data_1ODC
# 
_entry.id   1ODC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ODC         
PDBE  EBI-12137    
WWPDB D_1290012137 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 2J3D unspecified 'NATIVE MONOCLINIC FORM OF TORPEDO ACETYLCHOLINESTERASE' 
PDB 2VQ6 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2WG0 unspecified 'AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (OBTAINED BY IN CRYSTALLO AGING)' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 2J3Q unspecified 'TORPEDO ACETYLCHOLINESTERASE COMPLEXED WITH FLUOROPHORE THIOFLAVIN T' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 2J4F unspecified 'TORPEDO ACETYLCHOLINESTERASE - HG HEAVY-ATOM DERIVATIVE' 
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 2VJC unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 150K
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VJB unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET D AT 100K
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2WFZ unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN' 
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2VJD unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET C AT 150K
;
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 2WG1 unspecified 'TERNARY COMPLEX OF THE AGED CONJUGATE OF TORPEDO CALIFORNICA ACEYLCHOLINESTERASE WITH SOMAN AND 2-PAM' 
PDB 2VT6 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 9400000 GY' 
PDB 2W9I unspecified 'ACHE IN COMPLEX WITH METHYLENE BLUE' 
PDB 2WG2 unspecified 'NON-AGED CONJUGATE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE WITH SOMAN (ALTERNATIVE REFINEMENT)' 
PDB 2VT7 unspecified 'NATIVE TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COLLECTED WITH A CUMULATED DOSE OF 800000 GY' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2W6C unspecified 'ACHE IN COMPLEX WITH A BIS-(-)-NOR- MEPTAZINOL DERIVATIVE' 
PDB 2VJA unspecified 
;TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N- TRIMETHYLPENTANAMINIUM - ORTHORHOMBIC SPACE GROUP - DATASET A AT 100K
;
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 2V96 unspecified 
'STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AT 100K' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2VA9 unspecified 
;STRUCTURE OF NATIVE TCACHE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE DURING THE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 2V98 unspecified 
;STRUCTURE OF THE COMPLEX OF TCACHE WITH 1 -(2-NITROPHENYL)-2,2,2-TRIFLUOROETHYL- ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE, DURING HTE FIRST 5 SECONDS OF WHICH LASER IRRADIATION AT 266NM TOOK PLACE
;
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 2VB4 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH 2-PAM' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 2V97 unspecified 
;STRUCTURE OF THE UNPHOTOLYSED COMPLEX OF TCACHE WITH 1-(2-NITROPHENYL)-2,2,2- TRIFLUOROETHYL-ARSENOCHOLINE AFTER A 9 SECONDS ANNEALING TO ROOM TEMPERATURE
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ODC 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-02-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wong, D.M.'       1 
'Greenblatt, H.M.' 2 
'Carlier, P.R.'    3 
'Han, Y.-F.'       4 
'Pang, Y.-P.'      5 
'Silman, I.'       6 
'Sussman, J.L.'    7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Complexes of Alkylene-Linked Tacrine Dimers with Torpedo Californica Acetylcholinesterase: Binding of Bis(5)-Tacrine Produces a Dramatic Rearrangement in the Active-Site Gorge.
;
J.Med.Chem.                  49  5491 ? 2006 JMCMAR US 0022-2623 0151 ? 16942022 10.1021/JM060164B       
1       
;Acetylcholinesterase Complexed with Bivalent Ligands Related to Huperzine A: Experimental Evidence for Species-Dependent Protein-Ligand Complementarity
;
J.Am.Chem.Soc.               125 363  ? 2003 JACSAT US 0002-7863 0004 ? 12517147 10.1021/JA021111W       
2       'Heterodimeric Tacrine-Based Acetylcholinesterase Inhibitors: Investigating Ligand-Peripheral Site Interactions' 
J.Med.Chem.                  42  4225 ? 1999 JMCMAR US 0022-2623 0151 ? 10514292 10.1021/JM990224W       
3       'Prediction of the Binding Sites of Huperzine a in Acetylcholinesterase by Docking Studies' 'J. Comput. Aided Mol. Des.' 8 
669  ? 1994 ?      NE 0920-654X ?    ? 7738603  10.1007/BF00124014      
4       'Quaternary Ligand Binding to Aromatic Residues in the Active-Site Gorge of Acetylcholinesterase' Proc.Natl.Acad.Sci.USA 
90  9031 ? 1993 PNASA6 US 0027-8424 0040 ? 8415649  10.1073/PNAS.90.19.9031 
5       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ? 1991 SCIEAS US 0036-8075 0038 ? 1678899  10.1126/SCIENCE.1678899 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rydberg, E.H.'      1  ? 
primary 'Brumshtein, B.'     2  ? 
primary 'Greenblatt, H.M.'   3  ? 
primary 'Wong, D.M.'         4  ? 
primary 'Shaya, D.'          5  ? 
primary 'Williams, L.D.'     6  ? 
primary 'Carlier, P.R.'      7  ? 
primary 'Pang, Y.-P.'        8  ? 
primary 'Silman, I.'         9  ? 
primary 'Sussman, J.L.'      10 ? 
1       'Wong, D.M.'         11 ? 
1       'Greenblatt, H.M.'   12 ? 
1       'Dvir, H.'           13 ? 
1       'Carlier, P.R.'      14 ? 
1       'Han, Y.-F.'         15 ? 
1       'Pang, Y.-P.'        16 ? 
1       'Silman, I.'         17 ? 
1       'Sussman, J.L.'      18 ? 
2       'Carlier, P.R.'      19 ? 
2       'Chow, E.S.-H.'      20 ? 
2       'Han, Y.-F.'         21 ? 
2       'Liu, J.'            22 ? 
2       'El Yazal, J.'       23 ? 
2       'Pang, Y.-P.'        24 ? 
3       'Pang, Y.-P.'        25 ? 
3       'Kozikowski, A.P.'   26 ? 
4       'Harel, M.'          27 ? 
4       'Schalk, I.'         28 ? 
4       'Ehret-Sabatier, L.' 29 ? 
4       'Bouet, F.'          30 ? 
4       'Goeldner, M.'       31 ? 
4       'Hirth, C.'          32 ? 
4       'Axelsen, P.H.'      33 ? 
4       'Silman, I.'         34 ? 
4       'Sussman, J.L.'      35 ? 
5       'Sussman, J.L.'      36 ? 
5       'Harel, M.'          37 ? 
5       'Frolow, F.'         38 ? 
5       'Oefner, C.'         39 ? 
5       'Goldman, A.'        40 ? 
5       'Toker, L.'          41 ? 
5       'Silman, I.'         42 ? 
# 
_cell.entry_id           1ODC 
_cell.length_a           111.487 
_cell.length_b           111.487 
_cell.length_c           136.744 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ODC 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                    61325.090 1   3.1.1.7 ? ? 
'INTER-MONOMER DISULFIDE BRIDGE' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                221.208   2   ?       ? ? ? 
3 non-polymer syn "N-QUINOLIN-4-YL-N'-(1,2,3,4-TETRAHYDROACRIDIN-9-YL)OCTANE-1,8-DIAMINE" 452.634   1   ?       ? ? ? 
4 water       nat water                                                                   18.015    153 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    
;SYNTHETIC HETEROBIVALENT TACRINE-BASED DIMER, A8B (N-4'-QUINOLYL-N'-9"-(1", 2", 3", 4" -TETRAHYDROACRIDINYL)-1, 8-DIAMINOOCTANE) DIHYDROCHLORIDE WITH THE TACRINE MOIETY BOUND TO THE 'ANIONIC' SUBSITE, NEAR THE BOTTOM OF THE ACTIVE SITE GORGE, AND THE 4-AMINOQUINOLINE MOIETY BOUND TO THE 'PERIPHERAL' ANIONIC SITE (PAS) AT THE TOP OF THE GORGE OF TCACHE, BOTH IN A DOUBLE-STACKING SANDWICH. THE LIGAND, A8B, THUS BINDS BY SPANNING THE ACTIVE-SITE GORGE.
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ODC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A8B non-polymer                  . "N-QUINOLIN-4-YL-N'-(1,2,3,4-TETRAHYDROACRIDIN-9-YL)OCTANE-1,8-DIAMINE" 
'TACRINE(8)-4-AMINOQUINOLINE' 'C30 H36 N4'     452.634 
ALA 'L-peptide linking'          y ALANINE                                                                 ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'          y ARGININE                                                                ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                              ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                         ? 'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                ? 'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                               ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                         ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'            y GLYCINE                                                                 ? 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                               ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                  . WATER                                                                   ? 'H2 O'           
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                              ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                 ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'          y LYSINE                                                                  ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'          y METHIONINE                                                              ? 'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                           ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'          y PROLINE                                                                 ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'          y SERINE                                                                  ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'          y THREONINE                                                               ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                              ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'          y VALINE                                                                  ? 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          1ODC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.06 
_exptl_crystal.density_percent_sol   69.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLISED FROM 28-33% V/V PEG 200 0.5M MES PH 5.8 AT 4 DEG. CELSIUS; THEN SOAKED IN MOTHER LIQUOR (40% V/V PEG 200 IN 0.1 M MES BUFFER, PH 5.8) CONTAINING 1MM N-4'-QUINOLYL-N'-9"-(1",2", 3",4"-TETRAHYDROACRIDINYL)-1,8-DIAMINOOCTANE DIHYRDOCHLORIDE FOR ONE DAY.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2000-10-15 
_diffrn_detector.details                'OSMIC BLUE CONFOCAL MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1ODC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   50284 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.04900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.1000 
_reflns.B_iso_Wilson_estimate        26.4 
_reflns.pdbx_redundancy              0.350 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.28700 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        9.81 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1ODC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49443 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2034289.24 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.12 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    98.3 
_refine.ls_R_factor_obs                          0.1991 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1991 
_refine.ls_R_factor_R_free                       0.2401 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2428 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               35.2 
_refine.aniso_B[1][1]                            7.03 
_refine.aniso_B[2][2]                            7.03 
_refine.aniso_B[3][3]                            -14.04 
_refine.aniso_B[1][2]                            3.07 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.38 
_refine.solvent_model_param_bsol                 51.6 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;SEVERAL RESIDUES ARE NOT SEEN IN THE CRYSTAL STRUCTURE, DUE TO DISORDER. THESE INCLUDE ASP 1, ASP 2, HIS 3 AND THE C-TERMINAL RESIDUES AFTER ALA 536. SEVERAL RESIDUES MISSING IN CHAIN BREAK, FROM HIS 486 - GLU 489 (INCLUSIVE). TWO WATER MOLECULES WERE FITTED WITH 0.75 OCCUPANCIES EACH (HOH Z 152 AND HOH Z 153).
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1ODC 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.14 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4178 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             153 
_refine_hist.number_atoms_total               4393 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        29.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.020 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.27  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.233 1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.811 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.153 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.994 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.28 
_refine_ls_shell.number_reflns_R_work             4544 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               96.1 
_refine_ls_shell.R_factor_R_free                  0.226 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             225 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 A8B_1.PAR          A8B.TOP          
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 4 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 5 CIS_PEPTIDE.PARAM  ?                
# 
_struct.entry_id                  1ODC 
_struct.title                     
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9"-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ODC 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, SERINE HYDROLASE, NEUROTRANSMITTER CLEAVAGE, ALZHEIMER'S DISEASE, BIVALENT LIGAND, DUAL-SITE BINDING, INHIBITOR, SERINE ESTERASE SYNAPSE, NERVE, MUSCLE, GPI-ANCHOR NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.076 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 1536 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 416 A NAG 1537 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          1ODC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ODC 
_atom_sites.fract_transf_matrix[1][1]   0.008970 
_atom_sites.fract_transf_matrix[1][2]   0.005179 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010357 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007313 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.322 87.549 34.370 1.00 49.32 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.672 87.827 35.701 1.00 49.54 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.508 86.894 36.059 1.00 47.32 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.552 85.692 35.845 1.00 47.49 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.683 87.765 36.856 1.00 49.26 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.005 87.958 38.112 1.00 52.24 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.479 87.495 36.630 1.00 45.33 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.295  86.803 37.078 1.00 44.02 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.639  85.759 38.164 1.00 42.57 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.946  84.752 38.284 1.00 40.87 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.325  87.831 37.633 1.00 43.98 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -7.077  87.265 38.212 1.00 49.72 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.908  88.205 38.063 1.00 51.20 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -6.136  89.369 37.690 1.00 54.62 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.761  87.790 38.303 1.00 53.25 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.703 86.013 38.933 1.00 38.84 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.105 85.132 40.012 1.00 38.07 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.099 84.051 39.618 1.00 37.21 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.544 83.256 40.456 1.00 38.23 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.677 85.961 41.184 1.00 35.68 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.723 86.978 41.827 1.00 36.35 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.441 87.655 43.055 1.00 34.70 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.408  86.271 42.323 1.00 35.26 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.441 83.998 38.348 1.00 37.89 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.377 82.987 37.906 1.00 38.46 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.659 81.994 37.019 1.00 37.86 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.003 82.367 36.044 1.00 36.54 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.519 83.619 37.132 1.00 41.76 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.568 82.623 36.672 1.00 44.27 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.326 82.094 37.911 1.00 46.11 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.527 83.329 35.696 1.00 46.82 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.761 80.717 37.355 1.00 36.49 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.093 79.731 36.525 1.00 35.58 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.053 78.596 36.244 1.00 34.41 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.707 78.103 37.127 1.00 35.09 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.828 79.181 37.243 1.00 36.58 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.269 77.977 36.495 1.00 33.62 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.768  80.294 37.370 1.00 33.39 ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.134 78.190 35.000 1.00 34.59 ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.995 77.091 34.640 1.00 35.80 ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.181 75.798 34.594 1.00 34.57 ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.194 75.724 33.890 1.00 35.55 ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.642 77.322 33.281 1.00 36.60 ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.782 76.325 33.041 1.00 44.17 ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.292 75.708 34.010 1.00 44.93 ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.199 76.155 31.765 1.00 45.06 ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.562 74.785 35.354 1.00 33.41 ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.791 73.546 35.301 1.00 32.60 ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.677 72.471 34.686 1.00 33.67 ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.865 72.722 34.452 1.00 33.62 ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.387 73.050 36.718 1.00 32.19 ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.540 72.506 37.371 1.00 28.56 ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.802 74.199 37.578 1.00 28.35 ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.114 71.276 34.443 1.00 33.44 ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.889 70.151 33.907 1.00 33.81 ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.969 69.758 34.919 1.00 34.25 ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.937 69.095 34.557 1.00 34.70 ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.980 68.932 33.627 1.00 34.18 ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.884 69.197 32.553 1.00 32.92 ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.759 68.187 32.622 1.00 30.80 ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.820  68.280 31.390 1.00 27.90 ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.654  67.284 31.498 1.00 29.41 ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.817 70.141 36.185 1.00 33.82 ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.855 69.787 37.173 1.00 36.14 ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.892 70.871 37.474 1.00 35.76 ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.880 70.619 38.192 1.00 34.20 ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.229 69.330 38.506 1.00 36.75 ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.714 68.021 38.326 1.00 40.97 ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.688 72.060 36.913 1.00 36.39 ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.615 73.162 37.169 1.00 36.61 ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.841 74.455 37.317 1.00 36.10 ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.612 74.418 37.245 1.00 35.97 ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.526 75.582 37.513 1.00 36.01 ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.835 76.885 37.657 1.00 37.31 ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.543 77.160 39.109 1.00 36.82 ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.291 76.777 39.995 1.00 35.98 ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.680 78.041 37.104 1.00 39.21 ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -18.771 77.570 36.136 1.00 44.94 ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.692 78.137 34.704 1.00 48.79 ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.040 79.626 34.604 1.00 50.08 ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -19.849 79.923 33.373 1.00 51.05 ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.442 77.822 39.373 1.00 37.61 ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.120 78.129 40.752 1.00 37.75 ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.756 79.606 40.804 1.00 37.36 ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -14.216 80.149 39.821 1.00 35.05 ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.956 77.206 41.282 1.00 38.93 ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.694 77.385 40.496 1.00 39.19 ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.682 77.543 42.689 1.00 43.12 ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -15.105 80.249 41.924 1.00 36.66 ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.857 81.671 42.140 1.00 37.64 ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.900 81.829 43.306 1.00 36.81 ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -14.202 81.471 44.467 1.00 35.75 ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -16.185 82.422 42.445 1.00 41.16 ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.073 83.980 42.654 1.00 46.11 ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.534 84.885 41.132 1.00 54.09 ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -15.133 86.616 41.847 1.00 54.51 ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.735 82.371 43.000 1.00 36.02 ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.764 82.547 44.059 1.00 37.47 ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.866 83.897 44.742 1.00 38.68 ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.853 84.626 44.589 1.00 38.35 ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.825 84.230 45.487 1.00 39.37 ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.777 85.488 46.208 1.00 40.85 ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -9.403  86.093 46.053 1.00 40.69 ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -8.411  85.376 45.880 1.00 39.43 ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -11.045 85.300 47.701 1.00 41.71 ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.903 86.571 48.348 1.00 42.91 ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.004 84.317 48.326 1.00 42.80 ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -9.326  87.412 46.118 1.00 41.04 ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -8.037  88.064 45.946 1.00 43.55 ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -7.368  88.240 47.306 1.00 43.24 ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -8.005  88.662 48.251 1.00 42.44 ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -8.204  89.400 45.221 1.00 45.99 ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -7.160  90.412 45.628 1.00 52.25 ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.974  91.533 44.620 1.00 58.31 ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.884  91.228 43.687 1.00 64.14 ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -5.151  92.139 43.034 1.00 65.22 ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.391  93.445 43.217 1.00 64.97 ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -4.175  91.732 42.207 1.00 63.63 ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -6.089  87.889 47.423 1.00 42.60 ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -5.458  88.021 48.727 1.00 43.19 ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -4.230  88.853 48.680 1.00 41.29 ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.470  88.785 47.733 1.00 41.68 ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -5.057  86.637 49.383 1.00 44.50 ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.239  85.710 49.412 1.00 43.89 ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.900  86.008 48.634 1.00 44.19 ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -4.012  89.653 49.730 1.00 41.88 ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.820  90.509 49.783 1.00 41.60 ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.615  89.651 50.194 1.00 41.31 ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.766  88.684 50.970 1.00 41.92 ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -3.196  91.570 50.827 1.00 40.62 ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -4.045  90.808 51.778 1.00 42.98 ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.879  89.849 50.908 1.00 41.42 ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? -0.442  89.994 49.660 1.00 39.98 ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 0.803   89.288 49.958 1.00 39.73 ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 1.951   90.244 49.788 1.00 39.94 ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.176   90.733 48.689 1.00 38.73 ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.122   88.141 48.936 1.00 39.86 ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.232   87.239 49.493 1.00 36.38 ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? -0.094  87.391 48.606 1.00 39.94 ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.706   90.480 50.850 1.00 42.23 ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 3.867   91.379 50.780 1.00 43.67 ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.598   92.683 49.973 1.00 44.35 ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.346   93.051 49.050 1.00 43.93 ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.043   90.591 50.199 1.00 43.56 ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.402   89.360 51.054 1.00 44.37 ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.490   88.552 50.365 1.00 43.37 ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.852   89.819 52.470 1.00 44.28 ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 2.503   93.343 50.352 1.00 45.25 ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.020   94.596 49.754 1.00 46.93 ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 1.662   94.514 48.251 1.00 46.22 ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 1.721   95.512 47.530 1.00 46.98 ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 3.014   95.740 50.016 1.00 46.05 ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 4.049   95.672 49.073 1.00 48.14 ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.292   93.314 47.794 1.00 45.53 ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 0.826   93.079 46.428 1.00 42.58 ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.352  92.121 46.583 1.00 41.92 ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.955  92.040 47.666 1.00 38.61 ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 1.929   92.493 45.558 1.00 44.69 ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.483   92.230 44.242 1.00 45.61 ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.702  91.381 45.538 1.00 41.08 ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.848  90.500 45.673 1.00 42.08 ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.782  89.331 44.711 1.00 41.57 ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -1.094  89.406 43.680 1.00 39.25 ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -3.170  91.241 45.354 1.00 46.15 ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.467  92.429 46.231 1.00 52.90 ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.135  93.726 45.876 1.00 55.31 ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.167  92.529 47.396 1.00 54.96 ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.626  94.568 46.775 1.00 56.34 ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.258  93.867 47.707 1.00 56.25 ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -2.524  88.268 45.041 1.00 39.17 ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -2.640  87.111 44.157 1.00 39.84 ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -4.004  86.524 44.369 1.00 38.52 ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.717  86.938 45.269 1.00 38.61 ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -1.575  86.017 44.397 1.00 38.97 ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.637  85.506 45.808 1.00 41.21 ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? -0.203  86.564 44.126 1.00 41.37 ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.687  84.367 46.003 1.00 44.53 ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -4.368  85.565 43.534 1.00 37.26 ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -5.677  84.932 43.649 1.00 36.78 ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -5.548  83.632 44.440 1.00 36.44 ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -4.512  82.942 44.345 1.00 37.78 ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -6.226  84.587 42.263 1.00 36.28 ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.820  85.520 41.277 1.00 37.48 ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.599  83.298 45.190 1.00 35.02 ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.650  82.074 45.969 1.00 33.93 ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.979  81.412 45.713 1.00 33.91 ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -9.026  82.075 45.667 1.00 32.18 ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -6.479  82.342 47.487 1.00 34.08 ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.926  80.100 45.496 1.00 32.36 ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -9.132  79.322 45.256 1.00 32.21 ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -9.063  78.300 46.358 1.00 32.46 ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.346  77.299 46.245 1.00 31.99 ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -9.077  78.661 43.882 1.00 31.10 ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -9.025  79.651 42.749 1.00 32.36 ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.798  80.207 42.354 1.00 32.93 ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -10.209 80.066 42.117 1.00 30.52 ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.723  81.158 41.351 1.00 33.22 ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -10.179 81.025 41.105 1.00 30.08 ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.930  81.582 40.710 1.00 35.01 ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.766  78.598 47.438 1.00 32.66 ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.766  77.783 48.636 1.00 33.90 ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.970 76.871 48.714 1.00 34.46 ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -12.074 77.255 48.322 1.00 35.32 ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.746  78.696 49.869 1.00 33.27 ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.727  79.837 49.781 1.00 33.73 ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.742  80.656 51.079 1.00 33.48 ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -7.321  79.262 49.541 1.00 32.98 ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.751 75.663 49.232 1.00 34.18 ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.844 74.712 49.395 1.00 32.49 ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.469 74.130 48.129 1.00 31.95 ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.690 73.983 48.078 1.00 31.81 ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.677 73.821 47.104 1.00 30.07 ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -12.268 73.222 45.915 1.00 31.90 ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.449 71.716 46.228 1.00 31.92 ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.503 71.045 46.651 1.00 30.49 ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.355 73.362 44.670 1.00 31.18 ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -11.132 74.846 44.341 1.00 31.55 ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.978 72.574 43.505 1.00 30.65 ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -10.219 75.102 43.156 1.00 30.23 ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.654 71.179 46.012 1.00 32.40 ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.905 69.764 46.292 1.00 32.31 ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.312 68.841 45.208 1.00 32.60 ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.454 69.109 44.017 1.00 32.79 ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.431 69.704 46.355 1.00 33.60 ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.840 70.724 45.217 1.00 32.66 ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.882 71.873 45.528 1.00 34.17 ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.632 67.766 45.598 1.00 31.03 ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -12.072 66.885 44.558 1.00 30.99 ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.571 65.444 44.693 1.00 30.97 ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -12.291 64.615 43.844 1.00 31.45 ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.527 66.939 44.548 1.00 30.97 ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.882  66.396 45.808 1.00 28.73 ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.796  65.017 46.021 1.00 29.54 ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.453  67.274 46.817 1.00 27.02 ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.298  64.495 47.239 1.00 29.82 ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.940  66.774 48.058 1.00 28.40 ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.871  65.383 48.259 1.00 29.84 ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.350 65.178 45.741 1.00 30.21 ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.926 63.853 45.982 1.00 31.98 ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.342 64.030 46.562 1.00 33.77 ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.658 65.085 47.133 1.00 34.84 ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.057 63.070 47.012 1.00 28.14 ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.201 63.016 46.426 1.00 34.31 ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.518 63.086 47.053 1.00 34.76 ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.232 63.019 48.576 1.00 34.17 ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.248 62.406 48.994 1.00 32.80 ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.373 61.857 46.659 1.00 36.05 ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -19.091 61.987 45.275 1.00 38.45 ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.993 63.227 45.237 1.00 38.20 ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.866 63.298 46.095 1.00 39.50 ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.812 64.131 44.393 1.00 39.63 ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -18.080 63.650 49.414 1.00 35.30 ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.851 63.599 50.881 1.00 34.45 ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.813 62.117 51.353 1.00 34.71 ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.740 61.343 51.127 1.00 33.08 ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -19.032 64.397 51.447 1.00 34.54 ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -19.240 65.505 50.314 1.00 35.34 ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -19.167 64.608 49.059 1.00 35.24 ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.732 61.711 52.035 1.00 34.30 ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.680 60.299 52.455 1.00 34.07 ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.373 60.032 53.778 1.00 35.52 ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.765 59.629 54.777 1.00 35.69 ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.181 60.021 52.469 1.00 32.94 ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.623 61.306 52.972 1.00 33.02 ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.433 62.375 52.207 1.00 32.38 ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.677 60.254 53.756 1.00 37.09 ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.517 60.144 54.937 1.00 36.83 ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.483 58.959 54.878 1.00 37.84 ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.675 58.359 53.807 1.00 37.69 ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.288 61.474 55.086 1.00 37.51 ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.247 62.631 55.095 1.00 35.77 ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.255 61.694 53.850 1.00 35.65 ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.044 58.613 56.039 1.00 37.09 ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -21.995 57.522 56.132 1.00 37.99 ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.436 56.186 55.675 1.00 39.42 ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.395 55.712 56.166 1.00 40.03 ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.135 55.555 54.746 1.00 38.71 ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.692 54.290 54.203 1.00 40.34 ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.366 54.464 53.483 1.00 38.54 ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.706 53.492 53.197 1.00 39.56 ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.733 53.749 53.207 1.00 46.30 ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.638 52.669 53.815 1.00 52.19 ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -24.203 52.844 54.915 1.00 54.59 ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -23.793 51.538 53.088 1.00 55.99 ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -19.980 55.686 53.155 1.00 37.59 ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.705 55.883 52.450 1.00 38.67 ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.471 55.926 53.385 1.00 36.10 ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.334 55.960 52.907 1.00 34.21 ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.738 57.178 51.620 1.00 41.89 ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.835 57.229 50.592 1.00 47.69 ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.467 55.954 49.417 1.00 57.05 ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -18.399 57.094 48.246 1.00 54.94 ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.684 55.977 54.702 1.00 34.74 ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.538 56.006 55.641 1.00 32.52 ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.725 54.725 55.476 1.00 32.67 ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.281 53.616 55.404 1.00 33.21 ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.018 56.168 57.099 1.00 33.04 ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -15.884 56.124 58.170 1.00 32.10 ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.465 56.022 59.599 1.00 31.87 ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.106 57.270 60.058 1.00 30.50 ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.775 57.372 61.202 1.00 30.66 ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.912 56.296 61.995 1.00 31.53 ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.253 58.550 61.597 1.00 29.11 ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.416 54.895 55.358 1.00 30.59 ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.448 53.810 55.189 1.00 32.63 ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.284 53.346 53.754 1.00 32.47 ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.323 52.620 53.434 1.00 32.27 ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.750 52.573 56.073 1.00 33.18 ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -14.004 52.890 57.527 1.00 33.56 ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -13.072 53.586 58.281 1.00 34.56 ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -15.153 52.412 58.157 1.00 33.60 ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.275 53.801 59.663 1.00 34.49 ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.377 52.616 59.517 1.00 34.79 ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.432 53.315 60.283 1.00 35.15 ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.179 53.776 52.871 1.00 33.67 ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.059 53.366 51.464 1.00 35.27 ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.124 54.238 50.621 1.00 34.43 ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -12.789 55.370 50.993 1.00 29.94 ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.418 53.399 50.755 1.00 40.10 ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.418 52.392 51.242 1.00 45.83 ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.647 52.409 50.328 1.00 51.86 ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -18.643 51.511 50.899 1.00 59.03 ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -19.950 51.543 50.652 1.00 60.91 ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -20.743 50.656 51.268 1.00 61.44 ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -20.460 52.443 49.797 1.00 61.59 ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -12.722 53.683 49.477 1.00 32.97 ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -11.924 54.416 48.519 1.00 34.72 ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.713 55.705 48.194 1.00 33.20 ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -13.944 55.704 48.236 1.00 30.10 ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.772 53.578 47.255 1.00 38.17 ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -10.922 52.377 47.500 1.00 46.81 ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -11.118 51.333 46.412 1.00 52.63 ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -10.531 50.053 46.833 1.00 58.37 ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -9.238  49.765 46.700 1.00 59.25 ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -8.418  50.669 46.163 1.00 60.68 ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -8.771  48.571 47.057 1.00 59.90 ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.014 56.808 47.857 1.00 32.02 ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.758 58.031 47.546 1.00 31.12 ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.397 57.875 46.171 1.00 32.25 ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.923 57.093 45.374 1.00 28.80 ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.663 59.106 47.468 1.00 31.97 ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.480 58.322 46.843 1.00 30.22 ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.552 56.997 47.656 1.00 31.65 ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.462 58.624 45.917 1.00 33.20 ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.124 58.643 44.613 1.00 35.19 ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -14.936 60.084 44.095 1.00 33.75 ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -14.974 61.047 44.861 1.00 31.87 ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.638 58.364 44.733 1.00 38.28 ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.006 56.930 45.184 1.00 44.97 ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.411 55.808 44.277 1.00 50.06 ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -16.004 56.093 43.127 1.00 50.24 ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -16.363 54.623 44.716 1.00 53.07 ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.790 60.243 42.780 1.00 32.23 ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.604 61.580 42.203 1.00 31.70 ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.796 62.500 42.477 1.00 32.74 ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.918 62.036 42.540 1.00 32.15 ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.391 61.302 40.719 1.00 31.78 ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -15.203 60.003 40.489 1.00 33.41 ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.995 59.188 41.760 1.00 31.17 ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.543 63.799 42.665 1.00 31.95 ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.612 64.758 42.953 1.00 33.90 ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.557 64.901 41.743 1.00 35.36 ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -17.096 65.042 40.613 1.00 33.37 ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -15.986 66.109 43.287 1.00 34.19 ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -16.970 67.248 43.447 1.00 33.89 ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -17.947 67.018 44.604 1.00 34.97 ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.796 68.284 44.892 1.00 34.72 ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.720 68.035 46.051 1.00 36.79 ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.873 64.797 41.947 1.00 36.81 ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.785 64.968 40.798 1.00 36.41 ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.705 66.420 40.308 1.00 35.89 ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.710 67.359 41.117 1.00 34.59 ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -21.216 64.639 41.199 1.00 38.76 ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.421 63.169 41.567 1.00 43.07 ? 52   LYS A CG  1 
ATOM   375  N N   . PRO A 1 53  ? -19.630 66.631 38.978 1.00 36.15 ? 53   PRO A N   1 
ATOM   376  C CA  . PRO A 1 53  ? -19.553 68.024 38.515 1.00 36.60 ? 53   PRO A CA  1 
ATOM   377  C C   . PRO A 1 53  ? -20.769 68.805 39.023 1.00 37.43 ? 53   PRO A C   1 
ATOM   378  O O   . PRO A 1 53  ? -21.839 68.226 39.250 1.00 35.79 ? 53   PRO A O   1 
ATOM   379  C CB  . PRO A 1 53  ? -19.507 67.892 36.992 1.00 37.37 ? 53   PRO A CB  1 
ATOM   380  C CG  . PRO A 1 53  ? -18.896 66.495 36.791 1.00 37.00 ? 53   PRO A CG  1 
ATOM   381  C CD  . PRO A 1 53  ? -19.624 65.693 37.841 1.00 35.55 ? 53   PRO A CD  1 
ATOM   382  N N   . TRP A 1 54  ? -20.582 70.104 39.235 1.00 37.53 ? 54   TRP A N   1 
ATOM   383  C CA  . TRP A 1 54  ? -21.661 70.953 39.723 1.00 39.58 ? 54   TRP A CA  1 
ATOM   384  C C   . TRP A 1 54  ? -22.013 72.036 38.696 1.00 41.40 ? 54   TRP A C   1 
ATOM   385  O O   . TRP A 1 54  ? -21.158 72.469 37.908 1.00 41.65 ? 54   TRP A O   1 
ATOM   386  C CB  . TRP A 1 54  ? -21.261 71.613 41.058 1.00 38.42 ? 54   TRP A CB  1 
ATOM   387  C CG  . TRP A 1 54  ? -20.038 72.450 40.938 1.00 36.56 ? 54   TRP A CG  1 
ATOM   388  C CD1 . TRP A 1 54  ? -19.963 73.742 40.485 1.00 36.79 ? 54   TRP A CD1 1 
ATOM   389  C CD2 . TRP A 1 54  ? -18.697 72.014 41.134 1.00 35.36 ? 54   TRP A CD2 1 
ATOM   390  N NE1 . TRP A 1 54  ? -18.640 74.135 40.376 1.00 36.22 ? 54   TRP A NE1 1 
ATOM   391  C CE2 . TRP A 1 54  ? -17.843 73.093 40.769 1.00 36.02 ? 54   TRP A CE2 1 
ATOM   392  C CE3 . TRP A 1 54  ? -18.122 70.818 41.583 1.00 36.18 ? 54   TRP A CE3 1 
ATOM   393  C CZ2 . TRP A 1 54  ? -16.455 73.003 40.840 1.00 34.32 ? 54   TRP A CZ2 1 
ATOM   394  C CZ3 . TRP A 1 54  ? -16.733 70.728 41.657 1.00 33.88 ? 54   TRP A CZ3 1 
ATOM   395  C CH2 . TRP A 1 54  ? -15.916 71.820 41.283 1.00 35.75 ? 54   TRP A CH2 1 
ATOM   396  N N   . SER A 1 55  ? -23.270 72.479 38.684 1.00 41.80 ? 55   SER A N   1 
ATOM   397  C CA  . SER A 1 55  ? -23.608 73.545 37.756 1.00 43.27 ? 55   SER A CA  1 
ATOM   398  C C   . SER A 1 55  ? -23.471 74.800 38.626 1.00 42.44 ? 55   SER A C   1 
ATOM   399  O O   . SER A 1 55  ? -23.290 74.703 39.831 1.00 41.66 ? 55   SER A O   1 
ATOM   400  C CB  . SER A 1 55  ? -25.027 73.377 37.221 1.00 45.01 ? 55   SER A CB  1 
ATOM   401  O OG  . SER A 1 55  ? -25.962 73.534 38.272 1.00 48.63 ? 55   SER A OG  1 
ATOM   402  N N   . GLY A 1 56  ? -23.499 75.978 38.035 1.00 42.52 ? 56   GLY A N   1 
ATOM   403  C CA  . GLY A 1 56  ? -23.352 77.155 38.876 1.00 41.41 ? 56   GLY A CA  1 
ATOM   404  C C   . GLY A 1 56  ? -21.904 77.449 39.236 1.00 41.43 ? 56   GLY A C   1 
ATOM   405  O O   . GLY A 1 56  ? -20.947 76.910 38.637 1.00 39.78 ? 56   GLY A O   1 
ATOM   406  N N   . VAL A 1 57  ? -21.741 78.290 40.245 1.00 39.81 ? 57   VAL A N   1 
ATOM   407  C CA  . VAL A 1 57  ? -20.419 78.712 40.646 1.00 39.45 ? 57   VAL A CA  1 
ATOM   408  C C   . VAL A 1 57  ? -20.029 78.316 42.067 1.00 39.50 ? 57   VAL A C   1 
ATOM   409  O O   . VAL A 1 57  ? -20.688 78.716 43.036 1.00 37.47 ? 57   VAL A O   1 
ATOM   410  C CB  . VAL A 1 57  ? -20.293 80.231 40.473 1.00 40.01 ? 57   VAL A CB  1 
ATOM   411  C CG1 . VAL A 1 57  ? -18.946 80.709 41.056 1.00 39.20 ? 57   VAL A CG1 1 
ATOM   412  C CG2 . VAL A 1 57  ? -20.412 80.576 38.953 1.00 37.92 ? 57   VAL A CG2 1 
ATOM   413  N N   . TRP A 1 58  ? -18.958 77.522 42.176 1.00 37.25 ? 58   TRP A N   1 
ATOM   414  C CA  . TRP A 1 58  ? -18.512 77.073 43.484 1.00 36.54 ? 58   TRP A CA  1 
ATOM   415  C C   . TRP A 1 58  ? -17.779 78.216 44.145 1.00 35.66 ? 58   TRP A C   1 
ATOM   416  O O   . TRP A 1 58  ? -16.850 78.796 43.575 1.00 34.91 ? 58   TRP A O   1 
ATOM   417  C CB  . TRP A 1 58  ? -17.591 75.837 43.384 1.00 34.67 ? 58   TRP A CB  1 
ATOM   418  C CG  . TRP A 1 58  ? -17.311 75.250 44.758 1.00 34.95 ? 58   TRP A CG  1 
ATOM   419  C CD1 . TRP A 1 58  ? -16.484 75.766 45.723 1.00 35.27 ? 58   TRP A CD1 1 
ATOM   420  C CD2 . TRP A 1 58  ? -17.967 74.120 45.360 1.00 34.19 ? 58   TRP A CD2 1 
ATOM   421  N NE1 . TRP A 1 58  ? -16.593 75.036 46.882 1.00 34.89 ? 58   TRP A NE1 1 
ATOM   422  C CE2 . TRP A 1 58  ? -17.494 74.019 46.688 1.00 34.00 ? 58   TRP A CE2 1 
ATOM   423  C CE3 . TRP A 1 58  ? -18.908 73.181 44.898 1.00 35.11 ? 58   TRP A CE3 1 
ATOM   424  C CZ2 . TRP A 1 58  ? -17.933 73.012 47.573 1.00 34.32 ? 58   TRP A CZ2 1 
ATOM   425  C CZ3 . TRP A 1 58  ? -19.347 72.174 45.775 1.00 35.92 ? 58   TRP A CZ3 1 
ATOM   426  C CH2 . TRP A 1 58  ? -18.857 72.105 47.099 1.00 34.38 ? 58   TRP A CH2 1 
ATOM   427  N N   . ASN A 1 59  ? -18.212 78.545 45.346 1.00 35.71 ? 59   ASN A N   1 
ATOM   428  C CA  . ASN A 1 59  ? -17.591 79.625 46.095 1.00 37.74 ? 59   ASN A CA  1 
ATOM   429  C C   . ASN A 1 59  ? -16.277 79.073 46.704 1.00 35.86 ? 59   ASN A C   1 
ATOM   430  O O   . ASN A 1 59  ? -16.340 78.248 47.591 1.00 35.65 ? 59   ASN A O   1 
ATOM   431  C CB  . ASN A 1 59  ? -18.547 80.074 47.212 1.00 41.19 ? 59   ASN A CB  1 
ATOM   432  C CG  . ASN A 1 59  ? -18.035 81.292 47.980 1.00 46.67 ? 59   ASN A CG  1 
ATOM   433  O OD1 . ASN A 1 59  ? -16.842 81.494 48.068 1.00 45.22 ? 59   ASN A OD1 1 
ATOM   434  N ND2 . ASN A 1 59  ? -18.944 82.092 48.546 1.00 54.00 ? 59   ASN A ND2 1 
ATOM   435  N N   . ALA A 1 60  ? -15.117 79.522 46.231 1.00 34.56 ? 60   ALA A N   1 
ATOM   436  C CA  . ALA A 1 60  ? -13.824 79.056 46.764 1.00 34.24 ? 60   ALA A CA  1 
ATOM   437  C C   . ALA A 1 60  ? -13.115 80.226 47.405 1.00 34.61 ? 60   ALA A C   1 
ATOM   438  O O   . ALA A 1 60  ? -11.917 80.446 47.173 1.00 34.20 ? 60   ALA A O   1 
ATOM   439  C CB  . ALA A 1 60  ? -12.942 78.537 45.641 1.00 33.51 ? 60   ALA A CB  1 
ATOM   440  N N   . SER A 1 61  ? -13.826 80.994 48.211 1.00 34.09 ? 61   SER A N   1 
ATOM   441  C CA  . SER A 1 61  ? -13.194 82.172 48.806 1.00 34.68 ? 61   SER A CA  1 
ATOM   442  C C   . SER A 1 61  ? -12.765 81.900 50.229 1.00 34.21 ? 61   SER A C   1 
ATOM   443  O O   . SER A 1 61  ? -12.160 82.753 50.853 1.00 36.18 ? 61   SER A O   1 
ATOM   444  C CB  . SER A 1 61  ? -14.182 83.344 48.802 1.00 31.81 ? 61   SER A CB  1 
ATOM   445  O OG  . SER A 1 61  ? -15.248 83.002 49.687 1.00 33.35 ? 61   SER A OG  1 
ATOM   446  N N   . THR A 1 62  ? -13.117 80.737 50.764 1.00 34.87 ? 62   THR A N   1 
ATOM   447  C CA  . THR A 1 62  ? -12.752 80.434 52.148 1.00 36.63 ? 62   THR A CA  1 
ATOM   448  C C   . THR A 1 62  ? -12.220 79.016 52.378 1.00 35.64 ? 62   THR A C   1 
ATOM   449  O O   . THR A 1 62  ? -12.541 78.077 51.651 1.00 35.58 ? 62   THR A O   1 
ATOM   450  C CB  . THR A 1 62  ? -13.950 80.667 53.084 1.00 38.52 ? 62   THR A CB  1 
ATOM   451  O OG1 . THR A 1 62  ? -14.982 79.731 52.769 1.00 40.84 ? 62   THR A OG1 1 
ATOM   452  C CG2 . THR A 1 62  ? -14.537 82.071 52.858 1.00 41.30 ? 62   THR A CG2 1 
ATOM   453  N N   . TYR A 1 63  ? -11.378 78.873 53.391 1.00 34.23 ? 63   TYR A N   1 
ATOM   454  C CA  . TYR A 1 63  ? -10.810 77.573 53.716 1.00 32.16 ? 63   TYR A CA  1 
ATOM   455  C C   . TYR A 1 63  ? -11.885 76.552 54.016 1.00 32.06 ? 63   TYR A C   1 
ATOM   456  O O   . TYR A 1 63  ? -12.912 76.869 54.582 1.00 31.11 ? 63   TYR A O   1 
ATOM   457  C CB  . TYR A 1 63  ? -9.881  77.655 54.934 1.00 29.76 ? 63   TYR A CB  1 
ATOM   458  C CG  . TYR A 1 63  ? -8.460  78.064 54.583 1.00 30.67 ? 63   TYR A CG  1 
ATOM   459  C CD1 . TYR A 1 63  ? -7.824  77.547 53.447 1.00 30.68 ? 63   TYR A CD1 1 
ATOM   460  C CD2 . TYR A 1 63  ? -7.713  78.884 55.455 1.00 32.23 ? 63   TYR A CD2 1 
ATOM   461  C CE1 . TYR A 1 63  ? -6.480  77.822 53.191 1.00 29.77 ? 63   TYR A CE1 1 
ATOM   462  C CE2 . TYR A 1 63  ? -6.354  79.171 55.221 1.00 30.10 ? 63   TYR A CE2 1 
ATOM   463  C CZ  . TYR A 1 63  ? -5.761  78.633 54.098 1.00 30.57 ? 63   TYR A CZ  1 
ATOM   464  O OH  . TYR A 1 63  ? -4.460  78.898 53.891 1.00 29.64 ? 63   TYR A OH  1 
ATOM   465  N N   . PRO A 1 64  ? -11.651 75.302 53.619 1.00 30.04 ? 64   PRO A N   1 
ATOM   466  C CA  . PRO A 1 64  ? -12.592 74.224 53.861 1.00 30.04 ? 64   PRO A CA  1 
ATOM   467  C C   . PRO A 1 64  ? -12.408 73.725 55.313 1.00 29.56 ? 64   PRO A C   1 
ATOM   468  O O   . PRO A 1 64  ? -11.539 74.200 56.035 1.00 29.13 ? 64   PRO A O   1 
ATOM   469  C CB  . PRO A 1 64  ? -12.136 73.164 52.867 1.00 30.24 ? 64   PRO A CB  1 
ATOM   470  C CG  . PRO A 1 64  ? -10.625 73.321 52.929 1.00 29.57 ? 64   PRO A CG  1 
ATOM   471  C CD  . PRO A 1 64  ? -10.474 74.827 52.872 1.00 30.26 ? 64   PRO A CD  1 
ATOM   472  N N   . ASN A 1 65  ? -13.263 72.799 55.724 1.00 28.55 ? 65   ASN A N   1 
ATOM   473  C CA  . ASN A 1 65  ? -13.168 72.165 57.011 1.00 30.84 ? 65   ASN A CA  1 
ATOM   474  C C   . ASN A 1 65  ? -11.895 71.276 57.017 1.00 30.86 ? 65   ASN A C   1 
ATOM   475  O O   . ASN A 1 65  ? -11.417 70.842 55.966 1.00 32.00 ? 65   ASN A O   1 
ATOM   476  C CB  . ASN A 1 65  ? -14.351 71.215 57.198 1.00 34.09 ? 65   ASN A CB  1 
ATOM   477  C CG  . ASN A 1 65  ? -15.683 71.940 57.376 1.00 37.12 ? 65   ASN A CG  1 
ATOM   478  O OD1 . ASN A 1 65  ? -15.799 72.865 58.164 1.00 41.21 ? 65   ASN A OD1 1 
ATOM   479  N ND2 . ASN A 1 65  ? -16.690 71.498 56.643 1.00 38.41 ? 65   ASN A ND2 1 
ATOM   480  N N   . ASN A 1 66  ? -11.389 70.947 58.195 1.00 31.98 ? 66   ASN A N   1 
ATOM   481  C CA  . ASN A 1 66  ? -10.221 70.046 58.307 1.00 31.56 ? 66   ASN A CA  1 
ATOM   482  C C   . ASN A 1 66  ? -10.781 68.636 58.570 1.00 33.33 ? 66   ASN A C   1 
ATOM   483  O O   . ASN A 1 66  ? -11.910 68.509 59.091 1.00 33.98 ? 66   ASN A O   1 
ATOM   484  C CB  . ASN A 1 66  ? -9.365  70.455 59.493 1.00 29.68 ? 66   ASN A CB  1 
ATOM   485  C CG  . ASN A 1 66  ? -8.798  71.864 59.345 1.00 32.71 ? 66   ASN A CG  1 
ATOM   486  O OD1 . ASN A 1 66  ? -8.656  72.592 60.324 1.00 33.09 ? 66   ASN A OD1 1 
ATOM   487  N ND2 . ASN A 1 66  ? -8.457  72.239 58.123 1.00 30.59 ? 66   ASN A ND2 1 
ATOM   488  N N   . CYS A 1 67  ? -10.028 67.584 58.240 1.00 31.21 ? 67   CYS A N   1 
ATOM   489  C CA  . CYS A 1 67  ? -10.522 66.230 58.511 1.00 32.06 ? 67   CYS A CA  1 
ATOM   490  C C   . CYS A 1 67  ? -10.535 65.938 60.002 1.00 30.95 ? 67   CYS A C   1 
ATOM   491  O O   . CYS A 1 67  ? -9.788  66.555 60.761 1.00 31.30 ? 67   CYS A O   1 
ATOM   492  C CB  . CYS A 1 67  ? -9.669  65.173 57.794 1.00 30.40 ? 67   CYS A CB  1 
ATOM   493  S SG  . CYS A 1 67  ? -9.735  65.321 55.983 1.00 33.25 ? 67   CYS A SG  1 
ATOM   494  N N   . GLN A 1 68  ? -11.385 64.991 60.415 1.00 31.07 ? 68   GLN A N   1 
ATOM   495  C CA  . GLN A 1 68  ? -11.533 64.609 61.825 1.00 31.72 ? 68   GLN A CA  1 
ATOM   496  C C   . GLN A 1 68  ? -10.231 64.034 62.349 1.00 32.36 ? 68   GLN A C   1 
ATOM   497  O O   . GLN A 1 68  ? -9.666  63.110 61.731 1.00 32.06 ? 68   GLN A O   1 
ATOM   498  C CB  . GLN A 1 68  ? -12.652 63.576 61.999 1.00 31.49 ? 68   GLN A CB  1 
ATOM   499  C CG  . GLN A 1 68  ? -14.072 64.136 61.824 1.00 31.36 ? 68   GLN A CG  1 
ATOM   500  C CD  . GLN A 1 68  ? -14.577 64.930 63.029 1.00 33.34 ? 68   GLN A CD  1 
ATOM   501  O OE1 . GLN A 1 68  ? -15.733 65.380 63.055 1.00 35.23 ? 68   GLN A OE1 1 
ATOM   502  N NE2 . GLN A 1 68  ? -13.739 65.090 64.030 1.00 29.25 ? 68   GLN A NE2 1 
ATOM   503  N N   . GLN A 1 69  ? -9.774  64.580 63.479 1.00 31.82 ? 69   GLN A N   1 
ATOM   504  C CA  . GLN A 1 69  ? -8.518  64.164 64.097 1.00 31.04 ? 69   GLN A CA  1 
ATOM   505  C C   . GLN A 1 69  ? -8.378  64.483 65.603 1.00 31.15 ? 69   GLN A C   1 
ATOM   506  O O   . GLN A 1 69  ? -9.090  65.327 66.164 1.00 29.22 ? 69   GLN A O   1 
ATOM   507  C CB  . GLN A 1 69  ? -7.353  64.843 63.365 1.00 29.40 ? 69   GLN A CB  1 
ATOM   508  C CG  . GLN A 1 69  ? -7.476  66.368 63.335 1.00 28.28 ? 69   GLN A CG  1 
ATOM   509  C CD  . GLN A 1 69  ? -6.474  67.047 62.377 1.00 29.23 ? 69   GLN A CD  1 
ATOM   510  O OE1 . GLN A 1 69  ? -5.332  67.370 62.757 1.00 30.43 ? 69   GLN A OE1 1 
ATOM   511  N NE2 . GLN A 1 69  ? -6.905  67.265 61.121 1.00 25.52 ? 69   GLN A NE2 1 
ATOM   512  N N   . TYR A 1 70  ? -7.440  63.776 66.231 1.00 29.92 ? 70   TYR A N   1 
ATOM   513  C CA  . TYR A 1 70  ? -7.068  64.010 67.617 1.00 30.82 ? 70   TYR A CA  1 
ATOM   514  C C   . TYR A 1 70  ? -6.512  65.465 67.685 1.00 31.83 ? 70   TYR A C   1 
ATOM   515  O O   . TYR A 1 70  ? -5.812  65.902 66.776 1.00 31.16 ? 70   TYR A O   1 
ATOM   516  C CB  . TYR A 1 70  ? -5.937  63.066 67.990 1.00 31.05 ? 70   TYR A CB  1 
ATOM   517  C CG  . TYR A 1 70  ? -5.440  63.304 69.388 1.00 33.66 ? 70   TYR A CG  1 
ATOM   518  C CD1 . TYR A 1 70  ? -6.128  62.799 70.516 1.00 31.45 ? 70   TYR A CD1 1 
ATOM   519  C CD2 . TYR A 1 70  ? -4.243  63.991 69.591 1.00 33.08 ? 70   TYR A CD2 1 
ATOM   520  C CE1 . TYR A 1 70  ? -5.580  62.983 71.827 1.00 34.63 ? 70   TYR A CE1 1 
ATOM   521  C CE2 . TYR A 1 70  ? -3.719  64.182 70.869 1.00 34.52 ? 70   TYR A CE2 1 
ATOM   522  C CZ  . TYR A 1 70  ? -4.375  63.689 71.964 1.00 35.45 ? 70   TYR A CZ  1 
ATOM   523  O OH  . TYR A 1 70  ? -3.793  63.965 73.190 1.00 43.55 ? 70   TYR A OH  1 
ATOM   524  N N   . VAL A 1 71  ? -6.799  66.190 68.763 1.00 32.30 ? 71   VAL A N   1 
ATOM   525  C CA  . VAL A 1 71  ? -6.378  67.579 68.902 1.00 31.78 ? 71   VAL A CA  1 
ATOM   526  C C   . VAL A 1 71  ? -5.441  67.692 70.097 1.00 33.73 ? 71   VAL A C   1 
ATOM   527  O O   . VAL A 1 71  ? -5.777  67.274 71.218 1.00 33.56 ? 71   VAL A O   1 
ATOM   528  C CB  . VAL A 1 71  ? -7.616  68.504 69.115 1.00 31.31 ? 71   VAL A CB  1 
ATOM   529  C CG1 . VAL A 1 71  ? -7.198  69.920 69.534 1.00 31.12 ? 71   VAL A CG1 1 
ATOM   530  C CG2 . VAL A 1 71  ? -8.446  68.573 67.821 1.00 31.51 ? 71   VAL A CG2 1 
ATOM   531  N N   . ASP A 1 72  ? -4.272  68.273 69.853 1.00 33.83 ? 72   ASP A N   1 
ATOM   532  C CA  . ASP A 1 72  ? -3.244  68.462 70.880 1.00 34.54 ? 72   ASP A CA  1 
ATOM   533  C C   . ASP A 1 72  ? -3.674  69.514 71.903 1.00 33.69 ? 72   ASP A C   1 
ATOM   534  O O   . ASP A 1 72  ? -3.915  70.648 71.533 1.00 33.67 ? 72   ASP A O   1 
ATOM   535  C CB  . ASP A 1 72  ? -1.955  68.947 70.204 1.00 35.56 ? 72   ASP A CB  1 
ATOM   536  C CG  . ASP A 1 72  ? -0.789  69.037 71.164 1.00 37.67 ? 72   ASP A CG  1 
ATOM   537  O OD1 . ASP A 1 72  ? -0.998  69.035 72.394 1.00 37.24 ? 72   ASP A OD1 1 
ATOM   538  O OD2 . ASP A 1 72  ? 0.343   69.106 70.670 1.00 39.07 ? 72   ASP A OD2 1 
ATOM   539  N N   . GLU A 1 73  ? -3.764  69.133 73.176 1.00 34.26 ? 73   GLU A N   1 
ATOM   540  C CA  . GLU A 1 73  ? -4.123  70.055 74.257 1.00 33.87 ? 73   GLU A CA  1 
ATOM   541  C C   . GLU A 1 73  ? -3.011  70.070 75.346 1.00 33.72 ? 73   GLU A C   1 
ATOM   542  O O   . GLU A 1 73  ? -3.222  70.506 76.487 1.00 33.17 ? 73   GLU A O   1 
ATOM   543  C CB  . GLU A 1 73  ? -5.452  69.623 74.890 1.00 34.16 ? 73   GLU A CB  1 
ATOM   544  C CG  . GLU A 1 73  ? -6.645  69.822 73.982 1.00 37.25 ? 73   GLU A CG  1 
ATOM   545  C CD  . GLU A 1 73  ? -7.985  69.343 74.603 1.00 41.53 ? 73   GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 73  ? -8.257  69.545 75.822 1.00 41.19 ? 73   GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 73  ? -8.799  68.789 73.841 1.00 42.18 ? 73   GLU A OE2 1 
ATOM   548  N N   . GLN A 1 74  ? -1.832  69.591 75.008 1.00 33.62 ? 74   GLN A N   1 
ATOM   549  C CA  . GLN A 1 74  ? -0.770  69.542 76.014 1.00 35.18 ? 74   GLN A CA  1 
ATOM   550  C C   . GLN A 1 74  ? -0.321  70.915 76.531 1.00 33.84 ? 74   GLN A C   1 
ATOM   551  O O   . GLN A 1 74  ? -0.044  71.045 77.706 1.00 32.00 ? 74   GLN A O   1 
ATOM   552  C CB  . GLN A 1 74  ? 0.443   68.736 75.497 1.00 35.61 ? 74   GLN A CB  1 
ATOM   553  C CG  . GLN A 1 74  ? 0.269   67.179 75.540 1.00 41.75 ? 74   GLN A CG  1 
ATOM   554  C CD  . GLN A 1 74  ? -0.755  66.606 76.598 1.00 44.16 ? 74   GLN A CD  1 
ATOM   555  O OE1 . GLN A 1 74  ? -1.954  66.542 76.322 1.00 46.19 ? 74   GLN A OE1 1 
ATOM   556  N NE2 . GLN A 1 74  ? -0.263  66.175 77.788 1.00 43.98 ? 74   GLN A NE2 1 
ATOM   557  N N   . PHE A 1 75  ? -0.275  71.925 75.665 1.00 32.93 ? 75   PHE A N   1 
ATOM   558  C CA  . PHE A 1 75  ? 0.130   73.298 76.059 1.00 34.24 ? 75   PHE A CA  1 
ATOM   559  C C   . PHE A 1 75  ? -0.904  74.279 75.511 1.00 34.21 ? 75   PHE A C   1 
ATOM   560  O O   . PHE A 1 75  ? -0.627  75.005 74.570 1.00 32.97 ? 75   PHE A O   1 
ATOM   561  C CB  . PHE A 1 75  ? 1.509   73.617 75.469 1.00 32.52 ? 75   PHE A CB  1 
ATOM   562  C CG  . PHE A 1 75  ? 2.546   72.583 75.813 1.00 30.88 ? 75   PHE A CG  1 
ATOM   563  C CD1 . PHE A 1 75  ? 3.008   72.461 77.145 1.00 28.40 ? 75   PHE A CD1 1 
ATOM   564  C CD2 . PHE A 1 75  ? 3.003   71.683 74.837 1.00 29.91 ? 75   PHE A CD2 1 
ATOM   565  C CE1 . PHE A 1 75  ? 3.885   71.473 77.501 1.00 28.73 ? 75   PHE A CE1 1 
ATOM   566  C CE2 . PHE A 1 75  ? 3.906   70.658 75.180 1.00 31.75 ? 75   PHE A CE2 1 
ATOM   567  C CZ  . PHE A 1 75  ? 4.349   70.549 76.528 1.00 30.44 ? 75   PHE A CZ  1 
ATOM   568  N N   . PRO A 1 76  ? -2.109  74.305 76.111 1.00 35.81 ? 76   PRO A N   1 
ATOM   569  C CA  . PRO A 1 76  ? -3.227  75.165 75.710 1.00 37.24 ? 76   PRO A CA  1 
ATOM   570  C C   . PRO A 1 76  ? -2.798  76.586 75.414 1.00 39.07 ? 76   PRO A C   1 
ATOM   571  O O   . PRO A 1 76  ? -2.215  77.259 76.268 1.00 38.31 ? 76   PRO A O   1 
ATOM   572  C CB  . PRO A 1 76  ? -4.194  75.053 76.899 1.00 36.37 ? 76   PRO A CB  1 
ATOM   573  C CG  . PRO A 1 76  ? -3.920  73.680 77.407 1.00 34.09 ? 76   PRO A CG  1 
ATOM   574  C CD  . PRO A 1 76  ? -2.408  73.645 77.393 1.00 35.91 ? 76   PRO A CD  1 
ATOM   575  N N   . GLY A 1 77  ? -3.062  77.021 74.180 1.00 41.02 ? 77   GLY A N   1 
ATOM   576  C CA  . GLY A 1 77  ? -2.699  78.372 73.752 1.00 41.89 ? 77   GLY A CA  1 
ATOM   577  C C   . GLY A 1 77  ? -1.226  78.643 73.449 1.00 42.46 ? 77   GLY A C   1 
ATOM   578  O O   . GLY A 1 77  ? -0.838  79.776 73.074 1.00 44.59 ? 77   GLY A O   1 
ATOM   579  N N   . PHE A 1 78  ? -0.380  77.635 73.629 1.00 39.31 ? 78   PHE A N   1 
ATOM   580  C CA  . PHE A 1 78  ? 1.046   77.803 73.336 1.00 36.80 ? 78   PHE A CA  1 
ATOM   581  C C   . PHE A 1 78  ? 1.108   77.752 71.810 1.00 36.05 ? 78   PHE A C   1 
ATOM   582  O O   . PHE A 1 78  ? 0.663   76.787 71.202 1.00 33.82 ? 78   PHE A O   1 
ATOM   583  C CB  . PHE A 1 78  ? 1.828   76.645 73.982 1.00 35.72 ? 78   PHE A CB  1 
ATOM   584  C CG  . PHE A 1 78  ? 3.289   76.684 73.721 1.00 36.03 ? 78   PHE A CG  1 
ATOM   585  C CD1 . PHE A 1 78  ? 4.060   77.773 74.160 1.00 36.60 ? 78   PHE A CD1 1 
ATOM   586  C CD2 . PHE A 1 78  ? 3.906   75.646 73.033 1.00 35.25 ? 78   PHE A CD2 1 
ATOM   587  C CE1 . PHE A 1 78  ? 5.424   77.832 73.910 1.00 36.79 ? 78   PHE A CE1 1 
ATOM   588  C CE2 . PHE A 1 78  ? 5.272   75.677 72.773 1.00 36.26 ? 78   PHE A CE2 1 
ATOM   589  C CZ  . PHE A 1 78  ? 6.040   76.779 73.212 1.00 37.63 ? 78   PHE A CZ  1 
ATOM   590  N N   . SER A 1 79  ? 1.646   78.779 71.169 1.00 35.34 ? 79   SER A N   1 
ATOM   591  C CA  . SER A 1 79  ? 1.655   78.768 69.710 1.00 36.21 ? 79   SER A CA  1 
ATOM   592  C C   . SER A 1 79  ? 2.520   77.626 69.117 1.00 36.43 ? 79   SER A C   1 
ATOM   593  O O   . SER A 1 79  ? 2.237   77.147 68.009 1.00 34.66 ? 79   SER A O   1 
ATOM   594  C CB  . SER A 1 79  ? 2.144   80.109 69.162 1.00 34.04 ? 79   SER A CB  1 
ATOM   595  O OG  . SER A 1 79  ? 3.439   80.350 69.689 1.00 37.91 ? 79   SER A OG  1 
ATOM   596  N N   . GLY A 1 80  ? 3.552   77.207 69.864 1.00 34.67 ? 80   GLY A N   1 
ATOM   597  C CA  . GLY A 1 80  ? 4.438   76.158 69.389 1.00 34.13 ? 80   GLY A CA  1 
ATOM   598  C C   . GLY A 1 80  ? 3.699   74.887 69.027 1.00 33.27 ? 80   GLY A C   1 
ATOM   599  O O   . GLY A 1 80  ? 4.034   74.245 68.041 1.00 31.07 ? 80   GLY A O   1 
ATOM   600  N N   . SER A 1 81  ? 2.720   74.505 69.845 1.00 33.39 ? 81   SER A N   1 
ATOM   601  C CA  . SER A 1 81  ? 1.946   73.303 69.577 1.00 34.07 ? 81   SER A CA  1 
ATOM   602  C C   . SER A 1 81  ? 0.622   73.591 68.878 1.00 35.42 ? 81   SER A C   1 
ATOM   603  O O   . SER A 1 81  ? 0.164   72.774 68.058 1.00 34.82 ? 81   SER A O   1 
ATOM   604  C CB  . SER A 1 81  ? 1.674   72.533 70.862 1.00 34.41 ? 81   SER A CB  1 
ATOM   605  O OG  . SER A 1 81  ? 1.052   73.363 71.820 1.00 35.96 ? 81   SER A OG  1 
ATOM   606  N N   . GLU A 1 82  ? 0.002   74.736 69.154 1.00 33.58 ? 82   GLU A N   1 
ATOM   607  C CA  . GLU A 1 82  ? -1.287  74.971 68.507 1.00 36.07 ? 82   GLU A CA  1 
ATOM   608  C C   . GLU A 1 82  ? -1.218  75.293 67.017 1.00 34.16 ? 82   GLU A C   1 
ATOM   609  O O   . GLU A 1 82  ? -2.194  75.115 66.314 1.00 32.53 ? 82   GLU A O   1 
ATOM   610  C CB  . GLU A 1 82  ? -2.115  76.027 69.277 1.00 40.53 ? 82   GLU A CB  1 
ATOM   611  C CG  . GLU A 1 82  ? -3.405  75.352 69.845 1.00 46.53 ? 82   GLU A CG  1 
ATOM   612  C CD  . GLU A 1 82  ? -3.515  75.509 71.319 1.00 50.45 ? 82   GLU A CD  1 
ATOM   613  O OE1 . GLU A 1 82  ? -3.475  76.679 71.734 1.00 53.17 ? 82   GLU A OE1 1 
ATOM   614  O OE2 . GLU A 1 82  ? -3.638  74.487 72.064 1.00 54.79 ? 82   GLU A OE2 1 
ATOM   615  N N   . MET A 1 83  ? -0.037  75.706 66.542 1.00 32.40 ? 83   MET A N   1 
ATOM   616  C CA  . MET A 1 83  ? 0.153   76.000 65.134 1.00 32.16 ? 83   MET A CA  1 
ATOM   617  C C   . MET A 1 83  ? -0.038  74.738 64.263 1.00 32.20 ? 83   MET A C   1 
ATOM   618  O O   . MET A 1 83  ? -0.159  74.865 63.059 1.00 30.77 ? 83   MET A O   1 
ATOM   619  C CB  . MET A 1 83  ? 1.556   76.556 64.882 1.00 30.97 ? 83   MET A CB  1 
ATOM   620  C CG  . MET A 1 83  ? 2.678   75.546 65.115 1.00 33.29 ? 83   MET A CG  1 
ATOM   621  S SD  . MET A 1 83  ? 4.351   76.267 64.765 1.00 33.92 ? 83   MET A SD  1 
ATOM   622  C CE  . MET A 1 83  ? 4.409   76.133 62.949 1.00 32.08 ? 83   MET A CE  1 
ATOM   623  N N   . TRP A 1 84  ? -0.040  73.546 64.887 1.00 30.91 ? 84   TRP A N   1 
ATOM   624  C CA  . TRP A 1 84  ? -0.214  72.276 64.200 1.00 30.11 ? 84   TRP A CA  1 
ATOM   625  C C   . TRP A 1 84  ? -1.647  71.756 64.279 1.00 31.61 ? 84   TRP A C   1 
ATOM   626  O O   . TRP A 1 84  ? -2.019  70.899 63.494 1.00 31.58 ? 84   TRP A O   1 
ATOM   627  C CB  . TRP A 1 84  ? 0.717   71.198 64.794 1.00 30.24 ? 84   TRP A CB  1 
ATOM   628  C CG  . TRP A 1 84  ? 2.149   71.596 64.763 1.00 29.16 ? 84   TRP A CG  1 
ATOM   629  C CD1 . TRP A 1 84  ? 2.938   71.922 65.827 1.00 28.55 ? 84   TRP A CD1 1 
ATOM   630  C CD2 . TRP A 1 84  ? 2.949   71.760 63.595 1.00 27.97 ? 84   TRP A CD2 1 
ATOM   631  N NE1 . TRP A 1 84  ? 4.207   72.279 65.388 1.00 30.26 ? 84   TRP A NE1 1 
ATOM   632  C CE2 . TRP A 1 84  ? 4.235   72.189 64.020 1.00 29.17 ? 84   TRP A CE2 1 
ATOM   633  C CE3 . TRP A 1 84  ? 2.705   71.587 62.224 1.00 28.44 ? 84   TRP A CE3 1 
ATOM   634  C CZ2 . TRP A 1 84  ? 5.277   72.446 63.122 1.00 28.45 ? 84   TRP A CZ2 1 
ATOM   635  C CZ3 . TRP A 1 84  ? 3.757   71.845 61.312 1.00 27.20 ? 84   TRP A CZ3 1 
ATOM   636  C CH2 . TRP A 1 84  ? 5.020   72.268 61.777 1.00 26.92 ? 84   TRP A CH2 1 
ATOM   637  N N   . ASN A 1 85  ? -2.420  72.246 65.248 1.00 31.11 ? 85   ASN A N   1 
ATOM   638  C CA  . ASN A 1 85  ? -3.808  71.826 65.431 1.00 32.47 ? 85   ASN A CA  1 
ATOM   639  C C   . ASN A 1 85  ? -4.708  72.357 64.337 1.00 32.64 ? 85   ASN A C   1 
ATOM   640  O O   . ASN A 1 85  ? -4.405  73.362 63.717 1.00 34.11 ? 85   ASN A O   1 
ATOM   641  C CB  . ASN A 1 85  ? -4.386  72.345 66.757 1.00 33.37 ? 85   ASN A CB  1 
ATOM   642  C CG  . ASN A 1 85  ? -4.074  71.437 67.936 1.00 32.83 ? 85   ASN A CG  1 
ATOM   643  O OD1 . ASN A 1 85  ? -3.938  70.208 67.782 1.00 32.72 ? 85   ASN A OD1 1 
ATOM   644  N ND2 . ASN A 1 85  ? -3.982  72.038 69.136 1.00 31.08 ? 85   ASN A ND2 1 
ATOM   645  N N   . PRO A 1 86  ? -5.836  71.685 64.093 1.00 31.30 ? 86   PRO A N   1 
ATOM   646  C CA  . PRO A 1 86  ? -6.750  72.146 63.053 1.00 30.30 ? 86   PRO A CA  1 
ATOM   647  C C   . PRO A 1 86  ? -7.223  73.536 63.414 1.00 31.71 ? 86   PRO A C   1 
ATOM   648  O O   . PRO A 1 86  ? -7.480  73.795 64.588 1.00 29.46 ? 86   PRO A O   1 
ATOM   649  C CB  . PRO A 1 86  ? -7.875  71.111 63.073 1.00 30.14 ? 86   PRO A CB  1 
ATOM   650  C CG  . PRO A 1 86  ? -7.749  70.439 64.388 1.00 29.34 ? 86   PRO A CG  1 
ATOM   651  C CD  . PRO A 1 86  ? -6.309  70.455 64.741 1.00 28.39 ? 86   PRO A CD  1 
ATOM   652  N N   . ASN A 1 87  ? -7.283  74.434 62.417 1.00 30.08 ? 87   ASN A N   1 
ATOM   653  C CA  . ASN A 1 87  ? -7.703  75.797 62.672 1.00 32.62 ? 87   ASN A CA  1 
ATOM   654  C C   . ASN A 1 87  ? -9.063  76.056 61.979 1.00 34.04 ? 87   ASN A C   1 
ATOM   655  O O   . ASN A 1 87  ? -9.499  77.185 61.864 1.00 32.48 ? 87   ASN A O   1 
ATOM   656  C CB  . ASN A 1 87  ? -6.639  76.777 62.170 1.00 30.22 ? 87   ASN A CB  1 
ATOM   657  C CG  . ASN A 1 87  ? -6.398  76.620 60.709 1.00 34.44 ? 87   ASN A CG  1 
ATOM   658  O OD1 . ASN A 1 87  ? -6.841  75.641 60.098 1.00 36.04 ? 87   ASN A OD1 1 
ATOM   659  N ND2 . ASN A 1 87  ? -5.699  77.568 60.118 1.00 35.31 ? 87   ASN A ND2 1 
ATOM   660  N N   . ARG A 1 88  ? -9.719  74.992 61.530 1.00 34.49 ? 88   ARG A N   1 
ATOM   661  C CA  . ARG A 1 88  ? -11.045 75.109 60.939 1.00 37.19 ? 88   ARG A CA  1 
ATOM   662  C C   . ARG A 1 88  ? -11.888 74.107 61.691 1.00 37.37 ? 88   ARG A C   1 
ATOM   663  O O   . ARG A 1 88  ? -11.353 73.299 62.430 1.00 36.48 ? 88   ARG A O   1 
ATOM   664  C CB  . ARG A 1 88  ? -10.994 74.740 59.462 1.00 38.67 ? 88   ARG A CB  1 
ATOM   665  C CG  . ARG A 1 88  ? -10.292 75.825 58.674 1.00 42.91 ? 88   ARG A CG  1 
ATOM   666  C CD  . ARG A 1 88  ? -11.372 76.793 58.318 1.00 44.32 ? 88   ARG A CD  1 
ATOM   667  N NE  . ARG A 1 88  ? -10.962 78.127 58.589 1.00 47.63 ? 88   ARG A NE  1 
ATOM   668  C CZ  . ARG A 1 88  ? -11.623 79.184 58.168 1.00 48.64 ? 88   ARG A CZ  1 
ATOM   669  N NH1 . ARG A 1 88  ? -12.738 79.023 57.456 1.00 51.11 ? 88   ARG A NH1 1 
ATOM   670  N NH2 . ARG A 1 88  ? -11.143 80.388 58.434 1.00 50.82 ? 88   ARG A NH2 1 
ATOM   671  N N   . GLU A 1 89  ? -13.198 74.150 61.527 1.00 36.66 ? 89   GLU A N   1 
ATOM   672  C CA  . GLU A 1 89  ? -14.017 73.166 62.197 1.00 37.22 ? 89   GLU A CA  1 
ATOM   673  C C   . GLU A 1 89  ? -13.678 71.819 61.561 1.00 34.37 ? 89   GLU A C   1 
ATOM   674  O O   . GLU A 1 89  ? -13.299 71.744 60.389 1.00 33.70 ? 89   GLU A O   1 
ATOM   675  C CB  . GLU A 1 89  ? -15.507 73.468 61.996 1.00 42.45 ? 89   GLU A CB  1 
ATOM   676  C CG  . GLU A 1 89  ? -16.402 72.233 62.207 1.00 50.20 ? 89   GLU A CG  1 
ATOM   677  C CD  . GLU A 1 89  ? -17.876 72.432 61.753 1.00 55.95 ? 89   GLU A CD  1 
ATOM   678  O OE1 . GLU A 1 89  ? -18.592 71.392 61.549 1.00 59.16 ? 89   GLU A OE1 1 
ATOM   679  O OE2 . GLU A 1 89  ? -18.307 73.612 61.603 1.00 58.26 ? 89   GLU A OE2 1 
ATOM   680  N N   . MET A 1 90  ? -13.822 70.753 62.321 1.00 32.52 ? 90   MET A N   1 
ATOM   681  C CA  . MET A 1 90  ? -13.534 69.441 61.788 1.00 33.58 ? 90   MET A CA  1 
ATOM   682  C C   . MET A 1 90  ? -14.788 68.801 61.230 1.00 33.96 ? 90   MET A C   1 
ATOM   683  O O   . MET A 1 90  ? -15.900 69.019 61.731 1.00 34.01 ? 90   MET A O   1 
ATOM   684  C CB  . MET A 1 90  ? -12.938 68.541 62.876 1.00 33.22 ? 90   MET A CB  1 
ATOM   685  C CG  . MET A 1 90  ? -11.485 68.906 63.240 1.00 33.46 ? 90   MET A CG  1 
ATOM   686  S SD  . MET A 1 90  ? -10.750 67.747 64.420 1.00 32.07 ? 90   MET A SD  1 
ATOM   687  C CE  . MET A 1 90  ? -11.683 68.162 65.957 1.00 30.84 ? 90   MET A CE  1 
ATOM   688  N N   . SER A 1 91  ? -14.609 68.006 60.190 1.00 32.80 ? 91   SER A N   1 
ATOM   689  C CA  . SER A 1 91  ? -15.727 67.311 59.600 1.00 31.72 ? 91   SER A CA  1 
ATOM   690  C C   . SER A 1 91  ? -15.252 66.135 58.764 1.00 31.66 ? 91   SER A C   1 
ATOM   691  O O   . SER A 1 91  ? -14.145 66.188 58.193 1.00 31.43 ? 91   SER A O   1 
ATOM   692  C CB  . SER A 1 91  ? -16.522 68.269 58.706 1.00 30.39 ? 91   SER A CB  1 
ATOM   693  O OG  . SER A 1 91  ? -17.502 67.540 58.013 1.00 32.19 ? 91   SER A OG  1 
ATOM   694  N N   . GLU A 1 92  ? -16.057 65.074 58.678 1.00 29.55 ? 92   GLU A N   1 
ATOM   695  C CA  . GLU A 1 92  ? -15.652 63.995 57.779 1.00 29.84 ? 92   GLU A CA  1 
ATOM   696  C C   . GLU A 1 92  ? -15.739 64.482 56.349 1.00 30.81 ? 92   GLU A C   1 
ATOM   697  O O   . GLU A 1 92  ? -15.107 63.897 55.449 1.00 31.09 ? 92   GLU A O   1 
ATOM   698  C CB  . GLU A 1 92  ? -16.515 62.756 57.939 1.00 29.24 ? 92   GLU A CB  1 
ATOM   699  C CG  . GLU A 1 92  ? -16.083 61.879 59.085 1.00 29.32 ? 92   GLU A CG  1 
ATOM   700  C CD  . GLU A 1 92  ? -16.912 60.596 59.188 1.00 32.76 ? 92   GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 92  ? -18.022 60.664 59.778 1.00 33.84 ? 92   GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 92  ? -16.454 59.538 58.664 1.00 31.46 ? 92   GLU A OE2 1 
ATOM   703  N N   . ASP A 1 93  ? -16.512 65.559 56.131 1.00 30.58 ? 93   ASP A N   1 
ATOM   704  C CA  . ASP A 1 93  ? -16.660 66.127 54.792 1.00 32.69 ? 93   ASP A CA  1 
ATOM   705  C C   . ASP A 1 93  ? -15.443 67.037 54.714 1.00 31.97 ? 93   ASP A C   1 
ATOM   706  O O   . ASP A 1 93  ? -15.542 68.202 55.062 1.00 31.74 ? 93   ASP A O   1 
ATOM   707  C CB  . ASP A 1 93  ? -17.976 66.956 54.678 1.00 32.59 ? 93   ASP A CB  1 
ATOM   708  C CG  . ASP A 1 93  ? -18.131 67.659 53.298 1.00 35.35 ? 93   ASP A CG  1 
ATOM   709  O OD1 . ASP A 1 93  ? -17.206 67.649 52.436 1.00 34.97 ? 93   ASP A OD1 1 
ATOM   710  O OD2 . ASP A 1 93  ? -19.199 68.248 53.071 1.00 37.72 ? 93   ASP A OD2 1 
ATOM   711  N N   . CYS A 1 94  ? -14.310 66.517 54.238 1.00 30.68 ? 94   CYS A N   1 
ATOM   712  C CA  . CYS A 1 94  ? -13.110 67.337 54.265 1.00 30.89 ? 94   CYS A CA  1 
ATOM   713  C C   . CYS A 1 94  ? -12.204 67.161 53.085 1.00 32.11 ? 94   CYS A C   1 
ATOM   714  O O   . CYS A 1 94  ? -11.040 67.609 53.138 1.00 32.00 ? 94   CYS A O   1 
ATOM   715  C CB  . CYS A 1 94  ? -12.290 67.005 55.538 1.00 30.58 ? 94   CYS A CB  1 
ATOM   716  S SG  . CYS A 1 94  ? -11.769 65.237 55.575 1.00 30.59 ? 94   CYS A SG  1 
ATOM   717  N N   . LEU A 1 95  ? -12.679 66.506 52.031 1.00 30.67 ? 95   LEU A N   1 
ATOM   718  C CA  . LEU A 1 95  ? -11.779 66.315 50.915 1.00 30.54 ? 95   LEU A CA  1 
ATOM   719  C C   . LEU A 1 95  ? -11.778 67.486 49.918 1.00 30.91 ? 95   LEU A C   1 
ATOM   720  O O   . LEU A 1 95  ? -12.486 67.469 48.888 1.00 31.35 ? 95   LEU A O   1 
ATOM   721  C CB  . LEU A 1 95  ? -12.087 64.999 50.224 1.00 28.30 ? 95   LEU A CB  1 
ATOM   722  C CG  . LEU A 1 95  ? -11.766 63.826 51.118 1.00 31.25 ? 95   LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 95  ? -11.965 62.561 50.281 1.00 30.05 ? 95   LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 95  ? -10.307 63.932 51.707 1.00 27.99 ? 95   LEU A CD2 1 
ATOM   725  N N   . TYR A 1 96  ? -10.964 68.490 50.231 1.00 30.64 ? 96   TYR A N   1 
ATOM   726  C CA  . TYR A 1 96  ? -10.832 69.688 49.397 1.00 30.79 ? 96   TYR A CA  1 
ATOM   727  C C   . TYR A 1 96  ? -9.367  70.024 49.148 1.00 31.18 ? 96   TYR A C   1 
ATOM   728  O O   . TYR A 1 96  ? -8.463  69.532 49.837 1.00 31.95 ? 96   TYR A O   1 
ATOM   729  C CB  . TYR A 1 96  ? -11.510 70.897 50.083 1.00 31.38 ? 96   TYR A CB  1 
ATOM   730  C CG  . TYR A 1 96  ? -12.976 70.634 50.370 1.00 31.03 ? 96   TYR A CG  1 
ATOM   731  C CD1 . TYR A 1 96  ? -13.365 69.848 51.467 1.00 31.43 ? 96   TYR A CD1 1 
ATOM   732  C CD2 . TYR A 1 96  ? -13.959 71.101 49.509 1.00 30.00 ? 96   TYR A CD2 1 
ATOM   733  C CE1 . TYR A 1 96  ? -14.699 69.531 51.690 1.00 29.43 ? 96   TYR A CE1 1 
ATOM   734  C CE2 . TYR A 1 96  ? -15.313 70.797 49.714 1.00 30.65 ? 96   TYR A CE2 1 
ATOM   735  C CZ  . TYR A 1 96  ? -15.679 70.016 50.796 1.00 31.82 ? 96   TYR A CZ  1 
ATOM   736  O OH  . TYR A 1 96  ? -17.015 69.715 50.986 1.00 29.87 ? 96   TYR A OH  1 
ATOM   737  N N   . LEU A 1 97  ? -9.136  70.844 48.142 1.00 29.69 ? 97   LEU A N   1 
ATOM   738  C CA  . LEU A 1 97  ? -7.806  71.278 47.846 1.00 30.27 ? 97   LEU A CA  1 
ATOM   739  C C   . LEU A 1 97  ? -7.814  72.810 47.728 1.00 29.68 ? 97   LEU A C   1 
ATOM   740  O O   . LEU A 1 97  ? -8.854  73.416 47.488 1.00 30.67 ? 97   LEU A O   1 
ATOM   741  C CB  . LEU A 1 97  ? -7.278  70.568 46.585 1.00 28.65 ? 97   LEU A CB  1 
ATOM   742  C CG  . LEU A 1 97  ? -7.892  70.514 45.185 1.00 30.17 ? 97   LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 97  ? -7.647  71.798 44.423 1.00 29.08 ? 97   LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 97  ? -7.195  69.382 44.411 1.00 29.31 ? 97   LEU A CD2 1 
ATOM   745  N N   . ASN A 1 98  ? -6.659  73.425 47.900 1.00 28.97 ? 98   ASN A N   1 
ATOM   746  C CA  . ASN A 1 98  ? -6.523  74.875 47.816 1.00 29.65 ? 98   ASN A CA  1 
ATOM   747  C C   . ASN A 1 98  ? -5.477  75.221 46.761 1.00 30.96 ? 98   ASN A C   1 
ATOM   748  O O   . ASN A 1 98  ? -4.479  74.483 46.608 1.00 30.35 ? 98   ASN A O   1 
ATOM   749  C CB  . ASN A 1 98  ? -6.074  75.457 49.163 1.00 30.06 ? 98   ASN A CB  1 
ATOM   750  C CG  . ASN A 1 98  ? -6.885  74.925 50.312 1.00 33.56 ? 98   ASN A CG  1 
ATOM   751  O OD1 . ASN A 1 98  ? -8.106  75.150 50.396 1.00 31.39 ? 98   ASN A OD1 1 
ATOM   752  N ND2 . ASN A 1 98  ? -6.215  74.192 51.215 1.00 31.16 ? 98   ASN A ND2 1 
ATOM   753  N N   . ILE A 1 99  ? -5.713  76.329 46.038 1.00 30.19 ? 99   ILE A N   1 
ATOM   754  C CA  . ILE A 1 99  ? -4.806  76.781 45.007 1.00 30.81 ? 99   ILE A CA  1 
ATOM   755  C C   . ILE A 1 99  ? -4.429  78.284 45.088 1.00 32.74 ? 99   ILE A C   1 
ATOM   756  O O   . ILE A 1 99  ? -5.312  79.124 45.131 1.00 32.84 ? 99   ILE A O   1 
ATOM   757  C CB  . ILE A 1 99  ? -5.385  76.560 43.586 1.00 29.48 ? 99   ILE A CB  1 
ATOM   758  C CG1 . ILE A 1 99  ? -6.122  75.203 43.461 1.00 30.58 ? 99   ILE A CG1 1 
ATOM   759  C CG2 . ILE A 1 99  ? -4.226  76.631 42.588 1.00 29.09 ? 99   ILE A CG2 1 
ATOM   760  C CD1 . ILE A 1 99  ? -6.584  74.869 41.960 1.00 26.94 ? 99   ILE A CD1 1 
ATOM   761  N N   . TRP A 1 100 ? -3.136  78.614 45.105 1.00 31.52 ? 100  TRP A N   1 
ATOM   762  C CA  . TRP A 1 100 ? -2.733  80.024 45.086 1.00 32.16 ? 100  TRP A CA  1 
ATOM   763  C C   . TRP A 1 100 ? -2.176  80.228 43.674 1.00 32.74 ? 100  TRP A C   1 
ATOM   764  O O   . TRP A 1 100 ? -1.334  79.457 43.202 1.00 31.96 ? 100  TRP A O   1 
ATOM   765  C CB  . TRP A 1 100 ? -1.661  80.334 46.129 1.00 31.57 ? 100  TRP A CB  1 
ATOM   766  C CG  . TRP A 1 100 ? -2.228  80.465 47.519 1.00 33.47 ? 100  TRP A CG  1 
ATOM   767  C CD1 . TRP A 1 100 ? -2.660  81.595 48.131 1.00 31.84 ? 100  TRP A CD1 1 
ATOM   768  C CD2 . TRP A 1 100 ? -2.431  79.400 48.464 1.00 34.09 ? 100  TRP A CD2 1 
ATOM   769  N NE1 . TRP A 1 100 ? -3.117  81.317 49.404 1.00 31.99 ? 100  TRP A NE1 1 
ATOM   770  C CE2 . TRP A 1 100 ? -2.987  79.977 49.635 1.00 33.57 ? 100  TRP A CE2 1 
ATOM   771  C CE3 . TRP A 1 100 ? -2.192  78.024 48.436 1.00 34.87 ? 100  TRP A CE3 1 
ATOM   772  C CZ2 . TRP A 1 100 ? -3.309  79.223 50.760 1.00 33.79 ? 100  TRP A CZ2 1 
ATOM   773  C CZ3 . TRP A 1 100 ? -2.513  77.261 49.575 1.00 34.43 ? 100  TRP A CZ3 1 
ATOM   774  C CH2 . TRP A 1 100 ? -3.066  77.869 50.716 1.00 33.93 ? 100  TRP A CH2 1 
ATOM   775  N N   . VAL A 1 101 ? -2.666  81.260 43.007 1.00 33.07 ? 101  VAL A N   1 
ATOM   776  C CA  . VAL A 1 101 ? -2.295  81.542 41.632 1.00 33.64 ? 101  VAL A CA  1 
ATOM   777  C C   . VAL A 1 101 ? -1.731  82.952 41.461 1.00 33.84 ? 101  VAL A C   1 
ATOM   778  O O   . VAL A 1 101 ? -2.367  83.920 41.843 1.00 33.93 ? 101  VAL A O   1 
ATOM   779  C CB  . VAL A 1 101 ? -3.567  81.419 40.714 1.00 34.50 ? 101  VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 101 ? -3.246  81.811 39.256 1.00 29.87 ? 101  VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 101 ? -4.176  80.004 40.855 1.00 31.83 ? 101  VAL A CG2 1 
ATOM   782  N N   . PRO A 1 102 ? -0.531  83.073 40.877 1.00 34.94 ? 102  PRO A N   1 
ATOM   783  C CA  . PRO A 1 102 ? 0.056   84.408 40.667 1.00 34.92 ? 102  PRO A CA  1 
ATOM   784  C C   . PRO A 1 102 ? -0.938  85.295 39.892 1.00 37.10 ? 102  PRO A C   1 
ATOM   785  O O   . PRO A 1 102 ? -1.832  84.790 39.185 1.00 36.81 ? 102  PRO A O   1 
ATOM   786  C CB  . PRO A 1 102 ? 1.291   84.134 39.825 1.00 33.70 ? 102  PRO A CB  1 
ATOM   787  C CG  . PRO A 1 102 ? 1.729   82.718 40.269 1.00 34.92 ? 102  PRO A CG  1 
ATOM   788  C CD  . PRO A 1 102 ? 0.399   81.986 40.502 1.00 34.45 ? 102  PRO A CD  1 
ATOM   789  N N   . SER A 1 103 ? -0.765  86.613 40.028 1.00 37.70 ? 103  SER A N   1 
ATOM   790  C CA  . SER A 1 103 ? -1.596  87.591 39.343 1.00 38.57 ? 103  SER A CA  1 
ATOM   791  C C   . SER A 1 103 ? -0.664  88.522 38.610 1.00 38.93 ? 103  SER A C   1 
ATOM   792  O O   . SER A 1 103 ? 0.220   89.127 39.219 1.00 36.56 ? 103  SER A O   1 
ATOM   793  C CB  . SER A 1 103 ? -2.437  88.400 40.332 1.00 38.90 ? 103  SER A CB  1 
ATOM   794  O OG  . SER A 1 103 ? -3.283  89.300 39.619 1.00 39.79 ? 103  SER A OG  1 
ATOM   795  N N   . PRO A 1 104 ? -0.858  88.678 37.285 1.00 39.34 ? 104  PRO A N   1 
ATOM   796  C CA  . PRO A 1 104 ? -1.899  88.066 36.441 1.00 38.47 ? 104  PRO A CA  1 
ATOM   797  C C   . PRO A 1 104 ? -1.774  86.521 36.266 1.00 37.68 ? 104  PRO A C   1 
ATOM   798  O O   . PRO A 1 104 ? -0.680  85.970 36.327 1.00 36.55 ? 104  PRO A O   1 
ATOM   799  C CB  . PRO A 1 104 ? -1.740  88.814 35.109 1.00 38.31 ? 104  PRO A CB  1 
ATOM   800  C CG  . PRO A 1 104 ? -0.229  89.095 35.052 1.00 40.77 ? 104  PRO A CG  1 
ATOM   801  C CD  . PRO A 1 104 ? 0.074   89.515 36.495 1.00 38.44 ? 104  PRO A CD  1 
ATOM   802  N N   . ARG A 1 105 ? -2.908  85.857 36.014 1.00 36.36 ? 105  ARG A N   1 
ATOM   803  C CA  . ARG A 1 105 ? -2.959  84.397 35.851 1.00 35.89 ? 105  ARG A CA  1 
ATOM   804  C C   . ARG A 1 105 ? -1.923  83.885 34.883 1.00 36.16 ? 105  ARG A C   1 
ATOM   805  O O   . ARG A 1 105 ? -1.889  84.302 33.717 1.00 36.24 ? 105  ARG A O   1 
ATOM   806  C CB  . ARG A 1 105 ? -4.349  83.937 35.384 1.00 35.08 ? 105  ARG A CB  1 
ATOM   807  C CG  . ARG A 1 105 ? -4.518  82.394 35.415 1.00 34.26 ? 105  ARG A CG  1 
ATOM   808  C CD  . ARG A 1 105 ? -5.832  81.990 34.880 1.00 31.72 ? 105  ARG A CD  1 
ATOM   809  N NE  . ARG A 1 105 ? -6.925  82.553 35.656 1.00 35.07 ? 105  ARG A NE  1 
ATOM   810  C CZ  . ARG A 1 105 ? -8.167  82.620 35.190 1.00 35.16 ? 105  ARG A CZ  1 
ATOM   811  N NH1 . ARG A 1 105 ? -8.415  82.161 33.976 1.00 36.46 ? 105  ARG A NH1 1 
ATOM   812  N NH2 . ARG A 1 105 ? -9.152  83.133 35.901 1.00 34.14 ? 105  ARG A NH2 1 
ATOM   813  N N   . PRO A 1 106 ? -1.061  82.958 35.333 1.00 35.17 ? 106  PRO A N   1 
ATOM   814  C CA  . PRO A 1 106 ? -0.044  82.450 34.389 1.00 34.39 ? 106  PRO A CA  1 
ATOM   815  C C   . PRO A 1 106 ? -0.752  81.705 33.270 1.00 33.78 ? 106  PRO A C   1 
ATOM   816  O O   . PRO A 1 106 ? -1.962  81.465 33.343 1.00 34.21 ? 106  PRO A O   1 
ATOM   817  C CB  . PRO A 1 106 ? 0.789   81.474 35.239 1.00 32.41 ? 106  PRO A CB  1 
ATOM   818  C CG  . PRO A 1 106 ? 0.526   81.949 36.656 1.00 33.43 ? 106  PRO A CG  1 
ATOM   819  C CD  . PRO A 1 106 ? -0.926  82.321 36.648 1.00 33.35 ? 106  PRO A CD  1 
ATOM   820  N N   . LYS A 1 107 ? 0.027   81.306 32.278 1.00 32.04 ? 107  LYS A N   1 
ATOM   821  C CA  . LYS A 1 107 ? -0.431  80.554 31.141 1.00 33.45 ? 107  LYS A CA  1 
ATOM   822  C C   . LYS A 1 107 ? -0.062  79.077 31.311 1.00 34.45 ? 107  LYS A C   1 
ATOM   823  O O   . LYS A 1 107 ? -0.872  78.197 31.064 1.00 33.80 ? 107  LYS A O   1 
ATOM   824  C CB  . LYS A 1 107 ? 0.242   81.059 29.849 1.00 34.84 ? 107  LYS A CB  1 
ATOM   825  C CG  . LYS A 1 107 ? 0.010   82.546 29.565 1.00 33.30 ? 107  LYS A CG  1 
ATOM   826  C CD  . LYS A 1 107 ? -1.489  82.816 29.648 1.00 37.79 ? 107  LYS A CD  1 
ATOM   827  C CE  . LYS A 1 107 ? -1.805  84.313 29.503 1.00 38.63 ? 107  LYS A CE  1 
ATOM   828  N NZ  . LYS A 1 107 ? -3.260  84.551 29.606 1.00 39.30 ? 107  LYS A NZ  1 
ATOM   829  N N   . SER A 1 108 ? 1.170   78.803 31.700 1.00 34.37 ? 108  SER A N   1 
ATOM   830  C CA  . SER A 1 108 ? 1.579   77.424 31.829 1.00 35.26 ? 108  SER A CA  1 
ATOM   831  C C   . SER A 1 108 ? 2.850   77.386 32.631 1.00 34.31 ? 108  SER A C   1 
ATOM   832  O O   . SER A 1 108 ? 3.939   77.168 32.115 1.00 35.36 ? 108  SER A O   1 
ATOM   833  C CB  . SER A 1 108 ? 1.794   76.816 30.453 1.00 34.20 ? 108  SER A CB  1 
ATOM   834  O OG  . SER A 1 108 ? 2.170   75.447 30.557 1.00 34.31 ? 108  SER A OG  1 
ATOM   835  N N   . THR A 1 109 ? 2.708   77.576 33.921 1.00 33.59 ? 109  THR A N   1 
ATOM   836  C CA  . THR A 1 109 ? 3.892   77.611 34.742 1.00 32.70 ? 109  THR A CA  1 
ATOM   837  C C   . THR A 1 109 ? 4.019   76.410 35.712 1.00 32.34 ? 109  THR A C   1 
ATOM   838  O O   . THR A 1 109 ? 3.071   75.607 35.896 1.00 31.89 ? 109  THR A O   1 
ATOM   839  C CB  . THR A 1 109 ? 3.921   78.947 35.572 1.00 30.15 ? 109  THR A CB  1 
ATOM   840  O OG1 . THR A 1 109 ? 5.213   79.074 36.191 1.00 32.72 ? 109  THR A OG1 1 
ATOM   841  C CG2 . THR A 1 109 ? 2.925   78.886 36.710 1.00 29.73 ? 109  THR A CG2 1 
ATOM   842  N N   . THR A 1 110 ? 5.182   76.348 36.363 1.00 32.22 ? 110  THR A N   1 
ATOM   843  C CA  . THR A 1 110 ? 5.509   75.331 37.366 1.00 31.18 ? 110  THR A CA  1 
ATOM   844  C C   . THR A 1 110 ? 4.448   75.145 38.473 1.00 30.51 ? 110  THR A C   1 
ATOM   845  O O   . THR A 1 110 ? 3.984   76.107 39.119 1.00 28.50 ? 110  THR A O   1 
ATOM   846  C CB  . THR A 1 110 ? 6.839   75.695 38.038 1.00 33.26 ? 110  THR A CB  1 
ATOM   847  O OG1 . THR A 1 110 ? 7.881   75.715 37.046 1.00 33.75 ? 110  THR A OG1 1 
ATOM   848  C CG2 . THR A 1 110 ? 7.178   74.668 39.147 1.00 32.56 ? 110  THR A CG2 1 
ATOM   849  N N   . VAL A 1 111 ? 4.084   73.889 38.721 1.00 30.41 ? 111  VAL A N   1 
ATOM   850  C CA  . VAL A 1 111 ? 3.099   73.587 39.760 1.00 27.85 ? 111  VAL A CA  1 
ATOM   851  C C   . VAL A 1 111 ? 3.755   72.815 40.954 1.00 28.46 ? 111  VAL A C   1 
ATOM   852  O O   . VAL A 1 111 ? 4.539   71.858 40.728 1.00 27.61 ? 111  VAL A O   1 
ATOM   853  C CB  . VAL A 1 111 ? 1.948   72.702 39.147 1.00 29.03 ? 111  VAL A CB  1 
ATOM   854  C CG1 . VAL A 1 111 ? 0.918   72.336 40.226 1.00 23.97 ? 111  VAL A CG1 1 
ATOM   855  C CG2 . VAL A 1 111 ? 1.295   73.404 37.983 1.00 26.61 ? 111  VAL A CG2 1 
ATOM   856  N N   . MET A 1 112 ? 3.412   73.215 42.190 1.00 27.87 ? 112  MET A N   1 
ATOM   857  C CA  . MET A 1 112 ? 3.887   72.544 43.408 1.00 29.16 ? 112  MET A CA  1 
ATOM   858  C C   . MET A 1 112 ? 2.653   72.155 44.213 1.00 29.86 ? 112  MET A C   1 
ATOM   859  O O   . MET A 1 112 ? 1.748   72.979 44.422 1.00 31.12 ? 112  MET A O   1 
ATOM   860  C CB  . MET A 1 112 ? 4.829   73.448 44.235 1.00 29.10 ? 112  MET A CB  1 
ATOM   861  C CG  . MET A 1 112 ? 6.111   73.768 43.445 1.00 29.20 ? 112  MET A CG  1 
ATOM   862  S SD  . MET A 1 112 ? 7.258   74.773 44.355 1.00 33.36 ? 112  MET A SD  1 
ATOM   863  C CE  . MET A 1 112 ? 7.812   73.597 45.615 1.00 31.49 ? 112  MET A CE  1 
ATOM   864  N N   . VAL A 1 113 ? 2.605   70.876 44.609 1.00 28.73 ? 113  VAL A N   1 
ATOM   865  C CA  . VAL A 1 113 ? 1.502   70.320 45.363 1.00 27.32 ? 113  VAL A CA  1 
ATOM   866  C C   . VAL A 1 113 ? 2.012   69.851 46.725 1.00 28.53 ? 113  VAL A C   1 
ATOM   867  O O   . VAL A 1 113 ? 2.801   68.926 46.818 1.00 29.12 ? 113  VAL A O   1 
ATOM   868  C CB  . VAL A 1 113 ? 0.838   69.076 44.630 1.00 27.18 ? 113  VAL A CB  1 
ATOM   869  C CG1 . VAL A 1 113 ? -0.328  68.525 45.500 1.00 22.83 ? 113  VAL A CG1 1 
ATOM   870  C CG2 . VAL A 1 113 ? 0.359   69.453 43.229 1.00 23.23 ? 113  VAL A CG2 1 
ATOM   871  N N   . TRP A 1 114 ? 1.493   70.466 47.773 1.00 27.68 ? 114  TRP A N   1 
ATOM   872  C CA  . TRP A 1 114 ? 1.896   70.180 49.136 1.00 27.18 ? 114  TRP A CA  1 
ATOM   873  C C   . TRP A 1 114 ? 1.026   69.131 49.796 1.00 27.04 ? 114  TRP A C   1 
ATOM   874  O O   . TRP A 1 114 ? -0.213  69.236 49.763 1.00 26.13 ? 114  TRP A O   1 
ATOM   875  C CB  . TRP A 1 114 ? 1.822   71.474 49.977 1.00 24.59 ? 114  TRP A CB  1 
ATOM   876  C CG  . TRP A 1 114 ? 2.069   71.255 51.459 1.00 26.75 ? 114  TRP A CG  1 
ATOM   877  C CD1 . TRP A 1 114 ? 1.153   71.359 52.488 1.00 27.70 ? 114  TRP A CD1 1 
ATOM   878  C CD2 . TRP A 1 114 ? 3.333   70.980 52.077 1.00 26.21 ? 114  TRP A CD2 1 
ATOM   879  N NE1 . TRP A 1 114 ? 1.781   71.181 53.713 1.00 26.84 ? 114  TRP A NE1 1 
ATOM   880  C CE2 . TRP A 1 114 ? 3.116   70.955 53.493 1.00 27.47 ? 114  TRP A CE2 1 
ATOM   881  C CE3 . TRP A 1 114 ? 4.630   70.766 51.578 1.00 22.58 ? 114  TRP A CE3 1 
ATOM   882  C CZ2 . TRP A 1 114 ? 4.164   70.730 54.417 1.00 27.32 ? 114  TRP A CZ2 1 
ATOM   883  C CZ3 . TRP A 1 114 ? 5.676   70.545 52.496 1.00 24.42 ? 114  TRP A CZ3 1 
ATOM   884  C CH2 . TRP A 1 114 ? 5.437   70.531 53.897 1.00 25.72 ? 114  TRP A CH2 1 
ATOM   885  N N   . ILE A 1 115 ? 1.684   68.154 50.425 1.00 26.57 ? 115  ILE A N   1 
ATOM   886  C CA  . ILE A 1 115 ? 1.001   67.080 51.172 1.00 25.93 ? 115  ILE A CA  1 
ATOM   887  C C   . ILE A 1 115 ? 1.430   67.187 52.639 1.00 26.62 ? 115  ILE A C   1 
ATOM   888  O O   . ILE A 1 115 ? 2.604   66.926 52.990 1.00 26.06 ? 115  ILE A O   1 
ATOM   889  C CB  . ILE A 1 115 ? 1.411   65.688 50.642 1.00 27.38 ? 115  ILE A CB  1 
ATOM   890  C CG1 . ILE A 1 115 ? 1.151   65.639 49.120 1.00 27.31 ? 115  ILE A CG1 1 
ATOM   891  C CG2 . ILE A 1 115 ? 0.653   64.582 51.436 1.00 24.01 ? 115  ILE A CG2 1 
ATOM   892  C CD1 . ILE A 1 115 ? 1.426   64.278 48.454 1.00 27.64 ? 115  ILE A CD1 1 
ATOM   893  N N   . TYR A 1 116 ? 0.492   67.555 53.504 1.00 26.11 ? 116  TYR A N   1 
ATOM   894  C CA  . TYR A 1 116 ? 0.807   67.717 54.914 1.00 26.07 ? 116  TYR A CA  1 
ATOM   895  C C   . TYR A 1 116 ? 1.134   66.437 55.685 1.00 26.29 ? 116  TYR A C   1 
ATOM   896  O O   . TYR A 1 116 ? 0.666   65.338 55.347 1.00 25.94 ? 116  TYR A O   1 
ATOM   897  C CB  . TYR A 1 116 ? -0.326  68.482 55.660 1.00 26.65 ? 116  TYR A CB  1 
ATOM   898  C CG  . TYR A 1 116 ? -1.723  67.834 55.714 1.00 26.77 ? 116  TYR A CG  1 
ATOM   899  C CD1 . TYR A 1 116 ? -1.969  66.637 56.436 1.00 26.72 ? 116  TYR A CD1 1 
ATOM   900  C CD2 . TYR A 1 116 ? -2.797  68.414 55.031 1.00 26.57 ? 116  TYR A CD2 1 
ATOM   901  C CE1 . TYR A 1 116 ? -3.242  66.043 56.468 1.00 25.55 ? 116  TYR A CE1 1 
ATOM   902  C CE2 . TYR A 1 116 ? -4.071  67.829 55.043 1.00 24.53 ? 116  TYR A CE2 1 
ATOM   903  C CZ  . TYR A 1 116 ? -4.295  66.649 55.755 1.00 27.35 ? 116  TYR A CZ  1 
ATOM   904  O OH  . TYR A 1 116 ? -5.577  66.096 55.737 1.00 30.05 ? 116  TYR A OH  1 
ATOM   905  N N   . GLY A 1 117 ? 1.980   66.624 56.702 1.00 25.69 ? 117  GLY A N   1 
ATOM   906  C CA  . GLY A 1 117 ? 2.369   65.569 57.631 1.00 25.86 ? 117  GLY A CA  1 
ATOM   907  C C   . GLY A 1 117 ? 1.408   65.553 58.830 1.00 25.72 ? 117  GLY A C   1 
ATOM   908  O O   . GLY A 1 117 ? 0.298   66.141 58.798 1.00 23.77 ? 117  GLY A O   1 
ATOM   909  N N   . GLY A 1 118 ? 1.825   64.871 59.887 1.00 26.17 ? 118  GLY A N   1 
ATOM   910  C CA  . GLY A 1 118 ? 0.973   64.705 61.047 1.00 26.29 ? 118  GLY A CA  1 
ATOM   911  C C   . GLY A 1 118 ? 0.806   63.213 61.418 1.00 28.08 ? 118  GLY A C   1 
ATOM   912  O O   . GLY A 1 118 ? -0.224  62.835 61.972 1.00 29.14 ? 118  GLY A O   1 
ATOM   913  N N   . GLY A 1 119 ? 1.827   62.374 61.158 1.00 27.25 ? 119  GLY A N   1 
ATOM   914  C CA  . GLY A 1 119 ? 1.769   60.958 61.534 1.00 26.09 ? 119  GLY A CA  1 
ATOM   915  C C   . GLY A 1 119 ? 0.622   60.099 60.984 1.00 26.54 ? 119  GLY A C   1 
ATOM   916  O O   . GLY A 1 119 ? 0.357   58.998 61.486 1.00 24.59 ? 119  GLY A O   1 
ATOM   917  N N   . PHE A 1 120 ? -0.007  60.575 59.904 1.00 26.93 ? 120  PHE A N   1 
ATOM   918  C CA  . PHE A 1 120 ? -1.163  59.912 59.284 1.00 26.42 ? 120  PHE A CA  1 
ATOM   919  C C   . PHE A 1 120 ? -2.380  59.906 60.235 1.00 26.98 ? 120  PHE A C   1 
ATOM   920  O O   . PHE A 1 120 ? -3.413  59.281 59.928 1.00 27.80 ? 120  PHE A O   1 
ATOM   921  C CB  . PHE A 1 120 ? -0.820  58.474 58.841 1.00 24.57 ? 120  PHE A CB  1 
ATOM   922  C CG  . PHE A 1 120 ? 0.192   58.404 57.734 1.00 24.89 ? 120  PHE A CG  1 
ATOM   923  C CD1 . PHE A 1 120 ? -0.127  58.845 56.461 1.00 23.26 ? 120  PHE A CD1 1 
ATOM   924  C CD2 . PHE A 1 120 ? 1.460   57.834 57.959 1.00 24.91 ? 120  PHE A CD2 1 
ATOM   925  C CE1 . PHE A 1 120 ? 0.782   58.725 55.397 1.00 25.29 ? 120  PHE A CE1 1 
ATOM   926  C CE2 . PHE A 1 120 ? 2.395   57.699 56.913 1.00 25.36 ? 120  PHE A CE2 1 
ATOM   927  C CZ  . PHE A 1 120 ? 2.057   58.145 55.611 1.00 24.28 ? 120  PHE A CZ  1 
ATOM   928  N N   . TYR A 1 121 ? -2.286  60.584 61.386 1.00 26.99 ? 121  TYR A N   1 
ATOM   929  C CA  . TYR A 1 121 ? -3.451  60.641 62.296 1.00 26.49 ? 121  TYR A CA  1 
ATOM   930  C C   . TYR A 1 121 ? -3.988  62.073 62.495 1.00 28.08 ? 121  TYR A C   1 
ATOM   931  O O   . TYR A 1 121 ? -5.016  62.291 63.178 1.00 28.22 ? 121  TYR A O   1 
ATOM   932  C CB  . TYR A 1 121 ? -3.121  60.039 63.688 1.00 27.02 ? 121  TYR A CB  1 
ATOM   933  C CG  . TYR A 1 121 ? -2.293  60.947 64.576 1.00 26.53 ? 121  TYR A CG  1 
ATOM   934  C CD1 . TYR A 1 121 ? -2.910  61.867 65.438 1.00 25.61 ? 121  TYR A CD1 1 
ATOM   935  C CD2 . TYR A 1 121 ? -0.886  60.940 64.502 1.00 27.99 ? 121  TYR A CD2 1 
ATOM   936  C CE1 . TYR A 1 121 ? -2.135  62.795 66.228 1.00 27.36 ? 121  TYR A CE1 1 
ATOM   937  C CE2 . TYR A 1 121 ? -0.100  61.844 65.282 1.00 28.39 ? 121  TYR A CE2 1 
ATOM   938  C CZ  . TYR A 1 121 ? -0.752  62.764 66.142 1.00 27.69 ? 121  TYR A CZ  1 
ATOM   939  O OH  . TYR A 1 121 ? -0.014  63.586 66.948 1.00 32.57 ? 121  TYR A OH  1 
ATOM   940  N N   . SER A 1 122 ? -3.283  63.052 61.922 1.00 27.58 ? 122  SER A N   1 
ATOM   941  C CA  . SER A 1 122 ? -3.671  64.436 62.069 1.00 27.33 ? 122  SER A CA  1 
ATOM   942  C C   . SER A 1 122 ? -3.089  65.217 60.898 1.00 27.16 ? 122  SER A C   1 
ATOM   943  O O   . SER A 1 122 ? -2.400  64.644 60.050 1.00 25.11 ? 122  SER A O   1 
ATOM   944  C CB  . SER A 1 122 ? -3.127  65.005 63.394 1.00 28.90 ? 122  SER A CB  1 
ATOM   945  O OG  . SER A 1 122 ? -1.710  64.935 63.415 1.00 28.99 ? 122  SER A OG  1 
ATOM   946  N N   . GLY A 1 123 ? -3.373  66.520 60.887 1.00 27.16 ? 123  GLY A N   1 
ATOM   947  C CA  . GLY A 1 123 ? -2.903  67.401 59.833 1.00 27.10 ? 123  GLY A CA  1 
ATOM   948  C C   . GLY A 1 123 ? -4.023  68.123 59.090 1.00 27.68 ? 123  GLY A C   1 
ATOM   949  O O   . GLY A 1 123 ? -5.117  67.616 58.958 1.00 27.20 ? 123  GLY A O   1 
ATOM   950  N N   . SER A 1 124 ? -3.715  69.300 58.573 1.00 27.51 ? 124  SER A N   1 
ATOM   951  C CA  . SER A 1 124 ? -4.672  70.136 57.886 1.00 28.19 ? 124  SER A CA  1 
ATOM   952  C C   . SER A 1 124 ? -3.948  70.893 56.783 1.00 29.97 ? 124  SER A C   1 
ATOM   953  O O   . SER A 1 124 ? -2.769  71.226 56.917 1.00 29.06 ? 124  SER A O   1 
ATOM   954  C CB  . SER A 1 124 ? -5.234  71.182 58.842 1.00 27.17 ? 124  SER A CB  1 
ATOM   955  O OG  . SER A 1 124 ? -5.807  70.596 59.975 1.00 28.72 ? 124  SER A OG  1 
ATOM   956  N N   . SER A 1 125 ? -4.655  71.181 55.700 1.00 30.08 ? 125  SER A N   1 
ATOM   957  C CA  . SER A 1 125 ? -4.030  71.900 54.617 1.00 31.89 ? 125  SER A CA  1 
ATOM   958  C C   . SER A 1 125 ? -4.141  73.399 54.851 1.00 32.81 ? 125  SER A C   1 
ATOM   959  O O   . SER A 1 125 ? -3.593  74.164 54.057 1.00 34.10 ? 125  SER A O   1 
ATOM   960  C CB  . SER A 1 125 ? -4.748  71.602 53.306 1.00 32.52 ? 125  SER A CB  1 
ATOM   961  O OG  . SER A 1 125 ? -6.073  72.055 53.391 1.00 32.00 ? 125  SER A OG  1 
ATOM   962  N N   . THR A 1 126 ? -4.801  73.791 55.949 1.00 31.91 ? 126  THR A N   1 
ATOM   963  C CA  . THR A 1 126 ? -5.119  75.191 56.202 1.00 32.09 ? 126  THR A CA  1 
ATOM   964  C C   . THR A 1 126 ? -4.341  75.921 57.256 1.00 32.87 ? 126  THR A C   1 
ATOM   965  O O   . THR A 1 126 ? -4.663  77.067 57.571 1.00 31.49 ? 126  THR A O   1 
ATOM   966  C CB  . THR A 1 126 ? -6.602  75.344 56.562 1.00 32.36 ? 126  THR A CB  1 
ATOM   967  O OG1 . THR A 1 126 ? -6.842  74.681 57.803 1.00 30.53 ? 126  THR A OG1 1 
ATOM   968  C CG2 . THR A 1 126 ? -7.511  74.746 55.472 1.00 30.63 ? 126  THR A CG2 1 
ATOM   969  N N   . LEU A 1 127 ? -3.321  75.260 57.798 1.00 32.16 ? 127  LEU A N   1 
ATOM   970  C CA  . LEU A 1 127 ? -2.473  75.858 58.816 1.00 32.53 ? 127  LEU A CA  1 
ATOM   971  C C   . LEU A 1 127 ? -1.772  77.116 58.296 1.00 33.00 ? 127  LEU A C   1 
ATOM   972  O O   . LEU A 1 127 ? -1.390  77.197 57.104 1.00 30.74 ? 127  LEU A O   1 
ATOM   973  C CB  . LEU A 1 127 ? -1.401  74.851 59.284 1.00 29.40 ? 127  LEU A CB  1 
ATOM   974  C CG  . LEU A 1 127 ? -1.905  73.465 59.798 1.00 31.53 ? 127  LEU A CG  1 
ATOM   975  C CD1 . LEU A 1 127 ? -0.742  72.634 60.301 1.00 25.55 ? 127  LEU A CD1 1 
ATOM   976  C CD2 . LEU A 1 127 ? -2.964  73.636 60.905 1.00 27.81 ? 127  LEU A CD2 1 
ATOM   977  N N   . ASP A 1 128 ? -1.574  78.079 59.196 1.00 34.18 ? 128  ASP A N   1 
ATOM   978  C CA  . ASP A 1 128 ? -0.860  79.314 58.828 1.00 34.87 ? 128  ASP A CA  1 
ATOM   979  C C   . ASP A 1 128 ? 0.536   78.974 58.259 1.00 35.34 ? 128  ASP A C   1 
ATOM   980  O O   . ASP A 1 128 ? 0.947   79.593 57.266 1.00 36.10 ? 128  ASP A O   1 
ATOM   981  C CB  . ASP A 1 128 ? -0.730  80.258 60.039 1.00 36.66 ? 128  ASP A CB  1 
ATOM   982  C CG  . ASP A 1 128 ? -2.086  80.730 60.567 1.00 39.88 ? 128  ASP A CG  1 
ATOM   983  O OD1 . ASP A 1 128 ? -3.095  80.728 59.829 1.00 41.81 ? 128  ASP A OD1 1 
ATOM   984  O OD2 . ASP A 1 128 ? -2.149  81.110 61.751 1.00 46.72 ? 128  ASP A OD2 1 
ATOM   985  N N   . VAL A 1 129 ? 1.262   77.992 58.835 1.00 34.03 ? 129  VAL A N   1 
ATOM   986  C CA  . VAL A 1 129 ? 2.577   77.676 58.280 1.00 32.55 ? 129  VAL A CA  1 
ATOM   987  C C   . VAL A 1 129 ? 2.503   77.126 56.878 1.00 31.57 ? 129  VAL A C   1 
ATOM   988  O O   . VAL A 1 129 ? 3.552   77.030 56.220 1.00 30.72 ? 129  VAL A O   1 
ATOM   989  C CB  . VAL A 1 129 ? 3.422   76.561 59.029 1.00 33.60 ? 129  VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 129 ? 4.400   77.189 59.915 1.00 33.33 ? 129  VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 129 ? 2.528   75.532 59.698 1.00 32.31 ? 129  VAL A CG2 1 
ATOM   992  N N   . TYR A 1 130 ? 1.322   76.692 56.430 1.00 30.69 ? 130  TYR A N   1 
ATOM   993  C CA  . TYR A 1 130 ? 1.204   76.139 55.061 1.00 30.62 ? 130  TYR A CA  1 
ATOM   994  C C   . TYR A 1 130 ? 0.574   77.136 54.056 1.00 31.18 ? 130  TYR A C   1 
ATOM   995  O O   . TYR A 1 130 ? 0.262   76.762 52.920 1.00 29.50 ? 130  TYR A O   1 
ATOM   996  C CB  . TYR A 1 130 ? 0.347   74.858 55.033 1.00 29.86 ? 130  TYR A CB  1 
ATOM   997  C CG  . TYR A 1 130 ? 0.833   73.712 55.920 1.00 28.91 ? 130  TYR A CG  1 
ATOM   998  C CD1 . TYR A 1 130 ? 2.179   73.566 56.255 1.00 27.39 ? 130  TYR A CD1 1 
ATOM   999  C CD2 . TYR A 1 130 ? -0.072  72.771 56.409 1.00 28.24 ? 130  TYR A CD2 1 
ATOM   1000 C CE1 . TYR A 1 130 ? 2.610   72.513 57.066 1.00 29.13 ? 130  TYR A CE1 1 
ATOM   1001 C CE2 . TYR A 1 130 ? 0.335   71.715 57.214 1.00 26.28 ? 130  TYR A CE2 1 
ATOM   1002 C CZ  . TYR A 1 130 ? 1.677   71.595 57.541 1.00 26.89 ? 130  TYR A CZ  1 
ATOM   1003 O OH  . TYR A 1 130 ? 2.060   70.586 58.362 1.00 25.41 ? 130  TYR A OH  1 
ATOM   1004 N N   . ASN A 1 131 ? 0.382   78.385 54.472 1.00 32.61 ? 131  ASN A N   1 
ATOM   1005 C CA  . ASN A 1 131 ? -0.208  79.406 53.580 1.00 33.27 ? 131  ASN A CA  1 
ATOM   1006 C C   . ASN A 1 131 ? 0.672   79.496 52.328 1.00 32.74 ? 131  ASN A C   1 
ATOM   1007 O O   . ASN A 1 131 ? 1.840   79.894 52.412 1.00 31.30 ? 131  ASN A O   1 
ATOM   1008 C CB  . ASN A 1 131 ? -0.263  80.755 54.302 1.00 34.87 ? 131  ASN A CB  1 
ATOM   1009 C CG  . ASN A 1 131 ? -1.168  81.755 53.590 1.00 38.23 ? 131  ASN A CG  1 
ATOM   1010 O OD1 . ASN A 1 131 ? -1.299  81.717 52.365 1.00 38.16 ? 131  ASN A OD1 1 
ATOM   1011 N ND2 . ASN A 1 131 ? -1.773  82.680 54.361 1.00 39.40 ? 131  ASN A ND2 1 
ATOM   1012 N N   . GLY A 1 132 ? 0.120   79.125 51.166 1.00 33.11 ? 132  GLY A N   1 
ATOM   1013 C CA  . GLY A 1 132 ? 0.952   79.113 49.965 1.00 33.47 ? 132  GLY A CA  1 
ATOM   1014 C C   . GLY A 1 132 ? 1.152   80.425 49.208 1.00 33.68 ? 132  GLY A C   1 
ATOM   1015 O O   . GLY A 1 132 ? 1.845   80.480 48.174 1.00 33.54 ? 132  GLY A O   1 
ATOM   1016 N N   . LYS A 1 133 ? 0.571   81.500 49.730 1.00 34.82 ? 133  LYS A N   1 
ATOM   1017 C CA  . LYS A 1 133 ? 0.651   82.760 49.024 1.00 34.90 ? 133  LYS A CA  1 
ATOM   1018 C C   . LYS A 1 133 ? 2.072   83.299 48.864 1.00 35.16 ? 133  LYS A C   1 
ATOM   1019 O O   . LYS A 1 133 ? 2.386   83.817 47.782 1.00 34.09 ? 133  LYS A O   1 
ATOM   1020 C CB  . LYS A 1 133 ? -0.277  83.791 49.675 1.00 35.44 ? 133  LYS A CB  1 
ATOM   1021 C CG  . LYS A 1 133 ? 0.316   84.532 50.874 1.00 36.10 ? 133  LYS A CG  1 
ATOM   1022 C CD  . LYS A 1 133 ? -0.813  85.198 51.663 1.00 35.80 ? 133  LYS A CD  1 
ATOM   1023 C CE  . LYS A 1 133 ? -0.253  86.338 52.545 1.00 37.00 ? 133  LYS A CE  1 
ATOM   1024 N NZ  . LYS A 1 133 ? -1.434  86.994 53.185 1.00 38.40 ? 133  LYS A NZ  1 
ATOM   1025 N N   . TYR A 1 134 ? 2.944   83.147 49.875 1.00 34.06 ? 134  TYR A N   1 
ATOM   1026 C CA  . TYR A 1 134 ? 4.308   83.695 49.741 1.00 33.96 ? 134  TYR A CA  1 
ATOM   1027 C C   . TYR A 1 134 ? 5.104   82.964 48.678 1.00 34.49 ? 134  TYR A C   1 
ATOM   1028 O O   . TYR A 1 134 ? 5.774   83.577 47.852 1.00 35.30 ? 134  TYR A O   1 
ATOM   1029 C CB  . TYR A 1 134 ? 5.076   83.673 51.076 1.00 34.18 ? 134  TYR A CB  1 
ATOM   1030 C CG  . TYR A 1 134 ? 4.307   84.268 52.218 1.00 35.18 ? 134  TYR A CG  1 
ATOM   1031 C CD1 . TYR A 1 134 ? 3.712   83.455 53.165 1.00 34.01 ? 134  TYR A CD1 1 
ATOM   1032 C CD2 . TYR A 1 134 ? 4.088   85.653 52.299 1.00 35.78 ? 134  TYR A CD2 1 
ATOM   1033 C CE1 . TYR A 1 134 ? 2.908   83.982 54.151 1.00 32.60 ? 134  TYR A CE1 1 
ATOM   1034 C CE2 . TYR A 1 134 ? 3.276   86.200 53.301 1.00 32.88 ? 134  TYR A CE2 1 
ATOM   1035 C CZ  . TYR A 1 134 ? 2.689   85.358 54.215 1.00 35.06 ? 134  TYR A CZ  1 
ATOM   1036 O OH  . TYR A 1 134 ? 1.876   85.875 55.217 1.00 34.64 ? 134  TYR A OH  1 
ATOM   1037 N N   . LEU A 1 135 ? 5.017   81.649 48.667 1.00 33.98 ? 135  LEU A N   1 
ATOM   1038 C CA  . LEU A 1 135 ? 5.750   80.881 47.671 1.00 34.99 ? 135  LEU A CA  1 
ATOM   1039 C C   . LEU A 1 135 ? 5.140   81.094 46.263 1.00 35.87 ? 135  LEU A C   1 
ATOM   1040 O O   . LEU A 1 135 ? 5.868   81.247 45.254 1.00 36.59 ? 135  LEU A O   1 
ATOM   1041 C CB  . LEU A 1 135 ? 5.718   79.398 48.082 1.00 34.83 ? 135  LEU A CB  1 
ATOM   1042 C CG  . LEU A 1 135 ? 6.613   78.370 47.430 1.00 35.63 ? 135  LEU A CG  1 
ATOM   1043 C CD1 . LEU A 1 135 ? 8.049   78.837 47.376 1.00 36.46 ? 135  LEU A CD1 1 
ATOM   1044 C CD2 . LEU A 1 135 ? 6.487   77.088 48.258 1.00 33.56 ? 135  LEU A CD2 1 
ATOM   1045 N N   . ALA A 1 136 ? 3.812   81.108 46.162 1.00 35.87 ? 136  ALA A N   1 
ATOM   1046 C CA  . ALA A 1 136 ? 3.216   81.311 44.832 1.00 35.73 ? 136  ALA A CA  1 
ATOM   1047 C C   . ALA A 1 136 ? 3.688   82.666 44.288 1.00 35.83 ? 136  ALA A C   1 
ATOM   1048 O O   . ALA A 1 136 ? 4.172   82.795 43.144 1.00 35.47 ? 136  ALA A O   1 
ATOM   1049 C CB  . ALA A 1 136 ? 1.678   81.266 44.906 1.00 33.23 ? 136  ALA A CB  1 
ATOM   1050 N N   . TYR A 1 137 ? 3.598   83.665 45.148 1.00 36.44 ? 137  TYR A N   1 
ATOM   1051 C CA  . TYR A 1 137 ? 3.954   85.016 44.759 1.00 35.95 ? 137  TYR A CA  1 
ATOM   1052 C C   . TYR A 1 137 ? 5.411   85.229 44.428 1.00 35.58 ? 137  TYR A C   1 
ATOM   1053 O O   . TYR A 1 137 ? 5.749   85.665 43.323 1.00 33.55 ? 137  TYR A O   1 
ATOM   1054 C CB  . TYR A 1 137 ? 3.507   85.988 45.852 1.00 36.84 ? 137  TYR A CB  1 
ATOM   1055 C CG  . TYR A 1 137 ? 3.972   87.377 45.613 1.00 40.51 ? 137  TYR A CG  1 
ATOM   1056 C CD1 . TYR A 1 137 ? 4.863   87.991 46.489 1.00 41.70 ? 137  TYR A CD1 1 
ATOM   1057 C CD2 . TYR A 1 137 ? 3.517   88.100 44.490 1.00 43.09 ? 137  TYR A CD2 1 
ATOM   1058 C CE1 . TYR A 1 137 ? 5.307   89.321 46.270 1.00 44.07 ? 137  TYR A CE1 1 
ATOM   1059 C CE2 . TYR A 1 137 ? 3.943   89.412 44.252 1.00 44.81 ? 137  TYR A CE2 1 
ATOM   1060 C CZ  . TYR A 1 137 ? 4.836   90.016 45.152 1.00 44.69 ? 137  TYR A CZ  1 
ATOM   1061 O OH  . TYR A 1 137 ? 5.216   91.305 44.933 1.00 46.41 ? 137  TYR A OH  1 
ATOM   1062 N N   . THR A 1 138 ? 6.289   84.890 45.361 1.00 34.98 ? 138  THR A N   1 
ATOM   1063 C CA  . THR A 1 138 ? 7.727   85.128 45.155 1.00 34.20 ? 138  THR A CA  1 
ATOM   1064 C C   . THR A 1 138 ? 8.317   84.309 44.021 1.00 35.24 ? 138  THR A C   1 
ATOM   1065 O O   . THR A 1 138 ? 9.142   84.799 43.242 1.00 33.82 ? 138  THR A O   1 
ATOM   1066 C CB  . THR A 1 138 ? 8.532   84.850 46.474 1.00 35.13 ? 138  THR A CB  1 
ATOM   1067 O OG1 . THR A 1 138 ? 7.907   85.547 47.571 1.00 33.85 ? 138  THR A OG1 1 
ATOM   1068 C CG2 . THR A 1 138 ? 9.983   85.334 46.344 1.00 33.08 ? 138  THR A CG2 1 
ATOM   1069 N N   . GLU A 1 139 ? 7.888   83.057 43.882 1.00 35.56 ? 139  GLU A N   1 
ATOM   1070 C CA  . GLU A 1 139 ? 8.487   82.246 42.831 1.00 35.85 ? 139  GLU A CA  1 
ATOM   1071 C C   . GLU A 1 139 ? 7.669   82.066 41.571 1.00 36.37 ? 139  GLU A C   1 
ATOM   1072 O O   . GLU A 1 139 ? 8.097   81.348 40.676 1.00 34.93 ? 139  GLU A O   1 
ATOM   1073 C CB  . GLU A 1 139 ? 8.885   80.882 43.391 1.00 35.56 ? 139  GLU A CB  1 
ATOM   1074 C CG  . GLU A 1 139 ? 9.948   80.966 44.503 1.00 37.32 ? 139  GLU A CG  1 
ATOM   1075 C CD  . GLU A 1 139 ? 11.311  81.469 44.041 1.00 36.79 ? 139  GLU A CD  1 
ATOM   1076 O OE1 . GLU A 1 139 ? 11.775  81.111 42.949 1.00 36.08 ? 139  GLU A OE1 1 
ATOM   1077 O OE2 . GLU A 1 139 ? 11.966  82.200 44.802 1.00 39.06 ? 139  GLU A OE2 1 
ATOM   1078 N N   . GLU A 1 140 ? 6.498   82.700 41.512 1.00 36.93 ? 140  GLU A N   1 
ATOM   1079 C CA  . GLU A 1 140 ? 5.637   82.595 40.350 1.00 40.19 ? 140  GLU A CA  1 
ATOM   1080 C C   . GLU A 1 140 ? 5.250   81.135 40.068 1.00 38.19 ? 140  GLU A C   1 
ATOM   1081 O O   . GLU A 1 140 ? 5.361   80.645 38.950 1.00 39.02 ? 140  GLU A O   1 
ATOM   1082 C CB  . GLU A 1 140 ? 6.333   83.219 39.119 1.00 44.84 ? 140  GLU A CB  1 
ATOM   1083 C CG  . GLU A 1 140 ? 5.736   84.566 38.654 1.00 53.50 ? 140  GLU A CG  1 
ATOM   1084 C CD  . GLU A 1 140 ? 6.817   85.629 38.282 1.00 58.29 ? 140  GLU A CD  1 
ATOM   1085 O OE1 . GLU A 1 140 ? 7.779   85.318 37.533 1.00 61.06 ? 140  GLU A OE1 1 
ATOM   1086 O OE2 . GLU A 1 140 ? 6.704   86.794 38.734 1.00 61.64 ? 140  GLU A OE2 1 
ATOM   1087 N N   . VAL A 1 141 ? 4.816   80.417 41.092 1.00 36.23 ? 141  VAL A N   1 
ATOM   1088 C CA  . VAL A 1 141 ? 4.394   79.069 40.841 1.00 33.19 ? 141  VAL A CA  1 
ATOM   1089 C C   . VAL A 1 141 ? 2.938   78.968 41.246 1.00 33.63 ? 141  VAL A C   1 
ATOM   1090 O O   . VAL A 1 141 ? 2.437   79.787 42.037 1.00 30.83 ? 141  VAL A O   1 
ATOM   1091 C CB  . VAL A 1 141 ? 5.235   78.048 41.647 1.00 34.64 ? 141  VAL A CB  1 
ATOM   1092 C CG1 . VAL A 1 141 ? 6.753   78.199 41.310 1.00 32.67 ? 141  VAL A CG1 1 
ATOM   1093 C CG2 . VAL A 1 141 ? 5.019   78.240 43.117 1.00 33.88 ? 141  VAL A CG2 1 
ATOM   1094 N N   . VAL A 1 142 ? 2.235   77.989 40.668 1.00 33.31 ? 142  VAL A N   1 
ATOM   1095 C CA  . VAL A 1 142 ? 0.868   77.752 41.091 1.00 32.54 ? 142  VAL A CA  1 
ATOM   1096 C C   . VAL A 1 142 ? 1.060   76.740 42.219 1.00 32.14 ? 142  VAL A C   1 
ATOM   1097 O O   . VAL A 1 142 ? 1.542   75.644 41.995 1.00 31.00 ? 142  VAL A O   1 
ATOM   1098 C CB  . VAL A 1 142 ? 0.011   77.152 40.003 1.00 32.52 ? 142  VAL A CB  1 
ATOM   1099 C CG1 . VAL A 1 142 ? -1.265  76.573 40.602 1.00 31.14 ? 142  VAL A CG1 1 
ATOM   1100 C CG2 . VAL A 1 142 ? -0.321  78.233 38.975 1.00 33.79 ? 142  VAL A CG2 1 
ATOM   1101 N N   . LEU A 1 143 ? 0.697   77.142 43.432 1.00 32.17 ? 143  LEU A N   1 
ATOM   1102 C CA  . LEU A 1 143 ? 0.853   76.297 44.591 1.00 31.25 ? 143  LEU A CA  1 
ATOM   1103 C C   . LEU A 1 143 ? -0.452  75.616 45.021 1.00 30.62 ? 143  LEU A C   1 
ATOM   1104 O O   . LEU A 1 143 ? -1.474  76.277 45.267 1.00 31.89 ? 143  LEU A O   1 
ATOM   1105 C CB  . LEU A 1 143 ? 1.396   77.115 45.769 1.00 33.75 ? 143  LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 143 ? 1.661   76.074 46.858 1.00 36.42 ? 143  LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 143 ? 3.125   75.723 46.907 1.00 36.07 ? 143  LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 143 ? 1.149   76.538 48.134 1.00 37.30 ? 143  LEU A CD2 1 
ATOM   1109 N N   . VAL A 1 144 ? -0.428  74.295 45.131 1.00 28.07 ? 144  VAL A N   1 
ATOM   1110 C CA  . VAL A 1 144 ? -1.633  73.576 45.559 1.00 26.11 ? 144  VAL A CA  1 
ATOM   1111 C C   . VAL A 1 144 ? -1.382  72.858 46.884 1.00 25.71 ? 144  VAL A C   1 
ATOM   1112 O O   . VAL A 1 144 ? -0.284  72.314 47.077 1.00 24.29 ? 144  VAL A O   1 
ATOM   1113 C CB  . VAL A 1 144 ? -2.027  72.440 44.530 1.00 26.24 ? 144  VAL A CB  1 
ATOM   1114 C CG1 . VAL A 1 144 ? -3.225  71.627 45.079 1.00 23.57 ? 144  VAL A CG1 1 
ATOM   1115 C CG2 . VAL A 1 144 ? -2.335  73.018 43.140 1.00 25.03 ? 144  VAL A CG2 1 
ATOM   1116 N N   . SER A 1 145 ? -2.363  72.874 47.798 1.00 26.70 ? 145  SER A N   1 
ATOM   1117 C CA  . SER A 1 145 ? -2.259  72.051 49.026 1.00 26.27 ? 145  SER A CA  1 
ATOM   1118 C C   . SER A 1 145 ? -3.487  71.160 48.988 1.00 27.71 ? 145  SER A C   1 
ATOM   1119 O O   . SER A 1 145 ? -4.626  71.635 48.817 1.00 26.16 ? 145  SER A O   1 
ATOM   1120 C CB  . SER A 1 145 ? -2.216  72.867 50.350 1.00 26.56 ? 145  SER A CB  1 
ATOM   1121 O OG  . SER A 1 145 ? -3.266  73.820 50.496 1.00 28.07 ? 145  SER A OG  1 
ATOM   1122 N N   . LEU A 1 146 ? -3.283  69.847 49.100 1.00 28.24 ? 146  LEU A N   1 
ATOM   1123 C CA  . LEU A 1 146 ? -4.441  68.954 49.098 1.00 27.94 ? 146  LEU A CA  1 
ATOM   1124 C C   . LEU A 1 146 ? -4.728  68.510 50.545 1.00 28.38 ? 146  LEU A C   1 
ATOM   1125 O O   . LEU A 1 146 ? -4.076  68.960 51.495 1.00 28.74 ? 146  LEU A O   1 
ATOM   1126 C CB  . LEU A 1 146 ? -4.172  67.752 48.165 1.00 27.46 ? 146  LEU A CB  1 
ATOM   1127 C CG  . LEU A 1 146 ? -2.825  67.050 48.416 1.00 26.75 ? 146  LEU A CG  1 
ATOM   1128 C CD1 . LEU A 1 146 ? -2.966  66.267 49.736 1.00 24.84 ? 146  LEU A CD1 1 
ATOM   1129 C CD2 . LEU A 1 146 ? -2.455  66.081 47.234 1.00 25.89 ? 146  LEU A CD2 1 
ATOM   1130 N N   . SER A 1 147 ? -5.727  67.665 50.723 1.00 27.81 ? 147  SER A N   1 
ATOM   1131 C CA  . SER A 1 147 ? -6.031  67.145 52.047 1.00 29.78 ? 147  SER A CA  1 
ATOM   1132 C C   . SER A 1 147 ? -6.324  65.667 51.837 1.00 29.01 ? 147  SER A C   1 
ATOM   1133 O O   . SER A 1 147 ? -6.472  65.197 50.683 1.00 30.05 ? 147  SER A O   1 
ATOM   1134 C CB  . SER A 1 147 ? -7.235  67.849 52.654 1.00 29.55 ? 147  SER A CB  1 
ATOM   1135 O OG  . SER A 1 147 ? -8.375  67.629 51.852 1.00 35.08 ? 147  SER A OG  1 
ATOM   1136 N N   . TYR A 1 148 ? -6.389  64.926 52.930 1.00 27.61 ? 148  TYR A N   1 
ATOM   1137 C CA  . TYR A 1 148 ? -6.650  63.496 52.855 1.00 26.29 ? 148  TYR A CA  1 
ATOM   1138 C C   . TYR A 1 148 ? -7.048  63.016 54.244 1.00 27.19 ? 148  TYR A C   1 
ATOM   1139 O O   . TYR A 1 148 ? -6.630  63.588 55.264 1.00 26.28 ? 148  TYR A O   1 
ATOM   1140 C CB  . TYR A 1 148 ? -5.419  62.703 52.357 1.00 25.59 ? 148  TYR A CB  1 
ATOM   1141 C CG  . TYR A 1 148 ? -4.166  62.852 53.224 1.00 25.92 ? 148  TYR A CG  1 
ATOM   1142 C CD1 . TYR A 1 148 ? -3.306  63.974 53.084 1.00 23.75 ? 148  TYR A CD1 1 
ATOM   1143 C CD2 . TYR A 1 148 ? -3.855  61.886 54.203 1.00 22.40 ? 148  TYR A CD2 1 
ATOM   1144 C CE1 . TYR A 1 148 ? -2.171  64.129 53.907 1.00 23.90 ? 148  TYR A CE1 1 
ATOM   1145 C CE2 . TYR A 1 148 ? -2.725  62.027 55.029 1.00 23.00 ? 148  TYR A CE2 1 
ATOM   1146 C CZ  . TYR A 1 148 ? -1.894  63.136 54.892 1.00 24.47 ? 148  TYR A CZ  1 
ATOM   1147 O OH  . TYR A 1 148 ? -0.800  63.239 55.750 1.00 23.60 ? 148  TYR A OH  1 
ATOM   1148 N N   . ARG A 1 149 ? -7.893  61.990 54.265 1.00 26.63 ? 149  ARG A N   1 
ATOM   1149 C CA  . ARG A 1 149 ? -8.368  61.433 55.517 1.00 26.97 ? 149  ARG A CA  1 
ATOM   1150 C C   . ARG A 1 149 ? -7.213  60.856 56.318 1.00 25.75 ? 149  ARG A C   1 
ATOM   1151 O O   . ARG A 1 149 ? -6.298  60.213 55.743 1.00 26.07 ? 149  ARG A O   1 
ATOM   1152 C CB  . ARG A 1 149 ? -9.415  60.332 55.253 1.00 26.54 ? 149  ARG A CB  1 
ATOM   1153 C CG  . ARG A 1 149 ? -10.756 60.843 54.689 1.00 25.11 ? 149  ARG A CG  1 
ATOM   1154 C CD  . ARG A 1 149 ? -11.674 59.656 54.266 1.00 24.80 ? 149  ARG A CD  1 
ATOM   1155 N NE  . ARG A 1 149 ? -11.343 59.218 52.914 1.00 26.05 ? 149  ARG A NE  1 
ATOM   1156 C CZ  . ARG A 1 149 ? -11.872 58.162 52.298 1.00 27.15 ? 149  ARG A CZ  1 
ATOM   1157 N NH1 . ARG A 1 149 ? -12.782 57.406 52.946 1.00 25.05 ? 149  ARG A NH1 1 
ATOM   1158 N NH2 . ARG A 1 149 ? -11.502 57.867 51.028 1.00 22.68 ? 149  ARG A NH2 1 
ATOM   1159 N N   . VAL A 1 150 ? -7.250  61.109 57.627 1.00 23.68 ? 150  VAL A N   1 
ATOM   1160 C CA  . VAL A 1 150 ? -6.238  60.610 58.525 1.00 23.73 ? 150  VAL A CA  1 
ATOM   1161 C C   . VAL A 1 150 ? -6.887  59.724 59.594 1.00 25.67 ? 150  VAL A C   1 
ATOM   1162 O O   . VAL A 1 150 ? -8.135  59.577 59.669 1.00 25.24 ? 150  VAL A O   1 
ATOM   1163 C CB  . VAL A 1 150 ? -5.415  61.807 59.201 1.00 24.78 ? 150  VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 150 ? -4.622  62.596 58.089 1.00 23.52 ? 150  VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 150 ? -6.342  62.755 59.972 1.00 21.88 ? 150  VAL A CG2 1 
ATOM   1166 N N   . GLY A 1 151 ? -6.034  59.127 60.422 1.00 26.37 ? 151  GLY A N   1 
ATOM   1167 C CA  . GLY A 1 151 ? -6.510  58.268 61.492 1.00 26.23 ? 151  GLY A CA  1 
ATOM   1168 C C   . GLY A 1 151 ? -7.248  57.054 60.948 1.00 27.99 ? 151  GLY A C   1 
ATOM   1169 O O   . GLY A 1 151 ? -6.984  56.604 59.828 1.00 28.12 ? 151  GLY A O   1 
ATOM   1170 N N   . ALA A 1 152 ? -8.186  56.514 61.727 1.00 27.96 ? 152  ALA A N   1 
ATOM   1171 C CA  . ALA A 1 152 ? -8.930  55.347 61.269 1.00 28.39 ? 152  ALA A CA  1 
ATOM   1172 C C   . ALA A 1 152 ? -9.735  55.675 59.965 1.00 27.33 ? 152  ALA A C   1 
ATOM   1173 O O   . ALA A 1 152 ? -9.821  54.851 59.060 1.00 26.23 ? 152  ALA A O   1 
ATOM   1174 C CB  . ALA A 1 152 ? -9.889  54.830 62.441 1.00 28.31 ? 152  ALA A CB  1 
ATOM   1175 N N   . PHE A 1 153 ? -10.257 56.902 59.865 1.00 27.90 ? 153  PHE A N   1 
ATOM   1176 C CA  . PHE A 1 153 ? -11.026 57.329 58.680 1.00 28.08 ? 153  PHE A CA  1 
ATOM   1177 C C   . PHE A 1 153 ? -10.245 57.164 57.425 1.00 26.33 ? 153  PHE A C   1 
ATOM   1178 O O   . PHE A 1 153 ? -10.818 56.914 56.374 1.00 27.24 ? 153  PHE A O   1 
ATOM   1179 C CB  . PHE A 1 153 ? -11.456 58.810 58.806 1.00 26.85 ? 153  PHE A CB  1 
ATOM   1180 C CG  . PHE A 1 153 ? -12.078 59.124 60.124 1.00 28.35 ? 153  PHE A CG  1 
ATOM   1181 C CD1 . PHE A 1 153 ? -13.472 58.976 60.321 1.00 29.33 ? 153  PHE A CD1 1 
ATOM   1182 C CD2 . PHE A 1 153 ? -11.282 59.527 61.193 1.00 27.33 ? 153  PHE A CD2 1 
ATOM   1183 C CE1 . PHE A 1 153 ? -14.054 59.227 61.586 1.00 29.32 ? 153  PHE A CE1 1 
ATOM   1184 C CE2 . PHE A 1 153 ? -11.844 59.787 62.490 1.00 29.78 ? 153  PHE A CE2 1 
ATOM   1185 C CZ  . PHE A 1 153 ? -13.224 59.635 62.687 1.00 29.93 ? 153  PHE A CZ  1 
ATOM   1186 N N   . GLY A 1 154 ? -8.925  57.327 57.509 1.00 28.53 ? 154  GLY A N   1 
ATOM   1187 C CA  . GLY A 1 154 ? -8.118  57.180 56.303 1.00 27.87 ? 154  GLY A CA  1 
ATOM   1188 C C   . GLY A 1 154 ? -7.320  55.889 56.174 1.00 27.04 ? 154  GLY A C   1 
ATOM   1189 O O   . GLY A 1 154 ? -6.943  55.513 55.079 1.00 27.66 ? 154  GLY A O   1 
ATOM   1190 N N   . PHE A 1 155 ? -7.098  55.192 57.273 1.00 25.98 ? 155  PHE A N   1 
ATOM   1191 C CA  . PHE A 1 155 ? -6.248  54.050 57.211 1.00 26.92 ? 155  PHE A CA  1 
ATOM   1192 C C   . PHE A 1 155 ? -6.681  52.771 57.902 1.00 28.83 ? 155  PHE A C   1 
ATOM   1193 O O   . PHE A 1 155 ? -5.896  51.821 57.986 1.00 30.04 ? 155  PHE A O   1 
ATOM   1194 C CB  . PHE A 1 155 ? -4.848  54.502 57.676 1.00 27.46 ? 155  PHE A CB  1 
ATOM   1195 C CG  . PHE A 1 155 ? -4.251  55.557 56.769 1.00 26.19 ? 155  PHE A CG  1 
ATOM   1196 C CD1 . PHE A 1 155 ? -3.687  55.204 55.553 1.00 26.49 ? 155  PHE A CD1 1 
ATOM   1197 C CD2 . PHE A 1 155 ? -4.355  56.905 57.086 1.00 25.13 ? 155  PHE A CD2 1 
ATOM   1198 C CE1 . PHE A 1 155 ? -3.220  56.186 54.633 1.00 27.62 ? 155  PHE A CE1 1 
ATOM   1199 C CE2 . PHE A 1 155 ? -3.896  57.889 56.194 1.00 26.08 ? 155  PHE A CE2 1 
ATOM   1200 C CZ  . PHE A 1 155 ? -3.323  57.531 54.960 1.00 25.64 ? 155  PHE A CZ  1 
ATOM   1201 N N   . LEU A 1 156 ? -7.920  52.725 58.371 1.00 29.64 ? 156  LEU A N   1 
ATOM   1202 C CA  . LEU A 1 156 ? -8.442  51.484 58.966 1.00 31.80 ? 156  LEU A CA  1 
ATOM   1203 C C   . LEU A 1 156 ? -8.226  50.439 57.872 1.00 31.21 ? 156  LEU A C   1 
ATOM   1204 O O   . LEU A 1 156 ? -8.686  50.622 56.744 1.00 31.56 ? 156  LEU A O   1 
ATOM   1205 C CB  . LEU A 1 156 ? -9.958  51.596 59.238 1.00 32.22 ? 156  LEU A CB  1 
ATOM   1206 C CG  . LEU A 1 156 ? -10.583 50.359 59.912 1.00 35.91 ? 156  LEU A CG  1 
ATOM   1207 C CD1 . LEU A 1 156 ? -10.236 50.366 61.417 1.00 33.08 ? 156  LEU A CD1 1 
ATOM   1208 C CD2 . LEU A 1 156 ? -12.113 50.377 59.737 1.00 35.69 ? 156  LEU A CD2 1 
ATOM   1209 N N   . ALA A 1 157 ? -7.531  49.351 58.166 1.00 31.01 ? 157  ALA A N   1 
ATOM   1210 C CA  . ALA A 1 157 ? -7.301  48.360 57.111 1.00 30.56 ? 157  ALA A CA  1 
ATOM   1211 C C   . ALA A 1 157 ? -7.731  46.878 57.406 1.00 32.58 ? 157  ALA A C   1 
ATOM   1212 O O   . ALA A 1 157 ? -7.160  46.212 58.268 1.00 30.20 ? 157  ALA A O   1 
ATOM   1213 C CB  . ALA A 1 157 ? -5.874  48.395 56.707 1.00 26.46 ? 157  ALA A CB  1 
ATOM   1214 N N   . LEU A 1 158 ? -8.730  46.388 56.661 1.00 33.53 ? 158  LEU A N   1 
ATOM   1215 C CA  . LEU A 1 158 ? -9.225  45.009 56.800 1.00 35.49 ? 158  LEU A CA  1 
ATOM   1216 C C   . LEU A 1 158 ? -9.013  44.396 55.426 1.00 35.89 ? 158  LEU A C   1 
ATOM   1217 O O   . LEU A 1 158 ? -9.932  44.325 54.599 1.00 34.89 ? 158  LEU A O   1 
ATOM   1218 C CB  . LEU A 1 158 ? -10.709 45.025 57.195 1.00 34.73 ? 158  LEU A CB  1 
ATOM   1219 C CG  . LEU A 1 158 ? -10.870 45.329 58.698 1.00 37.46 ? 158  LEU A CG  1 
ATOM   1220 C CD1 . LEU A 1 158 ? -12.350 45.703 59.020 1.00 34.71 ? 158  LEU A CD1 1 
ATOM   1221 C CD2 . LEU A 1 158 ? -10.332 44.095 59.549 1.00 33.84 ? 158  LEU A CD2 1 
ATOM   1222 N N   . HIS A 1 159 ? -7.773  43.981 55.169 1.00 38.84 ? 159  HIS A N   1 
ATOM   1223 C CA  . HIS A 1 159 ? -7.380  43.444 53.855 1.00 40.85 ? 159  HIS A CA  1 
ATOM   1224 C C   . HIS A 1 159 ? -8.285  42.320 53.443 1.00 43.20 ? 159  HIS A C   1 
ATOM   1225 O O   . HIS A 1 159 ? -8.508  41.395 54.232 1.00 43.75 ? 159  HIS A O   1 
ATOM   1226 C CB  . HIS A 1 159 ? -5.956  42.915 53.879 1.00 41.06 ? 159  HIS A CB  1 
ATOM   1227 C CG  . HIS A 1 159 ? -5.436  42.550 52.527 1.00 41.07 ? 159  HIS A CG  1 
ATOM   1228 N ND1 . HIS A 1 159 ? -5.386  43.454 51.478 1.00 40.96 ? 159  HIS A ND1 1 
ATOM   1229 C CD2 . HIS A 1 159 ? -4.974  41.373 52.035 1.00 41.41 ? 159  HIS A CD2 1 
ATOM   1230 C CE1 . HIS A 1 159 ? -4.918  42.845 50.402 1.00 39.72 ? 159  HIS A CE1 1 
ATOM   1231 N NE2 . HIS A 1 159 ? -4.663  41.584 50.712 1.00 39.70 ? 159  HIS A NE2 1 
ATOM   1232 N N   . GLY A 1 160 ? -8.797  42.394 52.212 1.00 44.48 ? 160  GLY A N   1 
ATOM   1233 C CA  . GLY A 1 160 ? -9.707  41.372 51.723 1.00 43.48 ? 160  GLY A CA  1 
ATOM   1234 C C   . GLY A 1 160 ? -11.121 41.940 51.620 1.00 43.82 ? 160  GLY A C   1 
ATOM   1235 O O   . GLY A 1 160 ? -11.948 41.446 50.874 1.00 43.30 ? 160  GLY A O   1 
ATOM   1236 N N   . SER A 1 161 ? -11.395 42.989 52.385 1.00 43.57 ? 161  SER A N   1 
ATOM   1237 C CA  . SER A 1 161 ? -12.689 43.644 52.380 1.00 43.27 ? 161  SER A CA  1 
ATOM   1238 C C   . SER A 1 161 ? -12.637 44.838 51.428 1.00 43.96 ? 161  SER A C   1 
ATOM   1239 O O   . SER A 1 161 ? -11.603 45.504 51.325 1.00 44.16 ? 161  SER A O   1 
ATOM   1240 C CB  . SER A 1 161 ? -12.999 44.131 53.787 1.00 44.34 ? 161  SER A CB  1 
ATOM   1241 O OG  . SER A 1 161 ? -14.076 45.041 53.747 1.00 49.49 ? 161  SER A OG  1 
ATOM   1242 N N   . GLN A 1 162 ? -13.731 45.136 50.739 1.00 43.38 ? 162  GLN A N   1 
ATOM   1243 C CA  . GLN A 1 162 ? -13.713 46.265 49.820 1.00 44.08 ? 162  GLN A CA  1 
ATOM   1244 C C   . GLN A 1 162 ? -14.318 47.445 50.512 1.00 42.66 ? 162  GLN A C   1 
ATOM   1245 O O   . GLN A 1 162 ? -14.234 48.560 50.022 1.00 41.89 ? 162  GLN A O   1 
ATOM   1246 C CB  . GLN A 1 162 ? -14.489 45.969 48.528 1.00 47.87 ? 162  GLN A CB  1 
ATOM   1247 C CG  . GLN A 1 162 ? -13.784 44.979 47.594 1.00 52.20 ? 162  GLN A CG  1 
ATOM   1248 C CD  . GLN A 1 162 ? -12.321 45.346 47.351 1.00 56.15 ? 162  GLN A CD  1 
ATOM   1249 O OE1 . GLN A 1 162 ? -11.984 46.514 47.062 1.00 58.17 ? 162  GLN A OE1 1 
ATOM   1250 N NE2 . GLN A 1 162 ? -11.440 44.350 47.463 1.00 57.01 ? 162  GLN A NE2 1 
ATOM   1251 N N   . GLU A 1 163 ? -14.945 47.184 51.652 1.00 41.61 ? 163  GLU A N   1 
ATOM   1252 C CA  . GLU A 1 163 ? -15.546 48.244 52.457 1.00 41.93 ? 163  GLU A CA  1 
ATOM   1253 C C   . GLU A 1 163 ? -14.498 49.079 53.248 1.00 39.58 ? 163  GLU A C   1 
ATOM   1254 O O   . GLU A 1 163 ? -14.715 50.262 53.462 1.00 39.04 ? 163  GLU A O   1 
ATOM   1255 C CB  . GLU A 1 163 ? -16.586 47.656 53.420 1.00 44.82 ? 163  GLU A CB  1 
ATOM   1256 C CG  . GLU A 1 163 ? -17.835 47.107 52.716 1.00 47.51 ? 163  GLU A CG  1 
ATOM   1257 C CD  . GLU A 1 163 ? -18.480 48.141 51.825 1.00 50.77 ? 163  GLU A CD  1 
ATOM   1258 O OE1 . GLU A 1 163 ? -19.069 47.738 50.807 1.00 53.38 ? 163  GLU A OE1 1 
ATOM   1259 O OE2 . GLU A 1 163 ? -18.401 49.355 52.123 1.00 51.39 ? 163  GLU A OE2 1 
ATOM   1260 N N   . ALA A 1 164 ? -13.402 48.463 53.689 1.00 36.41 ? 164  ALA A N   1 
ATOM   1261 C CA  . ALA A 1 164 ? -12.323 49.193 54.414 1.00 36.58 ? 164  ALA A CA  1 
ATOM   1262 C C   . ALA A 1 164 ? -11.023 48.452 54.011 1.00 35.68 ? 164  ALA A C   1 
ATOM   1263 O O   . ALA A 1 164 ? -10.431 47.687 54.804 1.00 34.40 ? 164  ALA A O   1 
ATOM   1264 C CB  . ALA A 1 164 ? -12.545 49.149 55.974 1.00 35.17 ? 164  ALA A CB  1 
ATOM   1265 N N   . PRO A 1 165 ? -10.577 48.672 52.752 1.00 34.33 ? 165  PRO A N   1 
ATOM   1266 C CA  . PRO A 1 165 ? -9.376  48.029 52.210 1.00 34.55 ? 165  PRO A CA  1 
ATOM   1267 C C   . PRO A 1 165 ? -8.079  48.572 52.754 1.00 35.42 ? 165  PRO A C   1 
ATOM   1268 O O   . PRO A 1 165 ? -7.067  47.891 52.693 1.00 37.45 ? 165  PRO A O   1 
ATOM   1269 C CB  . PRO A 1 165 ? -9.503  48.247 50.707 1.00 33.24 ? 165  PRO A CB  1 
ATOM   1270 C CG  . PRO A 1 165 ? -10.184 49.610 50.618 1.00 33.98 ? 165  PRO A CG  1 
ATOM   1271 C CD  . PRO A 1 165 ? -11.130 49.672 51.820 1.00 33.57 ? 165  PRO A CD  1 
ATOM   1272 N N   . GLY A 1 166 ? -8.124  49.776 53.313 1.00 33.52 ? 166  GLY A N   1 
ATOM   1273 C CA  . GLY A 1 166 ? -6.902  50.383 53.810 1.00 33.05 ? 166  GLY A CA  1 
ATOM   1274 C C   . GLY A 1 166 ? -6.330  51.322 52.747 1.00 31.64 ? 166  GLY A C   1 
ATOM   1275 O O   . GLY A 1 166 ? -6.771  51.298 51.598 1.00 31.21 ? 166  GLY A O   1 
ATOM   1276 N N   . ASN A 1 167 ? -5.381  52.167 53.147 1.00 30.69 ? 167  ASN A N   1 
ATOM   1277 C CA  . ASN A 1 167 ? -4.738  53.094 52.229 1.00 29.09 ? 167  ASN A CA  1 
ATOM   1278 C C   . ASN A 1 167 ? -5.681  54.113 51.583 1.00 27.55 ? 167  ASN A C   1 
ATOM   1279 O O   . ASN A 1 167 ? -5.280  54.822 50.672 1.00 27.45 ? 167  ASN A O   1 
ATOM   1280 C CB  . ASN A 1 167 ? -4.006  52.279 51.133 1.00 28.09 ? 167  ASN A CB  1 
ATOM   1281 C CG  . ASN A 1 167 ? -2.821  51.510 51.700 1.00 29.12 ? 167  ASN A CG  1 
ATOM   1282 O OD1 . ASN A 1 167 ? -2.339  51.873 52.758 1.00 28.53 ? 167  ASN A OD1 1 
ATOM   1283 N ND2 . ASN A 1 167 ? -2.347  50.466 51.008 1.00 24.80 ? 167  ASN A ND2 1 
ATOM   1284 N N   . VAL A 1 168 ? -6.902  54.250 52.068 1.00 26.78 ? 168  VAL A N   1 
ATOM   1285 C CA  . VAL A 1 168 ? -7.806  55.164 51.356 1.00 26.69 ? 168  VAL A CA  1 
ATOM   1286 C C   . VAL A 1 168 ? -7.388  56.630 51.417 1.00 27.95 ? 168  VAL A C   1 
ATOM   1287 O O   . VAL A 1 168 ? -7.677  57.431 50.475 1.00 27.67 ? 168  VAL A O   1 
ATOM   1288 C CB  . VAL A 1 168 ? -9.326  54.952 51.767 1.00 26.41 ? 168  VAL A CB  1 
ATOM   1289 C CG1 . VAL A 1 168 ? -9.726  53.485 51.458 1.00 22.41 ? 168  VAL A CG1 1 
ATOM   1290 C CG2 . VAL A 1 168 ? -9.576  55.304 53.196 1.00 23.67 ? 168  VAL A CG2 1 
ATOM   1291 N N   . GLY A 1 169 ? -6.643  56.957 52.478 1.00 27.53 ? 169  GLY A N   1 
ATOM   1292 C CA  . GLY A 1 169 ? -6.126  58.305 52.647 1.00 27.25 ? 169  GLY A CA  1 
ATOM   1293 C C   . GLY A 1 169 ? -5.095  58.569 51.560 1.00 27.38 ? 169  GLY A C   1 
ATOM   1294 O O   . GLY A 1 169 ? -5.038  59.687 51.013 1.00 28.13 ? 169  GLY A O   1 
ATOM   1295 N N   . LEU A 1 170 ? -4.313  57.545 51.216 1.00 25.10 ? 170  LEU A N   1 
ATOM   1296 C CA  . LEU A 1 170 ? -3.335  57.688 50.135 1.00 26.09 ? 170  LEU A CA  1 
ATOM   1297 C C   . LEU A 1 170 ? -4.104  57.845 48.809 1.00 26.82 ? 170  LEU A C   1 
ATOM   1298 O O   . LEU A 1 170 ? -3.666  58.618 47.912 1.00 26.77 ? 170  LEU A O   1 
ATOM   1299 C CB  . LEU A 1 170 ? -2.406  56.452 50.042 1.00 24.85 ? 170  LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 170 ? -1.342  56.426 51.159 1.00 23.86 ? 170  LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 170 ? -0.612  55.095 51.188 1.00 21.73 ? 170  LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 170 ? -0.312  57.523 50.893 1.00 24.40 ? 170  LEU A CD2 1 
ATOM   1303 N N   . LEU A 1 171 ? -5.222  57.115 48.676 1.00 25.76 ? 171  LEU A N   1 
ATOM   1304 C CA  . LEU A 1 171 ? -6.042  57.217 47.473 1.00 26.98 ? 171  LEU A CA  1 
ATOM   1305 C C   . LEU A 1 171 ? -6.656  58.632 47.461 1.00 27.53 ? 171  LEU A C   1 
ATOM   1306 O O   . LEU A 1 171 ? -6.835  59.204 46.383 1.00 26.20 ? 171  LEU A O   1 
ATOM   1307 C CB  . LEU A 1 171 ? -7.140  56.116 47.417 1.00 26.57 ? 171  LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 171 ? -6.514  54.727 47.147 1.00 30.25 ? 171  LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 171 ? -7.587  53.665 47.211 1.00 28.93 ? 171  LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 171 ? -5.793  54.683 45.794 1.00 25.50 ? 171  LEU A CD2 1 
ATOM   1311 N N   . ASP A 1 172 ? -6.987  59.198 48.635 1.00 28.03 ? 172  ASP A N   1 
ATOM   1312 C CA  . ASP A 1 172 ? -7.491  60.590 48.621 1.00 27.78 ? 172  ASP A CA  1 
ATOM   1313 C C   . ASP A 1 172 ? -6.405  61.495 47.956 1.00 26.62 ? 172  ASP A C   1 
ATOM   1314 O O   . ASP A 1 172 ? -6.687  62.288 47.051 1.00 25.69 ? 172  ASP A O   1 
ATOM   1315 C CB  . ASP A 1 172 ? -7.768  61.117 50.041 1.00 27.86 ? 172  ASP A CB  1 
ATOM   1316 C CG  . ASP A 1 172 ? -8.917  60.383 50.742 1.00 31.09 ? 172  ASP A CG  1 
ATOM   1317 O OD1 . ASP A 1 172 ? -9.738  59.720 50.062 1.00 31.08 ? 172  ASP A OD1 1 
ATOM   1318 O OD2 . ASP A 1 172 ? -9.004  60.484 51.989 1.00 33.20 ? 172  ASP A OD2 1 
ATOM   1319 N N   . GLN A 1 173 ? -5.155  61.335 48.381 1.00 26.92 ? 173  GLN A N   1 
ATOM   1320 C CA  . GLN A 1 173 ? -4.079  62.152 47.836 1.00 26.46 ? 173  GLN A CA  1 
ATOM   1321 C C   . GLN A 1 173 ? -3.987  61.909 46.341 1.00 27.38 ? 173  GLN A C   1 
ATOM   1322 O O   . GLN A 1 173 ? -3.857  62.848 45.569 1.00 28.98 ? 173  GLN A O   1 
ATOM   1323 C CB  . GLN A 1 173 ? -2.742  61.817 48.505 1.00 24.86 ? 173  GLN A CB  1 
ATOM   1324 C CG  . GLN A 1 173 ? -2.683  62.010 50.012 1.00 23.16 ? 173  GLN A CG  1 
ATOM   1325 C CD  . GLN A 1 173 ? -1.342  61.495 50.616 1.00 27.56 ? 173  GLN A CD  1 
ATOM   1326 O OE1 . GLN A 1 173 ? -0.413  61.150 49.877 1.00 24.31 ? 173  GLN A OE1 1 
ATOM   1327 N NE2 . GLN A 1 173 ? -1.253  61.451 51.961 1.00 25.19 ? 173  GLN A NE2 1 
ATOM   1328 N N   . ARG A 1 174 ? -4.105  60.655 45.919 1.00 26.98 ? 174  ARG A N   1 
ATOM   1329 C CA  . ARG A 1 174 ? -3.981  60.367 44.501 1.00 27.98 ? 174  ARG A CA  1 
ATOM   1330 C C   . ARG A 1 174 ? -5.089  61.069 43.701 1.00 28.57 ? 174  ARG A C   1 
ATOM   1331 O O   . ARG A 1 174 ? -4.831  61.633 42.613 1.00 25.83 ? 174  ARG A O   1 
ATOM   1332 C CB  . ARG A 1 174 ? -4.019  58.836 44.210 1.00 27.34 ? 174  ARG A CB  1 
ATOM   1333 C CG  . ARG A 1 174 ? -3.874  58.525 42.693 1.00 28.64 ? 174  ARG A CG  1 
ATOM   1334 C CD  . ARG A 1 174 ? -3.956  57.021 42.364 1.00 27.76 ? 174  ARG A CD  1 
ATOM   1335 N NE  . ARG A 1 174 ? -2.879  56.237 42.969 1.00 26.66 ? 174  ARG A NE  1 
ATOM   1336 C CZ  . ARG A 1 174 ? -2.911  54.912 43.133 1.00 28.33 ? 174  ARG A CZ  1 
ATOM   1337 N NH1 . ARG A 1 174 ? -3.979  54.202 42.766 1.00 28.64 ? 174  ARG A NH1 1 
ATOM   1338 N NH2 . ARG A 1 174 ? -1.830  54.263 43.569 1.00 26.75 ? 174  ARG A NH2 1 
ATOM   1339 N N   . MET A 1 175 ? -6.310  61.004 44.235 1.00 28.14 ? 175  MET A N   1 
ATOM   1340 C CA  . MET A 1 175 ? -7.446  61.626 43.573 1.00 29.98 ? 175  MET A CA  1 
ATOM   1341 C C   . MET A 1 175 ? -7.216  63.115 43.398 1.00 29.30 ? 175  MET A C   1 
ATOM   1342 O O   . MET A 1 175 ? -7.579  63.664 42.383 1.00 30.82 ? 175  MET A O   1 
ATOM   1343 C CB  . MET A 1 175 ? -8.739  61.416 44.354 1.00 30.88 ? 175  MET A CB  1 
ATOM   1344 C CG  . MET A 1 175 ? -9.950  61.868 43.519 1.00 35.77 ? 175  MET A CG  1 
ATOM   1345 S SD  . MET A 1 175 ? -11.374 60.831 43.798 1.00 41.45 ? 175  MET A SD  1 
ATOM   1346 C CE  . MET A 1 175 ? -11.845 61.460 44.972 1.00 36.73 ? 175  MET A CE  1 
ATOM   1347 N N   . ALA A 1 176 ? -6.626  63.768 44.395 1.00 29.65 ? 176  ALA A N   1 
ATOM   1348 C CA  . ALA A 1 176 ? -6.354  65.193 44.312 1.00 29.32 ? 176  ALA A CA  1 
ATOM   1349 C C   . ALA A 1 176 ? -5.288  65.420 43.203 1.00 29.07 ? 176  ALA A C   1 
ATOM   1350 O O   . ALA A 1 176 ? -5.348  66.397 42.446 1.00 28.22 ? 176  ALA A O   1 
ATOM   1351 C CB  . ALA A 1 176 ? -5.844  65.708 45.694 1.00 28.70 ? 176  ALA A CB  1 
ATOM   1352 N N   . LEU A 1 177 ? -4.319  64.515 43.109 1.00 28.18 ? 177  LEU A N   1 
ATOM   1353 C CA  . LEU A 1 177 ? -3.281  64.648 42.102 1.00 28.54 ? 177  LEU A CA  1 
ATOM   1354 C C   . LEU A 1 177 ? -3.909  64.432 40.708 1.00 29.68 ? 177  LEU A C   1 
ATOM   1355 O O   . LEU A 1 177 ? -3.494  65.054 39.734 1.00 28.01 ? 177  LEU A O   1 
ATOM   1356 C CB  . LEU A 1 177 ? -2.157  63.639 42.333 1.00 28.30 ? 177  LEU A CB  1 
ATOM   1357 C CG  . LEU A 1 177 ? -1.364  63.847 43.623 1.00 30.22 ? 177  LEU A CG  1 
ATOM   1358 C CD1 . LEU A 1 177 ? -0.247  62.817 43.642 1.00 29.45 ? 177  LEU A CD1 1 
ATOM   1359 C CD2 . LEU A 1 177 ? -0.752  65.287 43.683 1.00 28.50 ? 177  LEU A CD2 1 
ATOM   1360 N N   . GLN A 1 178 ? -4.903  63.546 40.629 1.00 29.99 ? 178  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 178 ? -5.589  63.291 39.355 1.00 30.32 ? 178  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 178 ? -6.346  64.576 38.986 1.00 29.27 ? 178  GLN A C   1 
ATOM   1363 O O   . GLN A 1 178 ? -6.373  64.977 37.830 1.00 29.12 ? 178  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 178 ? -6.582  62.117 39.472 1.00 29.92 ? 178  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 178 ? -7.309  61.773 38.153 1.00 30.38 ? 178  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 178 ? -6.347  61.177 37.125 1.00 32.81 ? 178  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 178 ? -5.816  60.109 37.331 1.00 33.80 ? 178  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 178 ? -6.113  61.886 36.028 1.00 30.50 ? 178  GLN A NE2 1 
ATOM   1369 N N   . TRP A 1 179 ? -6.927  65.233 39.980 1.00 28.51 ? 179  TRP A N   1 
ATOM   1370 C CA  . TRP A 1 179 ? -7.666  66.464 39.717 1.00 28.41 ? 179  TRP A CA  1 
ATOM   1371 C C   . TRP A 1 179 ? -6.727  67.569 39.198 1.00 29.74 ? 179  TRP A C   1 
ATOM   1372 O O   . TRP A 1 179 ? -7.094  68.304 38.237 1.00 30.68 ? 179  TRP A O   1 
ATOM   1373 C CB  . TRP A 1 179 ? -8.361  66.918 40.981 1.00 28.72 ? 179  TRP A CB  1 
ATOM   1374 C CG  . TRP A 1 179 ? -9.422  67.933 40.765 1.00 29.29 ? 179  TRP A CG  1 
ATOM   1375 C CD1 . TRP A 1 179 ? -10.773 67.702 40.541 1.00 30.21 ? 179  TRP A CD1 1 
ATOM   1376 C CD2 . TRP A 1 179 ? -9.236  69.349 40.668 1.00 28.41 ? 179  TRP A CD2 1 
ATOM   1377 N NE1 . TRP A 1 179 ? -11.411 68.905 40.294 1.00 29.03 ? 179  TRP A NE1 1 
ATOM   1378 C CE2 . TRP A 1 179 ? -10.499 69.923 40.373 1.00 26.45 ? 179  TRP A CE2 1 
ATOM   1379 C CE3 . TRP A 1 179 ? -8.127  70.186 40.794 1.00 26.14 ? 179  TRP A CE3 1 
ATOM   1380 C CZ2 . TRP A 1 179 ? -10.679 71.303 40.210 1.00 26.92 ? 179  TRP A CZ2 1 
ATOM   1381 C CZ3 . TRP A 1 179 ? -8.313  71.559 40.624 1.00 27.22 ? 179  TRP A CZ3 1 
ATOM   1382 C CH2 . TRP A 1 179 ? -9.578  72.101 40.340 1.00 26.60 ? 179  TRP A CH2 1 
ATOM   1383 N N   . VAL A 1 180 ? -5.534  67.683 39.812 1.00 27.54 ? 180  VAL A N   1 
ATOM   1384 C CA  . VAL A 1 180 ? -4.512  68.675 39.410 1.00 27.20 ? 180  VAL A CA  1 
ATOM   1385 C C   . VAL A 1 180 ? -4.050  68.350 37.972 1.00 27.87 ? 180  VAL A C   1 
ATOM   1386 O O   . VAL A 1 180 ? -3.952  69.232 37.091 1.00 28.19 ? 180  VAL A O   1 
ATOM   1387 C CB  . VAL A 1 180 ? -3.289  68.628 40.402 1.00 26.64 ? 180  VAL A CB  1 
ATOM   1388 C CG1 . VAL A 1 180 ? -2.047  69.374 39.843 1.00 26.38 ? 180  VAL A CG1 1 
ATOM   1389 C CG2 . VAL A 1 180 ? -3.701  69.238 41.713 1.00 25.96 ? 180  VAL A CG2 1 
ATOM   1390 N N   . HIS A 1 181 ? -3.759  67.082 37.727 1.00 26.83 ? 181  HIS A N   1 
ATOM   1391 C CA  . HIS A 1 181 ? -3.366  66.673 36.392 1.00 26.77 ? 181  HIS A CA  1 
ATOM   1392 C C   . HIS A 1 181 ? -4.439  67.118 35.374 1.00 29.00 ? 181  HIS A C   1 
ATOM   1393 O O   . HIS A 1 181 ? -4.103  67.659 34.304 1.00 29.23 ? 181  HIS A O   1 
ATOM   1394 C CB  . HIS A 1 181 ? -3.242  65.141 36.320 1.00 26.63 ? 181  HIS A CB  1 
ATOM   1395 C CG  . HIS A 1 181 ? -3.075  64.598 34.919 1.00 28.93 ? 181  HIS A CG  1 
ATOM   1396 N ND1 . HIS A 1 181 ? -4.144  64.323 34.080 1.00 26.44 ? 181  HIS A ND1 1 
ATOM   1397 C CD2 . HIS A 1 181 ? -1.957  64.269 34.225 1.00 25.89 ? 181  HIS A CD2 1 
ATOM   1398 C CE1 . HIS A 1 181 ? -3.681  63.846 32.933 1.00 27.98 ? 181  HIS A CE1 1 
ATOM   1399 N NE2 . HIS A 1 181 ? -2.357  63.801 32.996 1.00 26.08 ? 181  HIS A NE2 1 
ATOM   1400 N N   . ASP A 1 182 ? -5.711  66.902 35.724 1.00 27.33 ? 182  ASP A N   1 
ATOM   1401 C CA  . ASP A 1 182 ? -6.821  67.168 34.817 1.00 28.09 ? 182  ASP A CA  1 
ATOM   1402 C C   . ASP A 1 182 ? -7.267  68.628 34.672 1.00 29.00 ? 182  ASP A C   1 
ATOM   1403 O O   . ASP A 1 182 ? -7.751  69.034 33.602 1.00 28.52 ? 182  ASP A O   1 
ATOM   1404 C CB  . ASP A 1 182 ? -8.068  66.381 35.249 1.00 27.90 ? 182  ASP A CB  1 
ATOM   1405 C CG  . ASP A 1 182 ? -7.914  64.848 35.122 1.00 30.51 ? 182  ASP A CG  1 
ATOM   1406 O OD1 . ASP A 1 182 ? -6.994  64.346 34.431 1.00 30.39 ? 182  ASP A OD1 1 
ATOM   1407 O OD2 . ASP A 1 182 ? -8.764  64.143 35.698 1.00 31.20 ? 182  ASP A OD2 1 
ATOM   1408 N N   . ASN A 1 183 ? -7.104  69.392 35.735 1.00 27.34 ? 183  ASN A N   1 
ATOM   1409 C CA  . ASN A 1 183 ? -7.596  70.760 35.758 1.00 29.61 ? 183  ASN A CA  1 
ATOM   1410 C C   . ASN A 1 183 ? -6.655  71.912 35.994 1.00 30.27 ? 183  ASN A C   1 
ATOM   1411 O O   . ASN A 1 183 ? -7.064  73.075 35.805 1.00 30.90 ? 183  ASN A O   1 
ATOM   1412 C CB  . ASN A 1 183 ? -8.691  70.861 36.835 1.00 29.47 ? 183  ASN A CB  1 
ATOM   1413 C CG  . ASN A 1 183 ? -9.888  69.984 36.515 1.00 31.81 ? 183  ASN A CG  1 
ATOM   1414 O OD1 . ASN A 1 183 ? -10.742 70.341 35.646 1.00 29.55 ? 183  ASN A OD1 1 
ATOM   1415 N ND2 . ASN A 1 183 ? -9.965  68.816 37.194 1.00 28.75 ? 183  ASN A ND2 1 
ATOM   1416 N N   . ILE A 1 184 ? -5.408  71.640 36.379 1.00 29.96 ? 184  ILE A N   1 
ATOM   1417 C CA  . ILE A 1 184 ? -4.544  72.757 36.724 1.00 30.48 ? 184  ILE A CA  1 
ATOM   1418 C C   . ILE A 1 184 ? -4.222  73.723 35.552 1.00 30.69 ? 184  ILE A C   1 
ATOM   1419 O O   . ILE A 1 184 ? -3.937  74.896 35.786 1.00 30.20 ? 184  ILE A O   1 
ATOM   1420 C CB  . ILE A 1 184 ? -3.268  72.266 37.466 1.00 29.09 ? 184  ILE A CB  1 
ATOM   1421 C CG1 . ILE A 1 184 ? -2.748  73.375 38.401 1.00 28.58 ? 184  ILE A CG1 1 
ATOM   1422 C CG2 . ILE A 1 184 ? -2.222  71.847 36.482 1.00 27.91 ? 184  ILE A CG2 1 
ATOM   1423 C CD1 . ILE A 1 184 ? -3.695  73.689 39.625 1.00 27.42 ? 184  ILE A CD1 1 
ATOM   1424 N N   . GLN A 1 185 ? -4.326  73.238 34.313 1.00 30.37 ? 185  GLN A N   1 
ATOM   1425 C CA  . GLN A 1 185 ? -4.066  74.067 33.138 1.00 30.23 ? 185  GLN A CA  1 
ATOM   1426 C C   . GLN A 1 185 ? -5.016  75.265 33.151 1.00 31.73 ? 185  GLN A C   1 
ATOM   1427 O O   . GLN A 1 185 ? -4.629  76.338 32.697 1.00 32.45 ? 185  GLN A O   1 
ATOM   1428 C CB  . GLN A 1 185 ? -4.287  73.277 31.825 1.00 29.27 ? 185  GLN A CB  1 
ATOM   1429 C CG  . GLN A 1 185 ? -5.760  73.011 31.529 1.00 30.72 ? 185  GLN A CG  1 
ATOM   1430 C CD  . GLN A 1 185 ? -6.007  71.828 30.544 1.00 32.63 ? 185  GLN A CD  1 
ATOM   1431 O OE1 . GLN A 1 185 ? -5.790  70.656 30.871 1.00 33.04 ? 185  GLN A OE1 1 
ATOM   1432 N NE2 . GLN A 1 185 ? -6.468  72.150 29.349 1.00 31.10 ? 185  GLN A NE2 1 
ATOM   1433 N N   . PHE A 1 186 ? -6.237  75.107 33.681 1.00 31.00 ? 186  PHE A N   1 
ATOM   1434 C CA  . PHE A 1 186 ? -7.177  76.241 33.678 1.00 32.57 ? 186  PHE A CA  1 
ATOM   1435 C C   . PHE A 1 186 ? -6.802  77.362 34.653 1.00 33.34 ? 186  PHE A C   1 
ATOM   1436 O O   . PHE A 1 186 ? -7.306  78.477 34.532 1.00 32.28 ? 186  PHE A O   1 
ATOM   1437 C CB  . PHE A 1 186 ? -8.619  75.752 33.906 1.00 30.90 ? 186  PHE A CB  1 
ATOM   1438 C CG  . PHE A 1 186 ? -9.033  74.667 32.931 1.00 32.62 ? 186  PHE A CG  1 
ATOM   1439 C CD1 . PHE A 1 186 ? -9.089  74.932 31.549 1.00 30.50 ? 186  PHE A CD1 1 
ATOM   1440 C CD2 . PHE A 1 186 ? -9.267  73.355 33.378 1.00 30.53 ? 186  PHE A CD2 1 
ATOM   1441 C CE1 . PHE A 1 186 ? -9.374  73.901 30.610 1.00 32.20 ? 186  PHE A CE1 1 
ATOM   1442 C CE2 . PHE A 1 186 ? -9.548  72.314 32.472 1.00 33.19 ? 186  PHE A CE2 1 
ATOM   1443 C CZ  . PHE A 1 186 ? -9.606  72.578 31.068 1.00 32.70 ? 186  PHE A CZ  1 
ATOM   1444 N N   . PHE A 1 187 ? -5.892  77.073 35.588 1.00 32.79 ? 187  PHE A N   1 
ATOM   1445 C CA  . PHE A 1 187 ? -5.452  78.064 36.575 1.00 32.15 ? 187  PHE A CA  1 
ATOM   1446 C C   . PHE A 1 187 ? -4.102  78.584 36.163 1.00 32.06 ? 187  PHE A C   1 
ATOM   1447 O O   . PHE A 1 187 ? -3.451  79.321 36.891 1.00 32.48 ? 187  PHE A O   1 
ATOM   1448 C CB  . PHE A 1 187 ? -5.343  77.446 37.979 1.00 29.88 ? 187  PHE A CB  1 
ATOM   1449 C CG  . PHE A 1 187 ? -6.651  76.967 38.525 1.00 31.04 ? 187  PHE A CG  1 
ATOM   1450 C CD1 . PHE A 1 187 ? -7.131  75.694 38.215 1.00 29.22 ? 187  PHE A CD1 1 
ATOM   1451 C CD2 . PHE A 1 187 ? -7.416  77.796 39.366 1.00 30.30 ? 187  PHE A CD2 1 
ATOM   1452 C CE1 . PHE A 1 187 ? -8.349  75.251 38.737 1.00 28.70 ? 187  PHE A CE1 1 
ATOM   1453 C CE2 . PHE A 1 187 ? -8.623  77.364 39.886 1.00 28.78 ? 187  PHE A CE2 1 
ATOM   1454 C CZ  . PHE A 1 187 ? -9.100  76.080 39.572 1.00 29.42 ? 187  PHE A CZ  1 
ATOM   1455 N N   . GLY A 1 188 ? -3.652  78.144 35.000 1.00 33.02 ? 188  GLY A N   1 
ATOM   1456 C CA  . GLY A 1 188 ? -2.367  78.617 34.532 1.00 31.90 ? 188  GLY A CA  1 
ATOM   1457 C C   . GLY A 1 188 ? -1.216  77.673 34.808 1.00 32.82 ? 188  GLY A C   1 
ATOM   1458 O O   . GLY A 1 188 ? -0.066  77.995 34.402 1.00 32.13 ? 188  GLY A O   1 
ATOM   1459 N N   . GLY A 1 189 ? -1.501  76.528 35.464 1.00 30.42 ? 189  GLY A N   1 
ATOM   1460 C CA  . GLY A 1 189 ? -0.441  75.569 35.780 1.00 28.84 ? 189  GLY A CA  1 
ATOM   1461 C C   . GLY A 1 189 ? -0.106  74.664 34.598 1.00 29.83 ? 189  GLY A C   1 
ATOM   1462 O O   . GLY A 1 189 ? -0.942  74.483 33.726 1.00 29.48 ? 189  GLY A O   1 
ATOM   1463 N N   . ASP A 1 190 ? 1.124   74.163 34.529 1.00 28.64 ? 190  ASP A N   1 
ATOM   1464 C CA  . ASP A 1 190 ? 1.541   73.219 33.500 1.00 31.44 ? 190  ASP A CA  1 
ATOM   1465 C C   . ASP A 1 190 ? 1.388   71.789 34.143 1.00 30.48 ? 190  ASP A C   1 
ATOM   1466 O O   . ASP A 1 190 ? 2.203   71.400 34.961 1.00 32.89 ? 190  ASP A O   1 
ATOM   1467 C CB  . ASP A 1 190 ? 3.015   73.482 33.102 1.00 32.21 ? 190  ASP A CB  1 
ATOM   1468 C CG  . ASP A 1 190 ? 3.553   72.423 32.162 1.00 33.48 ? 190  ASP A CG  1 
ATOM   1469 O OD1 . ASP A 1 190 ? 2.763   71.554 31.742 1.00 35.00 ? 190  ASP A OD1 1 
ATOM   1470 O OD2 . ASP A 1 190 ? 4.751   72.433 31.854 1.00 31.09 ? 190  ASP A OD2 1 
ATOM   1471 N N   . PRO A 1 191 ? 0.362   71.002 33.754 1.00 28.86 ? 191  PRO A N   1 
ATOM   1472 C CA  . PRO A 1 191 ? 0.237   69.676 34.378 1.00 28.45 ? 191  PRO A CA  1 
ATOM   1473 C C   . PRO A 1 191 ? 1.399   68.731 34.079 1.00 28.80 ? 191  PRO A C   1 
ATOM   1474 O O   . PRO A 1 191 ? 1.521   67.679 34.696 1.00 28.65 ? 191  PRO A O   1 
ATOM   1475 C CB  . PRO A 1 191 ? -1.126  69.154 33.859 1.00 27.37 ? 191  PRO A CB  1 
ATOM   1476 C CG  . PRO A 1 191 ? -1.183  69.760 32.389 1.00 28.21 ? 191  PRO A CG  1 
ATOM   1477 C CD  . PRO A 1 191 ? -0.607  71.195 32.648 1.00 28.95 ? 191  PRO A CD  1 
ATOM   1478 N N   . LYS A 1 192 ? 2.277   69.097 33.149 1.00 29.45 ? 192  LYS A N   1 
ATOM   1479 C CA  . LYS A 1 192 ? 3.406   68.219 32.854 1.00 28.94 ? 192  LYS A CA  1 
ATOM   1480 C C   . LYS A 1 192 ? 4.598   68.605 33.750 1.00 29.46 ? 192  LYS A C   1 
ATOM   1481 O O   . LYS A 1 192 ? 5.657   67.918 33.771 1.00 27.71 ? 192  LYS A O   1 
ATOM   1482 C CB  . LYS A 1 192 ? 3.789   68.291 31.373 1.00 30.38 ? 192  LYS A CB  1 
ATOM   1483 C CG  . LYS A 1 192 ? 4.712   69.443 31.064 1.00 34.59 ? 192  LYS A CG  1 
ATOM   1484 N N   . THR A 1 193 ? 4.428   69.675 34.516 1.00 27.06 ? 193  THR A N   1 
ATOM   1485 C CA  . THR A 1 193 ? 5.520   70.045 35.396 1.00 29.38 ? 193  THR A CA  1 
ATOM   1486 C C   . THR A 1 193 ? 5.064   70.204 36.873 1.00 29.79 ? 193  THR A C   1 
ATOM   1487 O O   . THR A 1 193 ? 5.259   71.300 37.460 1.00 29.62 ? 193  THR A O   1 
ATOM   1488 C CB  . THR A 1 193 ? 6.203   71.363 34.907 1.00 31.70 ? 193  THR A CB  1 
ATOM   1489 O OG1 . THR A 1 193 ? 6.534   71.224 33.513 1.00 31.27 ? 193  THR A OG1 1 
ATOM   1490 C CG2 . THR A 1 193 ? 7.489   71.653 35.705 1.00 28.06 ? 193  THR A CG2 1 
ATOM   1491 N N   . VAL A 1 194 ? 4.434   69.155 37.451 1.00 28.14 ? 194  VAL A N   1 
ATOM   1492 C CA  . VAL A 1 194 ? 4.051   69.220 38.845 1.00 27.02 ? 194  VAL A CA  1 
ATOM   1493 C C   . VAL A 1 194 ? 4.979   68.477 39.787 1.00 29.04 ? 194  VAL A C   1 
ATOM   1494 O O   . VAL A 1 194 ? 5.413   67.326 39.556 1.00 30.00 ? 194  VAL A O   1 
ATOM   1495 C CB  . VAL A 1 194 ? 2.502   68.879 39.136 1.00 30.39 ? 194  VAL A CB  1 
ATOM   1496 C CG1 . VAL A 1 194 ? 1.701   68.646 37.870 1.00 27.72 ? 194  VAL A CG1 1 
ATOM   1497 C CG2 . VAL A 1 194 ? 2.305   67.840 40.178 1.00 28.37 ? 194  VAL A CG2 1 
ATOM   1498 N N   . THR A 1 195 ? 5.373   69.203 40.826 1.00 30.16 ? 195  THR A N   1 
ATOM   1499 C CA  . THR A 1 195 ? 6.228   68.662 41.870 1.00 28.21 ? 195  THR A CA  1 
ATOM   1500 C C   . THR A 1 195 ? 5.361   68.424 43.101 1.00 28.81 ? 195  THR A C   1 
ATOM   1501 O O   . THR A 1 195 ? 4.658   69.353 43.549 1.00 29.25 ? 195  THR A O   1 
ATOM   1502 C CB  . THR A 1 195 ? 7.364   69.643 42.265 1.00 28.47 ? 195  THR A CB  1 
ATOM   1503 O OG1 . THR A 1 195 ? 8.261   69.771 41.163 1.00 28.57 ? 195  THR A OG1 1 
ATOM   1504 C CG2 . THR A 1 195 ? 8.188   69.086 43.518 1.00 26.52 ? 195  THR A CG2 1 
ATOM   1505 N N   . ILE A 1 196 ? 5.332   67.183 43.605 1.00 27.98 ? 196  ILE A N   1 
ATOM   1506 C CA  . ILE A 1 196 ? 4.647   66.940 44.883 1.00 26.66 ? 196  ILE A CA  1 
ATOM   1507 C C   . ILE A 1 196 ? 5.722   67.075 45.989 1.00 27.03 ? 196  ILE A C   1 
ATOM   1508 O O   . ILE A 1 196 ? 6.878   66.619 45.827 1.00 25.59 ? 196  ILE A O   1 
ATOM   1509 C CB  . ILE A 1 196 ? 4.019   65.538 44.982 1.00 27.46 ? 196  ILE A CB  1 
ATOM   1510 C CG1 . ILE A 1 196 ? 5.037   64.451 44.715 1.00 25.92 ? 196  ILE A CG1 1 
ATOM   1511 C CG2 . ILE A 1 196 ? 2.883   65.384 43.959 1.00 27.69 ? 196  ILE A CG2 1 
ATOM   1512 C CD1 . ILE A 1 196 ? 4.376   63.037 44.868 1.00 24.30 ? 196  ILE A CD1 1 
ATOM   1513 N N   . PHE A 1 197 ? 5.386   67.747 47.085 1.00 26.44 ? 197  PHE A N   1 
ATOM   1514 C CA  . PHE A 1 197 ? 6.335   67.900 48.198 1.00 25.44 ? 197  PHE A CA  1 
ATOM   1515 C C   . PHE A 1 197 ? 5.591   67.794 49.523 1.00 27.18 ? 197  PHE A C   1 
ATOM   1516 O O   . PHE A 1 197 ? 4.413   68.122 49.610 1.00 27.73 ? 197  PHE A O   1 
ATOM   1517 C CB  . PHE A 1 197 ? 7.174   69.203 48.069 1.00 25.07 ? 197  PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 197 ? 6.430   70.536 48.319 1.00 24.92 ? 197  PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 197 ? 5.277   70.886 47.629 1.00 25.85 ? 197  PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 197 ? 6.995   71.491 49.179 1.00 25.90 ? 197  PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 197 ? 4.693   72.181 47.795 1.00 26.08 ? 197  PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 197 ? 6.437   72.802 49.374 1.00 24.92 ? 197  PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 197 ? 5.288   73.144 48.680 1.00 28.11 ? 197  PHE A CZ  1 
ATOM   1524 N N   . GLY A 1 198 ? 6.246   67.295 50.561 1.00 27.42 ? 198  GLY A N   1 
ATOM   1525 C CA  . GLY A 1 198 ? 5.541   67.127 51.821 1.00 26.24 ? 198  GLY A CA  1 
ATOM   1526 C C   . GLY A 1 198 ? 6.537   66.885 52.930 1.00 25.73 ? 198  GLY A C   1 
ATOM   1527 O O   . GLY A 1 198 ? 7.681   66.608 52.639 1.00 26.38 ? 198  GLY A O   1 
ATOM   1528 N N   . GLU A 1 199 ? 6.105   66.995 54.184 1.00 24.39 ? 199  GLU A N   1 
ATOM   1529 C CA  . GLU A 1 199 ? 6.997   66.843 55.315 1.00 25.83 ? 199  GLU A CA  1 
ATOM   1530 C C   . GLU A 1 199 ? 6.486   65.771 56.251 1.00 24.98 ? 199  GLU A C   1 
ATOM   1531 O O   . GLU A 1 199 ? 5.298   65.625 56.414 1.00 26.25 ? 199  GLU A O   1 
ATOM   1532 C CB  . GLU A 1 199 ? 7.143   68.207 56.061 1.00 24.53 ? 199  GLU A CB  1 
ATOM   1533 C CG  . GLU A 1 199 ? 8.129   68.196 57.248 1.00 25.07 ? 199  GLU A CG  1 
ATOM   1534 C CD  . GLU A 1 199 ? 7.493   67.832 58.589 1.00 26.27 ? 199  GLU A CD  1 
ATOM   1535 O OE1 . GLU A 1 199 ? 6.268   67.722 58.634 1.00 26.88 ? 199  GLU A OE1 1 
ATOM   1536 O OE2 . GLU A 1 199 ? 8.219   67.650 59.616 1.00 28.07 ? 199  GLU A OE2 1 
ATOM   1537 N N   . SER A 1 200 ? 7.402   65.042 56.867 1.00 24.91 ? 200  SER A N   1 
ATOM   1538 C CA  . SER A 1 200 ? 7.085   63.964 57.788 1.00 25.91 ? 200  SER A CA  1 
ATOM   1539 C C   . SER A 1 200 ? 6.133   62.954 57.101 1.00 23.96 ? 200  SER A C   1 
ATOM   1540 O O   . SER A 1 200 ? 6.479   62.453 56.041 1.00 26.20 ? 200  SER A O   1 
ATOM   1541 C CB  . SER A 1 200 ? 6.501   64.529 59.092 1.00 27.55 ? 200  SER A CB  1 
ATOM   1542 O OG  . SER A 1 200 ? 6.666   63.537 60.101 1.00 31.48 ? 200  SER A OG  1 
ATOM   1543 N N   . ALA A 1 201 ? 4.975   62.627 57.662 1.00 22.32 ? 201  ALA A N   1 
ATOM   1544 C CA  . ALA A 1 201 ? 4.071   61.697 56.958 1.00 23.26 ? 201  ALA A CA  1 
ATOM   1545 C C   . ALA A 1 201 ? 3.824   62.156 55.494 1.00 24.33 ? 201  ALA A C   1 
ATOM   1546 O O   . ALA A 1 201 ? 3.608   61.310 54.614 1.00 26.02 ? 201  ALA A O   1 
ATOM   1547 C CB  . ALA A 1 201 ? 2.713   61.545 57.707 1.00 20.23 ? 201  ALA A CB  1 
ATOM   1548 N N   . GLY A 1 202 ? 3.861   63.481 55.249 1.00 23.44 ? 202  GLY A N   1 
ATOM   1549 C CA  . GLY A 1 202 ? 3.698   64.014 53.906 1.00 23.69 ? 202  GLY A CA  1 
ATOM   1550 C C   . GLY A 1 202 ? 4.896   63.634 53.017 1.00 24.52 ? 202  GLY A C   1 
ATOM   1551 O O   . GLY A 1 202 ? 4.733   63.357 51.814 1.00 25.82 ? 202  GLY A O   1 
ATOM   1552 N N   . GLY A 1 203 ? 6.102   63.618 53.584 1.00 23.22 ? 203  GLY A N   1 
ATOM   1553 C CA  . GLY A 1 203 ? 7.267   63.217 52.794 1.00 23.89 ? 203  GLY A CA  1 
ATOM   1554 C C   . GLY A 1 203 ? 7.205   61.691 52.573 1.00 24.30 ? 203  GLY A C   1 
ATOM   1555 O O   . GLY A 1 203 ? 7.505   61.182 51.495 1.00 26.43 ? 203  GLY A O   1 
ATOM   1556 N N   . ALA A 1 204 ? 6.829   60.941 53.603 1.00 25.36 ? 204  ALA A N   1 
ATOM   1557 C CA  . ALA A 1 204 ? 6.675   59.494 53.447 1.00 25.38 ? 204  ALA A CA  1 
ATOM   1558 C C   . ALA A 1 204 ? 5.613   59.267 52.293 1.00 26.25 ? 204  ALA A C   1 
ATOM   1559 O O   . ALA A 1 204 ? 5.833   58.427 51.375 1.00 27.06 ? 204  ALA A O   1 
ATOM   1560 C CB  . ALA A 1 204 ? 6.186   58.878 54.794 1.00 23.02 ? 204  ALA A CB  1 
ATOM   1561 N N   . SER A 1 205 ? 4.482   59.990 52.356 1.00 24.81 ? 205  SER A N   1 
ATOM   1562 C CA  . SER A 1 205 ? 3.455   59.882 51.309 1.00 26.14 ? 205  SER A CA  1 
ATOM   1563 C C   . SER A 1 205 ? 4.055   60.156 49.908 1.00 25.46 ? 205  SER A C   1 
ATOM   1564 O O   . SER A 1 205 ? 3.841   59.397 48.961 1.00 26.30 ? 205  SER A O   1 
ATOM   1565 C CB  . SER A 1 205 ? 2.317   60.883 51.534 1.00 25.25 ? 205  SER A CB  1 
ATOM   1566 O OG  . SER A 1 205 ? 1.571   60.567 52.682 1.00 26.10 ? 205  SER A OG  1 
ATOM   1567 N N   . VAL A 1 206 ? 4.794   61.260 49.786 1.00 25.24 ? 206  VAL A N   1 
ATOM   1568 C CA  . VAL A 1 206 ? 5.406   61.604 48.521 1.00 24.34 ? 206  VAL A CA  1 
ATOM   1569 C C   . VAL A 1 206 ? 6.174   60.378 48.019 1.00 25.08 ? 206  VAL A C   1 
ATOM   1570 O O   . VAL A 1 206 ? 5.984   59.949 46.873 1.00 26.18 ? 206  VAL A O   1 
ATOM   1571 C CB  . VAL A 1 206 ? 6.361   62.848 48.664 1.00 25.16 ? 206  VAL A CB  1 
ATOM   1572 C CG1 . VAL A 1 206 ? 7.363   62.933 47.469 1.00 23.29 ? 206  VAL A CG1 1 
ATOM   1573 C CG2 . VAL A 1 206 ? 5.509   64.139 48.694 1.00 24.79 ? 206  VAL A CG2 1 
ATOM   1574 N N   . GLY A 1 207 ? 7.033   59.826 48.871 1.00 23.57 ? 207  GLY A N   1 
ATOM   1575 C CA  . GLY A 1 207 ? 7.809   58.649 48.498 1.00 23.89 ? 207  GLY A CA  1 
ATOM   1576 C C   . GLY A 1 207 ? 6.932   57.453 48.135 1.00 25.29 ? 207  GLY A C   1 
ATOM   1577 O O   . GLY A 1 207 ? 7.299   56.631 47.255 1.00 24.22 ? 207  GLY A O   1 
ATOM   1578 N N   . MET A 1 208 ? 5.768   57.360 48.786 1.00 23.89 ? 208  MET A N   1 
ATOM   1579 C CA  . MET A 1 208 ? 4.831   56.272 48.504 1.00 25.12 ? 208  MET A CA  1 
ATOM   1580 C C   . MET A 1 208 ? 4.250   56.406 47.064 1.00 26.38 ? 208  MET A C   1 
ATOM   1581 O O   . MET A 1 208 ? 3.988   55.392 46.400 1.00 24.87 ? 208  MET A O   1 
ATOM   1582 C CB  . MET A 1 208 ? 3.693   56.239 49.562 1.00 24.33 ? 208  MET A CB  1 
ATOM   1583 C CG  . MET A 1 208 ? 4.138   55.498 50.869 1.00 23.97 ? 208  MET A CG  1 
ATOM   1584 S SD  . MET A 1 208 ? 3.137   55.803 52.324 1.00 26.84 ? 208  MET A SD  1 
ATOM   1585 C CE  . MET A 1 208 ? 4.075   54.740 53.494 1.00 24.13 ? 208  MET A CE  1 
ATOM   1586 N N   . HIS A 1 209 ? 4.047   57.640 46.600 1.00 26.30 ? 209  HIS A N   1 
ATOM   1587 C CA  . HIS A 1 209 ? 3.526   57.836 45.247 1.00 27.05 ? 209  HIS A CA  1 
ATOM   1588 C C   . HIS A 1 209 ? 4.621   57.599 44.236 1.00 26.76 ? 209  HIS A C   1 
ATOM   1589 O O   . HIS A 1 209 ? 4.340   57.271 43.081 1.00 27.86 ? 209  HIS A O   1 
ATOM   1590 C CB  . HIS A 1 209 ? 2.940   59.232 45.052 1.00 26.30 ? 209  HIS A CB  1 
ATOM   1591 C CG  . HIS A 1 209 ? 1.726   59.480 45.889 1.00 29.38 ? 209  HIS A CG  1 
ATOM   1592 N ND1 . HIS A 1 209 ? 0.549   58.776 45.717 1.00 28.23 ? 209  HIS A ND1 1 
ATOM   1593 C CD2 . HIS A 1 209 ? 1.516   60.330 46.931 1.00 27.04 ? 209  HIS A CD2 1 
ATOM   1594 C CE1 . HIS A 1 209 ? -0.332  59.183 46.612 1.00 27.76 ? 209  HIS A CE1 1 
ATOM   1595 N NE2 . HIS A 1 209 ? 0.229   60.123 47.360 1.00 28.16 ? 209  HIS A NE2 1 
ATOM   1596 N N   . ILE A 1 210 ? 5.873   57.790 44.647 1.00 27.54 ? 210  ILE A N   1 
ATOM   1597 C CA  . ILE A 1 210 ? 6.993   57.523 43.725 1.00 26.58 ? 210  ILE A CA  1 
ATOM   1598 C C   . ILE A 1 210 ? 7.005   55.976 43.532 1.00 27.26 ? 210  ILE A C   1 
ATOM   1599 O O   . ILE A 1 210 ? 7.263   55.470 42.442 1.00 25.24 ? 210  ILE A O   1 
ATOM   1600 C CB  . ILE A 1 210 ? 8.336   57.963 44.365 1.00 28.36 ? 210  ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 210 ? 8.505   59.469 44.233 1.00 27.27 ? 210  ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 210 ? 9.523   57.171 43.757 1.00 27.70 ? 210  ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 210 ? 9.576   59.967 45.146 1.00 25.61 ? 210  ILE A CD1 1 
ATOM   1604 N N   . LEU A 1 211 ? 6.683   55.247 44.603 1.00 26.14 ? 211  LEU A N   1 
ATOM   1605 C CA  . LEU A 1 211 ? 6.689   53.794 44.549 1.00 27.45 ? 211  LEU A CA  1 
ATOM   1606 C C   . LEU A 1 211 ? 5.483   53.149 43.865 1.00 27.57 ? 211  LEU A C   1 
ATOM   1607 O O   . LEU A 1 211 ? 5.629   52.289 43.019 1.00 29.63 ? 211  LEU A O   1 
ATOM   1608 C CB  . LEU A 1 211 ? 6.802   53.226 45.953 1.00 24.99 ? 211  LEU A CB  1 
ATOM   1609 C CG  . LEU A 1 211 ? 8.167   53.378 46.652 1.00 29.52 ? 211  LEU A CG  1 
ATOM   1610 C CD1 . LEU A 1 211 ? 7.990   53.308 48.188 1.00 27.45 ? 211  LEU A CD1 1 
ATOM   1611 C CD2 . LEU A 1 211 ? 9.066   52.256 46.211 1.00 29.95 ? 211  LEU A CD2 1 
ATOM   1612 N N   . SER A 1 212 ? 4.298   53.592 44.220 1.00 27.08 ? 212  SER A N   1 
ATOM   1613 C CA  . SER A 1 212 ? 3.084   53.005 43.711 1.00 28.37 ? 212  SER A CA  1 
ATOM   1614 C C   . SER A 1 212 ? 2.814   53.218 42.237 1.00 27.92 ? 212  SER A C   1 
ATOM   1615 O O   . SER A 1 212 ? 2.641   54.368 41.788 1.00 28.71 ? 212  SER A O   1 
ATOM   1616 C CB  . SER A 1 212 ? 1.914   53.521 44.546 1.00 29.93 ? 212  SER A CB  1 
ATOM   1617 O OG  . SER A 1 212 ? 0.689   53.022 44.077 1.00 31.00 ? 212  SER A OG  1 
ATOM   1618 N N   . PRO A 1 213 ? 2.753   52.117 41.467 1.00 26.56 ? 213  PRO A N   1 
ATOM   1619 C CA  . PRO A 1 213 ? 2.495   52.129 40.010 1.00 27.29 ? 213  PRO A CA  1 
ATOM   1620 C C   . PRO A 1 213 ? 1.315   53.042 39.662 1.00 27.21 ? 213  PRO A C   1 
ATOM   1621 O O   . PRO A 1 213 ? 1.368   53.811 38.712 1.00 27.65 ? 213  PRO A O   1 
ATOM   1622 C CB  . PRO A 1 213 ? 2.135   50.665 39.677 1.00 28.99 ? 213  PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 213 ? 3.030   49.866 40.719 1.00 29.82 ? 213  PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 213 ? 2.879   50.755 42.008 1.00 26.56 ? 213  PRO A CD  1 
ATOM   1625 N N   . GLY A 1 214 ? 0.258   52.949 40.466 1.00 27.15 ? 214  GLY A N   1 
ATOM   1626 C CA  . GLY A 1 214 ? -0.942  53.723 40.214 1.00 27.68 ? 214  GLY A CA  1 
ATOM   1627 C C   . GLY A 1 214 ? -0.817  55.216 40.427 1.00 29.21 ? 214  GLY A C   1 
ATOM   1628 O O   . GLY A 1 214 ? -1.703  55.956 40.005 1.00 30.14 ? 214  GLY A O   1 
ATOM   1629 N N   . SER A 1 215 ? 0.253   55.688 41.062 1.00 27.42 ? 215  SER A N   1 
ATOM   1630 C CA  . SER A 1 215 ? 0.378   57.135 41.290 1.00 28.78 ? 215  SER A CA  1 
ATOM   1631 C C   . SER A 1 215 ? 1.471   57.775 40.437 1.00 29.14 ? 215  SER A C   1 
ATOM   1632 O O   . SER A 1 215 ? 1.396   58.972 40.159 1.00 29.34 ? 215  SER A O   1 
ATOM   1633 C CB  . SER A 1 215 ? 0.706   57.469 42.783 1.00 28.94 ? 215  SER A CB  1 
ATOM   1634 O OG  . SER A 1 215 ? -0.323  57.052 43.675 1.00 30.28 ? 215  SER A OG  1 
ATOM   1635 N N   . ARG A 1 216 ? 2.454   56.983 40.008 1.00 28.58 ? 216  ARG A N   1 
ATOM   1636 C CA  . ARG A 1 216 ? 3.618   57.494 39.271 1.00 29.92 ? 216  ARG A CA  1 
ATOM   1637 C C   . ARG A 1 216 ? 3.424   58.467 38.130 1.00 30.70 ? 216  ARG A C   1 
ATOM   1638 O O   . ARG A 1 216 ? 4.205   59.420 37.995 1.00 30.26 ? 216  ARG A O   1 
ATOM   1639 C CB  . ARG A 1 216 ? 4.471   56.347 38.712 1.00 31.00 ? 216  ARG A CB  1 
ATOM   1640 C CG  . ARG A 1 216 ? 5.041   55.417 39.758 1.00 30.89 ? 216  ARG A CG  1 
ATOM   1641 C CD  . ARG A 1 216 ? 5.753   54.263 39.094 1.00 29.86 ? 216  ARG A CD  1 
ATOM   1642 N NE  . ARG A 1 216 ? 5.991   53.187 40.042 1.00 28.74 ? 216  ARG A NE  1 
ATOM   1643 C CZ  . ARG A 1 216 ? 6.577   52.036 39.720 1.00 31.70 ? 216  ARG A CZ  1 
ATOM   1644 N NH1 . ARG A 1 216 ? 6.751   51.090 40.657 1.00 27.14 ? 216  ARG A NH1 1 
ATOM   1645 N NH2 . ARG A 1 216 ? 6.994   51.837 38.455 1.00 27.31 ? 216  ARG A NH2 1 
ATOM   1646 N N   . ASP A 1 217 ? 2.396   58.237 37.318 1.00 30.04 ? 217  ASP A N   1 
ATOM   1647 C CA  . ASP A 1 217 ? 2.197   59.068 36.148 1.00 30.28 ? 217  ASP A CA  1 
ATOM   1648 C C   . ASP A 1 217 ? 1.567   60.412 36.471 1.00 29.86 ? 217  ASP A C   1 
ATOM   1649 O O   . ASP A 1 217 ? 1.541   61.268 35.621 1.00 28.84 ? 217  ASP A O   1 
ATOM   1650 C CB  . ASP A 1 217 ? 1.339   58.331 35.096 1.00 28.75 ? 217  ASP A CB  1 
ATOM   1651 C CG  . ASP A 1 217 ? 1.902   56.925 34.721 1.00 31.63 ? 217  ASP A CG  1 
ATOM   1652 O OD1 . ASP A 1 217 ? 2.979   56.491 35.204 1.00 31.48 ? 217  ASP A OD1 1 
ATOM   1653 O OD2 . ASP A 1 217 ? 1.242   56.233 33.931 1.00 32.43 ? 217  ASP A OD2 1 
ATOM   1654 N N   . LEU A 1 218 ? 1.084   60.598 37.696 1.00 29.60 ? 218  LEU A N   1 
ATOM   1655 C CA  . LEU A 1 218 ? 0.406   61.838 38.043 1.00 30.58 ? 218  LEU A CA  1 
ATOM   1656 C C   . LEU A 1 218 ? 1.282   62.999 38.545 1.00 32.20 ? 218  LEU A C   1 
ATOM   1657 O O   . LEU A 1 218 ? 0.749   63.982 39.112 1.00 32.44 ? 218  LEU A O   1 
ATOM   1658 C CB  . LEU A 1 218 ? -0.694  61.565 39.073 1.00 28.79 ? 218  LEU A CB  1 
ATOM   1659 C CG  . LEU A 1 218 ? -1.818  60.595 38.654 1.00 31.86 ? 218  LEU A CG  1 
ATOM   1660 C CD1 . LEU A 1 218 ? -2.676  60.202 39.903 1.00 31.42 ? 218  LEU A CD1 1 
ATOM   1661 C CD2 . LEU A 1 218 ? -2.687  61.242 37.612 1.00 31.18 ? 218  LEU A CD2 1 
ATOM   1662 N N   . PHE A 1 219 ? 2.604   62.896 38.414 1.00 29.37 ? 219  PHE A N   1 
ATOM   1663 C CA  . PHE A 1 219 ? 3.426   64.028 38.844 1.00 28.59 ? 219  PHE A CA  1 
ATOM   1664 C C   . PHE A 1 219 ? 4.775   63.909 38.163 1.00 29.31 ? 219  PHE A C   1 
ATOM   1665 O O   . PHE A 1 219 ? 5.167   62.821 37.638 1.00 27.97 ? 219  PHE A O   1 
ATOM   1666 C CB  . PHE A 1 219 ? 3.580   64.107 40.397 1.00 28.76 ? 219  PHE A CB  1 
ATOM   1667 C CG  . PHE A 1 219 ? 4.280   62.915 40.998 1.00 26.51 ? 219  PHE A CG  1 
ATOM   1668 C CD1 . PHE A 1 219 ? 3.569   61.713 41.241 1.00 25.51 ? 219  PHE A CD1 1 
ATOM   1669 C CD2 . PHE A 1 219 ? 5.658   62.955 41.249 1.00 24.26 ? 219  PHE A CD2 1 
ATOM   1670 C CE1 . PHE A 1 219 ? 4.231   60.536 41.734 1.00 24.82 ? 219  PHE A CE1 1 
ATOM   1671 C CE2 . PHE A 1 219 ? 6.343   61.797 41.726 1.00 23.74 ? 219  PHE A CE2 1 
ATOM   1672 C CZ  . PHE A 1 219 ? 5.621   60.578 41.970 1.00 24.66 ? 219  PHE A CZ  1 
ATOM   1673 N N   . ARG A 1 220 ? 5.510   65.007 38.184 1.00 27.13 ? 220  ARG A N   1 
ATOM   1674 C CA  . ARG A 1 220 ? 6.761   65.001 37.496 1.00 28.40 ? 220  ARG A CA  1 
ATOM   1675 C C   . ARG A 1 220 ? 8.008   64.739 38.335 1.00 29.87 ? 220  ARG A C   1 
ATOM   1676 O O   . ARG A 1 220 ? 8.840   63.933 37.943 1.00 28.42 ? 220  ARG A O   1 
ATOM   1677 C CB  . ARG A 1 220 ? 6.917   66.353 36.768 1.00 28.58 ? 220  ARG A CB  1 
ATOM   1678 C CG  . ARG A 1 220 ? 8.243   66.539 36.009 1.00 29.47 ? 220  ARG A CG  1 
ATOM   1679 C CD  . ARG A 1 220 ? 8.370   65.559 34.856 1.00 31.42 ? 220  ARG A CD  1 
ATOM   1680 N NE  . ARG A 1 220 ? 9.502   65.890 33.980 1.00 35.01 ? 220  ARG A NE  1 
ATOM   1681 C CZ  . ARG A 1 220 ? 9.473   66.862 33.059 1.00 36.39 ? 220  ARG A CZ  1 
ATOM   1682 N NH1 . ARG A 1 220 ? 8.366   67.605 32.898 1.00 34.11 ? 220  ARG A NH1 1 
ATOM   1683 N NH2 . ARG A 1 220 ? 10.529  67.069 32.270 1.00 34.92 ? 220  ARG A NH2 1 
ATOM   1684 N N   . ARG A 1 221 ? 8.114   65.449 39.464 1.00 28.47 ? 221  ARG A N   1 
ATOM   1685 C CA  . ARG A 1 221 ? 9.282   65.433 40.345 1.00 29.73 ? 221  ARG A CA  1 
ATOM   1686 C C   . ARG A 1 221 ? 8.812   65.468 41.770 1.00 27.99 ? 221  ARG A C   1 
ATOM   1687 O O   . ARG A 1 221 ? 7.649   65.808 42.044 1.00 25.90 ? 221  ARG A O   1 
ATOM   1688 C CB  . ARG A 1 221 ? 10.158  66.692 40.085 1.00 32.05 ? 221  ARG A CB  1 
ATOM   1689 C CG  . ARG A 1 221 ? 11.041  66.519 38.926 1.00 39.97 ? 221  ARG A CG  1 
ATOM   1690 C CD  . ARG A 1 221 ? 12.053  67.642 38.755 1.00 38.13 ? 221  ARG A CD  1 
ATOM   1691 N NE  . ARG A 1 221 ? 11.470  68.722 38.047 1.00 38.99 ? 221  ARG A NE  1 
ATOM   1692 C CZ  . ARG A 1 221 ? 11.471  68.871 36.734 1.00 37.50 ? 221  ARG A CZ  1 
ATOM   1693 N NH1 . ARG A 1 221 ? 12.054  68.008 35.908 1.00 34.74 ? 221  ARG A NH1 1 
ATOM   1694 N NH2 . ARG A 1 221 ? 10.813  69.900 36.250 1.00 38.73 ? 221  ARG A NH2 1 
ATOM   1695 N N   . ALA A 1 222 ? 9.746   65.199 42.687 1.00 27.59 ? 222  ALA A N   1 
ATOM   1696 C CA  . ALA A 1 222 ? 9.376   65.075 44.088 1.00 27.65 ? 222  ALA A CA  1 
ATOM   1697 C C   . ALA A 1 222 ? 10.350  65.632 45.089 1.00 27.56 ? 222  ALA A C   1 
ATOM   1698 O O   . ALA A 1 222 ? 11.566  65.579 44.876 1.00 28.09 ? 222  ALA A O   1 
ATOM   1699 C CB  . ALA A 1 222 ? 9.096   63.577 44.403 1.00 25.79 ? 222  ALA A CB  1 
ATOM   1700 N N   . ILE A 1 223 ? 9.787   66.143 46.192 1.00 27.11 ? 223  ILE A N   1 
ATOM   1701 C CA  . ILE A 1 223 ? 10.553  66.710 47.295 1.00 27.82 ? 223  ILE A CA  1 
ATOM   1702 C C   . ILE A 1 223 ? 10.069  66.055 48.592 1.00 27.27 ? 223  ILE A C   1 
ATOM   1703 O O   . ILE A 1 223 ? 8.878   66.065 48.879 1.00 28.21 ? 223  ILE A O   1 
ATOM   1704 C CB  . ILE A 1 223 ? 10.362  68.261 47.409 1.00 27.20 ? 223  ILE A CB  1 
ATOM   1705 C CG1 . ILE A 1 223 ? 11.003  68.975 46.209 1.00 26.67 ? 223  ILE A CG1 1 
ATOM   1706 C CG2 . ILE A 1 223 ? 11.092  68.810 48.677 1.00 26.03 ? 223  ILE A CG2 1 
ATOM   1707 C CD1 . ILE A 1 223 ? 10.756  70.525 46.247 1.00 23.41 ? 223  ILE A CD1 1 
ATOM   1708 N N   . LEU A 1 224 ? 10.985  65.472 49.357 1.00 25.80 ? 224  LEU A N   1 
ATOM   1709 C CA  . LEU A 1 224 ? 10.612  64.822 50.621 1.00 26.35 ? 224  LEU A CA  1 
ATOM   1710 C C   . LEU A 1 224 ? 11.335  65.506 51.798 1.00 27.26 ? 224  LEU A C   1 
ATOM   1711 O O   . LEU A 1 224 ? 12.577  65.564 51.843 1.00 27.10 ? 224  LEU A O   1 
ATOM   1712 C CB  . LEU A 1 224 ? 10.977  63.324 50.588 1.00 24.97 ? 224  LEU A CB  1 
ATOM   1713 C CG  . LEU A 1 224 ? 10.404  62.438 49.466 1.00 23.94 ? 224  LEU A CG  1 
ATOM   1714 C CD1 . LEU A 1 224 ? 11.124  62.685 48.168 1.00 23.77 ? 224  LEU A CD1 1 
ATOM   1715 C CD2 . LEU A 1 224 ? 10.498  60.990 49.878 1.00 24.19 ? 224  LEU A CD2 1 
ATOM   1716 N N   . GLN A 1 225 ? 10.573  66.051 52.743 1.00 28.44 ? 225  GLN A N   1 
ATOM   1717 C CA  . GLN A 1 225 ? 11.194  66.747 53.903 1.00 27.43 ? 225  GLN A CA  1 
ATOM   1718 C C   . GLN A 1 225 ? 10.979  65.930 55.177 1.00 27.45 ? 225  GLN A C   1 
ATOM   1719 O O   . GLN A 1 225 ? 9.845   65.698 55.602 1.00 27.66 ? 225  GLN A O   1 
ATOM   1720 C CB  . GLN A 1 225 ? 10.572  68.139 54.091 1.00 25.06 ? 225  GLN A CB  1 
ATOM   1721 C CG  . GLN A 1 225 ? 10.684  68.968 52.829 1.00 26.61 ? 225  GLN A CG  1 
ATOM   1722 C CD  . GLN A 1 225 ? 9.867   70.283 52.812 1.00 27.76 ? 225  GLN A CD  1 
ATOM   1723 O OE1 . GLN A 1 225 ? 9.508   70.750 51.745 1.00 28.45 ? 225  GLN A OE1 1 
ATOM   1724 N NE2 . GLN A 1 225 ? 9.598   70.869 53.971 1.00 24.93 ? 225  GLN A NE2 1 
ATOM   1725 N N   . SER A 1 226 ? 12.080  65.464 55.744 1.00 27.11 ? 226  SER A N   1 
ATOM   1726 C CA  . SER A 1 226 ? 12.078  64.730 56.994 1.00 26.08 ? 226  SER A CA  1 
ATOM   1727 C C   . SER A 1 226 ? 11.128  63.560 56.965 1.00 25.97 ? 226  SER A C   1 
ATOM   1728 O O   . SER A 1 226 ? 10.402  63.348 57.921 1.00 24.64 ? 226  SER A O   1 
ATOM   1729 C CB  . SER A 1 226 ? 11.678  65.684 58.155 1.00 27.98 ? 226  SER A CB  1 
ATOM   1730 O OG  . SER A 1 226 ? 12.509  66.849 58.285 1.00 25.56 ? 226  SER A OG  1 
ATOM   1731 N N   . GLY A 1 227 ? 11.108  62.799 55.880 1.00 24.80 ? 227  GLY A N   1 
ATOM   1732 C CA  . GLY A 1 227 ? 10.207  61.667 55.861 1.00 25.88 ? 227  GLY A CA  1 
ATOM   1733 C C   . GLY A 1 227 ? 10.514  60.880 54.616 1.00 27.66 ? 227  GLY A C   1 
ATOM   1734 O O   . GLY A 1 227 ? 11.014  61.457 53.647 1.00 28.27 ? 227  GLY A O   1 
ATOM   1735 N N   . SER A 1 228 ? 10.287  59.570 54.671 1.00 26.82 ? 228  SER A N   1 
ATOM   1736 C CA  . SER A 1 228 ? 10.551  58.728 53.548 1.00 27.86 ? 228  SER A CA  1 
ATOM   1737 C C   . SER A 1 228 ? 9.589   57.552 53.690 1.00 28.72 ? 228  SER A C   1 
ATOM   1738 O O   . SER A 1 228 ? 9.054   57.267 54.788 1.00 29.24 ? 228  SER A O   1 
ATOM   1739 C CB  . SER A 1 228 ? 12.059  58.368 53.392 1.00 26.60 ? 228  SER A CB  1 
ATOM   1740 O OG  . SER A 1 228 ? 12.526  57.523 54.377 1.00 29.09 ? 228  SER A OG  1 
ATOM   1741 N N   . PRO A 1 229 ? 9.318   56.872 52.566 1.00 28.38 ? 229  PRO A N   1 
ATOM   1742 C CA  . PRO A 1 229 ? 8.357   55.770 52.616 1.00 27.27 ? 229  PRO A CA  1 
ATOM   1743 C C   . PRO A 1 229 ? 8.607   54.550 53.467 1.00 27.98 ? 229  PRO A C   1 
ATOM   1744 O O   . PRO A 1 229 ? 7.653   53.949 53.960 1.00 26.66 ? 229  PRO A O   1 
ATOM   1745 C CB  . PRO A 1 229 ? 8.118   55.456 51.120 1.00 27.83 ? 229  PRO A CB  1 
ATOM   1746 C CG  . PRO A 1 229 ? 9.513   55.689 50.504 1.00 25.61 ? 229  PRO A CG  1 
ATOM   1747 C CD  . PRO A 1 229 ? 9.959   56.995 51.237 1.00 24.71 ? 229  PRO A CD  1 
ATOM   1748 N N   . ASN A 1 230 ? 9.884   54.222 53.663 1.00 26.71 ? 230  ASN A N   1 
ATOM   1749 C CA  . ASN A 1 230 ? 10.308  53.074 54.433 1.00 25.17 ? 230  ASN A CA  1 
ATOM   1750 C C   . ASN A 1 230 ? 10.465  53.439 55.914 1.00 26.60 ? 230  ASN A C   1 
ATOM   1751 O O   . ASN A 1 230 ? 11.075  52.665 56.648 1.00 25.34 ? 230  ASN A O   1 
ATOM   1752 C CB  . ASN A 1 230 ? 11.663  52.595 53.896 1.00 23.92 ? 230  ASN A CB  1 
ATOM   1753 C CG  . ASN A 1 230 ? 12.687  53.767 53.824 1.00 27.60 ? 230  ASN A CG  1 
ATOM   1754 O OD1 . ASN A 1 230 ? 12.329  54.880 53.400 1.00 27.72 ? 230  ASN A OD1 1 
ATOM   1755 N ND2 . ASN A 1 230 ? 13.926  53.530 54.222 1.00 25.41 ? 230  ASN A ND2 1 
ATOM   1756 N N   . CYS A 1 231 ? 9.965   54.590 56.370 1.00 24.64 ? 231  CYS A N   1 
ATOM   1757 C CA  . CYS A 1 231 ? 10.120  54.895 57.793 1.00 27.04 ? 231  CYS A CA  1 
ATOM   1758 C C   . CYS A 1 231 ? 9.437   53.777 58.614 1.00 28.26 ? 231  CYS A C   1 
ATOM   1759 O O   . CYS A 1 231 ? 8.394   53.251 58.206 1.00 28.08 ? 231  CYS A O   1 
ATOM   1760 C CB  . CYS A 1 231 ? 9.520   56.275 58.157 1.00 27.42 ? 231  CYS A CB  1 
ATOM   1761 S SG  . CYS A 1 231 ? 10.579  57.647 57.569 1.00 26.54 ? 231  CYS A SG  1 
ATOM   1762 N N   . PRO A 1 232 ? 10.028  53.409 59.768 1.00 27.20 ? 232  PRO A N   1 
ATOM   1763 C CA  . PRO A 1 232 ? 9.449   52.336 60.580 1.00 26.56 ? 232  PRO A CA  1 
ATOM   1764 C C   . PRO A 1 232 ? 8.034   52.564 61.091 1.00 26.82 ? 232  PRO A C   1 
ATOM   1765 O O   . PRO A 1 232 ? 7.369   51.594 61.402 1.00 24.92 ? 232  PRO A O   1 
ATOM   1766 C CB  . PRO A 1 232 ? 10.491  52.112 61.698 1.00 23.96 ? 232  PRO A CB  1 
ATOM   1767 C CG  . PRO A 1 232 ? 11.053  53.539 61.918 1.00 26.91 ? 232  PRO A CG  1 
ATOM   1768 C CD  . PRO A 1 232 ? 11.190  54.044 60.438 1.00 27.06 ? 232  PRO A CD  1 
ATOM   1769 N N   . TRP A 1 233 ? 7.593   53.834 61.174 1.00 26.86 ? 233  TRP A N   1 
ATOM   1770 C CA  . TRP A 1 233 ? 6.240   54.222 61.605 1.00 25.26 ? 233  TRP A CA  1 
ATOM   1771 C C   . TRP A 1 233 ? 5.261   54.480 60.433 1.00 27.02 ? 233  TRP A C   1 
ATOM   1772 O O   . TRP A 1 233 ? 4.065   54.713 60.652 1.00 28.12 ? 233  TRP A O   1 
ATOM   1773 C CB  . TRP A 1 233 ? 6.294   55.535 62.385 1.00 24.41 ? 233  TRP A CB  1 
ATOM   1774 C CG  . TRP A 1 233 ? 7.126   56.604 61.661 1.00 25.24 ? 233  TRP A CG  1 
ATOM   1775 C CD1 . TRP A 1 233 ? 8.493   56.848 61.823 1.00 24.52 ? 233  TRP A CD1 1 
ATOM   1776 C CD2 . TRP A 1 233 ? 6.675   57.529 60.665 1.00 22.75 ? 233  TRP A CD2 1 
ATOM   1777 N NE1 . TRP A 1 233 ? 8.890   57.863 60.990 1.00 25.40 ? 233  TRP A NE1 1 
ATOM   1778 C CE2 . TRP A 1 233 ? 7.808   58.297 60.260 1.00 24.24 ? 233  TRP A CE2 1 
ATOM   1779 C CE3 . TRP A 1 233 ? 5.430   57.791 60.075 1.00 24.39 ? 233  TRP A CE3 1 
ATOM   1780 C CZ2 . TRP A 1 233 ? 7.728   59.302 59.287 1.00 22.83 ? 233  TRP A CZ2 1 
ATOM   1781 C CZ3 . TRP A 1 233 ? 5.342   58.804 59.106 1.00 25.24 ? 233  TRP A CZ3 1 
ATOM   1782 C CH2 . TRP A 1 233 ? 6.490   59.552 58.718 1.00 24.36 ? 233  TRP A CH2 1 
ATOM   1783 N N   . ALA A 1 234 ? 5.747   54.467 59.202 1.00 25.58 ? 234  ALA A N   1 
ATOM   1784 C CA  . ALA A 1 234 ? 4.893   54.824 58.071 1.00 25.32 ? 234  ALA A CA  1 
ATOM   1785 C C   . ALA A 1 234 ? 4.032   53.718 57.437 1.00 26.79 ? 234  ALA A C   1 
ATOM   1786 O O   . ALA A 1 234 ? 3.193   54.026 56.588 1.00 25.72 ? 234  ALA A O   1 
ATOM   1787 C CB  . ALA A 1 234 ? 5.773   55.478 56.973 1.00 23.40 ? 234  ALA A CB  1 
ATOM   1788 N N   . SER A 1 235 ? 4.264   52.446 57.788 1.00 25.44 ? 235  SER A N   1 
ATOM   1789 C CA  . SER A 1 235 ? 3.431   51.378 57.239 1.00 26.90 ? 235  SER A CA  1 
ATOM   1790 C C   . SER A 1 235 ? 3.410   50.174 58.159 1.00 27.53 ? 235  SER A C   1 
ATOM   1791 O O   . SER A 1 235 ? 4.227   50.069 59.054 1.00 28.75 ? 235  SER A O   1 
ATOM   1792 C CB  . SER A 1 235 ? 3.898   50.945 55.849 1.00 25.77 ? 235  SER A CB  1 
ATOM   1793 O OG  . SER A 1 235 ? 5.167   50.346 55.890 1.00 25.11 ? 235  SER A OG  1 
ATOM   1794 N N   . VAL A 1 236 ? 2.442   49.299 57.961 1.00 27.28 ? 236  VAL A N   1 
ATOM   1795 C CA  . VAL A 1 236 ? 2.348   48.082 58.747 1.00 29.92 ? 236  VAL A CA  1 
ATOM   1796 C C   . VAL A 1 236 ? 1.941   46.972 57.785 1.00 30.10 ? 236  VAL A C   1 
ATOM   1797 O O   . VAL A 1 236 ? 1.545   47.235 56.634 1.00 30.03 ? 236  VAL A O   1 
ATOM   1798 C CB  . VAL A 1 236 ? 1.271   48.177 59.880 1.00 28.23 ? 236  VAL A CB  1 
ATOM   1799 C CG1 . VAL A 1 236 ? 1.670   49.219 60.899 1.00 27.77 ? 236  VAL A CG1 1 
ATOM   1800 C CG2 . VAL A 1 236 ? -0.107  48.498 59.257 1.00 27.91 ? 236  VAL A CG2 1 
ATOM   1801 N N   . SER A 1 237 ? 2.045   45.732 58.232 1.00 29.10 ? 237  SER A N   1 
ATOM   1802 C CA  . SER A 1 237 ? 1.634   44.624 57.356 1.00 30.13 ? 237  SER A CA  1 
ATOM   1803 C C   . SER A 1 237 ? 0.093   44.519 57.402 1.00 30.10 ? 237  SER A C   1 
ATOM   1804 O O   . SER A 1 237 ? -0.581  45.149 58.278 1.00 28.85 ? 237  SER A O   1 
ATOM   1805 C CB  . SER A 1 237 ? 2.214   43.298 57.870 1.00 30.29 ? 237  SER A CB  1 
ATOM   1806 O OG  . SER A 1 237 ? 1.616   43.032 59.124 1.00 30.12 ? 237  SER A OG  1 
ATOM   1807 N N   . VAL A 1 238 ? -0.475  43.722 56.489 1.00 30.08 ? 238  VAL A N   1 
ATOM   1808 C CA  . VAL A 1 238 ? -1.923  43.614 56.501 1.00 31.38 ? 238  VAL A CA  1 
ATOM   1809 C C   . VAL A 1 238 ? -2.403  42.892 57.738 1.00 30.89 ? 238  VAL A C   1 
ATOM   1810 O O   . VAL A 1 238 ? -3.488  43.196 58.237 1.00 30.93 ? 238  VAL A O   1 
ATOM   1811 C CB  . VAL A 1 238 ? -2.483  42.919 55.247 1.00 33.94 ? 238  VAL A CB  1 
ATOM   1812 C CG1 . VAL A 1 238 ? -2.242  43.783 54.076 1.00 34.52 ? 238  VAL A CG1 1 
ATOM   1813 C CG2 . VAL A 1 238 ? -1.816  41.557 55.026 1.00 34.55 ? 238  VAL A CG2 1 
ATOM   1814 N N   . ALA A 1 239 ? -1.598  41.961 58.258 1.00 30.30 ? 239  ALA A N   1 
ATOM   1815 C CA  . ALA A 1 239 ? -2.018  41.257 59.476 1.00 31.68 ? 239  ALA A CA  1 
ATOM   1816 C C   . ALA A 1 239 ? -2.030  42.245 60.657 1.00 31.32 ? 239  ALA A C   1 
ATOM   1817 O O   . ALA A 1 239 ? -2.938  42.221 61.498 1.00 31.81 ? 239  ALA A O   1 
ATOM   1818 C CB  . ALA A 1 239 ? -1.060  40.056 59.783 1.00 29.21 ? 239  ALA A CB  1 
ATOM   1819 N N   . GLU A 1 240 ? -1.034  43.129 60.727 1.00 30.93 ? 240  GLU A N   1 
ATOM   1820 C CA  . GLU A 1 240 ? -1.037  44.069 61.845 1.00 30.62 ? 240  GLU A CA  1 
ATOM   1821 C C   . GLU A 1 240 ? -2.159  45.118 61.659 1.00 29.98 ? 240  GLU A C   1 
ATOM   1822 O O   . GLU A 1 240 ? -2.816  45.546 62.633 1.00 30.16 ? 240  GLU A O   1 
ATOM   1823 C CB  . GLU A 1 240 ? 0.356   44.700 62.021 1.00 29.82 ? 240  GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 240 ? 0.425   45.866 63.032 1.00 31.39 ? 240  GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 240 ? 0.093   45.448 64.477 1.00 33.12 ? 240  GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 240 ? 0.041   44.230 64.732 1.00 32.25 ? 240  GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 240 ? -0.102  46.332 65.348 1.00 32.57 ? 240  GLU A OE2 1 
ATOM   1828 N N   . GLY A 1 241 ? -2.399  45.524 60.412 1.00 30.74 ? 241  GLY A N   1 
ATOM   1829 C CA  . GLY A 1 241 ? -3.489  46.472 60.180 1.00 28.76 ? 241  GLY A CA  1 
ATOM   1830 C C   . GLY A 1 241 ? -4.805  45.847 60.619 1.00 29.08 ? 241  GLY A C   1 
ATOM   1831 O O   . GLY A 1 241 ? -5.625  46.481 61.285 1.00 26.67 ? 241  GLY A O   1 
ATOM   1832 N N   . ARG A 1 242 ? -4.997  44.582 60.246 1.00 29.88 ? 242  ARG A N   1 
ATOM   1833 C CA  . ARG A 1 242 ? -6.208  43.856 60.603 1.00 31.36 ? 242  ARG A CA  1 
ATOM   1834 C C   . ARG A 1 242 ? -6.378  43.796 62.128 1.00 31.23 ? 242  ARG A C   1 
ATOM   1835 O O   . ARG A 1 242 ? -7.448  44.107 62.684 1.00 30.48 ? 242  ARG A O   1 
ATOM   1836 C CB  . ARG A 1 242 ? -6.152  42.428 60.001 1.00 32.54 ? 242  ARG A CB  1 
ATOM   1837 C CG  . ARG A 1 242 ? -7.234  41.487 60.514 1.00 34.99 ? 242  ARG A CG  1 
ATOM   1838 C CD  . ARG A 1 242 ? -7.422  40.257 59.556 1.00 37.35 ? 242  ARG A CD  1 
ATOM   1839 N NE  . ARG A 1 242 ? -8.000  40.668 58.270 1.00 37.01 ? 242  ARG A NE  1 
ATOM   1840 C CZ  . ARG A 1 242 ? -9.296  40.889 58.063 1.00 36.84 ? 242  ARG A CZ  1 
ATOM   1841 N NH1 . ARG A 1 242 ? -9.717  41.277 56.856 1.00 36.44 ? 242  ARG A NH1 1 
ATOM   1842 N NH2 . ARG A 1 242 ? -10.172 40.683 59.047 1.00 33.85 ? 242  ARG A NH2 1 
ATOM   1843 N N   . ARG A 1 243 ? -5.303  43.407 62.804 1.00 31.24 ? 243  ARG A N   1 
ATOM   1844 C CA  . ARG A 1 243 ? -5.313  43.291 64.265 1.00 32.24 ? 243  ARG A CA  1 
ATOM   1845 C C   . ARG A 1 243 ? -5.649  44.646 64.955 1.00 33.06 ? 243  ARG A C   1 
ATOM   1846 O O   . ARG A 1 243 ? -6.343  44.675 65.981 1.00 32.57 ? 243  ARG A O   1 
ATOM   1847 C CB  . ARG A 1 243 ? -3.945  42.786 64.695 1.00 33.03 ? 243  ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 243 ? -3.745  42.491 66.152 1.00 37.23 ? 243  ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 243 ? -2.372  43.085 66.663 1.00 39.99 ? 243  ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 243 ? -2.779  43.803 67.839 1.00 44.84 ? 243  ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 243 ? -2.445  45.022 68.206 1.00 44.68 ? 243  ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 243 ? -1.606  45.798 67.514 1.00 42.36 ? 243  ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 243 ? -3.079  45.477 69.271 1.00 45.99 ? 243  ARG A NH2 1 
ATOM   1854 N N   . ARG A 1 244 ? -5.164  45.771 64.405 1.00 32.21 ? 244  ARG A N   1 
ATOM   1855 C CA  . ARG A 1 244 ? -5.474  47.059 65.034 1.00 31.00 ? 244  ARG A CA  1 
ATOM   1856 C C   . ARG A 1 244 ? -6.923  47.435 64.787 1.00 30.31 ? 244  ARG A C   1 
ATOM   1857 O O   . ARG A 1 244 ? -7.572  48.029 65.663 1.00 30.61 ? 244  ARG A O   1 
ATOM   1858 C CB  . ARG A 1 244 ? -4.535  48.180 64.535 1.00 31.17 ? 244  ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 244 ? -3.118  48.047 65.018 1.00 27.45 ? 244  ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 244 ? -2.180  49.025 64.318 1.00 29.75 ? 244  ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 244 ? -0.782  48.718 64.623 1.00 28.92 ? 244  ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 244 ? 0.236   49.556 64.478 1.00 30.08 ? 244  ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 244 ? 0.058   50.812 64.022 1.00 26.76 ? 244  ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 244 ? 1.446   49.130 64.798 1.00 25.06 ? 244  ARG A NH2 1 
ATOM   1865 N N   . ALA A 1 245 ? -7.433  47.100 63.602 1.00 30.87 ? 245  ALA A N   1 
ATOM   1866 C CA  . ALA A 1 245 ? -8.832  47.382 63.264 1.00 32.89 ? 245  ALA A CA  1 
ATOM   1867 C C   . ALA A 1 245 ? -9.743  46.599 64.226 1.00 33.41 ? 245  ALA A C   1 
ATOM   1868 O O   . ALA A 1 245 ? -10.686 47.151 64.795 1.00 34.75 ? 245  ALA A O   1 
ATOM   1869 C CB  . ALA A 1 245 ? -9.139  46.948 61.791 1.00 33.81 ? 245  ALA A CB  1 
ATOM   1870 N N   . VAL A 1 246 ? -9.428  45.321 64.428 1.00 33.63 ? 246  VAL A N   1 
ATOM   1871 C CA  . VAL A 1 246 ? -10.212 44.485 65.326 1.00 33.42 ? 246  VAL A CA  1 
ATOM   1872 C C   . VAL A 1 246 ? -10.133 44.998 66.766 1.00 34.52 ? 246  VAL A C   1 
ATOM   1873 O O   . VAL A 1 246 ? -11.152 45.071 67.496 1.00 35.26 ? 246  VAL A O   1 
ATOM   1874 C CB  . VAL A 1 246 ? -9.732  43.015 65.288 1.00 34.19 ? 246  VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 246 ? -10.466 42.207 66.404 1.00 32.83 ? 246  VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 246 ? -9.999  42.394 63.848 1.00 29.73 ? 246  VAL A CG2 1 
ATOM   1877 N N   . GLU A 1 247 ? -8.932  45.364 67.177 1.00 33.19 ? 247  GLU A N   1 
ATOM   1878 C CA  . GLU A 1 247 ? -8.747  45.893 68.513 1.00 33.08 ? 247  GLU A CA  1 
ATOM   1879 C C   . GLU A 1 247 ? -9.516  47.235 68.651 1.00 32.22 ? 247  GLU A C   1 
ATOM   1880 O O   . GLU A 1 247 ? -10.064 47.522 69.733 1.00 32.65 ? 247  GLU A O   1 
ATOM   1881 C CB  . GLU A 1 247 ? -7.237  46.047 68.817 1.00 33.97 ? 247  GLU A CB  1 
ATOM   1882 C CG  . GLU A 1 247 ? -6.962  46.499 70.249 1.00 37.89 ? 247  GLU A CG  1 
ATOM   1883 C CD  . GLU A 1 247 ? -7.484  45.469 71.315 1.00 40.37 ? 247  GLU A CD  1 
ATOM   1884 O OE1 . GLU A 1 247 ? -7.552  45.825 72.513 1.00 40.07 ? 247  GLU A OE1 1 
ATOM   1885 O OE2 . GLU A 1 247 ? -7.837  44.322 70.953 1.00 39.23 ? 247  GLU A OE2 1 
ATOM   1886 N N   . LEU A 1 248 ? -9.612  48.029 67.571 1.00 30.38 ? 248  LEU A N   1 
ATOM   1887 C CA  . LEU A 1 248 ? -10.382 49.294 67.660 1.00 32.22 ? 248  LEU A CA  1 
ATOM   1888 C C   . LEU A 1 248 ? -11.856 48.945 67.898 1.00 33.57 ? 248  LEU A C   1 
ATOM   1889 O O   . LEU A 1 248 ? -12.532 49.547 68.752 1.00 33.55 ? 248  LEU A O   1 
ATOM   1890 C CB  . LEU A 1 248 ? -10.325 50.119 66.369 1.00 31.48 ? 248  LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 248 ? -11.018 51.499 66.432 1.00 32.36 ? 248  LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 248 ? -10.119 52.483 67.252 1.00 33.00 ? 248  LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 248 ? -11.252 52.052 65.025 1.00 30.66 ? 248  LEU A CD2 1 
ATOM   1894 N N   . GLY A 1 249 ? -12.359 47.995 67.113 1.00 32.84 ? 249  GLY A N   1 
ATOM   1895 C CA  . GLY A 1 249 ? -13.733 47.573 67.314 1.00 34.25 ? 249  GLY A CA  1 
ATOM   1896 C C   . GLY A 1 249 ? -13.950 47.047 68.730 1.00 34.54 ? 249  GLY A C   1 
ATOM   1897 O O   . GLY A 1 249 ? -14.967 47.322 69.361 1.00 35.03 ? 249  GLY A O   1 
ATOM   1898 N N   . ARG A 1 250 ? -12.975 46.319 69.251 1.00 35.50 ? 250  ARG A N   1 
ATOM   1899 C CA  . ARG A 1 250 ? -13.103 45.776 70.591 1.00 36.28 ? 250  ARG A CA  1 
ATOM   1900 C C   . ARG A 1 250 ? -13.216 46.916 71.629 1.00 37.96 ? 250  ARG A C   1 
ATOM   1901 O O   . ARG A 1 250 ? -13.937 46.786 72.627 1.00 38.79 ? 250  ARG A O   1 
ATOM   1902 C CB  . ARG A 1 250 ? -11.905 44.839 70.831 1.00 38.59 ? 250  ARG A CB  1 
ATOM   1903 C CG  . ARG A 1 250 ? -11.949 43.937 72.081 1.00 42.01 ? 250  ARG A CG  1 
ATOM   1904 C CD  . ARG A 1 250 ? -10.626 43.140 72.244 1.00 43.90 ? 250  ARG A CD  1 
ATOM   1905 N NE  . ARG A 1 250 ? -10.603 41.883 71.465 1.00 47.29 ? 250  ARG A NE  1 
ATOM   1906 C CZ  . ARG A 1 250 ? -9.844  41.609 70.388 1.00 50.81 ? 250  ARG A CZ  1 
ATOM   1907 N NH1 . ARG A 1 250 ? -8.975  42.501 69.864 1.00 49.98 ? 250  ARG A NH1 1 
ATOM   1908 N NH2 . ARG A 1 250 ? -9.939  40.394 69.829 1.00 50.77 ? 250  ARG A NH2 1 
ATOM   1909 N N   . ASN A 1 251 ? -12.528 48.047 71.395 1.00 37.90 ? 251  ASN A N   1 
ATOM   1910 C CA  . ASN A 1 251 ? -12.600 49.199 72.312 1.00 36.28 ? 251  ASN A CA  1 
ATOM   1911 C C   . ASN A 1 251 ? -13.966 49.867 72.276 1.00 35.63 ? 251  ASN A C   1 
ATOM   1912 O O   . ASN A 1 251 ? -14.318 50.577 73.206 1.00 35.86 ? 251  ASN A O   1 
ATOM   1913 C CB  . ASN A 1 251 ? -11.546 50.277 71.954 1.00 33.30 ? 251  ASN A CB  1 
ATOM   1914 C CG  . ASN A 1 251 ? -10.210 50.075 72.684 1.00 30.76 ? 251  ASN A CG  1 
ATOM   1915 O OD1 . ASN A 1 251 ? -9.940  50.736 73.684 1.00 28.89 ? 251  ASN A OD1 1 
ATOM   1916 N ND2 . ASN A 1 251 ? -9.383  49.170 72.183 1.00 27.53 ? 251  ASN A ND2 1 
ATOM   1917 N N   . LEU A 1 252 ? -14.721 49.665 71.191 1.00 37.60 ? 252  LEU A N   1 
ATOM   1918 C CA  . LEU A 1 252 ? -16.051 50.286 71.046 1.00 38.43 ? 252  LEU A CA  1 
ATOM   1919 C C   . LEU A 1 252 ? -17.196 49.269 71.255 1.00 40.40 ? 252  LEU A C   1 
ATOM   1920 O O   . LEU A 1 252 ? -18.351 49.532 70.912 1.00 40.08 ? 252  LEU A O   1 
ATOM   1921 C CB  . LEU A 1 252 ? -16.177 50.984 69.671 1.00 34.42 ? 252  LEU A CB  1 
ATOM   1922 C CG  . LEU A 1 252 ? -15.054 52.062 69.556 1.00 36.70 ? 252  LEU A CG  1 
ATOM   1923 C CD1 . LEU A 1 252 ? -14.746 52.442 68.082 1.00 32.91 ? 252  LEU A CD1 1 
ATOM   1924 C CD2 . LEU A 1 252 ? -15.476 53.298 70.347 1.00 34.24 ? 252  LEU A CD2 1 
ATOM   1925 N N   . ASN A 1 253 ? -16.854 48.107 71.794 1.00 41.97 ? 253  ASN A N   1 
ATOM   1926 C CA  . ASN A 1 253 ? -17.834 47.071 72.088 1.00 44.93 ? 253  ASN A CA  1 
ATOM   1927 C C   . ASN A 1 253 ? -18.538 46.617 70.809 1.00 44.87 ? 253  ASN A C   1 
ATOM   1928 O O   . ASN A 1 253 ? -19.752 46.437 70.778 1.00 45.71 ? 253  ASN A O   1 
ATOM   1929 C CB  . ASN A 1 253 ? -18.809 47.658 73.115 1.00 46.80 ? 253  ASN A CB  1 
ATOM   1930 C CG  . ASN A 1 253 ? -18.062 48.222 74.354 1.00 50.99 ? 253  ASN A CG  1 
ATOM   1931 O OD1 . ASN A 1 253 ? -17.438 47.460 75.107 1.00 52.51 ? 253  ASN A OD1 1 
ATOM   1932 N ND2 . ASN A 1 253 ? -18.101 49.552 74.546 1.00 50.34 ? 253  ASN A ND2 1 
ATOM   1933 N N   . CYS A 1 254 ? -17.772 46.457 69.740 1.00 44.24 ? 254  CYS A N   1 
ATOM   1934 C CA  . CYS A 1 254 ? -18.350 46.048 68.474 1.00 42.89 ? 254  CYS A CA  1 
ATOM   1935 C C   . CYS A 1 254 ? -18.464 44.552 68.382 1.00 43.59 ? 254  CYS A C   1 
ATOM   1936 O O   . CYS A 1 254 ? -17.748 43.796 69.023 1.00 42.37 ? 254  CYS A O   1 
ATOM   1937 C CB  . CYS A 1 254 ? -17.483 46.506 67.287 1.00 44.00 ? 254  CYS A CB  1 
ATOM   1938 S SG  . CYS A 1 254 ? -17.524 48.288 66.874 1.00 42.59 ? 254  CYS A SG  1 
ATOM   1939 N N   . ASN A 1 255 ? -19.379 44.127 67.533 1.00 44.47 ? 255  ASN A N   1 
ATOM   1940 C CA  . ASN A 1 255 ? -19.566 42.726 67.263 1.00 44.39 ? 255  ASN A CA  1 
ATOM   1941 C C   . ASN A 1 255 ? -18.332 42.411 66.377 1.00 43.70 ? 255  ASN A C   1 
ATOM   1942 O O   . ASN A 1 255 ? -18.109 43.090 65.348 1.00 42.51 ? 255  ASN A O   1 
ATOM   1943 C CB  . ASN A 1 255 ? -20.868 42.577 66.469 1.00 46.57 ? 255  ASN A CB  1 
ATOM   1944 C CG  . ASN A 1 255 ? -21.125 41.161 66.057 1.00 47.87 ? 255  ASN A CG  1 
ATOM   1945 O OD1 . ASN A 1 255 ? -20.239 40.468 65.535 1.00 47.15 ? 255  ASN A OD1 1 
ATOM   1946 N ND2 . ASN A 1 255 ? -22.349 40.712 66.289 1.00 50.09 ? 255  ASN A ND2 1 
ATOM   1947 N N   . LEU A 1 256 ? -17.550 41.398 66.743 1.00 41.79 ? 256  LEU A N   1 
ATOM   1948 C CA  . LEU A 1 256 ? -16.357 41.073 65.984 1.00 42.70 ? 256  LEU A CA  1 
ATOM   1949 C C   . LEU A 1 256 ? -16.405 39.801 65.140 1.00 44.55 ? 256  LEU A C   1 
ATOM   1950 O O   . LEU A 1 256 ? -15.366 39.340 64.662 1.00 45.00 ? 256  LEU A O   1 
ATOM   1951 C CB  . LEU A 1 256 ? -15.172 40.967 66.936 1.00 42.02 ? 256  LEU A CB  1 
ATOM   1952 C CG  . LEU A 1 256 ? -15.050 42.109 67.951 1.00 42.23 ? 256  LEU A CG  1 
ATOM   1953 C CD1 . LEU A 1 256 ? -13.789 41.896 68.823 1.00 40.95 ? 256  LEU A CD1 1 
ATOM   1954 C CD2 . LEU A 1 256 ? -14.998 43.460 67.171 1.00 42.12 ? 256  LEU A CD2 1 
ATOM   1955 N N   . ASN A 1 257 ? -17.590 39.248 64.922 1.00 45.44 ? 257  ASN A N   1 
ATOM   1956 C CA  . ASN A 1 257 ? -17.709 37.992 64.173 1.00 46.07 ? 257  ASN A CA  1 
ATOM   1957 C C   . ASN A 1 257 ? -17.302 37.995 62.714 1.00 44.93 ? 257  ASN A C   1 
ATOM   1958 O O   . ASN A 1 257 ? -16.972 36.954 62.161 1.00 44.99 ? 257  ASN A O   1 
ATOM   1959 C CB  . ASN A 1 257 ? -19.139 37.486 64.290 1.00 49.17 ? 257  ASN A CB  1 
ATOM   1960 C CG  . ASN A 1 257 ? -19.450 36.938 65.684 1.00 52.66 ? 257  ASN A CG  1 
ATOM   1961 O OD1 . ASN A 1 257 ? -20.628 36.701 66.024 1.00 56.07 ? 257  ASN A OD1 1 
ATOM   1962 N ND2 . ASN A 1 257 ? -18.402 36.720 66.493 1.00 50.71 ? 257  ASN A ND2 1 
ATOM   1963 N N   . SER A 1 258 ? -17.366 39.158 62.077 1.00 43.12 ? 258  SER A N   1 
ATOM   1964 C CA  . SER A 1 258 ? -16.990 39.283 60.683 1.00 41.13 ? 258  SER A CA  1 
ATOM   1965 C C   . SER A 1 258 ? -16.631 40.716 60.349 1.00 40.97 ? 258  SER A C   1 
ATOM   1966 O O   . SER A 1 258 ? -17.047 41.678 61.050 1.00 40.52 ? 258  SER A O   1 
ATOM   1967 C CB  . SER A 1 258 ? -18.149 38.888 59.764 1.00 40.38 ? 258  SER A CB  1 
ATOM   1968 O OG  . SER A 1 258 ? -19.171 39.873 59.834 1.00 40.77 ? 258  SER A OG  1 
ATOM   1969 N N   . ASP A 1 259 ? -15.886 40.856 59.254 1.00 40.17 ? 259  ASP A N   1 
ATOM   1970 C CA  . ASP A 1 259 ? -15.511 42.169 58.778 1.00 40.98 ? 259  ASP A CA  1 
ATOM   1971 C C   . ASP A 1 259 ? -16.772 43.048 58.651 1.00 41.27 ? 259  ASP A C   1 
ATOM   1972 O O   . ASP A 1 259 ? -16.803 44.171 59.175 1.00 41.92 ? 259  ASP A O   1 
ATOM   1973 C CB  . ASP A 1 259 ? -14.790 42.064 57.423 1.00 41.30 ? 259  ASP A CB  1 
ATOM   1974 C CG  . ASP A 1 259 ? -13.348 41.546 57.562 1.00 43.60 ? 259  ASP A CG  1 
ATOM   1975 O OD1 . ASP A 1 259 ? -12.884 41.318 58.702 1.00 43.15 ? 259  ASP A OD1 1 
ATOM   1976 O OD2 . ASP A 1 259 ? -12.660 41.373 56.529 1.00 46.48 ? 259  ASP A OD2 1 
ATOM   1977 N N   . GLU A 1 260 ? -17.817 42.531 57.997 1.00 41.23 ? 260  GLU A N   1 
ATOM   1978 C CA  . GLU A 1 260 ? -19.053 43.296 57.780 1.00 40.68 ? 260  GLU A CA  1 
ATOM   1979 C C   . GLU A 1 260 ? -19.638 43.766 59.085 1.00 39.78 ? 260  GLU A C   1 
ATOM   1980 O O   . GLU A 1 260 ? -20.101 44.907 59.173 1.00 39.94 ? 260  GLU A O   1 
ATOM   1981 C CB  . GLU A 1 260 ? -20.106 42.474 57.015 1.00 42.68 ? 260  GLU A CB  1 
ATOM   1982 C CG  . GLU A 1 260 ? -19.500 41.589 55.919 1.00 45.47 ? 260  GLU A CG  1 
ATOM   1983 N N   . GLU A 1 261 ? -19.625 42.901 60.100 1.00 39.21 ? 261  GLU A N   1 
ATOM   1984 C CA  . GLU A 1 261 ? -20.139 43.295 61.409 1.00 39.63 ? 261  GLU A CA  1 
ATOM   1985 C C   . GLU A 1 261 ? -19.257 44.416 62.005 1.00 37.60 ? 261  GLU A C   1 
ATOM   1986 O O   . GLU A 1 261 ? -19.778 45.422 62.504 1.00 36.65 ? 261  GLU A O   1 
ATOM   1987 C CB  . GLU A 1 261 ? -20.142 42.115 62.403 1.00 43.10 ? 261  GLU A CB  1 
ATOM   1988 C CG  . GLU A 1 261 ? -21.107 40.954 62.102 1.00 50.98 ? 261  GLU A CG  1 
ATOM   1989 C CD  . GLU A 1 261 ? -22.483 41.111 62.765 1.00 54.99 ? 261  GLU A CD  1 
ATOM   1990 O OE1 . GLU A 1 261 ? -22.752 42.144 63.446 1.00 56.87 ? 261  GLU A OE1 1 
ATOM   1991 O OE2 . GLU A 1 261 ? -23.304 40.176 62.600 1.00 57.65 ? 261  GLU A OE2 1 
ATOM   1992 N N   . LEU A 1 262 ? -17.934 44.233 61.958 1.00 36.31 ? 262  LEU A N   1 
ATOM   1993 C CA  . LEU A 1 262 ? -16.985 45.218 62.528 1.00 34.86 ? 262  LEU A CA  1 
ATOM   1994 C C   . LEU A 1 262 ? -17.132 46.588 61.846 1.00 35.04 ? 262  LEU A C   1 
ATOM   1995 O O   . LEU A 1 262 ? -17.388 47.619 62.499 1.00 33.68 ? 262  LEU A O   1 
ATOM   1996 C CB  . LEU A 1 262 ? -15.556 44.704 62.369 1.00 34.20 ? 262  LEU A CB  1 
ATOM   1997 C CG  . LEU A 1 262 ? -14.401 45.604 62.854 1.00 33.33 ? 262  LEU A CG  1 
ATOM   1998 C CD1 . LEU A 1 262 ? -14.693 46.118 64.258 1.00 27.77 ? 262  LEU A CD1 1 
ATOM   1999 C CD2 . LEU A 1 262 ? -13.084 44.784 62.796 1.00 31.48 ? 262  LEU A CD2 1 
ATOM   2000 N N   . ILE A 1 263 ? -17.057 46.566 60.520 1.00 36.21 ? 263  ILE A N   1 
ATOM   2001 C CA  . ILE A 1 263 ? -17.163 47.783 59.714 1.00 38.01 ? 263  ILE A CA  1 
ATOM   2002 C C   . ILE A 1 263 ? -18.497 48.471 59.930 1.00 39.62 ? 263  ILE A C   1 
ATOM   2003 O O   . ILE A 1 263 ? -18.566 49.682 60.101 1.00 40.36 ? 263  ILE A O   1 
ATOM   2004 C CB  . ILE A 1 263 ? -16.963 47.450 58.218 1.00 37.59 ? 263  ILE A CB  1 
ATOM   2005 C CG1 . ILE A 1 263 ? -15.541 46.966 58.001 1.00 35.68 ? 263  ILE A CG1 1 
ATOM   2006 C CG2 . ILE A 1 263 ? -17.232 48.673 57.337 1.00 37.07 ? 263  ILE A CG2 1 
ATOM   2007 C CD1 . ILE A 1 263 ? -15.311 46.449 56.566 1.00 35.13 ? 263  ILE A CD1 1 
ATOM   2008 N N   . HIS A 1 264 ? -19.565 47.688 59.959 1.00 41.25 ? 264  HIS A N   1 
ATOM   2009 C CA  . HIS A 1 264 ? -20.867 48.271 60.168 1.00 42.59 ? 264  HIS A CA  1 
ATOM   2010 C C   . HIS A 1 264 ? -20.936 48.966 61.524 1.00 40.73 ? 264  HIS A C   1 
ATOM   2011 O O   . HIS A 1 264 ? -21.506 50.057 61.653 1.00 40.49 ? 264  HIS A O   1 
ATOM   2012 C CB  . HIS A 1 264 ? -21.983 47.211 60.068 1.00 46.92 ? 264  HIS A CB  1 
ATOM   2013 C CG  . HIS A 1 264 ? -23.331 47.762 60.417 1.00 50.94 ? 264  HIS A CG  1 
ATOM   2014 N ND1 . HIS A 1 264 ? -23.810 47.787 61.715 1.00 53.42 ? 264  HIS A ND1 1 
ATOM   2015 C CD2 . HIS A 1 264 ? -24.213 48.482 59.680 1.00 53.50 ? 264  HIS A CD2 1 
ATOM   2016 C CE1 . HIS A 1 264 ? -24.918 48.511 61.764 1.00 54.04 ? 264  HIS A CE1 1 
ATOM   2017 N NE2 . HIS A 1 264 ? -25.183 48.945 60.543 1.00 55.69 ? 264  HIS A NE2 1 
ATOM   2018 N N   . CYS A 1 265 ? -20.377 48.320 62.541 1.00 39.62 ? 265  CYS A N   1 
ATOM   2019 C CA  . CYS A 1 265 ? -20.362 48.898 63.874 1.00 39.62 ? 265  CYS A CA  1 
ATOM   2020 C C   . CYS A 1 265 ? -19.490 50.156 63.853 1.00 38.24 ? 265  CYS A C   1 
ATOM   2021 O O   . CYS A 1 265 ? -19.896 51.205 64.355 1.00 37.19 ? 265  CYS A O   1 
ATOM   2022 C CB  . CYS A 1 265 ? -19.799 47.898 64.900 1.00 40.99 ? 265  CYS A CB  1 
ATOM   2023 S SG  . CYS A 1 265 ? -19.504 48.594 66.590 1.00 46.25 ? 265  CYS A SG  1 
ATOM   2024 N N   . LEU A 1 266 ? -18.303 50.054 63.261 1.00 37.29 ? 266  LEU A N   1 
ATOM   2025 C CA  . LEU A 1 266 ? -17.432 51.240 63.230 1.00 37.43 ? 266  LEU A CA  1 
ATOM   2026 C C   . LEU A 1 266 ? -18.112 52.409 62.471 1.00 37.68 ? 266  LEU A C   1 
ATOM   2027 O O   . LEU A 1 266 ? -17.909 53.574 62.803 1.00 36.04 ? 266  LEU A O   1 
ATOM   2028 C CB  . LEU A 1 266 ? -16.057 50.900 62.618 1.00 33.52 ? 266  LEU A CB  1 
ATOM   2029 C CG  . LEU A 1 266 ? -15.218 49.958 63.484 1.00 33.99 ? 266  LEU A CG  1 
ATOM   2030 C CD1 . LEU A 1 266 ? -13.907 49.589 62.791 1.00 32.70 ? 266  LEU A CD1 1 
ATOM   2031 C CD2 . LEU A 1 266 ? -14.963 50.624 64.832 1.00 33.63 ? 266  LEU A CD2 1 
ATOM   2032 N N   . ARG A 1 267 ? -18.949 52.097 61.485 1.00 37.97 ? 267  ARG A N   1 
ATOM   2033 C CA  . ARG A 1 267 ? -19.608 53.175 60.751 1.00 38.96 ? 267  ARG A CA  1 
ATOM   2034 C C   . ARG A 1 267 ? -20.709 53.891 61.486 1.00 38.85 ? 267  ARG A C   1 
ATOM   2035 O O   . ARG A 1 267 ? -21.109 54.972 61.059 1.00 38.68 ? 267  ARG A O   1 
ATOM   2036 C CB  . ARG A 1 267 ? -20.174 52.688 59.421 1.00 37.87 ? 267  ARG A CB  1 
ATOM   2037 C CG  . ARG A 1 267 ? -19.119 52.471 58.397 1.00 39.69 ? 267  ARG A CG  1 
ATOM   2038 C CD  . ARG A 1 267 ? -19.692 52.158 57.068 1.00 39.89 ? 267  ARG A CD  1 
ATOM   2039 N NE  . ARG A 1 267 ? -18.614 51.881 56.152 1.00 43.94 ? 267  ARG A NE  1 
ATOM   2040 C CZ  . ARG A 1 267 ? -18.701 51.030 55.128 1.00 46.24 ? 267  ARG A CZ  1 
ATOM   2041 N NH1 . ARG A 1 267 ? -19.847 50.372 54.911 1.00 44.77 ? 267  ARG A NH1 1 
ATOM   2042 N NH2 . ARG A 1 267 ? -17.646 50.843 54.330 1.00 43.74 ? 267  ARG A NH2 1 
ATOM   2043 N N   . GLU A 1 268 ? -21.219 53.323 62.575 1.00 39.81 ? 268  GLU A N   1 
ATOM   2044 C CA  . GLU A 1 268 ? -22.292 54.028 63.290 1.00 40.63 ? 268  GLU A CA  1 
ATOM   2045 C C   . GLU A 1 268 ? -21.759 54.905 64.396 1.00 40.62 ? 268  GLU A C   1 
ATOM   2046 O O   . GLU A 1 268 ? -22.503 55.730 64.934 1.00 40.76 ? 268  GLU A O   1 
ATOM   2047 C CB  . GLU A 1 268 ? -23.325 53.054 63.886 1.00 41.44 ? 268  GLU A CB  1 
ATOM   2048 C CG  . GLU A 1 268 ? -24.159 52.316 62.806 1.00 44.15 ? 268  GLU A CG  1 
ATOM   2049 C CD  . GLU A 1 268 ? -24.871 53.281 61.832 1.00 43.84 ? 268  GLU A CD  1 
ATOM   2050 N N   . LYS A 1 269 ? -20.485 54.706 64.752 1.00 39.36 ? 269  LYS A N   1 
ATOM   2051 C CA  . LYS A 1 269 ? -19.862 55.499 65.803 1.00 39.19 ? 269  LYS A CA  1 
ATOM   2052 C C   . LYS A 1 269 ? -19.668 56.928 65.307 1.00 38.80 ? 269  LYS A C   1 
ATOM   2053 O O   . LYS A 1 269 ? -19.419 57.178 64.112 1.00 38.46 ? 269  LYS A O   1 
ATOM   2054 C CB  . LYS A 1 269 ? -18.484 54.928 66.179 1.00 38.35 ? 269  LYS A CB  1 
ATOM   2055 C CG  . LYS A 1 269 ? -18.513 53.525 66.700 1.00 40.42 ? 269  LYS A CG  1 
ATOM   2056 C CD  . LYS A 1 269 ? -19.406 53.470 67.951 1.00 41.44 ? 269  LYS A CD  1 
ATOM   2057 C CE  . LYS A 1 269 ? -19.643 52.030 68.426 1.00 44.03 ? 269  LYS A CE  1 
ATOM   2058 N NZ  . LYS A 1 269 ? -20.453 52.036 69.702 1.00 45.31 ? 269  LYS A NZ  1 
ATOM   2059 N N   . LYS A 1 270 ? -19.773 57.861 66.232 1.00 38.44 ? 270  LYS A N   1 
ATOM   2060 C CA  . LYS A 1 270 ? -19.549 59.254 65.890 1.00 38.93 ? 270  LYS A CA  1 
ATOM   2061 C C   . LYS A 1 270 ? -18.024 59.379 65.712 1.00 37.75 ? 270  LYS A C   1 
ATOM   2062 O O   . LYS A 1 270 ? -17.257 58.551 66.218 1.00 37.49 ? 270  LYS A O   1 
ATOM   2063 C CB  . LYS A 1 270 ? -20.064 60.159 67.010 1.00 39.66 ? 270  LYS A CB  1 
ATOM   2064 C CG  . LYS A 1 270 ? -21.607 60.211 67.075 1.00 43.00 ? 270  LYS A CG  1 
ATOM   2065 C CD  . LYS A 1 270 ? -22.144 61.019 68.296 1.00 45.47 ? 270  LYS A CD  1 
ATOM   2066 N N   . PRO A 1 271 ? -17.574 60.392 64.969 1.00 36.45 ? 271  PRO A N   1 
ATOM   2067 C CA  . PRO A 1 271 ? -16.134 60.548 64.759 1.00 35.66 ? 271  PRO A CA  1 
ATOM   2068 C C   . PRO A 1 271 ? -15.300 60.558 66.054 1.00 34.97 ? 271  PRO A C   1 
ATOM   2069 O O   . PRO A 1 271 ? -14.313 59.813 66.181 1.00 33.06 ? 271  PRO A O   1 
ATOM   2070 C CB  . PRO A 1 271 ? -16.035 61.869 63.980 1.00 36.44 ? 271  PRO A CB  1 
ATOM   2071 C CG  . PRO A 1 271 ? -17.332 61.887 63.197 1.00 36.95 ? 271  PRO A CG  1 
ATOM   2072 C CD  . PRO A 1 271 ? -18.359 61.376 64.192 1.00 34.58 ? 271  PRO A CD  1 
ATOM   2073 N N   . GLN A 1 272 ? -15.716 61.385 67.003 1.00 34.62 ? 272  GLN A N   1 
ATOM   2074 C CA  . GLN A 1 272 ? -15.008 61.522 68.262 1.00 35.05 ? 272  GLN A CA  1 
ATOM   2075 C C   . GLN A 1 272 ? -14.869 60.202 69.048 1.00 35.57 ? 272  GLN A C   1 
ATOM   2076 O O   . GLN A 1 272 ? -13.907 60.033 69.811 1.00 33.39 ? 272  GLN A O   1 
ATOM   2077 C CB  . GLN A 1 272 ? -15.660 62.626 69.124 1.00 35.09 ? 272  GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 272 ? -14.727 63.171 70.288 1.00 37.36 ? 272  GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 272 ? -13.284 63.516 69.784 1.00 39.38 ? 272  GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 272 ? -13.121 64.132 68.705 1.00 37.32 ? 272  GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 272 ? -12.242 63.110 70.570 1.00 35.75 ? 272  GLN A NE2 1 
ATOM   2082 N N   . GLU A 1 273 ? -15.814 59.267 68.871 1.00 35.81 ? 273  GLU A N   1 
ATOM   2083 C CA  . GLU A 1 273 ? -15.700 57.960 69.565 1.00 35.31 ? 273  GLU A CA  1 
ATOM   2084 C C   . GLU A 1 273 ? -14.499 57.219 69.003 1.00 33.64 ? 273  GLU A C   1 
ATOM   2085 O O   . GLU A 1 273 ? -13.758 56.593 69.736 1.00 34.49 ? 273  GLU A O   1 
ATOM   2086 C CB  . GLU A 1 273 ? -16.974 57.087 69.373 1.00 36.11 ? 273  GLU A CB  1 
ATOM   2087 C CG  . GLU A 1 273 ? -18.213 57.737 69.975 1.00 39.00 ? 273  GLU A CG  1 
ATOM   2088 C CD  . GLU A 1 273 ? -19.499 56.937 69.709 1.00 42.45 ? 273  GLU A CD  1 
ATOM   2089 O OE1 . GLU A 1 273 ? -19.711 55.881 70.350 1.00 41.92 ? 273  GLU A OE1 1 
ATOM   2090 O OE2 . GLU A 1 273 ? -20.285 57.366 68.844 1.00 42.69 ? 273  GLU A OE2 1 
ATOM   2091 N N   . LEU A 1 274 ? -14.300 57.272 67.698 1.00 32.75 ? 274  LEU A N   1 
ATOM   2092 C CA  . LEU A 1 274 ? -13.126 56.589 67.147 1.00 34.18 ? 274  LEU A CA  1 
ATOM   2093 C C   . LEU A 1 274 ? -11.839 57.300 67.655 1.00 32.82 ? 274  LEU A C   1 
ATOM   2094 O O   . LEU A 1 274 ? -10.882 56.661 68.080 1.00 31.97 ? 274  LEU A O   1 
ATOM   2095 C CB  . LEU A 1 274 ? -13.154 56.596 65.605 1.00 34.76 ? 274  LEU A CB  1 
ATOM   2096 C CG  . LEU A 1 274 ? -13.872 55.453 64.872 1.00 38.76 ? 274  LEU A CG  1 
ATOM   2097 C CD1 . LEU A 1 274 ? -15.189 55.122 65.519 1.00 37.07 ? 274  LEU A CD1 1 
ATOM   2098 C CD2 . LEU A 1 274 ? -14.080 55.835 63.392 1.00 36.85 ? 274  LEU A CD2 1 
ATOM   2099 N N   . ILE A 1 275 ? -11.834 58.618 67.626 1.00 32.39 ? 275  ILE A N   1 
ATOM   2100 C CA  . ILE A 1 275 ? -10.658 59.362 68.053 1.00 31.78 ? 275  ILE A CA  1 
ATOM   2101 C C   . ILE A 1 275 ? -10.348 59.123 69.528 1.00 30.61 ? 275  ILE A C   1 
ATOM   2102 O O   . ILE A 1 275 ? -9.207  59.030 69.906 1.00 28.62 ? 275  ILE A O   1 
ATOM   2103 C CB  . ILE A 1 275 ? -10.858 60.828 67.767 1.00 30.11 ? 275  ILE A CB  1 
ATOM   2104 C CG1 . ILE A 1 275 ? -10.867 61.015 66.249 1.00 30.64 ? 275  ILE A CG1 1 
ATOM   2105 C CG2 . ILE A 1 275 ? -9.796  61.698 68.456 1.00 29.86 ? 275  ILE A CG2 1 
ATOM   2106 C CD1 . ILE A 1 275 ? -11.257 62.453 65.816 1.00 29.89 ? 275  ILE A CD1 1 
ATOM   2107 N N   . ASP A 1 276 ? -11.373 58.963 70.347 1.00 31.08 ? 276  ASP A N   1 
ATOM   2108 C CA  . ASP A 1 276 ? -11.153 58.736 71.754 1.00 30.46 ? 276  ASP A CA  1 
ATOM   2109 C C   . ASP A 1 276 ? -10.427 57.434 72.129 1.00 31.37 ? 276  ASP A C   1 
ATOM   2110 O O   . ASP A 1 276 ? -9.849  57.374 73.209 1.00 31.03 ? 276  ASP A O   1 
ATOM   2111 C CB  . ASP A 1 276 ? -12.506 58.799 72.504 1.00 32.15 ? 276  ASP A CB  1 
ATOM   2112 C CG  . ASP A 1 276 ? -12.952 60.241 72.798 1.00 34.58 ? 276  ASP A CG  1 
ATOM   2113 O OD1 . ASP A 1 276 ? -12.174 61.218 72.585 1.00 35.94 ? 276  ASP A OD1 1 
ATOM   2114 O OD2 . ASP A 1 276 ? -14.083 60.411 73.249 1.00 36.36 ? 276  ASP A OD2 1 
ATOM   2115 N N   . VAL A 1 277 ? -10.440 56.387 71.281 1.00 30.08 ? 277  VAL A N   1 
ATOM   2116 C CA  . VAL A 1 277 ? -9.786  55.115 71.664 1.00 28.31 ? 277  VAL A CA  1 
ATOM   2117 C C   . VAL A 1 277 ? -8.740  54.668 70.670 1.00 29.33 ? 277  VAL A C   1 
ATOM   2118 O O   . VAL A 1 277 ? -8.107  53.630 70.834 1.00 30.90 ? 277  VAL A O   1 
ATOM   2119 C CB  . VAL A 1 277 ? -10.835 53.955 71.803 1.00 29.35 ? 277  VAL A CB  1 
ATOM   2120 C CG1 . VAL A 1 277 ? -11.822 54.285 72.918 1.00 27.57 ? 277  VAL A CG1 1 
ATOM   2121 C CG2 . VAL A 1 277 ? -11.639 53.766 70.462 1.00 27.67 ? 277  VAL A CG2 1 
ATOM   2122 N N   . GLU A 1 278 ? -8.576  55.470 69.627 1.00 28.89 ? 278  GLU A N   1 
ATOM   2123 C CA  . GLU A 1 278 ? -7.642  55.227 68.538 1.00 29.49 ? 278  GLU A CA  1 
ATOM   2124 C C   . GLU A 1 278 ? -6.238  54.792 68.993 1.00 30.77 ? 278  GLU A C   1 
ATOM   2125 O O   . GLU A 1 278 ? -5.630  53.813 68.452 1.00 29.58 ? 278  GLU A O   1 
ATOM   2126 C CB  . GLU A 1 278 ? -7.579  56.536 67.705 1.00 31.91 ? 278  GLU A CB  1 
ATOM   2127 C CG  . GLU A 1 278 ? -6.349  56.715 66.878 1.00 35.16 ? 278  GLU A CG  1 
ATOM   2128 C CD  . GLU A 1 278 ? -6.373  57.960 65.970 1.00 34.72 ? 278  GLU A CD  1 
ATOM   2129 O OE1 . GLU A 1 278 ? -6.695  59.082 66.404 1.00 37.93 ? 278  GLU A OE1 1 
ATOM   2130 O OE2 . GLU A 1 278 ? -6.027  57.806 64.811 1.00 37.28 ? 278  GLU A OE2 1 
ATOM   2131 N N   . TRP A 1 279 ? -5.725  55.507 69.990 1.00 28.83 ? 279  TRP A N   1 
ATOM   2132 C CA  . TRP A 1 279 ? -4.376  55.253 70.506 1.00 30.37 ? 279  TRP A CA  1 
ATOM   2133 C C   . TRP A 1 279 ? -4.265  53.978 71.309 1.00 31.22 ? 279  TRP A C   1 
ATOM   2134 O O   . TRP A 1 279 ? -3.158  53.502 71.511 1.00 30.90 ? 279  TRP A O   1 
ATOM   2135 C CB  . TRP A 1 279 ? -3.871  56.452 71.344 1.00 28.93 ? 279  TRP A CB  1 
ATOM   2136 C CG  . TRP A 1 279 ? -2.605  56.992 70.806 1.00 29.61 ? 279  TRP A CG  1 
ATOM   2137 C CD1 . TRP A 1 279 ? -1.402  57.075 71.456 1.00 29.74 ? 279  TRP A CD1 1 
ATOM   2138 C CD2 . TRP A 1 279 ? -2.373  57.453 69.467 1.00 30.73 ? 279  TRP A CD2 1 
ATOM   2139 N NE1 . TRP A 1 279 ? -0.427  57.541 70.598 1.00 29.80 ? 279  TRP A NE1 1 
ATOM   2140 C CE2 . TRP A 1 279 ? -0.996  57.784 69.371 1.00 32.56 ? 279  TRP A CE2 1 
ATOM   2141 C CE3 . TRP A 1 279 ? -3.190  57.612 68.338 1.00 30.61 ? 279  TRP A CE3 1 
ATOM   2142 C CZ2 . TRP A 1 279 ? -0.417  58.270 68.172 1.00 33.04 ? 279  TRP A CZ2 1 
ATOM   2143 C CZ3 . TRP A 1 279 ? -2.624  58.090 67.147 1.00 33.33 ? 279  TRP A CZ3 1 
ATOM   2144 C CH2 . TRP A 1 279 ? -1.255  58.413 67.070 1.00 33.69 ? 279  TRP A CH2 1 
ATOM   2145 N N   . ASN A 1 280 ? -5.400  53.392 71.713 1.00 31.38 ? 280  ASN A N   1 
ATOM   2146 C CA  . ASN A 1 280 ? -5.374  52.154 72.504 1.00 31.32 ? 280  ASN A CA  1 
ATOM   2147 C C   . ASN A 1 280 ? -4.988  50.902 71.710 1.00 30.65 ? 280  ASN A C   1 
ATOM   2148 O O   . ASN A 1 280 ? -4.801  49.828 72.307 1.00 31.27 ? 280  ASN A O   1 
ATOM   2149 C CB  . ASN A 1 280 ? -6.750  51.921 73.191 1.00 31.85 ? 280  ASN A CB  1 
ATOM   2150 C CG  . ASN A 1 280 ? -7.158  53.076 74.165 1.00 34.59 ? 280  ASN A CG  1 
ATOM   2151 O OD1 . ASN A 1 280 ? -6.332  53.928 74.548 1.00 35.81 ? 280  ASN A OD1 1 
ATOM   2152 N ND2 . ASN A 1 280 ? -8.427  53.078 74.588 1.00 31.76 ? 280  ASN A ND2 1 
ATOM   2153 N N   . VAL A 1 281 ? -4.829  51.009 70.389 1.00 30.41 ? 281  VAL A N   1 
ATOM   2154 C CA  . VAL A 1 281 ? -4.521  49.809 69.596 1.00 30.70 ? 281  VAL A CA  1 
ATOM   2155 C C   . VAL A 1 281 ? -3.047  49.535 69.269 1.00 31.09 ? 281  VAL A C   1 
ATOM   2156 O O   . VAL A 1 281 ? -2.729  48.505 68.645 1.00 29.45 ? 281  VAL A O   1 
ATOM   2157 C CB  . VAL A 1 281 ? -5.341  49.769 68.220 1.00 31.91 ? 281  VAL A CB  1 
ATOM   2158 C CG1 . VAL A 1 281 ? -6.870  49.918 68.505 1.00 30.61 ? 281  VAL A CG1 1 
ATOM   2159 C CG2 . VAL A 1 281 ? -4.834  50.846 67.250 1.00 31.62 ? 281  VAL A CG2 1 
ATOM   2160 N N   . LEU A 1 282 ? -2.160  50.449 69.660 1.00 29.06 ? 282  LEU A N   1 
ATOM   2161 C CA  . LEU A 1 282 ? -0.734  50.271 69.388 1.00 29.31 ? 282  LEU A CA  1 
ATOM   2162 C C   . LEU A 1 282 ? -0.322  48.982 70.040 1.00 30.19 ? 282  LEU A C   1 
ATOM   2163 O O   . LEU A 1 282 ? -0.747  48.671 71.153 1.00 29.30 ? 282  LEU A O   1 
ATOM   2164 C CB  . LEU A 1 282 ? 0.106   51.452 69.953 1.00 29.56 ? 282  LEU A CB  1 
ATOM   2165 C CG  . LEU A 1 282 ? -0.100  52.706 69.044 1.00 31.75 ? 282  LEU A CG  1 
ATOM   2166 C CD1 . LEU A 1 282 ? 0.509   53.993 69.677 1.00 32.19 ? 282  LEU A CD1 1 
ATOM   2167 C CD2 . LEU A 1 282 ? 0.533   52.446 67.668 1.00 29.32 ? 282  LEU A CD2 1 
ATOM   2168 N N   . PRO A 1 283 ? 0.513   48.203 69.368 1.00 30.26 ? 283  PRO A N   1 
ATOM   2169 C CA  . PRO A 1 283 ? 0.891   46.958 70.027 1.00 32.71 ? 283  PRO A CA  1 
ATOM   2170 C C   . PRO A 1 283 ? 1.897   47.161 71.165 1.00 33.98 ? 283  PRO A C   1 
ATOM   2171 O O   . PRO A 1 283 ? 1.940   46.344 72.062 1.00 36.91 ? 283  PRO A O   1 
ATOM   2172 C CB  . PRO A 1 283 ? 1.485   46.133 68.875 1.00 32.54 ? 283  PRO A CB  1 
ATOM   2173 C CG  . PRO A 1 283 ? 2.233   47.221 68.100 1.00 31.65 ? 283  PRO A CG  1 
ATOM   2174 C CD  . PRO A 1 283 ? 1.223   48.377 68.087 1.00 30.98 ? 283  PRO A CD  1 
ATOM   2175 N N   . PHE A 1 284 ? 2.690   48.230 71.152 1.00 33.20 ? 284  PHE A N   1 
ATOM   2176 C CA  . PHE A 1 284 ? 3.698   48.419 72.213 1.00 32.30 ? 284  PHE A CA  1 
ATOM   2177 C C   . PHE A 1 284 ? 3.665   49.799 72.882 1.00 32.12 ? 284  PHE A C   1 
ATOM   2178 O O   . PHE A 1 284 ? 3.076   50.735 72.345 1.00 30.83 ? 284  PHE A O   1 
ATOM   2179 C CB  . PHE A 1 284 ? 5.103   48.267 71.622 1.00 35.11 ? 284  PHE A CB  1 
ATOM   2180 C CG  . PHE A 1 284 ? 5.241   47.113 70.673 1.00 39.41 ? 284  PHE A CG  1 
ATOM   2181 C CD1 . PHE A 1 284 ? 5.160   45.795 71.146 1.00 41.71 ? 284  PHE A CD1 1 
ATOM   2182 C CD2 . PHE A 1 284 ? 5.423   47.345 69.306 1.00 40.20 ? 284  PHE A CD2 1 
ATOM   2183 C CE1 . PHE A 1 284 ? 5.260   44.692 70.254 1.00 43.25 ? 284  PHE A CE1 1 
ATOM   2184 C CE2 . PHE A 1 284 ? 5.526   46.287 68.399 1.00 42.05 ? 284  PHE A CE2 1 
ATOM   2185 C CZ  . PHE A 1 284 ? 5.443   44.939 68.879 1.00 43.52 ? 284  PHE A CZ  1 
ATOM   2186 N N   . ASP A 1 285 ? 4.380   49.913 74.003 1.00 30.85 ? 285  ASP A N   1 
ATOM   2187 C CA  . ASP A 1 285 ? 4.546   51.155 74.735 1.00 30.01 ? 285  ASP A CA  1 
ATOM   2188 C C   . ASP A 1 285 ? 5.606   51.814 73.849 1.00 30.59 ? 285  ASP A C   1 
ATOM   2189 O O   . ASP A 1 285 ? 6.783   51.465 73.884 1.00 33.15 ? 285  ASP A O   1 
ATOM   2190 C CB  . ASP A 1 285 ? 5.132   50.869 76.110 1.00 29.84 ? 285  ASP A CB  1 
ATOM   2191 C CG  . ASP A 1 285 ? 5.166   52.109 77.003 1.00 30.39 ? 285  ASP A CG  1 
ATOM   2192 O OD1 . ASP A 1 285 ? 4.799   53.216 76.530 1.00 27.75 ? 285  ASP A OD1 1 
ATOM   2193 O OD2 . ASP A 1 285 ? 5.571   51.950 78.174 1.00 32.23 ? 285  ASP A OD2 1 
ATOM   2194 N N   . SER A 1 286 ? 5.227   52.812 73.092 1.00 28.37 ? 286  SER A N   1 
ATOM   2195 C CA  . SER A 1 286 ? 6.195   53.323 72.172 1.00 28.44 ? 286  SER A CA  1 
ATOM   2196 C C   . SER A 1 286 ? 6.141   54.816 72.012 1.00 28.27 ? 286  SER A C   1 
ATOM   2197 O O   . SER A 1 286 ? 5.232   55.480 72.489 1.00 28.15 ? 286  SER A O   1 
ATOM   2198 C CB  . SER A 1 286 ? 5.896   52.703 70.804 1.00 28.79 ? 286  SER A CB  1 
ATOM   2199 O OG  . SER A 1 286 ? 4.584   53.165 70.391 1.00 29.31 ? 286  SER A OG  1 
ATOM   2200 N N   . ILE A 1 287 ? 7.102   55.302 71.247 1.00 29.16 ? 287  ILE A N   1 
ATOM   2201 C CA  . ILE A 1 287 ? 7.184   56.689 70.873 1.00 28.20 ? 287  ILE A CA  1 
ATOM   2202 C C   . ILE A 1 287 ? 7.424   56.664 69.363 1.00 29.59 ? 287  ILE A C   1 
ATOM   2203 O O   . ILE A 1 287 ? 8.030   55.715 68.824 1.00 25.84 ? 287  ILE A O   1 
ATOM   2204 C CB  . ILE A 1 287 ? 8.278   57.342 71.702 1.00 32.15 ? 287  ILE A CB  1 
ATOM   2205 C CG1 . ILE A 1 287 ? 7.670   58.556 72.309 1.00 31.74 ? 287  ILE A CG1 1 
ATOM   2206 C CG2 . ILE A 1 287 ? 9.605   57.451 71.038 1.00 29.98 ? 287  ILE A CG2 1 
ATOM   2207 C CD1 . ILE A 1 287 ? 6.938   58.103 73.426 1.00 33.77 ? 287  ILE A CD1 1 
ATOM   2208 N N   . PHE A 1 288 ? 6.889   57.669 68.677 1.00 26.48 ? 288  PHE A N   1 
ATOM   2209 C CA  . PHE A 1 288 ? 7.031   57.777 67.238 1.00 28.50 ? 288  PHE A CA  1 
ATOM   2210 C C   . PHE A 1 288 ? 6.392   56.593 66.450 1.00 27.41 ? 288  PHE A C   1 
ATOM   2211 O O   . PHE A 1 288 ? 6.973   56.096 65.490 1.00 27.93 ? 288  PHE A O   1 
ATOM   2212 C CB  . PHE A 1 288 ? 8.507   57.917 66.824 1.00 25.29 ? 288  PHE A CB  1 
ATOM   2213 C CG  . PHE A 1 288 ? 8.729   58.916 65.701 1.00 26.92 ? 288  PHE A CG  1 
ATOM   2214 C CD1 . PHE A 1 288 ? 7.931   58.877 64.528 1.00 25.00 ? 288  PHE A CD1 1 
ATOM   2215 C CD2 . PHE A 1 288 ? 9.732   59.896 65.805 1.00 23.50 ? 288  PHE A CD2 1 
ATOM   2216 C CE1 . PHE A 1 288 ? 8.122   59.787 63.476 1.00 27.66 ? 288  PHE A CE1 1 
ATOM   2217 C CE2 . PHE A 1 288 ? 9.941   60.814 64.756 1.00 26.00 ? 288  PHE A CE2 1 
ATOM   2218 C CZ  . PHE A 1 288 ? 9.142   60.775 63.584 1.00 25.15 ? 288  PHE A CZ  1 
ATOM   2219 N N   . ARG A 1 289 ? 5.204   56.179 66.867 1.00 27.30 ? 289  ARG A N   1 
ATOM   2220 C CA  . ARG A 1 289 ? 4.424   55.105 66.208 1.00 27.01 ? 289  ARG A CA  1 
ATOM   2221 C C   . ARG A 1 289 ? 2.973   55.610 66.273 1.00 27.07 ? 289  ARG A C   1 
ATOM   2222 O O   . ARG A 1 289 ? 2.551   56.202 67.277 1.00 25.41 ? 289  ARG A O   1 
ATOM   2223 C CB  . ARG A 1 289 ? 4.530   53.750 66.957 1.00 26.23 ? 289  ARG A CB  1 
ATOM   2224 C CG  . ARG A 1 289 ? 5.915   53.116 66.911 1.00 27.36 ? 289  ARG A CG  1 
ATOM   2225 C CD  . ARG A 1 289 ? 6.348   52.725 65.460 1.00 25.76 ? 289  ARG A CD  1 
ATOM   2226 N NE  . ARG A 1 289 ? 7.648   52.021 65.506 1.00 26.38 ? 289  ARG A NE  1 
ATOM   2227 C CZ  . ARG A 1 289 ? 8.849   52.595 65.392 1.00 27.40 ? 289  ARG A CZ  1 
ATOM   2228 N NH1 . ARG A 1 289 ? 8.976   53.910 65.216 1.00 24.99 ? 289  ARG A NH1 1 
ATOM   2229 N NH2 . ARG A 1 289 ? 9.945   51.850 65.449 1.00 26.33 ? 289  ARG A NH2 1 
ATOM   2230 N N   . PHE A 1 290 ? 2.215   55.344 65.211 1.00 27.36 ? 290  PHE A N   1 
ATOM   2231 C CA  . PHE A 1 290 ? 0.855   55.829 65.087 1.00 26.81 ? 290  PHE A CA  1 
ATOM   2232 C C   . PHE A 1 290 ? -0.047  54.652 64.727 1.00 28.80 ? 290  PHE A C   1 
ATOM   2233 O O   . PHE A 1 290 ? 0.328   53.749 63.963 1.00 26.69 ? 290  PHE A O   1 
ATOM   2234 C CB  . PHE A 1 290 ? 0.847   56.892 63.990 1.00 27.24 ? 290  PHE A CB  1 
ATOM   2235 C CG  . PHE A 1 290 ? 2.018   57.894 64.092 1.00 26.55 ? 290  PHE A CG  1 
ATOM   2236 C CD1 . PHE A 1 290 ? 2.044   58.853 65.099 1.00 26.33 ? 290  PHE A CD1 1 
ATOM   2237 C CD2 . PHE A 1 290 ? 3.073   57.861 63.173 1.00 25.22 ? 290  PHE A CD2 1 
ATOM   2238 C CE1 . PHE A 1 290 ? 3.105   59.792 65.199 1.00 27.32 ? 290  PHE A CE1 1 
ATOM   2239 C CE2 . PHE A 1 290 ? 4.163   58.789 63.247 1.00 25.50 ? 290  PHE A CE2 1 
ATOM   2240 C CZ  . PHE A 1 290 ? 4.174   59.762 64.266 1.00 25.19 ? 290  PHE A CZ  1 
ATOM   2241 N N   . SER A 1 291 ? -1.265  54.692 65.238 1.00 27.78 ? 291  SER A N   1 
ATOM   2242 C CA  . SER A 1 291 ? -2.177  53.580 65.028 1.00 29.60 ? 291  SER A CA  1 
ATOM   2243 C C   . SER A 1 291 ? -2.542  53.161 63.604 1.00 29.84 ? 291  SER A C   1 
ATOM   2244 O O   . SER A 1 291 ? -2.267  52.033 63.201 1.00 29.36 ? 291  SER A O   1 
ATOM   2245 C CB  . SER A 1 291 ? -3.460  53.845 65.820 1.00 29.79 ? 291  SER A CB  1 
ATOM   2246 O OG  . SER A 1 291 ? -3.093  53.939 67.170 1.00 31.61 ? 291  SER A OG  1 
ATOM   2247 N N   . PHE A 1 292 ? -3.136  54.084 62.857 1.00 28.38 ? 292  PHE A N   1 
ATOM   2248 C CA  . PHE A 1 292 ? -3.600  53.820 61.508 1.00 28.36 ? 292  PHE A CA  1 
ATOM   2249 C C   . PHE A 1 292 ? -2.778  54.460 60.427 1.00 27.87 ? 292  PHE A C   1 
ATOM   2250 O O   . PHE A 1 292 ? -2.841  55.678 60.223 1.00 27.23 ? 292  PHE A O   1 
ATOM   2251 C CB  . PHE A 1 292 ? -5.035  54.281 61.452 1.00 28.34 ? 292  PHE A CB  1 
ATOM   2252 C CG  . PHE A 1 292 ? -5.892  53.481 62.355 1.00 30.15 ? 292  PHE A CG  1 
ATOM   2253 C CD1 . PHE A 1 292 ? -6.164  52.143 62.032 1.00 30.43 ? 292  PHE A CD1 1 
ATOM   2254 C CD2 . PHE A 1 292 ? -6.322  54.001 63.599 1.00 28.78 ? 292  PHE A CD2 1 
ATOM   2255 C CE1 . PHE A 1 292 ? -6.861  51.288 62.955 1.00 30.54 ? 292  PHE A CE1 1 
ATOM   2256 C CE2 . PHE A 1 292 ? -6.994  53.191 64.503 1.00 29.01 ? 292  PHE A CE2 1 
ATOM   2257 C CZ  . PHE A 1 292 ? -7.266  51.806 64.176 1.00 30.68 ? 292  PHE A CZ  1 
ATOM   2258 N N   . VAL A 1 293 ? -2.043  53.620 59.718 1.00 26.45 ? 293  VAL A N   1 
ATOM   2259 C CA  . VAL A 1 293 ? -1.140  54.086 58.716 1.00 25.83 ? 293  VAL A CA  1 
ATOM   2260 C C   . VAL A 1 293 ? -1.251  53.179 57.487 1.00 27.41 ? 293  VAL A C   1 
ATOM   2261 O O   . VAL A 1 293 ? -1.971  52.168 57.507 1.00 26.73 ? 293  VAL A O   1 
ATOM   2262 C CB  . VAL A 1 293 ? 0.322   54.031 59.282 1.00 27.76 ? 293  VAL A CB  1 
ATOM   2263 C CG1 . VAL A 1 293 ? 0.444   54.905 60.544 1.00 25.67 ? 293  VAL A CG1 1 
ATOM   2264 C CG2 . VAL A 1 293 ? 0.726   52.552 59.585 1.00 25.56 ? 293  VAL A CG2 1 
ATOM   2265 N N   . PRO A 1 294 ? -0.603  53.576 56.379 1.00 27.15 ? 294  PRO A N   1 
ATOM   2266 C CA  . PRO A 1 294 ? -0.605  52.808 55.135 1.00 26.88 ? 294  PRO A CA  1 
ATOM   2267 C C   . PRO A 1 294 ? -0.275  51.303 55.401 1.00 29.86 ? 294  PRO A C   1 
ATOM   2268 O O   . PRO A 1 294 ? 0.494   50.969 56.367 1.00 28.57 ? 294  PRO A O   1 
ATOM   2269 C CB  . PRO A 1 294 ? 0.488   53.498 54.329 1.00 25.04 ? 294  PRO A CB  1 
ATOM   2270 C CG  . PRO A 1 294 ? 0.252   54.980 54.655 1.00 26.43 ? 294  PRO A CG  1 
ATOM   2271 C CD  . PRO A 1 294 ? 0.002   54.922 56.185 1.00 28.49 ? 294  PRO A CD  1 
ATOM   2272 N N   . VAL A 1 295 ? -0.851  50.416 54.577 1.00 28.96 ? 295  VAL A N   1 
ATOM   2273 C CA  . VAL A 1 295 ? -0.611  48.953 54.679 1.00 30.35 ? 295  VAL A CA  1 
ATOM   2274 C C   . VAL A 1 295 ? 0.005   48.447 53.383 1.00 30.22 ? 295  VAL A C   1 
ATOM   2275 O O   . VAL A 1 295 ? -0.360  48.894 52.294 1.00 29.76 ? 295  VAL A O   1 
ATOM   2276 C CB  . VAL A 1 295 ? -1.899  48.081 54.849 1.00 30.93 ? 295  VAL A CB  1 
ATOM   2277 C CG1 . VAL A 1 295 ? -2.272  47.997 56.257 1.00 32.22 ? 295  VAL A CG1 1 
ATOM   2278 C CG2 . VAL A 1 295 ? -3.058  48.652 54.027 1.00 30.16 ? 295  VAL A CG2 1 
ATOM   2279 N N   . ILE A 1 296 ? 0.944   47.520 53.528 1.00 29.89 ? 296  ILE A N   1 
ATOM   2280 C CA  . ILE A 1 296 ? 1.623   46.900 52.416 1.00 31.99 ? 296  ILE A CA  1 
ATOM   2281 C C   . ILE A 1 296 ? 0.589   45.852 51.989 1.00 34.11 ? 296  ILE A C   1 
ATOM   2282 O O   . ILE A 1 296 ? 0.567   44.721 52.503 1.00 34.99 ? 296  ILE A O   1 
ATOM   2283 C CB  . ILE A 1 296 ? 2.961   46.267 52.908 1.00 31.77 ? 296  ILE A CB  1 
ATOM   2284 C CG1 . ILE A 1 296 ? 3.785   47.358 53.618 1.00 31.66 ? 296  ILE A CG1 1 
ATOM   2285 C CG2 . ILE A 1 296 ? 3.748   45.707 51.696 1.00 31.02 ? 296  ILE A CG2 1 
ATOM   2286 C CD1 . ILE A 1 296 ? 4.043   48.615 52.699 1.00 28.72 ? 296  ILE A CD1 1 
ATOM   2287 N N   . ASP A 1 297 ? -0.262  46.254 51.046 1.00 33.52 ? 297  ASP A N   1 
ATOM   2288 C CA  . ASP A 1 297 ? -1.388  45.446 50.631 1.00 35.05 ? 297  ASP A CA  1 
ATOM   2289 C C   . ASP A 1 297 ? -1.246  44.618 49.358 1.00 35.81 ? 297  ASP A C   1 
ATOM   2290 O O   . ASP A 1 297 ? -2.108  43.811 49.072 1.00 37.97 ? 297  ASP A O   1 
ATOM   2291 C CB  . ASP A 1 297 ? -2.625  46.365 50.496 1.00 32.55 ? 297  ASP A CB  1 
ATOM   2292 C CG  . ASP A 1 297 ? -2.397  47.491 49.475 1.00 35.00 ? 297  ASP A CG  1 
ATOM   2293 O OD1 . ASP A 1 297 ? -1.243  47.634 49.009 1.00 32.68 ? 297  ASP A OD1 1 
ATOM   2294 O OD2 . ASP A 1 297 ? -3.357  48.247 49.141 1.00 37.62 ? 297  ASP A OD2 1 
ATOM   2295 N N   . GLY A 1 298 ? -0.200  44.806 48.580 1.00 35.93 ? 298  GLY A N   1 
ATOM   2296 C CA  . GLY A 1 298 ? -0.132  44.038 47.354 1.00 36.60 ? 298  GLY A CA  1 
ATOM   2297 C C   . GLY A 1 298 ? -0.887  44.744 46.224 1.00 37.92 ? 298  GLY A C   1 
ATOM   2298 O O   . GLY A 1 298 ? -1.007  44.190 45.136 1.00 38.45 ? 298  GLY A O   1 
ATOM   2299 N N   . GLU A 1 299 ? -1.436  45.938 46.475 1.00 36.71 ? 299  GLU A N   1 
ATOM   2300 C CA  . GLU A 1 299 ? -2.163  46.674 45.443 1.00 33.68 ? 299  GLU A CA  1 
ATOM   2301 C C   . GLU A 1 299 ? -1.518  48.071 45.270 1.00 32.76 ? 299  GLU A C   1 
ATOM   2302 O O   . GLU A 1 299 ? -0.843  48.324 44.274 1.00 32.90 ? 299  GLU A O   1 
ATOM   2303 C CB  . GLU A 1 299 ? -3.628  46.810 45.833 1.00 34.47 ? 299  GLU A CB  1 
ATOM   2304 N N   . PHE A 1 300 ? -1.726  48.962 46.237 1.00 30.16 ? 300  PHE A N   1 
ATOM   2305 C CA  . PHE A 1 300 ? -1.125  50.257 46.189 1.00 29.51 ? 300  PHE A CA  1 
ATOM   2306 C C   . PHE A 1 300 ? 0.409   50.000 46.199 1.00 30.61 ? 300  PHE A C   1 
ATOM   2307 O O   . PHE A 1 300 ? 1.151   50.638 45.462 1.00 29.49 ? 300  PHE A O   1 
ATOM   2308 C CB  . PHE A 1 300 ? -1.588  51.085 47.392 1.00 30.43 ? 300  PHE A CB  1 
ATOM   2309 C CG  . PHE A 1 300 ? -1.219  52.552 47.288 1.00 32.17 ? 300  PHE A CG  1 
ATOM   2310 C CD1 . PHE A 1 300 ? 0.116   52.979 47.509 1.00 31.20 ? 300  PHE A CD1 1 
ATOM   2311 C CD2 . PHE A 1 300 ? -2.183  53.506 46.941 1.00 28.84 ? 300  PHE A CD2 1 
ATOM   2312 C CE1 . PHE A 1 300 ? 0.464   54.361 47.385 1.00 29.44 ? 300  PHE A CE1 1 
ATOM   2313 C CE2 . PHE A 1 300 ? -1.836  54.866 46.814 1.00 30.26 ? 300  PHE A CE2 1 
ATOM   2314 C CZ  . PHE A 1 300 ? -0.515  55.285 47.040 1.00 29.57 ? 300  PHE A CZ  1 
ATOM   2315 N N   . PHE A 1 301 ? 0.876   49.083 47.049 1.00 31.43 ? 301  PHE A N   1 
ATOM   2316 C CA  . PHE A 1 301 ? 2.305   48.694 47.108 1.00 30.88 ? 301  PHE A CA  1 
ATOM   2317 C C   . PHE A 1 301 ? 2.272   47.242 46.602 1.00 32.73 ? 301  PHE A C   1 
ATOM   2318 O O   . PHE A 1 301 ? 1.792   46.356 47.294 1.00 32.91 ? 301  PHE A O   1 
ATOM   2319 C CB  . PHE A 1 301 ? 2.814   48.756 48.551 1.00 31.03 ? 301  PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 301 ? 2.688   50.128 49.168 1.00 30.34 ? 301  PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 301 ? 3.504   51.180 48.726 1.00 29.45 ? 301  PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 301 ? 1.716   50.388 50.141 1.00 27.55 ? 301  PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 301 ? 3.340   52.494 49.251 1.00 31.90 ? 301  PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 301 ? 1.542   51.691 50.673 1.00 28.91 ? 301  PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 301 ? 2.354   52.757 50.229 1.00 28.75 ? 301  PHE A CZ  1 
ATOM   2326 N N   . PRO A 1 302 ? 2.755   46.984 45.370 1.00 34.21 ? 302  PRO A N   1 
ATOM   2327 C CA  . PRO A 1 302 ? 2.708   45.600 44.884 1.00 34.44 ? 302  PRO A CA  1 
ATOM   2328 C C   . PRO A 1 302 ? 3.478   44.579 45.704 1.00 34.68 ? 302  PRO A C   1 
ATOM   2329 O O   . PRO A 1 302 ? 2.999   43.472 45.852 1.00 35.02 ? 302  PRO A O   1 
ATOM   2330 C CB  . PRO A 1 302 ? 3.179   45.712 43.418 1.00 36.01 ? 302  PRO A CB  1 
ATOM   2331 C CG  . PRO A 1 302 ? 4.009   46.982 43.408 1.00 36.66 ? 302  PRO A CG  1 
ATOM   2332 C CD  . PRO A 1 302 ? 3.255   47.909 44.335 1.00 33.85 ? 302  PRO A CD  1 
ATOM   2333 N N   . THR A 1 303 ? 4.642   44.936 46.245 1.00 33.18 ? 303  THR A N   1 
ATOM   2334 C CA  . THR A 1 303 ? 5.404   44.011 47.082 1.00 34.60 ? 303  THR A CA  1 
ATOM   2335 C C   . THR A 1 303 ? 5.981   44.827 48.226 1.00 33.36 ? 303  THR A C   1 
ATOM   2336 O O   . THR A 1 303 ? 5.680   46.015 48.319 1.00 33.89 ? 303  THR A O   1 
ATOM   2337 C CB  . THR A 1 303 ? 6.579   43.324 46.319 1.00 36.73 ? 303  THR A CB  1 
ATOM   2338 O OG1 . THR A 1 303 ? 7.534   44.307 45.871 1.00 38.14 ? 303  THR A OG1 1 
ATOM   2339 C CG2 . THR A 1 303 ? 6.059   42.585 45.115 1.00 38.51 ? 303  THR A CG2 1 
ATOM   2340 N N   . SER A 1 304 ? 6.806   44.215 49.077 1.00 30.44 ? 304  SER A N   1 
ATOM   2341 C CA  . SER A 1 304 ? 7.395   44.938 50.218 1.00 31.09 ? 304  SER A CA  1 
ATOM   2342 C C   . SER A 1 304 ? 8.149   46.187 49.730 1.00 30.53 ? 304  SER A C   1 
ATOM   2343 O O   . SER A 1 304 ? 8.677   46.216 48.606 1.00 30.56 ? 304  SER A O   1 
ATOM   2344 C CB  . SER A 1 304 ? 8.373   44.051 50.994 1.00 30.07 ? 304  SER A CB  1 
ATOM   2345 O OG  . SER A 1 304 ? 9.493   43.810 50.162 1.00 30.47 ? 304  SER A OG  1 
ATOM   2346 N N   . LEU A 1 305 ? 8.196   47.221 50.563 1.00 30.65 ? 305  LEU A N   1 
ATOM   2347 C CA  . LEU A 1 305 ? 8.881   48.412 50.132 1.00 31.74 ? 305  LEU A CA  1 
ATOM   2348 C C   . LEU A 1 305 ? 10.363  48.111 49.836 1.00 32.64 ? 305  LEU A C   1 
ATOM   2349 O O   . LEU A 1 305 ? 10.914  48.598 48.838 1.00 33.59 ? 305  LEU A O   1 
ATOM   2350 C CB  . LEU A 1 305 ? 8.743   49.498 51.183 1.00 30.94 ? 305  LEU A CB  1 
ATOM   2351 C CG  . LEU A 1 305 ? 7.311   49.818 51.594 1.00 30.09 ? 305  LEU A CG  1 
ATOM   2352 C CD1 . LEU A 1 305 ? 7.308   50.924 52.661 1.00 30.03 ? 305  LEU A CD1 1 
ATOM   2353 C CD2 . LEU A 1 305 ? 6.543   50.243 50.370 1.00 31.16 ? 305  LEU A CD2 1 
ATOM   2354 N N   . GLU A 1 306 ? 11.006  47.290 50.666 1.00 32.99 ? 306  GLU A N   1 
ATOM   2355 C CA  . GLU A 1 306 ? 12.425  47.005 50.446 1.00 33.70 ? 306  GLU A CA  1 
ATOM   2356 C C   . GLU A 1 306 ? 12.666  46.293 49.112 1.00 33.41 ? 306  GLU A C   1 
ATOM   2357 O O   . GLU A 1 306 ? 13.606  46.637 48.395 1.00 32.71 ? 306  GLU A O   1 
ATOM   2358 C CB  . GLU A 1 306 ? 13.025  46.171 51.609 1.00 35.40 ? 306  GLU A CB  1 
ATOM   2359 C CG  . GLU A 1 306 ? 14.540  45.881 51.425 1.00 40.22 ? 306  GLU A CG  1 
ATOM   2360 C CD  . GLU A 1 306 ? 15.442  47.139 51.473 1.00 41.72 ? 306  GLU A CD  1 
ATOM   2361 O OE1 . GLU A 1 306 ? 14.969  48.255 51.791 1.00 41.81 ? 306  GLU A OE1 1 
ATOM   2362 O OE2 . GLU A 1 306 ? 16.645  47.001 51.203 1.00 43.94 ? 306  GLU A OE2 1 
ATOM   2363 N N   . SER A 1 307 ? 11.822  45.329 48.738 1.00 32.43 ? 307  SER A N   1 
ATOM   2364 C CA  . SER A 1 307 ? 12.088  44.681 47.453 1.00 33.67 ? 307  SER A CA  1 
ATOM   2365 C C   . SER A 1 307 ? 11.820  45.654 46.289 1.00 33.09 ? 307  SER A C   1 
ATOM   2366 O O   . SER A 1 307 ? 12.464  45.580 45.244 1.00 32.17 ? 307  SER A O   1 
ATOM   2367 C CB  . SER A 1 307 ? 11.291  43.374 47.301 1.00 33.92 ? 307  SER A CB  1 
ATOM   2368 O OG  . SER A 1 307 ? 9.893   43.591 47.354 1.00 39.46 ? 307  SER A OG  1 
ATOM   2369 N N   . MET A 1 308 ? 10.879  46.576 46.475 1.00 32.02 ? 308  MET A N   1 
ATOM   2370 C CA  . MET A 1 308 ? 10.618  47.566 45.442 1.00 32.16 ? 308  MET A CA  1 
ATOM   2371 C C   . MET A 1 308 ? 11.853  48.466 45.308 1.00 30.67 ? 308  MET A C   1 
ATOM   2372 O O   . MET A 1 308 ? 12.312  48.737 44.205 1.00 29.41 ? 308  MET A O   1 
ATOM   2373 C CB  . MET A 1 308 ? 9.364   48.402 45.785 1.00 31.89 ? 308  MET A CB  1 
ATOM   2374 C CG  . MET A 1 308 ? 8.059   47.638 45.574 1.00 31.06 ? 308  MET A CG  1 
ATOM   2375 S SD  . MET A 1 308 ? 6.591   48.613 45.904 1.00 33.87 ? 308  MET A SD  1 
ATOM   2376 C CE  . MET A 1 308 ? 6.554   49.567 44.323 1.00 31.37 ? 308  MET A CE  1 
ATOM   2377 N N   . LEU A 1 309 ? 12.388  48.931 46.427 1.00 30.64 ? 309  LEU A N   1 
ATOM   2378 C CA  . LEU A 1 309 ? 13.580  49.783 46.373 1.00 33.32 ? 309  LEU A CA  1 
ATOM   2379 C C   . LEU A 1 309 ? 14.776  49.030 45.767 1.00 35.44 ? 309  LEU A C   1 
ATOM   2380 O O   . LEU A 1 309 ? 15.539  49.585 44.945 1.00 36.33 ? 309  LEU A O   1 
ATOM   2381 C CB  . LEU A 1 309 ? 13.938  50.271 47.768 1.00 31.39 ? 309  LEU A CB  1 
ATOM   2382 C CG  . LEU A 1 309 ? 12.928  51.290 48.348 1.00 33.13 ? 309  LEU A CG  1 
ATOM   2383 C CD1 . LEU A 1 309 ? 13.247  51.546 49.818 1.00 31.54 ? 309  LEU A CD1 1 
ATOM   2384 C CD2 . LEU A 1 309 ? 12.947  52.587 47.526 1.00 28.88 ? 309  LEU A CD2 1 
ATOM   2385 N N   . ASN A 1 310 ? 14.923  47.763 46.148 1.00 36.07 ? 310  ASN A N   1 
ATOM   2386 C CA  . ASN A 1 310 ? 16.009  46.945 45.646 1.00 38.70 ? 310  ASN A CA  1 
ATOM   2387 C C   . ASN A 1 310 ? 16.005  46.696 44.150 1.00 37.98 ? 310  ASN A C   1 
ATOM   2388 O O   . ASN A 1 310 ? 17.062  46.718 43.510 1.00 37.02 ? 310  ASN A O   1 
ATOM   2389 C CB  . ASN A 1 310 ? 16.038  45.598 46.371 1.00 41.71 ? 310  ASN A CB  1 
ATOM   2390 C CG  . ASN A 1 310 ? 16.822  45.675 47.654 1.00 45.85 ? 310  ASN A CG  1 
ATOM   2391 O OD1 . ASN A 1 310 ? 17.772  46.466 47.749 1.00 47.30 ? 310  ASN A OD1 1 
ATOM   2392 N ND2 . ASN A 1 310 ? 16.448  44.860 48.654 1.00 47.73 ? 310  ASN A ND2 1 
ATOM   2393 N N   . SER A 1 311 ? 14.818  46.487 43.594 1.00 36.72 ? 311  SER A N   1 
ATOM   2394 C CA  . SER A 1 311 ? 14.693  46.205 42.181 1.00 37.22 ? 311  SER A CA  1 
ATOM   2395 C C   . SER A 1 311 ? 14.443  47.410 41.260 1.00 35.99 ? 311  SER A C   1 
ATOM   2396 O O   . SER A 1 311 ? 14.244  47.222 40.060 1.00 35.92 ? 311  SER A O   1 
ATOM   2397 C CB  . SER A 1 311 ? 13.570  45.172 41.962 1.00 38.01 ? 311  SER A CB  1 
ATOM   2398 O OG  . SER A 1 311 ? 12.286  45.712 42.307 1.00 41.56 ? 311  SER A OG  1 
ATOM   2399 N N   . GLY A 1 312 ? 14.473  48.629 41.781 1.00 35.22 ? 312  GLY A N   1 
ATOM   2400 C CA  . GLY A 1 312 ? 14.199  49.781 40.920 1.00 32.13 ? 312  GLY A CA  1 
ATOM   2401 C C   . GLY A 1 312 ? 12.712  49.848 40.555 1.00 31.86 ? 312  GLY A C   1 
ATOM   2402 O O   . GLY A 1 312 ? 12.289  50.504 39.584 1.00 31.80 ? 312  GLY A O   1 
ATOM   2403 N N   . ASN A 1 313 ? 11.880  49.155 41.317 1.00 31.03 ? 313  ASN A N   1 
ATOM   2404 C CA  . ASN A 1 313 ? 10.472  49.194 41.000 1.00 31.17 ? 313  ASN A CA  1 
ATOM   2405 C C   . ASN A 1 313 ? 9.837   50.497 41.525 1.00 30.62 ? 313  ASN A C   1 
ATOM   2406 O O   . ASN A 1 313 ? 9.120   50.513 42.537 1.00 30.83 ? 313  ASN A O   1 
ATOM   2407 C CB  . ASN A 1 313 ? 9.746   47.991 41.578 1.00 30.14 ? 313  ASN A CB  1 
ATOM   2408 C CG  . ASN A 1 313 ? 8.348   47.853 41.008 1.00 31.61 ? 313  ASN A CG  1 
ATOM   2409 O OD1 . ASN A 1 313 ? 7.926   48.676 40.181 1.00 31.24 ? 313  ASN A OD1 1 
ATOM   2410 N ND2 . ASN A 1 313 ? 7.619   46.836 41.444 1.00 29.53 ? 313  ASN A ND2 1 
ATOM   2411 N N   . PHE A 1 314 ? 10.093  51.585 40.816 1.00 31.40 ? 314  PHE A N   1 
ATOM   2412 C CA  . PHE A 1 314 ? 9.572   52.887 41.220 1.00 30.14 ? 314  PHE A CA  1 
ATOM   2413 C C   . PHE A 1 314 ? 9.770   53.961 40.169 1.00 31.50 ? 314  PHE A C   1 
ATOM   2414 O O   . PHE A 1 314 ? 10.526  53.768 39.207 1.00 30.17 ? 314  PHE A O   1 
ATOM   2415 C CB  . PHE A 1 314 ? 10.198  53.323 42.561 1.00 28.36 ? 314  PHE A CB  1 
ATOM   2416 C CG  . PHE A 1 314 ? 11.713  53.287 42.602 1.00 27.87 ? 314  PHE A CG  1 
ATOM   2417 C CD1 . PHE A 1 314 ? 12.490  54.279 41.972 1.00 27.94 ? 314  PHE A CD1 1 
ATOM   2418 C CD2 . PHE A 1 314 ? 12.370  52.268 43.310 1.00 29.67 ? 314  PHE A CD2 1 
ATOM   2419 C CE1 . PHE A 1 314 ? 13.900  54.251 42.048 1.00 27.14 ? 314  PHE A CE1 1 
ATOM   2420 C CE2 . PHE A 1 314 ? 13.780  52.228 43.399 1.00 27.17 ? 314  PHE A CE2 1 
ATOM   2421 C CZ  . PHE A 1 314 ? 14.543  53.207 42.772 1.00 27.55 ? 314  PHE A CZ  1 
ATOM   2422 N N   . LYS A 1 315 ? 9.092   55.099 40.344 1.00 31.41 ? 315  LYS A N   1 
ATOM   2423 C CA  . LYS A 1 315 ? 9.221   56.178 39.365 1.00 31.79 ? 315  LYS A CA  1 
ATOM   2424 C C   . LYS A 1 315 ? 10.651  56.734 39.337 1.00 32.83 ? 315  LYS A C   1 
ATOM   2425 O O   . LYS A 1 315 ? 11.216  57.096 40.388 1.00 31.95 ? 315  LYS A O   1 
ATOM   2426 C CB  . LYS A 1 315 ? 8.268   57.351 39.683 1.00 30.89 ? 315  LYS A CB  1 
ATOM   2427 C CG  . LYS A 1 315 ? 8.258   58.412 38.573 1.00 30.16 ? 315  LYS A CG  1 
ATOM   2428 C CD  . LYS A 1 315 ? 7.469   59.657 39.065 1.00 29.29 ? 315  LYS A CD  1 
ATOM   2429 C CE  . LYS A 1 315 ? 7.416   60.752 38.014 1.00 27.54 ? 315  LYS A CE  1 
ATOM   2430 N NZ  . LYS A 1 315 ? 6.509   60.381 36.879 1.00 26.25 ? 315  LYS A NZ  1 
ATOM   2431 N N   . LYS A 1 316 ? 11.218  56.819 38.141 1.00 31.80 ? 316  LYS A N   1 
ATOM   2432 C CA  . LYS A 1 316 ? 12.550  57.351 37.964 1.00 32.90 ? 316  LYS A CA  1 
ATOM   2433 C C   . LYS A 1 316 ? 12.453  58.818 37.553 1.00 33.84 ? 316  LYS A C   1 
ATOM   2434 O O   . LYS A 1 316 ? 11.928  59.125 36.501 1.00 33.00 ? 316  LYS A O   1 
ATOM   2435 C CB  . LYS A 1 316 ? 13.275  56.586 36.867 1.00 36.64 ? 316  LYS A CB  1 
ATOM   2436 C CG  . LYS A 1 316 ? 13.966  55.350 37.349 1.00 41.00 ? 316  LYS A CG  1 
ATOM   2437 C CD  . LYS A 1 316 ? 13.001  54.250 37.498 1.00 43.40 ? 316  LYS A CD  1 
ATOM   2438 C CE  . LYS A 1 316 ? 13.767  52.939 37.628 1.00 43.74 ? 316  LYS A CE  1 
ATOM   2439 N NZ  . LYS A 1 316 ? 12.757  51.856 37.514 1.00 45.73 ? 316  LYS A NZ  1 
ATOM   2440 N N   . THR A 1 317 ? 12.950  59.733 38.369 1.00 31.65 ? 317  THR A N   1 
ATOM   2441 C CA  . THR A 1 317 ? 12.853  61.136 38.011 1.00 29.85 ? 317  THR A CA  1 
ATOM   2442 C C   . THR A 1 317 ? 13.852  61.780 38.968 1.00 30.31 ? 317  THR A C   1 
ATOM   2443 O O   . THR A 1 317 ? 14.729  61.075 39.520 1.00 30.77 ? 317  THR A O   1 
ATOM   2444 C CB  . THR A 1 317 ? 11.395  61.648 38.270 1.00 29.24 ? 317  THR A CB  1 
ATOM   2445 O OG1 . THR A 1 317 ? 11.308  63.040 37.926 1.00 26.71 ? 317  THR A OG1 1 
ATOM   2446 C CG2 . THR A 1 317 ? 11.015  61.461 39.788 1.00 28.14 ? 317  THR A CG2 1 
ATOM   2447 N N   . GLN A 1 318 ? 13.745  63.079 39.169 1.00 28.72 ? 318  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 318 ? 14.637  63.771 40.113 1.00 29.47 ? 318  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 318 ? 13.959  63.944 41.500 1.00 28.23 ? 318  GLN A C   1 
ATOM   2450 O O   . GLN A 1 318 ? 12.735  64.125 41.604 1.00 26.56 ? 318  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 318 ? 15.012  65.194 39.604 1.00 30.17 ? 318  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 318 ? 15.633  65.251 38.180 1.00 33.76 ? 318  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 318 ? 14.550  65.162 37.087 1.00 35.23 ? 318  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 318 ? 13.458  65.679 37.277 1.00 33.23 ? 318  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 318 ? 14.856  64.496 35.951 1.00 34.73 ? 318  GLN A NE2 1 
ATOM   2456 N N   . ILE A 1 319 ? 14.748  63.902 42.568 1.00 27.66 ? 319  ILE A N   1 
ATOM   2457 C CA  . ILE A 1 319 ? 14.180  64.146 43.870 1.00 27.26 ? 319  ILE A CA  1 
ATOM   2458 C C   . ILE A 1 319 ? 15.102  65.077 44.617 1.00 28.63 ? 319  ILE A C   1 
ATOM   2459 O O   . ILE A 1 319 ? 16.327  65.101 44.361 1.00 28.61 ? 319  ILE A O   1 
ATOM   2460 C CB  . ILE A 1 319 ? 13.999  62.840 44.690 1.00 27.20 ? 319  ILE A CB  1 
ATOM   2461 C CG1 . ILE A 1 319 ? 15.337  62.105 44.860 1.00 27.40 ? 319  ILE A CG1 1 
ATOM   2462 C CG2 . ILE A 1 319 ? 12.993  61.932 44.011 1.00 27.37 ? 319  ILE A CG2 1 
ATOM   2463 C CD1 . ILE A 1 319 ? 15.323  61.000 45.925 1.00 26.45 ? 319  ILE A CD1 1 
ATOM   2464 N N   . LEU A 1 320 ? 14.509  65.841 45.533 1.00 27.36 ? 320  LEU A N   1 
ATOM   2465 C CA  . LEU A 1 320 ? 15.229  66.748 46.414 1.00 28.53 ? 320  LEU A CA  1 
ATOM   2466 C C   . LEU A 1 320 ? 14.655  66.441 47.816 1.00 28.14 ? 320  LEU A C   1 
ATOM   2467 O O   . LEU A 1 320 ? 13.447  66.381 47.991 1.00 28.79 ? 320  LEU A O   1 
ATOM   2468 C CB  . LEU A 1 320 ? 15.004  68.190 45.995 1.00 27.97 ? 320  LEU A CB  1 
ATOM   2469 C CG  . LEU A 1 320 ? 15.723  69.192 46.894 1.00 30.28 ? 320  LEU A CG  1 
ATOM   2470 C CD1 . LEU A 1 320 ? 15.945  70.515 46.065 1.00 31.40 ? 320  LEU A CD1 1 
ATOM   2471 C CD2 . LEU A 1 320 ? 14.895  69.490 48.152 1.00 28.54 ? 320  LEU A CD2 1 
ATOM   2472 N N   . LEU A 1 321 ? 15.520  66.229 48.808 1.00 28.23 ? 321  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 321 ? 15.035  65.812 50.109 1.00 26.56 ? 321  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 321 ? 16.103  66.039 51.157 1.00 27.65 ? 321  LEU A C   1 
ATOM   2475 O O   . LEU A 1 321 ? 17.280  66.294 50.835 1.00 28.47 ? 321  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 321 ? 14.668  64.316 50.041 1.00 25.27 ? 321  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 321 ? 15.818  63.241 50.007 1.00 25.78 ? 321  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 321 ? 15.205  61.806 50.017 1.00 21.13 ? 321  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 321 ? 16.674  63.377 48.754 1.00 21.11 ? 321  LEU A CD2 1 
ATOM   2480 N N   . GLY A 1 322 ? 15.707  65.906 52.414 1.00 26.73 ? 322  GLY A N   1 
ATOM   2481 C CA  . GLY A 1 322 ? 16.642  66.137 53.481 1.00 27.25 ? 322  GLY A CA  1 
ATOM   2482 C C   . GLY A 1 322 ? 16.000  66.015 54.831 1.00 28.42 ? 322  GLY A C   1 
ATOM   2483 O O   . GLY A 1 322 ? 14.783  65.698 54.920 1.00 26.90 ? 322  GLY A O   1 
ATOM   2484 N N   . VAL A 1 323 ? 16.807  66.278 55.877 1.00 27.14 ? 323  VAL A N   1 
ATOM   2485 C CA  . VAL A 1 323 ? 16.360  66.162 57.242 1.00 25.91 ? 323  VAL A CA  1 
ATOM   2486 C C   . VAL A 1 323 ? 16.775  67.344 58.100 1.00 28.41 ? 323  VAL A C   1 
ATOM   2487 O O   . VAL A 1 323 ? 17.594  68.167 57.690 1.00 29.04 ? 323  VAL A O   1 
ATOM   2488 C CB  . VAL A 1 323 ? 16.960  64.915 57.880 1.00 26.36 ? 323  VAL A CB  1 
ATOM   2489 C CG1 . VAL A 1 323 ? 16.566  63.651 57.106 1.00 27.71 ? 323  VAL A CG1 1 
ATOM   2490 C CG2 . VAL A 1 323 ? 18.468  65.019 57.856 1.00 26.10 ? 323  VAL A CG2 1 
ATOM   2491 N N   . ASN A 1 324 ? 16.223  67.408 59.310 1.00 27.17 ? 324  ASN A N   1 
ATOM   2492 C CA  . ASN A 1 324 ? 16.595  68.451 60.268 1.00 27.81 ? 324  ASN A CA  1 
ATOM   2493 C C   . ASN A 1 324 ? 17.545  67.841 61.326 1.00 27.96 ? 324  ASN A C   1 
ATOM   2494 O O   . ASN A 1 324 ? 17.571  66.615 61.562 1.00 27.03 ? 324  ASN A O   1 
ATOM   2495 C CB  . ASN A 1 324 ? 15.370  69.024 60.965 1.00 25.52 ? 324  ASN A CB  1 
ATOM   2496 C CG  . ASN A 1 324 ? 14.441  69.763 60.012 1.00 26.98 ? 324  ASN A CG  1 
ATOM   2497 O OD1 . ASN A 1 324 ? 14.738  69.936 58.799 1.00 27.02 ? 324  ASN A OD1 1 
ATOM   2498 N ND2 . ASN A 1 324 ? 13.289  70.206 60.550 1.00 26.13 ? 324  ASN A ND2 1 
ATOM   2499 N N   . LYS A 1 325 ? 18.314  68.705 61.972 1.00 27.88 ? 325  LYS A N   1 
ATOM   2500 C CA  . LYS A 1 325 ? 19.285  68.260 62.970 1.00 28.37 ? 325  LYS A CA  1 
ATOM   2501 C C   . LYS A 1 325 ? 18.713  67.500 64.132 1.00 27.58 ? 325  LYS A C   1 
ATOM   2502 O O   . LYS A 1 325 ? 19.320  66.522 64.559 1.00 26.47 ? 325  LYS A O   1 
ATOM   2503 C CB  . LYS A 1 325 ? 20.070  69.451 63.544 1.00 30.58 ? 325  LYS A CB  1 
ATOM   2504 C CG  . LYS A 1 325 ? 21.335  69.092 64.343 1.00 32.32 ? 325  LYS A CG  1 
ATOM   2505 C CD  . LYS A 1 325 ? 21.997  70.398 64.775 1.00 36.56 ? 325  LYS A CD  1 
ATOM   2506 C CE  . LYS A 1 325 ? 22.792  70.247 66.055 1.00 40.65 ? 325  LYS A CE  1 
ATOM   2507 N NZ  . LYS A 1 325 ? 23.547  68.991 66.087 1.00 44.43 ? 325  LYS A NZ  1 
ATOM   2508 N N   . ASP A 1 326 ? 17.560  67.924 64.651 1.00 26.79 ? 326  ASP A N   1 
ATOM   2509 C CA  . ASP A 1 326 ? 17.002  67.246 65.856 1.00 27.77 ? 326  ASP A CA  1 
ATOM   2510 C C   . ASP A 1 326 ? 15.569  66.755 65.649 1.00 29.54 ? 326  ASP A C   1 
ATOM   2511 O O   . ASP A 1 326 ? 14.606  67.232 66.294 1.00 29.81 ? 326  ASP A O   1 
ATOM   2512 C CB  . ASP A 1 326 ? 17.073  68.228 67.049 1.00 27.28 ? 326  ASP A CB  1 
ATOM   2513 C CG  . ASP A 1 326 ? 18.500  68.790 67.259 1.00 28.44 ? 326  ASP A CG  1 
ATOM   2514 O OD1 . ASP A 1 326 ? 19.377  68.041 67.753 1.00 27.28 ? 326  ASP A OD1 1 
ATOM   2515 O OD2 . ASP A 1 326 ? 18.741  69.967 66.906 1.00 27.99 ? 326  ASP A OD2 1 
ATOM   2516 N N   . GLU A 1 327 ? 15.435  65.787 64.746 1.00 29.01 ? 327  GLU A N   1 
ATOM   2517 C CA  . GLU A 1 327 ? 14.150  65.268 64.383 1.00 27.53 ? 327  GLU A CA  1 
ATOM   2518 C C   . GLU A 1 327 ? 13.438  64.659 65.594 1.00 28.16 ? 327  GLU A C   1 
ATOM   2519 O O   . GLU A 1 327 ? 12.233  64.824 65.715 1.00 28.45 ? 327  GLU A O   1 
ATOM   2520 C CB  . GLU A 1 327 ? 14.306  64.224 63.253 1.00 27.28 ? 327  GLU A CB  1 
ATOM   2521 C CG  . GLU A 1 327 ? 14.947  64.759 61.956 1.00 28.17 ? 327  GLU A CG  1 
ATOM   2522 C CD  . GLU A 1 327 ? 13.960  65.544 61.097 1.00 29.12 ? 327  GLU A CD  1 
ATOM   2523 O OE1 . GLU A 1 327 ? 12.873  65.909 61.626 1.00 31.00 ? 327  GLU A OE1 1 
ATOM   2524 O OE2 . GLU A 1 327 ? 14.258  65.799 59.907 1.00 27.79 ? 327  GLU A OE2 1 
ATOM   2525 N N   . GLY A 1 328 ? 14.158  64.031 66.519 1.00 26.92 ? 328  GLY A N   1 
ATOM   2526 C CA  . GLY A 1 328 ? 13.460  63.382 67.604 1.00 27.01 ? 328  GLY A CA  1 
ATOM   2527 C C   . GLY A 1 328 ? 12.990  64.151 68.828 1.00 28.91 ? 328  GLY A C   1 
ATOM   2528 O O   . GLY A 1 328 ? 12.158  63.646 69.607 1.00 25.54 ? 328  GLY A O   1 
ATOM   2529 N N   . SER A 1 329 ? 13.477  65.380 69.015 1.00 29.57 ? 329  SER A N   1 
ATOM   2530 C CA  . SER A 1 329 ? 13.159  66.049 70.273 1.00 28.06 ? 329  SER A CA  1 
ATOM   2531 C C   . SER A 1 329 ? 11.696  66.198 70.665 1.00 28.05 ? 329  SER A C   1 
ATOM   2532 O O   . SER A 1 329 ? 11.351  66.009 71.836 1.00 25.94 ? 329  SER A O   1 
ATOM   2533 C CB  . SER A 1 329 ? 13.847  67.430 70.355 1.00 27.69 ? 329  SER A CB  1 
ATOM   2534 O OG  . SER A 1 329 ? 13.370  68.295 69.333 1.00 25.00 ? 329  SER A OG  1 
ATOM   2535 N N   . PHE A 1 330 ? 10.807  66.508 69.735 1.00 28.74 ? 330  PHE A N   1 
ATOM   2536 C CA  . PHE A 1 330 ? 9.464   66.699 70.225 1.00 31.87 ? 330  PHE A CA  1 
ATOM   2537 C C   . PHE A 1 330 ? 8.743   65.409 70.625 1.00 30.94 ? 330  PHE A C   1 
ATOM   2538 O O   . PHE A 1 330 ? 7.870   65.423 71.509 1.00 31.22 ? 330  PHE A O   1 
ATOM   2539 C CB  . PHE A 1 330 ? 8.674   67.578 69.266 1.00 35.35 ? 330  PHE A CB  1 
ATOM   2540 C CG  . PHE A 1 330 ? 7.824   66.849 68.320 1.00 39.65 ? 330  PHE A CG  1 
ATOM   2541 C CD1 . PHE A 1 330 ? 8.177   66.740 67.016 1.00 43.08 ? 330  PHE A CD1 1 
ATOM   2542 C CD2 . PHE A 1 330 ? 6.645   66.280 68.735 1.00 42.96 ? 330  PHE A CD2 1 
ATOM   2543 C CE1 . PHE A 1 330 ? 7.352   66.057 66.131 1.00 47.13 ? 330  PHE A CE1 1 
ATOM   2544 C CE2 . PHE A 1 330 ? 5.827   65.586 67.848 1.00 44.18 ? 330  PHE A CE2 1 
ATOM   2545 C CZ  . PHE A 1 330 ? 6.168   65.472 66.568 1.00 43.93 ? 330  PHE A CZ  1 
ATOM   2546 N N   . PHE A 1 331 ? 9.118   64.286 70.027 1.00 30.56 ? 331  PHE A N   1 
ATOM   2547 C CA  . PHE A 1 331 ? 8.470   63.042 70.444 1.00 32.22 ? 331  PHE A CA  1 
ATOM   2548 C C   . PHE A 1 331 ? 8.913   62.697 71.871 1.00 30.28 ? 331  PHE A C   1 
ATOM   2549 O O   . PHE A 1 331 ? 8.142   62.152 72.623 1.00 30.43 ? 331  PHE A O   1 
ATOM   2550 C CB  . PHE A 1 331 ? 8.792   61.889 69.490 1.00 34.91 ? 331  PHE A CB  1 
ATOM   2551 C CG  . PHE A 1 331 ? 8.342   62.145 68.077 1.00 38.09 ? 331  PHE A CG  1 
ATOM   2552 C CD1 . PHE A 1 331 ? 9.061   63.058 67.255 1.00 39.82 ? 331  PHE A CD1 1 
ATOM   2553 C CD2 . PHE A 1 331 ? 7.135   61.573 67.598 1.00 37.01 ? 331  PHE A CD2 1 
ATOM   2554 C CE1 . PHE A 1 331 ? 8.593   63.435 65.949 1.00 39.30 ? 331  PHE A CE1 1 
ATOM   2555 C CE2 . PHE A 1 331 ? 6.661   61.924 66.326 1.00 39.77 ? 331  PHE A CE2 1 
ATOM   2556 C CZ  . PHE A 1 331 ? 7.392   62.868 65.485 1.00 39.52 ? 331  PHE A CZ  1 
ATOM   2557 N N   . LEU A 1 332 ? 10.134  63.045 72.266 1.00 28.58 ? 332  LEU A N   1 
ATOM   2558 C CA  . LEU A 1 332 ? 10.556  62.753 73.645 1.00 28.09 ? 332  LEU A CA  1 
ATOM   2559 C C   . LEU A 1 332 ? 9.814   63.716 74.578 1.00 28.56 ? 332  LEU A C   1 
ATOM   2560 O O   . LEU A 1 332 ? 9.337   63.331 75.640 1.00 29.10 ? 332  LEU A O   1 
ATOM   2561 C CB  . LEU A 1 332 ? 12.081  62.917 73.790 1.00 28.33 ? 332  LEU A CB  1 
ATOM   2562 C CG  . LEU A 1 332 ? 12.885  61.854 72.976 1.00 28.25 ? 332  LEU A CG  1 
ATOM   2563 C CD1 . LEU A 1 332 ? 14.333  62.437 72.628 1.00 23.31 ? 332  LEU A CD1 1 
ATOM   2564 C CD2 . LEU A 1 332 ? 12.983  60.556 73.801 1.00 24.21 ? 332  LEU A CD2 1 
ATOM   2565 N N   . LEU A 1 333 ? 9.694   64.979 74.183 1.00 28.24 ? 333  LEU A N   1 
ATOM   2566 C CA  . LEU A 1 333 ? 8.975   65.938 75.031 1.00 29.01 ? 333  LEU A CA  1 
ATOM   2567 C C   . LEU A 1 333 ? 7.599   65.376 75.390 1.00 28.42 ? 333  LEU A C   1 
ATOM   2568 O O   . LEU A 1 333 ? 7.222   65.327 76.558 1.00 27.41 ? 333  LEU A O   1 
ATOM   2569 C CB  . LEU A 1 333 ? 8.762   67.285 74.302 1.00 27.93 ? 333  LEU A CB  1 
ATOM   2570 C CG  . LEU A 1 333 ? 7.787   68.267 75.003 1.00 30.63 ? 333  LEU A CG  1 
ATOM   2571 C CD1 . LEU A 1 333 ? 8.349   68.633 76.439 1.00 26.83 ? 333  LEU A CD1 1 
ATOM   2572 C CD2 . LEU A 1 333 ? 7.591   69.591 74.111 1.00 29.86 ? 333  LEU A CD2 1 
ATOM   2573 N N   . TYR A 1 334 ? 6.861   64.943 74.365 1.00 28.58 ? 334  TYR A N   1 
ATOM   2574 C CA  . TYR A 1 334 ? 5.509   64.422 74.576 1.00 29.02 ? 334  TYR A CA  1 
ATOM   2575 C C   . TYR A 1 334 ? 5.413   63.023 75.190 1.00 29.22 ? 334  TYR A C   1 
ATOM   2576 O O   . TYR A 1 334 ? 4.471   62.764 75.920 1.00 32.15 ? 334  TYR A O   1 
ATOM   2577 C CB  . TYR A 1 334 ? 4.668   64.422 73.252 1.00 26.48 ? 334  TYR A CB  1 
ATOM   2578 C CG  . TYR A 1 334 ? 4.165   65.804 72.800 1.00 27.14 ? 334  TYR A CG  1 
ATOM   2579 C CD1 . TYR A 1 334 ? 5.054   66.793 72.354 1.00 26.72 ? 334  TYR A CD1 1 
ATOM   2580 C CD2 . TYR A 1 334 ? 2.799   66.124 72.840 1.00 26.80 ? 334  TYR A CD2 1 
ATOM   2581 C CE1 . TYR A 1 334 ? 4.603   68.049 71.955 1.00 27.27 ? 334  TYR A CE1 1 
ATOM   2582 C CE2 . TYR A 1 334 ? 2.321   67.400 72.445 1.00 25.81 ? 334  TYR A CE2 1 
ATOM   2583 C CZ  . TYR A 1 334 ? 3.219   68.341 72.003 1.00 28.12 ? 334  TYR A CZ  1 
ATOM   2584 O OH  . TYR A 1 334 ? 2.755   69.562 71.568 1.00 27.51 ? 334  TYR A OH  1 
ATOM   2585 N N   . GLY A 1 335 ? 6.360   62.133 74.949 1.00 28.33 ? 335  GLY A N   1 
ATOM   2586 C CA  . GLY A 1 335 ? 6.154   60.783 75.462 1.00 29.10 ? 335  GLY A CA  1 
ATOM   2587 C C   . GLY A 1 335 ? 7.235   60.048 76.268 1.00 30.78 ? 335  GLY A C   1 
ATOM   2588 O O   . GLY A 1 335 ? 7.031   58.885 76.583 1.00 29.92 ? 335  GLY A O   1 
ATOM   2589 N N   . ALA A 1 336 ? 8.353   60.689 76.618 1.00 28.05 ? 336  ALA A N   1 
ATOM   2590 C CA  . ALA A 1 336 ? 9.391   59.977 77.382 1.00 27.80 ? 336  ALA A CA  1 
ATOM   2591 C C   . ALA A 1 336 ? 9.618   60.609 78.760 1.00 28.27 ? 336  ALA A C   1 
ATOM   2592 O O   . ALA A 1 336 ? 9.677   61.825 78.889 1.00 27.93 ? 336  ALA A O   1 
ATOM   2593 C CB  . ALA A 1 336 ? 10.685  59.965 76.598 1.00 26.44 ? 336  ALA A CB  1 
ATOM   2594 N N   . PRO A 1 337 ? 9.725   59.795 79.821 1.00 29.74 ? 337  PRO A N   1 
ATOM   2595 C CA  . PRO A 1 337 ? 9.937   60.379 81.151 1.00 29.27 ? 337  PRO A CA  1 
ATOM   2596 C C   . PRO A 1 337 ? 11.233  61.198 81.275 1.00 31.14 ? 337  PRO A C   1 
ATOM   2597 O O   . PRO A 1 337 ? 12.307  60.806 80.748 1.00 32.21 ? 337  PRO A O   1 
ATOM   2598 C CB  . PRO A 1 337 ? 9.960   59.150 82.069 1.00 30.45 ? 337  PRO A CB  1 
ATOM   2599 C CG  . PRO A 1 337 ? 10.630  58.090 81.142 1.00 29.83 ? 337  PRO A CG  1 
ATOM   2600 C CD  . PRO A 1 337 ? 9.857   58.323 79.849 1.00 29.95 ? 337  PRO A CD  1 
ATOM   2601 N N   . GLY A 1 338 ? 11.116  62.335 81.965 1.00 31.39 ? 338  GLY A N   1 
ATOM   2602 C CA  . GLY A 1 338 ? 12.250  63.208 82.227 1.00 32.20 ? 338  GLY A CA  1 
ATOM   2603 C C   . GLY A 1 338 ? 12.393  64.442 81.354 1.00 32.75 ? 338  GLY A C   1 
ATOM   2604 O O   . GLY A 1 338 ? 13.241  65.324 81.603 1.00 31.79 ? 338  GLY A O   1 
ATOM   2605 N N   . PHE A 1 339 ? 11.591  64.483 80.301 1.00 31.87 ? 339  PHE A N   1 
ATOM   2606 C CA  . PHE A 1 339 ? 11.632  65.589 79.366 1.00 30.99 ? 339  PHE A CA  1 
ATOM   2607 C C   . PHE A 1 339 ? 10.450  66.486 79.655 1.00 31.52 ? 339  PHE A C   1 
ATOM   2608 O O   . PHE A 1 339 ? 9.344   65.982 79.868 1.00 34.17 ? 339  PHE A O   1 
ATOM   2609 C CB  . PHE A 1 339 ? 11.487  65.075 77.926 1.00 28.22 ? 339  PHE A CB  1 
ATOM   2610 C CG  . PHE A 1 339 ? 12.664  64.329 77.440 1.00 27.24 ? 339  PHE A CG  1 
ATOM   2611 C CD1 . PHE A 1 339 ? 13.649  64.992 76.711 1.00 26.19 ? 339  PHE A CD1 1 
ATOM   2612 C CD2 . PHE A 1 339 ? 12.795  62.943 77.711 1.00 24.64 ? 339  PHE A CD2 1 
ATOM   2613 C CE1 . PHE A 1 339 ? 14.775  64.294 76.231 1.00 24.20 ? 339  PHE A CE1 1 
ATOM   2614 C CE2 . PHE A 1 339 ? 13.883  62.232 77.254 1.00 27.05 ? 339  PHE A CE2 1 
ATOM   2615 C CZ  . PHE A 1 339 ? 14.883  62.882 76.516 1.00 25.80 ? 339  PHE A CZ  1 
ATOM   2616 N N   . SER A 1 340 ? 10.652  67.786 79.650 1.00 29.33 ? 340  SER A N   1 
ATOM   2617 C CA  . SER A 1 340 ? 9.528   68.690 79.859 1.00 31.58 ? 340  SER A CA  1 
ATOM   2618 C C   . SER A 1 340 ? 9.814   69.986 79.138 1.00 31.50 ? 340  SER A C   1 
ATOM   2619 O O   . SER A 1 340 ? 10.969  70.317 78.814 1.00 31.53 ? 340  SER A O   1 
ATOM   2620 C CB  . SER A 1 340 ? 9.199   68.909 81.343 1.00 32.60 ? 340  SER A CB  1 
ATOM   2621 O OG  . SER A 1 340 ? 10.365  68.982 82.118 1.00 39.05 ? 340  SER A OG  1 
ATOM   2622 N N   . LYS A 1 341 ? 8.741   70.690 78.837 1.00 30.82 ? 341  LYS A N   1 
ATOM   2623 C CA  . LYS A 1 341 ? 8.858   71.877 78.061 1.00 32.53 ? 341  LYS A CA  1 
ATOM   2624 C C   . LYS A 1 341 ? 9.639   72.996 78.701 1.00 32.55 ? 341  LYS A C   1 
ATOM   2625 O O   . LYS A 1 341 ? 10.431  73.671 78.028 1.00 31.34 ? 341  LYS A O   1 
ATOM   2626 C CB  . LYS A 1 341 ? 7.473   72.404 77.649 1.00 31.53 ? 341  LYS A CB  1 
ATOM   2627 C CG  . LYS A 1 341 ? 7.625   73.657 76.750 1.00 32.54 ? 341  LYS A CG  1 
ATOM   2628 C CD  . LYS A 1 341 ? 6.331   74.056 76.026 1.00 31.57 ? 341  LYS A CD  1 
ATOM   2629 C CE  . LYS A 1 341 ? 5.610   75.068 76.906 1.00 30.89 ? 341  LYS A CE  1 
ATOM   2630 N NZ  . LYS A 1 341 ? 6.571   76.133 77.435 1.00 33.64 ? 341  LYS A NZ  1 
ATOM   2631 N N   . ASP A 1 342 ? 9.450   73.170 79.999 1.00 31.88 ? 342  ASP A N   1 
ATOM   2632 C CA  . ASP A 1 342 ? 10.098  74.292 80.663 1.00 32.81 ? 342  ASP A CA  1 
ATOM   2633 C C   . ASP A 1 342 ? 11.401  74.017 81.422 1.00 32.84 ? 342  ASP A C   1 
ATOM   2634 O O   . ASP A 1 342 ? 11.795  74.808 82.265 1.00 30.53 ? 342  ASP A O   1 
ATOM   2635 C CB  . ASP A 1 342 ? 9.092   75.002 81.579 1.00 30.71 ? 342  ASP A CB  1 
ATOM   2636 C CG  . ASP A 1 342 ? 7.843   75.486 80.827 1.00 33.44 ? 342  ASP A CG  1 
ATOM   2637 O OD1 . ASP A 1 342 ? 7.841   75.604 79.551 1.00 29.53 ? 342  ASP A OD1 1 
ATOM   2638 O OD2 . ASP A 1 342 ? 6.851   75.765 81.541 1.00 31.87 ? 342  ASP A OD2 1 
ATOM   2639 N N   . SER A 1 343 ? 12.055  72.894 81.171 1.00 32.81 ? 343  SER A N   1 
ATOM   2640 C CA  . SER A 1 343 ? 13.342  72.715 81.843 1.00 35.33 ? 343  SER A CA  1 
ATOM   2641 C C   . SER A 1 343 ? 14.297  72.251 80.761 1.00 36.02 ? 343  SER A C   1 
ATOM   2642 O O   . SER A 1 343 ? 13.863  71.930 79.659 1.00 35.21 ? 343  SER A O   1 
ATOM   2643 C CB  . SER A 1 343 ? 13.292  71.694 82.972 1.00 35.63 ? 343  SER A CB  1 
ATOM   2644 O OG  . SER A 1 343 ? 13.358  70.405 82.474 1.00 39.71 ? 343  SER A OG  1 
ATOM   2645 N N   . GLU A 1 344 ? 15.581  72.243 81.079 1.00 34.22 ? 344  GLU A N   1 
ATOM   2646 C CA  . GLU A 1 344 ? 16.597  71.849 80.156 1.00 35.38 ? 344  GLU A CA  1 
ATOM   2647 C C   . GLU A 1 344 ? 16.535  70.363 79.849 1.00 34.00 ? 344  GLU A C   1 
ATOM   2648 O O   . GLU A 1 344 ? 17.204  69.903 78.933 1.00 33.98 ? 344  GLU A O   1 
ATOM   2649 C CB  . GLU A 1 344 ? 17.963  72.169 80.739 1.00 39.22 ? 344  GLU A CB  1 
ATOM   2650 C CG  . GLU A 1 344 ? 18.512  73.526 80.418 1.00 44.40 ? 344  GLU A CG  1 
ATOM   2651 C CD  . GLU A 1 344 ? 19.839  73.726 81.155 1.00 49.63 ? 344  GLU A CD  1 
ATOM   2652 O OE1 . GLU A 1 344 ? 20.756  72.881 80.994 1.00 50.57 ? 344  GLU A OE1 1 
ATOM   2653 O OE2 . GLU A 1 344 ? 19.945  74.720 81.916 1.00 52.20 ? 344  GLU A OE2 1 
ATOM   2654 N N   . SER A 1 345 ? 15.800  69.613 80.666 1.00 34.17 ? 345  SER A N   1 
ATOM   2655 C CA  . SER A 1 345 ? 15.591  68.173 80.465 1.00 33.26 ? 345  SER A CA  1 
ATOM   2656 C C   . SER A 1 345 ? 16.846  67.280 80.482 1.00 34.05 ? 345  SER A C   1 
ATOM   2657 O O   . SER A 1 345 ? 17.003  66.351 79.664 1.00 32.95 ? 345  SER A O   1 
ATOM   2658 C CB  . SER A 1 345 ? 14.838  67.929 79.144 1.00 32.64 ? 345  SER A CB  1 
ATOM   2659 O OG  . SER A 1 345 ? 13.513  68.420 79.168 1.00 33.88 ? 345  SER A OG  1 
ATOM   2660 N N   . LYS A 1 346 ? 17.723  67.557 81.418 1.00 34.41 ? 346  LYS A N   1 
ATOM   2661 C CA  . LYS A 1 346 ? 18.905  66.767 81.604 1.00 36.59 ? 346  LYS A CA  1 
ATOM   2662 C C   . LYS A 1 346 ? 18.284  65.460 82.051 1.00 36.36 ? 346  LYS A C   1 
ATOM   2663 O O   . LYS A 1 346 ? 17.425  65.432 82.900 1.00 36.19 ? 346  LYS A O   1 
ATOM   2664 C CB  . LYS A 1 346 ? 19.755  67.383 82.698 1.00 37.63 ? 346  LYS A CB  1 
ATOM   2665 C CG  . LYS A 1 346 ? 20.343  68.719 82.293 1.00 41.24 ? 346  LYS A CG  1 
ATOM   2666 C CD  . LYS A 1 346 ? 21.343  69.156 83.376 1.00 46.13 ? 346  LYS A CD  1 
ATOM   2667 C CE  . LYS A 1 346 ? 21.718  70.637 83.302 1.00 49.67 ? 346  LYS A CE  1 
ATOM   2668 N NZ  . LYS A 1 346 ? 22.393  70.969 84.613 1.00 51.92 ? 346  LYS A NZ  1 
ATOM   2669 N N   . ILE A 1 347 ? 18.751  64.373 81.480 1.00 36.26 ? 347  ILE A N   1 
ATOM   2670 C CA  . ILE A 1 347 ? 18.163  63.063 81.695 1.00 36.76 ? 347  ILE A CA  1 
ATOM   2671 C C   . ILE A 1 347 ? 19.057  62.133 82.533 1.00 35.77 ? 347  ILE A C   1 
ATOM   2672 O O   . ILE A 1 347 ? 20.252  62.012 82.252 1.00 34.79 ? 347  ILE A O   1 
ATOM   2673 C CB  . ILE A 1 347 ? 17.945  62.423 80.238 1.00 37.10 ? 347  ILE A CB  1 
ATOM   2674 C CG1 . ILE A 1 347 ? 16.903  63.244 79.444 1.00 39.75 ? 347  ILE A CG1 1 
ATOM   2675 C CG2 . ILE A 1 347 ? 17.553  60.960 80.319 1.00 38.88 ? 347  ILE A CG2 1 
ATOM   2676 C CD1 . ILE A 1 347 ? 15.519  63.248 80.080 1.00 36.74 ? 347  ILE A CD1 1 
ATOM   2677 N N   . SER A 1 348 ? 18.467  61.457 83.512 1.00 35.55 ? 348  SER A N   1 
ATOM   2678 C CA  . SER A 1 348 ? 19.201  60.491 84.337 1.00 37.66 ? 348  SER A CA  1 
ATOM   2679 C C   . SER A 1 348 ? 19.406  59.229 83.488 1.00 39.85 ? 348  SER A C   1 
ATOM   2680 O O   . SER A 1 348 ? 18.779  59.032 82.452 1.00 40.51 ? 348  SER A O   1 
ATOM   2681 C CB  . SER A 1 348 ? 18.412  60.106 85.591 1.00 34.64 ? 348  SER A CB  1 
ATOM   2682 O OG  . SER A 1 348 ? 17.344  59.222 85.268 1.00 34.07 ? 348  SER A OG  1 
ATOM   2683 N N   . ARG A 1 349 ? 20.303  58.387 83.945 1.00 40.33 ? 349  ARG A N   1 
ATOM   2684 C CA  . ARG A 1 349 ? 20.633  57.166 83.276 1.00 41.19 ? 349  ARG A CA  1 
ATOM   2685 C C   . ARG A 1 349 ? 19.407  56.260 83.205 1.00 41.02 ? 349  ARG A C   1 
ATOM   2686 O O   . ARG A 1 349 ? 19.231  55.559 82.229 1.00 40.75 ? 349  ARG A O   1 
ATOM   2687 C CB  . ARG A 1 349 ? 21.743  56.455 84.064 1.00 43.25 ? 349  ARG A CB  1 
ATOM   2688 C CG  . ARG A 1 349 ? 22.446  55.364 83.304 1.00 44.30 ? 349  ARG A CG  1 
ATOM   2689 C CD  . ARG A 1 349 ? 23.205  56.014 82.218 1.00 45.84 ? 349  ARG A CD  1 
ATOM   2690 N NE  . ARG A 1 349 ? 23.479  55.035 81.207 1.00 47.05 ? 349  ARG A NE  1 
ATOM   2691 C CZ  . ARG A 1 349 ? 23.630  55.317 79.923 1.00 45.14 ? 349  ARG A CZ  1 
ATOM   2692 N NH1 . ARG A 1 349 ? 23.539  56.569 79.490 1.00 45.30 ? 349  ARG A NH1 1 
ATOM   2693 N NH2 . ARG A 1 349 ? 23.849  54.326 79.076 1.00 43.86 ? 349  ARG A NH2 1 
ATOM   2694 N N   . GLU A 1 350 ? 18.577  56.247 84.245 1.00 40.31 ? 350  GLU A N   1 
ATOM   2695 C CA  . GLU A 1 350 ? 17.407  55.382 84.218 1.00 40.96 ? 350  GLU A CA  1 
ATOM   2696 C C   . GLU A 1 350 ? 16.376  55.883 83.195 1.00 40.20 ? 350  GLU A C   1 
ATOM   2697 O O   . GLU A 1 350 ? 15.753  55.070 82.501 1.00 40.18 ? 350  GLU A O   1 
ATOM   2698 C CB  . GLU A 1 350 ? 16.745  55.273 85.602 1.00 43.32 ? 350  GLU A CB  1 
ATOM   2699 C CG  . GLU A 1 350 ? 17.643  54.680 86.702 1.00 49.01 ? 350  GLU A CG  1 
ATOM   2700 C CD  . GLU A 1 350 ? 18.338  55.771 87.549 1.00 51.79 ? 350  GLU A CD  1 
ATOM   2701 O OE2 . GLU A 1 350 ? 19.310  56.401 87.046 1.00 53.63 ? 350  GLU A OE2 1 
ATOM   2702 N N   . ASP A 1 351 ? 16.182  57.204 83.112 1.00 38.55 ? 351  ASP A N   1 
ATOM   2703 C CA  . ASP A 1 351 ? 15.237  57.759 82.134 1.00 38.01 ? 351  ASP A CA  1 
ATOM   2704 C C   . ASP A 1 351 ? 15.773  57.527 80.713 1.00 35.63 ? 351  ASP A C   1 
ATOM   2705 O O   . ASP A 1 351 ? 15.003  57.376 79.775 1.00 34.65 ? 351  ASP A O   1 
ATOM   2706 C CB  . ASP A 1 351 ? 14.995  59.265 82.353 1.00 38.77 ? 351  ASP A CB  1 
ATOM   2707 C CG  . ASP A 1 351 ? 14.028  59.553 83.506 1.00 39.53 ? 351  ASP A CG  1 
ATOM   2708 O OD1 . ASP A 1 351 ? 13.309  58.652 83.961 1.00 39.11 ? 351  ASP A OD1 1 
ATOM   2709 O OD2 . ASP A 1 351 ? 13.983  60.714 83.947 1.00 41.74 ? 351  ASP A OD2 1 
ATOM   2710 N N   . PHE A 1 352 ? 17.091  57.494 80.572 1.00 34.52 ? 352  PHE A N   1 
ATOM   2711 C CA  . PHE A 1 352 ? 17.720  57.246 79.281 1.00 34.05 ? 352  PHE A CA  1 
ATOM   2712 C C   . PHE A 1 352 ? 17.308  55.859 78.878 1.00 35.28 ? 352  PHE A C   1 
ATOM   2713 O O   . PHE A 1 352 ? 16.845  55.627 77.765 1.00 34.82 ? 352  PHE A O   1 
ATOM   2714 C CB  . PHE A 1 352 ? 19.241  57.242 79.405 1.00 33.26 ? 352  PHE A CB  1 
ATOM   2715 C CG  . PHE A 1 352 ? 19.946  56.969 78.126 1.00 31.63 ? 352  PHE A CG  1 
ATOM   2716 C CD1 . PHE A 1 352 ? 20.094  57.973 77.179 1.00 28.80 ? 352  PHE A CD1 1 
ATOM   2717 C CD2 . PHE A 1 352 ? 20.439  55.682 77.851 1.00 31.77 ? 352  PHE A CD2 1 
ATOM   2718 C CE1 . PHE A 1 352 ? 20.723  57.708 75.972 1.00 28.33 ? 352  PHE A CE1 1 
ATOM   2719 C CE2 . PHE A 1 352 ? 21.061  55.408 76.671 1.00 30.15 ? 352  PHE A CE2 1 
ATOM   2720 C CZ  . PHE A 1 352 ? 21.206  56.434 75.713 1.00 31.40 ? 352  PHE A CZ  1 
ATOM   2721 N N   . MET A 1 353 ? 17.489  54.919 79.801 1.00 36.50 ? 353  MET A N   1 
ATOM   2722 C CA  . MET A 1 353 ? 17.138  53.534 79.508 1.00 38.94 ? 353  MET A CA  1 
ATOM   2723 C C   . MET A 1 353 ? 15.645  53.409 79.241 1.00 37.08 ? 353  MET A C   1 
ATOM   2724 O O   . MET A 1 353 ? 15.243  52.672 78.332 1.00 35.75 ? 353  MET A O   1 
ATOM   2725 C CB  . MET A 1 353 ? 17.630  52.599 80.629 1.00 42.42 ? 353  MET A CB  1 
ATOM   2726 C CG  . MET A 1 353 ? 19.184  52.373 80.557 1.00 47.72 ? 353  MET A CG  1 
ATOM   2727 S SD  . MET A 1 353 ? 19.780  51.308 81.933 1.00 57.41 ? 353  MET A SD  1 
ATOM   2728 C CE  . MET A 1 353 ? 19.733  52.452 83.327 1.00 53.36 ? 353  MET A CE  1 
ATOM   2729 N N   . SER A 1 354 ? 14.829  54.126 80.006 1.00 34.51 ? 354  SER A N   1 
ATOM   2730 C CA  . SER A 1 354 ? 13.383  54.105 79.749 1.00 34.87 ? 354  SER A CA  1 
ATOM   2731 C C   . SER A 1 354 ? 13.116  54.689 78.334 1.00 34.63 ? 354  SER A C   1 
ATOM   2732 O O   . SER A 1 354 ? 12.254  54.191 77.585 1.00 35.49 ? 354  SER A O   1 
ATOM   2733 C CB  . SER A 1 354 ? 12.652  54.952 80.773 1.00 34.24 ? 354  SER A CB  1 
ATOM   2734 O OG  . SER A 1 354 ? 12.326  54.152 81.883 1.00 39.82 ? 354  SER A OG  1 
ATOM   2735 N N   . GLY A 1 355 ? 13.886  55.723 77.984 1.00 32.61 ? 355  GLY A N   1 
ATOM   2736 C CA  . GLY A 1 355 ? 13.782  56.351 76.683 1.00 30.88 ? 355  GLY A CA  1 
ATOM   2737 C C   . GLY A 1 355 ? 14.160  55.369 75.573 1.00 31.12 ? 355  GLY A C   1 
ATOM   2738 O O   . GLY A 1 355 ? 13.449  55.284 74.555 1.00 30.63 ? 355  GLY A O   1 
ATOM   2739 N N   . VAL A 1 356 ? 15.228  54.586 75.733 1.00 29.85 ? 356  VAL A N   1 
ATOM   2740 C CA  . VAL A 1 356 ? 15.508  53.719 74.603 1.00 31.73 ? 356  VAL A CA  1 
ATOM   2741 C C   . VAL A 1 356 ? 14.510  52.612 74.382 1.00 31.02 ? 356  VAL A C   1 
ATOM   2742 O O   . VAL A 1 356 ? 14.257  52.257 73.231 1.00 28.60 ? 356  VAL A O   1 
ATOM   2743 C CB  . VAL A 1 356 ? 17.020  53.159 74.505 1.00 33.40 ? 356  VAL A CB  1 
ATOM   2744 C CG1 . VAL A 1 356 ? 17.944  53.840 75.467 1.00 31.56 ? 356  VAL A CG1 1 
ATOM   2745 C CG2 . VAL A 1 356 ? 17.043  51.686 74.527 1.00 32.67 ? 356  VAL A CG2 1 
ATOM   2746 N N   . LYS A 1 357 ? 13.906  52.099 75.457 1.00 32.71 ? 357  LYS A N   1 
ATOM   2747 C CA  . LYS A 1 357 ? 12.871  51.046 75.331 1.00 34.14 ? 357  LYS A CA  1 
ATOM   2748 C C   . LYS A 1 357 ? 11.647  51.601 74.526 1.00 33.81 ? 357  LYS A C   1 
ATOM   2749 O O   . LYS A 1 357 ? 11.109  50.946 73.634 1.00 33.83 ? 357  LYS A O   1 
ATOM   2750 C CB  . LYS A 1 357 ? 12.419  50.582 76.737 1.00 35.79 ? 357  LYS A CB  1 
ATOM   2751 C CG  . LYS A 1 357 ? 11.320  49.527 76.687 1.00 41.13 ? 357  LYS A CG  1 
ATOM   2752 C CD  . LYS A 1 357 ? 11.849  48.228 76.025 1.00 43.88 ? 357  LYS A CD  1 
ATOM   2753 C CE  . LYS A 1 357 ? 10.757  47.233 75.546 1.00 46.54 ? 357  LYS A CE  1 
ATOM   2754 N NZ  . LYS A 1 357 ? 11.345  46.166 74.581 1.00 47.82 ? 357  LYS A NZ  1 
ATOM   2755 N N   . LEU A 1 358 ? 11.243  52.828 74.838 1.00 32.65 ? 358  LEU A N   1 
ATOM   2756 C CA  . LEU A 1 358 ? 10.141  53.480 74.147 1.00 32.51 ? 358  LEU A CA  1 
ATOM   2757 C C   . LEU A 1 358 ? 10.482  53.714 72.662 1.00 33.81 ? 358  LEU A C   1 
ATOM   2758 O O   . LEU A 1 358 ? 9.596   53.652 71.801 1.00 33.03 ? 358  LEU A O   1 
ATOM   2759 C CB  . LEU A 1 358 ? 9.911   54.833 74.781 1.00 32.87 ? 358  LEU A CB  1 
ATOM   2760 C CG  . LEU A 1 358 ? 8.754   55.197 75.712 1.00 36.03 ? 358  LEU A CG  1 
ATOM   2761 C CD1 . LEU A 1 358 ? 7.956   54.003 76.201 1.00 33.93 ? 358  LEU A CD1 1 
ATOM   2762 C CD2 . LEU A 1 358 ? 9.318   56.098 76.781 1.00 31.01 ? 358  LEU A CD2 1 
ATOM   2763 N N   . SER A 1 359 ? 11.758  54.015 72.376 1.00 32.04 ? 359  SER A N   1 
ATOM   2764 C CA  . SER A 1 359 ? 12.164  54.330 71.011 1.00 31.14 ? 359  SER A CA  1 
ATOM   2765 C C   . SER A 1 359 ? 12.302  53.197 70.064 1.00 30.84 ? 359  SER A C   1 
ATOM   2766 O O   . SER A 1 359 ? 12.140  53.387 68.870 1.00 31.88 ? 359  SER A O   1 
ATOM   2767 C CB  . SER A 1 359 ? 13.480  55.093 70.979 1.00 31.60 ? 359  SER A CB  1 
ATOM   2768 O OG  . SER A 1 359 ? 13.435  56.241 71.775 1.00 29.11 ? 359  SER A OG  1 
ATOM   2769 N N   . VAL A 1 360 ? 12.615  52.021 70.563 1.00 29.83 ? 360  VAL A N   1 
ATOM   2770 C CA  . VAL A 1 360 ? 12.803  50.906 69.672 1.00 32.30 ? 360  VAL A CA  1 
ATOM   2771 C C   . VAL A 1 360 ? 11.880  49.880 70.275 1.00 34.08 ? 360  VAL A C   1 
ATOM   2772 O O   . VAL A 1 360 ? 12.325  48.840 70.765 1.00 31.68 ? 360  VAL A O   1 
ATOM   2773 C CB  . VAL A 1 360 ? 14.262  50.432 69.757 1.00 33.23 ? 360  VAL A CB  1 
ATOM   2774 C CG1 . VAL A 1 360 ? 14.587  49.507 68.612 1.00 33.71 ? 360  VAL A CG1 1 
ATOM   2775 C CG2 . VAL A 1 360 ? 15.166  51.631 69.770 1.00 34.59 ? 360  VAL A CG2 1 
ATOM   2776 N N   . PRO A 1 361 ? 10.560  50.153 70.213 1.00 36.44 ? 361  PRO A N   1 
ATOM   2777 C CA  . PRO A 1 361 ? 9.527   49.274 70.786 1.00 38.04 ? 361  PRO A CA  1 
ATOM   2778 C C   . PRO A 1 361 ? 9.596   47.824 70.331 1.00 39.69 ? 361  PRO A C   1 
ATOM   2779 O O   . PRO A 1 361 ? 9.335   46.915 71.082 1.00 41.23 ? 361  PRO A O   1 
ATOM   2780 C CB  . PRO A 1 361 ? 8.238   50.007 70.408 1.00 37.43 ? 361  PRO A CB  1 
ATOM   2781 C CG  . PRO A 1 361 ? 8.566   50.512 69.032 1.00 35.28 ? 361  PRO A CG  1 
ATOM   2782 C CD  . PRO A 1 361 ? 9.975   51.057 69.202 1.00 35.08 ? 361  PRO A CD  1 
ATOM   2783 N N   . HIS A 1 362 ? 10.012  47.623 69.099 1.00 43.70 ? 362  HIS A N   1 
ATOM   2784 C CA  . HIS A 1 362 ? 10.147  46.294 68.527 1.00 47.24 ? 362  HIS A CA  1 
ATOM   2785 C C   . HIS A 1 362 ? 11.453  45.535 68.871 1.00 48.13 ? 362  HIS A C   1 
ATOM   2786 O O   . HIS A 1 362 ? 11.755  44.528 68.202 1.00 48.44 ? 362  HIS A O   1 
ATOM   2787 C CB  . HIS A 1 362 ? 10.060  46.397 67.003 1.00 49.71 ? 362  HIS A CB  1 
ATOM   2788 C CG  . HIS A 1 362 ? 11.144  47.247 66.392 1.00 52.77 ? 362  HIS A CG  1 
ATOM   2789 N ND1 . HIS A 1 362 ? 11.176  48.624 66.519 1.00 52.20 ? 362  HIS A ND1 1 
ATOM   2790 C CD2 . HIS A 1 362 ? 12.209  46.914 65.614 1.00 51.90 ? 362  HIS A CD2 1 
ATOM   2791 C CE1 . HIS A 1 362 ? 12.211  49.099 65.842 1.00 52.89 ? 362  HIS A CE1 1 
ATOM   2792 N NE2 . HIS A 1 362 ? 12.851  48.085 65.281 1.00 52.23 ? 362  HIS A NE2 1 
ATOM   2793 N N   . ALA A 1 363 ? 12.202  45.958 69.901 1.00 47.10 ? 363  ALA A N   1 
ATOM   2794 C CA  . ALA A 1 363 ? 13.476  45.280 70.180 1.00 45.61 ? 363  ALA A CA  1 
ATOM   2795 C C   . ALA A 1 363 ? 13.578  44.364 71.381 1.00 44.53 ? 363  ALA A C   1 
ATOM   2796 O O   . ALA A 1 363 ? 13.010  44.640 72.427 1.00 45.96 ? 363  ALA A O   1 
ATOM   2797 C CB  . ALA A 1 363 ? 14.596  46.314 70.270 1.00 43.63 ? 363  ALA A CB  1 
ATOM   2798 N N   . ASN A 1 364 ? 14.327  43.266 71.227 1.00 43.19 ? 364  ASN A N   1 
ATOM   2799 C CA  . ASN A 1 364 ? 14.568  42.376 72.362 1.00 41.09 ? 364  ASN A CA  1 
ATOM   2800 C C   . ASN A 1 364 ? 15.679  43.031 73.188 1.00 40.32 ? 364  ASN A C   1 
ATOM   2801 O O   . ASN A 1 364 ? 16.188  44.132 72.823 1.00 38.36 ? 364  ASN A O   1 
ATOM   2802 C CB  . ASN A 1 364 ? 15.003  40.970 71.925 1.00 40.77 ? 364  ASN A CB  1 
ATOM   2803 C CG  . ASN A 1 364 ? 16.217  40.983 71.001 1.00 42.47 ? 364  ASN A CG  1 
ATOM   2804 O OD1 . ASN A 1 364 ? 17.033  41.919 71.001 1.00 42.90 ? 364  ASN A OD1 1 
ATOM   2805 N ND2 . ASN A 1 364 ? 16.338  39.944 70.210 1.00 41.09 ? 364  ASN A ND2 1 
ATOM   2806 N N   . ASP A 1 365 ? 16.031  42.375 74.297 1.00 39.05 ? 365  ASP A N   1 
ATOM   2807 C CA  . ASP A 1 365 ? 17.043  42.860 75.208 1.00 40.91 ? 365  ASP A CA  1 
ATOM   2808 C C   . ASP A 1 365 ? 18.409  43.116 74.592 1.00 39.91 ? 365  ASP A C   1 
ATOM   2809 O O   . ASP A 1 365 ? 19.054  44.117 74.897 1.00 39.40 ? 365  ASP A O   1 
ATOM   2810 C CB  . ASP A 1 365 ? 17.190  41.902 76.376 1.00 46.95 ? 365  ASP A CB  1 
ATOM   2811 C CG  . ASP A 1 365 ? 16.220  42.218 77.493 1.00 53.15 ? 365  ASP A CG  1 
ATOM   2812 O OD1 . ASP A 1 365 ? 15.249  42.995 77.220 1.00 56.36 ? 365  ASP A OD1 1 
ATOM   2813 O OD2 . ASP A 1 365 ? 16.414  41.698 78.629 1.00 56.20 ? 365  ASP A OD2 1 
ATOM   2814 N N   . LEU A 1 366 ? 18.847  42.198 73.738 1.00 38.06 ? 366  LEU A N   1 
ATOM   2815 C CA  . LEU A 1 366 ? 20.110  42.331 73.061 1.00 37.21 ? 366  LEU A CA  1 
ATOM   2816 C C   . LEU A 1 366 ? 20.073  43.634 72.213 1.00 36.65 ? 366  LEU A C   1 
ATOM   2817 O O   . LEU A 1 366 ? 21.015  44.421 72.231 1.00 36.94 ? 366  LEU A O   1 
ATOM   2818 C CB  . LEU A 1 366 ? 20.332  41.120 72.162 1.00 35.89 ? 366  LEU A CB  1 
ATOM   2819 C CG  . LEU A 1 366 ? 21.759  41.083 71.607 1.00 39.23 ? 366  LEU A CG  1 
ATOM   2820 C CD1 . LEU A 1 366 ? 22.781  40.998 72.787 1.00 36.68 ? 366  LEU A CD1 1 
ATOM   2821 C CD2 . LEU A 1 366 ? 21.898  39.899 70.645 1.00 36.71 ? 366  LEU A CD2 1 
ATOM   2822 N N   . GLY A 1 367 ? 18.973  43.836 71.477 1.00 34.77 ? 367  GLY A N   1 
ATOM   2823 C CA  . GLY A 1 367 ? 18.810  45.019 70.649 1.00 32.15 ? 367  GLY A CA  1 
ATOM   2824 C C   . GLY A 1 367 ? 18.844  46.296 71.478 1.00 29.91 ? 367  GLY A C   1 
ATOM   2825 O O   . GLY A 1 367 ? 19.494  47.270 71.089 1.00 30.07 ? 367  GLY A O   1 
ATOM   2826 N N   . LEU A 1 368 ? 18.165  46.293 72.616 1.00 28.73 ? 368  LEU A N   1 
ATOM   2827 C CA  . LEU A 1 368 ? 18.181  47.467 73.482 1.00 31.40 ? 368  LEU A CA  1 
ATOM   2828 C C   . LEU A 1 368 ? 19.605  47.736 73.977 1.00 32.18 ? 368  LEU A C   1 
ATOM   2829 O O   . LEU A 1 368 ? 20.021  48.915 74.067 1.00 31.30 ? 368  LEU A O   1 
ATOM   2830 C CB  . LEU A 1 368 ? 17.235  47.297 74.678 1.00 30.16 ? 368  LEU A CB  1 
ATOM   2831 C CG  . LEU A 1 368 ? 15.774  47.064 74.261 1.00 31.31 ? 368  LEU A CG  1 
ATOM   2832 C CD1 . LEU A 1 368 ? 14.958  46.829 75.515 1.00 30.40 ? 368  LEU A CD1 1 
ATOM   2833 C CD2 . LEU A 1 368 ? 15.227  48.281 73.476 1.00 30.96 ? 368  LEU A CD2 1 
ATOM   2834 N N   . ASP A 1 369 ? 20.347  46.660 74.303 1.00 31.66 ? 369  ASP A N   1 
ATOM   2835 C CA  . ASP A 1 369 ? 21.745  46.829 74.724 1.00 32.40 ? 369  ASP A CA  1 
ATOM   2836 C C   . ASP A 1 369 ? 22.581  47.397 73.570 1.00 29.86 ? 369  ASP A C   1 
ATOM   2837 O O   . ASP A 1 369 ? 23.436  48.242 73.783 1.00 29.23 ? 369  ASP A O   1 
ATOM   2838 C CB  . ASP A 1 369 ? 22.404  45.501 75.138 1.00 35.06 ? 369  ASP A CB  1 
ATOM   2839 C CG  . ASP A 1 369 ? 21.921  45.021 76.464 1.00 39.98 ? 369  ASP A CG  1 
ATOM   2840 O OD1 . ASP A 1 369 ? 21.380  45.870 77.224 1.00 42.27 ? 369  ASP A OD1 1 
ATOM   2841 O OD2 . ASP A 1 369 ? 22.088  43.816 76.746 1.00 41.53 ? 369  ASP A OD2 1 
ATOM   2842 N N   . ALA A 1 370 ? 22.352  46.924 72.353 1.00 28.41 ? 370  ALA A N   1 
ATOM   2843 C CA  . ALA A 1 370 ? 23.162  47.433 71.248 1.00 27.90 ? 370  ALA A CA  1 
ATOM   2844 C C   . ALA A 1 370 ? 22.907  48.923 71.046 1.00 27.99 ? 370  ALA A C   1 
ATOM   2845 O O   . ALA A 1 370 ? 23.855  49.678 70.853 1.00 29.35 ? 370  ALA A O   1 
ATOM   2846 C CB  . ALA A 1 370 ? 22.874  46.646 69.934 1.00 24.77 ? 370  ALA A CB  1 
ATOM   2847 N N   . VAL A 1 371 ? 21.650  49.369 71.113 1.00 28.30 ? 371  VAL A N   1 
ATOM   2848 C CA  . VAL A 1 371 ? 21.346  50.801 70.921 1.00 27.91 ? 371  VAL A CA  1 
ATOM   2849 C C   . VAL A 1 371 ? 21.996  51.628 72.049 1.00 30.58 ? 371  VAL A C   1 
ATOM   2850 O O   . VAL A 1 371 ? 22.646  52.658 71.795 1.00 29.02 ? 371  VAL A O   1 
ATOM   2851 C CB  . VAL A 1 371 ? 19.784  51.080 70.942 1.00 28.84 ? 371  VAL A CB  1 
ATOM   2852 C CG1 . VAL A 1 371 ? 19.506  52.600 71.008 1.00 26.00 ? 371  VAL A CG1 1 
ATOM   2853 C CG2 . VAL A 1 371 ? 19.100  50.411 69.692 1.00 26.60 ? 371  VAL A CG2 1 
ATOM   2854 N N   . THR A 1 372 ? 21.823  51.151 73.285 1.00 31.74 ? 372  THR A N   1 
ATOM   2855 C CA  . THR A 1 372 ? 22.358  51.821 74.469 1.00 33.17 ? 372  THR A CA  1 
ATOM   2856 C C   . THR A 1 372 ? 23.880  51.946 74.386 1.00 34.78 ? 372  THR A C   1 
ATOM   2857 O O   . THR A 1 372 ? 24.430  53.009 74.644 1.00 34.77 ? 372  THR A O   1 
ATOM   2858 C CB  . THR A 1 372 ? 21.979  51.054 75.760 1.00 34.61 ? 372  THR A CB  1 
ATOM   2859 O OG1 . THR A 1 372 ? 20.545  51.040 75.891 1.00 35.96 ? 372  THR A OG1 1 
ATOM   2860 C CG2 . THR A 1 372 ? 22.619  51.706 77.002 1.00 33.50 ? 372  THR A CG2 1 
ATOM   2861 N N   . LEU A 1 373 ? 24.565  50.868 74.027 1.00 34.19 ? 373  LEU A N   1 
ATOM   2862 C CA  . LEU A 1 373 ? 26.018  50.944 73.874 1.00 34.55 ? 373  LEU A CA  1 
ATOM   2863 C C   . LEU A 1 373 ? 26.411  51.933 72.770 1.00 35.52 ? 373  LEU A C   1 
ATOM   2864 O O   . LEU A 1 373 ? 27.361  52.695 72.912 1.00 35.74 ? 373  LEU A O   1 
ATOM   2865 C CB  . LEU A 1 373 ? 26.559  49.577 73.478 1.00 37.64 ? 373  LEU A CB  1 
ATOM   2866 C CG  . LEU A 1 373 ? 27.999  49.556 72.988 1.00 39.86 ? 373  LEU A CG  1 
ATOM   2867 C CD1 . LEU A 1 373 ? 28.914  49.667 74.193 1.00 42.27 ? 373  LEU A CD1 1 
ATOM   2868 C CD2 . LEU A 1 373 ? 28.276  48.256 72.242 1.00 42.78 ? 373  LEU A CD2 1 
ATOM   2869 N N   . GLN A 1 374 ? 25.682  51.917 71.655 1.00 34.78 ? 374  GLN A N   1 
ATOM   2870 C CA  . GLN A 1 374 ? 26.010  52.797 70.526 1.00 34.68 ? 374  GLN A CA  1 
ATOM   2871 C C   . GLN A 1 374 ? 25.846  54.285 70.832 1.00 33.90 ? 374  GLN A C   1 
ATOM   2872 O O   . GLN A 1 374 ? 26.487  55.105 70.220 1.00 34.65 ? 374  GLN A O   1 
ATOM   2873 C CB  . GLN A 1 374 ? 25.116  52.452 69.339 1.00 35.14 ? 374  GLN A CB  1 
ATOM   2874 C CG  . GLN A 1 374 ? 25.500  53.074 68.062 1.00 38.31 ? 374  GLN A CG  1 
ATOM   2875 C CD  . GLN A 1 374 ? 26.649  52.329 67.373 1.00 40.60 ? 374  GLN A CD  1 
ATOM   2876 O OE1 . GLN A 1 374 ? 27.093  52.746 66.305 1.00 44.18 ? 374  GLN A OE1 1 
ATOM   2877 N NE2 . GLN A 1 374 ? 27.126  51.236 67.975 1.00 39.66 ? 374  GLN A NE2 1 
ATOM   2878 N N   . TYR A 1 375 ? 24.986  54.632 71.768 1.00 32.64 ? 375  TYR A N   1 
ATOM   2879 C CA  . TYR A 1 375 ? 24.753  56.037 72.037 1.00 33.93 ? 375  TYR A CA  1 
ATOM   2880 C C   . TYR A 1 375 ? 25.213  56.526 73.421 1.00 35.16 ? 375  TYR A C   1 
ATOM   2881 O O   . TYR A 1 375 ? 24.932  57.661 73.820 1.00 37.19 ? 375  TYR A O   1 
ATOM   2882 C CB  . TYR A 1 375 ? 23.245  56.339 71.818 1.00 31.51 ? 375  TYR A CB  1 
ATOM   2883 C CG  . TYR A 1 375 ? 22.878  56.453 70.351 1.00 29.40 ? 375  TYR A CG  1 
ATOM   2884 C CD1 . TYR A 1 375 ? 22.957  57.682 69.695 1.00 28.49 ? 375  TYR A CD1 1 
ATOM   2885 C CD2 . TYR A 1 375 ? 22.470  55.329 69.610 1.00 28.36 ? 375  TYR A CD2 1 
ATOM   2886 C CE1 . TYR A 1 375 ? 22.631  57.811 68.314 1.00 29.50 ? 375  TYR A CE1 1 
ATOM   2887 C CE2 . TYR A 1 375 ? 22.157  55.440 68.239 1.00 27.69 ? 375  TYR A CE2 1 
ATOM   2888 C CZ  . TYR A 1 375 ? 22.238  56.683 67.604 1.00 29.21 ? 375  TYR A CZ  1 
ATOM   2889 O OH  . TYR A 1 375 ? 21.933  56.819 66.265 1.00 31.48 ? 375  TYR A OH  1 
ATOM   2890 N N   . THR A 1 376 ? 25.928  55.691 74.157 1.00 34.56 ? 376  THR A N   1 
ATOM   2891 C CA  . THR A 1 376 ? 26.381  56.100 75.488 1.00 32.88 ? 376  THR A CA  1 
ATOM   2892 C C   . THR A 1 376 ? 27.871  56.416 75.469 1.00 32.65 ? 376  THR A C   1 
ATOM   2893 O O   . THR A 1 376 ? 28.670  55.661 74.911 1.00 32.16 ? 376  THR A O   1 
ATOM   2894 C CB  . THR A 1 376 ? 26.172  54.939 76.523 1.00 32.70 ? 376  THR A CB  1 
ATOM   2895 O OG1 . THR A 1 376 ? 24.787  54.689 76.684 1.00 30.23 ? 376  THR A OG1 1 
ATOM   2896 C CG2 . THR A 1 376 ? 26.785  55.265 77.888 1.00 31.08 ? 376  THR A CG2 1 
ATOM   2897 N N   . ASP A 1 377 ? 28.237  57.524 76.084 1.00 32.38 ? 377  ASP A N   1 
ATOM   2898 C CA  . ASP A 1 377 ? 29.639  57.898 76.239 1.00 34.00 ? 377  ASP A CA  1 
ATOM   2899 C C   . ASP A 1 377 ? 30.000  57.225 77.585 1.00 35.13 ? 377  ASP A C   1 
ATOM   2900 O O   . ASP A 1 377 ? 29.609  57.755 78.664 1.00 33.62 ? 377  ASP A O   1 
ATOM   2901 C CB  . ASP A 1 377 ? 29.768  59.396 76.430 1.00 35.30 ? 377  ASP A CB  1 
ATOM   2902 C CG  . ASP A 1 377 ? 31.209  59.825 76.655 1.00 39.21 ? 377  ASP A CG  1 
ATOM   2903 O OD1 . ASP A 1 377 ? 32.045  58.957 77.040 1.00 37.56 ? 377  ASP A OD1 1 
ATOM   2904 O OD2 . ASP A 1 377 ? 31.493  61.036 76.457 1.00 40.17 ? 377  ASP A OD2 1 
ATOM   2905 N N   . TRP A 1 378 ? 30.708  56.091 77.550 1.00 33.89 ? 378  TRP A N   1 
ATOM   2906 C CA  . TRP A 1 378 ? 31.008  55.390 78.808 1.00 37.58 ? 378  TRP A CA  1 
ATOM   2907 C C   . TRP A 1 378 ? 32.053  56.006 79.722 1.00 38.66 ? 378  TRP A C   1 
ATOM   2908 O O   . TRP A 1 378 ? 32.339  55.464 80.796 1.00 38.32 ? 378  TRP A O   1 
ATOM   2909 C CB  . TRP A 1 378 ? 31.341  53.888 78.606 1.00 37.29 ? 378  TRP A CB  1 
ATOM   2910 C CG  . TRP A 1 378 ? 30.192  53.120 78.040 1.00 40.09 ? 378  TRP A CG  1 
ATOM   2911 C CD1 . TRP A 1 378 ? 30.038  52.746 76.736 1.00 39.69 ? 378  TRP A CD1 1 
ATOM   2912 C CD2 . TRP A 1 378 ? 28.959  52.772 78.705 1.00 39.54 ? 378  TRP A CD2 1 
ATOM   2913 N NE1 . TRP A 1 378 ? 28.800  52.203 76.551 1.00 42.68 ? 378  TRP A NE1 1 
ATOM   2914 C CE2 . TRP A 1 378 ? 28.110  52.212 77.734 1.00 39.48 ? 378  TRP A CE2 1 
ATOM   2915 C CE3 . TRP A 1 378 ? 28.497  52.897 80.016 1.00 40.31 ? 378  TRP A CE3 1 
ATOM   2916 C CZ2 . TRP A 1 378 ? 26.802  51.774 78.021 1.00 42.14 ? 378  TRP A CZ2 1 
ATOM   2917 C CZ3 . TRP A 1 378 ? 27.174  52.459 80.322 1.00 41.13 ? 378  TRP A CZ3 1 
ATOM   2918 C CH2 . TRP A 1 378 ? 26.353  51.912 79.327 1.00 40.89 ? 378  TRP A CH2 1 
ATOM   2919 N N   . MET A 1 379 ? 32.671  57.098 79.321 1.00 40.66 ? 379  MET A N   1 
ATOM   2920 C CA  . MET A 1 379 ? 33.546  57.688 80.305 1.00 43.82 ? 379  MET A CA  1 
ATOM   2921 C C   . MET A 1 379 ? 32.819  58.856 80.970 1.00 44.30 ? 379  MET A C   1 
ATOM   2922 O O   . MET A 1 379 ? 33.372  59.542 81.819 1.00 44.45 ? 379  MET A O   1 
ATOM   2923 C CB  . MET A 1 379 ? 34.907  58.096 79.729 1.00 47.28 ? 379  MET A CB  1 
ATOM   2924 C CG  . MET A 1 379 ? 34.950  58.982 78.564 1.00 51.73 ? 379  MET A CG  1 
ATOM   2925 S SD  . MET A 1 379 ? 36.631  58.714 77.801 1.00 58.64 ? 379  MET A SD  1 
ATOM   2926 C CE  . MET A 1 379 ? 37.642  58.432 79.412 1.00 55.81 ? 379  MET A CE  1 
ATOM   2927 N N   . ASP A 1 380 ? 31.545  59.049 80.637 1.00 43.04 ? 380  ASP A N   1 
ATOM   2928 C CA  . ASP A 1 380 ? 30.792  60.149 81.245 1.00 42.45 ? 380  ASP A CA  1 
ATOM   2929 C C   . ASP A 1 380 ? 29.302  59.805 81.178 1.00 42.69 ? 380  ASP A C   1 
ATOM   2930 O O   . ASP A 1 380 ? 28.501  60.606 80.754 1.00 41.86 ? 380  ASP A O   1 
ATOM   2931 C CB  . ASP A 1 380 ? 31.103  61.440 80.473 1.00 41.97 ? 380  ASP A CB  1 
ATOM   2932 C CG  . ASP A 1 380 ? 30.589  62.697 81.179 1.00 43.16 ? 380  ASP A CG  1 
ATOM   2933 O OD1 . ASP A 1 380 ? 30.146  62.614 82.357 1.00 42.98 ? 380  ASP A OD1 1 
ATOM   2934 O OD2 . ASP A 1 380 ? 30.624  63.771 80.537 1.00 43.66 ? 380  ASP A OD2 1 
ATOM   2935 N N   . ASP A 1 381 ? 28.945  58.609 81.641 1.00 43.87 ? 381  ASP A N   1 
ATOM   2936 C CA  . ASP A 1 381 ? 27.578  58.117 81.531 1.00 44.91 ? 381  ASP A CA  1 
ATOM   2937 C C   . ASP A 1 381 ? 26.472  58.786 82.339 1.00 45.27 ? 381  ASP A C   1 
ATOM   2938 O O   . ASP A 1 381 ? 25.282  58.542 82.072 1.00 43.59 ? 381  ASP A O   1 
ATOM   2939 C CB  . ASP A 1 381 ? 27.554  56.598 81.764 1.00 46.19 ? 381  ASP A CB  1 
ATOM   2940 C CG  . ASP A 1 381 ? 28.126  56.211 83.111 1.00 50.01 ? 381  ASP A CG  1 
ATOM   2941 O OD1 . ASP A 1 381 ? 29.318  56.520 83.398 1.00 49.89 ? 381  ASP A OD1 1 
ATOM   2942 O OD2 . ASP A 1 381 ? 27.363  55.595 83.883 1.00 51.97 ? 381  ASP A OD2 1 
ATOM   2943 N N   . ASN A 1 382 ? 26.842  59.604 83.323 1.00 44.60 ? 382  ASN A N   1 
ATOM   2944 C CA  . ASN A 1 382 ? 25.829  60.311 84.107 1.00 45.52 ? 382  ASN A CA  1 
ATOM   2945 C C   . ASN A 1 382 ? 25.692  61.753 83.686 1.00 44.24 ? 382  ASN A C   1 
ATOM   2946 O O   . ASN A 1 382 ? 25.126  62.567 84.404 1.00 45.94 ? 382  ASN A O   1 
ATOM   2947 C CB  . ASN A 1 382 ? 26.138  60.265 85.595 1.00 47.21 ? 382  ASN A CB  1 
ATOM   2948 C CG  . ASN A 1 382 ? 26.009  58.891 86.128 1.00 50.01 ? 382  ASN A CG  1 
ATOM   2949 O OD1 . ASN A 1 382 ? 24.972  58.243 85.959 1.00 48.62 ? 382  ASN A OD1 1 
ATOM   2950 N ND2 . ASN A 1 382 ? 27.073  58.403 86.756 1.00 53.24 ? 382  ASN A ND2 1 
ATOM   2951 N N   . ASN A 1 383 ? 26.229  62.079 82.526 1.00 41.73 ? 383  ASN A N   1 
ATOM   2952 C CA  . ASN A 1 383 ? 26.113  63.421 82.048 1.00 39.55 ? 383  ASN A CA  1 
ATOM   2953 C C   . ASN A 1 383 ? 24.663  63.565 81.517 1.00 38.65 ? 383  ASN A C   1 
ATOM   2954 O O   . ASN A 1 383 ? 24.276  62.943 80.520 1.00 36.77 ? 383  ASN A O   1 
ATOM   2955 C CB  . ASN A 1 383 ? 27.145  63.633 80.966 1.00 39.97 ? 383  ASN A CB  1 
ATOM   2956 C CG  . ASN A 1 383 ? 27.141  65.044 80.449 1.00 40.12 ? 383  ASN A CG  1 
ATOM   2957 O OD1 . ASN A 1 383 ? 28.189  65.577 80.104 1.00 40.92 ? 383  ASN A OD1 1 
ATOM   2958 N ND2 . ASN A 1 383 ? 25.963  65.651 80.364 1.00 38.43 ? 383  ASN A ND2 1 
ATOM   2959 N N   . GLY A 1 384 ? 23.873  64.364 82.232 1.00 36.43 ? 384  GLY A N   1 
ATOM   2960 C CA  . GLY A 1 384 ? 22.485  64.603 81.888 1.00 35.36 ? 384  GLY A CA  1 
ATOM   2961 C C   . GLY A 1 384 ? 22.221  65.180 80.510 1.00 34.20 ? 384  GLY A C   1 
ATOM   2962 O O   . GLY A 1 384 ? 21.236  64.807 79.885 1.00 34.00 ? 384  GLY A O   1 
ATOM   2963 N N   . ILE A 1 385 ? 23.094  66.064 80.048 1.00 33.03 ? 385  ILE A N   1 
ATOM   2964 C CA  . ILE A 1 385 ? 22.976  66.697 78.755 1.00 33.84 ? 385  ILE A CA  1 
ATOM   2965 C C   . ILE A 1 385 ? 23.285  65.648 77.671 1.00 35.42 ? 385  ILE A C   1 
ATOM   2966 O O   . ILE A 1 385 ? 22.628  65.625 76.614 1.00 35.46 ? 385  ILE A O   1 
ATOM   2967 C CB  . ILE A 1 385 ? 24.003  67.850 78.605 1.00 35.83 ? 385  ILE A CB  1 
ATOM   2968 C CG1 . ILE A 1 385 ? 23.831  68.851 79.743 1.00 37.77 ? 385  ILE A CG1 1 
ATOM   2969 C CG2 . ILE A 1 385 ? 23.849  68.568 77.246 1.00 32.63 ? 385  ILE A CG2 1 
ATOM   2970 C CD1 . ILE A 1 385 ? 22.719  69.799 79.537 1.00 41.64 ? 385  ILE A CD1 1 
ATOM   2971 N N   . LYS A 1 386 ? 24.266  64.786 77.935 1.00 34.33 ? 386  LYS A N   1 
ATOM   2972 C CA  . LYS A 1 386 ? 24.660  63.771 76.966 1.00 35.91 ? 386  LYS A CA  1 
ATOM   2973 C C   . LYS A 1 386 ? 23.597  62.687 76.845 1.00 34.09 ? 386  LYS A C   1 
ATOM   2974 O O   . LYS A 1 386 ? 23.335  62.198 75.755 1.00 32.96 ? 386  LYS A O   1 
ATOM   2975 C CB  . LYS A 1 386 ? 26.003  63.147 77.340 1.00 37.42 ? 386  LYS A CB  1 
ATOM   2976 C CG  . LYS A 1 386 ? 27.196  63.956 76.905 1.00 39.33 ? 386  LYS A CG  1 
ATOM   2977 C CD  . LYS A 1 386 ? 28.488  63.290 77.386 1.00 41.19 ? 386  LYS A CD  1 
ATOM   2978 C CE  . LYS A 1 386 ? 29.739  64.033 76.892 1.00 41.67 ? 386  LYS A CE  1 
ATOM   2979 N NZ  . LYS A 1 386 ? 30.999  63.431 77.476 1.00 43.69 ? 386  LYS A NZ  1 
ATOM   2980 N N   . ASN A 1 387 ? 22.994  62.336 77.973 1.00 33.35 ? 387  ASN A N   1 
ATOM   2981 C CA  . ASN A 1 387 ? 21.924  61.370 77.968 1.00 33.41 ? 387  ASN A CA  1 
ATOM   2982 C C   . ASN A 1 387 ? 20.725  61.953 77.165 1.00 31.62 ? 387  ASN A C   1 
ATOM   2983 O O   . ASN A 1 387 ? 20.158  61.268 76.328 1.00 30.01 ? 387  ASN A O   1 
ATOM   2984 C CB  . ASN A 1 387 ? 21.518  61.046 79.394 1.00 33.93 ? 387  ASN A CB  1 
ATOM   2985 C CG  . ASN A 1 387 ? 22.555  60.155 80.104 1.00 38.03 ? 387  ASN A CG  1 
ATOM   2986 O OD1 . ASN A 1 387 ? 23.424  59.556 79.450 1.00 36.87 ? 387  ASN A OD1 1 
ATOM   2987 N ND2 . ASN A 1 387 ? 22.471  60.075 81.439 1.00 35.24 ? 387  ASN A ND2 1 
ATOM   2988 N N   . ARG A 1 388 ? 20.392  63.223 77.397 1.00 30.98 ? 388  ARG A N   1 
ATOM   2989 C CA  . ARG A 1 388 ? 19.273  63.890 76.697 1.00 31.05 ? 388  ARG A CA  1 
ATOM   2990 C C   . ARG A 1 388 ? 19.552  63.953 75.193 1.00 30.46 ? 388  ARG A C   1 
ATOM   2991 O O   . ARG A 1 388 ? 18.715  63.551 74.369 1.00 30.79 ? 388  ARG A O   1 
ATOM   2992 C CB  . ARG A 1 388 ? 19.087  65.310 77.243 1.00 30.92 ? 388  ARG A CB  1 
ATOM   2993 C CG  . ARG A 1 388 ? 17.939  66.134 76.604 1.00 31.26 ? 388  ARG A CG  1 
ATOM   2994 C CD  . ARG A 1 388 ? 18.112  67.602 76.938 1.00 29.83 ? 388  ARG A CD  1 
ATOM   2995 N NE  . ARG A 1 388 ? 19.236  68.144 76.180 1.00 29.86 ? 388  ARG A NE  1 
ATOM   2996 C CZ  . ARG A 1 388 ? 19.909  69.256 76.488 1.00 30.44 ? 388  ARG A CZ  1 
ATOM   2997 N NH1 . ARG A 1 388 ? 20.904  69.650 75.732 1.00 29.29 ? 388  ARG A NH1 1 
ATOM   2998 N NH2 . ARG A 1 388 ? 19.577  69.983 77.539 1.00 31.90 ? 388  ARG A NH2 1 
ATOM   2999 N N   . ASP A 1 389 ? 20.733  64.435 74.831 1.00 29.08 ? 389  ASP A N   1 
ATOM   3000 C CA  . ASP A 1 389 ? 21.094  64.525 73.426 1.00 29.09 ? 389  ASP A CA  1 
ATOM   3001 C C   . ASP A 1 389 ? 21.220  63.167 72.710 1.00 28.40 ? 389  ASP A C   1 
ATOM   3002 O O   . ASP A 1 389 ? 20.823  63.034 71.524 1.00 25.85 ? 389  ASP A O   1 
ATOM   3003 C CB  . ASP A 1 389 ? 22.381  65.336 73.276 1.00 29.51 ? 389  ASP A CB  1 
ATOM   3004 C CG  . ASP A 1 389 ? 22.163  66.828 73.610 1.00 30.09 ? 389  ASP A CG  1 
ATOM   3005 O OD1 . ASP A 1 389 ? 21.002  67.287 73.721 1.00 29.00 ? 389  ASP A OD1 1 
ATOM   3006 O OD2 . ASP A 1 389 ? 23.165  67.531 73.754 1.00 33.36 ? 389  ASP A OD2 1 
ATOM   3007 N N   . GLY A 1 390 ? 21.760  62.181 73.427 1.00 28.01 ? 390  GLY A N   1 
ATOM   3008 C CA  . GLY A 1 390 ? 21.902  60.840 72.867 1.00 29.42 ? 390  GLY A CA  1 
ATOM   3009 C C   . GLY A 1 390 ? 20.542  60.247 72.481 1.00 30.28 ? 390  GLY A C   1 
ATOM   3010 O O   . GLY A 1 390 ? 20.396  59.663 71.408 1.00 30.98 ? 390  GLY A O   1 
ATOM   3011 N N   . LEU A 1 391 ? 19.560  60.413 73.369 1.00 30.21 ? 391  LEU A N   1 
ATOM   3012 C CA  . LEU A 1 391 ? 18.186  59.927 73.183 1.00 29.98 ? 391  LEU A CA  1 
ATOM   3013 C C   . LEU A 1 391 ? 17.528  60.718 72.011 1.00 29.24 ? 391  LEU A C   1 
ATOM   3014 O O   . LEU A 1 391 ? 16.838  60.160 71.152 1.00 27.43 ? 391  LEU A O   1 
ATOM   3015 C CB  . LEU A 1 391 ? 17.431  60.147 74.506 1.00 30.88 ? 391  LEU A CB  1 
ATOM   3016 C CG  . LEU A 1 391 ? 16.273  59.269 74.973 1.00 34.13 ? 391  LEU A CG  1 
ATOM   3017 C CD1 . LEU A 1 391 ? 16.582  57.811 74.588 1.00 35.98 ? 391  LEU A CD1 1 
ATOM   3018 C CD2 . LEU A 1 391 ? 16.047  59.409 76.524 1.00 31.12 ? 391  LEU A CD2 1 
ATOM   3019 N N   . ASP A 1 392 ? 17.774  62.014 71.973 1.00 27.74 ? 392  ASP A N   1 
ATOM   3020 C CA  . ASP A 1 392 ? 17.266  62.852 70.898 1.00 29.70 ? 392  ASP A CA  1 
ATOM   3021 C C   . ASP A 1 392 ? 17.801  62.230 69.573 1.00 29.19 ? 392  ASP A C   1 
ATOM   3022 O O   . ASP A 1 392 ? 17.031  61.947 68.628 1.00 28.96 ? 392  ASP A O   1 
ATOM   3023 C CB  . ASP A 1 392 ? 17.813  64.276 71.080 1.00 33.23 ? 392  ASP A CB  1 
ATOM   3024 C CG  . ASP A 1 392 ? 17.060  65.325 70.273 1.00 38.86 ? 392  ASP A CG  1 
ATOM   3025 O OD1 . ASP A 1 392 ? 16.350  64.972 69.287 1.00 38.67 ? 392  ASP A OD1 1 
ATOM   3026 O OD2 . ASP A 1 392 ? 17.188  66.534 70.649 1.00 41.16 ? 392  ASP A OD2 1 
ATOM   3027 N N   . ASP A 1 393 ? 19.114  62.005 69.483 1.00 27.95 ? 393  ASP A N   1 
ATOM   3028 C CA  . ASP A 1 393 ? 19.656  61.417 68.238 1.00 26.92 ? 393  ASP A CA  1 
ATOM   3029 C C   . ASP A 1 393 ? 19.121  60.006 67.937 1.00 26.93 ? 393  ASP A C   1 
ATOM   3030 O O   . ASP A 1 393 ? 18.922  59.659 66.781 1.00 25.69 ? 393  ASP A O   1 
ATOM   3031 C CB  . ASP A 1 393 ? 21.163  61.347 68.311 1.00 29.42 ? 393  ASP A CB  1 
ATOM   3032 C CG  . ASP A 1 393 ? 21.798  62.701 68.204 1.00 32.40 ? 393  ASP A CG  1 
ATOM   3033 O OD1 . ASP A 1 393 ? 21.197  63.604 67.558 1.00 35.37 ? 393  ASP A OD1 1 
ATOM   3034 O OD2 . ASP A 1 393 ? 22.900  62.853 68.745 1.00 34.33 ? 393  ASP A OD2 1 
ATOM   3035 N N   . ILE A 1 394 ? 18.915  59.183 68.975 1.00 26.36 ? 394  ILE A N   1 
ATOM   3036 C CA  . ILE A 1 394 ? 18.364  57.830 68.746 1.00 26.74 ? 394  ILE A CA  1 
ATOM   3037 C C   . ILE A 1 394 ? 16.988  57.935 68.061 1.00 25.66 ? 394  ILE A C   1 
ATOM   3038 O O   . ILE A 1 394 ? 16.738  57.283 67.074 1.00 25.96 ? 394  ILE A O   1 
ATOM   3039 C CB  . ILE A 1 394 ? 18.180  57.029 70.078 1.00 27.12 ? 394  ILE A CB  1 
ATOM   3040 C CG1 . ILE A 1 394 ? 19.552  56.529 70.596 1.00 23.93 ? 394  ILE A CG1 1 
ATOM   3041 C CG2 . ILE A 1 394 ? 17.188  55.825 69.854 1.00 24.27 ? 394  ILE A CG2 1 
ATOM   3042 C CD1 . ILE A 1 394 ? 19.459  56.102 72.090 1.00 23.98 ? 394  ILE A CD1 1 
ATOM   3043 N N   . VAL A 1 395 ? 16.128  58.811 68.553 1.00 25.32 ? 395  VAL A N   1 
ATOM   3044 C CA  . VAL A 1 395 ? 14.811  58.940 67.983 1.00 25.13 ? 395  VAL A CA  1 
ATOM   3045 C C   . VAL A 1 395 ? 14.845  59.447 66.557 1.00 24.96 ? 395  VAL A C   1 
ATOM   3046 O O   . VAL A 1 395 ? 14.197  58.859 65.665 1.00 26.57 ? 395  VAL A O   1 
ATOM   3047 C CB  . VAL A 1 395 ? 13.908  59.859 68.868 1.00 24.84 ? 395  VAL A CB  1 
ATOM   3048 C CG1 . VAL A 1 395 ? 12.546  59.994 68.248 1.00 23.49 ? 395  VAL A CG1 1 
ATOM   3049 C CG2 . VAL A 1 395 ? 13.756  59.244 70.270 1.00 25.37 ? 395  VAL A CG2 1 
ATOM   3050 N N   . GLY A 1 396 ? 15.606  60.529 66.341 1.00 25.24 ? 396  GLY A N   1 
ATOM   3051 C CA  . GLY A 1 396 ? 15.768  61.093 65.019 1.00 23.33 ? 396  GLY A CA  1 
ATOM   3052 C C   . GLY A 1 396 ? 16.491  60.156 64.042 1.00 24.82 ? 396  GLY A C   1 
ATOM   3053 O O   . GLY A 1 396 ? 16.061  60.009 62.890 1.00 25.31 ? 396  GLY A O   1 
ATOM   3054 N N   . ASP A 1 397 ? 17.601  59.544 64.452 1.00 25.49 ? 397  ASP A N   1 
ATOM   3055 C CA  . ASP A 1 397 ? 18.309  58.631 63.547 1.00 25.32 ? 397  ASP A CA  1 
ATOM   3056 C C   . ASP A 1 397 ? 17.419  57.449 63.122 1.00 25.06 ? 397  ASP A C   1 
ATOM   3057 O O   . ASP A 1 397 ? 17.299  57.169 61.937 1.00 27.09 ? 397  ASP A O   1 
ATOM   3058 C CB  . ASP A 1 397 ? 19.603  58.053 64.179 1.00 24.94 ? 397  ASP A CB  1 
ATOM   3059 C CG  . ASP A 1 397 ? 20.684  59.125 64.402 1.00 28.13 ? 397  ASP A CG  1 
ATOM   3060 O OD1 . ASP A 1 397 ? 20.606  60.208 63.771 1.00 25.86 ? 397  ASP A OD1 1 
ATOM   3061 O OD2 . ASP A 1 397 ? 21.622  58.866 65.198 1.00 27.27 ? 397  ASP A OD2 1 
ATOM   3062 N N   . HIS A 1 398 ? 16.790  56.787 64.076 1.00 24.99 ? 398  HIS A N   1 
ATOM   3063 C CA  . HIS A 1 398 ? 15.941  55.619 63.797 1.00 24.58 ? 398  HIS A CA  1 
ATOM   3064 C C   . HIS A 1 398 ? 14.635  55.942 63.065 1.00 24.91 ? 398  HIS A C   1 
ATOM   3065 O O   . HIS A 1 398 ? 14.239  55.223 62.168 1.00 23.98 ? 398  HIS A O   1 
ATOM   3066 C CB  . HIS A 1 398 ? 15.613  54.864 65.106 1.00 24.61 ? 398  HIS A CB  1 
ATOM   3067 C CG  . HIS A 1 398 ? 14.552  53.809 64.954 1.00 26.62 ? 398  HIS A CG  1 
ATOM   3068 N ND1 . HIS A 1 398 ? 14.717  52.684 64.160 1.00 25.19 ? 398  HIS A ND1 1 
ATOM   3069 C CD2 . HIS A 1 398 ? 13.332  53.683 65.536 1.00 25.53 ? 398  HIS A CD2 1 
ATOM   3070 C CE1 . HIS A 1 398 ? 13.651  51.912 64.261 1.00 25.18 ? 398  HIS A CE1 1 
ATOM   3071 N NE2 . HIS A 1 398 ? 12.793  52.491 65.094 1.00 27.40 ? 398  HIS A NE2 1 
ATOM   3072 N N   . ASN A 1 399 ? 13.995  57.052 63.394 1.00 26.08 ? 399  ASN A N   1 
ATOM   3073 C CA  . ASN A 1 399 ? 12.725  57.333 62.754 1.00 26.81 ? 399  ASN A CA  1 
ATOM   3074 C C   . ASN A 1 399 ? 12.729  58.164 61.504 1.00 27.43 ? 399  ASN A C   1 
ATOM   3075 O O   . ASN A 1 399 ? 11.815  58.089 60.689 1.00 27.49 ? 399  ASN A O   1 
ATOM   3076 C CB  . ASN A 1 399 ? 11.820  57.967 63.784 1.00 25.95 ? 399  ASN A CB  1 
ATOM   3077 C CG  . ASN A 1 399 ? 11.416  56.968 64.847 1.00 27.30 ? 399  ASN A CG  1 
ATOM   3078 O OD1 . ASN A 1 399 ? 10.664  56.032 64.567 1.00 26.73 ? 399  ASN A OD1 1 
ATOM   3079 N ND2 . ASN A 1 399 ? 11.939  57.138 66.065 1.00 26.72 ? 399  ASN A ND2 1 
ATOM   3080 N N   . VAL A 1 400 ? 13.783  58.937 61.314 1.00 27.79 ? 400  VAL A N   1 
ATOM   3081 C CA  . VAL A 1 400 ? 13.765  59.837 60.168 1.00 26.06 ? 400  VAL A CA  1 
ATOM   3082 C C   . VAL A 1 400 ? 15.040  59.791 59.324 1.00 26.64 ? 400  VAL A C   1 
ATOM   3083 O O   . VAL A 1 400 ? 15.023  59.406 58.153 1.00 26.59 ? 400  VAL A O   1 
ATOM   3084 C CB  . VAL A 1 400 ? 13.536  61.291 60.681 1.00 26.79 ? 400  VAL A CB  1 
ATOM   3085 C CG1 . VAL A 1 400 ? 13.680  62.269 59.538 1.00 24.57 ? 400  VAL A CG1 1 
ATOM   3086 C CG2 . VAL A 1 400 ? 12.093  61.411 61.385 1.00 22.47 ? 400  VAL A CG2 1 
ATOM   3087 N N   . ILE A 1 401 ? 16.167  60.121 59.953 1.00 27.10 ? 401  ILE A N   1 
ATOM   3088 C CA  . ILE A 1 401 ? 17.409  60.211 59.208 1.00 25.86 ? 401  ILE A CA  1 
ATOM   3089 C C   . ILE A 1 401 ? 17.900  58.982 58.535 1.00 25.35 ? 401  ILE A C   1 
ATOM   3090 O O   . ILE A 1 401 ? 18.114  59.012 57.330 1.00 27.15 ? 401  ILE A O   1 
ATOM   3091 C CB  . ILE A 1 401 ? 18.539  60.796 60.066 1.00 26.12 ? 401  ILE A CB  1 
ATOM   3092 C CG1 . ILE A 1 401 ? 18.049  62.130 60.644 1.00 27.29 ? 401  ILE A CG1 1 
ATOM   3093 C CG2 . ILE A 1 401 ? 19.815  60.964 59.182 1.00 24.37 ? 401  ILE A CG2 1 
ATOM   3094 C CD1 . ILE A 1 401 ? 19.119  63.007 61.284 1.00 30.74 ? 401  ILE A CD1 1 
ATOM   3095 N N   . CYS A 1 402 ? 18.061  57.887 59.274 1.00 24.40 ? 402  CYS A N   1 
ATOM   3096 C CA  . CYS A 1 402 ? 18.608  56.666 58.658 1.00 25.64 ? 402  CYS A CA  1 
ATOM   3097 C C   . CYS A 1 402 ? 17.657  56.055 57.675 1.00 25.03 ? 402  CYS A C   1 
ATOM   3098 O O   . CYS A 1 402 ? 18.090  55.507 56.707 1.00 22.97 ? 402  CYS A O   1 
ATOM   3099 C CB  . CYS A 1 402 ? 19.055  55.669 59.745 1.00 27.36 ? 402  CYS A CB  1 
ATOM   3100 S SG  . CYS A 1 402 ? 20.429  56.442 60.696 1.00 30.40 ? 402  CYS A SG  1 
ATOM   3101 N N   . PRO A 1 403 ? 16.327  56.106 57.941 1.00 27.13 ? 403  PRO A N   1 
ATOM   3102 C CA  . PRO A 1 403 ? 15.429  55.523 56.916 1.00 26.09 ? 403  PRO A CA  1 
ATOM   3103 C C   . PRO A 1 403 ? 15.530  56.443 55.663 1.00 26.54 ? 403  PRO A C   1 
ATOM   3104 O O   . PRO A 1 403 ? 15.522  55.944 54.547 1.00 25.58 ? 403  PRO A O   1 
ATOM   3105 C CB  . PRO A 1 403 ? 14.020  55.616 57.563 1.00 26.16 ? 403  PRO A CB  1 
ATOM   3106 C CG  . PRO A 1 403 ? 14.343  55.400 59.055 1.00 28.45 ? 403  PRO A CG  1 
ATOM   3107 C CD  . PRO A 1 403 ? 15.639  56.243 59.255 1.00 25.53 ? 403  PRO A CD  1 
ATOM   3108 N N   . LEU A 1 404 ? 15.610  57.778 55.833 1.00 26.32 ? 404  LEU A N   1 
ATOM   3109 C CA  . LEU A 1 404 ? 15.719  58.603 54.618 1.00 26.34 ? 404  LEU A CA  1 
ATOM   3110 C C   . LEU A 1 404 ? 17.064  58.292 53.895 1.00 27.38 ? 404  LEU A C   1 
ATOM   3111 O O   . LEU A 1 404 ? 17.112  58.170 52.668 1.00 27.18 ? 404  LEU A O   1 
ATOM   3112 C CB  . LEU A 1 404 ? 15.629  60.099 54.939 1.00 27.76 ? 404  LEU A CB  1 
ATOM   3113 C CG  . LEU A 1 404 ? 15.632  61.060 53.729 1.00 30.84 ? 404  LEU A CG  1 
ATOM   3114 C CD1 . LEU A 1 404 ? 14.677  62.253 53.953 1.00 29.40 ? 404  LEU A CD1 1 
ATOM   3115 C CD2 . LEU A 1 404 ? 17.058  61.550 53.463 1.00 28.89 ? 404  LEU A CD2 1 
ATOM   3116 N N   . MET A 1 405 ? 18.153  58.161 54.643 1.00 25.92 ? 405  MET A N   1 
ATOM   3117 C CA  . MET A 1 405 ? 19.430  57.847 53.999 1.00 27.24 ? 405  MET A CA  1 
ATOM   3118 C C   . MET A 1 405 ? 19.395  56.502 53.264 1.00 27.51 ? 405  MET A C   1 
ATOM   3119 O O   . MET A 1 405 ? 19.943  56.376 52.178 1.00 28.32 ? 405  MET A O   1 
ATOM   3120 C CB  . MET A 1 405 ? 20.574  57.894 55.021 1.00 27.77 ? 405  MET A CB  1 
ATOM   3121 C CG  . MET A 1 405 ? 20.761  59.327 55.545 1.00 26.88 ? 405  MET A CG  1 
ATOM   3122 S SD  . MET A 1 405 ? 20.986  60.532 54.212 1.00 28.07 ? 405  MET A SD  1 
ATOM   3123 C CE  . MET A 1 405 ? 22.402  59.671 53.392 1.00 23.66 ? 405  MET A CE  1 
ATOM   3124 N N   . HIS A 1 406 ? 18.683  55.518 53.804 1.00 29.42 ? 406  HIS A N   1 
ATOM   3125 C CA  . HIS A 1 406 ? 18.570  54.217 53.128 1.00 29.67 ? 406  HIS A CA  1 
ATOM   3126 C C   . HIS A 1 406 ? 17.754  54.467 51.818 1.00 30.87 ? 406  HIS A C   1 
ATOM   3127 O O   . HIS A 1 406 ? 18.109  53.982 50.728 1.00 29.64 ? 406  HIS A O   1 
ATOM   3128 C CB  . HIS A 1 406 ? 17.831  53.226 54.026 1.00 30.87 ? 406  HIS A CB  1 
ATOM   3129 C CG  . HIS A 1 406 ? 17.659  51.875 53.410 1.00 34.17 ? 406  HIS A CG  1 
ATOM   3130 N ND1 . HIS A 1 406 ? 18.716  51.015 53.202 1.00 35.33 ? 406  HIS A ND1 1 
ATOM   3131 C CD2 . HIS A 1 406 ? 16.558  51.247 52.919 1.00 33.53 ? 406  HIS A CD2 1 
ATOM   3132 C CE1 . HIS A 1 406 ? 18.279  49.917 52.608 1.00 34.73 ? 406  HIS A CE1 1 
ATOM   3133 N NE2 . HIS A 1 406 ? 16.973  50.033 52.430 1.00 35.67 ? 406  HIS A NE2 1 
ATOM   3134 N N   . PHE A 1 407 ? 16.671  55.233 51.922 1.00 28.08 ? 407  PHE A N   1 
ATOM   3135 C CA  . PHE A 1 407 ? 15.886  55.526 50.712 1.00 28.62 ? 407  PHE A CA  1 
ATOM   3136 C C   . PHE A 1 407 ? 16.718  56.251 49.655 1.00 28.01 ? 407  PHE A C   1 
ATOM   3137 O O   . PHE A 1 407 ? 16.661  55.874 48.467 1.00 27.54 ? 407  PHE A O   1 
ATOM   3138 C CB  . PHE A 1 407 ? 14.698  56.424 51.037 1.00 27.81 ? 407  PHE A CB  1 
ATOM   3139 C CG  . PHE A 1 407 ? 13.904  56.859 49.832 1.00 26.92 ? 407  PHE A CG  1 
ATOM   3140 C CD1 . PHE A 1 407 ? 13.063  55.971 49.187 1.00 27.75 ? 407  PHE A CD1 1 
ATOM   3141 C CD2 . PHE A 1 407 ? 13.977  58.174 49.370 1.00 27.04 ? 407  PHE A CD2 1 
ATOM   3142 C CE1 . PHE A 1 407 ? 12.277  56.392 48.076 1.00 26.34 ? 407  PHE A CE1 1 
ATOM   3143 C CE2 . PHE A 1 407 ? 13.225  58.604 48.278 1.00 26.05 ? 407  PHE A CE2 1 
ATOM   3144 C CZ  . PHE A 1 407 ? 12.363  57.702 47.631 1.00 27.55 ? 407  PHE A CZ  1 
ATOM   3145 N N   . VAL A 1 408 ? 17.496  57.270 50.069 1.00 27.03 ? 408  VAL A N   1 
ATOM   3146 C CA  . VAL A 1 408 ? 18.226  58.030 49.070 1.00 30.28 ? 408  VAL A CA  1 
ATOM   3147 C C   . VAL A 1 408 ? 19.298  57.223 48.354 1.00 30.96 ? 408  VAL A C   1 
ATOM   3148 O O   . VAL A 1 408 ? 19.475  57.369 47.142 1.00 30.03 ? 408  VAL A O   1 
ATOM   3149 C CB  . VAL A 1 408 ? 18.828  59.371 49.624 1.00 31.20 ? 408  VAL A CB  1 
ATOM   3150 C CG1 . VAL A 1 408 ? 19.904  59.078 50.609 1.00 30.78 ? 408  VAL A CG1 1 
ATOM   3151 C CG2 . VAL A 1 408 ? 19.369  60.232 48.430 1.00 32.60 ? 408  VAL A CG2 1 
ATOM   3152 N N   . ASN A 1 409 ? 19.992  56.361 49.089 1.00 32.28 ? 409  ASN A N   1 
ATOM   3153 C CA  . ASN A 1 409 ? 20.999  55.528 48.460 1.00 32.99 ? 409  ASN A CA  1 
ATOM   3154 C C   . ASN A 1 409 ? 20.328  54.496 47.540 1.00 33.95 ? 409  ASN A C   1 
ATOM   3155 O O   . ASN A 1 409 ? 20.830  54.226 46.454 1.00 35.09 ? 409  ASN A O   1 
ATOM   3156 C CB  . ASN A 1 409 ? 21.886  54.883 49.523 1.00 32.87 ? 409  ASN A CB  1 
ATOM   3157 C CG  . ASN A 1 409 ? 22.967  55.847 49.989 1.00 35.80 ? 409  ASN A CG  1 
ATOM   3158 O OD1 . ASN A 1 409 ? 23.899  56.169 49.225 1.00 38.76 ? 409  ASN A OD1 1 
ATOM   3159 N ND2 . ASN A 1 409 ? 22.837  56.345 51.202 1.00 34.68 ? 409  ASN A ND2 1 
ATOM   3160 N N   . LYS A 1 410 ? 19.199  53.923 47.935 1.00 32.59 ? 410  LYS A N   1 
ATOM   3161 C CA  . LYS A 1 410 ? 18.545  52.975 47.033 1.00 33.34 ? 410  LYS A CA  1 
ATOM   3162 C C   . LYS A 1 410 ? 17.988  53.702 45.773 1.00 33.81 ? 410  LYS A C   1 
ATOM   3163 O O   . LYS A 1 410 ? 18.041  53.184 44.645 1.00 32.43 ? 410  LYS A O   1 
ATOM   3164 C CB  . LYS A 1 410 ? 17.384  52.299 47.755 1.00 33.60 ? 410  LYS A CB  1 
ATOM   3165 C CG  . LYS A 1 410 ? 17.823  51.266 48.759 1.00 35.60 ? 410  LYS A CG  1 
ATOM   3166 C CD  . LYS A 1 410 ? 18.527  50.071 48.093 1.00 37.27 ? 410  LYS A CD  1 
ATOM   3167 C CE  . LYS A 1 410 ? 19.029  49.087 49.156 1.00 40.16 ? 410  LYS A CE  1 
ATOM   3168 N NZ  . LYS A 1 410 ? 19.714  47.869 48.561 1.00 41.89 ? 410  LYS A NZ  1 
ATOM   3169 N N   . TYR A 1 411 ? 17.470  54.911 45.978 1.00 32.56 ? 411  TYR A N   1 
ATOM   3170 C CA  . TYR A 1 411 ? 16.844  55.641 44.891 1.00 31.67 ? 411  TYR A CA  1 
ATOM   3171 C C   . TYR A 1 411 ? 17.841  56.117 43.863 1.00 31.94 ? 411  TYR A C   1 
ATOM   3172 O O   . TYR A 1 411 ? 17.621  55.991 42.657 1.00 31.66 ? 411  TYR A O   1 
ATOM   3173 C CB  . TYR A 1 411 ? 16.081  56.879 45.398 1.00 31.65 ? 411  TYR A CB  1 
ATOM   3174 C CG  . TYR A 1 411 ? 15.236  57.486 44.300 1.00 28.65 ? 411  TYR A CG  1 
ATOM   3175 C CD1 . TYR A 1 411 ? 13.983  56.969 44.027 1.00 28.60 ? 411  TYR A CD1 1 
ATOM   3176 C CD2 . TYR A 1 411 ? 15.735  58.522 43.489 1.00 28.24 ? 411  TYR A CD2 1 
ATOM   3177 C CE1 . TYR A 1 411 ? 13.203  57.455 42.963 1.00 30.82 ? 411  TYR A CE1 1 
ATOM   3178 C CE2 . TYR A 1 411 ? 14.989  59.034 42.414 1.00 28.40 ? 411  TYR A CE2 1 
ATOM   3179 C CZ  . TYR A 1 411 ? 13.704  58.489 42.151 1.00 30.20 ? 411  TYR A CZ  1 
ATOM   3180 O OH  . TYR A 1 411 ? 12.925  58.933 41.099 1.00 31.16 ? 411  TYR A OH  1 
ATOM   3181 N N   . THR A 1 412 ? 18.920  56.693 44.360 1.00 31.95 ? 412  THR A N   1 
ATOM   3182 C CA  . THR A 1 412 ? 19.955  57.226 43.530 1.00 31.94 ? 412  THR A CA  1 
ATOM   3183 C C   . THR A 1 412 ? 20.568  56.175 42.581 1.00 34.80 ? 412  THR A C   1 
ATOM   3184 O O   . THR A 1 412 ? 21.050  56.534 41.516 1.00 35.50 ? 412  THR A O   1 
ATOM   3185 C CB  . THR A 1 412 ? 21.016  57.898 44.417 1.00 31.02 ? 412  THR A CB  1 
ATOM   3186 O OG1 . THR A 1 412 ? 20.415  59.038 45.070 1.00 33.54 ? 412  THR A OG1 1 
ATOM   3187 C CG2 . THR A 1 412 ? 22.225  58.386 43.583 1.00 28.38 ? 412  THR A CG2 1 
ATOM   3188 N N   . LYS A 1 413 ? 20.566  54.897 42.931 1.00 34.49 ? 413  LYS A N   1 
ATOM   3189 C CA  . LYS A 1 413 ? 21.106  53.949 41.968 1.00 37.07 ? 413  LYS A CA  1 
ATOM   3190 C C   . LYS A 1 413 ? 20.264  53.941 40.651 1.00 39.14 ? 413  LYS A C   1 
ATOM   3191 O O   . LYS A 1 413 ? 20.808  53.701 39.548 1.00 38.98 ? 413  LYS A O   1 
ATOM   3192 C CB  . LYS A 1 413 ? 21.127  52.535 42.544 1.00 38.02 ? 413  LYS A CB  1 
ATOM   3193 C CG  . LYS A 1 413 ? 21.427  51.464 41.479 1.00 40.24 ? 413  LYS A CG  1 
ATOM   3194 N N   . PHE A 1 414 ? 18.952  54.193 40.750 1.00 36.78 ? 414  PHE A N   1 
ATOM   3195 C CA  . PHE A 1 414 ? 18.111  54.178 39.557 1.00 36.15 ? 414  PHE A CA  1 
ATOM   3196 C C   . PHE A 1 414 ? 17.558  55.525 39.126 1.00 35.58 ? 414  PHE A C   1 
ATOM   3197 O O   . PHE A 1 414 ? 17.092  55.644 38.013 1.00 35.14 ? 414  PHE A O   1 
ATOM   3198 C CB  . PHE A 1 414 ? 16.890  53.270 39.763 1.00 35.63 ? 414  PHE A CB  1 
ATOM   3199 C CG  . PHE A 1 414 ? 17.220  51.837 39.907 1.00 36.57 ? 414  PHE A CG  1 
ATOM   3200 C CD1 . PHE A 1 414 ? 17.364  51.021 38.772 1.00 37.63 ? 414  PHE A CD1 1 
ATOM   3201 C CD2 . PHE A 1 414 ? 17.430  51.298 41.156 1.00 34.01 ? 414  PHE A CD2 1 
ATOM   3202 C CE1 . PHE A 1 414 ? 17.725  49.675 38.907 1.00 38.14 ? 414  PHE A CE1 1 
ATOM   3203 C CE2 . PHE A 1 414 ? 17.799  49.939 41.318 1.00 37.85 ? 414  PHE A CE2 1 
ATOM   3204 C CZ  . PHE A 1 414 ? 17.949  49.127 40.198 1.00 37.97 ? 414  PHE A CZ  1 
ATOM   3205 N N   . GLY A 1 415 ? 17.572  56.530 39.995 1.00 34.76 ? 415  GLY A N   1 
ATOM   3206 C CA  . GLY A 1 415 ? 16.956  57.801 39.622 1.00 33.49 ? 415  GLY A CA  1 
ATOM   3207 C C   . GLY A 1 415 ? 17.655  58.680 38.603 1.00 33.29 ? 415  GLY A C   1 
ATOM   3208 O O   . GLY A 1 415 ? 18.696  58.353 38.067 1.00 32.20 ? 415  GLY A O   1 
ATOM   3209 N N   . ASN A 1 416 ? 17.097  59.849 38.371 1.00 33.95 ? 416  ASN A N   1 
ATOM   3210 C CA  . ASN A 1 416 ? 17.698  60.717 37.401 1.00 34.58 ? 416  ASN A CA  1 
ATOM   3211 C C   . ASN A 1 416 ? 18.236  62.000 38.025 1.00 33.90 ? 416  ASN A C   1 
ATOM   3212 O O   . ASN A 1 416 ? 18.364  63.004 37.350 1.00 34.69 ? 416  ASN A O   1 
ATOM   3213 C CB  . ASN A 1 416 ? 16.655  61.004 36.279 1.00 37.60 ? 416  ASN A CB  1 
ATOM   3214 C CG  . ASN A 1 416 ? 17.243  61.842 35.140 1.00 41.27 ? 416  ASN A CG  1 
ATOM   3215 O OD1 . ASN A 1 416 ? 16.751  62.961 34.839 1.00 37.60 ? 416  ASN A OD1 1 
ATOM   3216 N ND2 . ASN A 1 416 ? 18.316  61.330 34.539 1.00 41.49 ? 416  ASN A ND2 1 
ATOM   3217 N N   . GLY A 1 417 ? 18.578  61.966 39.313 1.00 33.59 ? 417  GLY A N   1 
ATOM   3218 C CA  . GLY A 1 417 ? 19.129  63.156 39.965 1.00 32.90 ? 417  GLY A CA  1 
ATOM   3219 C C   . GLY A 1 417 ? 18.595  63.375 41.373 1.00 33.17 ? 417  GLY A C   1 
ATOM   3220 O O   . GLY A 1 417 ? 17.377  63.453 41.589 1.00 34.04 ? 417  GLY A O   1 
ATOM   3221 N N   . THR A 1 418 ? 19.499  63.486 42.328 1.00 31.07 ? 418  THR A N   1 
ATOM   3222 C CA  . THR A 1 418 ? 19.144  63.626 43.736 1.00 30.03 ? 418  THR A CA  1 
ATOM   3223 C C   . THR A 1 418 ? 19.892  64.807 44.340 1.00 30.16 ? 418  THR A C   1 
ATOM   3224 O O   . THR A 1 418 ? 21.092  64.968 44.057 1.00 29.98 ? 418  THR A O   1 
ATOM   3225 C CB  . THR A 1 418 ? 19.651  62.375 44.560 1.00 31.01 ? 418  THR A CB  1 
ATOM   3226 O OG1 . THR A 1 418 ? 19.122  61.153 44.006 1.00 32.07 ? 418  THR A OG1 1 
ATOM   3227 C CG2 . THR A 1 418 ? 19.293  62.540 46.061 1.00 27.19 ? 418  THR A CG2 1 
ATOM   3228 N N   . TYR A 1 419 ? 19.200  65.602 45.154 1.00 28.20 ? 419  TYR A N   1 
ATOM   3229 C CA  . TYR A 1 419 ? 19.786  66.722 45.901 1.00 28.69 ? 419  TYR A CA  1 
ATOM   3230 C C   . TYR A 1 419 ? 19.338  66.520 47.369 1.00 28.44 ? 419  TYR A C   1 
ATOM   3231 O O   . TYR A 1 419 ? 18.125  66.459 47.682 1.00 28.18 ? 419  TYR A O   1 
ATOM   3232 C CB  . TYR A 1 419 ? 19.331  68.102 45.372 1.00 28.90 ? 419  TYR A CB  1 
ATOM   3233 C CG  . TYR A 1 419 ? 19.751  68.309 43.926 1.00 30.54 ? 419  TYR A CG  1 
ATOM   3234 C CD1 . TYR A 1 419 ? 18.958  67.828 42.876 1.00 29.11 ? 419  TYR A CD1 1 
ATOM   3235 C CD2 . TYR A 1 419 ? 20.965  68.918 43.621 1.00 29.27 ? 419  TYR A CD2 1 
ATOM   3236 C CE1 . TYR A 1 419 ? 19.356  67.947 41.560 1.00 29.82 ? 419  TYR A CE1 1 
ATOM   3237 C CE2 . TYR A 1 419 ? 21.376  69.037 42.316 1.00 31.72 ? 419  TYR A CE2 1 
ATOM   3238 C CZ  . TYR A 1 419 ? 20.565  68.555 41.289 1.00 32.67 ? 419  TYR A CZ  1 
ATOM   3239 O OH  . TYR A 1 419 ? 20.951  68.722 39.986 1.00 34.03 ? 419  TYR A OH  1 
ATOM   3240 N N   . LEU A 1 420 ? 20.341  66.412 48.240 1.00 27.64 ? 420  LEU A N   1 
ATOM   3241 C CA  . LEU A 1 420 ? 20.154  66.121 49.640 1.00 28.05 ? 420  LEU A CA  1 
ATOM   3242 C C   . LEU A 1 420 ? 20.567  67.291 50.525 1.00 29.03 ? 420  LEU A C   1 
ATOM   3243 O O   . LEU A 1 420 ? 21.598  67.937 50.289 1.00 29.90 ? 420  LEU A O   1 
ATOM   3244 C CB  . LEU A 1 420 ? 20.969  64.849 49.983 1.00 26.17 ? 420  LEU A CB  1 
ATOM   3245 C CG  . LEU A 1 420 ? 21.000  64.414 51.461 1.00 26.86 ? 420  LEU A CG  1 
ATOM   3246 C CD1 . LEU A 1 420 ? 19.576  64.077 51.885 1.00 25.78 ? 420  LEU A CD1 1 
ATOM   3247 C CD2 . LEU A 1 420 ? 21.945  63.175 51.678 1.00 25.76 ? 420  LEU A CD2 1 
ATOM   3248 N N   . TYR A 1 421 ? 19.777  67.591 51.558 1.00 29.28 ? 421  TYR A N   1 
ATOM   3249 C CA  . TYR A 1 421 ? 20.201  68.694 52.434 1.00 28.57 ? 421  TYR A CA  1 
ATOM   3250 C C   . TYR A 1 421 ? 20.107  68.303 53.908 1.00 28.79 ? 421  TYR A C   1 
ATOM   3251 O O   . TYR A 1 421 ? 19.399  67.342 54.235 1.00 28.38 ? 421  TYR A O   1 
ATOM   3252 C CB  . TYR A 1 421 ? 19.320  69.926 52.203 1.00 27.39 ? 421  TYR A CB  1 
ATOM   3253 C CG  . TYR A 1 421 ? 17.886  69.741 52.675 1.00 27.64 ? 421  TYR A CG  1 
ATOM   3254 C CD1 . TYR A 1 421 ? 17.569  69.765 54.048 1.00 27.93 ? 421  TYR A CD1 1 
ATOM   3255 C CD2 . TYR A 1 421 ? 16.848  69.473 51.757 1.00 26.73 ? 421  TYR A CD2 1 
ATOM   3256 C CE1 . TYR A 1 421 ? 16.227  69.515 54.507 1.00 28.26 ? 421  TYR A CE1 1 
ATOM   3257 C CE2 . TYR A 1 421 ? 15.528  69.223 52.201 1.00 25.53 ? 421  TYR A CE2 1 
ATOM   3258 C CZ  . TYR A 1 421 ? 15.217  69.243 53.563 1.00 28.08 ? 421  TYR A CZ  1 
ATOM   3259 O OH  . TYR A 1 421 ? 13.913  68.993 53.989 1.00 26.01 ? 421  TYR A OH  1 
ATOM   3260 N N   . PHE A 1 422 ? 20.760  69.098 54.769 1.00 28.38 ? 422  PHE A N   1 
ATOM   3261 C CA  . PHE A 1 422 ? 20.754  68.933 56.218 1.00 29.68 ? 422  PHE A CA  1 
ATOM   3262 C C   . PHE A 1 422 ? 20.427  70.315 56.756 1.00 31.86 ? 422  PHE A C   1 
ATOM   3263 O O   . PHE A 1 422 ? 21.284  71.224 56.700 1.00 32.90 ? 422  PHE A O   1 
ATOM   3264 C CB  . PHE A 1 422 ? 22.132  68.509 56.718 1.00 30.38 ? 422  PHE A CB  1 
ATOM   3265 C CG  . PHE A 1 422 ? 22.206  68.270 58.209 1.00 32.40 ? 422  PHE A CG  1 
ATOM   3266 C CD1 . PHE A 1 422 ? 21.543  67.180 58.795 1.00 33.66 ? 422  PHE A CD1 1 
ATOM   3267 C CD2 . PHE A 1 422 ? 22.988  69.085 59.015 1.00 32.03 ? 422  PHE A CD2 1 
ATOM   3268 C CE1 . PHE A 1 422 ? 21.663  66.903 60.179 1.00 33.41 ? 422  PHE A CE1 1 
ATOM   3269 C CE2 . PHE A 1 422 ? 23.123  68.831 60.398 1.00 33.24 ? 422  PHE A CE2 1 
ATOM   3270 C CZ  . PHE A 1 422 ? 22.450  67.728 60.977 1.00 34.61 ? 422  PHE A CZ  1 
ATOM   3271 N N   . PHE A 1 423 ? 19.197  70.480 57.266 1.00 31.54 ? 423  PHE A N   1 
ATOM   3272 C CA  . PHE A 1 423 ? 18.727  71.752 57.780 1.00 31.18 ? 423  PHE A CA  1 
ATOM   3273 C C   . PHE A 1 423 ? 19.050  71.871 59.267 1.00 32.95 ? 423  PHE A C   1 
ATOM   3274 O O   . PHE A 1 423 ? 18.479  71.144 60.113 1.00 31.21 ? 423  PHE A O   1 
ATOM   3275 C CB  . PHE A 1 423 ? 17.222  71.899 57.544 1.00 30.30 ? 423  PHE A CB  1 
ATOM   3276 C CG  . PHE A 1 423 ? 16.653  73.239 58.009 1.00 32.37 ? 423  PHE A CG  1 
ATOM   3277 C CD1 . PHE A 1 423 ? 16.671  74.358 57.169 1.00 29.82 ? 423  PHE A CD1 1 
ATOM   3278 C CD2 . PHE A 1 423 ? 16.083  73.359 59.287 1.00 30.10 ? 423  PHE A CD2 1 
ATOM   3279 C CE1 . PHE A 1 423 ? 16.128  75.574 57.591 1.00 32.23 ? 423  PHE A CE1 1 
ATOM   3280 C CE2 . PHE A 1 423 ? 15.541  74.568 59.727 1.00 32.65 ? 423  PHE A CE2 1 
ATOM   3281 C CZ  . PHE A 1 423 ? 15.558  75.691 58.883 1.00 31.51 ? 423  PHE A CZ  1 
ATOM   3282 N N   . ASN A 1 424 ? 19.969  72.792 59.590 1.00 32.51 ? 424  ASN A N   1 
ATOM   3283 C CA  . ASN A 1 424 ? 20.374  72.933 60.958 1.00 34.70 ? 424  ASN A CA  1 
ATOM   3284 C C   . ASN A 1 424 ? 20.368  74.359 61.462 1.00 36.04 ? 424  ASN A C   1 
ATOM   3285 O O   . ASN A 1 424 ? 21.228  74.722 62.291 1.00 35.20 ? 424  ASN A O   1 
ATOM   3286 C CB  . ASN A 1 424 ? 21.756  72.257 61.201 1.00 34.20 ? 424  ASN A CB  1 
ATOM   3287 C CG  . ASN A 1 424 ? 22.862  72.887 60.358 1.00 36.11 ? 424  ASN A CG  1 
ATOM   3288 O OD1 . ASN A 1 424 ? 22.592  73.756 59.532 1.00 37.38 ? 424  ASN A OD1 1 
ATOM   3289 N ND2 . ASN A 1 424 ? 24.090  72.453 60.548 1.00 33.00 ? 424  ASN A ND2 1 
ATOM   3290 N N   . HIS A 1 425 ? 19.409  75.169 60.993 1.00 34.84 ? 425  HIS A N   1 
ATOM   3291 C CA  . HIS A 1 425 ? 19.325  76.522 61.522 1.00 35.67 ? 425  HIS A CA  1 
ATOM   3292 C C   . HIS A 1 425 ? 18.230  76.549 62.583 1.00 36.66 ? 425  HIS A C   1 
ATOM   3293 O O   . HIS A 1 425 ? 17.063  76.178 62.334 1.00 37.52 ? 425  HIS A O   1 
ATOM   3294 C CB  . HIS A 1 425 ? 18.954  77.591 60.467 1.00 34.17 ? 425  HIS A CB  1 
ATOM   3295 C CG  . HIS A 1 425 ? 18.787  78.977 61.056 1.00 35.15 ? 425  HIS A CG  1 
ATOM   3296 N ND1 . HIS A 1 425 ? 19.851  79.724 61.523 1.00 33.47 ? 425  HIS A ND1 1 
ATOM   3297 C CD2 . HIS A 1 425 ? 17.674  79.714 61.321 1.00 35.70 ? 425  HIS A CD2 1 
ATOM   3298 C CE1 . HIS A 1 425 ? 19.402  80.849 62.054 1.00 35.67 ? 425  HIS A CE1 1 
ATOM   3299 N NE2 . HIS A 1 425 ? 18.084  80.871 61.946 1.00 35.70 ? 425  HIS A NE2 1 
ATOM   3300 N N   . ARG A 1 426 ? 18.603  77.011 63.754 1.00 36.13 ? 426  ARG A N   1 
ATOM   3301 C CA  . ARG A 1 426 ? 17.676  77.161 64.852 1.00 38.62 ? 426  ARG A CA  1 
ATOM   3302 C C   . ARG A 1 426 ? 17.142  78.603 64.748 1.00 38.42 ? 426  ARG A C   1 
ATOM   3303 O O   . ARG A 1 426 ? 17.919  79.543 64.887 1.00 39.28 ? 426  ARG A O   1 
ATOM   3304 C CB  . ARG A 1 426 ? 18.418  76.952 66.179 1.00 38.20 ? 426  ARG A CB  1 
ATOM   3305 C CG  . ARG A 1 426 ? 17.726  77.587 67.376 1.00 40.21 ? 426  ARG A CG  1 
ATOM   3306 C CD  . ARG A 1 426 ? 16.900  76.641 68.166 1.00 37.50 ? 426  ARG A CD  1 
ATOM   3307 N NE  . ARG A 1 426 ? 16.310  77.296 69.329 1.00 35.47 ? 426  ARG A NE  1 
ATOM   3308 C CZ  . ARG A 1 426 ? 15.579  76.659 70.240 1.00 36.21 ? 426  ARG A CZ  1 
ATOM   3309 N NH1 . ARG A 1 426 ? 15.064  77.348 71.262 1.00 33.19 ? 426  ARG A NH1 1 
ATOM   3310 N NH2 . ARG A 1 426 ? 15.364  75.321 70.127 1.00 33.75 ? 426  ARG A NH2 1 
ATOM   3311 N N   . ALA A 1 427 ? 15.839  78.759 64.509 1.00 37.44 ? 427  ALA A N   1 
ATOM   3312 C CA  . ALA A 1 427 ? 15.220  80.083 64.349 1.00 38.30 ? 427  ALA A CA  1 
ATOM   3313 C C   . ALA A 1 427 ? 15.338  80.983 65.582 1.00 38.86 ? 427  ALA A C   1 
ATOM   3314 O O   . ALA A 1 427 ? 15.063  80.576 66.723 1.00 39.08 ? 427  ALA A O   1 
ATOM   3315 C CB  . ALA A 1 427 ? 13.737  79.960 63.935 1.00 35.22 ? 427  ALA A CB  1 
ATOM   3316 N N   . SER A 1 428 ? 15.727  82.228 65.320 1.00 40.06 ? 428  SER A N   1 
ATOM   3317 C CA  . SER A 1 428 ? 15.949  83.230 66.368 1.00 40.39 ? 428  SER A CA  1 
ATOM   3318 C C   . SER A 1 428 ? 14.717  83.465 67.205 1.00 41.20 ? 428  SER A C   1 
ATOM   3319 O O   . SER A 1 428 ? 14.824  83.831 68.366 1.00 42.19 ? 428  SER A O   1 
ATOM   3320 C CB  . SER A 1 428 ? 16.416  84.555 65.750 1.00 38.62 ? 428  SER A CB  1 
ATOM   3321 O OG  . SER A 1 428 ? 15.453  85.043 64.815 1.00 40.72 ? 428  SER A OG  1 
ATOM   3322 N N   . ASN A 1 429 ? 13.546  83.242 66.625 1.00 40.75 ? 429  ASN A N   1 
ATOM   3323 C CA  . ASN A 1 429 ? 12.300  83.464 67.351 1.00 39.70 ? 429  ASN A CA  1 
ATOM   3324 C C   . ASN A 1 429 ? 11.611  82.187 67.812 1.00 39.28 ? 429  ASN A C   1 
ATOM   3325 O O   . ASN A 1 429 ? 10.383  82.218 68.062 1.00 39.09 ? 429  ASN A O   1 
ATOM   3326 C CB  . ASN A 1 429 ? 11.318  84.252 66.459 1.00 40.01 ? 429  ASN A CB  1 
ATOM   3327 C CG  . ASN A 1 429 ? 10.996  83.523 65.127 1.00 41.37 ? 429  ASN A CG  1 
ATOM   3328 O OD1 . ASN A 1 429 ? 11.455  82.391 64.888 1.00 39.33 ? 429  ASN A OD1 1 
ATOM   3329 N ND2 . ASN A 1 429 ? 10.207  84.182 64.260 1.00 38.16 ? 429  ASN A ND2 1 
ATOM   3330 N N   . LEU A 1 430 ? 12.341  81.071 67.926 1.00 36.66 ? 430  LEU A N   1 
ATOM   3331 C CA  . LEU A 1 430 ? 11.671  79.813 68.345 1.00 37.26 ? 430  LEU A CA  1 
ATOM   3332 C C   . LEU A 1 430 ? 11.019  79.894 69.728 1.00 36.19 ? 430  LEU A C   1 
ATOM   3333 O O   . LEU A 1 430 ? 11.655  80.345 70.679 1.00 35.77 ? 430  LEU A O   1 
ATOM   3334 C CB  . LEU A 1 430 ? 12.662  78.629 68.370 1.00 38.79 ? 430  LEU A CB  1 
ATOM   3335 C CG  . LEU A 1 430 ? 12.512  77.450 67.400 1.00 40.88 ? 430  LEU A CG  1 
ATOM   3336 C CD1 . LEU A 1 430 ? 12.901  76.234 68.189 1.00 41.74 ? 430  LEU A CD1 1 
ATOM   3337 C CD2 . LEU A 1 430 ? 11.128  77.256 66.845 1.00 40.82 ? 430  LEU A CD2 1 
ATOM   3338 N N   . VAL A 1 431 ? 9.776   79.438 69.866 1.00 34.21 ? 431  VAL A N   1 
ATOM   3339 C CA  . VAL A 1 431 ? 9.137   79.508 71.165 1.00 32.84 ? 431  VAL A CA  1 
ATOM   3340 C C   . VAL A 1 431 ? 9.445   78.277 72.026 1.00 33.67 ? 431  VAL A C   1 
ATOM   3341 O O   . VAL A 1 431 ? 9.221   78.286 73.246 1.00 34.16 ? 431  VAL A O   1 
ATOM   3342 C CB  . VAL A 1 431 ? 7.575   79.709 71.033 1.00 34.17 ? 431  VAL A CB  1 
ATOM   3343 C CG1 . VAL A 1 431 ? 7.278   80.955 70.142 1.00 33.73 ? 431  VAL A CG1 1 
ATOM   3344 C CG2 . VAL A 1 431 ? 6.908   78.471 70.388 1.00 32.67 ? 431  VAL A CG2 1 
ATOM   3345 N N   . TRP A 1 432 ? 9.960   77.224 71.398 1.00 32.45 ? 432  TRP A N   1 
ATOM   3346 C CA  . TRP A 1 432 ? 10.324  75.959 72.094 1.00 31.39 ? 432  TRP A CA  1 
ATOM   3347 C C   . TRP A 1 432 ? 11.669  76.090 72.843 1.00 29.55 ? 432  TRP A C   1 
ATOM   3348 O O   . TRP A 1 432 ? 12.525  76.870 72.432 1.00 31.05 ? 432  TRP A O   1 
ATOM   3349 C CB  . TRP A 1 432 ? 10.420  74.796 71.052 1.00 30.23 ? 432  TRP A CB  1 
ATOM   3350 C CG  . TRP A 1 432 ? 9.069   74.379 70.457 1.00 29.65 ? 432  TRP A CG  1 
ATOM   3351 C CD1 . TRP A 1 432 ? 8.586   74.662 69.199 1.00 29.51 ? 432  TRP A CD1 1 
ATOM   3352 C CD2 . TRP A 1 432 ? 8.031   73.654 71.130 1.00 27.88 ? 432  TRP A CD2 1 
ATOM   3353 N NE1 . TRP A 1 432 ? 7.307   74.147 69.058 1.00 30.24 ? 432  TRP A NE1 1 
ATOM   3354 C CE2 . TRP A 1 432 ? 6.947   73.526 70.224 1.00 28.81 ? 432  TRP A CE2 1 
ATOM   3355 C CE3 . TRP A 1 432 ? 7.911   73.103 72.414 1.00 28.97 ? 432  TRP A CE3 1 
ATOM   3356 C CZ2 . TRP A 1 432 ? 5.762   72.862 70.562 1.00 27.93 ? 432  TRP A CZ2 1 
ATOM   3357 C CZ3 . TRP A 1 432 ? 6.744   72.445 72.758 1.00 27.69 ? 432  TRP A CZ3 1 
ATOM   3358 C CH2 . TRP A 1 432 ? 5.678   72.326 71.826 1.00 29.90 ? 432  TRP A CH2 1 
ATOM   3359 N N   . PRO A 1 433 ? 11.882  75.322 73.931 1.00 29.55 ? 433  PRO A N   1 
ATOM   3360 C CA  . PRO A 1 433 ? 13.164  75.466 74.623 1.00 30.31 ? 433  PRO A CA  1 
ATOM   3361 C C   . PRO A 1 433 ? 14.341  75.017 73.770 1.00 32.67 ? 433  PRO A C   1 
ATOM   3362 O O   . PRO A 1 433 ? 14.218  74.210 72.806 1.00 34.18 ? 433  PRO A O   1 
ATOM   3363 C CB  . PRO A 1 433 ? 13.008  74.577 75.848 1.00 28.62 ? 433  PRO A CB  1 
ATOM   3364 C CG  . PRO A 1 433 ? 12.086  73.445 75.264 1.00 28.62 ? 433  PRO A CG  1 
ATOM   3365 C CD  . PRO A 1 433 ? 11.063  74.277 74.581 1.00 28.08 ? 433  PRO A CD  1 
ATOM   3366 N N   . GLU A 1 434 ? 15.485  75.536 74.159 1.00 32.50 ? 434  GLU A N   1 
ATOM   3367 C CA  . GLU A 1 434 ? 16.773  75.278 73.534 1.00 34.81 ? 434  GLU A CA  1 
ATOM   3368 C C   . GLU A 1 434 ? 17.121  73.816 73.340 1.00 31.59 ? 434  GLU A C   1 
ATOM   3369 O O   . GLU A 1 434 ? 17.683  73.405 72.297 1.00 29.53 ? 434  GLU A O   1 
ATOM   3370 C CB  . GLU A 1 434 ? 17.877  75.852 74.421 1.00 38.84 ? 434  GLU A CB  1 
ATOM   3371 C CG  . GLU A 1 434 ? 18.913  76.526 73.613 1.00 46.47 ? 434  GLU A CG  1 
ATOM   3372 C CD  . GLU A 1 434 ? 18.411  77.897 73.192 1.00 52.85 ? 434  GLU A CD  1 
ATOM   3373 O OE1 . GLU A 1 434 ? 18.090  78.682 74.128 1.00 57.00 ? 434  GLU A OE1 1 
ATOM   3374 N N   . TRP A 1 435 ? 16.848  73.039 74.375 1.00 28.45 ? 435  TRP A N   1 
ATOM   3375 C CA  . TRP A 1 435 ? 17.219  71.638 74.322 1.00 29.94 ? 435  TRP A CA  1 
ATOM   3376 C C   . TRP A 1 435 ? 16.643  70.884 73.098 1.00 29.65 ? 435  TRP A C   1 
ATOM   3377 O O   . TRP A 1 435 ? 17.250  69.934 72.640 1.00 29.33 ? 435  TRP A O   1 
ATOM   3378 C CB  . TRP A 1 435 ? 16.879  70.923 75.640 1.00 28.40 ? 435  TRP A CB  1 
ATOM   3379 C CG  . TRP A 1 435 ? 15.415  70.608 75.894 1.00 30.56 ? 435  TRP A CG  1 
ATOM   3380 C CD1 . TRP A 1 435 ? 14.582  71.255 76.765 1.00 29.16 ? 435  TRP A CD1 1 
ATOM   3381 C CD2 . TRP A 1 435 ? 14.651  69.476 75.373 1.00 29.77 ? 435  TRP A CD2 1 
ATOM   3382 N NE1 . TRP A 1 435 ? 13.365  70.605 76.832 1.00 31.08 ? 435  TRP A NE1 1 
ATOM   3383 C CE2 . TRP A 1 435 ? 13.376  69.517 75.990 1.00 29.64 ? 435  TRP A CE2 1 
ATOM   3384 C CE3 . TRP A 1 435 ? 14.932  68.445 74.456 1.00 28.13 ? 435  TRP A CE3 1 
ATOM   3385 C CZ2 . TRP A 1 435 ? 12.364  68.560 75.721 1.00 30.22 ? 435  TRP A CZ2 1 
ATOM   3386 C CZ3 . TRP A 1 435 ? 13.933  67.481 74.182 1.00 30.35 ? 435  TRP A CZ3 1 
ATOM   3387 C CH2 . TRP A 1 435 ? 12.660  67.550 74.818 1.00 29.82 ? 435  TRP A CH2 1 
ATOM   3388 N N   . MET A 1 436 ? 15.535  71.363 72.531 1.00 28.82 ? 436  MET A N   1 
ATOM   3389 C CA  . MET A 1 436 ? 14.918  70.659 71.415 1.00 29.30 ? 436  MET A CA  1 
ATOM   3390 C C   . MET A 1 436 ? 15.613  70.898 70.081 1.00 27.97 ? 436  MET A C   1 
ATOM   3391 O O   . MET A 1 436 ? 15.352  70.198 69.101 1.00 26.13 ? 436  MET A O   1 
ATOM   3392 C CB  . MET A 1 436 ? 13.424  71.002 71.342 1.00 28.46 ? 436  MET A CB  1 
ATOM   3393 C CG  . MET A 1 436 ? 12.621  70.475 72.570 1.00 28.96 ? 436  MET A CG  1 
ATOM   3394 S SD  . MET A 1 436 ? 10.925  71.165 72.645 1.00 30.65 ? 436  MET A SD  1 
ATOM   3395 C CE  . MET A 1 436 ? 10.131  70.151 71.314 1.00 31.27 ? 436  MET A CE  1 
ATOM   3396 N N   . GLY A 1 437 ? 16.508  71.878 70.049 1.00 29.04 ? 437  GLY A N   1 
ATOM   3397 C CA  . GLY A 1 437 ? 17.300  72.143 68.839 1.00 27.12 ? 437  GLY A CA  1 
ATOM   3398 C C   . GLY A 1 437 ? 16.547  72.545 67.576 1.00 28.04 ? 437  GLY A C   1 
ATOM   3399 O O   . GLY A 1 437 ? 15.707  73.422 67.595 1.00 28.36 ? 437  GLY A O   1 
ATOM   3400 N N   . VAL A 1 438 ? 16.891  71.917 66.464 1.00 28.21 ? 438  VAL A N   1 
ATOM   3401 C CA  . VAL A 1 438 ? 16.265  72.199 65.190 1.00 29.59 ? 438  VAL A CA  1 
ATOM   3402 C C   . VAL A 1 438 ? 15.232  71.083 65.024 1.00 29.96 ? 438  VAL A C   1 
ATOM   3403 O O   . VAL A 1 438 ? 15.505  69.949 64.548 1.00 29.08 ? 438  VAL A O   1 
ATOM   3404 C CB  . VAL A 1 438 ? 17.326  72.184 64.100 1.00 30.89 ? 438  VAL A CB  1 
ATOM   3405 C CG1 . VAL A 1 438 ? 16.701  72.601 62.737 1.00 30.47 ? 438  VAL A CG1 1 
ATOM   3406 C CG2 . VAL A 1 438 ? 18.427  73.177 64.496 1.00 30.73 ? 438  VAL A CG2 1 
ATOM   3407 N N   . ILE A 1 439 ? 14.044  71.455 65.465 1.00 29.85 ? 439  ILE A N   1 
ATOM   3408 C CA  . ILE A 1 439 ? 12.870  70.613 65.576 1.00 27.98 ? 439  ILE A CA  1 
ATOM   3409 C C   . ILE A 1 439 ? 12.180  70.094 64.336 1.00 28.74 ? 439  ILE A C   1 
ATOM   3410 O O   . ILE A 1 439 ? 12.146  70.754 63.288 1.00 28.58 ? 439  ILE A O   1 
ATOM   3411 C CB  . ILE A 1 439 ? 11.873  71.368 66.446 1.00 28.42 ? 439  ILE A CB  1 
ATOM   3412 C CG1 . ILE A 1 439 ? 12.569  71.691 67.790 1.00 26.27 ? 439  ILE A CG1 1 
ATOM   3413 C CG2 . ILE A 1 439 ? 10.577  70.576 66.680 1.00 25.80 ? 439  ILE A CG2 1 
ATOM   3414 C CD1 . ILE A 1 439 ? 11.666  72.534 68.693 1.00 24.29 ? 439  ILE A CD1 1 
ATOM   3415 N N   . HIS A 1 440 ? 11.653  68.875 64.467 1.00 26.54 ? 440  HIS A N   1 
ATOM   3416 C CA  . HIS A 1 440 ? 10.896  68.233 63.406 1.00 26.81 ? 440  HIS A CA  1 
ATOM   3417 C C   . HIS A 1 440 ? 9.767   69.198 63.013 1.00 27.92 ? 440  HIS A C   1 
ATOM   3418 O O   . HIS A 1 440 ? 8.940   69.577 63.856 1.00 28.74 ? 440  HIS A O   1 
ATOM   3419 C CB  . HIS A 1 440 ? 10.306  66.965 63.968 1.00 25.29 ? 440  HIS A CB  1 
ATOM   3420 C CG  . HIS A 1 440 ? 9.598   66.113 62.977 1.00 26.75 ? 440  HIS A CG  1 
ATOM   3421 N ND1 . HIS A 1 440 ? 10.227  65.571 61.875 1.00 24.40 ? 440  HIS A ND1 1 
ATOM   3422 C CD2 . HIS A 1 440 ? 8.332   65.611 62.985 1.00 26.58 ? 440  HIS A CD2 1 
ATOM   3423 C CE1 . HIS A 1 440 ? 9.379   64.763 61.254 1.00 27.12 ? 440  HIS A CE1 1 
ATOM   3424 N NE2 . HIS A 1 440 ? 8.225   64.769 61.908 1.00 26.70 ? 440  HIS A NE2 1 
ATOM   3425 N N   . GLY A 1 441 ? 9.744   69.571 61.736 1.00 27.98 ? 441  GLY A N   1 
ATOM   3426 C CA  . GLY A 1 441 ? 8.729   70.460 61.211 1.00 27.55 ? 441  GLY A CA  1 
ATOM   3427 C C   . GLY A 1 441 ? 9.110   71.945 61.103 1.00 29.36 ? 441  GLY A C   1 
ATOM   3428 O O   . GLY A 1 441 ? 8.396   72.725 60.436 1.00 26.77 ? 441  GLY A O   1 
ATOM   3429 N N   . TYR A 1 442 ? 10.242  72.329 61.694 1.00 28.54 ? 442  TYR A N   1 
ATOM   3430 C CA  . TYR A 1 442 ? 10.611  73.727 61.701 1.00 29.16 ? 442  TYR A CA  1 
ATOM   3431 C C   . TYR A 1 442 ? 11.395  74.265 60.528 1.00 30.27 ? 442  TYR A C   1 
ATOM   3432 O O   . TYR A 1 442 ? 11.861  75.425 60.576 1.00 30.48 ? 442  TYR A O   1 
ATOM   3433 C CB  . TYR A 1 442 ? 11.235  74.102 63.057 1.00 30.65 ? 442  TYR A CB  1 
ATOM   3434 C CG  . TYR A 1 442 ? 10.108  74.250 64.089 1.00 32.16 ? 442  TYR A CG  1 
ATOM   3435 C CD1 . TYR A 1 442 ? 9.483   73.114 64.635 1.00 32.34 ? 442  TYR A CD1 1 
ATOM   3436 C CD2 . TYR A 1 442 ? 9.537   75.507 64.368 1.00 33.04 ? 442  TYR A CD2 1 
ATOM   3437 C CE1 . TYR A 1 442 ? 8.314   73.226 65.419 1.00 31.86 ? 442  TYR A CE1 1 
ATOM   3438 C CE2 . TYR A 1 442 ? 8.350   75.625 65.149 1.00 31.24 ? 442  TYR A CE2 1 
ATOM   3439 C CZ  . TYR A 1 442 ? 7.746   74.474 65.661 1.00 33.09 ? 442  TYR A CZ  1 
ATOM   3440 O OH  . TYR A 1 442 ? 6.531   74.551 66.336 1.00 32.14 ? 442  TYR A OH  1 
ATOM   3441 N N   . GLU A 1 443 ? 11.569  73.438 59.482 1.00 28.07 ? 443  GLU A N   1 
ATOM   3442 C CA  . GLU A 1 443 ? 12.165  73.959 58.239 1.00 27.83 ? 443  GLU A CA  1 
ATOM   3443 C C   . GLU A 1 443 ? 10.952  74.414 57.354 1.00 28.32 ? 443  GLU A C   1 
ATOM   3444 O O   . GLU A 1 443 ? 11.087  75.169 56.385 1.00 28.89 ? 443  GLU A O   1 
ATOM   3445 C CB  . GLU A 1 443 ? 12.973  72.887 57.484 1.00 27.26 ? 443  GLU A CB  1 
ATOM   3446 C CG  . GLU A 1 443 ? 12.149  72.025 56.498 1.00 27.13 ? 443  GLU A CG  1 
ATOM   3447 C CD  . GLU A 1 443 ? 11.122  71.080 57.197 1.00 30.36 ? 443  GLU A CD  1 
ATOM   3448 O OE1 . GLU A 1 443 ? 11.126  70.980 58.457 1.00 29.41 ? 443  GLU A OE1 1 
ATOM   3449 O OE2 . GLU A 1 443 ? 10.329  70.423 56.473 1.00 29.61 ? 443  GLU A OE2 1 
ATOM   3450 N N   . ILE A 1 444 ? 9.745   74.016 57.734 1.00 28.88 ? 444  ILE A N   1 
ATOM   3451 C CA  . ILE A 1 444 ? 8.579   74.330 56.915 1.00 28.90 ? 444  ILE A CA  1 
ATOM   3452 C C   . ILE A 1 444 ? 8.329   75.849 56.728 1.00 30.19 ? 444  ILE A C   1 
ATOM   3453 O O   . ILE A 1 444 ? 8.117   76.335 55.601 1.00 28.49 ? 444  ILE A O   1 
ATOM   3454 C CB  . ILE A 1 444 ? 7.312   73.639 57.511 1.00 28.45 ? 444  ILE A CB  1 
ATOM   3455 C CG1 . ILE A 1 444 ? 7.479   72.097 57.435 1.00 25.76 ? 444  ILE A CG1 1 
ATOM   3456 C CG2 . ILE A 1 444 ? 6.047   74.176 56.777 1.00 27.82 ? 444  ILE A CG2 1 
ATOM   3457 C CD1 . ILE A 1 444 ? 6.286   71.272 58.000 1.00 23.98 ? 444  ILE A CD1 1 
ATOM   3458 N N   . GLU A 1 445 ? 8.358   76.575 57.844 1.00 30.04 ? 445  GLU A N   1 
ATOM   3459 C CA  . GLU A 1 445 ? 8.139   78.012 57.817 1.00 31.08 ? 445  GLU A CA  1 
ATOM   3460 C C   . GLU A 1 445 ? 9.137   78.714 56.867 1.00 30.90 ? 445  GLU A C   1 
ATOM   3461 O O   . GLU A 1 445 ? 8.812   79.765 56.276 1.00 30.15 ? 445  GLU A O   1 
ATOM   3462 C CB  . GLU A 1 445 ? 8.206   78.577 59.256 1.00 30.83 ? 445  GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 445 ? 9.522   78.275 60.010 1.00 31.19 ? 445  GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 445 ? 9.327   78.369 61.525 1.00 31.58 ? 445  GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 445 ? 8.427   77.662 62.044 1.00 31.47 ? 445  GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 445 ? 10.061  79.136 62.203 1.00 30.61 ? 445  GLU A OE2 1 
ATOM   3467 N N   . PHE A 1 446 ? 10.317  78.122 56.682 1.00 30.65 ? 446  PHE A N   1 
ATOM   3468 C CA  . PHE A 1 446 ? 11.292  78.702 55.773 1.00 30.91 ? 446  PHE A CA  1 
ATOM   3469 C C   . PHE A 1 446 ? 10.935  78.327 54.323 1.00 32.22 ? 446  PHE A C   1 
ATOM   3470 O O   . PHE A 1 446 ? 11.135  79.139 53.393 1.00 32.87 ? 446  PHE A O   1 
ATOM   3471 C CB  . PHE A 1 446 ? 12.720  78.208 56.072 1.00 31.60 ? 446  PHE A CB  1 
ATOM   3472 C CG  . PHE A 1 446 ? 13.362  78.887 57.265 1.00 34.85 ? 446  PHE A CG  1 
ATOM   3473 C CD1 . PHE A 1 446 ? 13.110  78.432 58.569 1.00 32.45 ? 446  PHE A CD1 1 
ATOM   3474 C CD2 . PHE A 1 446 ? 14.134  80.063 57.086 1.00 35.14 ? 446  PHE A CD2 1 
ATOM   3475 C CE1 . PHE A 1 446 ? 13.590  79.132 59.677 1.00 33.62 ? 446  PHE A CE1 1 
ATOM   3476 C CE2 . PHE A 1 446 ? 14.629  80.776 58.203 1.00 34.77 ? 446  PHE A CE2 1 
ATOM   3477 C CZ  . PHE A 1 446 ? 14.348  80.305 59.501 1.00 34.10 ? 446  PHE A CZ  1 
ATOM   3478 N N   . VAL A 1 447 ? 10.406  77.109 54.118 1.00 30.76 ? 447  VAL A N   1 
ATOM   3479 C CA  . VAL A 1 447 ? 10.042  76.688 52.771 1.00 30.11 ? 447  VAL A CA  1 
ATOM   3480 C C   . VAL A 1 447 ? 8.866   77.509 52.258 1.00 31.61 ? 447  VAL A C   1 
ATOM   3481 O O   . VAL A 1 447 ? 8.786   77.804 51.053 1.00 30.32 ? 447  VAL A O   1 
ATOM   3482 C CB  . VAL A 1 447 ? 9.656   75.176 52.723 1.00 29.00 ? 447  VAL A CB  1 
ATOM   3483 C CG1 . VAL A 1 447 ? 8.943   74.844 51.414 1.00 27.33 ? 447  VAL A CG1 1 
ATOM   3484 C CG2 . VAL A 1 447 ? 10.955  74.297 52.855 1.00 28.77 ? 447  VAL A CG2 1 
ATOM   3485 N N   . PHE A 1 448 ? 7.953   77.846 53.179 1.00 31.10 ? 448  PHE A N   1 
ATOM   3486 C CA  . PHE A 1 448 ? 6.768   78.605 52.823 1.00 32.51 ? 448  PHE A CA  1 
ATOM   3487 C C   . PHE A 1 448 ? 6.958   80.125 52.955 1.00 33.34 ? 448  PHE A C   1 
ATOM   3488 O O   . PHE A 1 448 ? 6.039   80.900 52.736 1.00 34.22 ? 448  PHE A O   1 
ATOM   3489 C CB  . PHE A 1 448 ? 5.571   78.110 53.636 1.00 30.83 ? 448  PHE A CB  1 
ATOM   3490 C CG  . PHE A 1 448 ? 4.938   76.899 53.053 1.00 32.69 ? 448  PHE A CG  1 
ATOM   3491 C CD1 . PHE A 1 448 ? 5.468   75.618 53.303 1.00 31.86 ? 448  PHE A CD1 1 
ATOM   3492 C CD2 . PHE A 1 448 ? 3.817   77.017 52.224 1.00 32.58 ? 448  PHE A CD2 1 
ATOM   3493 C CE1 . PHE A 1 448 ? 4.879   74.456 52.729 1.00 32.09 ? 448  PHE A CE1 1 
ATOM   3494 C CE2 . PHE A 1 448 ? 3.218   75.867 51.647 1.00 31.81 ? 448  PHE A CE2 1 
ATOM   3495 C CZ  . PHE A 1 448 ? 3.750   74.582 51.898 1.00 31.39 ? 448  PHE A CZ  1 
ATOM   3496 N N   . GLY A 1 449 ? 8.169   80.516 53.334 1.00 33.62 ? 449  GLY A N   1 
ATOM   3497 C CA  . GLY A 1 449 ? 8.539   81.911 53.392 1.00 35.26 ? 449  GLY A CA  1 
ATOM   3498 C C   . GLY A 1 449 ? 8.015   82.848 54.452 1.00 35.02 ? 449  GLY A C   1 
ATOM   3499 O O   . GLY A 1 449 ? 7.965   84.037 54.179 1.00 35.08 ? 449  GLY A O   1 
ATOM   3500 N N   . LEU A 1 450 ? 7.633   82.341 55.619 1.00 36.33 ? 450  LEU A N   1 
ATOM   3501 C CA  . LEU A 1 450 ? 7.160   83.180 56.724 1.00 37.61 ? 450  LEU A CA  1 
ATOM   3502 C C   . LEU A 1 450 ? 8.203   84.261 57.156 1.00 38.22 ? 450  LEU A C   1 
ATOM   3503 O O   . LEU A 1 450 ? 7.833   85.350 57.617 1.00 38.95 ? 450  LEU A O   1 
ATOM   3504 C CB  . LEU A 1 450 ? 6.764   82.311 57.920 1.00 36.71 ? 450  LEU A CB  1 
ATOM   3505 C CG  . LEU A 1 450 ? 5.462   81.491 57.831 1.00 39.31 ? 450  LEU A CG  1 
ATOM   3506 C CD1 . LEU A 1 450 ? 4.263   82.379 57.780 1.00 39.72 ? 450  LEU A CD1 1 
ATOM   3507 C CD2 . LEU A 1 450 ? 5.471   80.646 56.573 1.00 39.16 ? 450  LEU A CD2 1 
ATOM   3508 N N   . PRO A 1 451 ? 9.508   83.973 57.025 1.00 38.66 ? 451  PRO A N   1 
ATOM   3509 C CA  . PRO A 1 451 ? 10.513  84.974 57.409 1.00 40.20 ? 451  PRO A CA  1 
ATOM   3510 C C   . PRO A 1 451 ? 10.449  86.248 56.545 1.00 42.23 ? 451  PRO A C   1 
ATOM   3511 O O   . PRO A 1 451 ? 11.082  87.239 56.864 1.00 41.94 ? 451  PRO A O   1 
ATOM   3512 C CB  . PRO A 1 451 ? 11.831  84.236 57.228 1.00 38.40 ? 451  PRO A CB  1 
ATOM   3513 C CG  . PRO A 1 451 ? 11.458  82.854 57.629 1.00 39.13 ? 451  PRO A CG  1 
ATOM   3514 C CD  . PRO A 1 451 ? 10.141  82.655 56.875 1.00 39.27 ? 451  PRO A CD  1 
ATOM   3515 N N   . LEU A 1 452 ? 9.719   86.207 55.436 1.00 44.05 ? 452  LEU A N   1 
ATOM   3516 C CA  . LEU A 1 452 ? 9.568   87.393 54.613 1.00 45.36 ? 452  LEU A CA  1 
ATOM   3517 C C   . LEU A 1 452 ? 8.602   88.379 55.269 1.00 46.10 ? 452  LEU A C   1 
ATOM   3518 O O   . LEU A 1 452 ? 8.599   89.537 54.891 1.00 46.52 ? 452  LEU A O   1 
ATOM   3519 C CB  . LEU A 1 452 ? 9.009   87.075 53.232 1.00 46.82 ? 452  LEU A CB  1 
ATOM   3520 C CG  . LEU A 1 452 ? 9.876   86.372 52.213 1.00 49.45 ? 452  LEU A CG  1 
ATOM   3521 C CD1 . LEU A 1 452 ? 9.400   86.763 50.783 1.00 51.12 ? 452  LEU A CD1 1 
ATOM   3522 C CD2 . LEU A 1 452 ? 11.298  86.792 52.429 1.00 53.00 ? 452  LEU A CD2 1 
ATOM   3523 N N   . VAL A 1 453 ? 7.767   87.946 56.216 1.00 46.41 ? 453  VAL A N   1 
ATOM   3524 C CA  . VAL A 1 453 ? 6.854   88.900 56.839 1.00 46.74 ? 453  VAL A CA  1 
ATOM   3525 C C   . VAL A 1 453 ? 7.365   89.454 58.172 1.00 46.52 ? 453  VAL A C   1 
ATOM   3526 O O   . VAL A 1 453 ? 7.432   88.762 59.228 1.00 43.80 ? 453  VAL A O   1 
ATOM   3527 C CB  . VAL A 1 453 ? 5.404   88.343 56.974 1.00 48.63 ? 453  VAL A CB  1 
ATOM   3528 C CG1 . VAL A 1 453 ? 5.248   87.047 56.170 1.00 48.95 ? 453  VAL A CG1 1 
ATOM   3529 C CG2 . VAL A 1 453 ? 5.008   88.209 58.411 1.00 48.64 ? 453  VAL A CG2 1 
ATOM   3530 N N   . LYS A 1 454 ? 7.739   90.733 58.074 1.00 45.96 ? 454  LYS A N   1 
ATOM   3531 C CA  . LYS A 1 454 ? 8.316   91.517 59.167 1.00 46.42 ? 454  LYS A CA  1 
ATOM   3532 C C   . LYS A 1 454 ? 7.705   91.261 60.543 1.00 45.85 ? 454  LYS A C   1 
ATOM   3533 O O   . LYS A 1 454 ? 8.432   90.990 61.484 1.00 44.36 ? 454  LYS A O   1 
ATOM   3534 C CB  . LYS A 1 454 ? 8.270   93.025 58.811 1.00 47.06 ? 454  LYS A CB  1 
ATOM   3535 N N   . GLU A 1 455 ? 6.381   91.316 60.659 1.00 47.10 ? 455  GLU A N   1 
ATOM   3536 C CA  . GLU A 1 455 ? 5.756   91.078 61.945 1.00 49.42 ? 455  GLU A CA  1 
ATOM   3537 C C   . GLU A 1 455 ? 6.124   89.748 62.595 1.00 50.26 ? 455  GLU A C   1 
ATOM   3538 O O   . GLU A 1 455 ? 6.027   89.626 63.810 1.00 51.38 ? 455  GLU A O   1 
ATOM   3539 C CB  . GLU A 1 455 ? 4.235   91.154 61.853 1.00 51.34 ? 455  GLU A CB  1 
ATOM   3540 C CG  . GLU A 1 455 ? 3.760   92.375 61.151 1.00 56.26 ? 455  GLU A CG  1 
ATOM   3541 C CD  . GLU A 1 455 ? 3.967   92.256 59.656 1.00 58.99 ? 455  GLU A CD  1 
ATOM   3542 O OE1 . GLU A 1 455 ? 3.145   91.547 59.022 1.00 60.11 ? 455  GLU A OE1 1 
ATOM   3543 O OE2 . GLU A 1 455 ? 4.947   92.844 59.123 1.00 60.57 ? 455  GLU A OE2 1 
ATOM   3544 N N   . LEU A 1 456 ? 6.538   88.744 61.826 1.00 49.67 ? 456  LEU A N   1 
ATOM   3545 C CA  . LEU A 1 456 ? 6.872   87.477 62.466 1.00 48.89 ? 456  LEU A CA  1 
ATOM   3546 C C   . LEU A 1 456 ? 8.241   87.528 63.143 1.00 49.44 ? 456  LEU A C   1 
ATOM   3547 O O   . LEU A 1 456 ? 8.757   86.538 63.650 1.00 50.33 ? 456  LEU A O   1 
ATOM   3548 C CB  . LEU A 1 456 ? 6.783   86.327 61.463 1.00 47.46 ? 456  LEU A CB  1 
ATOM   3549 C CG  . LEU A 1 456 ? 5.355   86.137 60.951 1.00 46.39 ? 456  LEU A CG  1 
ATOM   3550 C CD1 . LEU A 1 456 ? 5.339   84.983 59.930 1.00 45.91 ? 456  LEU A CD1 1 
ATOM   3551 C CD2 . LEU A 1 456 ? 4.402   85.898 62.124 1.00 42.43 ? 456  LEU A CD2 1 
ATOM   3552 N N   . ASN A 1 457 ? 8.863   88.687 63.116 1.00 49.48 ? 457  ASN A N   1 
ATOM   3553 C CA  . ASN A 1 457 ? 10.103  88.834 63.845 1.00 48.19 ? 457  ASN A CA  1 
ATOM   3554 C C   . ASN A 1 457 ? 11.280  87.926 63.514 1.00 47.14 ? 457  ASN A C   1 
ATOM   3555 O O   . ASN A 1 457 ? 11.944  87.468 64.443 1.00 47.13 ? 457  ASN A O   1 
ATOM   3556 C CB  . ASN A 1 457 ? 9.814   88.675 65.353 1.00 49.56 ? 457  ASN A CB  1 
ATOM   3557 C CG  . ASN A 1 457 ? 8.812   89.704 65.896 1.00 51.16 ? 457  ASN A CG  1 
ATOM   3558 O OD1 . ASN A 1 457 ? 8.193   89.491 66.944 1.00 53.01 ? 457  ASN A OD1 1 
ATOM   3559 N ND2 . ASN A 1 457 ? 8.661   90.819 65.199 1.00 51.27 ? 457  ASN A ND2 1 
ATOM   3560 N N   . TYR A 1 458 ? 11.554  87.626 62.254 1.00 44.66 ? 458  TYR A N   1 
ATOM   3561 C CA  . TYR A 1 458 ? 12.752  86.826 61.971 1.00 42.66 ? 458  TYR A CA  1 
ATOM   3562 C C   . TYR A 1 458 ? 13.887  87.834 61.691 1.00 43.56 ? 458  TYR A C   1 
ATOM   3563 O O   . TYR A 1 458 ? 13.643  89.030 61.549 1.00 44.06 ? 458  TYR A O   1 
ATOM   3564 C CB  . TYR A 1 458 ? 12.580  85.932 60.728 1.00 40.51 ? 458  TYR A CB  1 
ATOM   3565 C CG  . TYR A 1 458 ? 11.647  84.752 60.893 1.00 39.44 ? 458  TYR A CG  1 
ATOM   3566 C CD1 . TYR A 1 458 ? 10.273  84.895 60.730 1.00 37.56 ? 458  TYR A CD1 1 
ATOM   3567 C CD2 . TYR A 1 458 ? 12.147  83.492 61.217 1.00 37.90 ? 458  TYR A CD2 1 
ATOM   3568 C CE1 . TYR A 1 458 ? 9.412   83.820 60.883 1.00 37.10 ? 458  TYR A CE1 1 
ATOM   3569 C CE2 . TYR A 1 458 ? 11.301  82.409 61.374 1.00 37.88 ? 458  TYR A CE2 1 
ATOM   3570 C CZ  . TYR A 1 458 ? 9.927   82.568 61.209 1.00 38.48 ? 458  TYR A CZ  1 
ATOM   3571 O OH  . TYR A 1 458 ? 9.062   81.475 61.363 1.00 34.98 ? 458  TYR A OH  1 
ATOM   3572 N N   . THR A 1 459 ? 15.122  87.360 61.595 1.00 43.61 ? 459  THR A N   1 
ATOM   3573 C CA  . THR A 1 459 ? 16.233  88.253 61.307 1.00 43.93 ? 459  THR A CA  1 
ATOM   3574 C C   . THR A 1 459 ? 16.403  88.380 59.802 1.00 44.46 ? 459  THR A C   1 
ATOM   3575 O O   . THR A 1 459 ? 15.928  87.532 59.028 1.00 43.67 ? 459  THR A O   1 
ATOM   3576 C CB  . THR A 1 459 ? 17.576  87.697 61.784 1.00 44.27 ? 459  THR A CB  1 
ATOM   3577 O OG1 . THR A 1 459 ? 17.839  86.483 61.062 1.00 43.67 ? 459  THR A OG1 1 
ATOM   3578 C CG2 . THR A 1 459 ? 17.575  87.463 63.303 1.00 44.73 ? 459  THR A CG2 1 
ATOM   3579 N N   . ALA A 1 460 ? 17.139  89.413 59.398 1.00 43.13 ? 460  ALA A N   1 
ATOM   3580 C CA  . ALA A 1 460 ? 17.418  89.651 57.994 1.00 42.13 ? 460  ALA A CA  1 
ATOM   3581 C C   . ALA A 1 460 ? 18.090  88.418 57.405 1.00 41.15 ? 460  ALA A C   1 
ATOM   3582 O O   . ALA A 1 460 ? 17.844  88.050 56.256 1.00 41.81 ? 460  ALA A O   1 
ATOM   3583 C CB  . ALA A 1 460 ? 18.342  90.859 57.823 1.00 39.90 ? 460  ALA A CB  1 
ATOM   3584 N N   . GLU A 1 461 ? 18.964  87.779 58.157 1.00 39.60 ? 461  GLU A N   1 
ATOM   3585 C CA  . GLU A 1 461 ? 19.595  86.624 57.559 1.00 40.08 ? 461  GLU A CA  1 
ATOM   3586 C C   . GLU A 1 461 ? 18.587  85.457 57.449 1.00 38.58 ? 461  GLU A C   1 
ATOM   3587 O O   . GLU A 1 461 ? 18.684  84.633 56.550 1.00 36.98 ? 461  GLU A O   1 
ATOM   3588 C CB  . GLU A 1 461 ? 20.890  86.244 58.318 1.00 42.27 ? 461  GLU A CB  1 
ATOM   3589 C CG  . GLU A 1 461 ? 20.930  86.692 59.776 1.00 47.65 ? 461  GLU A CG  1 
ATOM   3590 C CD  . GLU A 1 461 ? 21.181  88.196 59.943 1.00 48.65 ? 461  GLU A CD  1 
ATOM   3591 O OE1 . GLU A 1 461 ? 22.172  88.673 59.368 1.00 51.93 ? 461  GLU A OE1 1 
ATOM   3592 O OE2 . GLU A 1 461 ? 20.412  88.896 60.641 1.00 48.93 ? 461  GLU A OE2 1 
ATOM   3593 N N   . GLU A 1 462 ? 17.613  85.408 58.351 1.00 38.20 ? 462  GLU A N   1 
ATOM   3594 C CA  . GLU A 1 462 ? 16.612  84.368 58.269 1.00 38.23 ? 462  GLU A CA  1 
ATOM   3595 C C   . GLU A 1 462 ? 15.733  84.585 57.025 1.00 39.43 ? 462  GLU A C   1 
ATOM   3596 O O   . GLU A 1 462 ? 15.343  83.604 56.359 1.00 38.77 ? 462  GLU A O   1 
ATOM   3597 C CB  . GLU A 1 462 ? 15.810  84.286 59.578 1.00 36.69 ? 462  GLU A CB  1 
ATOM   3598 C CG  . GLU A 1 462 ? 16.637  83.519 60.650 1.00 35.24 ? 462  GLU A CG  1 
ATOM   3599 C CD  . GLU A 1 462 ? 16.030  83.577 62.037 1.00 36.93 ? 462  GLU A CD  1 
ATOM   3600 O OE1 . GLU A 1 462 ? 15.245  84.527 62.279 1.00 37.63 ? 462  GLU A OE1 1 
ATOM   3601 O OE2 . GLU A 1 462 ? 16.359  82.696 62.885 1.00 36.30 ? 462  GLU A OE2 1 
ATOM   3602 N N   . GLU A 1 463 ? 15.453  85.850 56.694 1.00 38.32 ? 463  GLU A N   1 
ATOM   3603 C CA  . GLU A 1 463 ? 14.689  86.169 55.500 1.00 38.26 ? 463  GLU A CA  1 
ATOM   3604 C C   . GLU A 1 463 ? 15.511  85.749 54.282 1.00 37.72 ? 463  GLU A C   1 
ATOM   3605 O O   . GLU A 1 463 ? 14.966  85.169 53.314 1.00 36.62 ? 463  GLU A O   1 
ATOM   3606 C CB  . GLU A 1 463 ? 14.382  87.672 55.400 1.00 40.25 ? 463  GLU A CB  1 
ATOM   3607 C CG  . GLU A 1 463 ? 14.160  88.101 53.944 1.00 43.52 ? 463  GLU A CG  1 
ATOM   3608 C CD  . GLU A 1 463 ? 13.450  89.423 53.780 1.00 44.38 ? 463  GLU A CD  1 
ATOM   3609 O OE1 . GLU A 1 463 ? 13.601  90.300 54.645 1.00 45.90 ? 463  GLU A OE1 1 
ATOM   3610 O OE2 . GLU A 1 463 ? 12.743  89.594 52.766 1.00 46.01 ? 463  GLU A OE2 1 
ATOM   3611 N N   . ALA A 1 464 ? 16.817  86.020 54.305 1.00 35.21 ? 464  ALA A N   1 
ATOM   3612 C CA  . ALA A 1 464 ? 17.635  85.613 53.148 1.00 34.75 ? 464  ALA A CA  1 
ATOM   3613 C C   . ALA A 1 464 ? 17.658  84.083 52.984 1.00 34.12 ? 464  ALA A C   1 
ATOM   3614 O O   . ALA A 1 464 ? 17.598  83.562 51.860 1.00 33.63 ? 464  ALA A O   1 
ATOM   3615 C CB  . ALA A 1 464 ? 19.099  86.156 53.251 1.00 32.24 ? 464  ALA A CB  1 
ATOM   3616 N N   . LEU A 1 465 ? 17.758  83.369 54.101 1.00 33.49 ? 465  LEU A N   1 
ATOM   3617 C CA  . LEU A 1 465 ? 17.764  81.905 54.047 1.00 33.93 ? 465  LEU A CA  1 
ATOM   3618 C C   . LEU A 1 465 ? 16.424  81.406 53.460 1.00 33.59 ? 465  LEU A C   1 
ATOM   3619 O O   . LEU A 1 465 ? 16.399  80.533 52.589 1.00 33.55 ? 465  LEU A O   1 
ATOM   3620 C CB  . LEU A 1 465 ? 17.957  81.332 55.460 1.00 33.01 ? 465  LEU A CB  1 
ATOM   3621 C CG  . LEU A 1 465 ? 17.812  79.802 55.568 1.00 29.93 ? 465  LEU A CG  1 
ATOM   3622 C CD1 . LEU A 1 465 ? 18.798  79.067 54.624 1.00 29.46 ? 465  LEU A CD1 1 
ATOM   3623 C CD2 . LEU A 1 465 ? 18.085  79.437 57.003 1.00 29.41 ? 465  LEU A CD2 1 
ATOM   3624 N N   . SER A 1 466 ? 15.319  81.972 53.939 1.00 33.17 ? 466  SER A N   1 
ATOM   3625 C CA  . SER A 1 466 ? 14.020  81.575 53.424 1.00 35.60 ? 466  SER A CA  1 
ATOM   3626 C C   . SER A 1 466 ? 13.976  81.842 51.911 1.00 37.48 ? 466  SER A C   1 
ATOM   3627 O O   . SER A 1 466 ? 13.548  80.963 51.122 1.00 37.51 ? 466  SER A O   1 
ATOM   3628 C CB  . SER A 1 466 ? 12.879  82.311 54.146 1.00 34.60 ? 466  SER A CB  1 
ATOM   3629 O OG  . SER A 1 466 ? 11.594  81.965 53.623 1.00 34.53 ? 466  SER A OG  1 
ATOM   3630 N N   . ARG A 1 467 ? 14.442  83.016 51.474 1.00 36.76 ? 467  ARG A N   1 
ATOM   3631 C CA  . ARG A 1 467 ? 14.400  83.267 50.033 1.00 36.44 ? 467  ARG A CA  1 
ATOM   3632 C C   . ARG A 1 467 ? 15.269  82.299 49.257 1.00 37.01 ? 467  ARG A C   1 
ATOM   3633 O O   . ARG A 1 467 ? 14.849  81.890 48.152 1.00 35.99 ? 467  ARG A O   1 
ATOM   3634 C CB  . ARG A 1 467 ? 14.768  84.725 49.644 1.00 37.91 ? 467  ARG A CB  1 
ATOM   3635 C CG  . ARG A 1 467 ? 13.687  85.785 49.995 1.00 38.02 ? 467  ARG A CG  1 
ATOM   3636 C CD  . ARG A 1 467 ? 14.207  87.258 49.801 1.00 38.10 ? 467  ARG A CD  1 
ATOM   3637 N NE  . ARG A 1 467 ? 13.177  88.209 50.214 1.00 37.76 ? 467  ARG A NE  1 
ATOM   3638 C CZ  . ARG A 1 467 ? 12.058  88.460 49.531 1.00 38.35 ? 467  ARG A CZ  1 
ATOM   3639 N NH1 . ARG A 1 467 ? 11.800  87.847 48.365 1.00 34.56 ? 467  ARG A NH1 1 
ATOM   3640 N NH2 . ARG A 1 467 ? 11.170  89.286 50.052 1.00 37.36 ? 467  ARG A NH2 1 
ATOM   3641 N N   . ARG A 1 468 ? 16.461  81.913 49.750 1.00 35.25 ? 468  ARG A N   1 
ATOM   3642 C CA  . ARG A 1 468 ? 17.186  80.934 48.922 1.00 35.48 ? 468  ARG A CA  1 
ATOM   3643 C C   . ARG A 1 468 ? 16.513  79.542 48.920 1.00 32.71 ? 468  ARG A C   1 
ATOM   3644 O O   . ARG A 1 468 ? 16.571  78.832 47.919 1.00 32.97 ? 468  ARG A O   1 
ATOM   3645 C CB  . ARG A 1 468 ? 18.676  80.718 49.311 1.00 38.53 ? 468  ARG A CB  1 
ATOM   3646 C CG  . ARG A 1 468 ? 19.217  81.593 50.383 1.00 43.49 ? 468  ARG A CG  1 
ATOM   3647 C CD  . ARG A 1 468 ? 20.765  81.543 50.386 1.00 45.94 ? 468  ARG A CD  1 
ATOM   3648 N NE  . ARG A 1 468 ? 21.293  80.189 50.296 1.00 46.43 ? 468  ARG A NE  1 
ATOM   3649 C CZ  . ARG A 1 468 ? 21.651  79.446 51.337 1.00 47.24 ? 468  ARG A CZ  1 
ATOM   3650 N NH1 . ARG A 1 468 ? 21.537  79.934 52.556 1.00 48.58 ? 468  ARG A NH1 1 
ATOM   3651 N NH2 . ARG A 1 468 ? 22.139  78.217 51.150 1.00 46.36 ? 468  ARG A NH2 1 
ATOM   3652 N N   . ILE A 1 469 ? 15.891  79.142 50.022 1.00 31.86 ? 469  ILE A N   1 
ATOM   3653 C CA  . ILE A 1 469 ? 15.249  77.812 50.060 1.00 30.42 ? 469  ILE A CA  1 
ATOM   3654 C C   . ILE A 1 469 ? 14.049  77.812 49.089 1.00 30.82 ? 469  ILE A C   1 
ATOM   3655 O O   . ILE A 1 469 ? 13.890  76.929 48.195 1.00 29.25 ? 469  ILE A O   1 
ATOM   3656 C CB  . ILE A 1 469 ? 14.845  77.451 51.560 1.00 29.97 ? 469  ILE A CB  1 
ATOM   3657 C CG1 . ILE A 1 469 ? 16.120  77.109 52.358 1.00 26.78 ? 469  ILE A CG1 1 
ATOM   3658 C CG2 . ILE A 1 469 ? 13.826  76.279 51.608 1.00 28.03 ? 469  ILE A CG2 1 
ATOM   3659 C CD1 . ILE A 1 469 ? 15.858  76.885 53.865 1.00 26.89 ? 469  ILE A CD1 1 
ATOM   3660 N N   . MET A 1 470 ? 13.226  78.839 49.213 1.00 32.40 ? 470  MET A N   1 
ATOM   3661 C CA  . MET A 1 470 ? 12.076  78.950 48.325 1.00 33.74 ? 470  MET A CA  1 
ATOM   3662 C C   . MET A 1 470 ? 12.523  78.890 46.856 1.00 34.79 ? 470  MET A C   1 
ATOM   3663 O O   . MET A 1 470 ? 11.881  78.211 45.997 1.00 32.89 ? 470  MET A O   1 
ATOM   3664 C CB  . MET A 1 470 ? 11.329  80.250 48.579 1.00 34.26 ? 470  MET A CB  1 
ATOM   3665 C CG  . MET A 1 470 ? 10.472  80.211 49.815 1.00 35.87 ? 470  MET A CG  1 
ATOM   3666 S SD  . MET A 1 470 ? 9.242   81.521 49.703 1.00 41.32 ? 470  MET A SD  1 
ATOM   3667 C CE  . MET A 1 470 ? 10.300  82.895 50.135 1.00 34.67 ? 470  MET A CE  1 
ATOM   3668 N N   . HIS A 1 471 ? 13.633  79.577 46.565 1.00 34.77 ? 471  HIS A N   1 
ATOM   3669 C CA  . HIS A 1 471 ? 14.107  79.582 45.191 1.00 34.02 ? 471  HIS A CA  1 
ATOM   3670 C C   . HIS A 1 471 ? 14.760  78.233 44.840 1.00 33.38 ? 471  HIS A C   1 
ATOM   3671 O O   . HIS A 1 471 ? 14.673  77.785 43.687 1.00 33.79 ? 471  HIS A O   1 
ATOM   3672 C CB  . HIS A 1 471 ? 15.062  80.772 44.919 1.00 34.70 ? 471  HIS A CB  1 
ATOM   3673 C CG  . HIS A 1 471 ? 15.323  81.007 43.458 1.00 35.81 ? 471  HIS A CG  1 
ATOM   3674 N ND1 . HIS A 1 471 ? 14.321  81.368 42.570 1.00 36.20 ? 471  HIS A ND1 1 
ATOM   3675 C CD2 . HIS A 1 471 ? 16.462  80.918 42.724 1.00 36.11 ? 471  HIS A CD2 1 
ATOM   3676 C CE1 . HIS A 1 471 ? 14.836  81.498 41.358 1.00 35.94 ? 471  HIS A CE1 1 
ATOM   3677 N NE2 . HIS A 1 471 ? 16.131  81.233 41.423 1.00 37.65 ? 471  HIS A NE2 1 
ATOM   3678 N N   . TYR A 1 472 ? 15.431  77.583 45.791 1.00 32.01 ? 472  TYR A N   1 
ATOM   3679 C CA  . TYR A 1 472 ? 15.975  76.252 45.463 1.00 31.79 ? 472  TYR A CA  1 
ATOM   3680 C C   . TYR A 1 472 ? 14.776  75.335 45.180 1.00 30.00 ? 472  TYR A C   1 
ATOM   3681 O O   . TYR A 1 472 ? 14.770  74.619 44.193 1.00 28.42 ? 472  TYR A O   1 
ATOM   3682 C CB  . TYR A 1 472 ? 16.690  75.583 46.615 1.00 31.30 ? 472  TYR A CB  1 
ATOM   3683 C CG  . TYR A 1 472 ? 18.033  76.136 46.968 1.00 33.29 ? 472  TYR A CG  1 
ATOM   3684 C CD1 . TYR A 1 472 ? 18.945  76.525 45.980 1.00 34.35 ? 472  TYR A CD1 1 
ATOM   3685 C CD2 . TYR A 1 472 ? 18.444  76.147 48.309 1.00 33.71 ? 472  TYR A CD2 1 
ATOM   3686 C CE1 . TYR A 1 472 ? 20.242  76.902 46.327 1.00 36.11 ? 472  TYR A CE1 1 
ATOM   3687 C CE2 . TYR A 1 472 ? 19.707  76.510 48.674 1.00 35.94 ? 472  TYR A CE2 1 
ATOM   3688 C CZ  . TYR A 1 472 ? 20.609  76.888 47.691 1.00 36.90 ? 472  TYR A CZ  1 
ATOM   3689 O OH  . TYR A 1 472 ? 21.844  77.254 48.124 1.00 39.18 ? 472  TYR A OH  1 
ATOM   3690 N N   . TRP A 1 473 ? 13.766  75.365 46.059 1.00 30.59 ? 473  TRP A N   1 
ATOM   3691 C CA  . TRP A 1 473 ? 12.623  74.472 45.870 1.00 30.27 ? 473  TRP A CA  1 
ATOM   3692 C C   . TRP A 1 473 ? 11.897  74.711 44.540 1.00 30.66 ? 473  TRP A C   1 
ATOM   3693 O O   . TRP A 1 473 ? 11.629  73.758 43.808 1.00 30.96 ? 473  TRP A O   1 
ATOM   3694 C CB  . TRP A 1 473 ? 11.628  74.577 47.028 1.00 27.44 ? 473  TRP A CB  1 
ATOM   3695 C CG  . TRP A 1 473 ? 11.756  73.553 48.192 1.00 28.32 ? 473  TRP A CG  1 
ATOM   3696 C CD1 . TRP A 1 473 ? 10.711  72.906 48.822 1.00 26.27 ? 473  TRP A CD1 1 
ATOM   3697 C CD2 . TRP A 1 473 ? 12.929  73.255 48.989 1.00 26.57 ? 473  TRP A CD2 1 
ATOM   3698 N NE1 . TRP A 1 473 ? 11.150  72.264 49.957 1.00 26.05 ? 473  TRP A NE1 1 
ATOM   3699 C CE2 . TRP A 1 473 ? 12.497  72.449 50.089 1.00 25.55 ? 473  TRP A CE2 1 
ATOM   3700 C CE3 . TRP A 1 473 ? 14.292  73.587 48.882 1.00 25.96 ? 473  TRP A CE3 1 
ATOM   3701 C CZ2 . TRP A 1 473 ? 13.384  71.969 51.084 1.00 25.43 ? 473  TRP A CZ2 1 
ATOM   3702 C CZ3 . TRP A 1 473 ? 15.187  73.104 49.880 1.00 26.52 ? 473  TRP A CZ3 1 
ATOM   3703 C CH2 . TRP A 1 473 ? 14.718  72.302 50.965 1.00 25.34 ? 473  TRP A CH2 1 
ATOM   3704 N N   . ALA A 1 474 ? 11.564  75.966 44.220 1.00 31.73 ? 474  ALA A N   1 
ATOM   3705 C CA  . ALA A 1 474 ? 10.856  76.260 42.957 1.00 30.23 ? 474  ALA A CA  1 
ATOM   3706 C C   . ALA A 1 474 ? 11.702  76.048 41.729 1.00 30.83 ? 474  ALA A C   1 
ATOM   3707 O O   . ALA A 1 474 ? 11.186  75.653 40.688 1.00 30.43 ? 474  ALA A O   1 
ATOM   3708 C CB  . ALA A 1 474 ? 10.303  77.682 42.956 1.00 29.66 ? 474  ALA A CB  1 
ATOM   3709 N N   . THR A 1 475 ? 13.002  76.301 41.827 1.00 31.60 ? 475  THR A N   1 
ATOM   3710 C CA  . THR A 1 475 ? 13.831  76.098 40.657 1.00 31.11 ? 475  THR A CA  1 
ATOM   3711 C C   . THR A 1 475 ? 13.953  74.613 40.407 1.00 32.51 ? 475  THR A C   1 
ATOM   3712 O O   . THR A 1 475 ? 13.971  74.152 39.246 1.00 32.95 ? 475  THR A O   1 
ATOM   3713 C CB  . THR A 1 475 ? 15.235  76.674 40.829 1.00 31.11 ? 475  THR A CB  1 
ATOM   3714 O OG1 . THR A 1 475 ? 15.138  78.083 41.108 1.00 29.90 ? 475  THR A OG1 1 
ATOM   3715 C CG2 . THR A 1 475 ? 16.056  76.414 39.543 1.00 28.33 ? 475  THR A CG2 1 
ATOM   3716 N N   . PHE A 1 476 ? 14.078  73.839 41.484 1.00 32.95 ? 476  PHE A N   1 
ATOM   3717 C CA  . PHE A 1 476 ? 14.140  72.397 41.277 1.00 30.86 ? 476  PHE A CA  1 
ATOM   3718 C C   . PHE A 1 476 ? 12.777  71.911 40.716 1.00 30.19 ? 476  PHE A C   1 
ATOM   3719 O O   . PHE A 1 476 ? 12.722  71.027 39.848 1.00 30.19 ? 476  PHE A O   1 
ATOM   3720 C CB  . PHE A 1 476 ? 14.421  71.665 42.592 1.00 31.37 ? 476  PHE A CB  1 
ATOM   3721 C CG  . PHE A 1 476 ? 14.138  70.183 42.514 1.00 29.66 ? 476  PHE A CG  1 
ATOM   3722 C CD1 . PHE A 1 476 ? 15.108  69.300 42.033 1.00 30.42 ? 476  PHE A CD1 1 
ATOM   3723 C CD2 . PHE A 1 476 ? 12.905  69.680 42.935 1.00 28.95 ? 476  PHE A CD2 1 
ATOM   3724 C CE1 . PHE A 1 476 ? 14.861  67.923 41.990 1.00 28.57 ? 476  PHE A CE1 1 
ATOM   3725 C CE2 . PHE A 1 476 ? 12.628  68.301 42.896 1.00 28.85 ? 476  PHE A CE2 1 
ATOM   3726 C CZ  . PHE A 1 476 ? 13.609  67.418 42.430 1.00 29.03 ? 476  PHE A CZ  1 
ATOM   3727 N N   . ALA A 1 477 ? 11.673  72.479 41.200 1.00 29.91 ? 477  ALA A N   1 
ATOM   3728 C CA  . ALA A 1 477 ? 10.359  72.040 40.704 1.00 29.73 ? 477  ALA A CA  1 
ATOM   3729 C C   . ALA A 1 477 ? 10.268  72.332 39.206 1.00 31.48 ? 477  ALA A C   1 
ATOM   3730 O O   . ALA A 1 477 ? 9.793   71.507 38.397 1.00 32.31 ? 477  ALA A O   1 
ATOM   3731 C CB  . ALA A 1 477 ? 9.240   72.759 41.459 1.00 26.81 ? 477  ALA A CB  1 
ATOM   3732 N N   . LYS A 1 478 ? 10.779  73.491 38.813 1.00 33.04 ? 478  LYS A N   1 
ATOM   3733 C CA  . LYS A 1 478 ? 10.707  73.851 37.428 1.00 34.69 ? 478  LYS A CA  1 
ATOM   3734 C C   . LYS A 1 478 ? 11.641  73.110 36.495 1.00 34.39 ? 478  LYS A C   1 
ATOM   3735 O O   . LYS A 1 478 ? 11.255  72.753 35.383 1.00 34.33 ? 478  LYS A O   1 
ATOM   3736 C CB  . LYS A 1 478 ? 10.942  75.351 37.255 1.00 38.08 ? 478  LYS A CB  1 
ATOM   3737 C CG  . LYS A 1 478 ? 10.893  75.761 35.765 1.00 40.27 ? 478  LYS A CG  1 
ATOM   3738 C CD  . LYS A 1 478 ? 10.896  77.268 35.610 1.00 44.02 ? 478  LYS A CD  1 
ATOM   3739 C CE  . LYS A 1 478 ? 12.211  77.897 36.086 1.00 47.03 ? 478  LYS A CE  1 
ATOM   3740 N NZ  . LYS A 1 478 ? 12.641  78.990 35.149 1.00 49.51 ? 478  LYS A NZ  1 
ATOM   3741 N N   . THR A 1 479 ? 12.846  72.814 36.966 1.00 33.57 ? 479  THR A N   1 
ATOM   3742 C CA  . THR A 1 479 ? 13.849  72.208 36.106 1.00 33.13 ? 479  THR A CA  1 
ATOM   3743 C C   . THR A 1 479 ? 14.416  70.857 36.459 1.00 33.69 ? 479  THR A C   1 
ATOM   3744 O O   . THR A 1 479 ? 15.051  70.246 35.599 1.00 30.85 ? 479  THR A O   1 
ATOM   3745 C CB  . THR A 1 479 ? 15.086  73.124 35.991 1.00 33.83 ? 479  THR A CB  1 
ATOM   3746 O OG1 . THR A 1 479 ? 15.734  73.174 37.281 1.00 34.20 ? 479  THR A OG1 1 
ATOM   3747 C CG2 . THR A 1 479 ? 14.673  74.558 35.559 1.00 33.20 ? 479  THR A CG2 1 
ATOM   3748 N N   . GLY A 1 480 ? 14.210  70.398 37.697 1.00 32.79 ? 480  GLY A N   1 
ATOM   3749 C CA  . GLY A 1 480 ? 14.798  69.130 38.109 1.00 31.63 ? 480  GLY A CA  1 
ATOM   3750 C C   . GLY A 1 480 ? 16.177  69.393 38.718 1.00 31.78 ? 480  GLY A C   1 
ATOM   3751 O O   . GLY A 1 480 ? 16.877  68.454 39.021 1.00 31.21 ? 480  GLY A O   1 
ATOM   3752 N N   . ASN A 1 481 ? 16.549  70.674 38.897 1.00 33.01 ? 481  ASN A N   1 
ATOM   3753 C CA  . ASN A 1 481 ? 17.844  71.096 39.451 1.00 33.56 ? 481  ASN A CA  1 
ATOM   3754 C C   . ASN A 1 481 ? 17.632  72.351 40.327 1.00 34.38 ? 481  ASN A C   1 
ATOM   3755 O O   . ASN A 1 481 ? 17.130  73.373 39.849 1.00 34.40 ? 481  ASN A O   1 
ATOM   3756 C CB  . ASN A 1 481 ? 18.809  71.429 38.286 1.00 35.19 ? 481  ASN A CB  1 
ATOM   3757 C CG  . ASN A 1 481 ? 20.273  71.695 38.750 1.00 36.11 ? 481  ASN A CG  1 
ATOM   3758 O OD1 . ASN A 1 481 ? 20.533  72.125 39.874 1.00 38.05 ? 481  ASN A OD1 1 
ATOM   3759 N ND2 . ASN A 1 481 ? 21.224  71.435 37.859 1.00 36.68 ? 481  ASN A ND2 1 
ATOM   3760 N N   . PRO A 1 482 ? 18.014  72.303 41.626 1.00 34.36 ? 482  PRO A N   1 
ATOM   3761 C CA  . PRO A 1 482 ? 17.803  73.499 42.465 1.00 35.00 ? 482  PRO A CA  1 
ATOM   3762 C C   . PRO A 1 482 ? 18.668  74.709 42.098 1.00 36.17 ? 482  PRO A C   1 
ATOM   3763 O O   . PRO A 1 482 ? 18.368  75.850 42.495 1.00 34.38 ? 482  PRO A O   1 
ATOM   3764 C CB  . PRO A 1 482 ? 18.124  73.014 43.875 1.00 32.67 ? 482  PRO A CB  1 
ATOM   3765 C CG  . PRO A 1 482 ? 19.249  72.004 43.614 1.00 32.89 ? 482  PRO A CG  1 
ATOM   3766 C CD  . PRO A 1 482 ? 18.761  71.264 42.357 1.00 34.38 ? 482  PRO A CD  1 
ATOM   3767 N N   . ASN A 1 483 ? 19.732  74.456 41.349 1.00 37.15 ? 483  ASN A N   1 
ATOM   3768 C CA  . ASN A 1 483 ? 20.641  75.528 40.960 1.00 40.52 ? 483  ASN A CA  1 
ATOM   3769 C C   . ASN A 1 483 ? 20.285  76.349 39.746 1.00 43.85 ? 483  ASN A C   1 
ATOM   3770 O O   . ASN A 1 483 ? 19.866  75.835 38.713 1.00 41.03 ? 483  ASN A O   1 
ATOM   3771 C CB  . ASN A 1 483 ? 22.007  74.946 40.732 1.00 38.02 ? 483  ASN A CB  1 
ATOM   3772 C CG  . ASN A 1 483 ? 22.513  74.319 41.951 1.00 38.81 ? 483  ASN A CG  1 
ATOM   3773 O OD1 . ASN A 1 483 ? 22.757  75.017 42.946 1.00 37.31 ? 483  ASN A OD1 1 
ATOM   3774 N ND2 . ASN A 1 483 ? 22.623  72.991 41.939 1.00 35.65 ? 483  ASN A ND2 1 
ATOM   3775 N N   . GLU A 1 484 ? 20.501  77.644 39.887 1.00 48.86 ? 484  GLU A N   1 
ATOM   3776 C CA  . GLU A 1 484 ? 20.273  78.590 38.800 1.00 55.05 ? 484  GLU A CA  1 
ATOM   3777 C C   . GLU A 1 484 ? 21.513  78.413 37.872 1.00 56.50 ? 484  GLU A C   1 
ATOM   3778 O O   . GLU A 1 484 ? 22.641  78.663 38.278 1.00 56.73 ? 484  GLU A O   1 
ATOM   3779 C CB  . GLU A 1 484 ? 20.200  79.991 39.432 1.00 57.27 ? 484  GLU A CB  1 
ATOM   3780 C CG  . GLU A 1 484 ? 19.695  81.087 38.550 1.00 60.24 ? 484  GLU A CG  1 
ATOM   3781 C CD  . GLU A 1 484 ? 18.268  80.879 38.170 1.00 60.24 ? 484  GLU A CD  1 
ATOM   3782 O OE1 . GLU A 1 484 ? 17.381  81.269 38.958 1.00 61.48 ? 484  GLU A OE1 1 
ATOM   3783 O OE2 . GLU A 1 484 ? 18.053  80.312 37.082 1.00 62.37 ? 484  GLU A OE2 1 
ATOM   3784 N N   . PRO A 1 485 ? 21.310  77.958 36.625 1.00 59.35 ? 485  PRO A N   1 
ATOM   3785 C CA  . PRO A 1 485 ? 22.357  77.720 35.606 1.00 61.12 ? 485  PRO A CA  1 
ATOM   3786 C C   . PRO A 1 485 ? 23.660  78.570 35.639 1.00 62.09 ? 485  PRO A C   1 
ATOM   3787 O O   . PRO A 1 485 ? 23.664  79.783 35.374 1.00 62.12 ? 485  PRO A O   1 
ATOM   3788 C CB  . PRO A 1 485 ? 21.599  77.893 34.283 1.00 61.51 ? 485  PRO A CB  1 
ATOM   3789 C CG  . PRO A 1 485 ? 20.408  78.776 34.659 1.00 60.79 ? 485  PRO A CG  1 
ATOM   3790 C CD  . PRO A 1 485 ? 19.999  78.144 35.970 1.00 60.88 ? 485  PRO A CD  1 
ATOM   3791 N N   . SER A 1 490 ? 26.986  79.832 43.889 1.00 46.66 ? 490  SER A N   1 
ATOM   3792 C CA  . SER A 1 490 ? 27.513  78.774 44.794 1.00 48.81 ? 490  SER A CA  1 
ATOM   3793 C C   . SER A 1 490 ? 26.562  77.532 44.739 1.00 46.33 ? 490  SER A C   1 
ATOM   3794 O O   . SER A 1 490 ? 25.424  77.584 45.211 1.00 43.60 ? 490  SER A O   1 
ATOM   3795 C CB  . SER A 1 490 ? 27.624  79.310 46.226 1.00 50.80 ? 490  SER A CB  1 
ATOM   3796 O OG  . SER A 1 490 ? 28.319  78.373 47.041 1.00 55.33 ? 490  SER A OG  1 
ATOM   3797 N N   . LYS A 1 491 ? 27.078  76.453 44.150 1.00 45.44 ? 491  LYS A N   1 
ATOM   3798 C CA  . LYS A 1 491 ? 26.359  75.216 43.835 1.00 45.87 ? 491  LYS A CA  1 
ATOM   3799 C C   . LYS A 1 491 ? 26.073  74.046 44.792 1.00 44.39 ? 491  LYS A C   1 
ATOM   3800 O O   . LYS A 1 491 ? 26.993  73.486 45.408 1.00 44.32 ? 491  LYS A O   1 
ATOM   3801 C CB  . LYS A 1 491 ? 27.002  74.601 42.590 1.00 47.20 ? 491  LYS A CB  1 
ATOM   3802 C CG  . LYS A 1 491 ? 27.187  75.581 41.468 1.00 51.93 ? 491  LYS A CG  1 
ATOM   3803 C CD  . LYS A 1 491 ? 25.963  76.472 41.358 1.00 54.71 ? 491  LYS A CD  1 
ATOM   3804 C CE  . LYS A 1 491 ? 26.028  77.345 40.127 1.00 57.80 ? 491  LYS A CE  1 
ATOM   3805 N NZ  . LYS A 1 491 ? 24.624  77.757 39.792 1.00 61.11 ? 491  LYS A NZ  1 
ATOM   3806 N N   . TRP A 1 492 ? 24.790  73.660 44.835 1.00 40.69 ? 492  TRP A N   1 
ATOM   3807 C CA  . TRP A 1 492 ? 24.307  72.527 45.624 1.00 36.51 ? 492  TRP A CA  1 
ATOM   3808 C C   . TRP A 1 492 ? 24.666  71.402 44.715 1.00 35.33 ? 492  TRP A C   1 
ATOM   3809 O O   . TRP A 1 492 ? 24.055  71.248 43.663 1.00 35.27 ? 492  TRP A O   1 
ATOM   3810 C CB  . TRP A 1 492 ? 22.805  72.565 45.725 1.00 34.81 ? 492  TRP A CB  1 
ATOM   3811 C CG  . TRP A 1 492 ? 22.160  71.539 46.641 1.00 33.31 ? 492  TRP A CG  1 
ATOM   3812 C CD1 . TRP A 1 492 ? 22.624  70.283 46.960 1.00 33.15 ? 492  TRP A CD1 1 
ATOM   3813 C CD2 . TRP A 1 492 ? 20.874  71.658 47.248 1.00 31.28 ? 492  TRP A CD2 1 
ATOM   3814 N NE1 . TRP A 1 492 ? 21.692  69.615 47.729 1.00 32.06 ? 492  TRP A NE1 1 
ATOM   3815 C CE2 . TRP A 1 492 ? 20.609  70.433 47.922 1.00 31.46 ? 492  TRP A CE2 1 
ATOM   3816 C CE3 . TRP A 1 492 ? 19.919  72.680 47.289 1.00 30.52 ? 492  TRP A CE3 1 
ATOM   3817 C CZ2 . TRP A 1 492 ? 19.416  70.202 48.634 1.00 27.65 ? 492  TRP A CZ2 1 
ATOM   3818 C CZ3 . TRP A 1 492 ? 18.718  72.449 47.999 1.00 31.36 ? 492  TRP A CZ3 1 
ATOM   3819 C CH2 . TRP A 1 492 ? 18.490  71.206 48.661 1.00 29.29 ? 492  TRP A CH2 1 
ATOM   3820 N N   . PRO A 1 493 ? 25.658  70.582 45.087 1.00 34.15 ? 493  PRO A N   1 
ATOM   3821 C CA  . PRO A 1 493 ? 25.998  69.497 44.166 1.00 33.13 ? 493  PRO A CA  1 
ATOM   3822 C C   . PRO A 1 493 ? 25.032  68.329 44.220 1.00 33.17 ? 493  PRO A C   1 
ATOM   3823 O O   . PRO A 1 493 ? 24.327  68.096 45.204 1.00 32.60 ? 493  PRO A O   1 
ATOM   3824 C CB  . PRO A 1 493 ? 27.404  69.084 44.629 1.00 33.82 ? 493  PRO A CB  1 
ATOM   3825 C CG  . PRO A 1 493 ? 27.309  69.244 46.077 1.00 33.22 ? 493  PRO A CG  1 
ATOM   3826 C CD  . PRO A 1 493 ? 26.583  70.594 46.229 1.00 33.74 ? 493  PRO A CD  1 
ATOM   3827 N N   . LEU A 1 494 ? 25.042  67.589 43.146 1.00 32.27 ? 494  LEU A N   1 
ATOM   3828 C CA  . LEU A 1 494 ? 24.228  66.421 42.988 1.00 33.98 ? 494  LEU A CA  1 
ATOM   3829 C C   . LEU A 1 494 ? 24.730  65.330 43.956 1.00 34.60 ? 494  LEU A C   1 
ATOM   3830 O O   . LEU A 1 494 ? 25.937  65.177 44.176 1.00 34.53 ? 494  LEU A O   1 
ATOM   3831 C CB  . LEU A 1 494 ? 24.360  65.999 41.530 1.00 33.57 ? 494  LEU A CB  1 
ATOM   3832 C CG  . LEU A 1 494 ? 23.379  65.231 40.650 1.00 37.36 ? 494  LEU A CG  1 
ATOM   3833 C CD1 . LEU A 1 494 ? 21.947  65.749 40.655 1.00 35.21 ? 494  LEU A CD1 1 
ATOM   3834 C CD2 . LEU A 1 494 ? 23.967  65.350 39.246 1.00 37.06 ? 494  LEU A CD2 1 
ATOM   3835 N N   . PHE A 1 495 ? 23.799  64.627 44.595 1.00 33.92 ? 495  PHE A N   1 
ATOM   3836 C CA  . PHE A 1 495 ? 24.140  63.508 45.464 1.00 33.40 ? 495  PHE A CA  1 
ATOM   3837 C C   . PHE A 1 495 ? 24.367  62.342 44.475 1.00 33.85 ? 495  PHE A C   1 
ATOM   3838 O O   . PHE A 1 495 ? 23.550  62.135 43.592 1.00 34.68 ? 495  PHE A O   1 
ATOM   3839 C CB  . PHE A 1 495 ? 22.948  63.202 46.410 1.00 31.42 ? 495  PHE A CB  1 
ATOM   3840 C CG  . PHE A 1 495 ? 23.117  61.933 47.206 1.00 30.86 ? 495  PHE A CG  1 
ATOM   3841 C CD1 . PHE A 1 495 ? 22.813  60.685 46.639 1.00 29.97 ? 495  PHE A CD1 1 
ATOM   3842 C CD2 . PHE A 1 495 ? 23.585  61.978 48.526 1.00 30.52 ? 495  PHE A CD2 1 
ATOM   3843 C CE1 . PHE A 1 495 ? 22.969  59.504 47.393 1.00 31.36 ? 495  PHE A CE1 1 
ATOM   3844 C CE2 . PHE A 1 495 ? 23.738  60.804 49.276 1.00 31.96 ? 495  PHE A CE2 1 
ATOM   3845 C CZ  . PHE A 1 495 ? 23.428  59.572 48.709 1.00 31.16 ? 495  PHE A CZ  1 
ATOM   3846 N N   . THR A 1 496 ? 25.466  61.595 44.589 1.00 34.94 ? 496  THR A N   1 
ATOM   3847 C CA  . THR A 1 496 ? 25.726  60.464 43.669 1.00 35.11 ? 496  THR A CA  1 
ATOM   3848 C C   . THR A 1 496 ? 26.015  59.275 44.553 1.00 37.02 ? 496  THR A C   1 
ATOM   3849 O O   . THR A 1 496 ? 26.379  59.451 45.715 1.00 36.33 ? 496  THR A O   1 
ATOM   3850 C CB  . THR A 1 496 ? 26.962  60.709 42.736 1.00 35.76 ? 496  THR A CB  1 
ATOM   3851 O OG1 . THR A 1 496 ? 28.137  60.904 43.549 1.00 33.91 ? 496  THR A OG1 1 
ATOM   3852 C CG2 . THR A 1 496 ? 26.734  61.940 41.802 1.00 29.04 ? 496  THR A CG2 1 
ATOM   3853 N N   . THR A 1 497 ? 25.857  58.058 44.049 1.00 39.98 ? 497  THR A N   1 
ATOM   3854 C CA  . THR A 1 497 ? 26.083  56.925 44.948 1.00 43.57 ? 497  THR A CA  1 
ATOM   3855 C C   . THR A 1 497 ? 27.547  56.842 45.320 1.00 44.37 ? 497  THR A C   1 
ATOM   3856 O O   . THR A 1 497 ? 27.910  56.345 46.399 1.00 44.51 ? 497  THR A O   1 
ATOM   3857 C CB  . THR A 1 497 ? 25.527  55.581 44.354 1.00 45.63 ? 497  THR A CB  1 
ATOM   3858 O OG1 . THR A 1 497 ? 25.609  55.620 42.938 1.00 46.50 ? 497  THR A OG1 1 
ATOM   3859 C CG2 . THR A 1 497 ? 23.992  55.407 44.720 1.00 46.73 ? 497  THR A CG2 1 
ATOM   3860 N N   . LYS A 1 498 ? 28.397  57.390 44.458 1.00 44.73 ? 498  LYS A N   1 
ATOM   3861 C CA  . LYS A 1 498 ? 29.809  57.381 44.763 1.00 44.47 ? 498  LYS A CA  1 
ATOM   3862 C C   . LYS A 1 498 ? 30.206  58.434 45.807 1.00 44.11 ? 498  LYS A C   1 
ATOM   3863 O O   . LYS A 1 498 ? 30.743  58.070 46.853 1.00 43.86 ? 498  LYS A O   1 
ATOM   3864 C CB  . LYS A 1 498 ? 30.640  57.570 43.502 1.00 44.12 ? 498  LYS A CB  1 
ATOM   3865 C CG  . LYS A 1 498 ? 32.127  57.445 43.779 1.00 45.99 ? 498  LYS A CG  1 
ATOM   3866 N N   . GLU A 1 499 ? 29.943  59.717 45.544 1.00 43.25 ? 499  GLU A N   1 
ATOM   3867 C CA  . GLU A 1 499 ? 30.344  60.774 46.482 1.00 43.19 ? 499  GLU A CA  1 
ATOM   3868 C C   . GLU A 1 499 ? 29.409  61.054 47.644 1.00 40.77 ? 499  GLU A C   1 
ATOM   3869 O O   . GLU A 1 499 ? 29.870  61.500 48.693 1.00 40.46 ? 499  GLU A O   1 
ATOM   3870 C CB  . GLU A 1 499 ? 30.574  62.109 45.763 1.00 47.26 ? 499  GLU A CB  1 
ATOM   3871 C CG  . GLU A 1 499 ? 31.914  62.273 45.083 1.00 53.34 ? 499  GLU A CG  1 
ATOM   3872 C CD  . GLU A 1 499 ? 32.108  61.250 44.029 1.00 57.10 ? 499  GLU A CD  1 
ATOM   3873 O OE1 . GLU A 1 499 ? 31.273  61.221 43.077 1.00 59.30 ? 499  GLU A OE1 1 
ATOM   3874 O OE2 . GLU A 1 499 ? 33.083  60.466 44.162 1.00 59.75 ? 499  GLU A OE2 1 
ATOM   3875 N N   . GLN A 1 500 ? 28.103  60.866 47.437 1.00 39.07 ? 500  GLN A N   1 
ATOM   3876 C CA  . GLN A 1 500 ? 27.079  61.074 48.496 1.00 36.87 ? 500  GLN A CA  1 
ATOM   3877 C C   . GLN A 1 500 ? 27.125  62.459 49.143 1.00 34.21 ? 500  GLN A C   1 
ATOM   3878 O O   . GLN A 1 500 ? 26.938  62.626 50.325 1.00 32.13 ? 500  GLN A O   1 
ATOM   3879 C CB  . GLN A 1 500 ? 27.238  59.962 49.547 1.00 37.15 ? 500  GLN A CB  1 
ATOM   3880 C CG  . GLN A 1 500 ? 26.989  58.583 48.900 1.00 39.56 ? 500  GLN A CG  1 
ATOM   3881 C CD  . GLN A 1 500 ? 27.372  57.400 49.788 1.00 42.24 ? 500  GLN A CD  1 
ATOM   3882 O OE1 . GLN A 1 500 ? 26.994  57.335 50.950 1.00 39.59 ? 500  GLN A OE1 1 
ATOM   3883 N NE2 . GLN A 1 500 ? 28.125  56.449 49.223 1.00 42.88 ? 500  GLN A NE2 1 
ATOM   3884 N N   . LYS A 1 501 ? 27.374  63.462 48.334 1.00 33.10 ? 501  LYS A N   1 
ATOM   3885 C CA  . LYS A 1 501 ? 27.464  64.803 48.840 1.00 33.74 ? 501  LYS A CA  1 
ATOM   3886 C C   . LYS A 1 501 ? 26.122  65.411 49.230 1.00 33.44 ? 501  LYS A C   1 
ATOM   3887 O O   . LYS A 1 501 ? 25.067  65.072 48.667 1.00 33.06 ? 501  LYS A O   1 
ATOM   3888 C CB  . LYS A 1 501 ? 28.124  65.691 47.783 1.00 34.73 ? 501  LYS A CB  1 
ATOM   3889 C CG  . LYS A 1 501 ? 29.574  65.262 47.423 1.00 39.14 ? 501  LYS A CG  1 
ATOM   3890 C CD  . LYS A 1 501 ? 30.191  66.297 46.435 1.00 41.13 ? 501  LYS A CD  1 
ATOM   3891 C CE  . LYS A 1 501 ? 31.586  65.860 45.963 1.00 43.36 ? 501  LYS A CE  1 
ATOM   3892 N NZ  . LYS A 1 501 ? 32.078  66.713 44.857 1.00 44.10 ? 501  LYS A NZ  1 
ATOM   3893 N N   . PHE A 1 502 ? 26.171  66.321 50.183 1.00 30.90 ? 502  PHE A N   1 
ATOM   3894 C CA  . PHE A 1 502 ? 24.965  67.022 50.581 1.00 31.82 ? 502  PHE A CA  1 
ATOM   3895 C C   . PHE A 1 502 ? 25.419  68.382 51.080 1.00 32.06 ? 502  PHE A C   1 
ATOM   3896 O O   . PHE A 1 502 ? 26.624  68.606 51.287 1.00 31.16 ? 502  PHE A O   1 
ATOM   3897 C CB  . PHE A 1 502 ? 24.213  66.253 51.686 1.00 29.83 ? 502  PHE A CB  1 
ATOM   3898 C CG  . PHE A 1 502 ? 24.932  66.190 53.027 1.00 29.35 ? 502  PHE A CG  1 
ATOM   3899 C CD1 . PHE A 1 502 ? 24.655  67.113 54.023 1.00 27.73 ? 502  PHE A CD1 1 
ATOM   3900 C CD2 . PHE A 1 502 ? 25.820  65.141 53.305 1.00 29.00 ? 502  PHE A CD2 1 
ATOM   3901 C CE1 . PHE A 1 502 ? 25.229  67.014 55.294 1.00 29.79 ? 502  PHE A CE1 1 
ATOM   3902 C CE2 . PHE A 1 502 ? 26.401  65.008 54.556 1.00 29.88 ? 502  PHE A CE2 1 
ATOM   3903 C CZ  . PHE A 1 502 ? 26.108  65.952 55.578 1.00 30.53 ? 502  PHE A CZ  1 
ATOM   3904 N N   . ILE A 1 503 ? 24.465  69.293 51.241 1.00 32.69 ? 503  ILE A N   1 
ATOM   3905 C CA  . ILE A 1 503 ? 24.766  70.604 51.796 1.00 33.22 ? 503  ILE A CA  1 
ATOM   3906 C C   . ILE A 1 503 ? 24.050  70.871 53.119 1.00 34.74 ? 503  ILE A C   1 
ATOM   3907 O O   . ILE A 1 503 ? 23.043  70.240 53.445 1.00 32.76 ? 503  ILE A O   1 
ATOM   3908 C CB  . ILE A 1 503 ? 24.343  71.789 50.860 1.00 34.57 ? 503  ILE A CB  1 
ATOM   3909 C CG1 . ILE A 1 503 ? 22.815  71.795 50.664 1.00 34.09 ? 503  ILE A CG1 1 
ATOM   3910 C CG2 . ILE A 1 503 ? 25.114  71.719 49.541 1.00 30.73 ? 503  ILE A CG2 1 
ATOM   3911 C CD1 . ILE A 1 503 ? 22.281  73.118 50.121 1.00 37.32 ? 503  ILE A CD1 1 
ATOM   3912 N N   . ASP A 1 504 ? 24.612  71.798 53.890 1.00 35.06 ? 504  ASP A N   1 
ATOM   3913 C CA  . ASP A 1 504 ? 23.972  72.240 55.105 1.00 37.51 ? 504  ASP A CA  1 
ATOM   3914 C C   . ASP A 1 504 ? 23.079  73.345 54.601 1.00 36.60 ? 504  ASP A C   1 
ATOM   3915 O O   . ASP A 1 504 ? 23.390  74.012 53.623 1.00 36.65 ? 504  ASP A O   1 
ATOM   3916 C CB  . ASP A 1 504 ? 24.956  72.868 56.102 1.00 39.11 ? 504  ASP A CB  1 
ATOM   3917 C CG  . ASP A 1 504 ? 25.949  71.872 56.625 1.00 42.71 ? 504  ASP A CG  1 
ATOM   3918 O OD1 . ASP A 1 504 ? 25.536  70.732 56.917 1.00 42.62 ? 504  ASP A OD1 1 
ATOM   3919 O OD2 . ASP A 1 504 ? 27.141  72.224 56.742 1.00 46.32 ? 504  ASP A OD2 1 
ATOM   3920 N N   . LEU A 1 505 ? 21.977  73.555 55.286 1.00 36.71 ? 505  LEU A N   1 
ATOM   3921 C CA  . LEU A 1 505 ? 21.066  74.598 54.911 1.00 36.85 ? 505  LEU A CA  1 
ATOM   3922 C C   . LEU A 1 505 ? 20.889  75.448 56.162 1.00 37.89 ? 505  LEU A C   1 
ATOM   3923 O O   . LEU A 1 505 ? 20.183  75.052 57.119 1.00 37.55 ? 505  LEU A O   1 
ATOM   3924 C CB  . LEU A 1 505 ? 19.769  73.954 54.455 1.00 36.80 ? 505  LEU A CB  1 
ATOM   3925 C CG  . LEU A 1 505 ? 18.967  74.458 53.280 1.00 38.59 ? 505  LEU A CG  1 
ATOM   3926 C CD1 . LEU A 1 505 ? 19.852  74.938 52.099 1.00 37.43 ? 505  LEU A CD1 1 
ATOM   3927 C CD2 . LEU A 1 505 ? 18.025  73.292 52.876 1.00 37.46 ? 505  LEU A CD2 1 
ATOM   3928 N N   . ASN A 1 506 ? 21.572  76.595 56.177 1.00 37.76 ? 506  ASN A N   1 
ATOM   3929 C CA  . ASN A 1 506 ? 21.497  77.526 57.300 1.00 38.81 ? 506  ASN A CA  1 
ATOM   3930 C C   . ASN A 1 506 ? 21.897  78.952 56.864 1.00 40.42 ? 506  ASN A C   1 
ATOM   3931 O O   . ASN A 1 506 ? 21.922  79.270 55.678 1.00 40.03 ? 506  ASN A O   1 
ATOM   3932 C CB  . ASN A 1 506 ? 22.389  77.021 58.442 1.00 37.57 ? 506  ASN A CB  1 
ATOM   3933 C CG  . ASN A 1 506 ? 23.827  76.804 57.996 1.00 38.37 ? 506  ASN A CG  1 
ATOM   3934 O OD1 . ASN A 1 506 ? 24.404  77.665 57.321 1.00 36.78 ? 506  ASN A OD1 1 
ATOM   3935 N ND2 . ASN A 1 506 ? 24.419  75.664 58.379 1.00 34.73 ? 506  ASN A ND2 1 
ATOM   3936 N N   . THR A 1 507 ? 22.209  79.826 57.806 1.00 42.70 ? 507  THR A N   1 
ATOM   3937 C CA  . THR A 1 507 ? 22.535  81.209 57.428 1.00 44.38 ? 507  THR A CA  1 
ATOM   3938 C C   . THR A 1 507 ? 24.016  81.451 57.089 1.00 46.24 ? 507  THR A C   1 
ATOM   3939 O O   . THR A 1 507 ? 24.413  82.550 56.713 1.00 47.06 ? 507  THR A O   1 
ATOM   3940 C CB  . THR A 1 507 ? 22.111  82.155 58.537 1.00 42.60 ? 507  THR A CB  1 
ATOM   3941 O OG1 . THR A 1 507 ? 22.687  81.700 59.766 1.00 44.24 ? 507  THR A OG1 1 
ATOM   3942 C CG2 . THR A 1 507 ? 20.609  82.161 58.683 1.00 41.13 ? 507  THR A CG2 1 
ATOM   3943 N N   . GLU A 1 508 ? 24.822  80.413 57.210 1.00 47.19 ? 508  GLU A N   1 
ATOM   3944 C CA  . GLU A 1 508 ? 26.235  80.511 56.931 1.00 48.18 ? 508  GLU A CA  1 
ATOM   3945 C C   . GLU A 1 508 ? 26.519  80.115 55.498 1.00 48.94 ? 508  GLU A C   1 
ATOM   3946 O O   . GLU A 1 508 ? 25.689  79.487 54.846 1.00 48.80 ? 508  GLU A O   1 
ATOM   3947 C CB  . GLU A 1 508 ? 27.002  79.606 57.896 1.00 49.91 ? 508  GLU A CB  1 
ATOM   3948 C CG  . GLU A 1 508 ? 26.838  80.035 59.365 1.00 52.13 ? 508  GLU A CG  1 
ATOM   3949 C CD  . GLU A 1 508 ? 27.481  79.056 60.347 1.00 55.96 ? 508  GLU A CD  1 
ATOM   3950 O OE1 . GLU A 1 508 ? 26.894  77.967 60.597 1.00 56.66 ? 508  GLU A OE1 1 
ATOM   3951 N N   . PRO A 1 509 ? 27.678  80.527 54.967 1.00 49.66 ? 509  PRO A N   1 
ATOM   3952 C CA  . PRO A 1 509 ? 28.078  80.199 53.593 1.00 50.39 ? 509  PRO A CA  1 
ATOM   3953 C C   . PRO A 1 509 ? 27.928  78.697 53.393 1.00 50.07 ? 509  PRO A C   1 
ATOM   3954 O O   . PRO A 1 509 ? 28.411  77.925 54.212 1.00 50.25 ? 509  PRO A O   1 
ATOM   3955 C CB  . PRO A 1 509 ? 29.547  80.609 53.553 1.00 49.77 ? 509  PRO A CB  1 
ATOM   3956 C CG  . PRO A 1 509 ? 29.556  81.829 54.440 1.00 51.25 ? 509  PRO A CG  1 
ATOM   3957 C CD  . PRO A 1 509 ? 28.648  81.438 55.604 1.00 50.35 ? 509  PRO A CD  1 
ATOM   3958 N N   . MET A 1 510 ? 27.288  78.292 52.306 1.00 49.58 ? 510  MET A N   1 
ATOM   3959 C CA  . MET A 1 510 ? 27.065  76.882 52.022 1.00 50.21 ? 510  MET A CA  1 
ATOM   3960 C C   . MET A 1 510 ? 28.306  76.027 52.228 1.00 49.53 ? 510  MET A C   1 
ATOM   3961 O O   . MET A 1 510 ? 29.393  76.402 51.814 1.00 51.85 ? 510  MET A O   1 
ATOM   3962 C CB  . MET A 1 510 ? 26.597  76.728 50.576 1.00 52.23 ? 510  MET A CB  1 
ATOM   3963 C CG  . MET A 1 510 ? 26.337  75.284 50.092 1.00 54.18 ? 510  MET A CG  1 
ATOM   3964 S SD  . MET A 1 510 ? 26.209  75.140 48.258 1.00 56.44 ? 510  MET A SD  1 
ATOM   3965 C CE  . MET A 1 510 ? 24.556  75.727 48.014 1.00 55.12 ? 510  MET A CE  1 
ATOM   3966 N N   . LYS A 1 511 ? 28.163  74.904 52.918 1.00 47.62 ? 511  LYS A N   1 
ATOM   3967 C CA  . LYS A 1 511 ? 29.267  73.954 53.069 1.00 46.02 ? 511  LYS A CA  1 
ATOM   3968 C C   . LYS A 1 511 ? 28.744  72.624 52.496 1.00 45.06 ? 511  LYS A C   1 
ATOM   3969 O O   . LYS A 1 511 ? 27.569  72.269 52.698 1.00 44.97 ? 511  LYS A O   1 
ATOM   3970 C CB  . LYS A 1 511 ? 29.663  73.735 54.531 1.00 44.95 ? 511  LYS A CB  1 
ATOM   3971 C CG  . LYS A 1 511 ? 30.443  74.873 55.161 1.00 46.58 ? 511  LYS A CG  1 
ATOM   3972 N N   . VAL A 1 512 ? 29.601  71.908 51.783 1.00 42.33 ? 512  VAL A N   1 
ATOM   3973 C CA  . VAL A 1 512 ? 29.261  70.613 51.230 1.00 41.33 ? 512  VAL A CA  1 
ATOM   3974 C C   . VAL A 1 512 ? 29.908  69.546 52.110 1.00 41.51 ? 512  VAL A C   1 
ATOM   3975 O O   . VAL A 1 512 ? 31.048  69.712 52.529 1.00 41.41 ? 512  VAL A O   1 
ATOM   3976 C CB  . VAL A 1 512 ? 29.812  70.452 49.801 1.00 40.59 ? 512  VAL A CB  1 
ATOM   3977 C CG1 . VAL A 1 512 ? 29.628  68.986 49.322 1.00 38.89 ? 512  VAL A CG1 1 
ATOM   3978 C CG2 . VAL A 1 512 ? 29.094  71.442 48.864 1.00 39.54 ? 512  VAL A CG2 1 
ATOM   3979 N N   . HIS A 1 513 ? 29.189  68.462 52.402 1.00 40.01 ? 513  HIS A N   1 
ATOM   3980 C CA  . HIS A 1 513 ? 29.750  67.365 53.208 1.00 39.01 ? 513  HIS A CA  1 
ATOM   3981 C C   . HIS A 1 513 ? 29.428  66.069 52.517 1.00 38.24 ? 513  HIS A C   1 
ATOM   3982 O O   . HIS A 1 513 ? 28.835  66.044 51.440 1.00 38.78 ? 513  HIS A O   1 
ATOM   3983 C CB  . HIS A 1 513 ? 29.141  67.279 54.591 1.00 38.05 ? 513  HIS A CB  1 
ATOM   3984 C CG  . HIS A 1 513 ? 29.061  68.584 55.301 1.00 40.41 ? 513  HIS A CG  1 
ATOM   3985 N ND1 . HIS A 1 513 ? 30.151  69.160 55.919 1.00 40.68 ? 513  HIS A ND1 1 
ATOM   3986 C CD2 . HIS A 1 513 ? 28.005  69.392 55.565 1.00 41.74 ? 513  HIS A CD2 1 
ATOM   3987 C CE1 . HIS A 1 513 ? 29.771  70.259 56.547 1.00 40.33 ? 513  HIS A CE1 1 
ATOM   3988 N NE2 . HIS A 1 513 ? 28.473  70.422 56.350 1.00 43.73 ? 513  HIS A NE2 1 
ATOM   3989 N N   . GLN A 1 514 ? 29.775  64.966 53.156 1.00 38.41 ? 514  GLN A N   1 
ATOM   3990 C CA  . GLN A 1 514 ? 29.515  63.688 52.533 1.00 37.45 ? 514  GLN A CA  1 
ATOM   3991 C C   . GLN A 1 514 ? 29.081  62.666 53.555 1.00 35.66 ? 514  GLN A C   1 
ATOM   3992 O O   . GLN A 1 514 ? 29.485  62.734 54.697 1.00 34.21 ? 514  GLN A O   1 
ATOM   3993 C CB  . GLN A 1 514 ? 30.792  63.194 51.843 1.00 39.45 ? 514  GLN A CB  1 
ATOM   3994 C CG  . GLN A 1 514 ? 31.220  63.989 50.614 1.00 44.23 ? 514  GLN A CG  1 
ATOM   3995 C CD  . GLN A 1 514 ? 32.543  63.464 50.033 1.00 45.87 ? 514  GLN A CD  1 
ATOM   3996 O OE1 . GLN A 1 514 ? 33.621  63.894 50.439 1.00 47.94 ? 514  GLN A OE1 1 
ATOM   3997 N NE2 . GLN A 1 514 ? 32.456  62.511 49.113 1.00 46.18 ? 514  GLN A NE2 1 
ATOM   3998 N N   . ARG A 1 515 ? 28.275  61.713 53.116 1.00 35.04 ? 515  ARG A N   1 
ATOM   3999 C CA  . ARG A 1 515 ? 27.856  60.594 53.970 1.00 37.12 ? 515  ARG A CA  1 
ATOM   4000 C C   . ARG A 1 515 ? 27.165  60.993 55.248 1.00 34.25 ? 515  ARG A C   1 
ATOM   4001 O O   . ARG A 1 515 ? 27.658  60.686 56.329 1.00 32.38 ? 515  ARG A O   1 
ATOM   4002 C CB  . ARG A 1 515 ? 29.080  59.792 54.372 1.00 40.21 ? 515  ARG A CB  1 
ATOM   4003 C CG  . ARG A 1 515 ? 30.089  59.744 53.298 1.00 45.76 ? 515  ARG A CG  1 
ATOM   4004 C CD  . ARG A 1 515 ? 29.842  58.572 52.449 1.00 48.89 ? 515  ARG A CD  1 
ATOM   4005 N NE  . ARG A 1 515 ? 30.750  57.488 52.775 1.00 52.21 ? 515  ARG A NE  1 
ATOM   4006 C CZ  . ARG A 1 515 ? 31.622  56.992 51.912 1.00 56.20 ? 515  ARG A CZ  1 
ATOM   4007 N NH1 . ARG A 1 515 ? 31.689  57.530 50.686 1.00 59.58 ? 515  ARG A NH1 1 
ATOM   4008 N NH2 . ARG A 1 515 ? 32.360  55.923 52.238 1.00 56.98 ? 515  ARG A NH2 1 
ATOM   4009 N N   . LEU A 1 516 ? 26.054  61.691 55.097 1.00 33.08 ? 516  LEU A N   1 
ATOM   4010 C CA  . LEU A 1 516 ? 25.221  62.158 56.210 1.00 32.88 ? 516  LEU A CA  1 
ATOM   4011 C C   . LEU A 1 516 ? 24.945  61.000 57.182 1.00 31.90 ? 516  LEU A C   1 
ATOM   4012 O O   . LEU A 1 516 ? 24.339  59.982 56.822 1.00 29.98 ? 516  LEU A O   1 
ATOM   4013 C CB  . LEU A 1 516 ? 23.920  62.731 55.619 1.00 32.55 ? 516  LEU A CB  1 
ATOM   4014 C CG  . LEU A 1 516 ? 22.781  63.223 56.519 1.00 36.31 ? 516  LEU A CG  1 
ATOM   4015 C CD1 . LEU A 1 516 ? 23.314  64.106 57.620 1.00 35.04 ? 516  LEU A CD1 1 
ATOM   4016 C CD2 . LEU A 1 516 ? 21.798  64.034 55.611 1.00 36.56 ? 516  LEU A CD2 1 
ATOM   4017 N N   . ARG A 1 517 ? 25.418  61.184 58.407 1.00 32.28 ? 517  ARG A N   1 
ATOM   4018 C CA  . ARG A 1 517 ? 25.307  60.229 59.518 1.00 32.31 ? 517  ARG A CA  1 
ATOM   4019 C C   . ARG A 1 517 ? 25.578  58.772 59.170 1.00 32.47 ? 517  ARG A C   1 
ATOM   4020 O O   . ARG A 1 517 ? 24.921  57.865 59.750 1.00 30.11 ? 517  ARG A O   1 
ATOM   4021 C CB  . ARG A 1 517 ? 23.939  60.389 60.266 1.00 34.51 ? 517  ARG A CB  1 
ATOM   4022 C CG  . ARG A 1 517 ? 24.127  61.460 61.395 1.00 39.22 ? 517  ARG A CG  1 
ATOM   4023 C CD  . ARG A 1 517 ? 22.937  62.008 62.113 1.00 40.07 ? 517  ARG A CD  1 
ATOM   4024 N NE  . ARG A 1 517 ? 22.835  61.340 63.391 1.00 42.47 ? 517  ARG A NE  1 
ATOM   4025 C CZ  . ARG A 1 517 ? 23.736  61.433 64.366 1.00 42.91 ? 517  ARG A CZ  1 
ATOM   4026 N NH1 . ARG A 1 517 ? 24.814  62.208 64.199 1.00 42.03 ? 517  ARG A NH1 1 
ATOM   4027 N NH2 . ARG A 1 517 ? 23.589  60.712 65.484 1.00 37.27 ? 517  ARG A NH2 1 
ATOM   4028 N N   . VAL A 1 518 ? 26.555  58.542 58.272 1.00 30.16 ? 518  VAL A N   1 
ATOM   4029 C CA  . VAL A 1 518 ? 26.868  57.165 57.882 1.00 31.27 ? 518  VAL A CA  1 
ATOM   4030 C C   . VAL A 1 518 ? 27.090  56.244 59.081 1.00 30.92 ? 518  VAL A C   1 
ATOM   4031 O O   . VAL A 1 518 ? 26.599  55.122 59.104 1.00 30.26 ? 518  VAL A O   1 
ATOM   4032 C CB  . VAL A 1 518 ? 28.205  56.899 57.184 1.00 32.16 ? 518  VAL A CB  1 
ATOM   4033 C CG1 . VAL A 1 518 ? 27.965  56.118 55.929 1.00 29.23 ? 518  VAL A CG1 1 
ATOM   4034 C CG2 . VAL A 1 518 ? 29.078  58.111 57.135 1.00 31.37 ? 518  VAL A CG2 1 
ATOM   4035 N N   . GLN A 1 519 ? 27.888  56.712 60.030 1.00 30.40 ? 519  GLN A N   1 
ATOM   4036 C CA  . GLN A 1 519 ? 28.248  55.876 61.175 1.00 32.02 ? 519  GLN A CA  1 
ATOM   4037 C C   . GLN A 1 519 ? 26.993  55.295 61.887 1.00 31.36 ? 519  GLN A C   1 
ATOM   4038 O O   . GLN A 1 519 ? 26.801  54.075 61.979 1.00 30.31 ? 519  GLN A O   1 
ATOM   4039 C CB  . GLN A 1 519 ? 29.156  56.688 62.124 1.00 31.50 ? 519  GLN A CB  1 
ATOM   4040 C CG  . GLN A 1 519 ? 29.947  55.785 63.091 1.00 34.31 ? 519  GLN A CG  1 
ATOM   4041 C CD  . GLN A 1 519 ? 30.967  54.908 62.371 1.00 36.34 ? 519  GLN A CD  1 
ATOM   4042 O OE1 . GLN A 1 519 ? 31.626  55.356 61.429 1.00 36.52 ? 519  GLN A OE1 1 
ATOM   4043 N NE2 . GLN A 1 519 ? 31.100  53.647 62.806 1.00 37.46 ? 519  GLN A NE2 1 
ATOM   4044 N N   . MET A 1 520 ? 26.123  56.169 62.347 1.00 30.68 ? 520  MET A N   1 
ATOM   4045 C CA  . MET A 1 520 ? 24.899  55.725 62.989 1.00 31.24 ? 520  MET A CA  1 
ATOM   4046 C C   . MET A 1 520 ? 23.974  54.985 62.009 1.00 31.46 ? 520  MET A C   1 
ATOM   4047 O O   . MET A 1 520 ? 23.339  54.003 62.381 1.00 32.38 ? 520  MET A O   1 
ATOM   4048 C CB  . MET A 1 520 ? 24.182  56.932 63.605 1.00 32.16 ? 520  MET A CB  1 
ATOM   4049 C CG  . MET A 1 520 ? 24.968  57.557 64.758 1.00 34.55 ? 520  MET A CG  1 
ATOM   4050 S SD  . MET A 1 520 ? 25.350  56.264 66.037 1.00 41.54 ? 520  MET A SD  1 
ATOM   4051 C CE  . MET A 1 520 ? 27.144  56.054 65.664 1.00 40.00 ? 520  MET A CE  1 
ATOM   4052 N N   . CYS A 1 521 ? 23.901  55.408 60.751 1.00 30.15 ? 521  CYS A N   1 
ATOM   4053 C CA  . CYS A 1 521 ? 23.010  54.704 59.864 1.00 30.47 ? 521  CYS A CA  1 
ATOM   4054 C C   . CYS A 1 521 ? 23.458  53.292 59.452 1.00 30.19 ? 521  CYS A C   1 
ATOM   4055 O O   . CYS A 1 521 ? 22.602  52.465 59.158 1.00 29.92 ? 521  CYS A O   1 
ATOM   4056 C CB  . CYS A 1 521 ? 22.630  55.588 58.676 1.00 31.21 ? 521  CYS A CB  1 
ATOM   4057 S SG  . CYS A 1 521 ? 21.693  57.068 59.226 1.00 32.74 ? 521  CYS A SG  1 
ATOM   4058 N N   . VAL A 1 522 ? 24.759  52.971 59.475 1.00 30.14 ? 522  VAL A N   1 
ATOM   4059 C CA  . VAL A 1 522 ? 25.146  51.579 59.178 1.00 29.48 ? 522  VAL A CA  1 
ATOM   4060 C C   . VAL A 1 522 ? 24.585  50.790 60.398 1.00 30.27 ? 522  VAL A C   1 
ATOM   4061 O O   . VAL A 1 522 ? 24.062  49.667 60.271 1.00 29.76 ? 522  VAL A O   1 
ATOM   4062 C CB  . VAL A 1 522 ? 26.694  51.384 59.059 1.00 30.16 ? 522  VAL A CB  1 
ATOM   4063 C CG1 . VAL A 1 522 ? 27.027  49.889 58.989 1.00 31.31 ? 522  VAL A CG1 1 
ATOM   4064 C CG2 . VAL A 1 522 ? 27.235  52.056 57.786 1.00 27.72 ? 522  VAL A CG2 1 
ATOM   4065 N N   . PHE A 1 523 ? 24.650  51.381 61.588 1.00 27.84 ? 523  PHE A N   1 
ATOM   4066 C CA  . PHE A 1 523 ? 24.059  50.688 62.735 1.00 29.32 ? 523  PHE A CA  1 
ATOM   4067 C C   . PHE A 1 523 ? 22.530  50.430 62.565 1.00 29.26 ? 523  PHE A C   1 
ATOM   4068 O O   . PHE A 1 523 ? 22.072  49.301 62.692 1.00 28.78 ? 523  PHE A O   1 
ATOM   4069 C CB  . PHE A 1 523 ? 24.280  51.470 64.025 1.00 28.85 ? 523  PHE A CB  1 
ATOM   4070 C CG  . PHE A 1 523 ? 23.545  50.895 65.199 1.00 29.63 ? 523  PHE A CG  1 
ATOM   4071 C CD1 . PHE A 1 523 ? 24.109  49.879 65.953 1.00 31.13 ? 523  PHE A CD1 1 
ATOM   4072 C CD2 . PHE A 1 523 ? 22.291  51.399 65.568 1.00 31.07 ? 523  PHE A CD2 1 
ATOM   4073 C CE1 . PHE A 1 523 ? 23.442  49.358 67.078 1.00 31.90 ? 523  PHE A CE1 1 
ATOM   4074 C CE2 . PHE A 1 523 ? 21.604  50.895 66.678 1.00 30.59 ? 523  PHE A CE2 1 
ATOM   4075 C CZ  . PHE A 1 523 ? 22.182  49.873 67.440 1.00 32.84 ? 523  PHE A CZ  1 
ATOM   4076 N N   . TRP A 1 524 ? 21.755  51.463 62.234 1.00 29.27 ? 524  TRP A N   1 
ATOM   4077 C CA  . TRP A 1 524 ? 20.293  51.289 62.103 1.00 30.50 ? 524  TRP A CA  1 
ATOM   4078 C C   . TRP A 1 524 ? 19.803  50.559 60.878 1.00 31.02 ? 524  TRP A C   1 
ATOM   4079 O O   . TRP A 1 524 ? 18.753  49.915 60.913 1.00 30.57 ? 524  TRP A O   1 
ATOM   4080 C CB  . TRP A 1 524 ? 19.568  52.650 62.137 1.00 27.73 ? 524  TRP A CB  1 
ATOM   4081 C CG  . TRP A 1 524 ? 19.706  53.342 63.481 1.00 28.98 ? 524  TRP A CG  1 
ATOM   4082 C CD1 . TRP A 1 524 ? 20.543  54.382 63.794 1.00 26.86 ? 524  TRP A CD1 1 
ATOM   4083 C CD2 . TRP A 1 524 ? 18.995  53.020 64.686 1.00 27.31 ? 524  TRP A CD2 1 
ATOM   4084 N NE1 . TRP A 1 524 ? 20.392  54.726 65.106 1.00 26.04 ? 524  TRP A NE1 1 
ATOM   4085 C CE2 . TRP A 1 524 ? 19.453  53.906 65.685 1.00 27.16 ? 524  TRP A CE2 1 
ATOM   4086 C CE3 . TRP A 1 524 ? 18.020  52.071 65.015 1.00 26.30 ? 524  TRP A CE3 1 
ATOM   4087 C CZ2 . TRP A 1 524 ? 18.965  53.868 67.011 1.00 24.89 ? 524  TRP A CZ2 1 
ATOM   4088 C CZ3 . TRP A 1 524 ? 17.535  52.033 66.318 1.00 25.99 ? 524  TRP A CZ3 1 
ATOM   4089 C CH2 . TRP A 1 524 ? 18.009  52.927 67.305 1.00 24.47 ? 524  TRP A CH2 1 
ATOM   4090 N N   . ASN A 1 525 ? 20.551  50.677 59.789 1.00 30.99 ? 525  ASN A N   1 
ATOM   4091 C CA  . ASN A 1 525 ? 20.117  50.070 58.566 1.00 32.14 ? 525  ASN A CA  1 
ATOM   4092 C C   . ASN A 1 525 ? 20.706  48.712 58.275 1.00 33.57 ? 525  ASN A C   1 
ATOM   4093 O O   . ASN A 1 525 ? 20.104  47.976 57.541 1.00 32.71 ? 525  ASN A O   1 
ATOM   4094 C CB  . ASN A 1 525 ? 20.400  50.990 57.379 1.00 32.78 ? 525  ASN A CB  1 
ATOM   4095 C CG  . ASN A 1 525 ? 19.618  52.298 57.457 1.00 34.38 ? 525  ASN A CG  1 
ATOM   4096 O OD1 . ASN A 1 525 ? 18.613  52.376 58.157 1.00 36.13 ? 525  ASN A OD1 1 
ATOM   4097 N ND2 . ASN A 1 525 ? 20.085  53.329 56.747 1.00 31.85 ? 525  ASN A ND2 1 
ATOM   4098 N N   . GLN A 1 526 ? 21.880  48.387 58.798 1.00 33.22 ? 526  GLN A N   1 
ATOM   4099 C CA  . GLN A 1 526 ? 22.460  47.083 58.521 1.00 35.05 ? 526  GLN A CA  1 
ATOM   4100 C C   . GLN A 1 526 ? 22.625  46.216 59.765 1.00 34.40 ? 526  GLN A C   1 
ATOM   4101 O O   . GLN A 1 526 ? 22.098  45.124 59.831 1.00 34.53 ? 526  GLN A O   1 
ATOM   4102 C CB  . GLN A 1 526 ? 23.813  47.220 57.847 1.00 38.19 ? 526  GLN A CB  1 
ATOM   4103 C CG  . GLN A 1 526 ? 23.798  47.857 56.466 1.00 46.13 ? 526  GLN A CG  1 
ATOM   4104 C CD  . GLN A 1 526 ? 25.214  47.874 55.850 1.00 51.66 ? 526  GLN A CD  1 
ATOM   4105 O OE1 . GLN A 1 526 ? 25.640  48.884 55.247 1.00 53.07 ? 526  GLN A OE1 1 
ATOM   4106 N NE2 . GLN A 1 526 ? 25.963  46.744 56.015 1.00 52.14 ? 526  GLN A NE2 1 
ATOM   4107 N N   . PHE A 1 527 ? 23.327  46.701 60.782 1.00 32.73 ? 527  PHE A N   1 
ATOM   4108 C CA  . PHE A 1 527 ? 23.521  45.855 61.927 1.00 31.90 ? 527  PHE A CA  1 
ATOM   4109 C C   . PHE A 1 527 ? 22.306  45.487 62.781 1.00 32.21 ? 527  PHE A C   1 
ATOM   4110 O O   . PHE A 1 527 ? 22.006  44.299 62.958 1.00 32.20 ? 527  PHE A O   1 
ATOM   4111 C CB  . PHE A 1 527 ? 24.600  46.428 62.843 1.00 29.96 ? 527  PHE A CB  1 
ATOM   4112 C CG  . PHE A 1 527 ? 24.906  45.527 64.006 1.00 28.74 ? 527  PHE A CG  1 
ATOM   4113 C CD1 . PHE A 1 527 ? 25.617  44.339 63.808 1.00 30.51 ? 527  PHE A CD1 1 
ATOM   4114 C CD2 . PHE A 1 527 ? 24.515  45.869 65.293 1.00 29.53 ? 527  PHE A CD2 1 
ATOM   4115 C CE1 . PHE A 1 527 ? 25.943  43.519 64.866 1.00 27.91 ? 527  PHE A CE1 1 
ATOM   4116 C CE2 . PHE A 1 527 ? 24.827  45.063 66.372 1.00 29.08 ? 527  PHE A CE2 1 
ATOM   4117 C CZ  . PHE A 1 527 ? 25.550  43.882 66.155 1.00 29.89 ? 527  PHE A CZ  1 
ATOM   4118 N N   . LEU A 1 528 ? 21.601  46.489 63.303 1.00 31.79 ? 528  LEU A N   1 
ATOM   4119 C CA  . LEU A 1 528 ? 20.467  46.214 64.174 1.00 32.10 ? 528  LEU A CA  1 
ATOM   4120 C C   . LEU A 1 528 ? 19.408  45.256 63.598 1.00 32.93 ? 528  LEU A C   1 
ATOM   4121 O O   . LEU A 1 528 ? 18.995  44.325 64.284 1.00 33.57 ? 528  LEU A O   1 
ATOM   4122 C CB  . LEU A 1 528 ? 19.812  47.516 64.650 1.00 29.98 ? 528  LEU A CB  1 
ATOM   4123 C CG  . LEU A 1 528 ? 18.756  47.298 65.735 1.00 32.38 ? 528  LEU A CG  1 
ATOM   4124 C CD1 . LEU A 1 528 ? 19.372  46.522 66.948 1.00 31.98 ? 528  LEU A CD1 1 
ATOM   4125 C CD2 . LEU A 1 528 ? 18.181  48.665 66.168 1.00 31.67 ? 528  LEU A CD2 1 
ATOM   4126 N N   . PRO A 1 529 ? 18.965  45.467 62.345 1.00 33.68 ? 529  PRO A N   1 
ATOM   4127 C CA  . PRO A 1 529 ? 17.954  44.577 61.739 1.00 35.43 ? 529  PRO A CA  1 
ATOM   4128 C C   . PRO A 1 529 ? 18.551  43.166 61.607 1.00 37.73 ? 529  PRO A C   1 
ATOM   4129 O O   . PRO A 1 529 ? 17.871  42.167 61.869 1.00 39.58 ? 529  PRO A O   1 
ATOM   4130 C CB  . PRO A 1 529 ? 17.665  45.232 60.368 1.00 34.01 ? 529  PRO A CB  1 
ATOM   4131 C CG  . PRO A 1 529 ? 18.195  46.646 60.516 1.00 33.16 ? 529  PRO A CG  1 
ATOM   4132 C CD  . PRO A 1 529 ? 19.430  46.464 61.370 1.00 31.77 ? 529  PRO A CD  1 
ATOM   4133 N N   . LYS A 1 530 ? 19.829  43.069 61.233 1.00 38.87 ? 530  LYS A N   1 
ATOM   4134 C CA  . LYS A 1 530 ? 20.454  41.748 61.167 1.00 39.65 ? 530  LYS A CA  1 
ATOM   4135 C C   . LYS A 1 530 ? 20.407  41.146 62.581 1.00 39.78 ? 530  LYS A C   1 
ATOM   4136 O O   . LYS A 1 530 ? 20.004  39.990 62.761 1.00 39.83 ? 530  LYS A O   1 
ATOM   4137 C CB  . LYS A 1 530 ? 21.899  41.840 60.698 1.00 41.93 ? 530  LYS A CB  1 
ATOM   4138 C CG  . LYS A 1 530 ? 22.498  40.481 60.423 1.00 45.23 ? 530  LYS A CG  1 
ATOM   4139 C CD  . LYS A 1 530 ? 23.861  40.573 59.762 1.00 47.34 ? 530  LYS A CD  1 
ATOM   4140 C CE  . LYS A 1 530 ? 24.306  39.208 59.257 1.00 47.97 ? 530  LYS A CE  1 
ATOM   4141 N NZ  . LYS A 1 530 ? 25.570  39.291 58.476 1.00 49.00 ? 530  LYS A NZ  1 
ATOM   4142 N N   . LEU A 1 531 ? 20.782  41.931 63.592 1.00 37.75 ? 531  LEU A N   1 
ATOM   4143 C CA  . LEU A 1 531 ? 20.732  41.443 64.961 1.00 37.36 ? 531  LEU A CA  1 
ATOM   4144 C C   . LEU A 1 531 ? 19.313  41.013 65.417 1.00 39.80 ? 531  LEU A C   1 
ATOM   4145 O O   . LEU A 1 531 ? 19.136  39.947 66.026 1.00 36.70 ? 531  LEU A O   1 
ATOM   4146 C CB  . LEU A 1 531 ? 21.264  42.518 65.922 1.00 35.63 ? 531  LEU A CB  1 
ATOM   4147 C CG  . LEU A 1 531 ? 21.258  42.190 67.417 1.00 34.06 ? 531  LEU A CG  1 
ATOM   4148 C CD1 . LEU A 1 531 ? 22.169  43.152 68.139 1.00 36.66 ? 531  LEU A CD1 1 
ATOM   4149 C CD2 . LEU A 1 531 ? 19.836  42.301 67.994 1.00 36.55 ? 531  LEU A CD2 1 
ATOM   4150 N N   . LEU A 1 532 ? 18.310  41.858 65.177 1.00 41.49 ? 532  LEU A N   1 
ATOM   4151 C CA  . LEU A 1 532 ? 16.954  41.500 65.608 1.00 45.88 ? 532  LEU A CA  1 
ATOM   4152 C C   . LEU A 1 532 ? 16.444  40.262 64.857 1.00 48.09 ? 532  LEU A C   1 
ATOM   4153 O O   . LEU A 1 532 ? 15.713  39.461 65.425 1.00 48.41 ? 532  LEU A O   1 
ATOM   4154 C CB  . LEU A 1 532 ? 15.967  42.664 65.416 1.00 44.81 ? 532  LEU A CB  1 
ATOM   4155 C CG  . LEU A 1 532 ? 16.238  43.914 66.254 1.00 45.20 ? 532  LEU A CG  1 
ATOM   4156 C CD1 . LEU A 1 532 ? 15.306  45.044 65.811 1.00 44.53 ? 532  LEU A CD1 1 
ATOM   4157 C CD2 . LEU A 1 532 ? 16.079  43.584 67.730 1.00 43.08 ? 532  LEU A CD2 1 
ATOM   4158 N N   . ASN A 1 533 ? 16.845  40.092 63.604 1.00 50.78 ? 533  ASN A N   1 
ATOM   4159 C CA  . ASN A 1 533 ? 16.410  38.919 62.852 1.00 55.12 ? 533  ASN A CA  1 
ATOM   4160 C C   . ASN A 1 533 ? 17.026  37.587 63.301 1.00 57.35 ? 533  ASN A C   1 
ATOM   4161 O O   . ASN A 1 533 ? 16.447  36.528 63.075 1.00 57.04 ? 533  ASN A O   1 
ATOM   4162 C CB  . ASN A 1 533 ? 16.714  39.041 61.367 1.00 55.61 ? 533  ASN A CB  1 
ATOM   4163 C CG  . ASN A 1 533 ? 16.003  37.971 60.572 1.00 58.57 ? 533  ASN A CG  1 
ATOM   4164 O OD1 . ASN A 1 533 ? 14.766  37.910 60.597 1.00 60.00 ? 533  ASN A OD1 1 
ATOM   4165 N ND2 . ASN A 1 533 ? 16.758  37.101 59.891 1.00 58.09 ? 533  ASN A ND2 1 
ATOM   4166 N N   . ALA A 1 534 ? 18.204  37.621 63.909 1.00 59.93 ? 534  ALA A N   1 
ATOM   4167 C CA  . ALA A 1 534 ? 18.835  36.379 64.314 1.00 62.55 ? 534  ALA A CA  1 
ATOM   4168 C C   . ALA A 1 534 ? 18.424  36.019 65.720 1.00 64.90 ? 534  ALA A C   1 
ATOM   4169 O O   . ALA A 1 534 ? 18.078  34.885 66.001 1.00 66.63 ? 534  ALA A O   1 
ATOM   4170 C CB  . ALA A 1 534 ? 20.330  36.507 64.230 1.00 62.17 ? 534  ALA A CB  1 
ATOM   4171 N N   . THR A 1 535 ? 18.444  37.000 66.602 1.00 67.03 ? 535  THR A N   1 
ATOM   4172 C CA  . THR A 1 535 ? 18.093  36.780 67.994 1.00 68.92 ? 535  THR A CA  1 
ATOM   4173 C C   . THR A 1 535 ? 16.585  36.908 68.174 1.00 69.59 ? 535  THR A C   1 
ATOM   4174 O O   . THR A 1 535 ? 15.928  37.166 67.144 1.00 70.39 ? 535  THR A O   1 
ATOM   4175 C CB  . THR A 1 535 ? 18.821  37.807 68.874 1.00 70.08 ? 535  THR A CB  1 
ATOM   4176 O OG1 . THR A 1 535 ? 18.553  37.548 70.267 1.00 72.59 ? 535  THR A OG1 1 
ATOM   4177 C CG2 . THR A 1 535 ? 18.380  39.201 68.495 1.00 69.62 ? 535  THR A CG2 1 
ATOM   4178 N N   . ALA A 1 536 ? 16.078  36.742 69.317 1.00 69.39 ? 536  ALA A N   1 
HETATM 4179 C C1  . NAG B 2 .   ? -18.666 82.783 49.802 1.00 60.59 ? 1536 NAG A C1  1 
HETATM 4180 C C2  . NAG B 2 .   ? -19.567 84.002 49.924 1.00 63.84 ? 1536 NAG A C2  1 
HETATM 4181 C C3  . NAG B 2 .   ? -19.128 84.790 51.153 1.00 66.07 ? 1536 NAG A C3  1 
HETATM 4182 C C4  . NAG B 2 .   ? -19.343 83.896 52.392 1.00 66.73 ? 1536 NAG A C4  1 
HETATM 4183 C C5  . NAG B 2 .   ? -18.593 82.560 52.238 1.00 66.00 ? 1536 NAG A C5  1 
HETATM 4184 C C6  . NAG B 2 .   ? -19.005 81.583 53.339 1.00 65.74 ? 1536 NAG A C6  1 
HETATM 4185 C C7  . NAG B 2 .   ? -20.390 84.577 47.729 1.00 65.11 ? 1536 NAG A C7  1 
HETATM 4186 C C8  . NAG B 2 .   ? -20.210 85.408 46.467 1.00 64.16 ? 1536 NAG A C8  1 
HETATM 4187 N N2  . NAG B 2 .   ? -19.535 84.820 48.725 1.00 65.12 ? 1536 NAG A N2  1 
HETATM 4188 O O3  . NAG B 2 .   ? -19.906 85.981 51.250 1.00 67.46 ? 1536 NAG A O3  1 
HETATM 4189 O O4  . NAG B 2 .   ? -18.918 84.554 53.584 1.00 68.39 ? 1536 NAG A O4  1 
HETATM 4190 O O5  . NAG B 2 .   ? -18.908 81.925 50.948 1.00 64.58 ? 1536 NAG A O5  1 
HETATM 4191 O O6  . NAG B 2 .   ? -18.674 82.074 54.635 1.00 66.23 ? 1536 NAG A O6  1 
HETATM 4192 O O7  . NAG B 2 .   ? -21.294 83.723 47.792 1.00 63.93 ? 1536 NAG A O7  1 
HETATM 4193 C C1  . NAG C 2 .   ? 18.940  62.065 33.462 1.00 45.84 ? 1537 NAG A C1  1 
HETATM 4194 C C2  . NAG C 2 .   ? 20.479  61.950 33.557 1.00 48.53 ? 1537 NAG A C2  1 
HETATM 4195 C C3  . NAG C 2 .   ? 21.173  62.513 32.293 1.00 50.68 ? 1537 NAG A C3  1 
HETATM 4196 C C4  . NAG C 2 .   ? 20.518  61.923 31.023 1.00 51.32 ? 1537 NAG A C4  1 
HETATM 4197 C C5  . NAG C 2 .   ? 19.023  62.195 31.064 1.00 50.43 ? 1537 NAG A C5  1 
HETATM 4198 C C6  . NAG C 2 .   ? 18.281  61.669 29.822 1.00 51.18 ? 1537 NAG A C6  1 
HETATM 4199 C C7  . NAG C 2 .   ? 21.280  62.061 35.837 1.00 49.10 ? 1537 NAG A C7  1 
HETATM 4200 C C8  . NAG C 2 .   ? 21.499  62.903 37.097 1.00 49.53 ? 1537 NAG A C8  1 
HETATM 4201 N N2  . NAG C 2 .   ? 20.966  62.689 34.711 1.00 48.55 ? 1537 NAG A N2  1 
HETATM 4202 O O3  . NAG C 2 .   ? 22.563  62.177 32.341 1.00 50.96 ? 1537 NAG A O3  1 
HETATM 4203 O O4  . NAG C 2 .   ? 21.096  62.468 29.835 1.00 55.20 ? 1537 NAG A O4  1 
HETATM 4204 O O5  . NAG C 2 .   ? 18.456  61.546 32.226 1.00 47.09 ? 1537 NAG A O5  1 
HETATM 4205 O O6  . NAG C 2 .   ? 17.927  60.278 29.918 1.00 51.60 ? 1537 NAG A O6  1 
HETATM 4206 O O7  . NAG C 2 .   ? 21.385  60.843 35.899 1.00 48.72 ? 1537 NAG A O7  1 
HETATM 4207 C C1  . A8B D 3 .   ? 5.861   69.454 65.936 1.00 35.80 ? 1538 A8B A C1  1 
HETATM 4208 C C2  . A8B D 3 .   ? 4.545   69.130 66.463 1.00 37.30 ? 1538 A8B A C2  1 
HETATM 4209 C C3  . A8B D 3 .   ? 4.346   69.446 67.861 1.00 36.59 ? 1538 A8B A C3  1 
HETATM 4210 C C4  . A8B D 3 .   ? 5.354   70.023 68.640 1.00 36.09 ? 1538 A8B A C4  1 
HETATM 4211 C C5  . A8B D 3 .   ? 6.645   70.325 68.080 1.00 35.77 ? 1538 A8B A C5  1 
HETATM 4212 C C6  . A8B D 3 .   ? 6.889   70.041 66.741 1.00 35.40 ? 1538 A8B A C6  1 
HETATM 4213 N N7  . A8B D 3 .   ? 6.135   69.190 64.591 1.00 35.30 ? 1538 A8B A N7  1 
HETATM 4214 C C8  . A8B D 3 .   ? 5.255   68.623 63.689 1.00 36.22 ? 1538 A8B A C8  1 
HETATM 4215 C C9  . A8B D 3 .   ? 3.918   68.256 64.137 1.00 37.12 ? 1538 A8B A C9  1 
HETATM 4216 C C10 . A8B D 3 .   ? 3.543   68.538 65.529 1.00 39.03 ? 1538 A8B A C10 1 
HETATM 4217 N N11 . A8B D 3 .   ? 2.273   68.248 65.969 1.00 41.09 ? 1538 A8B A N11 1 
HETATM 4218 C C14 . A8B D 3 .   ? 2.982   67.603 63.106 1.00 36.64 ? 1538 A8B A C14 1 
HETATM 4219 C C15 . A8B D 3 .   ? 3.654   67.076 61.786 1.00 37.54 ? 1538 A8B A C15 1 
HETATM 4220 C C16 . A8B D 3 .   ? 4.588   68.155 61.235 1.00 40.09 ? 1538 A8B A C16 1 
HETATM 4221 C C17 . A8B D 3 .   ? 5.747   68.402 62.264 1.00 37.08 ? 1538 A8B A C17 1 
HETATM 4222 C C19 . A8B D 3 .   ? 2.754   63.280 68.724 1.00 49.70 ? 1538 A8B A C19 1 
HETATM 4223 C C20 . A8B D 3 .   ? 2.428   64.700 69.280 1.00 50.08 ? 1538 A8B A C20 1 
HETATM 4224 C C21 . A8B D 3 .   ? 2.890   65.768 68.294 1.00 47.61 ? 1538 A8B A C21 1 
HETATM 4225 C C22 . A8B D 3 .   ? 3.027   62.212 69.804 1.00 44.57 ? 1538 A8B A C22 1 
HETATM 4226 C C24 . A8B D 3 .   ? 1.800   66.765 67.919 1.00 46.80 ? 1538 A8B A C24 1 
HETATM 4227 N N24 . A8B D 3 .   ? -0.294  61.106 71.379 1.00 34.13 ? 1538 A8B A N24 1 
HETATM 4228 C C25 . A8B D 3 .   ? 1.774   66.940 66.399 1.00 45.16 ? 1538 A8B A C25 1 
HETATM 4229 C C26 . A8B D 3 .   ? -3.532  60.664 69.578 1.00 32.75 ? 1538 A8B A C26 1 
HETATM 4230 C C27 . A8B D 3 .   ? -2.193  60.981 69.820 1.00 34.99 ? 1538 A8B A C27 1 
HETATM 4231 C C29 . A8B D 3 .   ? 1.888   62.112 70.854 1.00 42.42 ? 1538 A8B A C29 1 
HETATM 4232 C C30 . A8B D 3 .   ? 0.567   61.621 70.288 1.00 37.40 ? 1538 A8B A C30 1 
HETATM 4233 N N32 . A8B D 3 .   ? -4.324  60.162 70.574 1.00 31.95 ? 1538 A8B A N32 1 
HETATM 4234 C C33 . A8B D 3 .   ? -3.851  59.936 71.898 1.00 34.03 ? 1538 A8B A C33 1 
HETATM 4235 C C34 . A8B D 3 .   ? -2.441  60.257 72.218 1.00 34.77 ? 1538 A8B A C34 1 
HETATM 4236 C C35 . A8B D 3 .   ? -1.610  60.789 71.146 1.00 33.46 ? 1538 A8B A C35 1 
HETATM 4237 C C39 . A8B D 3 .   ? -1.987  60.004 73.569 1.00 33.83 ? 1538 A8B A C39 1 
HETATM 4238 C C40 . A8B D 3 .   ? -2.865  59.474 74.514 1.00 33.76 ? 1538 A8B A C40 1 
HETATM 4239 C C41 . A8B D 3 .   ? -4.246  59.166 74.178 1.00 33.76 ? 1538 A8B A C41 1 
HETATM 4240 C C42 . A8B D 3 .   ? -4.731  59.398 72.887 1.00 31.86 ? 1538 A8B A C42 1 
HETATM 4241 O O   . HOH E 4 .   ? -6.533  83.600 38.413 1.00 30.67 ? 2001 HOH A O   1 
HETATM 4242 O O   . HOH E 4 .   ? -6.777  68.269 29.585 1.00 30.11 ? 2002 HOH A O   1 
HETATM 4243 O O   . HOH E 4 .   ? -9.794  65.065 32.333 1.00 30.81 ? 2003 HOH A O   1 
HETATM 4244 O O   . HOH E 4 .   ? -15.441 67.117 48.769 1.00 28.68 ? 2004 HOH A O   1 
HETATM 4245 O O   . HOH E 4 .   ? -15.423 60.009 48.331 1.00 37.14 ? 2005 HOH A O   1 
HETATM 4246 O O   . HOH E 4 .   ? -18.008 68.101 48.437 1.00 33.09 ? 2006 HOH A O   1 
HETATM 4247 O O   . HOH E 4 .   ? -20.503 74.825 37.144 1.00 34.66 ? 2007 HOH A O   1 
HETATM 4248 O O   . HOH E 4 .   ? -9.745  69.814 54.162 1.00 32.75 ? 2008 HOH A O   1 
HETATM 4249 O O   . HOH E 4 .   ? -7.747  58.866 41.590 1.00 32.09 ? 2009 HOH A O   1 
HETATM 4250 O O   . HOH E 4 .   ? -12.269 62.790 58.704 1.00 31.16 ? 2010 HOH A O   1 
HETATM 4251 O O   . HOH E 4 .   ? -9.701  61.988 59.343 1.00 30.33 ? 2011 HOH A O   1 
HETATM 4252 O O   . HOH E 4 .   ? -8.691  60.625 63.152 1.00 28.31 ? 2012 HOH A O   1 
HETATM 4253 O O   . HOH E 4 .   ? -14.534 65.183 66.552 1.00 36.53 ? 2013 HOH A O   1 
HETATM 4254 O O   . HOH E 4 .   ? -10.684 65.468 68.101 1.00 28.06 ? 2014 HOH A O   1 
HETATM 4255 O O   . HOH E 4 .   ? -4.280  67.866 65.368 1.00 36.78 ? 2015 HOH A O   1 
HETATM 4256 O O   . HOH E 4 .   ? -5.157  66.285 30.279 1.00 37.43 ? 2016 HOH A O   1 
HETATM 4257 O O   . HOH E 4 .   ? -1.286  64.324 29.237 0.75 27.91 ? 2017 HOH A O   1 
HETATM 4258 O O   . HOH E 4 .   ? -3.436  68.473 78.160 1.00 35.45 ? 2018 HOH A O   1 
HETATM 4259 O O   . HOH E 4 .   ? -2.873  66.761 74.086 1.00 44.55 ? 2019 HOH A O   1 
HETATM 4260 O O   . HOH E 4 .   ? -1.570  62.935 76.547 1.00 38.68 ? 2020 HOH A O   1 
HETATM 4261 O O   . HOH E 4 .   ? 3.784   63.667 64.003 1.00 47.81 ? 2021 HOH A O   1 
HETATM 4262 O O   . HOH E 4 .   ? 0.033   70.162 67.960 1.00 31.84 ? 2022 HOH A O   1 
HETATM 4263 O O   . HOH E 4 .   ? -1.054  72.121 72.866 1.00 47.76 ? 2023 HOH A O   1 
HETATM 4264 O O   . HOH E 4 .   ? 0.425   77.108 61.632 1.00 32.19 ? 2024 HOH A O   1 
HETATM 4265 O O   . HOH E 4 .   ? -0.333  69.171 62.033 1.00 29.32 ? 2025 HOH A O   1 
HETATM 4266 O O   . HOH E 4 .   ? -3.413  75.814 63.902 1.00 38.20 ? 2026 HOH A O   1 
HETATM 4267 O O   . HOH E 4 .   ? -1.702  68.325 66.255 1.00 34.45 ? 2027 HOH A O   1 
HETATM 4268 O O   . HOH E 4 .   ? 4.898   47.565 62.639 1.00 41.80 ? 2028 HOH A O   1 
HETATM 4269 O O   . HOH E 4 .   ? -17.859 64.946 60.803 1.00 33.10 ? 2029 HOH A O   1 
HETATM 4270 O O   . HOH E 4 .   ? -13.516 61.981 56.275 1.00 30.69 ? 2030 HOH A O   1 
HETATM 4271 O O   . HOH E 4 .   ? -20.073 59.199 58.652 1.00 36.09 ? 2031 HOH A O   1 
HETATM 4272 O O   . HOH E 4 .   ? -14.839 59.601 56.699 1.00 29.14 ? 2032 HOH A O   1 
HETATM 4273 O O   . HOH E 4 .   ? -19.417 62.794 60.462 1.00 36.90 ? 2033 HOH A O   1 
HETATM 4274 O O   . HOH E 4 .   ? -15.379 66.078 51.272 1.00 28.24 ? 2034 HOH A O   1 
HETATM 4275 O O   . HOH E 4 .   ? -4.355  85.183 39.186 1.00 33.62 ? 2035 HOH A O   1 
HETATM 4276 O O   . HOH E 4 .   ? 8.076   54.591 80.248 1.00 41.53 ? 2036 HOH A O   1 
HETATM 4277 O O   . HOH E 4 .   ? 4.193   43.475 55.251 1.00 32.26 ? 2037 HOH A O   1 
HETATM 4278 O O   . HOH E 4 .   ? 6.303   44.268 53.450 1.00 36.87 ? 2038 HOH A O   1 
HETATM 4279 O O   . HOH E 4 .   ? -0.561  62.930 58.577 1.00 25.50 ? 2039 HOH A O   1 
HETATM 4280 O O   . HOH E 4 .   ? -1.325  65.738 67.641 1.00 48.21 ? 2040 HOH A O   1 
HETATM 4281 O O   . HOH E 4 .   ? -6.744  61.368 64.914 1.00 23.96 ? 2041 HOH A O   1 
HETATM 4282 O O   . HOH E 4 .   ? -0.316  67.313 64.163 1.00 35.65 ? 2042 HOH A O   1 
HETATM 4283 O O   . HOH E 4 .   ? -7.299  67.651 57.301 1.00 27.25 ? 2043 HOH A O   1 
HETATM 4284 O O   . HOH E 4 .   ? -4.145  69.843 61.970 1.00 23.76 ? 2044 HOH A O   1 
HETATM 4285 O O   . HOH E 4 .   ? 3.810   59.312 73.151 1.00 30.34 ? 2045 HOH A O   1 
HETATM 4286 O O   . HOH E 4 .   ? -7.639  70.070 55.885 1.00 26.20 ? 2046 HOH A O   1 
HETATM 4287 O O   . HOH E 4 .   ? -8.008  71.156 52.089 1.00 38.89 ? 2047 HOH A O   1 
HETATM 4288 O O   . HOH E 4 .   ? -2.469  77.502 61.943 1.00 35.75 ? 2048 HOH A O   1 
HETATM 4289 O O   . HOH E 4 .   ? 3.733   68.708 57.368 1.00 20.98 ? 2049 HOH A O   1 
HETATM 4290 O O   . HOH E 4 .   ? 0.156   68.976 59.179 1.00 26.69 ? 2050 HOH A O   1 
HETATM 4291 O O   . HOH E 4 .   ? 3.969   80.584 51.029 1.00 29.76 ? 2051 HOH A O   1 
HETATM 4292 O O   . HOH E 4 .   ? 12.788  83.328 46.939 1.00 34.53 ? 2052 HOH A O   1 
HETATM 4293 O O   . HOH E 4 .   ? -1.948  75.153 52.224 1.00 31.50 ? 2053 HOH A O   1 
HETATM 4294 O O   . HOH E 4 .   ? -1.528  69.316 52.224 1.00 26.15 ? 2054 HOH A O   1 
HETATM 4295 O O   . HOH E 4 .   ? -8.971  57.856 64.009 1.00 27.58 ? 2055 HOH A O   1 
HETATM 4296 O O   . HOH E 4 .   ? -13.421 57.521 55.845 1.00 31.10 ? 2056 HOH A O   1 
HETATM 4297 O O   . HOH E 4 .   ? -4.156  51.632 55.748 1.00 25.00 ? 2057 HOH A O   1 
HETATM 4298 O O   . HOH E 4 .   ? -3.647  50.663 59.189 1.00 27.48 ? 2058 HOH A O   1 
HETATM 4299 O O   . HOH E 4 .   ? -5.550  44.650 56.985 1.00 34.12 ? 2059 HOH A O   1 
HETATM 4300 O O   . HOH E 4 .   ? -6.254  49.084 60.591 1.00 30.17 ? 2060 HOH A O   1 
HETATM 4301 O O   . HOH E 4 .   ? -13.669 50.999 48.933 1.00 38.75 ? 2061 HOH A O   1 
HETATM 4302 O O   . HOH E 4 .   ? -9.898  51.546 54.207 1.00 28.12 ? 2062 HOH A O   1 
HETATM 4303 O O   . HOH E 4 .   ? -7.658  57.679 43.908 1.00 35.10 ? 2063 HOH A O   1 
HETATM 4304 O O   . HOH E 4 .   ? -6.088  58.382 39.499 1.00 36.80 ? 2064 HOH A O   1 
HETATM 4305 O O   . HOH E 4 .   ? -3.027  67.030 31.879 1.00 33.79 ? 2065 HOH A O   1 
HETATM 4306 O O   . HOH E 4 .   ? -1.186  62.554 30.815 0.75 25.75 ? 2066 HOH A O   1 
HETATM 4307 O O   . HOH E 4 .   ? -6.725  64.721 31.885 1.00 39.24 ? 2067 HOH A O   1 
HETATM 4308 O O   . HOH E 4 .   ? -10.082 65.080 37.906 1.00 27.83 ? 2068 HOH A O   1 
HETATM 4309 O O   . HOH E 4 .   ? -12.093 66.953 36.880 1.00 34.74 ? 2069 HOH A O   1 
HETATM 4310 O O   . HOH E 4 .   ? -3.360  77.459 30.734 1.00 35.46 ? 2070 HOH A O   1 
HETATM 4311 O O   . HOH E 4 .   ? -4.538  70.402 33.462 1.00 25.92 ? 2071 HOH A O   1 
HETATM 4312 O O   . HOH E 4 .   ? 3.636   66.687 36.122 1.00 23.73 ? 2072 HOH A O   1 
HETATM 4313 O O   . HOH E 4 .   ? 0.062   65.945 36.271 1.00 31.98 ? 2073 HOH A O   1 
HETATM 4314 O O   . HOH E 4 .   ? 8.853   70.883 32.190 1.00 34.18 ? 2074 HOH A O   1 
HETATM 4315 O O   . HOH E 4 .   ? 7.420   70.528 38.953 1.00 37.99 ? 2075 HOH A O   1 
HETATM 4316 O O   . HOH E 4 .   ? 10.666  68.442 59.314 1.00 27.76 ? 2076 HOH A O   1 
HETATM 4317 O O   . HOH E 4 .   ? 4.158   63.721 61.028 1.00 34.32 ? 2077 HOH A O   1 
HETATM 4318 O O   . HOH E 4 .   ? -0.865  50.658 41.905 1.00 40.94 ? 2078 HOH A O   1 
HETATM 4319 O O   . HOH E 4 .   ? -0.621  57.904 32.804 1.00 36.49 ? 2079 HOH A O   1 
HETATM 4320 O O   . HOH E 4 .   ? 1.737   63.860 35.140 1.00 27.63 ? 2080 HOH A O   1 
HETATM 4321 O O   . HOH E 4 .   ? -1.226  60.556 34.137 1.00 36.34 ? 2081 HOH A O   1 
HETATM 4322 O O   . HOH E 4 .   ? 0.258   56.514 37.571 1.00 44.55 ? 2082 HOH A O   1 
HETATM 4323 O O   . HOH E 4 .   ? -0.763  66.195 39.182 1.00 31.49 ? 2083 HOH A O   1 
HETATM 4324 O O   . HOH E 4 .   ? 4.473   64.218 34.859 1.00 33.69 ? 2084 HOH A O   1 
HETATM 4325 O O   . HOH E 4 .   ? 8.773   62.000 35.532 1.00 41.08 ? 2085 HOH A O   1 
HETATM 4326 O O   . HOH E 4 .   ? 11.413  64.447 35.135 1.00 42.35 ? 2086 HOH A O   1 
HETATM 4327 O O   . HOH E 4 .   ? 11.112  70.197 33.591 1.00 39.58 ? 2087 HOH A O   1 
HETATM 4328 O O   . HOH E 4 .   ? 13.536  68.673 56.635 1.00 28.56 ? 2088 HOH A O   1 
HETATM 4329 O O   . HOH E 4 .   ? 7.311   52.250 56.035 1.00 26.71 ? 2089 HOH A O   1 
HETATM 4330 O O   . HOH E 4 .   ? 5.056   50.347 61.657 1.00 30.09 ? 2090 HOH A O   1 
HETATM 4331 O O   . HOH E 4 .   ? 3.186   53.890 63.071 1.00 28.59 ? 2091 HOH A O   1 
HETATM 4332 O O   . HOH E 4 .   ? 6.569   48.149 55.448 1.00 31.07 ? 2092 HOH A O   1 
HETATM 4333 O O   . HOH E 4 .   ? 3.440   45.632 60.685 1.00 32.37 ? 2093 HOH A O   1 
HETATM 4334 O O   . HOH E 4 .   ? 0.406   40.421 56.769 1.00 36.08 ? 2094 HOH A O   1 
HETATM 4335 O O   . HOH E 4 .   ? 3.565   51.106 63.920 1.00 32.10 ? 2095 HOH A O   1 
HETATM 4336 O O   . HOH E 4 .   ? 3.554   47.243 64.788 1.00 33.08 ? 2096 HOH A O   1 
HETATM 4337 O O   . HOH E 4 .   ? 4.387   49.875 66.601 1.00 32.59 ? 2097 HOH A O   1 
HETATM 4338 O O   . HOH E 4 .   ? -21.666 45.910 66.581 1.00 40.02 ? 2098 HOH A O   1 
HETATM 4339 O O   . HOH E 4 .   ? -20.002 56.486 59.064 1.00 38.00 ? 2099 HOH A O   1 
HETATM 4340 O O   . HOH E 4 .   ? -3.867  56.570 63.908 1.00 32.59 ? 2100 HOH A O   1 
HETATM 4341 O O   . HOH E 4 .   ? -6.612  59.975 69.023 1.00 31.18 ? 2101 HOH A O   1 
HETATM 4342 O O   . HOH E 4 .   ? 2.502   57.423 71.537 1.00 34.81 ? 2102 HOH A O   1 
HETATM 4343 O O   . HOH E 4 .   ? -6.975  48.444 73.521 1.00 35.83 ? 2103 HOH A O   1 
HETATM 4344 O O   . HOH E 4 .   ? 3.512   50.377 69.154 1.00 33.02 ? 2104 HOH A O   1 
HETATM 4345 O O   . HOH E 4 .   ? 3.947   55.100 74.917 1.00 35.65 ? 2105 HOH A O   1 
HETATM 4346 O O   . HOH E 4 .   ? 5.285   53.505 80.117 1.00 35.54 ? 2106 HOH A O   1 
HETATM 4347 O O   . HOH E 4 .   ? 4.004   55.720 69.818 1.00 29.46 ? 2107 HOH A O   1 
HETATM 4348 O O   . HOH E 4 .   ? 1.665   55.346 73.054 1.00 34.87 ? 2108 HOH A O   1 
HETATM 4349 O O   . HOH E 4 .   ? -1.923  57.365 62.149 1.00 24.79 ? 2109 HOH A O   1 
HETATM 4350 O O   . HOH E 4 .   ? 1.506   43.111 54.390 1.00 32.08 ? 2110 HOH A O   1 
HETATM 4351 O O   . HOH E 4 .   ? 7.442   46.670 53.360 1.00 32.03 ? 2111 HOH A O   1 
HETATM 4352 O O   . HOH E 4 .   ? 9.868   46.485 53.184 1.00 34.96 ? 2112 HOH A O   1 
HETATM 4353 O O   . HOH E 4 .   ? 9.513   44.914 43.322 1.00 48.32 ? 2113 HOH A O   1 
HETATM 4354 O O   . HOH E 4 .   ? 6.222   62.283 34.767 1.00 29.36 ? 2114 HOH A O   1 
HETATM 4355 O O   . HOH E 4 .   ? 21.036  71.198 67.751 1.00 40.58 ? 2115 HOH A O   1 
HETATM 4356 O O   . HOH E 4 .   ? 11.977  67.317 66.988 1.00 28.46 ? 2116 HOH A O   1 
HETATM 4357 O O   . HOH E 4 .   ? 17.497  64.458 63.621 1.00 42.95 ? 2117 HOH A O   1 
HETATM 4358 O O   . HOH E 4 .   ? 7.516   63.666 78.529 1.00 27.69 ? 2118 HOH A O   1 
HETATM 4359 O O   . HOH E 4 .   ? 6.219   57.455 78.698 1.00 33.46 ? 2119 HOH A O   1 
HETATM 4360 O O   . HOH E 4 .   ? 4.660   57.701 75.352 1.00 30.12 ? 2120 HOH A O   1 
HETATM 4361 O O   . HOH E 4 .   ? 14.850  65.223 83.560 1.00 33.89 ? 2121 HOH A O   1 
HETATM 4362 O O   . HOH E 4 .   ? 8.386   76.830 75.579 1.00 33.48 ? 2122 HOH A O   1 
HETATM 4363 O O   . HOH E 4 .   ? 7.570   72.172 81.713 1.00 26.29 ? 2123 HOH A O   1 
HETATM 4364 O O   . HOH E 4 .   ? 13.203  59.078 78.706 1.00 29.11 ? 2124 HOH A O   1 
HETATM 4365 O O   . HOH E 4 .   ? 15.868  62.380 84.265 1.00 37.58 ? 2125 HOH A O   1 
HETATM 4366 O O   . HOH E 4 .   ? 9.736   52.786 79.000 1.00 40.66 ? 2126 HOH A O   1 
HETATM 4367 O O   . HOH E 4 .   ? 10.659  55.546 68.137 1.00 26.04 ? 2127 HOH A O   1 
HETATM 4368 O O   . HOH E 4 .   ? 18.638  67.301 72.919 1.00 40.26 ? 2128 HOH A O   1 
HETATM 4369 O O   . HOH E 4 .   ? 16.988  63.855 66.649 1.00 35.18 ? 2129 HOH A O   1 
HETATM 4370 O O   . HOH E 4 .   ? 19.145  65.215 68.255 1.00 44.49 ? 2130 HOH A O   1 
HETATM 4371 O O   . HOH E 4 .   ? 19.883  62.671 64.765 1.00 41.81 ? 2131 HOH A O   1 
HETATM 4372 O O   . HOH E 4 .   ? 18.068  50.534 44.603 1.00 29.74 ? 2132 HOH A O   1 
HETATM 4373 O O   . HOH E 4 .   ? 18.448  59.930 41.430 1.00 31.66 ? 2133 HOH A O   1 
HETATM 4374 O O   . HOH E 4 .   ? 22.415  79.250 61.010 1.00 38.19 ? 2134 HOH A O   1 
HETATM 4375 O O   . HOH E 4 .   ? 14.451  76.252 63.711 1.00 38.48 ? 2135 HOH A O   1 
HETATM 4376 O O   . HOH E 4 .   ? 16.176  79.906 69.528 1.00 36.43 ? 2136 HOH A O   1 
HETATM 4377 O O   . HOH E 4 .   ? 8.541   79.147 66.970 1.00 36.30 ? 2137 HOH A O   1 
HETATM 4378 O O   . HOH E 4 .   ? 13.766  74.455 65.707 1.00 37.51 ? 2138 HOH A O   1 
HETATM 4379 O O   . HOH E 4 .   ? 12.319  77.380 62.276 1.00 35.86 ? 2139 HOH A O   1 
HETATM 4380 O O   . HOH E 4 .   ? 7.926   75.592 60.340 1.00 25.99 ? 2140 HOH A O   1 
HETATM 4381 O O   . HOH E 4 .   ? 10.029  79.971 64.818 1.00 34.39 ? 2141 HOH A O   1 
HETATM 4382 O O   . HOH E 4 .   ? 20.884  84.108 55.696 1.00 43.16 ? 2142 HOH A O   1 
HETATM 4383 O O   . HOH E 4 .   ? 13.232  86.109 46.659 1.00 35.97 ? 2143 HOH A O   1 
HETATM 4384 O O   . HOH E 4 .   ? 9.043   88.264 47.627 1.00 43.12 ? 2144 HOH A O   1 
HETATM 4385 O O   . HOH E 4 .   ? 23.206  77.167 53.688 1.00 39.96 ? 2145 HOH A O   1 
HETATM 4386 O O   . HOH E 4 .   ? 23.165  66.889 47.401 1.00 29.86 ? 2146 HOH A O   1 
HETATM 4387 O O   . HOH E 4 .   ? 27.715  63.481 45.440 1.00 31.59 ? 2147 HOH A O   1 
HETATM 4388 O O   . HOH E 4 .   ? 22.120  61.864 41.554 1.00 30.83 ? 2148 HOH A O   1 
HETATM 4389 O O   . HOH E 4 .   ? 25.182  58.706 51.993 1.00 30.92 ? 2149 HOH A O   1 
HETATM 4390 O O   . HOH E 4 .   ? 25.141  61.466 52.377 1.00 26.67 ? 2150 HOH A O   1 
HETATM 4391 O O   . HOH E 4 .   ? 28.885  59.286 60.714 1.00 35.84 ? 2151 HOH A O   1 
HETATM 4392 O O   . HOH E 4 .   ? 26.692  58.991 62.467 1.00 32.59 ? 2152 HOH A O   1 
HETATM 4393 O O   . HOH E 4 .   ? 1.361   60.754 73.770 1.00 36.37 ? 2153 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1536 1536 NAG NAG A . 
C 2 NAG 1   1537 1537 NAG NAG A . 
D 3 A8B 1   1538 1538 A8B A8B A . 
E 4 HOH 1   2001 2001 HOH HOH A . 
E 4 HOH 2   2002 2002 HOH HOH A . 
E 4 HOH 3   2003 2003 HOH HOH A . 
E 4 HOH 4   2004 2004 HOH HOH A . 
E 4 HOH 5   2005 2005 HOH HOH A . 
E 4 HOH 6   2006 2006 HOH HOH A . 
E 4 HOH 7   2007 2007 HOH HOH A . 
E 4 HOH 8   2008 2008 HOH HOH A . 
E 4 HOH 9   2009 2009 HOH HOH A . 
E 4 HOH 10  2010 2010 HOH HOH A . 
E 4 HOH 11  2011 2011 HOH HOH A . 
E 4 HOH 12  2012 2012 HOH HOH A . 
E 4 HOH 13  2013 2013 HOH HOH A . 
E 4 HOH 14  2014 2014 HOH HOH A . 
E 4 HOH 15  2015 2015 HOH HOH A . 
E 4 HOH 16  2016 2016 HOH HOH A . 
E 4 HOH 17  2017 2017 HOH HOH A . 
E 4 HOH 18  2018 2018 HOH HOH A . 
E 4 HOH 19  2019 2019 HOH HOH A . 
E 4 HOH 20  2020 2020 HOH HOH A . 
E 4 HOH 21  2021 2021 HOH HOH A . 
E 4 HOH 22  2022 2022 HOH HOH A . 
E 4 HOH 23  2023 2023 HOH HOH A . 
E 4 HOH 24  2024 2024 HOH HOH A . 
E 4 HOH 25  2025 2025 HOH HOH A . 
E 4 HOH 26  2026 2026 HOH HOH A . 
E 4 HOH 27  2027 2027 HOH HOH A . 
E 4 HOH 28  2028 2028 HOH HOH A . 
E 4 HOH 29  2029 2029 HOH HOH A . 
E 4 HOH 30  2030 2030 HOH HOH A . 
E 4 HOH 31  2031 2031 HOH HOH A . 
E 4 HOH 32  2032 2032 HOH HOH A . 
E 4 HOH 33  2033 2033 HOH HOH A . 
E 4 HOH 34  2034 2034 HOH HOH A . 
E 4 HOH 35  2035 2035 HOH HOH A . 
E 4 HOH 36  2036 2036 HOH HOH A . 
E 4 HOH 37  2037 2037 HOH HOH A . 
E 4 HOH 38  2038 2038 HOH HOH A . 
E 4 HOH 39  2039 2039 HOH HOH A . 
E 4 HOH 40  2040 2040 HOH HOH A . 
E 4 HOH 41  2041 2041 HOH HOH A . 
E 4 HOH 42  2042 2042 HOH HOH A . 
E 4 HOH 43  2043 2043 HOH HOH A . 
E 4 HOH 44  2044 2044 HOH HOH A . 
E 4 HOH 45  2045 2045 HOH HOH A . 
E 4 HOH 46  2046 2046 HOH HOH A . 
E 4 HOH 47  2047 2047 HOH HOH A . 
E 4 HOH 48  2048 2048 HOH HOH A . 
E 4 HOH 49  2049 2049 HOH HOH A . 
E 4 HOH 50  2050 2050 HOH HOH A . 
E 4 HOH 51  2051 2051 HOH HOH A . 
E 4 HOH 52  2052 2052 HOH HOH A . 
E 4 HOH 53  2053 2053 HOH HOH A . 
E 4 HOH 54  2054 2054 HOH HOH A . 
E 4 HOH 55  2055 2055 HOH HOH A . 
E 4 HOH 56  2056 2056 HOH HOH A . 
E 4 HOH 57  2057 2057 HOH HOH A . 
E 4 HOH 58  2058 2058 HOH HOH A . 
E 4 HOH 59  2059 2059 HOH HOH A . 
E 4 HOH 60  2060 2060 HOH HOH A . 
E 4 HOH 61  2061 2061 HOH HOH A . 
E 4 HOH 62  2062 2062 HOH HOH A . 
E 4 HOH 63  2063 2063 HOH HOH A . 
E 4 HOH 64  2064 2064 HOH HOH A . 
E 4 HOH 65  2065 2065 HOH HOH A . 
E 4 HOH 66  2066 2066 HOH HOH A . 
E 4 HOH 67  2067 2067 HOH HOH A . 
E 4 HOH 68  2068 2068 HOH HOH A . 
E 4 HOH 69  2069 2069 HOH HOH A . 
E 4 HOH 70  2070 2070 HOH HOH A . 
E 4 HOH 71  2071 2071 HOH HOH A . 
E 4 HOH 72  2072 2072 HOH HOH A . 
E 4 HOH 73  2073 2073 HOH HOH A . 
E 4 HOH 74  2074 2074 HOH HOH A . 
E 4 HOH 75  2075 2075 HOH HOH A . 
E 4 HOH 76  2076 2076 HOH HOH A . 
E 4 HOH 77  2077 2077 HOH HOH A . 
E 4 HOH 78  2078 2078 HOH HOH A . 
E 4 HOH 79  2079 2079 HOH HOH A . 
E 4 HOH 80  2080 2080 HOH HOH A . 
E 4 HOH 81  2081 2081 HOH HOH A . 
E 4 HOH 82  2082 2082 HOH HOH A . 
E 4 HOH 83  2083 2083 HOH HOH A . 
E 4 HOH 84  2084 2084 HOH HOH A . 
E 4 HOH 85  2085 2085 HOH HOH A . 
E 4 HOH 86  2086 2086 HOH HOH A . 
E 4 HOH 87  2087 2087 HOH HOH A . 
E 4 HOH 88  2088 2088 HOH HOH A . 
E 4 HOH 89  2089 2089 HOH HOH A . 
E 4 HOH 90  2090 2090 HOH HOH A . 
E 4 HOH 91  2091 2091 HOH HOH A . 
E 4 HOH 92  2092 2092 HOH HOH A . 
E 4 HOH 93  2093 2093 HOH HOH A . 
E 4 HOH 94  2094 2094 HOH HOH A . 
E 4 HOH 95  2095 2095 HOH HOH A . 
E 4 HOH 96  2096 2096 HOH HOH A . 
E 4 HOH 97  2097 2097 HOH HOH A . 
E 4 HOH 98  2098 2098 HOH HOH A . 
E 4 HOH 99  2099 2099 HOH HOH A . 
E 4 HOH 100 2100 2100 HOH HOH A . 
E 4 HOH 101 2101 2101 HOH HOH A . 
E 4 HOH 102 2102 2102 HOH HOH A . 
E 4 HOH 103 2103 2103 HOH HOH A . 
E 4 HOH 104 2104 2104 HOH HOH A . 
E 4 HOH 105 2105 2105 HOH HOH A . 
E 4 HOH 106 2106 2106 HOH HOH A . 
E 4 HOH 107 2107 2107 HOH HOH A . 
E 4 HOH 108 2108 2108 HOH HOH A . 
E 4 HOH 109 2109 2109 HOH HOH A . 
E 4 HOH 110 2110 2110 HOH HOH A . 
E 4 HOH 111 2111 2111 HOH HOH A . 
E 4 HOH 112 2112 2112 HOH HOH A . 
E 4 HOH 113 2113 2113 HOH HOH A . 
E 4 HOH 114 2114 2114 HOH HOH A . 
E 4 HOH 115 2115 2115 HOH HOH A . 
E 4 HOH 116 2116 2116 HOH HOH A . 
E 4 HOH 117 2117 2117 HOH HOH A . 
E 4 HOH 118 2118 2118 HOH HOH A . 
E 4 HOH 119 2119 2119 HOH HOH A . 
E 4 HOH 120 2120 2120 HOH HOH A . 
E 4 HOH 121 2121 2121 HOH HOH A . 
E 4 HOH 122 2122 2122 HOH HOH A . 
E 4 HOH 123 2123 2123 HOH HOH A . 
E 4 HOH 124 2124 2124 HOH HOH A . 
E 4 HOH 125 2125 2125 HOH HOH A . 
E 4 HOH 126 2126 2126 HOH HOH A . 
E 4 HOH 127 2127 2127 HOH HOH A . 
E 4 HOH 128 2128 2128 HOH HOH A . 
E 4 HOH 129 2129 2129 HOH HOH A . 
E 4 HOH 130 2130 2130 HOH HOH A . 
E 4 HOH 131 2131 2131 HOH HOH A . 
E 4 HOH 132 2132 2132 HOH HOH A . 
E 4 HOH 133 2133 2133 HOH HOH A . 
E 4 HOH 134 2134 2134 HOH HOH A . 
E 4 HOH 135 2135 2135 HOH HOH A . 
E 4 HOH 136 2136 2136 HOH HOH A . 
E 4 HOH 137 2137 2137 HOH HOH A . 
E 4 HOH 138 2138 2138 HOH HOH A . 
E 4 HOH 139 2139 2139 HOH HOH A . 
E 4 HOH 140 2140 2140 HOH HOH A . 
E 4 HOH 141 2141 2141 HOH HOH A . 
E 4 HOH 142 2142 2142 HOH HOH A . 
E 4 HOH 143 2143 2143 HOH HOH A . 
E 4 HOH 144 2144 2144 HOH HOH A . 
E 4 HOH 145 2145 2145 HOH HOH A . 
E 4 HOH 146 2146 2146 HOH HOH A . 
E 4 HOH 147 2147 2147 HOH HOH A . 
E 4 HOH 148 2148 2148 HOH HOH A . 
E 4 HOH 149 2149 2149 HOH HOH A . 
E 4 HOH 150 2150 2150 HOH HOH A . 
E 4 HOH 151 2151 2151 HOH HOH A . 
E 4 HOH 152 2152 2152 HOH HOH A . 
E 4 HOH 153 2153 2153 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E 
1 2 A,B,C,D,E 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 136.7440000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-03-23 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' 'Experimental preparation'  
7  4 'Structure model' Other                       
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Derived calculations'      
10 5 'Structure model' Other                       
11 5 'Structure model' 'Structure summary'         
12 6 'Structure model' 'Derived calculations'      
13 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' exptl_crystal_grow        
3  4 'Structure model' pdbx_database_proc        
4  4 'Structure model' pdbx_database_status      
5  4 'Structure model' struct_conn               
6  5 'Structure model' chem_comp                 
7  5 'Structure model' entity                    
8  5 'Structure model' pdbx_chem_comp_identifier 
9  5 'Structure model' pdbx_database_status      
10 5 'Structure model' pdbx_entity_nonpoly       
11 5 'Structure model' struct_conn               
12 5 'Structure model' struct_site               
13 5 'Structure model' struct_site_gen           
14 6 'Structure model' chem_comp                 
15 6 'Structure model' pdbx_struct_assembly      
16 6 'Structure model' pdbx_struct_assembly_gen  
17 6 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.country'                           
2  4 'Structure model' '_exptl_crystal_grow.temp'                    
3  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
5  5 'Structure model' '_chem_comp.name'                             
6  5 'Structure model' '_chem_comp.type'                             
7  5 'Structure model' '_entity.pdbx_description'                    
8  5 'Structure model' '_pdbx_database_status.status_code_sf'        
9  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
10 5 'Structure model' '_struct_conn.pdbx_role'                      
11 6 'Structure model' '_chem_comp.pdbx_synonyms'                    
12 6 'Structure model' '_pdbx_struct_assembly.details'               
13 6 'Structure model' '_pdbx_struct_assembly.method_details'        
14 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
15 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1ODC 
_pdbx_entry_details.compound_details         
;COMPOUND HYDROLYZES CHOLINE RELEASED INTO THE SYNAPSE.
 CATALYTIC ACTIVITY: ACETYLCHOLINE + H(2)O = CHOLINE
 ACETATE. INHIBITORS OF THE ENZYME ACETYLCHOLINESTERASE
 (ACHE) IMPROVE THE COGNITIVE ABILITIES OF INDIVIDUALS WITH
 EARLY STAGE ALZHEIMER'S DISEASE. 9-AMINO-1,2,3,4-TETRA-
 HYDROACRIDINE (TACRINE, ALSO KNOWN AS THA OR COGNEX), A
 SYNTHETIC COMPOUND, IS AMONG THE POTENT ACHE INHIBITORS
 USED IN THIS TREATMENT. THE LIGAND, A8B
 (N-4'-QUINOLYL-N'- 9"-(1",2",3",4"
 -TETRA-HYDROACRIDINYL)-1,8-DIAMINOOCTANE) DIHYDROCHLORIDE,
 A C8-ALKYLENE LINKED HETERODIMER OF TACRINE AND
 4-AMINOQUINOLINE, WAS DESIGNED TO PROBE THE PROTEIN-LIGAND
 INTERACTIONS AT THE 'PERIPHEAL' ANIONIC
 SITE (PAS) OF THE ACTIVE-SITE GORGE OF ACHE. IT HAS BEEN
 SHOWN TO EXHIBIT POTENT INHIBITION OF ACHE. THE TACRINE
 MOIETY BINDS TO THE 'ANIONIC' SUBSITE, NEAR THE BOTTOM OF
 THE ACTIVE-SITE GORGE OF TCACHE, BETWEEN THE AROMATIC RINGS
 OF TRP84 AND PHE330, AS SEEN FOR THE TCACHE/TACRINE
 COMPLEX, AND THE 4-AMINOQUINOLINE MOIETY BINDS TO THE PAS
 AT THE TOP OF THE GORGE, BETWEEN THE AROMATIC RINGS OF
 TRP279 AND TYR70. THE LIGAND, A8B, THUS BINDS BY SPANNING
 THE ACTIVE SITE GORGE, WITH BOTH BINDING MOIETIES OF A8B
 BINDING IN A DOUBLE-STACKING SANDWICH.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_1             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MET 
_pdbx_validate_rmsd_bond.auth_seq_id_2             175 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.413 
_pdbx_validate_rmsd_bond.bond_target_value         1.774 
_pdbx_validate_rmsd_bond.bond_deviation            -0.361 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.056 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 117.00 120.30 -3.30  0.50 N 
2 1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH1 A ARG 243 ? ? 123.57 120.30 3.27   0.50 N 
3 1 NE A ARG 243 ? ? CZ A ARG 243 ? ? NH2 A ARG 243 ? ? 114.98 120.30 -5.32  0.50 N 
4 1 CA A LEU 494 ? ? CB A LEU 494 ? ? CG  A LEU 494 ? ? 129.48 115.30 14.18  2.30 N 
5 1 CB A VAL 518 ? ? CA A VAL 518 ? ? C   A VAL 518 ? ? 97.24  111.40 -14.16 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 25  ? ? -138.41 -157.89 
2 1 PHE A 45  ? ? 83.90   -12.00  
3 1 CYS A 94  ? ? -143.38 12.91   
4 1 SER A 108 ? ? -164.49 75.51   
5 1 SER A 200 ? ? 54.18   -125.40 
6 1 GLU A 299 ? ? -123.33 -72.88  
7 1 THR A 317 ? ? -164.78 -161.47 
8 1 ASP A 380 ? ? -156.28 51.15   
9 1 VAL A 400 ? ? -131.71 -60.43  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     442 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.080 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 52  ? CD  ? A LYS 52  CD  
2  1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
3  1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
4  1 Y 1 A LYS 192 ? CD  ? A LYS 192 CD  
5  1 Y 1 A LYS 192 ? CE  ? A LYS 192 CE  
6  1 Y 1 A LYS 192 ? NZ  ? A LYS 192 NZ  
7  1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
8  1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
9  1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
10 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
11 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
12 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
13 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
14 1 Y 1 A GLU 299 ? CG  ? A GLU 299 CG  
15 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
16 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
17 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
18 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
19 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
20 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
21 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
22 1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
23 1 Y 1 A LYS 454 ? CG  ? A LYS 454 CG  
24 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
25 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
26 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
27 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
28 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
29 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
30 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
31 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
32 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
33 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
34 1 Y 1 A ALA 536 ? CA  ? A ALA 536 CA  
35 1 Y 1 A ALA 536 ? C   ? A ALA 536 C   
36 1 Y 1 A ALA 536 ? O   ? A ALA 536 O   
37 1 Y 1 A ALA 536 ? CB  ? A ALA 536 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A HIS 486 ? A HIS 486 
5  1 Y 1 A SER 487 ? A SER 487 
6  1 Y 1 A GLN 488 ? A GLN 488 
7  1 Y 1 A GLU 489 ? A GLU 489 
8  1 Y 1 A CYS 537 ? A CYS 537 
9  1 Y 1 A ASP 538 ? A ASP 538 
10 1 Y 1 A GLY 539 ? A GLY 539 
11 1 Y 1 A GLU 540 ? A GLU 540 
12 1 Y 1 A LEU 541 ? A LEU 541 
13 1 Y 1 A SER 542 ? A SER 542 
14 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                                NAG 
3 "N-QUINOLIN-4-YL-N'-(1,2,3,4-TETRAHYDROACRIDIN-9-YL)OCTANE-1,8-DIAMINE" A8B 
4 water                                                                   HOH 
#