 1.00 40.20 ? 260 GLU A CA  1 
ATOM   1985 C C   . GLU A 1 260 ? -19.847 44.077 59.373 1.00 39.30 ? 260 GLU A C   1 
ATOM   1986 O O   . GLU A 1 260 ? -20.283 45.231 59.358 1.00 39.29 ? 260 GLU A O   1 
ATOM   1987 C CB  . GLU A 1 260 ? -20.221 42.543 57.456 1.00 43.43 ? 260 GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 260 ? -19.692 41.870 56.184 1.00 47.37 ? 260 GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 260 ? -18.670 40.771 56.466 1.00 46.96 ? 260 GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 260 ? -19.033 39.774 57.125 0.00 45.37 ? 260 GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 260 ? -17.509 40.911 56.028 0.00 45.38 ? 260 GLU A OE2 1 
ATOM   1992 N N   . GLU A 1 261 ? -19.912 43.293 60.442 1.00 39.01 ? 261 GLU A N   1 
ATOM   1993 C CA  . GLU A 1 261 ? -20.488 43.777 61.690 1.00 38.83 ? 261 GLU A CA  1 
ATOM   1994 C C   . GLU A 1 261 ? -19.607 44.899 62.232 1.00 37.19 ? 261 GLU A C   1 
ATOM   1995 O O   . GLU A 1 261 ? -20.081 46.007 62.489 1.00 35.20 ? 261 GLU A O   1 
ATOM   1996 C CB  . GLU A 1 261 ? -20.572 42.639 62.706 1.00 41.43 ? 261 GLU A CB  1 
ATOM   1997 C CG  . GLU A 1 261 ? -20.768 41.275 62.087 1.00 42.05 ? 261 GLU A CG  1 
ATOM   1998 C CD  . GLU A 1 261 ? -22.150 40.717 62.345 1.00 46.68 ? 261 GLU A CD  1 
ATOM   1999 O OE1 . GLU A 1 261 ? -22.994 41.452 62.912 1.00 45.44 ? 261 GLU A OE1 1 
ATOM   2000 O OE2 . GLU A 1 261 ? -22.391 39.539 61.980 1.00 51.25 ? 261 GLU A OE2 1 
ATOM   2001 N N   . LEU A 1 262 ? -18.322 44.591 62.395 1.00 35.84 ? 262 LEU A N   1 
ATOM   2002 C CA  . LEU A 1 262 ? -17.333 45.548 62.880 1.00 35.55 ? 262 LEU A CA  1 
ATOM   2003 C C   . LEU A 1 262 ? -17.432 46.847 62.085 1.00 35.59 ? 262 LEU A C   1 
ATOM   2004 O O   . LEU A 1 262 ? -17.853 47.884 62.611 1.00 34.53 ? 262 LEU A O   1 
ATOM   2005 C CB  . LEU A 1 262 ? -15.931 44.959 62.713 1.00 36.42 ? 262 LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 262 ? -14.733 45.613 63.405 1.00 34.18 ? 262 LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 262 ? -15.168 46.301 64.686 1.00 33.35 ? 262 LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 262 ? -13.691 44.543 63.692 1.00 32.69 ? 262 LEU A CD2 1 
ATOM   2009 N N   . ILE A 1 263 ? -17.040 46.775 60.812 1.00 35.72 ? 263 ILE A N   1 
ATOM   2010 C CA  . ILE A 1 263 ? -17.081 47.932 59.917 1.00 35.54 ? 263 ILE A CA  1 
ATOM   2011 C C   . ILE A 1 263 ? -18.391 48.676 60.093 1.00 36.81 ? 263 ILE A C   1 
ATOM   2012 O O   . ILE A 1 263 ? -18.396 49.897 60.190 1.00 40.42 ? 263 ILE A O   1 
ATOM   2013 C CB  . ILE A 1 263 ? -16.965 47.534 58.416 1.00 33.57 ? 263 ILE A CB  1 
ATOM   2014 C CG1 . ILE A 1 263 ? -15.516 47.198 58.060 1.00 29.72 ? 263 ILE A CG1 1 
ATOM   2015 C CG2 . ILE A 1 263 ? -17.457 48.674 57.533 1.00 29.91 ? 263 ILE A CG2 1 
ATOM   2016 C CD1 . ILE A 1 263 ? -15.382 46.477 56.747 1.00 26.15 ? 263 ILE A CD1 1 
ATOM   2017 N N   . HIS A 1 264 ? -19.507 47.956 60.132 1.00 36.77 ? 264 HIS A N   1 
ATOM   2018 C CA  . HIS A 1 264 ? -20.761 48.655 60.295 1.00 38.24 ? 264 HIS A CA  1 
ATOM   2019 C C   . HIS A 1 264 ? -20.738 49.392 61.612 1.00 38.10 ? 264 HIS A C   1 
ATOM   2020 O O   . HIS A 1 264 ? -21.007 50.592 61.668 1.00 39.69 ? 264 HIS A O   1 
ATOM   2021 C CB  . HIS A 1 264 ? -21.964 47.720 60.295 1.00 42.85 ? 264 HIS A CB  1 
ATOM   2022 C CG  . HIS A 1 264 ? -23.235 48.409 60.700 1.00 50.62 ? 264 HIS A CG  1 
ATOM   2023 N ND1 . HIS A 1 264 ? -24.078 47.917 61.675 1.00 52.48 ? 264 HIS A ND1 1 
ATOM   2024 C CD2 . HIS A 1 264 ? -23.774 49.588 60.299 1.00 53.27 ? 264 HIS A CD2 1 
ATOM   2025 C CE1 . HIS A 1 264 ? -25.078 48.762 61.858 1.00 53.84 ? 264 HIS A CE1 1 
ATOM   2026 N NE2 . HIS A 1 264 ? -24.917 49.785 61.035 1.00 54.15 ? 264 HIS A NE2 1 
ATOM   2027 N N   . CYS A 1 265 ? -20.413 48.671 62.677 1.00 37.71 ? 265 CYS A N   1 
ATOM   2028 C CA  . CYS A 1 265 ? -20.385 49.271 64.000 1.00 35.70 ? 265 CYS A CA  1 
ATOM   2029 C C   . CYS A 1 265 ? -19.520 50.511 64.025 1.00 32.75 ? 265 CYS A C   1 
ATOM   2030 O O   . CYS A 1 265 ? -19.957 51.573 64.466 1.00 31.35 ? 265 CYS A O   1 
ATOM   2031 C CB  . CYS A 1 265 ? -19.862 48.279 65.033 1.00 39.35 ? 265 CYS A CB  1 
ATOM   2032 S SG  . CYS A 1 265 ? -19.656 49.034 66.679 1.00 47.43 ? 265 CYS A SG  1 
ATOM   2033 N N   . LEU A 1 266 ? -18.288 50.373 63.550 1.00 29.39 ? 266 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 266 ? -17.373 51.496 63.547 1.00 26.20 ? 266 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 266 ? -17.986 52.646 62.791 1.00 26.06 ? 266 LEU A C   1 
ATOM   2036 O O   . LEU A 1 266 ? -17.733 53.799 63.100 1.00 27.15 ? 266 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 266 ? -16.054 51.104 62.899 1.00 24.43 ? 266 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 266 ? -14.901 50.707 63.819 1.00 24.13 ? 266 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 266 ? -15.332 50.722 65.270 1.00 22.82 ? 266 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 266 ? -14.428 49.329 63.425 1.00 25.43 ? 266 LEU A CD2 1 
ATOM   2041 N N   . ARG A 1 267 ? -18.805 52.325 61.801 1.00 26.28 ? 267 ARG A N   1 
ATOM   2042 C CA  . ARG A 1 267 ? -19.445 53.347 60.989 1.00 27.91 ? 267 ARG A CA  1 
ATOM   2043 C C   . ARG A 1 267 ? -20.632 53.996 61.690 1.00 28.44 ? 267 ARG A C   1 
ATOM   2044 O O   . ARG A 1 267 ? -21.181 54.989 61.209 1.00 27.39 ? 267 ARG A O   1 
ATOM   2045 C CB  . ARG A 1 267 ? -19.905 52.746 59.659 1.00 28.90 ? 267 ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 267 ? -18.776 52.370 58.728 1.00 24.88 ? 267 ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 267 ? -19.156 52.640 57.302 1.00 22.41 ? 267 ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 267 ? -18.117 52.149 56.415 1.00 22.78 ? 267 ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 267 ? -18.315 51.210 55.501 1.00 26.20 ? 267 ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 267 ? -19.520 50.667 55.361 1.00 28.02 ? 267 ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 267 ? -17.313 50.807 54.733 1.00 23.61 ? 267 ARG A NH2 1 
ATOM   2052 N N   . GLU A 1 268 ? -21.031 53.428 62.822 1.00 30.30 ? 268 GLU A N   1 
ATOM   2053 C CA  . GLU A 1 268 ? -22.157 53.963 63.584 1.00 31.51 ? 268 GLU A CA  1 
ATOM   2054 C C   . GLU A 1 268 ? -21.680 54.929 64.671 1.00 31.41 ? 268 GLU A C   1 
ATOM   2055 O O   . GLU A 1 268 ? -22.387 55.874 65.018 1.00 32.54 ? 268 GLU A O   1 
ATOM   2056 C CB  . GLU A 1 268 ? -22.955 52.821 64.216 1.00 31.25 ? 268 GLU A CB  1 
ATOM   2057 C CG  . GLU A 1 268 ? -24.213 52.454 63.454 1.00 32.05 ? 268 GLU A CG  1 
ATOM   2058 C CD  . GLU A 1 268 ? -25.296 51.893 64.357 1.00 33.01 ? 268 GLU A CD  1 
ATOM   2059 O OE1 . GLU A 1 268 ? -24.962 51.122 65.282 0.00 32.59 ? 268 GLU A OE1 1 
ATOM   2060 O OE2 . GLU A 1 268 ? -26.481 52.224 64.143 0.00 32.59 ? 268 GLU A OE2 1 
ATOM   2061 N N   . LYS A 1 269 ? -20.478 54.689 65.197 1.00 29.49 ? 269 LYS A N   1 
ATOM   2062 C CA  . LYS A 1 269 ? -19.906 55.533 66.235 1.00 27.25 ? 269 LYS A CA  1 
ATOM   2063 C C   . LYS A 1 269 ? -19.605 56.914 65.700 1.00 26.89 ? 269 LYS A C   1 
ATOM   2064 O O   . LYS A 1 269 ? -19.176 57.071 64.567 1.00 27.78 ? 269 LYS A O   1 
ATOM   2065 C CB  . LYS A 1 269 ? -18.616 54.917 66.777 1.00 27.22 ? 269 LYS A CB  1 
ATOM   2066 C CG  . LYS A 1 269 ? -18.801 53.553 67.393 1.00 29.07 ? 269 LYS A CG  1 
ATOM   2067 C CD  . LYS A 1 269 ? -19.976 53.548 68.360 1.00 32.72 ? 269 LYS A CD  1 
ATOM   2068 C CE  . LYS A 1 269 ? -19.878 52.391 69.353 1.00 37.81 ? 269 LYS A CE  1 
ATOM   2069 N NZ  . LYS A 1 269 ? -19.769 52.842 70.778 1.00 38.57 ? 269 LYS A NZ  1 
ATOM   2070 N N   . LYS A 1 270 ? -19.844 57.922 66.521 1.00 29.09 ? 270 LYS A N   1 
ATOM   2071 C CA  . LYS A 1 270 ? -19.568 59.289 66.128 1.00 29.91 ? 270 LYS A CA  1 
ATOM   2072 C C   . LYS A 1 270 ? -18.055 59.353 65.925 1.00 29.86 ? 270 LYS A C   1 
ATOM   2073 O O   . LYS A 1 270 ? -17.330 58.454 66.346 1.00 29.88 ? 270 LYS A O   1 
ATOM   2074 C CB  . LYS A 1 270 ? -20.006 60.247 67.239 1.00 32.33 ? 270 LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 270 ? -20.743 61.496 66.758 1.00 36.36 ? 270 LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 270 ? -21.964 61.149 65.916 1.00 37.95 ? 270 LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 270 ? -23.245 61.278 66.726 0.00 36.63 ? 270 LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 270 ? -23.418 62.652 67.273 0.00 36.91 ? 270 LYS A NZ  1 
ATOM   2079 N N   . PRO A 1 271 ? -17.559 60.413 65.279 1.00 29.48 ? 271 PRO A N   1 
ATOM   2080 C CA  . PRO A 1 271 ? -16.120 60.534 65.045 1.00 28.68 ? 271 PRO A CA  1 
ATOM   2081 C C   . PRO A 1 271 ? -15.275 60.571 66.305 1.00 27.71 ? 271 PRO A C   1 
ATOM   2082 O O   . PRO A 1 271 ? -14.307 59.829 66.432 1.00 30.11 ? 271 PRO A O   1 
ATOM   2083 C CB  . PRO A 1 271 ? -15.995 61.830 64.251 1.00 29.41 ? 271 PRO A CB  1 
ATOM   2084 C CG  . PRO A 1 271 ? -17.365 62.081 63.694 1.00 29.34 ? 271 PRO A CG  1 
ATOM   2085 C CD  . PRO A 1 271 ? -18.299 61.558 64.725 1.00 30.05 ? 271 PRO A CD  1 
ATOM   2086 N N   . GLN A 1 272 ? -15.648 61.443 67.231 1.00 27.31 ? 272 GLN A N   1 
ATOM   2087 C CA  . GLN A 1 272 ? -14.917 61.625 68.484 1.00 26.80 ? 272 GLN A CA  1 
ATOM   2088 C C   . GLN A 1 272 ? -14.824 60.393 69.392 1.00 27.48 ? 272 GLN A C   1 
ATOM   2089 O O   . GLN A 1 272 ? -14.003 60.349 70.300 1.00 26.01 ? 272 GLN A O   1 
ATOM   2090 C CB  . GLN A 1 272 ? -15.529 62.793 69.250 1.00 26.45 ? 272 GLN A CB  1 
ATOM   2091 C CG  . GLN A 1 272 ? -14.827 63.121 70.550 1.00 30.27 ? 272 GLN A CG  1 
ATOM   2092 C CD  . GLN A 1 272 ? -13.393 63.526 70.344 1.00 28.00 ? 272 GLN A CD  1 
ATOM   2093 O OE1 . GLN A 1 272 ? -13.106 64.473 69.613 1.00 31.20 ? 272 GLN A OE1 1 
ATOM   2094 N NE2 . GLN A 1 272 ? -12.478 62.810 70.985 1.00 26.94 ? 272 GLN A NE2 1 
ATOM   2095 N N   . GLU A 1 273 ? -15.667 59.394 69.157 1.00 30.02 ? 273 GLU A N   1 
ATOM   2096 C CA  . GLU A 1 273 ? -15.627 58.173 69.959 1.00 29.85 ? 273 GLU A CA  1 
ATOM   2097 C C   . GLU A 1 273 ? -14.466 57.343 69.455 1.00 30.84 ? 273 GLU A C   1 
ATOM   2098 O O   . GLU A 1 273 ? -13.779 56.683 70.230 1.00 34.68 ? 273 GLU A O   1 
ATOM   2099 C CB  . GLU A 1 273 ? -16.917 57.369 69.801 1.00 29.17 ? 273 GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 273 ? -18.190 58.174 69.977 1.00 27.29 ? 273 GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 273 ? -19.391 57.298 70.242 1.00 26.00 ? 273 GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 273 ? -19.238 56.247 70.904 1.00 23.27 ? 273 GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 273 ? -20.491 57.663 69.789 1.00 26.86 ? 273 GLU A OE2 1 
ATOM   2104 N N   . LEU A 1 274 ? -14.265 57.372 68.141 1.00 30.34 ? 274 LEU A N   1 
ATOM   2105 C CA  . LEU A 1 274 ? -13.176 56.638 67.512 1.00 28.84 ? 274 LEU A CA  1 
ATOM   2106 C C   . LEU A 1 274 ? -11.898 57.300 67.980 1.00 27.30 ? 274 LEU A C   1 
ATOM   2107 O O   . LEU A 1 274 ? -10.939 56.643 68.384 1.00 26.72 ? 274 LEU A O   1 
ATOM   2108 C CB  . LEU A 1 274 ? -13.270 56.737 65.985 1.00 28.01 ? 274 LEU A CB  1 
ATOM   2109 C CG  . LEU A 1 274 ? -13.921 55.571 65.242 1.00 26.82 ? 274 LEU A CG  1 
ATOM   2110 C CD1 . LEU A 1 274 ? -15.348 55.414 65.718 1.00 28.11 ? 274 LEU A CD1 1 
ATOM   2111 C CD2 . LEU A 1 274 ? -13.894 55.827 63.743 1.00 26.55 ? 274 LEU A CD2 1 
ATOM   2112 N N   . ILE A 1 275 ? -11.901 58.622 67.932 1.00 25.41 ? 275 ILE A N   1 
ATOM   2113 C CA  . ILE A 1 275 ? -10.740 59.376 68.341 1.00 26.59 ? 275 ILE A CA  1 
ATOM   2114 C C   . ILE A 1 275 ? -10.397 59.134 69.806 1.00 27.20 ? 275 ILE A C   1 
ATOM   2115 O O   . ILE A 1 275 ? -9.233  58.942 70.148 1.00 29.08 ? 275 ILE A O   1 
ATOM   2116 C CB  . ILE A 1 275 ? -10.962 60.861 68.099 1.00 25.17 ? 275 ILE A CB  1 
ATOM   2117 C CG1 . ILE A 1 275 ? -11.373 61.080 66.639 1.00 24.96 ? 275 ILE A CG1 1 
ATOM   2118 C CG2 . ILE A 1 275 ? -9.708  61.625 68.444 1.00 25.05 ? 275 ILE A CG2 1 
ATOM   2119 C CD1 . ILE A 1 275 ? -11.683 62.519 66.278 1.00 22.95 ? 275 ILE A CD1 1 
ATOM   2120 N N   . ASP A 1 276 ? -11.414 59.118 70.662 1.00 27.09 ? 276 ASP A N   1 
ATOM   2121 C CA  . ASP A 1 276 ? -11.214 58.904 72.092 1.00 25.96 ? 276 ASP A CA  1 
ATOM   2122 C C   . ASP A 1 276 ? -10.370 57.672 72.436 1.00 26.54 ? 276 ASP A C   1 
ATOM   2123 O O   . ASP A 1 276 ? -9.452  57.766 73.247 1.00 27.63 ? 276 ASP A O   1 
ATOM   2124 C CB  . ASP A 1 276 ? -12.566 58.804 72.805 1.00 27.86 ? 276 ASP A CB  1 
ATOM   2125 C CG  . ASP A 1 276 ? -13.089 60.157 73.275 1.00 28.45 ? 276 ASP A CG  1 
ATOM   2126 O OD1 . ASP A 1 276 ? -12.314 61.143 73.236 1.00 27.54 ? 276 ASP A OD1 1 
ATOM   2127 O OD2 . ASP A 1 276 ? -14.278 60.224 73.681 1.00 25.72 ? 276 ASP A OD2 1 
ATOM   2128 N N   . VAL A 1 277 ? -10.662 56.520 71.835 1.00 26.26 ? 277 VAL A N   1 
ATOM   2129 C CA  . VAL A 1 277 ? -9.889  55.310 72.143 1.00 27.07 ? 277 VAL A CA  1 
ATOM   2130 C C   . VAL A 1 277 ? -8.840  54.957 71.073 1.00 27.00 ? 277 VAL A C   1 
ATOM   2131 O O   . VAL A 1 277 ? -8.305  53.843 71.039 1.00 26.19 ? 277 VAL A O   1 
ATOM   2132 C CB  . VAL A 1 277 ? -10.829 54.083 72.345 1.00 26.39 ? 277 VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 277 ? -12.035 54.472 73.189 1.00 23.38 ? 277 VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 277 ? -11.279 53.546 71.000 1.00 28.88 ? 277 VAL A CG2 1 
ATOM   2135 N N   . GLU A 1 278 ? -8.528  55.923 70.219 1.00 25.90 ? 278 GLU A N   1 
ATOM   2136 C CA  . GLU A 1 278 ? -7.593  55.700 69.127 1.00 25.99 ? 278 GLU A CA  1 
ATOM   2137 C C   . GLU A 1 278 ? -6.245  55.102 69.500 1.00 23.26 ? 278 GLU A C   1 
ATOM   2138 O O   . GLU A 1 278 ? -5.842  54.086 68.950 1.00 22.96 ? 278 GLU A O   1 
ATOM   2139 C CB  . GLU A 1 278 ? -7.385  57.012 68.371 1.00 29.42 ? 278 GLU A CB  1 
ATOM   2140 C CG  . GLU A 1 278 ? -6.850  56.871 66.951 1.00 27.72 ? 278 GLU A CG  1 
ATOM   2141 C CD  . GLU A 1 278 ? -5.972  58.049 66.561 1.00 28.37 ? 278 GLU A CD  1 
ATOM   2142 O OE1 . GLU A 1 278 ? -6.506  59.068 66.065 1.00 23.85 ? 278 GLU A OE1 1 
ATOM   2143 O OE2 . GLU A 1 278 ? -4.740  57.956 66.761 1.00 33.43 ? 278 GLU A OE2 1 
ATOM   2144 N N   . TRP A 1 279 ? -5.554  55.737 70.435 1.00 22.66 ? 279 TRP A N   1 
ATOM   2145 C CA  . TRP A 1 279 ? -4.231  55.296 70.862 1.00 22.13 ? 279 TRP A CA  1 
ATOM   2146 C C   . TRP A 1 279 ? -4.161  54.022 71.688 1.00 23.63 ? 279 TRP A C   1 
ATOM   2147 O O   . TRP A 1 279 ? -3.071  53.536 71.985 1.00 25.26 ? 279 TRP A O   1 
ATOM   2148 C CB  . TRP A 1 279 ? -3.565  56.411 71.649 1.00 19.73 ? 279 TRP A CB  1 
ATOM   2149 C CG  . TRP A 1 279 ? -3.488  57.677 70.884 1.00 21.84 ? 279 TRP A CG  1 
ATOM   2150 C CD1 . TRP A 1 279 ? -4.387  58.703 70.897 1.00 19.66 ? 279 TRP A CD1 1 
ATOM   2151 C CD2 . TRP A 1 279 ? -2.458  58.053 69.967 1.00 20.95 ? 279 TRP A CD2 1 
ATOM   2152 N NE1 . TRP A 1 279 ? -3.977  59.697 70.042 1.00 20.50 ? 279 TRP A NE1 1 
ATOM   2153 C CE2 . TRP A 1 279 ? -2.796  59.322 69.459 1.00 20.02 ? 279 TRP A CE2 1 
ATOM   2154 C CE3 . TRP A 1 279 ? -1.281  57.438 69.527 1.00 22.27 ? 279 TRP A CE3 1 
ATOM   2155 C CZ2 . TRP A 1 279 ? -2.002  59.989 68.532 1.00 23.59 ? 279 TRP A CZ2 1 
ATOM   2156 C CZ3 . TRP A 1 279 ? -0.491  58.100 68.605 1.00 24.17 ? 279 TRP A CZ3 1 
ATOM   2157 C CH2 . TRP A 1 279 ? -0.855  59.366 68.117 1.00 24.75 ? 279 TRP A CH2 1 
ATOM   2158 N N   . ASN A 1 280 ? -5.306  53.470 72.058 1.00 24.55 ? 280 ASN A N   1 
ATOM   2159 C CA  . ASN A 1 280 ? -5.305  52.274 72.879 1.00 25.54 ? 280 ASN A CA  1 
ATOM   2160 C C   . ASN A 1 280 ? -4.976  50.984 72.118 1.00 27.86 ? 280 ASN A C   1 
ATOM   2161 O O   . ASN A 1 280 ? -4.773  49.934 72.732 1.00 32.05 ? 280 ASN A O   1 
ATOM   2162 C CB  . ASN A 1 280 ? -6.663  52.118 73.576 1.00 26.24 ? 280 ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 280 ? -7.096  53.369 74.334 1.00 27.44 ? 280 ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 280 ? -6.336  54.329 74.482 1.00 30.04 ? 280 ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 280 ? -8.335  53.357 74.819 1.00 27.16 ? 280 ASN A ND2 1 
ATOM   2166 N N   . VAL A 1 281 ? -4.896  51.048 70.794 1.00 27.00 ? 281 VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? -4.646  49.836 70.015 1.00 24.84 ? 281 VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? -3.189  49.500 69.682 1.00 23.59 ? 281 VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? -2.885  48.403 69.208 1.00 18.93 ? 281 VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? -5.485  49.876 68.728 1.00 25.71 ? 281 VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? -6.927  50.203 69.079 1.00 22.87 ? 281 VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? -4.930  50.922 67.767 1.00 27.09 ? 281 VAL A CG2 1 
ATOM   2173 N N   . LEU A 1 282 ? -2.290  50.442 69.931 1.00 23.46 ? 282 LEU A N   1 
ATOM   2174 C CA  . LEU A 1 282 ? -0.875  50.217 69.671 1.00 24.13 ? 282 LEU A CA  1 
ATOM   2175 C C   . LEU A 1 282 ? -0.399  49.006 70.456 1.00 25.46 ? 282 LEU A C   1 
ATOM   2176 O O   . LEU A 1 282 ? -0.844  48.772 71.579 1.00 28.04 ? 282 LEU A O   1 
ATOM   2177 C CB  . LEU A 1 282 ? -0.069  51.441 70.076 1.00 22.00 ? 282 LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 282 ? -0.024  52.471 68.961 1.00 18.65 ? 282 LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 282 ? 0.229   53.834 69.542 1.00 18.85 ? 282 LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 282 ? 1.056   52.079 67.977 1.00 18.76 ? 282 LEU A CD2 1 
ATOM   2181 N N   . PRO A 1 283 ? 0.522   48.222 69.875 1.00 26.64 ? 283 PRO A N   1 
ATOM   2182 C CA  . PRO A 1 283 ? 1.080   47.010 70.487 1.00 26.10 ? 283 PRO A CA  1 
ATOM   2183 C C   . PRO A 1 283 ? 1.979   47.196 71.709 1.00 27.28 ? 283 PRO A C   1 
ATOM   2184 O O   . PRO A 1 283 ? 2.144   46.268 72.509 1.00 26.15 ? 283 PRO A O   1 
ATOM   2185 C CB  . PRO A 1 283 ? 1.820   46.331 69.334 1.00 22.90 ? 283 PRO A CB  1 
ATOM   2186 C CG  . PRO A 1 283 ? 1.369   47.053 68.096 1.00 25.33 ? 283 PRO A CG  1 
ATOM   2187 C CD  . PRO A 1 283 ? 1.091   48.447 68.542 1.00 25.71 ? 283 PRO A CD  1 
ATOM   2188 N N   . PHE A 1 284 ? 2.574   48.374 71.855 1.00 27.45 ? 284 PHE A N   1 
ATOM   2189 C CA  . PHE A 1 284 ? 3.433   48.604 73.001 1.00 27.40 ? 284 PHE A CA  1 
ATOM   2190 C C   . PHE A 1 284 ? 3.537   50.045 73.410 1.00 27.60 ? 284 PHE A C   1 
ATOM   2191 O O   . PHE A 1 284 ? 3.077   50.937 72.705 1.00 28.32 ? 284 PHE A O   1 
ATOM   2192 C CB  . PHE A 1 284 ? 4.855   48.110 72.743 1.00 27.84 ? 284 PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 284 ? 5.013   47.278 71.511 1.00 28.23 ? 284 PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 284 ? 5.202   47.878 70.273 1.00 30.63 ? 284 PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 284 ? 5.064   45.890 71.600 1.00 29.15 ? 284 PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 284 ? 5.451   47.106 69.135 1.00 32.32 ? 284 PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 284 ? 5.312   45.106 70.476 1.00 29.53 ? 284 PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 284 ? 5.508   45.714 69.239 1.00 31.51 ? 284 PHE A CZ  1 
ATOM   2199 N N   . ASP A 1 285 ? 4.148   50.248 74.574 1.00 28.23 ? 285 ASP A N   1 
ATOM   2200 C CA  . ASP A 1 285 ? 4.418   51.574 75.117 1.00 28.05 ? 285 ASP A CA  1 
ATOM   2201 C C   . ASP A 1 285 ? 5.524   52.027 74.162 1.00 28.43 ? 285 ASP A C   1 
ATOM   2202 O O   . ASP A 1 285 ? 6.557   51.353 74.046 1.00 27.88 ? 285 ASP A O   1 
ATOM   2203 C CB  . ASP A 1 285 ? 4.969   51.445 76.538 1.00 28.54 ? 285 ASP A CB  1 
ATOM   2204 C CG  . ASP A 1 285 ? 4.722   52.677 77.390 1.00 32.72 ? 285 ASP A CG  1 
ATOM   2205 O OD1 . ASP A 1 285 ? 4.137   53.676 76.906 1.00 36.35 ? 285 ASP A OD1 1 
ATOM   2206 O OD2 . ASP A 1 285 ? 5.122   52.638 78.570 1.00 34.51 ? 285 ASP A OD2 1 
ATOM   2207 N N   . SER A 1 286 ? 5.314   53.142 73.465 1.00 26.59 ? 286 SER A N   1 
ATOM   2208 C CA  . SER A 1 286 ? 6.312   53.589 72.513 1.00 24.59 ? 286 SER A CA  1 
ATOM   2209 C C   . SER A 1 286 ? 6.362   55.071 72.249 1.00 24.32 ? 286 SER A C   1 
ATOM   2210 O O   . SER A 1 286 ? 5.474   55.825 72.622 1.00 24.08 ? 286 SER A O   1 
ATOM   2211 C CB  . SER A 1 286 ? 6.100   52.875 71.191 1.00 27.40 ? 286 SER A CB  1 
ATOM   2212 O OG  . SER A 1 286 ? 4.716   52.755 70.919 1.00 26.29 ? 286 SER A OG  1 
ATOM   2213 N N   . ILE A 1 287 ? 7.433   55.467 71.581 1.00 25.21 ? 287 ILE A N   1 
ATOM   2214 C CA  . ILE A 1 287 ? 7.670   56.850 71.214 1.00 26.31 ? 287 ILE A CA  1 
ATOM   2215 C C   . ILE A 1 287 ? 7.829   56.871 69.690 1.00 25.02 ? 287 ILE A C   1 
ATOM   2216 O O   . ILE A 1 287 ? 8.566   56.064 69.126 1.00 25.21 ? 287 ILE A O   1 
ATOM   2217 C CB  . ILE A 1 287 ? 8.955   57.378 71.931 1.00 26.97 ? 287 ILE A CB  1 
ATOM   2218 C CG1 . ILE A 1 287 ? 8.612   57.795 73.361 1.00 29.01 ? 287 ILE A CG1 1 
ATOM   2219 C CG2 . ILE A 1 287 ? 9.542   58.568 71.207 1.00 28.36 ? 287 ILE A CG2 1 
ATOM   2220 C CD1 . ILE A 1 287 ? 7.237   58.429 73.517 1.00 26.88 ? 287 ILE A CD1 1 
ATOM   2221 N N   . PHE A 1 288 ? 7.110   57.779 69.034 1.00 25.05 ? 288 PHE A N   1 
ATOM   2222 C CA  . PHE A 1 288 ? 7.149   57.926 67.576 1.00 22.97 ? 288 PHE A CA  1 
ATOM   2223 C C   . PHE A 1 288 ? 6.516   56.722 66.893 1.00 22.13 ? 288 PHE A C   1 
ATOM   2224 O O   . PHE A 1 288 ? 7.111   56.117 66.006 1.00 23.54 ? 288 PHE A O   1 
ATOM   2225 C CB  . PHE A 1 288 ? 8.593   58.098 67.084 1.00 24.52 ? 288 PHE A CB  1 
ATOM   2226 C CG  . PHE A 1 288 ? 8.760   59.141 66.004 1.00 23.33 ? 288 PHE A CG  1 
ATOM   2227 C CD1 . PHE A 1 288 ? 7.810   59.284 64.992 1.00 22.55 ? 288 PHE A CD1 1 
ATOM   2228 C CD2 . PHE A 1 288 ? 9.888   59.963 65.983 1.00 21.26 ? 288 PHE A CD2 1 
ATOM   2229 C CE1 . PHE A 1 288 ? 7.983   60.225 63.979 1.00 19.70 ? 288 PHE A CE1 1 
ATOM   2230 C CE2 . PHE A 1 288 ? 10.070  60.907 64.971 1.00 18.30 ? 288 PHE A CE2 1 
ATOM   2231 C CZ  . PHE A 1 288 ? 9.114   61.035 63.968 1.00 19.23 ? 288 PHE A CZ  1 
ATOM   2232 N N   . ARG A 1 289 ? 5.314   56.370 67.332 1.00 19.82 ? 289 ARG A N   1 
ATOM   2233 C CA  . ARG A 1 289 ? 4.571   55.263 66.758 1.00 18.40 ? 289 ARG A CA  1 
ATOM   2234 C C   . ARG A 1 289 ? 3.111   55.701 66.777 1.00 19.98 ? 289 ARG A C   1 
ATOM   2235 O O   . ARG A 1 289 ? 2.630   56.208 67.786 1.00 20.99 ? 289 ARG A O   1 
ATOM   2236 C CB  . ARG A 1 289 ? 4.775   54.000 67.585 1.00 17.76 ? 289 ARG A CB  1 
ATOM   2237 C CG  . ARG A 1 289 ? 5.464   52.871 66.824 1.00 20.25 ? 289 ARG A CG  1 
ATOM   2238 C CD  . ARG A 1 289 ? 6.730   53.363 66.131 1.00 20.69 ? 289 ARG A CD  1 
ATOM   2239 N NE  . ARG A 1 289 ? 7.774   52.345 66.001 1.00 18.69 ? 289 ARG A NE  1 
ATOM   2240 C CZ  . ARG A 1 289 ? 9.044   52.633 65.727 1.00 20.37 ? 289 ARG A CZ  1 
ATOM   2241 N NH1 . ARG A 1 289 ? 9.411   53.896 65.558 1.00 18.61 ? 289 ARG A NH1 1 
ATOM   2242 N NH2 . ARG A 1 289 ? 9.949   51.668 65.618 1.00 20.37 ? 289 ARG A NH2 1 
ATOM   2243 N N   . PHE A 1 290 ? 2.411   55.519 65.660 1.00 19.92 ? 290 PHE A N   1 
ATOM   2244 C CA  . PHE A 1 290 ? 1.022   55.949 65.556 1.00 17.55 ? 290 PHE A CA  1 
ATOM   2245 C C   . PHE A 1 290 ? 0.107   54.797 65.195 1.00 18.93 ? 290 PHE A C   1 
ATOM   2246 O O   . PHE A 1 290 ? 0.529   53.824 64.575 1.00 18.64 ? 290 PHE A O   1 
ATOM   2247 C CB  . PHE A 1 290 ? 0.929   57.093 64.538 1.00 15.62 ? 290 PHE A CB  1 
ATOM   2248 C CG  . PHE A 1 290 ? 2.074   58.077 64.642 1.00 15.30 ? 290 PHE A CG  1 
ATOM   2249 C CD1 . PHE A 1 290 ? 2.014   59.145 65.532 1.00 12.53 ? 290 PHE A CD1 1 
ATOM   2250 C CD2 . PHE A 1 290 ? 3.239   57.897 63.895 1.00 15.34 ? 290 PHE A CD2 1 
ATOM   2251 C CE1 . PHE A 1 290 ? 3.094   60.018 65.688 1.00 11.63 ? 290 PHE A CE1 1 
ATOM   2252 C CE2 . PHE A 1 290 ? 4.329   58.769 64.044 1.00 15.96 ? 290 PHE A CE2 1 
ATOM   2253 C CZ  . PHE A 1 290 ? 4.257   59.831 64.943 1.00 11.89 ? 290 PHE A CZ  1 
ATOM   2254 N N   . SER A 1 291 ? -1.155  54.917 65.584 1.00 21.08 ? 291 SER A N   1 
ATOM   2255 C CA  . SER A 1 291 ? -2.132  53.854 65.370 1.00 23.90 ? 291 SER A CA  1 
ATOM   2256 C C   . SER A 1 291 ? -2.434  53.398 63.942 1.00 23.83 ? 291 SER A C   1 
ATOM   2257 O O   . SER A 1 291 ? -1.931  52.364 63.508 1.00 20.82 ? 291 SER A O   1 
ATOM   2258 C CB  . SER A 1 291 ? -3.442  54.224 66.071 1.00 26.46 ? 291 SER A CB  1 
ATOM   2259 O OG  . SER A 1 291 ? -3.653  53.394 67.195 1.00 25.56 ? 291 SER A OG  1 
ATOM   2260 N N   . PHE A 1 292 ? -3.263  54.167 63.230 1.00 24.67 ? 292 PHE A N   1 
ATOM   2261 C CA  . PHE A 1 292 ? -3.675  53.839 61.863 1.00 22.53 ? 292 PHE A CA  1 
ATOM   2262 C C   . PHE A 1 292 ? -2.889  54.516 60.742 1.00 23.29 ? 292 PHE A C   1 
ATOM   2263 O O   . PHE A 1 292 ? -3.090  55.692 60.434 1.00 19.96 ? 292 PHE A O   1 
ATOM   2264 C CB  . PHE A 1 292 ? -5.162  54.136 61.712 1.00 23.47 ? 292 PHE A CB  1 
ATOM   2265 C CG  . PHE A 1 292 ? -5.988  53.585 62.838 1.00 26.88 ? 292 PHE A CG  1 
ATOM   2266 C CD1 . PHE A 1 292 ? -6.401  52.252 62.825 1.00 24.86 ? 292 PHE A CD1 1 
ATOM   2267 C CD2 . PHE A 1 292 ? -6.304  54.377 63.941 1.00 26.41 ? 292 PHE A CD2 1 
ATOM   2268 C CE1 . PHE A 1 292 ? -7.105  51.721 63.883 1.00 22.13 ? 292 PHE A CE1 1 
ATOM   2269 C CE2 . PHE A 1 292 ? -7.015  53.852 65.014 1.00 24.54 ? 292 PHE A CE2 1 
ATOM   2270 C CZ  . PHE A 1 292 ? -7.414  52.524 64.985 1.00 25.73 ? 292 PHE A CZ  1 
ATOM   2271 N N   . VAL A 1 293 ? -2.004  53.736 60.126 1.00 23.81 ? 293 VAL A N   1 
ATOM   2272 C CA  . VAL A 1 293 ? -1.159  54.201 59.038 1.00 23.39 ? 293 VAL A CA  1 
ATOM   2273 C C   . VAL A 1 293 ? -1.216  53.193 57.885 1.00 24.91 ? 293 VAL A C   1 
ATOM   2274 O O   . VAL A 1 293 ? -1.670  52.066 58.066 1.00 26.69 ? 293 VAL A O   1 
ATOM   2275 C CB  . VAL A 1 293 ? 0.294   54.331 59.514 1.00 22.19 ? 293 VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 293 ? 0.413   55.478 60.482 1.00 24.53 ? 293 VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 293 ? 0.740   53.050 60.184 1.00 18.80 ? 293 VAL A CG2 1 
ATOM   2278 N N   . PRO A 1 294 ? -0.773  53.596 56.679 1.00 24.70 ? 294 PRO A N   1 
ATOM   2279 C CA  . PRO A 1 294 ? -0.775  52.717 55.504 1.00 23.62 ? 294 PRO A CA  1 
ATOM   2280 C C   . PRO A 1 294 ? -0.298  51.283 55.752 1.00 23.11 ? 294 PRO A C   1 
ATOM   2281 O O   . PRO A 1 294 ? 0.614   51.045 56.543 1.00 24.21 ? 294 PRO A O   1 
ATOM   2282 C CB  . PRO A 1 294 ? 0.130   53.444 54.500 1.00 23.70 ? 294 PRO A CB  1 
ATOM   2283 C CG  . PRO A 1 294 ? 0.649   54.659 55.208 1.00 23.24 ? 294 PRO A CG  1 
ATOM   2284 C CD  . PRO A 1 294 ? -0.278  54.939 56.335 1.00 24.22 ? 294 PRO A CD  1 
ATOM   2285 N N   . VAL A 1 295 ? -0.925  50.332 55.066 1.00 21.77 ? 295 VAL A N   1 
ATOM   2286 C CA  . VAL A 1 295 ? -0.553  48.932 55.193 1.00 20.24 ? 295 VAL A CA  1 
ATOM   2287 C C   . VAL A 1 295 ? 0.011   48.466 53.882 1.00 21.64 ? 295 VAL A C   1 
ATOM   2288 O O   . VAL A 1 295 ? -0.446  48.878 52.822 1.00 24.91 ? 295 VAL A O   1 
ATOM   2289 C CB  . VAL A 1 295 ? -1.747  47.996 55.462 1.00 16.93 ? 295 VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 295 ? -2.117  48.002 56.930 1.00 19.15 ? 295 VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 295 ? -2.910  48.392 54.597 1.00 18.61 ? 295 VAL A CG2 1 
ATOM   2292 N N   . ILE A 1 296 ? 1.019   47.616 53.959 1.00 20.48 ? 296 ILE A N   1 
ATOM   2293 C CA  . ILE A 1 296 ? 1.579   47.045 52.768 1.00 21.21 ? 296 ILE A CA  1 
ATOM   2294 C C   . ILE A 1 296 ? 0.475   46.052 52.424 1.00 25.04 ? 296 ILE A C   1 
ATOM   2295 O O   . ILE A 1 296 ? 0.507   44.899 52.852 1.00 25.09 ? 296 ILE A O   1 
ATOM   2296 C CB  . ILE A 1 296 ? 2.872   46.317 53.093 1.00 21.01 ? 296 ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 296 ? 3.871   47.311 53.689 1.00 23.08 ? 296 ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 296 ? 3.430   45.658 51.854 1.00 20.69 ? 296 ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 296 ? 3.965   48.618 52.935 1.00 21.72 ? 296 ILE A CD1 1 
ATOM   2300 N N   . ASP A 1 297 ? -0.519  46.525 51.676 1.00 28.04 ? 297 ASP A N   1 
ATOM   2301 C CA  . ASP A 1 297 ? -1.670  45.712 51.292 1.00 30.56 ? 297 ASP A CA  1 
ATOM   2302 C C   . ASP A 1 297 ? -1.504  44.860 50.047 1.00 32.13 ? 297 ASP A C   1 
ATOM   2303 O O   . ASP A 1 297 ? -2.300  43.959 49.813 1.00 34.96 ? 297 ASP A O   1 
ATOM   2304 C CB  . ASP A 1 297 ? -2.891  46.602 51.100 1.00 29.65 ? 297 ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 297 ? -2.696  47.606 50.005 1.00 30.03 ? 297 ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 297 ? -1.584  47.644 49.440 1.00 29.35 ? 297 ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 297 ? -3.652  48.359 49.707 1.00 35.47 ? 297 ASP A OD2 1 
ATOM   2308 N N   . GLY A 1 298 ? -0.494  45.147 49.237 1.00 33.35 ? 298 GLY A N   1 
ATOM   2309 C CA  . GLY A 1 298 ? -0.294  44.358 48.037 1.00 33.78 ? 298 GLY A CA  1 
ATOM   2310 C C   . GLY A 1 298 ? -0.957  44.956 46.815 1.00 35.10 ? 298 GLY A C   1 
ATOM   2311 O O   . GLY A 1 298 ? -0.854  44.409 45.720 1.00 36.20 ? 298 GLY A O   1 
ATOM   2312 N N   . GLU A 1 299 ? -1.649  46.073 47.002 1.00 35.23 ? 299 GLU A N   1 
ATOM   2313 C CA  . GLU A 1 299 ? -2.313  46.754 45.903 1.00 34.70 ? 299 GLU A CA  1 
ATOM   2314 C C   . GLU A 1 299 ? -1.670  48.124 45.799 1.00 32.66 ? 299 GLU A C   1 
ATOM   2315 O O   . GLU A 1 299 ? -0.881  48.370 44.894 1.00 33.21 ? 299 GLU A O   1 
ATOM   2316 C CB  . GLU A 1 299 ? -3.808  46.881 46.176 1.00 41.10 ? 299 GLU A CB  1 
ATOM   2317 C CG  . GLU A 1 299 ? -4.431  45.609 46.758 1.00 53.53 ? 299 GLU A CG  1 
ATOM   2318 C CD  . GLU A 1 299 ? -5.947  45.715 46.961 1.00 60.77 ? 299 GLU A CD  1 
ATOM   2319 O OE1 . GLU A 1 299 ? -6.514  46.806 46.688 1.00 62.68 ? 299 GLU A OE1 1 
ATOM   2320 O OE2 . GLU A 1 299 ? -6.566  44.705 47.392 1.00 63.70 ? 299 GLU A OE2 1 
ATOM   2321 N N   . PHE A 1 300 ? -1.990  49.023 46.723 1.00 31.10 ? 300 PHE A N   1 
ATOM   2322 C CA  . PHE A 1 300 ? -1.370  50.339 46.675 1.00 27.71 ? 300 PHE A CA  1 
ATOM   2323 C C   . PHE A 1 300 ? 0.135   50.085 46.647 1.00 26.83 ? 300 PHE A C   1 
ATOM   2324 O O   . PHE A 1 300 ? 0.887   50.830 46.030 1.00 27.12 ? 300 PHE A O   1 
ATOM   2325 C CB  . PHE A 1 300 ? -1.755  51.174 47.900 1.00 24.81 ? 300 PHE A CB  1 
ATOM   2326 C CG  . PHE A 1 300 ? -1.417  52.645 47.769 1.00 23.02 ? 300 PHE A CG  1 
ATOM   2327 C CD1 . PHE A 1 300 ? -0.091  53.081 47.771 1.00 23.68 ? 300 PHE A CD1 1 
ATOM   2328 C CD2 . PHE A 1 300 ? -2.418  53.596 47.656 1.00 18.46 ? 300 PHE A CD2 1 
ATOM   2329 C CE1 . PHE A 1 300 ? 0.221   54.438 47.665 1.00 18.01 ? 300 PHE A CE1 1 
ATOM   2330 C CE2 . PHE A 1 300 ? -2.108  54.947 47.548 1.00 16.90 ? 300 PHE A CE2 1 
ATOM   2331 C CZ  . PHE A 1 300 ? -0.787  55.364 47.553 1.00 16.66 ? 300 PHE A CZ  1 
ATOM   2332 N N   . PHE A 1 301 ? 0.563   49.014 47.309 1.00 25.87 ? 301 PHE A N   1 
ATOM   2333 C CA  . PHE A 1 301 ? 1.970   48.641 47.337 1.00 26.29 ? 301 PHE A CA  1 
ATOM   2334 C C   . PHE A 1 301 ? 2.114   47.211 46.822 1.00 27.82 ? 301 PHE A C   1 
ATOM   2335 O O   . PHE A 1 301 ? 1.769   46.258 47.514 1.00 28.58 ? 301 PHE A O   1 
ATOM   2336 C CB  . PHE A 1 301 ? 2.529   48.733 48.759 1.00 26.52 ? 301 PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 301 ? 2.584   50.138 49.301 1.00 26.37 ? 301 PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 301 ? 3.576   51.020 48.887 1.00 25.81 ? 301 PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 301 ? 1.632   50.582 50.214 1.00 24.96 ? 301 PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 301 ? 3.618   52.322 49.371 1.00 26.05 ? 301 PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 301 ? 1.664   51.882 50.703 1.00 24.09 ? 301 PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 301 ? 2.658   52.755 50.283 1.00 25.24 ? 301 PHE A CZ  1 
ATOM   2343 N N   . PRO A 1 302 ? 2.624   47.049 45.588 1.00 28.31 ? 302 PRO A N   1 
ATOM   2344 C CA  . PRO A 1 302 ? 2.824   45.740 44.954 1.00 27.53 ? 302 PRO A CA  1 
ATOM   2345 C C   . PRO A 1 302 ? 3.444   44.700 45.886 1.00 27.87 ? 302 PRO A C   1 
ATOM   2346 O O   . PRO A 1 302 ? 2.949   43.579 45.996 1.00 28.27 ? 302 PRO A O   1 
ATOM   2347 C CB  . PRO A 1 302 ? 3.738   46.052 43.768 1.00 26.77 ? 302 PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 302 ? 3.464   47.471 43.443 1.00 26.17 ? 302 PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 302 ? 3.053   48.157 44.713 1.00 27.31 ? 302 PRO A CD  1 
ATOM   2350 N N   . THR A 1 303 ? 4.540   45.083 46.536 1.00 28.11 ? 303 THR A N   1 
ATOM   2351 C CA  . THR A 1 303 ? 5.261   44.217 47.465 1.00 27.07 ? 303 THR A CA  1 
ATOM   2352 C C   . THR A 1 303 ? 5.796   45.030 48.630 1.00 24.34 ? 303 THR A C   1 
ATOM   2353 O O   . THR A 1 303 ? 5.364   46.153 48.871 1.00 23.56 ? 303 THR A O   1 
ATOM   2354 C CB  . THR A 1 303 ? 6.476   43.529 46.803 1.00 30.43 ? 303 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 303 ? 6.785   44.159 45.553 1.00 30.76 ? 303 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 303 ? 6.182   42.067 46.572 1.00 34.01 ? 303 THR A CG2 1 
ATOM   2357 N N   . SER A 1 304 ? 6.745   44.456 49.351 1.00 23.47 ? 304 SER A N   1 
ATOM   2358 C CA  . SER A 1 304 ? 7.336   45.144 50.484 1.00 24.49 ? 304 SER A CA  1 
ATOM   2359 C C   . SER A 1 304 ? 8.094   46.349 49.975 1.00 23.74 ? 304 SER A C   1 
ATOM   2360 O O   . SER A 1 304 ? 8.572   46.360 48.838 1.00 24.15 ? 304 SER A O   1 
ATOM   2361 C CB  . SER A 1 304 ? 8.295   44.218 51.242 1.00 27.44 ? 304 SER A CB  1 
ATOM   2362 O OG  . SER A 1 304 ? 9.519   44.039 50.544 1.00 28.40 ? 304 SER A OG  1 
ATOM   2363 N N   . LEU A 1 305 ? 8.212   47.363 50.821 1.00 21.87 ? 305 LEU A N   1 
ATOM   2364 C CA  . LEU A 1 305 ? 8.914   48.570 50.438 1.00 20.95 ? 305 LEU A CA  1 
ATOM   2365 C C   . LEU A 1 305 ? 10.370  48.274 50.041 1.00 23.69 ? 305 LEU A C   1 
ATOM   2366 O O   . LEU A 1 305 ? 10.794  48.590 48.930 1.00 23.22 ? 305 LEU A O   1 
ATOM   2367 C CB  . LEU A 1 305 ? 8.859   49.574 51.589 1.00 15.84 ? 305 LEU A CB  1 
ATOM   2368 C CG  . LEU A 1 305 ? 7.498   50.196 51.935 1.00 14.51 ? 305 LEU A CG  1 
ATOM   2369 C CD1 . LEU A 1 305 ? 7.734   51.561 52.574 1.00 12.22 ? 305 LEU A CD1 1 
ATOM   2370 C CD2 . LEU A 1 305 ? 6.622   50.341 50.702 1.00 11.47 ? 305 LEU A CD2 1 
ATOM   2371 N N   . GLU A 1 306 ? 11.128  47.654 50.940 1.00 27.08 ? 306 GLU A N   1 
ATOM   2372 C CA  . GLU A 1 306 ? 12.527  47.339 50.674 1.00 28.67 ? 306 GLU A CA  1 
ATOM   2373 C C   . GLU A 1 306 ? 12.752  46.664 49.331 1.00 31.70 ? 306 GLU A C   1 
ATOM   2374 O O   . GLU A 1 306 ? 13.577  47.117 48.531 1.00 33.90 ? 306 GLU A O   1 
ATOM   2375 C CB  . GLU A 1 306 ? 13.084  46.441 51.766 1.00 28.18 ? 306 GLU A CB  1 
ATOM   2376 C CG  . GLU A 1 306 ? 14.565  46.199 51.633 1.00 30.14 ? 306 GLU A CG  1 
ATOM   2377 C CD  . GLU A 1 306 ? 15.371  47.477 51.733 1.00 34.70 ? 306 GLU A CD  1 
ATOM   2378 O OE1 . GLU A 1 306 ? 14.769  48.574 51.744 1.00 36.10 ? 306 GLU A OE1 1 
ATOM   2379 O OE2 . GLU A 1 306 ? 16.615  47.386 51.805 1.00 38.20 ? 306 GLU A OE2 1 
ATOM   2380 N N   . SER A 1 307 ? 12.019  45.574 49.098 1.00 31.67 ? 307 SER A N   1 
ATOM   2381 C CA  . SER A 1 307 ? 12.114  44.802 47.859 1.00 30.10 ? 307 SER A CA  1 
ATOM   2382 C C   . SER A 1 307 ? 11.874  45.649 46.615 1.00 30.18 ? 307 SER A C   1 
ATOM   2383 O O   . SER A 1 307 ? 12.391  45.341 45.540 1.00 32.80 ? 307 SER A O   1 
ATOM   2384 C CB  . SER A 1 307 ? 11.113  43.654 47.883 1.00 29.34 ? 307 SER A CB  1 
ATOM   2385 O OG  . SER A 1 307 ? 9.842   44.094 47.455 1.00 31.88 ? 307 SER A OG  1 
ATOM   2386 N N   . MET A 1 308 ? 11.074  46.701 46.762 1.00 28.55 ? 308 MET A N   1 
ATOM   2387 C CA  . MET A 1 308 ? 10.783  47.609 45.661 1.00 25.05 ? 308 MET A CA  1 
ATOM   2388 C C   . MET A 1 308 ? 11.966  48.553 45.502 1.00 23.80 ? 308 MET A C   1 
ATOM   2389 O O   . MET A 1 308 ? 12.349  48.917 44.397 1.00 25.01 ? 308 MET A O   1 
ATOM   2390 C CB  . MET A 1 308 ? 9.524   48.421 45.960 1.00 24.08 ? 308 MET A CB  1 
ATOM   2391 C CG  . MET A 1 308 ? 8.243   47.614 45.991 1.00 21.48 ? 308 MET A CG  1 
ATOM   2392 S SD  . MET A 1 308 ? 6.797   48.676 46.207 1.00 24.42 ? 308 MET A SD  1 
ATOM   2393 C CE  . MET A 1 308 ? 6.670   49.429 44.624 1.00 22.27 ? 308 MET A CE  1 
ATOM   2394 N N   . LEU A 1 309 ? 12.547  48.956 46.621 1.00 24.85 ? 309 LEU A N   1 
ATOM   2395 C CA  . LEU A 1 309 ? 13.688  49.856 46.580 1.00 26.69 ? 309 LEU A CA  1 
ATOM   2396 C C   . LEU A 1 309 ? 14.897  49.074 46.101 1.00 28.07 ? 309 LEU A C   1 
ATOM   2397 O O   . LEU A 1 309 ? 15.902  49.639 45.683 1.00 30.32 ? 309 LEU A O   1 
ATOM   2398 C CB  . LEU A 1 309 ? 13.961  50.421 47.972 1.00 25.15 ? 309 LEU A CB  1 
ATOM   2399 C CG  . LEU A 1 309 ? 12.933  51.436 48.458 1.00 24.56 ? 309 LEU A CG  1 
ATOM   2400 C CD1 . LEU A 1 309 ? 12.736  51.283 49.950 1.00 27.61 ? 309 LEU A CD1 1 
ATOM   2401 C CD2 . LEU A 1 309 ? 13.404  52.829 48.127 1.00 25.48 ? 309 LEU A CD2 1 
ATOM   2402 N N   . ASN A 1 310 ? 14.789  47.759 46.166 1.00 28.88 ? 310 ASN A N   1 
ATOM   2403 C CA  . ASN A 1 310 ? 15.879  46.902 45.752 1.00 29.83 ? 310 ASN A CA  1 
ATOM   2404 C C   . ASN A 1 310 ? 15.816  46.603 44.262 1.00 29.49 ? 310 ASN A C   1 
ATOM   2405 O O   . ASN A 1 310 ? 16.838  46.406 43.614 1.00 32.37 ? 310 ASN A O   1 
ATOM   2406 C CB  . ASN A 1 310 ? 15.826  45.591 46.537 1.00 30.09 ? 310 ASN A CB  1 
ATOM   2407 C CG  . ASN A 1 310 ? 16.702  45.615 47.759 1.00 30.36 ? 310 ASN A CG  1 
ATOM   2408 O OD1 . ASN A 1 310 ? 17.636  46.405 47.848 1.00 29.81 ? 310 ASN A OD1 1 
ATOM   2409 N ND2 . ASN A 1 310 ? 16.410  44.739 48.714 1.00 34.82 ? 310 ASN A ND2 1 
ATOM   2410 N N   . SER A 1 311 ? 14.611  46.563 43.718 1.00 27.21 ? 311 SER A N   1 
ATOM   2411 C CA  . SER A 1 311 ? 14.449  46.256 42.314 1.00 25.76 ? 311 SER A CA  1 
ATOM   2412 C C   . SER A 1 311 ? 14.191  47.504 41.500 1.00 25.08 ? 311 SER A C   1 
ATOM   2413 O O   . SER A 1 311 ? 13.787  47.423 40.345 1.00 25.26 ? 311 SER A O   1 
ATOM   2414 C CB  . SER A 1 311 ? 13.295  45.274 42.134 1.00 27.11 ? 311 SER A CB  1 
ATOM   2415 O OG  . SER A 1 311 ? 12.054  45.955 42.085 1.00 30.33 ? 311 SER A OG  1 
ATOM   2416 N N   . GLY A 1 312 ? 14.428  48.663 42.098 1.00 25.81 ? 312 GLY A N   1 
ATOM   2417 C CA  . GLY A 1 312 ? 14.195  49.898 41.376 1.00 26.17 ? 312 GLY A CA  1 
ATOM   2418 C C   . GLY A 1 312 ? 12.777  49.929 40.839 1.00 25.99 ? 312 GLY A C   1 
ATOM   2419 O O   . GLY A 1 312 ? 12.506  50.503 39.781 1.00 25.33 ? 312 GLY A O   1 
ATOM   2420 N N   . ASN A 1 313 ? 11.872  49.286 41.568 1.00 24.33 ? 313 ASN A N   1 
ATOM   2421 C CA  . ASN A 1 313 ? 10.476  49.239 41.175 1.00 22.85 ? 313 ASN A CA  1 
ATOM   2422 C C   . ASN A 1 313 ? 9.811   50.498 41.705 1.00 23.82 ? 313 ASN A C   1 
ATOM   2423 O O   . ASN A 1 313 ? 8.912   50.440 42.543 1.00 24.20 ? 313 ASN A O   1 
ATOM   2424 C CB  . ASN A 1 313 ? 9.806   47.987 41.750 1.00 23.42 ? 313 ASN A CB  1 
ATOM   2425 C CG  . ASN A 1 313 ? 8.325   47.905 41.419 1.00 25.96 ? 313 ASN A CG  1 
ATOM   2426 O OD1 . ASN A 1 313 ? 7.809   48.688 40.616 1.00 28.27 ? 313 ASN A OD1 1 
ATOM   2427 N ND2 . ASN A 1 313 ? 7.630   46.952 42.042 1.00 24.03 ? 313 ASN A ND2 1 
ATOM   2428 N N   . PHE A 1 314 ? 10.270  51.645 41.213 1.00 22.98 ? 314 PHE A N   1 
ATOM   2429 C CA  . PHE A 1 314 ? 9.716   52.921 41.636 1.00 22.16 ? 314 PHE A CA  1 
ATOM   2430 C C   . PHE A 1 314 ? 9.893   54.022 40.588 1.00 22.68 ? 314 PHE A C   1 
ATOM   2431 O O   . PHE A 1 314 ? 10.729  53.922 39.680 1.00 22.31 ? 314 PHE A O   1 
ATOM   2432 C CB  . PHE A 1 314 ? 10.351  53.349 42.968 1.00 18.76 ? 314 PHE A CB  1 
ATOM   2433 C CG  . PHE A 1 314 ? 11.851  53.323 42.963 1.00 14.88 ? 314 PHE A CG  1 
ATOM   2434 C CD1 . PHE A 1 314 ? 12.577  54.367 42.401 1.00 13.24 ? 314 PHE A CD1 1 
ATOM   2435 C CD2 . PHE A 1 314 ? 12.539  52.246 43.496 1.00 16.13 ? 314 PHE A CD2 1 
ATOM   2436 C CE1 . PHE A 1 314 ? 13.964  54.333 42.366 1.00 9.35  ? 314 PHE A CE1 1 
ATOM   2437 C CE2 . PHE A 1 314 ? 13.927  52.207 43.466 1.00 12.95 ? 314 PHE A CE2 1 
ATOM   2438 C CZ  . PHE A 1 314 ? 14.636  53.254 42.898 1.00 11.08 ? 314 PHE A CZ  1 
ATOM   2439 N N   . LYS A 1 315 ? 9.092   55.073 40.711 1.00 22.30 ? 315 LYS A N   1 
ATOM   2440 C CA  . LYS A 1 315 ? 9.176   56.183 39.779 1.00 21.23 ? 315 LYS A CA  1 
ATOM   2441 C C   . LYS A 1 315 ? 10.581  56.784 39.816 1.00 22.09 ? 315 LYS A C   1 
ATOM   2442 O O   . LYS A 1 315 ? 11.078  57.164 40.879 1.00 23.03 ? 315 LYS A O   1 
ATOM   2443 C CB  . LYS A 1 315 ? 8.146   57.250 40.135 1.00 18.80 ? 315 LYS A CB  1 
ATOM   2444 C CG  . LYS A 1 315 ? 8.411   58.571 39.467 1.00 21.93 ? 315 LYS A CG  1 
ATOM   2445 C CD  . LYS A 1 315 ? 7.274   59.550 39.675 1.00 25.16 ? 315 LYS A CD  1 
ATOM   2446 C CE  . LYS A 1 315 ? 7.355   60.678 38.661 1.00 26.94 ? 315 LYS A CE  1 
ATOM   2447 N NZ  . LYS A 1 315 ? 6.746   60.283 37.363 1.00 28.08 ? 315 LYS A NZ  1 
ATOM   2448 N N   . LYS A 1 316 ? 11.221  56.855 38.652 1.00 20.87 ? 316 LYS A N   1 
ATOM   2449 C CA  . LYS A 1 316 ? 12.562  57.413 38.545 1.00 20.48 ? 316 LYS A CA  1 
ATOM   2450 C C   . LYS A 1 316 ? 12.521  58.853 38.019 1.00 22.63 ? 316 LYS A C   1 
ATOM   2451 O O   . LYS A 1 316 ? 12.070  59.101 36.903 1.00 26.98 ? 316 LYS A O   1 
ATOM   2452 C CB  . LYS A 1 316 ? 13.402  56.540 37.622 1.00 18.33 ? 316 LYS A CB  1 
ATOM   2453 C CG  . LYS A 1 316 ? 13.017  55.078 37.674 1.00 18.70 ? 316 LYS A CG  1 
ATOM   2454 C CD  . LYS A 1 316 ? 14.190  54.248 38.123 1.00 21.94 ? 316 LYS A CD  1 
ATOM   2455 C CE  . LYS A 1 316 ? 13.731  52.944 38.737 1.00 23.54 ? 316 LYS A CE  1 
ATOM   2456 N NZ  . LYS A 1 316 ? 12.874  52.196 37.790 1.00 25.24 ? 316 LYS A NZ  1 
ATOM   2457 N N   . THR A 1 317 ? 12.990  59.803 38.823 1.00 20.48 ? 317 THR A N   1 
ATOM   2458 C CA  . THR A 1 317 ? 12.990  61.199 38.429 1.00 17.96 ? 317 THR A CA  1 
ATOM   2459 C C   . THR A 1 317 ? 13.970  61.928 39.339 1.00 18.86 ? 317 THR A C   1 
ATOM   2460 O O   . THR A 1 317 ? 14.929  61.323 39.820 1.00 17.33 ? 317 THR A O   1 
ATOM   2461 C CB  . THR A 1 317 ? 11.553  61.791 38.556 1.00 19.82 ? 317 THR A CB  1 
ATOM   2462 O OG1 . THR A 1 317 ? 11.589  63.217 38.385 1.00 19.44 ? 317 THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 317 ? 10.932  61.424 39.919 1.00 14.27 ? 317 THR A CG2 1 
ATOM   2464 N N   . GLN A 1 318 ? 13.755  63.221 39.557 1.00 18.96 ? 318 GLN A N   1 
ATOM   2465 C CA  . GLN A 1 318 ? 14.625  63.988 40.442 1.00 21.61 ? 318 GLN A CA  1 
ATOM   2466 C C   . GLN A 1 318 ? 13.949  64.110 41.798 1.00 22.19 ? 318 GLN A C   1 
ATOM   2467 O O   . GLN A 1 318 ? 12.721  64.133 41.892 1.00 22.24 ? 318 GLN A O   1 
ATOM   2468 C CB  . GLN A 1 318 ? 14.876  65.397 39.894 1.00 23.01 ? 318 GLN A CB  1 
ATOM   2469 C CG  . GLN A 1 318 ? 15.467  65.447 38.493 1.00 27.73 ? 318 GLN A CG  1 
ATOM   2470 C CD  . GLN A 1 318 ? 14.455  65.074 37.423 1.00 31.82 ? 318 GLN A CD  1 
ATOM   2471 O OE1 . GLN A 1 318 ? 13.272  65.416 37.519 1.00 33.71 ? 318 GLN A OE1 1 
ATOM   2472 N NE2 . GLN A 1 318 ? 14.917  64.363 36.395 1.00 33.58 ? 318 GLN A NE2 1 
ATOM   2473 N N   . ILE A 1 319 ? 14.745  64.159 42.856 1.00 21.74 ? 319 ILE A N   1 
ATOM   2474 C CA  . ILE A 1 319 ? 14.194  64.320 44.188 1.00 19.66 ? 319 ILE A CA  1 
ATOM   2475 C C   . ILE A 1 319 ? 15.155  65.153 45.000 1.00 19.15 ? 319 ILE A C   1 
ATOM   2476 O O   . ILE A 1 319 ? 16.377  65.028 44.870 1.00 17.10 ? 319 ILE A O   1 
ATOM   2477 C CB  . ILE A 1 319 ? 13.953  62.967 44.919 1.00 18.52 ? 319 ILE A CB  1 
ATOM   2478 C CG1 . ILE A 1 319 ? 15.279  62.326 45.315 1.00 20.10 ? 319 ILE A CG1 1 
ATOM   2479 C CG2 . ILE A 1 319 ? 13.149  62.034 44.047 1.00 21.68 ? 319 ILE A CG2 1 
ATOM   2480 C CD1 . ILE A 1 319 ? 15.216  61.536 46.628 1.00 20.39 ? 319 ILE A CD1 1 
ATOM   2481 N N   . LEU A 1 320 ? 14.588  66.027 45.817 1.00 18.42 ? 320 LEU A N   1 
ATOM   2482 C CA  . LEU A 1 320 ? 15.367  66.885 46.687 1.00 20.10 ? 320 LEU A CA  1 
ATOM   2483 C C   . LEU A 1 320 ? 14.796  66.574 48.059 1.00 22.97 ? 320 LEU A C   1 
ATOM   2484 O O   . LEU A 1 320 ? 13.580  66.650 48.252 1.00 24.13 ? 320 LEU A O   1 
ATOM   2485 C CB  . LEU A 1 320 ? 15.132  68.352 46.321 1.00 18.71 ? 320 LEU A CB  1 
ATOM   2486 C CG  . LEU A 1 320 ? 15.927  69.446 47.029 1.00 15.62 ? 320 LEU A CG  1 
ATOM   2487 C CD1 . LEU A 1 320 ? 15.755  70.764 46.292 1.00 11.45 ? 320 LEU A CD1 1 
ATOM   2488 C CD2 . LEU A 1 320 ? 15.436  69.576 48.449 1.00 16.19 ? 320 LEU A CD2 1 
ATOM   2489 N N   . LEU A 1 321 ? 15.662  66.192 48.998 1.00 24.76 ? 321 LEU A N   1 
ATOM   2490 C CA  . LEU A 1 321 ? 15.223  65.860 50.352 1.00 24.25 ? 321 LEU A CA  1 
ATOM   2491 C C   . LEU A 1 321 ? 16.256  66.101 51.450 1.00 24.50 ? 321 LEU A C   1 
ATOM   2492 O O   . LEU A 1 321 ? 17.425  66.393 51.186 1.00 21.46 ? 321 LEU A O   1 
ATOM   2493 C CB  . LEU A 1 321 ? 14.747  64.404 50.420 1.00 23.62 ? 321 LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 321 ? 15.508  63.264 49.736 1.00 24.96 ? 321 LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 321 ? 16.936  63.645 49.431 1.00 27.35 ? 321 LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 321 ? 15.472  62.063 50.642 1.00 23.80 ? 321 LEU A CD2 1 
ATOM   2497 N N   . GLY A 1 322 ? 15.803  65.968 52.693 1.00 26.44 ? 322 GLY A N   1 
ATOM   2498 C CA  . GLY A 1 322 ? 16.682  66.186 53.825 1.00 27.59 ? 322 GLY A CA  1 
ATOM   2499 C C   . GLY A 1 322 ? 16.075  65.909 55.191 1.00 26.93 ? 322 GLY A C   1 
ATOM   2500 O O   . GLY A 1 322 ? 14.972  65.358 55.309 1.00 25.35 ? 322 GLY A O   1 
ATOM   2501 N N   . VAL A 1 323 ? 16.811  66.309 56.227 1.00 25.03 ? 323 VAL A N   1 
ATOM   2502 C CA  . VAL A 1 323 ? 16.407  66.098 57.606 1.00 25.10 ? 323 VAL A CA  1 
ATOM   2503 C C   . VAL A 1 323 ? 16.739  67.300 58.497 1.00 26.32 ? 323 VAL A C   1 
ATOM   2504 O O   . VAL A 1 323 ? 17.513  68.169 58.108 1.00 28.83 ? 323 VAL A O   1 
ATOM   2505 C CB  . VAL A 1 323 ? 17.127  64.872 58.169 1.00 24.37 ? 323 VAL A CB  1 
ATOM   2506 C CG1 . VAL A 1 323 ? 17.148  63.756 57.139 1.00 22.24 ? 323 VAL A CG1 1 
ATOM   2507 C CG2 . VAL A 1 323 ? 18.548  65.249 58.535 1.00 26.34 ? 323 VAL A CG2 1 
ATOM   2508 N N   . ASN A 1 324 ? 16.150  67.340 59.692 1.00 27.26 ? 324 ASN A N   1 
ATOM   2509 C CA  . ASN A 1 324 ? 16.398  68.414 60.661 1.00 27.22 ? 324 ASN A CA  1 
ATOM   2510 C C   . ASN A 1 324 ? 17.441  67.967 61.682 1.00 26.73 ? 324 ASN A C   1 
ATOM   2511 O O   . ASN A 1 324 ? 17.487  66.803 62.063 1.00 28.38 ? 324 ASN A O   1 
ATOM   2512 C CB  . ASN A 1 324 ? 15.117  68.778 61.404 1.00 27.52 ? 324 ASN A CB  1 
ATOM   2513 C CG  . ASN A 1 324 ? 14.321  69.820 60.688 1.00 26.02 ? 324 ASN A CG  1 
ATOM   2514 O OD1 . ASN A 1 324 ? 14.540  70.075 59.506 1.00 29.10 ? 324 ASN A OD1 1 
ATOM   2515 N ND2 . ASN A 1 324 ? 13.385  70.433 61.393 1.00 25.42 ? 324 ASN A ND2 1 
ATOM   2516 N N   . LYS A 1 325 ? 18.265  68.893 62.144 1.00 27.28 ? 325 LYS A N   1 
ATOM   2517 C CA  . LYS A 1 325 ? 19.307  68.547 63.097 1.00 27.83 ? 325 LYS A CA  1 
ATOM   2518 C C   . LYS A 1 325 ? 18.844  67.803 64.347 1.00 26.41 ? 325 LYS A C   1 
ATOM   2519 O O   . LYS A 1 325 ? 19.502  66.862 64.777 1.00 27.86 ? 325 LYS A O   1 
ATOM   2520 C CB  . LYS A 1 325 ? 20.065  69.803 63.517 1.00 30.88 ? 325 LYS A CB  1 
ATOM   2521 C CG  . LYS A 1 325 ? 21.290  69.509 64.356 1.00 33.11 ? 325 LYS A CG  1 
ATOM   2522 C CD  . LYS A 1 325 ? 21.269  70.281 65.659 1.00 36.35 ? 325 LYS A CD  1 
ATOM   2523 C CE  . LYS A 1 325 ? 22.677  70.548 66.127 1.00 37.53 ? 325 LYS A CE  1 
ATOM   2524 N NZ  . LYS A 1 325 ? 23.395  69.263 66.337 1.00 39.61 ? 325 LYS A NZ  1 
ATOM   2525 N N   . ASP A 1 326 ? 17.724  68.225 64.928 1.00 26.18 ? 326 ASP A N   1 
ATOM   2526 C CA  . ASP A 1 326 ? 17.199  67.607 66.148 1.00 25.46 ? 326 ASP A CA  1 
ATOM   2527 C C   . ASP A 1 326 ? 15.769  67.129 65.954 1.00 26.59 ? 326 ASP A C   1 
ATOM   2528 O O   . ASP A 1 326 ? 14.825  67.802 66.360 1.00 27.48 ? 326 ASP A O   1 
ATOM   2529 C CB  . ASP A 1 326 ? 17.217  68.616 67.306 1.00 24.69 ? 326 ASP A CB  1 
ATOM   2530 C CG  . ASP A 1 326 ? 18.596  69.178 67.580 1.00 24.16 ? 326 ASP A CG  1 
ATOM   2531 O OD1 . ASP A 1 326 ? 19.477  68.396 67.982 1.00 24.21 ? 326 ASP A OD1 1 
ATOM   2532 O OD2 . ASP A 1 326 ? 18.801  70.397 67.398 1.00 22.08 ? 326 ASP A OD2 1 
ATOM   2533 N N   . GLU A 1 327 ? 15.593  65.961 65.355 1.00 27.97 ? 327 GLU A N   1 
ATOM   2534 C CA  . GLU A 1 327 ? 14.245  65.466 65.134 1.00 28.39 ? 327 GLU A CA  1 
ATOM   2535 C C   . GLU A 1 327 ? 13.589  64.980 66.429 1.00 29.45 ? 327 GLU A C   1 
ATOM   2536 O O   . GLU A 1 327 ? 12.614  65.579 66.897 1.00 32.68 ? 327 GLU A O   1 
ATOM   2537 C CB  . GLU A 1 327 ? 14.251  64.347 64.080 1.00 28.33 ? 327 GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 327 ? 14.842  64.750 62.720 1.00 28.32 ? 327 GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 327 ? 13.811  65.364 61.778 1.00 30.82 ? 327 GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 327 ? 12.701  65.691 62.241 1.00 32.81 ? 327 GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 327 ? 14.103  65.527 60.573 1.00 27.88 ? 327 GLU A OE2 1 
ATOM   2542 N N   . GLY A 1 328 ? 14.145  63.918 67.009 1.00 28.58 ? 328 GLY A N   1 
ATOM   2543 C CA  . GLY A 1 328 ? 13.621  63.313 68.229 1.00 28.01 ? 328 GLY A CA  1 
ATOM   2544 C C   . GLY A 1 328 ? 13.006  64.157 69.338 1.00 28.67 ? 328 GLY A C   1 
ATOM   2545 O O   . GLY A 1 328 ? 12.055  63.721 69.985 1.00 29.26 ? 328 GLY A O   1 
ATOM   2546 N N   . SER A 1 329 ? 13.548  65.350 69.563 1.00 27.57 ? 329 SER A N   1 
ATOM   2547 C CA  . SER A 1 329 ? 13.081  66.260 70.603 1.00 25.87 ? 329 SER A CA  1 
ATOM   2548 C C   . SER A 1 329 ? 11.605  66.174 70.951 1.00 27.41 ? 329 SER A C   1 
ATOM   2549 O O   . SER A 1 329 ? 11.237  65.740 72.036 1.00 31.11 ? 329 SER A O   1 
ATOM   2550 C CB  . SER A 1 329 ? 13.404  67.701 70.209 1.00 25.99 ? 329 SER A CB  1 
ATOM   2551 O OG  . SER A 1 329 ? 14.799  67.900 70.107 1.00 27.43 ? 329 SER A OG  1 
ATOM   2552 N N   . PHE A 1 330 ? 10.763  66.597 70.018 1.00 28.55 ? 330 PHE A N   1 
ATOM   2553 C CA  . PHE A 1 330 ? 9.316   66.633 70.206 1.00 28.54 ? 330 PHE A CA  1 
ATOM   2554 C C   . PHE A 1 330 ? 8.623   65.405 70.790 1.00 28.29 ? 330 PHE A C   1 
ATOM   2555 O O   . PHE A 1 330 ? 7.649   65.531 71.542 1.00 29.15 ? 330 PHE A O   1 
ATOM   2556 C CB  . PHE A 1 330 ? 8.655   66.987 68.880 1.00 29.29 ? 330 PHE A CB  1 
ATOM   2557 C CG  . PHE A 1 330 ? 7.550   67.979 69.008 1.00 35.10 ? 330 PHE A CG  1 
ATOM   2558 C CD1 . PHE A 1 330 ? 6.247   67.556 69.268 1.00 37.87 ? 330 PHE A CD1 1 
ATOM   2559 C CD2 . PHE A 1 330 ? 7.800   69.341 68.857 1.00 37.38 ? 330 PHE A CD2 1 
ATOM   2560 C CE1 . PHE A 1 330 ? 5.195   68.483 69.375 1.00 39.87 ? 330 PHE A CE1 1 
ATOM   2561 C CE2 . PHE A 1 330 ? 6.766   70.278 68.961 1.00 39.36 ? 330 PHE A CE2 1 
ATOM   2562 C CZ  . PHE A 1 330 ? 5.455   69.847 69.221 1.00 38.53 ? 330 PHE A CZ  1 
ATOM   2563 N N   . PHE A 1 331 ? 9.120   64.222 70.449 1.00 27.80 ? 331 PHE A N   1 
ATOM   2564 C CA  . PHE A 1 331 ? 8.515   62.970 70.898 1.00 26.82 ? 331 PHE A CA  1 
ATOM   2565 C C   . PHE A 1 331 ? 8.968   62.519 72.265 1.00 26.70 ? 331 PHE A C   1 
ATOM   2566 O O   . PHE A 1 331 ? 8.303   61.709 72.908 1.00 28.60 ? 331 PHE A O   1 
ATOM   2567 C CB  . PHE A 1 331 ? 8.790   61.885 69.856 1.00 26.17 ? 331 PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 331 ? 8.509   62.340 68.461 1.00 24.13 ? 331 PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 331 ? 9.449   63.097 67.768 1.00 21.82 ? 331 PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 331 ? 7.256   62.138 67.895 1.00 22.51 ? 331 PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 331 ? 9.144   63.656 66.547 1.00 21.44 ? 331 PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 331 ? 6.940   62.694 66.668 1.00 21.23 ? 331 PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 331 ? 7.882   63.457 65.995 1.00 21.77 ? 331 PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 332 ? 10.104  63.047 72.703 1.00 25.52 ? 332 LEU A N   1 
ATOM   2575 C CA  . LEU A 1 332 ? 10.652  62.717 74.004 1.00 22.29 ? 332 LEU A CA  1 
ATOM   2576 C C   . LEU A 1 332 ? 9.978   63.595 75.040 1.00 24.04 ? 332 LEU A C   1 
ATOM   2577 O O   . LEU A 1 332 ? 9.619   63.122 76.115 1.00 25.37 ? 332 LEU A O   1 
ATOM   2578 C CB  . LEU A 1 332 ? 12.147  62.970 74.014 1.00 19.49 ? 332 LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 332 ? 12.946  61.940 73.234 1.00 15.57 ? 332 LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 332 ? 14.171  62.620 72.658 1.00 14.64 ? 332 LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 332 ? 13.326  60.784 74.147 1.00 14.28 ? 332 LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 333 ? 9.811   64.875 74.712 1.00 23.57 ? 333 LEU A N   1 
ATOM   2583 C CA  . LEU A 1 333 ? 9.162   65.815 75.615 1.00 25.63 ? 333 LEU A CA  1 
ATOM   2584 C C   . LEU A 1 333 ? 7.730   65.380 75.837 1.00 26.67 ? 333 LEU A C   1 
ATOM   2585 O O   . LEU A 1 333 ? 7.182   65.546 76.925 1.00 29.99 ? 333 LEU A O   1 
ATOM   2586 C CB  . LEU A 1 333 ? 9.159   67.227 75.022 1.00 28.08 ? 333 LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 333 ? 7.925   68.088 75.341 1.00 27.72 ? 333 LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 333 ? 8.157   68.820 76.650 1.00 26.13 ? 333 LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 333 ? 7.645   69.083 74.217 1.00 25.63 ? 333 LEU A CD2 1 
ATOM   2590 N N   . TYR A 1 334 ? 7.129   64.821 74.791 1.00 27.84 ? 334 TYR A N   1 
ATOM   2591 C CA  . TYR A 1 334 ? 5.744   64.364 74.836 1.00 26.76 ? 334 TYR A CA  1 
ATOM   2592 C C   . TYR A 1 334 ? 5.568   62.928 75.322 1.00 27.12 ? 334 TYR A C   1 
ATOM   2593 O O   . TYR A 1 334 ? 4.457   62.521 75.635 1.00 27.71 ? 334 TYR A O   1 
ATOM   2594 C CB  . TYR A 1 334 ? 5.124   64.479 73.450 1.00 28.10 ? 334 TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 334 ? 4.457   65.797 73.177 1.00 29.46 ? 334 TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 334 ? 5.206   66.944 72.923 1.00 30.21 ? 334 TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 334 ? 3.078   65.898 73.166 1.00 29.41 ? 334 TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 334 ? 4.588   68.160 72.665 1.00 29.61 ? 334 TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 334 ? 2.452   67.104 72.910 1.00 31.07 ? 334 TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 334 ? 3.208   68.232 72.659 1.00 30.73 ? 334 TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 334 ? 2.564   69.420 72.383 1.00 32.04 ? 334 TYR A OH  1 
ATOM   2602 N N   . GLY A 1 335 ? 6.643   62.151 75.387 1.00 26.82 ? 335 GLY A N   1 
ATOM   2603 C CA  . GLY A 1 335 ? 6.479   60.777 75.817 1.00 27.28 ? 335 GLY A CA  1 
ATOM   2604 C C   . GLY A 1 335 ? 7.479   60.202 76.795 1.00 28.36 ? 335 GLY A C   1 
ATOM   2605 O O   . GLY A 1 335 ? 7.132   59.322 77.577 1.00 28.74 ? 335 GLY A O   1 
ATOM   2606 N N   . ALA A 1 336 ? 8.715   60.684 76.762 1.00 29.19 ? 336 ALA A N   1 
ATOM   2607 C CA  . ALA A 1 336 ? 9.744   60.169 77.656 1.00 30.25 ? 336 ALA A CA  1 
ATOM   2608 C C   . ALA A 1 336 ? 9.726   60.801 79.055 1.00 32.23 ? 336 ALA A C   1 
ATOM   2609 O O   . ALA A 1 336 ? 9.365   61.974 79.219 1.00 33.85 ? 336 ALA A O   1 
ATOM   2610 C CB  . ALA A 1 336 ? 11.100  60.356 77.017 1.00 28.99 ? 336 ALA A CB  1 
ATOM   2611 N N   . PRO A 1 337 ? 10.107  60.019 80.088 1.00 32.53 ? 337 PRO A N   1 
ATOM   2612 C CA  . PRO A 1 337 ? 10.148  60.470 81.485 1.00 30.86 ? 337 PRO A CA  1 
ATOM   2613 C C   . PRO A 1 337 ? 11.455  61.177 81.806 1.00 29.73 ? 337 PRO A C   1 
ATOM   2614 O O   . PRO A 1 337 ? 12.529  60.614 81.650 1.00 30.30 ? 337 PRO A O   1 
ATOM   2615 C CB  . PRO A 1 337 ? 10.016  59.182 82.270 1.00 29.51 ? 337 PRO A CB  1 
ATOM   2616 C CG  . PRO A 1 337 ? 10.773  58.209 81.435 1.00 31.00 ? 337 PRO A CG  1 
ATOM   2617 C CD  . PRO A 1 337 ? 10.512  58.606 79.982 1.00 32.40 ? 337 PRO A CD  1 
ATOM   2618 N N   . GLY A 1 338 ? 11.352  62.415 82.262 1.00 29.56 ? 338 GLY A N   1 
ATOM   2619 C CA  . GLY A 1 338 ? 12.541  63.173 82.593 1.00 29.14 ? 338 GLY A CA  1 
ATOM   2620 C C   . GLY A 1 338 ? 12.556  64.434 81.767 1.00 28.29 ? 338 GLY A C   1 
ATOM   2621 O O   . GLY A 1 338 ? 13.399  65.314 81.955 1.00 28.58 ? 338 GLY A O   1 
ATOM   2622 N N   . PHE A 1 339 ? 11.597  64.518 80.851 1.00 26.72 ? 339 PHE A N   1 
ATOM   2623 C CA  . PHE A 1 339 ? 11.484  65.663 79.963 1.00 25.74 ? 339 PHE A CA  1 
ATOM   2624 C C   . PHE A 1 339 ? 10.340  66.578 80.369 1.00 26.01 ? 339 PHE A C   1 
ATOM   2625 O O   . PHE A 1 339 ? 9.295   66.128 80.838 1.00 27.59 ? 339 PHE A O   1 
ATOM   2626 C CB  . PHE A 1 339 ? 11.278  65.188 78.522 1.00 23.51 ? 339 PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 339 ? 12.487  64.529 77.920 1.00 19.68 ? 339 PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 339 ? 13.571  65.287 77.499 1.00 22.11 ? 339 PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 339 ? 12.533  63.158 77.753 1.00 17.34 ? 339 PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 339 ? 14.688  64.684 76.915 1.00 20.32 ? 339 PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 339 ? 13.639  62.546 77.173 1.00 19.02 ? 339 PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 339 ? 14.717  63.311 76.753 1.00 20.39 ? 339 PHE A CZ  1 
ATOM   2633 N N   . SER A 1 340 ? 10.550  67.874 80.194 1.00 25.69 ? 340 SER A N   1 
ATOM   2634 C CA  . SER A 1 340 ? 9.533   68.848 80.529 1.00 27.05 ? 340 SER A CA  1 
ATOM   2635 C C   . SER A 1 340 ? 9.759   70.083 79.668 1.00 28.32 ? 340 SER A C   1 
ATOM   2636 O O   . SER A 1 340 ? 10.897  70.463 79.386 1.00 29.58 ? 340 SER A O   1 
ATOM   2637 C CB  . SER A 1 340 ? 9.602   69.207 82.014 1.00 27.20 ? 340 SER A CB  1 
ATOM   2638 O OG  . SER A 1 340 ? 10.385  68.269 82.734 1.00 31.86 ? 340 SER A OG  1 
ATOM   2639 N N   . LYS A 1 341 ? 8.663   70.696 79.243 1.00 27.05 ? 341 LYS A N   1 
ATOM   2640 C CA  . LYS A 1 341 ? 8.724   71.876 78.404 1.00 28.49 ? 341 LYS A CA  1 
ATOM   2641 C C   . LYS A 1 341 ? 9.502   73.010 79.063 1.00 29.70 ? 341 LYS A C   1 
ATOM   2642 O O   . LYS A 1 341 ? 10.122  73.827 78.380 1.00 30.97 ? 341 LYS A O   1 
ATOM   2643 C CB  . LYS A 1 341 ? 7.297   72.340 78.089 1.00 27.72 ? 341 LYS A CB  1 
ATOM   2644 C CG  . LYS A 1 341 ? 7.174   73.239 76.882 1.00 27.03 ? 341 LYS A CG  1 
ATOM   2645 C CD  . LYS A 1 341 ? 7.006   74.682 77.303 1.00 27.13 ? 341 LYS A CD  1 
ATOM   2646 C CE  . LYS A 1 341 ? 5.554   75.128 77.220 1.00 30.14 ? 341 LYS A CE  1 
ATOM   2647 N NZ  . LYS A 1 341 ? 5.264   76.314 78.099 1.00 31.19 ? 341 LYS A NZ  1 
ATOM   2648 N N   . ASP A 1 342 ? 9.492   73.046 80.393 1.00 30.55 ? 342 ASP A N   1 
ATOM   2649 C CA  . ASP A 1 342 ? 10.145  74.128 81.117 1.00 30.09 ? 342 ASP A CA  1 
ATOM   2650 C C   . ASP A 1 342 ? 11.396  73.802 81.929 1.00 30.11 ? 342 ASP A C   1 
ATOM   2651 O O   . ASP A 1 342 ? 11.603  74.367 82.998 1.00 30.00 ? 342 ASP A O   1 
ATOM   2652 C CB  . ASP A 1 342 ? 9.113   74.820 82.020 1.00 30.50 ? 342 ASP A CB  1 
ATOM   2653 C CG  . ASP A 1 342 ? 7.811   75.135 81.291 1.00 31.07 ? 342 ASP A CG  1 
ATOM   2654 O OD1 . ASP A 1 342 ? 7.821   75.150 80.046 1.00 31.77 ? 342 ASP A OD1 1 
ATOM   2655 O OD2 . ASP A 1 342 ? 6.775   75.368 81.953 1.00 33.05 ? 342 ASP A OD2 1 
ATOM   2656 N N   . SER A 1 343 ? 12.235  72.905 81.431 1.00 30.54 ? 343 SER A N   1 
ATOM   2657 C CA  . SER A 1 343 ? 13.472  72.577 82.132 1.00 29.89 ? 343 SER A CA  1 
ATOM   2658 C C   . SER A 1 343 ? 14.543  72.131 81.146 1.00 31.02 ? 343 SER A C   1 
ATOM   2659 O O   . SER A 1 343 ? 14.286  72.007 79.950 1.00 31.47 ? 343 SER A O   1 
ATOM   2660 C CB  . SER A 1 343 ? 13.240  71.484 83.169 1.00 27.10 ? 343 SER A CB  1 
ATOM   2661 O OG  . SER A 1 343 ? 12.361  70.502 82.674 1.00 30.67 ? 343 SER A OG  1 
ATOM   2662 N N   . GLU A 1 344 ? 15.748  71.906 81.656 1.00 31.78 ? 344 GLU A N   1 
ATOM   2663 C CA  . GLU A 1 344 ? 16.872  71.473 80.836 1.00 31.43 ? 344 GLU A CA  1 
ATOM   2664 C C   . GLU A 1 344 ? 16.711  69.982 80.545 1.00 31.61 ? 344 GLU A C   1 
ATOM   2665 O O   . GLU A 1 344 ? 17.474  69.393 79.769 1.00 31.48 ? 344 GLU A O   1 
ATOM   2666 C CB  . GLU A 1 344 ? 18.182  71.710 81.596 1.00 33.61 ? 344 GLU A CB  1 
ATOM   2667 C CG  . GLU A 1 344 ? 18.892  73.019 81.280 1.00 34.58 ? 344 GLU A CG  1 
ATOM   2668 C CD  . GLU A 1 344 ? 20.190  73.177 82.055 1.00 33.83 ? 344 GLU A CD  1 
ATOM   2669 O OE1 . GLU A 1 344 ? 20.129  73.437 83.275 0.00 33.95 ? 344 GLU A OE1 1 
ATOM   2670 O OE2 . GLU A 1 344 ? 21.269  73.042 81.440 0.00 33.94 ? 344 GLU A OE2 1 
ATOM   2671 N N   . SER A 1 345 ? 15.714  69.382 81.190 1.00 29.33 ? 345 SER A N   1 
ATOM   2672 C CA  . SER A 1 345 ? 15.428  67.968 81.041 1.00 27.48 ? 345 SER A CA  1 
ATOM   2673 C C   . SER A 1 345 ? 16.696  67.129 80.917 1.00 28.95 ? 345 SER A C   1 
ATOM   2674 O O   . SER A 1 345 ? 16.843  66.341 79.987 1.00 29.63 ? 345 SER A O   1 
ATOM   2675 C CB  . SER A 1 345 ? 14.530  67.735 79.831 1.00 27.59 ? 345 SER A CB  1 
ATOM   2676 O OG  . SER A 1 345 ? 13.327  68.478 79.940 1.00 30.86 ? 345 SER A OG  1 
ATOM   2677 N N   . LYS A 1 346 ? 17.625  67.318 81.846 1.00 29.20 ? 346 LYS A N   1 
ATOM   2678 C CA  . LYS A 1 346 ? 18.845  66.527 81.854 1.00 31.12 ? 346 LYS A CA  1 
ATOM   2679 C C   . LYS A 1 346 ? 18.370  65.154 82.319 1.00 32.27 ? 346 LYS A C   1 
ATOM   2680 O O   . LYS A 1 346 ? 17.687  65.054 83.334 1.00 35.30 ? 346 LYS A O   1 
ATOM   2681 C CB  . LYS A 1 346 ? 19.844  67.112 82.852 1.00 32.22 ? 346 LYS A CB  1 
ATOM   2682 C CG  . LYS A 1 346 ? 20.592  68.327 82.335 1.00 34.88 ? 346 LYS A CG  1 
ATOM   2683 C CD  . LYS A 1 346 ? 20.692  69.403 83.400 1.00 39.94 ? 346 LYS A CD  1 
ATOM   2684 C CE  . LYS A 1 346 ? 22.078  70.053 83.426 1.00 44.57 ? 346 LYS A CE  1 
ATOM   2685 N NZ  . LYS A 1 346 ? 22.000  71.547 83.462 1.00 42.37 ? 346 LYS A NZ  1 
ATOM   2686 N N   . ILE A 1 347 ? 18.712  64.098 81.590 1.00 32.77 ? 347 ILE A N   1 
ATOM   2687 C CA  . ILE A 1 347 ? 18.250  62.762 81.959 1.00 31.24 ? 347 ILE A CA  1 
ATOM   2688 C C   . ILE A 1 347 ? 19.267  61.898 82.692 1.00 32.50 ? 347 ILE A C   1 
ATOM   2689 O O   . ILE A 1 347 ? 20.473  62.076 82.558 1.00 35.75 ? 347 ILE A O   1 
ATOM   2690 C CB  . ILE A 1 347 ? 17.739  62.005 80.710 1.00 28.06 ? 347 ILE A CB  1 
ATOM   2691 C CG1 . ILE A 1 347 ? 16.264  62.318 80.500 1.00 23.39 ? 347 ILE A CG1 1 
ATOM   2692 C CG2 . ILE A 1 347 ? 17.904  60.508 80.875 1.00 29.68 ? 347 ILE A CG2 1 
ATOM   2693 C CD1 . ILE A 1 347 ? 16.019  63.728 80.107 1.00 21.72 ? 347 ILE A CD1 1 
ATOM   2694 N N   . SER A 1 348 ? 18.757  60.945 83.462 1.00 32.55 ? 348 SER A N   1 
ATOM   2695 C CA  . SER A 1 348 ? 19.593  60.042 84.236 1.00 30.31 ? 348 SER A CA  1 
ATOM   2696 C C   . SER A 1 348 ? 19.750  58.722 83.523 1.00 30.73 ? 348 SER A C   1 
ATOM   2697 O O   . SER A 1 348 ? 18.839  58.292 82.818 1.00 32.03 ? 348 SER A O   1 
ATOM   2698 C CB  . SER A 1 348 ? 18.953  59.786 85.595 1.00 30.50 ? 348 SER A CB  1 
ATOM   2699 O OG  . SER A 1 348 ? 17.592  59.426 85.449 1.00 27.65 ? 348 SER A OG  1 
ATOM   2700 N N   . ARG A 1 349 ? 20.896  58.075 83.725 1.00 30.87 ? 349 ARG A N   1 
ATOM   2701 C CA  . ARG A 1 349 ? 21.172  56.784 83.107 1.00 31.07 ? 349 ARG A CA  1 
ATOM   2702 C C   . ARG A 1 349 ? 19.891  55.969 83.109 1.00 31.18 ? 349 ARG A C   1 
ATOM   2703 O O   . ARG A 1 349 ? 19.569  55.286 82.139 1.00 31.73 ? 349 ARG A O   1 
ATOM   2704 C CB  . ARG A 1 349 ? 22.256  56.038 83.891 1.00 33.33 ? 349 ARG A CB  1 
ATOM   2705 C CG  . ARG A 1 349 ? 23.415  55.476 83.050 1.00 33.40 ? 349 ARG A CG  1 
ATOM   2706 C CD  . ARG A 1 349 ? 22.922  54.618 81.884 1.00 35.25 ? 349 ARG A CD  1 
ATOM   2707 N NE  . ARG A 1 349 ? 23.651  54.889 80.651 1.00 31.61 ? 349 ARG A NE  1 
ATOM   2708 C CZ  . ARG A 1 349 ? 24.017  56.102 80.253 1.00 32.85 ? 349 ARG A CZ  1 
ATOM   2709 N NH1 . ARG A 1 349 ? 23.728  57.168 80.981 1.00 33.06 ? 349 ARG A NH1 1 
ATOM   2710 N NH2 . ARG A 1 349 ? 24.680  56.253 79.122 1.00 36.65 ? 349 ARG A NH2 1 
ATOM   2711 N N   . GLU A 1 350 ? 19.158  56.061 84.212 1.00 32.10 ? 350 GLU A N   1 
ATOM   2712 C CA  . GLU A 1 350 ? 17.903  55.343 84.372 1.00 32.27 ? 350 GLU A CA  1 
ATOM   2713 C C   . GLU A 1 350 ? 16.860  55.848 83.375 1.00 33.42 ? 350 GLU A C   1 
ATOM   2714 O O   . GLU A 1 350 ? 16.468  55.124 82.452 1.00 35.47 ? 350 GLU A O   1 
ATOM   2715 C CB  . GLU A 1 350 ? 17.401  55.516 85.802 1.00 32.57 ? 350 GLU A CB  1 
ATOM   2716 C CG  . GLU A 1 350 ? 16.739  54.289 86.378 1.00 35.98 ? 350 GLU A CG  1 
ATOM   2717 C CD  . GLU A 1 350 ? 15.290  54.543 86.767 1.00 38.10 ? 350 GLU A CD  1 
ATOM   2718 O OE1 . GLU A 1 350 ? 15.053  55.016 87.899 0.00 36.85 ? 350 GLU A OE1 1 
ATOM   2719 O OE2 . GLU A 1 350 ? 14.393  54.270 85.942 0.00 36.87 ? 350 GLU A OE2 1 
ATOM   2720 N N   . ASP A 1 351 ? 16.414  57.090 83.558 1.00 33.12 ? 351 ASP A N   1 
ATOM   2721 C CA  . ASP A 1 351 ? 15.431  57.684 82.659 1.00 31.71 ? 351 ASP A CA  1 
ATOM   2722 C C   . ASP A 1 351 ? 15.885  57.419 81.227 1.00 30.04 ? 351 ASP A C   1 
ATOM   2723 O O   . ASP A 1 351 ? 15.094  57.017 80.387 1.00 30.85 ? 351 ASP A O   1 
ATOM   2724 C CB  . ASP A 1 351 ? 15.308  59.194 82.912 1.00 34.29 ? 351 ASP A CB  1 
ATOM   2725 C CG  . ASP A 1 351 ? 14.118  59.552 83.821 1.00 35.23 ? 351 ASP A CG  1 
ATOM   2726 O OD1 . ASP A 1 351 ? 13.223  58.700 84.018 1.00 35.81 ? 351 ASP A OD1 1 
ATOM   2727 O OD2 . ASP A 1 351 ? 14.077  60.690 84.339 1.00 33.58 ? 351 ASP A OD2 1 
ATOM   2728 N N   . PHE A 1 352 ? 17.167  57.627 80.959 1.00 27.64 ? 352 PHE A N   1 
ATOM   2729 C CA  . PHE A 1 352 ? 17.705  57.377 79.630 1.00 27.73 ? 352 PHE A CA  1 
ATOM   2730 C C   . PHE A 1 352 ? 17.428  55.936 79.243 1.00 29.43 ? 352 PHE A C   1 
ATOM   2731 O O   . PHE A 1 352 ? 16.758  55.660 78.256 1.00 30.77 ? 352 PHE A O   1 
ATOM   2732 C CB  . PHE A 1 352 ? 19.212  57.614 79.611 1.00 25.30 ? 352 PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 352 ? 19.875  57.257 78.310 1.00 20.51 ? 352 PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 352 ? 20.062  55.933 77.948 1.00 19.58 ? 352 PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 352 ? 20.361  58.251 77.468 1.00 21.14 ? 352 PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 352 ? 20.733  55.602 76.765 1.00 20.64 ? 352 PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 352 ? 21.034  57.928 76.281 1.00 20.53 ? 352 PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 352 ? 21.219  56.604 75.934 1.00 18.04 ? 352 PHE A CZ  1 
ATOM   2739 N N   . MET A 1 353 ? 17.957  55.014 80.030 1.00 32.34 ? 353 MET A N   1 
ATOM   2740 C CA  . MET A 1 353 ? 17.772  53.599 79.753 1.00 33.75 ? 353 MET A CA  1 
ATOM   2741 C C   . MET A 1 353 ? 16.312  53.253 79.560 1.00 33.23 ? 353 MET A C   1 
ATOM   2742 O O   . MET A 1 353 ? 15.978  52.331 78.812 1.00 33.25 ? 353 MET A O   1 
ATOM   2743 C CB  . MET A 1 353 ? 18.339  52.760 80.885 1.00 34.15 ? 353 MET A CB  1 
ATOM   2744 C CG  . MET A 1 353 ? 19.502  51.898 80.468 1.00 36.78 ? 353 MET A CG  1 
ATOM   2745 S SD  . MET A 1 353 ? 20.534  51.572 81.891 1.00 44.48 ? 353 MET A SD  1 
ATOM   2746 C CE  . MET A 1 353 ? 19.285  51.051 83.094 1.00 38.76 ? 353 MET A CE  1 
ATOM   2747 N N   . SER A 1 354 ? 15.444  53.998 80.234 1.00 32.11 ? 354 SER A N   1 
ATOM   2748 C CA  . SER A 1 354 ? 14.016  53.750 80.132 1.00 33.80 ? 354 SER A CA  1 
ATOM   2749 C C   . SER A 1 354 ? 13.405  54.405 78.883 1.00 34.88 ? 354 SER A C   1 
ATOM   2750 O O   . SER A 1 354 ? 12.338  53.993 78.407 1.00 35.84 ? 354 SER A O   1 
ATOM   2751 C CB  . SER A 1 354 ? 13.315  54.226 81.416 1.00 31.85 ? 354 SER A CB  1 
ATOM   2752 O OG  . SER A 1 354 ? 12.755  55.516 81.268 1.00 32.22 ? 354 SER A OG  1 
ATOM   2753 N N   . GLY A 1 355 ? 14.097  55.412 78.349 1.00 35.76 ? 355 GLY A N   1 
ATOM   2754 C CA  . GLY A 1 355 ? 13.626  56.102 77.162 1.00 32.70 ? 355 GLY A CA  1 
ATOM   2755 C C   . GLY A 1 355 ? 13.945  55.284 75.927 1.00 33.16 ? 355 GLY A C   1 
ATOM   2756 O O   . GLY A 1 355 ? 13.123  55.156 75.023 1.00 33.43 ? 355 GLY A O   1 
ATOM   2757 N N   . VAL A 1 356 ? 15.141  54.711 75.896 1.00 32.28 ? 356 VAL A N   1 
ATOM   2758 C CA  . VAL A 1 356 ? 15.563  53.904 74.761 1.00 32.74 ? 356 VAL A CA  1 
ATOM   2759 C C   . VAL A 1 356 ? 14.614  52.742 74.515 1.00 31.86 ? 356 VAL A C   1 
ATOM   2760 O O   . VAL A 1 356 ? 14.520  52.244 73.402 1.00 33.52 ? 356 VAL A O   1 
ATOM   2761 C CB  . VAL A 1 356 ? 17.000  53.360 74.962 1.00 34.20 ? 356 VAL A CB  1 
ATOM   2762 C CG1 . VAL A 1 356 ? 17.385  53.442 76.427 1.00 34.49 ? 356 VAL A CG1 1 
ATOM   2763 C CG2 . VAL A 1 356 ? 17.100  51.925 74.464 1.00 36.68 ? 356 VAL A CG2 1 
ATOM   2764 N N   . LYS A 1 357 ? 13.925  52.300 75.558 1.00 32.63 ? 357 LYS A N   1 
ATOM   2765 C CA  . LYS A 1 357 ? 12.972  51.204 75.422 1.00 32.35 ? 357 LYS A CA  1 
ATOM   2766 C C   . LYS A 1 357 ? 11.703  51.744 74.758 1.00 31.85 ? 357 LYS A C   1 
ATOM   2767 O O   . LYS A 1 357 ? 10.995  51.030 74.050 1.00 34.55 ? 357 LYS A O   1 
ATOM   2768 C CB  . LYS A 1 357 ? 12.639  50.613 76.797 1.00 32.73 ? 357 LYS A CB  1 
ATOM   2769 C CG  . LYS A 1 357 ? 11.617  49.475 76.767 1.00 35.87 ? 357 LYS A CG  1 
ATOM   2770 C CD  . LYS A 1 357 ? 12.208  48.173 76.204 1.00 39.07 ? 357 LYS A CD  1 
ATOM   2771 C CE  . LYS A 1 357 ? 11.140  47.089 76.001 1.00 38.26 ? 357 LYS A CE  1 
ATOM   2772 N NZ  . LYS A 1 357 ? 10.761  46.437 77.285 0.00 38.52 ? 357 LYS A NZ  1 
ATOM   2773 N N   . LEU A 1 358 ? 11.429  53.019 74.997 1.00 30.28 ? 358 LEU A N   1 
ATOM   2774 C CA  . LEU A 1 358 ? 10.273  53.687 74.423 1.00 27.41 ? 358 LEU A CA  1 
ATOM   2775 C C   . LEU A 1 358 ? 10.562  54.014 72.947 1.00 28.07 ? 358 LEU A C   1 
ATOM   2776 O O   . LEU A 1 358 ? 9.634   54.164 72.153 1.00 29.50 ? 358 LEU A O   1 
ATOM   2777 C CB  . LEU A 1 358 ? 10.008  54.988 75.194 1.00 23.44 ? 358 LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 358 ? 8.763   55.201 76.058 1.00 21.51 ? 358 LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 358 ? 8.257   53.899 76.604 1.00 21.81 ? 358 LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 358 ? 9.101   56.135 77.194 1.00 20.53 ? 358 LEU A CD2 1 
ATOM   2781 N N   . SER A 1 359 ? 11.849  54.124 72.595 1.00 26.35 ? 359 SER A N   1 
ATOM   2782 C CA  . SER A 1 359 ? 12.298  54.460 71.227 1.00 24.57 ? 359 SER A CA  1 
ATOM   2783 C C   . SER A 1 359 ? 12.385  53.282 70.249 1.00 24.62 ? 359 SER A C   1 
ATOM   2784 O O   . SER A 1 359 ? 11.950  53.378 69.099 1.00 25.55 ? 359 SER A O   1 
ATOM   2785 C CB  . SER A 1 359 ? 13.661  55.153 71.276 1.00 22.53 ? 359 SER A CB  1 
ATOM   2786 O OG  . SER A 1 359 ? 13.627  56.284 72.131 1.00 20.80 ? 359 SER A OG  1 
ATOM   2787 N N   . VAL A 1 360 ? 12.977  52.187 70.697 1.00 21.56 ? 360 VAL A N   1 
ATOM   2788 C CA  . VAL A 1 360 ? 13.090  50.995 69.882 1.00 21.28 ? 360 VAL A CA  1 
ATOM   2789 C C   . VAL A 1 360 ? 12.182  49.997 70.592 1.00 26.43 ? 360 VAL A C   1 
ATOM   2790 O O   . VAL A 1 360 ? 12.649  49.063 71.249 1.00 30.46 ? 360 VAL A O   1 
ATOM   2791 C CB  . VAL A 1 360 ? 14.543  50.494 69.864 1.00 17.66 ? 360 VAL A CB  1 
ATOM   2792 C CG1 . VAL A 1 360 ? 14.719  49.424 68.817 1.00 11.24 ? 360 VAL A CG1 1 
ATOM   2793 C CG2 . VAL A 1 360 ? 15.472  51.656 69.585 1.00 15.85 ? 360 VAL A CG2 1 
ATOM   2794 N N   . PRO A 1 361 ? 10.859  50.178 70.460 1.00 28.47 ? 361 PRO A N   1 
ATOM   2795 C CA  . PRO A 1 361 ? 9.879   49.295 71.107 1.00 29.57 ? 361 PRO A CA  1 
ATOM   2796 C C   . PRO A 1 361 ? 9.879   47.852 70.620 1.00 31.55 ? 361 PRO A C   1 
ATOM   2797 O O   . PRO A 1 361 ? 9.525   46.934 71.367 1.00 32.32 ? 361 PRO A O   1 
ATOM   2798 C CB  . PRO A 1 361 ? 8.542   49.995 70.847 1.00 28.14 ? 361 PRO A CB  1 
ATOM   2799 C CG  . PRO A 1 361 ? 8.765   50.782 69.606 1.00 25.48 ? 361 PRO A CG  1 
ATOM   2800 C CD  . PRO A 1 361 ? 10.207  51.214 69.638 1.00 27.92 ? 361 PRO A CD  1 
ATOM   2801 N N   . HIS A 1 362 ? 10.274  47.659 69.367 1.00 33.59 ? 362 HIS A N   1 
ATOM   2802 C CA  . HIS A 1 362 ? 10.313  46.332 68.765 1.00 35.51 ? 362 HIS A CA  1 
ATOM   2803 C C   . HIS A 1 362 ? 11.614  45.611 69.105 1.00 34.58 ? 362 HIS A C   1 
ATOM   2804 O O   . HIS A 1 362 ? 11.850  44.479 68.673 1.00 35.40 ? 362 HIS A O   1 
ATOM   2805 C CB  . HIS A 1 362 ? 10.160  46.452 67.241 1.00 40.09 ? 362 HIS A CB  1 
ATOM   2806 C CG  . HIS A 1 362 ? 11.245  47.252 66.571 1.00 45.07 ? 362 HIS A CG  1 
ATOM   2807 N ND1 . HIS A 1 362 ? 10.977  48.244 65.648 1.00 45.61 ? 362 HIS A ND1 1 
ATOM   2808 C CD2 . HIS A 1 362 ? 12.597  47.169 66.647 1.00 44.77 ? 362 HIS A CD2 1 
ATOM   2809 C CE1 . HIS A 1 362 ? 12.114  48.734 65.186 1.00 45.62 ? 362 HIS A CE1 1 
ATOM   2810 N NE2 . HIS A 1 362 ? 13.112  48.099 65.776 1.00 44.28 ? 362 HIS A NE2 1 
ATOM   2811 N N   . ALA A 1 363 ? 12.452  46.275 69.892 1.00 32.19 ? 363 ALA A N   1 
ATOM   2812 C CA  . ALA A 1 363 ? 13.739  45.722 70.268 1.00 30.81 ? 363 ALA A CA  1 
ATOM   2813 C C   . ALA A 1 363 ? 13.683  44.811 71.485 1.00 29.59 ? 363 ALA A C   1 
ATOM   2814 O O   . ALA A 1 363 ? 12.934  45.067 72.425 1.00 30.26 ? 363 ALA A O   1 
ATOM   2815 C CB  . ALA A 1 363 ? 14.717  46.853 70.517 1.00 28.81 ? 363 ALA A CB  1 
ATOM   2816 N N   . ASN A 1 364 ? 14.477  43.742 71.454 1.00 28.02 ? 364 ASN A N   1 
ATOM   2817 C CA  . ASN A 1 364 ? 14.550  42.811 72.568 1.00 27.36 ? 364 ASN A CA  1 
ATOM   2818 C C   . ASN A 1 364 ? 15.643  43.361 73.453 1.00 30.29 ? 364 ASN A C   1 
ATOM   2819 O O   . ASN A 1 364 ? 16.252  44.377 73.108 1.00 34.46 ? 364 ASN A O   1 
ATOM   2820 C CB  . ASN A 1 364 ? 14.885  41.388 72.102 1.00 25.70 ? 364 ASN A CB  1 
ATOM   2821 C CG  . ASN A 1 364 ? 16.267  41.266 71.488 1.00 25.81 ? 364 ASN A CG  1 
ATOM   2822 O OD1 . ASN A 1 364 ? 17.069  42.189 71.542 1.00 31.45 ? 364 ASN A OD1 1 
ATOM   2823 N ND2 . ASN A 1 364 ? 16.550  40.111 70.897 1.00 24.33 ? 364 ASN A ND2 1 
ATOM   2824 N N   . ASP A 1 365 ? 15.902  42.705 74.582 1.00 31.24 ? 365 ASP A N   1 
ATOM   2825 C CA  . ASP A 1 365 ? 16.908  43.180 75.528 1.00 28.12 ? 365 ASP A CA  1 
ATOM   2826 C C   . ASP A 1 365 ? 18.326  43.246 74.979 1.00 27.28 ? 365 ASP A C   1 
ATOM   2827 O O   . ASP A 1 365 ? 19.076  44.161 75.300 1.00 29.38 ? 365 ASP A O   1 
ATOM   2828 C CB  . ASP A 1 365 ? 16.863  42.329 76.794 1.00 27.23 ? 365 ASP A CB  1 
ATOM   2829 C CG  . ASP A 1 365 ? 15.752  42.755 77.732 1.00 26.66 ? 365 ASP A CG  1 
ATOM   2830 O OD1 . ASP A 1 365 ? 14.579  42.763 77.301 0.00 26.91 ? 365 ASP A OD1 1 
ATOM   2831 O OD2 . ASP A 1 365 ? 16.049  43.082 78.900 0.00 26.87 ? 365 ASP A OD2 1 
ATOM   2832 N N   . LEU A 1 366 ? 18.709  42.285 74.156 1.00 26.05 ? 366 LEU A N   1 
ATOM   2833 C CA  . LEU A 1 366 ? 20.042  42.319 73.582 1.00 24.49 ? 366 LEU A CA  1 
ATOM   2834 C C   . LEU A 1 366 ? 20.115  43.558 72.708 1.00 24.49 ? 366 LEU A C   1 
ATOM   2835 O O   . LEU A 1 366 ? 21.142  44.224 72.643 1.00 25.42 ? 366 LEU A O   1 
ATOM   2836 C CB  . LEU A 1 366 ? 20.280  41.078 72.732 1.00 25.73 ? 366 LEU A CB  1 
ATOM   2837 C CG  . LEU A 1 366 ? 21.725  40.639 72.520 1.00 27.01 ? 366 LEU A CG  1 
ATOM   2838 C CD1 . LEU A 1 366 ? 21.990  40.567 71.028 1.00 26.74 ? 366 LEU A CD1 1 
ATOM   2839 C CD2 . LEU A 1 366 ? 22.689  41.598 73.208 1.00 29.29 ? 366 LEU A CD2 1 
ATOM   2840 N N   . GLY A 1 367 ? 19.003  43.856 72.041 1.00 25.33 ? 367 GLY A N   1 
ATOM   2841 C CA  . GLY A 1 367 ? 18.922  45.008 71.162 1.00 25.81 ? 367 GLY A CA  1 
ATOM   2842 C C   . GLY A 1 367 ? 19.062  46.303 71.929 1.00 27.25 ? 367 GLY A C   1 
ATOM   2843 O O   . GLY A 1 367 ? 19.933  47.119 71.630 1.00 28.79 ? 367 GLY A O   1 
ATOM   2844 N N   . LEU A 1 368 ? 18.198  46.498 72.917 1.00 27.62 ? 368 LEU A N   1 
ATOM   2845 C CA  . LEU A 1 368 ? 18.245  47.693 73.746 1.00 27.35 ? 368 LEU A CA  1 
ATOM   2846 C C   . LEU A 1 368 ? 19.678  47.899 74.225 1.00 28.11 ? 368 LEU A C   1 
ATOM   2847 O O   . LEU A 1 368 ? 20.149  49.029 74.337 1.00 29.28 ? 368 LEU A O   1 
ATOM   2848 C CB  . LEU A 1 368 ? 17.311  47.535 74.948 1.00 27.20 ? 368 LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 368 ? 15.832  47.316 74.612 1.00 28.02 ? 368 LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 368 ? 15.100  46.797 75.830 1.00 27.31 ? 368 LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 368 ? 15.217  48.626 74.131 1.00 29.73 ? 368 LEU A CD2 1 
ATOM   2852 N N   . ASP A 1 369 ? 20.366  46.797 74.502 1.00 28.19 ? 369 ASP A N   1 
ATOM   2853 C CA  . ASP A 1 369 ? 21.752  46.852 74.956 1.00 30.99 ? 369 ASP A CA  1 
ATOM   2854 C C   . ASP A 1 369 ? 22.617  47.474 73.866 1.00 31.40 ? 369 ASP A C   1 
ATOM   2855 O O   . ASP A 1 369 ? 23.393  48.398 74.126 1.00 32.73 ? 369 ASP A O   1 
ATOM   2856 C CB  . ASP A 1 369 ? 22.274  45.445 75.270 1.00 32.71 ? 369 ASP A CB  1 
ATOM   2857 C CG  . ASP A 1 369 ? 21.772  44.919 76.599 1.00 32.30 ? 369 ASP A CG  1 
ATOM   2858 O OD1 . ASP A 1 369 ? 21.492  45.744 77.490 1.00 36.21 ? 369 ASP A OD1 1 
ATOM   2859 O OD2 . ASP A 1 369 ? 21.658  43.685 76.753 1.00 33.31 ? 369 ASP A OD2 1 
ATOM   2860 N N   . ALA A 1 370 ? 22.478  46.958 72.647 1.00 30.13 ? 370 ALA A N   1 
ATOM   2861 C CA  . ALA A 1 370 ? 23.230  47.466 71.510 1.00 28.59 ? 370 ALA A CA  1 
ATOM   2862 C C   . ALA A 1 370 ? 22.995  48.966 71.366 1.00 26.87 ? 370 ALA A C   1 
ATOM   2863 O O   . ALA A 1 370 ? 23.939  49.746 71.271 1.00 28.20 ? 370 ALA A O   1 
ATOM   2864 C CB  . ALA A 1 370 ? 22.810  46.747 70.244 1.00 28.62 ? 370 ALA A CB  1 
ATOM   2865 N N   . VAL A 1 371 ? 21.734  49.374 71.358 1.00 24.49 ? 371 VAL A N   1 
ATOM   2866 C CA  . VAL A 1 371 ? 21.426  50.789 71.229 1.00 25.41 ? 371 VAL A CA  1 
ATOM   2867 C C   . VAL A 1 371 ? 22.178  51.611 72.285 1.00 27.12 ? 371 VAL A C   1 
ATOM   2868 O O   . VAL A 1 371 ? 22.933  52.530 71.960 1.00 27.11 ? 371 VAL A O   1 
ATOM   2869 C CB  . VAL A 1 371 ? 19.911  51.045 71.381 1.00 24.26 ? 371 VAL A CB  1 
ATOM   2870 C CG1 . VAL A 1 371 ? 19.621  52.530 71.230 1.00 23.86 ? 371 VAL A CG1 1 
ATOM   2871 C CG2 . VAL A 1 371 ? 19.131  50.237 70.346 1.00 22.84 ? 371 VAL A CG2 1 
ATOM   2872 N N   . THR A 1 372 ? 21.973  51.261 73.551 1.00 28.39 ? 372 THR A N   1 
ATOM   2873 C CA  . THR A 1 372 ? 22.600  51.960 74.668 1.00 28.32 ? 372 THR A CA  1 
ATOM   2874 C C   . THR A 1 372 ? 24.114  52.050 74.528 1.00 27.21 ? 372 THR A C   1 
ATOM   2875 O O   . THR A 1 372 ? 24.697  53.135 74.508 1.00 23.65 ? 372 THR A O   1 
ATOM   2876 C CB  . THR A 1 372 ? 22.267  51.265 76.005 1.00 29.12 ? 372 THR A CB  1 
ATOM   2877 O OG1 . THR A 1 372 ? 20.847  51.058 76.107 1.00 28.42 ? 372 THR A OG1 1 
ATOM   2878 C CG2 . THR A 1 372 ? 22.739  52.122 77.168 1.00 29.36 ? 372 THR A CG2 1 
ATOM   2879 N N   . LEU A 1 373 ? 24.753  50.897 74.440 1.00 28.65 ? 373 LEU A N   1 
ATOM   2880 C CA  . LEU A 1 373 ? 26.196  50.860 74.294 1.00 32.16 ? 373 LEU A CA  1 
ATOM   2881 C C   . LEU A 1 373 ? 26.608  51.748 73.131 1.00 32.27 ? 373 LEU A C   1 
ATOM   2882 O O   . LEU A 1 373 ? 27.704  52.302 73.114 1.00 36.07 ? 373 LEU A O   1 
ATOM   2883 C CB  . LEU A 1 373 ? 26.652  49.422 74.034 1.00 33.05 ? 373 LEU A CB  1 
ATOM   2884 C CG  . LEU A 1 373 ? 28.118  49.141 73.700 1.00 32.01 ? 373 LEU A CG  1 
ATOM   2885 C CD1 . LEU A 1 373 ? 28.710  48.180 74.720 1.00 30.27 ? 373 LEU A CD1 1 
ATOM   2886 C CD2 . LEU A 1 373 ? 28.199  48.544 72.309 1.00 31.95 ? 373 LEU A CD2 1 
ATOM   2887 N N   . GLN A 1 374 ? 25.709  51.894 72.166 1.00 33.54 ? 374 GLN A N   1 
ATOM   2888 C CA  . GLN A 1 374 ? 25.985  52.685 70.972 1.00 33.55 ? 374 GLN A CA  1 
ATOM   2889 C C   . GLN A 1 374 ? 25.857  54.195 71.151 1.00 32.16 ? 374 GLN A C   1 
ATOM   2890 O O   . GLN A 1 374 ? 26.600  54.963 70.544 1.00 31.36 ? 374 GLN A O   1 
ATOM   2891 C CB  . GLN A 1 374 ? 25.066  52.228 69.840 1.00 34.41 ? 374 GLN A CB  1 
ATOM   2892 C CG  . GLN A 1 374 ? 25.248  53.007 68.560 1.00 37.68 ? 374 GLN A CG  1 
ATOM   2893 C CD  . GLN A 1 374 ? 26.491  52.594 67.813 1.00 39.50 ? 374 GLN A CD  1 
ATOM   2894 O OE1 . GLN A 1 374 ? 26.923  53.277 66.881 1.00 40.31 ? 374 GLN A OE1 1 
ATOM   2895 N NE2 . GLN A 1 374 ? 27.077  51.466 68.214 1.00 39.22 ? 374 GLN A NE2 1 
ATOM   2896 N N   . TYR A 1 375 ? 24.918  54.614 71.990 1.00 30.36 ? 375 TYR A N   1 
ATOM   2897 C CA  . TYR A 1 375 ? 24.681  56.030 72.230 1.00 28.73 ? 375 TYR A CA  1 
ATOM   2898 C C   . TYR A 1 375 ? 25.003  56.428 73.674 1.00 29.28 ? 375 TYR A C   1 
ATOM   2899 O O   . TYR A 1 375 ? 24.275  57.219 74.283 1.00 30.75 ? 375 TYR A O   1 
ATOM   2900 C CB  . TYR A 1 375 ? 23.216  56.344 71.920 1.00 29.56 ? 375 TYR A CB  1 
ATOM   2901 C CG  . TYR A 1 375 ? 22.887  56.373 70.439 1.00 26.61 ? 375 TYR A CG  1 
ATOM   2902 C CD1 . TYR A 1 375 ? 22.556  55.206 69.746 1.00 23.74 ? 375 TYR A CD1 1 
ATOM   2903 C CD2 . TYR A 1 375 ? 22.901  57.572 69.739 1.00 24.70 ? 375 TYR A CD2 1 
ATOM   2904 C CE1 . TYR A 1 375 ? 22.247  55.244 68.402 1.00 22.71 ? 375 TYR A CE1 1 
ATOM   2905 C CE2 . TYR A 1 375 ? 22.598  57.619 68.403 1.00 25.35 ? 375 TYR A CE2 1 
ATOM   2906 C CZ  . TYR A 1 375 ? 22.268  56.463 67.738 1.00 25.30 ? 375 TYR A CZ  1 
ATOM   2907 O OH  . TYR A 1 375 ? 21.925  56.560 66.409 1.00 30.11 ? 375 TYR A OH  1 
ATOM   2908 N N   . THR A 1 376 ? 26.102  55.896 74.208 1.00 27.65 ? 376 THR A N   1 
ATOM   2909 C CA  . THR A 1 376 ? 26.502  56.161 75.585 1.00 24.57 ? 376 THR A CA  1 
ATOM   2910 C C   . THR A 1 376 ? 27.968  56.484 75.754 1.00 24.67 ? 376 THR A C   1 
ATOM   2911 O O   . THR A 1 376 ? 28.809  55.683 75.393 1.00 25.35 ? 376 THR A O   1 
ATOM   2912 C CB  . THR A 1 376 ? 26.254  54.943 76.470 1.00 23.88 ? 376 THR A CB  1 
ATOM   2913 O OG1 . THR A 1 376 ? 24.851  54.679 76.550 1.00 25.17 ? 376 THR A OG1 1 
ATOM   2914 C CG2 . THR A 1 376 ? 26.816  55.176 77.855 1.00 20.61 ? 376 THR A CG2 1 
ATOM   2915 N N   . ASP A 1 377 ? 28.279  57.638 76.331 1.00 24.97 ? 377 ASP A N   1 
ATOM   2916 C CA  . ASP A 1 377 ? 29.669  57.978 76.566 1.00 26.11 ? 377 ASP A CA  1 
ATOM   2917 C C   . ASP A 1 377 ? 30.056  57.326 77.886 1.00 26.95 ? 377 ASP A C   1 
ATOM   2918 O O   . ASP A 1 377 ? 29.822  57.891 78.946 1.00 28.26 ? 377 ASP A O   1 
ATOM   2919 C CB  . ASP A 1 377 ? 29.853  59.488 76.667 1.00 27.72 ? 377 ASP A CB  1 
ATOM   2920 C CG  . ASP A 1 377 ? 31.288  59.869 76.980 1.00 32.29 ? 377 ASP A CG  1 
ATOM   2921 O OD1 . ASP A 1 377 ? 32.119  58.935 77.102 1.00 33.22 ? 377 ASP A OD1 1 
ATOM   2922 O OD2 . ASP A 1 377 ? 31.587  61.086 77.104 1.00 33.67 ? 377 ASP A OD2 1 
ATOM   2923 N N   . TRP A 1 378 ? 30.645  56.138 77.818 1.00 27.92 ? 378 TRP A N   1 
ATOM   2924 C CA  . TRP A 1 378 ? 31.031  55.396 79.016 1.00 27.85 ? 378 TRP A CA  1 
ATOM   2925 C C   . TRP A 1 378 ? 32.186  56.023 79.760 1.00 28.29 ? 378 TRP A C   1 
ATOM   2926 O O   . TRP A 1 378 ? 32.722  55.442 80.694 1.00 29.84 ? 378 TRP A O   1 
ATOM   2927 C CB  . TRP A 1 378 ? 31.395  53.961 78.653 1.00 28.98 ? 378 TRP A CB  1 
ATOM   2928 C CG  . TRP A 1 378 ? 30.227  53.151 78.246 1.00 31.10 ? 378 TRP A CG  1 
ATOM   2929 C CD1 . TRP A 1 378 ? 30.017  52.560 77.032 1.00 33.28 ? 378 TRP A CD1 1 
ATOM   2930 C CD2 . TRP A 1 378 ? 29.090  52.842 79.046 1.00 31.34 ? 378 TRP A CD2 1 
ATOM   2931 N NE1 . TRP A 1 378 ? 28.814  51.899 77.026 1.00 33.10 ? 378 TRP A NE1 1 
ATOM   2932 C CE2 . TRP A 1 378 ? 28.223  52.056 78.253 1.00 32.88 ? 378 TRP A CE2 1 
ATOM   2933 C CE3 . TRP A 1 378 ? 28.717  53.150 80.358 1.00 32.70 ? 378 TRP A CE3 1 
ATOM   2934 C CZ2 . TRP A 1 378 ? 27.000  51.572 78.731 1.00 33.10 ? 378 TRP A CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 378 ? 27.504  52.670 80.837 1.00 34.74 ? 378 TRP A CZ3 1 
ATOM   2936 C CH2 . TRP A 1 378 ? 26.658  51.887 80.022 1.00 35.26 ? 378 TRP A CH2 1 
ATOM   2937 N N   . MET A 1 379 ? 32.578  57.210 79.338 1.00 29.98 ? 379 MET A N   1 
ATOM   2938 C CA  . MET A 1 379 ? 33.674  57.906 79.984 1.00 32.26 ? 379 MET A CA  1 
ATOM   2939 C C   . MET A 1 379 ? 33.067  58.927 80.925 1.00 32.70 ? 379 MET A C   1 
ATOM   2940 O O   . MET A 1 379 ? 33.769  59.546 81.716 1.00 33.72 ? 379 MET A O   1 
ATOM   2941 C CB  . MET A 1 379 ? 34.530  58.612 78.931 1.00 33.82 ? 379 MET A CB  1 
ATOM   2942 C CG  . MET A 1 379 ? 35.868  59.110 79.430 1.00 36.87 ? 379 MET A CG  1 
ATOM   2943 S SD  . MET A 1 379 ? 37.211  58.776 78.254 1.00 38.75 ? 379 MET A SD  1 
ATOM   2944 C CE  . MET A 1 379 ? 37.855  57.169 78.907 1.00 35.71 ? 379 MET A CE  1 
ATOM   2945 N N   . ASP A 1 380 ? 31.747  59.081 80.828 1.00 34.05 ? 380 ASP A N   1 
ATOM   2946 C CA  . ASP A 1 380 ? 30.985  60.038 81.626 1.00 34.30 ? 380 ASP A CA  1 
ATOM   2947 C C   . ASP A 1 380 ? 29.489  59.727 81.468 1.00 34.41 ? 380 ASP A C   1 
ATOM   2948 O O   . ASP A 1 380 ? 28.674  60.614 81.223 1.00 34.19 ? 380 ASP A O   1 
ATOM   2949 C CB  . ASP A 1 380 ? 31.302  61.453 81.127 1.00 35.95 ? 380 ASP A CB  1 
ATOM   2950 C CG  . ASP A 1 380 ? 30.376  62.502 81.698 1.00 37.58 ? 380 ASP A CG  1 
ATOM   2951 O OD1 . ASP A 1 380 ? 30.342  62.659 82.935 1.00 39.95 ? 380 ASP A OD1 1 
ATOM   2952 O OD2 . ASP A 1 380 ? 29.684  63.173 80.904 1.00 38.20 ? 380 ASP A OD2 1 
ATOM   2953 N N   . ASP A 1 381 ? 29.148  58.450 81.622 1.00 35.15 ? 381 ASP A N   1 
ATOM   2954 C CA  . ASP A 1 381 ? 27.779  57.951 81.475 1.00 36.22 ? 381 ASP A CA  1 
ATOM   2955 C C   . ASP A 1 381 ? 26.721  58.596 82.366 1.00 37.23 ? 381 ASP A C   1 
ATOM   2956 O O   . ASP A 1 381 ? 25.545  58.220 82.322 1.00 36.70 ? 381 ASP A O   1 
ATOM   2957 C CB  . ASP A 1 381 ? 27.756  56.441 81.709 1.00 35.60 ? 381 ASP A CB  1 
ATOM   2958 C CG  . ASP A 1 381 ? 28.129  56.075 83.126 1.00 37.06 ? 381 ASP A CG  1 
ATOM   2959 O OD1 . ASP A 1 381 ? 29.170  56.570 83.611 1.00 37.14 ? 381 ASP A OD1 1 
ATOM   2960 O OD2 . ASP A 1 381 ? 27.382  55.298 83.759 1.00 39.87 ? 381 ASP A OD2 1 
ATOM   2961 N N   . ASN A 1 382 ? 27.117  59.556 83.186 1.00 37.88 ? 382 ASN A N   1 
ATOM   2962 C CA  . ASN A 1 382 ? 26.133  60.183 84.042 1.00 38.41 ? 382 ASN A CA  1 
ATOM   2963 C C   . ASN A 1 382 ? 25.789  61.581 83.575 1.00 38.14 ? 382 ASN A C   1 
ATOM   2964 O O   . ASN A 1 382 ? 24.904  62.221 84.135 1.00 40.80 ? 382 ASN A O   1 
ATOM   2965 C CB  . ASN A 1 382 ? 26.612  60.202 85.494 1.00 38.95 ? 382 ASN A CB  1 
ATOM   2966 C CG  . ASN A 1 382 ? 26.094  59.011 86.285 1.00 39.75 ? 382 ASN A CG  1 
ATOM   2967 O OD1 . ASN A 1 382 ? 24.904  58.687 86.235 1.00 37.74 ? 382 ASN A OD1 1 
ATOM   2968 N ND2 . ASN A 1 382 ? 26.990  58.344 87.011 1.00 41.46 ? 382 ASN A ND2 1 
ATOM   2969 N N   . ASN A 1 383 ? 26.468  62.058 82.539 1.00 34.95 ? 383 ASN A N   1 
ATOM   2970 C CA  . ASN A 1 383 ? 26.168  63.390 82.050 1.00 33.24 ? 383 ASN A CA  1 
ATOM   2971 C C   . ASN A 1 383 ? 24.683  63.481 81.729 1.00 33.93 ? 383 ASN A C   1 
ATOM   2972 O O   . ASN A 1 383 ? 24.169  62.721 80.910 1.00 36.05 ? 383 ASN A O   1 
ATOM   2973 C CB  . ASN A 1 383 ? 26.981  63.707 80.806 1.00 31.68 ? 383 ASN A CB  1 
ATOM   2974 C CG  . ASN A 1 383 ? 27.163  65.187 80.611 1.00 30.09 ? 383 ASN A CG  1 
ATOM   2975 O OD1 . ASN A 1 383 ? 28.250  65.652 80.274 1.00 30.87 ? 383 ASN A OD1 1 
ATOM   2976 N ND2 . ASN A 1 383 ? 26.095  65.945 80.829 1.00 26.58 ? 383 ASN A ND2 1 
ATOM   2977 N N   . GLY A 1 384 ? 23.996  64.403 82.390 1.00 32.59 ? 384 GLY A N   1 
ATOM   2978 C CA  . GLY A 1 384 ? 22.576  64.565 82.163 1.00 29.88 ? 384 GLY A CA  1 
ATOM   2979 C C   . GLY A 1 384 ? 22.279  65.228 80.837 1.00 29.03 ? 384 GLY A C   1 
ATOM   2980 O O   . GLY A 1 384 ? 21.303  64.898 80.169 1.00 31.85 ? 384 GLY A O   1 
ATOM   2981 N N   . ILE A 1 385 ? 23.112  66.181 80.451 1.00 27.61 ? 385 ILE A N   1 
ATOM   2982 C CA  . ILE A 1 385 ? 22.907  66.860 79.192 1.00 26.06 ? 385 ILE A CA  1 
ATOM   2983 C C   . ILE A 1 385 ? 23.243  65.881 78.087 1.00 26.37 ? 385 ILE A C   1 
ATOM   2984 O O   . ILE A 1 385 ? 22.671  65.926 77.014 1.00 29.47 ? 385 ILE A O   1 
ATOM   2985 C CB  . ILE A 1 385 ? 23.800  68.090 79.088 1.00 26.42 ? 385 ILE A CB  1 
ATOM   2986 C CG1 . ILE A 1 385 ? 23.099  69.272 79.758 1.00 29.18 ? 385 ILE A CG1 1 
ATOM   2987 C CG2 . ILE A 1 385 ? 24.106  68.398 77.646 1.00 22.64 ? 385 ILE A CG2 1 
ATOM   2988 C CD1 . ILE A 1 385 ? 24.020  70.449 80.069 1.00 31.29 ? 385 ILE A CD1 1 
ATOM   2989 N N   . LYS A 1 386 ? 24.176  64.982 78.349 1.00 27.14 ? 386 LYS A N   1 
ATOM   2990 C CA  . LYS A 1 386 ? 24.538  64.002 77.346 1.00 27.62 ? 386 LYS A CA  1 
ATOM   2991 C C   . LYS A 1 386 ? 23.417  62.978 77.245 1.00 28.84 ? 386 LYS A C   1 
ATOM   2992 O O   . LYS A 1 386 ? 22.915  62.704 76.157 1.00 33.24 ? 386 LYS A O   1 
ATOM   2993 C CB  . LYS A 1 386 ? 25.840  63.310 77.724 1.00 28.24 ? 386 LYS A CB  1 
ATOM   2994 C CG  . LYS A 1 386 ? 27.061  63.965 77.142 1.00 31.20 ? 386 LYS A CG  1 
ATOM   2995 C CD  . LYS A 1 386 ? 28.289  63.142 77.459 1.00 36.83 ? 386 LYS A CD  1 
ATOM   2996 C CE  . LYS A 1 386 ? 29.558  63.921 77.171 1.00 40.23 ? 386 LYS A CE  1 
ATOM   2997 N NZ  . LYS A 1 386 ? 30.441  63.937 78.368 1.00 43.03 ? 386 LYS A NZ  1 
ATOM   2998 N N   . ASN A 1 387 ? 23.021  62.415 78.379 1.00 26.94 ? 387 ASN A N   1 
ATOM   2999 C CA  . ASN A 1 387 ? 21.951  61.428 78.393 1.00 25.73 ? 387 ASN A CA  1 
ATOM   3000 C C   . ASN A 1 387 ? 20.719  61.956 77.651 1.00 25.39 ? 387 ASN A C   1 
ATOM   3001 O O   . ASN A 1 387 ? 20.032  61.213 76.951 1.00 24.14 ? 387 ASN A O   1 
ATOM   3002 C CB  . ASN A 1 387 ? 21.577  61.088 79.837 1.00 27.68 ? 387 ASN A CB  1 
ATOM   3003 C CG  . ASN A 1 387 ? 22.641  60.262 80.537 1.00 27.48 ? 387 ASN A CG  1 
ATOM   3004 O OD1 . ASN A 1 387 ? 23.622  59.835 79.918 1.00 25.12 ? 387 ASN A OD1 1 
ATOM   3005 N ND2 . ASN A 1 387 ? 22.449  60.030 81.836 1.00 25.77 ? 387 ASN A ND2 1 
ATOM   3006 N N   . ARG A 1 388 ? 20.455  63.248 77.801 1.00 24.03 ? 388 ARG A N   1 
ATOM   3007 C CA  . ARG A 1 388 ? 19.315  63.883 77.162 1.00 23.72 ? 388 ARG A CA  1 
ATOM   3008 C C   . ARG A 1 388 ? 19.461  63.966 75.645 1.00 25.07 ? 388 ARG A C   1 
ATOM   3009 O O   . ARG A 1 388 ? 18.550  63.587 74.895 1.00 23.41 ? 388 ARG A O   1 
ATOM   3010 C CB  . ARG A 1 388 ? 19.128  65.288 77.732 1.00 23.35 ? 388 ARG A CB  1 
ATOM   3011 C CG  . ARG A 1 388 ? 17.987  66.068 77.103 1.00 24.40 ? 388 ARG A CG  1 
ATOM   3012 C CD  . ARG A 1 388 ? 18.500  67.319 76.422 1.00 21.58 ? 388 ARG A CD  1 
ATOM   3013 N NE  . ARG A 1 388 ? 18.771  68.373 77.391 1.00 19.16 ? 388 ARG A NE  1 
ATOM   3014 C CZ  . ARG A 1 388 ? 19.697  69.308 77.229 1.00 18.44 ? 388 ARG A CZ  1 
ATOM   3015 N NH1 . ARG A 1 388 ? 20.437  69.317 76.134 1.00 12.46 ? 388 ARG A NH1 1 
ATOM   3016 N NH2 . ARG A 1 388 ? 19.890  70.229 78.164 1.00 21.81 ? 388 ARG A NH2 1 
ATOM   3017 N N   . ASP A 1 389 ? 20.608  64.475 75.202 1.00 25.12 ? 389 ASP A N   1 
ATOM   3018 C CA  . ASP A 1 389 ? 20.898  64.637 73.779 1.00 24.77 ? 389 ASP A CA  1 
ATOM   3019 C C   . ASP A 1 389 ? 21.059  63.301 73.057 1.00 25.42 ? 389 ASP A C   1 
ATOM   3020 O O   . ASP A 1 389 ? 20.570  63.122 71.941 1.00 26.26 ? 389 ASP A O   1 
ATOM   3021 C CB  . ASP A 1 389 ? 22.178  65.455 73.595 1.00 22.91 ? 389 ASP A CB  1 
ATOM   3022 C CG  . ASP A 1 389 ? 22.018  66.905 74.008 1.00 20.89 ? 389 ASP A CG  1 
ATOM   3023 O OD1 . ASP A 1 389 ? 20.866  67.364 74.169 1.00 20.42 ? 389 ASP A OD1 1 
ATOM   3024 O OD2 . ASP A 1 389 ? 23.057  67.584 74.172 1.00 19.93 ? 389 ASP A OD2 1 
ATOM   3025 N N   . GLY A 1 390 ? 21.767  62.373 73.688 1.00 23.78 ? 390 GLY A N   1 
ATOM   3026 C CA  . GLY A 1 390 ? 21.970  61.078 73.077 1.00 22.95 ? 390 GLY A CA  1 
ATOM   3027 C C   . GLY A 1 390 ? 20.646  60.373 72.931 1.00 22.84 ? 390 GLY A C   1 
ATOM   3028 O O   . GLY A 1 390 ? 20.509  59.448 72.141 1.00 26.55 ? 390 GLY A O   1 
ATOM   3029 N N   . LEU A 1 391 ? 19.664  60.807 73.708 1.00 22.87 ? 391 LEU A N   1 
ATOM   3030 C CA  . LEU A 1 391 ? 18.335  60.215 73.650 1.00 23.88 ? 391 LEU A CA  1 
ATOM   3031 C C   . LEU A 1 391 ? 17.552  60.946 72.573 1.00 23.64 ? 391 LEU A C   1 
ATOM   3032 O O   . LEU A 1 391 ? 16.638  60.398 71.974 1.00 23.92 ? 391 LEU A O   1 
ATOM   3033 C CB  . LEU A 1 391 ? 17.630  60.364 74.999 1.00 23.99 ? 391 LEU A CB  1 
ATOM   3034 C CG  . LEU A 1 391 ? 16.589  59.322 75.407 1.00 22.55 ? 391 LEU A CG  1 
ATOM   3035 C CD1 . LEU A 1 391 ? 17.237  57.973 75.625 1.00 23.05 ? 391 LEU A CD1 1 
ATOM   3036 C CD2 . LEU A 1 391 ? 15.915  59.782 76.680 1.00 23.69 ? 391 LEU A CD2 1 
ATOM   3037 N N   . ASP A 1 392 ? 17.921  62.197 72.340 1.00 26.95 ? 392 ASP A N   1 
ATOM   3038 C CA  . ASP A 1 392 ? 17.274  63.018 71.327 1.00 29.02 ? 392 ASP A CA  1 
ATOM   3039 C C   . ASP A 1 392 ? 17.789  62.553 69.970 1.00 30.51 ? 392 ASP A C   1 
ATOM   3040 O O   . ASP A 1 392 ? 17.179  62.838 68.934 1.00 34.12 ? 392 ASP A O   1 
ATOM   3041 C CB  . ASP A 1 392 ? 17.626  64.498 71.556 1.00 32.44 ? 392 ASP A CB  1 
ATOM   3042 C CG  . ASP A 1 392 ? 17.057  65.430 70.480 1.00 35.01 ? 392 ASP A CG  1 
ATOM   3043 O OD1 . ASP A 1 392 ? 15.830  65.439 70.269 1.00 35.66 ? 392 ASP A OD1 1 
ATOM   3044 O OD2 . ASP A 1 392 ? 17.839  66.172 69.847 1.00 37.99 ? 392 ASP A OD2 1 
ATOM   3045 N N   . ASP A 1 393 ? 18.908  61.824 69.988 1.00 29.43 ? 393 ASP A N   1 
ATOM   3046 C CA  . ASP A 1 393 ? 19.540  61.317 68.769 1.00 26.56 ? 393 ASP A CA  1 
ATOM   3047 C C   . ASP A 1 393 ? 18.993  59.963 68.359 1.00 26.45 ? 393 ASP A C   1 
ATOM   3048 O O   . ASP A 1 393 ? 18.933  59.641 67.179 1.00 28.22 ? 393 ASP A O   1 
ATOM   3049 C CB  . ASP A 1 393 ? 21.051  61.191 68.961 1.00 26.23 ? 393 ASP A CB  1 
ATOM   3050 C CG  . ASP A 1 393 ? 21.791  62.484 68.674 1.00 29.83 ? 393 ASP A CG  1 
ATOM   3051 O OD1 . ASP A 1 393 ? 21.234  63.349 67.971 1.00 35.19 ? 393 ASP A OD1 1 
ATOM   3052 O OD2 . ASP A 1 393 ? 22.937  62.642 69.147 1.00 32.04 ? 393 ASP A OD2 1 
ATOM   3053 N N   . ILE A 1 394 ? 18.601  59.158 69.334 1.00 25.09 ? 394 ILE A N   1 
ATOM   3054 C CA  . ILE A 1 394 ? 18.081  57.839 69.032 1.00 22.92 ? 394 ILE A CA  1 
ATOM   3055 C C   . ILE A 1 394 ? 16.688  57.956 68.410 1.00 23.89 ? 394 ILE A C   1 
ATOM   3056 O O   . ILE A 1 394 ? 16.314  57.168 67.546 1.00 26.89 ? 394 ILE A O   1 
ATOM   3057 C CB  . ILE A 1 394 ? 18.048  56.963 70.321 1.00 21.63 ? 394 ILE A CB  1 
ATOM   3058 C CG1 . ILE A 1 394 ? 19.422  56.331 70.550 1.00 21.60 ? 394 ILE A CG1 1 
ATOM   3059 C CG2 . ILE A 1 394 ? 17.011  55.862 70.208 1.00 21.08 ? 394 ILE A CG2 1 
ATOM   3060 C CD1 . ILE A 1 394 ? 19.942  56.466 71.972 1.00 21.44 ? 394 ILE A CD1 1 
ATOM   3061 N N   . VAL A 1 395 ? 15.924  58.953 68.834 1.00 22.72 ? 395 VAL A N   1 
ATOM   3062 C CA  . VAL A 1 395 ? 14.581  59.135 68.312 1.00 20.52 ? 395 VAL A CA  1 
ATOM   3063 C C   . VAL A 1 395 ? 14.612  59.649 66.870 1.00 21.84 ? 395 VAL A C   1 
ATOM   3064 O O   . VAL A 1 395 ? 13.832  59.207 66.020 1.00 22.82 ? 395 VAL A O   1 
ATOM   3065 C CB  . VAL A 1 395 ? 13.791  60.097 69.214 1.00 17.95 ? 395 VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 395 ? 12.403  60.308 68.675 1.00 17.85 ? 395 VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 395 ? 13.716  59.521 70.612 1.00 15.41 ? 395 VAL A CG2 1 
ATOM   3068 N N   . GLY A 1 396 ? 15.526  60.573 66.597 1.00 22.15 ? 396 GLY A N   1 
ATOM   3069 C CA  . GLY A 1 396 ? 15.650  61.119 65.261 1.00 20.22 ? 396 GLY A CA  1 
ATOM   3070 C C   . GLY A 1 396 ? 16.302  60.089 64.368 1.00 22.91 ? 396 GLY A C   1 
ATOM   3071 O O   . GLY A 1 396 ? 15.707  59.655 63.389 1.00 25.38 ? 396 GLY A O   1 
ATOM   3072 N N   . ASP A 1 397 ? 17.526  59.693 64.716 1.00 22.72 ? 397 ASP A N   1 
ATOM   3073 C CA  . ASP A 1 397 ? 18.281  58.695 63.958 1.00 19.57 ? 397 ASP A CA  1 
ATOM   3074 C C   . ASP A 1 397 ? 17.407  57.538 63.502 1.00 18.51 ? 397 ASP A C   1 
ATOM   3075 O O   . ASP A 1 397 ? 17.254  57.296 62.312 1.00 20.15 ? 397 ASP A O   1 
ATOM   3076 C CB  . ASP A 1 397 ? 19.417  58.116 64.812 1.00 20.25 ? 397 ASP A CB  1 
ATOM   3077 C CG  . ASP A 1 397 ? 20.668  58.965 64.784 1.00 22.58 ? 397 ASP A CG  1 
ATOM   3078 O OD1 . ASP A 1 397 ? 20.866  59.701 63.800 1.00 22.94 ? 397 ASP A OD1 1 
ATOM   3079 O OD2 . ASP A 1 397 ? 21.461  58.888 65.748 1.00 23.26 ? 397 ASP A OD2 1 
ATOM   3080 N N   . HIS A 1 398 ? 16.832  56.831 64.468 1.00 18.33 ? 398 HIS A N   1 
ATOM   3081 C CA  . HIS A 1 398 ? 16.012  55.654 64.201 1.00 21.03 ? 398 HIS A CA  1 
ATOM   3082 C C   . HIS A 1 398 ? 14.683  55.860 63.495 1.00 22.18 ? 398 HIS A C   1 
ATOM   3083 O O   . HIS A 1 398 ? 14.259  54.990 62.750 1.00 25.95 ? 398 HIS A O   1 
ATOM   3084 C CB  . HIS A 1 398 ? 15.757  54.878 65.508 1.00 20.55 ? 398 HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 398 ? 14.645  53.877 65.411 1.00 16.82 ? 398 HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 398 ? 14.799  52.650 64.806 1.00 19.11 ? 398 HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 398 ? 13.351  53.940 65.802 1.00 18.34 ? 398 HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 398 ? 13.649  52.000 64.824 1.00 18.00 ? 398 HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 398 ? 12.753  52.762 65.423 1.00 18.59 ? 398 HIS A NE2 1 
ATOM   3090 N N   . ASN A 1 399 ? 14.025  56.990 63.719 1.00 23.22 ? 399 ASN A N   1 
ATOM   3091 C CA  . ASN A 1 399 ? 12.730  57.228 63.109 1.00 21.70 ? 399 ASN A CA  1 
ATOM   3092 C C   . ASN A 1 399 ? 12.709  58.146 61.897 1.00 23.79 ? 399 ASN A C   1 
ATOM   3093 O O   . ASN A 1 399 ? 11.747  58.137 61.131 1.00 27.85 ? 399 ASN A O   1 
ATOM   3094 C CB  . ASN A 1 399 ? 11.785  57.803 64.148 1.00 23.07 ? 399 ASN A CB  1 
ATOM   3095 C CG  . ASN A 1 399 ? 11.293  56.770 65.127 1.00 26.13 ? 399 ASN A CG  1 
ATOM   3096 O OD1 . ASN A 1 399 ? 10.468  55.922 64.788 1.00 21.72 ? 399 ASN A OD1 1 
ATOM   3097 N ND2 . ASN A 1 399 ? 11.790  56.842 66.364 1.00 27.46 ? 399 ASN A ND2 1 
ATOM   3098 N N   . VAL A 1 400 ? 13.751  58.940 61.704 1.00 21.83 ? 400 VAL A N   1 
ATOM   3099 C CA  . VAL A 1 400 ? 13.743  59.879 60.593 1.00 20.58 ? 400 VAL A CA  1 
ATOM   3100 C C   . VAL A 1 400 ? 14.965  59.888 59.678 1.00 21.64 ? 400 VAL A C   1 
ATOM   3101 O O   . VAL A 1 400 ? 14.850  59.540 58.500 1.00 24.12 ? 400 VAL A O   1 
ATOM   3102 C CB  . VAL A 1 400 ? 13.502  61.302 61.123 1.00 18.93 ? 400 VAL A CB  1 
ATOM   3103 C CG1 . VAL A 1 400 ? 13.727  62.315 60.043 1.00 20.06 ? 400 VAL A CG1 1 
ATOM   3104 C CG2 . VAL A 1 400 ? 12.096  61.404 61.663 1.00 18.24 ? 400 VAL A CG2 1 
ATOM   3105 N N   . ILE A 1 401 ? 16.125  60.281 60.206 1.00 19.76 ? 401 ILE A N   1 
ATOM   3106 C CA  . ILE A 1 401 ? 17.339  60.358 59.395 1.00 17.31 ? 401 ILE A CA  1 
ATOM   3107 C C   . ILE A 1 401 ? 17.782  59.067 58.737 1.00 19.95 ? 401 ILE A C   1 
ATOM   3108 O O   . ILE A 1 401 ? 17.955  59.020 57.525 1.00 21.66 ? 401 ILE A O   1 
ATOM   3109 C CB  . ILE A 1 401 ? 18.534  60.899 60.193 1.00 12.56 ? 401 ILE A CB  1 
ATOM   3110 C CG1 . ILE A 1 401 ? 18.383  62.403 60.409 1.00 11.55 ? 401 ILE A CG1 1 
ATOM   3111 C CG2 . ILE A 1 401 ? 19.811  60.644 59.428 1.00 9.79  ? 401 ILE A CG2 1 
ATOM   3112 C CD1 . ILE A 1 401 ? 18.271  62.810 61.853 1.00 11.85 ? 401 ILE A CD1 1 
ATOM   3113 N N   . CYS A 1 402 ? 17.979  58.023 59.532 1.00 23.36 ? 402 CYS A N   1 
ATOM   3114 C CA  . CYS A 1 402 ? 18.437  56.744 59.001 1.00 24.38 ? 402 CYS A CA  1 
ATOM   3115 C C   . CYS A 1 402 ? 17.488  56.100 57.989 1.00 25.71 ? 402 CYS A C   1 
ATOM   3116 O O   . CYS A 1 402 ? 17.932  55.624 56.946 1.00 27.14 ? 402 CYS A O   1 
ATOM   3117 C CB  . CYS A 1 402 ? 18.751  55.801 60.158 1.00 24.93 ? 402 CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 402 ? 20.184  56.367 61.143 1.00 28.78 ? 402 CYS A SG  1 
ATOM   3119 N N   . PRO A 1 403 ? 16.177  56.049 58.284 1.00 26.27 ? 403 PRO A N   1 
ATOM   3120 C CA  . PRO A 1 403 ? 15.288  55.441 57.287 1.00 25.49 ? 403 PRO A CA  1 
ATOM   3121 C C   . PRO A 1 403 ? 15.270  56.283 56.003 1.00 24.72 ? 403 PRO A C   1 
ATOM   3122 O O   . PRO A 1 403 ? 14.930  55.781 54.937 1.00 26.37 ? 403 PRO A O   1 
ATOM   3123 C CB  . PRO A 1 403 ? 13.916  55.425 57.969 1.00 24.45 ? 403 PRO A CB  1 
ATOM   3124 C CG  . PRO A 1 403 ? 14.177  55.672 59.401 1.00 25.04 ? 403 PRO A CG  1 
ATOM   3125 C CD  . PRO A 1 403 ? 15.442  56.469 59.486 1.00 27.91 ? 403 PRO A CD  1 
ATOM   3126 N N   . LEU A 1 404 ? 15.625  57.563 56.114 1.00 22.82 ? 404 LEU A N   1 
ATOM   3127 C CA  . LEU A 1 404 ? 15.653  58.451 54.953 1.00 21.86 ? 404 LEU A CA  1 
ATOM   3128 C C   . LEU A 1 404 ? 16.924  58.210 54.157 1.00 24.90 ? 404 LEU A C   1 
ATOM   3129 O O   . LEU A 1 404 ? 16.897  58.145 52.924 1.00 26.21 ? 404 LEU A O   1 
ATOM   3130 C CB  . LEU A 1 404 ? 15.609  59.925 55.375 1.00 17.35 ? 404 LEU A CB  1 
ATOM   3131 C CG  . LEU A 1 404 ? 15.649  60.964 54.241 1.00 13.25 ? 404 LEU A CG  1 
ATOM   3132 C CD1 . LEU A 1 404 ? 14.884  62.199 54.662 1.00 10.26 ? 404 LEU A CD1 1 
ATOM   3133 C CD2 . LEU A 1 404 ? 17.078  61.334 53.886 1.00 10.14 ? 404 LEU A CD2 1 
ATOM   3134 N N   . MET A 1 405 ? 18.037  58.075 54.873 1.00 25.40 ? 405 MET A N   1 
ATOM   3135 C CA  . MET A 1 405 ? 19.335  57.846 54.254 1.00 25.42 ? 405 MET A CA  1 
ATOM   3136 C C   . MET A 1 405 ? 19.439  56.500 53.547 1.00 25.72 ? 405 MET A C   1 
ATOM   3137 O O   . MET A 1 405 ? 20.357  56.288 52.759 1.00 25.87 ? 405 MET A O   1 
ATOM   3138 C CB  . MET A 1 405 ? 20.435  57.957 55.301 1.00 25.48 ? 405 MET A CB  1 
ATOM   3139 C CG  . MET A 1 405 ? 20.681  59.371 55.773 1.00 24.80 ? 405 MET A CG  1 
ATOM   3140 S SD  . MET A 1 405 ? 21.192  60.440 54.434 1.00 24.32 ? 405 MET A SD  1 
ATOM   3141 C CE  . MET A 1 405 ? 22.372  59.429 53.650 1.00 24.89 ? 405 MET A CE  1 
ATOM   3142 N N   . HIS A 1 406 ? 18.507  55.593 53.829 1.00 25.92 ? 406 HIS A N   1 
ATOM   3143 C CA  . HIS A 1 406 ? 18.505  54.273 53.190 1.00 26.93 ? 406 HIS A CA  1 
ATOM   3144 C C   . HIS A 1 406 ? 17.661  54.368 51.930 1.00 27.45 ? 406 HIS A C   1 
ATOM   3145 O O   . HIS A 1 406 ? 17.949  53.723 50.930 1.00 29.91 ? 406 HIS A O   1 
ATOM   3146 C CB  . HIS A 1 406 ? 17.930  53.214 54.139 1.00 25.88 ? 406 HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 406 ? 17.535  51.929 53.472 1.00 25.95 ? 406 HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 406 ? 18.433  50.913 53.218 1.00 25.69 ? 406 HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 406 ? 16.324  51.466 53.073 1.00 25.86 ? 406 HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 406 ? 17.793  49.882 52.694 1.00 22.00 ? 406 HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 406 ? 16.512  50.191 52.595 1.00 22.13 ? 406 HIS A NE2 1 
ATOM   3152 N N   . PHE A 1 407 ? 16.615  55.184 51.985 1.00 26.92 ? 407 PHE A N   1 
ATOM   3153 C CA  . PHE A 1 407 ? 15.744  55.373 50.841 1.00 24.62 ? 407 PHE A CA  1 
ATOM   3154 C C   . PHE A 1 407 ? 16.490  56.267 49.870 1.00 27.62 ? 407 PHE A C   1 
ATOM   3155 O O   . PHE A 1 407 ? 16.261  56.202 48.665 1.00 30.17 ? 407 PHE A O   1 
ATOM   3156 C CB  . PHE A 1 407 ? 14.441  56.034 51.281 1.00 23.10 ? 407 PHE A CB  1 
ATOM   3157 C CG  . PHE A 1 407 ? 13.668  56.673 50.162 1.00 20.26 ? 407 PHE A CG  1 
ATOM   3158 C CD1 . PHE A 1 407 ? 12.838  55.908 49.350 1.00 16.62 ? 407 PHE A CD1 1 
ATOM   3159 C CD2 . PHE A 1 407 ? 13.747  58.047 49.941 1.00 18.21 ? 407 PHE A CD2 1 
ATOM   3160 C CE1 . PHE A 1 407 ? 12.099  56.501 48.337 1.00 16.26 ? 407 PHE A CE1 1 
ATOM   3161 C CE2 . PHE A 1 407 ? 13.011  58.651 48.928 1.00 17.55 ? 407 PHE A CE2 1 
ATOM   3162 C CZ  . PHE A 1 407 ? 12.184  57.876 48.125 1.00 16.82 ? 407 PHE A CZ  1 
ATOM   3163 N N   . VAL A 1 408 ? 17.383  57.106 50.396 1.00 28.08 ? 408 VAL A N   1 
ATOM   3164 C CA  . VAL A 1 408 ? 18.174  57.995 49.547 1.00 27.42 ? 408 VAL A CA  1 
ATOM   3165 C C   . VAL A 1 408 ? 19.129  57.137 48.734 1.00 30.03 ? 408 VAL A C   1 
ATOM   3166 O O   . VAL A 1 408 ? 19.080  57.119 47.509 1.00 31.71 ? 408 VAL A O   1 
ATOM   3167 C CB  . VAL A 1 408 ? 19.040  58.982 50.362 1.00 25.87 ? 408 VAL A CB  1 
ATOM   3168 C CG1 . VAL A 1 408 ? 19.983  59.722 49.438 1.00 25.29 ? 408 VAL A CG1 1 
ATOM   3169 C CG2 . VAL A 1 408 ? 18.173  59.973 51.088 1.00 27.63 ? 408 VAL A CG2 1 
ATOM   3170 N N   . ASN A 1 409 ? 19.997  56.420 49.438 1.00 30.66 ? 409 ASN A N   1 
ATOM   3171 C CA  . ASN A 1 409 ? 20.989  55.564 48.810 1.00 30.88 ? 409 ASN A CA  1 
ATOM   3172 C C   . ASN A 1 409 ? 20.408  54.539 47.843 1.00 31.27 ? 409 ASN A C   1 
ATOM   3173 O O   . ASN A 1 409 ? 21.047  54.172 46.861 1.00 32.24 ? 409 ASN A O   1 
ATOM   3174 C CB  . ASN A 1 409 ? 21.806  54.862 49.893 1.00 32.53 ? 409 ASN A CB  1 
ATOM   3175 C CG  . ASN A 1 409 ? 22.881  55.760 50.478 1.00 32.66 ? 409 ASN A CG  1 
ATOM   3176 O OD1 . ASN A 1 409 ? 23.917  55.989 49.856 1.00 35.18 ? 409 ASN A OD1 1 
ATOM   3177 N ND2 . ASN A 1 409 ? 22.638  56.280 51.673 1.00 31.22 ? 409 ASN A ND2 1 
ATOM   3178 N N   . LYS A 1 410 ? 19.198  54.073 48.124 1.00 32.31 ? 410 LYS A N   1 
ATOM   3179 C CA  . LYS A 1 410 ? 18.536  53.097 47.266 1.00 31.91 ? 410 LYS A CA  1 
ATOM   3180 C C   . LYS A 1 410 ? 17.965  53.791 46.040 1.00 32.51 ? 410 LYS A C   1 
ATOM   3181 O O   . LYS A 1 410 ? 18.133  53.313 44.922 1.00 34.91 ? 410 LYS A O   1 
ATOM   3182 C CB  . LYS A 1 410 ? 17.410  52.406 48.021 1.00 31.35 ? 410 LYS A CB  1 
ATOM   3183 C CG  . LYS A 1 410 ? 17.597  50.926 48.144 1.00 34.18 ? 410 LYS A CG  1 
ATOM   3184 C CD  . LYS A 1 410 ? 18.494  50.590 49.315 1.00 35.97 ? 410 LYS A CD  1 
ATOM   3185 C CE  . LYS A 1 410 ? 18.690  49.088 49.419 1.00 37.91 ? 410 LYS A CE  1 
ATOM   3186 N NZ  . LYS A 1 410 ? 18.838  48.471 48.072 1.00 40.37 ? 410 LYS A NZ  1 
ATOM   3187 N N   . TYR A 1 411 ? 17.274  54.909 46.253 1.00 30.47 ? 411 TYR A N   1 
ATOM   3188 C CA  . TYR A 1 411 ? 16.714  55.664 45.141 1.00 29.64 ? 411 TYR A CA  1 
ATOM   3189 C C   . TYR A 1 411 ? 17.856  56.130 44.246 1.00 31.00 ? 411 TYR A C   1 
ATOM   3190 O O   . TYR A 1 411 ? 17.885  55.829 43.063 1.00 34.38 ? 411 TYR A O   1 
ATOM   3191 C CB  . TYR A 1 411 ? 15.938  56.889 45.625 1.00 25.36 ? 411 TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 411 ? 15.156  57.535 44.505 1.00 24.45 ? 411 TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 411 ? 13.902  57.037 44.124 1.00 21.53 ? 411 TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 411 ? 15.696  58.595 43.771 1.00 24.55 ? 411 TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 411 ? 13.214  57.574 43.038 1.00 19.75 ? 411 TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 411 ? 15.012  59.141 42.680 1.00 19.58 ? 411 TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 411 ? 13.779  58.624 42.321 1.00 19.29 ? 411 TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 411 ? 13.117  59.145 41.240 1.00 17.88 ? 411 TYR A OH  1 
ATOM   3199 N N   . THR A 1 412 ? 18.791  56.870 44.829 1.00 31.17 ? 412 THR A N   1 
ATOM   3200 C CA  . THR A 1 412 ? 19.955  57.384 44.116 1.00 31.55 ? 412 THR A CA  1 
ATOM   3201 C C   . THR A 1 412 ? 20.764  56.239 43.505 1.00 32.21 ? 412 THR A C   1 
ATOM   3202 O O   . THR A 1 412 ? 21.943  56.053 43.819 1.00 35.34 ? 412 THR A O   1 
ATOM   3203 C CB  . THR A 1 412 ? 20.856  58.183 45.078 1.00 30.96 ? 412 THR A CB  1 
ATOM   3204 O OG1 . THR A 1 412 ? 20.093  59.244 45.671 1.00 28.24 ? 412 THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 412 ? 22.055  58.759 44.341 1.00 32.07 ? 412 THR A CG2 1 
ATOM   3206 N N   . LYS A 1 413 ? 20.116  55.479 42.633 1.00 30.58 ? 413 LYS A N   1 
ATOM   3207 C CA  . LYS A 1 413 ? 20.718  54.335 41.965 1.00 31.04 ? 413 LYS A CA  1 
ATOM   3208 C C   . LYS A 1 413 ? 19.732  53.918 40.872 1.00 33.41 ? 413 LYS A C   1 
ATOM   3209 O O   . LYS A 1 413 ? 19.864  52.866 40.249 1.00 37.27 ? 413 LYS A O   1 
ATOM   3210 C CB  . LYS A 1 413 ? 20.912  53.193 42.966 1.00 29.59 ? 413 LYS A CB  1 
ATOM   3211 C CG  . LYS A 1 413 ? 21.622  51.972 42.412 1.00 28.49 ? 413 LYS A CG  1 
ATOM   3212 C CD  . LYS A 1 413 ? 23.062  51.904 42.896 0.00 28.64 ? 413 LYS A CD  1 
ATOM   3213 C CE  . LYS A 1 413 ? 24.016  51.600 41.752 0.00 28.32 ? 413 LYS A CE  1 
ATOM   3214 N NZ  . LYS A 1 413 ? 25.439  51.780 42.154 0.00 27.89 ? 413 LYS A NZ  1 
ATOM   3215 N N   . PHE A 1 414 ? 18.735  54.768 40.655 1.00 32.44 ? 414 PHE A N   1 
ATOM   3216 C CA  . PHE A 1 414 ? 17.705  54.538 39.658 1.00 31.18 ? 414 PHE A CA  1 
ATOM   3217 C C   . PHE A 1 414 ? 17.089  55.893 39.344 1.00 31.65 ? 414 PHE A C   1 
ATOM   3218 O O   . PHE A 1 414 ? 16.465  56.083 38.304 1.00 33.93 ? 414 PHE A O   1 
ATOM   3219 C CB  . PHE A 1 414 ? 16.620  53.626 40.220 1.00 31.29 ? 414 PHE A CB  1 
ATOM   3220 C CG  . PHE A 1 414 ? 17.024  52.191 40.334 1.00 30.77 ? 414 PHE A CG  1 
ATOM   3221 C CD1 . PHE A 1 414 ? 17.150  51.398 39.203 1.00 31.32 ? 414 PHE A CD1 1 
ATOM   3222 C CD2 . PHE A 1 414 ? 17.247  51.618 41.580 1.00 31.21 ? 414 PHE A CD2 1 
ATOM   3223 C CE1 . PHE A 1 414 ? 17.490  50.052 39.315 1.00 31.92 ? 414 PHE A CE1 1 
ATOM   3224 C CE2 . PHE A 1 414 ? 17.587  50.272 41.702 1.00 29.40 ? 414 PHE A CE2 1 
ATOM   3225 C CZ  . PHE A 1 414 ? 17.708  49.490 40.570 1.00 29.47 ? 414 PHE A CZ  1 
ATOM   3226 N N   . GLY A 1 415 ? 17.258  56.830 40.267 1.00 29.74 ? 415 GLY A N   1 
ATOM   3227 C CA  . GLY A 1 415 ? 16.703  58.149 40.083 1.00 29.81 ? 415 GLY A CA  1 
ATOM   3228 C C   . GLY A 1 415 ? 17.537  58.905 39.086 1.00 32.44 ? 415 GLY A C   1 
ATOM   3229 O O   . GLY A 1 415 ? 18.640  58.479 38.754 1.00 33.90 ? 415 GLY A O   1 
ATOM   3230 N N   . ASN A 1 416 ? 17.014  60.034 38.621 1.00 33.28 ? 416 ASN A N   1 
ATOM   3231 C CA  . ASN A 1 416 ? 17.698  60.860 37.641 1.00 32.70 ? 416 ASN A CA  1 
ATOM   3232 C C   . ASN A 1 416 ? 18.493  62.000 38.281 1.00 31.92 ? 416 ASN A C   1 
ATOM   3233 O O   . ASN A 1 416 ? 19.118  62.795 37.582 1.00 34.21 ? 416 ASN A O   1 
ATOM   3234 C CB  . ASN A 1 416 ? 16.668  61.424 36.664 1.00 35.18 ? 416 ASN A CB  1 
ATOM   3235 C CG  . ASN A 1 416 ? 17.298  62.019 35.422 1.00 38.57 ? 416 ASN A CG  1 
ATOM   3236 O OD1 . ASN A 1 416 ? 16.965  63.138 35.026 1.00 40.13 ? 416 ASN A OD1 1 
ATOM   3237 N ND2 . ASN A 1 416 ? 18.208  61.274 34.795 1.00 37.55 ? 416 ASN A ND2 1 
ATOM   3238 N N   . GLY A 1 417 ? 18.477  62.073 39.607 1.00 30.20 ? 417 GLY A N   1 
ATOM   3239 C CA  . GLY A 1 417 ? 19.196  63.129 40.304 1.00 28.74 ? 417 GLY A CA  1 
ATOM   3240 C C   . GLY A 1 417 ? 18.712  63.236 41.740 1.00 29.16 ? 417 GLY A C   1 
ATOM   3241 O O   . GLY A 1 417 ? 17.523  63.062 42.009 1.00 30.18 ? 417 GLY A O   1 
ATOM   3242 N N   . THR A 1 418 ? 19.619  63.526 42.667 1.00 27.02 ? 418 THR A N   1 
ATOM   3243 C CA  . THR A 1 418 ? 19.250  63.616 44.072 1.00 25.25 ? 418 THR A CA  1 
ATOM   3244 C C   . THR A 1 418 ? 19.991  64.722 44.781 1.00 26.54 ? 418 THR A C   1 
ATOM   3245 O O   . THR A 1 418 ? 21.209  64.792 44.716 1.00 28.33 ? 418 THR A O   1 
ATOM   3246 C CB  . THR A 1 418 ? 19.574  62.299 44.802 1.00 26.02 ? 418 THR A CB  1 
ATOM   3247 O OG1 . THR A 1 418 ? 18.660  61.280 44.376 1.00 27.84 ? 418 THR A OG1 1 
ATOM   3248 C CG2 . THR A 1 418 ? 19.487  62.474 46.312 1.00 20.05 ? 418 THR A CG2 1 
ATOM   3249 N N   . TYR A 1 419 ? 19.251  65.587 45.461 1.00 27.57 ? 419 TYR A N   1 
ATOM   3250 C CA  . TYR A 1 419 ? 19.852  66.675 46.220 1.00 26.60 ? 419 TYR A CA  1 
ATOM   3251 C C   . TYR A 1 419 ? 19.431  66.474 47.671 1.00 25.98 ? 419 TYR A C   1 
ATOM   3252 O O   . TYR A 1 419 ? 18.238  66.386 47.969 1.00 24.19 ? 419 TYR A O   1 
ATOM   3253 C CB  . TYR A 1 419 ? 19.370  68.027 45.707 1.00 27.68 ? 419 TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 419 ? 19.828  68.325 44.304 1.00 28.53 ? 419 TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 419 ? 19.081  67.901 43.210 1.00 31.45 ? 419 TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 419 ? 21.006  69.024 44.067 1.00 29.42 ? 419 TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 419 ? 19.494  68.162 41.914 1.00 33.68 ? 419 TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 419 ? 21.431  69.292 42.774 1.00 32.01 ? 419 TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 419 ? 20.669  68.856 41.702 1.00 33.54 ? 419 TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 419 ? 21.072  69.103 40.413 1.00 35.99 ? 419 TYR A OH  1 
ATOM   3261 N N   . LEU A 1 420 ? 20.424  66.405 48.556 1.00 25.56 ? 420 LEU A N   1 
ATOM   3262 C CA  . LEU A 1 420 ? 20.207  66.161 49.977 1.00 23.44 ? 420 LEU A CA  1 
ATOM   3263 C C   . LEU A 1 420 ? 20.686  67.278 50.897 1.00 23.53 ? 420 LEU A C   1 
ATOM   3264 O O   . LEU A 1 420 ? 21.836  67.704 50.818 1.00 21.80 ? 420 LEU A O   1 
ATOM   3265 C CB  . LEU A 1 420 ? 20.914  64.864 50.361 1.00 20.12 ? 420 LEU A CB  1 
ATOM   3266 C CG  . LEU A 1 420 ? 20.717  64.466 51.809 1.00 18.60 ? 420 LEU A CG  1 
ATOM   3267 C CD1 . LEU A 1 420 ? 19.333  63.850 51.990 1.00 18.26 ? 420 LEU A CD1 1 
ATOM   3268 C CD2 . LEU A 1 420 ? 21.801  63.511 52.200 1.00 13.25 ? 420 LEU A CD2 1 
ATOM   3269 N N   . TYR A 1 421 ? 19.802  67.724 51.791 1.00 25.58 ? 421 TYR A N   1 
ATOM   3270 C CA  . TYR A 1 421 ? 20.117  68.800 52.740 1.00 23.73 ? 421 TYR A CA  1 
ATOM   3271 C C   . TYR A 1 421 ? 20.030  68.374 54.196 1.00 22.84 ? 421 TYR A C   1 
ATOM   3272 O O   . TYR A 1 421 ? 19.390  67.389 54.540 1.00 24.34 ? 421 TYR A O   1 
ATOM   3273 C CB  . TYR A 1 421 ? 19.174  69.996 52.539 1.00 24.32 ? 421 TYR A CB  1 
ATOM   3274 C CG  . TYR A 1 421 ? 17.779  69.808 53.124 1.00 25.92 ? 421 TYR A CG  1 
ATOM   3275 C CD1 . TYR A 1 421 ? 17.560  69.835 54.506 1.00 24.92 ? 421 TYR A CD1 1 
ATOM   3276 C CD2 . TYR A 1 421 ? 16.681  69.573 52.294 1.00 24.89 ? 421 TYR A CD2 1 
ATOM   3277 C CE1 . TYR A 1 421 ? 16.283  69.626 55.044 1.00 23.63 ? 421 TYR A CE1 1 
ATOM   3278 C CE2 . TYR A 1 421 ? 15.401  69.363 52.827 1.00 25.19 ? 421 TYR A CE2 1 
ATOM   3279 C CZ  . TYR A 1 421 ? 15.211  69.387 54.201 1.00 21.37 ? 421 TYR A CZ  1 
ATOM   3280 O OH  . TYR A 1 421 ? 13.963  69.132 54.726 1.00 15.90 ? 421 TYR A OH  1 
ATOM   3281 N N   . PHE A 1 422 ? 20.669  69.156 55.048 1.00 23.39 ? 422 PHE A N   1 
ATOM   3282 C CA  . PHE A 1 422 ? 20.665  68.918 56.477 1.00 23.68 ? 422 PHE A CA  1 
ATOM   3283 C C   . PHE A 1 422 ? 20.369  70.276 57.085 1.00 25.16 ? 422 PHE A C   1 
ATOM   3284 O O   . PHE A 1 422 ? 21.283  71.080 57.295 1.00 26.67 ? 422 PHE A O   1 
ATOM   3285 C CB  . PHE A 1 422 ? 22.037  68.434 56.941 1.00 24.61 ? 422 PHE A CB  1 
ATOM   3286 C CG  . PHE A 1 422 ? 22.127  68.197 58.420 1.00 25.23 ? 422 PHE A CG  1 
ATOM   3287 C CD1 . PHE A 1 422 ? 21.556  67.067 58.993 1.00 25.66 ? 422 PHE A CD1 1 
ATOM   3288 C CD2 . PHE A 1 422 ? 22.769  69.107 59.242 1.00 25.62 ? 422 PHE A CD2 1 
ATOM   3289 C CE1 . PHE A 1 422 ? 21.624  66.852 60.358 1.00 24.81 ? 422 PHE A CE1 1 
ATOM   3290 C CE2 . PHE A 1 422 ? 22.841  68.899 60.608 1.00 25.32 ? 422 PHE A CE2 1 
ATOM   3291 C CZ  . PHE A 1 422 ? 22.268  67.770 61.167 1.00 25.23 ? 422 PHE A CZ  1 
ATOM   3292 N N   . PHE A 1 423 ? 19.091  70.546 57.336 1.00 24.61 ? 423 PHE A N   1 
ATOM   3293 C CA  . PHE A 1 423 ? 18.696  71.828 57.909 1.00 23.81 ? 423 PHE A CA  1 
ATOM   3294 C C   . PHE A 1 423 ? 18.996  71.875 59.403 1.00 23.36 ? 423 PHE A C   1 
ATOM   3295 O O   . PHE A 1 423 ? 18.455  71.093 60.182 1.00 24.23 ? 423 PHE A O   1 
ATOM   3296 C CB  . PHE A 1 423 ? 17.209  72.079 57.671 1.00 23.31 ? 423 PHE A CB  1 
ATOM   3297 C CG  . PHE A 1 423 ? 16.693  73.312 58.349 1.00 24.13 ? 423 PHE A CG  1 
ATOM   3298 C CD1 . PHE A 1 423 ? 16.853  74.558 57.764 1.00 22.60 ? 423 PHE A CD1 1 
ATOM   3299 C CD2 . PHE A 1 423 ? 16.060  73.229 59.585 1.00 24.53 ? 423 PHE A CD2 1 
ATOM   3300 C CE1 . PHE A 1 423 ? 16.391  75.698 58.397 1.00 22.70 ? 423 PHE A CE1 1 
ATOM   3301 C CE2 . PHE A 1 423 ? 15.593  74.371 60.224 1.00 23.14 ? 423 PHE A CE2 1 
ATOM   3302 C CZ  . PHE A 1 423 ? 15.758  75.602 59.633 1.00 22.08 ? 423 PHE A CZ  1 
ATOM   3303 N N   . ASN A 1 424 ? 19.858  72.793 59.813 1.00 22.10 ? 424 ASN A N   1 
ATOM   3304 C CA  . ASN A 1 424 ? 20.187  72.866 61.220 1.00 22.21 ? 424 ASN A CA  1 
ATOM   3305 C C   . ASN A 1 424 ? 20.297  74.273 61.765 1.00 22.27 ? 424 ASN A C   1 
ATOM   3306 O O   . ASN A 1 424 ? 21.293  74.644 62.361 1.00 24.13 ? 424 ASN A O   1 
ATOM   3307 C CB  . ASN A 1 424 ? 21.474  72.084 61.503 1.00 22.64 ? 424 ASN A CB  1 
ATOM   3308 C CG  . ASN A 1 424 ? 22.685  72.691 60.842 1.00 19.22 ? 424 ASN A CG  1 
ATOM   3309 O OD1 . ASN A 1 424 ? 22.571  73.597 60.033 1.00 22.40 ? 424 ASN A OD1 1 
ATOM   3310 N ND2 . ASN A 1 424 ? 23.858  72.191 61.192 1.00 20.66 ? 424 ASN A ND2 1 
ATOM   3311 N N   . HIS A 1 425 ? 19.251  75.054 61.564 1.00 23.21 ? 425 HIS A N   1 
ATOM   3312 C CA  . HIS A 1 425 ? 19.213  76.405 62.069 1.00 24.31 ? 425 HIS A CA  1 
ATOM   3313 C C   . HIS A 1 425 ? 18.018  76.521 63.020 1.00 29.79 ? 425 HIS A C   1 
ATOM   3314 O O   . HIS A 1 425 ? 16.897  76.113 62.692 1.00 32.22 ? 425 HIS A O   1 
ATOM   3315 C CB  . HIS A 1 425 ? 19.063  77.404 60.924 1.00 21.40 ? 425 HIS A CB  1 
ATOM   3316 C CG  . HIS A 1 425 ? 18.800  78.800 61.387 1.00 18.81 ? 425 HIS A CG  1 
ATOM   3317 N ND1 . HIS A 1 425 ? 19.807  79.649 61.790 1.00 17.78 ? 425 HIS A ND1 1 
ATOM   3318 C CD2 . HIS A 1 425 ? 17.641  79.467 61.590 1.00 18.83 ? 425 HIS A CD2 1 
ATOM   3319 C CE1 . HIS A 1 425 ? 19.278  80.778 62.224 1.00 18.28 ? 425 HIS A CE1 1 
ATOM   3320 N NE2 . HIS A 1 425 ? 17.965  80.694 62.113 1.00 17.12 ? 425 HIS A NE2 1 
ATOM   3321 N N   . ARG A 1 426 ? 18.263  77.072 64.204 1.00 32.92 ? 426 ARG A N   1 
ATOM   3322 C CA  . ARG A 1 426 ? 17.211  77.244 65.192 1.00 35.02 ? 426 ARG A CA  1 
ATOM   3323 C C   . ARG A 1 426 ? 16.546  78.607 65.035 1.00 36.59 ? 426 ARG A C   1 
ATOM   3324 O O   . ARG A 1 426 ? 17.162  79.636 65.311 1.00 37.62 ? 426 ARG A O   1 
ATOM   3325 C CB  . ARG A 1 426 ? 17.787  77.116 66.607 1.00 33.72 ? 426 ARG A CB  1 
ATOM   3326 C CG  . ARG A 1 426 ? 16.923  76.287 67.543 1.00 34.86 ? 426 ARG A CG  1 
ATOM   3327 C CD  . ARG A 1 426 ? 16.684  76.978 68.880 1.00 36.21 ? 426 ARG A CD  1 
ATOM   3328 N NE  . ARG A 1 426 ? 15.869  76.145 69.766 1.00 37.89 ? 426 ARG A NE  1 
ATOM   3329 C CZ  . ARG A 1 426 ? 15.204  76.599 70.823 1.00 37.13 ? 426 ARG A CZ  1 
ATOM   3330 N NH1 . ARG A 1 426 ? 15.251  77.888 71.141 1.00 39.52 ? 426 ARG A NH1 1 
ATOM   3331 N NH2 . ARG A 1 426 ? 14.484  75.766 71.559 1.00 35.35 ? 426 ARG A NH2 1 
ATOM   3332 N N   . ALA A 1 427 ? 15.295  78.613 64.587 1.00 37.76 ? 427 ALA A N   1 
ATOM   3333 C CA  . ALA A 1 427 ? 14.563  79.863 64.421 1.00 39.57 ? 427 ALA A CA  1 
ATOM   3334 C C   . ALA A 1 427 ? 14.837  80.740 65.640 1.00 40.52 ? 427 ALA A C   1 
ATOM   3335 O O   . ALA A 1 427 ? 14.763  80.274 66.780 1.00 41.28 ? 427 ALA A O   1 
ATOM   3336 C CB  . ALA A 1 427 ? 13.065  79.588 64.294 1.00 40.61 ? 427 ALA A CB  1 
ATOM   3337 N N   . SER A 1 428 ? 15.160  82.006 65.394 1.00 40.64 ? 428 SER A N   1 
ATOM   3338 C CA  . SER A 1 428 ? 15.466  82.941 66.471 1.00 38.89 ? 428 SER A CA  1 
ATOM   3339 C C   . SER A 1 428 ? 14.272  83.232 67.373 1.00 38.94 ? 428 SER A C   1 
ATOM   3340 O O   . SER A 1 428 ? 14.450  83.619 68.527 1.00 39.42 ? 428 SER A O   1 
ATOM   3341 C CB  . SER A 1 428 ? 15.995  84.254 65.892 1.00 37.07 ? 428 SER A CB  1 
ATOM   3342 O OG  . SER A 1 428 ? 14.936  85.086 65.449 1.00 36.81 ? 428 SER A OG  1 
ATOM   3343 N N   . ASN A 1 429 ? 13.060  83.039 66.856 1.00 37.59 ? 429 ASN A N   1 
ATOM   3344 C CA  . ASN A 1 429 ? 11.856  83.313 67.638 1.00 35.25 ? 429 ASN A CA  1 
ATOM   3345 C C   . ASN A 1 429 ? 11.157  82.075 68.200 1.00 34.41 ? 429 ASN A C   1 
ATOM   3346 O O   . ASN A 1 429 ? 10.048  82.169 68.721 1.00 35.09 ? 429 ASN A O   1 
ATOM   3347 C CB  . ASN A 1 429 ? 10.862  84.120 66.796 1.00 33.60 ? 429 ASN A CB  1 
ATOM   3348 C CG  . ASN A 1 429 ? 10.467  83.414 65.516 1.00 34.65 ? 429 ASN A CG  1 
ATOM   3349 O OD1 . ASN A 1 429 ? 11.016  82.365 65.166 1.00 35.23 ? 429 ASN A OD1 1 
ATOM   3350 N ND2 . ASN A 1 429 ? 9.504   83.988 64.806 1.00 33.49 ? 429 ASN A ND2 1 
ATOM   3351 N N   . LEU A 1 430 ? 11.802  80.918 68.102 1.00 33.51 ? 430 LEU A N   1 
ATOM   3352 C CA  . LEU A 1 430 ? 11.205  79.688 68.609 1.00 30.48 ? 430 LEU A CA  1 
ATOM   3353 C C   . LEU A 1 430 ? 10.806  79.901 70.060 1.00 29.48 ? 430 LEU A C   1 
ATOM   3354 O O   . LEU A 1 430 ? 11.465  80.651 70.778 1.00 30.24 ? 430 LEU A O   1 
ATOM   3355 C CB  . LEU A 1 430 ? 12.198  78.525 68.501 1.00 27.55 ? 430 LEU A CB  1 
ATOM   3356 C CG  . LEU A 1 430 ? 11.867  77.449 67.463 1.00 23.48 ? 430 LEU A CG  1 
ATOM   3357 C CD1 . LEU A 1 430 ? 12.890  76.325 67.531 1.00 26.11 ? 430 LEU A CD1 1 
ATOM   3358 C CD2 . LEU A 1 430 ? 10.492  76.902 67.730 1.00 21.86 ? 430 LEU A CD2 1 
ATOM   3359 N N   . VAL A 1 431 ? 9.723   79.248 70.480 1.00 27.61 ? 431 VAL A N   1 
ATOM   3360 C CA  . VAL A 1 431 ? 9.225   79.359 71.846 1.00 25.06 ? 431 VAL A CA  1 
ATOM   3361 C C   . VAL A 1 431 ? 9.562   78.111 72.652 1.00 24.46 ? 431 VAL A C   1 
ATOM   3362 O O   . VAL A 1 431 ? 9.621   78.151 73.875 1.00 26.42 ? 431 VAL A O   1 
ATOM   3363 C CB  . VAL A 1 431 ? 7.705   79.564 71.865 1.00 25.17 ? 431 VAL A CB  1 
ATOM   3364 C CG1 . VAL A 1 431 ? 7.358   80.850 71.145 1.00 25.65 ? 431 VAL A CG1 1 
ATOM   3365 C CG2 . VAL A 1 431 ? 7.009   78.392 71.197 1.00 26.84 ? 431 VAL A CG2 1 
ATOM   3366 N N   . TRP A 1 432 ? 9.781   77.002 71.961 1.00 22.33 ? 432 TRP A N   1 
ATOM   3367 C CA  . TRP A 1 432 ? 10.127  75.751 72.618 1.00 21.87 ? 432 TRP A CA  1 
ATOM   3368 C C   . TRP A 1 432 ? 11.452  75.880 73.364 1.00 21.87 ? 432 TRP A C   1 
ATOM   3369 O O   . TRP A 1 432 ? 12.308  76.678 72.994 1.00 22.57 ? 432 TRP A O   1 
ATOM   3370 C CB  . TRP A 1 432 ? 10.244  74.625 71.583 1.00 21.10 ? 432 TRP A CB  1 
ATOM   3371 C CG  . TRP A 1 432 ? 8.970   74.328 70.906 1.00 16.99 ? 432 TRP A CG  1 
ATOM   3372 C CD1 . TRP A 1 432 ? 8.567   74.779 69.687 1.00 19.06 ? 432 TRP A CD1 1 
ATOM   3373 C CD2 . TRP A 1 432 ? 7.893   73.567 71.431 1.00 17.29 ? 432 TRP A CD2 1 
ATOM   3374 N NE1 . TRP A 1 432 ? 7.291   74.347 69.418 1.00 18.33 ? 432 TRP A NE1 1 
ATOM   3375 C CE2 . TRP A 1 432 ? 6.853   73.599 70.477 1.00 19.03 ? 432 TRP A CE2 1 
ATOM   3376 C CE3 . TRP A 1 432 ? 7.698   72.859 72.620 1.00 20.58 ? 432 TRP A CE3 1 
ATOM   3377 C CZ2 . TRP A 1 432 ? 5.634   72.949 70.676 1.00 21.27 ? 432 TRP A CZ2 1 
ATOM   3378 C CZ3 . TRP A 1 432 ? 6.481   72.211 72.823 1.00 21.53 ? 432 TRP A CZ3 1 
ATOM   3379 C CH2 . TRP A 1 432 ? 5.466   72.262 71.853 1.00 23.47 ? 432 TRP A CH2 1 
ATOM   3380 N N   . PRO A 1 433 ? 11.638  75.084 74.427 1.00 21.92 ? 433 PRO A N   1 
ATOM   3381 C CA  . PRO A 1 433 ? 12.872  75.115 75.215 1.00 21.46 ? 433 PRO A CA  1 
ATOM   3382 C C   . PRO A 1 433 ? 14.090  74.857 74.347 1.00 24.37 ? 433 PRO A C   1 
ATOM   3383 O O   . PRO A 1 433 ? 14.088  73.949 73.522 1.00 27.78 ? 433 PRO A O   1 
ATOM   3384 C CB  . PRO A 1 433 ? 12.677  73.998 76.229 1.00 21.63 ? 433 PRO A CB  1 
ATOM   3385 C CG  . PRO A 1 433 ? 11.594  73.130 75.648 1.00 21.37 ? 433 PRO A CG  1 
ATOM   3386 C CD  . PRO A 1 433 ? 10.691  74.088 74.951 1.00 21.64 ? 433 PRO A CD  1 
ATOM   3387 N N   . GLU A 1 434 ? 15.139  75.640 74.550 1.00 26.68 ? 434 GLU A N   1 
ATOM   3388 C CA  . GLU A 1 434 ? 16.365  75.488 73.782 1.00 27.69 ? 434 GLU A CA  1 
ATOM   3389 C C   . GLU A 1 434 ? 16.879  74.045 73.699 1.00 26.18 ? 434 GLU A C   1 
ATOM   3390 O O   . GLU A 1 434 ? 17.476  73.654 72.694 1.00 25.26 ? 434 GLU A O   1 
ATOM   3391 C CB  . GLU A 1 434 ? 17.451  76.392 74.367 1.00 31.86 ? 434 GLU A CB  1 
ATOM   3392 C CG  . GLU A 1 434 ? 18.568  76.726 73.388 1.00 40.73 ? 434 GLU A CG  1 
ATOM   3393 C CD  . GLU A 1 434 ? 18.433  78.119 72.799 1.00 44.99 ? 434 GLU A CD  1 
ATOM   3394 O OE1 . GLU A 1 434 ? 17.634  78.913 73.344 1.00 48.16 ? 434 GLU A OE1 1 
ATOM   3395 O OE2 . GLU A 1 434 ? 19.122  78.420 71.794 1.00 48.58 ? 434 GLU A OE2 1 
ATOM   3396 N N   . TRP A 1 435 ? 16.648  73.253 74.743 1.00 24.23 ? 435 TRP A N   1 
ATOM   3397 C CA  . TRP A 1 435 ? 17.116  71.870 74.745 1.00 25.29 ? 435 TRP A CA  1 
ATOM   3398 C C   . TRP A 1 435 ? 16.538  71.047 73.590 1.00 27.01 ? 435 TRP A C   1 
ATOM   3399 O O   . TRP A 1 435 ? 17.000  69.934 73.308 1.00 27.76 ? 435 TRP A O   1 
ATOM   3400 C CB  . TRP A 1 435 ? 16.798  71.182 76.090 1.00 22.88 ? 435 TRP A CB  1 
ATOM   3401 C CG  . TRP A 1 435 ? 15.346  70.769 76.300 1.00 22.50 ? 435 TRP A CG  1 
ATOM   3402 C CD1 . TRP A 1 435 ? 14.403  71.449 77.012 1.00 21.84 ? 435 TRP A CD1 1 
ATOM   3403 C CD2 . TRP A 1 435 ? 14.699  69.572 75.827 1.00 20.17 ? 435 TRP A CD2 1 
ATOM   3404 N NE1 . TRP A 1 435 ? 13.216  70.757 77.017 1.00 20.65 ? 435 TRP A NE1 1 
ATOM   3405 C CE2 . TRP A 1 435 ? 13.368  69.603 76.298 1.00 20.08 ? 435 TRP A CE2 1 
ATOM   3406 C CE3 . TRP A 1 435 ? 15.115  68.479 75.052 1.00 20.21 ? 435 TRP A CE3 1 
ATOM   3407 C CZ2 . TRP A 1 435 ? 12.450  68.585 76.022 1.00 19.89 ? 435 TRP A CZ2 1 
ATOM   3408 C CZ3 . TRP A 1 435 ? 14.201  67.467 74.780 1.00 17.38 ? 435 TRP A CZ3 1 
ATOM   3409 C CH2 . TRP A 1 435 ? 12.884  67.529 75.265 1.00 19.14 ? 435 TRP A CH2 1 
ATOM   3410 N N   . MET A 1 436 ? 15.533  71.597 72.918 1.00 24.67 ? 436 MET A N   1 
ATOM   3411 C CA  . MET A 1 436 ? 14.910  70.887 71.823 1.00 22.79 ? 436 MET A CA  1 
ATOM   3412 C C   . MET A 1 436 ? 15.617  71.143 70.486 1.00 25.28 ? 436 MET A C   1 
ATOM   3413 O O   . MET A 1 436 ? 15.360  70.446 69.509 1.00 29.36 ? 436 MET A O   1 
ATOM   3414 C CB  . MET A 1 436 ? 13.428  71.255 71.761 1.00 19.59 ? 436 MET A CB  1 
ATOM   3415 C CG  . MET A 1 436 ? 12.586  70.544 72.824 1.00 18.13 ? 436 MET A CG  1 
ATOM   3416 S SD  . MET A 1 436 ? 10.848  71.061 72.890 1.00 20.84 ? 436 MET A SD  1 
ATOM   3417 C CE  . MET A 1 436 ? 10.028  69.695 72.156 1.00 16.07 ? 436 MET A CE  1 
ATOM   3418 N N   . GLY A 1 437 ? 16.513  72.129 70.450 1.00 23.79 ? 437 GLY A N   1 
ATOM   3419 C CA  . GLY A 1 437 ? 17.261  72.435 69.236 1.00 22.23 ? 437 GLY A CA  1 
ATOM   3420 C C   . GLY A 1 437 ? 16.479  72.680 67.955 1.00 22.41 ? 437 GLY A C   1 
ATOM   3421 O O   . GLY A 1 437 ? 15.463  73.376 67.954 1.00 26.10 ? 437 GLY A O   1 
ATOM   3422 N N   . VAL A 1 438 ? 16.969  72.137 66.846 1.00 20.58 ? 438 VAL A N   1 
ATOM   3423 C CA  . VAL A 1 438 ? 16.285  72.285 65.565 1.00 20.54 ? 438 VAL A CA  1 
ATOM   3424 C C   . VAL A 1 438 ? 15.227  71.183 65.533 1.00 21.00 ? 438 VAL A C   1 
ATOM   3425 O O   . VAL A 1 438 ? 15.493  70.033 65.172 1.00 20.49 ? 438 VAL A O   1 
ATOM   3426 C CB  . VAL A 1 438 ? 17.282  72.139 64.402 1.00 22.02 ? 438 VAL A CB  1 
ATOM   3427 C CG1 . VAL A 1 438 ? 16.610  72.486 63.068 1.00 20.00 ? 438 VAL A CG1 1 
ATOM   3428 C CG2 . VAL A 1 438 ? 18.475  73.053 64.656 1.00 20.96 ? 438 VAL A CG2 1 
ATOM   3429 N N   . ILE A 1 439 ? 14.019  71.566 65.927 1.00 22.54 ? 439 ILE A N   1 
ATOM   3430 C CA  . ILE A 1 439 ? 12.878  70.662 66.056 1.00 22.35 ? 439 ILE A CA  1 
ATOM   3431 C C   . ILE A 1 439 ? 12.134  70.219 64.802 1.00 23.10 ? 439 ILE A C   1 
ATOM   3432 O O   . ILE A 1 439 ? 12.016  70.956 63.816 1.00 23.12 ? 439 ILE A O   1 
ATOM   3433 C CB  . ILE A 1 439 ? 11.826  71.271 67.035 1.00 22.68 ? 439 ILE A CB  1 
ATOM   3434 C CG1 . ILE A 1 439 ? 12.528  71.908 68.234 1.00 20.56 ? 439 ILE A CG1 1 
ATOM   3435 C CG2 . ILE A 1 439 ? 10.870  70.210 67.516 1.00 25.88 ? 439 ILE A CG2 1 
ATOM   3436 C CD1 . ILE A 1 439 ? 11.872  73.183 68.713 1.00 22.24 ? 439 ILE A CD1 1 
ATOM   3437 N N   . HIS A 1 440 ? 11.616  68.996 64.888 1.00 23.14 ? 440 HIS A N   1 
ATOM   3438 C CA  . HIS A 1 440 ? 10.831  68.366 63.838 1.00 22.63 ? 440 HIS A CA  1 
ATOM   3439 C C   . HIS A 1 440 ? 9.797   69.363 63.359 1.00 23.41 ? 440 HIS A C   1 
ATOM   3440 O O   . HIS A 1 440 ? 9.079   69.945 64.159 1.00 24.46 ? 440 HIS A O   1 
ATOM   3441 C CB  . HIS A 1 440 ? 10.122  67.140 64.419 1.00 22.72 ? 440 HIS A CB  1 
ATOM   3442 C CG  . HIS A 1 440 ? 9.553   66.197 63.398 1.00 24.55 ? 440 HIS A CG  1 
ATOM   3443 N ND1 . HIS A 1 440 ? 10.332  65.530 62.476 1.00 23.45 ? 440 HIS A ND1 1 
ATOM   3444 C CD2 . HIS A 1 440 ? 8.289   65.743 63.214 1.00 23.13 ? 440 HIS A CD2 1 
ATOM   3445 C CE1 . HIS A 1 440 ? 9.574   64.705 61.772 1.00 23.61 ? 440 HIS A CE1 1 
ATOM   3446 N NE2 . HIS A 1 440 ? 8.330   64.815 62.201 1.00 22.78 ? 440 HIS A NE2 1 
ATOM   3447 N N   . GLY A 1 441 ? 9.742   69.578 62.052 1.00 25.31 ? 441 GLY A N   1 
ATOM   3448 C CA  . GLY A 1 441 ? 8.753   70.481 61.495 1.00 25.47 ? 441 GLY A CA  1 
ATOM   3449 C C   . GLY A 1 441 ? 8.985   71.974 61.599 1.00 25.31 ? 441 GLY A C   1 
ATOM   3450 O O   . GLY A 1 441 ? 8.066   72.748 61.326 1.00 26.63 ? 441 GLY A O   1 
ATOM   3451 N N   . TYR A 1 442 ? 10.188  72.402 61.966 1.00 24.61 ? 442 TYR A N   1 
ATOM   3452 C CA  . TYR A 1 442 ? 10.421  73.831 62.083 1.00 24.17 ? 442 TYR A CA  1 
ATOM   3453 C C   . TYR A 1 442 ? 11.338  74.408 61.022 1.00 24.09 ? 442 TYR A C   1 
ATOM   3454 O O   . TYR A 1 442 ? 12.134  75.308 61.275 1.00 24.80 ? 442 TYR A O   1 
ATOM   3455 C CB  . TYR A 1 442 ? 10.903  74.162 63.496 1.00 24.67 ? 442 TYR A CB  1 
ATOM   3456 C CG  . TYR A 1 442 ? 9.735   74.252 64.465 1.00 26.33 ? 442 TYR A CG  1 
ATOM   3457 C CD1 . TYR A 1 442 ? 9.097   73.095 64.925 1.00 26.41 ? 442 TYR A CD1 1 
ATOM   3458 C CD2 . TYR A 1 442 ? 9.219   75.488 64.864 1.00 25.39 ? 442 TYR A CD2 1 
ATOM   3459 C CE1 . TYR A 1 442 ? 7.972   73.164 65.751 1.00 25.82 ? 442 TYR A CE1 1 
ATOM   3460 C CE2 . TYR A 1 442 ? 8.088   75.565 65.696 1.00 25.47 ? 442 TYR A CE2 1 
ATOM   3461 C CZ  . TYR A 1 442 ? 7.473   74.399 66.131 1.00 25.97 ? 442 TYR A CZ  1 
ATOM   3462 O OH  . TYR A 1 442 ? 6.359   74.459 66.941 1.00 26.21 ? 442 TYR A OH  1 
ATOM   3463 N N   . GLU A 1 443 ? 11.189  73.876 59.817 1.00 26.11 ? 443 GLU A N   1 
ATOM   3464 C CA  . GLU A 1 443 ? 11.947  74.304 58.650 1.00 26.59 ? 443 GLU A CA  1 
ATOM   3465 C C   . GLU A 1 443 ? 10.882  74.788 57.694 1.00 26.35 ? 443 GLU A C   1 
ATOM   3466 O O   . GLU A 1 443 ? 11.113  75.662 56.862 1.00 30.67 ? 443 GLU A O   1 
ATOM   3467 C CB  . GLU A 1 443 ? 12.687  73.122 58.023 1.00 25.93 ? 443 GLU A CB  1 
ATOM   3468 C CG  . GLU A 1 443 ? 11.897  72.388 56.950 1.00 25.97 ? 443 GLU A CG  1 
ATOM   3469 C CD  . GLU A 1 443 ? 11.120  71.206 57.501 1.00 28.06 ? 443 GLU A CD  1 
ATOM   3470 O OE1 . GLU A 1 443 ? 11.209  70.950 58.717 1.00 31.03 ? 443 GLU A OE1 1 
ATOM   3471 O OE2 . GLU A 1 443 ? 10.420  70.526 56.724 1.00 28.50 ? 443 GLU A OE2 1 
ATOM   3472 N N   . ILE A 1 444 ? 9.707   74.189 57.836 1.00 25.63 ? 444 ILE A N   1 
ATOM   3473 C CA  . ILE A 1 444 ? 8.553   74.505 57.023 1.00 25.06 ? 444 ILE A CA  1 
ATOM   3474 C C   . ILE A 1 444 ? 8.328   76.003 56.968 1.00 27.56 ? 444 ILE A C   1 
ATOM   3475 O O   . ILE A 1 444 ? 8.002   76.551 55.912 1.00 31.39 ? 444 ILE A O   1 
ATOM   3476 C CB  . ILE A 1 444 ? 7.284   73.856 57.596 1.00 23.83 ? 444 ILE A CB  1 
ATOM   3477 C CG1 . ILE A 1 444 ? 7.512   72.364 57.822 1.00 22.65 ? 444 ILE A CG1 1 
ATOM   3478 C CG2 . ILE A 1 444 ? 6.122   74.074 56.655 1.00 23.71 ? 444 ILE A CG2 1 
ATOM   3479 C CD1 . ILE A 1 444 ? 6.539   71.750 58.798 1.00 21.41 ? 444 ILE A CD1 1 
ATOM   3480 N N   . GLU A 1 445 ? 8.493   76.672 58.105 1.00 28.08 ? 445 GLU A N   1 
ATOM   3481 C CA  . GLU A 1 445 ? 8.276   78.112 58.148 1.00 28.13 ? 445 GLU A CA  1 
ATOM   3482 C C   . GLU A 1 445 ? 9.275   78.851 57.285 1.00 26.66 ? 445 GLU A C   1 
ATOM   3483 O O   . GLU A 1 445 ? 9.004   79.945 56.815 1.00 29.57 ? 445 GLU A O   1 
ATOM   3484 C CB  . GLU A 1 445 ? 8.340   78.631 59.584 1.00 31.06 ? 445 GLU A CB  1 
ATOM   3485 C CG  . GLU A 1 445 ? 9.542   78.170 60.379 1.00 32.57 ? 445 GLU A CG  1 
ATOM   3486 C CD  . GLU A 1 445 ? 9.418   78.553 61.834 1.00 34.27 ? 445 GLU A CD  1 
ATOM   3487 O OE1 . GLU A 1 445 ? 8.505   78.014 62.497 1.00 33.02 ? 445 GLU A OE1 1 
ATOM   3488 O OE2 . GLU A 1 445 ? 10.222  79.390 62.310 1.00 35.17 ? 445 GLU A OE2 1 
ATOM   3489 N N   . PHE A 1 446 ? 10.439  78.258 57.078 1.00 26.01 ? 446 PHE A N   1 
ATOM   3490 C CA  . PHE A 1 446 ? 11.441  78.887 56.244 1.00 24.48 ? 446 PHE A CA  1 
ATOM   3491 C C   . PHE A 1 446 ? 11.071  78.540 54.821 1.00 24.26 ? 446 PHE A C   1 
ATOM   3492 O O   . PHE A 1 446 ? 11.192  79.360 53.909 1.00 24.87 ? 446 PHE A O   1 
ATOM   3493 C CB  . PHE A 1 446 ? 12.824  78.349 56.584 1.00 24.59 ? 446 PHE A CB  1 
ATOM   3494 C CG  . PHE A 1 446 ? 13.401  78.943 57.830 1.00 27.17 ? 446 PHE A CG  1 
ATOM   3495 C CD1 . PHE A 1 446 ? 13.020  78.474 59.078 1.00 27.09 ? 446 PHE A CD1 1 
ATOM   3496 C CD2 . PHE A 1 446 ? 14.328  79.978 57.759 1.00 28.06 ? 446 PHE A CD2 1 
ATOM   3497 C CE1 . PHE A 1 446 ? 13.560  79.030 60.237 1.00 29.00 ? 446 PHE A CE1 1 
ATOM   3498 C CE2 . PHE A 1 446 ? 14.872  80.538 58.911 1.00 26.53 ? 446 PHE A CE2 1 
ATOM   3499 C CZ  . PHE A 1 446 ? 14.490  80.065 60.150 1.00 25.35 ? 446 PHE A CZ  1 
ATOM   3500 N N   . VAL A 1 447 ? 10.593  77.316 54.642 1.00 22.67 ? 447 VAL A N   1 
ATOM   3501 C CA  . VAL A 1 447 ? 10.188  76.841 53.328 1.00 22.40 ? 447 VAL A CA  1 
ATOM   3502 C C   . VAL A 1 447 ? 8.980   77.627 52.803 1.00 22.90 ? 447 VAL A C   1 
ATOM   3503 O O   . VAL A 1 447 ? 8.871   77.879 51.604 1.00 22.79 ? 447 VAL A O   1 
ATOM   3504 C CB  . VAL A 1 447 ? 9.836   75.348 53.381 1.00 20.21 ? 447 VAL A CB  1 
ATOM   3505 C CG1 . VAL A 1 447 ? 9.031   74.957 52.162 1.00 19.91 ? 447 VAL A CG1 1 
ATOM   3506 C CG2 . VAL A 1 447 ? 11.103  74.530 53.488 1.00 18.85 ? 447 VAL A CG2 1 
ATOM   3507 N N   . PHE A 1 448 ? 8.082   78.018 53.704 1.00 21.45 ? 448 PHE A N   1 
ATOM   3508 C CA  . PHE A 1 448 ? 6.903   78.760 53.305 1.00 19.87 ? 448 PHE A CA  1 
ATOM   3509 C C   . PHE A 1 448 ? 7.086   80.263 53.392 1.00 23.37 ? 448 PHE A C   1 
ATOM   3510 O O   . PHE A 1 448 ? 6.137   81.026 53.226 1.00 25.08 ? 448 PHE A O   1 
ATOM   3511 C CB  . PHE A 1 448 ? 5.710   78.303 54.123 1.00 16.64 ? 448 PHE A CB  1 
ATOM   3512 C CG  . PHE A 1 448 ? 5.024   77.113 53.531 1.00 19.28 ? 448 PHE A CG  1 
ATOM   3513 C CD1 . PHE A 1 448 ? 4.057   77.272 52.533 1.00 18.21 ? 448 PHE A CD1 1 
ATOM   3514 C CD2 . PHE A 1 448 ? 5.390   75.828 53.903 1.00 18.23 ? 448 PHE A CD2 1 
ATOM   3515 C CE1 . PHE A 1 448 ? 3.469   76.168 51.911 1.00 13.07 ? 448 PHE A CE1 1 
ATOM   3516 C CE2 . PHE A 1 448 ? 4.803   74.715 53.282 1.00 18.82 ? 448 PHE A CE2 1 
ATOM   3517 C CZ  . PHE A 1 448 ? 3.842   74.893 52.284 1.00 15.06 ? 448 PHE A CZ  1 
ATOM   3518 N N   . GLY A 1 449 ? 8.320   80.684 53.642 1.00 24.74 ? 449 GLY A N   1 
ATOM   3519 C CA  . GLY A 1 449 ? 8.625   82.098 53.704 1.00 25.09 ? 449 GLY A CA  1 
ATOM   3520 C C   . GLY A 1 449 ? 7.906   82.925 54.744 1.00 27.59 ? 449 GLY A C   1 
ATOM   3521 O O   . GLY A 1 449 ? 7.462   84.038 54.460 1.00 30.21 ? 449 GLY A O   1 
ATOM   3522 N N   . LEU A 1 450 ? 7.768   82.392 55.949 1.00 28.68 ? 450 LEU A N   1 
ATOM   3523 C CA  . LEU A 1 450 ? 7.137   83.156 57.018 1.00 28.09 ? 450 LEU A CA  1 
ATOM   3524 C C   . LEU A 1 450 ? 8.142   84.208 57.508 1.00 27.44 ? 450 LEU A C   1 
ATOM   3525 O O   . LEU A 1 450 ? 7.739   85.258 57.988 1.00 27.06 ? 450 LEU A O   1 
ATOM   3526 C CB  . LEU A 1 450 ? 6.714   82.240 58.173 1.00 28.03 ? 450 LEU A CB  1 
ATOM   3527 C CG  . LEU A 1 450 ? 5.375   81.495 58.047 1.00 24.60 ? 450 LEU A CG  1 
ATOM   3528 C CD1 . LEU A 1 450 ? 4.269   82.354 58.602 1.00 22.70 ? 450 LEU A CD1 1 
ATOM   3529 C CD2 . LEU A 1 450 ? 5.087   81.140 56.598 1.00 24.13 ? 450 LEU A CD2 1 
ATOM   3530 N N   . PRO A 1 451 ? 9.465   83.928 57.412 1.00 27.93 ? 451 PRO A N   1 
ATOM   3531 C CA  . PRO A 1 451 ? 10.444  84.923 57.864 1.00 28.51 ? 451 PRO A CA  1 
ATOM   3532 C C   . PRO A 1 451 ? 10.384  86.199 57.025 1.00 30.63 ? 451 PRO A C   1 
ATOM   3533 O O   . PRO A 1 451 ? 11.101  87.166 57.286 1.00 33.64 ? 451 PRO A O   1 
ATOM   3534 C CB  . PRO A 1 451 ? 11.793  84.209 57.706 1.00 25.36 ? 451 PRO A CB  1 
ATOM   3535 C CG  . PRO A 1 451 ? 11.470  82.780 57.664 1.00 23.17 ? 451 PRO A CG  1 
ATOM   3536 C CD  . PRO A 1 451 ? 10.148  82.702 56.960 1.00 26.52 ? 451 PRO A CD  1 
ATOM   3537 N N   . LEU A 1 452 ? 9.528   86.194 56.010 1.00 32.46 ? 452 LEU A N   1 
ATOM   3538 C CA  . LEU A 1 452 ? 9.382   87.349 55.135 1.00 31.32 ? 452 LEU A CA  1 
ATOM   3539 C C   . LEU A 1 452 ? 8.426   88.372 55.729 1.00 32.31 ? 452 LEU A C   1 
ATOM   3540 O O   . LEU A 1 452 ? 8.582   89.564 55.491 1.00 35.34 ? 452 LEU A O   1 
ATOM   3541 C CB  . LEU A 1 452 ? 8.876   86.907 53.762 1.00 31.37 ? 452 LEU A CB  1 
ATOM   3542 C CG  . LEU A 1 452 ? 9.857   86.164 52.854 1.00 28.90 ? 452 LEU A CG  1 
ATOM   3543 C CD1 . LEU A 1 452 ? 9.612   86.588 51.418 1.00 28.91 ? 452 LEU A CD1 1 
ATOM   3544 C CD2 . LEU A 1 452 ? 11.290  86.468 53.261 1.00 31.14 ? 452 LEU A CD2 1 
ATOM   3545 N N   . VAL A 1 453 ? 7.434   87.905 56.487 1.00 32.11 ? 453 VAL A N   1 
ATOM   3546 C CA  . VAL A 1 453 ? 6.467   88.795 57.128 1.00 32.68 ? 453 VAL A CA  1 
ATOM   3547 C C   . VAL A 1 453 ? 7.060   89.311 58.438 1.00 34.71 ? 453 VAL A C   1 
ATOM   3548 O O   . VAL A 1 453 ? 7.268   88.548 59.387 1.00 35.14 ? 453 VAL A O   1 
ATOM   3549 C CB  . VAL A 1 453 ? 5.116   88.072 57.393 1.00 32.64 ? 453 VAL A CB  1 
ATOM   3550 C CG1 . VAL A 1 453 ? 5.300   86.575 57.308 1.00 34.40 ? 453 VAL A CG1 1 
ATOM   3551 C CG2 . VAL A 1 453 ? 4.547   88.476 58.738 1.00 28.93 ? 453 VAL A CG2 1 
ATOM   3552 N N   . LYS A 1 454 ? 7.324   90.614 58.471 1.00 36.14 ? 454 LYS A N   1 
ATOM   3553 C CA  . LYS A 1 454 ? 7.937   91.282 59.620 1.00 39.05 ? 454 LYS A CA  1 
ATOM   3554 C C   . LYS A 1 454 ? 7.345   90.979 60.993 1.00 39.00 ? 454 LYS A C   1 
ATOM   3555 O O   . LYS A 1 454 ? 8.010   90.410 61.858 1.00 40.49 ? 454 LYS A O   1 
ATOM   3556 C CB  . LYS A 1 454 ? 7.938   92.794 59.388 1.00 41.18 ? 454 LYS A CB  1 
ATOM   3557 C CG  . LYS A 1 454 ? 8.638   93.204 58.094 1.00 46.30 ? 454 LYS A CG  1 
ATOM   3558 C CD  . LYS A 1 454 ? 10.152  92.946 58.151 1.00 46.94 ? 454 LYS A CD  1 
ATOM   3559 C CE  . LYS A 1 454 ? 10.585  91.783 57.259 1.00 45.31 ? 454 LYS A CE  1 
ATOM   3560 N NZ  . LYS A 1 454 ? 11.512  90.847 57.969 1.00 46.03 ? 454 LYS A NZ  1 
ATOM   3561 N N   . GLU A 1 455 ? 6.100   91.379 61.190 1.00 38.82 ? 455 GLU A N   1 
ATOM   3562 C CA  . GLU A 1 455 ? 5.409   91.167 62.449 1.00 39.24 ? 455 GLU A CA  1 
ATOM   3563 C C   . GLU A 1 455 ? 5.724   89.843 63.145 1.00 38.40 ? 455 GLU A C   1 
ATOM   3564 O O   . GLU A 1 455 ? 5.463   89.704 64.335 1.00 41.37 ? 455 GLU A O   1 
ATOM   3565 C CB  . GLU A 1 455 ? 3.895   91.262 62.231 1.00 43.20 ? 455 GLU A CB  1 
ATOM   3566 C CG  . GLU A 1 455 ? 3.440   92.437 61.367 1.00 48.18 ? 455 GLU A CG  1 
ATOM   3567 C CD  . GLU A 1 455 ? 3.916   92.340 59.923 1.00 52.22 ? 455 GLU A CD  1 
ATOM   3568 O OE1 . GLU A 1 455 ? 4.068   91.206 59.414 1.00 53.84 ? 455 GLU A OE1 1 
ATOM   3569 O OE2 . GLU A 1 455 ? 4.142   93.402 59.298 1.00 54.45 ? 455 GLU A OE2 1 
ATOM   3570 N N   . LEU A 1 456 ? 6.281   88.873 62.428 1.00 36.71 ? 456 LEU A N   1 
ATOM   3571 C CA  . LEU A 1 456 ? 6.569   87.576 63.036 1.00 36.34 ? 456 LEU A CA  1 
ATOM   3572 C C   . LEU A 1 456 ? 7.879   87.455 63.783 1.00 37.48 ? 456 LEU A C   1 
ATOM   3573 O O   . LEU A 1 456 ? 8.197   86.390 64.310 1.00 38.45 ? 456 LEU A O   1 
ATOM   3574 C CB  . LEU A 1 456 ? 6.484   86.478 61.989 1.00 33.85 ? 456 LEU A CB  1 
ATOM   3575 C CG  . LEU A 1 456 ? 5.143   86.505 61.270 1.00 31.41 ? 456 LEU A CG  1 
ATOM   3576 C CD1 . LEU A 1 456 ? 5.021   85.285 60.390 1.00 32.91 ? 456 LEU A CD1 1 
ATOM   3577 C CD2 . LEU A 1 456 ? 4.015   86.567 62.290 1.00 30.16 ? 456 LEU A CD2 1 
ATOM   3578 N N   . ASN A 1 457 ? 8.643   88.539 63.821 1.00 39.02 ? 457 ASN A N   1 
ATOM   3579 C CA  . ASN A 1 457 ? 9.908   88.558 64.551 1.00 40.40 ? 457 ASN A CA  1 
ATOM   3580 C C   . ASN A 1 457 ? 10.944  87.530 64.090 1.00 38.94 ? 457 ASN A C   1 
ATOM   3581 O O   . ASN A 1 457 ? 11.009  86.427 64.634 1.00 41.10 ? 457 ASN A O   1 
ATOM   3582 C CB  . ASN A 1 457 ? 9.644   88.352 66.057 1.00 43.76 ? 457 ASN A CB  1 
ATOM   3583 C CG  . ASN A 1 457 ? 8.765   89.449 66.672 1.00 46.37 ? 457 ASN A CG  1 
ATOM   3584 O OD1 . ASN A 1 457 ? 7.797   89.161 67.384 1.00 46.68 ? 457 ASN A OD1 1 
ATOM   3585 N ND2 . ASN A 1 457 ? 9.108   90.709 66.405 1.00 47.97 ? 457 ASN A ND2 1 
ATOM   3586 N N   . TYR A 1 458 ? 11.754  87.896 63.100 1.00 36.34 ? 458 TYR A N   1 
ATOM   3587 C CA  . TYR A 1 458 ? 12.815  87.019 62.587 1.00 35.24 ? 458 TYR A CA  1 
ATOM   3588 C C   . TYR A 1 458 ? 13.994  87.929 62.242 1.00 35.87 ? 458 TYR A C   1 
ATOM   3589 O O   . TYR A 1 458 ? 13.802  89.070 61.821 1.00 35.70 ? 458 TYR A O   1 
ATOM   3590 C CB  . TYR A 1 458 ? 12.393  86.290 61.294 1.00 32.44 ? 458 TYR A CB  1 
ATOM   3591 C CG  . TYR A 1 458 ? 11.512  85.054 61.426 1.00 28.67 ? 458 TYR A CG  1 
ATOM   3592 C CD1 . TYR A 1 458 ? 12.067  83.778 61.537 1.00 27.03 ? 458 TYR A CD1 1 
ATOM   3593 C CD2 . TYR A 1 458 ? 10.118  85.159 61.357 1.00 28.74 ? 458 TYR A CD2 1 
ATOM   3594 C CE1 . TYR A 1 458 ? 11.253  82.635 61.571 1.00 27.60 ? 458 TYR A CE1 1 
ATOM   3595 C CE2 . TYR A 1 458 ? 9.296   84.029 61.388 1.00 27.72 ? 458 TYR A CE2 1 
ATOM   3596 C CZ  . TYR A 1 458 ? 9.864   82.768 61.494 1.00 29.51 ? 458 TYR A CZ  1 
ATOM   3597 O OH  . TYR A 1 458 ? 9.038   81.652 61.511 1.00 27.17 ? 458 TYR A OH  1 
ATOM   3598 N N   . THR A 1 459 ? 15.213  87.436 62.409 1.00 36.94 ? 459 THR A N   1 
ATOM   3599 C CA  . THR A 1 459 ? 16.373  88.247 62.067 1.00 36.71 ? 459 THR A CA  1 
ATOM   3600 C C   . THR A 1 459 ? 16.313  88.514 60.570 1.00 37.14 ? 459 THR A C   1 
ATOM   3601 O O   . THR A 1 459 ? 15.442  87.995 59.877 1.00 35.49 ? 459 THR A O   1 
ATOM   3602 C CB  . THR A 1 459 ? 17.693  87.516 62.383 1.00 36.61 ? 459 THR A CB  1 
ATOM   3603 O OG1 . THR A 1 459 ? 17.881  86.418 61.472 1.00 36.11 ? 459 THR A OG1 1 
ATOM   3604 C CG2 . THR A 1 459 ? 17.666  86.995 63.801 1.00 37.89 ? 459 THR A CG2 1 
ATOM   3605 N N   . ALA A 1 460 ? 17.229  89.336 60.075 1.00 38.39 ? 460 ALA A N   1 
ATOM   3606 C CA  . ALA A 1 460 ? 17.274  89.633 58.656 1.00 38.40 ? 460 ALA A CA  1 
ATOM   3607 C C   . ALA A 1 460 ? 17.965  88.438 58.039 1.00 39.78 ? 460 ALA A C   1 
ATOM   3608 O O   . ALA A 1 460 ? 17.666  88.030 56.914 1.00 42.45 ? 460 ALA A O   1 
ATOM   3609 C CB  . ALA A 1 460 ? 18.078  90.878 58.413 1.00 38.87 ? 460 ALA A CB  1 
ATOM   3610 N N   . GLU A 1 461 ? 18.896  87.877 58.802 1.00 40.54 ? 461 GLU A N   1 
ATOM   3611 C CA  . GLU A 1 461 ? 19.655  86.712 58.374 1.00 40.94 ? 461 GLU A CA  1 
ATOM   3612 C C   . GLU A 1 461 ? 18.672  85.577 58.101 1.00 40.88 ? 461 GLU A C   1 
ATOM   3613 O O   . GLU A 1 461 ? 18.852  84.792 57.167 1.00 41.77 ? 461 GLU A O   1 
ATOM   3614 C CB  . GLU A 1 461 ? 20.636  86.291 59.474 1.00 40.78 ? 461 GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 461 ? 21.734  87.300 59.778 1.00 44.29 ? 461 GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 461 ? 21.223  88.555 60.475 1.00 47.32 ? 461 GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 461 ? 20.602  88.440 61.554 1.00 49.52 ? 461 GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 461 ? 21.447  89.665 59.941 1.00 50.46 ? 461 GLU A OE2 1 
ATOM   3619 N N   . GLU A 1 462 ? 17.630  85.507 58.924 1.00 39.21 ? 462 GLU A N   1 
ATOM   3620 C CA  . GLU A 1 462 ? 16.614  84.477 58.800 1.00 37.30 ? 462 GLU A CA  1 
ATOM   3621 C C   . GLU A 1 462 ? 15.731  84.656 57.570 1.00 38.41 ? 462 GLU A C   1 
ATOM   3622 O O   . GLU A 1 462 ? 15.490  83.704 56.835 1.00 41.16 ? 462 GLU A O   1 
ATOM   3623 C CB  . GLU A 1 462 ? 15.749  84.457 60.055 1.00 35.77 ? 462 GLU A CB  1 
ATOM   3624 C CG  . GLU A 1 462 ? 15.820  83.155 60.810 1.00 33.77 ? 462 GLU A CG  1 
ATOM   3625 C CD  . GLU A 1 462 ? 15.863  83.352 62.303 1.00 33.31 ? 462 GLU A CD  1 
ATOM   3626 O OE1 . GLU A 1 462 ? 15.004  84.088 62.839 1.00 29.82 ? 462 GLU A OE1 1 
ATOM   3627 O OE2 . GLU A 1 462 ? 16.760  82.766 62.940 1.00 34.56 ? 462 GLU A OE2 1 
ATOM   3628 N N   . GLU A 1 463 ? 15.239  85.866 57.341 1.00 38.52 ? 463 GLU A N   1 
ATOM   3629 C CA  . GLU A 1 463 ? 14.392  86.100 56.182 1.00 37.60 ? 463 GLU A CA  1 
ATOM   3630 C C   . GLU A 1 463 ? 15.170  85.750 54.930 1.00 36.28 ? 463 GLU A C   1 
ATOM   3631 O O   . GLU A 1 463 ? 14.586  85.368 53.923 1.00 37.69 ? 463 GLU A O   1 
ATOM   3632 C CB  . GLU A 1 463 ? 13.959  87.563 56.106 1.00 39.43 ? 463 GLU A CB  1 
ATOM   3633 C CG  . GLU A 1 463 ? 14.382  88.256 54.810 1.00 45.70 ? 463 GLU A CG  1 
ATOM   3634 C CD  . GLU A 1 463 ? 13.377  89.287 54.322 1.00 47.71 ? 463 GLU A CD  1 
ATOM   3635 O OE1 . GLU A 1 463 ? 13.042  90.201 55.102 1.00 51.39 ? 463 GLU A OE1 1 
ATOM   3636 O OE2 . GLU A 1 463 ? 12.927  89.188 53.159 1.00 47.51 ? 463 GLU A OE2 1 
ATOM   3637 N N   . ALA A 1 464 ? 16.491  85.887 55.001 1.00 34.62 ? 464 ALA A N   1 
ATOM   3638 C CA  . ALA A 1 464 ? 17.369  85.609 53.868 1.00 34.32 ? 464 ALA A CA  1 
ATOM   3639 C C   . ALA A 1 464 ? 17.549  84.121 53.577 1.00 35.05 ? 464 ALA A C   1 
ATOM   3640 O O   . ALA A 1 464 ? 17.823  83.731 52.440 1.00 36.87 ? 464 ALA A O   1 
ATOM   3641 C CB  . ALA A 1 464 ? 18.717  86.257 54.096 1.00 35.27 ? 464 ALA A CB  1 
ATOM   3642 N N   . LEU A 1 465 ? 17.414  83.294 54.607 1.00 34.86 ? 465 LEU A N   1 
ATOM   3643 C CA  . LEU A 1 465 ? 17.536  81.845 54.454 1.00 32.53 ? 465 LEU A CA  1 
ATOM   3644 C C   . LEU A 1 465 ? 16.244  81.366 53.802 1.00 32.07 ? 465 LEU A C   1 
ATOM   3645 O O   . LEU A 1 465 ? 16.255  80.578 52.859 1.00 33.27 ? 465 LEU A O   1 
ATOM   3646 C CB  . LEU A 1 465 ? 17.691  81.178 55.825 1.00 31.74 ? 465 LEU A CB  1 
ATOM   3647 C CG  . LEU A 1 465 ? 18.265  79.768 55.912 1.00 28.50 ? 465 LEU A CG  1 
ATOM   3648 C CD1 . LEU A 1 465 ? 19.714  79.777 55.488 1.00 28.86 ? 465 LEU A CD1 1 
ATOM   3649 C CD2 . LEU A 1 465 ? 18.147  79.282 57.338 1.00 29.80 ? 465 LEU A CD2 1 
ATOM   3650 N N   . SER A 1 466 ? 15.126  81.858 54.316 1.00 29.22 ? 466 SER A N   1 
ATOM   3651 C CA  . SER A 1 466 ? 13.834  81.485 53.784 1.00 27.63 ? 466 SER A CA  1 
ATOM   3652 C C   . SER A 1 466 ? 13.795  81.803 52.302 1.00 27.37 ? 466 SER A C   1 
ATOM   3653 O O   . SER A 1 466 ? 13.392  80.975 51.491 1.00 29.36 ? 466 SER A O   1 
ATOM   3654 C CB  . SER A 1 466 ? 12.730  82.253 54.504 1.00 27.26 ? 466 SER A CB  1 
ATOM   3655 O OG  . SER A 1 466 ? 11.459  81.957 53.949 1.00 29.35 ? 466 SER A OG  1 
ATOM   3656 N N   . ARG A 1 467 ? 14.225  83.010 51.954 1.00 26.48 ? 467 ARG A N   1 
ATOM   3657 C CA  . ARG A 1 467 ? 14.221  83.456 50.570 1.00 24.57 ? 467 ARG A CA  1 
ATOM   3658 C C   . ARG A 1 467 ? 15.096  82.581 49.697 1.00 24.77 ? 467 ARG A C   1 
ATOM   3659 O O   . ARG A 1 467 ? 14.724  82.227 48.582 1.00 26.14 ? 467 ARG A O   1 
ATOM   3660 C CB  . ARG A 1 467 ? 14.702  84.899 50.486 1.00 23.86 ? 467 ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 467 ? 13.623  85.927 50.757 1.00 23.05 ? 467 ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 467 ? 14.053  87.303 50.270 1.00 24.46 ? 467 ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 467 ? 12.990  88.291 50.419 1.00 27.01 ? 467 ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 467 ? 11.827  88.248 49.779 1.00 28.59 ? 467 ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 467 ? 11.565  87.257 48.932 1.00 30.47 ? 467 ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 467 ? 10.916  89.189 49.999 1.00 28.50 ? 467 ARG A NH2 1 
ATOM   3667 N N   . ARG A 1 468 ? 16.258  82.220 50.213 1.00 24.94 ? 468 ARG A N   1 
ATOM   3668 C CA  . ARG A 1 468 ? 17.181  81.393 49.455 1.00 26.79 ? 468 ARG A CA  1 
ATOM   3669 C C   . ARG A 1 468 ? 16.786  79.919 49.449 1.00 27.02 ? 468 ARG A C   1 
ATOM   3670 O O   . ARG A 1 468 ? 17.187  79.175 48.562 1.00 30.32 ? 468 ARG A O   1 
ATOM   3671 C CB  . ARG A 1 468 ? 18.599  81.580 50.005 1.00 28.09 ? 468 ARG A CB  1 
ATOM   3672 C CG  . ARG A 1 468 ? 19.187  80.383 50.697 1.00 30.03 ? 468 ARG A CG  1 
ATOM   3673 C CD  . ARG A 1 468 ? 20.578  80.102 50.172 1.00 34.22 ? 468 ARG A CD  1 
ATOM   3674 N NE  . ARG A 1 468 ? 21.351  79.247 51.065 1.00 35.51 ? 468 ARG A NE  1 
ATOM   3675 C CZ  . ARG A 1 468 ? 21.862  79.648 52.226 1.00 38.53 ? 468 ARG A CZ  1 
ATOM   3676 N NH1 . ARG A 1 468 ? 21.678  80.903 52.640 1.00 34.33 ? 468 ARG A NH1 1 
ATOM   3677 N NH2 . ARG A 1 468 ? 22.569  78.794 52.964 1.00 39.69 ? 468 ARG A NH2 1 
ATOM   3678 N N   . ILE A 1 469 ? 16.001  79.499 50.436 1.00 27.98 ? 469 ILE A N   1 
ATOM   3679 C CA  . ILE A 1 469 ? 15.547  78.108 50.528 1.00 25.87 ? 469 ILE A CA  1 
ATOM   3680 C C   . ILE A 1 469 ? 14.342  77.936 49.614 1.00 26.18 ? 469 ILE A C   1 
ATOM   3681 O O   . ILE A 1 469 ? 14.185  76.907 48.960 1.00 25.42 ? 469 ILE A O   1 
ATOM   3682 C CB  . ILE A 1 469 ? 15.120  77.743 51.977 1.00 24.89 ? 469 ILE A CB  1 
ATOM   3683 C CG1 . ILE A 1 469 ? 16.346  77.321 52.795 1.00 24.84 ? 469 ILE A CG1 1 
ATOM   3684 C CG2 . ILE A 1 469 ? 14.061  76.647 51.950 1.00 21.73 ? 469 ILE A CG2 1 
ATOM   3685 C CD1 . ILE A 1 469 ? 16.067  76.255 53.840 1.00 21.19 ? 469 ILE A CD1 1 
ATOM   3686 N N   . MET A 1 470 ? 13.491  78.958 49.590 1.00 27.08 ? 470 MET A N   1 
ATOM   3687 C CA  . MET A 1 470 ? 12.288  78.965 48.764 1.00 28.43 ? 470 MET A CA  1 
ATOM   3688 C C   . MET A 1 470 ? 12.666  78.850 47.286 1.00 29.00 ? 470 MET A C   1 
ATOM   3689 O O   . MET A 1 470 ? 12.008  78.140 46.518 1.00 26.43 ? 470 MET A O   1 
ATOM   3690 C CB  . MET A 1 470 ? 11.494  80.259 49.003 1.00 26.92 ? 470 MET A CB  1 
ATOM   3691 C CG  . MET A 1 470 ? 10.424  80.150 50.086 1.00 27.09 ? 470 MET A CG  1 
ATOM   3692 S SD  . MET A 1 470 ? 9.432   81.654 50.315 1.00 27.72 ? 470 MET A SD  1 
ATOM   3693 C CE  . MET A 1 470 ? 10.702  82.850 50.578 1.00 25.41 ? 470 MET A CE  1 
ATOM   3694 N N   . HIS A 1 471 ? 13.731  79.551 46.899 1.00 29.97 ? 471 HIS A N   1 
ATOM   3695 C CA  . HIS A 1 471 ? 14.207  79.522 45.522 1.00 31.69 ? 471 HIS A CA  1 
ATOM   3696 C C   . HIS A 1 471 ? 14.783  78.144 45.185 1.00 32.77 ? 471 HIS A C   1 
ATOM   3697 O O   . HIS A 1 471 ? 14.662  77.667 44.054 1.00 30.52 ? 471 HIS A O   1 
ATOM   3698 C CB  . HIS A 1 471 ? 15.267  80.604 45.300 1.00 34.47 ? 471 HIS A CB  1 
ATOM   3699 C CG  . HIS A 1 471 ? 15.511  80.912 43.856 1.00 37.78 ? 471 HIS A CG  1 
ATOM   3700 N ND1 . HIS A 1 471 ? 14.509  81.330 43.004 1.00 37.49 ? 471 HIS A ND1 1 
ATOM   3701 C CD2 . HIS A 1 471 ? 16.632  80.821 43.101 1.00 37.58 ? 471 HIS A CD2 1 
ATOM   3702 C CE1 . HIS A 1 471 ? 15.002  81.480 41.787 1.00 37.98 ? 471 HIS A CE1 1 
ATOM   3703 N NE2 . HIS A 1 471 ? 16.288  81.177 41.819 1.00 37.16 ? 471 HIS A NE2 1 
ATOM   3704 N N   . TYR A 1 472 ? 15.419  77.512 46.169 1.00 34.46 ? 472 TYR A N   1 
ATOM   3705 C CA  . TYR A 1 472 ? 15.981  76.177 45.978 1.00 34.37 ? 472 TYR A CA  1 
ATOM   3706 C C   . TYR A 1 472 ? 14.800  75.270 45.625 1.00 34.17 ? 472 TYR A C   1 
ATOM   3707 O O   . TYR A 1 472 ? 14.762  74.643 44.562 1.00 35.42 ? 472 TYR A O   1 
ATOM   3708 C CB  . TYR A 1 472 ? 16.603  75.659 47.275 1.00 35.65 ? 472 TYR A CB  1 
ATOM   3709 C CG  . TYR A 1 472 ? 18.012  76.103 47.578 1.00 36.78 ? 472 TYR A CG  1 
ATOM   3710 C CD1 . TYR A 1 472 ? 18.824  76.671 46.601 1.00 38.56 ? 472 TYR A CD1 1 
ATOM   3711 C CD2 . TYR A 1 472 ? 18.546  75.924 48.856 1.00 38.08 ? 472 TYR A CD2 1 
ATOM   3712 C CE1 . TYR A 1 472 ? 20.138  77.046 46.895 1.00 40.13 ? 472 TYR A CE1 1 
ATOM   3713 C CE2 . TYR A 1 472 ? 19.845  76.293 49.158 1.00 37.31 ? 472 TYR A CE2 1 
ATOM   3714 C CZ  . TYR A 1 472 ? 20.637  76.851 48.181 1.00 39.03 ? 472 TYR A CZ  1 
ATOM   3715 O OH  . TYR A 1 472 ? 21.928  77.212 48.496 1.00 41.84 ? 472 TYR A OH  1 
ATOM   3716 N N   . TRP A 1 473 ? 13.837  75.207 46.542 1.00 31.58 ? 473 TRP A N   1 
ATOM   3717 C CA  . TRP A 1 473 ? 12.655  74.382 46.351 1.00 29.28 ? 473 TRP A CA  1 
ATOM   3718 C C   . TRP A 1 473 ? 12.025  74.693 44.987 1.00 28.59 ? 473 TRP A C   1 
ATOM   3719 O O   . TRP A 1 473 ? 11.928  73.809 44.131 1.00 29.35 ? 473 TRP A O   1 
ATOM   3720 C CB  . TRP A 1 473 ? 11.646  74.638 47.482 1.00 26.55 ? 473 TRP A CB  1 
ATOM   3721 C CG  . TRP A 1 473 ? 11.765  73.724 48.699 1.00 24.60 ? 473 TRP A CG  1 
ATOM   3722 C CD1 . TRP A 1 473 ? 10.738  73.097 49.347 1.00 24.62 ? 473 TRP A CD1 1 
ATOM   3723 C CD2 . TRP A 1 473 ? 12.960  73.369 49.420 1.00 23.22 ? 473 TRP A CD2 1 
ATOM   3724 N NE1 . TRP A 1 473 ? 11.213  72.379 50.417 1.00 22.62 ? 473 TRP A NE1 1 
ATOM   3725 C CE2 . TRP A 1 473 ? 12.572  72.528 50.486 1.00 21.82 ? 473 TRP A CE2 1 
ATOM   3726 C CE3 . TRP A 1 473 ? 14.317  73.680 49.271 1.00 23.37 ? 473 TRP A CE3 1 
ATOM   3727 C CZ2 . TRP A 1 473 ? 13.491  71.995 51.394 1.00 19.71 ? 473 TRP A CZ2 1 
ATOM   3728 C CZ3 . TRP A 1 473 ? 15.230  73.145 50.181 1.00 22.47 ? 473 TRP A CZ3 1 
ATOM   3729 C CH2 . TRP A 1 473 ? 14.809  72.315 51.225 1.00 18.25 ? 473 TRP A CH2 1 
ATOM   3730 N N   . ALA A 1 474 ? 11.629  75.953 44.782 1.00 25.43 ? 474 ALA A N   1 
ATOM   3731 C CA  . ALA A 1 474 ? 11.001  76.394 43.534 1.00 21.24 ? 474 ALA A CA  1 
ATOM   3732 C C   . ALA A 1 474 ? 11.850  76.179 42.284 1.00 19.88 ? 474 ALA A C   1 
ATOM   3733 O O   . ALA A 1 474 ? 11.367  75.654 41.291 1.00 18.63 ? 474 ALA A O   1 
ATOM   3734 C CB  . ALA A 1 474 ? 10.631  77.845 43.639 1.00 21.40 ? 474 ALA A CB  1 
ATOM   3735 N N   . THR A 1 475 ? 13.110  76.588 42.316 1.00 19.06 ? 475 THR A N   1 
ATOM   3736 C CA  . THR A 1 475 ? 13.955  76.400 41.152 1.00 20.31 ? 475 THR A CA  1 
ATOM   3737 C C   . THR A 1 475 ? 14.040  74.928 40.802 1.00 22.97 ? 475 THR A C   1 
ATOM   3738 O O   . THR A 1 475 ? 13.990  74.559 39.634 1.00 26.89 ? 475 THR A O   1 
ATOM   3739 C CB  . THR A 1 475 ? 15.362  76.901 41.392 1.00 21.18 ? 475 THR A CB  1 
ATOM   3740 O OG1 . THR A 1 475 ? 15.344  78.329 41.506 1.00 21.75 ? 475 THR A OG1 1 
ATOM   3741 C CG2 . THR A 1 475 ? 16.261  76.487 40.241 1.00 21.04 ? 475 THR A CG2 1 
ATOM   3742 N N   . PHE A 1 476 ? 14.176  74.086 41.820 1.00 23.59 ? 476 PHE A N   1 
ATOM   3743 C CA  . PHE A 1 476 ? 14.254  72.649 41.611 1.00 21.96 ? 476 PHE A CA  1 
ATOM   3744 C C   . PHE A 1 476 ? 12.944  72.148 41.015 1.00 23.55 ? 476 PHE A C   1 
ATOM   3745 O O   . PHE A 1 476 ? 12.933  71.432 40.018 1.00 22.68 ? 476 PHE A O   1 
ATOM   3746 C CB  . PHE A 1 476 ? 14.508  71.941 42.939 1.00 22.12 ? 476 PHE A CB  1 
ATOM   3747 C CG  . PHE A 1 476 ? 14.224  70.461 42.903 1.00 21.45 ? 476 PHE A CG  1 
ATOM   3748 C CD1 . PHE A 1 476 ? 15.146  69.574 42.345 1.00 19.63 ? 476 PHE A CD1 1 
ATOM   3749 C CD2 . PHE A 1 476 ? 13.028  69.956 43.406 1.00 18.88 ? 476 PHE A CD2 1 
ATOM   3750 C CE1 . PHE A 1 476 ? 14.879  68.207 42.285 1.00 20.99 ? 476 PHE A CE1 1 
ATOM   3751 C CE2 . PHE A 1 476 ? 12.748  68.589 43.351 1.00 18.33 ? 476 PHE A CE2 1 
ATOM   3752 C CZ  . PHE A 1 476 ? 13.671  67.713 42.791 1.00 20.35 ? 476 PHE A CZ  1 
ATOM   3753 N N   . ALA A 1 477 ? 11.837  72.532 41.639 1.00 25.03 ? 477 ALA A N   1 
ATOM   3754 C CA  . ALA A 1 477 ? 10.515  72.120 41.187 1.00 27.55 ? 477 ALA A CA  1 
ATOM   3755 C C   . ALA A 1 477 ? 10.290  72.412 39.715 1.00 30.40 ? 477 ALA A C   1 
ATOM   3756 O O   . ALA A 1 477 ? 9.587   71.663 39.031 1.00 32.76 ? 477 ALA A O   1 
ATOM   3757 C CB  . ALA A 1 477 ? 9.440   72.819 42.010 1.00 26.96 ? 477 ALA A CB  1 
ATOM   3758 N N   . LYS A 1 478 ? 10.883  73.501 39.228 1.00 32.62 ? 478 LYS A N   1 
ATOM   3759 C CA  . LYS A 1 478 ? 10.713  73.898 37.832 1.00 33.80 ? 478 LYS A CA  1 
ATOM   3760 C C   . LYS A 1 478 ? 11.782  73.336 36.897 1.00 34.41 ? 478 LYS A C   1 
ATOM   3761 O O   . LYS A 1 478 ? 11.461  72.807 35.828 1.00 36.51 ? 478 LYS A O   1 
ATOM   3762 C CB  . LYS A 1 478 ? 10.640  75.433 37.737 1.00 32.60 ? 478 LYS A CB  1 
ATOM   3763 C CG  . LYS A 1 478 ? 11.725  76.111 36.929 1.00 35.37 ? 478 LYS A CG  1 
ATOM   3764 C CD  . LYS A 1 478 ? 11.814  77.592 37.294 1.00 39.81 ? 478 LYS A CD  1 
ATOM   3765 C CE  . LYS A 1 478 ? 13.275  78.074 37.436 1.00 44.84 ? 478 LYS A CE  1 
ATOM   3766 N NZ  . LYS A 1 478 ? 13.495  79.108 38.518 1.00 44.21 ? 478 LYS A NZ  1 
ATOM   3767 N N   . THR A 1 479 ? 13.042  73.425 37.309 1.00 32.84 ? 479 THR A N   1 
ATOM   3768 C CA  . THR A 1 479 ? 14.149  72.936 36.495 1.00 31.73 ? 479 THR A CA  1 
ATOM   3769 C C   . THR A 1 479 ? 14.546  71.483 36.754 1.00 30.98 ? 479 THR A C   1 
ATOM   3770 O O   . THR A 1 479 ? 15.100  70.822 35.879 1.00 32.95 ? 479 THR A O   1 
ATOM   3771 C CB  . THR A 1 479 ? 15.406  73.811 36.698 1.00 32.41 ? 479 THR A CB  1 
ATOM   3772 O OG1 . THR A 1 479 ? 16.060  73.447 37.920 1.00 32.06 ? 479 THR A OG1 1 
ATOM   3773 C CG2 . THR A 1 479 ? 15.024  75.278 36.767 1.00 35.78 ? 479 THR A CG2 1 
ATOM   3774 N N   . GLY A 1 480 ? 14.257  70.983 37.948 1.00 29.82 ? 480 GLY A N   1 
ATOM   3775 C CA  . GLY A 1 480 ? 14.644  69.629 38.286 1.00 25.79 ? 480 GLY A CA  1 
ATOM   3776 C C   . GLY A 1 480 ? 15.978  69.691 39.004 1.00 24.49 ? 480 GLY A C   1 
ATOM   3777 O O   . GLY A 1 480 ? 16.545  68.666 39.366 1.00 25.83 ? 480 GLY A O   1 
ATOM   3778 N N   . ASN A 1 481 ? 16.471  70.910 39.204 1.00 23.57 ? 481 ASN A N   1 
ATOM   3779 C CA  . ASN A 1 481 ? 17.734  71.173 39.888 1.00 25.40 ? 481 ASN A CA  1 
ATOM   3780 C C   . ASN A 1 481 ? 17.510  72.426 40.736 1.00 28.51 ? 481 ASN A C   1 
ATOM   3781 O O   . ASN A 1 481 ? 16.906  73.397 40.273 1.00 30.53 ? 481 ASN A O   1 
ATOM   3782 C CB  . ASN A 1 481 ? 18.841  71.424 38.861 1.00 27.45 ? 481 ASN A CB  1 
ATOM   3783 C CG  . ASN A 1 481 ? 20.201  71.675 39.497 1.00 31.37 ? 481 ASN A CG  1 
ATOM   3784 O OD1 . ASN A 1 481 ? 20.305  72.269 40.571 1.00 36.57 ? 481 ASN A OD1 1 
ATOM   3785 N ND2 . ASN A 1 481 ? 21.258  71.224 38.826 1.00 32.03 ? 481 ASN A ND2 1 
ATOM   3786 N N   . PRO A 1 482 ? 17.977  72.418 41.998 1.00 30.65 ? 482 PRO A N   1 
ATOM   3787 C CA  . PRO A 1 482 ? 17.800  73.582 42.877 1.00 31.03 ? 482 PRO A CA  1 
ATOM   3788 C C   . PRO A 1 482 ? 18.577  74.829 42.449 1.00 32.49 ? 482 PRO A C   1 
ATOM   3789 O O   . PRO A 1 482 ? 18.140  75.955 42.669 1.00 32.30 ? 482 PRO A O   1 
ATOM   3790 C CB  . PRO A 1 482 ? 18.259  73.066 44.237 1.00 30.83 ? 482 PRO A CB  1 
ATOM   3791 C CG  . PRO A 1 482 ? 19.243  71.985 43.907 1.00 29.38 ? 482 PRO A CG  1 
ATOM   3792 C CD  . PRO A 1 482 ? 18.680  71.319 42.686 1.00 30.72 ? 482 PRO A CD  1 
ATOM   3793 N N   . ASN A 1 483 ? 19.730  74.624 41.829 1.00 35.35 ? 483 ASN A N   1 
ATOM   3794 C CA  . ASN A 1 483 ? 20.564  75.740 41.397 1.00 38.74 ? 483 ASN A CA  1 
ATOM   3795 C C   . ASN A 1 483 ? 20.148  76.426 40.087 1.00 42.55 ? 483 ASN A C   1 
ATOM   3796 O O   . ASN A 1 483 ? 19.417  75.854 39.265 1.00 44.03 ? 483 ASN A O   1 
ATOM   3797 C CB  . ASN A 1 483 ? 22.010  75.265 41.298 1.00 34.77 ? 483 ASN A CB  1 
ATOM   3798 C CG  . ASN A 1 483 ? 22.484  74.614 42.573 1.00 33.72 ? 483 ASN A CG  1 
ATOM   3799 O OD1 . ASN A 1 483 ? 22.941  75.295 43.495 1.00 30.44 ? 483 ASN A OD1 1 
ATOM   3800 N ND2 . ASN A 1 483 ? 22.372  73.287 42.642 1.00 31.69 ? 483 ASN A ND2 1 
ATOM   3801 N N   . GLU A 1 484 ? 20.622  77.659 39.903 1.00 45.26 ? 484 GLU A N   1 
ATOM   3802 C CA  . GLU A 1 484 ? 20.319  78.434 38.702 1.00 47.81 ? 484 GLU A CA  1 
ATOM   3803 C C   . GLU A 1 484 ? 21.423  78.281 37.653 1.00 49.92 ? 484 GLU A C   1 
ATOM   3804 O O   . GLU A 1 484 ? 21.094  77.887 36.511 1.00 53.36 ? 484 GLU A O   1 
ATOM   3805 C CB  . GLU A 1 484 ? 20.147  79.914 39.057 1.00 47.56 ? 484 GLU A CB  1 
ATOM   3806 C CG  . GLU A 1 484 ? 18.701  80.377 39.131 1.00 49.07 ? 484 GLU A CG  1 
ATOM   3807 C CD  . GLU A 1 484 ? 18.536  81.649 39.951 1.00 51.95 ? 484 GLU A CD  1 
ATOM   3808 O OE1 . GLU A 1 484 ? 19.216  81.777 40.994 1.00 54.47 ? 484 GLU A OE1 1 
ATOM   3809 O OE2 . GLU A 1 484 ? 17.728  82.522 39.556 1.00 52.63 ? 484 GLU A OE2 1 
ATOM   3810 N N   . SER A 1 490 ? 28.559  78.270 46.039 1.00 37.89 ? 490 SER A N   1 
ATOM   3811 C CA  . SER A 1 490 ? 27.185  78.749 45.697 1.00 36.98 ? 490 SER A CA  1 
ATOM   3812 C C   . SER A 1 490 ? 26.322  77.576 45.231 1.00 35.71 ? 490 SER A C   1 
ATOM   3813 O O   . SER A 1 490 ? 25.087  77.616 45.323 1.00 36.03 ? 490 SER A O   1 
ATOM   3814 C CB  . SER A 1 490 ? 27.260  79.810 44.585 1.00 38.24 ? 490 SER A CB  1 
ATOM   3815 O OG  . SER A 1 490 ? 26.458  80.950 44.872 1.00 38.25 ? 490 SER A OG  1 
ATOM   3816 N N   . LYS A 1 491 ? 26.990  76.528 44.755 1.00 33.58 ? 491 LYS A N   1 
ATOM   3817 C CA  . LYS A 1 491 ? 26.320  75.342 44.238 1.00 33.42 ? 491 LYS A CA  1 
ATOM   3818 C C   . LYS A 1 491 ? 26.035  74.256 45.263 1.00 32.81 ? 491 LYS A C   1 
ATOM   3819 O O   . LYS A 1 491 ? 26.876  73.925 46.100 1.00 35.94 ? 491 LYS A O   1 
ATOM   3820 C CB  . LYS A 1 491 ? 27.136  74.722 43.090 1.00 33.89 ? 491 LYS A CB  1 
ATOM   3821 C CG  . LYS A 1 491 ? 26.943  75.385 41.732 1.00 33.33 ? 491 LYS A CG  1 
ATOM   3822 C CD  . LYS A 1 491 ? 25.774  74.784 40.972 0.00 32.78 ? 491 LYS A CD  1 
ATOM   3823 C CE  . LYS A 1 491 ? 25.648  75.409 39.593 0.00 32.30 ? 491 LYS A CE  1 
ATOM   3824 N NZ  . LYS A 1 491 ? 24.230  75.685 39.233 0.00 32.04 ? 491 LYS A NZ  1 
ATOM   3825 N N   . TRP A 1 492 ? 24.832  73.701 45.163 1.00 30.73 ? 492 TRP A N   1 
ATOM   3826 C CA  . TRP A 1 492 ? 24.368  72.621 46.017 1.00 26.34 ? 492 TRP A CA  1 
ATOM   3827 C C   . TRP A 1 492 ? 24.713  71.392 45.192 1.00 26.28 ? 492 TRP A C   1 
ATOM   3828 O O   . TRP A 1 492 ? 24.150  71.185 44.118 1.00 26.26 ? 492 TRP A O   1 
ATOM   3829 C CB  . TRP A 1 492 ? 22.854  72.752 46.210 1.00 24.96 ? 492 TRP A CB  1 
ATOM   3830 C CG  . TRP A 1 492 ? 22.201  71.699 47.054 1.00 23.77 ? 492 TRP A CG  1 
ATOM   3831 C CD1 . TRP A 1 492 ? 22.694  70.466 47.366 1.00 22.23 ? 492 TRP A CD1 1 
ATOM   3832 C CD2 . TRP A 1 492 ? 20.898  71.769 47.643 1.00 21.69 ? 492 TRP A CD2 1 
ATOM   3833 N NE1 . TRP A 1 492 ? 21.778  69.764 48.106 1.00 22.34 ? 492 TRP A NE1 1 
ATOM   3834 C CE2 . TRP A 1 492 ? 20.665  70.541 48.291 1.00 20.71 ? 492 TRP A CE2 1 
ATOM   3835 C CE3 . TRP A 1 492 ? 19.902  72.753 47.683 1.00 23.28 ? 492 TRP A CE3 1 
ATOM   3836 C CZ2 . TRP A 1 492 ? 19.475  70.266 48.975 1.00 20.63 ? 492 TRP A CZ2 1 
ATOM   3837 C CZ3 . TRP A 1 492 ? 18.714  72.477 48.365 1.00 22.92 ? 492 TRP A CZ3 1 
ATOM   3838 C CH2 . TRP A 1 492 ? 18.516  71.241 49.001 1.00 18.62 ? 492 TRP A CH2 1 
ATOM   3839 N N   . PRO A 1 493 ? 25.671  70.578 45.664 1.00 27.56 ? 493 PRO A N   1 
ATOM   3840 C CA  . PRO A 1 493 ? 26.098  69.367 44.956 1.00 26.95 ? 493 PRO A CA  1 
ATOM   3841 C C   . PRO A 1 493 ? 25.063  68.258 44.808 1.00 27.97 ? 493 PRO A C   1 
ATOM   3842 O O   . PRO A 1 493 ? 24.165  68.091 45.638 1.00 29.48 ? 493 PRO A O   1 
ATOM   3843 C CB  . PRO A 1 493 ? 27.322  68.886 45.745 1.00 26.31 ? 493 PRO A CB  1 
ATOM   3844 C CG  . PRO A 1 493 ? 27.682  69.993 46.660 1.00 26.74 ? 493 PRO A CG  1 
ATOM   3845 C CD  . PRO A 1 493 ? 26.429  70.768 46.910 1.00 27.98 ? 493 PRO A CD  1 
ATOM   3846 N N   . LEU A 1 494 ? 25.212  67.498 43.729 1.00 29.55 ? 494 LEU A N   1 
ATOM   3847 C CA  . LEU A 1 494 ? 24.341  66.375 43.436 1.00 28.01 ? 494 LEU A CA  1 
ATOM   3848 C C   . LEU A 1 494 ? 24.802  65.212 44.316 1.00 28.61 ? 494 LEU A C   1 
ATOM   3849 O O   . LEU A 1 494 ? 26.003  64.976 44.497 1.00 28.10 ? 494 LEU A O   1 
ATOM   3850 C CB  . LEU A 1 494 ? 24.461  65.990 41.955 1.00 27.71 ? 494 LEU A CB  1 
ATOM   3851 C CG  . LEU A 1 494 ? 23.225  65.808 41.064 1.00 28.76 ? 494 LEU A CG  1 
ATOM   3852 C CD1 . LEU A 1 494 ? 23.679  65.373 39.684 1.00 24.72 ? 494 LEU A CD1 1 
ATOM   3853 C CD2 . LEU A 1 494 ? 22.284  64.766 41.643 1.00 28.62 ? 494 LEU A CD2 1 
ATOM   3854 N N   . PHE A 1 495 ? 23.838  64.500 44.876 1.00 29.46 ? 495 PHE A N   1 
ATOM   3855 C CA  . PHE A 1 495 ? 24.125  63.358 45.720 1.00 29.75 ? 495 PHE A CA  1 
ATOM   3856 C C   . PHE A 1 495 ? 24.398  62.174 44.803 1.00 32.18 ? 495 PHE A C   1 
ATOM   3857 O O   . PHE A 1 495 ? 23.596  61.849 43.919 1.00 33.08 ? 495 PHE A O   1 
ATOM   3858 C CB  . PHE A 1 495 ? 22.919  63.062 46.623 1.00 28.60 ? 495 PHE A CB  1 
ATOM   3859 C CG  . PHE A 1 495 ? 23.093  61.852 47.496 1.00 26.72 ? 495 PHE A CG  1 
ATOM   3860 C CD1 . PHE A 1 495 ? 22.759  60.590 47.029 1.00 26.98 ? 495 PHE A CD1 1 
ATOM   3861 C CD2 . PHE A 1 495 ? 23.612  61.972 48.778 1.00 26.20 ? 495 PHE A CD2 1 
ATOM   3862 C CE1 . PHE A 1 495 ? 22.943  59.465 47.825 1.00 28.47 ? 495 PHE A CE1 1 
ATOM   3863 C CE2 . PHE A 1 495 ? 23.798  60.855 49.581 1.00 26.28 ? 495 PHE A CE2 1 
ATOM   3864 C CZ  . PHE A 1 495 ? 23.464  59.600 49.105 1.00 28.04 ? 495 PHE A CZ  1 
ATOM   3865 N N   . THR A 1 496 ? 25.533  61.523 45.005 1.00 33.68 ? 496 THR A N   1 
ATOM   3866 C CA  . THR A 1 496 ? 25.867  60.375 44.180 1.00 34.04 ? 496 THR A CA  1 
ATOM   3867 C C   . THR A 1 496 ? 26.259  59.206 45.053 1.00 35.16 ? 496 THR A C   1 
ATOM   3868 O O   . THR A 1 496 ? 26.838  59.392 46.127 1.00 35.39 ? 496 THR A O   1 
ATOM   3869 C CB  . THR A 1 496 ? 27.023  60.701 43.257 1.00 33.04 ? 496 THR A CB  1 
ATOM   3870 O OG1 . THR A 1 496 ? 28.243  60.680 44.004 1.00 35.31 ? 496 THR A OG1 1 
ATOM   3871 C CG2 . THR A 1 496 ? 26.834  62.080 42.663 1.00 35.94 ? 496 THR A CG2 1 
ATOM   3872 N N   . THR A 1 497 ? 25.948  58.000 44.590 1.00 36.70 ? 497 THR A N   1 
ATOM   3873 C CA  . THR A 1 497 ? 26.280  56.799 45.344 1.00 38.37 ? 497 THR A CA  1 
ATOM   3874 C C   . THR A 1 497 ? 27.782  56.736 45.604 1.00 36.85 ? 497 THR A C   1 
ATOM   3875 O O   . THR A 1 497 ? 28.243  55.948 46.429 1.00 37.96 ? 497 THR A O   1 
ATOM   3876 C CB  . THR A 1 497 ? 25.840  55.497 44.601 1.00 41.54 ? 497 THR A CB  1 
ATOM   3877 O OG1 . THR A 1 497 ? 25.262  55.822 43.327 1.00 43.90 ? 497 THR A OG1 1 
ATOM   3878 C CG2 . THR A 1 497 ? 24.809  54.730 45.439 1.00 43.15 ? 497 THR A CG2 1 
ATOM   3879 N N   . LYS A 1 498 ? 28.539  57.576 44.904 1.00 35.58 ? 498 LYS A N   1 
ATOM   3880 C CA  . LYS A 1 498 ? 29.987  57.608 45.060 1.00 35.43 ? 498 LYS A CA  1 
ATOM   3881 C C   . LYS A 1 498 ? 30.358  58.542 46.196 1.00 35.86 ? 498 LYS A C   1 
ATOM   3882 O O   . LYS A 1 498 ? 30.661  58.093 47.300 1.00 39.15 ? 498 LYS A O   1 
ATOM   3883 C CB  . LYS A 1 498 ? 30.645  58.076 43.766 1.00 36.60 ? 498 LYS A CB  1 
ATOM   3884 C CG  . LYS A 1 498 ? 31.208  56.950 42.913 0.00 34.06 ? 498 LYS A CG  1 
ATOM   3885 C CD  . LYS A 1 498 ? 31.077  57.261 41.431 0.00 32.95 ? 498 LYS A CD  1 
ATOM   3886 C CE  . LYS A 1 498 ? 32.342  57.903 40.887 0.00 31.99 ? 498 LYS A CE  1 
ATOM   3887 N NZ  . LYS A 1 498 ? 33.539  57.044 41.102 0.00 31.07 ? 498 LYS A NZ  1 
ATOM   3888 N N   . GLU A 1 499 ? 30.356  59.840 45.914 1.00 34.98 ? 499 GLU A N   1 
ATOM   3889 C CA  . GLU A 1 499 ? 30.650  60.849 46.925 1.00 36.08 ? 499 GLU A CA  1 
ATOM   3890 C C   . GLU A 1 499 ? 29.275  61.306 47.389 1.00 37.16 ? 499 GLU A C   1 
ATOM   3891 O O   . GLU A 1 499 ? 28.658  62.165 46.759 1.00 41.87 ? 499 GLU A O   1 
ATOM   3892 C CB  . GLU A 1 499 ? 31.402  62.035 46.311 1.00 35.31 ? 499 GLU A CB  1 
ATOM   3893 C CG  . GLU A 1 499 ? 32.248  61.689 45.109 1.00 33.64 ? 499 GLU A CG  1 
ATOM   3894 C CD  . GLU A 1 499 ? 33.709  61.520 45.465 1.00 35.27 ? 499 GLU A CD  1 
ATOM   3895 O OE1 . GLU A 1 499 ? 34.072  60.450 45.997 0.00 34.20 ? 499 GLU A OE1 1 
ATOM   3896 O OE2 . GLU A 1 499 ? 34.497  62.457 45.216 0.00 34.20 ? 499 GLU A OE2 1 
ATOM   3897 N N   . GLN A 1 500 ? 28.787  60.727 48.477 1.00 35.13 ? 500 GLN A N   1 
ATOM   3898 C CA  . GLN A 1 500 ? 27.461  61.065 48.979 1.00 34.46 ? 500 GLN A CA  1 
ATOM   3899 C C   . GLN A 1 500 ? 27.379  62.466 49.558 1.00 33.02 ? 500 GLN A C   1 
ATOM   3900 O O   . GLN A 1 500 ? 27.118  62.631 50.742 1.00 34.04 ? 500 GLN A O   1 
ATOM   3901 C CB  . GLN A 1 500 ? 27.053  60.057 50.041 1.00 35.95 ? 500 GLN A CB  1 
ATOM   3902 C CG  . GLN A 1 500 ? 28.040  58.923 50.197 1.00 37.10 ? 500 GLN A CG  1 
ATOM   3903 C CD  . GLN A 1 500 ? 27.343  57.596 50.252 1.00 38.16 ? 500 GLN A CD  1 
ATOM   3904 O OE1 . GLN A 1 500 ? 26.159  57.529 50.585 1.00 41.23 ? 500 GLN A OE1 1 
ATOM   3905 N NE2 . GLN A 1 500 ? 28.063  56.529 49.925 1.00 38.16 ? 500 GLN A NE2 1 
ATOM   3906 N N   . LYS A 1 501 ? 27.571  63.474 48.714 1.00 32.62 ? 501 LYS A N   1 
ATOM   3907 C CA  . LYS A 1 501 ? 27.543  64.864 49.159 1.00 30.86 ? 501 LYS A CA  1 
ATOM   3908 C C   . LYS A 1 501 ? 26.167  65.402 49.503 1.00 28.00 ? 501 LYS A C   1 
ATOM   3909 O O   . LYS A 1 501 ? 25.155  65.002 48.938 1.00 27.69 ? 501 LYS A O   1 
ATOM   3910 C CB  . LYS A 1 501 ? 28.166  65.781 48.100 1.00 32.49 ? 501 LYS A CB  1 
ATOM   3911 C CG  . LYS A 1 501 ? 29.555  65.367 47.641 1.00 36.73 ? 501 LYS A CG  1 
ATOM   3912 C CD  . LYS A 1 501 ? 30.229  66.502 46.885 1.00 40.78 ? 501 LYS A CD  1 
ATOM   3913 C CE  . LYS A 1 501 ? 31.621  66.105 46.371 1.00 43.33 ? 501 LYS A CE  1 
ATOM   3914 N NZ  . LYS A 1 501 ? 32.417  67.294 45.909 1.00 43.63 ? 501 LYS A NZ  1 
ATOM   3915 N N   . PHE A 1 502 ? 26.155  66.317 50.457 1.00 25.61 ? 502 PHE A N   1 
ATOM   3916 C CA  . PHE A 1 502 ? 24.945  66.984 50.881 1.00 24.04 ? 502 PHE A CA  1 
ATOM   3917 C C   . PHE A 1 502 ? 25.445  68.287 51.444 1.00 24.04 ? 502 PHE A C   1 
ATOM   3918 O O   . PHE A 1 502 ? 26.651  68.491 51.550 1.00 23.77 ? 502 PHE A O   1 
ATOM   3919 C CB  . PHE A 1 502 ? 24.195  66.178 51.943 1.00 24.61 ? 502 PHE A CB  1 
ATOM   3920 C CG  . PHE A 1 502 ? 24.812  66.240 53.310 1.00 22.43 ? 502 PHE A CG  1 
ATOM   3921 C CD1 . PHE A 1 502 ? 24.600  67.334 54.134 1.00 19.67 ? 502 PHE A CD1 1 
ATOM   3922 C CD2 . PHE A 1 502 ? 25.595  65.194 53.777 1.00 20.50 ? 502 PHE A CD2 1 
ATOM   3923 C CE1 . PHE A 1 502 ? 25.159  67.378 55.391 1.00 18.15 ? 502 PHE A CE1 1 
ATOM   3924 C CE2 . PHE A 1 502 ? 26.153  65.243 55.036 1.00 17.82 ? 502 PHE A CE2 1 
ATOM   3925 C CZ  . PHE A 1 502 ? 25.934  66.332 55.839 1.00 15.74 ? 502 PHE A CZ  1 
ATOM   3926 N N   . ILE A 1 503 ? 24.534  69.175 51.803 1.00 25.70 ? 503 ILE A N   1 
ATOM   3927 C CA  . ILE A 1 503 ? 24.952  70.454 52.337 1.00 27.63 ? 503 ILE A CA  1 
ATOM   3928 C C   . ILE A 1 503 ? 24.174  70.784 53.586 1.00 27.89 ? 503 ILE A C   1 
ATOM   3929 O O   . ILE A 1 503 ? 23.232  70.084 53.938 1.00 28.47 ? 503 ILE A O   1 
ATOM   3930 C CB  . ILE A 1 503 ? 24.757  71.581 51.291 1.00 28.10 ? 503 ILE A CB  1 
ATOM   3931 C CG1 . ILE A 1 503 ? 23.299  72.044 51.273 1.00 29.67 ? 503 ILE A CG1 1 
ATOM   3932 C CG2 . ILE A 1 503 ? 25.149  71.080 49.919 1.00 24.52 ? 503 ILE A CG2 1 
ATOM   3933 C CD1 . ILE A 1 503 ? 22.977  73.043 50.164 1.00 32.95 ? 503 ILE A CD1 1 
ATOM   3934 N N   . ASP A 1 504 ? 24.593  71.854 54.251 1.00 30.52 ? 504 ASP A N   1 
ATOM   3935 C CA  . ASP A 1 504 ? 23.959  72.341 55.470 1.00 31.74 ? 504 ASP A CA  1 
ATOM   3936 C C   . ASP A 1 504 ? 22.993  73.456 55.049 1.00 32.56 ? 504 ASP A C   1 
ATOM   3937 O O   . ASP A 1 504 ? 23.263  74.180 54.085 1.00 32.72 ? 504 ASP A O   1 
ATOM   3938 C CB  . ASP A 1 504 ? 25.027  72.923 56.408 1.00 32.76 ? 504 ASP A CB  1 
ATOM   3939 C CG  . ASP A 1 504 ? 25.558  71.906 57.414 1.00 34.86 ? 504 ASP A CG  1 
ATOM   3940 O OD1 . ASP A 1 504 ? 25.002  70.790 57.491 1.00 34.25 ? 504 ASP A OD1 1 
ATOM   3941 O OD2 . ASP A 1 504 ? 26.533  72.232 58.135 1.00 33.61 ? 504 ASP A OD2 1 
ATOM   3942 N N   . LEU A 1 505 ? 21.877  73.596 55.762 1.00 31.72 ? 505 LEU A N   1 
ATOM   3943 C CA  . LEU A 1 505 ? 20.903  74.646 55.458 1.00 30.16 ? 505 LEU A CA  1 
ATOM   3944 C C   . LEU A 1 505 ? 20.731  75.569 56.672 1.00 29.80 ? 505 LEU A C   1 
ATOM   3945 O O   . LEU A 1 505 ? 19.922  75.314 57.560 1.00 29.58 ? 505 LEU A O   1 
ATOM   3946 C CB  . LEU A 1 505 ? 19.558  74.025 55.081 1.00 31.71 ? 505 LEU A CB  1 
ATOM   3947 C CG  . LEU A 1 505 ? 18.933  74.321 53.714 1.00 31.47 ? 505 LEU A CG  1 
ATOM   3948 C CD1 . LEU A 1 505 ? 19.998  74.430 52.639 1.00 30.87 ? 505 LEU A CD1 1 
ATOM   3949 C CD2 . LEU A 1 505 ? 17.958  73.207 53.384 1.00 29.77 ? 505 LEU A CD2 1 
ATOM   3950 N N   . ASN A 1 506 ? 21.502  76.646 56.699 1.00 30.19 ? 506 ASN A N   1 
ATOM   3951 C CA  . ASN A 1 506 ? 21.453  77.594 57.799 1.00 30.94 ? 506 ASN A CA  1 
ATOM   3952 C C   . ASN A 1 506 ? 22.022  78.920 57.335 1.00 31.07 ? 506 ASN A C   1 
ATOM   3953 O O   . ASN A 1 506 ? 22.629  79.000 56.272 1.00 32.60 ? 506 ASN A O   1 
ATOM   3954 C CB  . ASN A 1 506 ? 22.290  77.075 58.954 1.00 31.18 ? 506 ASN A CB  1 
ATOM   3955 C CG  . ASN A 1 506 ? 23.688  76.714 58.520 1.00 32.85 ? 506 ASN A CG  1 
ATOM   3956 O OD1 . ASN A 1 506 ? 24.254  77.353 57.626 1.00 31.75 ? 506 ASN A OD1 1 
ATOM   3957 N ND2 . ASN A 1 506 ? 24.258  75.679 59.140 1.00 33.33 ? 506 ASN A ND2 1 
ATOM   3958 N N   . THR A 1 507 ? 21.846  79.950 58.153 1.00 31.01 ? 507 THR A N   1 
ATOM   3959 C CA  . THR A 1 507 ? 22.318  81.293 57.839 1.00 30.89 ? 507 THR A CA  1 
ATOM   3960 C C   . THR A 1 507 ? 23.836  81.465 57.617 1.00 32.75 ? 507 THR A C   1 
ATOM   3961 O O   . THR A 1 507 ? 24.304  82.552 57.280 1.00 33.48 ? 507 THR A O   1 
ATOM   3962 C CB  . THR A 1 507 ? 21.848  82.273 58.930 1.00 29.05 ? 507 THR A CB  1 
ATOM   3963 O OG1 . THR A 1 507 ? 22.627  82.090 60.116 1.00 32.17 ? 507 THR A OG1 1 
ATOM   3964 C CG2 . THR A 1 507 ? 20.398  82.020 59.265 1.00 26.60 ? 507 THR A CG2 1 
ATOM   3965 N N   . GLU A 1 508 ? 24.612  80.406 57.802 1.00 35.43 ? 508 GLU A N   1 
ATOM   3966 C CA  . GLU A 1 508 ? 26.056  80.506 57.592 1.00 37.00 ? 508 GLU A CA  1 
ATOM   3967 C C   . GLU A 1 508 ? 26.423  80.106 56.150 1.00 39.11 ? 508 GLU A C   1 
ATOM   3968 O O   . GLU A 1 508 ? 25.743  79.274 55.534 1.00 38.60 ? 508 GLU A O   1 
ATOM   3969 C CB  . GLU A 1 508 ? 26.802  79.613 58.593 1.00 34.68 ? 508 GLU A CB  1 
ATOM   3970 C CG  . GLU A 1 508 ? 26.416  79.839 60.044 1.00 31.41 ? 508 GLU A CG  1 
ATOM   3971 C CD  . GLU A 1 508 ? 26.540  78.582 60.884 0.00 31.37 ? 508 GLU A CD  1 
ATOM   3972 O OE1 . GLU A 1 508 ? 27.187  77.617 60.424 0.00 30.99 ? 508 GLU A OE1 1 
ATOM   3973 O OE2 . GLU A 1 508 ? 25.991  78.558 62.006 0.00 30.93 ? 508 GLU A OE2 1 
ATOM   3974 N N   . PRO A 1 509 ? 27.505  80.693 55.599 1.00 41.19 ? 509 PRO A N   1 
ATOM   3975 C CA  . PRO A 1 509 ? 27.981  80.418 54.235 1.00 42.37 ? 509 PRO A CA  1 
ATOM   3976 C C   . PRO A 1 509 ? 27.907  78.940 53.893 1.00 43.12 ? 509 PRO A C   1 
ATOM   3977 O O   . PRO A 1 509 ? 28.503  78.122 54.585 1.00 44.77 ? 509 PRO A O   1 
ATOM   3978 C CB  . PRO A 1 509 ? 29.425  80.930 54.238 1.00 41.37 ? 509 PRO A CB  1 
ATOM   3979 C CG  . PRO A 1 509 ? 29.701  81.382 55.654 1.00 41.45 ? 509 PRO A CG  1 
ATOM   3980 C CD  . PRO A 1 509 ? 28.374  81.669 56.272 1.00 42.01 ? 509 PRO A CD  1 
ATOM   3981 N N   . MET A 1 510 ? 27.188  78.599 52.824 1.00 43.79 ? 510 MET A N   1 
ATOM   3982 C CA  . MET A 1 510 ? 27.032  77.199 52.439 1.00 42.75 ? 510 MET A CA  1 
ATOM   3983 C C   . MET A 1 510 ? 28.275  76.381 52.710 1.00 41.97 ? 510 MET A C   1 
ATOM   3984 O O   . MET A 1 510 ? 29.395  76.800 52.414 1.00 43.80 ? 510 MET A O   1 
ATOM   3985 C CB  . MET A 1 510 ? 26.660  77.047 50.958 1.00 43.35 ? 510 MET A CB  1 
ATOM   3986 C CG  . MET A 1 510 ? 26.202  75.622 50.596 1.00 41.64 ? 510 MET A CG  1 
ATOM   3987 S SD  . MET A 1 510 ? 26.196  75.222 48.823 1.00 38.94 ? 510 MET A SD  1 
ATOM   3988 C CE  . MET A 1 510 ? 24.519  75.649 48.375 1.00 35.84 ? 510 MET A CE  1 
ATOM   3989 N N   . LYS A 1 511 ? 28.056  75.214 53.299 1.00 39.87 ? 511 LYS A N   1 
ATOM   3990 C CA  . LYS A 1 511 ? 29.125  74.288 53.610 1.00 37.74 ? 511 LYS A CA  1 
ATOM   3991 C C   . LYS A 1 511 ? 28.660  72.945 53.061 1.00 37.64 ? 511 LYS A C   1 
ATOM   3992 O O   . LYS A 1 511 ? 27.484  72.592 53.179 1.00 39.22 ? 511 LYS A O   1 
ATOM   3993 C CB  . LYS A 1 511 ? 29.334  74.206 55.121 1.00 37.33 ? 511 LYS A CB  1 
ATOM   3994 C CG  . LYS A 1 511 ? 30.478  73.298 55.540 1.00 37.04 ? 511 LYS A CG  1 
ATOM   3995 C CD  . LYS A 1 511 ? 31.760  74.085 55.757 0.00 35.35 ? 511 LYS A CD  1 
ATOM   3996 C CE  . LYS A 1 511 ? 32.372  73.777 57.113 0.00 34.46 ? 511 LYS A CE  1 
ATOM   3997 N NZ  . LYS A 1 511 ? 33.731  74.367 57.257 0.00 33.78 ? 511 LYS A NZ  1 
ATOM   3998 N N   . VAL A 1 512 ? 29.568  72.205 52.440 1.00 34.77 ? 512 VAL A N   1 
ATOM   3999 C CA  . VAL A 1 512 ? 29.208  70.913 51.891 1.00 31.96 ? 512 VAL A CA  1 
ATOM   4000 C C   . VAL A 1 512 ? 29.892  69.799 52.663 1.00 31.20 ? 512 VAL A C   1 
ATOM   4001 O O   . VAL A 1 512 ? 31.099  69.832 52.889 1.00 31.94 ? 512 VAL A O   1 
ATOM   4002 C CB  . VAL A 1 512 ? 29.592  70.828 50.412 1.00 30.76 ? 512 VAL A CB  1 
ATOM   4003 C CG1 . VAL A 1 512 ? 29.474  69.396 49.911 1.00 30.18 ? 512 VAL A CG1 1 
ATOM   4004 C CG2 . VAL A 1 512 ? 28.699  71.747 49.616 1.00 32.03 ? 512 VAL A CG2 1 
ATOM   4005 N N   . HIS A 1 513 ? 29.107  68.820 53.084 1.00 29.58 ? 513 HIS A N   1 
ATOM   4006 C CA  . HIS A 1 513 ? 29.638  67.692 53.820 1.00 29.70 ? 513 HIS A CA  1 
ATOM   4007 C C   . HIS A 1 513 ? 29.374  66.464 52.989 1.00 30.14 ? 513 HIS A C   1 
ATOM   4008 O O   . HIS A 1 513 ? 28.981  66.565 51.829 1.00 31.60 ? 513 HIS A O   1 
ATOM   4009 C CB  . HIS A 1 513 ? 28.942  67.557 55.169 1.00 30.76 ? 513 HIS A CB  1 
ATOM   4010 C CG  . HIS A 1 513 ? 28.781  68.853 55.891 1.00 29.96 ? 513 HIS A CG  1 
ATOM   4011 N ND1 . HIS A 1 513 ? 29.800  69.427 56.620 1.00 29.64 ? 513 HIS A ND1 1 
ATOM   4012 C CD2 . HIS A 1 513 ? 27.734  69.708 55.963 1.00 29.32 ? 513 HIS A CD2 1 
ATOM   4013 C CE1 . HIS A 1 513 ? 29.387  70.582 57.110 1.00 31.65 ? 513 HIS A CE1 1 
ATOM   4014 N NE2 . HIS A 1 513 ? 28.137  70.776 56.726 1.00 31.19 ? 513 HIS A NE2 1 
ATOM   4015 N N   . GLN A 1 514 ? 29.560  65.297 53.584 1.00 29.80 ? 514 GLN A N   1 
ATOM   4016 C CA  . GLN A 1 514 ? 29.343  64.083 52.841 1.00 30.74 ? 514 GLN A CA  1 
ATOM   4017 C C   . GLN A 1 514 ? 29.191  62.859 53.746 1.00 31.13 ? 514 GLN A C   1 
ATOM   4018 O O   . GLN A 1 514 ? 30.010  62.603 54.627 1.00 31.14 ? 514 GLN A O   1 
ATOM   4019 C CB  . GLN A 1 514 ? 30.497  63.931 51.849 1.00 33.26 ? 514 GLN A CB  1 
ATOM   4020 C CG  . GLN A 1 514 ? 30.604  62.612 51.136 1.00 38.47 ? 514 GLN A CG  1 
ATOM   4021 C CD  . GLN A 1 514 ? 32.040  62.310 50.779 1.00 41.14 ? 514 GLN A CD  1 
ATOM   4022 O OE1 . GLN A 1 514 ? 32.885  63.209 50.775 1.00 39.62 ? 514 GLN A OE1 1 
ATOM   4023 N NE2 . GLN A 1 514 ? 32.332  61.042 50.483 1.00 45.23 ? 514 GLN A NE2 1 
ATOM   4024 N N   . ARG A 1 515 ? 28.103  62.128 53.519 1.00 32.08 ? 515 ARG A N   1 
ATOM   4025 C CA  . ARG A 1 515 ? 27.770  60.922 54.258 1.00 29.68 ? 515 ARG A CA  1 
ATOM   4026 C C   . ARG A 1 515 ? 27.060  61.199 55.581 1.00 29.19 ? 515 ARG A C   1 
ATOM   4027 O O   . ARG A 1 515 ? 27.595  60.907 56.654 1.00 29.56 ? 515 ARG A O   1 
ATOM   4028 C CB  . ARG A 1 515 ? 29.030  60.089 54.486 1.00 28.33 ? 515 ARG A CB  1 
ATOM   4029 C CG  . ARG A 1 515 ? 29.246  59.034 53.412 1.00 29.39 ? 515 ARG A CG  1 
ATOM   4030 C CD  . ARG A 1 515 ? 30.662  58.471 53.426 1.00 29.46 ? 515 ARG A CD  1 
ATOM   4031 N NE  . ARG A 1 515 ? 30.949  57.715 52.210 1.00 32.12 ? 515 ARG A NE  1 
ATOM   4032 C CZ  . ARG A 1 515 ? 30.950  56.388 52.137 0.00 31.53 ? 515 ARG A CZ  1 
ATOM   4033 N NH1 . ARG A 1 515 ? 30.677  55.662 53.212 0.00 31.66 ? 515 ARG A NH1 1 
ATOM   4034 N NH2 . ARG A 1 515 ? 31.224  55.786 50.988 0.00 31.66 ? 515 ARG A NH2 1 
ATOM   4035 N N   . LEU A 1 516 ? 25.851  61.755 55.490 1.00 27.07 ? 516 LEU A N   1 
ATOM   4036 C CA  . LEU A 1 516 ? 25.036  62.067 56.668 1.00 25.75 ? 516 LEU A CA  1 
ATOM   4037 C C   . LEU A 1 516 ? 24.911  60.846 57.560 1.00 27.08 ? 516 LEU A C   1 
ATOM   4038 O O   . LEU A 1 516 ? 24.569  59.763 57.088 1.00 27.97 ? 516 LEU A O   1 
ATOM   4039 C CB  . LEU A 1 516 ? 23.631  62.507 56.250 1.00 25.25 ? 516 LEU A CB  1 
ATOM   4040 C CG  . LEU A 1 516 ? 22.791  63.303 57.249 1.00 23.03 ? 516 LEU A CG  1 
ATOM   4041 C CD1 . LEU A 1 516 ? 23.632  64.395 57.869 1.00 23.50 ? 516 LEU A CD1 1 
ATOM   4042 C CD2 . LEU A 1 516 ? 21.603  63.918 56.538 1.00 22.45 ? 516 LEU A CD2 1 
ATOM   4043 N N   . ARG A 1 517 ? 25.176  61.040 58.849 1.00 28.44 ? 517 ARG A N   1 
ATOM   4044 C CA  . ARG A 1 517 ? 25.118  59.985 59.861 1.00 29.54 ? 517 ARG A CA  1 
ATOM   4045 C C   . ARG A 1 517 ? 25.365  58.578 59.320 1.00 28.78 ? 517 ARG A C   1 
ATOM   4046 O O   . ARG A 1 517 ? 24.480  57.722 59.385 1.00 30.36 ? 517 ARG A O   1 
ATOM   4047 C CB  . ARG A 1 517 ? 23.768  60.016 60.604 1.00 32.49 ? 517 ARG A CB  1 
ATOM   4048 C CG  . ARG A 1 517 ? 22.912  61.258 60.339 1.00 39.60 ? 517 ARG A CG  1 
ATOM   4049 C CD  . ARG A 1 517 ? 22.738  62.164 61.579 1.00 41.11 ? 517 ARG A CD  1 
ATOM   4050 N NE  . ARG A 1 517 ? 23.513  61.711 62.730 1.00 44.02 ? 517 ARG A NE  1 
ATOM   4051 C CZ  . ARG A 1 517 ? 23.019  61.566 63.957 1.00 46.50 ? 517 ARG A CZ  1 
ATOM   4052 N NH1 . ARG A 1 517 ? 21.736  61.843 64.194 1.00 46.91 ? 517 ARG A NH1 1 
ATOM   4053 N NH2 . ARG A 1 517 ? 23.803  61.136 64.947 1.00 43.05 ? 517 ARG A NH2 1 
ATOM   4054 N N   . VAL A 1 518 ? 26.563  58.342 58.792 1.00 26.57 ? 518 VAL A N   1 
ATOM   4055 C CA  . VAL A 1 518 ? 26.922  57.031 58.262 1.00 25.48 ? 518 VAL A CA  1 
ATOM   4056 C C   . VAL A 1 518 ? 26.858  56.022 59.401 1.00 29.33 ? 518 VAL A C   1 
ATOM   4057 O O   . VAL A 1 518 ? 25.987  55.143 59.442 1.00 30.77 ? 518 VAL A O   1 
ATOM   4058 C CB  . VAL A 1 518 ? 28.358  57.007 57.740 1.00 23.19 ? 518 VAL A CB  1 
ATOM   4059 C CG1 . VAL A 1 518 ? 28.453  56.068 56.579 1.00 22.28 ? 518 VAL A CG1 1 
ATOM   4060 C CG2 . VAL A 1 518 ? 28.810  58.403 57.359 1.00 24.24 ? 518 VAL A CG2 1 
ATOM   4061 N N   . GLN A 1 519 ? 27.805  56.184 60.323 1.00 30.60 ? 519 GLN A N   1 
ATOM   4062 C CA  . GLN A 1 519 ? 27.979  55.359 61.516 1.00 28.81 ? 519 GLN A CA  1 
ATOM   4063 C C   . GLN A 1 519 ? 26.712  54.955 62.253 1.00 27.07 ? 519 GLN A C   1 
ATOM   4064 O O   . GLN A 1 519 ? 26.430  53.775 62.416 1.00 28.38 ? 519 GLN A O   1 
ATOM   4065 C CB  . GLN A 1 519 ? 28.880  56.098 62.499 1.00 31.13 ? 519 GLN A CB  1 
ATOM   4066 C CG  . GLN A 1 519 ? 29.958  55.246 63.102 1.00 34.11 ? 519 GLN A CG  1 
ATOM   4067 C CD  . GLN A 1 519 ? 31.159  55.110 62.190 1.00 35.79 ? 519 GLN A CD  1 
ATOM   4068 O OE1 . GLN A 1 519 ? 31.522  56.045 61.459 1.00 35.98 ? 519 GLN A OE1 1 
ATOM   4069 N NE2 . GLN A 1 519 ? 31.787  53.942 62.228 1.00 36.51 ? 519 GLN A NE2 1 
ATOM   4070 N N   . MET A 1 520 ? 25.963  55.938 62.732 1.00 25.10 ? 520 MET A N   1 
ATOM   4071 C CA  . MET A 1 520 ? 24.754  55.634 63.465 1.00 25.23 ? 520 MET A CA  1 
ATOM   4072 C C   . MET A 1 520 ? 23.779  54.872 62.591 1.00 27.78 ? 520 MET A C   1 
ATOM   4073 O O   . MET A 1 520 ? 23.129  53.936 63.053 1.00 30.40 ? 520 MET A O   1 
ATOM   4074 C CB  . MET A 1 520 ? 24.108  56.916 63.980 1.00 24.03 ? 520 MET A CB  1 
ATOM   4075 C CG  . MET A 1 520 ? 24.791  57.489 65.205 1.00 25.32 ? 520 MET A CG  1 
ATOM   4076 S SD  . MET A 1 520 ? 25.299  56.213 66.402 1.00 24.58 ? 520 MET A SD  1 
ATOM   4077 C CE  . MET A 1 520 ? 27.050  56.121 66.098 1.00 22.54 ? 520 MET A CE  1 
ATOM   4078 N N   . CYS A 1 521 ? 23.686  55.254 61.321 1.00 27.27 ? 521 CYS A N   1 
ATOM   4079 C CA  . CYS A 1 521 ? 22.762  54.588 60.421 1.00 26.16 ? 521 CYS A CA  1 
ATOM   4080 C C   . CYS A 1 521 ? 23.237  53.219 59.920 1.00 26.04 ? 521 CYS A C   1 
ATOM   4081 O O   . CYS A 1 521 ? 22.444  52.465 59.367 1.00 27.20 ? 521 CYS A O   1 
ATOM   4082 C CB  . CYS A 1 521 ? 22.418  55.507 59.251 1.00 26.33 ? 521 CYS A CB  1 
ATOM   4083 S SG  . CYS A 1 521 ? 21.516  57.012 59.752 1.00 27.96 ? 521 CYS A SG  1 
ATOM   4084 N N   . VAL A 1 522 ? 24.515  52.888 60.105 1.00 24.78 ? 522 VAL A N   1 
ATOM   4085 C CA  . VAL A 1 522 ? 25.011  51.566 59.695 1.00 23.33 ? 522 VAL A CA  1 
ATOM   4086 C C   . VAL A 1 522 ? 24.521  50.592 60.757 1.00 24.04 ? 522 VAL A C   1 
ATOM   4087 O O   . VAL A 1 522 ? 24.372  49.397 60.519 1.00 25.00 ? 522 VAL A O   1 
ATOM   4088 C CB  . VAL A 1 522 ? 26.546  51.451 59.715 1.00 21.93 ? 522 VAL A CB  1 
ATOM   4089 C CG1 . VAL A 1 522 ? 26.960  50.178 59.029 1.00 21.79 ? 522 VAL A CG1 1 
ATOM   4090 C CG2 . VAL A 1 522 ? 27.190  52.642 59.062 1.00 23.54 ? 522 VAL A CG2 1 
ATOM   4091 N N   . PHE A 1 523 ? 24.292  51.133 61.946 1.00 24.96 ? 523 PHE A N   1 
ATOM   4092 C CA  . PHE A 1 523 ? 23.829  50.367 63.094 1.00 23.39 ? 523 PHE A CA  1 
ATOM   4093 C C   . PHE A 1 523 ? 22.328  50.161 62.983 1.00 23.52 ? 523 PHE A C   1 
ATOM   4094 O O   . PHE A 1 523 ? 21.818  49.057 63.141 1.00 25.41 ? 523 PHE A O   1 
ATOM   4095 C CB  . PHE A 1 523 ? 24.183  51.144 64.365 1.00 21.02 ? 523 PHE A CB  1 
ATOM   4096 C CG  . PHE A 1 523 ? 23.349  50.796 65.556 1.00 21.94 ? 523 PHE A CG  1 
ATOM   4097 C CD1 . PHE A 1 523 ? 23.667  49.703 66.346 1.00 23.79 ? 523 PHE A CD1 1 
ATOM   4098 C CD2 . PHE A 1 523 ? 22.274  51.595 65.924 1.00 24.17 ? 523 PHE A CD2 1 
ATOM   4099 C CE1 . PHE A 1 523 ? 22.932  49.413 67.485 1.00 24.37 ? 523 PHE A CE1 1 
ATOM   4100 C CE2 . PHE A 1 523 ? 21.530  51.313 67.065 1.00 23.79 ? 523 PHE A CE2 1 
ATOM   4101 C CZ  . PHE A 1 523 ? 21.862  50.221 67.846 1.00 24.60 ? 523 PHE A CZ  1 
ATOM   4102 N N   . TRP A 1 524 ? 21.625  51.239 62.683 1.00 23.69 ? 524 TRP A N   1 
ATOM   4103 C CA  . TRP A 1 524 ? 20.183  51.193 62.568 1.00 22.30 ? 524 TRP A CA  1 
ATOM   4104 C C   . TRP A 1 524 ? 19.774  50.518 61.285 1.00 23.01 ? 524 TRP A C   1 
ATOM   4105 O O   . TRP A 1 524 ? 18.914  49.639 61.279 1.00 23.64 ? 524 TRP A O   1 
ATOM   4106 C CB  . TRP A 1 524 ? 19.617  52.614 62.600 1.00 22.88 ? 524 TRP A CB  1 
ATOM   4107 C CG  . TRP A 1 524 ? 19.714  53.289 63.954 1.00 22.12 ? 524 TRP A CG  1 
ATOM   4108 C CD1 . TRP A 1 524 ? 20.527  54.331 64.296 1.00 18.03 ? 524 TRP A CD1 1 
ATOM   4109 C CD2 . TRP A 1 524 ? 18.933  52.990 65.120 1.00 21.38 ? 524 TRP A CD2 1 
ATOM   4110 N NE1 . TRP A 1 524 ? 20.296  54.703 65.594 1.00 19.26 ? 524 TRP A NE1 1 
ATOM   4111 C CE2 . TRP A 1 524 ? 19.322  53.896 66.123 1.00 21.93 ? 524 TRP A CE2 1 
ATOM   4112 C CE3 . TRP A 1 524 ? 17.938  52.045 65.410 1.00 20.08 ? 524 TRP A CE3 1 
ATOM   4113 C CZ2 . TRP A 1 524 ? 18.753  53.886 67.400 1.00 22.21 ? 524 TRP A CZ2 1 
ATOM   4114 C CZ3 . TRP A 1 524 ? 17.375  52.039 66.673 1.00 21.55 ? 524 TRP A CZ3 1 
ATOM   4115 C CH2 . TRP A 1 524 ? 17.783  52.955 67.654 1.00 19.97 ? 524 TRP A CH2 1 
ATOM   4116 N N   . ASN A 1 525 ? 20.402  50.929 60.192 1.00 24.79 ? 525 ASN A N   1 
ATOM   4117 C CA  . ASN A 1 525 ? 20.076  50.378 58.886 1.00 26.20 ? 525 ASN A CA  1 
ATOM   4118 C C   . ASN A 1 525 ? 20.685  49.020 58.608 1.00 27.49 ? 525 ASN A C   1 
ATOM   4119 O O   . ASN A 1 525 ? 20.213  48.302 57.733 1.00 29.22 ? 525 ASN A O   1 
ATOM   4120 C CB  . ASN A 1 525 ? 20.499  51.337 57.779 1.00 25.94 ? 525 ASN A CB  1 
ATOM   4121 C CG  . ASN A 1 525 ? 19.624  52.555 57.707 1.00 26.14 ? 525 ASN A CG  1 
ATOM   4122 O OD1 . ASN A 1 525 ? 18.438  52.508 58.047 1.00 28.38 ? 525 ASN A OD1 1 
ATOM   4123 N ND2 . ASN A 1 525 ? 20.200  53.663 57.269 1.00 26.86 ? 525 ASN A ND2 1 
ATOM   4124 N N   . GLN A 1 526 ? 21.726  48.649 59.336 1.00 27.81 ? 526 GLN A N   1 
ATOM   4125 C CA  . GLN A 1 526 ? 22.320  47.360 59.061 1.00 29.06 ? 526 GLN A CA  1 
ATOM   4126 C C   . GLN A 1 526 ? 22.571  46.450 60.252 1.00 30.53 ? 526 GLN A C   1 
ATOM   4127 O O   . GLN A 1 526 ? 22.092  45.315 60.250 1.00 35.22 ? 526 GLN A O   1 
ATOM   4128 C CB  . GLN A 1 526 ? 23.606  47.551 58.260 1.00 29.80 ? 526 GLN A CB  1 
ATOM   4129 C CG  . GLN A 1 526 ? 23.458  48.553 57.115 1.00 32.39 ? 526 GLN A CG  1 
ATOM   4130 C CD  . GLN A 1 526 ? 24.769  48.828 56.396 1.00 32.37 ? 526 GLN A CD  1 
ATOM   4131 O OE1 . GLN A 1 526 ? 25.066  49.967 56.036 0.00 32.85 ? 526 GLN A OE1 1 
ATOM   4132 N NE2 . GLN A 1 526 ? 25.558  47.781 56.184 0.00 32.86 ? 526 GLN A NE2 1 
ATOM   4133 N N   . PHE A 1 527 ? 23.290  46.912 61.274 1.00 27.12 ? 527 PHE A N   1 
ATOM   4134 C CA  . PHE A 1 527 ? 23.559  46.025 62.399 1.00 24.01 ? 527 PHE A CA  1 
ATOM   4135 C C   . PHE A 1 527 ? 22.344  45.596 63.210 1.00 23.51 ? 527 PHE A C   1 
ATOM   4136 O O   . PHE A 1 527 ? 22.003  44.414 63.248 1.00 22.11 ? 527 PHE A O   1 
ATOM   4137 C CB  . PHE A 1 527 ? 24.593  46.624 63.348 1.00 23.76 ? 527 PHE A CB  1 
ATOM   4138 C CG  . PHE A 1 527 ? 24.943  45.708 64.494 1.00 22.82 ? 527 PHE A CG  1 
ATOM   4139 C CD1 . PHE A 1 527 ? 25.519  44.466 64.252 1.00 22.62 ? 527 PHE A CD1 1 
ATOM   4140 C CD2 . PHE A 1 527 ? 24.652  46.064 65.805 1.00 23.76 ? 527 PHE A CD2 1 
ATOM   4141 C CE1 . PHE A 1 527 ? 25.798  43.589 65.292 1.00 22.23 ? 527 PHE A CE1 1 
ATOM   4142 C CE2 . PHE A 1 527 ? 24.928  45.193 66.855 1.00 22.72 ? 527 PHE A CE2 1 
ATOM   4143 C CZ  . PHE A 1 527 ? 25.502  43.952 66.593 1.00 22.93 ? 527 PHE A CZ  1 
ATOM   4144 N N   . LEU A 1 528 ? 21.705  46.554 63.871 1.00 24.83 ? 528 LEU A N   1 
ATOM   4145 C CA  . LEU A 1 528 ? 20.541  46.270 64.697 1.00 25.80 ? 528 LEU A CA  1 
ATOM   4146 C C   . LEU A 1 528 ? 19.595  45.273 64.044 1.00 28.86 ? 528 LEU A C   1 
ATOM   4147 O O   . LEU A 1 528 ? 19.333  44.207 64.601 1.00 31.59 ? 528 LEU A O   1 
ATOM   4148 C CB  . LEU A 1 528 ? 19.784  47.560 65.019 1.00 21.87 ? 528 LEU A CB  1 
ATOM   4149 C CG  . LEU A 1 528 ? 18.639  47.420 66.032 1.00 21.50 ? 528 LEU A CG  1 
ATOM   4150 C CD1 . LEU A 1 528 ? 19.171  46.833 67.336 1.00 17.29 ? 528 LEU A CD1 1 
ATOM   4151 C CD2 . LEU A 1 528 ? 17.982  48.780 66.268 1.00 15.13 ? 528 LEU A CD2 1 
ATOM   4152 N N   . PRO A 1 529 ? 19.081  45.595 62.844 1.00 30.22 ? 529 PRO A N   1 
ATOM   4153 C CA  . PRO A 1 529 ? 18.159  44.678 62.165 1.00 31.21 ? 529 PRO A CA  1 
ATOM   4154 C C   . PRO A 1 529 ? 18.654  43.228 62.152 1.00 33.63 ? 529 PRO A C   1 
ATOM   4155 O O   . PRO A 1 529 ? 17.904  42.307 62.488 1.00 34.02 ? 529 PRO A O   1 
ATOM   4156 C CB  . PRO A 1 529 ? 18.042  45.271 60.765 1.00 30.57 ? 529 PRO A CB  1 
ATOM   4157 C CG  . PRO A 1 529 ? 18.295  46.727 60.958 1.00 28.69 ? 529 PRO A CG  1 
ATOM   4158 C CD  . PRO A 1 529 ? 19.333  46.806 62.041 1.00 31.11 ? 529 PRO A CD  1 
ATOM   4159 N N   . LYS A 1 530 ? 19.916  43.043 61.761 1.00 34.85 ? 530 LYS A N   1 
ATOM   4160 C CA  . LYS A 1 530 ? 20.556  41.726 61.700 1.00 32.95 ? 530 LYS A CA  1 
ATOM   4161 C C   . LYS A 1 530 ? 20.501  41.081 63.082 1.00 32.02 ? 530 LYS A C   1 
ATOM   4162 O O   . LYS A 1 530 ? 19.941  39.996 63.257 1.00 31.03 ? 530 LYS A O   1 
ATOM   4163 C CB  . LYS A 1 530 ? 22.023  41.875 61.272 1.00 34.52 ? 530 LYS A CB  1 
ATOM   4164 C CG  . LYS A 1 530 ? 22.422  41.067 60.045 1.00 37.36 ? 530 LYS A CG  1 
ATOM   4165 C CD  . LYS A 1 530 ? 23.939  40.825 59.980 1.00 40.33 ? 530 LYS A CD  1 
ATOM   4166 C CE  . LYS A 1 530 ? 24.263  39.344 59.707 1.00 42.34 ? 530 LYS A CE  1 
ATOM   4167 N NZ  . LYS A 1 530 ? 25.478  39.132 58.859 1.00 39.62 ? 530 LYS A NZ  1 
ATOM   4168 N N   . LEU A 1 531 ? 21.103  41.756 64.055 1.00 28.83 ? 531 LEU A N   1 
ATOM   4169 C CA  . LEU A 1 531 ? 21.122  41.274 65.422 1.00 27.52 ? 531 LEU A CA  1 
ATOM   4170 C C   . LEU A 1 531 ? 19.714  40.850 65.823 1.00 27.44 ? 531 LEU A C   1 
ATOM   4171 O O   . LEU A 1 531 ? 19.466  39.697 66.172 1.00 26.63 ? 531 LEU A O   1 
ATOM   4172 C CB  . LEU A 1 531 ? 21.612  42.395 66.343 1.00 28.74 ? 531 LEU A CB  1 
ATOM   4173 C CG  . LEU A 1 531 ? 21.341  42.406 67.854 1.00 26.28 ? 531 LEU A CG  1 
ATOM   4174 C CD1 . LEU A 1 531 ? 22.304  43.389 68.505 1.00 26.71 ? 531 LEU A CD1 1 
ATOM   4175 C CD2 . LEU A 1 531 ? 19.923  42.830 68.161 1.00 27.68 ? 531 LEU A CD2 1 
ATOM   4176 N N   . LEU A 1 532 ? 18.789  41.796 65.744 1.00 27.47 ? 532 LEU A N   1 
ATOM   4177 C CA  . LEU A 1 532 ? 17.411  41.549 66.121 1.00 29.23 ? 532 LEU A CA  1 
ATOM   4178 C C   . LEU A 1 532 ? 16.771  40.362 65.410 1.00 30.91 ? 532 LEU A C   1 
ATOM   4179 O O   . LEU A 1 532 ? 15.668  39.959 65.755 1.00 33.79 ? 532 LEU A O   1 
ATOM   4180 C CB  . LEU A 1 532 ? 16.578  42.813 65.902 1.00 29.52 ? 532 LEU A CB  1 
ATOM   4181 C CG  . LEU A 1 532 ? 16.047  43.507 67.165 1.00 29.86 ? 532 LEU A CG  1 
ATOM   4182 C CD1 . LEU A 1 532 ? 15.570  44.921 66.818 1.00 29.50 ? 532 LEU A CD1 1 
ATOM   4183 C CD2 . LEU A 1 532 ? 14.898  42.687 67.756 1.00 29.16 ? 532 LEU A CD2 1 
ATOM   4184 N N   . ASN A 1 533 ? 17.440  39.805 64.410 1.00 33.02 ? 533 ASN A N   1 
ATOM   4185 C CA  . ASN A 1 533 ? 16.881  38.645 63.724 1.00 35.46 ? 533 ASN A CA  1 
ATOM   4186 C C   . ASN A 1 533 ? 17.619  37.420 64.253 1.00 36.76 ? 533 ASN A C   1 
ATOM   4187 O O   . ASN A 1 533 ? 17.009  36.398 64.561 1.00 37.55 ? 533 ASN A O   1 
ATOM   4188 C CB  . ASN A 1 533 ? 17.044  38.755 62.200 1.00 34.28 ? 533 ASN A CB  1 
ATOM   4189 C CG  . ASN A 1 533 ? 15.726  38.989 61.489 0.00 33.71 ? 533 ASN A CG  1 
ATOM   4190 O OD1 . ASN A 1 533 ? 14.654  38.811 62.067 0.00 33.14 ? 533 ASN A OD1 1 
ATOM   4191 N ND2 . ASN A 1 533 ? 15.799  39.393 60.226 0.00 33.18 ? 533 ASN A ND2 1 
ATOM   4192 N N   . ALA A 1 534 ? 18.936  37.526 64.366 1.00 38.02 ? 534 ALA A N   1 
ATOM   4193 C CA  . ALA A 1 534 ? 19.710  36.415 64.885 1.00 39.85 ? 534 ALA A CA  1 
ATOM   4194 C C   . ALA A 1 534 ? 19.098  36.121 66.237 1.00 41.38 ? 534 ALA A C   1 
ATOM   4195 O O   . ALA A 1 534 ? 18.790  34.971 66.563 1.00 42.18 ? 534 ALA A O   1 
ATOM   4196 C CB  . ALA A 1 534 ? 21.160  36.810 65.045 1.00 41.71 ? 534 ALA A CB  1 
ATOM   4197 N N   . THR A 1 535 ? 18.915  37.184 67.015 1.00 42.37 ? 535 THR A N   1 
ATOM   4198 C CA  . THR A 1 535 ? 18.323  37.080 68.341 1.00 43.13 ? 535 THR A CA  1 
ATOM   4199 C C   . THR A 1 535 ? 16.830  37.362 68.228 1.00 43.99 ? 535 THR A C   1 
ATOM   4200 O O   . THR A 1 535 ? 16.191  36.760 67.333 1.00 43.01 ? 535 THR A O   1 
ATOM   4201 C CB  . THR A 1 535 ? 18.955  38.092 69.320 1.00 43.75 ? 535 THR A CB  1 
ATOM   4202 O OG1 . THR A 1 535 ? 18.659  39.428 68.890 1.00 45.58 ? 535 THR A OG1 1 
ATOM   4203 C CG2 . THR A 1 535 ? 20.464  37.903 69.377 1.00 43.62 ? 535 THR A CG2 1 
HETATM 4204 C C2  . MF2 B 2 .   ? 1.081   63.548 71.660 1.00 42.41 ? 700 MF2 A C2  1 
HETATM 4205 C C3  . MF2 B 2 .   ? -0.436  63.570 72.015 1.00 44.34 ? 700 MF2 A C3  1 
HETATM 4206 O O4  . MF2 B 2 .   ? -0.746  62.395 72.832 1.00 42.81 ? 700 MF2 A O4  1 
HETATM 4207 C C7  . MF2 B 2 .   ? -0.870  59.974 73.060 1.00 38.00 ? 700 MF2 A C7  1 
HETATM 4208 C C8  . MF2 B 2 .   ? -0.808  64.856 72.812 1.00 43.29 ? 700 MF2 A C8  1 
HETATM 4209 C C9  . MF2 B 2 .   ? 2.823   62.313 70.452 1.00 39.49 ? 700 MF2 A C9  1 
HETATM 4210 C C10 . MF2 B 2 .   ? 3.010   62.903 69.016 1.00 42.07 ? 700 MF2 A C10 1 
HETATM 4211 C C11 . MF2 B 2 .   ? 3.354   64.439 69.030 1.00 44.96 ? 700 MF2 A C11 1 
HETATM 4212 C C12 . MF2 B 2 .   ? 4.552   64.796 68.084 1.00 42.85 ? 700 MF2 A C12 1 
HETATM 4213 C C13 . MF2 B 2 .   ? 4.091   65.575 66.803 1.00 45.85 ? 700 MF2 A C13 1 
HETATM 4214 C C14 . MF2 B 2 .   ? 3.377   64.653 65.749 1.00 40.21 ? 700 MF2 A C14 1 
HETATM 4215 C C15 . MF2 B 2 .   ? 4.014   64.776 64.337 1.00 35.04 ? 700 MF2 A C15 1 
HETATM 4216 C C16 . MF2 B 2 .   ? 4.294   63.385 63.716 1.00 31.86 ? 700 MF2 A C16 1 
HETATM 4217 N N1  . MF2 B 2 .   ? 1.399   62.286 70.923 1.00 40.13 ? 700 MF2 A N1  1 
HETATM 4218 C C5  . MF2 B 2 .   ? -0.452  61.154 72.143 1.00 39.02 ? 700 MF2 A C5  1 
HETATM 4219 C C6  . MF2 B 2 .   ? 1.074   61.110 71.789 1.00 38.60 ? 700 MF2 A C6  1 
HETATM 4220 N N17 . MF2 B 2 .   ? 5.448   63.418 62.812 1.00 34.03 ? 700 MF2 A N17 1 
HETATM 4221 C C18 . MF2 B 2 .   ? 5.284   63.234 61.410 1.00 35.48 ? 700 MF2 A C18 1 
HETATM 4222 O O19 . MF2 B 2 .   ? 4.212   62.873 60.954 1.00 38.02 ? 700 MF2 A O19 1 
HETATM 4223 O O   . HOH C 3 .   ? -11.217 62.558 59.517 1.00 37.79 ? 800 HOH A O   1 
HETATM 4224 O O   . HOH C 3 .   ? 10.788  55.512 68.404 1.00 15.06 ? 801 HOH A O   1 
HETATM 4225 O O   . HOH C 3 .   ? 1.737   89.700 54.075 1.00 17.14 ? 802 HOH A O   1 
HETATM 4226 O O   . HOH C 3 .   ? -7.733  70.452 56.237 1.00 27.04 ? 803 HOH A O   1 
HETATM 4227 O O   . HOH C 3 .   ? -14.598 59.201 57.001 1.00 19.43 ? 804 HOH A O   1 
HETATM 4228 O O   . HOH C 3 .   ? 3.318   53.943 63.236 1.00 18.92 ? 805 HOH A O   1 
HETATM 4229 O O   . HOH C 3 .   ? -8.962  58.596 64.378 1.00 10.02 ? 806 HOH A O   1 
HETATM 4230 O O   . HOH C 3 .   ? 5.558   78.715 68.169 1.00 41.69 ? 807 HOH A O   1 
HETATM 4231 O O   . HOH C 3 .   ? 0.289   48.503 75.937 1.00 20.52 ? 808 HOH A O   1 
HETATM 4232 O O   . HOH C 3 .   ? -5.013  49.632 61.586 1.00 32.17 ? 809 HOH A O   1 
HETATM 4233 O O   . HOH C 3 .   ? 26.345  53.839 52.977 1.00 29.69 ? 810 HOH A O   1 
HETATM 4234 O O   . HOH C 3 .   ? -0.589  70.533 68.322 1.00 49.97 ? 811 HOH A O   1 
HETATM 4235 O O   . HOH C 3 .   ? -0.178  69.017 59.895 1.00 14.54 ? 812 HOH A O   1 
HETATM 4236 O O   . HOH C 3 .   ? -1.064  50.721 42.667 1.00 29.86 ? 813 HOH A O   1 
HETATM 4237 O O   . HOH C 3 .   ? 3.587   69.302 57.602 1.00 20.03 ? 814 HOH A O   1 
HETATM 4238 O O   . HOH C 3 .   ? 4.297   43.659 55.328 1.00 18.32 ? 815 HOH A O   1 
HETATM 4239 O O   . HOH C 3 .   ? 8.869   54.818 35.251 1.00 43.10 ? 816 HOH A O   1 
HETATM 4240 O O   . HOH C 3 .   ? 13.871  48.576 36.819 1.00 38.95 ? 817 HOH A O   1 
HETATM 4241 O O   . HOH C 3 .   ? 7.372   61.493 34.821 1.00 55.60 ? 818 HOH A O   1 
HETATM 4242 O O   . HOH C 3 .   ? -0.456  69.631 62.325 1.00 21.38 ? 819 HOH A O   1 
HETATM 4243 O O   . HOH C 3 .   ? -4.944  56.325 38.766 1.00 25.28 ? 820 HOH A O   1 
HETATM 4244 O O   . HOH C 3 .   ? 9.913   46.812 53.052 1.00 38.35 ? 821 HOH A O   1 
HETATM 4245 O O   . HOH C 3 .   ? -20.769 68.849 50.431 1.00 31.88 ? 822 HOH A O   1 
HETATM 4246 O O   . HOH C 3 .   ? 6.630   83.150 64.590 1.00 43.41 ? 823 HOH A O   1 
HETATM 4247 O O   . HOH C 3 .   ? 14.117  51.373 56.302 1.00 38.83 ? 824 HOH A O   1 
HETATM 4248 O O   . HOH C 3 .   ? -4.529  80.784 31.964 1.00 22.74 ? 825 HOH A O   1 
HETATM 4249 O O   . HOH C 3 .   ? -4.440  83.066 51.998 1.00 24.15 ? 826 HOH A O   1 
HETATM 4250 O O   . HOH C 3 .   ? 14.565  46.785 64.219 1.00 26.30 ? 827 HOH A O   1 
HETATM 4251 O O   . HOH C 3 .   ? -20.180 63.329 60.586 1.00 43.22 ? 828 HOH A O   1 
HETATM 4252 O O   . HOH C 3 .   ? 13.793  83.648 43.349 1.00 37.72 ? 829 HOH A O   1 
HETATM 4253 O O   . HOH C 3 .   ? 6.853   83.215 67.637 1.00 50.70 ? 830 HOH A O   1 
HETATM 4254 O O   . HOH C 3 .   ? -2.662  57.454 62.859 1.00 29.53 ? 831 HOH A O   1 
HETATM 4255 O O   . HOH C 3 .   ? -13.716 62.377 57.117 1.00 45.68 ? 832 HOH A O   1 
HETATM 4256 O O   . HOH C 3 .   ? 20.810  55.069 35.667 1.00 38.14 ? 833 HOH A O   1 
HETATM 4257 O O   . HOH C 3 .   ? 24.306  59.100 34.438 1.00 31.03 ? 834 HOH A O   1 
HETATM 4258 O O   . HOH C 3 .   ? -3.343  45.812 72.592 1.00 23.23 ? 835 HOH A O   1 
HETATM 4259 O O   . HOH C 3 .   ? -2.965  77.221 31.003 1.00 31.42 ? 836 HOH A O   1 
HETATM 4260 O O   . HOH C 3 .   ? 3.717   51.769 64.459 1.00 28.46 ? 837 HOH A O   1 
HETATM 4261 O O   . HOH C 3 .   ? 21.514  51.745 54.028 1.00 21.24 ? 838 HOH A O   1 
HETATM 4262 O O   . HOH C 3 .   ? 4.315   67.805 61.983 1.00 24.00 ? 839 HOH A O   1 
HETATM 4263 O O   . HOH C 3 .   ? 5.103   68.653 64.925 1.00 26.51 ? 840 HOH A O   1 
HETATM 4264 O O   . HOH C 3 .   ? -11.459 81.803 29.475 1.00 40.11 ? 841 HOH A O   1 
HETATM 4265 O O   . HOH C 3 .   ? 0.642   67.411 64.042 1.00 27.66 ? 842 HOH A O   1 
HETATM 4266 O O   . HOH C 3 .   ? -22.234 59.010 63.164 1.00 50.62 ? 843 HOH A O   1 
HETATM 4267 O O   . HOH C 3 .   ? 5.204   48.144 39.002 1.00 41.95 ? 844 HOH A O   1 
HETATM 4268 O O   . HOH C 3 .   ? 12.704  83.906 46.981 1.00 35.53 ? 845 HOH A O   1 
HETATM 4269 O O   . HOH C 3 .   ? 18.962  67.662 72.537 1.00 40.76 ? 846 HOH A O   1 
HETATM 4270 O O   . HOH C 3 .   ? 22.731  68.229 36.559 1.00 34.69 ? 847 HOH A O   1 
HETATM 4271 O O   . HOH C 3 .   ? -20.809 46.599 56.822 1.00 44.32 ? 848 HOH A O   1 
HETATM 4272 O O   . HOH C 3 .   ? 2.191   88.447 42.791 1.00 37.79 ? 849 HOH A O   1 
HETATM 4273 O O   . HOH C 3 .   ? 15.932  59.276 87.555 1.00 27.68 ? 850 HOH A O   1 
HETATM 4274 O O   . HOH C 3 .   ? 10.060  44.855 43.472 1.00 25.99 ? 851 HOH A O   1 
HETATM 4275 O O   . HOH C 3 .   ? 10.106  57.623 33.068 1.00 52.93 ? 852 HOH A O   1 
HETATM 4276 O O   . HOH C 3 .   ? -8.977  82.789 29.839 1.00 18.65 ? 853 HOH A O   1 
HETATM 4277 O O   . HOH C 3 .   ? 21.606  62.179 36.496 1.00 11.78 ? 854 HOH A O   1 
HETATM 4278 O O   . HOH C 3 .   ? -7.048  85.095 31.696 1.00 36.13 ? 855 HOH A O   1 
HETATM 4279 O O   . HOH C 3 .   ? -8.042  71.120 52.561 1.00 15.80 ? 856 HOH A O   1 
HETATM 4280 O O   . HOH C 3 .   ? -11.968 83.377 57.326 1.00 56.83 ? 857 HOH A O   1 
HETATM 4281 O O   . HOH C 3 .   ? 20.270  62.276 34.061 1.00 20.20 ? 858 HOH A O   1 
HETATM 4282 O O   . HOH C 3 .   ? 14.379  61.925 89.220 1.00 36.25 ? 859 HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? 15.391  49.053 64.013 1.00 41.19 ? 860 HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? 12.468  50.803 59.317 1.00 35.16 ? 861 HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? -18.684 82.729 54.702 1.00 35.54 ? 862 HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 9.132   88.296 48.381 1.00 21.31 ? 863 HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? 14.368  75.325 79.228 1.00 43.93 ? 864 HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? 8.976   79.499 38.296 1.00 40.68 ? 865 HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? -18.824 84.504 49.999 1.00 54.84 ? 866 HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? 0.032   46.803 40.635 1.00 52.19 ? 867 HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? -2.230  69.900 29.019 1.00 22.58 ? 868 HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? 6.788   85.956 66.618 1.00 42.53 ? 869 HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? 23.143  66.950 69.946 1.00 33.84 ? 870 HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? 23.235  54.229 54.594 1.00 31.55 ? 871 HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? 8.327   61.640 85.605 1.00 30.41 ? 872 HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? 18.980  74.833 70.846 1.00 49.65 ? 873 HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? -15.740 67.757 49.227 1.00 26.77 ? 874 HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? -18.272 68.556 48.467 1.00 28.94 ? 875 HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? -22.133 68.099 43.164 1.00 38.95 ? 876 HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? 6.026   57.256 35.359 1.00 27.95 ? 877 HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? 20.912  70.835 71.662 1.00 22.62 ? 878 HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? -10.739 83.170 33.916 1.00 41.80 ? 879 HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? -14.940 66.504 51.631 1.00 32.84 ? 880 HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? -6.681  50.086 49.547 1.00 26.50 ? 881 HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? -2.084  48.115 76.134 1.00 35.64 ? 882 HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? -8.808  86.708 32.768 1.00 39.92 ? 883 HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? -0.623  62.947 58.854 1.00 20.96 ? 884 HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? 18.799  60.350 41.606 1.00 42.08 ? 885 HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? -3.464  50.364 59.497 1.00 19.57 ? 886 HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? 16.472  70.699 33.534 1.00 57.82 ? 887 HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? 5.034   87.553 67.628 1.00 27.64 ? 888 HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? 7.481   92.148 48.404 1.00 29.75 ? 889 HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? 26.858  60.050 79.579 1.00 42.87 ? 890 HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? -7.733  60.982 64.244 1.00 30.35 ? 891 HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? 5.456   61.052 72.117 1.00 20.66 ? 892 HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? 10.138  49.653 36.845 1.00 28.78 ? 893 HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? -3.827  57.743 35.928 1.00 25.97 ? 894 HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? -7.158  80.272 31.339 1.00 32.40 ? 895 HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? 15.648  63.152 84.400 1.00 27.51 ? 896 HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? 7.679   79.232 67.037 1.00 24.72 ? 897 HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? 7.876   75.754 60.502 1.00 31.99 ? 898 HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? -4.848  46.881 75.828 1.00 30.57 ? 899 HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? 3.948   47.483 64.255 1.00 26.48 ? 900 HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? -20.449 58.537 59.760 1.00 37.32 ? 901 HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? 11.319  64.368 35.894 1.00 35.80 ? 902 HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? -2.666  68.454 66.851 1.00 23.34 ? 903 HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? 0.324   40.321 56.381 1.00 33.25 ? 904 HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? 8.097   76.957 76.182 1.00 40.45 ? 905 HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? 19.139  70.519 35.009 1.00 27.89 ? 906 HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? 12.960  79.800 74.526 1.00 40.62 ? 907 HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? 20.296  58.331 31.526 1.00 36.41 ? 908 HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? 12.540  49.145 53.748 1.00 33.85 ? 909 HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? -4.768  87.947 34.983 1.00 39.76 ? 910 HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? 22.162  62.600 32.493 1.00 29.69 ? 911 HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? 2.797   81.201 32.030 1.00 24.32 ? 912 HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? -15.493 72.136 54.287 1.00 26.47 ? 913 HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? -14.861 75.663 49.141 1.00 46.89 ? 914 HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? -10.100 82.063 55.229 1.00 24.35 ? 915 HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? 6.475   79.061 28.945 1.00 44.76 ? 916 HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? -10.460 61.031 39.625 1.00 26.40 ? 917 HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? 8.382   48.612 64.505 1.00 31.72 ? 918 HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? 6.421   89.771 69.408 1.00 48.47 ? 919 HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? 8.493   42.969 72.180 1.00 68.12 ? 920 HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? 5.398   80.267 73.841 1.00 31.51 ? 921 HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? -11.002 65.704 68.515 1.00 23.67 ? 922 HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 19.882  62.152 31.043 1.00 22.40 ? 923 HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? 1.629   42.506 54.560 1.00 20.64 ? 924 HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? 1.527   52.957 73.545 1.00 38.89 ? 925 HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? 1.592   42.335 42.717 1.00 45.92 ? 926 HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? -1.107  81.324 71.624 1.00 17.89 ? 927 HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 3.044   41.469 51.308 1.00 26.75 ? 928 HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? -13.546 40.679 62.336 1.00 22.40 ? 929 HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? 27.808  82.814 42.545 1.00 35.66 ? 930 HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 19.812  58.758 34.775 1.00 40.89 ? 931 HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 24.509  67.178 84.538 1.00 44.26 ? 932 HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? 34.944  71.170 59.622 1.00 62.87 ? 933 HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? 11.552  62.610 86.347 1.00 49.70 ? 934 HOH A O   1 
HETATM 4358 O O   . HOH C 3 .   ? 24.529  79.545 35.163 1.00 35.67 ? 935 HOH A O   1 
HETATM 4359 O O   . HOH C 3 .   ? 24.870  81.695 36.649 1.00 45.84 ? 936 HOH A O   1 
HETATM 4360 O O   . HOH C 3 .   ? 26.092  62.707 34.520 1.00 53.23 ? 937 HOH A O   1 
HETATM 4361 O O   . HOH C 3 .   ? -19.463 76.850 48.196 1.00 35.41 ? 938 HOH A O   1 
HETATM 4362 O O   . HOH C 3 .   ? 28.906  38.738 58.542 1.00 53.90 ? 939 HOH A O   1 
HETATM 4363 O O   . HOH C 3 .   ? 27.828  53.389 50.128 1.00 31.36 ? 940 HOH A O   1 
HETATM 4364 O O   . HOH C 3 .   ? -6.165  96.981 49.337 1.00 59.09 ? 941 HOH A O   1 
HETATM 4365 O O   . HOH C 3 .   ? -15.585 65.209 36.965 1.00 51.74 ? 942 HOH A O   1 
HETATM 4366 O O   . HOH C 3 .   ? 5.353   46.973 75.858 1.00 39.24 ? 943 HOH A O   1 
HETATM 4367 O O   . HOH C 3 .   ? 24.756  82.668 44.243 1.00 24.32 ? 944 HOH A O   1 
HETATM 4368 O O   . HOH C 3 .   ? -18.139 78.095 63.896 1.00 52.34 ? 945 HOH A O   1 
HETATM 4369 O O   . HOH C 3 .   ? 18.075  84.519 48.581 1.00 30.26 ? 946 HOH A O   1 
HETATM 4370 O O   . HOH C 3 .   ? -19.090 86.896 52.167 1.00 62.72 ? 947 HOH A O   1 
HETATM 4371 O O   . HOH C 3 .   ? 24.550  73.261 37.964 1.00 46.00 ? 948 HOH A O   1 
HETATM 4372 O O   . HOH C 3 .   ? 23.125  79.500 61.766 1.00 39.75 ? 949 HOH A O   1 
HETATM 4373 O O   . HOH C 3 .   ? 0.891   83.591 69.350 1.00 49.79 ? 950 HOH A O   1 
HETATM 4374 O O   . HOH C 3 .   ? 10.829  83.769 72.307 1.00 47.89 ? 951 HOH A O   1 
HETATM 4375 O O   . HOH C 3 .   ? -7.202  41.001 66.736 1.00 31.43 ? 952 HOH A O   1 
HETATM 4376 O O   . HOH C 3 .   ? 6.768   76.609 29.465 1.00 58.28 ? 953 HOH A O   1 
HETATM 4377 O O   . HOH C 3 .   ? 26.207  68.408 59.447 1.00 40.61 ? 954 HOH A O   1 
HETATM 4378 O O   . HOH C 3 .   ? 25.364  81.723 62.663 1.00 70.60 ? 955 HOH A O   1 
HETATM 4379 O O   . HOH C 3 .   ? -21.538 69.706 47.849 1.00 41.11 ? 956 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 ?   ?   ?   A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MF2 1   700 700 MF2 MF2 A . 
C 3 HOH 1   800 800 HOH HOH A . 
C 3 HOH 2   801 801 HOH HOH A . 
C 3 HOH 3   802 802 HOH HOH A . 
C 3 HOH 4   803 803 HOH HOH A . 
C 3 HOH 5   804 804 HOH HOH A . 
C 3 HOH 6   805 805 HOH HOH A . 
C 3 HOH 7   806 806 HOH HOH A . 
C 3 HOH 8   807 807 HOH HOH A . 
C 3 HOH 9   808 808 HOH HOH A . 
C 3 HOH 10  809 809 HOH HOH A . 
C 3 HOH 11  810 810 HOH HOH A . 
C 3 HOH 12  811 811 HOH HOH A . 
C 3 HOH 13  812 812 HOH HOH A . 
C 3 HOH 14  813 813 HOH HOH A . 
C 3 HOH 15  814 814 HOH HOH A . 
C 3 HOH 16  815 815 HOH HOH A . 
C 3 HOH 17  816 816 HOH HOH A . 
C 3 HOH 18  817 817 HOH HOH A . 
C 3 HOH 19  818 818 HOH HOH A . 
C 3 HOH 20  819 819 HOH HOH A . 
C 3 HOH 21  820 820 HOH HOH A . 
C 3 HOH 22  821 821 HOH HOH A . 
C 3 HOH 23  822 822 HOH HOH A . 
C 3 HOH 24  823 823 HOH HOH A . 
C 3 HOH 25  824 824 HOH HOH A . 
C 3 HOH 26  825 825 HOH HOH A . 
C 3 HOH 27  826 826 HOH HOH A . 
C 3 HOH 28  827 827 HOH HOH A . 
C 3 HOH 29  828 828 HOH HOH A . 
C 3 HOH 30  829 829 HOH HOH A . 
C 3 HOH 31  830 830 HOH HOH A . 
C 3 HOH 32  831 831 HOH HOH A . 
C 3 HOH 33  832 832 HOH HOH A . 
C 3 HOH 34  833 833 HOH HOH A . 
C 3 HOH 35  834 834 HOH HOH A . 
C 3 HOH 36  835 835 HOH HOH A . 
C 3 HOH 37  836 836 HOH HOH A . 
C 3 HOH 38  837 837 HOH HOH A . 
C 3 HOH 39  838 838 HOH HOH A . 
C 3 HOH 40  839 839 HOH HOH A . 
C 3 HOH 41  840 840 HOH HOH A . 
C 3 HOH 42  841 841 HOH HOH A . 
C 3 HOH 43  842 842 HOH HOH A . 
C 3 HOH 44  843 843 HOH HOH A . 
C 3 HOH 45  844 844 HOH HOH A . 
C 3 HOH 46  845 845 HOH HOH A . 
C 3 HOH 47  846 846 HOH HOH A . 
C 3 HOH 48  847 847 HOH HOH A . 
C 3 HOH 49  848 848 HOH HOH A . 
C 3 HOH 50  849 849 HOH HOH A . 
C 3 HOH 51  850 850 HOH HOH A . 
C 3 HOH 52  851 851 HOH HOH A . 
C 3 HOH 53  852 852 HOH HOH A . 
C 3 HOH 54  853 853 HOH HOH A . 
C 3 HOH 55  854 854 HOH HOH A . 
C 3 HOH 56  855 855 HOH HOH A . 
C 3 HOH 57  856 856 HOH HOH A . 
C 3 HOH 58  857 857 HOH HOH A . 
C 3 HOH 59  858 858 HOH HOH A . 
C 3 HOH 60  859 859 HOH HOH A . 
C 3 HOH 61  860 860 HOH HOH A . 
C 3 HOH 62  861 861 HOH HOH A . 
C 3 HOH 63  862 862 HOH HOH A . 
C 3 HOH 64  863 863 HOH HOH A . 
C 3 HOH 65  864 864 HOH HOH A . 
C 3 HOH 66  865 865 HOH HOH A . 
C 3 HOH 67  866 866 HOH HOH A . 
C 3 HOH 68  867 867 HOH HOH A . 
C 3 HOH 69  868 868 HOH HOH A . 
C 3 HOH 70  869 869 HOH HOH A . 
C 3 HOH 71  870 870 HOH HOH A . 
C 3 HOH 72  871 871 HOH HOH A . 
C 3 HOH 73  872 872 HOH HOH A . 
C 3 HOH 74  873 873 HOH HOH A . 
C 3 HOH 75  874 874 HOH HOH A . 
C 3 HOH 76  875 875 HOH HOH A . 
C 3 HOH 77  876 876 HOH HOH A . 
C 3 HOH 78  877 877 HOH HOH A . 
C 3 HOH 79  878 878 HOH HOH A . 
C 3 HOH 80  879 879 HOH HOH A . 
C 3 HOH 81  880 880 HOH HOH A . 
C 3 HOH 82  881 881 HOH HOH A . 
C 3 HOH 83  882 882 HOH HOH A . 
C 3 HOH 84  883 883 HOH HOH A . 
C 3 HOH 85  884 884 HOH HOH A . 
C 3 HOH 86  885 885 HOH HOH A . 
C 3 HOH 87  886 886 HOH HOH A . 
C 3 HOH 88  887 887 HOH HOH A . 
C 3 HOH 89  888 888 HOH HOH A . 
C 3 HOH 90  889 889 HOH HOH A . 
C 3 HOH 91  890 890 HOH HOH A . 
C 3 HOH 92  891 891 HOH HOH A . 
C 3 HOH 93  892 892 HOH HOH A . 
C 3 HOH 94  893 893 HOH HOH A . 
C 3 HOH 95  894 894 HOH HOH A . 
C 3 HOH 96  895 895 HOH HOH A . 
C 3 HOH 97  896 896 HOH HOH A . 
C 3 HOH 98  897 897 HOH HOH A . 
C 3 HOH 99  898 898 HOH HOH A . 
C 3 HOH 100 899 899 HOH HOH A . 
C 3 HOH 101 900 900 HOH HOH A . 
C 3 HOH 102 901 901 HOH HOH A . 
C 3 HOH 103 902 902 HOH HOH A . 
C 3 HOH 104 903 903 HOH HOH A . 
C 3 HOH 105 904 904 HOH HOH A . 
C 3 HOH 106 905 905 HOH HOH A . 
C 3 HOH 107 906 906 HOH HOH A . 
C 3 HOH 108 907 907 HOH HOH A . 
C 3 HOH 109 908 908 HOH HOH A . 
C 3 HOH 110 909 909 HOH HOH A . 
C 3 HOH 111 910 910 HOH HOH A . 
C 3 HOH 112 911 911 HOH HOH A . 
C 3 HOH 113 912 912 HOH HOH A . 
C 3 HOH 114 913 913 HOH HOH A . 
C 3 HOH 115 914 914 HOH HOH A . 
C 3 HOH 116 915 915 HOH HOH A . 
C 3 HOH 117 916 916 HOH HOH A . 
C 3 HOH 118 917 917 HOH HOH A . 
C 3 HOH 119 918 918 HOH HOH A . 
C 3 HOH 120 919 919 HOH HOH A . 
C 3 HOH 121 920 920 HOH HOH A . 
C 3 HOH 122 921 921 HOH HOH A . 
C 3 HOH 123 922 922 HOH HOH A . 
C 3 HOH 124 923 923 HOH HOH A . 
C 3 HOH 125 924 924 HOH HOH A . 
C 3 HOH 126 925 925 HOH HOH A . 
C 3 HOH 127 926 926 HOH HOH A . 
C 3 HOH 128 927 927 HOH HOH A . 
C 3 HOH 129 928 928 HOH HOH A . 
C 3 HOH 130 929 929 HOH HOH A . 
C 3 HOH 131 930 930 HOH HOH A . 
C 3 HOH 132 931 931 HOH HOH A . 
C 3 HOH 133 932 932 HOH HOH A . 
C 3 HOH 134 933 933 HOH HOH A . 
C 3 HOH 135 934 934 HOH HOH A . 
C 3 HOH 136 935 935 HOH HOH A . 
C 3 HOH 137 936 936 HOH HOH A . 
C 3 HOH 138 937 937 HOH HOH A . 
C 3 HOH 139 938 938 HOH HOH A . 
C 3 HOH 140 939 939 HOH HOH A . 
C 3 HOH 141 940 940 HOH HOH A . 
C 3 HOH 142 941 941 HOH HOH A . 
C 3 HOH 143 942 942 HOH HOH A . 
C 3 HOH 144 943 943 HOH HOH A . 
C 3 HOH 145 944 944 HOH HOH A . 
C 3 HOH 146 945 945 HOH HOH A . 
C 3 HOH 147 946 946 HOH HOH A . 
C 3 HOH 148 947 947 HOH HOH A . 
C 3 HOH 149 948 948 HOH HOH A . 
C 3 HOH 150 949 949 HOH HOH A . 
C 3 HOH 151 950 950 HOH HOH A . 
C 3 HOH 152 951 951 HOH HOH A . 
C 3 HOH 153 952 952 HOH HOH A . 
C 3 HOH 154 953 953 HOH HOH A . 
C 3 HOH 155 954 954 HOH HOH A . 
C 3 HOH 156 955 955 HOH HOH A . 
C 3 HOH 157 956 956 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3240  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  36970 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.3900000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-05-18 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-06-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_struct_assembly         
2 4 'Structure model' pdbx_struct_assembly_gen     
3 4 'Structure model' pdbx_struct_assembly_prop    
4 4 'Structure model' pdbx_struct_oper_list        
5 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
6 4 'Structure model' struct_conn                  
7 4 'Structure model' struct_site                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_struct_assembly.details'             
2  4 'Structure model' '_pdbx_struct_assembly.method_details'      
3  4 'Structure model' '_pdbx_struct_assembly.oligomeric_count'    
4  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
5  4 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 
6  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
7  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'           
8  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'            
9  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'          
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'          
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'          
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'           
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'           
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'          
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'          
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'           
19 4 'Structure model' '_struct_site.pdbx_auth_asym_id'            
20 4 'Structure model' '_struct_site.pdbx_auth_comp_id'            
21 4 'Structure model' '_struct_site.pdbx_auth_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
X-PLOR    refinement       . ? 4 
X-PLOR    phasing          . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 40.29   73.53   
2  1 PRO A 39  ? ? -76.72  42.07   
3  1 PHE A 45  ? ? 86.16   -20.29  
4  1 ALA A 60  ? ? -113.34 57.77   
5  1 GLU A 73  ? ? -143.30 26.46   
6  1 PHE A 78  ? ? -26.78  114.79  
7  1 LEU A 95  ? ? -65.26  93.96   
8  1 SER A 108 ? ? -179.96 84.53   
9  1 PHE A 120 ? ? 67.41   -1.86   
10 1 TYR A 137 ? ? -59.54  -76.60  
11 1 GLU A 140 ? ? 71.30   31.12   
12 1 PHE A 155 ? ? -150.88 -3.29   
13 1 ALA A 157 ? ? -107.96 71.18   
14 1 ALA A 164 ? ? -151.31 80.80   
15 1 PRO A 191 ? ? -54.76  -4.52   
16 1 SER A 200 ? ? 46.69   -118.52 
17 1 ARG A 220 ? ? -99.41  -64.53  
18 1 ASN A 230 ? ? -88.16  30.35   
19 1 SER A 291 ? ? -60.11  -79.39  
20 1 GLU A 299 ? ? -117.86 -74.42  
21 1 THR A 317 ? ? -162.06 -152.93 
22 1 SER A 345 ? ? 37.46   51.17   
23 1 VAL A 360 ? ? -112.14 74.15   
24 1 TRP A 378 ? ? -69.98  7.84    
25 1 ASP A 380 ? ? -167.97 48.19   
26 1 ASP A 381 ? ? -56.83  0.60    
27 1 VAL A 400 ? ? -129.79 -65.49  
28 1 THR A 412 ? ? -58.29  59.82   
29 1 LYS A 413 ? ? -169.59 10.07   
30 1 PHE A 414 ? ? -159.18 -21.01  
31 1 GLU A 455 ? ? -36.79  -17.53  
32 1 ASN A 457 ? ? 59.48   87.60   
33 1 LYS A 498 ? ? -86.98  -79.64  
34 1 GLN A 500 ? ? -69.64  64.61   
35 1 THR A 507 ? ? -59.93  -3.84   
36 1 MET A 510 ? ? -35.35  134.12  
37 1 HIS A 513 ? ? -117.74 -168.06 
38 1 ARG A 515 ? ? 83.37   65.16   
39 1 ARG A 517 ? ? 26.75   63.11   
40 1 GLN A 526 ? ? -131.00 -54.65  
41 1 LEU A 532 ? ? -54.45  -9.27   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A PRO 485 ? A PRO 485 
5  1 Y 1 A HIS 486 ? A HIS 486 
6  1 Y 1 A SER 487 ? A SER 487 
7  1 Y 1 A GLN 488 ? A GLN 488 
8  1 Y 1 A GLU 489 ? A GLU 489 
9  1 Y 1 A ALA 536 ? A ALA 536 
10 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 CIS-2,6-DIMETHYLMORPHOLINOOCTYLCARBAMYLESEROLINE MF2 
3 water                                            HOH 
#