data_1OFD
# 
_entry.id   1OFD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OFD         
PDBE  EBI-12582    
WWPDB D_1290012582 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1LLW unspecified 
'STRUCTURAL STUDIES ON THE SYNCHRONIZATION OF CATALYTICCENTERS IN GLUTAMATE SYNTHASE: COMPLEX WITH 2-OXOGLUTARATE' 
PDB 1LLZ unspecified 'STRUCTURAL STUDIES ON THE SYNCHRONIZATION OF CATALYTICCENTERS IN GLUTAMATE SYNTHASE: REDUCED ENZYME' 
PDB 1LM1 unspecified 'STRUCTURAL STUDIES ON THE SYNCHRONIZATION OF CATALYTICCENTERS IN GLUTAMATE SYNTHASE: NATIVE ENZYME' 
PDB 1OFE unspecified 
'GLUTAMATE SYNTHASE FROM SYNECHOCYSTIS SP IN COMPLEX WITH 2-OXOGLUTARATE AND L-DON AT 2.45 ANGSTROM RESOLUTION'    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OFD 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Van Den heuvel, R.H.H.' 1 
'Mattevi, A.'            2 
# 
_citation.id                        primary 
_citation.title                     'The Active Conformation of Glutamate Synthase and its Binding to Ferredoxin' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            330 
_citation.page_first                113 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12818206 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(03)00522-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Van Den Heuvel, R.H.H.' 1 
primary 'Svergun, D.I.'          2 
primary 'Petoukhov, M.V.'        3 
primary 'Coda, A.'               4 
primary 'Curti, B.'              5 
primary 'Ravasio, S.'            6 
primary 'Vanoni, M.A.'           7 
primary 'Mattevi, A.'            8 
# 
_cell.entry_id           1OFD 
_cell.length_a           125.017 
_cell.length_b           149.665 
_cell.length_c           195.926 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OFD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 2' 165711.688 2    1.4.7.1 ? ? ? 
2 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                     456.344    2    ?       ? ? ? 
3 non-polymer syn 'FE3-S4 CLUSTER'                            295.795    2    ?       ? ? ? 
4 non-polymer syn '2-OXOGLUTARIC ACID'                        146.098    2    ?       ? ? ? 
5 water       nat water                                       18.015     1424 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GLUTAMATE SYNTHASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CGVGFIANLRGKPDHTLVEQALKALGCMEHRGGCSADNDSGDGAGVMTAIPRELLAQWFNTRNLPMPDGDRLGVGMVFLP
QEPSAREVARAYVEEVVRLEKLTVLGWREVPVNSDVLGIQAKNNQPHIEQILVTCPEGCAGDELDRRLYIARSIIGKKLA
EDFYVCSFSCRTIVYKGMVRSIILGEFYLDLKNPGYTSNFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTLLGNINWM
AAREKELEVSGWTKAELEALTPIVNQANSDSYNLDSALELLVRTGRSPLEAAMILVPEAYKNQPALKDYPEISDFHDYYS
GLQEPWDGPALLVFSDGKIVGAGLDRNGLRPARYCITKDDYIVLGSEAGVVDLPEVDIVEKGRLAPGQMIAVDLAEQKIL
KNYQIKQQAAQKYPYGEWIKIQRQTVASDSFAEKTLFNDAQTVLQQQAAFGYTAEDVEMVVVPMASQGKEPTFCMGDDTP
LAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGKRGNLLEPKAESARTIKLRSPLVNEVELQAIKTGQLQ
VAEVSTLYDLDGVNSLEDALTNLVKTAIATVQAGAEILVLTDRPNGAILTENQSFIPPLLAVGAVHHHLIRAGLRLKASL
IVDTAQCWSTHHFACLVGYGASAICPYLALESVRQWWLDEKTQKLMENGRLDRIDLPTALKNYRQSVEAGLFKILSKMGI
SLLASYHGAQIFEAIGLGAELVEYAFAGTTSRVGGLTIADVAGEVMVFHGMAFPEMAKKLENFGFVNYRPGGEYHMNSPE
MSKSLHKAVAAYKVGGNGNNGEAYDHYELYRQYLKDRPVTALRDLLDFNADQPAISLEEVESVESIVKRFCTGGMSLGAL
SREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHGLQNGDTANSAIKQIASGRFGVTPEYLMSG
KQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIG
IGTIAAGVAKANADIIQISGHDGGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALM
GAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVATQQERLRQRFKGVPGQVVNFFYFIAEEVRSLLAHLGYRSLDDIIGRT
DLLKVRSDVQLSKTQNLTLDCLLNLPDTKQNRQWLNHEPVHSNGPVLDDDILADPDIQEAINHQTTATKTYRLVNTDRTV
GTRLSGAIAKKYGNNGFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPEDNVII
GNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEGAGDHCCEYMTGGVIVVLGPVGRNVGAGMTGGLAYFLDEVGDLPE
KINPEIITLQRITASKGEEQLKSLITAHVEHTGSPKGKAILANWSDYLGKFWQAVPPSEKDSPEANNDVSLTGEKTLTSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CGVGFIANLRGKPDHTLVEQALKALGCMEHRGGCSADNDSGDGAGVMTAIPRELLAQWFNTRNLPMPDGDRLGVGMVFLP
QEPSAREVARAYVEEVVRLEKLTVLGWREVPVNSDVLGIQAKNNQPHIEQILVTCPEGCAGDELDRRLYIARSIIGKKLA
EDFYVCSFSCRTIVYKGMVRSIILGEFYLDLKNPGYTSNFAVYHRRFSTNTMPKWPLAQPMRLLGHNGEINTLLGNINWM
AAREKELEVSGWTKAELEALTPIVNQANSDSYNLDSALELLVRTGRSPLEAAMILVPEAYKNQPALKDYPEISDFHDYYS
GLQEPWDGPALLVFSDGKIVGAGLDRNGLRPARYCITKDDYIVLGSEAGVVDLPEVDIVEKGRLAPGQMIAVDLAEQKIL
KNYQIKQQAAQKYPYGEWIKIQRQTVASDSFAEKTLFNDAQTVLQQQAAFGYTAEDVEMVVVPMASQGKEPTFCMGDDTP
LAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGKRGNLLEPKAESARTIKLRSPLVNEVELQAIKTGQLQ
VAEVSTLYDLDGVNSLEDALTNLVKTAIATVQAGAEILVLTDRPNGAILTENQSFIPPLLAVGAVHHHLIRAGLRLKASL
IVDTAQCWSTHHFACLVGYGASAICPYLALESVRQWWLDEKTQKLMENGRLDRIDLPTALKNYRQSVEAGLFKILSKMGI
SLLASYHGAQIFEAIGLGAELVEYAFAGTTSRVGGLTIADVAGEVMVFHGMAFPEMAKKLENFGFVNYRPGGEYHMNSPE
MSKSLHKAVAAYKVGGNGNNGEAYDHYELYRQYLKDRPVTALRDLLDFNADQPAISLEEVESVESIVKRFCTGGMSLGAL
SREAHETLAIAMNRLGAKSNSGEGGEDVVRYLTLDDVDSEGNSPTLPHLHGLQNGDTANSAIKQIASGRFGVTPEYLMSG
KQLEIKMAQGAKPGEGGQLPGKKVSEYIAMLRRSKPGVTLISPPPHHDIYSIEDLAQLIYDLHQINPEAQVSVKLVAEIG
IGTIAAGVAKANADIIQISGHDGGTGASPLSSIKHAGSPWELGVTEVHRVLMENQLRDRVLLRADGGLKTGWDVVMAALM
GAEEYGFGSIAMIAEGCIMARVCHTNNCPVGVATQQERLRQRFKGVPGQVVNFFYFIAEEVRSLLAHLGYRSLDDIIGRT
DLLKVRSDVQLSKTQNLTLDCLLNLPDTKQNRQWLNHEPVHSNGPVLDDDILADPDIQEAINHQTTATKTYRLVNTDRTV
GTRLSGAIAKKYGNNGFEGNITLNFQGAAGQSFGAFNLDGMTLHLQGEANDYVGKGMNGGEIVIVPHPQASFAPEDNVII
GNTCLYGATGGNLYANGRAGERFAVRNSVGKAVIEGAGDHCCEYMTGGVIVVLGPVGRNVGAGMTGGLAYFLDEVGDLPE
KINPEIITLQRITASKGEEQLKSLITAHVEHTGSPKGKAILANWSDYLGKFWQAVPPSEKDSPEANNDVSLTGEKTLTSV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    CYS n 
1 2    GLY n 
1 3    VAL n 
1 4    GLY n 
1 5    PHE n 
1 6    ILE n 
1 7    ALA n 
1 8    ASN n 
1 9    LEU n 
1 10   ARG n 
1 11   GLY n 
1 12   LYS n 
1 13   PRO n 
1 14   ASP n 
1 15   HIS n 
1 16   THR n 
1 17   LEU n 
1 18   VAL n 
1 19   GLU n 
1 20   GLN n 
1 21   ALA n 
1 22   LEU n 
1 23   LYS n 
1 24   ALA n 
1 25   LEU n 
1 26   GLY n 
1 27   CYS n 
1 28   MET n 
1 29   GLU n 
1 30   HIS n 
1 31   ARG n 
1 32   GLY n 
1 33   GLY n 
1 34   CYS n 
1 35   SER n 
1 36   ALA n 
1 37   ASP n 
1 38   ASN n 
1 39   ASP n 
1 40   SER n 
1 41   GLY n 
1 42   ASP n 
1 43   GLY n 
1 44   ALA n 
1 45   GLY n 
1 46   VAL n 
1 47   MET n 
1 48   THR n 
1 49   ALA n 
1 50   ILE n 
1 51   PRO n 
1 52   ARG n 
1 53   GLU n 
1 54   LEU n 
1 55   LEU n 
1 56   ALA n 
1 57   GLN n 
1 58   TRP n 
1 59   PHE n 
1 60   ASN n 
1 61   THR n 
1 62   ARG n 
1 63   ASN n 
1 64   LEU n 
1 65   PRO n 
1 66   MET n 
1 67   PRO n 
1 68   ASP n 
1 69   GLY n 
1 70   ASP n 
1 71   ARG n 
1 72   LEU n 
1 73   GLY n 
1 74   VAL n 
1 75   GLY n 
1 76   MET n 
1 77   VAL n 
1 78   PHE n 
1 79   LEU n 
1 80   PRO n 
1 81   GLN n 
1 82   GLU n 
1 83   PRO n 
1 84   SER n 
1 85   ALA n 
1 86   ARG n 
1 87   GLU n 
1 88   VAL n 
1 89   ALA n 
1 90   ARG n 
1 91   ALA n 
1 92   TYR n 
1 93   VAL n 
1 94   GLU n 
1 95   GLU n 
1 96   VAL n 
1 97   VAL n 
1 98   ARG n 
1 99   LEU n 
1 100  GLU n 
1 101  LYS n 
1 102  LEU n 
1 103  THR n 
1 104  VAL n 
1 105  LEU n 
1 106  GLY n 
1 107  TRP n 
1 108  ARG n 
1 109  GLU n 
1 110  VAL n 
1 111  PRO n 
1 112  VAL n 
1 113  ASN n 
1 114  SER n 
1 115  ASP n 
1 116  VAL n 
1 117  LEU n 
1 118  GLY n 
1 119  ILE n 
1 120  GLN n 
1 121  ALA n 
1 122  LYS n 
1 123  ASN n 
1 124  ASN n 
1 125  GLN n 
1 126  PRO n 
1 127  HIS n 
1 128  ILE n 
1 129  GLU n 
1 130  GLN n 
1 131  ILE n 
1 132  LEU n 
1 133  VAL n 
1 134  THR n 
1 135  CYS n 
1 136  PRO n 
1 137  GLU n 
1 138  GLY n 
1 139  CYS n 
1 140  ALA n 
1 141  GLY n 
1 142  ASP n 
1 143  GLU n 
1 144  LEU n 
1 145  ASP n 
1 146  ARG n 
1 147  ARG n 
1 148  LEU n 
1 149  TYR n 
1 150  ILE n 
1 151  ALA n 
1 152  ARG n 
1 153  SER n 
1 154  ILE n 
1 155  ILE n 
1 156  GLY n 
1 157  LYS n 
1 158  LYS n 
1 159  LEU n 
1 160  ALA n 
1 161  GLU n 
1 162  ASP n 
1 163  PHE n 
1 164  TYR n 
1 165  VAL n 
1 166  CYS n 
1 167  SER n 
1 168  PHE n 
1 169  SER n 
1 170  CYS n 
1 171  ARG n 
1 172  THR n 
1 173  ILE n 
1 174  VAL n 
1 175  TYR n 
1 176  LYS n 
1 177  GLY n 
1 178  MET n 
1 179  VAL n 
1 180  ARG n 
1 181  SER n 
1 182  ILE n 
1 183  ILE n 
1 184  LEU n 
1 185  GLY n 
1 186  GLU n 
1 187  PHE n 
1 188  TYR n 
1 189  LEU n 
1 190  ASP n 
1 191  LEU n 
1 192  LYS n 
1 193  ASN n 
1 194  PRO n 
1 195  GLY n 
1 196  TYR n 
1 197  THR n 
1 198  SER n 
1 199  ASN n 
1 200  PHE n 
1 201  ALA n 
1 202  VAL n 
1 203  TYR n 
1 204  HIS n 
1 205  ARG n 
1 206  ARG n 
1 207  PHE n 
1 208  SER n 
1 209  THR n 
1 210  ASN n 
1 211  THR n 
1 212  MET n 
1 213  PRO n 
1 214  LYS n 
1 215  TRP n 
1 216  PRO n 
1 217  LEU n 
1 218  ALA n 
1 219  GLN n 
1 220  PRO n 
1 221  MET n 
1 222  ARG n 
1 223  LEU n 
1 224  LEU n 
1 225  GLY n 
1 226  HIS n 
1 227  ASN n 
1 228  GLY n 
1 229  GLU n 
1 230  ILE n 
1 231  ASN n 
1 232  THR n 
1 233  LEU n 
1 234  LEU n 
1 235  GLY n 
1 236  ASN n 
1 237  ILE n 
1 238  ASN n 
1 239  TRP n 
1 240  MET n 
1 241  ALA n 
1 242  ALA n 
1 243  ARG n 
1 244  GLU n 
1 245  LYS n 
1 246  GLU n 
1 247  LEU n 
1 248  GLU n 
1 249  VAL n 
1 250  SER n 
1 251  GLY n 
1 252  TRP n 
1 253  THR n 
1 254  LYS n 
1 255  ALA n 
1 256  GLU n 
1 257  LEU n 
1 258  GLU n 
1 259  ALA n 
1 260  LEU n 
1 261  THR n 
1 262  PRO n 
1 263  ILE n 
1 264  VAL n 
1 265  ASN n 
1 266  GLN n 
1 267  ALA n 
1 268  ASN n 
1 269  SER n 
1 270  ASP n 
1 271  SER n 
1 272  TYR n 
1 273  ASN n 
1 274  LEU n 
1 275  ASP n 
1 276  SER n 
1 277  ALA n 
1 278  LEU n 
1 279  GLU n 
1 280  LEU n 
1 281  LEU n 
1 282  VAL n 
1 283  ARG n 
1 284  THR n 
1 285  GLY n 
1 286  ARG n 
1 287  SER n 
1 288  PRO n 
1 289  LEU n 
1 290  GLU n 
1 291  ALA n 
1 292  ALA n 
1 293  MET n 
1 294  ILE n 
1 295  LEU n 
1 296  VAL n 
1 297  PRO n 
1 298  GLU n 
1 299  ALA n 
1 300  TYR n 
1 301  LYS n 
1 302  ASN n 
1 303  GLN n 
1 304  PRO n 
1 305  ALA n 
1 306  LEU n 
1 307  LYS n 
1 308  ASP n 
1 309  TYR n 
1 310  PRO n 
1 311  GLU n 
1 312  ILE n 
1 313  SER n 
1 314  ASP n 
1 315  PHE n 
1 316  HIS n 
1 317  ASP n 
1 318  TYR n 
1 319  TYR n 
1 320  SER n 
1 321  GLY n 
1 322  LEU n 
1 323  GLN n 
1 324  GLU n 
1 325  PRO n 
1 326  TRP n 
1 327  ASP n 
1 328  GLY n 
1 329  PRO n 
1 330  ALA n 
1 331  LEU n 
1 332  LEU n 
1 333  VAL n 
1 334  PHE n 
1 335  SER n 
1 336  ASP n 
1 337  GLY n 
1 338  LYS n 
1 339  ILE n 
1 340  VAL n 
1 341  GLY n 
1 342  ALA n 
1 343  GLY n 
1 344  LEU n 
1 345  ASP n 
1 346  ARG n 
1 347  ASN n 
1 348  GLY n 
1 349  LEU n 
1 350  ARG n 
1 351  PRO n 
1 352  ALA n 
1 353  ARG n 
1 354  TYR n 
1 355  CYS n 
1 356  ILE n 
1 357  THR n 
1 358  LYS n 
1 359  ASP n 
1 360  ASP n 
1 361  TYR n 
1 362  ILE n 
1 363  VAL n 
1 364  LEU n 
1 365  GLY n 
1 366  SER n 
1 367  GLU n 
1 368  ALA n 
1 369  GLY n 
1 370  VAL n 
1 371  VAL n 
1 372  ASP n 
1 373  LEU n 
1 374  PRO n 
1 375  GLU n 
1 376  VAL n 
1 377  ASP n 
1 378  ILE n 
1 379  VAL n 
1 380  GLU n 
1 381  LYS n 
1 382  GLY n 
1 383  ARG n 
1 384  LEU n 
1 385  ALA n 
1 386  PRO n 
1 387  GLY n 
1 388  GLN n 
1 389  MET n 
1 390  ILE n 
1 391  ALA n 
1 392  VAL n 
1 393  ASP n 
1 394  LEU n 
1 395  ALA n 
1 396  GLU n 
1 397  GLN n 
1 398  LYS n 
1 399  ILE n 
1 400  LEU n 
1 401  LYS n 
1 402  ASN n 
1 403  TYR n 
1 404  GLN n 
1 405  ILE n 
1 406  LYS n 
1 407  GLN n 
1 408  GLN n 
1 409  ALA n 
1 410  ALA n 
1 411  GLN n 
1 412  LYS n 
1 413  TYR n 
1 414  PRO n 
1 415  TYR n 
1 416  GLY n 
1 417  GLU n 
1 418  TRP n 
1 419  ILE n 
1 420  LYS n 
1 421  ILE n 
1 422  GLN n 
1 423  ARG n 
1 424  GLN n 
1 425  THR n 
1 426  VAL n 
1 427  ALA n 
1 428  SER n 
1 429  ASP n 
1 430  SER n 
1 431  PHE n 
1 432  ALA n 
1 433  GLU n 
1 434  LYS n 
1 435  THR n 
1 436  LEU n 
1 437  PHE n 
1 438  ASN n 
1 439  ASP n 
1 440  ALA n 
1 441  GLN n 
1 442  THR n 
1 443  VAL n 
1 444  LEU n 
1 445  GLN n 
1 446  GLN n 
1 447  GLN n 
1 448  ALA n 
1 449  ALA n 
1 450  PHE n 
1 451  GLY n 
1 452  TYR n 
1 453  THR n 
1 454  ALA n 
1 455  GLU n 
1 456  ASP n 
1 457  VAL n 
1 458  GLU n 
1 459  MET n 
1 460  VAL n 
1 461  VAL n 
1 462  VAL n 
1 463  PRO n 
1 464  MET n 
1 465  ALA n 
1 466  SER n 
1 467  GLN n 
1 468  GLY n 
1 469  LYS n 
1 470  GLU n 
1 471  PRO n 
1 472  THR n 
1 473  PHE n 
1 474  CYS n 
1 475  MET n 
1 476  GLY n 
1 477  ASP n 
1 478  ASP n 
1 479  THR n 
1 480  PRO n 
1 481  LEU n 
1 482  ALA n 
1 483  VAL n 
1 484  LEU n 
1 485  SER n 
1 486  HIS n 
1 487  LYS n 
1 488  PRO n 
1 489  ARG n 
1 490  LEU n 
1 491  LEU n 
1 492  TYR n 
1 493  ASP n 
1 494  TYR n 
1 495  PHE n 
1 496  LYS n 
1 497  GLN n 
1 498  ARG n 
1 499  PHE n 
1 500  ALA n 
1 501  GLN n 
1 502  VAL n 
1 503  THR n 
1 504  ASN n 
1 505  PRO n 
1 506  PRO n 
1 507  ILE n 
1 508  ASP n 
1 509  PRO n 
1 510  LEU n 
1 511  ARG n 
1 512  GLU n 
1 513  ASN n 
1 514  LEU n 
1 515  VAL n 
1 516  MET n 
1 517  SER n 
1 518  LEU n 
1 519  ALA n 
1 520  MET n 
1 521  PHE n 
1 522  LEU n 
1 523  GLY n 
1 524  LYS n 
1 525  ARG n 
1 526  GLY n 
1 527  ASN n 
1 528  LEU n 
1 529  LEU n 
1 530  GLU n 
1 531  PRO n 
1 532  LYS n 
1 533  ALA n 
1 534  GLU n 
1 535  SER n 
1 536  ALA n 
1 537  ARG n 
1 538  THR n 
1 539  ILE n 
1 540  LYS n 
1 541  LEU n 
1 542  ARG n 
1 543  SER n 
1 544  PRO n 
1 545  LEU n 
1 546  VAL n 
1 547  ASN n 
1 548  GLU n 
1 549  VAL n 
1 550  GLU n 
1 551  LEU n 
1 552  GLN n 
1 553  ALA n 
1 554  ILE n 
1 555  LYS n 
1 556  THR n 
1 557  GLY n 
1 558  GLN n 
1 559  LEU n 
1 560  GLN n 
1 561  VAL n 
1 562  ALA n 
1 563  GLU n 
1 564  VAL n 
1 565  SER n 
1 566  THR n 
1 567  LEU n 
1 568  TYR n 
1 569  ASP n 
1 570  LEU n 
1 571  ASP n 
1 572  GLY n 
1 573  VAL n 
1 574  ASN n 
1 575  SER n 
1 576  LEU n 
1 577  GLU n 
1 578  ASP n 
1 579  ALA n 
1 580  LEU n 
1 581  THR n 
1 582  ASN n 
1 583  LEU n 
1 584  VAL n 
1 585  LYS n 
1 586  THR n 
1 587  ALA n 
1 588  ILE n 
1 589  ALA n 
1 590  THR n 
1 591  VAL n 
1 592  GLN n 
1 593  ALA n 
1 594  GLY n 
1 595  ALA n 
1 596  GLU n 
1 597  ILE n 
1 598  LEU n 
1 599  VAL n 
1 600  LEU n 
1 601  THR n 
1 602  ASP n 
1 603  ARG n 
1 604  PRO n 
1 605  ASN n 
1 606  GLY n 
1 607  ALA n 
1 608  ILE n 
1 609  LEU n 
1 610  THR n 
1 611  GLU n 
1 612  ASN n 
1 613  GLN n 
1 614  SER n 
1 615  PHE n 
1 616  ILE n 
1 617  PRO n 
1 618  PRO n 
1 619  LEU n 
1 620  LEU n 
1 621  ALA n 
1 622  VAL n 
1 623  GLY n 
1 624  ALA n 
1 625  VAL n 
1 626  HIS n 
1 627  HIS n 
1 628  HIS n 
1 629  LEU n 
1 630  ILE n 
1 631  ARG n 
1 632  ALA n 
1 633  GLY n 
1 634  LEU n 
1 635  ARG n 
1 636  LEU n 
1 637  LYS n 
1 638  ALA n 
1 639  SER n 
1 640  LEU n 
1 641  ILE n 
1 642  VAL n 
1 643  ASP n 
1 644  THR n 
1 645  ALA n 
1 646  GLN n 
1 647  CYS n 
1 648  TRP n 
1 649  SER n 
1 650  THR n 
1 651  HIS n 
1 652  HIS n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  LEU n 
1 657  VAL n 
1 658  GLY n 
1 659  TYR n 
1 660  GLY n 
1 661  ALA n 
1 662  SER n 
1 663  ALA n 
1 664  ILE n 
1 665  CYS n 
1 666  PRO n 
1 667  TYR n 
1 668  LEU n 
1 669  ALA n 
1 670  LEU n 
1 671  GLU n 
1 672  SER n 
1 673  VAL n 
1 674  ARG n 
1 675  GLN n 
1 676  TRP n 
1 677  TRP n 
1 678  LEU n 
1 679  ASP n 
1 680  GLU n 
1 681  LYS n 
1 682  THR n 
1 683  GLN n 
1 684  LYS n 
1 685  LEU n 
1 686  MET n 
1 687  GLU n 
1 688  ASN n 
1 689  GLY n 
1 690  ARG n 
1 691  LEU n 
1 692  ASP n 
1 693  ARG n 
1 694  ILE n 
1 695  ASP n 
1 696  LEU n 
1 697  PRO n 
1 698  THR n 
1 699  ALA n 
1 700  LEU n 
1 701  LYS n 
1 702  ASN n 
1 703  TYR n 
1 704  ARG n 
1 705  GLN n 
1 706  SER n 
1 707  VAL n 
1 708  GLU n 
1 709  ALA n 
1 710  GLY n 
1 711  LEU n 
1 712  PHE n 
1 713  LYS n 
1 714  ILE n 
1 715  LEU n 
1 716  SER n 
1 717  LYS n 
1 718  MET n 
1 719  GLY n 
1 720  ILE n 
1 721  SER n 
1 722  LEU n 
1 723  LEU n 
1 724  ALA n 
1 725  SER n 
1 726  TYR n 
1 727  HIS n 
1 728  GLY n 
1 729  ALA n 
1 730  GLN n 
1 731  ILE n 
1 732  PHE n 
1 733  GLU n 
1 734  ALA n 
1 735  ILE n 
1 736  GLY n 
1 737  LEU n 
1 738  GLY n 
1 739  ALA n 
1 740  GLU n 
1 741  LEU n 
1 742  VAL n 
1 743  GLU n 
1 744  TYR n 
1 745  ALA n 
1 746  PHE n 
1 747  ALA n 
1 748  GLY n 
1 749  THR n 
1 750  THR n 
1 751  SER n 
1 752  ARG n 
1 753  VAL n 
1 754  GLY n 
1 755  GLY n 
1 756  LEU n 
1 757  THR n 
1 758  ILE n 
1 759  ALA n 
1 760  ASP n 
1 761  VAL n 
1 762  ALA n 
1 763  GLY n 
1 764  GLU n 
1 765  VAL n 
1 766  MET n 
1 767  VAL n 
1 768  PHE n 
1 769  HIS n 
1 770  GLY n 
1 771  MET n 
1 772  ALA n 
1 773  PHE n 
1 774  PRO n 
1 775  GLU n 
1 776  MET n 
1 777  ALA n 
1 778  LYS n 
1 779  LYS n 
1 780  LEU n 
1 781  GLU n 
1 782  ASN n 
1 783  PHE n 
1 784  GLY n 
1 785  PHE n 
1 786  VAL n 
1 787  ASN n 
1 788  TYR n 
1 789  ARG n 
1 790  PRO n 
1 791  GLY n 
1 792  GLY n 
1 793  GLU n 
1 794  TYR n 
1 795  HIS n 
1 796  MET n 
1 797  ASN n 
1 798  SER n 
1 799  PRO n 
1 800  GLU n 
1 801  MET n 
1 802  SER n 
1 803  LYS n 
1 804  SER n 
1 805  LEU n 
1 806  HIS n 
1 807  LYS n 
1 808  ALA n 
1 809  VAL n 
1 810  ALA n 
1 811  ALA n 
1 812  TYR n 
1 813  LYS n 
1 814  VAL n 
1 815  GLY n 
1 816  GLY n 
1 817  ASN n 
1 818  GLY n 
1 819  ASN n 
1 820  ASN n 
1 821  GLY n 
1 822  GLU n 
1 823  ALA n 
1 824  TYR n 
1 825  ASP n 
1 826  HIS n 
1 827  TYR n 
1 828  GLU n 
1 829  LEU n 
1 830  TYR n 
1 831  ARG n 
1 832  GLN n 
1 833  TYR n 
1 834  LEU n 
1 835  LYS n 
1 836  ASP n 
1 837  ARG n 
1 838  PRO n 
1 839  VAL n 
1 840  THR n 
1 841  ALA n 
1 842  LEU n 
1 843  ARG n 
1 844  ASP n 
1 845  LEU n 
1 846  LEU n 
1 847  ASP n 
1 848  PHE n 
1 849  ASN n 
1 850  ALA n 
1 851  ASP n 
1 852  GLN n 
1 853  PRO n 
1 854  ALA n 
1 855  ILE n 
1 856  SER n 
1 857  LEU n 
1 858  GLU n 
1 859  GLU n 
1 860  VAL n 
1 861  GLU n 
1 862  SER n 
1 863  VAL n 
1 864  GLU n 
1 865  SER n 
1 866  ILE n 
1 867  VAL n 
1 868  LYS n 
1 869  ARG n 
1 870  PHE n 
1 871  CYS n 
1 872  THR n 
1 873  GLY n 
1 874  GLY n 
1 875  MET n 
1 876  SER n 
1 877  LEU n 
1 878  GLY n 
1 879  ALA n 
1 880  LEU n 
1 881  SER n 
1 882  ARG n 
1 883  GLU n 
1 884  ALA n 
1 885  HIS n 
1 886  GLU n 
1 887  THR n 
1 888  LEU n 
1 889  ALA n 
1 890  ILE n 
1 891  ALA n 
1 892  MET n 
1 893  ASN n 
1 894  ARG n 
1 895  LEU n 
1 896  GLY n 
1 897  ALA n 
1 898  LYS n 
1 899  SER n 
1 900  ASN n 
1 901  SER n 
1 902  GLY n 
1 903  GLU n 
1 904  GLY n 
1 905  GLY n 
1 906  GLU n 
1 907  ASP n 
1 908  VAL n 
1 909  VAL n 
1 910  ARG n 
1 911  TYR n 
1 912  LEU n 
1 913  THR n 
1 914  LEU n 
1 915  ASP n 
1 916  ASP n 
1 917  VAL n 
1 918  ASP n 
1 919  SER n 
1 920  GLU n 
1 921  GLY n 
1 922  ASN n 
1 923  SER n 
1 924  PRO n 
1 925  THR n 
1 926  LEU n 
1 927  PRO n 
1 928  HIS n 
1 929  LEU n 
1 930  HIS n 
1 931  GLY n 
1 932  LEU n 
1 933  GLN n 
1 934  ASN n 
1 935  GLY n 
1 936  ASP n 
1 937  THR n 
1 938  ALA n 
1 939  ASN n 
1 940  SER n 
1 941  ALA n 
1 942  ILE n 
1 943  LYS n 
1 944  GLN n 
1 945  ILE n 
1 946  ALA n 
1 947  SER n 
1 948  GLY n 
1 949  ARG n 
1 950  PHE n 
1 951  GLY n 
1 952  VAL n 
1 953  THR n 
1 954  PRO n 
1 955  GLU n 
1 956  TYR n 
1 957  LEU n 
1 958  MET n 
1 959  SER n 
1 960  GLY n 
1 961  LYS n 
1 962  GLN n 
1 963  LEU n 
1 964  GLU n 
1 965  ILE n 
1 966  LYS n 
1 967  MET n 
1 968  ALA n 
1 969  GLN n 
1 970  GLY n 
1 971  ALA n 
1 972  LYS n 
1 973  PRO n 
1 974  GLY n 
1 975  GLU n 
1 976  GLY n 
1 977  GLY n 
1 978  GLN n 
1 979  LEU n 
1 980  PRO n 
1 981  GLY n 
1 982  LYS n 
1 983  LYS n 
1 984  VAL n 
1 985  SER n 
1 986  GLU n 
1 987  TYR n 
1 988  ILE n 
1 989  ALA n 
1 990  MET n 
1 991  LEU n 
1 992  ARG n 
1 993  ARG n 
1 994  SER n 
1 995  LYS n 
1 996  PRO n 
1 997  GLY n 
1 998  VAL n 
1 999  THR n 
1 1000 LEU n 
1 1001 ILE n 
1 1002 SER n 
1 1003 PRO n 
1 1004 PRO n 
1 1005 PRO n 
1 1006 HIS n 
1 1007 HIS n 
1 1008 ASP n 
1 1009 ILE n 
1 1010 TYR n 
1 1011 SER n 
1 1012 ILE n 
1 1013 GLU n 
1 1014 ASP n 
1 1015 LEU n 
1 1016 ALA n 
1 1017 GLN n 
1 1018 LEU n 
1 1019 ILE n 
1 1020 TYR n 
1 1021 ASP n 
1 1022 LEU n 
1 1023 HIS n 
1 1024 GLN n 
1 1025 ILE n 
1 1026 ASN n 
1 1027 PRO n 
1 1028 GLU n 
1 1029 ALA n 
1 1030 GLN n 
1 1031 VAL n 
1 1032 SER n 
1 1033 VAL n 
1 1034 LYS n 
1 1035 LEU n 
1 1036 VAL n 
1 1037 ALA n 
1 1038 GLU n 
1 1039 ILE n 
1 1040 GLY n 
1 1041 ILE n 
1 1042 GLY n 
1 1043 THR n 
1 1044 ILE n 
1 1045 ALA n 
1 1046 ALA n 
1 1047 GLY n 
1 1048 VAL n 
1 1049 ALA n 
1 1050 LYS n 
1 1051 ALA n 
1 1052 ASN n 
1 1053 ALA n 
1 1054 ASP n 
1 1055 ILE n 
1 1056 ILE n 
1 1057 GLN n 
1 1058 ILE n 
1 1059 SER n 
1 1060 GLY n 
1 1061 HIS n 
1 1062 ASP n 
1 1063 GLY n 
1 1064 GLY n 
1 1065 THR n 
1 1066 GLY n 
1 1067 ALA n 
1 1068 SER n 
1 1069 PRO n 
1 1070 LEU n 
1 1071 SER n 
1 1072 SER n 
1 1073 ILE n 
1 1074 LYS n 
1 1075 HIS n 
1 1076 ALA n 
1 1077 GLY n 
1 1078 SER n 
1 1079 PRO n 
1 1080 TRP n 
1 1081 GLU n 
1 1082 LEU n 
1 1083 GLY n 
1 1084 VAL n 
1 1085 THR n 
1 1086 GLU n 
1 1087 VAL n 
1 1088 HIS n 
1 1089 ARG n 
1 1090 VAL n 
1 1091 LEU n 
1 1092 MET n 
1 1093 GLU n 
1 1094 ASN n 
1 1095 GLN n 
1 1096 LEU n 
1 1097 ARG n 
1 1098 ASP n 
1 1099 ARG n 
1 1100 VAL n 
1 1101 LEU n 
1 1102 LEU n 
1 1103 ARG n 
1 1104 ALA n 
1 1105 ASP n 
1 1106 GLY n 
1 1107 GLY n 
1 1108 LEU n 
1 1109 LYS n 
1 1110 THR n 
1 1111 GLY n 
1 1112 TRP n 
1 1113 ASP n 
1 1114 VAL n 
1 1115 VAL n 
1 1116 MET n 
1 1117 ALA n 
1 1118 ALA n 
1 1119 LEU n 
1 1120 MET n 
1 1121 GLY n 
1 1122 ALA n 
1 1123 GLU n 
1 1124 GLU n 
1 1125 TYR n 
1 1126 GLY n 
1 1127 PHE n 
1 1128 GLY n 
1 1129 SER n 
1 1130 ILE n 
1 1131 ALA n 
1 1132 MET n 
1 1133 ILE n 
1 1134 ALA n 
1 1135 GLU n 
1 1136 GLY n 
1 1137 CYS n 
1 1138 ILE n 
1 1139 MET n 
1 1140 ALA n 
1 1141 ARG n 
1 1142 VAL n 
1 1143 CYS n 
1 1144 HIS n 
1 1145 THR n 
1 1146 ASN n 
1 1147 ASN n 
1 1148 CYS n 
1 1149 PRO n 
1 1150 VAL n 
1 1151 GLY n 
1 1152 VAL n 
1 1153 ALA n 
1 1154 THR n 
1 1155 GLN n 
1 1156 GLN n 
1 1157 GLU n 
1 1158 ARG n 
1 1159 LEU n 
1 1160 ARG n 
1 1161 GLN n 
1 1162 ARG n 
1 1163 PHE n 
1 1164 LYS n 
1 1165 GLY n 
1 1166 VAL n 
1 1167 PRO n 
1 1168 GLY n 
1 1169 GLN n 
1 1170 VAL n 
1 1171 VAL n 
1 1172 ASN n 
1 1173 PHE n 
1 1174 PHE n 
1 1175 TYR n 
1 1176 PHE n 
1 1177 ILE n 
1 1178 ALA n 
1 1179 GLU n 
1 1180 GLU n 
1 1181 VAL n 
1 1182 ARG n 
1 1183 SER n 
1 1184 LEU n 
1 1185 LEU n 
1 1186 ALA n 
1 1187 HIS n 
1 1188 LEU n 
1 1189 GLY n 
1 1190 TYR n 
1 1191 ARG n 
1 1192 SER n 
1 1193 LEU n 
1 1194 ASP n 
1 1195 ASP n 
1 1196 ILE n 
1 1197 ILE n 
1 1198 GLY n 
1 1199 ARG n 
1 1200 THR n 
1 1201 ASP n 
1 1202 LEU n 
1 1203 LEU n 
1 1204 LYS n 
1 1205 VAL n 
1 1206 ARG n 
1 1207 SER n 
1 1208 ASP n 
1 1209 VAL n 
1 1210 GLN n 
1 1211 LEU n 
1 1212 SER n 
1 1213 LYS n 
1 1214 THR n 
1 1215 GLN n 
1 1216 ASN n 
1 1217 LEU n 
1 1218 THR n 
1 1219 LEU n 
1 1220 ASP n 
1 1221 CYS n 
1 1222 LEU n 
1 1223 LEU n 
1 1224 ASN n 
1 1225 LEU n 
1 1226 PRO n 
1 1227 ASP n 
1 1228 THR n 
1 1229 LYS n 
1 1230 GLN n 
1 1231 ASN n 
1 1232 ARG n 
1 1233 GLN n 
1 1234 TRP n 
1 1235 LEU n 
1 1236 ASN n 
1 1237 HIS n 
1 1238 GLU n 
1 1239 PRO n 
1 1240 VAL n 
1 1241 HIS n 
1 1242 SER n 
1 1243 ASN n 
1 1244 GLY n 
1 1245 PRO n 
1 1246 VAL n 
1 1247 LEU n 
1 1248 ASP n 
1 1249 ASP n 
1 1250 ASP n 
1 1251 ILE n 
1 1252 LEU n 
1 1253 ALA n 
1 1254 ASP n 
1 1255 PRO n 
1 1256 ASP n 
1 1257 ILE n 
1 1258 GLN n 
1 1259 GLU n 
1 1260 ALA n 
1 1261 ILE n 
1 1262 ASN n 
1 1263 HIS n 
1 1264 GLN n 
1 1265 THR n 
1 1266 THR n 
1 1267 ALA n 
1 1268 THR n 
1 1269 LYS n 
1 1270 THR n 
1 1271 TYR n 
1 1272 ARG n 
1 1273 LEU n 
1 1274 VAL n 
1 1275 ASN n 
1 1276 THR n 
1 1277 ASP n 
1 1278 ARG n 
1 1279 THR n 
1 1280 VAL n 
1 1281 GLY n 
1 1282 THR n 
1 1283 ARG n 
1 1284 LEU n 
1 1285 SER n 
1 1286 GLY n 
1 1287 ALA n 
1 1288 ILE n 
1 1289 ALA n 
1 1290 LYS n 
1 1291 LYS n 
1 1292 TYR n 
1 1293 GLY n 
1 1294 ASN n 
1 1295 ASN n 
1 1296 GLY n 
1 1297 PHE n 
1 1298 GLU n 
1 1299 GLY n 
1 1300 ASN n 
1 1301 ILE n 
1 1302 THR n 
1 1303 LEU n 
1 1304 ASN n 
1 1305 PHE n 
1 1306 GLN n 
1 1307 GLY n 
1 1308 ALA n 
1 1309 ALA n 
1 1310 GLY n 
1 1311 GLN n 
1 1312 SER n 
1 1313 PHE n 
1 1314 GLY n 
1 1315 ALA n 
1 1316 PHE n 
1 1317 ASN n 
1 1318 LEU n 
1 1319 ASP n 
1 1320 GLY n 
1 1321 MET n 
1 1322 THR n 
1 1323 LEU n 
1 1324 HIS n 
1 1325 LEU n 
1 1326 GLN n 
1 1327 GLY n 
1 1328 GLU n 
1 1329 ALA n 
1 1330 ASN n 
1 1331 ASP n 
1 1332 TYR n 
1 1333 VAL n 
1 1334 GLY n 
1 1335 LYS n 
1 1336 GLY n 
1 1337 MET n 
1 1338 ASN n 
1 1339 GLY n 
1 1340 GLY n 
1 1341 GLU n 
1 1342 ILE n 
1 1343 VAL n 
1 1344 ILE n 
1 1345 VAL n 
1 1346 PRO n 
1 1347 HIS n 
1 1348 PRO n 
1 1349 GLN n 
1 1350 ALA n 
1 1351 SER n 
1 1352 PHE n 
1 1353 ALA n 
1 1354 PRO n 
1 1355 GLU n 
1 1356 ASP n 
1 1357 ASN n 
1 1358 VAL n 
1 1359 ILE n 
1 1360 ILE n 
1 1361 GLY n 
1 1362 ASN n 
1 1363 THR n 
1 1364 CYS n 
1 1365 LEU n 
1 1366 TYR n 
1 1367 GLY n 
1 1368 ALA n 
1 1369 THR n 
1 1370 GLY n 
1 1371 GLY n 
1 1372 ASN n 
1 1373 LEU n 
1 1374 TYR n 
1 1375 ALA n 
1 1376 ASN n 
1 1377 GLY n 
1 1378 ARG n 
1 1379 ALA n 
1 1380 GLY n 
1 1381 GLU n 
1 1382 ARG n 
1 1383 PHE n 
1 1384 ALA n 
1 1385 VAL n 
1 1386 ARG n 
1 1387 ASN n 
1 1388 SER n 
1 1389 VAL n 
1 1390 GLY n 
1 1391 LYS n 
1 1392 ALA n 
1 1393 VAL n 
1 1394 ILE n 
1 1395 GLU n 
1 1396 GLY n 
1 1397 ALA n 
1 1398 GLY n 
1 1399 ASP n 
1 1400 HIS n 
1 1401 CYS n 
1 1402 CYS n 
1 1403 GLU n 
1 1404 TYR n 
1 1405 MET n 
1 1406 THR n 
1 1407 GLY n 
1 1408 GLY n 
1 1409 VAL n 
1 1410 ILE n 
1 1411 VAL n 
1 1412 VAL n 
1 1413 LEU n 
1 1414 GLY n 
1 1415 PRO n 
1 1416 VAL n 
1 1417 GLY n 
1 1418 ARG n 
1 1419 ASN n 
1 1420 VAL n 
1 1421 GLY n 
1 1422 ALA n 
1 1423 GLY n 
1 1424 MET n 
1 1425 THR n 
1 1426 GLY n 
1 1427 GLY n 
1 1428 LEU n 
1 1429 ALA n 
1 1430 TYR n 
1 1431 PHE n 
1 1432 LEU n 
1 1433 ASP n 
1 1434 GLU n 
1 1435 VAL n 
1 1436 GLY n 
1 1437 ASP n 
1 1438 LEU n 
1 1439 PRO n 
1 1440 GLU n 
1 1441 LYS n 
1 1442 ILE n 
1 1443 ASN n 
1 1444 PRO n 
1 1445 GLU n 
1 1446 ILE n 
1 1447 ILE n 
1 1448 THR n 
1 1449 LEU n 
1 1450 GLN n 
1 1451 ARG n 
1 1452 ILE n 
1 1453 THR n 
1 1454 ALA n 
1 1455 SER n 
1 1456 LYS n 
1 1457 GLY n 
1 1458 GLU n 
1 1459 GLU n 
1 1460 GLN n 
1 1461 LEU n 
1 1462 LYS n 
1 1463 SER n 
1 1464 LEU n 
1 1465 ILE n 
1 1466 THR n 
1 1467 ALA n 
1 1468 HIS n 
1 1469 VAL n 
1 1470 GLU n 
1 1471 HIS n 
1 1472 THR n 
1 1473 GLY n 
1 1474 SER n 
1 1475 PRO n 
1 1476 LYS n 
1 1477 GLY n 
1 1478 LYS n 
1 1479 ALA n 
1 1480 ILE n 
1 1481 LEU n 
1 1482 ALA n 
1 1483 ASN n 
1 1484 TRP n 
1 1485 SER n 
1 1486 ASP n 
1 1487 TYR n 
1 1488 LEU n 
1 1489 GLY n 
1 1490 LYS n 
1 1491 PHE n 
1 1492 TRP n 
1 1493 GLN n 
1 1494 ALA n 
1 1495 VAL n 
1 1496 PRO n 
1 1497 PRO n 
1 1498 SER n 
1 1499 GLU n 
1 1500 LYS n 
1 1501 ASP n 
1 1502 SER n 
1 1503 PRO n 
1 1504 GLU n 
1 1505 ALA n 
1 1506 ASN n 
1 1507 ASN n 
1 1508 ASP n 
1 1509 VAL n 
1 1510 SER n 
1 1511 LEU n 
1 1512 THR n 
1 1513 GLY n 
1 1514 GLU n 
1 1515 LYS n 
1 1516 THR n 
1 1517 LEU n 
1 1518 THR n 
1 1519 SER n 
1 1520 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PCC6803 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SYNECHOCYSTIS SP.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1148 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'CLR207 RECA' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLTS_SYNY3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P55038 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OFD A 1 ? 1520 ? P55038 37 ? 1556 ? 1 1520 
2 1 1OFD B 1 ? 1520 ? P55038 37 ? 1556 ? 1 1520 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1OFD ASP A 578  ? UNP P55038 THR 614  conflict 578  1 
1 1OFD THR A 581  ? UNP P55038 ASP 617  conflict 581  2 
1 1OFD ASN A 1507 ? UNP P55038 GLY 1543 conflict 1507 3 
2 1OFD ASP B 578  ? UNP P55038 THR 614  conflict 578  4 
2 1OFD THR B 581  ? UNP P55038 ASP 617  conflict 581  5 
2 1OFD ASN B 1507 ? UNP P55038 GLY 1543 conflict 1507 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AKG non-polymer         . '2-OXOGLUTARIC ACID'    ?                          'C5 H6 O5'        146.098 
ALA 'L-peptide linking' y ALANINE                 ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                          'C3 H7 N O2 S'    121.158 
F3S non-polymer         . 'FE3-S4 CLUSTER'        ?                          'Fe3 S4'          295.795 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE               ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                 ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE               ?                          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                   ?                          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                  ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE              ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE           ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                 ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                  ?                          'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE               ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                  ?                          'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1OFD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1. 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             1. 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OFD 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.000 
_reflns.number_obs                   238970 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.06800 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           0.25600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OFD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     225812 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.194 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.192 
_refine.ls_R_factor_R_free                       0.231 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  11929 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.910 
_refine.B_iso_mean                               8.09 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    BABINET 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  NONE 
_refine.pdbx_starting_model                      'PDB ENTRY 1LLW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.173 
_refine.pdbx_overall_ESU_R_Free                  0.157 
_refine.overall_SU_ML                            0.105 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.684 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        22868 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             1424 
_refine_hist.number_atoms_total               24388 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.021  ? 23416 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.563  1.965  ? 31754 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.685  5.000  ? 2976  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       27.483 30.000 ? 2836  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       28.331 20.000 ? 2836  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.118  0.200  ? 3546  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 17788 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.226  0.200  ? 11559 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.164  0.200  ? 1575  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.190  0.200  ? 75    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.121  0.200  ? 25    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.524  1.500  ? 14764 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.985  2.000  ? 23668 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.859  3.000  ? 8652  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.891  4.500  ? 8080  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.05 
_refine_ls_shell.number_reflns_R_work             15791 
_refine_ls_shell.R_factor_R_work                  0.2040 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2480 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             813 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.990790 
_struct_ncs_oper.matrix[1][2]   -0.135290 
_struct_ncs_oper.matrix[1][3]   0.006130 
_struct_ncs_oper.matrix[2][1]   0.135400 
_struct_ncs_oper.matrix[2][2]   0.988660 
_struct_ncs_oper.matrix[2][3]   -0.064940 
_struct_ncs_oper.matrix[3][1]   0.002730 
_struct_ncs_oper.matrix[3][2]   0.065170 
_struct_ncs_oper.matrix[3][3]   0.997870 
_struct_ncs_oper.vector[1]      -41.11935 
_struct_ncs_oper.vector[2]      -82.68583 
_struct_ncs_oper.vector[3]      -7.54323 
# 
_struct.entry_id                  1OFD 
_struct.title                     
'Glutamate Synthase from Synechocystis sp in complex with 2-Oxoglutarate at 2.0 Angstrom resolution' 
_struct.pdbx_descriptor           'FERREDOXIN-DEPENDENT GLUTAMATE SYNTHASE 2 (E.C.1.4.7.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OFD 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'OXIDOREDUCTASE, COMPLEX ENZYME, SUBSTRATE CHANNELING, AMIDOTRANSFERASE, FLAVOPROTEIN, IRON-SULPHUR, FD-GOGAT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   HIS A 15   ? MET A 28   ? HIS A 15   MET A 28   1 ? 14 
HELX_P HELX_P2   2   GLU A 29   ? GLY A 32   ? GLU A 29   GLY A 32   5 ? 4  
HELX_P HELX_P3   3   PRO A 51   ? ARG A 62   ? PRO A 51   ARG A 62   1 ? 12 
HELX_P HELX_P4   4   ASP A 68   ? LEU A 72   ? ASP A 68   LEU A 72   5 ? 5  
HELX_P HELX_P5   5   GLU A 82   ? GLU A 100  ? GLU A 82   GLU A 100  1 ? 19 
HELX_P HELX_P6   6   ASN A 113  ? LEU A 117  ? ASN A 113  LEU A 117  5 ? 5  
HELX_P HELX_P7   7   GLY A 118  ? GLN A 125  ? GLY A 118  GLN A 125  1 ? 8  
HELX_P HELX_P8   8   ALA A 140  ? GLY A 156  ? ALA A 140  GLY A 156  1 ? 17 
HELX_P HELX_P9   9   LYS A 157  ? LEU A 159  ? LYS A 157  LEU A 159  5 ? 3  
HELX_P HELX_P10  10  ARG A 180  ? ILE A 182  ? ARG A 180  ILE A 182  5 ? 3  
HELX_P HELX_P11  11  ILE A 183  ? TYR A 188  ? ILE A 183  TYR A 188  1 ? 6  
HELX_P HELX_P12  12  TYR A 188  ? ASN A 193  ? TYR A 188  ASN A 193  1 ? 6  
HELX_P HELX_P13  13  LYS A 214  ? ALA A 218  ? LYS A 214  ALA A 218  5 ? 5  
HELX_P HELX_P14  14  THR A 232  ? GLU A 244  ? THR A 232  GLU A 244  1 ? 13 
HELX_P HELX_P15  15  LYS A 245  ? LEU A 247  ? LYS A 245  LEU A 247  5 ? 3  
HELX_P HELX_P16  16  THR A 253  ? THR A 261  ? THR A 253  THR A 261  1 ? 9  
HELX_P HELX_P17  17  SER A 269  ? THR A 284  ? SER A 269  THR A 284  1 ? 16 
HELX_P HELX_P18  18  SER A 287  ? VAL A 296  ? SER A 287  VAL A 296  1 ? 10 
HELX_P HELX_P19  19  GLN A 303  ? LYS A 307  ? GLN A 303  LYS A 307  5 ? 5  
HELX_P HELX_P20  20  TYR A 309  ? SER A 320  ? TYR A 309  SER A 320  1 ? 12 
HELX_P HELX_P21  21  PRO A 374  ? VAL A 376  ? PRO A 374  VAL A 376  5 ? 3  
HELX_P HELX_P22  22  LYS A 401  ? GLN A 411  ? LYS A 401  GLN A 411  1 ? 11 
HELX_P HELX_P23  23  PRO A 414  ? GLN A 422  ? PRO A 414  GLN A 422  1 ? 9  
HELX_P HELX_P24  24  ASP A 439  ? PHE A 450  ? ASP A 439  PHE A 450  1 ? 12 
HELX_P HELX_P25  25  THR A 453  ? VAL A 460  ? THR A 453  VAL A 460  1 ? 8  
HELX_P HELX_P26  26  VAL A 460  ? GLY A 468  ? VAL A 460  GLY A 468  1 ? 9  
HELX_P HELX_P27  27  LEU A 490  ? ASP A 493  ? LEU A 490  ASP A 493  5 ? 4  
HELX_P HELX_P28  28  GLU A 512  ? MET A 516  ? GLU A 512  MET A 516  5 ? 5  
HELX_P HELX_P29  29  LYS A 532  ? ARG A 537  ? LYS A 532  ARG A 537  5 ? 6  
HELX_P HELX_P30  30  ASN A 547  ? GLY A 557  ? ASN A 547  GLY A 557  1 ? 11 
HELX_P HELX_P31  31  SER A 575  ? ALA A 593  ? SER A 575  ALA A 593  1 ? 19 
HELX_P HELX_P32  32  ARG A 603  ? ALA A 607  ? ARG A 603  ALA A 607  5 ? 5  
HELX_P HELX_P33  33  PRO A 617  ? ALA A 632  ? PRO A 617  ALA A 632  1 ? 16 
HELX_P HELX_P34  34  LEU A 634  ? ALA A 638  ? LEU A 634  ALA A 638  5 ? 5  
HELX_P HELX_P35  35  SER A 649  ? TYR A 659  ? SER A 649  TYR A 659  1 ? 11 
HELX_P HELX_P36  36  PRO A 666  ? LEU A 678  ? PRO A 666  LEU A 678  1 ? 13 
HELX_P HELX_P37  37  ASP A 679  ? GLU A 687  ? ASP A 679  GLU A 687  1 ? 9  
HELX_P HELX_P38  38  ASP A 695  ? MET A 718  ? ASP A 695  MET A 718  1 ? 24 
HELX_P HELX_P39  39  LEU A 722  ? GLY A 728  ? LEU A 722  GLY A 728  1 ? 7  
HELX_P HELX_P40  40  GLY A 738  ? PHE A 746  ? GLY A 738  PHE A 746  1 ? 9  
HELX_P HELX_P41  41  THR A 757  ? PHE A 773  ? THR A 757  PHE A 773  1 ? 17 
HELX_P HELX_P42  42  SER A 798  ? TYR A 812  ? SER A 798  TYR A 812  1 ? 15 
HELX_P HELX_P43  43  ASP A 825  ? ASP A 836  ? ASP A 825  ASP A 836  1 ? 12 
HELX_P HELX_P44  44  ALA A 841  ? ASP A 844  ? ALA A 841  ASP A 844  5 ? 4  
HELX_P HELX_P45  45  SER A 856  ? VAL A 860  ? SER A 856  VAL A 860  5 ? 5  
HELX_P HELX_P46  46  SER A 862  ? LYS A 868  ? SER A 862  LYS A 868  1 ? 7  
HELX_P HELX_P47  47  SER A 881  ? GLY A 896  ? SER A 881  GLY A 896  1 ? 16 
HELX_P HELX_P48  48  ASP A 907  ? LEU A 912  ? ASP A 907  LEU A 912  5 ? 6  
HELX_P HELX_P49  49  THR A 953  ? GLY A 960  ? THR A 953  GLY A 960  1 ? 8  
HELX_P HELX_P50  50  PRO A 980  ? VAL A 984  ? PRO A 980  VAL A 984  5 ? 5  
HELX_P HELX_P51  51  SER A 985  ? ARG A 993  ? SER A 985  ARG A 993  1 ? 9  
HELX_P HELX_P52  52  SER A 1011 ? ASN A 1026 ? SER A 1011 ASN A 1026 1 ? 16 
HELX_P HELX_P53  53  GLY A 1040 ? ALA A 1051 ? GLY A 1040 ALA A 1051 1 ? 12 
HELX_P HELX_P54  54  LEU A 1070 ? ALA A 1076 ? LEU A 1070 ALA A 1076 1 ? 7  
HELX_P HELX_P55  55  PRO A 1079 ? ASN A 1094 ? PRO A 1079 ASN A 1094 1 ? 16 
HELX_P HELX_P56  56  LEU A 1096 ? VAL A 1100 ? LEU A 1096 VAL A 1100 5 ? 5  
HELX_P HELX_P57  57  THR A 1110 ? MET A 1120 ? THR A 1110 MET A 1120 1 ? 11 
HELX_P HELX_P58  58  GLY A 1128 ? GLU A 1135 ? GLY A 1128 GLU A 1135 1 ? 8  
HELX_P HELX_P59  59  VAL A 1142 ? ASN A 1146 ? VAL A 1142 ASN A 1146 5 ? 5  
HELX_P HELX_P60  60  GLN A 1156 ? GLN A 1161 ? GLN A 1156 GLN A 1161 1 ? 6  
HELX_P HELX_P61  61  VAL A 1166 ? GLY A 1189 ? VAL A 1166 GLY A 1189 1 ? 24 
HELX_P HELX_P62  62  SER A 1192 ? ILE A 1197 ? SER A 1192 ILE A 1197 1 ? 6  
HELX_P HELX_P63  63  ARG A 1199 ? ASP A 1201 ? ARG A 1199 ASP A 1201 5 ? 3  
HELX_P HELX_P64  64  LEU A 1219 ? ASN A 1224 ? LEU A 1219 ASN A 1224 1 ? 6  
HELX_P HELX_P65  65  ARG A 1232 ? ASN A 1236 ? ARG A 1232 ASN A 1236 5 ? 5  
HELX_P HELX_P66  66  VAL A 1246 ? ASP A 1254 ? VAL A 1246 ASP A 1254 1 ? 9  
HELX_P HELX_P67  67  ASP A 1254 ? GLN A 1264 ? ASP A 1254 GLN A 1264 1 ? 11 
HELX_P HELX_P68  68  GLY A 1281 ? GLY A 1293 ? GLY A 1281 GLY A 1293 1 ? 13 
HELX_P HELX_P69  69  ALA A 1353 ? ASN A 1357 ? ALA A 1353 ASN A 1357 5 ? 5  
HELX_P HELX_P70  70  ASP A 1437 ? ILE A 1442 ? ASP A 1437 ILE A 1442 1 ? 6  
HELX_P HELX_P71  71  ALA A 1454 ? GLY A 1473 ? ALA A 1454 GLY A 1473 1 ? 20 
HELX_P HELX_P72  72  SER A 1474 ? ASN A 1483 ? SER A 1474 ASN A 1483 1 ? 10 
HELX_P HELX_P73  73  ASN A 1483 ? GLY A 1489 ? ASN A 1483 GLY A 1489 1 ? 7  
HELX_P HELX_P74  74  HIS B 15   ? CYS B 27   ? HIS B 15   CYS B 27   1 ? 13 
HELX_P HELX_P75  75  MET B 28   ? GLY B 32   ? MET B 28   GLY B 32   5 ? 5  
HELX_P HELX_P76  76  PRO B 51   ? ARG B 62   ? PRO B 51   ARG B 62   1 ? 12 
HELX_P HELX_P77  77  ASP B 68   ? LEU B 72   ? ASP B 68   LEU B 72   5 ? 5  
HELX_P HELX_P78  78  GLU B 82   ? GLU B 100  ? GLU B 82   GLU B 100  1 ? 19 
HELX_P HELX_P79  79  ASN B 113  ? LEU B 117  ? ASN B 113  LEU B 117  5 ? 5  
HELX_P HELX_P80  80  GLY B 118  ? GLN B 125  ? GLY B 118  GLN B 125  1 ? 8  
HELX_P HELX_P81  81  ALA B 140  ? GLY B 156  ? ALA B 140  GLY B 156  1 ? 17 
HELX_P HELX_P82  82  LYS B 157  ? LEU B 159  ? LYS B 157  LEU B 159  5 ? 3  
HELX_P HELX_P83  83  ARG B 180  ? ILE B 182  ? ARG B 180  ILE B 182  5 ? 3  
HELX_P HELX_P84  84  ILE B 183  ? TYR B 188  ? ILE B 183  TYR B 188  1 ? 6  
HELX_P HELX_P85  85  TYR B 188  ? ASN B 193  ? TYR B 188  ASN B 193  1 ? 6  
HELX_P HELX_P86  86  LYS B 214  ? ALA B 218  ? LYS B 214  ALA B 218  5 ? 5  
HELX_P HELX_P87  87  THR B 232  ? GLU B 244  ? THR B 232  GLU B 244  1 ? 13 
HELX_P HELX_P88  88  THR B 253  ? THR B 261  ? THR B 253  THR B 261  1 ? 9  
HELX_P HELX_P89  89  SER B 269  ? THR B 284  ? SER B 269  THR B 284  1 ? 16 
HELX_P HELX_P90  90  SER B 287  ? VAL B 296  ? SER B 287  VAL B 296  1 ? 10 
HELX_P HELX_P91  91  GLN B 303  ? LYS B 307  ? GLN B 303  LYS B 307  5 ? 5  
HELX_P HELX_P92  92  TYR B 309  ? SER B 320  ? TYR B 309  SER B 320  1 ? 12 
HELX_P HELX_P93  93  PRO B 374  ? VAL B 376  ? PRO B 374  VAL B 376  5 ? 3  
HELX_P HELX_P94  94  ASN B 402  ? GLN B 411  ? ASN B 402  GLN B 411  1 ? 10 
HELX_P HELX_P95  95  PRO B 414  ? GLN B 422  ? PRO B 414  GLN B 422  1 ? 9  
HELX_P HELX_P96  96  ASP B 439  ? PHE B 450  ? ASP B 439  PHE B 450  1 ? 12 
HELX_P HELX_P97  97  THR B 453  ? VAL B 460  ? THR B 453  VAL B 460  1 ? 8  
HELX_P HELX_P98  98  VAL B 460  ? GLY B 468  ? VAL B 460  GLY B 468  1 ? 9  
HELX_P HELX_P99  99  LEU B 490  ? ASP B 493  ? LEU B 490  ASP B 493  5 ? 4  
HELX_P HELX_P100 100 GLU B 512  ? MET B 516  ? GLU B 512  MET B 516  5 ? 5  
HELX_P HELX_P101 101 LYS B 532  ? ARG B 537  ? LYS B 532  ARG B 537  5 ? 6  
HELX_P HELX_P102 102 ASN B 547  ? GLY B 557  ? ASN B 547  GLY B 557  1 ? 11 
HELX_P HELX_P103 103 SER B 575  ? ALA B 593  ? SER B 575  ALA B 593  1 ? 19 
HELX_P HELX_P104 104 ARG B 603  ? ALA B 607  ? ARG B 603  ALA B 607  5 ? 5  
HELX_P HELX_P105 105 PRO B 617  ? ALA B 632  ? PRO B 617  ALA B 632  1 ? 16 
HELX_P HELX_P106 106 LEU B 634  ? ALA B 638  ? LEU B 634  ALA B 638  5 ? 5  
HELX_P HELX_P107 107 SER B 649  ? TYR B 659  ? SER B 649  TYR B 659  1 ? 11 
HELX_P HELX_P108 108 PRO B 666  ? ASP B 679  ? PRO B 666  ASP B 679  1 ? 14 
HELX_P HELX_P109 109 ASP B 679  ? GLU B 687  ? ASP B 679  GLU B 687  1 ? 9  
HELX_P HELX_P110 110 ASP B 695  ? MET B 718  ? ASP B 695  MET B 718  1 ? 24 
HELX_P HELX_P111 111 LEU B 722  ? GLY B 728  ? LEU B 722  GLY B 728  1 ? 7  
HELX_P HELX_P112 112 GLY B 738  ? PHE B 746  ? GLY B 738  PHE B 746  1 ? 9  
HELX_P HELX_P113 113 THR B 757  ? PHE B 773  ? THR B 757  PHE B 773  1 ? 17 
HELX_P HELX_P114 114 SER B 798  ? TYR B 812  ? SER B 798  TYR B 812  1 ? 15 
HELX_P HELX_P115 115 ASP B 825  ? ASP B 836  ? ASP B 825  ASP B 836  1 ? 12 
HELX_P HELX_P116 116 ALA B 841  ? ASP B 844  ? ALA B 841  ASP B 844  5 ? 4  
HELX_P HELX_P117 117 SER B 856  ? VAL B 860  ? SER B 856  VAL B 860  5 ? 5  
HELX_P HELX_P118 118 SER B 862  ? LYS B 868  ? SER B 862  LYS B 868  1 ? 7  
HELX_P HELX_P119 119 SER B 881  ? GLY B 896  ? SER B 881  GLY B 896  1 ? 16 
HELX_P HELX_P120 120 ASP B 907  ? LEU B 912  ? ASP B 907  LEU B 912  5 ? 6  
HELX_P HELX_P121 121 THR B 953  ? GLY B 960  ? THR B 953  GLY B 960  1 ? 8  
HELX_P HELX_P122 122 PRO B 980  ? VAL B 984  ? PRO B 980  VAL B 984  5 ? 5  
HELX_P HELX_P123 123 SER B 985  ? ARG B 993  ? SER B 985  ARG B 993  1 ? 9  
HELX_P HELX_P124 124 SER B 1011 ? ASN B 1026 ? SER B 1011 ASN B 1026 1 ? 16 
HELX_P HELX_P125 125 GLY B 1040 ? ALA B 1051 ? GLY B 1040 ALA B 1051 1 ? 12 
HELX_P HELX_P126 126 LEU B 1070 ? ALA B 1076 ? LEU B 1070 ALA B 1076 1 ? 7  
HELX_P HELX_P127 127 PRO B 1079 ? ASN B 1094 ? PRO B 1079 ASN B 1094 1 ? 16 
HELX_P HELX_P128 128 LEU B 1096 ? VAL B 1100 ? LEU B 1096 VAL B 1100 5 ? 5  
HELX_P HELX_P129 129 THR B 1110 ? MET B 1120 ? THR B 1110 MET B 1120 1 ? 11 
HELX_P HELX_P130 130 GLY B 1128 ? GLU B 1135 ? GLY B 1128 GLU B 1135 1 ? 8  
HELX_P HELX_P131 131 VAL B 1142 ? ASN B 1146 ? VAL B 1142 ASN B 1146 5 ? 5  
HELX_P HELX_P132 132 GLN B 1156 ? GLN B 1161 ? GLN B 1156 GLN B 1161 1 ? 6  
HELX_P HELX_P133 133 VAL B 1166 ? GLY B 1189 ? VAL B 1166 GLY B 1189 1 ? 24 
HELX_P HELX_P134 134 SER B 1192 ? ILE B 1197 ? SER B 1192 ILE B 1197 1 ? 6  
HELX_P HELX_P135 135 ARG B 1199 ? ASP B 1201 ? ARG B 1199 ASP B 1201 5 ? 3  
HELX_P HELX_P136 136 LEU B 1219 ? ASN B 1224 ? LEU B 1219 ASN B 1224 1 ? 6  
HELX_P HELX_P137 137 ARG B 1232 ? ASN B 1236 ? ARG B 1232 ASN B 1236 5 ? 5  
HELX_P HELX_P138 138 VAL B 1246 ? ASP B 1254 ? VAL B 1246 ASP B 1254 1 ? 9  
HELX_P HELX_P139 139 ASP B 1254 ? GLN B 1264 ? ASP B 1254 GLN B 1264 1 ? 11 
HELX_P HELX_P140 140 GLY B 1281 ? GLY B 1293 ? GLY B 1281 GLY B 1293 1 ? 13 
HELX_P HELX_P141 141 ALA B 1353 ? ASN B 1357 ? ALA B 1353 ASN B 1357 5 ? 5  
HELX_P HELX_P142 142 ASP B 1437 ? ILE B 1442 ? ASP B 1437 ILE B 1442 1 ? 6  
HELX_P HELX_P143 143 ALA B 1454 ? GLY B 1473 ? ALA B 1454 GLY B 1473 1 ? 20 
HELX_P HELX_P144 144 SER B 1474 ? ASN B 1483 ? SER B 1474 ASN B 1483 1 ? 10 
HELX_P HELX_P145 145 ASN B 1483 ? GLY B 1489 ? ASN B 1483 GLY B 1489 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 1137 SG ? ? ? 1_555 D F3S . FE1 ? ? A CYS 1137 A F3S 3509 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc2 metalc ? ? A CYS 1143 SG ? ? ? 1_555 D F3S . FE4 ? ? A CYS 1143 A F3S 3509 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc3 metalc ? ? A CYS 1148 SG ? ? ? 1_555 D F3S . FE3 ? ? A CYS 1148 A F3S 3509 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc4 metalc ? ? B CYS 1137 SG ? ? ? 1_555 G F3S . FE1 ? ? B CYS 1137 B F3S 3509 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc5 metalc ? ? B CYS 1143 SG ? ? ? 1_555 G F3S . FE4 ? ? B CYS 1143 B F3S 3509 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc6 metalc ? ? B CYS 1148 SG ? ? ? 1_555 G F3S . FE3 ? ? B CYS 1148 B F3S 3509 1_555 ? ? ? ? ? ? ? 2.432 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 219 A . ? GLN 219 A PRO 220 A ? PRO 220 A 1 0.06  
2 GLN 219 B . ? GLN 219 B PRO 220 B ? PRO 220 B 1 -0.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7  ? 
AB ? 4  ? 
AC ? 5  ? 
AD ? 3  ? 
AE ? 2  ? 
AF ? 2  ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 8  ? 
AK ? 2  ? 
AL ? 10 ? 
BA ? 7  ? 
BB ? 4  ? 
BC ? 5  ? 
BD ? 3  ? 
BE ? 2  ? 
BF ? 2  ? 
BG ? 4  ? 
BH ? 2  ? 
BI ? 2  ? 
BJ ? 8  ? 
BK ? 2  ? 
BL ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? anti-parallel 
AA 2 3  ? anti-parallel 
AA 3 4  ? anti-parallel 
AA 4 5  ? anti-parallel 
AA 5 6  ? anti-parallel 
AA 6 7  ? anti-parallel 
AB 1 2  ? anti-parallel 
AB 2 3  ? anti-parallel 
AB 3 4  ? anti-parallel 
AC 1 2  ? anti-parallel 
AC 2 3  ? anti-parallel 
AC 3 4  ? anti-parallel 
AC 4 5  ? anti-parallel 
AD 1 2  ? parallel      
AD 2 3  ? anti-parallel 
AE 1 2  ? anti-parallel 
AF 1 2  ? anti-parallel 
AG 1 2  ? parallel      
AG 2 3  ? parallel      
AG 3 4  ? parallel      
AH 1 2  ? anti-parallel 
AI 1 2  ? anti-parallel 
AJ 1 2  ? parallel      
AJ 2 3  ? parallel      
AJ 3 4  ? parallel      
AJ 4 5  ? parallel      
AJ 5 6  ? parallel      
AJ 6 7  ? parallel      
AJ 7 8  ? parallel      
AK 1 2  ? anti-parallel 
AL 1 2  ? parallel      
AL 2 3  ? parallel      
AL 3 4  ? parallel      
AL 4 5  ? parallel      
AL 5 6  ? parallel      
AL 6 7  ? parallel      
AL 7 8  ? parallel      
AL 8 9  ? anti-parallel 
AL 9 10 ? anti-parallel 
BA 1 2  ? anti-parallel 
BA 2 3  ? anti-parallel 
BA 3 4  ? anti-parallel 
BA 4 5  ? anti-parallel 
BA 5 6  ? anti-parallel 
BA 6 7  ? anti-parallel 
BB 1 2  ? anti-parallel 
BB 2 3  ? anti-parallel 
BB 3 4  ? anti-parallel 
BC 1 2  ? anti-parallel 
BC 2 3  ? anti-parallel 
BC 3 4  ? anti-parallel 
BC 4 5  ? anti-parallel 
BD 1 2  ? parallel      
BD 2 3  ? anti-parallel 
BE 1 2  ? anti-parallel 
BF 1 2  ? anti-parallel 
BG 1 2  ? parallel      
BG 2 3  ? parallel      
BG 3 4  ? parallel      
BH 1 2  ? anti-parallel 
BI 1 2  ? anti-parallel 
BJ 1 2  ? parallel      
BJ 2 3  ? parallel      
BJ 3 4  ? parallel      
BJ 4 5  ? parallel      
BJ 5 6  ? parallel      
BJ 6 7  ? parallel      
BJ 7 8  ? parallel      
BK 1 2  ? anti-parallel 
BL 1 2  ? parallel      
BL 2 3  ? parallel      
BL 3 4  ? parallel      
BL 4 5  ? parallel      
BL 5 6  ? parallel      
BL 6 7  ? parallel      
BL 7 8  ? parallel      
BL 8 9  ? anti-parallel 
BL 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  THR A 172  ? GLY A 177  ? THR A 172  GLY A 177  
AA 2  ALA A 44   ? ALA A 49   ? ALA A 44   ALA A 49   
AA 3  PHE A 200  ? ARG A 205  ? PHE A 200  ARG A 205  
AA 4  GLY A 2    ? ALA A 7    ? GLY A 2    ALA A 7    
AA 5  ILE A 362  ? GLY A 365  ? ILE A 362  GLY A 365  
AA 6  ARG A 353  ? THR A 357  ? ARG A 353  THR A 357  
AA 7  ILE A 378  ? ARG A 383  ? ILE A 378  ARG A 383  
AB 1  THR A 103  ? GLU A 109  ? THR A 103  GLU A 109  
AB 2  HIS A 127  ? THR A 134  ? HIS A 127  THR A 134  
AB 3  GLY A 73   ? LEU A 79   ? GLY A 73   LEU A 79   
AB 4  TYR A 164  ? SER A 169  ? TYR A 164  SER A 169  
AC 1  LEU A 224  ? GLY A 228  ? LEU A 224  GLY A 228  
AC 2  ALA A 330  ? SER A 335  ? ALA A 330  SER A 335  
AC 3  ILE A 339  ? LEU A 344  ? ILE A 339  LEU A 344  
AC 4  MET A 389  ? ASP A 393  ? MET A 389  ASP A 393  
AC 5  LYS A 398  ? LEU A 400  ? LYS A 398  LEU A 400  
AD 1  ARG A 423  ? VAL A 426  ? ARG A 423  VAL A 426  
AD 2  THR A 538  ? LEU A 541  ? THR A 538  LEU A 541  
AD 3  MET A 520  ? LEU A 522  ? MET A 520  LEU A 522  
AE 1  THR A 472  ? PHE A 473  ? THR A 472  PHE A 473  
AE 2  SER A 1068 ? PRO A 1069 ? SER A 1068 PRO A 1069 
AF 1  PHE A 495  ? GLN A 497  ? PHE A 495  GLN A 497  
AF 2  PHE A 732  ? ALA A 734  ? PHE A 732  ALA A 734  
AG 1  VAL A 561  ? SER A 565  ? VAL A 561  SER A 565  
AG 2  ILE A 597  ? THR A 601  ? ILE A 597  THR A 601  
AG 3  SER A 639  ? ASP A 643  ? SER A 639  ASP A 643  
AG 4  ALA A 663  ? CYS A 665  ? ALA A 663  CYS A 665  
AH 1  LEU A 567  ? ASP A 569  ? LEU A 567  ASP A 569  
AH 2  GLN A 613  ? PHE A 615  ? GLN A 613  PHE A 615  
AI 1  LEU A 846  ? PHE A 848  ? LEU A 846  PHE A 848  
AI 2  LEU A 1203 ? VAL A 1205 ? LEU A 1203 VAL A 1205 
AJ 1  PHE A 870  ? CYS A 871  ? PHE A 870  CYS A 871  
AJ 2  GLU A 1124 ? GLY A 1126 ? GLU A 1124 GLY A 1126 
AJ 3  LEU A 1101 ? ASP A 1105 ? LEU A 1101 ASP A 1105 
AJ 4  ILE A 1055 ? SER A 1059 ? ILE A 1055 SER A 1059 
AJ 5  GLN A 1030 ? VAL A 1036 ? GLN A 1030 VAL A 1036 
AJ 6  GLN A 962  ? LYS A 966  ? GLN A 962  LYS A 966  
AJ 7  ILE A 942  ? ILE A 945  ? ILE A 942  ILE A 945  
AJ 8  ASN A 900  ? SER A 901  ? ASN A 900  SER A 901  
AK 1  GLN A 978  ? LEU A 979  ? GLN A 978  LEU A 979  
AK 2  LEU A 1000 ? ILE A 1001 ? LEU A 1000 ILE A 1001 
AL 1  THR A 1266 ? LEU A 1273 ? THR A 1266 LEU A 1273 
AL 2  ASN A 1300 ? ALA A 1309 ? ASN A 1300 ALA A 1309 
AL 3  MET A 1321 ? ALA A 1329 ? MET A 1321 ALA A 1329 
AL 4  GLU A 1341 ? VAL A 1345 ? GLU A 1341 VAL A 1345 
AL 5  ASN A 1372 ? ALA A 1375 ? ASN A 1372 ALA A 1375 
AL 6  LYS A 1391 ? ILE A 1394 ? LYS A 1391 ILE A 1394 
AL 7  THR A 1406 ? VAL A 1412 ? THR A 1406 VAL A 1412 
AL 8  GLY A 1426 ? LEU A 1432 ? GLY A 1426 LEU A 1432 
AL 9  PHE A 1491 ? VAL A 1495 ? PHE A 1491 VAL A 1495 
AL 10 THR A 1448 ? GLN A 1450 ? THR A 1448 GLN A 1450 
BA 1  THR B 172  ? GLY B 177  ? THR B 172  GLY B 177  
BA 2  ALA B 44   ? ALA B 49   ? ALA B 44   ALA B 49   
BA 3  PHE B 200  ? ARG B 205  ? PHE B 200  ARG B 205  
BA 4  GLY B 2    ? ALA B 7    ? GLY B 2    ALA B 7    
BA 5  ILE B 362  ? GLY B 365  ? ILE B 362  GLY B 365  
BA 6  ARG B 353  ? THR B 357  ? ARG B 353  THR B 357  
BA 7  ILE B 378  ? ARG B 383  ? ILE B 378  ARG B 383  
BB 1  THR B 103  ? GLU B 109  ? THR B 103  GLU B 109  
BB 2  HIS B 127  ? THR B 134  ? HIS B 127  THR B 134  
BB 3  GLY B 73   ? LEU B 79   ? GLY B 73   LEU B 79   
BB 4  TYR B 164  ? SER B 169  ? TYR B 164  SER B 169  
BC 1  LEU B 224  ? GLY B 228  ? LEU B 224  GLY B 228  
BC 2  ALA B 330  ? SER B 335  ? ALA B 330  SER B 335  
BC 3  ILE B 339  ? LEU B 344  ? ILE B 339  LEU B 344  
BC 4  MET B 389  ? ASP B 393  ? MET B 389  ASP B 393  
BC 5  LYS B 398  ? LYS B 401  ? LYS B 398  LYS B 401  
BD 1  ARG B 423  ? VAL B 426  ? ARG B 423  VAL B 426  
BD 2  THR B 538  ? LEU B 541  ? THR B 538  LEU B 541  
BD 3  MET B 520  ? LEU B 522  ? MET B 520  LEU B 522  
BE 1  THR B 472  ? PHE B 473  ? THR B 472  PHE B 473  
BE 2  SER B 1068 ? PRO B 1069 ? SER B 1068 PRO B 1069 
BF 1  PHE B 495  ? GLN B 497  ? PHE B 495  GLN B 497  
BF 2  PHE B 732  ? ALA B 734  ? PHE B 732  ALA B 734  
BG 1  VAL B 561  ? SER B 565  ? VAL B 561  SER B 565  
BG 2  ILE B 597  ? THR B 601  ? ILE B 597  THR B 601  
BG 3  SER B 639  ? ASP B 643  ? SER B 639  ASP B 643  
BG 4  ALA B 663  ? CYS B 665  ? ALA B 663  CYS B 665  
BH 1  LEU B 567  ? ASP B 569  ? LEU B 567  ASP B 569  
BH 2  GLN B 613  ? PHE B 615  ? GLN B 613  PHE B 615  
BI 1  LEU B 846  ? PHE B 848  ? LEU B 846  PHE B 848  
BI 2  LEU B 1203 ? VAL B 1205 ? LEU B 1203 VAL B 1205 
BJ 1  PHE B 870  ? CYS B 871  ? PHE B 870  CYS B 871  
BJ 2  GLU B 1124 ? GLY B 1126 ? GLU B 1124 GLY B 1126 
BJ 3  LEU B 1101 ? ASP B 1105 ? LEU B 1101 ASP B 1105 
BJ 4  ILE B 1055 ? SER B 1059 ? ILE B 1055 SER B 1059 
BJ 5  GLN B 1030 ? VAL B 1036 ? GLN B 1030 VAL B 1036 
BJ 6  GLN B 962  ? LYS B 966  ? GLN B 962  LYS B 966  
BJ 7  ILE B 942  ? ILE B 945  ? ILE B 942  ILE B 945  
BJ 8  ASN B 900  ? SER B 901  ? ASN B 900  SER B 901  
BK 1  GLN B 978  ? LEU B 979  ? GLN B 978  LEU B 979  
BK 2  LEU B 1000 ? ILE B 1001 ? LEU B 1000 ILE B 1001 
BL 1  THR B 1266 ? LEU B 1273 ? THR B 1266 LEU B 1273 
BL 2  ASN B 1300 ? ALA B 1309 ? ASN B 1300 ALA B 1309 
BL 3  MET B 1321 ? ALA B 1329 ? MET B 1321 ALA B 1329 
BL 4  GLU B 1341 ? VAL B 1345 ? GLU B 1341 VAL B 1345 
BL 5  ASN B 1372 ? ALA B 1375 ? ASN B 1372 ALA B 1375 
BL 6  LYS B 1391 ? ILE B 1394 ? LYS B 1391 ILE B 1394 
BL 7  THR B 1406 ? VAL B 1412 ? THR B 1406 VAL B 1412 
BL 8  GLY B 1426 ? LEU B 1432 ? GLY B 1426 LEU B 1432 
BL 9  PHE B 1491 ? VAL B 1495 ? PHE B 1491 VAL B 1495 
BL 10 THR B 1448 ? GLN B 1450 ? THR B 1448 GLN B 1450 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N GLY A 177  ? N GLY A 177  O ALA A 44   ? O ALA A 44   
AA 2 3  N ALA A 49   ? N ALA A 49   O PHE A 200  ? O PHE A 200  
AA 3 4  N ARG A 205  ? N ARG A 205  O GLY A 2    ? O GLY A 2    
AA 4 5  N ALA A 7    ? N ALA A 7    O ILE A 362  ? O ILE A 362  
AA 5 6  N GLY A 365  ? N GLY A 365  O ARG A 353  ? O ARG A 353  
AA 6 7  O ILE A 356  ? O ILE A 356  N VAL A 379  ? N VAL A 379  
AB 1 2  N ARG A 108  ? N ARG A 108  O GLN A 130  ? O GLN A 130  
AB 2 3  N VAL A 133  ? N VAL A 133  O GLY A 73   ? O GLY A 73   
AB 3 4  N PHE A 78   ? N PHE A 78   O TYR A 164  ? O TYR A 164  
AC 1 2  N ASN A 227  ? N ASN A 227  O LEU A 331  ? O LEU A 331  
AC 2 3  N PHE A 334  ? N PHE A 334  O GLY A 341  ? O GLY A 341  
AC 3 4  N ALA A 342  ? N ALA A 342  O ILE A 390  ? O ILE A 390  
AC 4 5  N ASP A 393  ? N ASP A 393  O LYS A 398  ? O LYS A 398  
AD 1 2  N GLN A 424  ? N GLN A 424  O THR A 538  ? O THR A 538  
AD 2 3  N LEU A 541  ? N LEU A 541  O MET A 520  ? O MET A 520  
AE 1 2  N PHE A 473  ? N PHE A 473  O SER A 1068 ? O SER A 1068 
AF 1 2  N LYS A 496  ? N LYS A 496  O GLU A 733  ? O GLU A 733  
AG 1 2  N ALA A 562  ? N ALA A 562  O ILE A 597  ? O ILE A 597  
AG 2 3  N LEU A 598  ? N LEU A 598  O SER A 639  ? O SER A 639  
AG 3 4  N VAL A 642  ? N VAL A 642  O ALA A 663  ? O ALA A 663  
AH 1 2  N TYR A 568  ? N TYR A 568  O SER A 614  ? O SER A 614  
AI 1 2  N ASP A 847  ? N ASP A 847  O LYS A 1204 ? O LYS A 1204 
AJ 1 2  N CYS A 871  ? N CYS A 871  O TYR A 1125 ? O TYR A 1125 
AJ 2 3  N GLY A 1126 ? N GLY A 1126 O ALA A 1104 ? O ALA A 1104 
AJ 3 4  N ARG A 1103 ? N ARG A 1103 O ILE A 1056 ? O ILE A 1056 
AJ 4 5  N GLN A 1057 ? N GLN A 1057 O VAL A 1033 ? O VAL A 1033 
AJ 5 6  N SER A 1032 ? N SER A 1032 O LEU A 963  ? O LEU A 963  
AJ 6 7  N GLU A 964  ? N GLU A 964  O LYS A 943  ? O LYS A 943  
AJ 7 8  N GLN A 944  ? N GLN A 944  O SER A 901  ? O SER A 901  
AK 1 2  N LEU A 979  ? N LEU A 979  O LEU A 1000 ? O LEU A 1000 
AL 1 2  N ALA A 1267 ? N ALA A 1267 O ASN A 1300 ? O ASN A 1300 
AL 2 3  N LEU A 1303 ? N LEU A 1303 O THR A 1322 ? O THR A 1322 
AL 3 4  N LEU A 1323 ? N LEU A 1323 O GLU A 1341 ? O GLU A 1341 
AL 4 5  N ILE A 1342 ? N ILE A 1342 O ASN A 1372 ? O ASN A 1372 
AL 5 6  N LEU A 1373 ? N LEU A 1373 O LYS A 1391 ? O LYS A 1391 
AL 6 7  N ALA A 1392 ? N ALA A 1392 O VAL A 1409 ? O VAL A 1409 
AL 7 8  N GLY A 1407 ? N GLY A 1407 O GLY A 1426 ? O GLY A 1426 
AL 8 9  N PHE A 1431 ? N PHE A 1431 O TRP A 1492 ? O TRP A 1492 
AL 9 10 N VAL A 1495 ? N VAL A 1495 O THR A 1448 ? O THR A 1448 
BA 1 2  N GLY B 177  ? N GLY B 177  O ALA B 44   ? O ALA B 44   
BA 2 3  N ALA B 49   ? N ALA B 49   O PHE B 200  ? O PHE B 200  
BA 3 4  N ARG B 205  ? N ARG B 205  O GLY B 2    ? O GLY B 2    
BA 4 5  N ALA B 7    ? N ALA B 7    O ILE B 362  ? O ILE B 362  
BA 5 6  N GLY B 365  ? N GLY B 365  O ARG B 353  ? O ARG B 353  
BA 6 7  O ILE B 356  ? O ILE B 356  N VAL B 379  ? N VAL B 379  
BB 1 2  N ARG B 108  ? N ARG B 108  O GLN B 130  ? O GLN B 130  
BB 2 3  N VAL B 133  ? N VAL B 133  O GLY B 73   ? O GLY B 73   
BB 3 4  N PHE B 78   ? N PHE B 78   O TYR B 164  ? O TYR B 164  
BC 1 2  N ASN B 227  ? N ASN B 227  O LEU B 331  ? O LEU B 331  
BC 2 3  N PHE B 334  ? N PHE B 334  O GLY B 341  ? O GLY B 341  
BC 3 4  N ALA B 342  ? N ALA B 342  O ILE B 390  ? O ILE B 390  
BC 4 5  N ASP B 393  ? N ASP B 393  O LYS B 398  ? O LYS B 398  
BD 1 2  N GLN B 424  ? N GLN B 424  O THR B 538  ? O THR B 538  
BD 2 3  N LEU B 541  ? N LEU B 541  O MET B 520  ? O MET B 520  
BE 1 2  N PHE B 473  ? N PHE B 473  O SER B 1068 ? O SER B 1068 
BF 1 2  N LYS B 496  ? N LYS B 496  O GLU B 733  ? O GLU B 733  
BG 1 2  N ALA B 562  ? N ALA B 562  O ILE B 597  ? O ILE B 597  
BG 2 3  N LEU B 598  ? N LEU B 598  O SER B 639  ? O SER B 639  
BG 3 4  N VAL B 642  ? N VAL B 642  O ALA B 663  ? O ALA B 663  
BH 1 2  N TYR B 568  ? N TYR B 568  O SER B 614  ? O SER B 614  
BI 1 2  N ASP B 847  ? N ASP B 847  O LYS B 1204 ? O LYS B 1204 
BJ 1 2  N CYS B 871  ? N CYS B 871  O TYR B 1125 ? O TYR B 1125 
BJ 2 3  N GLY B 1126 ? N GLY B 1126 O ALA B 1104 ? O ALA B 1104 
BJ 3 4  N ARG B 1103 ? N ARG B 1103 O ILE B 1056 ? O ILE B 1056 
BJ 4 5  N GLN B 1057 ? N GLN B 1057 O VAL B 1033 ? O VAL B 1033 
BJ 5 6  N SER B 1032 ? N SER B 1032 O LEU B 963  ? O LEU B 963  
BJ 6 7  N GLU B 964  ? N GLU B 964  O LYS B 943  ? O LYS B 943  
BJ 7 8  N GLN B 944  ? N GLN B 944  O SER B 901  ? O SER B 901  
BK 1 2  N LEU B 979  ? N LEU B 979  O LEU B 1000 ? O LEU B 1000 
BL 1 2  N ALA B 1267 ? N ALA B 1267 O ASN B 1300 ? O ASN B 1300 
BL 2 3  N LEU B 1303 ? N LEU B 1303 O THR B 1322 ? O THR B 1322 
BL 3 4  N LEU B 1323 ? N LEU B 1323 O GLU B 1341 ? O GLU B 1341 
BL 4 5  N ILE B 1342 ? N ILE B 1342 O ASN B 1372 ? O ASN B 1372 
BL 5 6  N LEU B 1373 ? N LEU B 1373 O LYS B 1391 ? O LYS B 1391 
BL 6 7  N ALA B 1392 ? N ALA B 1392 O VAL B 1409 ? O VAL B 1409 
BL 7 8  N GLY B 1407 ? N GLY B 1407 O GLY B 1426 ? O GLY B 1426 
BL 8 9  N PHE B 1431 ? N PHE B 1431 O TRP B 1492 ? O TRP B 1492 
BL 9 10 N VAL B 1495 ? N VAL B 1495 O THR B 1448 ? O THR B 1448 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE FMN A 3508' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE F3S A 3509' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE AKG A 3510' 
AC4 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE FMN B 3508' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE F3S B 3509' 
AC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE AKG B 3510' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 GLY A 874  ? GLY A 874  . ? 1_555 ? 
2  AC1 24 MET A 875  ? MET A 875  . ? 1_555 ? 
3  AC1 24 SER A 876  ? SER A 876  . ? 1_555 ? 
4  AC1 24 GLY A 902  ? GLY A 902  . ? 1_555 ? 
5  AC1 24 GLU A 903  ? GLU A 903  . ? 1_555 ? 
6  AC1 24 GLN A 944  ? GLN A 944  . ? 1_555 ? 
7  AC1 24 LYS A 966  ? LYS A 966  . ? 1_555 ? 
8  AC1 24 GLN A 969  ? GLN A 969  . ? 1_555 ? 
9  AC1 24 LYS A 1034 ? LYS A 1034 . ? 1_555 ? 
10 AC1 24 GLY A 1063 ? GLY A 1063 . ? 1_555 ? 
11 AC1 24 GLY A 1064 ? GLY A 1064 . ? 1_555 ? 
12 AC1 24 THR A 1065 ? THR A 1065 . ? 1_555 ? 
13 AC1 24 GLY A 1066 ? GLY A 1066 . ? 1_555 ? 
14 AC1 24 ASP A 1105 ? ASP A 1105 . ? 1_555 ? 
15 AC1 24 GLY A 1106 ? GLY A 1106 . ? 1_555 ? 
16 AC1 24 GLY A 1107 ? GLY A 1107 . ? 1_555 ? 
17 AC1 24 GLY A 1128 ? GLY A 1128 . ? 1_555 ? 
18 AC1 24 SER A 1129 ? SER A 1129 . ? 1_555 ? 
19 AC1 24 ILE A 1130 ? ILE A 1130 . ? 1_555 ? 
20 AC1 24 MET A 1132 ? MET A 1132 . ? 1_555 ? 
21 AC1 24 HOH I .    ? HOH A 2703 . ? 1_555 ? 
22 AC1 24 HOH I .    ? HOH A 2704 . ? 1_555 ? 
23 AC1 24 HOH I .    ? HOH A 2705 . ? 1_555 ? 
24 AC1 24 AKG E .    ? AKG A 3510 . ? 1_555 ? 
25 AC2 10 MET A 1132 ? MET A 1132 . ? 1_555 ? 
26 AC2 10 CYS A 1137 ? CYS A 1137 . ? 1_555 ? 
27 AC2 10 ILE A 1138 ? ILE A 1138 . ? 1_555 ? 
28 AC2 10 MET A 1139 ? MET A 1139 . ? 1_555 ? 
29 AC2 10 ALA A 1140 ? ALA A 1140 . ? 1_555 ? 
30 AC2 10 ARG A 1141 ? ARG A 1141 . ? 1_555 ? 
31 AC2 10 VAL A 1142 ? VAL A 1142 . ? 1_555 ? 
32 AC2 10 CYS A 1143 ? CYS A 1143 . ? 1_555 ? 
33 AC2 10 CYS A 1148 ? CYS A 1148 . ? 1_555 ? 
34 AC2 10 ALA A 1153 ? ALA A 1153 . ? 1_555 ? 
35 AC3 13 SER A 876  ? SER A 876  . ? 1_555 ? 
36 AC3 13 ALA A 879  ? ALA A 879  . ? 1_555 ? 
37 AC3 13 GLU A 903  ? GLU A 903  . ? 1_555 ? 
38 AC3 13 GLN A 969  ? GLN A 969  . ? 1_555 ? 
39 AC3 13 LYS A 972  ? LYS A 972  . ? 1_555 ? 
40 AC3 13 GLY A 977  ? GLY A 977  . ? 1_555 ? 
41 AC3 13 GLN A 978  ? GLN A 978  . ? 1_555 ? 
42 AC3 13 ARG A 992  ? ARG A 992  . ? 1_555 ? 
43 AC3 13 THR A 1065 ? THR A 1065 . ? 1_555 ? 
44 AC3 13 GLY A 1066 ? GLY A 1066 . ? 1_555 ? 
45 AC3 13 HOH I .    ? HOH A 2463 . ? 1_555 ? 
46 AC3 13 HOH I .    ? HOH A 2487 . ? 1_555 ? 
47 AC3 13 FMN C .    ? FMN A 3508 . ? 1_555 ? 
48 AC4 23 GLY B 874  ? GLY B 874  . ? 1_555 ? 
49 AC4 23 MET B 875  ? MET B 875  . ? 1_555 ? 
50 AC4 23 SER B 876  ? SER B 876  . ? 1_555 ? 
51 AC4 23 GLY B 902  ? GLY B 902  . ? 1_555 ? 
52 AC4 23 GLU B 903  ? GLU B 903  . ? 1_555 ? 
53 AC4 23 GLN B 944  ? GLN B 944  . ? 1_555 ? 
54 AC4 23 LYS B 966  ? LYS B 966  . ? 1_555 ? 
55 AC4 23 GLN B 969  ? GLN B 969  . ? 1_555 ? 
56 AC4 23 LYS B 1034 ? LYS B 1034 . ? 1_555 ? 
57 AC4 23 GLY B 1063 ? GLY B 1063 . ? 1_555 ? 
58 AC4 23 GLY B 1064 ? GLY B 1064 . ? 1_555 ? 
59 AC4 23 THR B 1065 ? THR B 1065 . ? 1_555 ? 
60 AC4 23 GLY B 1066 ? GLY B 1066 . ? 1_555 ? 
61 AC4 23 ASP B 1105 ? ASP B 1105 . ? 1_555 ? 
62 AC4 23 GLY B 1106 ? GLY B 1106 . ? 1_555 ? 
63 AC4 23 GLY B 1107 ? GLY B 1107 . ? 1_555 ? 
64 AC4 23 GLY B 1128 ? GLY B 1128 . ? 1_555 ? 
65 AC4 23 SER B 1129 ? SER B 1129 . ? 1_555 ? 
66 AC4 23 ILE B 1130 ? ILE B 1130 . ? 1_555 ? 
67 AC4 23 HOH J .    ? HOH B 2535 . ? 1_555 ? 
68 AC4 23 HOH J .    ? HOH B 2716 . ? 1_555 ? 
69 AC4 23 HOH J .    ? HOH B 2717 . ? 1_555 ? 
70 AC4 23 AKG H .    ? AKG B 3510 . ? 1_555 ? 
71 AC5 10 MET B 1132 ? MET B 1132 . ? 1_555 ? 
72 AC5 10 CYS B 1137 ? CYS B 1137 . ? 1_555 ? 
73 AC5 10 ILE B 1138 ? ILE B 1138 . ? 1_555 ? 
74 AC5 10 MET B 1139 ? MET B 1139 . ? 1_555 ? 
75 AC5 10 ALA B 1140 ? ALA B 1140 . ? 1_555 ? 
76 AC5 10 ARG B 1141 ? ARG B 1141 . ? 1_555 ? 
77 AC5 10 VAL B 1142 ? VAL B 1142 . ? 1_555 ? 
78 AC5 10 CYS B 1143 ? CYS B 1143 . ? 1_555 ? 
79 AC5 10 CYS B 1148 ? CYS B 1148 . ? 1_555 ? 
80 AC5 10 ALA B 1153 ? ALA B 1153 . ? 1_555 ? 
81 AC6 14 SER B 876  ? SER B 876  . ? 1_555 ? 
82 AC6 14 ALA B 879  ? ALA B 879  . ? 1_555 ? 
83 AC6 14 GLU B 903  ? GLU B 903  . ? 1_555 ? 
84 AC6 14 GLN B 969  ? GLN B 969  . ? 1_555 ? 
85 AC6 14 LYS B 972  ? LYS B 972  . ? 1_555 ? 
86 AC6 14 GLY B 977  ? GLY B 977  . ? 1_555 ? 
87 AC6 14 GLN B 978  ? GLN B 978  . ? 1_555 ? 
88 AC6 14 ARG B 992  ? ARG B 992  . ? 1_555 ? 
89 AC6 14 THR B 1065 ? THR B 1065 . ? 1_555 ? 
90 AC6 14 GLY B 1066 ? GLY B 1066 . ? 1_555 ? 
91 AC6 14 ALA B 1067 ? ALA B 1067 . ? 1_555 ? 
92 AC6 14 HOH J .    ? HOH B 2718 . ? 1_555 ? 
93 AC6 14 HOH J .    ? HOH B 2719 . ? 1_555 ? 
94 AC6 14 FMN F .    ? FMN B 3508 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OFD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OFD 
_atom_sites.fract_transf_matrix[1][1]   0.007999 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006682 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005104 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . CYS A 1 1    ? 86.961  112.774 24.775  1.00 8.07  ? 1    CYS A N     1 
ATOM   2     C  CA    . CYS A 1 1    ? 88.419  112.527 24.942  1.00 8.52  ? 1    CYS A CA    1 
ATOM   3     C  C     . CYS A 1 1    ? 89.126  112.632 23.587  1.00 8.54  ? 1    CYS A C     1 
ATOM   4     O  O     . CYS A 1 1    ? 88.493  112.478 22.539  1.00 9.19  ? 1    CYS A O     1 
ATOM   5     C  CB    . CYS A 1 1    ? 88.653  111.141 25.563  1.00 9.06  ? 1    CYS A CB    1 
ATOM   6     S  SG    . CYS A 1 1    ? 87.720  110.876 27.110  1.00 10.56 ? 1    CYS A SG    1 
ATOM   7     N  N     . GLY A 1 2    ? 90.410  112.967 23.612  1.00 7.82  ? 2    GLY A N     1 
ATOM   8     C  CA    . GLY A 1 2    ? 91.263  112.859 22.436  1.00 7.19  ? 2    GLY A CA    1 
ATOM   9     C  C     . GLY A 1 2    ? 92.351  111.829 22.709  1.00 6.51  ? 2    GLY A C     1 
ATOM   10    O  O     . GLY A 1 2    ? 92.814  111.726 23.842  1.00 6.77  ? 2    GLY A O     1 
ATOM   11    N  N     . VAL A 1 3    ? 92.762  111.069 21.693  1.00 5.57  ? 3    VAL A N     1 
ATOM   12    C  CA    . VAL A 1 3    ? 93.740  109.996 21.886  1.00 5.18  ? 3    VAL A CA    1 
ATOM   13    C  C     . VAL A 1 3    ? 94.562  109.771 20.609  1.00 4.96  ? 3    VAL A C     1 
ATOM   14    O  O     . VAL A 1 3    ? 94.139  110.144 19.508  1.00 4.98  ? 3    VAL A O     1 
ATOM   15    C  CB    . VAL A 1 3    ? 93.029  108.685 22.364  1.00 5.31  ? 3    VAL A CB    1 
ATOM   16    C  CG1   . VAL A 1 3    ? 92.171  108.096 21.263  1.00 5.78  ? 3    VAL A CG1   1 
ATOM   17    C  CG2   . VAL A 1 3    ? 94.033  107.659 22.934  1.00 6.31  ? 3    VAL A CG2   1 
ATOM   18    N  N     . GLY A 1 4    ? 95.752  109.206 20.739  1.00 4.58  ? 4    GLY A N     1 
ATOM   19    C  CA    . GLY A 1 4    ? 96.522  108.896 19.549  1.00 3.95  ? 4    GLY A CA    1 
ATOM   20    C  C     . GLY A 1 4    ? 97.869  108.314 19.880  1.00 4.28  ? 4    GLY A C     1 
ATOM   21    O  O     . GLY A 1 4    ? 98.180  108.101 21.053  1.00 3.72  ? 4    GLY A O     1 
ATOM   22    N  N     . PHE A 1 5    ? 98.664  108.057 18.846  1.00 4.02  ? 5    PHE A N     1 
ATOM   23    C  CA    . PHE A 1 5    ? 100.026 107.575 19.026  1.00 3.54  ? 5    PHE A CA    1 
ATOM   24    C  C     . PHE A 1 5    ? 100.968 108.132 17.993  1.00 3.58  ? 5    PHE A C     1 
ATOM   25    O  O     . PHE A 1 5    ? 100.544 108.598 16.922  1.00 3.34  ? 5    PHE A O     1 
ATOM   26    C  CB    . PHE A 1 5    ? 100.109 106.029 19.093  1.00 3.45  ? 5    PHE A CB    1 
ATOM   27    C  CG    . PHE A 1 5    ? 99.996  105.329 17.768  1.00 2.69  ? 5    PHE A CG    1 
ATOM   28    C  CD1   . PHE A 1 5    ? 101.101 105.199 16.925  1.00 3.95  ? 5    PHE A CD1   1 
ATOM   29    C  CD2   . PHE A 1 5    ? 98.785  104.739 17.383  1.00 2.91  ? 5    PHE A CD2   1 
ATOM   30    C  CE1   . PHE A 1 5    ? 100.977 104.532 15.694  1.00 4.31  ? 5    PHE A CE1   1 
ATOM   31    C  CE2   . PHE A 1 5    ? 98.667  104.061 16.184  1.00 1.00  ? 5    PHE A CE2   1 
ATOM   32    C  CZ    . PHE A 1 5    ? 99.746  103.969 15.333  1.00 3.93  ? 5    PHE A CZ    1 
ATOM   33    N  N     . ILE A 1 6    ? 102.253 108.086 18.336  1.00 3.26  ? 6    ILE A N     1 
ATOM   34    C  CA    . ILE A 1 6    ? 103.320 108.476 17.431  1.00 3.02  ? 6    ILE A CA    1 
ATOM   35    C  C     . ILE A 1 6    ? 104.359 107.390 17.529  1.00 3.12  ? 6    ILE A C     1 
ATOM   36    O  O     . ILE A 1 6    ? 104.647 106.904 18.619  1.00 2.58  ? 6    ILE A O     1 
ATOM   37    C  CB    . ILE A 1 6    ? 103.959 109.820 17.849  1.00 2.59  ? 6    ILE A CB    1 
ATOM   38    C  CG1   . ILE A 1 6    ? 102.903 110.920 18.002  1.00 4.47  ? 6    ILE A CG1   1 
ATOM   39    C  CG2   . ILE A 1 6    ? 105.044 110.238 16.847  1.00 2.37  ? 6    ILE A CG2   1 
ATOM   40    C  CD1   . ILE A 1 6    ? 103.473 112.280 18.425  1.00 4.49  ? 6    ILE A CD1   1 
ATOM   41    N  N     . ALA A 1 7    ? 104.928 107.014 16.392  1.00 3.28  ? 7    ALA A N     1 
ATOM   42    C  CA    . ALA A 1 7    ? 105.999 106.022 16.395  1.00 3.52  ? 7    ALA A CA    1 
ATOM   43    C  C     . ALA A 1 7    ? 107.128 106.362 15.435  1.00 3.99  ? 7    ALA A C     1 
ATOM   44    O  O     . ALA A 1 7    ? 106.911 106.662 14.242  1.00 3.36  ? 7    ALA A O     1 
ATOM   45    C  CB    . ALA A 1 7    ? 105.437 104.627 16.100  1.00 3.41  ? 7    ALA A CB    1 
ATOM   46    N  N     . ASN A 1 8    ? 108.342 106.318 15.986  1.00 4.39  ? 8    ASN A N     1 
ATOM   47    C  CA    . ASN A 1 8    ? 109.578 106.425 15.235  1.00 5.46  ? 8    ASN A CA    1 
ATOM   48    C  C     . ASN A 1 8    ? 110.118 105.016 14.913  1.00 5.92  ? 8    ASN A C     1 
ATOM   49    O  O     . ASN A 1 8    ? 110.641 104.323 15.791  1.00 5.21  ? 8    ASN A O     1 
ATOM   50    C  CB    . ASN A 1 8    ? 110.580 107.244 16.058  1.00 5.17  ? 8    ASN A CB    1 
ATOM   51    C  CG    . ASN A 1 8    ? 111.894 107.488 15.332  1.00 5.39  ? 8    ASN A CG    1 
ATOM   52    O  OD1   . ASN A 1 8    ? 112.049 107.155 14.161  1.00 5.45  ? 8    ASN A OD1   1 
ATOM   53    N  ND2   . ASN A 1 8    ? 112.868 108.048 16.053  1.00 4.36  ? 8    ASN A ND2   1 
ATOM   54    N  N     . LEU A 1 9    ? 109.967 104.581 13.662  1.00 6.69  ? 9    LEU A N     1 
ATOM   55    C  CA    . LEU A 1 9    ? 110.347 103.211 13.309  1.00 8.23  ? 9    LEU A CA    1 
ATOM   56    C  C     . LEU A 1 9    ? 111.828 103.061 13.047  1.00 9.46  ? 9    LEU A C     1 
ATOM   57    O  O     . LEU A 1 9    ? 112.452 102.134 13.558  1.00 10.35 ? 9    LEU A O     1 
ATOM   58    C  CB    . LEU A 1 9    ? 109.564 102.674 12.101  1.00 7.51  ? 9    LEU A CB    1 
ATOM   59    C  CG    . LEU A 1 9    ? 108.030 102.632 12.139  1.00 8.54  ? 9    LEU A CG    1 
ATOM   60    C  CD1   . LEU A 1 9    ? 107.442 101.395 11.472  1.00 7.42  ? 9    LEU A CD1   1 
ATOM   61    C  CD2   . LEU A 1 9    ? 107.462 102.835 13.520  1.00 8.85  ? 9    LEU A CD2   1 
ATOM   62    N  N     . ARG A 1 10   ? 112.385 103.987 12.268  1.00 10.14 ? 10   ARG A N     1 
ATOM   63    C  CA    . ARG A 1 10   ? 113.721 103.830 11.711  1.00 11.20 ? 10   ARG A CA    1 
ATOM   64    C  C     . ARG A 1 10   ? 114.813 104.673 12.362  1.00 11.88 ? 10   ARG A C     1 
ATOM   65    O  O     . ARG A 1 10   ? 115.982 104.292 12.340  1.00 12.47 ? 10   ARG A O     1 
ATOM   66    C  CB    . ARG A 1 10   ? 113.687 104.112 10.211  1.00 11.24 ? 10   ARG A CB    1 
ATOM   67    C  CG    . ARG A 1 10   ? 112.711 103.247 9.446   1.00 10.91 ? 10   ARG A CG    1 
ATOM   68    C  CD    . ARG A 1 10   ? 112.997 103.231 7.976   1.00 13.05 ? 10   ARG A CD    1 
ATOM   69    N  NE    . ARG A 1 10   ? 111.867 102.740 7.202   1.00 15.31 ? 10   ARG A NE    1 
ATOM   70    C  CZ    . ARG A 1 10   ? 111.576 103.144 5.969   1.00 16.91 ? 10   ARG A CZ    1 
ATOM   71    N  NH1   . ARG A 1 10   ? 112.336 104.052 5.357   1.00 17.32 ? 10   ARG A NH1   1 
ATOM   72    N  NH2   . ARG A 1 10   ? 110.527 102.633 5.339   1.00 17.61 ? 10   ARG A NH2   1 
ATOM   73    N  N     . GLY A 1 11   ? 114.445 105.824 12.919  1.00 12.92 ? 11   GLY A N     1 
ATOM   74    C  CA    . GLY A 1 11   ? 115.415 106.695 13.573  1.00 13.38 ? 11   GLY A CA    1 
ATOM   75    C  C     . GLY A 1 11   ? 115.773 106.232 14.971  1.00 13.84 ? 11   GLY A C     1 
ATOM   76    O  O     . GLY A 1 11   ? 115.067 105.412 15.557  1.00 14.58 ? 11   GLY A O     1 
ATOM   77    N  N     . LYS A 1 12   ? 116.873 106.752 15.515  1.00 13.92 ? 12   LYS A N     1 
ATOM   78    C  CA    . LYS A 1 12   ? 117.253 106.484 16.901  1.00 13.62 ? 12   LYS A CA    1 
ATOM   79    C  C     . LYS A 1 12   ? 116.208 107.119 17.834  1.00 13.15 ? 12   LYS A C     1 
ATOM   80    O  O     . LYS A 1 12   ? 115.677 108.182 17.507  1.00 14.00 ? 12   LYS A O     1 
ATOM   81    C  CB    . LYS A 1 12   ? 118.644 107.062 17.204  1.00 13.83 ? 12   LYS A CB    1 
ATOM   82    C  CG    . LYS A 1 12   ? 119.513 107.330 15.966  1.00 15.60 ? 12   LYS A CG    1 
ATOM   83    C  CD    . LYS A 1 12   ? 120.959 106.877 16.174  1.00 18.16 ? 12   LYS A CD    1 
ATOM   84    C  CE    . LYS A 1 12   ? 121.606 106.441 14.864  1.00 18.29 ? 12   LYS A CE    1 
ATOM   85    N  NZ    . LYS A 1 12   ? 123.107 106.465 14.934  1.00 20.42 ? 12   LYS A NZ    1 
ATOM   86    N  N     . PRO A 1 13   ? 115.894 106.468 18.957  1.00 12.27 ? 13   PRO A N     1 
ATOM   87    C  CA    . PRO A 1 13   ? 114.957 107.026 19.952  1.00 11.82 ? 13   PRO A CA    1 
ATOM   88    C  C     . PRO A 1 13   ? 115.390 108.396 20.473  1.00 11.08 ? 13   PRO A C     1 
ATOM   89    O  O     . PRO A 1 13   ? 116.541 108.569 20.877  1.00 10.56 ? 13   PRO A O     1 
ATOM   90    C  CB    . PRO A 1 13   ? 114.965 105.993 21.084  1.00 11.75 ? 13   PRO A CB    1 
ATOM   91    C  CG    . PRO A 1 13   ? 116.153 105.098 20.802  1.00 12.56 ? 13   PRO A CG    1 
ATOM   92    C  CD    . PRO A 1 13   ? 116.373 105.127 19.330  1.00 12.24 ? 13   PRO A CD    1 
ATOM   93    N  N     . ASP A 1 14   ? 114.469 109.358 20.452  1.00 10.39 ? 14   ASP A N     1 
ATOM   94    C  CA    . ASP A 1 14   ? 114.829 110.750 20.717  1.00 9.58  ? 14   ASP A CA    1 
ATOM   95    C  C     . ASP A 1 14   ? 113.807 111.492 21.580  1.00 9.07  ? 14   ASP A C     1 
ATOM   96    O  O     . ASP A 1 14   ? 112.744 110.947 21.924  1.00 8.62  ? 14   ASP A O     1 
ATOM   97    C  CB    . ASP A 1 14   ? 115.083 111.508 19.404  1.00 9.58  ? 14   ASP A CB    1 
ATOM   98    C  CG    . ASP A 1 14   ? 113.870 111.522 18.480  1.00 10.93 ? 14   ASP A CG    1 
ATOM   99    O  OD1   . ASP A 1 14   ? 114.075 111.675 17.250  1.00 11.58 ? 14   ASP A OD1   1 
ATOM   100   O  OD2   . ASP A 1 14   ? 112.674 111.390 18.872  1.00 11.28 ? 14   ASP A OD2   1 
ATOM   101   N  N     . HIS A 1 15   ? 114.152 112.726 21.939  1.00 7.81  ? 15   HIS A N     1 
ATOM   102   C  CA    . HIS A 1 15   ? 113.272 113.560 22.728  1.00 7.62  ? 15   HIS A CA    1 
ATOM   103   C  C     . HIS A 1 15   ? 112.194 114.226 21.878  1.00 7.39  ? 15   HIS A C     1 
ATOM   104   O  O     . HIS A 1 15   ? 111.099 114.496 22.377  1.00 7.47  ? 15   HIS A O     1 
ATOM   105   C  CB    . HIS A 1 15   ? 114.054 114.607 23.523  1.00 7.65  ? 15   HIS A CB    1 
ATOM   106   C  CG    . HIS A 1 15   ? 113.228 115.305 24.559  1.00 6.13  ? 15   HIS A CG    1 
ATOM   107   N  ND1   . HIS A 1 15   ? 113.043 116.670 24.567  1.00 7.49  ? 15   HIS A ND1   1 
ATOM   108   C  CD2   . HIS A 1 15   ? 112.516 114.826 25.602  1.00 6.27  ? 15   HIS A CD2   1 
ATOM   109   C  CE1   . HIS A 1 15   ? 112.256 117.003 25.573  1.00 6.43  ? 15   HIS A CE1   1 
ATOM   110   N  NE2   . HIS A 1 15   ? 111.921 115.903 26.217  1.00 8.93  ? 15   HIS A NE2   1 
ATOM   111   N  N     . THR A 1 16   ? 112.492 114.460 20.597  1.00 6.56  ? 16   THR A N     1 
ATOM   112   C  CA    . THR A 1 16   ? 111.552 115.113 19.683  1.00 6.60  ? 16   THR A CA    1 
ATOM   113   C  C     . THR A 1 16   ? 110.168 114.491 19.679  1.00 6.01  ? 16   THR A C     1 
ATOM   114   O  O     . THR A 1 16   ? 109.170 115.217 19.715  1.00 6.32  ? 16   THR A O     1 
ATOM   115   C  CB    . THR A 1 16   ? 112.112 115.142 18.245  1.00 6.55  ? 16   THR A CB    1 
ATOM   116   O  OG1   . THR A 1 16   ? 113.314 115.907 18.239  1.00 8.59  ? 16   THR A OG1   1 
ATOM   117   C  CG2   . THR A 1 16   ? 111.180 115.930 17.314  1.00 6.73  ? 16   THR A CG2   1 
ATOM   118   N  N     . LEU A 1 17   ? 110.114 113.160 19.614  1.00 5.67  ? 17   LEU A N     1 
ATOM   119   C  CA    . LEU A 1 17   ? 108.856 112.411 19.625  1.00 5.62  ? 17   LEU A CA    1 
ATOM   120   C  C     . LEU A 1 17   ? 108.046 112.707 20.891  1.00 5.26  ? 17   LEU A C     1 
ATOM   121   O  O     . LEU A 1 17   ? 106.825 112.826 20.836  1.00 4.84  ? 17   LEU A O     1 
ATOM   122   C  CB    . LEU A 1 17   ? 109.171 110.909 19.504  1.00 5.77  ? 17   LEU A CB    1 
ATOM   123   C  CG    . LEU A 1 17   ? 108.324 109.640 19.756  1.00 6.07  ? 17   LEU A CG    1 
ATOM   124   C  CD1   . LEU A 1 17   ? 107.255 109.661 20.844  1.00 5.06  ? 17   LEU A CD1   1 
ATOM   125   C  CD2   . LEU A 1 17   ? 107.824 109.035 18.454  1.00 7.08  ? 17   LEU A CD2   1 
ATOM   126   N  N     . VAL A 1 18   ? 108.730 112.831 22.024  1.00 4.82  ? 18   VAL A N     1 
ATOM   127   C  CA    . VAL A 1 18   ? 108.056 113.132 23.291  1.00 4.95  ? 18   VAL A CA    1 
ATOM   128   C  C     . VAL A 1 18   ? 107.439 114.539 23.286  1.00 5.03  ? 18   VAL A C     1 
ATOM   129   O  O     . VAL A 1 18   ? 106.284 114.714 23.694  1.00 4.43  ? 18   VAL A O     1 
ATOM   130   C  CB    . VAL A 1 18   ? 108.991 112.913 24.506  1.00 5.06  ? 18   VAL A CB    1 
ATOM   131   C  CG1   . VAL A 1 18   ? 108.241 113.158 25.838  1.00 4.85  ? 18   VAL A CG1   1 
ATOM   132   C  CG2   . VAL A 1 18   ? 109.572 111.513 24.456  1.00 5.68  ? 18   VAL A CG2   1 
ATOM   133   N  N     . GLU A 1 19   ? 108.212 115.520 22.814  1.00 5.42  ? 19   GLU A N     1 
ATOM   134   C  CA    . GLU A 1 19   ? 107.742 116.896 22.602  1.00 5.67  ? 19   GLU A CA    1 
ATOM   135   C  C     . GLU A 1 19   ? 106.534 116.944 21.668  1.00 5.34  ? 19   GLU A C     1 
ATOM   136   O  O     . GLU A 1 19   ? 105.562 117.674 21.925  1.00 5.03  ? 19   GLU A O     1 
ATOM   137   C  CB    . GLU A 1 19   ? 108.857 117.760 21.999  1.00 6.13  ? 19   GLU A CB    1 
ATOM   138   C  CG    . GLU A 1 19   ? 110.097 117.945 22.872  1.00 8.32  ? 19   GLU A CG    1 
ATOM   139   C  CD    . GLU A 1 19   ? 111.191 118.770 22.193  1.00 12.34 ? 19   GLU A CD    1 
ATOM   140   O  OE1   . GLU A 1 19   ? 111.739 119.688 22.842  1.00 16.13 ? 19   GLU A OE1   1 
ATOM   141   O  OE2   . GLU A 1 19   ? 111.521 118.507 21.011  1.00 12.83 ? 19   GLU A OE2   1 
ATOM   142   N  N     . GLN A 1 20   ? 106.614 116.173 20.581  1.00 5.14  ? 20   GLN A N     1 
ATOM   143   C  CA    . GLN A 1 20   ? 105.521 116.060 19.620  1.00 5.04  ? 20   GLN A CA    1 
ATOM   144   C  C     . GLN A 1 20   ? 104.266 115.497 20.283  1.00 4.75  ? 20   GLN A C     1 
ATOM   145   O  O     . GLN A 1 20   ? 103.172 115.976 20.031  1.00 5.52  ? 20   GLN A O     1 
ATOM   146   C  CB    . GLN A 1 20   ? 105.914 115.188 18.422  1.00 4.79  ? 20   GLN A CB    1 
ATOM   147   C  CG    . GLN A 1 20   ? 106.886 115.852 17.425  1.00 5.20  ? 20   GLN A CG    1 
ATOM   148   C  CD    . GLN A 1 20   ? 107.313 114.888 16.315  1.00 8.54  ? 20   GLN A CD    1 
ATOM   149   O  OE1   . GLN A 1 20   ? 107.143 113.674 16.455  1.00 8.84  ? 20   GLN A OE1   1 
ATOM   150   N  NE2   . GLN A 1 20   ? 107.880 115.422 15.219  1.00 7.59  ? 20   GLN A NE2   1 
ATOM   151   N  N     . ALA A 1 21   ? 104.424 114.493 21.134  1.00 4.97  ? 21   ALA A N     1 
ATOM   152   C  CA    . ALA A 1 21   ? 103.280 113.904 21.831  1.00 5.19  ? 21   ALA A CA    1 
ATOM   153   C  C     . ALA A 1 21   ? 102.607 114.935 22.744  1.00 5.71  ? 21   ALA A C     1 
ATOM   154   O  O     . ALA A 1 21   ? 101.363 115.016 22.797  1.00 4.98  ? 21   ALA A O     1 
ATOM   155   C  CB    . ALA A 1 21   ? 103.709 112.656 22.617  1.00 5.27  ? 21   ALA A CB    1 
ATOM   156   N  N     . LEU A 1 22   ? 103.428 115.745 23.422  1.00 5.61  ? 22   LEU A N     1 
ATOM   157   C  CA    . LEU A 1 22   ? 102.899 116.789 24.299  1.00 6.10  ? 22   LEU A CA    1 
ATOM   158   C  C     . LEU A 1 22   ? 102.172 117.884 23.521  1.00 6.26  ? 22   LEU A C     1 
ATOM   159   O  O     . LEU A 1 22   ? 101.120 118.360 23.941  1.00 6.73  ? 22   LEU A O     1 
ATOM   160   C  CB    . LEU A 1 22   ? 103.996 117.384 25.185  1.00 5.78  ? 22   LEU A CB    1 
ATOM   161   C  CG    . LEU A 1 22   ? 104.646 116.437 26.205  1.00 5.91  ? 22   LEU A CG    1 
ATOM   162   C  CD1   . LEU A 1 22   ? 105.792 117.115 26.969  1.00 6.79  ? 22   LEU A CD1   1 
ATOM   163   C  CD2   . LEU A 1 22   ? 103.648 115.853 27.176  1.00 4.74  ? 22   LEU A CD2   1 
ATOM   164   N  N     . LYS A 1 23   ? 102.725 118.256 22.376  1.00 6.54  ? 23   LYS A N     1 
ATOM   165   C  CA    . LYS A 1 23   ? 102.082 119.196 21.462  1.00 6.97  ? 23   LYS A CA    1 
ATOM   166   C  C     . LYS A 1 23   ? 100.757 118.626 20.946  1.00 6.84  ? 23   LYS A C     1 
ATOM   167   O  O     . LYS A 1 23   ? 99.756  119.333 20.908  1.00 6.61  ? 23   LYS A O     1 
ATOM   168   C  CB    . LYS A 1 23   ? 103.026 119.485 20.287  1.00 7.65  ? 23   LYS A CB    1 
ATOM   169   C  CG    . LYS A 1 23   ? 102.784 120.777 19.541  1.00 10.42 ? 23   LYS A CG    1 
ATOM   170   C  CD    . LYS A 1 23   ? 104.055 121.631 19.576  1.00 14.26 ? 23   LYS A CD    1 
ATOM   171   C  CE    . LYS A 1 23   ? 103.742 123.083 19.957  1.00 18.29 ? 23   LYS A CE    1 
ATOM   172   N  NZ    . LYS A 1 23   ? 103.625 123.225 21.443  1.00 19.66 ? 23   LYS A NZ    1 
ATOM   173   N  N     . ALA A 1 24   ? 100.759 117.353 20.543  1.00 6.21  ? 24   ALA A N     1 
ATOM   174   C  CA    . ALA A 1 24   ? 99.540  116.697 20.053  1.00 6.05  ? 24   ALA A CA    1 
ATOM   175   C  C     . ALA A 1 24   ? 98.439  116.705 21.130  1.00 6.31  ? 24   ALA A C     1 
ATOM   176   O  O     . ALA A 1 24   ? 97.286  117.068 20.861  1.00 5.36  ? 24   ALA A O     1 
ATOM   177   C  CB    . ALA A 1 24   ? 99.848  115.284 19.579  1.00 6.28  ? 24   ALA A CB    1 
ATOM   178   N  N     . LEU A 1 25   ? 98.823  116.372 22.360  1.00 6.45  ? 25   LEU A N     1 
ATOM   179   C  CA    . LEU A 1 25   ? 97.917  116.475 23.506  1.00 7.39  ? 25   LEU A CA    1 
ATOM   180   C  C     . LEU A 1 25   ? 97.312  117.871 23.594  1.00 7.18  ? 25   LEU A C     1 
ATOM   181   O  O     . LEU A 1 25   ? 96.109  118.020 23.808  1.00 7.04  ? 25   LEU A O     1 
ATOM   182   C  CB    . LEU A 1 25   ? 98.680  116.199 24.787  1.00 7.80  ? 25   LEU A CB    1 
ATOM   183   C  CG    . LEU A 1 25   ? 98.536  114.881 25.519  1.00 9.40  ? 25   LEU A CG    1 
ATOM   184   C  CD1   . LEU A 1 25   ? 99.151  115.079 26.881  1.00 9.58  ? 25   LEU A CD1   1 
ATOM   185   C  CD2   . LEU A 1 25   ? 97.081  114.450 25.625  1.00 8.04  ? 25   LEU A CD2   1 
ATOM   186   N  N     . GLY A 1 26   ? 98.150  118.889 23.402  1.00 7.91  ? 26   GLY A N     1 
ATOM   187   C  CA    . GLY A 1 26   ? 97.716  120.280 23.438  1.00 8.04  ? 26   GLY A CA    1 
ATOM   188   C  C     . GLY A 1 26   ? 96.690  120.631 22.374  1.00 8.99  ? 26   GLY A C     1 
ATOM   189   O  O     . GLY A 1 26   ? 95.780  121.432 22.617  1.00 8.93  ? 26   GLY A O     1 
ATOM   190   N  N     . CYS A 1 27   ? 96.839  120.049 21.185  1.00 8.60  ? 27   CYS A N     1 
ATOM   191   C  CA    . CYS A 1 27   ? 95.871  120.267 20.112  1.00 9.60  ? 27   CYS A CA    1 
ATOM   192   C  C     . CYS A 1 27   ? 94.543  119.569 20.378  1.00 9.93  ? 27   CYS A C     1 
ATOM   193   O  O     . CYS A 1 27   ? 93.556  119.812 19.675  1.00 10.74 ? 27   CYS A O     1 
ATOM   194   C  CB    . CYS A 1 27   ? 96.433  119.784 18.776  1.00 9.34  ? 27   CYS A CB    1 
ATOM   195   S  SG    . CYS A 1 27   ? 97.884  120.716 18.219  1.00 10.47 ? 27   CYS A SG    1 
ATOM   196   N  N     . MET A 1 28   ? 94.512  118.690 21.371  1.00 9.26  ? 28   MET A N     1 
ATOM   197   C  CA    . MET A 1 28   ? 93.263  118.013 21.696  1.00 9.60  ? 28   MET A CA    1 
ATOM   198   C  C     . MET A 1 28   ? 92.547  118.501 22.960  1.00 8.69  ? 28   MET A C     1 
ATOM   199   O  O     . MET A 1 28   ? 91.647  117.827 23.466  1.00 9.04  ? 28   MET A O     1 
ATOM   200   C  CB    . MET A 1 28   ? 93.490  116.507 21.696  1.00 9.74  ? 28   MET A CB    1 
ATOM   201   C  CG    . MET A 1 28   ? 93.708  116.053 20.256  1.00 12.40 ? 28   MET A CG    1 
ATOM   202   S  SD    . MET A 1 28   ? 93.690  114.346 20.094  1.00 16.02 ? 28   MET A SD    1 
ATOM   203   C  CE    . MET A 1 28   ? 94.414  113.930 21.679  1.00 15.25 ? 28   MET A CE    1 
ATOM   204   N  N     . GLU A 1 29   ? 92.936  119.680 23.438  1.00 7.81  ? 29   GLU A N     1 
ATOM   205   C  CA    . GLU A 1 29   ? 92.398  120.237 24.671  1.00 8.06  ? 29   GLU A CA    1 
ATOM   206   C  C     . GLU A 1 29   ? 90.861  120.352 24.640  1.00 8.31  ? 29   GLU A C     1 
ATOM   207   O  O     . GLU A 1 29   ? 90.198  119.967 25.611  1.00 7.23  ? 29   GLU A O     1 
ATOM   208   C  CB    . GLU A 1 29   ? 93.066  121.589 24.993  1.00 8.20  ? 29   GLU A CB    1 
ATOM   209   C  CG    . GLU A 1 29   ? 92.588  122.295 26.271  1.00 9.42  ? 29   GLU A CG    1 
ATOM   210   C  CD    . GLU A 1 29   ? 92.773  121.484 27.558  1.00 9.45  ? 29   GLU A CD    1 
ATOM   211   O  OE1   . GLU A 1 29   ? 93.762  120.734 27.688  1.00 8.68  ? 29   GLU A OE1   1 
ATOM   212   O  OE2   . GLU A 1 29   ? 91.916  121.612 28.458  1.00 9.18  ? 29   GLU A OE2   1 
ATOM   213   N  N     . HIS A 1 30   ? 90.314  120.844 23.517  1.00 7.77  ? 30   HIS A N     1 
ATOM   214   C  CA    . HIS A 1 30   ? 88.871  120.999 23.349  1.00 8.10  ? 30   HIS A CA    1 
ATOM   215   C  C     . HIS A 1 30   ? 88.105  119.677 23.408  1.00 7.97  ? 30   HIS A C     1 
ATOM   216   O  O     . HIS A 1 30   ? 86.892  119.695 23.546  1.00 7.86  ? 30   HIS A O     1 
ATOM   217   C  CB    . HIS A 1 30   ? 88.541  121.738 22.036  1.00 8.51  ? 30   HIS A CB    1 
ATOM   218   C  CG    . HIS A 1 30   ? 89.047  121.039 20.807  1.00 9.50  ? 30   HIS A CG    1 
ATOM   219   N  ND1   . HIS A 1 30   ? 90.334  121.191 20.340  1.00 9.01  ? 30   HIS A ND1   1 
ATOM   220   C  CD2   . HIS A 1 30   ? 88.436  120.181 19.953  1.00 9.72  ? 30   HIS A CD2   1 
ATOM   221   C  CE1   . HIS A 1 30   ? 90.498  120.456 19.254  1.00 9.55  ? 30   HIS A CE1   1 
ATOM   222   N  NE2   . HIS A 1 30   ? 89.361  119.831 19.000  1.00 9.17  ? 30   HIS A NE2   1 
ATOM   223   N  N     . ARG A 1 31   ? 88.809  118.541 23.301  1.00 7.43  ? 31   ARG A N     1 
ATOM   224   C  CA    . ARG A 1 31   ? 88.185  117.222 23.406  1.00 7.66  ? 31   ARG A CA    1 
ATOM   225   C  C     . ARG A 1 31   ? 88.102  116.711 24.844  1.00 7.15  ? 31   ARG A C     1 
ATOM   226   O  O     . ARG A 1 31   ? 87.495  115.666 25.090  1.00 6.79  ? 31   ARG A O     1 
ATOM   227   C  CB    . ARG A 1 31   ? 88.935  116.179 22.566  1.00 7.55  ? 31   ARG A CB    1 
ATOM   228   C  CG    . ARG A 1 31   ? 88.965  116.528 21.071  1.00 10.03 ? 31   ARG A CG    1 
ATOM   229   C  CD    . ARG A 1 31   ? 89.251  115.349 20.144  1.00 13.05 ? 31   ARG A CD    1 
ATOM   230   N  NE    . ARG A 1 31   ? 88.654  115.650 18.839  1.00 16.08 ? 31   ARG A NE    1 
ATOM   231   C  CZ    . ARG A 1 31   ? 87.711  114.940 18.248  1.00 13.11 ? 31   ARG A CZ    1 
ATOM   232   N  NH1   . ARG A 1 31   ? 87.237  113.825 18.799  1.00 16.00 ? 31   ARG A NH1   1 
ATOM   233   N  NH2   . ARG A 1 31   ? 87.256  115.342 17.077  1.00 17.56 ? 31   ARG A NH2   1 
ATOM   234   N  N     . GLY A 1 32   ? 88.758  117.418 25.760  1.00 6.90  ? 32   GLY A N     1 
ATOM   235   C  CA    . GLY A 1 32   ? 88.717  117.091 27.181  1.00 7.05  ? 32   GLY A CA    1 
ATOM   236   C  C     . GLY A 1 32   ? 87.955  118.106 28.014  1.00 6.36  ? 32   GLY A C     1 
ATOM   237   O  O     . GLY A 1 32   ? 87.469  119.106 27.500  1.00 6.72  ? 32   GLY A O     1 
ATOM   238   N  N     . GLY A 1 33   ? 87.845  117.857 29.312  1.00 6.35  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1 33   ? 87.115  118.758 30.184  1.00 6.52  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1 33   ? 87.949  119.168 31.389  1.00 7.16  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1 33   ? 89.069  118.661 31.580  1.00 6.98  ? 33   GLY A O     1 
ATOM   242   N  N     . CYS A 1 34   ? 87.389  120.052 32.212  1.00 7.03  ? 34   CYS A N     1 
ATOM   243   C  CA    . CYS A 1 34   ? 88.063  120.517 33.420  1.00 7.73  ? 34   CYS A CA    1 
ATOM   244   C  C     . CYS A 1 34   ? 87.158  120.381 34.647  1.00 7.00  ? 34   CYS A C     1 
ATOM   245   O  O     . CYS A 1 34   ? 85.939  120.308 34.524  1.00 5.81  ? 34   CYS A O     1 
ATOM   246   C  CB    . CYS A 1 34   ? 88.513  121.970 33.235  1.00 8.20  ? 34   CYS A CB    1 
ATOM   247   S  SG    . CYS A 1 34   ? 89.863  122.129 32.028  1.00 12.97 ? 34   CYS A SG    1 
ATOM   248   N  N     . SER A 1 35   ? 87.775  120.342 35.829  1.00 7.19  ? 35   SER A N     1 
ATOM   249   C  CA    . SER A 1 35   ? 87.063  120.265 37.114  1.00 7.56  ? 35   SER A CA    1 
ATOM   250   C  C     . SER A 1 35   ? 86.364  121.586 37.434  1.00 7.68  ? 35   SER A C     1 
ATOM   251   O  O     . SER A 1 35   ? 86.376  122.511 36.613  1.00 7.41  ? 35   SER A O     1 
ATOM   252   C  CB    . SER A 1 35   ? 88.050  119.907 38.236  1.00 8.27  ? 35   SER A CB    1 
ATOM   253   O  OG    . SER A 1 35   ? 89.041  119.006 37.790  1.00 8.91  ? 35   SER A OG    1 
ATOM   254   N  N     . ALA A 1 36   ? 85.762  121.683 38.624  1.00 7.80  ? 36   ALA A N     1 
ATOM   255   C  CA    . ALA A 1 36   ? 84.965  122.864 39.004  1.00 7.65  ? 36   ALA A CA    1 
ATOM   256   C  C     . ALA A 1 36   ? 85.808  124.137 39.151  1.00 7.76  ? 36   ALA A C     1 
ATOM   257   O  O     . ALA A 1 36   ? 85.311  125.244 38.998  1.00 6.98  ? 36   ALA A O     1 
ATOM   258   C  CB    . ALA A 1 36   ? 84.172  122.595 40.282  1.00 7.63  ? 36   ALA A CB    1 
ATOM   259   N  N     . ASP A 1 37   ? 87.097  123.972 39.428  1.00 8.13  ? 37   ASP A N     1 
ATOM   260   C  CA    . ASP A 1 37   ? 87.989  125.125 39.527  1.00 8.33  ? 37   ASP A CA    1 
ATOM   261   C  C     . ASP A 1 37   ? 88.381  125.679 38.152  1.00 8.72  ? 37   ASP A C     1 
ATOM   262   O  O     . ASP A 1 37   ? 89.115  126.674 38.076  1.00 8.78  ? 37   ASP A O     1 
ATOM   263   C  CB    . ASP A 1 37   ? 89.221  124.804 40.383  1.00 7.73  ? 37   ASP A CB    1 
ATOM   264   C  CG    . ASP A 1 37   ? 90.083  123.702 39.799  1.00 7.97  ? 37   ASP A CG    1 
ATOM   265   O  OD1   . ASP A 1 37   ? 89.863  123.302 38.631  1.00 6.24  ? 37   ASP A OD1   1 
ATOM   266   O  OD2   . ASP A 1 37   ? 91.026  123.187 40.451  1.00 6.17  ? 37   ASP A OD2   1 
ATOM   267   N  N     . ASN A 1 38   ? 87.899  125.033 37.081  1.00 8.50  ? 38   ASN A N     1 
ATOM   268   C  CA    . ASN A 1 38   ? 88.127  125.503 35.706  1.00 9.31  ? 38   ASN A CA    1 
ATOM   269   C  C     . ASN A 1 38   ? 89.619  125.612 35.389  1.00 9.20  ? 38   ASN A C     1 
ATOM   270   O  O     . ASN A 1 38   ? 90.048  126.457 34.588  1.00 9.04  ? 38   ASN A O     1 
ATOM   271   C  CB    . ASN A 1 38   ? 87.446  126.865 35.474  1.00 9.73  ? 38   ASN A CB    1 
ATOM   272   C  CG    . ASN A 1 38   ? 85.933  126.789 35.564  1.00 11.11 ? 38   ASN A CG    1 
ATOM   273   O  OD1   . ASN A 1 38   ? 85.327  125.784 35.199  1.00 13.38 ? 38   ASN A OD1   1 
ATOM   274   N  ND2   . ASN A 1 38   ? 85.317  127.862 36.049  1.00 12.73 ? 38   ASN A ND2   1 
ATOM   275   N  N     . ASP A 1 39   ? 90.398  124.752 36.039  1.00 8.47  ? 39   ASP A N     1 
ATOM   276   C  CA    . ASP A 1 39   ? 91.855  124.825 35.999  1.00 8.20  ? 39   ASP A CA    1 
ATOM   277   C  C     . ASP A 1 39   ? 92.421  123.405 35.998  1.00 7.89  ? 39   ASP A C     1 
ATOM   278   O  O     . ASP A 1 39   ? 93.087  123.000 35.039  1.00 8.09  ? 39   ASP A O     1 
ATOM   279   C  CB    . ASP A 1 39   ? 92.368  125.649 37.184  1.00 8.11  ? 39   ASP A CB    1 
ATOM   280   C  CG    . ASP A 1 39   ? 93.841  125.996 37.076  1.00 9.35  ? 39   ASP A CG    1 
ATOM   281   O  OD1   . ASP A 1 39   ? 94.506  125.618 36.073  1.00 9.93  ? 39   ASP A OD1   1 
ATOM   282   O  OD2   . ASP A 1 39   ? 94.420  126.644 37.977  1.00 10.94 ? 39   ASP A OD2   1 
ATOM   283   N  N     . SER A 1 40   ? 92.117  122.632 37.037  1.00 6.95  ? 40   SER A N     1 
ATOM   284   C  CA    . SER A 1 40   ? 92.477  121.209 37.043  1.00 6.37  ? 40   SER A CA    1 
ATOM   285   C  C     . SER A 1 40   ? 91.801  120.493 35.858  1.00 6.37  ? 40   SER A C     1 
ATOM   286   O  O     . SER A 1 40   ? 90.671  120.816 35.503  1.00 6.24  ? 40   SER A O     1 
ATOM   287   C  CB    . SER A 1 40   ? 92.056  120.551 38.357  1.00 5.80  ? 40   SER A CB    1 
ATOM   288   O  OG    . SER A 1 40   ? 92.468  121.297 39.491  1.00 4.59  ? 40   SER A OG    1 
ATOM   289   N  N     . GLY A 1 41   ? 92.503  119.547 35.245  1.00 6.54  ? 41   GLY A N     1 
ATOM   290   C  CA    . GLY A 1 41   ? 91.966  118.795 34.122  1.00 6.37  ? 41   GLY A CA    1 
ATOM   291   C  C     . GLY A 1 41   ? 91.300  117.497 34.537  1.00 6.58  ? 41   GLY A C     1 
ATOM   292   O  O     . GLY A 1 41   ? 91.596  116.944 35.603  1.00 6.59  ? 41   GLY A O     1 
ATOM   293   N  N     . ASP A 1 42   ? 90.402  117.009 33.683  1.00 6.27  ? 42   ASP A N     1 
ATOM   294   C  CA    . ASP A 1 42   ? 89.816  115.676 33.821  1.00 5.73  ? 42   ASP A CA    1 
ATOM   295   C  C     . ASP A 1 42   ? 90.834  114.575 33.621  1.00 5.47  ? 42   ASP A C     1 
ATOM   296   O  O     . ASP A 1 42   ? 90.561  113.421 33.919  1.00 5.28  ? 42   ASP A O     1 
ATOM   297   C  CB    . ASP A 1 42   ? 88.687  115.473 32.816  1.00 4.96  ? 42   ASP A CB    1 
ATOM   298   C  CG    . ASP A 1 42   ? 87.540  116.456 33.010  1.00 5.26  ? 42   ASP A CG    1 
ATOM   299   O  OD1   . ASP A 1 42   ? 87.493  117.159 34.040  1.00 4.97  ? 42   ASP A OD1   1 
ATOM   300   O  OD2   . ASP A 1 42   ? 86.638  116.580 32.160  1.00 4.40  ? 42   ASP A OD2   1 
ATOM   301   N  N     . GLY A 1 43   ? 91.998  114.926 33.074  1.00 5.15  ? 43   GLY A N     1 
ATOM   302   C  CA    . GLY A 1 43   ? 93.021  113.934 32.820  1.00 4.32  ? 43   GLY A CA    1 
ATOM   303   C  C     . GLY A 1 43   ? 93.793  114.168 31.542  1.00 3.95  ? 43   GLY A C     1 
ATOM   304   O  O     . GLY A 1 43   ? 93.203  114.509 30.516  1.00 3.32  ? 43   GLY A O     1 
ATOM   305   N  N     . ALA A 1 44   ? 95.114  113.995 31.622  1.00 3.23  ? 44   ALA A N     1 
ATOM   306   C  CA    . ALA A 1 44   ? 95.985  113.968 30.451  1.00 3.30  ? 44   ALA A CA    1 
ATOM   307   C  C     . ALA A 1 44   ? 97.123  113.029 30.781  1.00 3.63  ? 44   ALA A C     1 
ATOM   308   O  O     . ALA A 1 44   ? 97.580  112.982 31.929  1.00 3.36  ? 44   ALA A O     1 
ATOM   309   C  CB    . ALA A 1 44   ? 96.531  115.349 30.126  1.00 3.38  ? 44   ALA A CB    1 
ATOM   310   N  N     . GLY A 1 45   ? 97.593  112.290 29.785  1.00 3.23  ? 45   GLY A N     1 
ATOM   311   C  CA    . GLY A 1 45   ? 98.673  111.362 30.019  1.00 3.11  ? 45   GLY A CA    1 
ATOM   312   C  C     . GLY A 1 45   ? 99.354  110.885 28.762  1.00 3.73  ? 45   GLY A C     1 
ATOM   313   O  O     . GLY A 1 45   ? 98.840  111.039 27.649  1.00 3.31  ? 45   GLY A O     1 
ATOM   314   N  N     . VAL A 1 46   ? 100.520 110.288 28.955  1.00 3.74  ? 46   VAL A N     1 
ATOM   315   C  CA    . VAL A 1 46   ? 101.288 109.723 27.866  1.00 4.68  ? 46   VAL A CA    1 
ATOM   316   C  C     . VAL A 1 46   ? 101.853 108.374 28.341  1.00 4.84  ? 46   VAL A C     1 
ATOM   317   O  O     . VAL A 1 46   ? 102.239 108.219 29.502  1.00 5.39  ? 46   VAL A O     1 
ATOM   318   C  CB    . VAL A 1 46   ? 102.396 110.719 27.403  1.00 4.84  ? 46   VAL A CB    1 
ATOM   319   C  CG1   . VAL A 1 46   ? 103.494 110.847 28.472  1.00 5.15  ? 46   VAL A CG1   1 
ATOM   320   C  CG2   . VAL A 1 46   ? 103.014 110.280 26.098  1.00 8.53  ? 46   VAL A CG2   1 
ATOM   321   N  N     . MET A 1 47   ? 101.837 107.380 27.467  1.00 4.76  ? 47   MET A N     1 
ATOM   322   C  CA    . MET A 1 47   ? 102.575 106.153 27.702  1.00 4.63  ? 47   MET A CA    1 
ATOM   323   C  C     . MET A 1 47   ? 103.766 106.182 26.767  1.00 4.96  ? 47   MET A C     1 
ATOM   324   O  O     . MET A 1 47   ? 103.614 106.528 25.595  1.00 4.14  ? 47   MET A O     1 
ATOM   325   C  CB    . MET A 1 47   ? 101.701 104.939 27.389  1.00 5.10  ? 47   MET A CB    1 
ATOM   326   C  CG    . MET A 1 47   ? 102.412 103.604 27.625  1.00 4.73  ? 47   MET A CG    1 
ATOM   327   S  SD    . MET A 1 47   ? 101.691 102.165 26.774  1.00 7.24  ? 47   MET A SD    1 
ATOM   328   C  CE    . MET A 1 47   ? 100.058 102.108 27.534  1.00 6.43  ? 47   MET A CE    1 
ATOM   329   N  N     . THR A 1 48   ? 104.952 105.832 27.269  1.00 5.10  ? 48   THR A N     1 
ATOM   330   C  CA    . THR A 1 48   ? 106.138 105.764 26.414  1.00 5.61  ? 48   THR A CA    1 
ATOM   331   C  C     . THR A 1 48   ? 106.961 104.523 26.716  1.00 5.51  ? 48   THR A C     1 
ATOM   332   O  O     . THR A 1 48   ? 106.602 103.729 27.583  1.00 5.06  ? 48   THR A O     1 
ATOM   333   C  CB    . THR A 1 48   ? 107.052 107.003 26.577  1.00 5.88  ? 48   THR A CB    1 
ATOM   334   O  OG1   . THR A 1 48   ? 107.727 106.936 27.840  1.00 5.43  ? 48   THR A OG1   1 
ATOM   335   C  CG2   . THR A 1 48   ? 106.257 108.314 26.630  1.00 6.67  ? 48   THR A CG2   1 
ATOM   336   N  N     . ALA A 1 49   ? 108.078 104.369 26.003  1.00 5.93  ? 49   ALA A N     1 
ATOM   337   C  CA    . ALA A 1 49   ? 109.061 103.351 26.358  1.00 6.19  ? 49   ALA A CA    1 
ATOM   338   C  C     . ALA A 1 49   ? 109.714 103.795 27.664  1.00 6.75  ? 49   ALA A C     1 
ATOM   339   O  O     . ALA A 1 49   ? 109.588 104.951 28.076  1.00 6.05  ? 49   ALA A O     1 
ATOM   340   C  CB    . ALA A 1 49   ? 110.099 103.184 25.264  1.00 6.58  ? 49   ALA A CB    1 
ATOM   341   N  N     . ILE A 1 50   ? 110.407 102.880 28.329  1.00 7.26  ? 50   ILE A N     1 
ATOM   342   C  CA    . ILE A 1 50   ? 111.116 103.255 29.546  1.00 7.87  ? 50   ILE A CA    1 
ATOM   343   C  C     . ILE A 1 50   ? 112.223 104.249 29.195  1.00 7.52  ? 50   ILE A C     1 
ATOM   344   O  O     . ILE A 1 50   ? 112.986 103.989 28.279  1.00 8.23  ? 50   ILE A O     1 
ATOM   345   C  CB    . ILE A 1 50   ? 111.639 101.999 30.250  1.00 8.15  ? 50   ILE A CB    1 
ATOM   346   C  CG1   . ILE A 1 50   ? 110.442 101.237 30.807  1.00 10.09 ? 50   ILE A CG1   1 
ATOM   347   C  CG2   . ILE A 1 50   ? 112.571 102.363 31.421  1.00 7.47  ? 50   ILE A CG2   1 
ATOM   348   C  CD1   . ILE A 1 50   ? 110.706 99.819  30.898  1.00 13.56 ? 50   ILE A CD1   1 
ATOM   349   N  N     . PRO A 1 51   ? 112.287 105.396 29.882  1.00 7.38  ? 51   PRO A N     1 
ATOM   350   C  CA    . PRO A 1 51   ? 113.326 106.398 29.595  1.00 6.96  ? 51   PRO A CA    1 
ATOM   351   C  C     . PRO A 1 51   ? 114.660 105.961 30.214  1.00 7.04  ? 51   PRO A C     1 
ATOM   352   O  O     . PRO A 1 51   ? 115.041 106.421 31.300  1.00 6.60  ? 51   PRO A O     1 
ATOM   353   C  CB    . PRO A 1 51   ? 112.795 107.663 30.282  1.00 6.91  ? 51   PRO A CB    1 
ATOM   354   C  CG    . PRO A 1 51   ? 112.010 107.129 31.485  1.00 6.57  ? 51   PRO A CG    1 
ATOM   355   C  CD    . PRO A 1 51   ? 111.410 105.822 30.996  1.00 6.99  ? 51   PRO A CD    1 
ATOM   356   N  N     . ARG A 1 52   ? 115.361 105.079 29.511  1.00 7.13  ? 52   ARG A N     1 
ATOM   357   C  CA    . ARG A 1 52   ? 116.561 104.431 30.050  1.00 7.48  ? 52   ARG A CA    1 
ATOM   358   C  C     . ARG A 1 52   ? 117.667 105.426 30.394  1.00 7.80  ? 52   ARG A C     1 
ATOM   359   O  O     . ARG A 1 52   ? 118.291 105.323 31.464  1.00 7.01  ? 52   ARG A O     1 
ATOM   360   C  CB    . ARG A 1 52   ? 117.053 103.360 29.079  1.00 7.71  ? 52   ARG A CB    1 
ATOM   361   C  CG    . ARG A 1 52   ? 118.150 102.483 29.615  1.00 8.80  ? 52   ARG A CG    1 
ATOM   362   C  CD    . ARG A 1 52   ? 118.406 101.220 28.798  1.00 8.64  ? 52   ARG A CD    1 
ATOM   363   N  NE    . ARG A 1 52   ? 119.590 100.547 29.328  1.00 10.16 ? 52   ARG A NE    1 
ATOM   364   C  CZ    . ARG A 1 52   ? 119.569 99.672  30.328  1.00 10.82 ? 52   ARG A CZ    1 
ATOM   365   N  NH1   . ARG A 1 52   ? 118.412 99.317  30.902  1.00 9.64  ? 52   ARG A NH1   1 
ATOM   366   N  NH2   . ARG A 1 52   ? 120.704 99.144  30.747  1.00 11.46 ? 52   ARG A NH2   1 
ATOM   367   N  N     . GLU A 1 53   ? 117.875 106.402 29.506  1.00 8.30  ? 53   GLU A N     1 
ATOM   368   C  CA    . GLU A 1 53   ? 118.915 107.419 29.678  1.00 9.10  ? 53   GLU A CA    1 
ATOM   369   C  C     . GLU A 1 53   ? 118.670 108.254 30.943  1.00 8.56  ? 53   GLU A C     1 
ATOM   370   O  O     . GLU A 1 53   ? 119.598 108.592 31.661  1.00 8.06  ? 53   GLU A O     1 
ATOM   371   C  CB    . GLU A 1 53   ? 119.011 108.309 28.425  1.00 9.43  ? 53   GLU A CB    1 
ATOM   372   C  CG    . GLU A 1 53   ? 120.250 109.189 28.370  1.00 12.36 ? 53   GLU A CG    1 
ATOM   373   C  CD    . GLU A 1 53   ? 120.252 110.200 27.215  1.00 15.85 ? 53   GLU A CD    1 
ATOM   374   O  OE1   . GLU A 1 53   ? 119.600 109.960 26.167  1.00 16.63 ? 53   GLU A OE1   1 
ATOM   375   O  OE2   . GLU A 1 53   ? 120.936 111.244 27.355  1.00 17.74 ? 53   GLU A OE2   1 
ATOM   376   N  N     . LEU A 1 54   ? 117.402 108.533 31.223  1.00 7.98  ? 54   LEU A N     1 
ATOM   377   C  CA    . LEU A 1 54   ? 117.005 109.271 32.413  1.00 8.28  ? 54   LEU A CA    1 
ATOM   378   C  C     . LEU A 1 54   ? 117.230 108.472 33.711  1.00 7.80  ? 54   LEU A C     1 
ATOM   379   O  O     . LEU A 1 54   ? 117.841 108.972 34.663  1.00 7.63  ? 54   LEU A O     1 
ATOM   380   C  CB    . LEU A 1 54   ? 115.540 109.698 32.266  1.00 8.68  ? 54   LEU A CB    1 
ATOM   381   C  CG    . LEU A 1 54   ? 115.004 110.699 33.282  1.00 10.48 ? 54   LEU A CG    1 
ATOM   382   C  CD1   . LEU A 1 54   ? 115.693 112.035 33.128  1.00 12.59 ? 54   LEU A CD1   1 
ATOM   383   C  CD2   . LEU A 1 54   ? 113.522 110.848 33.122  1.00 10.69 ? 54   LEU A CD2   1 
ATOM   384   N  N     . LEU A 1 55   ? 116.756 107.227 33.731  1.00 6.86  ? 55   LEU A N     1 
ATOM   385   C  CA    . LEU A 1 55   ? 116.933 106.327 34.881  1.00 6.53  ? 55   LEU A CA    1 
ATOM   386   C  C     . LEU A 1 55   ? 118.387 105.970 35.190  1.00 6.49  ? 55   LEU A C     1 
ATOM   387   O  O     . LEU A 1 55   ? 118.725 105.661 36.334  1.00 6.32  ? 55   LEU A O     1 
ATOM   388   C  CB    . LEU A 1 55   ? 116.118 105.051 34.680  1.00 5.81  ? 55   LEU A CB    1 
ATOM   389   C  CG    . LEU A 1 55   ? 114.587 105.258 34.676  1.00 6.61  ? 55   LEU A CG    1 
ATOM   390   C  CD1   . LEU A 1 55   ? 113.866 103.934 34.453  1.00 6.54  ? 55   LEU A CD1   1 
ATOM   391   C  CD2   . LEU A 1 55   ? 114.079 105.914 35.960  1.00 5.86  ? 55   LEU A CD2   1 
ATOM   392   N  N     . ALA A 1 56   ? 119.243 106.005 34.168  1.00 6.31  ? 56   ALA A N     1 
ATOM   393   C  CA    . ALA A 1 56   ? 120.681 105.781 34.341  1.00 6.22  ? 56   ALA A CA    1 
ATOM   394   C  C     . ALA A 1 56   ? 121.309 106.708 35.379  1.00 5.88  ? 56   ALA A C     1 
ATOM   395   O  O     . ALA A 1 56   ? 122.223 106.306 36.091  1.00 6.04  ? 56   ALA A O     1 
ATOM   396   C  CB    . ALA A 1 56   ? 121.417 105.903 33.001  1.00 5.99  ? 56   ALA A CB    1 
ATOM   397   N  N     . GLN A 1 57   ? 120.826 107.942 35.466  1.00 6.13  ? 57   GLN A N     1 
ATOM   398   C  CA    . GLN A 1 57   ? 121.327 108.911 36.457  1.00 6.30  ? 57   GLN A CA    1 
ATOM   399   C  C     . GLN A 1 57   ? 121.070 108.446 37.898  1.00 5.56  ? 57   GLN A C     1 
ATOM   400   O  O     . GLN A 1 57   ? 121.897 108.654 38.784  1.00 4.44  ? 57   GLN A O     1 
ATOM   401   C  CB    . GLN A 1 57   ? 120.666 110.280 36.245  1.00 7.18  ? 57   GLN A CB    1 
ATOM   402   C  CG    . GLN A 1 57   ? 120.802 110.838 34.817  1.00 10.70 ? 57   GLN A CG    1 
ATOM   403   C  CD    . GLN A 1 57   ? 120.432 112.322 34.748  1.00 15.34 ? 57   GLN A CD    1 
ATOM   404   O  OE1   . GLN A 1 57   ? 119.271 112.668 34.490  1.00 18.27 ? 57   GLN A OE1   1 
ATOM   405   N  NE2   . GLN A 1 57   ? 121.414 113.198 34.999  1.00 16.57 ? 57   GLN A NE2   1 
ATOM   406   N  N     . TRP A 1 58   ? 119.895 107.848 38.118  1.00 4.91  ? 58   TRP A N     1 
ATOM   407   C  CA    . TRP A 1 58   ? 119.542 107.248 39.407  1.00 4.72  ? 58   TRP A CA    1 
ATOM   408   C  C     . TRP A 1 58   ? 120.500 106.117 39.777  1.00 4.46  ? 58   TRP A C     1 
ATOM   409   O  O     . TRP A 1 58   ? 120.972 106.043 40.914  1.00 3.47  ? 58   TRP A O     1 
ATOM   410   C  CB    . TRP A 1 58   ? 118.090 106.742 39.364  1.00 4.68  ? 58   TRP A CB    1 
ATOM   411   C  CG    . TRP A 1 58   ? 117.560 106.203 40.674  1.00 4.96  ? 58   TRP A CG    1 
ATOM   412   C  CD1   . TRP A 1 58   ? 116.842 106.891 41.616  1.00 4.34  ? 58   TRP A CD1   1 
ATOM   413   C  CD2   . TRP A 1 58   ? 117.682 104.863 41.165  1.00 3.96  ? 58   TRP A CD2   1 
ATOM   414   N  NE1   . TRP A 1 58   ? 116.520 106.059 42.665  1.00 3.44  ? 58   TRP A NE1   1 
ATOM   415   C  CE2   . TRP A 1 58   ? 117.019 104.809 42.412  1.00 4.85  ? 58   TRP A CE2   1 
ATOM   416   C  CE3   . TRP A 1 58   ? 118.286 103.695 40.679  1.00 6.12  ? 58   TRP A CE3   1 
ATOM   417   C  CZ2   . TRP A 1 58   ? 116.958 103.638 43.185  1.00 5.23  ? 58   TRP A CZ2   1 
ATOM   418   C  CZ3   . TRP A 1 58   ? 118.229 102.531 41.448  1.00 6.62  ? 58   TRP A CZ3   1 
ATOM   419   C  CH2   . TRP A 1 58   ? 117.560 102.513 42.685  1.00 5.65  ? 58   TRP A CH2   1 
ATOM   420   N  N     . PHE A 1 59   ? 120.793 105.241 38.818  1.00 4.07  ? 59   PHE A N     1 
ATOM   421   C  CA    . PHE A 1 59   ? 121.746 104.155 39.047  1.00 4.62  ? 59   PHE A CA    1 
ATOM   422   C  C     . PHE A 1 59   ? 123.168 104.677 39.306  1.00 4.72  ? 59   PHE A C     1 
ATOM   423   O  O     . PHE A 1 59   ? 123.902 104.150 40.146  1.00 4.42  ? 59   PHE A O     1 
ATOM   424   C  CB    . PHE A 1 59   ? 121.734 103.188 37.867  1.00 4.48  ? 59   PHE A CB    1 
ATOM   425   C  CG    . PHE A 1 59   ? 120.570 102.249 37.890  1.00 5.01  ? 59   PHE A CG    1 
ATOM   426   C  CD1   . PHE A 1 59   ? 119.355 102.620 37.324  1.00 5.36  ? 59   PHE A CD1   1 
ATOM   427   C  CD2   . PHE A 1 59   ? 120.684 101.001 38.502  1.00 4.24  ? 59   PHE A CD2   1 
ATOM   428   C  CE1   . PHE A 1 59   ? 118.262 101.766 37.371  1.00 5.46  ? 59   PHE A CE1   1 
ATOM   429   C  CE2   . PHE A 1 59   ? 119.617 100.133 38.540  1.00 4.97  ? 59   PHE A CE2   1 
ATOM   430   C  CZ    . PHE A 1 59   ? 118.392 100.516 37.977  1.00 5.63  ? 59   PHE A CZ    1 
ATOM   431   N  N     . ASN A 1 60   ? 123.536 105.725 38.582  1.00 4.97  ? 60   ASN A N     1 
ATOM   432   C  CA    . ASN A 1 60   ? 124.843 106.356 38.739  1.00 5.80  ? 60   ASN A CA    1 
ATOM   433   C  C     . ASN A 1 60   ? 125.075 106.962 40.122  1.00 5.25  ? 60   ASN A C     1 
ATOM   434   O  O     . ASN A 1 60   ? 126.135 106.783 40.732  1.00 5.05  ? 60   ASN A O     1 
ATOM   435   C  CB    . ASN A 1 60   ? 124.986 107.455 37.711  1.00 6.13  ? 60   ASN A CB    1 
ATOM   436   C  CG    . ASN A 1 60   ? 126.047 107.166 36.746  1.00 10.06 ? 60   ASN A CG    1 
ATOM   437   O  OD1   . ASN A 1 60   ? 125.772 106.660 35.651  1.00 14.44 ? 60   ASN A OD1   1 
ATOM   438   N  ND2   . ASN A 1 60   ? 127.304 107.450 37.135  1.00 11.85 ? 60   ASN A ND2   1 
ATOM   439   N  N     . THR A 1 61   ? 124.078 107.699 40.587  1.00 4.78  ? 61   THR A N     1 
ATOM   440   C  CA    . THR A 1 61   ? 124.117 108.338 41.899  1.00 4.79  ? 61   THR A CA    1 
ATOM   441   C  C     . THR A 1 61   ? 124.323 107.288 43.007  1.00 4.20  ? 61   THR A C     1 
ATOM   442   O  O     . THR A 1 61   ? 124.984 107.544 44.009  1.00 4.09  ? 61   THR A O     1 
ATOM   443   C  CB    . THR A 1 61   ? 122.803 109.115 42.074  1.00 4.80  ? 61   THR A CB    1 
ATOM   444   O  OG1   . THR A 1 61   ? 122.822 110.229 41.176  1.00 4.67  ? 61   THR A OG1   1 
ATOM   445   C  CG2   . THR A 1 61   ? 122.701 109.763 43.459  1.00 5.21  ? 61   THR A CG2   1 
ATOM   446   N  N     . ARG A 1 62   ? 123.760 106.104 42.796  1.00 3.92  ? 62   ARG A N     1 
ATOM   447   C  CA    . ARG A 1 62   ? 123.825 105.009 43.762  1.00 3.73  ? 62   ARG A CA    1 
ATOM   448   C  C     . ARG A 1 62   ? 124.994 104.033 43.573  1.00 3.67  ? 62   ARG A C     1 
ATOM   449   O  O     . ARG A 1 62   ? 125.111 103.048 44.307  1.00 3.38  ? 62   ARG A O     1 
ATOM   450   C  CB    . ARG A 1 62   ? 122.480 104.265 43.761  1.00 3.76  ? 62   ARG A CB    1 
ATOM   451   C  CG    . ARG A 1 62   ? 121.420 104.986 44.583  1.00 3.28  ? 62   ARG A CG    1 
ATOM   452   C  CD    . ARG A 1 62   ? 119.990 104.808 44.110  1.00 3.86  ? 62   ARG A CD    1 
ATOM   453   N  NE    . ARG A 1 62   ? 119.092 105.781 44.741  1.00 3.65  ? 62   ARG A NE    1 
ATOM   454   C  CZ    . ARG A 1 62   ? 118.937 107.046 44.342  1.00 5.30  ? 62   ARG A CZ    1 
ATOM   455   N  NH1   . ARG A 1 62   ? 119.606 107.518 43.283  1.00 4.24  ? 62   ARG A NH1   1 
ATOM   456   N  NH2   . ARG A 1 62   ? 118.101 107.844 44.997  1.00 3.62  ? 62   ARG A NH2   1 
ATOM   457   N  N     . ASN A 1 63   ? 125.855 104.302 42.593  1.00 3.80  ? 63   ASN A N     1 
ATOM   458   C  CA    . ASN A 1 63   ? 126.938 103.378 42.229  1.00 4.82  ? 63   ASN A CA    1 
ATOM   459   C  C     . ASN A 1 63   ? 126.412 101.964 41.968  1.00 5.14  ? 63   ASN A C     1 
ATOM   460   O  O     . ASN A 1 63   ? 127.030 100.972 42.343  1.00 4.87  ? 63   ASN A O     1 
ATOM   461   C  CB    . ASN A 1 63   ? 128.050 103.363 43.292  1.00 4.44  ? 63   ASN A CB    1 
ATOM   462   C  CG    . ASN A 1 63   ? 129.355 102.801 42.765  1.00 6.07  ? 63   ASN A CG    1 
ATOM   463   O  OD1   . ASN A 1 63   ? 129.790 103.143 41.663  1.00 7.39  ? 63   ASN A OD1   1 
ATOM   464   N  ND2   . ASN A 1 63   ? 129.990 101.937 43.552  1.00 5.46  ? 63   ASN A ND2   1 
ATOM   465   N  N     . LEU A 1 64   ? 125.249 101.890 41.330  1.00 6.42  ? 64   LEU A N     1 
ATOM   466   C  CA    . LEU A 1 64   ? 124.577 100.622 41.094  1.00 7.41  ? 64   LEU A CA    1 
ATOM   467   C  C     . LEU A 1 64   ? 124.675 100.222 39.627  1.00 7.95  ? 64   LEU A C     1 
ATOM   468   O  O     . LEU A 1 64   ? 124.595 101.080 38.740  1.00 7.94  ? 64   LEU A O     1 
ATOM   469   C  CB    . LEU A 1 64   ? 123.117 100.744 41.520  1.00 7.99  ? 64   LEU A CB    1 
ATOM   470   C  CG    . LEU A 1 64   ? 122.547 99.828  42.611  1.00 9.92  ? 64   LEU A CG    1 
ATOM   471   C  CD1   . LEU A 1 64   ? 123.451 99.658  43.824  1.00 11.57 ? 64   LEU A CD1   1 
ATOM   472   C  CD2   . LEU A 1 64   ? 121.154 100.291 43.027  1.00 12.14 ? 64   LEU A CD2   1 
ATOM   473   N  N     . PRO A 1 65   ? 124.876 98.934  39.356  1.00 8.55  ? 65   PRO A N     1 
ATOM   474   C  CA    . PRO A 1 65   ? 124.817 98.453  37.970  1.00 8.73  ? 65   PRO A CA    1 
ATOM   475   C  C     . PRO A 1 65   ? 123.379 98.491  37.453  1.00 8.54  ? 65   PRO A C     1 
ATOM   476   O  O     . PRO A 1 65   ? 122.433 98.090  38.150  1.00 8.67  ? 65   PRO A O     1 
ATOM   477   C  CB    . PRO A 1 65   ? 125.372 97.021  38.047  1.00 8.99  ? 65   PRO A CB    1 
ATOM   478   C  CG    . PRO A 1 65   ? 125.240 96.613  39.489  1.00 9.41  ? 65   PRO A CG    1 
ATOM   479   C  CD    . PRO A 1 65   ? 125.213 97.864  40.316  1.00 8.44  ? 65   PRO A CD    1 
ATOM   480   N  N     . MET A 1 66   ? 123.230 99.012  36.245  1.00 8.31  ? 66   MET A N     1 
ATOM   481   C  CA    . MET A 1 66   ? 121.941 99.074  35.585  1.00 8.70  ? 66   MET A CA    1 
ATOM   482   C  C     . MET A 1 66   ? 121.724 97.824  34.729  1.00 8.62  ? 66   MET A C     1 
ATOM   483   O  O     . MET A 1 66   ? 122.535 97.519  33.851  1.00 8.14  ? 66   MET A O     1 
ATOM   484   C  CB    . MET A 1 66   ? 121.844 100.337 34.738  1.00 8.69  ? 66   MET A CB    1 
ATOM   485   C  CG    . MET A 1 66   ? 120.419 100.751 34.472  1.00 9.69  ? 66   MET A CG    1 
ATOM   486   S  SD    . MET A 1 66   ? 120.186 102.133 33.360  1.00 11.26 ? 66   MET A SD    1 
ATOM   487   C  CE    . MET A 1 66   ? 121.848 102.446 32.832  1.00 13.82 ? 66   MET A CE    1 
ATOM   488   N  N     . PRO A 1 67   ? 120.645 97.089  35.001  1.00 8.66  ? 67   PRO A N     1 
ATOM   489   C  CA    . PRO A 1 67   ? 120.324 95.883  34.224  1.00 8.74  ? 67   PRO A CA    1 
ATOM   490   C  C     . PRO A 1 67   ? 119.965 96.247  32.786  1.00 8.68  ? 67   PRO A C     1 
ATOM   491   O  O     . PRO A 1 67   ? 119.570 97.389  32.533  1.00 7.88  ? 67   PRO A O     1 
ATOM   492   C  CB    . PRO A 1 67   ? 119.096 95.317  34.940  1.00 8.78  ? 67   PRO A CB    1 
ATOM   493   C  CG    . PRO A 1 67   ? 118.529 96.467  35.684  1.00 8.69  ? 67   PRO A CG    1 
ATOM   494   C  CD    . PRO A 1 67   ? 119.663 97.338  36.072  1.00 8.54  ? 67   PRO A CD    1 
ATOM   495   N  N     . ASP A 1 68   ? 120.105 95.288  31.873  1.00 8.81  ? 68   ASP A N     1 
ATOM   496   C  CA    . ASP A 1 68   ? 119.678 95.455  30.487  1.00 9.56  ? 68   ASP A CA    1 
ATOM   497   C  C     . ASP A 1 68   ? 118.206 95.843  30.453  1.00 9.42  ? 68   ASP A C     1 
ATOM   498   O  O     . ASP A 1 68   ? 117.473 95.553  31.396  1.00 9.14  ? 68   ASP A O     1 
ATOM   499   C  CB    . ASP A 1 68   ? 119.883 94.161  29.697  1.00 9.66  ? 68   ASP A CB    1 
ATOM   500   C  CG    . ASP A 1 68   ? 121.347 93.824  29.474  1.00 11.54 ? 68   ASP A CG    1 
ATOM   501   O  OD1   . ASP A 1 68   ? 122.238 94.628  29.837  1.00 12.53 ? 68   ASP A OD1   1 
ATOM   502   O  OD2   . ASP A 1 68   ? 121.707 92.756  28.930  1.00 13.83 ? 68   ASP A OD2   1 
ATOM   503   N  N     . GLY A 1 69   ? 117.783 96.489  29.364  1.00 10.25 ? 69   GLY A N     1 
ATOM   504   C  CA    . GLY A 1 69   ? 116.455 97.070  29.255  1.00 11.32 ? 69   GLY A CA    1 
ATOM   505   C  C     . GLY A 1 69   ? 115.305 96.119  29.517  1.00 11.88 ? 69   GLY A C     1 
ATOM   506   O  O     . GLY A 1 69   ? 114.355 96.450  30.247  1.00 12.55 ? 69   GLY A O     1 
ATOM   507   N  N     . ASP A 1 70   ? 115.394 94.927  28.942  1.00 12.32 ? 70   ASP A N     1 
ATOM   508   C  CA    . ASP A 1 70   ? 114.350 93.924  29.135  1.00 12.52 ? 70   ASP A CA    1 
ATOM   509   C  C     . ASP A 1 70   ? 114.471 93.226  30.494  1.00 11.25 ? 70   ASP A C     1 
ATOM   510   O  O     . ASP A 1 70   ? 113.675 92.344  30.796  1.00 11.33 ? 70   ASP A O     1 
ATOM   511   C  CB    . ASP A 1 70   ? 114.377 92.888  28.002  1.00 13.40 ? 70   ASP A CB    1 
ATOM   512   C  CG    . ASP A 1 70   ? 113.500 93.277  26.819  1.00 16.62 ? 70   ASP A CG    1 
ATOM   513   O  OD1   . ASP A 1 70   ? 112.623 94.167  26.969  1.00 20.91 ? 70   ASP A OD1   1 
ATOM   514   O  OD2   . ASP A 1 70   ? 113.613 92.728  25.687  1.00 20.65 ? 70   ASP A OD2   1 
ATOM   515   N  N     . ARG A 1 71   ? 115.459 93.613  31.303  1.00 9.79  ? 71   ARG A N     1 
ATOM   516   C  CA    . ARG A 1 71   ? 115.612 93.041  32.647  1.00 8.96  ? 71   ARG A CA    1 
ATOM   517   C  C     . ARG A 1 71   ? 115.246 93.983  33.805  1.00 8.09  ? 71   ARG A C     1 
ATOM   518   O  O     . ARG A 1 71   ? 115.233 93.561  34.968  1.00 7.94  ? 71   ARG A O     1 
ATOM   519   C  CB    . ARG A 1 71   ? 117.018 92.468  32.838  1.00 9.08  ? 71   ARG A CB    1 
ATOM   520   C  CG    . ARG A 1 71   ? 117.220 91.123  32.150  1.00 10.38 ? 71   ARG A CG    1 
ATOM   521   C  CD    . ARG A 1 71   ? 118.370 90.296  32.701  1.00 13.45 ? 71   ARG A CD    1 
ATOM   522   N  NE    . ARG A 1 71   ? 119.476 90.199  31.752  1.00 16.29 ? 71   ARG A NE    1 
ATOM   523   C  CZ    . ARG A 1 71   ? 120.621 89.537  31.978  1.00 18.00 ? 71   ARG A CZ    1 
ATOM   524   N  NH1   . ARG A 1 71   ? 120.829 88.905  33.136  1.00 17.62 ? 71   ARG A NH1   1 
ATOM   525   N  NH2   . ARG A 1 71   ? 121.572 89.518  31.047  1.00 18.78 ? 71   ARG A NH2   1 
ATOM   526   N  N     . LEU A 1 72   ? 114.961 95.246  33.485  1.00 6.64  ? 72   LEU A N     1 
ATOM   527   C  CA    . LEU A 1 72   ? 114.637 96.258  34.498  1.00 6.18  ? 72   LEU A CA    1 
ATOM   528   C  C     . LEU A 1 72   ? 113.137 96.552  34.527  1.00 5.46  ? 72   LEU A C     1 
ATOM   529   O  O     . LEU A 1 72   ? 112.587 97.135  33.579  1.00 5.02  ? 72   LEU A O     1 
ATOM   530   C  CB    . LEU A 1 72   ? 115.438 97.557  34.268  1.00 5.92  ? 72   LEU A CB    1 
ATOM   531   C  CG    . LEU A 1 72   ? 115.159 98.767  35.191  1.00 6.68  ? 72   LEU A CG    1 
ATOM   532   C  CD1   . LEU A 1 72   ? 115.474 98.445  36.661  1.00 5.19  ? 72   LEU A CD1   1 
ATOM   533   C  CD2   . LEU A 1 72   ? 115.935 100.026 34.728  1.00 5.54  ? 72   LEU A CD2   1 
ATOM   534   N  N     . GLY A 1 73   ? 112.479 96.146  35.608  1.00 4.27  ? 73   GLY A N     1 
ATOM   535   C  CA    . GLY A 1 73   ? 111.074 96.460  35.780  1.00 4.49  ? 73   GLY A CA    1 
ATOM   536   C  C     . GLY A 1 73   ? 110.922 97.825  36.425  1.00 4.60  ? 73   GLY A C     1 
ATOM   537   O  O     . GLY A 1 73   ? 111.634 98.128  37.362  1.00 4.49  ? 73   GLY A O     1 
ATOM   538   N  N     . VAL A 1 74   ? 110.007 98.650  35.929  1.00 4.53  ? 74   VAL A N     1 
ATOM   539   C  CA    . VAL A 1 74   ? 109.772 99.969  36.514  1.00 5.46  ? 74   VAL A CA    1 
ATOM   540   C  C     . VAL A 1 74   ? 108.287 100.112 36.823  1.00 5.44  ? 74   VAL A C     1 
ATOM   541   O  O     . VAL A 1 74   ? 107.426 99.876  35.955  1.00 5.68  ? 74   VAL A O     1 
ATOM   542   C  CB    . VAL A 1 74   ? 110.224 101.128 35.585  1.00 5.40  ? 74   VAL A CB    1 
ATOM   543   C  CG1   . VAL A 1 74   ? 110.092 102.483 36.294  1.00 5.36  ? 74   VAL A CG1   1 
ATOM   544   C  CG2   . VAL A 1 74   ? 111.653 100.909 35.099  1.00 6.67  ? 74   VAL A CG2   1 
ATOM   545   N  N     . GLY A 1 75   ? 107.989 100.465 38.068  1.00 5.18  ? 75   GLY A N     1 
ATOM   546   C  CA    . GLY A 1 75   ? 106.621 100.697 38.490  1.00 5.46  ? 75   GLY A CA    1 
ATOM   547   C  C     . GLY A 1 75   ? 106.407 102.162 38.794  1.00 6.10  ? 75   GLY A C     1 
ATOM   548   O  O     . GLY A 1 75   ? 107.126 102.742 39.606  1.00 7.25  ? 75   GLY A O     1 
ATOM   549   N  N     . MET A 1 76   ? 105.439 102.767 38.125  1.00 5.54  ? 76   MET A N     1 
ATOM   550   C  CA    . MET A 1 76   ? 105.078 104.148 38.354  1.00 5.01  ? 76   MET A CA    1 
ATOM   551   C  C     . MET A 1 76   ? 103.907 104.123 39.344  1.00 5.05  ? 76   MET A C     1 
ATOM   552   O  O     . MET A 1 76   ? 102.824 103.634 39.019  1.00 4.74  ? 76   MET A O     1 
ATOM   553   C  CB    . MET A 1 76   ? 104.700 104.788 37.008  1.00 5.26  ? 76   MET A CB    1 
ATOM   554   C  CG    . MET A 1 76   ? 104.258 106.242 37.080  1.00 5.59  ? 76   MET A CG    1 
ATOM   555   S  SD    . MET A 1 76   ? 105.558 107.329 37.682  1.00 7.35  ? 76   MET A SD    1 
ATOM   556   C  CE    . MET A 1 76   ? 105.042 108.910 36.972  1.00 6.02  ? 76   MET A CE    1 
ATOM   557   N  N     . VAL A 1 77   ? 104.130 104.630 40.556  1.00 4.61  ? 77   VAL A N     1 
ATOM   558   C  CA    . VAL A 1 77   ? 103.179 104.424 41.646  1.00 4.30  ? 77   VAL A CA    1 
ATOM   559   C  C     . VAL A 1 77   ? 102.689 105.736 42.261  1.00 4.09  ? 77   VAL A C     1 
ATOM   560   O  O     . VAL A 1 77   ? 103.481 106.615 42.588  1.00 3.56  ? 77   VAL A O     1 
ATOM   561   C  CB    . VAL A 1 77   ? 103.769 103.515 42.757  1.00 4.74  ? 77   VAL A CB    1 
ATOM   562   C  CG1   . VAL A 1 77   ? 102.685 103.098 43.751  1.00 3.94  ? 77   VAL A CG1   1 
ATOM   563   C  CG2   . VAL A 1 77   ? 104.471 102.271 42.147  1.00 5.24  ? 77   VAL A CG2   1 
ATOM   564   N  N     . PHE A 1 78   ? 101.371 105.858 42.392  1.00 4.03  ? 78   PHE A N     1 
ATOM   565   C  CA    . PHE A 1 78   ? 100.766 106.937 43.175  1.00 3.62  ? 78   PHE A CA    1 
ATOM   566   C  C     . PHE A 1 78   ? 100.649 106.426 44.605  1.00 3.34  ? 78   PHE A C     1 
ATOM   567   O  O     . PHE A 1 78   ? 100.010 105.387 44.838  1.00 2.91  ? 78   PHE A O     1 
ATOM   568   C  CB    . PHE A 1 78   ? 99.366  107.275 42.641  1.00 4.07  ? 78   PHE A CB    1 
ATOM   569   C  CG    . PHE A 1 78   ? 99.350  107.921 41.268  1.00 4.24  ? 78   PHE A CG    1 
ATOM   570   C  CD1   . PHE A 1 78   ? 98.151  108.013 40.560  1.00 3.62  ? 78   PHE A CD1   1 
ATOM   571   C  CD2   . PHE A 1 78   ? 100.508 108.456 40.698  1.00 5.49  ? 78   PHE A CD2   1 
ATOM   572   C  CE1   . PHE A 1 78   ? 98.108  108.616 39.301  1.00 3.31  ? 78   PHE A CE1   1 
ATOM   573   C  CE2   . PHE A 1 78   ? 100.485 109.063 39.439  1.00 4.54  ? 78   PHE A CE2   1 
ATOM   574   C  CZ    . PHE A 1 78   ? 99.280  109.145 38.739  1.00 4.42  ? 78   PHE A CZ    1 
ATOM   575   N  N     . LEU A 1 79   ? 101.232 107.159 45.556  1.00 2.57  ? 79   LEU A N     1 
ATOM   576   C  CA    . LEU A 1 79   ? 101.249 106.759 46.968  1.00 2.92  ? 79   LEU A CA    1 
ATOM   577   C  C     . LEU A 1 79   ? 100.608 107.819 47.876  1.00 2.68  ? 79   LEU A C     1 
ATOM   578   O  O     . LEU A 1 79   ? 100.468 108.976 47.474  1.00 2.61  ? 79   LEU A O     1 
ATOM   579   C  CB    . LEU A 1 79   ? 102.698 106.516 47.439  1.00 3.08  ? 79   LEU A CB    1 
ATOM   580   C  CG    . LEU A 1 79   ? 103.532 105.389 46.801  1.00 4.09  ? 79   LEU A CG    1 
ATOM   581   C  CD1   . LEU A 1 79   ? 105.030 105.676 46.904  1.00 4.09  ? 79   LEU A CD1   1 
ATOM   582   C  CD2   . LEU A 1 79   ? 103.211 104.050 47.431  1.00 4.01  ? 79   LEU A CD2   1 
ATOM   583   N  N     . PRO A 1 80   ? 100.225 107.438 49.100  1.00 2.78  ? 80   PRO A N     1 
ATOM   584   C  CA    . PRO A 1 80   ? 99.693  108.414 50.056  1.00 3.30  ? 80   PRO A CA    1 
ATOM   585   C  C     . PRO A 1 80   ? 100.664 109.545 50.343  1.00 3.41  ? 80   PRO A C     1 
ATOM   586   O  O     . PRO A 1 80   ? 101.867 109.308 50.441  1.00 3.66  ? 80   PRO A O     1 
ATOM   587   C  CB    . PRO A 1 80   ? 99.456  107.587 51.326  1.00 3.20  ? 80   PRO A CB    1 
ATOM   588   C  CG    . PRO A 1 80   ? 99.328  106.165 50.840  1.00 2.61  ? 80   PRO A CG    1 
ATOM   589   C  CD    . PRO A 1 80   ? 100.221 106.067 49.652  1.00 2.51  ? 80   PRO A CD    1 
ATOM   590   N  N     . GLN A 1 81   ? 100.132 110.759 50.481  1.00 3.85  ? 81   GLN A N     1 
ATOM   591   C  CA    . GLN A 1 81   ? 100.927 111.912 50.903  1.00 4.18  ? 81   GLN A CA    1 
ATOM   592   C  C     . GLN A 1 81   ? 101.392 111.808 52.346  1.00 4.05  ? 81   GLN A C     1 
ATOM   593   O  O     . GLN A 1 81   ? 102.554 112.122 52.639  1.00 3.73  ? 81   GLN A O     1 
ATOM   594   C  CB    . GLN A 1 81   ? 100.148 113.220 50.707  1.00 4.87  ? 81   GLN A CB    1 
ATOM   595   C  CG    . GLN A 1 81   ? 100.062 113.653 49.236  1.00 6.20  ? 81   GLN A CG    1 
ATOM   596   C  CD    . GLN A 1 81   ? 101.380 114.196 48.688  1.00 6.68  ? 81   GLN A CD    1 
ATOM   597   O  OE1   . GLN A 1 81   ? 102.326 114.407 49.432  1.00 6.85  ? 81   GLN A OE1   1 
ATOM   598   N  NE2   . GLN A 1 81   ? 101.430 114.433 47.381  1.00 8.41  ? 81   GLN A NE2   1 
ATOM   599   N  N     . GLU A 1 82   ? 100.513 111.351 53.242  1.00 3.44  ? 82   GLU A N     1 
ATOM   600   C  CA    . GLU A 1 82   ? 100.865 111.289 54.671  1.00 3.30  ? 82   GLU A CA    1 
ATOM   601   C  C     . GLU A 1 82   ? 101.984 110.262 54.879  1.00 3.54  ? 82   GLU A C     1 
ATOM   602   O  O     . GLU A 1 82   ? 101.827 109.088 54.514  1.00 3.29  ? 82   GLU A O     1 
ATOM   603   C  CB    . GLU A 1 82   ? 99.652  111.002 55.568  1.00 3.51  ? 82   GLU A CB    1 
ATOM   604   C  CG    . GLU A 1 82   ? 99.921  111.243 57.062  1.00 3.84  ? 82   GLU A CG    1 
ATOM   605   C  CD    . GLU A 1 82   ? 100.689 110.109 57.732  1.00 4.45  ? 82   GLU A CD    1 
ATOM   606   O  OE1   . GLU A 1 82   ? 100.239 108.957 57.602  1.00 6.05  ? 82   GLU A OE1   1 
ATOM   607   O  OE2   . GLU A 1 82   ? 101.733 110.362 58.388  1.00 3.88  ? 82   GLU A OE2   1 
ATOM   608   N  N     . PRO A 1 83   ? 103.131 110.713 55.393  1.00 3.53  ? 83   PRO A N     1 
ATOM   609   C  CA    . PRO A 1 83   ? 104.324 109.859 55.493  1.00 3.73  ? 83   PRO A CA    1 
ATOM   610   C  C     . PRO A 1 83   ? 104.138 108.478 56.120  1.00 3.87  ? 83   PRO A C     1 
ATOM   611   O  O     . PRO A 1 83   ? 104.711 107.524 55.585  1.00 3.66  ? 83   PRO A O     1 
ATOM   612   C  CB    . PRO A 1 83   ? 105.287 110.712 56.323  1.00 4.28  ? 83   PRO A CB    1 
ATOM   613   C  CG    . PRO A 1 83   ? 104.942 112.099 55.886  1.00 4.18  ? 83   PRO A CG    1 
ATOM   614   C  CD    . PRO A 1 83   ? 103.417 112.091 55.836  1.00 3.57  ? 83   PRO A CD    1 
ATOM   615   N  N     . SER A 1 84   ? 103.394 108.359 57.217  1.00 4.09  ? 84   SER A N     1 
ATOM   616   C  CA    . SER A 1 84   ? 103.250 107.051 57.851  1.00 4.48  ? 84   SER A CA    1 
ATOM   617   C  C     . SER A 1 84   ? 102.414 106.128 56.956  1.00 4.59  ? 84   SER A C     1 
ATOM   618   O  O     . SER A 1 84   ? 102.764 104.956 56.767  1.00 4.61  ? 84   SER A O     1 
ATOM   619   C  CB    . SER A 1 84   ? 102.718 107.160 59.296  1.00 4.66  ? 84   SER A CB    1 
ATOM   620   O  OG    . SER A 1 84   ? 101.303 107.174 59.350  1.00 6.65  ? 84   SER A OG    1 
ATOM   621   N  N     . ALA A 1 85   ? 101.352 106.666 56.360  1.00 4.41  ? 85   ALA A N     1 
ATOM   622   C  CA    . ALA A 1 85   ? 100.550 105.898 55.402  1.00 4.27  ? 85   ALA A CA    1 
ATOM   623   C  C     . ALA A 1 85   ? 101.354 105.528 54.150  1.00 4.33  ? 85   ALA A C     1 
ATOM   624   O  O     . ALA A 1 85   ? 101.220 104.426 53.616  1.00 4.30  ? 85   ALA A O     1 
ATOM   625   C  CB    . ALA A 1 85   ? 99.277  106.655 55.022  1.00 4.91  ? 85   ALA A CB    1 
ATOM   626   N  N     . ARG A 1 86   ? 102.195 106.453 53.694  1.00 3.84  ? 86   ARG A N     1 
ATOM   627   C  CA    . ARG A 1 86   ? 103.043 106.238 52.524  1.00 3.96  ? 86   ARG A CA    1 
ATOM   628   C  C     . ARG A 1 86   ? 103.990 105.044 52.712  1.00 4.06  ? 86   ARG A C     1 
ATOM   629   O  O     . ARG A 1 86   ? 104.274 104.305 51.755  1.00 4.05  ? 86   ARG A O     1 
ATOM   630   C  CB    . ARG A 1 86   ? 103.866 107.502 52.260  1.00 3.38  ? 86   ARG A CB    1 
ATOM   631   C  CG    . ARG A 1 86   ? 104.659 107.516 50.967  1.00 3.89  ? 86   ARG A CG    1 
ATOM   632   C  CD    . ARG A 1 86   ? 105.610 108.675 50.882  1.00 3.14  ? 86   ARG A CD    1 
ATOM   633   N  NE    . ARG A 1 86   ? 104.876 109.934 50.960  1.00 3.40  ? 86   ARG A NE    1 
ATOM   634   C  CZ    . ARG A 1 86   ? 105.440 111.131 50.894  1.00 4.48  ? 86   ARG A CZ    1 
ATOM   635   N  NH1   . ARG A 1 86   ? 106.760 111.244 50.747  1.00 3.48  ? 86   ARG A NH1   1 
ATOM   636   N  NH2   . ARG A 1 86   ? 104.684 112.217 50.988  1.00 2.69  ? 86   ARG A NH2   1 
ATOM   637   N  N     . GLU A 1 87   ? 104.489 104.878 53.930  1.00 4.12  ? 87   GLU A N     1 
ATOM   638   C  CA    . GLU A 1 87   ? 105.428 103.797 54.224  1.00 4.65  ? 87   GLU A CA    1 
ATOM   639   C  C     . GLU A 1 87   ? 104.739 102.439 54.322  1.00 4.08  ? 87   GLU A C     1 
ATOM   640   O  O     . GLU A 1 87   ? 105.310 101.437 53.902  1.00 4.30  ? 87   GLU A O     1 
ATOM   641   C  CB    . GLU A 1 87   ? 106.260 104.104 55.474  1.00 5.16  ? 87   GLU A CB    1 
ATOM   642   C  CG    . GLU A 1 87   ? 107.399 105.088 55.230  1.00 7.19  ? 87   GLU A CG    1 
ATOM   643   C  CD    . GLU A 1 87   ? 108.031 104.956 53.848  1.00 11.17 ? 87   GLU A CD    1 
ATOM   644   O  OE1   . GLU A 1 87   ? 108.622 103.880 53.557  1.00 12.04 ? 87   GLU A OE1   1 
ATOM   645   O  OE2   . GLU A 1 87   ? 107.944 105.928 53.054  1.00 10.85 ? 87   GLU A OE2   1 
ATOM   646   N  N     . VAL A 1 88   ? 103.508 102.411 54.841  1.00 3.41  ? 88   VAL A N     1 
ATOM   647   C  CA    . VAL A 1 88   ? 102.720 101.174 54.849  1.00 2.64  ? 88   VAL A CA    1 
ATOM   648   C  C     . VAL A 1 88   ? 102.449 100.742 53.403  1.00 2.31  ? 88   VAL A C     1 
ATOM   649   O  O     . VAL A 1 88   ? 102.563 99.561  53.068  1.00 1.54  ? 88   VAL A O     1 
ATOM   650   C  CB    . VAL A 1 88   ? 101.389 101.325 55.656  1.00 3.19  ? 88   VAL A CB    1 
ATOM   651   C  CG1   . VAL A 1 88   ? 100.425 100.170 55.370  1.00 1.88  ? 88   VAL A CG1   1 
ATOM   652   C  CG2   . VAL A 1 88   ? 101.679 101.423 57.171  1.00 3.10  ? 88   VAL A CG2   1 
ATOM   653   N  N     . ALA A 1 89   ? 102.135 101.705 52.544  1.00 1.62  ? 89   ALA A N     1 
ATOM   654   C  CA    . ALA A 1 89   ? 101.879 101.420 51.128  1.00 2.42  ? 89   ALA A CA    1 
ATOM   655   C  C     . ALA A 1 89   ? 103.123 100.903 50.404  1.00 1.97  ? 89   ALA A C     1 
ATOM   656   O  O     . ALA A 1 89   ? 103.054 99.915  49.674  1.00 2.01  ? 89   ALA A O     1 
ATOM   657   C  CB    . ALA A 1 89   ? 101.311 102.651 50.412  1.00 2.03  ? 89   ALA A CB    1 
ATOM   658   N  N     . ARG A 1 90   ? 104.242 101.590 50.603  1.00 2.05  ? 90   ARG A N     1 
ATOM   659   C  CA    . ARG A 1 90   ? 105.525 101.179 50.037  1.00 2.46  ? 90   ARG A CA    1 
ATOM   660   C  C     . ARG A 1 90   ? 105.906 99.748  50.455  1.00 2.28  ? 90   ARG A C     1 
ATOM   661   O  O     . ARG A 1 90   ? 106.357 98.952  49.636  1.00 2.08  ? 90   ARG A O     1 
ATOM   662   C  CB    . ARG A 1 90   ? 106.627 102.150 50.477  1.00 2.20  ? 90   ARG A CB    1 
ATOM   663   C  CG    . ARG A 1 90   ? 107.997 101.869 49.840  1.00 3.35  ? 90   ARG A CG    1 
ATOM   664   C  CD    . ARG A 1 90   ? 109.175 102.664 50.454  1.00 6.39  ? 90   ARG A CD    1 
ATOM   665   N  NE    . ARG A 1 90   ? 108.853 104.082 50.659  1.00 8.94  ? 90   ARG A NE    1 
ATOM   666   C  CZ    . ARG A 1 90   ? 108.812 104.989 49.692  1.00 7.57  ? 90   ARG A CZ    1 
ATOM   667   N  NH1   . ARG A 1 90   ? 109.092 104.633 48.449  1.00 8.64  ? 90   ARG A NH1   1 
ATOM   668   N  NH2   . ARG A 1 90   ? 108.512 106.257 49.970  1.00 9.58  ? 90   ARG A NH2   1 
ATOM   669   N  N     . ALA A 1 91   ? 105.752 99.453  51.744  1.00 2.55  ? 91   ALA A N     1 
ATOM   670   C  CA    . ALA A 1 91   ? 106.080 98.139  52.284  1.00 2.77  ? 91   ALA A CA    1 
ATOM   671   C  C     . ALA A 1 91   ? 105.206 97.066  51.614  1.00 2.95  ? 91   ALA A C     1 
ATOM   672   O  O     . ALA A 1 91   ? 105.666 95.958  51.364  1.00 3.08  ? 91   ALA A O     1 
ATOM   673   C  CB    . ALA A 1 91   ? 105.902 98.118  53.780  1.00 2.55  ? 91   ALA A CB    1 
ATOM   674   N  N     . TYR A 1 92   ? 103.957 97.404  51.324  1.00 3.42  ? 92   TYR A N     1 
ATOM   675   C  CA    . TYR A 1 92   ? 103.057 96.455  50.663  1.00 4.24  ? 92   TYR A CA    1 
ATOM   676   C  C     . TYR A 1 92   ? 103.493 96.167  49.223  1.00 3.99  ? 92   TYR A C     1 
ATOM   677   O  O     . TYR A 1 92   ? 103.556 95.008  48.828  1.00 4.68  ? 92   TYR A O     1 
ATOM   678   C  CB    . TYR A 1 92   ? 101.582 96.890  50.705  1.00 4.34  ? 92   TYR A CB    1 
ATOM   679   C  CG    . TYR A 1 92   ? 100.673 95.756  50.281  1.00 5.91  ? 92   TYR A CG    1 
ATOM   680   C  CD1   . TYR A 1 92   ? 100.519 94.628  51.091  1.00 8.55  ? 92   TYR A CD1   1 
ATOM   681   C  CD2   . TYR A 1 92   ? 99.990  95.791  49.063  1.00 7.08  ? 92   TYR A CD2   1 
ATOM   682   C  CE1   . TYR A 1 92   ? 99.709  93.555  50.694  1.00 9.42  ? 92   TYR A CE1   1 
ATOM   683   C  CE2   . TYR A 1 92   ? 99.167  94.718  48.659  1.00 8.06  ? 92   TYR A CE2   1 
ATOM   684   C  CZ    . TYR A 1 92   ? 99.041  93.610  49.483  1.00 10.59 ? 92   TYR A CZ    1 
ATOM   685   O  OH    . TYR A 1 92   ? 98.237  92.544  49.117  1.00 13.87 ? 92   TYR A OH    1 
ATOM   686   N  N     . VAL A 1 93   ? 103.800 97.211  48.456  1.00 3.58  ? 93   VAL A N     1 
ATOM   687   C  CA    . VAL A 1 93   ? 104.320 97.043  47.093  1.00 3.68  ? 93   VAL A CA    1 
ATOM   688   C  C     . VAL A 1 93   ? 105.547 96.116  47.096  1.00 3.69  ? 93   VAL A C     1 
ATOM   689   O  O     . VAL A 1 93   ? 105.591 95.125  46.357  1.00 3.00  ? 93   VAL A O     1 
ATOM   690   C  CB    . VAL A 1 93   ? 104.661 98.415  46.415  1.00 3.82  ? 93   VAL A CB    1 
ATOM   691   C  CG1   . VAL A 1 93   ? 105.363 98.213  45.065  1.00 4.12  ? 93   VAL A CG1   1 
ATOM   692   C  CG2   . VAL A 1 93   ? 103.402 99.260  46.228  1.00 3.31  ? 93   VAL A CG2   1 
ATOM   693   N  N     . GLU A 1 94   ? 106.522 96.420  47.950  1.00 3.17  ? 94   GLU A N     1 
ATOM   694   C  CA    . GLU A 1 94   ? 107.721 95.580  48.064  1.00 3.47  ? 94   GLU A CA    1 
ATOM   695   C  C     . GLU A 1 94   ? 107.423 94.133  48.458  1.00 3.46  ? 94   GLU A C     1 
ATOM   696   O  O     . GLU A 1 94   ? 108.044 93.199  47.931  1.00 2.52  ? 94   GLU A O     1 
ATOM   697   C  CB    . GLU A 1 94   ? 108.730 96.201  49.034  1.00 3.24  ? 94   GLU A CB    1 
ATOM   698   C  CG    . GLU A 1 94   ? 109.251 97.545  48.527  1.00 3.98  ? 94   GLU A CG    1 
ATOM   699   C  CD    . GLU A 1 94   ? 110.438 98.065  49.309  1.00 7.49  ? 94   GLU A CD    1 
ATOM   700   O  OE1   . GLU A 1 94   ? 110.953 97.340  50.200  1.00 8.41  ? 94   GLU A OE1   1 
ATOM   701   O  OE2   . GLU A 1 94   ? 110.866 99.206  49.017  1.00 8.27  ? 94   GLU A OE2   1 
ATOM   702   N  N     . GLU A 1 95   ? 106.477 93.961  49.379  1.00 3.75  ? 95   GLU A N     1 
ATOM   703   C  CA    . GLU A 1 95   ? 106.047 92.636  49.819  1.00 4.71  ? 95   GLU A CA    1 
ATOM   704   C  C     . GLU A 1 95   ? 105.528 91.770  48.656  1.00 4.63  ? 95   GLU A C     1 
ATOM   705   O  O     . GLU A 1 95   ? 105.941 90.613  48.503  1.00 4.34  ? 95   GLU A O     1 
ATOM   706   C  CB    . GLU A 1 95   ? 104.979 92.743  50.911  1.00 4.92  ? 95   GLU A CB    1 
ATOM   707   C  CG    . GLU A 1 95   ? 104.666 91.405  51.557  1.00 7.19  ? 95   GLU A CG    1 
ATOM   708   C  CD    . GLU A 1 95   ? 103.565 91.467  52.601  1.00 10.54 ? 95   GLU A CD    1 
ATOM   709   O  OE1   . GLU A 1 95   ? 103.306 90.417  53.236  1.00 11.18 ? 95   GLU A OE1   1 
ATOM   710   O  OE2   . GLU A 1 95   ? 102.973 92.553  52.793  1.00 11.46 ? 95   GLU A OE2   1 
ATOM   711   N  N     . VAL A 1 96   ? 104.631 92.310  47.837  1.00 4.99  ? 96   VAL A N     1 
ATOM   712   C  CA    . VAL A 1 96   ? 104.152 91.499  46.716  1.00 4.69  ? 96   VAL A CA    1 
ATOM   713   C  C     . VAL A 1 96   ? 105.204 91.278  45.607  1.00 4.78  ? 96   VAL A C     1 
ATOM   714   O  O     . VAL A 1 96   ? 105.263 90.191  45.034  1.00 4.93  ? 96   VAL A O     1 
ATOM   715   C  CB    . VAL A 1 96   ? 102.686 91.802  46.213  1.00 5.35  ? 96   VAL A CB    1 
ATOM   716   C  CG1   . VAL A 1 96   ? 101.948 92.816  47.078  1.00 4.88  ? 96   VAL A CG1   1 
ATOM   717   C  CG2   . VAL A 1 96   ? 102.609 92.080  44.706  1.00 3.96  ? 96   VAL A CG2   1 
ATOM   718   N  N     . VAL A 1 97   ? 106.041 92.287  45.347  1.00 3.98  ? 97   VAL A N     1 
ATOM   719   C  CA    . VAL A 1 97   ? 107.166 92.140  44.407  1.00 4.00  ? 97   VAL A CA    1 
ATOM   720   C  C     . VAL A 1 97   ? 108.077 90.949  44.818  1.00 4.08  ? 97   VAL A C     1 
ATOM   721   O  O     . VAL A 1 97   ? 108.480 90.132  43.964  1.00 3.83  ? 97   VAL A O     1 
ATOM   722   C  CB    . VAL A 1 97   ? 107.984 93.467  44.238  1.00 4.01  ? 97   VAL A CB    1 
ATOM   723   C  CG1   . VAL A 1 97   ? 109.224 93.230  43.416  1.00 3.60  ? 97   VAL A CG1   1 
ATOM   724   C  CG2   . VAL A 1 97   ? 107.142 94.578  43.574  1.00 3.27  ? 97   VAL A CG2   1 
ATOM   725   N  N     . ARG A 1 98   ? 108.360 90.836  46.118  1.00 3.66  ? 98   ARG A N     1 
ATOM   726   C  CA    . ARG A 1 98   ? 109.155 89.733  46.663  1.00 4.23  ? 98   ARG A CA    1 
ATOM   727   C  C     . ARG A 1 98   ? 108.464 88.369  46.515  1.00 4.73  ? 98   ARG A C     1 
ATOM   728   O  O     . ARG A 1 98   ? 109.127 87.350  46.283  1.00 4.18  ? 98   ARG A O     1 
ATOM   729   C  CB    . ARG A 1 98   ? 109.461 89.973  48.149  1.00 4.19  ? 98   ARG A CB    1 
ATOM   730   C  CG    . ARG A 1 98   ? 110.720 90.740  48.434  1.00 4.39  ? 98   ARG A CG    1 
ATOM   731   C  CD    . ARG A 1 98   ? 110.995 90.866  49.914  1.00 6.95  ? 98   ARG A CD    1 
ATOM   732   N  NE    . ARG A 1 98   ? 110.848 92.254  50.329  1.00 12.47 ? 98   ARG A NE    1 
ATOM   733   C  CZ    . ARG A 1 98   ? 109.941 92.718  51.179  1.00 11.09 ? 98   ARG A CZ    1 
ATOM   734   N  NH1   . ARG A 1 98   ? 109.063 91.911  51.776  1.00 9.20  ? 98   ARG A NH1   1 
ATOM   735   N  NH2   . ARG A 1 98   ? 109.940 94.010  51.451  1.00 13.15 ? 98   ARG A NH2   1 
ATOM   736   N  N     . LEU A 1 99   ? 107.141 88.359  46.674  1.00 5.47  ? 99   LEU A N     1 
ATOM   737   C  CA    . LEU A 1 99   ? 106.339 87.145  46.516  1.00 6.64  ? 99   LEU A CA    1 
ATOM   738   C  C     . LEU A 1 99   ? 106.356 86.627  45.073  1.00 6.76  ? 99   LEU A C     1 
ATOM   739   O  O     . LEU A 1 99   ? 106.124 85.441  44.842  1.00 6.53  ? 99   LEU A O     1 
ATOM   740   C  CB    . LEU A 1 99   ? 104.894 87.397  46.961  1.00 6.95  ? 99   LEU A CB    1 
ATOM   741   C  CG    . LEU A 1 99   ? 104.415 86.847  48.318  1.00 9.11  ? 99   LEU A CG    1 
ATOM   742   C  CD1   . LEU A 1 99   ? 105.393 85.895  49.012  1.00 8.59  ? 99   LEU A CD1   1 
ATOM   743   C  CD2   . LEU A 1 99   ? 103.984 87.949  49.259  1.00 9.67  ? 99   LEU A CD2   1 
ATOM   744   N  N     . GLU A 1 100  ? 106.619 87.519  44.116  1.00 6.74  ? 100  GLU A N     1 
ATOM   745   C  CA    . GLU A 1 100  ? 106.837 87.130  42.716  1.00 7.46  ? 100  GLU A CA    1 
ATOM   746   C  C     . GLU A 1 100  ? 108.297 86.780  42.399  1.00 7.39  ? 100  GLU A C     1 
ATOM   747   O  O     . GLU A 1 100  ? 108.675 86.700  41.219  1.00 6.78  ? 100  GLU A O     1 
ATOM   748   C  CB    . GLU A 1 100  ? 106.356 88.231  41.768  1.00 7.87  ? 100  GLU A CB    1 
ATOM   749   C  CG    . GLU A 1 100  ? 104.834 88.400  41.736  1.00 10.17 ? 100  GLU A CG    1 
ATOM   750   C  CD    . GLU A 1 100  ? 104.106 87.083  41.492  1.00 13.16 ? 100  GLU A CD    1 
ATOM   751   O  OE1   . GLU A 1 100  ? 103.279 86.675  42.342  1.00 12.65 ? 100  GLU A OE1   1 
ATOM   752   O  OE2   . GLU A 1 100  ? 104.384 86.450  40.445  1.00 16.51 ? 100  GLU A OE2   1 
ATOM   753   N  N     . LYS A 1 101  ? 109.096 86.605  43.456  1.00 7.31  ? 101  LYS A N     1 
ATOM   754   C  CA    . LYS A 1 101  ? 110.530 86.274  43.385  1.00 7.84  ? 101  LYS A CA    1 
ATOM   755   C  C     . LYS A 1 101  ? 111.380 87.351  42.706  1.00 7.60  ? 101  LYS A C     1 
ATOM   756   O  O     . LYS A 1 101  ? 112.466 87.074  42.191  1.00 8.78  ? 101  LYS A O     1 
ATOM   757   C  CB    . LYS A 1 101  ? 110.768 84.901  42.738  1.00 8.14  ? 101  LYS A CB    1 
ATOM   758   C  CG    . LYS A 1 101  ? 110.142 83.738  43.487  1.00 10.10 ? 101  LYS A CG    1 
ATOM   759   C  CD    . LYS A 1 101  ? 109.914 82.553  42.542  1.00 14.79 ? 101  LYS A CD    1 
ATOM   760   C  CE    . LYS A 1 101  ? 110.603 81.298  43.069  1.00 16.23 ? 101  LYS A CE    1 
ATOM   761   N  NZ    . LYS A 1 101  ? 110.492 80.144  42.117  1.00 18.23 ? 101  LYS A NZ    1 
ATOM   762   N  N     . LEU A 1 102  ? 110.892 88.582  42.707  1.00 6.52  ? 102  LEU A N     1 
ATOM   763   C  CA    . LEU A 1 102  ? 111.667 89.691  42.175  1.00 5.47  ? 102  LEU A CA    1 
ATOM   764   C  C     . LEU A 1 102  ? 112.390 90.436  43.289  1.00 5.36  ? 102  LEU A C     1 
ATOM   765   O  O     . LEU A 1 102  ? 112.021 90.324  44.458  1.00 4.95  ? 102  LEU A O     1 
ATOM   766   C  CB    . LEU A 1 102  ? 110.752 90.636  41.412  1.00 5.40  ? 102  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1 102  ? 109.948 89.955  40.311  1.00 5.24  ? 102  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1 102  ? 108.965 90.950  39.738  1.00 5.90  ? 102  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1 102  ? 110.903 89.392  39.251  1.00 2.54  ? 102  LEU A CD2   1 
ATOM   770   N  N     . THR A 1 103  ? 113.411 91.194  42.904  1.00 5.10  ? 103  THR A N     1 
ATOM   771   C  CA    . THR A 1 103  ? 114.253 91.969  43.826  1.00 5.35  ? 103  THR A CA    1 
ATOM   772   C  C     . THR A 1 103  ? 113.969 93.467  43.684  1.00 4.15  ? 103  THR A C     1 
ATOM   773   O  O     . THR A 1 103  ? 113.951 93.992  42.566  1.00 3.33  ? 103  THR A O     1 
ATOM   774   C  CB    . THR A 1 103  ? 115.739 91.693  43.507  1.00 4.87  ? 103  THR A CB    1 
ATOM   775   O  OG1   . THR A 1 103  ? 116.034 90.329  43.814  1.00 9.80  ? 103  THR A OG1   1 
ATOM   776   C  CG2   . THR A 1 103  ? 116.667 92.452  44.464  1.00 6.85  ? 103  THR A CG2   1 
ATOM   777   N  N     . VAL A 1 104  ? 113.753 94.145  44.806  1.00 3.26  ? 104  VAL A N     1 
ATOM   778   C  CA    . VAL A 1 104  ? 113.611 95.596  44.799  1.00 2.85  ? 104  VAL A CA    1 
ATOM   779   C  C     . VAL A 1 104  ? 114.986 96.262  44.845  1.00 2.74  ? 104  VAL A C     1 
ATOM   780   O  O     . VAL A 1 104  ? 115.738 96.096  45.825  1.00 1.45  ? 104  VAL A O     1 
ATOM   781   C  CB    . VAL A 1 104  ? 112.725 96.112  45.962  1.00 3.28  ? 104  VAL A CB    1 
ATOM   782   C  CG1   . VAL A 1 104  ? 112.598 97.640  45.900  1.00 3.35  ? 104  VAL A CG1   1 
ATOM   783   C  CG2   . VAL A 1 104  ? 111.344 95.478  45.903  1.00 2.74  ? 104  VAL A CG2   1 
ATOM   784   N  N     . LEU A 1 105  ? 115.305 97.012  43.786  1.00 2.24  ? 105  LEU A N     1 
ATOM   785   C  CA    . LEU A 1 105  ? 116.560 97.776  43.730  1.00 2.99  ? 105  LEU A CA    1 
ATOM   786   C  C     . LEU A 1 105  ? 116.501 99.070  44.533  1.00 3.07  ? 105  LEU A C     1 
ATOM   787   O  O     . LEU A 1 105  ? 117.513 99.525  45.085  1.00 3.02  ? 105  LEU A O     1 
ATOM   788   C  CB    . LEU A 1 105  ? 116.951 98.082  42.280  1.00 3.38  ? 105  LEU A CB    1 
ATOM   789   C  CG    . LEU A 1 105  ? 117.348 96.887  41.406  1.00 4.61  ? 105  LEU A CG    1 
ATOM   790   C  CD1   . LEU A 1 105  ? 117.703 97.349  39.994  1.00 7.11  ? 105  LEU A CD1   1 
ATOM   791   C  CD2   . LEU A 1 105  ? 118.516 96.096  42.010  1.00 4.36  ? 105  LEU A CD2   1 
ATOM   792   N  N     . GLY A 1 106  ? 115.315 99.663  44.602  1.00 2.66  ? 106  GLY A N     1 
ATOM   793   C  CA    . GLY A 1 106  ? 115.152 100.956 45.248  1.00 2.50  ? 106  GLY A CA    1 
ATOM   794   C  C     . GLY A 1 106  ? 113.976 101.704 44.666  1.00 2.88  ? 106  GLY A C     1 
ATOM   795   O  O     . GLY A 1 106  ? 113.255 101.158 43.836  1.00 2.89  ? 106  GLY A O     1 
ATOM   796   N  N     . TRP A 1 107  ? 113.809 102.956 45.086  1.00 3.12  ? 107  TRP A N     1 
ATOM   797   C  CA    . TRP A 1 107  ? 112.741 103.821 44.611  1.00 3.24  ? 107  TRP A CA    1 
ATOM   798   C  C     . TRP A 1 107  ? 113.319 105.135 44.095  1.00 3.55  ? 107  TRP A C     1 
ATOM   799   O  O     . TRP A 1 107  ? 114.311 105.623 44.610  1.00 4.01  ? 107  TRP A O     1 
ATOM   800   C  CB    . TRP A 1 107  ? 111.753 104.140 45.740  1.00 3.33  ? 107  TRP A CB    1 
ATOM   801   C  CG    . TRP A 1 107  ? 110.910 103.001 46.202  1.00 2.83  ? 107  TRP A CG    1 
ATOM   802   C  CD1   . TRP A 1 107  ? 111.289 101.993 47.032  1.00 2.02  ? 107  TRP A CD1   1 
ATOM   803   C  CD2   . TRP A 1 107  ? 109.527 102.768 45.892  1.00 2.81  ? 107  TRP A CD2   1 
ATOM   804   N  NE1   . TRP A 1 107  ? 110.233 101.143 47.255  1.00 2.04  ? 107  TRP A NE1   1 
ATOM   805   C  CE2   . TRP A 1 107  ? 109.143 101.588 46.554  1.00 1.91  ? 107  TRP A CE2   1 
ATOM   806   C  CE3   . TRP A 1 107  ? 108.579 103.428 45.093  1.00 2.67  ? 107  TRP A CE3   1 
ATOM   807   C  CZ2   . TRP A 1 107  ? 107.848 101.052 46.461  1.00 1.39  ? 107  TRP A CZ2   1 
ATOM   808   C  CZ3   . TRP A 1 107  ? 107.291 102.906 45.004  1.00 4.31  ? 107  TRP A CZ3   1 
ATOM   809   C  CH2   . TRP A 1 107  ? 106.939 101.724 45.682  1.00 3.27  ? 107  TRP A CH2   1 
ATOM   810   N  N     . ARG A 1 108  ? 112.680 105.704 43.085  1.00 4.01  ? 108  ARG A N     1 
ATOM   811   C  CA    . ARG A 1 108  ? 113.053 107.009 42.545  1.00 4.32  ? 108  ARG A CA    1 
ATOM   812   C  C     . ARG A 1 108  ? 111.936 108.007 42.847  1.00 4.48  ? 108  ARG A C     1 
ATOM   813   O  O     . ARG A 1 108  ? 110.777 107.781 42.452  1.00 4.69  ? 108  ARG A O     1 
ATOM   814   C  CB    . ARG A 1 108  ? 113.285 106.879 41.023  1.00 4.26  ? 108  ARG A CB    1 
ATOM   815   C  CG    . ARG A 1 108  ? 113.739 108.147 40.315  1.00 4.16  ? 108  ARG A CG    1 
ATOM   816   C  CD    . ARG A 1 108  ? 113.958 107.988 38.794  1.00 5.35  ? 108  ARG A CD    1 
ATOM   817   N  NE    . ARG A 1 108  ? 114.304 109.285 38.211  1.00 4.49  ? 108  ARG A NE    1 
ATOM   818   C  CZ    . ARG A 1 108  ? 113.452 110.090 37.592  1.00 3.47  ? 108  ARG A CZ    1 
ATOM   819   N  NH1   . ARG A 1 108  ? 112.188 109.725 37.401  1.00 3.18  ? 108  ARG A NH1   1 
ATOM   820   N  NH2   . ARG A 1 108  ? 113.869 111.263 37.153  1.00 1.51  ? 108  ARG A NH2   1 
ATOM   821   N  N     . GLU A 1 109  ? 112.251 109.109 43.535  1.00 4.67  ? 109  GLU A N     1 
ATOM   822   C  CA    . GLU A 1 109  ? 111.256 110.186 43.661  1.00 6.23  ? 109  GLU A CA    1 
ATOM   823   C  C     . GLU A 1 109  ? 111.075 110.882 42.302  1.00 6.20  ? 109  GLU A C     1 
ATOM   824   O  O     . GLU A 1 109  ? 112.023 111.412 41.737  1.00 6.08  ? 109  GLU A O     1 
ATOM   825   C  CB    . GLU A 1 109  ? 111.599 111.202 44.772  1.00 6.75  ? 109  GLU A CB    1 
ATOM   826   C  CG    . GLU A 1 109  ? 110.376 112.039 45.205  1.00 11.24 ? 109  GLU A CG    1 
ATOM   827   C  CD    . GLU A 1 109  ? 110.572 112.917 46.454  1.00 16.38 ? 109  GLU A CD    1 
ATOM   828   O  OE1   . GLU A 1 109  ? 109.892 113.977 46.533  1.00 17.61 ? 109  GLU A OE1   1 
ATOM   829   O  OE2   . GLU A 1 109  ? 111.368 112.562 47.369  1.00 17.26 ? 109  GLU A OE2   1 
ATOM   830   N  N     . VAL A 1 110  ? 109.859 110.867 41.776  1.00 5.81  ? 110  VAL A N     1 
ATOM   831   C  CA    . VAL A 1 110  ? 109.571 111.528 40.501  1.00 5.85  ? 110  VAL A CA    1 
ATOM   832   C  C     . VAL A 1 110  ? 109.539 113.062 40.672  1.00 6.09  ? 110  VAL A C     1 
ATOM   833   O  O     . VAL A 1 110  ? 108.772 113.577 41.490  1.00 6.39  ? 110  VAL A O     1 
ATOM   834   C  CB    . VAL A 1 110  ? 108.256 110.992 39.892  1.00 6.18  ? 110  VAL A CB    1 
ATOM   835   C  CG1   . VAL A 1 110  ? 107.936 111.693 38.582  1.00 5.88  ? 110  VAL A CG1   1 
ATOM   836   C  CG2   . VAL A 1 110  ? 108.367 109.470 39.659  1.00 4.97  ? 110  VAL A CG2   1 
ATOM   837   N  N     . PRO A 1 111  ? 110.358 113.782 39.898  1.00 5.97  ? 111  PRO A N     1 
ATOM   838   C  CA    . PRO A 1 111  ? 110.447 115.241 40.022  1.00 6.10  ? 111  PRO A CA    1 
ATOM   839   C  C     . PRO A 1 111  ? 109.223 115.915 39.426  1.00 6.12  ? 111  PRO A C     1 
ATOM   840   O  O     . PRO A 1 111  ? 108.920 115.734 38.231  1.00 5.91  ? 111  PRO A O     1 
ATOM   841   C  CB    . PRO A 1 111  ? 111.718 115.620 39.221  1.00 6.33  ? 111  PRO A CB    1 
ATOM   842   C  CG    . PRO A 1 111  ? 112.147 114.395 38.476  1.00 6.54  ? 111  PRO A CG    1 
ATOM   843   C  CD    . PRO A 1 111  ? 111.247 113.248 38.844  1.00 5.50  ? 111  PRO A CD    1 
ATOM   844   N  N     . VAL A 1 112  ? 108.521 116.671 40.259  1.00 5.54  ? 112  VAL A N     1 
ATOM   845   C  CA    . VAL A 1 112  ? 107.310 117.344 39.826  1.00 5.90  ? 112  VAL A CA    1 
ATOM   846   C  C     . VAL A 1 112  ? 107.298 118.790 40.285  1.00 6.38  ? 112  VAL A C     1 
ATOM   847   O  O     . VAL A 1 112  ? 108.037 119.154 41.217  1.00 6.02  ? 112  VAL A O     1 
ATOM   848   C  CB    . VAL A 1 112  ? 106.025 116.606 40.298  1.00 6.54  ? 112  VAL A CB    1 
ATOM   849   C  CG1   . VAL A 1 112  ? 106.053 115.119 39.850  1.00 5.31  ? 112  VAL A CG1   1 
ATOM   850   C  CG2   . VAL A 1 112  ? 105.775 116.761 41.818  1.00 5.21  ? 112  VAL A CG2   1 
ATOM   851   N  N     . ASN A 1 113  ? 106.481 119.602 39.616  1.00 6.17  ? 113  ASN A N     1 
ATOM   852   C  CA    . ASN A 1 113  ? 106.198 120.961 40.069  1.00 7.18  ? 113  ASN A CA    1 
ATOM   853   C  C     . ASN A 1 113  ? 104.713 121.115 40.399  1.00 6.66  ? 113  ASN A C     1 
ATOM   854   O  O     . ASN A 1 113  ? 103.915 121.455 39.528  1.00 6.25  ? 113  ASN A O     1 
ATOM   855   C  CB    . ASN A 1 113  ? 106.633 121.990 39.015  1.00 7.20  ? 113  ASN A CB    1 
ATOM   856   C  CG    . ASN A 1 113  ? 106.377 123.424 39.456  1.00 8.78  ? 113  ASN A CG    1 
ATOM   857   O  OD1   . ASN A 1 113  ? 105.995 123.683 40.606  1.00 9.50  ? 113  ASN A OD1   1 
ATOM   858   N  ND2   . ASN A 1 113  ? 106.594 124.370 38.543  1.00 8.70  ? 113  ASN A ND2   1 
ATOM   859   N  N     . SER A 1 114  ? 104.358 120.877 41.660  1.00 6.81  ? 114  SER A N     1 
ATOM   860   C  CA    . SER A 1 114  ? 102.961 120.943 42.131  1.00 7.29  ? 114  SER A CA    1 
ATOM   861   C  C     . SER A 1 114  ? 102.323 122.332 42.016  1.00 7.55  ? 114  SER A C     1 
ATOM   862   O  O     . SER A 1 114  ? 101.099 122.467 42.052  1.00 6.76  ? 114  SER A O     1 
ATOM   863   C  CB    . SER A 1 114  ? 102.862 120.437 43.587  1.00 7.52  ? 114  SER A CB    1 
ATOM   864   O  OG    . SER A 1 114  ? 103.257 119.071 43.698  1.00 8.87  ? 114  SER A OG    1 
ATOM   865   N  N     . ASP A 1 115  ? 103.146 123.368 41.883  1.00 8.10  ? 115  ASP A N     1 
ATOM   866   C  CA    . ASP A 1 115  ? 102.613 124.729 41.795  1.00 9.09  ? 115  ASP A CA    1 
ATOM   867   C  C     . ASP A 1 115  ? 101.973 125.073 40.445  1.00 8.77  ? 115  ASP A C     1 
ATOM   868   O  O     . ASP A 1 115  ? 101.376 126.135 40.309  1.00 8.44  ? 115  ASP A O     1 
ATOM   869   C  CB    . ASP A 1 115  ? 103.676 125.757 42.163  1.00 9.99  ? 115  ASP A CB    1 
ATOM   870   C  CG    . ASP A 1 115  ? 103.668 126.078 43.645  1.00 13.53 ? 115  ASP A CG    1 
ATOM   871   O  OD1   . ASP A 1 115  ? 102.877 126.974 44.068  1.00 16.83 ? 115  ASP A OD1   1 
ATOM   872   O  OD2   . ASP A 1 115  ? 104.407 125.472 44.462  1.00 17.39 ? 115  ASP A OD2   1 
ATOM   873   N  N     . VAL A 1 116  ? 102.102 124.196 39.449  1.00 8.18  ? 116  VAL A N     1 
ATOM   874   C  CA    . VAL A 1 116  ? 101.425 124.444 38.170  1.00 8.21  ? 116  VAL A CA    1 
ATOM   875   C  C     . VAL A 1 116  ? 100.017 123.846 38.147  1.00 7.64  ? 116  VAL A C     1 
ATOM   876   O  O     . VAL A 1 116  ? 99.234  124.133 37.233  1.00 7.68  ? 116  VAL A O     1 
ATOM   877   C  CB    . VAL A 1 116  ? 102.228 123.975 36.931  1.00 8.01  ? 116  VAL A CB    1 
ATOM   878   C  CG1   . VAL A 1 116  ? 103.586 124.683 36.860  1.00 9.39  ? 116  VAL A CG1   1 
ATOM   879   C  CG2   . VAL A 1 116  ? 102.375 122.449 36.907  1.00 8.48  ? 116  VAL A CG2   1 
ATOM   880   N  N     . LEU A 1 117  ? 99.704  123.028 39.153  1.00 6.70  ? 117  LEU A N     1 
ATOM   881   C  CA    . LEU A 1 117  ? 98.418  122.318 39.197  1.00 6.48  ? 117  LEU A CA    1 
ATOM   882   C  C     . LEU A 1 117  ? 97.262  123.238 39.548  1.00 5.78  ? 117  LEU A C     1 
ATOM   883   O  O     . LEU A 1 117  ? 97.455  124.238 40.229  1.00 5.01  ? 117  LEU A O     1 
ATOM   884   C  CB    . LEU A 1 117  ? 98.467  121.170 40.220  1.00 6.69  ? 117  LEU A CB    1 
ATOM   885   C  CG    . LEU A 1 117  ? 99.443  120.025 39.953  1.00 6.55  ? 117  LEU A CG    1 
ATOM   886   C  CD1   . LEU A 1 117  ? 99.566  119.157 41.185  1.00 5.85  ? 117  LEU A CD1   1 
ATOM   887   C  CD2   . LEU A 1 117  ? 98.946  119.181 38.772  1.00 6.99  ? 117  LEU A CD2   1 
ATOM   888   N  N     . GLY A 1 118  ? 96.055  122.893 39.093  1.00 5.11  ? 118  GLY A N     1 
ATOM   889   C  CA    . GLY A 1 118  ? 94.848  123.575 39.542  1.00 4.69  ? 118  GLY A CA    1 
ATOM   890   C  C     . GLY A 1 118  ? 94.616  123.254 41.014  1.00 4.83  ? 118  GLY A C     1 
ATOM   891   O  O     . GLY A 1 118  ? 95.171  122.285 41.516  1.00 4.79  ? 118  GLY A O     1 
ATOM   892   N  N     . ILE A 1 119  ? 93.800  124.045 41.703  1.00 4.80  ? 119  ILE A N     1 
ATOM   893   C  CA    . ILE A 1 119  ? 93.615  123.857 43.153  1.00 5.37  ? 119  ILE A CA    1 
ATOM   894   C  C     . ILE A 1 119  ? 93.041  122.474 43.557  1.00 5.25  ? 119  ILE A C     1 
ATOM   895   O  O     . ILE A 1 119  ? 93.560  121.845 44.481  1.00 5.16  ? 119  ILE A O     1 
ATOM   896   C  CB    . ILE A 1 119  ? 92.839  125.062 43.794  1.00 6.02  ? 119  ILE A CB    1 
ATOM   897   C  CG1   . ILE A 1 119  ? 92.832  124.962 45.332  1.00 7.51  ? 119  ILE A CG1   1 
ATOM   898   C  CG2   . ILE A 1 119  ? 91.429  125.187 43.230  1.00 6.42  ? 119  ILE A CG2   1 
ATOM   899   C  CD1   . ILE A 1 119  ? 92.395  126.234 46.050  1.00 11.72 ? 119  ILE A CD1   1 
ATOM   900   N  N     . GLN A 1 120  ? 92.018  121.979 42.861  1.00 4.72  ? 120  GLN A N     1 
ATOM   901   C  CA    . GLN A 1 120  ? 91.467  120.668 43.203  1.00 5.77  ? 120  GLN A CA    1 
ATOM   902   C  C     . GLN A 1 120  ? 92.499  119.536 42.988  1.00 5.73  ? 120  GLN A C     1 
ATOM   903   O  O     . GLN A 1 120  ? 92.702  118.714 43.881  1.00 5.36  ? 120  GLN A O     1 
ATOM   904   C  CB    . GLN A 1 120  ? 90.189  120.366 42.420  1.00 5.65  ? 120  GLN A CB    1 
ATOM   905   C  CG    . GLN A 1 120  ? 89.030  121.305 42.724  1.00 7.30  ? 120  GLN A CG    1 
ATOM   906   C  CD    . GLN A 1 120  ? 87.835  120.950 41.871  1.00 9.56  ? 120  GLN A CD    1 
ATOM   907   O  OE1   . GLN A 1 120  ? 87.159  119.951 42.128  1.00 9.89  ? 120  GLN A OE1   1 
ATOM   908   N  NE2   . GLN A 1 120  ? 87.602  121.727 40.837  1.00 8.85  ? 120  GLN A NE2   1 
ATOM   909   N  N     . ALA A 1 121  ? 93.158  119.504 41.823  1.00 5.94  ? 121  ALA A N     1 
ATOM   910   C  CA    . ALA A 1 121  ? 94.207  118.503 41.573  1.00 6.39  ? 121  ALA A CA    1 
ATOM   911   C  C     . ALA A 1 121  ? 95.381  118.609 42.549  1.00 7.15  ? 121  ALA A C     1 
ATOM   912   O  O     . ALA A 1 121  ? 95.969  117.581 42.950  1.00 7.38  ? 121  ALA A O     1 
ATOM   913   C  CB    . ALA A 1 121  ? 94.709  118.585 40.136  1.00 6.51  ? 121  ALA A CB    1 
ATOM   914   N  N     . LYS A 1 122  ? 95.726  119.844 42.925  1.00 7.32  ? 122  LYS A N     1 
ATOM   915   C  CA    . LYS A 1 122  ? 96.781  120.099 43.914  1.00 8.40  ? 122  LYS A CA    1 
ATOM   916   C  C     . LYS A 1 122  ? 96.403  119.509 45.281  1.00 8.60  ? 122  LYS A C     1 
ATOM   917   O  O     . LYS A 1 122  ? 97.235  118.893 45.950  1.00 8.18  ? 122  LYS A O     1 
ATOM   918   C  CB    . LYS A 1 122  ? 97.059  121.606 44.042  1.00 8.02  ? 122  LYS A CB    1 
ATOM   919   C  CG    . LYS A 1 122  ? 98.415  121.984 44.624  1.00 8.85  ? 122  LYS A CG    1 
ATOM   920   C  CD    . LYS A 1 122  ? 98.441  123.464 45.083  1.00 12.55 ? 122  LYS A CD    1 
ATOM   921   C  CE    . LYS A 1 122  ? 98.281  124.430 43.894  1.00 14.46 ? 122  LYS A CE    1 
ATOM   922   N  NZ    . LYS A 1 122  ? 99.105  125.690 44.023  1.00 14.66 ? 122  LYS A NZ    1 
ATOM   923   N  N     . ASN A 1 123  ? 95.142  119.700 45.673  1.00 9.26  ? 123  ASN A N     1 
ATOM   924   C  CA    . ASN A 1 123  ? 94.617  119.187 46.937  1.00 9.90  ? 123  ASN A CA    1 
ATOM   925   C  C     . ASN A 1 123  ? 94.643  117.650 46.966  1.00 10.23 ? 123  ASN A C     1 
ATOM   926   O  O     . ASN A 1 123  ? 94.892  117.060 48.022  1.00 10.37 ? 123  ASN A O     1 
ATOM   927   C  CB    . ASN A 1 123  ? 93.171  119.660 47.139  1.00 10.51 ? 123  ASN A CB    1 
ATOM   928   C  CG    . ASN A 1 123  ? 93.047  121.188 47.375  1.00 11.19 ? 123  ASN A CG    1 
ATOM   929   O  OD1   . ASN A 1 123  ? 94.024  121.895 47.639  1.00 13.11 ? 123  ASN A OD1   1 
ATOM   930   N  ND2   . ASN A 1 123  ? 91.824  121.683 47.279  1.00 13.46 ? 123  ASN A ND2   1 
ATOM   931   N  N     . ASN A 1 124  ? 94.383  117.070 45.782  1.00 9.44  ? 124  ASN A N     1 
ATOM   932   C  CA    . ASN A 1 124  ? 94.178  115.644 45.425  1.00 9.83  ? 124  ASN A CA    1 
ATOM   933   C  C     . ASN A 1 124  ? 95.475  114.868 45.191  1.00 8.43  ? 124  ASN A C     1 
ATOM   934   O  O     . ASN A 1 124  ? 95.471  113.636 45.136  1.00 7.68  ? 124  ASN A O     1 
ATOM   935   C  CB    . ASN A 1 124  ? 93.480  115.587 44.025  1.00 9.18  ? 124  ASN A CB    1 
ATOM   936   C  CG    . ASN A 1 124  ? 92.045  115.074 44.062  1.00 13.16 ? 124  ASN A CG    1 
ATOM   937   O  OD1   . ASN A 1 124  ? 91.792  113.875 43.975  1.00 17.02 ? 124  ASN A OD1   1 
ATOM   938   N  ND2   . ASN A 1 124  ? 91.081  115.999 44.128  1.00 18.56 ? 124  ASN A ND2   1 
ATOM   939   N  N     . GLN A 1 125  ? 96.559  115.588 44.947  1.00 7.50  ? 125  GLN A N     1 
ATOM   940   C  CA    . GLN A 1 125  ? 97.740  114.967 44.347  1.00 6.89  ? 125  GLN A CA    1 
ATOM   941   C  C     . GLN A 1 125  ? 98.343  113.842 45.200  1.00 6.81  ? 125  GLN A C     1 
ATOM   942   O  O     . GLN A 1 125  ? 98.677  114.067 46.355  1.00 6.51  ? 125  GLN A O     1 
ATOM   943   C  CB    . GLN A 1 125  ? 98.805  116.024 44.062  1.00 6.74  ? 125  GLN A CB    1 
ATOM   944   C  CG    . GLN A 1 125  ? 99.967  115.483 43.223  1.00 6.39  ? 125  GLN A CG    1 
ATOM   945   C  CD    . GLN A 1 125  ? 101.256 116.229 43.467  1.00 5.99  ? 125  GLN A CD    1 
ATOM   946   O  OE1   . GLN A 1 125  ? 101.260 117.450 43.506  1.00 3.38  ? 125  GLN A OE1   1 
ATOM   947   N  NE2   . GLN A 1 125  ? 102.360 115.487 43.634  1.00 7.15  ? 125  GLN A NE2   1 
ATOM   948   N  N     . PRO A 1 126  ? 98.498  112.638 44.643  1.00 7.03  ? 126  PRO A N     1 
ATOM   949   C  CA    . PRO A 1 126  ? 99.248  111.586 45.347  1.00 6.85  ? 126  PRO A CA    1 
ATOM   950   C  C     . PRO A 1 126  ? 100.750 111.856 45.388  1.00 6.83  ? 126  PRO A C     1 
ATOM   951   O  O     . PRO A 1 126  ? 101.267 112.693 44.647  1.00 7.28  ? 126  PRO A O     1 
ATOM   952   C  CB    . PRO A 1 126  ? 98.991  110.347 44.505  1.00 7.14  ? 126  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1 126  ? 98.771  110.896 43.125  1.00 8.42  ? 126  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1 126  ? 97.965  112.159 43.356  1.00 6.82  ? 126  PRO A CD    1 
ATOM   955   N  N     . HIS A 1 127  ? 101.450 111.137 46.258  1.00 6.51  ? 127  HIS A N     1 
ATOM   956   C  CA    . HIS A 1 127  ? 102.900 111.164 46.228  1.00 6.15  ? 127  HIS A CA    1 
ATOM   957   C  C     . HIS A 1 127  ? 103.412 110.183 45.179  1.00 6.03  ? 127  HIS A C     1 
ATOM   958   O  O     . HIS A 1 127  ? 103.076 108.994 45.211  1.00 6.53  ? 127  HIS A O     1 
ATOM   959   C  CB    . HIS A 1 127  ? 103.516 110.839 47.579  1.00 6.41  ? 127  HIS A CB    1 
ATOM   960   C  CG    . HIS A 1 127  ? 105.002 110.987 47.565  1.00 5.93  ? 127  HIS A CG    1 
ATOM   961   N  ND1   . HIS A 1 127  ? 105.616 112.219 47.566  1.00 5.27  ? 127  HIS A ND1   1 
ATOM   962   C  CD2   . HIS A 1 127  ? 105.990 110.069 47.463  1.00 5.58  ? 127  HIS A CD2   1 
ATOM   963   C  CE1   . HIS A 1 127  ? 106.926 112.053 47.506  1.00 6.43  ? 127  HIS A CE1   1 
ATOM   964   N  NE2   . HIS A 1 127  ? 107.179 110.759 47.435  1.00 5.57  ? 127  HIS A NE2   1 
ATOM   965   N  N     . ILE A 1 128  ? 104.217 110.682 44.243  1.00 4.82  ? 128  ILE A N     1 
ATOM   966   C  CA    . ILE A 1 128  ? 104.536 109.903 43.044  1.00 4.11  ? 128  ILE A CA    1 
ATOM   967   C  C     . ILE A 1 128  ? 105.992 109.433 43.027  1.00 4.12  ? 128  ILE A C     1 
ATOM   968   O  O     . ILE A 1 128  ? 106.920 110.248 43.068  1.00 4.17  ? 128  ILE A O     1 
ATOM   969   C  CB    . ILE A 1 128  ? 104.221 110.698 41.757  1.00 4.10  ? 128  ILE A CB    1 
ATOM   970   C  CG1   . ILE A 1 128  ? 102.769 111.204 41.767  1.00 3.64  ? 128  ILE A CG1   1 
ATOM   971   C  CG2   . ILE A 1 128  ? 104.501 109.826 40.515  1.00 3.49  ? 128  ILE A CG2   1 
ATOM   972   C  CD1   . ILE A 1 128  ? 102.471 112.330 40.748  1.00 5.31  ? 128  ILE A CD1   1 
ATOM   973   N  N     . GLU A 1 129  ? 106.178 108.117 42.944  1.00 4.01  ? 129  GLU A N     1 
ATOM   974   C  CA    . GLU A 1 129  ? 107.514 107.525 42.940  1.00 4.02  ? 129  GLU A CA    1 
ATOM   975   C  C     . GLU A 1 129  ? 107.542 106.369 41.956  1.00 3.75  ? 129  GLU A C     1 
ATOM   976   O  O     . GLU A 1 129  ? 106.498 105.800 41.618  1.00 4.18  ? 129  GLU A O     1 
ATOM   977   C  CB    . GLU A 1 129  ? 107.903 107.002 44.339  1.00 4.06  ? 129  GLU A CB    1 
ATOM   978   C  CG    . GLU A 1 129  ? 108.007 108.060 45.432  1.00 5.77  ? 129  GLU A CG    1 
ATOM   979   C  CD    . GLU A 1 129  ? 108.697 107.570 46.723  1.00 8.71  ? 129  GLU A CD    1 
ATOM   980   O  OE1   . GLU A 1 129  ? 109.473 106.590 46.701  1.00 7.35  ? 129  GLU A OE1   1 
ATOM   981   O  OE2   . GLU A 1 129  ? 108.466 108.186 47.785  1.00 11.97 ? 129  GLU A OE2   1 
ATOM   982   N  N     . GLN A 1 130  ? 108.737 106.029 41.500  1.00 3.55  ? 130  GLN A N     1 
ATOM   983   C  CA    . GLN A 1 130  ? 108.937 104.836 40.684  1.00 3.91  ? 130  GLN A CA    1 
ATOM   984   C  C     . GLN A 1 130  ? 109.694 103.785 41.499  1.00 4.05  ? 130  GLN A C     1 
ATOM   985   O  O     . GLN A 1 130  ? 110.651 104.128 42.194  1.00 4.12  ? 130  GLN A O     1 
ATOM   986   C  CB    . GLN A 1 130  ? 109.715 105.191 39.412  1.00 3.92  ? 130  GLN A CB    1 
ATOM   987   C  CG    . GLN A 1 130  ? 108.874 105.825 38.312  1.00 3.79  ? 130  GLN A CG    1 
ATOM   988   C  CD    . GLN A 1 130  ? 109.627 106.888 37.492  1.00 4.54  ? 130  GLN A CD    1 
ATOM   989   O  OE1   . GLN A 1 130  ? 110.836 107.083 37.660  1.00 2.40  ? 130  GLN A OE1   1 
ATOM   990   N  NE2   . GLN A 1 130  ? 108.895 107.584 36.602  1.00 3.20  ? 130  GLN A NE2   1 
ATOM   991   N  N     . ILE A 1 131  ? 109.244 102.531 41.441  1.00 4.16  ? 131  ILE A N     1 
ATOM   992   C  CA    . ILE A 1 131  ? 109.982 101.411 42.021  1.00 3.95  ? 131  ILE A CA    1 
ATOM   993   C  C     . ILE A 1 131  ? 110.800 100.730 40.928  1.00 4.42  ? 131  ILE A C     1 
ATOM   994   O  O     . ILE A 1 131  ? 110.284 100.455 39.838  1.00 3.80  ? 131  ILE A O     1 
ATOM   995   C  CB    . ILE A 1 131  ? 109.044 100.391 42.758  1.00 4.16  ? 131  ILE A CB    1 
ATOM   996   C  CG1   . ILE A 1 131  ? 109.872 99.292  43.454  1.00 4.64  ? 131  ILE A CG1   1 
ATOM   997   C  CG2   . ILE A 1 131  ? 107.968 99.791  41.815  1.00 3.80  ? 131  ILE A CG2   1 
ATOM   998   C  CD1   . ILE A 1 131  ? 109.044 98.301  44.300  1.00 1.17  ? 131  ILE A CD1   1 
ATOM   999   N  N     . LEU A 1 132  ? 112.077 100.489 41.218  1.00 3.76  ? 132  LEU A N     1 
ATOM   1000  C  CA    . LEU A 1 132  ? 112.945 99.766  40.294  1.00 4.25  ? 132  LEU A CA    1 
ATOM   1001  C  C     . LEU A 1 132  ? 113.187 98.326  40.764  1.00 4.52  ? 132  LEU A C     1 
ATOM   1002  O  O     . LEU A 1 132  ? 113.527 98.089  41.926  1.00 3.66  ? 132  LEU A O     1 
ATOM   1003  C  CB    . LEU A 1 132  ? 114.252 100.541 40.060  1.00 3.97  ? 132  LEU A CB    1 
ATOM   1004  C  CG    . LEU A 1 132  ? 113.925 102.000 39.688  1.00 4.68  ? 132  LEU A CG    1 
ATOM   1005  C  CD1   . LEU A 1 132  ? 115.118 102.896 39.791  1.00 7.75  ? 132  LEU A CD1   1 
ATOM   1006  C  CD2   . LEU A 1 132  ? 113.315 102.105 38.290  1.00 4.33  ? 132  LEU A CD2   1 
ATOM   1007  N  N     . VAL A 1 133  ? 113.011 97.380  39.842  1.00 4.55  ? 133  VAL A N     1 
ATOM   1008  C  CA    . VAL A 1 133  ? 112.950 95.949  40.169  1.00 6.19  ? 133  VAL A CA    1 
ATOM   1009  C  C     . VAL A 1 133  ? 113.699 95.077  39.133  1.00 6.15  ? 133  VAL A C     1 
ATOM   1010  O  O     . VAL A 1 133  ? 113.785 95.451  37.964  1.00 5.46  ? 133  VAL A O     1 
ATOM   1011  C  CB    . VAL A 1 133  ? 111.448 95.540  40.238  1.00 6.62  ? 133  VAL A CB    1 
ATOM   1012  C  CG1   . VAL A 1 133  ? 111.243 94.045  40.122  1.00 9.37  ? 133  VAL A CG1   1 
ATOM   1013  C  CG2   . VAL A 1 133  ? 110.778 96.115  41.489  1.00 6.37  ? 133  VAL A CG2   1 
ATOM   1014  N  N     . THR A 1 134  ? 114.245 93.933  39.565  1.00 6.82  ? 134  THR A N     1 
ATOM   1015  C  CA    . THR A 1 134  ? 114.858 92.942  38.659  1.00 7.68  ? 134  THR A CA    1 
ATOM   1016  C  C     . THR A 1 134  ? 114.584 91.514  39.107  1.00 7.64  ? 134  THR A C     1 
ATOM   1017  O  O     . THR A 1 134  ? 114.169 91.279  40.240  1.00 6.71  ? 134  THR A O     1 
ATOM   1018  C  CB    . THR A 1 134  ? 116.404 93.116  38.473  1.00 8.03  ? 134  THR A CB    1 
ATOM   1019  O  OG1   . THR A 1 134  ? 117.103 92.895  39.714  1.00 8.77  ? 134  THR A OG1   1 
ATOM   1020  C  CG2   . THR A 1 134  ? 116.761 94.512  38.094  1.00 9.80  ? 134  THR A CG2   1 
ATOM   1021  N  N     . CYS A 1 135  ? 114.819 90.565  38.202  1.00 8.18  ? 135  CYS A N     1 
ATOM   1022  C  CA    . CYS A 1 135  ? 114.678 89.148  38.520  1.00 9.35  ? 135  CYS A CA    1 
ATOM   1023  C  C     . CYS A 1 135  ? 116.046 88.466  38.634  1.00 9.69  ? 135  CYS A C     1 
ATOM   1024  O  O     . CYS A 1 135  ? 116.761 88.361  37.634  1.00 9.63  ? 135  CYS A O     1 
ATOM   1025  C  CB    . CYS A 1 135  ? 113.816 88.445  37.469  1.00 9.62  ? 135  CYS A CB    1 
ATOM   1026  S  SG    . CYS A 1 135  ? 113.663 86.662  37.756  1.00 13.16 ? 135  CYS A SG    1 
ATOM   1027  N  N     . PRO A 1 136  ? 116.407 87.989  39.832  1.00 10.21 ? 136  PRO A N     1 
ATOM   1028  C  CA    . PRO A 1 136  ? 117.730 87.383  40.045  1.00 10.37 ? 136  PRO A CA    1 
ATOM   1029  C  C     . PRO A 1 136  ? 117.876 86.016  39.350  1.00 10.85 ? 136  PRO A C     1 
ATOM   1030  O  O     . PRO A 1 136  ? 118.998 85.602  39.047  1.00 10.18 ? 136  PRO A O     1 
ATOM   1031  C  CB    . PRO A 1 136  ? 117.819 87.247  41.570  1.00 10.66 ? 136  PRO A CB    1 
ATOM   1032  C  CG    . PRO A 1 136  ? 116.402 87.131  42.027  1.00 10.85 ? 136  PRO A CG    1 
ATOM   1033  C  CD    . PRO A 1 136  ? 115.589 87.981  41.064  1.00 10.34 ? 136  PRO A CD    1 
ATOM   1034  N  N     . GLU A 1 137  ? 116.751 85.351  39.088  1.00 10.97 ? 137  GLU A N     1 
ATOM   1035  C  CA    . GLU A 1 137  ? 116.739 84.124  38.304  1.00 12.04 ? 137  GLU A CA    1 
ATOM   1036  C  C     . GLU A 1 137  ? 116.973 84.368  36.806  1.00 11.85 ? 137  GLU A C     1 
ATOM   1037  O  O     . GLU A 1 137  ? 117.223 83.422  36.053  1.00 12.19 ? 137  GLU A O     1 
ATOM   1038  C  CB    . GLU A 1 137  ? 115.437 83.352  38.530  1.00 12.50 ? 137  GLU A CB    1 
ATOM   1039  C  CG    . GLU A 1 137  ? 115.555 82.213  39.539  1.00 14.75 ? 137  GLU A CG    1 
ATOM   1040  C  CD    . GLU A 1 137  ? 116.268 80.981  38.994  1.00 18.65 ? 137  GLU A CD    1 
ATOM   1041  O  OE1   . GLU A 1 137  ? 115.965 80.557  37.846  1.00 21.35 ? 137  GLU A OE1   1 
ATOM   1042  O  OE2   . GLU A 1 137  ? 117.135 80.422  39.722  1.00 19.01 ? 137  GLU A OE2   1 
ATOM   1043  N  N     . GLY A 1 138  ? 116.907 85.629  36.388  1.00 11.64 ? 138  GLY A N     1 
ATOM   1044  C  CA    . GLY A 1 138  ? 117.202 86.012  35.018  1.00 11.38 ? 138  GLY A CA    1 
ATOM   1045  C  C     . GLY A 1 138  ? 116.015 86.162  34.078  1.00 11.30 ? 138  GLY A C     1 
ATOM   1046  O  O     . GLY A 1 138  ? 116.200 86.186  32.854  1.00 11.13 ? 138  GLY A O     1 
ATOM   1047  N  N     . CYS A 1 139  ? 114.800 86.261  34.618  1.00 10.68 ? 139  CYS A N     1 
ATOM   1048  C  CA    . CYS A 1 139  ? 113.638 86.520  33.763  1.00 10.89 ? 139  CYS A CA    1 
ATOM   1049  C  C     . CYS A 1 139  ? 113.765 87.883  33.136  1.00 9.22  ? 139  CYS A C     1 
ATOM   1050  O  O     . CYS A 1 139  ? 114.394 88.783  33.693  1.00 8.13  ? 139  CYS A O     1 
ATOM   1051  C  CB    . CYS A 1 139  ? 112.314 86.420  34.525  1.00 11.40 ? 139  CYS A CB    1 
ATOM   1052  S  SG    . CYS A 1 139  ? 111.980 84.712  34.995  1.00 18.88 ? 139  CYS A SG    1 
ATOM   1053  N  N     . ALA A 1 140  ? 113.154 88.017  31.969  1.00 8.17  ? 140  ALA A N     1 
ATOM   1054  C  CA    . ALA A 1 140  ? 113.256 89.226  31.175  1.00 7.51  ? 140  ALA A CA    1 
ATOM   1055  C  C     . ALA A 1 140  ? 112.037 89.290  30.281  1.00 7.36  ? 140  ALA A C     1 
ATOM   1056  O  O     . ALA A 1 140  ? 111.274 88.319  30.194  1.00 7.08  ? 140  ALA A O     1 
ATOM   1057  C  CB    . ALA A 1 140  ? 114.546 89.195  30.316  1.00 7.47  ? 140  ALA A CB    1 
ATOM   1058  N  N     . GLY A 1 141  ? 111.852 90.432  29.620  1.00 6.44  ? 141  GLY A N     1 
ATOM   1059  C  CA    . GLY A 1 141  ? 110.870 90.546  28.559  1.00 6.52  ? 141  GLY A CA    1 
ATOM   1060  C  C     . GLY A 1 141  ? 109.480 90.075  28.947  1.00 6.54  ? 141  GLY A C     1 
ATOM   1061  O  O     . GLY A 1 141  ? 108.909 90.544  29.940  1.00 5.53  ? 141  GLY A O     1 
ATOM   1062  N  N     . ASP A 1 142  ? 108.951 89.127  28.167  1.00 6.20  ? 142  ASP A N     1 
ATOM   1063  C  CA    . ASP A 1 142  ? 107.583 88.645  28.355  1.00 6.46  ? 142  ASP A CA    1 
ATOM   1064  C  C     . ASP A 1 142  ? 107.351 88.088  29.763  1.00 6.05  ? 142  ASP A C     1 
ATOM   1065  O  O     . ASP A 1 142  ? 106.348 88.398  30.374  1.00 6.34  ? 142  ASP A O     1 
ATOM   1066  C  CB    . ASP A 1 142  ? 107.237 87.564  27.330  1.00 6.53  ? 142  ASP A CB    1 
ATOM   1067  C  CG    . ASP A 1 142  ? 107.081 88.106  25.911  1.00 7.94  ? 142  ASP A CG    1 
ATOM   1068  O  OD1   . ASP A 1 142  ? 107.045 89.341  25.691  1.00 8.33  ? 142  ASP A OD1   1 
ATOM   1069  O  OD2   . ASP A 1 142  ? 106.964 87.338  24.941  1.00 9.87  ? 142  ASP A OD2   1 
ATOM   1070  N  N     . GLU A 1 143  ? 108.264 87.266  30.269  1.00 5.97  ? 143  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1 143  ? 108.034 86.605  31.562  1.00 6.20  ? 143  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1 143  ? 108.090 87.606  32.710  1.00 6.06  ? 143  GLU A C     1 
ATOM   1073  O  O     . GLU A 1 143  ? 107.305 87.522  33.662  1.00 5.36  ? 143  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1 143  ? 108.992 85.411  31.780  1.00 6.52  ? 143  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1 143  ? 108.897 84.697  33.138  1.00 6.71  ? 143  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1 143  ? 107.502 84.177  33.499  1.00 7.95  ? 143  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1 143  ? 106.632 84.077  32.609  1.00 6.30  ? 143  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1 143  ? 107.275 83.855  34.694  1.00 6.79  ? 143  GLU A OE2   1 
ATOM   1079  N  N     . LEU A 1 144  ? 108.999 88.569  32.597  1.00 6.00  ? 144  LEU A N     1 
ATOM   1080  C  CA    . LEU A 1 144  ? 109.094 89.627  33.593  1.00 6.06  ? 144  LEU A CA    1 
ATOM   1081  C  C     . LEU A 1 144  ? 107.824 90.480  33.607  1.00 5.63  ? 144  LEU A C     1 
ATOM   1082  O  O     . LEU A 1 144  ? 107.311 90.781  34.680  1.00 4.95  ? 144  LEU A O     1 
ATOM   1083  C  CB    . LEU A 1 144  ? 110.351 90.486  33.385  1.00 6.12  ? 144  LEU A CB    1 
ATOM   1084  C  CG    . LEU A 1 144  ? 110.646 91.663  34.339  1.00 6.73  ? 144  LEU A CG    1 
ATOM   1085  C  CD1   . LEU A 1 144  ? 110.648 91.282  35.835  1.00 4.70  ? 144  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A 1 144  ? 111.975 92.276  33.953  1.00 6.14  ? 144  LEU A CD2   1 
ATOM   1087  N  N     . ASP A 1 145  ? 107.303 90.836  32.433  1.00 5.45  ? 145  ASP A N     1 
ATOM   1088  C  CA    . ASP A 1 145  ? 106.080 91.647  32.381  1.00 6.27  ? 145  ASP A CA    1 
ATOM   1089  C  C     . ASP A 1 145  ? 104.881 90.851  32.871  1.00 5.68  ? 145  ASP A C     1 
ATOM   1090  O  O     . ASP A 1 145  ? 103.955 91.402  33.432  1.00 5.79  ? 145  ASP A O     1 
ATOM   1091  C  CB    . ASP A 1 145  ? 105.834 92.260  30.987  1.00 6.40  ? 145  ASP A CB    1 
ATOM   1092  C  CG    . ASP A 1 145  ? 106.422 93.676  30.859  1.00 8.17  ? 145  ASP A CG    1 
ATOM   1093  O  OD1   . ASP A 1 145  ? 107.280 94.060  31.683  1.00 9.20  ? 145  ASP A OD1   1 
ATOM   1094  O  OD2   . ASP A 1 145  ? 106.093 94.480  29.969  1.00 10.36 ? 145  ASP A OD2   1 
ATOM   1095  N  N     . ARG A 1 146  ? 104.937 89.538  32.684  1.00 5.29  ? 146  ARG A N     1 
ATOM   1096  C  CA    . ARG A 1 146  ? 103.901 88.646  33.174  1.00 5.26  ? 146  ARG A CA    1 
ATOM   1097  C  C     . ARG A 1 146  ? 103.833 88.643  34.707  1.00 4.57  ? 146  ARG A C     1 
ATOM   1098  O  O     . ARG A 1 146  ? 102.750 88.656  35.287  1.00 3.76  ? 146  ARG A O     1 
ATOM   1099  C  CB    . ARG A 1 146  ? 104.208 87.247  32.657  1.00 5.27  ? 146  ARG A CB    1 
ATOM   1100  C  CG    . ARG A 1 146  ? 103.149 86.219  32.827  1.00 6.57  ? 146  ARG A CG    1 
ATOM   1101  C  CD    . ARG A 1 146  ? 103.750 84.802  32.841  1.00 9.95  ? 146  ARG A CD    1 
ATOM   1102  N  NE    . ARG A 1 146  ? 102.769 83.953  33.455  1.00 12.57 ? 146  ARG A NE    1 
ATOM   1103  C  CZ    . ARG A 1 146  ? 102.930 83.211  34.519  1.00 11.43 ? 146  ARG A CZ    1 
ATOM   1104  N  NH1   . ARG A 1 146  ? 104.106 83.077  35.146  1.00 12.15 ? 146  ARG A NH1   1 
ATOM   1105  N  NH2   . ARG A 1 146  ? 101.876 82.541  34.924  1.00 14.39 ? 146  ARG A NH2   1 
ATOM   1106  N  N     . ARG A 1 147  ? 104.995 88.635  35.350  1.00 3.95  ? 147  ARG A N     1 
ATOM   1107  C  CA    . ARG A 1 147  ? 105.071 88.603  36.808  1.00 4.48  ? 147  ARG A CA    1 
ATOM   1108  C  C     . ARG A 1 147  ? 104.733 89.934  37.423  1.00 4.59  ? 147  ARG A C     1 
ATOM   1109  O  O     . ARG A 1 147  ? 104.205 89.993  38.527  1.00 4.25  ? 147  ARG A O     1 
ATOM   1110  C  CB    . ARG A 1 147  ? 106.474 88.234  37.250  1.00 4.93  ? 147  ARG A CB    1 
ATOM   1111  C  CG    . ARG A 1 147  ? 106.889 86.862  36.898  1.00 5.45  ? 147  ARG A CG    1 
ATOM   1112  C  CD    . ARG A 1 147  ? 108.168 86.490  37.590  1.00 9.38  ? 147  ARG A CD    1 
ATOM   1113  N  NE    . ARG A 1 147  ? 108.642 85.174  37.203  1.00 9.37  ? 147  ARG A NE    1 
ATOM   1114  C  CZ    . ARG A 1 147  ? 109.726 84.599  37.710  1.00 11.51 ? 147  ARG A CZ    1 
ATOM   1115  N  NH1   . ARG A 1 147  ? 110.458 85.233  38.626  1.00 11.58 ? 147  ARG A NH1   1 
ATOM   1116  N  NH2   . ARG A 1 147  ? 110.084 83.389  37.299  1.00 10.92 ? 147  ARG A NH2   1 
ATOM   1117  N  N     . LEU A 1 148  ? 105.082 91.002  36.710  1.00 4.58  ? 148  LEU A N     1 
ATOM   1118  C  CA    . LEU A 1 148  ? 104.734 92.356  37.096  1.00 5.30  ? 148  LEU A CA    1 
ATOM   1119  C  C     . LEU A 1 148  ? 103.219 92.580  36.940  1.00 5.81  ? 148  LEU A C     1 
ATOM   1120  O  O     . LEU A 1 148  ? 102.601 93.319  37.720  1.00 5.35  ? 148  LEU A O     1 
ATOM   1121  C  CB    . LEU A 1 148  ? 105.498 93.329  36.198  1.00 5.28  ? 148  LEU A CB    1 
ATOM   1122  C  CG    . LEU A 1 148  ? 106.853 93.943  36.591  1.00 7.17  ? 148  LEU A CG    1 
ATOM   1123  C  CD1   . LEU A 1 148  ? 107.523 93.370  37.853  1.00 9.26  ? 148  LEU A CD1   1 
ATOM   1124  C  CD2   . LEU A 1 148  ? 107.810 93.975  35.422  1.00 5.53  ? 148  LEU A CD2   1 
ATOM   1125  N  N     . TYR A 1 149  ? 102.636 91.961  35.906  1.00 5.21  ? 149  TYR A N     1 
ATOM   1126  C  CA    . TYR A 1 149  ? 101.187 91.991  35.706  1.00 4.99  ? 149  TYR A CA    1 
ATOM   1127  C  C     . TYR A 1 149  ? 100.490 91.332  36.898  1.00 4.59  ? 149  TYR A C     1 
ATOM   1128  O  O     . TYR A 1 149  ? 99.534  91.891  37.430  1.00 3.92  ? 149  TYR A O     1 
ATOM   1129  C  CB    . TYR A 1 149  ? 100.800 91.331  34.363  1.00 4.81  ? 149  TYR A CB    1 
ATOM   1130  C  CG    . TYR A 1 149  ? 99.335  90.967  34.192  1.00 5.54  ? 149  TYR A CG    1 
ATOM   1131  C  CD1   . TYR A 1 149  ? 98.332  91.930  34.284  1.00 5.31  ? 149  TYR A CD1   1 
ATOM   1132  C  CD2   . TYR A 1 149  ? 98.965  89.650  33.908  1.00 5.27  ? 149  TYR A CD2   1 
ATOM   1133  C  CE1   . TYR A 1 149  ? 96.980  91.579  34.104  1.00 6.73  ? 149  TYR A CE1   1 
ATOM   1134  C  CE2   . TYR A 1 149  ? 97.646  89.286  33.719  1.00 3.78  ? 149  TYR A CE2   1 
ATOM   1135  C  CZ    . TYR A 1 149  ? 96.651  90.242  33.832  1.00 6.21  ? 149  TYR A CZ    1 
ATOM   1136  O  OH    . TYR A 1 149  ? 95.340  89.847  33.658  1.00 6.28  ? 149  TYR A OH    1 
ATOM   1137  N  N     . ILE A 1 150  ? 100.983 90.165  37.316  1.00 4.78  ? 150  ILE A N     1 
ATOM   1138  C  CA    . ILE A 1 150  ? 100.469 89.476  38.509  1.00 5.33  ? 150  ILE A CA    1 
ATOM   1139  C  C     . ILE A 1 150  ? 100.601 90.341  39.775  1.00 6.42  ? 150  ILE A C     1 
ATOM   1140  O  O     . ILE A 1 150  ? 99.639  90.481  40.552  1.00 6.65  ? 150  ILE A O     1 
ATOM   1141  C  CB    . ILE A 1 150  ? 101.160 88.096  38.691  1.00 4.96  ? 150  ILE A CB    1 
ATOM   1142  C  CG1   . ILE A 1 150  ? 100.816 87.175  37.509  1.00 4.02  ? 150  ILE A CG1   1 
ATOM   1143  C  CG2   . ILE A 1 150  ? 100.720 87.435  39.996  1.00 4.61  ? 150  ILE A CG2   1 
ATOM   1144  C  CD1   . ILE A 1 150  ? 101.540 85.800  37.515  1.00 3.48  ? 150  ILE A CD1   1 
ATOM   1145  N  N     . ALA A 1 151  ? 101.778 90.948  39.941  1.00 6.35  ? 151  ALA A N     1 
ATOM   1146  C  CA    . ALA A 1 151  ? 102.057 91.847  41.056  1.00 6.58  ? 151  ALA A CA    1 
ATOM   1147  C  C     . ALA A 1 151  ? 101.091 93.020  41.057  1.00 6.86  ? 151  ALA A C     1 
ATOM   1148  O  O     . ALA A 1 151  ? 100.469 93.305  42.086  1.00 6.01  ? 151  ALA A O     1 
ATOM   1149  C  CB    . ALA A 1 151  ? 103.519 92.332  40.996  1.00 6.80  ? 151  ALA A CB    1 
ATOM   1150  N  N     . ARG A 1 152  ? 100.927 93.660  39.892  1.00 6.81  ? 152  ARG A N     1 
ATOM   1151  C  CA    . ARG A 1 152  ? 99.961  94.738  39.729  1.00 8.10  ? 152  ARG A CA    1 
ATOM   1152  C  C     . ARG A 1 152  ? 98.544  94.331  40.137  1.00 8.24  ? 152  ARG A C     1 
ATOM   1153  O  O     . ARG A 1 152  ? 97.822  95.103  40.796  1.00 8.54  ? 152  ARG A O     1 
ATOM   1154  C  CB    . ARG A 1 152  ? 99.920  95.214  38.280  1.00 8.25  ? 152  ARG A CB    1 
ATOM   1155  C  CG    . ARG A 1 152  ? 100.646 96.503  38.077  1.00 10.40 ? 152  ARG A CG    1 
ATOM   1156  C  CD    . ARG A 1 152  ? 100.452 97.123  36.696  1.00 10.54 ? 152  ARG A CD    1 
ATOM   1157  N  NE    . ARG A 1 152  ? 101.018 96.309  35.612  1.00 11.64 ? 152  ARG A NE    1 
ATOM   1158  C  CZ    . ARG A 1 152  ? 100.283 95.644  34.713  1.00 11.68 ? 152  ARG A CZ    1 
ATOM   1159  N  NH1   . ARG A 1 152  ? 98.957  95.673  34.784  1.00 9.44  ? 152  ARG A NH1   1 
ATOM   1160  N  NH2   . ARG A 1 152  ? 100.876 94.944  33.747  1.00 11.43 ? 152  ARG A NH2   1 
ATOM   1161  N  N     . SER A 1 153  ? 98.151  93.123  39.742  1.00 7.62  ? 153  SER A N     1 
ATOM   1162  C  CA    . SER A 1 153  ? 96.805  92.645  40.030  1.00 7.81  ? 153  SER A CA    1 
ATOM   1163  C  C     . SER A 1 153  ? 96.600  92.463  41.536  1.00 7.33  ? 153  SER A C     1 
ATOM   1164  O  O     . SER A 1 153  ? 95.538  92.827  42.059  1.00 8.07  ? 153  SER A O     1 
ATOM   1165  C  CB    . SER A 1 153  ? 96.484  91.370  39.230  1.00 7.54  ? 153  SER A CB    1 
ATOM   1166  O  OG    . SER A 1 153  ? 96.544  91.633  37.821  1.00 7.73  ? 153  SER A OG    1 
ATOM   1167  N  N     . ILE A 1 154  ? 97.611  91.940  42.226  1.00 6.93  ? 154  ILE A N     1 
ATOM   1168  C  CA    . ILE A 1 154  ? 97.553  91.775  43.685  1.00 7.42  ? 154  ILE A CA    1 
ATOM   1169  C  C     . ILE A 1 154  ? 97.555  93.123  44.425  1.00 8.02  ? 154  ILE A C     1 
ATOM   1170  O  O     . ILE A 1 154  ? 96.729  93.337  45.316  1.00 8.19  ? 154  ILE A O     1 
ATOM   1171  C  CB    . ILE A 1 154  ? 98.681  90.839  44.213  1.00 7.14  ? 154  ILE A CB    1 
ATOM   1172  C  CG1   . ILE A 1 154  ? 98.595  89.436  43.584  1.00 6.38  ? 154  ILE A CG1   1 
ATOM   1173  C  CG2   . ILE A 1 154  ? 98.660  90.730  45.765  1.00 7.46  ? 154  ILE A CG2   1 
ATOM   1174  C  CD1   . ILE A 1 154  ? 99.908  88.609  43.762  1.00 3.80  ? 154  ILE A CD1   1 
ATOM   1175  N  N     . ILE A 1 155  ? 98.462  94.022  44.036  1.00 7.75  ? 155  ILE A N     1 
ATOM   1176  C  CA    . ILE A 1 155  ? 98.540  95.363  44.619  1.00 8.58  ? 155  ILE A CA    1 
ATOM   1177  C  C     . ILE A 1 155  ? 97.218  96.114  44.404  1.00 9.32  ? 155  ILE A C     1 
ATOM   1178  O  O     . ILE A 1 155  ? 96.805  96.911  45.256  1.00 9.76  ? 155  ILE A O     1 
ATOM   1179  C  CB    . ILE A 1 155  ? 99.724  96.174  44.015  1.00 7.63  ? 155  ILE A CB    1 
ATOM   1180  C  CG1   . ILE A 1 155  ? 101.071 95.559  44.427  1.00 7.98  ? 155  ILE A CG1   1 
ATOM   1181  C  CG2   . ILE A 1 155  ? 99.649  97.652  44.441  1.00 7.12  ? 155  ILE A CG2   1 
ATOM   1182  C  CD1   . ILE A 1 155  ? 102.255 96.048  43.608  1.00 6.66  ? 155  ILE A CD1   1 
ATOM   1183  N  N     . GLY A 1 156  ? 96.568  95.831  43.276  1.00 9.82  ? 156  GLY A N     1 
ATOM   1184  C  CA    . GLY A 1 156  ? 95.305  96.449  42.907  1.00 11.15 ? 156  GLY A CA    1 
ATOM   1185  C  C     . GLY A 1 156  ? 94.089  96.078  43.754  1.00 11.75 ? 156  GLY A C     1 
ATOM   1186  O  O     . GLY A 1 156  ? 93.028  96.689  43.604  1.00 12.65 ? 156  GLY A O     1 
ATOM   1187  N  N     . LYS A 1 157  ? 94.223  95.074  44.611  1.00 12.81 ? 157  LYS A N     1 
ATOM   1188  C  CA    . LYS A 1 157  ? 93.162  94.713  45.578  1.00 13.35 ? 157  LYS A CA    1 
ATOM   1189  C  C     . LYS A 1 157  ? 92.974  95.825  46.618  1.00 13.77 ? 157  LYS A C     1 
ATOM   1190  O  O     . LYS A 1 157  ? 91.925  95.910  47.266  1.00 14.01 ? 157  LYS A O     1 
ATOM   1191  C  CB    . LYS A 1 157  ? 93.460  93.387  46.290  1.00 13.08 ? 157  LYS A CB    1 
ATOM   1192  C  CG    . LYS A 1 157  ? 93.799  92.210  45.368  1.00 14.27 ? 157  LYS A CG    1 
ATOM   1193  C  CD    . LYS A 1 157  ? 92.583  91.421  44.918  1.00 14.55 ? 157  LYS A CD    1 
ATOM   1194  C  CE    . LYS A 1 157  ? 92.871  90.740  43.578  1.00 14.15 ? 157  LYS A CE    1 
ATOM   1195  N  NZ    . LYS A 1 157  ? 93.201  89.307  43.765  1.00 11.46 ? 157  LYS A NZ    1 
ATOM   1196  N  N     . LYS A 1 158  ? 93.997  96.670  46.765  1.00 13.34 ? 158  LYS A N     1 
ATOM   1197  C  CA    . LYS A 1 158  ? 93.957  97.783  47.702  1.00 12.58 ? 158  LYS A CA    1 
ATOM   1198  C  C     . LYS A 1 158  ? 93.817  99.130  46.998  1.00 11.99 ? 158  LYS A C     1 
ATOM   1199  O  O     . LYS A 1 158  ? 94.169  100.164 47.570  1.00 12.41 ? 158  LYS A O     1 
ATOM   1200  C  CB    . LYS A 1 158  ? 95.185  97.759  48.614  1.00 12.70 ? 158  LYS A CB    1 
ATOM   1201  C  CG    . LYS A 1 158  ? 95.329  96.451  49.390  1.00 13.38 ? 158  LYS A CG    1 
ATOM   1202  C  CD    . LYS A 1 158  ? 96.478  96.482  50.357  1.00 15.15 ? 158  LYS A CD    1 
ATOM   1203  C  CE    . LYS A 1 158  ? 96.488  95.179  51.171  1.00 16.51 ? 158  LYS A CE    1 
ATOM   1204  N  NZ    . LYS A 1 158  ? 96.836  95.387  52.603  1.00 15.58 ? 158  LYS A NZ    1 
ATOM   1205  N  N     . LEU A 1 159  ? 93.318  99.114  45.762  1.00 10.75 ? 159  LEU A N     1 
ATOM   1206  C  CA    . LEU A 1 159  ? 93.107  100.334 45.004  1.00 10.46 ? 159  LEU A CA    1 
ATOM   1207  C  C     . LEU A 1 159  ? 92.494  101.430 45.878  1.00 9.88  ? 159  LEU A C     1 
ATOM   1208  O  O     . LEU A 1 159  ? 91.534  101.176 46.608  1.00 8.79  ? 159  LEU A O     1 
ATOM   1209  C  CB    . LEU A 1 159  ? 92.180  100.083 43.803  1.00 10.55 ? 159  LEU A CB    1 
ATOM   1210  C  CG    . LEU A 1 159  ? 91.779  101.311 42.978  1.00 11.02 ? 159  LEU A CG    1 
ATOM   1211  C  CD1   . LEU A 1 159  ? 92.954  101.813 42.144  1.00 12.42 ? 159  LEU A CD1   1 
ATOM   1212  C  CD2   . LEU A 1 159  ? 90.582  101.037 42.087  1.00 10.94 ? 159  LEU A CD2   1 
ATOM   1213  N  N     . ALA A 1 160  ? 93.048  102.641 45.775  1.00 8.99  ? 160  ALA A N     1 
ATOM   1214  C  CA    . ALA A 1 160  ? 92.472  103.825 46.409  1.00 8.97  ? 160  ALA A CA    1 
ATOM   1215  C  C     . ALA A 1 160  ? 92.852  105.034 45.568  1.00 8.98  ? 160  ALA A C     1 
ATOM   1216  O  O     . ALA A 1 160  ? 93.722  104.924 44.682  1.00 8.37  ? 160  ALA A O     1 
ATOM   1217  C  CB    . ALA A 1 160  ? 92.982  103.967 47.855  1.00 8.53  ? 160  ALA A CB    1 
ATOM   1218  N  N     . GLU A 1 161  ? 92.240  106.190 45.834  1.00 8.87  ? 161  GLU A N     1 
ATOM   1219  C  CA    . GLU A 1 161  ? 92.554  107.392 45.047  1.00 9.86  ? 161  GLU A CA    1 
ATOM   1220  C  C     . GLU A 1 161  ? 94.015  107.740 45.294  1.00 9.54  ? 161  GLU A C     1 
ATOM   1221  O  O     . GLU A 1 161  ? 94.639  108.509 44.557  1.00 10.50 ? 161  GLU A O     1 
ATOM   1222  C  CB    . GLU A 1 161  ? 91.618  108.563 45.396  1.00 9.64  ? 161  GLU A CB    1 
ATOM   1223  C  CG    . GLU A 1 161  ? 91.968  109.361 46.654  1.00 13.59 ? 161  GLU A CG    1 
ATOM   1224  C  CD    . GLU A 1 161  ? 91.494  110.815 46.588  1.00 17.73 ? 161  GLU A CD    1 
ATOM   1225  O  OE1   . GLU A 1 161  ? 91.380  111.463 47.653  1.00 20.26 ? 161  GLU A OE1   1 
ATOM   1226  O  OE2   . GLU A 1 161  ? 91.226  111.321 45.468  1.00 19.94 ? 161  GLU A OE2   1 
ATOM   1227  N  N     . ASP A 1 162  ? 94.525  107.074 46.323  1.00 9.02  ? 162  ASP A N     1 
ATOM   1228  C  CA    . ASP A 1 162  ? 95.750  107.358 47.023  1.00 9.28  ? 162  ASP A CA    1 
ATOM   1229  C  C     . ASP A 1 162  ? 96.841  106.296 46.844  1.00 8.15  ? 162  ASP A C     1 
ATOM   1230  O  O     . ASP A 1 162  ? 97.978  106.482 47.295  1.00 7.35  ? 162  ASP A O     1 
ATOM   1231  C  CB    . ASP A 1 162  ? 95.399  107.428 48.532  1.00 9.37  ? 162  ASP A CB    1 
ATOM   1232  C  CG    . ASP A 1 162  ? 96.075  108.547 49.174  1.00 12.62 ? 162  ASP A CG    1 
ATOM   1233  O  OD1   . ASP A 1 162  ? 96.899  109.144 48.433  1.00 18.73 ? 162  ASP A OD1   1 
ATOM   1234  O  OD2   . ASP A 1 162  ? 95.909  108.921 50.355  1.00 13.83 ? 162  ASP A OD2   1 
ATOM   1235  N  N     . PHE A 1 163  ? 96.477  105.180 46.225  1.00 6.78  ? 163  PHE A N     1 
ATOM   1236  C  CA    . PHE A 1 163  ? 97.328  104.004 46.170  1.00 6.16  ? 163  PHE A CA    1 
ATOM   1237  C  C     . PHE A 1 163  ? 96.980  103.238 44.905  1.00 5.93  ? 163  PHE A C     1 
ATOM   1238  O  O     . PHE A 1 163  ? 96.036  102.436 44.860  1.00 5.71  ? 163  PHE A O     1 
ATOM   1239  C  CB    . PHE A 1 163  ? 97.139  103.124 47.418  1.00 6.72  ? 163  PHE A CB    1 
ATOM   1240  C  CG    . PHE A 1 163  ? 98.090  101.940 47.491  1.00 7.39  ? 163  PHE A CG    1 
ATOM   1241  C  CD1   . PHE A 1 163  ? 99.454  102.096 47.231  1.00 9.50  ? 163  PHE A CD1   1 
ATOM   1242  C  CD2   . PHE A 1 163  ? 97.618  100.674 47.799  1.00 9.15  ? 163  PHE A CD2   1 
ATOM   1243  C  CE1   . PHE A 1 163  ? 100.347 100.999 47.298  1.00 9.26  ? 163  PHE A CE1   1 
ATOM   1244  C  CE2   . PHE A 1 163  ? 98.497  99.567  47.876  1.00 10.09 ? 163  PHE A CE2   1 
ATOM   1245  C  CZ    . PHE A 1 163  ? 99.870  99.740  47.626  1.00 8.39  ? 163  PHE A CZ    1 
ATOM   1246  N  N     . TYR A 1 164  ? 97.767  103.493 43.869  1.00 5.00  ? 164  TYR A N     1 
ATOM   1247  C  CA    . TYR A 1 164  ? 97.448  103.013 42.538  1.00 3.80  ? 164  TYR A CA    1 
ATOM   1248  C  C     . TYR A 1 164  ? 98.719  102.912 41.733  1.00 3.13  ? 164  TYR A C     1 
ATOM   1249  O  O     . TYR A 1 164  ? 99.518  103.846 41.717  1.00 2.55  ? 164  TYR A O     1 
ATOM   1250  C  CB    . TYR A 1 164  ? 96.488  103.985 41.851  1.00 3.72  ? 164  TYR A CB    1 
ATOM   1251  C  CG    . TYR A 1 164  ? 96.273  103.701 40.380  1.00 3.13  ? 164  TYR A CG    1 
ATOM   1252  C  CD1   . TYR A 1 164  ? 95.505  102.608 39.960  1.00 4.85  ? 164  TYR A CD1   1 
ATOM   1253  C  CD2   . TYR A 1 164  ? 96.826  104.527 39.414  1.00 4.46  ? 164  TYR A CD2   1 
ATOM   1254  C  CE1   . TYR A 1 164  ? 95.296  102.344 38.588  1.00 4.65  ? 164  TYR A CE1   1 
ATOM   1255  C  CE2   . TYR A 1 164  ? 96.621  104.288 38.038  1.00 4.59  ? 164  TYR A CE2   1 
ATOM   1256  C  CZ    . TYR A 1 164  ? 95.864  103.196 37.635  1.00 7.56  ? 164  TYR A CZ    1 
ATOM   1257  O  OH    . TYR A 1 164  ? 95.696  102.966 36.276  1.00 7.90  ? 164  TYR A OH    1 
ATOM   1258  N  N     . VAL A 1 165  ? 98.886  101.779 41.062  1.00 2.71  ? 165  VAL A N     1 
ATOM   1259  C  CA    . VAL A 1 165  ? 100.012 101.573 40.164  1.00 3.18  ? 165  VAL A CA    1 
ATOM   1260  C  C     . VAL A 1 165  ? 99.579  101.907 38.735  1.00 4.01  ? 165  VAL A C     1 
ATOM   1261  O  O     . VAL A 1 165  ? 98.730  101.204 38.164  1.00 3.88  ? 165  VAL A O     1 
ATOM   1262  C  CB    . VAL A 1 165  ? 100.529 100.120 40.196  1.00 3.31  ? 165  VAL A CB    1 
ATOM   1263  C  CG1   . VAL A 1 165  ? 101.774 99.980  39.311  1.00 3.78  ? 165  VAL A CG1   1 
ATOM   1264  C  CG2   . VAL A 1 165  ? 100.836 99.661  41.626  1.00 2.29  ? 165  VAL A CG2   1 
ATOM   1265  N  N     . CYS A 1 166  ? 100.166 102.966 38.177  1.00 3.84  ? 166  CYS A N     1 
ATOM   1266  C  CA    . CYS A 1 166  ? 99.869  103.419 36.819  1.00 5.24  ? 166  CYS A CA    1 
ATOM   1267  C  C     . CYS A 1 166  ? 100.367 102.444 35.762  1.00 4.96  ? 166  CYS A C     1 
ATOM   1268  O  O     . CYS A 1 166  ? 99.711  102.222 34.733  1.00 4.83  ? 166  CYS A O     1 
ATOM   1269  C  CB    . CYS A 1 166  ? 100.491 104.793 36.549  1.00 4.79  ? 166  CYS A CB    1 
ATOM   1270  S  SG    . CYS A 1 166  ? 99.900  106.116 37.614  1.00 8.65  ? 166  CYS A SG    1 
ATOM   1271  N  N     . SER A 1 167  ? 101.551 101.892 36.011  1.00 4.65  ? 167  SER A N     1 
ATOM   1272  C  CA    . SER A 1 167  ? 102.179 100.948 35.104  1.00 4.44  ? 167  SER A CA    1 
ATOM   1273  C  C     . SER A 1 167  ? 103.270 100.210 35.860  1.00 4.70  ? 167  SER A C     1 
ATOM   1274  O  O     . SER A 1 167  ? 103.891 100.774 36.771  1.00 4.03  ? 167  SER A O     1 
ATOM   1275  C  CB    . SER A 1 167  ? 102.775 101.678 33.890  1.00 4.14  ? 167  SER A CB    1 
ATOM   1276  O  OG    . SER A 1 167  ? 103.687 102.696 34.279  1.00 4.30  ? 167  SER A OG    1 
ATOM   1277  N  N     . PHE A 1 168  ? 103.494 98.959  35.476  1.00 4.33  ? 168  PHE A N     1 
ATOM   1278  C  CA    . PHE A 1 168  ? 104.544 98.126  36.068  1.00 4.51  ? 168  PHE A CA    1 
ATOM   1279  C  C     . PHE A 1 168  ? 104.985 97.162  34.983  1.00 3.86  ? 168  PHE A C     1 
ATOM   1280  O  O     . PHE A 1 168  ? 104.336 96.149  34.723  1.00 4.20  ? 168  PHE A O     1 
ATOM   1281  C  CB    . PHE A 1 168  ? 104.048 97.392  37.339  1.00 4.26  ? 168  PHE A CB    1 
ATOM   1282  C  CG    . PHE A 1 168  ? 105.131 97.101  38.363  1.00 5.62  ? 168  PHE A CG    1 
ATOM   1283  C  CD1   . PHE A 1 168  ? 106.475 97.266  38.066  1.00 4.56  ? 168  PHE A CD1   1 
ATOM   1284  C  CD2   . PHE A 1 168  ? 104.790 96.642  39.631  1.00 7.57  ? 168  PHE A CD2   1 
ATOM   1285  C  CE1   . PHE A 1 168  ? 107.462 97.002  39.023  1.00 5.97  ? 168  PHE A CE1   1 
ATOM   1286  C  CE2   . PHE A 1 168  ? 105.775 96.370  40.589  1.00 5.74  ? 168  PHE A CE2   1 
ATOM   1287  C  CZ    . PHE A 1 168  ? 107.104 96.557  40.278  1.00 5.73  ? 168  PHE A CZ    1 
ATOM   1288  N  N     . SER A 1 169  ? 106.101 97.504  34.349  1.00 3.91  ? 169  SER A N     1 
ATOM   1289  C  CA    . SER A 1 169  ? 106.555 96.863  33.132  1.00 4.13  ? 169  SER A CA    1 
ATOM   1290  C  C     . SER A 1 169  ? 108.052 97.113  32.922  1.00 4.60  ? 169  SER A C     1 
ATOM   1291  O  O     . SER A 1 169  ? 108.615 98.056  33.479  1.00 4.52  ? 169  SER A O     1 
ATOM   1292  C  CB    . SER A 1 169  ? 105.754 97.397  31.922  1.00 4.40  ? 169  SER A CB    1 
ATOM   1293  O  OG    . SER A 1 169  ? 106.395 97.076  30.681  1.00 4.63  ? 169  SER A OG    1 
ATOM   1294  N  N     . CYS A 1 170  ? 108.693 96.229  32.164  1.00 4.79  ? 170  CYS A N     1 
ATOM   1295  C  CA    . CYS A 1 170  ? 110.049 96.460  31.688  1.00 5.16  ? 170  CYS A CA    1 
ATOM   1296  C  C     . CYS A 1 170  ? 110.087 97.062  30.272  1.00 5.51  ? 170  CYS A C     1 
ATOM   1297  O  O     . CYS A 1 170  ? 111.172 97.195  29.683  1.00 5.25  ? 170  CYS A O     1 
ATOM   1298  C  CB    . CYS A 1 170  ? 110.877 95.171  31.757  1.00 5.41  ? 170  CYS A CB    1 
ATOM   1299  S  SG    . CYS A 1 170  ? 110.421 93.922  30.529  1.00 6.64  ? 170  CYS A SG    1 
ATOM   1300  N  N     . ARG A 1 171  ? 108.924 97.455  29.736  1.00 4.96  ? 171  ARG A N     1 
ATOM   1301  C  CA    . ARG A 1 171  ? 108.870 97.958  28.365  1.00 5.46  ? 171  ARG A CA    1 
ATOM   1302  C  C     . ARG A 1 171  ? 108.138 99.280  28.223  1.00 5.37  ? 171  ARG A C     1 
ATOM   1303  O  O     . ARG A 1 171  ? 108.400 100.035 27.287  1.00 5.81  ? 171  ARG A O     1 
ATOM   1304  C  CB    . ARG A 1 171  ? 108.204 96.939  27.436  1.00 5.36  ? 171  ARG A CB    1 
ATOM   1305  C  CG    . ARG A 1 171  ? 109.034 95.686  27.126  1.00 6.59  ? 171  ARG A CG    1 
ATOM   1306  C  CD    . ARG A 1 171  ? 108.197 94.628  26.423  1.00 7.14  ? 171  ARG A CD    1 
ATOM   1307  N  NE    . ARG A 1 171  ? 108.923 93.413  26.054  1.00 8.96  ? 171  ARG A NE    1 
ATOM   1308  C  CZ    . ARG A 1 171  ? 108.434 92.176  26.195  1.00 9.61  ? 171  ARG A CZ    1 
ATOM   1309  N  NH1   . ARG A 1 171  ? 107.215 91.978  26.703  1.00 9.70  ? 171  ARG A NH1   1 
ATOM   1310  N  NH2   . ARG A 1 171  ? 109.155 91.134  25.802  1.00 8.91  ? 171  ARG A NH2   1 
ATOM   1311  N  N     . THR A 1 172  ? 107.212 99.550  29.135  1.00 4.66  ? 172  THR A N     1 
ATOM   1312  C  CA    . THR A 1 172  ? 106.314 100.690 29.013  1.00 4.87  ? 172  THR A CA    1 
ATOM   1313  C  C     . THR A 1 172  ? 106.197 101.426 30.346  1.00 4.28  ? 172  THR A C     1 
ATOM   1314  O  O     . THR A 1 172  ? 106.369 100.831 31.414  1.00 3.02  ? 172  THR A O     1 
ATOM   1315  C  CB    . THR A 1 172  ? 104.902 100.185 28.557  1.00 4.81  ? 172  THR A CB    1 
ATOM   1316  O  OG1   . THR A 1 172  ? 103.987 101.255 28.576  1.00 9.86  ? 172  THR A OG1   1 
ATOM   1317  C  CG2   . THR A 1 172  ? 104.250 99.366  29.603  1.00 3.82  ? 172  THR A CG2   1 
ATOM   1318  N  N     . ILE A 1 173  ? 105.888 102.719 30.280  1.00 4.21  ? 173  ILE A N     1 
ATOM   1319  C  CA    . ILE A 1 173  ? 105.605 103.510 31.487  1.00 3.70  ? 173  ILE A CA    1 
ATOM   1320  C  C     . ILE A 1 173  ? 104.582 104.589 31.171  1.00 3.51  ? 173  ILE A C     1 
ATOM   1321  O  O     . ILE A 1 173  ? 104.568 105.131 30.058  1.00 2.25  ? 173  ILE A O     1 
ATOM   1322  C  CB    . ILE A 1 173  ? 106.901 104.159 32.045  1.00 4.21  ? 173  ILE A CB    1 
ATOM   1323  C  CG1   . ILE A 1 173  ? 106.667 104.725 33.459  1.00 4.15  ? 173  ILE A CG1   1 
ATOM   1324  C  CG2   . ILE A 1 173  ? 107.445 105.236 31.093  1.00 2.81  ? 173  ILE A CG2   1 
ATOM   1325  C  CD1   . ILE A 1 173  ? 107.975 104.950 34.239  1.00 5.27  ? 173  ILE A CD1   1 
ATOM   1326  N  N     . VAL A 1 174  ? 103.731 104.889 32.150  1.00 2.98  ? 174  VAL A N     1 
ATOM   1327  C  CA    . VAL A 1 174  ? 102.687 105.889 31.973  1.00 3.29  ? 174  VAL A CA    1 
ATOM   1328  C  C     . VAL A 1 174  ? 102.904 107.074 32.910  1.00 3.69  ? 174  VAL A C     1 
ATOM   1329  O  O     . VAL A 1 174  ? 103.008 106.893 34.125  1.00 3.84  ? 174  VAL A O     1 
ATOM   1330  C  CB    . VAL A 1 174  ? 101.290 105.273 32.187  1.00 3.84  ? 174  VAL A CB    1 
ATOM   1331  C  CG1   . VAL A 1 174  ? 100.201 106.348 32.157  1.00 4.48  ? 174  VAL A CG1   1 
ATOM   1332  C  CG2   . VAL A 1 174  ? 101.002 104.186 31.127  1.00 4.33  ? 174  VAL A CG2   1 
ATOM   1333  N  N     . TYR A 1 175  ? 102.978 108.281 32.338  1.00 3.37  ? 175  TYR A N     1 
ATOM   1334  C  CA    . TYR A 1 175  ? 102.982 109.521 33.115  1.00 3.91  ? 175  TYR A CA    1 
ATOM   1335  C  C     . TYR A 1 175  ? 101.617 110.175 32.906  1.00 3.77  ? 175  TYR A C     1 
ATOM   1336  O  O     . TYR A 1 175  ? 101.315 110.608 31.783  1.00 3.80  ? 175  TYR A O     1 
ATOM   1337  C  CB    . TYR A 1 175  ? 104.065 110.468 32.593  1.00 4.00  ? 175  TYR A CB    1 
ATOM   1338  C  CG    . TYR A 1 175  ? 105.462 110.209 33.100  1.00 4.99  ? 175  TYR A CG    1 
ATOM   1339  C  CD1   . TYR A 1 175  ? 106.232 109.159 32.592  1.00 4.41  ? 175  TYR A CD1   1 
ATOM   1340  C  CD2   . TYR A 1 175  ? 106.035 111.046 34.075  1.00 4.80  ? 175  TYR A CD2   1 
ATOM   1341  C  CE1   . TYR A 1 175  ? 107.538 108.927 33.064  1.00 3.03  ? 175  TYR A CE1   1 
ATOM   1342  C  CE2   . TYR A 1 175  ? 107.326 110.832 34.543  1.00 4.95  ? 175  TYR A CE2   1 
ATOM   1343  C  CZ    . TYR A 1 175  ? 108.078 109.765 34.034  1.00 6.03  ? 175  TYR A CZ    1 
ATOM   1344  O  OH    . TYR A 1 175  ? 109.365 109.553 34.494  1.00 4.09  ? 175  TYR A OH    1 
ATOM   1345  N  N     . LYS A 1 176  ? 100.788 110.247 33.947  1.00 3.34  ? 176  LYS A N     1 
ATOM   1346  C  CA    . LYS A 1 176  ? 99.447  110.827 33.788  1.00 3.88  ? 176  LYS A CA    1 
ATOM   1347  C  C     . LYS A 1 176  ? 99.043  111.678 34.992  1.00 4.67  ? 176  LYS A C     1 
ATOM   1348  O  O     . LYS A 1 176  ? 99.576  111.496 36.094  1.00 4.14  ? 176  LYS A O     1 
ATOM   1349  C  CB    . LYS A 1 176  ? 98.391  109.735 33.529  1.00 3.98  ? 176  LYS A CB    1 
ATOM   1350  C  CG    . LYS A 1 176  ? 98.138  108.771 34.680  1.00 3.92  ? 176  LYS A CG    1 
ATOM   1351  C  CD    . LYS A 1 176  ? 97.248  107.606 34.218  1.00 4.05  ? 176  LYS A CD    1 
ATOM   1352  C  CE    . LYS A 1 176  ? 96.520  106.939 35.381  1.00 4.45  ? 176  LYS A CE    1 
ATOM   1353  N  NZ    . LYS A 1 176  ? 95.787  105.710 34.938  1.00 6.30  ? 176  LYS A NZ    1 
ATOM   1354  N  N     . GLY A 1 177  ? 98.099  112.591 34.785  1.00 4.65  ? 177  GLY A N     1 
ATOM   1355  C  CA    . GLY A 1 177  ? 97.576  113.364 35.896  1.00 4.96  ? 177  GLY A CA    1 
ATOM   1356  C  C     . GLY A 1 177  ? 96.333  114.171 35.595  1.00 5.26  ? 177  GLY A C     1 
ATOM   1357  O  O     . GLY A 1 177  ? 95.879  114.225 34.463  1.00 4.82  ? 177  GLY A O     1 
ATOM   1358  N  N     . MET A 1 178  ? 95.800  114.799 36.642  1.00 5.58  ? 178  MET A N     1 
ATOM   1359  C  CA    . MET A 1 178  ? 94.579  115.604 36.573  1.00 5.73  ? 178  MET A CA    1 
ATOM   1360  C  C     . MET A 1 178  ? 94.895  117.042 36.140  1.00 5.69  ? 178  MET A C     1 
ATOM   1361  O  O     . MET A 1 178  ? 94.768  118.023 36.899  1.00 5.45  ? 178  MET A O     1 
ATOM   1362  C  CB    . MET A 1 178  ? 93.813  115.506 37.882  1.00 5.78  ? 178  MET A CB    1 
ATOM   1363  C  CG    . MET A 1 178  ? 93.583  114.043 38.323  1.00 5.72  ? 178  MET A CG    1 
ATOM   1364  S  SD    . MET A 1 178  ? 93.116  112.954 36.952  1.00 12.04 ? 178  MET A SD    1 
ATOM   1365  C  CE    . MET A 1 178  ? 91.421  113.301 36.886  1.00 5.95  ? 178  MET A CE    1 
ATOM   1366  N  N     . VAL A 1 179  ? 95.317  117.133 34.885  1.00 5.65  ? 179  VAL A N     1 
ATOM   1367  C  CA    . VAL A 1 179  ? 95.903  118.352 34.326  1.00 5.63  ? 179  VAL A CA    1 
ATOM   1368  C  C     . VAL A 1 179  ? 95.348  118.641 32.938  1.00 5.85  ? 179  VAL A C     1 
ATOM   1369  O  O     . VAL A 1 179  ? 94.922  117.728 32.219  1.00 5.94  ? 179  VAL A O     1 
ATOM   1370  C  CB    . VAL A 1 179  ? 97.451  118.225 34.236  1.00 6.07  ? 179  VAL A CB    1 
ATOM   1371  C  CG1   . VAL A 1 179  ? 98.053  118.224 35.611  1.00 5.99  ? 179  VAL A CG1   1 
ATOM   1372  C  CG2   . VAL A 1 179  ? 97.881  116.948 33.467  1.00 5.91  ? 179  VAL A CG2   1 
ATOM   1373  N  N     . ARG A 1 180  ? 95.329  119.922 32.575  1.00 5.61  ? 180  ARG A N     1 
ATOM   1374  C  CA    . ARG A 1 180  ? 95.153  120.302 31.184  1.00 6.08  ? 180  ARG A CA    1 
ATOM   1375  C  C     . ARG A 1 180  ? 96.385  119.883 30.367  1.00 6.13  ? 180  ARG A C     1 
ATOM   1376  O  O     . ARG A 1 180  ? 97.479  119.738 30.925  1.00 5.39  ? 180  ARG A O     1 
ATOM   1377  C  CB    . ARG A 1 180  ? 94.909  121.799 31.069  1.00 6.43  ? 180  ARG A CB    1 
ATOM   1378  C  CG    . ARG A 1 180  ? 93.581  122.238 31.649  1.00 5.82  ? 180  ARG A CG    1 
ATOM   1379  C  CD    . ARG A 1 180  ? 93.405  123.745 31.693  1.00 7.45  ? 180  ARG A CD    1 
ATOM   1380  N  NE    . ARG A 1 180  ? 94.238  124.381 32.711  1.00 7.08  ? 180  ARG A NE    1 
ATOM   1381  C  CZ    . ARG A 1 180  ? 95.246  125.227 32.459  1.00 9.03  ? 180  ARG A CZ    1 
ATOM   1382  N  NH1   . ARG A 1 180  ? 95.570  125.558 31.211  1.00 6.03  ? 180  ARG A NH1   1 
ATOM   1383  N  NH2   . ARG A 1 180  ? 95.929  125.756 33.470  1.00 6.78  ? 180  ARG A NH2   1 
ATOM   1384  N  N     . SER A 1 181  ? 96.205  119.707 29.054  1.00 6.15  ? 181  SER A N     1 
ATOM   1385  C  CA    . SER A 1 181  ? 97.256  119.130 28.191  1.00 6.63  ? 181  SER A CA    1 
ATOM   1386  C  C     . SER A 1 181  ? 98.602  119.838 28.307  1.00 6.60  ? 181  SER A C     1 
ATOM   1387  O  O     . SER A 1 181  ? 99.639  119.196 28.468  1.00 6.55  ? 181  SER A O     1 
ATOM   1388  C  CB    . SER A 1 181  ? 96.837  119.138 26.722  1.00 6.62  ? 181  SER A CB    1 
ATOM   1389  O  OG    . SER A 1 181  ? 95.795  118.214 26.471  1.00 9.08  ? 181  SER A OG    1 
ATOM   1390  N  N     . ILE A 1 182  ? 98.589  121.160 28.235  1.00 6.69  ? 182  ILE A N     1 
ATOM   1391  C  CA    . ILE A 1 182  ? 99.847  121.907 28.268  1.00 7.57  ? 182  ILE A CA    1 
ATOM   1392  C  C     . ILE A 1 182  ? 100.471 121.927 29.666  1.00 7.01  ? 182  ILE A C     1 
ATOM   1393  O  O     . ILE A 1 182  ? 101.632 122.324 29.830  1.00 7.95  ? 182  ILE A O     1 
ATOM   1394  C  CB    . ILE A 1 182  ? 99.707  123.344 27.658  1.00 7.92  ? 182  ILE A CB    1 
ATOM   1395  C  CG1   . ILE A 1 182  ? 99.286  124.388 28.707  1.00 9.85  ? 182  ILE A CG1   1 
ATOM   1396  C  CG2   . ILE A 1 182  ? 98.851  123.344 26.356  1.00 9.65  ? 182  ILE A CG2   1 
ATOM   1397  C  CD1   . ILE A 1 182  ? 97.885  124.259 29.226  1.00 11.11 ? 182  ILE A CD1   1 
ATOM   1398  N  N     . ILE A 1 183  ? 99.711  121.487 30.667  1.00 6.14  ? 183  ILE A N     1 
ATOM   1399  C  CA    . ILE A 1 183  ? 100.220 121.433 32.041  1.00 5.38  ? 183  ILE A CA    1 
ATOM   1400  C  C     . ILE A 1 183  ? 101.007 120.132 32.330  1.00 5.29  ? 183  ILE A C     1 
ATOM   1401  O  O     . ILE A 1 183  ? 101.874 120.118 33.203  1.00 4.94  ? 183  ILE A O     1 
ATOM   1402  C  CB    . ILE A 1 183  ? 99.063  121.688 33.060  1.00 5.77  ? 183  ILE A CB    1 
ATOM   1403  C  CG1   . ILE A 1 183  ? 98.429  123.071 32.835  1.00 4.85  ? 183  ILE A CG1   1 
ATOM   1404  C  CG2   . ILE A 1 183  ? 99.504  121.492 34.534  1.00 5.12  ? 183  ILE A CG2   1 
ATOM   1405  C  CD1   . ILE A 1 183  ? 99.377  124.276 32.994  1.00 6.16  ? 183  ILE A CD1   1 
ATOM   1406  N  N     . LEU A 1 184  ? 100.727 119.066 31.573  1.00 5.03  ? 184  LEU A N     1 
ATOM   1407  C  CA    . LEU A 1 184  ? 101.312 117.732 31.840  1.00 5.23  ? 184  LEU A CA    1 
ATOM   1408  C  C     . LEU A 1 184  ? 102.852 117.764 31.910  1.00 5.31  ? 184  LEU A C     1 
ATOM   1409  O  O     . LEU A 1 184  ? 103.449 117.326 32.896  1.00 4.89  ? 184  LEU A O     1 
ATOM   1410  C  CB    . LEU A 1 184  ? 100.822 116.681 30.822  1.00 4.36  ? 184  LEU A CB    1 
ATOM   1411  C  CG    . LEU A 1 184  ? 101.294 115.228 31.064  1.00 5.84  ? 184  LEU A CG    1 
ATOM   1412  C  CD1   . LEU A 1 184  ? 100.590 114.607 32.269  1.00 6.06  ? 184  LEU A CD1   1 
ATOM   1413  C  CD2   . LEU A 1 184  ? 101.137 114.326 29.853  1.00 6.70  ? 184  LEU A CD2   1 
ATOM   1414  N  N     . GLY A 1 185  ? 103.471 118.327 30.879  1.00 5.36  ? 185  GLY A N     1 
ATOM   1415  C  CA    . GLY A 1 185  ? 104.912 118.484 30.834  1.00 5.68  ? 185  GLY A CA    1 
ATOM   1416  C  C     . GLY A 1 185  ? 105.456 119.561 31.758  1.00 6.19  ? 185  GLY A C     1 
ATOM   1417  O  O     . GLY A 1 185  ? 106.647 119.588 32.004  1.00 6.18  ? 185  GLY A O     1 
ATOM   1418  N  N     . GLU A 1 186  ? 104.605 120.454 32.258  1.00 6.03  ? 186  GLU A N     1 
ATOM   1419  C  CA    . GLU A 1 186  ? 105.070 121.427 33.241  1.00 6.40  ? 186  GLU A CA    1 
ATOM   1420  C  C     . GLU A 1 186  ? 105.022 120.806 34.638  1.00 5.62  ? 186  GLU A C     1 
ATOM   1421  O  O     . GLU A 1 186  ? 105.795 121.186 35.504  1.00 4.97  ? 186  GLU A O     1 
ATOM   1422  C  CB    . GLU A 1 186  ? 104.257 122.733 33.200  1.00 6.83  ? 186  GLU A CB    1 
ATOM   1423  C  CG    . GLU A 1 186  ? 104.162 123.440 31.844  1.00 9.67  ? 186  GLU A CG    1 
ATOM   1424  C  CD    . GLU A 1 186  ? 105.503 123.800 31.216  1.00 13.77 ? 186  GLU A CD    1 
ATOM   1425  O  OE1   . GLU A 1 186  ? 106.489 124.046 31.950  1.00 15.28 ? 186  GLU A OE1   1 
ATOM   1426  O  OE2   . GLU A 1 186  ? 105.572 123.835 29.964  1.00 16.52 ? 186  GLU A OE2   1 
ATOM   1427  N  N     . PHE A 1 187  ? 104.119 119.844 34.848  1.00 5.07  ? 187  PHE A N     1 
ATOM   1428  C  CA    . PHE A 1 187  ? 104.031 119.137 36.128  1.00 5.17  ? 187  PHE A CA    1 
ATOM   1429  C  C     . PHE A 1 187  ? 105.143 118.094 36.254  1.00 5.44  ? 187  PHE A C     1 
ATOM   1430  O  O     . PHE A 1 187  ? 105.908 118.118 37.220  1.00 5.94  ? 187  PHE A O     1 
ATOM   1431  C  CB    . PHE A 1 187  ? 102.657 118.479 36.339  1.00 4.35  ? 187  PHE A CB    1 
ATOM   1432  C  CG    . PHE A 1 187  ? 102.564 117.682 37.623  1.00 4.60  ? 187  PHE A CG    1 
ATOM   1433  C  CD1   . PHE A 1 187  ? 102.610 118.321 38.863  1.00 3.67  ? 187  PHE A CD1   1 
ATOM   1434  C  CD2   . PHE A 1 187  ? 102.473 116.296 37.590  1.00 3.62  ? 187  PHE A CD2   1 
ATOM   1435  C  CE1   . PHE A 1 187  ? 102.547 117.591 40.049  1.00 3.81  ? 187  PHE A CE1   1 
ATOM   1436  C  CE2   . PHE A 1 187  ? 102.404 115.562 38.765  1.00 5.32  ? 187  PHE A CE2   1 
ATOM   1437  C  CZ    . PHE A 1 187  ? 102.430 116.219 40.002  1.00 5.21  ? 187  PHE A CZ    1 
ATOM   1438  N  N     . TYR A 1 188  ? 105.228 117.182 35.286  1.00 5.14  ? 188  TYR A N     1 
ATOM   1439  C  CA    . TYR A 1 188  ? 106.293 116.178 35.271  1.00 5.56  ? 188  TYR A CA    1 
ATOM   1440  C  C     . TYR A 1 188  ? 107.562 116.716 34.620  1.00 6.22  ? 188  TYR A C     1 
ATOM   1441  O  O     . TYR A 1 188  ? 107.671 116.723 33.393  1.00 6.77  ? 188  TYR A O     1 
ATOM   1442  C  CB    . TYR A 1 188  ? 105.844 114.916 34.515  1.00 5.22  ? 188  TYR A CB    1 
ATOM   1443  C  CG    . TYR A 1 188  ? 104.816 114.083 35.232  1.00 4.58  ? 188  TYR A CG    1 
ATOM   1444  C  CD1   . TYR A 1 188  ? 103.498 114.014 34.765  1.00 4.71  ? 188  TYR A CD1   1 
ATOM   1445  C  CD2   . TYR A 1 188  ? 105.158 113.351 36.378  1.00 4.08  ? 188  TYR A CD2   1 
ATOM   1446  C  CE1   . TYR A 1 188  ? 102.547 113.219 35.418  1.00 5.92  ? 188  TYR A CE1   1 
ATOM   1447  C  CE2   . TYR A 1 188  ? 104.216 112.560 37.041  1.00 3.78  ? 188  TYR A CE2   1 
ATOM   1448  C  CZ    . TYR A 1 188  ? 102.922 112.491 36.559  1.00 5.19  ? 188  TYR A CZ    1 
ATOM   1449  O  OH    . TYR A 1 188  ? 101.998 111.710 37.215  1.00 4.44  ? 188  TYR A OH    1 
ATOM   1450  N  N     . LEU A 1 189  ? 108.534 117.126 35.438  1.00 6.59  ? 189  LEU A N     1 
ATOM   1451  C  CA    . LEU A 1 189  ? 109.833 117.596 34.933  1.00 7.12  ? 189  LEU A CA    1 
ATOM   1452  C  C     . LEU A 1 189  ? 110.511 116.591 33.983  1.00 6.63  ? 189  LEU A C     1 
ATOM   1453  O  O     . LEU A 1 189  ? 111.194 116.992 33.033  1.00 6.42  ? 189  LEU A O     1 
ATOM   1454  C  CB    . LEU A 1 189  ? 110.787 117.967 36.090  1.00 6.97  ? 189  LEU A CB    1 
ATOM   1455  C  CG    . LEU A 1 189  ? 110.417 119.062 37.120  1.00 9.58  ? 189  LEU A CG    1 
ATOM   1456  C  CD1   . LEU A 1 189  ? 111.641 119.904 37.474  1.00 12.03 ? 189  LEU A CD1   1 
ATOM   1457  C  CD2   . LEU A 1 189  ? 109.250 119.963 36.695  1.00 9.10  ? 189  LEU A CD2   1 
ATOM   1458  N  N     . ASP A 1 190  ? 110.324 115.294 34.238  1.00 6.38  ? 190  ASP A N     1 
ATOM   1459  C  CA    . ASP A 1 190  ? 110.888 114.243 33.372  1.00 6.05  ? 190  ASP A CA    1 
ATOM   1460  C  C     . ASP A 1 190  ? 110.527 114.442 31.911  1.00 5.99  ? 190  ASP A C     1 
ATOM   1461  O  O     . ASP A 1 190  ? 111.359 114.241 31.036  1.00 5.58  ? 190  ASP A O     1 
ATOM   1462  C  CB    . ASP A 1 190  ? 110.414 112.850 33.789  1.00 6.28  ? 190  ASP A CB    1 
ATOM   1463  C  CG    . ASP A 1 190  ? 111.069 112.362 35.068  1.00 6.90  ? 190  ASP A CG    1 
ATOM   1464  O  OD1   . ASP A 1 190  ? 112.150 112.888 35.448  1.00 5.54  ? 190  ASP A OD1   1 
ATOM   1465  O  OD2   . ASP A 1 190  ? 110.563 111.442 35.748  1.00 6.36  ? 190  ASP A OD2   1 
ATOM   1466  N  N     . LEU A 1 191  ? 109.282 114.834 31.656  1.00 6.20  ? 191  LEU A N     1 
ATOM   1467  C  CA    . LEU A 1 191  ? 108.787 114.967 30.289  1.00 7.00  ? 191  LEU A CA    1 
ATOM   1468  C  C     . LEU A 1 191  ? 109.424 116.097 29.492  1.00 7.28  ? 191  LEU A C     1 
ATOM   1469  O  O     . LEU A 1 191  ? 109.408 116.062 28.266  1.00 8.25  ? 191  LEU A O     1 
ATOM   1470  C  CB    . LEU A 1 191  ? 107.262 115.081 30.284  1.00 6.98  ? 191  LEU A CB    1 
ATOM   1471  C  CG    . LEU A 1 191  ? 106.365 113.842 30.119  1.00 8.76  ? 191  LEU A CG    1 
ATOM   1472  C  CD1   . LEU A 1 191  ? 107.017 112.470 30.319  1.00 11.24 ? 191  LEU A CD1   1 
ATOM   1473  C  CD2   . LEU A 1 191  ? 105.072 113.979 30.919  1.00 7.96  ? 191  LEU A CD2   1 
ATOM   1474  N  N     . LYS A 1 192  ? 109.967 117.102 30.175  1.00 7.72  ? 192  LYS A N     1 
ATOM   1475  C  CA    . LYS A 1 192  ? 110.687 118.188 29.513  1.00 8.15  ? 192  LYS A CA    1 
ATOM   1476  C  C     . LYS A 1 192  ? 112.203 118.022 29.616  1.00 7.80  ? 192  LYS A C     1 
ATOM   1477  O  O     . LYS A 1 192  ? 112.941 118.886 29.160  1.00 8.24  ? 192  LYS A O     1 
ATOM   1478  C  CB    . LYS A 1 192  ? 110.260 119.551 30.070  1.00 8.85  ? 192  LYS A CB    1 
ATOM   1479  C  CG    . LYS A 1 192  ? 108.969 120.091 29.476  1.00 10.82 ? 192  LYS A CG    1 
ATOM   1480  C  CD    . LYS A 1 192  ? 109.010 121.624 29.327  1.00 15.48 ? 192  LYS A CD    1 
ATOM   1481  C  CE    . LYS A 1 192  ? 108.104 122.093 28.203  1.00 17.24 ? 192  LYS A CE    1 
ATOM   1482  N  NZ    . LYS A 1 192  ? 106.952 121.175 28.056  1.00 19.10 ? 192  LYS A NZ    1 
ATOM   1483  N  N     . ASN A 1 193  ? 112.652 116.931 30.242  1.00 7.32  ? 193  ASN A N     1 
ATOM   1484  C  CA    . ASN A 1 193  ? 114.075 116.565 30.282  1.00 7.22  ? 193  ASN A CA    1 
ATOM   1485  C  C     . ASN A 1 193  ? 114.531 116.032 28.926  1.00 7.11  ? 193  ASN A C     1 
ATOM   1486  O  O     . ASN A 1 193  ? 114.034 114.997 28.470  1.00 7.32  ? 193  ASN A O     1 
ATOM   1487  C  CB    . ASN A 1 193  ? 114.325 115.491 31.345  1.00 6.78  ? 193  ASN A CB    1 
ATOM   1488  C  CG    . ASN A 1 193  ? 115.791 115.325 31.683  1.00 7.21  ? 193  ASN A CG    1 
ATOM   1489  O  OD1   . ASN A 1 193  ? 116.653 115.228 30.802  1.00 6.38  ? 193  ASN A OD1   1 
ATOM   1490  N  ND2   . ASN A 1 193  ? 116.084 115.292 32.970  1.00 6.74  ? 193  ASN A ND2   1 
ATOM   1491  N  N     . PRO A 1 194  ? 115.473 116.720 28.282  1.00 7.41  ? 194  PRO A N     1 
ATOM   1492  C  CA    . PRO A 1 194  ? 115.952 116.315 26.955  1.00 7.56  ? 194  PRO A CA    1 
ATOM   1493  C  C     . PRO A 1 194  ? 116.546 114.893 26.948  1.00 7.49  ? 194  PRO A C     1 
ATOM   1494  O  O     . PRO A 1 194  ? 116.660 114.280 25.887  1.00 7.83  ? 194  PRO A O     1 
ATOM   1495  C  CB    . PRO A 1 194  ? 117.015 117.376 26.625  1.00 8.10  ? 194  PRO A CB    1 
ATOM   1496  C  CG    . PRO A 1 194  ? 117.403 117.953 27.941  1.00 8.09  ? 194  PRO A CG    1 
ATOM   1497  C  CD    . PRO A 1 194  ? 116.169 117.921 28.782  1.00 7.85  ? 194  PRO A CD    1 
ATOM   1498  N  N     . GLY A 1 195  ? 116.900 114.388 28.126  1.00 7.16  ? 195  GLY A N     1 
ATOM   1499  C  CA    . GLY A 1 195  ? 117.306 113.005 28.303  1.00 7.07  ? 195  GLY A CA    1 
ATOM   1500  C  C     . GLY A 1 195  ? 116.190 111.975 28.238  1.00 6.83  ? 195  GLY A C     1 
ATOM   1501  O  O     . GLY A 1 195  ? 116.476 110.771 28.213  1.00 7.68  ? 195  GLY A O     1 
ATOM   1502  N  N     . TYR A 1 196  ? 114.932 112.430 28.231  1.00 6.23  ? 196  TYR A N     1 
ATOM   1503  C  CA    . TYR A 1 196  ? 113.784 111.538 28.050  1.00 5.62  ? 196  TYR A CA    1 
ATOM   1504  C  C     . TYR A 1 196  ? 113.570 111.286 26.559  1.00 5.61  ? 196  TYR A C     1 
ATOM   1505  O  O     . TYR A 1 196  ? 113.215 112.194 25.810  1.00 5.01  ? 196  TYR A O     1 
ATOM   1506  C  CB    . TYR A 1 196  ? 112.514 112.128 28.675  1.00 5.33  ? 196  TYR A CB    1 
ATOM   1507  C  CG    . TYR A 1 196  ? 111.422 111.131 29.009  1.00 4.80  ? 196  TYR A CG    1 
ATOM   1508  C  CD1   . TYR A 1 196  ? 110.926 111.036 30.305  1.00 4.72  ? 196  TYR A CD1   1 
ATOM   1509  C  CD2   . TYR A 1 196  ? 110.856 110.311 28.028  1.00 5.45  ? 196  TYR A CD2   1 
ATOM   1510  C  CE1   . TYR A 1 196  ? 109.914 110.130 30.635  1.00 5.53  ? 196  TYR A CE1   1 
ATOM   1511  C  CE2   . TYR A 1 196  ? 109.840 109.405 28.345  1.00 4.66  ? 196  TYR A CE2   1 
ATOM   1512  C  CZ    . TYR A 1 196  ? 109.365 109.332 29.646  1.00 5.26  ? 196  TYR A CZ    1 
ATOM   1513  O  OH    . TYR A 1 196  ? 108.356 108.442 29.978  1.00 6.51  ? 196  TYR A OH    1 
ATOM   1514  N  N     . THR A 1 197  ? 113.792 110.035 26.147  1.00 5.55  ? 197  THR A N     1 
ATOM   1515  C  CA    . THR A 1 197  ? 113.642 109.616 24.760  1.00 5.00  ? 197  THR A CA    1 
ATOM   1516  C  C     . THR A 1 197  ? 112.771 108.370 24.685  1.00 4.75  ? 197  THR A C     1 
ATOM   1517  O  O     . THR A 1 197  ? 112.691 107.612 25.652  1.00 5.04  ? 197  THR A O     1 
ATOM   1518  C  CB    . THR A 1 197  ? 115.014 109.325 24.115  1.00 5.33  ? 197  THR A CB    1 
ATOM   1519  O  OG1   . THR A 1 197  ? 115.634 108.209 24.768  1.00 5.39  ? 197  THR A OG1   1 
ATOM   1520  C  CG2   . THR A 1 197  ? 115.994 110.481 24.347  1.00 5.80  ? 197  THR A CG2   1 
ATOM   1521  N  N     . SER A 1 198  ? 112.124 108.155 23.539  1.00 4.05  ? 198  SER A N     1 
ATOM   1522  C  CA    . SER A 1 198  ? 111.225 107.007 23.348  1.00 3.98  ? 198  SER A CA    1 
ATOM   1523  C  C     . SER A 1 198  ? 110.932 106.862 21.884  1.00 4.44  ? 198  SER A C     1 
ATOM   1524  O  O     . SER A 1 198  ? 110.783 107.873 21.185  1.00 4.51  ? 198  SER A O     1 
ATOM   1525  C  CB    . SER A 1 198  ? 109.892 107.217 24.074  1.00 3.93  ? 198  SER A CB    1 
ATOM   1526  O  OG    . SER A 1 198  ? 109.033 106.102 23.917  1.00 3.20  ? 198  SER A OG    1 
ATOM   1527  N  N     . ASN A 1 199  ? 110.835 105.616 21.420  1.00 4.71  ? 199  ASN A N     1 
ATOM   1528  C  CA    . ASN A 1 199  ? 110.453 105.357 20.032  1.00 4.97  ? 199  ASN A CA    1 
ATOM   1529  C  C     . ASN A 1 199  ? 108.943 105.398 19.787  1.00 4.22  ? 199  ASN A C     1 
ATOM   1530  O  O     . ASN A 1 199  ? 108.497 105.310 18.643  1.00 3.35  ? 199  ASN A O     1 
ATOM   1531  C  CB    . ASN A 1 199  ? 111.012 104.022 19.543  1.00 5.47  ? 199  ASN A CB    1 
ATOM   1532  C  CG    . ASN A 1 199  ? 112.477 104.093 19.226  1.00 9.26  ? 199  ASN A CG    1 
ATOM   1533  O  OD1   . ASN A 1 199  ? 112.887 104.546 18.131  1.00 13.82 ? 199  ASN A OD1   1 
ATOM   1534  N  ND2   . ASN A 1 199  ? 113.296 103.614 20.159  1.00 12.02 ? 199  ASN A ND2   1 
ATOM   1535  N  N     . PHE A 1 200  ? 108.157 105.524 20.851  1.00 3.80  ? 200  PHE A N     1 
ATOM   1536  C  CA    . PHE A 1 200  ? 106.716 105.659 20.682  1.00 3.87  ? 200  PHE A CA    1 
ATOM   1537  C  C     . PHE A 1 200  ? 106.101 106.452 21.818  1.00 4.00  ? 200  PHE A C     1 
ATOM   1538  O  O     . PHE A 1 200  ? 106.717 106.605 22.892  1.00 3.14  ? 200  PHE A O     1 
ATOM   1539  C  CB    . PHE A 1 200  ? 106.035 104.275 20.579  1.00 4.17  ? 200  PHE A CB    1 
ATOM   1540  C  CG    . PHE A 1 200  ? 105.684 103.670 21.921  1.00 5.67  ? 200  PHE A CG    1 
ATOM   1541  C  CD1   . PHE A 1 200  ? 104.425 103.877 22.491  1.00 5.14  ? 200  PHE A CD1   1 
ATOM   1542  C  CD2   . PHE A 1 200  ? 106.612 102.892 22.609  1.00 6.22  ? 200  PHE A CD2   1 
ATOM   1543  C  CE1   . PHE A 1 200  ? 104.101 103.344 23.752  1.00 5.36  ? 200  PHE A CE1   1 
ATOM   1544  C  CE2   . PHE A 1 200  ? 106.299 102.344 23.859  1.00 7.38  ? 200  PHE A CE2   1 
ATOM   1545  C  CZ    . PHE A 1 200  ? 105.034 102.572 24.433  1.00 5.58  ? 200  PHE A CZ    1 
ATOM   1546  N  N     . ALA A 1 201  ? 104.889 106.955 21.571  1.00 3.41  ? 201  ALA A N     1 
ATOM   1547  C  CA    . ALA A 1 201  ? 104.037 107.491 22.627  1.00 4.28  ? 201  ALA A CA    1 
ATOM   1548  C  C     . ALA A 1 201  ? 102.565 107.230 22.283  1.00 4.71  ? 201  ALA A C     1 
ATOM   1549  O  O     . ALA A 1 201  ? 102.172 107.322 21.115  1.00 4.95  ? 201  ALA A O     1 
ATOM   1550  C  CB    . ALA A 1 201  ? 104.267 108.984 22.828  1.00 3.65  ? 201  ALA A CB    1 
ATOM   1551  N  N     . VAL A 1 202  ? 101.792 106.868 23.301  1.00 4.51  ? 202  VAL A N     1 
ATOM   1552  C  CA    . VAL A 1 202  ? 100.328 106.850 23.258  1.00 4.82  ? 202  VAL A CA    1 
ATOM   1553  C  C     . VAL A 1 202  ? 99.879  107.991 24.185  1.00 5.67  ? 202  VAL A C     1 
ATOM   1554  O  O     . VAL A 1 202  ? 100.244 107.986 25.365  1.00 6.40  ? 202  VAL A O     1 
ATOM   1555  C  CB    . VAL A 1 202  ? 99.783  105.489 23.791  1.00 4.55  ? 202  VAL A CB    1 
ATOM   1556  C  CG1   . VAL A 1 202  ? 98.262  105.495 23.846  1.00 5.03  ? 202  VAL A CG1   1 
ATOM   1557  C  CG2   . VAL A 1 202  ? 100.291 104.296 22.929  1.00 3.32  ? 202  VAL A CG2   1 
ATOM   1558  N  N     . TYR A 1 203  ? 99.131  108.973 23.670  1.00 5.09  ? 203  TYR A N     1 
ATOM   1559  C  CA    . TYR A 1 203  ? 98.686  110.112 24.486  1.00 5.15  ? 203  TYR A CA    1 
ATOM   1560  C  C     . TYR A 1 203  ? 97.163  110.141 24.626  1.00 4.76  ? 203  TYR A C     1 
ATOM   1561  O  O     . TYR A 1 203  ? 96.455  109.653 23.749  1.00 4.92  ? 203  TYR A O     1 
ATOM   1562  C  CB    . TYR A 1 203  ? 99.219  111.438 23.929  1.00 4.95  ? 203  TYR A CB    1 
ATOM   1563  C  CG    . TYR A 1 203  ? 98.724  111.762 22.525  1.00 6.07  ? 203  TYR A CG    1 
ATOM   1564  C  CD1   . TYR A 1 203  ? 97.518  112.444 22.328  1.00 7.52  ? 203  TYR A CD1   1 
ATOM   1565  C  CD2   . TYR A 1 203  ? 99.444  111.358 21.399  1.00 6.47  ? 203  TYR A CD2   1 
ATOM   1566  C  CE1   . TYR A 1 203  ? 97.046  112.712 21.028  1.00 8.39  ? 203  TYR A CE1   1 
ATOM   1567  C  CE2   . TYR A 1 203  ? 98.996  111.632 20.118  1.00 9.26  ? 203  TYR A CE2   1 
ATOM   1568  C  CZ    . TYR A 1 203  ? 97.800  112.306 19.936  1.00 9.51  ? 203  TYR A CZ    1 
ATOM   1569  O  OH    . TYR A 1 203  ? 97.363  112.568 18.658  1.00 10.29 ? 203  TYR A OH    1 
ATOM   1570  N  N     . HIS A 1 204  ? 96.660  110.697 25.719  1.00 3.55  ? 204  HIS A N     1 
ATOM   1571  C  CA    . HIS A 1 204  ? 95.212  110.731 25.947  1.00 3.33  ? 204  HIS A CA    1 
ATOM   1572  C  C     . HIS A 1 204  ? 94.841  111.989 26.724  1.00 3.03  ? 204  HIS A C     1 
ATOM   1573  O  O     . HIS A 1 204  ? 95.502  112.309 27.709  1.00 2.05  ? 204  HIS A O     1 
ATOM   1574  C  CB    . HIS A 1 204  ? 94.801  109.472 26.712  1.00 3.21  ? 204  HIS A CB    1 
ATOM   1575  C  CG    . HIS A 1 204  ? 93.331  109.348 26.963  1.00 4.49  ? 204  HIS A CG    1 
ATOM   1576  N  ND1   . HIS A 1 204  ? 92.669  110.114 27.896  1.00 3.60  ? 204  HIS A ND1   1 
ATOM   1577  C  CD2   . HIS A 1 204  ? 92.412  108.487 26.461  1.00 4.94  ? 204  HIS A CD2   1 
ATOM   1578  C  CE1   . HIS A 1 204  ? 91.394  109.764 27.926  1.00 3.72  ? 204  HIS A CE1   1 
ATOM   1579  N  NE2   . HIS A 1 204  ? 91.210  108.782 27.062  1.00 3.66  ? 204  HIS A NE2   1 
ATOM   1580  N  N     . ARG A 1 205  ? 93.798  112.702 26.275  1.00 3.03  ? 205  ARG A N     1 
ATOM   1581  C  CA    . ARG A 1 205  ? 93.224  113.833 27.021  1.00 3.22  ? 205  ARG A CA    1 
ATOM   1582  C  C     . ARG A 1 205  ? 91.765  113.491 27.363  1.00 3.94  ? 205  ARG A C     1 
ATOM   1583  O  O     . ARG A 1 205  ? 90.959  113.238 26.463  1.00 3.79  ? 205  ARG A O     1 
ATOM   1584  C  CB    . ARG A 1 205  ? 93.293  115.146 26.216  1.00 3.66  ? 205  ARG A CB    1 
ATOM   1585  C  CG    . ARG A 1 205  ? 92.619  116.367 26.915  1.00 2.40  ? 205  ARG A CG    1 
ATOM   1586  C  CD    . ARG A 1 205  ? 93.395  116.901 28.160  1.00 4.67  ? 205  ARG A CD    1 
ATOM   1587  N  NE    . ARG A 1 205  ? 92.845  118.168 28.676  1.00 5.67  ? 205  ARG A NE    1 
ATOM   1588  C  CZ    . ARG A 1 205  ? 91.914  118.242 29.617  1.00 4.78  ? 205  ARG A CZ    1 
ATOM   1589  N  NH1   . ARG A 1 205  ? 91.424  117.119 30.160  1.00 4.05  ? 205  ARG A NH1   1 
ATOM   1590  N  NH2   . ARG A 1 205  ? 91.481  119.427 30.029  1.00 3.73  ? 205  ARG A NH2   1 
ATOM   1591  N  N     . ARG A 1 206  ? 91.433  113.477 28.652  1.00 3.74  ? 206  ARG A N     1 
ATOM   1592  C  CA    . ARG A 1 206  ? 90.157  112.916 29.128  1.00 4.07  ? 206  ARG A CA    1 
ATOM   1593  C  C     . ARG A 1 206  ? 89.042  113.954 29.213  1.00 3.96  ? 206  ARG A C     1 
ATOM   1594  O  O     . ARG A 1 206  ? 89.287  115.101 29.584  1.00 3.22  ? 206  ARG A O     1 
ATOM   1595  C  CB    . ARG A 1 206  ? 90.368  112.278 30.520  1.00 4.50  ? 206  ARG A CB    1 
ATOM   1596  C  CG    . ARG A 1 206  ? 89.134  111.568 31.135  1.00 5.22  ? 206  ARG A CG    1 
ATOM   1597  C  CD    . ARG A 1 206  ? 89.510  110.609 32.301  1.00 4.78  ? 206  ARG A CD    1 
ATOM   1598  N  NE    . ARG A 1 206  ? 88.344  110.055 32.986  1.00 5.66  ? 206  ARG A NE    1 
ATOM   1599  C  CZ    . ARG A 1 206  ? 87.914  110.426 34.194  1.00 6.26  ? 206  ARG A CZ    1 
ATOM   1600  N  NH1   . ARG A 1 206  ? 88.523  111.388 34.890  1.00 6.26  ? 206  ARG A NH1   1 
ATOM   1601  N  NH2   . ARG A 1 206  ? 86.846  109.843 34.698  1.00 7.06  ? 206  ARG A NH2   1 
ATOM   1602  N  N     . PHE A 1 207  ? 87.815  113.546 28.871  1.00 3.68  ? 207  PHE A N     1 
ATOM   1603  C  CA    . PHE A 1 207  ? 86.623  114.332 29.182  1.00 4.51  ? 207  PHE A CA    1 
ATOM   1604  C  C     . PHE A 1 207  ? 85.788  113.501 30.164  1.00 4.35  ? 207  PHE A C     1 
ATOM   1605  O  O     . PHE A 1 207  ? 85.282  112.442 29.804  1.00 4.02  ? 207  PHE A O     1 
ATOM   1606  C  CB    . PHE A 1 207  ? 85.814  114.622 27.910  1.00 4.95  ? 207  PHE A CB    1 
ATOM   1607  C  CG    . PHE A 1 207  ? 84.787  115.741 28.054  1.00 6.57  ? 207  PHE A CG    1 
ATOM   1608  C  CD1   . PHE A 1 207  ? 84.726  116.760 27.099  1.00 5.99  ? 207  PHE A CD1   1 
ATOM   1609  C  CD2   . PHE A 1 207  ? 83.869  115.756 29.103  1.00 6.32  ? 207  PHE A CD2   1 
ATOM   1610  C  CE1   . PHE A 1 207  ? 83.778  117.791 27.207  1.00 8.04  ? 207  PHE A CE1   1 
ATOM   1611  C  CE2   . PHE A 1 207  ? 82.918  116.776 29.214  1.00 7.32  ? 207  PHE A CE2   1 
ATOM   1612  C  CZ    . PHE A 1 207  ? 82.884  117.804 28.270  1.00 7.61  ? 207  PHE A CZ    1 
ATOM   1613  N  N     . SER A 1 208  ? 85.651  113.967 31.394  1.00 4.21  ? 208  SER A N     1 
ATOM   1614  C  CA    . SER A 1 208  ? 84.811  113.252 32.356  1.00 5.39  ? 208  SER A CA    1 
ATOM   1615  C  C     . SER A 1 208  ? 83.460  113.939 32.606  1.00 5.64  ? 208  SER A C     1 
ATOM   1616  O  O     . SER A 1 208  ? 83.305  115.133 32.322  1.00 5.98  ? 208  SER A O     1 
ATOM   1617  C  CB    . SER A 1 208  ? 85.564  113.071 33.665  1.00 5.81  ? 208  SER A CB    1 
ATOM   1618  O  OG    . SER A 1 208  ? 85.431  114.207 34.466  1.00 5.80  ? 208  SER A OG    1 
ATOM   1619  N  N     . THR A 1 209  ? 82.499  113.198 33.157  1.00 6.05  ? 209  THR A N     1 
ATOM   1620  C  CA    . THR A 1 209  ? 81.160  113.751 33.440  1.00 7.35  ? 209  THR A CA    1 
ATOM   1621  C  C     . THR A 1 209  ? 80.994  114.180 34.890  1.00 7.04  ? 209  THR A C     1 
ATOM   1622  O  O     . THR A 1 209  ? 79.903  114.123 35.452  1.00 8.21  ? 209  THR A O     1 
ATOM   1623  C  CB    . THR A 1 209  ? 80.047  112.751 33.077  1.00 7.48  ? 209  THR A CB    1 
ATOM   1624  O  OG1   . THR A 1 209  ? 80.384  111.463 33.605  1.00 9.93  ? 209  THR A OG1   1 
ATOM   1625  C  CG2   . THR A 1 209  ? 79.975  112.544 31.570  1.00 7.23  ? 209  THR A CG2   1 
ATOM   1626  N  N     . ASN A 1 210  ? 82.088  114.563 35.515  1.00 6.19  ? 210  ASN A N     1 
ATOM   1627  C  CA    . ASN A 1 210  ? 81.998  115.124 36.842  1.00 5.64  ? 210  ASN A CA    1 
ATOM   1628  C  C     . ASN A 1 210  ? 83.128  116.120 37.043  1.00 5.76  ? 210  ASN A C     1 
ATOM   1629  O  O     . ASN A 1 210  ? 83.974  116.318 36.187  1.00 5.47  ? 210  ASN A O     1 
ATOM   1630  C  CB    . ASN A 1 210  ? 82.010  114.028 37.916  1.00 5.17  ? 210  ASN A CB    1 
ATOM   1631  C  CG    . ASN A 1 210  ? 83.343  113.351 38.026  1.00 4.34  ? 210  ASN A CG    1 
ATOM   1632  O  OD1   . ASN A 1 210  ? 84.289  113.925 38.543  1.00 4.21  ? 210  ASN A OD1   1 
ATOM   1633  N  ND2   . ASN A 1 210  ? 83.442  112.141 37.498  1.00 3.36  ? 210  ASN A ND2   1 
ATOM   1634  N  N     . THR A 1 211  ? 83.154  116.689 38.221  1.00 6.00  ? 211  THR A N     1 
ATOM   1635  C  CA    . THR A 1 211  ? 83.888  117.903 38.459  1.00 7.08  ? 211  THR A CA    1 
ATOM   1636  C  C     . THR A 1 211  ? 84.873  117.619 39.617  1.00 6.84  ? 211  THR A C     1 
ATOM   1637  O  O     . THR A 1 211  ? 85.501  118.521 40.186  1.00 7.40  ? 211  THR A O     1 
ATOM   1638  C  CB    . THR A 1 211  ? 82.763  118.904 38.736  1.00 7.69  ? 211  THR A CB    1 
ATOM   1639  O  OG1   . THR A 1 211  ? 82.788  119.985 37.779  1.00 9.94  ? 211  THR A OG1   1 
ATOM   1640  C  CG2   . THR A 1 211  ? 82.788  119.444 40.084  1.00 3.63  ? 211  THR A CG2   1 
ATOM   1641  N  N     . MET A 1 212  ? 85.032  116.332 39.909  1.00 6.67  ? 212  MET A N     1 
ATOM   1642  C  CA    . MET A 1 212  ? 85.791  115.865 41.069  1.00 7.41  ? 212  MET A CA    1 
ATOM   1643  C  C     . MET A 1 212  ? 86.877  114.871 40.637  1.00 6.98  ? 212  MET A C     1 
ATOM   1644  O  O     . MET A 1 212  ? 86.669  113.654 40.658  1.00 6.33  ? 212  MET A O     1 
ATOM   1645  C  CB    . MET A 1 212  ? 84.833  115.255 42.112  1.00 8.29  ? 212  MET A CB    1 
ATOM   1646  C  CG    . MET A 1 212  ? 83.917  116.309 42.764  1.00 10.25 ? 212  MET A CG    1 
ATOM   1647  S  SD    . MET A 1 212  ? 82.543  115.616 43.679  1.00 15.81 ? 212  MET A SD    1 
ATOM   1648  C  CE    . MET A 1 212  ? 81.179  116.312 42.844  1.00 13.07 ? 212  MET A CE    1 
ATOM   1649  N  N     . PRO A 1 213  ? 88.041  115.404 40.256  1.00 6.51  ? 213  PRO A N     1 
ATOM   1650  C  CA    . PRO A 1 213  ? 89.095  114.608 39.618  1.00 6.28  ? 213  PRO A CA    1 
ATOM   1651  C  C     . PRO A 1 213  ? 89.684  113.575 40.581  1.00 6.59  ? 213  PRO A C     1 
ATOM   1652  O  O     . PRO A 1 213  ? 89.878  113.890 41.748  1.00 7.04  ? 213  PRO A O     1 
ATOM   1653  C  CB    . PRO A 1 213  ? 90.139  115.661 39.243  1.00 6.08  ? 213  PRO A CB    1 
ATOM   1654  C  CG    . PRO A 1 213  ? 89.938  116.760 40.261  1.00 6.04  ? 213  PRO A CG    1 
ATOM   1655  C  CD    . PRO A 1 213  ? 88.450  116.810 40.452  1.00 6.46  ? 213  PRO A CD    1 
ATOM   1656  N  N     . LYS A 1 214  ? 89.899  112.350 40.110  1.00 6.62  ? 214  LYS A N     1 
ATOM   1657  C  CA    . LYS A 1 214  ? 90.634  111.343 40.874  1.00 7.10  ? 214  LYS A CA    1 
ATOM   1658  C  C     . LYS A 1 214  ? 91.805  110.849 39.999  1.00 6.39  ? 214  LYS A C     1 
ATOM   1659  O  O     . LYS A 1 214  ? 91.597  110.405 38.868  1.00 6.55  ? 214  LYS A O     1 
ATOM   1660  C  CB    . LYS A 1 214  ? 89.712  110.196 41.319  1.00 7.28  ? 214  LYS A CB    1 
ATOM   1661  C  CG    . LYS A 1 214  ? 88.430  110.644 42.087  1.00 9.25  ? 214  LYS A CG    1 
ATOM   1662  C  CD    . LYS A 1 214  ? 88.506  110.332 43.584  1.00 13.15 ? 214  LYS A CD    1 
ATOM   1663  C  CE    . LYS A 1 214  ? 87.366  111.017 44.366  1.00 14.56 ? 214  LYS A CE    1 
ATOM   1664  N  NZ    . LYS A 1 214  ? 87.813  111.511 45.716  1.00 16.19 ? 214  LYS A NZ    1 
ATOM   1665  N  N     . TRP A 1 215  ? 93.032  110.955 40.517  1.00 6.31  ? 215  TRP A N     1 
ATOM   1666  C  CA    . TRP A 1 215  ? 94.247  110.753 39.713  1.00 5.41  ? 215  TRP A CA    1 
ATOM   1667  C  C     . TRP A 1 215  ? 94.364  109.408 38.972  1.00 5.96  ? 215  TRP A C     1 
ATOM   1668  O  O     . TRP A 1 215  ? 94.778  109.377 37.793  1.00 6.16  ? 215  TRP A O     1 
ATOM   1669  C  CB    . TRP A 1 215  ? 95.496  111.056 40.559  1.00 5.96  ? 215  TRP A CB    1 
ATOM   1670  C  CG    . TRP A 1 215  ? 95.745  112.558 40.764  1.00 4.48  ? 215  TRP A CG    1 
ATOM   1671  C  CD1   . TRP A 1 215  ? 94.958  113.449 41.466  1.00 3.93  ? 215  TRP A CD1   1 
ATOM   1672  C  CD2   . TRP A 1 215  ? 96.841  113.322 40.244  1.00 3.30  ? 215  TRP A CD2   1 
ATOM   1673  N  NE1   . TRP A 1 215  ? 95.519  114.707 41.425  1.00 4.97  ? 215  TRP A NE1   1 
ATOM   1674  C  CE2   . TRP A 1 215  ? 96.676  114.658 40.690  1.00 3.67  ? 215  TRP A CE2   1 
ATOM   1675  C  CE3   . TRP A 1 215  ? 97.977  113.003 39.482  1.00 3.42  ? 215  TRP A CE3   1 
ATOM   1676  C  CZ2   . TRP A 1 215  ? 97.576  115.677 40.360  1.00 3.31  ? 215  TRP A CZ2   1 
ATOM   1677  C  CZ3   . TRP A 1 215  ? 98.879  114.007 39.170  1.00 5.49  ? 215  TRP A CZ3   1 
ATOM   1678  C  CH2   . TRP A 1 215  ? 98.668  115.336 39.600  1.00 5.04  ? 215  TRP A CH2   1 
ATOM   1679  N  N     . PRO A 1 216  ? 94.001  108.299 39.620  1.00 5.68  ? 216  PRO A N     1 
ATOM   1680  C  CA    . PRO A 1 216  ? 94.015  106.994 38.940  1.00 5.91  ? 216  PRO A CA    1 
ATOM   1681  C  C     . PRO A 1 216  ? 93.148  106.913 37.665  1.00 6.04  ? 216  PRO A C     1 
ATOM   1682  O  O     . PRO A 1 216  ? 93.350  106.022 36.850  1.00 5.73  ? 216  PRO A O     1 
ATOM   1683  C  CB    . PRO A 1 216  ? 93.470  106.032 40.006  1.00 6.12  ? 216  PRO A CB    1 
ATOM   1684  C  CG    . PRO A 1 216  ? 93.751  106.692 41.324  1.00 6.36  ? 216  PRO A CG    1 
ATOM   1685  C  CD    . PRO A 1 216  ? 93.606  108.180 41.042  1.00 5.95  ? 216  PRO A CD    1 
ATOM   1686  N  N     . LEU A 1 217  ? 92.201  107.831 37.508  1.00 6.45  ? 217  LEU A N     1 
ATOM   1687  C  CA    . LEU A 1 217  ? 91.236  107.751 36.416  1.00 7.19  ? 217  LEU A CA    1 
ATOM   1688  C  C     . LEU A 1 217  ? 91.678  108.511 35.169  1.00 6.81  ? 217  LEU A C     1 
ATOM   1689  O  O     . LEU A 1 217  ? 90.979  108.494 34.165  1.00 6.79  ? 217  LEU A O     1 
ATOM   1690  C  CB    . LEU A 1 217  ? 89.826  108.202 36.878  1.00 7.43  ? 217  LEU A CB    1 
ATOM   1691  C  CG    . LEU A 1 217  ? 89.132  107.341 37.952  1.00 9.79  ? 217  LEU A CG    1 
ATOM   1692  C  CD1   . LEU A 1 217  ? 87.658  107.711 38.112  1.00 11.29 ? 217  LEU A CD1   1 
ATOM   1693  C  CD2   . LEU A 1 217  ? 89.253  105.851 37.622  1.00 12.75 ? 217  LEU A CD2   1 
ATOM   1694  N  N     . ALA A 1 218  ? 92.823  109.191 35.225  1.00 5.93  ? 218  ALA A N     1 
ATOM   1695  C  CA    . ALA A 1 218  ? 93.408  109.712 33.992  1.00 5.79  ? 218  ALA A CA    1 
ATOM   1696  C  C     . ALA A 1 218  ? 93.830  108.513 33.128  1.00 5.81  ? 218  ALA A C     1 
ATOM   1697  O  O     . ALA A 1 218  ? 93.938  107.383 33.636  1.00 5.95  ? 218  ALA A O     1 
ATOM   1698  C  CB    . ALA A 1 218  ? 94.585  110.642 34.274  1.00 4.69  ? 218  ALA A CB    1 
ATOM   1699  N  N     . GLN A 1 219  ? 94.028  108.747 31.832  1.00 5.19  ? 219  GLN A N     1 
ATOM   1700  C  CA    . GLN A 1 219  ? 94.529  107.715 30.917  1.00 5.38  ? 219  GLN A CA    1 
ATOM   1701  C  C     . GLN A 1 219  ? 95.793  108.245 30.232  1.00 5.58  ? 219  GLN A C     1 
ATOM   1702  O  O     . GLN A 1 219  ? 96.038  109.444 30.299  1.00 4.49  ? 219  GLN A O     1 
ATOM   1703  C  CB    . GLN A 1 219  ? 93.457  107.339 29.888  1.00 5.00  ? 219  GLN A CB    1 
ATOM   1704  C  CG    . GLN A 1 219  ? 92.172  106.807 30.537  1.00 5.44  ? 219  GLN A CG    1 
ATOM   1705  C  CD    . GLN A 1 219  ? 91.204  106.215 29.541  1.00 7.30  ? 219  GLN A CD    1 
ATOM   1706  O  OE1   . GLN A 1 219  ? 91.615  105.577 28.563  1.00 6.57  ? 219  GLN A OE1   1 
ATOM   1707  N  NE2   . GLN A 1 219  ? 89.914  106.431 29.778  1.00 7.84  ? 219  GLN A NE2   1 
ATOM   1708  N  N     . PRO A 1 220  ? 96.596  107.396 29.566  1.00 6.00  ? 220  PRO A N     1 
ATOM   1709  C  CA    . PRO A 1 220  ? 96.388  105.952 29.413  1.00 6.11  ? 220  PRO A CA    1 
ATOM   1710  C  C     . PRO A 1 220  ? 96.354  105.128 30.692  1.00 6.64  ? 220  PRO A C     1 
ATOM   1711  O  O     . PRO A 1 220  ? 96.876  105.515 31.735  1.00 6.88  ? 220  PRO A O     1 
ATOM   1712  C  CB    . PRO A 1 220  ? 97.631  105.507 28.620  1.00 6.42  ? 220  PRO A CB    1 
ATOM   1713  C  CG    . PRO A 1 220  ? 98.050  106.737 27.843  1.00 6.34  ? 220  PRO A CG    1 
ATOM   1714  C  CD    . PRO A 1 220  ? 97.790  107.856 28.824  1.00 6.62  ? 220  PRO A CD    1 
ATOM   1715  N  N     . MET A 1 221  ? 95.769  103.948 30.562  1.00 6.79  ? 221  MET A N     1 
ATOM   1716  C  CA    . MET A 1 221  ? 95.864  102.921 31.584  1.00 7.49  ? 221  MET A CA    1 
ATOM   1717  C  C     . MET A 1 221  ? 97.113  102.085 31.360  1.00 6.98  ? 221  MET A C     1 
ATOM   1718  O  O     . MET A 1 221  ? 98.104  102.620 30.868  1.00 6.87  ? 221  MET A O     1 
ATOM   1719  C  CB    . MET A 1 221  ? 94.615  102.103 31.514  1.00 7.73  ? 221  MET A CB    1 
ATOM   1720  C  CG    . MET A 1 221  ? 93.542  103.014 31.231  1.00 11.00 ? 221  MET A CG    1 
ATOM   1721  S  SD    . MET A 1 221  ? 92.855  103.424 32.744  1.00 21.46 ? 221  MET A SD    1 
ATOM   1722  C  CE    . MET A 1 221  ? 91.470  102.492 32.205  1.00 13.54 ? 221  MET A CE    1 
ATOM   1723  N  N     . ARG A 1 222  ? 97.091  100.796 31.718  1.00 6.43  ? 222  ARG A N     1 
ATOM   1724  C  CA    . ARG A 1 222  ? 98.327  99.997  31.646  1.00 6.47  ? 222  ARG A CA    1 
ATOM   1725  C  C     . ARG A 1 222  ? 98.663  99.599  30.220  1.00 6.66  ? 222  ARG A C     1 
ATOM   1726  O  O     . ARG A 1 222  ? 99.830  99.594  29.825  1.00 7.32  ? 222  ARG A O     1 
ATOM   1727  C  CB    . ARG A 1 222  ? 98.238  98.753  32.531  1.00 6.60  ? 222  ARG A CB    1 
ATOM   1728  C  CG    . ARG A 1 222  ? 98.335  99.057  34.027  1.00 7.48  ? 222  ARG A CG    1 
ATOM   1729  C  CD    . ARG A 1 222  ? 97.139  99.842  34.585  1.00 9.35  ? 222  ARG A CD    1 
ATOM   1730  N  NE    . ARG A 1 222  ? 97.182  99.956  36.051  1.00 11.02 ? 222  ARG A NE    1 
ATOM   1731  C  CZ    . ARG A 1 222  ? 96.920  98.954  36.891  1.00 12.86 ? 222  ARG A CZ    1 
ATOM   1732  N  NH1   . ARG A 1 222  ? 96.586  97.752  36.421  1.00 13.67 ? 222  ARG A NH1   1 
ATOM   1733  N  NH2   . ARG A 1 222  ? 96.979  99.154  38.204  1.00 11.43 ? 222  ARG A NH2   1 
ATOM   1734  N  N     . LEU A 1 223  ? 97.629  99.285  29.450  1.00 6.64  ? 223  LEU A N     1 
ATOM   1735  C  CA    . LEU A 1 223  ? 97.795  98.902  28.060  1.00 7.62  ? 223  LEU A CA    1 
ATOM   1736  C  C     . LEU A 1 223  ? 97.140  99.880  27.099  1.00 7.50  ? 223  LEU A C     1 
ATOM   1737  O  O     . LEU A 1 223  ? 97.645  100.103 26.005  1.00 7.48  ? 223  LEU A O     1 
ATOM   1738  C  CB    . LEU A 1 223  ? 97.182  97.517  27.842  1.00 8.18  ? 223  LEU A CB    1 
ATOM   1739  C  CG    . LEU A 1 223  ? 97.247  96.913  26.445  1.00 9.90  ? 223  LEU A CG    1 
ATOM   1740  C  CD1   . LEU A 1 223  ? 98.666  96.464  26.160  1.00 10.34 ? 223  LEU A CD1   1 
ATOM   1741  C  CD2   . LEU A 1 223  ? 96.315  95.736  26.440  1.00 13.33 ? 223  LEU A CD2   1 
ATOM   1742  N  N     . LEU A 1 224  ? 96.016  100.452 27.518  1.00 7.50  ? 224  LEU A N     1 
ATOM   1743  C  CA    . LEU A 1 224  ? 95.071  101.067 26.589  1.00 7.81  ? 224  LEU A CA    1 
ATOM   1744  C  C     . LEU A 1 224  ? 94.747  102.511 26.956  1.00 7.18  ? 224  LEU A C     1 
ATOM   1745  O  O     . LEU A 1 224  ? 94.591  102.835 28.136  1.00 6.86  ? 224  LEU A O     1 
ATOM   1746  C  CB    . LEU A 1 224  ? 93.774  100.248 26.605  1.00 7.94  ? 224  LEU A CB    1 
ATOM   1747  C  CG    . LEU A 1 224  ? 92.465  100.914 26.194  1.00 9.82  ? 224  LEU A CG    1 
ATOM   1748  C  CD1   . LEU A 1 224  ? 92.365  100.863 24.690  1.00 11.58 ? 224  LEU A CD1   1 
ATOM   1749  C  CD2   . LEU A 1 224  ? 91.276  100.225 26.827  1.00 12.30 ? 224  LEU A CD2   1 
ATOM   1750  N  N     . GLY A 1 225  ? 94.665  103.363 25.934  1.00 7.12  ? 225  GLY A N     1 
ATOM   1751  C  CA    . GLY A 1 225  ? 93.926  104.620 26.002  1.00 6.61  ? 225  GLY A CA    1 
ATOM   1752  C  C     . GLY A 1 225  ? 92.606  104.487 25.249  1.00 6.97  ? 225  GLY A C     1 
ATOM   1753  O  O     . GLY A 1 225  ? 92.575  103.991 24.104  1.00 6.75  ? 225  GLY A O     1 
ATOM   1754  N  N     . HIS A 1 226  ? 91.515  104.946 25.867  1.00 6.42  ? 226  HIS A N     1 
ATOM   1755  C  CA    . HIS A 1 226  ? 90.185  104.650 25.363  1.00 6.86  ? 226  HIS A CA    1 
ATOM   1756  C  C     . HIS A 1 226  ? 89.392  105.945 25.179  1.00 7.06  ? 226  HIS A C     1 
ATOM   1757  O  O     . HIS A 1 226  ? 89.214  106.729 26.125  1.00 7.31  ? 226  HIS A O     1 
ATOM   1758  C  CB    . HIS A 1 226  ? 89.479  103.683 26.344  1.00 6.62  ? 226  HIS A CB    1 
ATOM   1759  C  CG    . HIS A 1 226  ? 88.027  103.450 26.047  1.00 7.54  ? 226  HIS A CG    1 
ATOM   1760  N  ND1   . HIS A 1 226  ? 87.045  103.585 27.005  1.00 9.70  ? 226  HIS A ND1   1 
ATOM   1761  C  CD2   . HIS A 1 226  ? 87.387  103.122 24.899  1.00 8.07  ? 226  HIS A CD2   1 
ATOM   1762  C  CE1   . HIS A 1 226  ? 85.864  103.332 26.464  1.00 7.92  ? 226  HIS A CE1   1 
ATOM   1763  N  NE2   . HIS A 1 226  ? 86.044  103.052 25.187  1.00 8.58  ? 226  HIS A NE2   1 
ATOM   1764  N  N     . ASN A 1 227  ? 88.953  106.197 23.947  1.00 6.75  ? 227  ASN A N     1 
ATOM   1765  C  CA    . ASN A 1 227  ? 87.952  107.234 23.690  1.00 6.55  ? 227  ASN A CA    1 
ATOM   1766  C  C     . ASN A 1 227  ? 86.660  106.542 23.255  1.00 6.50  ? 227  ASN A C     1 
ATOM   1767  O  O     . ASN A 1 227  ? 86.618  105.852 22.223  1.00 5.81  ? 227  ASN A O     1 
ATOM   1768  C  CB    . ASN A 1 227  ? 88.431  108.220 22.618  1.00 6.32  ? 227  ASN A CB    1 
ATOM   1769  C  CG    . ASN A 1 227  ? 87.328  109.194 22.140  1.00 7.83  ? 227  ASN A CG    1 
ATOM   1770  O  OD1   . ASN A 1 227  ? 87.284  109.555 20.956  1.00 10.03 ? 227  ASN A OD1   1 
ATOM   1771  N  ND2   . ASN A 1 227  ? 86.460  109.632 23.053  1.00 8.64  ? 227  ASN A ND2   1 
ATOM   1772  N  N     . GLY A 1 228  ? 85.611  106.719 24.042  1.00 6.34  ? 228  GLY A N     1 
ATOM   1773  C  CA    . GLY A 1 228  ? 84.321  106.146 23.708  1.00 6.01  ? 228  GLY A CA    1 
ATOM   1774  C  C     . GLY A 1 228  ? 83.528  105.800 24.946  1.00 6.53  ? 228  GLY A C     1 
ATOM   1775  O  O     . GLY A 1 228  ? 83.822  106.281 26.047  1.00 6.16  ? 228  GLY A O     1 
ATOM   1776  N  N     . GLU A 1 229  ? 82.529  104.941 24.764  1.00 6.60  ? 229  GLU A N     1 
ATOM   1777  C  CA    . GLU A 1 229  ? 81.582  104.630 25.817  1.00 7.42  ? 229  GLU A CA    1 
ATOM   1778  C  C     . GLU A 1 229  ? 81.055  103.216 25.590  1.00 7.15  ? 229  GLU A C     1 
ATOM   1779  O  O     . GLU A 1 229  ? 80.533  102.923 24.519  1.00 7.43  ? 229  GLU A O     1 
ATOM   1780  C  CB    . GLU A 1 229  ? 80.432  105.645 25.779  1.00 7.81  ? 229  GLU A CB    1 
ATOM   1781  C  CG    . GLU A 1 229  ? 80.580  106.766 26.792  1.00 13.87 ? 229  GLU A CG    1 
ATOM   1782  C  CD    . GLU A 1 229  ? 80.430  106.259 28.211  1.00 17.90 ? 229  GLU A CD    1 
ATOM   1783  O  OE1   . GLU A 1 229  ? 79.310  105.837 28.556  1.00 19.04 ? 229  GLU A OE1   1 
ATOM   1784  O  OE2   . GLU A 1 229  ? 81.439  106.247 28.958  1.00 22.04 ? 229  GLU A OE2   1 
ATOM   1785  N  N     . ILE A 1 230  ? 81.225  102.340 26.576  1.00 6.26  ? 230  ILE A N     1 
ATOM   1786  C  CA    . ILE A 1 230  ? 80.716  100.968 26.478  1.00 5.96  ? 230  ILE A CA    1 
ATOM   1787  C  C     . ILE A 1 230  ? 79.227  100.903 26.848  1.00 5.41  ? 230  ILE A C     1 
ATOM   1788  O  O     . ILE A 1 230  ? 78.841  101.211 27.977  1.00 5.86  ? 230  ILE A O     1 
ATOM   1789  C  CB    . ILE A 1 230  ? 81.573  99.980  27.314  1.00 5.90  ? 230  ILE A CB    1 
ATOM   1790  C  CG1   . ILE A 1 230  ? 83.041  100.049 26.877  1.00 6.78  ? 230  ILE A CG1   1 
ATOM   1791  C  CG2   . ILE A 1 230  ? 81.033  98.527  27.165  1.00 6.56  ? 230  ILE A CG2   1 
ATOM   1792  C  CD1   . ILE A 1 230  ? 83.288  99.593  25.417  1.00 7.34  ? 230  ILE A CD1   1 
ATOM   1793  N  N     . ASN A 1 231  ? 78.386  100.547 25.879  1.00 4.06  ? 231  ASN A N     1 
ATOM   1794  C  CA    . ASN A 1 231  ? 76.949  100.624 26.084  1.00 3.37  ? 231  ASN A CA    1 
ATOM   1795  C  C     . ASN A 1 231  ? 76.316  99.299  26.529  1.00 3.34  ? 231  ASN A C     1 
ATOM   1796  O  O     . ASN A 1 231  ? 75.100  99.219  26.706  1.00 2.94  ? 231  ASN A O     1 
ATOM   1797  C  CB    . ASN A 1 231  ? 76.235  101.223 24.850  1.00 3.18  ? 231  ASN A CB    1 
ATOM   1798  C  CG    . ASN A 1 231  ? 76.450  100.404 23.577  1.00 4.13  ? 231  ASN A CG    1 
ATOM   1799  O  OD1   . ASN A 1 231  ? 77.067  99.333  23.598  1.00 2.86  ? 231  ASN A OD1   1 
ATOM   1800  N  ND2   . ASN A 1 231  ? 75.943  100.918 22.452  1.00 5.53  ? 231  ASN A ND2   1 
ATOM   1801  N  N     . THR A 1 232  ? 77.145  98.272  26.709  1.00 3.26  ? 232  THR A N     1 
ATOM   1802  C  CA    . THR A 1 232  ? 76.657  96.947  27.145  1.00 3.57  ? 232  THR A CA    1 
ATOM   1803  C  C     . THR A 1 232  ? 77.390  96.500  28.422  1.00 3.66  ? 232  THR A C     1 
ATOM   1804  O  O     . THR A 1 232  ? 77.428  95.306  28.746  1.00 3.25  ? 232  THR A O     1 
ATOM   1805  C  CB    . THR A 1 232  ? 76.896  95.905  26.035  1.00 3.80  ? 232  THR A CB    1 
ATOM   1806  O  OG1   . THR A 1 232  ? 78.243  96.018  25.553  1.00 4.84  ? 232  THR A OG1   1 
ATOM   1807  C  CG2   . THR A 1 232  ? 76.059  96.217  24.792  1.00 4.34  ? 232  THR A CG2   1 
ATOM   1808  N  N     . LEU A 1 233  ? 77.961  97.470  29.143  1.00 3.48  ? 233  LEU A N     1 
ATOM   1809  C  CA    . LEU A 1 233  ? 78.942  97.175  30.196  1.00 3.41  ? 233  LEU A CA    1 
ATOM   1810  C  C     . LEU A 1 233  ? 78.484  96.210  31.289  1.00 3.28  ? 233  LEU A C     1 
ATOM   1811  O  O     . LEU A 1 233  ? 79.248  95.319  31.681  1.00 1.82  ? 233  LEU A O     1 
ATOM   1812  C  CB    . LEU A 1 233  ? 79.514  98.457  30.819  1.00 3.23  ? 233  LEU A CB    1 
ATOM   1813  C  CG    . LEU A 1 233  ? 80.695  98.309  31.798  1.00 4.89  ? 233  LEU A CG    1 
ATOM   1814  C  CD1   . LEU A 1 233  ? 81.972  97.816  31.113  1.00 5.50  ? 233  LEU A CD1   1 
ATOM   1815  C  CD2   . LEU A 1 233  ? 80.958  99.623  32.557  1.00 5.82  ? 233  LEU A CD2   1 
ATOM   1816  N  N     . LEU A 1 234  ? 77.258  96.380  31.785  1.00 3.45  ? 234  LEU A N     1 
ATOM   1817  C  CA    . LEU A 1 234  ? 76.800  95.551  32.896  1.00 4.14  ? 234  LEU A CA    1 
ATOM   1818  C  C     . LEU A 1 234  ? 76.807  94.086  32.432  1.00 4.00  ? 234  LEU A C     1 
ATOM   1819  O  O     . LEU A 1 234  ? 77.196  93.187  33.177  1.00 4.28  ? 234  LEU A O     1 
ATOM   1820  C  CB    . LEU A 1 234  ? 75.408  96.015  33.370  1.00 4.51  ? 234  LEU A CB    1 
ATOM   1821  C  CG    . LEU A 1 234  ? 74.231  95.247  34.029  1.00 6.11  ? 234  LEU A CG    1 
ATOM   1822  C  CD1   . LEU A 1 234  ? 74.064  93.714  33.748  1.00 5.50  ? 234  LEU A CD1   1 
ATOM   1823  C  CD2   . LEU A 1 234  ? 74.092  95.536  35.519  1.00 5.89  ? 234  LEU A CD2   1 
ATOM   1824  N  N     . GLY A 1 235  ? 76.370  93.867  31.191  1.00 4.26  ? 235  GLY A N     1 
ATOM   1825  C  CA    . GLY A 1 235  ? 76.375  92.545  30.590  1.00 3.81  ? 235  GLY A CA    1 
ATOM   1826  C  C     . GLY A 1 235  ? 77.782  92.011  30.395  1.00 3.71  ? 235  GLY A C     1 
ATOM   1827  O  O     . GLY A 1 235  ? 78.068  90.877  30.789  1.00 3.95  ? 235  GLY A O     1 
ATOM   1828  N  N     . ASN A 1 236  ? 78.659  92.842  29.828  1.00 3.16  ? 236  ASN A N     1 
ATOM   1829  C  CA    . ASN A 1 236  ? 80.037  92.446  29.541  1.00 3.00  ? 236  ASN A CA    1 
ATOM   1830  C  C     . ASN A 1 236  ? 80.736  92.031  30.836  1.00 3.26  ? 236  ASN A C     1 
ATOM   1831  O  O     . ASN A 1 236  ? 81.414  91.005  30.882  1.00 2.51  ? 236  ASN A O     1 
ATOM   1832  C  CB    . ASN A 1 236  ? 80.819  93.565  28.844  1.00 2.52  ? 236  ASN A CB    1 
ATOM   1833  C  CG    . ASN A 1 236  ? 80.239  93.943  27.470  1.00 2.84  ? 236  ASN A CG    1 
ATOM   1834  O  OD1   . ASN A 1 236  ? 79.820  93.079  26.672  1.00 3.84  ? 236  ASN A OD1   1 
ATOM   1835  N  ND2   . ASN A 1 236  ? 80.214  95.240  27.191  1.00 1.00  ? 236  ASN A ND2   1 
ATOM   1836  N  N     . ILE A 1 237  ? 80.521  92.821  31.883  1.00 2.52  ? 237  ILE A N     1 
ATOM   1837  C  CA    . ILE A 1 237  ? 81.047  92.523  33.214  1.00 2.74  ? 237  ILE A CA    1 
ATOM   1838  C  C     . ILE A 1 237  ? 80.532  91.201  33.753  1.00 2.47  ? 237  ILE A C     1 
ATOM   1839  O  O     . ILE A 1 237  ? 81.323  90.363  34.211  1.00 2.47  ? 237  ILE A O     1 
ATOM   1840  C  CB    . ILE A 1 237  ? 80.718  93.690  34.169  1.00 3.13  ? 237  ILE A CB    1 
ATOM   1841  C  CG1   . ILE A 1 237  ? 81.556  94.912  33.756  1.00 3.10  ? 237  ILE A CG1   1 
ATOM   1842  C  CG2   . ILE A 1 237  ? 80.999  93.311  35.650  1.00 2.37  ? 237  ILE A CG2   1 
ATOM   1843  C  CD1   . ILE A 1 237  ? 81.417  96.111  34.654  1.00 3.17  ? 237  ILE A CD1   1 
ATOM   1844  N  N     . ASN A 1 238  ? 79.211  91.000  33.678  1.00 2.07  ? 238  ASN A N     1 
ATOM   1845  C  CA    . ASN A 1 238  ? 78.596  89.794  34.215  1.00 1.87  ? 238  ASN A CA    1 
ATOM   1846  C  C     . ASN A 1 238  ? 79.087  88.529  33.515  1.00 2.07  ? 238  ASN A C     1 
ATOM   1847  O  O     . ASN A 1 238  ? 79.456  87.561  34.184  1.00 1.38  ? 238  ASN A O     1 
ATOM   1848  C  CB    . ASN A 1 238  ? 77.061  89.894  34.247  1.00 1.19  ? 238  ASN A CB    1 
ATOM   1849  C  CG    . ASN A 1 238  ? 76.571  90.746  35.423  1.00 2.37  ? 238  ASN A CG    1 
ATOM   1850  O  OD1   . ASN A 1 238  ? 77.385  91.259  36.180  1.00 1.80  ? 238  ASN A OD1   1 
ATOM   1851  N  ND2   . ASN A 1 238  ? 75.252  90.905  35.566  1.00 1.00  ? 238  ASN A ND2   1 
ATOM   1852  N  N     . TRP A 1 239  ? 79.132  88.559  32.183  1.00 1.91  ? 239  TRP A N     1 
ATOM   1853  C  CA    . TRP A 1 239  ? 79.667  87.426  31.432  1.00 2.63  ? 239  TRP A CA    1 
ATOM   1854  C  C     . TRP A 1 239  ? 81.146  87.142  31.746  1.00 2.95  ? 239  TRP A C     1 
ATOM   1855  O  O     . TRP A 1 239  ? 81.516  85.982  31.943  1.00 2.70  ? 239  TRP A O     1 
ATOM   1856  C  CB    . TRP A 1 239  ? 79.451  87.587  29.932  1.00 2.23  ? 239  TRP A CB    1 
ATOM   1857  C  CG    . TRP A 1 239  ? 77.988  87.621  29.508  1.00 3.89  ? 239  TRP A CG    1 
ATOM   1858  C  CD1   . TRP A 1 239  ? 77.354  88.638  28.848  1.00 4.55  ? 239  TRP A CD1   1 
ATOM   1859  C  CD2   . TRP A 1 239  ? 77.004  86.600  29.705  1.00 4.43  ? 239  TRP A CD2   1 
ATOM   1860  N  NE1   . TRP A 1 239  ? 76.036  88.313  28.630  1.00 6.31  ? 239  TRP A NE1   1 
ATOM   1861  C  CE2   . TRP A 1 239  ? 75.796  87.064  29.135  1.00 5.89  ? 239  TRP A CE2   1 
ATOM   1862  C  CE3   . TRP A 1 239  ? 77.020  85.325  30.298  1.00 5.43  ? 239  TRP A CE3   1 
ATOM   1863  C  CZ2   . TRP A 1 239  ? 74.613  86.307  29.150  1.00 7.50  ? 239  TRP A CZ2   1 
ATOM   1864  C  CZ3   . TRP A 1 239  ? 75.851  84.576  30.314  1.00 6.40  ? 239  TRP A CZ3   1 
ATOM   1865  C  CH2   . TRP A 1 239  ? 74.660  85.073  29.741  1.00 6.84  ? 239  TRP A CH2   1 
ATOM   1866  N  N     . MET A 1 240  ? 81.974  88.187  31.825  1.00 3.21  ? 240  MET A N     1 
ATOM   1867  C  CA    . MET A 1 240  ? 83.410  88.004  32.081  1.00 4.50  ? 240  MET A CA    1 
ATOM   1868  C  C     . MET A 1 240  ? 83.695  87.482  33.504  1.00 4.63  ? 240  MET A C     1 
ATOM   1869  O  O     . MET A 1 240  ? 84.521  86.576  33.703  1.00 4.12  ? 240  MET A O     1 
ATOM   1870  C  CB    . MET A 1 240  ? 84.179  89.303  31.785  1.00 4.61  ? 240  MET A CB    1 
ATOM   1871  C  CG    . MET A 1 240  ? 85.707  89.189  31.856  1.00 7.94  ? 240  MET A CG    1 
ATOM   1872  S  SD    . MET A 1 240  ? 86.472  87.998  30.692  1.00 15.26 ? 240  MET A SD    1 
ATOM   1873  C  CE    . MET A 1 240  ? 86.221  88.904  29.130  1.00 11.98 ? 240  MET A CE    1 
ATOM   1874  N  N     . ALA A 1 241  ? 83.002  88.057  34.484  1.00 4.55  ? 241  ALA A N     1 
ATOM   1875  C  CA    . ALA A 1 241  ? 83.096  87.619  35.870  1.00 4.84  ? 241  ALA A CA    1 
ATOM   1876  C  C     . ALA A 1 241  ? 82.732  86.142  36.039  1.00 5.21  ? 241  ALA A C     1 
ATOM   1877  O  O     . ALA A 1 241  ? 83.369  85.425  36.818  1.00 4.57  ? 241  ALA A O     1 
ATOM   1878  C  CB    . ALA A 1 241  ? 82.227  88.500  36.777  1.00 4.83  ? 241  ALA A CB    1 
ATOM   1879  N  N     . ALA A 1 242  ? 81.715  85.689  35.306  1.00 5.53  ? 242  ALA A N     1 
ATOM   1880  C  CA    . ALA A 1 242  ? 81.319  84.281  35.321  1.00 6.48  ? 242  ALA A CA    1 
ATOM   1881  C  C     . ALA A 1 242  ? 82.424  83.343  34.815  1.00 7.29  ? 242  ALA A C     1 
ATOM   1882  O  O     . ALA A 1 242  ? 82.414  82.159  35.134  1.00 8.01  ? 242  ALA A O     1 
ATOM   1883  C  CB    . ALA A 1 242  ? 80.040  84.069  34.519  1.00 5.76  ? 242  ALA A CB    1 
ATOM   1884  N  N     . ARG A 1 243  ? 83.349  83.866  34.017  1.00 8.14  ? 243  ARG A N     1 
ATOM   1885  C  CA    . ARG A 1 243  ? 84.510  83.097  33.558  1.00 9.85  ? 243  ARG A CA    1 
ATOM   1886  C  C     . ARG A 1 243  ? 85.610  82.919  34.601  1.00 10.74 ? 243  ARG A C     1 
ATOM   1887  O  O     . ARG A 1 243  ? 86.448  82.026  34.462  1.00 11.30 ? 243  ARG A O     1 
ATOM   1888  C  CB    . ARG A 1 243  ? 85.168  83.772  32.367  1.00 9.79  ? 243  ARG A CB    1 
ATOM   1889  C  CG    . ARG A 1 243  ? 84.347  83.920  31.136  1.00 10.56 ? 243  ARG A CG    1 
ATOM   1890  C  CD    . ARG A 1 243  ? 85.191  84.429  29.992  1.00 11.69 ? 243  ARG A CD    1 
ATOM   1891  N  NE    . ARG A 1 243  ? 84.403  84.796  28.825  1.00 13.17 ? 243  ARG A NE    1 
ATOM   1892  C  CZ    . ARG A 1 243  ? 83.993  83.938  27.903  1.00 14.21 ? 243  ARG A CZ    1 
ATOM   1893  N  NH1   . ARG A 1 243  ? 84.277  82.636  27.991  1.00 15.23 ? 243  ARG A NH1   1 
ATOM   1894  N  NH2   . ARG A 1 243  ? 83.301  84.390  26.877  1.00 15.01 ? 243  ARG A NH2   1 
ATOM   1895  N  N     . GLU A 1 244  ? 85.605  83.767  35.633  1.00 11.37 ? 244  GLU A N     1 
ATOM   1896  C  CA    . GLU A 1 244  ? 86.754  83.957  36.510  1.00 11.69 ? 244  GLU A CA    1 
ATOM   1897  C  C     . GLU A 1 244  ? 87.177  82.745  37.327  1.00 12.02 ? 244  GLU A C     1 
ATOM   1898  O  O     . GLU A 1 244  ? 88.375  82.475  37.450  1.00 12.22 ? 244  GLU A O     1 
ATOM   1899  C  CB    . GLU A 1 244  ? 86.529  85.163  37.437  1.00 11.60 ? 244  GLU A CB    1 
ATOM   1900  C  CG    . GLU A 1 244  ? 86.835  86.507  36.798  1.00 11.74 ? 244  GLU A CG    1 
ATOM   1901  C  CD    . GLU A 1 244  ? 86.331  87.698  37.618  1.00 12.95 ? 244  GLU A CD    1 
ATOM   1902  O  OE1   . GLU A 1 244  ? 85.700  87.496  38.685  1.00 14.41 ? 244  GLU A OE1   1 
ATOM   1903  O  OE2   . GLU A 1 244  ? 86.549  88.849  37.182  1.00 11.53 ? 244  GLU A OE2   1 
ATOM   1904  N  N     . LYS A 1 245  ? 86.213  82.013  37.881  1.00 12.48 ? 245  LYS A N     1 
ATOM   1905  C  CA    . LYS A 1 245  ? 86.529  80.867  38.725  1.00 12.84 ? 245  LYS A CA    1 
ATOM   1906  C  C     . LYS A 1 245  ? 87.105  79.679  37.941  1.00 12.75 ? 245  LYS A C     1 
ATOM   1907  O  O     . LYS A 1 245  ? 87.819  78.845  38.517  1.00 12.90 ? 245  LYS A O     1 
ATOM   1908  C  CB    . LYS A 1 245  ? 85.310  80.426  39.557  1.00 13.57 ? 245  LYS A CB    1 
ATOM   1909  C  CG    . LYS A 1 245  ? 84.813  81.458  40.589  1.00 14.80 ? 245  LYS A CG    1 
ATOM   1910  C  CD    . LYS A 1 245  ? 83.467  81.033  41.223  1.00 16.30 ? 245  LYS A CD    1 
ATOM   1911  C  CE    . LYS A 1 245  ? 82.284  81.948  40.809  1.00 15.99 ? 245  LYS A CE    1 
ATOM   1912  N  NZ    . LYS A 1 245  ? 81.887  81.845  39.359  1.00 12.09 ? 245  LYS A NZ    1 
ATOM   1913  N  N     . GLU A 1 246  ? 86.802  79.617  36.642  1.00 12.27 ? 246  GLU A N     1 
ATOM   1914  C  CA    . GLU A 1 246  ? 87.196  78.495  35.789  1.00 12.32 ? 246  GLU A CA    1 
ATOM   1915  C  C     . GLU A 1 246  ? 88.338  78.796  34.804  1.00 11.60 ? 246  GLU A C     1 
ATOM   1916  O  O     . GLU A 1 246  ? 88.615  77.979  33.923  1.00 12.25 ? 246  GLU A O     1 
ATOM   1917  C  CB    . GLU A 1 246  ? 85.973  77.918  35.035  1.00 12.87 ? 246  GLU A CB    1 
ATOM   1918  C  CG    . GLU A 1 246  ? 85.439  76.605  35.611  1.00 15.23 ? 246  GLU A CG    1 
ATOM   1919  C  CD    . GLU A 1 246  ? 85.381  75.452  34.595  1.00 18.90 ? 246  GLU A CD    1 
ATOM   1920  O  OE1   . GLU A 1 246  ? 85.764  74.309  34.962  1.00 18.77 ? 246  GLU A OE1   1 
ATOM   1921  O  OE2   . GLU A 1 246  ? 84.942  75.671  33.429  1.00 20.83 ? 246  GLU A OE2   1 
ATOM   1922  N  N     . LEU A 1 247  ? 89.005  79.939  34.951  1.00 10.28 ? 247  LEU A N     1 
ATOM   1923  C  CA    . LEU A 1 247  ? 90.130  80.294  34.074  1.00 9.31  ? 247  LEU A CA    1 
ATOM   1924  C  C     . LEU A 1 247  ? 91.199  79.192  34.008  1.00 8.68  ? 247  LEU A C     1 
ATOM   1925  O  O     . LEU A 1 247  ? 91.579  78.630  35.033  1.00 7.46  ? 247  LEU A O     1 
ATOM   1926  C  CB    . LEU A 1 247  ? 90.761  81.636  34.492  1.00 9.81  ? 247  LEU A CB    1 
ATOM   1927  C  CG    . LEU A 1 247  ? 89.873  82.890  34.436  1.00 9.56  ? 247  LEU A CG    1 
ATOM   1928  C  CD1   . LEU A 1 247  ? 90.486  84.047  35.173  1.00 11.04 ? 247  LEU A CD1   1 
ATOM   1929  C  CD2   . LEU A 1 247  ? 89.548  83.285  33.002  1.00 11.72 ? 247  LEU A CD2   1 
ATOM   1930  N  N     . GLU A 1 248  ? 91.651  78.885  32.790  1.00 8.29  ? 248  GLU A N     1 
ATOM   1931  C  CA    . GLU A 1 248  ? 92.667  77.859  32.552  1.00 8.34  ? 248  GLU A CA    1 
ATOM   1932  C  C     . GLU A 1 248  ? 93.385  78.146  31.226  1.00 8.38  ? 248  GLU A C     1 
ATOM   1933  O  O     . GLU A 1 248  ? 92.738  78.346  30.205  1.00 7.86  ? 248  GLU A O     1 
ATOM   1934  C  CB    . GLU A 1 248  ? 92.010  76.465  32.527  1.00 8.54  ? 248  GLU A CB    1 
ATOM   1935  C  CG    . GLU A 1 248  ? 92.969  75.286  32.422  1.00 8.78  ? 248  GLU A CG    1 
ATOM   1936  C  CD    . GLU A 1 248  ? 92.252  73.939  32.414  1.00 10.70 ? 248  GLU A CD    1 
ATOM   1937  O  OE1   . GLU A 1 248  ? 91.521  73.648  31.443  1.00 11.87 ? 248  GLU A OE1   1 
ATOM   1938  O  OE2   . GLU A 1 248  ? 92.421  73.164  33.377  1.00 12.10 ? 248  GLU A OE2   1 
ATOM   1939  N  N     . VAL A 1 249  ? 94.719  78.200  31.263  1.00 8.92  ? 249  VAL A N     1 
ATOM   1940  C  CA    . VAL A 1 249  ? 95.556  78.379  30.064  1.00 9.68  ? 249  VAL A CA    1 
ATOM   1941  C  C     . VAL A 1 249  ? 96.869  77.692  30.285  1.00 10.06 ? 249  VAL A C     1 
ATOM   1942  O  O     . VAL A 1 249  ? 97.364  77.671  31.402  1.00 10.24 ? 249  VAL A O     1 
ATOM   1943  C  CB    . VAL A 1 249  ? 96.002  79.863  29.767  1.00 9.83  ? 249  VAL A CB    1 
ATOM   1944  C  CG1   . VAL A 1 249  ? 95.732  80.237  28.322  1.00 9.87  ? 249  VAL A CG1   1 
ATOM   1945  C  CG2   . VAL A 1 249  ? 95.469  80.867  30.757  1.00 8.95  ? 249  VAL A CG2   1 
ATOM   1946  N  N     . SER A 1 250  ? 97.455  77.158  29.217  1.00 10.90 ? 250  SER A N     1 
ATOM   1947  C  CA    . SER A 1 250  ? 98.818  76.644  29.290  1.00 11.52 ? 250  SER A CA    1 
ATOM   1948  C  C     . SER A 1 250  ? 99.755  77.812  29.608  1.00 11.18 ? 250  SER A C     1 
ATOM   1949  O  O     . SER A 1 250  ? 99.536  78.938  29.153  1.00 11.59 ? 250  SER A O     1 
ATOM   1950  C  CB    . SER A 1 250  ? 99.213  75.960  27.979  1.00 12.01 ? 250  SER A CB    1 
ATOM   1951  O  OG    . SER A 1 250  ? 99.088  76.856  26.887  1.00 14.34 ? 250  SER A OG    1 
ATOM   1952  N  N     . GLY A 1 251  ? 100.771 77.551  30.418  1.00 11.05 ? 251  GLY A N     1 
ATOM   1953  C  CA    . GLY A 1 251  ? 101.732 78.567  30.804  1.00 11.19 ? 251  GLY A CA    1 
ATOM   1954  C  C     . GLY A 1 251  ? 101.407 79.286  32.111  1.00 11.38 ? 251  GLY A C     1 
ATOM   1955  O  O     . GLY A 1 251  ? 102.170 80.165  32.543  1.00 11.55 ? 251  GLY A O     1 
ATOM   1956  N  N     . TRP A 1 252  ? 100.288 78.912  32.741  1.00 10.96 ? 252  TRP A N     1 
ATOM   1957  C  CA    . TRP A 1 252  ? 99.795  79.581  33.956  1.00 10.06 ? 252  TRP A CA    1 
ATOM   1958  C  C     . TRP A 1 252  ? 99.296  78.554  34.971  1.00 9.80  ? 252  TRP A C     1 
ATOM   1959  O  O     . TRP A 1 252  ? 98.614  77.594  34.613  1.00 9.57  ? 252  TRP A O     1 
ATOM   1960  C  CB    . TRP A 1 252  ? 98.632  80.515  33.615  1.00 9.28  ? 252  TRP A CB    1 
ATOM   1961  C  CG    . TRP A 1 252  ? 99.018  81.807  32.970  1.00 8.29  ? 252  TRP A CG    1 
ATOM   1962  C  CD1   . TRP A 1 252  ? 99.436  81.994  31.684  1.00 7.39  ? 252  TRP A CD1   1 
ATOM   1963  C  CD2   . TRP A 1 252  ? 99.006  83.103  33.578  1.00 6.72  ? 252  TRP A CD2   1 
ATOM   1964  N  NE1   . TRP A 1 252  ? 99.692  83.326  31.453  1.00 7.59  ? 252  TRP A NE1   1 
ATOM   1965  C  CE2   . TRP A 1 252  ? 99.429  84.033  32.596  1.00 7.19  ? 252  TRP A CE2   1 
ATOM   1966  C  CE3   . TRP A 1 252  ? 98.673  83.580  34.851  1.00 6.71  ? 252  TRP A CE3   1 
ATOM   1967  C  CZ2   . TRP A 1 252  ? 99.543  85.403  32.854  1.00 5.50  ? 252  TRP A CZ2   1 
ATOM   1968  C  CZ3   . TRP A 1 252  ? 98.781  84.954  35.104  1.00 6.69  ? 252  TRP A CZ3   1 
ATOM   1969  C  CH2   . TRP A 1 252  ? 99.215  85.840  34.111  1.00 6.04  ? 252  TRP A CH2   1 
ATOM   1970  N  N     . THR A 1 253  ? 99.609  78.775  36.240  1.00 9.74  ? 253  THR A N     1 
ATOM   1971  C  CA    . THR A 1 253  ? 99.073  77.924  37.301  1.00 9.69  ? 253  THR A CA    1 
ATOM   1972  C  C     . THR A 1 253  ? 97.712  78.448  37.742  1.00 9.33  ? 253  THR A C     1 
ATOM   1973  O  O     . THR A 1 253  ? 97.394  79.617  37.529  1.00 8.95  ? 253  THR A O     1 
ATOM   1974  C  CB    . THR A 1 253  ? 100.022 77.879  38.493  1.00 9.66  ? 253  THR A CB    1 
ATOM   1975  O  OG1   . THR A 1 253  ? 100.165 79.193  39.027  1.00 11.09 ? 253  THR A OG1   1 
ATOM   1976  C  CG2   . THR A 1 253  ? 101.443 77.512  38.047  1.00 10.57 ? 253  THR A CG2   1 
ATOM   1977  N  N     . LYS A 1 254  ? 96.917  77.581  38.364  1.00 9.06  ? 254  LYS A N     1 
ATOM   1978  C  CA    . LYS A 1 254  ? 95.626  77.982  38.915  1.00 8.67  ? 254  LYS A CA    1 
ATOM   1979  C  C     . LYS A 1 254  ? 95.778  79.136  39.921  1.00 7.99  ? 254  LYS A C     1 
ATOM   1980  O  O     . LYS A 1 254  ? 94.939  80.031  39.967  1.00 7.56  ? 254  LYS A O     1 
ATOM   1981  C  CB    . LYS A 1 254  ? 94.926  76.783  39.574  1.00 8.69  ? 254  LYS A CB    1 
ATOM   1982  C  CG    . LYS A 1 254  ? 93.410  76.936  39.662  1.00 9.76  ? 254  LYS A CG    1 
ATOM   1983  C  CD    . LYS A 1 254  ? 92.840  76.091  40.786  1.00 13.15 ? 254  LYS A CD    1 
ATOM   1984  C  CE    . LYS A 1 254  ? 92.146  74.846  40.243  1.00 14.12 ? 254  LYS A CE    1 
ATOM   1985  N  NZ    . LYS A 1 254  ? 92.753  73.608  40.831  1.00 17.75 ? 254  LYS A NZ    1 
ATOM   1986  N  N     . ALA A 1 255  ? 96.855  79.098  40.708  1.00 7.66  ? 255  ALA A N     1 
ATOM   1987  C  CA    . ALA A 1 255  ? 97.134  80.110  41.736  1.00 7.21  ? 255  ALA A CA    1 
ATOM   1988  C  C     . ALA A 1 255  ? 97.507  81.468  41.155  1.00 6.65  ? 255  ALA A C     1 
ATOM   1989  O  O     . ALA A 1 255  ? 97.097  82.502  41.693  1.00 6.82  ? 255  ALA A O     1 
ATOM   1990  C  CB    . ALA A 1 255  ? 98.215  79.624  42.696  1.00 7.35  ? 255  ALA A CB    1 
ATOM   1991  N  N     . GLU A 1 256  ? 98.282  81.473  40.071  1.00 5.98  ? 256  GLU A N     1 
ATOM   1992  C  CA    . GLU A 1 256  ? 98.596  82.723  39.375  1.00 5.90  ? 256  GLU A CA    1 
ATOM   1993  C  C     . GLU A 1 256  ? 97.340  83.344  38.781  1.00 5.80  ? 256  GLU A C     1 
ATOM   1994  O  O     . GLU A 1 256  ? 97.163  84.557  38.851  1.00 5.79  ? 256  GLU A O     1 
ATOM   1995  C  CB    . GLU A 1 256  ? 99.637  82.518  38.274  1.00 5.82  ? 256  GLU A CB    1 
ATOM   1996  C  CG    . GLU A 1 256  ? 101.048 82.296  38.801  1.00 7.56  ? 256  GLU A CG    1 
ATOM   1997  C  CD    . GLU A 1 256  ? 102.013 81.843  37.724  1.00 8.76  ? 256  GLU A CD    1 
ATOM   1998  O  OE1   . GLU A 1 256  ? 101.583 81.168  36.751  1.00 7.91  ? 256  GLU A OE1   1 
ATOM   1999  O  OE2   . GLU A 1 256  ? 103.205 82.191  37.841  1.00 10.10 ? 256  GLU A OE2   1 
ATOM   2000  N  N     . LEU A 1 257  ? 96.471  82.511  38.200  1.00 6.12  ? 257  LEU A N     1 
ATOM   2001  C  CA    . LEU A 1 257  ? 95.215  83.004  37.620  1.00 6.42  ? 257  LEU A CA    1 
ATOM   2002  C  C     . LEU A 1 257  ? 94.265  83.539  38.695  1.00 6.45  ? 257  LEU A C     1 
ATOM   2003  O  O     . LEU A 1 257  ? 93.591  84.555  38.493  1.00 6.12  ? 257  LEU A O     1 
ATOM   2004  C  CB    . LEU A 1 257  ? 94.537  81.914  36.784  1.00 6.18  ? 257  LEU A CB    1 
ATOM   2005  C  CG    . LEU A 1 257  ? 95.247  81.527  35.478  1.00 6.83  ? 257  LEU A CG    1 
ATOM   2006  C  CD1   . LEU A 1 257  ? 94.738  80.192  34.946  1.00 5.70  ? 257  LEU A CD1   1 
ATOM   2007  C  CD2   . LEU A 1 257  ? 95.102  82.624  34.428  1.00 4.71  ? 257  LEU A CD2   1 
ATOM   2008  N  N     . GLU A 1 258  ? 94.234  82.847  39.835  1.00 6.99  ? 258  GLU A N     1 
ATOM   2009  C  CA    . GLU A 1 258  ? 93.485  83.276  41.019  1.00 7.85  ? 258  GLU A CA    1 
ATOM   2010  C  C     . GLU A 1 258  ? 93.953  84.651  41.512  1.00 7.86  ? 258  GLU A C     1 
ATOM   2011  O  O     . GLU A 1 258  ? 93.149  85.467  41.942  1.00 8.00  ? 258  GLU A O     1 
ATOM   2012  C  CB    . GLU A 1 258  ? 93.604  82.214  42.137  1.00 8.17  ? 258  GLU A CB    1 
ATOM   2013  C  CG    . GLU A 1 258  ? 92.726  82.439  43.367  1.00 10.23 ? 258  GLU A CG    1 
ATOM   2014  C  CD    . GLU A 1 258  ? 91.246  82.521  43.033  1.00 13.98 ? 258  GLU A CD    1 
ATOM   2015  O  OE1   . GLU A 1 258  ? 90.680  81.511  42.548  1.00 15.65 ? 258  GLU A OE1   1 
ATOM   2016  O  OE2   . GLU A 1 258  ? 90.642  83.596  43.252  1.00 13.97 ? 258  GLU A OE2   1 
ATOM   2017  N  N     . ALA A 1 259  ? 95.253  84.912  41.421  1.00 8.11  ? 259  ALA A N     1 
ATOM   2018  C  CA    . ALA A 1 259  ? 95.820  86.197  41.823  1.00 7.84  ? 259  ALA A CA    1 
ATOM   2019  C  C     . ALA A 1 259  ? 95.283  87.357  40.982  1.00 8.19  ? 259  ALA A C     1 
ATOM   2020  O  O     . ALA A 1 259  ? 95.139  88.469  41.487  1.00 8.29  ? 259  ALA A O     1 
ATOM   2021  C  CB    . ALA A 1 259  ? 97.340  86.145  41.738  1.00 8.31  ? 259  ALA A CB    1 
ATOM   2022  N  N     . LEU A 1 260  ? 94.995  87.090  39.707  1.00 7.80  ? 260  LEU A N     1 
ATOM   2023  C  CA    . LEU A 1 260  ? 94.425  88.085  38.792  1.00 8.34  ? 260  LEU A CA    1 
ATOM   2024  C  C     . LEU A 1 260  ? 93.001  88.437  39.189  1.00 9.17  ? 260  LEU A C     1 
ATOM   2025  O  O     . LEU A 1 260  ? 92.519  89.537  38.894  1.00 8.81  ? 260  LEU A O     1 
ATOM   2026  C  CB    . LEU A 1 260  ? 94.425  87.548  37.355  1.00 8.00  ? 260  LEU A CB    1 
ATOM   2027  C  CG    . LEU A 1 260  ? 95.765  87.115  36.770  1.00 7.33  ? 260  LEU A CG    1 
ATOM   2028  C  CD1   . LEU A 1 260  ? 95.614  86.806  35.269  1.00 5.43  ? 260  LEU A CD1   1 
ATOM   2029  C  CD2   . LEU A 1 260  ? 96.845  88.184  37.008  1.00 5.42  ? 260  LEU A CD2   1 
ATOM   2030  N  N     . THR A 1 261  ? 92.361  87.457  39.833  1.00 10.48 ? 261  THR A N     1 
ATOM   2031  C  CA    . THR A 1 261  ? 91.020  87.489  40.424  1.00 12.67 ? 261  THR A CA    1 
ATOM   2032  C  C     . THR A 1 261  ? 90.097  88.424  39.740  1.00 12.87 ? 261  THR A C     1 
ATOM   2033  O  O     . THR A 1 261  ? 90.022  88.357  38.512  1.00 15.33 ? 261  THR A O     1 
ATOM   2034  C  CB    . THR A 1 261  ? 91.057  87.763  41.923  1.00 12.34 ? 261  THR A CB    1 
ATOM   2035  O  OG1   . THR A 1 261  ? 92.326  88.324  42.252  1.00 16.93 ? 261  THR A OG1   1 
ATOM   2036  C  CG2   . THR A 1 261  ? 91.011  86.421  42.706  1.00 10.70 ? 261  THR A CG2   1 
ATOM   2037  N  N     . PRO A 1 262  ? 89.378  89.291  40.477  1.00 12.46 ? 262  PRO A N     1 
ATOM   2038  C  CA    . PRO A 1 262  ? 88.382  90.129  39.819  1.00 11.28 ? 262  PRO A CA    1 
ATOM   2039  C  C     . PRO A 1 262  ? 89.083  90.807  38.651  1.00 10.42 ? 262  PRO A C     1 
ATOM   2040  O  O     . PRO A 1 262  ? 89.862  91.745  38.848  1.00 10.02 ? 262  PRO A O     1 
ATOM   2041  C  CB    . PRO A 1 262  ? 87.967  91.125  40.920  1.00 11.73 ? 262  PRO A CB    1 
ATOM   2042  C  CG    . PRO A 1 262  ? 88.999  90.995  41.983  1.00 11.70 ? 262  PRO A CG    1 
ATOM   2043  C  CD    . PRO A 1 262  ? 89.441  89.571  41.921  1.00 11.93 ? 262  PRO A CD    1 
ATOM   2044  N  N     . ILE A 1 263  ? 88.869  90.265  37.454  1.00 9.35  ? 263  ILE A N     1 
ATOM   2045  C  CA    . ILE A 1 263  ? 89.364  90.881  36.226  1.00 8.93  ? 263  ILE A CA    1 
ATOM   2046  C  C     . ILE A 1 263  ? 88.515  92.124  35.999  1.00 8.79  ? 263  ILE A C     1 
ATOM   2047  O  O     . ILE A 1 263  ? 89.017  93.158  35.593  1.00 8.80  ? 263  ILE A O     1 
ATOM   2048  C  CB    . ILE A 1 263  ? 89.226  89.905  35.005  1.00 8.63  ? 263  ILE A CB    1 
ATOM   2049  C  CG1   . ILE A 1 263  ? 90.014  88.601  35.205  1.00 8.54  ? 263  ILE A CG1   1 
ATOM   2050  C  CG2   . ILE A 1 263  ? 89.636  90.603  33.694  1.00 8.21  ? 263  ILE A CG2   1 
ATOM   2051  C  CD1   . ILE A 1 263  ? 91.529  88.784  35.313  1.00 6.90  ? 263  ILE A CD1   1 
ATOM   2052  N  N     . VAL A 1 264  ? 87.221  92.003  36.296  1.00 8.46  ? 264  VAL A N     1 
ATOM   2053  C  CA    . VAL A 1 264  ? 86.234  93.045  36.021  1.00 8.48  ? 264  VAL A CA    1 
ATOM   2054  C  C     . VAL A 1 264  ? 85.468  93.384  37.314  1.00 8.68  ? 264  VAL A C     1 
ATOM   2055  O  O     . VAL A 1 264  ? 85.382  92.550  38.216  1.00 8.73  ? 264  VAL A O     1 
ATOM   2056  C  CB    . VAL A 1 264  ? 85.278  92.573  34.878  1.00 8.43  ? 264  VAL A CB    1 
ATOM   2057  C  CG1   . VAL A 1 264  ? 84.186  93.535  34.668  1.00 11.33 ? 264  VAL A CG1   1 
ATOM   2058  C  CG2   . VAL A 1 264  ? 86.020  92.468  33.556  1.00 7.72  ? 264  VAL A CG2   1 
ATOM   2059  N  N     . ASN A 1 265  ? 84.925  94.600  37.405  1.00 9.18  ? 265  ASN A N     1 
ATOM   2060  C  CA    . ASN A 1 265  ? 84.172  95.063  38.581  1.00 9.62  ? 265  ASN A CA    1 
ATOM   2061  C  C     . ASN A 1 265  ? 83.224  96.186  38.160  1.00 9.99  ? 265  ASN A C     1 
ATOM   2062  O  O     . ASN A 1 265  ? 83.682  97.154  37.556  1.00 9.80  ? 265  ASN A O     1 
ATOM   2063  C  CB    . ASN A 1 265  ? 85.148  95.608  39.644  1.00 9.90  ? 265  ASN A CB    1 
ATOM   2064  C  CG    . ASN A 1 265  ? 84.498  95.831  41.002  1.00 10.44 ? 265  ASN A CG    1 
ATOM   2065  O  OD1   . ASN A 1 265  ? 83.376  96.319  41.106  1.00 11.16 ? 265  ASN A OD1   1 
ATOM   2066  N  ND2   . ASN A 1 265  ? 85.222  95.484  42.060  1.00 12.66 ? 265  ASN A ND2   1 
ATOM   2067  N  N     . GLN A 1 266  ? 81.932  96.092  38.495  1.00 10.80 ? 266  GLN A N     1 
ATOM   2068  C  CA    . GLN A 1 266  ? 80.986  97.160  38.104  1.00 12.48 ? 266  GLN A CA    1 
ATOM   2069  C  C     . GLN A 1 266  ? 81.181  98.503  38.812  1.00 12.61 ? 266  GLN A C     1 
ATOM   2070  O  O     . GLN A 1 266  ? 80.646  99.527  38.363  1.00 12.58 ? 266  GLN A O     1 
ATOM   2071  C  CB    . GLN A 1 266  ? 79.516  96.745  38.176  1.00 12.68 ? 266  GLN A CB    1 
ATOM   2072  C  CG    . GLN A 1 266  ? 79.191  95.650  39.135  1.00 15.88 ? 266  GLN A CG    1 
ATOM   2073  C  CD    . GLN A 1 266  ? 78.542  94.440  38.457  1.00 18.68 ? 266  GLN A CD    1 
ATOM   2074  O  OE1   . GLN A 1 266  ? 78.312  93.413  39.120  1.00 21.40 ? 266  GLN A OE1   1 
ATOM   2075  N  NE2   . GLN A 1 266  ? 78.247  94.550  37.150  1.00 18.14 ? 266  GLN A NE2   1 
ATOM   2076  N  N     . ALA A 1 267  ? 81.941  98.489  39.905  1.00 12.74 ? 267  ALA A N     1 
ATOM   2077  C  CA    . ALA A 1 267  ? 82.325  99.705  40.610  1.00 13.09 ? 267  ALA A CA    1 
ATOM   2078  C  C     . ALA A 1 267  ? 83.259  100.570 39.758  1.00 13.31 ? 267  ALA A C     1 
ATOM   2079  O  O     . ALA A 1 267  ? 83.328  101.795 39.944  1.00 14.09 ? 267  ALA A O     1 
ATOM   2080  C  CB    . ALA A 1 267  ? 82.981  99.356  41.958  1.00 13.09 ? 267  ALA A CB    1 
ATOM   2081  N  N     . ASN A 1 268  ? 83.974  99.930  38.827  1.00 12.66 ? 268  ASN A N     1 
ATOM   2082  C  CA    . ASN A 1 268  ? 84.952  100.616 37.989  1.00 12.07 ? 268  ASN A CA    1 
ATOM   2083  C  C     . ASN A 1 268  ? 84.433  101.049 36.622  1.00 11.73 ? 268  ASN A C     1 
ATOM   2084  O  O     . ASN A 1 268  ? 83.444  100.503 36.083  1.00 11.51 ? 268  ASN A O     1 
ATOM   2085  C  CB    . ASN A 1 268  ? 86.241  99.784  37.831  1.00 11.96 ? 268  ASN A CB    1 
ATOM   2086  C  CG    . ASN A 1 268  ? 86.937  99.518  39.159  1.00 13.07 ? 268  ASN A CG    1 
ATOM   2087  O  OD1   . ASN A 1 268  ? 86.740  100.244 40.133  1.00 14.26 ? 268  ASN A OD1   1 
ATOM   2088  N  ND2   . ASN A 1 268  ? 87.747  98.464  39.205  1.00 13.19 ? 268  ASN A ND2   1 
ATOM   2089  N  N     . SER A 1 269  ? 85.122  102.030 36.056  1.00 11.39 ? 269  SER A N     1 
ATOM   2090  C  CA    . SER A 1 269  ? 84.715  102.608 34.785  1.00 11.69 ? 269  SER A CA    1 
ATOM   2091  C  C     . SER A 1 269  ? 84.789  101.586 33.666  1.00 11.39 ? 269  SER A C     1 
ATOM   2092  O  O     . SER A 1 269  ? 85.500  100.567 33.763  1.00 11.22 ? 269  SER A O     1 
ATOM   2093  C  CB    . SER A 1 269  ? 85.600  103.818 34.439  1.00 11.48 ? 269  SER A CB    1 
ATOM   2094  O  OG    . SER A 1 269  ? 86.904  103.426 34.044  1.00 13.34 ? 269  SER A OG    1 
ATOM   2095  N  N     . ASP A 1 270  ? 84.061  101.869 32.590  1.00 11.38 ? 270  ASP A N     1 
ATOM   2096  C  CA    . ASP A 1 270  ? 84.200  101.090 31.375  1.00 11.15 ? 270  ASP A CA    1 
ATOM   2097  C  C     . ASP A 1 270  ? 85.662  100.988 30.897  1.00 11.15 ? 270  ASP A C     1 
ATOM   2098  O  O     . ASP A 1 270  ? 86.115  99.905  30.516  1.00 10.61 ? 270  ASP A O     1 
ATOM   2099  C  CB    . ASP A 1 270  ? 83.223  101.573 30.278  1.00 11.07 ? 270  ASP A CB    1 
ATOM   2100  C  CG    . ASP A 1 270  ? 83.495  103.001 29.789  1.00 12.57 ? 270  ASP A CG    1 
ATOM   2101  O  OD1   . ASP A 1 270  ? 84.291  103.760 30.395  1.00 13.04 ? 270  ASP A OD1   1 
ATOM   2102  O  OD2   . ASP A 1 270  ? 82.918  103.448 28.775  1.00 12.96 ? 270  ASP A OD2   1 
ATOM   2103  N  N     . SER A 1 271  ? 86.396  102.103 30.945  1.00 10.57 ? 271  SER A N     1 
ATOM   2104  C  CA    . SER A 1 271  ? 87.786  102.130 30.494  1.00 10.40 ? 271  SER A CA    1 
ATOM   2105  C  C     . SER A 1 271  ? 88.713  101.230 31.322  1.00 9.61  ? 271  SER A C     1 
ATOM   2106  O  O     . SER A 1 271  ? 89.566  100.536 30.766  1.00 8.89  ? 271  SER A O     1 
ATOM   2107  C  CB    . SER A 1 271  ? 88.333  103.562 30.496  1.00 10.81 ? 271  SER A CB    1 
ATOM   2108  O  OG    . SER A 1 271  ? 87.598  104.396 29.609  1.00 12.00 ? 271  SER A OG    1 
ATOM   2109  N  N     . TYR A 1 272  ? 88.560  101.279 32.640  1.00 9.19  ? 272  TYR A N     1 
ATOM   2110  C  CA    . TYR A 1 272  ? 89.318  100.422 33.544  1.00 9.25  ? 272  TYR A CA    1 
ATOM   2111  C  C     . TYR A 1 272  ? 89.062  98.943  33.262  1.00 8.28  ? 272  TYR A C     1 
ATOM   2112  O  O     . TYR A 1 272  ? 89.987  98.158  33.215  1.00 7.15  ? 272  TYR A O     1 
ATOM   2113  C  CB    . TYR A 1 272  ? 88.931  100.731 34.989  1.00 9.89  ? 272  TYR A CB    1 
ATOM   2114  C  CG    . TYR A 1 272  ? 89.878  100.181 36.045  1.00 12.62 ? 272  TYR A CG    1 
ATOM   2115  C  CD1   . TYR A 1 272  ? 90.902  100.978 36.569  1.00 15.45 ? 272  TYR A CD1   1 
ATOM   2116  C  CD2   . TYR A 1 272  ? 89.727  98.886  36.554  1.00 15.77 ? 272  TYR A CD2   1 
ATOM   2117  C  CE1   . TYR A 1 272  ? 91.760  100.495 37.566  1.00 17.12 ? 272  TYR A CE1   1 
ATOM   2118  C  CE2   . TYR A 1 272  ? 90.591  98.389  37.558  1.00 16.50 ? 272  TYR A CE2   1 
ATOM   2119  C  CZ    . TYR A 1 272  ? 91.596  99.206  38.052  1.00 17.78 ? 272  TYR A CZ    1 
ATOM   2120  O  OH    . TYR A 1 272  ? 92.458  98.750  39.032  1.00 22.08 ? 272  TYR A OH    1 
ATOM   2121  N  N     . ASN A 1 273  ? 87.792  98.583  33.101  1.00 7.96  ? 273  ASN A N     1 
ATOM   2122  C  CA    . ASN A 1 273  ? 87.399  97.200  32.873  1.00 7.81  ? 273  ASN A CA    1 
ATOM   2123  C  C     . ASN A 1 273  ? 87.904  96.681  31.518  1.00 7.81  ? 273  ASN A C     1 
ATOM   2124  O  O     . ASN A 1 273  ? 88.331  95.528  31.400  1.00 7.74  ? 273  ASN A O     1 
ATOM   2125  C  CB    . ASN A 1 273  ? 85.875  97.069  32.962  1.00 7.93  ? 273  ASN A CB    1 
ATOM   2126  C  CG    . ASN A 1 273  ? 85.386  96.971  34.386  1.00 8.16  ? 273  ASN A CG    1 
ATOM   2127  O  OD1   . ASN A 1 273  ? 85.609  95.964  35.056  1.00 8.79  ? 273  ASN A OD1   1 
ATOM   2128  N  ND2   . ASN A 1 273  ? 84.716  98.018  34.864  1.00 7.50  ? 273  ASN A ND2   1 
ATOM   2129  N  N     . LEU A 1 274  ? 87.854  97.540  30.504  1.00 7.48  ? 274  LEU A N     1 
ATOM   2130  C  CA    . LEU A 1 274  ? 88.320  97.168  29.177  1.00 7.80  ? 274  LEU A CA    1 
ATOM   2131  C  C     . LEU A 1 274  ? 89.818  96.931  29.171  1.00 6.80  ? 274  LEU A C     1 
ATOM   2132  O  O     . LEU A 1 274  ? 90.286  95.954  28.606  1.00 6.26  ? 274  LEU A O     1 
ATOM   2133  C  CB    . LEU A 1 274  ? 87.976  98.252  28.148  1.00 7.98  ? 274  LEU A CB    1 
ATOM   2134  C  CG    . LEU A 1 274  ? 87.399  97.900  26.770  1.00 10.52 ? 274  LEU A CG    1 
ATOM   2135  C  CD1   . LEU A 1 274  ? 87.605  99.072  25.770  1.00 10.09 ? 274  LEU A CD1   1 
ATOM   2136  C  CD2   . LEU A 1 274  ? 87.899  96.605  26.192  1.00 9.15  ? 274  LEU A CD2   1 
ATOM   2137  N  N     . ASP A 1 275  ? 90.567  97.853  29.777  1.00 6.65  ? 275  ASP A N     1 
ATOM   2138  C  CA    . ASP A 1 275  ? 92.012  97.718  29.906  1.00 5.99  ? 275  ASP A CA    1 
ATOM   2139  C  C     . ASP A 1 275  ? 92.315  96.384  30.589  1.00 5.90  ? 275  ASP A C     1 
ATOM   2140  O  O     . ASP A 1 275  ? 93.180  95.622  30.161  1.00 5.33  ? 275  ASP A O     1 
ATOM   2141  C  CB    . ASP A 1 275  ? 92.576  98.884  30.732  1.00 6.57  ? 275  ASP A CB    1 
ATOM   2142  C  CG    . ASP A 1 275  ? 94.096  98.890  30.768  1.00 7.67  ? 275  ASP A CG    1 
ATOM   2143  O  OD1   . ASP A 1 275  ? 94.646  98.801  31.883  1.00 6.69  ? 275  ASP A OD1   1 
ATOM   2144  O  OD2   . ASP A 1 275  ? 94.827  98.999  29.751  1.00 7.21  ? 275  ASP A OD2   1 
ATOM   2145  N  N     . SER A 1 276  ? 91.579  96.102  31.655  1.00 5.77  ? 276  SER A N     1 
ATOM   2146  C  CA    . SER A 1 276  ? 91.825  94.896  32.434  1.00 5.72  ? 276  SER A CA    1 
ATOM   2147  C  C     . SER A 1 276  ? 91.544  93.631  31.627  1.00 5.72  ? 276  SER A C     1 
ATOM   2148  O  O     . SER A 1 276  ? 92.363  92.694  31.617  1.00 4.81  ? 276  SER A O     1 
ATOM   2149  C  CB    . SER A 1 276  ? 90.973  94.920  33.705  1.00 5.92  ? 276  SER A CB    1 
ATOM   2150  O  OG    . SER A 1 276  ? 91.325  93.860  34.569  1.00 6.86  ? 276  SER A OG    1 
ATOM   2151  N  N     . ALA A 1 277  ? 90.390  93.591  30.957  1.00 4.85  ? 277  ALA A N     1 
ATOM   2152  C  CA    . ALA A 1 277  ? 90.012  92.380  30.232  1.00 5.17  ? 277  ALA A CA    1 
ATOM   2153  C  C     . ALA A 1 277  ? 90.969  92.154  29.072  1.00 5.34  ? 277  ALA A C     1 
ATOM   2154  O  O     . ALA A 1 277  ? 91.348  91.035  28.772  1.00 4.50  ? 277  ALA A O     1 
ATOM   2155  C  CB    . ALA A 1 277  ? 88.564  92.462  29.730  1.00 4.77  ? 277  ALA A CB    1 
ATOM   2156  N  N     . LEU A 1 278  ? 91.331  93.244  28.411  1.00 5.62  ? 278  LEU A N     1 
ATOM   2157  C  CA    . LEU A 1 278  ? 92.210  93.200  27.268  1.00 6.43  ? 278  LEU A CA    1 
ATOM   2158  C  C     . LEU A 1 278  ? 93.610  92.751  27.682  1.00 6.05  ? 278  LEU A C     1 
ATOM   2159  O  O     . LEU A 1 278  ? 94.243  91.940  26.982  1.00 5.15  ? 278  LEU A O     1 
ATOM   2160  C  CB    . LEU A 1 278  ? 92.144  94.571  26.591  1.00 7.78  ? 278  LEU A CB    1 
ATOM   2161  C  CG    . LEU A 1 278  ? 93.181  95.359  25.824  1.00 12.23 ? 278  LEU A CG    1 
ATOM   2162  C  CD1   . LEU A 1 278  ? 93.621  94.655  24.570  1.00 14.37 ? 278  LEU A CD1   1 
ATOM   2163  C  CD2   . LEU A 1 278  ? 92.509  96.695  25.469  1.00 15.87 ? 278  LEU A CD2   1 
ATOM   2164  N  N     . GLU A 1 279  ? 94.080  93.222  28.844  1.00 5.68  ? 279  GLU A N     1 
ATOM   2165  C  CA    . GLU A 1 279  ? 95.381  92.759  29.335  1.00 5.46  ? 279  GLU A CA    1 
ATOM   2166  C  C     . GLU A 1 279  ? 95.382  91.287  29.738  1.00 4.90  ? 279  GLU A C     1 
ATOM   2167  O  O     . GLU A 1 279  ? 96.362  90.580  29.501  1.00 4.43  ? 279  GLU A O     1 
ATOM   2168  C  CB    . GLU A 1 279  ? 95.950  93.628  30.467  1.00 5.77  ? 279  GLU A CB    1 
ATOM   2169  C  CG    . GLU A 1 279  ? 97.439  93.313  30.648  1.00 7.67  ? 279  GLU A CG    1 
ATOM   2170  C  CD    . GLU A 1 279  ? 98.191  94.198  31.632  1.00 9.69  ? 279  GLU A CD    1 
ATOM   2171  O  OE1   . GLU A 1 279  ? 97.568  94.979  32.381  1.00 8.23  ? 279  GLU A OE1   1 
ATOM   2172  O  OE2   . GLU A 1 279  ? 99.439  94.063  31.657  1.00 12.15 ? 279  GLU A OE2   1 
ATOM   2173  N  N     . LEU A 1 280  ? 94.283  90.807  30.321  1.00 4.14  ? 280  LEU A N     1 
ATOM   2174  C  CA    . LEU A 1 280  ? 94.171  89.377  30.591  1.00 4.37  ? 280  LEU A CA    1 
ATOM   2175  C  C     . LEU A 1 280  ? 94.379  88.573  29.297  1.00 4.14  ? 280  LEU A C     1 
ATOM   2176  O  O     . LEU A 1 280  ? 95.084  87.566  29.298  1.00 3.46  ? 280  LEU A O     1 
ATOM   2177  C  CB    . LEU A 1 280  ? 92.815  89.025  31.229  1.00 4.33  ? 280  LEU A CB    1 
ATOM   2178  C  CG    . LEU A 1 280  ? 92.503  87.513  31.301  1.00 4.16  ? 280  LEU A CG    1 
ATOM   2179  C  CD1   . LEU A 1 280  ? 93.334  86.819  32.391  1.00 2.53  ? 280  LEU A CD1   1 
ATOM   2180  C  CD2   . LEU A 1 280  ? 91.016  87.248  31.502  1.00 3.50  ? 280  LEU A CD2   1 
ATOM   2181  N  N     . LEU A 1 281  ? 93.760  89.027  28.201  1.00 3.93  ? 281  LEU A N     1 
ATOM   2182  C  CA    . LEU A 1 281  ? 93.918  88.354  26.915  1.00 4.95  ? 281  LEU A CA    1 
ATOM   2183  C  C     . LEU A 1 281  ? 95.369  88.433  26.422  1.00 5.11  ? 281  LEU A C     1 
ATOM   2184  O  O     . LEU A 1 281  ? 95.930  87.439  25.943  1.00 5.58  ? 281  LEU A O     1 
ATOM   2185  C  CB    . LEU A 1 281  ? 92.932  88.911  25.864  1.00 5.09  ? 281  LEU A CB    1 
ATOM   2186  C  CG    . LEU A 1 281  ? 91.431  88.615  26.072  1.00 6.75  ? 281  LEU A CG    1 
ATOM   2187  C  CD1   . LEU A 1 281  ? 90.587  88.870  24.820  1.00 8.08  ? 281  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU A 1 281  ? 91.232  87.216  26.526  1.00 6.94  ? 281  LEU A CD2   1 
ATOM   2189  N  N     . VAL A 1 282  ? 95.982  89.607  26.569  1.00 5.60  ? 282  VAL A N     1 
ATOM   2190  C  CA    . VAL A 1 282  ? 97.366  89.807  26.119  1.00 5.63  ? 282  VAL A CA    1 
ATOM   2191  C  C     . VAL A 1 282  ? 98.341  88.916  26.887  1.00 5.90  ? 282  VAL A C     1 
ATOM   2192  O  O     . VAL A 1 282  ? 99.127  88.164  26.286  1.00 6.78  ? 282  VAL A O     1 
ATOM   2193  C  CB    . VAL A 1 282  ? 97.780  91.306  26.172  1.00 5.87  ? 282  VAL A CB    1 
ATOM   2194  C  CG1   . VAL A 1 282  ? 99.287  91.460  25.977  1.00 5.55  ? 282  VAL A CG1   1 
ATOM   2195  C  CG2   . VAL A 1 282  ? 97.039  92.080  25.088  1.00 4.89  ? 282  VAL A CG2   1 
ATOM   2196  N  N     . ARG A 1 283  ? 98.244  88.952  28.208  1.00 5.69  ? 283  ARG A N     1 
ATOM   2197  C  CA    . ARG A 1 283  ? 99.209  88.267  29.060  1.00 6.17  ? 283  ARG A CA    1 
ATOM   2198  C  C     . ARG A 1 283  ? 99.058  86.750  29.101  1.00 6.53  ? 283  ARG A C     1 
ATOM   2199  O  O     . ARG A 1 283  ? 99.951  86.064  29.594  1.00 6.75  ? 283  ARG A O     1 
ATOM   2200  C  CB    . ARG A 1 283  ? 99.188  88.850  30.474  1.00 5.83  ? 283  ARG A CB    1 
ATOM   2201  C  CG    . ARG A 1 283  ? 99.445  90.346  30.515  1.00 7.07  ? 283  ARG A CG    1 
ATOM   2202  C  CD    . ARG A 1 283  ? 100.909 90.749  30.433  1.00 6.71  ? 283  ARG A CD    1 
ATOM   2203  N  NE    . ARG A 1 283  ? 101.054 92.200  30.291  1.00 8.88  ? 283  ARG A NE    1 
ATOM   2204  C  CZ    . ARG A 1 283  ? 101.991 92.807  29.565  1.00 7.54  ? 283  ARG A CZ    1 
ATOM   2205  N  NH1   . ARG A 1 283  ? 102.904 92.099  28.907  1.00 7.84  ? 283  ARG A NH1   1 
ATOM   2206  N  NH2   . ARG A 1 283  ? 102.023 94.129  29.513  1.00 7.88  ? 283  ARG A NH2   1 
ATOM   2207  N  N     . THR A 1 284  ? 97.948  86.232  28.575  1.00 6.41  ? 284  THR A N     1 
ATOM   2208  C  CA    . THR A 1 284  ? 97.767  84.786  28.453  1.00 6.69  ? 284  THR A CA    1 
ATOM   2209  C  C     . THR A 1 284  ? 98.094  84.265  27.051  1.00 7.39  ? 284  THR A C     1 
ATOM   2210  O  O     . THR A 1 284  ? 97.817  83.108  26.745  1.00 7.78  ? 284  THR A O     1 
ATOM   2211  C  CB    . THR A 1 284  ? 96.345  84.353  28.877  1.00 6.26  ? 284  THR A CB    1 
ATOM   2212  O  OG1   . THR A 1 284  ? 95.382  85.211  28.255  1.00 5.27  ? 284  THR A OG1   1 
ATOM   2213  C  CG2   . THR A 1 284  ? 96.132  84.572  30.398  1.00 6.11  ? 284  THR A CG2   1 
ATOM   2214  N  N     . GLY A 1 285  ? 98.648  85.125  26.195  1.00 8.10  ? 285  GLY A N     1 
ATOM   2215  C  CA    . GLY A 1 285  ? 99.218  84.666  24.936  1.00 8.16  ? 285  GLY A CA    1 
ATOM   2216  C  C     . GLY A 1 285  ? 98.721  85.267  23.624  1.00 8.14  ? 285  GLY A C     1 
ATOM   2217  O  O     . GLY A 1 285  ? 98.970  84.696  22.553  1.00 8.97  ? 285  GLY A O     1 
ATOM   2218  N  N     . ARG A 1 286  ? 98.009  86.385  23.675  1.00 7.49  ? 286  ARG A N     1 
ATOM   2219  C  CA    . ARG A 1 286  ? 97.633  87.075  22.436  1.00 7.17  ? 286  ARG A CA    1 
ATOM   2220  C  C     . ARG A 1 286  ? 98.308  88.439  22.344  1.00 6.86  ? 286  ARG A C     1 
ATOM   2221  O  O     . ARG A 1 286  ? 98.598  89.068  23.367  1.00 5.72  ? 286  ARG A O     1 
ATOM   2222  C  CB    . ARG A 1 286  ? 96.114  87.271  22.368  1.00 7.55  ? 286  ARG A CB    1 
ATOM   2223  C  CG    . ARG A 1 286  ? 95.314  85.977  22.396  1.00 8.77  ? 286  ARG A CG    1 
ATOM   2224  C  CD    . ARG A 1 286  ? 93.838  86.193  22.198  1.00 10.29 ? 286  ARG A CD    1 
ATOM   2225  N  NE    . ARG A 1 286  ? 93.010  85.083  22.680  1.00 15.55 ? 286  ARG A NE    1 
ATOM   2226  C  CZ    . ARG A 1 286  ? 92.630  84.046  21.947  1.00 15.15 ? 286  ARG A CZ    1 
ATOM   2227  N  NH1   . ARG A 1 286  ? 93.021  83.939  20.684  1.00 16.79 ? 286  ARG A NH1   1 
ATOM   2228  N  NH2   . ARG A 1 286  ? 91.840  83.117  22.470  1.00 15.09 ? 286  ARG A NH2   1 
ATOM   2229  N  N     . SER A 1 287  ? 98.533  88.907  21.121  1.00 6.34  ? 287  SER A N     1 
ATOM   2230  C  CA    . SER A 1 287  ? 98.912  90.293  20.921  1.00 7.00  ? 287  SER A CA    1 
ATOM   2231  C  C     . SER A 1 287  ? 97.716  91.197  21.265  1.00 6.63  ? 287  SER A C     1 
ATOM   2232  O  O     . SER A 1 287  ? 96.576  90.734  21.276  1.00 6.52  ? 287  SER A O     1 
ATOM   2233  C  CB    . SER A 1 287  ? 99.371  90.520  19.479  1.00 7.41  ? 287  SER A CB    1 
ATOM   2234  O  OG    . SER A 1 287  ? 98.293  90.975  18.699  1.00 8.19  ? 287  SER A OG    1 
ATOM   2235  N  N     . PRO A 1 288  ? 97.955  92.470  21.571  1.00 6.39  ? 288  PRO A N     1 
ATOM   2236  C  CA    . PRO A 1 288  ? 96.845  93.389  21.865  1.00 5.75  ? 288  PRO A CA    1 
ATOM   2237  C  C     . PRO A 1 288  ? 95.903  93.564  20.676  1.00 5.62  ? 288  PRO A C     1 
ATOM   2238  O  O     . PRO A 1 288  ? 94.723  93.866  20.866  1.00 5.04  ? 288  PRO A O     1 
ATOM   2239  C  CB    . PRO A 1 288  ? 97.547  94.714  22.200  1.00 6.20  ? 288  PRO A CB    1 
ATOM   2240  C  CG    . PRO A 1 288  ? 98.946  94.341  22.532  1.00 6.22  ? 288  PRO A CG    1 
ATOM   2241  C  CD    . PRO A 1 288  ? 99.270  93.132  21.696  1.00 6.45  ? 288  PRO A CD    1 
ATOM   2242  N  N     . LEU A 1 289  ? 96.427  93.376  19.471  1.00 5.61  ? 289  LEU A N     1 
ATOM   2243  C  CA    . LEU A 1 289  ? 95.592  93.417  18.280  1.00 6.20  ? 289  LEU A CA    1 
ATOM   2244  C  C     . LEU A 1 289  ? 94.573  92.287  18.295  1.00 5.62  ? 289  LEU A C     1 
ATOM   2245  O  O     . LEU A 1 289  ? 93.394  92.530  18.095  1.00 6.02  ? 289  LEU A O     1 
ATOM   2246  C  CB    . LEU A 1 289  ? 96.459  93.370  17.015  1.00 6.04  ? 289  LEU A CB    1 
ATOM   2247  C  CG    . LEU A 1 289  ? 97.441  94.551  16.982  1.00 6.32  ? 289  LEU A CG    1 
ATOM   2248  C  CD1   . LEU A 1 289  ? 98.641  94.238  16.097  1.00 7.06  ? 289  LEU A CD1   1 
ATOM   2249  C  CD2   . LEU A 1 289  ? 96.728  95.811  16.529  1.00 7.67  ? 289  LEU A CD2   1 
ATOM   2250  N  N     . GLU A 1 290  ? 95.024  91.059  18.546  1.00 5.38  ? 290  GLU A N     1 
ATOM   2251  C  CA    . GLU A 1 290  ? 94.109  89.913  18.585  1.00 4.79  ? 290  GLU A CA    1 
ATOM   2252  C  C     . GLU A 1 290  ? 93.122  90.044  19.743  1.00 4.47  ? 290  GLU A C     1 
ATOM   2253  O  O     . GLU A 1 290  ? 91.943  89.753  19.580  1.00 3.80  ? 290  GLU A O     1 
ATOM   2254  C  CB    . GLU A 1 290  ? 94.858  88.576  18.646  1.00 5.28  ? 290  GLU A CB    1 
ATOM   2255  C  CG    . GLU A 1 290  ? 93.905  87.383  18.490  1.00 6.96  ? 290  GLU A CG    1 
ATOM   2256  C  CD    . GLU A 1 290  ? 94.576  86.022  18.574  1.00 9.81  ? 290  GLU A CD    1 
ATOM   2257  O  OE1   . GLU A 1 290  ? 95.819  85.936  18.456  1.00 10.55 ? 290  GLU A OE1   1 
ATOM   2258  O  OE2   . GLU A 1 290  ? 93.843  85.017  18.749  1.00 11.88 ? 290  GLU A OE2   1 
ATOM   2259  N  N     . ALA A 1 291  ? 93.601  90.505  20.902  1.00 4.14  ? 291  ALA A N     1 
ATOM   2260  C  CA    . ALA A 1 291  ? 92.709  90.766  22.042  1.00 4.00  ? 291  ALA A CA    1 
ATOM   2261  C  C     . ALA A 1 291  ? 91.533  91.691  21.668  1.00 4.05  ? 291  ALA A C     1 
ATOM   2262  O  O     . ALA A 1 291  ? 90.373  91.399  21.987  1.00 3.20  ? 291  ALA A O     1 
ATOM   2263  C  CB    . ALA A 1 291  ? 93.500  91.362  23.200  1.00 4.29  ? 291  ALA A CB    1 
ATOM   2264  N  N     . ALA A 1 292  ? 91.841  92.800  20.993  1.00 4.36  ? 292  ALA A N     1 
ATOM   2265  C  CA    . ALA A 1 292  ? 90.821  93.778  20.595  1.00 4.27  ? 292  ALA A CA    1 
ATOM   2266  C  C     . ALA A 1 292  ? 89.856  93.194  19.569  1.00 4.51  ? 292  ALA A C     1 
ATOM   2267  O  O     . ALA A 1 292  ? 88.658  93.485  19.625  1.00 3.84  ? 292  ALA A O     1 
ATOM   2268  C  CB    . ALA A 1 292  ? 91.462  95.052  20.056  1.00 4.56  ? 292  ALA A CB    1 
ATOM   2269  N  N     . MET A 1 293  ? 90.378  92.365  18.649  1.00 4.19  ? 293  MET A N     1 
ATOM   2270  C  CA    . MET A 1 293  ? 89.540  91.662  17.651  1.00 4.55  ? 293  MET A CA    1 
ATOM   2271  C  C     . MET A 1 293  ? 88.455  90.802  18.308  1.00 4.37  ? 293  MET A C     1 
ATOM   2272  O  O     . MET A 1 293  ? 87.355  90.682  17.778  1.00 4.39  ? 293  MET A O     1 
ATOM   2273  C  CB    . MET A 1 293  ? 90.387  90.745  16.762  1.00 4.39  ? 293  MET A CB    1 
ATOM   2274  C  CG    . MET A 1 293  ? 91.101  91.429  15.614  1.00 5.48  ? 293  MET A CG    1 
ATOM   2275  S  SD    . MET A 1 293  ? 92.347  90.324  14.848  1.00 7.08  ? 293  MET A SD    1 
ATOM   2276  C  CE    . MET A 1 293  ? 91.268  89.194  13.957  1.00 3.47  ? 293  MET A CE    1 
ATOM   2277  N  N     . ILE A 1 294  ? 88.782  90.193  19.453  1.00 3.85  ? 294  ILE A N     1 
ATOM   2278  C  CA    . ILE A 1 294  ? 87.844  89.341  20.191  1.00 3.41  ? 294  ILE A CA    1 
ATOM   2279  C  C     . ILE A 1 294  ? 86.863  90.147  21.051  1.00 3.49  ? 294  ILE A C     1 
ATOM   2280  O  O     . ILE A 1 294  ? 85.652  89.876  21.048  1.00 3.02  ? 294  ILE A O     1 
ATOM   2281  C  CB    . ILE A 1 294  ? 88.622  88.343  21.071  1.00 3.70  ? 294  ILE A CB    1 
ATOM   2282  C  CG1   . ILE A 1 294  ? 89.439  87.396  20.176  1.00 2.84  ? 294  ILE A CG1   1 
ATOM   2283  C  CG2   . ILE A 1 294  ? 87.635  87.563  21.978  1.00 3.67  ? 294  ILE A CG2   1 
ATOM   2284  C  CD1   . ILE A 1 294  ? 90.506  86.569  20.890  1.00 2.03  ? 294  ILE A CD1   1 
ATOM   2285  N  N     . LEU A 1 295  ? 87.376  91.128  21.792  1.00 3.18  ? 295  LEU A N     1 
ATOM   2286  C  CA    . LEU A 1 295  ? 86.504  91.952  22.642  1.00 4.09  ? 295  LEU A CA    1 
ATOM   2287  C  C     . LEU A 1 295  ? 85.664  92.970  21.865  1.00 3.79  ? 295  LEU A C     1 
ATOM   2288  O  O     . LEU A 1 295  ? 84.541  93.267  22.257  1.00 3.68  ? 295  LEU A O     1 
ATOM   2289  C  CB    . LEU A 1 295  ? 87.290  92.650  23.765  1.00 4.04  ? 295  LEU A CB    1 
ATOM   2290  C  CG    . LEU A 1 295  ? 87.928  91.715  24.808  1.00 5.95  ? 295  LEU A CG    1 
ATOM   2291  C  CD1   . LEU A 1 295  ? 88.514  92.524  25.971  1.00 8.31  ? 295  LEU A CD1   1 
ATOM   2292  C  CD2   . LEU A 1 295  ? 86.929  90.675  25.331  1.00 8.08  ? 295  LEU A CD2   1 
ATOM   2293  N  N     . VAL A 1 296  ? 86.208  93.491  20.765  1.00 3.71  ? 296  VAL A N     1 
ATOM   2294  C  CA    . VAL A 1 296  ? 85.532  94.535  19.983  1.00 4.14  ? 296  VAL A CA    1 
ATOM   2295  C  C     . VAL A 1 296  ? 85.600  94.146  18.498  1.00 3.89  ? 296  VAL A C     1 
ATOM   2296  O  O     . VAL A 1 296  ? 86.311  94.774  17.694  1.00 3.48  ? 296  VAL A O     1 
ATOM   2297  C  CB    . VAL A 1 296  ? 86.129  95.952  20.277  1.00 4.98  ? 296  VAL A CB    1 
ATOM   2298  C  CG1   . VAL A 1 296  ? 85.365  97.043  19.517  1.00 4.49  ? 296  VAL A CG1   1 
ATOM   2299  C  CG2   . VAL A 1 296  ? 86.092  96.249  21.795  1.00 4.84  ? 296  VAL A CG2   1 
ATOM   2300  N  N     . PRO A 1 297  ? 84.887  93.069  18.149  1.00 3.37  ? 297  PRO A N     1 
ATOM   2301  C  CA    . PRO A 1 297  ? 84.966  92.513  16.798  1.00 3.92  ? 297  PRO A CA    1 
ATOM   2302  C  C     . PRO A 1 297  ? 84.281  93.380  15.756  1.00 4.24  ? 297  PRO A C     1 
ATOM   2303  O  O     . PRO A 1 297  ? 83.254  94.016  16.015  1.00 4.79  ? 297  PRO A O     1 
ATOM   2304  C  CB    . PRO A 1 297  ? 84.248  91.163  16.920  1.00 3.05  ? 297  PRO A CB    1 
ATOM   2305  C  CG    . PRO A 1 297  ? 83.247  91.384  18.007  1.00 3.67  ? 297  PRO A CG    1 
ATOM   2306  C  CD    . PRO A 1 297  ? 83.956  92.301  19.002  1.00 3.21  ? 297  PRO A CD    1 
ATOM   2307  N  N     . GLU A 1 298  ? 84.886  93.384  14.579  1.00 5.03  ? 298  GLU A N     1 
ATOM   2308  C  CA    . GLU A 1 298  ? 84.343  93.967  13.353  1.00 5.83  ? 298  GLU A CA    1 
ATOM   2309  C  C     . GLU A 1 298  ? 82.948  93.452  13.026  1.00 5.24  ? 298  GLU A C     1 
ATOM   2310  O  O     . GLU A 1 298  ? 82.642  92.286  13.284  1.00 4.23  ? 298  GLU A O     1 
ATOM   2311  C  CB    . GLU A 1 298  ? 85.210  93.440  12.225  1.00 7.41  ? 298  GLU A CB    1 
ATOM   2312  C  CG    . GLU A 1 298  ? 85.645  94.448  11.224  1.00 9.67  ? 298  GLU A CG    1 
ATOM   2313  C  CD    . GLU A 1 298  ? 86.261  93.753  10.033  1.00 11.69 ? 298  GLU A CD    1 
ATOM   2314  O  OE1   . GLU A 1 298  ? 85.723  93.929  8.908   1.00 12.96 ? 298  GLU A OE1   1 
ATOM   2315  O  OE2   . GLU A 1 298  ? 87.285  93.043  10.236  1.00 12.93 ? 298  GLU A OE2   1 
ATOM   2316  N  N     . ALA A 1 299  ? 82.119  94.303  12.415  1.00 5.00  ? 299  ALA A N     1 
ATOM   2317  C  CA    . ALA A 1 299  ? 80.894  93.827  11.760  1.00 5.29  ? 299  ALA A CA    1 
ATOM   2318  C  C     . ALA A 1 299  ? 81.283  93.140  10.441  1.00 5.39  ? 299  ALA A C     1 
ATOM   2319  O  O     . ALA A 1 299  ? 81.287  93.753  9.363   1.00 4.92  ? 299  ALA A O     1 
ATOM   2320  C  CB    . ALA A 1 299  ? 79.893  94.990  11.522  1.00 4.44  ? 299  ALA A CB    1 
ATOM   2321  N  N     . TYR A 1 300  ? 81.622  91.858  10.554  1.00 6.10  ? 300  TYR A N     1 
ATOM   2322  C  CA    . TYR A 1 300  ? 82.220  91.079  9.462   1.00 6.87  ? 300  TYR A CA    1 
ATOM   2323  C  C     . TYR A 1 300  ? 81.225  90.519  8.439   1.00 7.23  ? 300  TYR A C     1 
ATOM   2324  O  O     . TYR A 1 300  ? 81.618  90.184  7.326   1.00 6.89  ? 300  TYR A O     1 
ATOM   2325  C  CB    . TYR A 1 300  ? 83.080  89.948  10.036  1.00 6.97  ? 300  TYR A CB    1 
ATOM   2326  C  CG    . TYR A 1 300  ? 82.266  88.817  10.635  1.00 7.12  ? 300  TYR A CG    1 
ATOM   2327  C  CD1   . TYR A 1 300  ? 82.041  87.641  9.923   1.00 7.03  ? 300  TYR A CD1   1 
ATOM   2328  C  CD2   . TYR A 1 300  ? 81.729  88.926  11.923  1.00 7.26  ? 300  TYR A CD2   1 
ATOM   2329  C  CE1   . TYR A 1 300  ? 81.282  86.595  10.472  1.00 7.52  ? 300  TYR A CE1   1 
ATOM   2330  C  CE2   . TYR A 1 300  ? 80.968  87.896  12.475  1.00 8.85  ? 300  TYR A CE2   1 
ATOM   2331  C  CZ    . TYR A 1 300  ? 80.760  86.733  11.745  1.00 7.73  ? 300  TYR A CZ    1 
ATOM   2332  O  OH    . TYR A 1 300  ? 80.010  85.718  12.293  1.00 11.48 ? 300  TYR A OH    1 
ATOM   2333  N  N     . LYS A 1 301  ? 79.956  90.390  8.815   1.00 8.16  ? 301  LYS A N     1 
ATOM   2334  C  CA    . LYS A 1 301  ? 78.928  89.885  7.887   1.00 9.83  ? 301  LYS A CA    1 
ATOM   2335  C  C     . LYS A 1 301  ? 78.682  90.899  6.786   1.00 10.01 ? 301  LYS A C     1 
ATOM   2336  O  O     . LYS A 1 301  ? 78.824  92.102  7.011   1.00 10.10 ? 301  LYS A O     1 
ATOM   2337  C  CB    . LYS A 1 301  ? 77.599  89.603  8.612   1.00 10.00 ? 301  LYS A CB    1 
ATOM   2338  C  CG    . LYS A 1 301  ? 77.689  88.536  9.672   1.00 10.99 ? 301  LYS A CG    1 
ATOM   2339  C  CD    . LYS A 1 301  ? 77.521  87.156  9.073   1.00 14.41 ? 301  LYS A CD    1 
ATOM   2340  C  CE    . LYS A 1 301  ? 77.155  86.134  10.135  1.00 16.08 ? 301  LYS A CE    1 
ATOM   2341  N  NZ    . LYS A 1 301  ? 77.031  86.790  11.483  1.00 18.03 ? 301  LYS A NZ    1 
ATOM   2342  N  N     . ASN A 1 302  ? 78.344  90.412  5.592   1.00 11.71 ? 302  ASN A N     1 
ATOM   2343  C  CA    . ASN A 1 302  ? 77.985  91.287  4.471   1.00 12.33 ? 302  ASN A CA    1 
ATOM   2344  C  C     . ASN A 1 302  ? 79.074  92.327  4.204   1.00 12.27 ? 302  ASN A C     1 
ATOM   2345  O  O     . ASN A 1 302  ? 78.788  93.514  3.949   1.00 12.57 ? 302  ASN A O     1 
ATOM   2346  C  CB    . ASN A 1 302  ? 76.647  91.977  4.768   1.00 13.48 ? 302  ASN A CB    1 
ATOM   2347  C  CG    . ASN A 1 302  ? 75.506  90.980  4.967   1.00 16.04 ? 302  ASN A CG    1 
ATOM   2348  O  OD1   . ASN A 1 302  ? 75.731  89.770  5.124   1.00 19.98 ? 302  ASN A OD1   1 
ATOM   2349  N  ND2   . ASN A 1 302  ? 74.275  91.484  4.960   1.00 19.37 ? 302  ASN A ND2   1 
ATOM   2350  N  N     . GLN A 1 303  ? 80.325  91.887  4.338   1.00 11.24 ? 303  GLN A N     1 
ATOM   2351  C  CA    . GLN A 1 303  ? 81.483  92.738  4.106   1.00 10.57 ? 303  GLN A CA    1 
ATOM   2352  C  C     . GLN A 1 303  ? 82.199  92.264  2.842   1.00 10.23 ? 303  GLN A C     1 
ATOM   2353  O  O     . GLN A 1 303  ? 82.970  91.299  2.888   1.00 9.48  ? 303  GLN A O     1 
ATOM   2354  C  CB    . GLN A 1 303  ? 82.422  92.743  5.334   1.00 10.25 ? 303  GLN A CB    1 
ATOM   2355  C  CG    . GLN A 1 303  ? 83.665  93.630  5.217   1.00 10.61 ? 303  GLN A CG    1 
ATOM   2356  C  CD    . GLN A 1 303  ? 83.333  95.091  4.915   1.00 12.00 ? 303  GLN A CD    1 
ATOM   2357  O  OE1   . GLN A 1 303  ? 83.426  95.947  5.799   1.00 12.68 ? 303  GLN A OE1   1 
ATOM   2358  N  NE2   . GLN A 1 303  ? 82.950  95.373  3.671   1.00 8.63  ? 303  GLN A NE2   1 
ATOM   2359  N  N     . PRO A 1 304  ? 81.922  92.919  1.712   1.00 10.03 ? 304  PRO A N     1 
ATOM   2360  C  CA    . PRO A 1 304  ? 82.625  92.623  0.454   1.00 10.06 ? 304  PRO A CA    1 
ATOM   2361  C  C     . PRO A 1 304  ? 84.146  92.694  0.591   1.00 9.98  ? 304  PRO A C     1 
ATOM   2362  O  O     . PRO A 1 304  ? 84.831  91.926  -0.084  1.00 10.43 ? 304  PRO A O     1 
ATOM   2363  C  CB    . PRO A 1 304  ? 82.107  93.709  -0.495  1.00 9.83  ? 304  PRO A CB    1 
ATOM   2364  C  CG    . PRO A 1 304  ? 80.701  93.970  0.022   1.00 9.87  ? 304  PRO A CG    1 
ATOM   2365  C  CD    . PRO A 1 304  ? 80.886  93.960  1.523   1.00 9.77  ? 304  PRO A CD    1 
ATOM   2366  N  N     . ALA A 1 305  ? 84.648  93.559  1.468   1.00 10.19 ? 305  ALA A N     1 
ATOM   2367  C  CA    . ALA A 1 305  ? 86.099  93.712  1.678   1.00 10.70 ? 305  ALA A CA    1 
ATOM   2368  C  C     . ALA A 1 305  ? 86.788  92.462  2.251   1.00 10.58 ? 305  ALA A C     1 
ATOM   2369  O  O     . ALA A 1 305  ? 88.027  92.400  2.289   1.00 10.90 ? 305  ALA A O     1 
ATOM   2370  C  CB    . ALA A 1 305  ? 86.387  94.930  2.551   1.00 10.41 ? 305  ALA A CB    1 
ATOM   2371  N  N     . LEU A 1 306  ? 85.985  91.487  2.695   1.00 10.13 ? 306  LEU A N     1 
ATOM   2372  C  CA    . LEU A 1 306  ? 86.485  90.255  3.320   1.00 9.71  ? 306  LEU A CA    1 
ATOM   2373  C  C     . LEU A 1 306  ? 86.390  89.040  2.391   1.00 10.14 ? 306  LEU A C     1 
ATOM   2374  O  O     . LEU A 1 306  ? 86.671  87.911  2.800   1.00 9.85  ? 306  LEU A O     1 
ATOM   2375  C  CB    . LEU A 1 306  ? 85.757  89.978  4.645   1.00 9.12  ? 306  LEU A CB    1 
ATOM   2376  C  CG    . LEU A 1 306  ? 86.138  90.800  5.880   1.00 9.17  ? 306  LEU A CG    1 
ATOM   2377  C  CD1   . LEU A 1 306  ? 85.242  90.457  7.073   1.00 7.33  ? 306  LEU A CD1   1 
ATOM   2378  C  CD2   . LEU A 1 306  ? 87.604  90.601  6.240   1.00 7.32  ? 306  LEU A CD2   1 
ATOM   2379  N  N     . LYS A 1 307  ? 86.007  89.287  1.140   1.00 10.57 ? 307  LYS A N     1 
ATOM   2380  C  CA    . LYS A 1 307  ? 85.857  88.242  0.123   1.00 11.05 ? 307  LYS A CA    1 
ATOM   2381  C  C     . LYS A 1 307  ? 87.106  87.362  -0.051  1.00 10.87 ? 307  LYS A C     1 
ATOM   2382  O  O     . LYS A 1 307  ? 87.001  86.138  -0.182  1.00 10.49 ? 307  LYS A O     1 
ATOM   2383  C  CB    . LYS A 1 307  ? 85.514  88.879  -1.220  1.00 11.03 ? 307  LYS A CB    1 
ATOM   2384  C  CG    . LYS A 1 307  ? 84.545  88.077  -2.055  1.00 13.65 ? 307  LYS A CG    1 
ATOM   2385  C  CD    . LYS A 1 307  ? 84.459  88.624  -3.493  1.00 16.13 ? 307  LYS A CD    1 
ATOM   2386  C  CE    . LYS A 1 307  ? 84.027  90.104  -3.524  1.00 16.22 ? 307  LYS A CE    1 
ATOM   2387  N  NZ    . LYS A 1 307  ? 83.524  90.490  -4.892  1.00 19.27 ? 307  LYS A NZ    1 
ATOM   2388  N  N     . ASP A 1 308  ? 88.274  87.994  -0.063  1.00 10.67 ? 308  ASP A N     1 
ATOM   2389  C  CA    . ASP A 1 308  ? 89.536  87.283  -0.245  1.00 11.06 ? 308  ASP A CA    1 
ATOM   2390  C  C     . ASP A 1 308  ? 90.180  86.898  1.088   1.00 10.50 ? 308  ASP A C     1 
ATOM   2391  O  O     . ASP A 1 308  ? 91.324  86.448  1.111   1.00 10.29 ? 308  ASP A O     1 
ATOM   2392  C  CB    . ASP A 1 308  ? 90.525  88.113  -1.088  1.00 12.00 ? 308  ASP A CB    1 
ATOM   2393  C  CG    . ASP A 1 308  ? 89.929  88.597  -2.427  1.00 14.24 ? 308  ASP A CG    1 
ATOM   2394  O  OD1   . ASP A 1 308  ? 89.148  87.857  -3.070  1.00 15.55 ? 308  ASP A OD1   1 
ATOM   2395  O  OD2   . ASP A 1 308  ? 90.202  89.721  -2.912  1.00 17.34 ? 308  ASP A OD2   1 
ATOM   2396  N  N     . TYR A 1 309  ? 89.444  87.068  2.189   1.00 9.74  ? 309  TYR A N     1 
ATOM   2397  C  CA    . TYR A 1 309  ? 89.934  86.709  3.525   1.00 9.06  ? 309  TYR A CA    1 
ATOM   2398  C  C     . TYR A 1 309  ? 88.960  85.785  4.280   1.00 8.74  ? 309  TYR A C     1 
ATOM   2399  O  O     . TYR A 1 309  ? 88.455  86.156  5.355   1.00 8.26  ? 309  TYR A O     1 
ATOM   2400  C  CB    . TYR A 1 309  ? 90.194  87.964  4.359   1.00 9.04  ? 309  TYR A CB    1 
ATOM   2401  C  CG    . TYR A 1 309  ? 91.226  88.911  3.776   1.00 9.39  ? 309  TYR A CG    1 
ATOM   2402  C  CD1   . TYR A 1 309  ? 90.842  89.932  2.914   1.00 11.11 ? 309  TYR A CD1   1 
ATOM   2403  C  CD2   . TYR A 1 309  ? 92.583  88.789  4.093   1.00 9.66  ? 309  TYR A CD2   1 
ATOM   2404  C  CE1   . TYR A 1 309  ? 91.772  90.815  2.378   1.00 12.49 ? 309  TYR A CE1   1 
ATOM   2405  C  CE2   . TYR A 1 309  ? 93.525  89.660  3.559   1.00 11.02 ? 309  TYR A CE2   1 
ATOM   2406  C  CZ    . TYR A 1 309  ? 93.108  90.677  2.703   1.00 13.08 ? 309  TYR A CZ    1 
ATOM   2407  O  OH    . TYR A 1 309  ? 94.013  91.565  2.162   1.00 13.72 ? 309  TYR A OH    1 
ATOM   2408  N  N     . PRO A 1 310  ? 88.692  84.591  3.738   1.00 8.48  ? 310  PRO A N     1 
ATOM   2409  C  CA    . PRO A 1 310  ? 87.785  83.635  4.401   1.00 8.28  ? 310  PRO A CA    1 
ATOM   2410  C  C     . PRO A 1 310  ? 88.178  83.310  5.844   1.00 7.50  ? 310  PRO A C     1 
ATOM   2411  O  O     . PRO A 1 310  ? 87.289  83.080  6.658   1.00 7.49  ? 310  PRO A O     1 
ATOM   2412  C  CB    . PRO A 1 310  ? 87.900  82.379  3.525   1.00 8.34  ? 310  PRO A CB    1 
ATOM   2413  C  CG    . PRO A 1 310  ? 89.169  82.562  2.755   1.00 8.80  ? 310  PRO A CG    1 
ATOM   2414  C  CD    . PRO A 1 310  ? 89.207  84.038  2.471   1.00 8.64  ? 310  PRO A CD    1 
ATOM   2415  N  N     . GLU A 1 311  ? 89.475  83.294  6.148   1.00 7.39  ? 311  GLU A N     1 
ATOM   2416  C  CA    . GLU A 1 311  ? 89.955  82.963  7.493   1.00 7.34  ? 311  GLU A CA    1 
ATOM   2417  C  C     . GLU A 1 311  ? 89.559  84.030  8.523   1.00 6.79  ? 311  GLU A C     1 
ATOM   2418  O  O     . GLU A 1 311  ? 89.331  83.709  9.687   1.00 6.45  ? 311  GLU A O     1 
ATOM   2419  C  CB    . GLU A 1 311  ? 91.475  82.678  7.504   1.00 7.99  ? 311  GLU A CB    1 
ATOM   2420  C  CG    . GLU A 1 311  ? 91.871  81.494  6.615   1.00 10.62 ? 311  GLU A CG    1 
ATOM   2421  C  CD    . GLU A 1 311  ? 93.377  81.211  6.552   1.00 14.65 ? 311  GLU A CD    1 
ATOM   2422  O  OE1   . GLU A 1 311  ? 93.962  80.811  7.591   1.00 16.15 ? 311  GLU A OE1   1 
ATOM   2423  O  OE2   . GLU A 1 311  ? 93.979  81.336  5.450   1.00 15.62 ? 311  GLU A OE2   1 
ATOM   2424  N  N     . ILE A 1 312  ? 89.456  85.290  8.098   1.00 5.77  ? 312  ILE A N     1 
ATOM   2425  C  CA    . ILE A 1 312  ? 89.035  86.351  9.017   1.00 5.63  ? 312  ILE A CA    1 
ATOM   2426  C  C     . ILE A 1 312  ? 87.565  86.188  9.381   1.00 5.41  ? 312  ILE A C     1 
ATOM   2427  O  O     . ILE A 1 312  ? 87.203  86.265  10.561  1.00 5.86  ? 312  ILE A O     1 
ATOM   2428  C  CB    . ILE A 1 312  ? 89.306  87.747  8.445   1.00 5.44  ? 312  ILE A CB    1 
ATOM   2429  C  CG1   . ILE A 1 312  ? 90.806  87.924  8.177   1.00 5.66  ? 312  ILE A CG1   1 
ATOM   2430  C  CG2   . ILE A 1 312  ? 88.749  88.834  9.390   1.00 6.23  ? 312  ILE A CG2   1 
ATOM   2431  C  CD1   . ILE A 1 312  ? 91.181  89.312  7.641   1.00 4.31  ? 312  ILE A CD1   1 
ATOM   2432  N  N     . SER A 1 313  ? 86.731  85.928  8.381   1.00 4.70  ? 313  SER A N     1 
ATOM   2433  C  CA    . SER A 1 313  ? 85.329  85.603  8.618   1.00 5.25  ? 313  SER A CA    1 
ATOM   2434  C  C     . SER A 1 313  ? 85.164  84.368  9.522   1.00 5.45  ? 313  SER A C     1 
ATOM   2435  O  O     . SER A 1 313  ? 84.312  84.373  10.408  1.00 5.07  ? 313  SER A O     1 
ATOM   2436  C  CB    . SER A 1 313  ? 84.592  85.409  7.294   1.00 5.53  ? 313  SER A CB    1 
ATOM   2437  O  OG    . SER A 1 313  ? 84.552  86.636  6.569   1.00 6.71  ? 313  SER A OG    1 
ATOM   2438  N  N     . ASP A 1 314  ? 86.003  83.344  9.320   1.00 5.20  ? 314  ASP A N     1 
ATOM   2439  C  CA    . ASP A 1 314  ? 85.991  82.141  10.164  1.00 5.18  ? 314  ASP A CA    1 
ATOM   2440  C  C     . ASP A 1 314  ? 86.304  82.451  11.640  1.00 4.35  ? 314  ASP A C     1 
ATOM   2441  O  O     . ASP A 1 314  ? 85.681  81.867  12.529  1.00 3.56  ? 314  ASP A O     1 
ATOM   2442  C  CB    . ASP A 1 314  ? 86.997  81.086  9.678   1.00 5.57  ? 314  ASP A CB    1 
ATOM   2443  C  CG    . ASP A 1 314  ? 86.610  80.434  8.353   1.00 7.19  ? 314  ASP A CG    1 
ATOM   2444  O  OD1   . ASP A 1 314  ? 85.445  80.525  7.906   1.00 9.31  ? 314  ASP A OD1   1 
ATOM   2445  O  OD2   . ASP A 1 314  ? 87.437  79.777  7.688   1.00 8.59  ? 314  ASP A OD2   1 
ATOM   2446  N  N     . PHE A 1 315  ? 87.302  83.316  11.873  1.00 3.73  ? 315  PHE A N     1 
ATOM   2447  C  CA    . PHE A 1 315  ? 87.729  83.745  13.213  1.00 3.94  ? 315  PHE A CA    1 
ATOM   2448  C  C     . PHE A 1 315  ? 86.540  84.343  13.950  1.00 3.71  ? 315  PHE A C     1 
ATOM   2449  O  O     . PHE A 1 315  ? 86.239  83.960  15.079  1.00 3.04  ? 315  PHE A O     1 
ATOM   2450  C  CB    . PHE A 1 315  ? 88.891  84.767  13.097  1.00 4.07  ? 315  PHE A CB    1 
ATOM   2451  C  CG    . PHE A 1 315  ? 89.343  85.405  14.419  1.00 5.34  ? 315  PHE A CG    1 
ATOM   2452  C  CD1   . PHE A 1 315  ? 90.528  84.994  15.034  1.00 5.27  ? 315  PHE A CD1   1 
ATOM   2453  C  CD2   . PHE A 1 315  ? 88.638  86.476  14.988  1.00 4.72  ? 315  PHE A CD2   1 
ATOM   2454  C  CE1   . PHE A 1 315  ? 90.980  85.605  16.225  1.00 5.58  ? 315  PHE A CE1   1 
ATOM   2455  C  CE2   . PHE A 1 315  ? 89.080  87.094  16.168  1.00 6.54  ? 315  PHE A CE2   1 
ATOM   2456  C  CZ    . PHE A 1 315  ? 90.253  86.650  16.792  1.00 6.46  ? 315  PHE A CZ    1 
ATOM   2457  N  N     . HIS A 1 316  ? 85.866  85.280  13.299  1.00 3.56  ? 316  HIS A N     1 
ATOM   2458  C  CA    . HIS A 1 316  ? 84.748  85.954  13.934  1.00 4.74  ? 316  HIS A CA    1 
ATOM   2459  C  C     . HIS A 1 316  ? 83.532  85.064  14.048  1.00 4.99  ? 316  HIS A C     1 
ATOM   2460  O  O     . HIS A 1 316  ? 82.802  85.154  15.034  1.00 5.66  ? 316  HIS A O     1 
ATOM   2461  C  CB    . HIS A 1 316  ? 84.428  87.256  13.219  1.00 4.00  ? 316  HIS A CB    1 
ATOM   2462  C  CG    . HIS A 1 316  ? 85.473  88.301  13.415  1.00 4.61  ? 316  HIS A CG    1 
ATOM   2463  N  ND1   . HIS A 1 316  ? 85.705  88.898  14.634  1.00 6.27  ? 316  HIS A ND1   1 
ATOM   2464  C  CD2   . HIS A 1 316  ? 86.371  88.835  12.558  1.00 5.52  ? 316  HIS A CD2   1 
ATOM   2465  C  CE1   . HIS A 1 316  ? 86.685  89.775  14.516  1.00 5.40  ? 316  HIS A CE1   1 
ATOM   2466  N  NE2   . HIS A 1 316  ? 87.114  89.747  13.266  1.00 7.32  ? 316  HIS A NE2   1 
ATOM   2467  N  N     . ASP A 1 317  ? 83.321  84.215  13.047  1.00 4.97  ? 317  ASP A N     1 
ATOM   2468  C  CA    . ASP A 1 317  ? 82.307  83.164  13.106  1.00 5.76  ? 317  ASP A CA    1 
ATOM   2469  C  C     . ASP A 1 317  ? 82.496  82.335  14.389  1.00 5.05  ? 317  ASP A C     1 
ATOM   2470  O  O     . ASP A 1 317  ? 81.536  82.052  15.101  1.00 5.60  ? 317  ASP A O     1 
ATOM   2471  C  CB    . ASP A 1 317  ? 82.442  82.268  11.870  1.00 5.64  ? 317  ASP A CB    1 
ATOM   2472  C  CG    . ASP A 1 317  ? 81.157  81.548  11.502  1.00 8.49  ? 317  ASP A CG    1 
ATOM   2473  O  OD1   . ASP A 1 317  ? 80.093  81.796  12.126  1.00 9.58  ? 317  ASP A OD1   1 
ATOM   2474  O  OD2   . ASP A 1 317  ? 81.135  80.680  10.593  1.00 11.17 ? 317  ASP A OD2   1 
ATOM   2475  N  N     . TYR A 1 318  ? 83.740  81.979  14.695  1.00 4.28  ? 318  TYR A N     1 
ATOM   2476  C  CA    . TYR A 1 318  ? 84.043  81.195  15.897  1.00 4.38  ? 318  TYR A CA    1 
ATOM   2477  C  C     . TYR A 1 318  ? 83.833  82.006  17.180  1.00 4.47  ? 318  TYR A C     1 
ATOM   2478  O  O     . TYR A 1 318  ? 83.126  81.562  18.085  1.00 4.06  ? 318  TYR A O     1 
ATOM   2479  C  CB    . TYR A 1 318  ? 85.472  80.652  15.827  1.00 4.11  ? 318  TYR A CB    1 
ATOM   2480  C  CG    . TYR A 1 318  ? 85.976  79.907  17.048  1.00 4.78  ? 318  TYR A CG    1 
ATOM   2481  C  CD1   . TYR A 1 318  ? 85.712  78.546  17.218  1.00 5.59  ? 318  TYR A CD1   1 
ATOM   2482  C  CD2   . TYR A 1 318  ? 86.773  80.556  18.007  1.00 6.51  ? 318  TYR A CD2   1 
ATOM   2483  C  CE1   . TYR A 1 318  ? 86.202  77.858  18.319  1.00 6.45  ? 318  TYR A CE1   1 
ATOM   2484  C  CE2   . TYR A 1 318  ? 87.276  79.879  19.107  1.00 5.99  ? 318  TYR A CE2   1 
ATOM   2485  C  CZ    . TYR A 1 318  ? 86.980  78.526  19.258  1.00 6.85  ? 318  TYR A CZ    1 
ATOM   2486  O  OH    . TYR A 1 318  ? 87.467  77.849  20.350  1.00 8.27  ? 318  TYR A OH    1 
ATOM   2487  N  N     . TYR A 1 319  ? 84.427  83.200  17.253  1.00 4.15  ? 319  TYR A N     1 
ATOM   2488  C  CA    . TYR A 1 319  ? 84.402  83.966  18.501  1.00 4.40  ? 319  TYR A CA    1 
ATOM   2489  C  C     . TYR A 1 319  ? 83.011  84.532  18.822  1.00 4.83  ? 319  TYR A C     1 
ATOM   2490  O  O     . TYR A 1 319  ? 82.672  84.752  19.997  1.00 5.05  ? 319  TYR A O     1 
ATOM   2491  C  CB    . TYR A 1 319  ? 85.498  85.029  18.523  1.00 3.74  ? 319  TYR A CB    1 
ATOM   2492  C  CG    . TYR A 1 319  ? 86.836  84.415  18.865  1.00 4.30  ? 319  TYR A CG    1 
ATOM   2493  C  CD1   . TYR A 1 319  ? 87.777  84.166  17.877  1.00 4.07  ? 319  TYR A CD1   1 
ATOM   2494  C  CD2   . TYR A 1 319  ? 87.138  84.035  20.175  1.00 5.68  ? 319  TYR A CD2   1 
ATOM   2495  C  CE1   . TYR A 1 319  ? 89.000  83.564  18.179  1.00 5.50  ? 319  TYR A CE1   1 
ATOM   2496  C  CE2   . TYR A 1 319  ? 88.374  83.433  20.494  1.00 6.60  ? 319  TYR A CE2   1 
ATOM   2497  C  CZ    . TYR A 1 319  ? 89.294  83.205  19.482  1.00 6.28  ? 319  TYR A CZ    1 
ATOM   2498  O  OH    . TYR A 1 319  ? 90.510  82.619  19.763  1.00 4.98  ? 319  TYR A OH    1 
ATOM   2499  N  N     . SER A 1 320  ? 82.199  84.703  17.783  1.00 4.76  ? 320  SER A N     1 
ATOM   2500  C  CA    . SER A 1 320  ? 80.800  85.082  17.945  1.00 5.66  ? 320  SER A CA    1 
ATOM   2501  C  C     . SER A 1 320  ? 80.103  84.175  18.947  1.00 5.94  ? 320  SER A C     1 
ATOM   2502  O  O     . SER A 1 320  ? 79.206  84.632  19.646  1.00 5.78  ? 320  SER A O     1 
ATOM   2503  C  CB    . SER A 1 320  ? 80.062  84.968  16.622  1.00 5.01  ? 320  SER A CB    1 
ATOM   2504  O  OG    . SER A 1 320  ? 80.463  86.023  15.793  1.00 7.12  ? 320  SER A OG    1 
ATOM   2505  N  N     . GLY A 1 321  ? 80.506  82.897  18.982  1.00 6.06  ? 321  GLY A N     1 
ATOM   2506  C  CA    . GLY A 1 321  ? 79.911  81.906  19.871  1.00 6.74  ? 321  GLY A CA    1 
ATOM   2507  C  C     . GLY A 1 321  ? 80.435  81.943  21.299  1.00 7.43  ? 321  GLY A C     1 
ATOM   2508  O  O     . GLY A 1 321  ? 79.814  81.382  22.221  1.00 8.85  ? 321  GLY A O     1 
ATOM   2509  N  N     . LEU A 1 322  ? 81.575  82.605  21.489  1.00 7.07  ? 322  LEU A N     1 
ATOM   2510  C  CA    . LEU A 1 322  ? 82.312  82.556  22.743  1.00 6.84  ? 322  LEU A CA    1 
ATOM   2511  C  C     . LEU A 1 322  ? 82.244  83.873  23.514  1.00 6.51  ? 322  LEU A C     1 
ATOM   2512  O  O     . LEU A 1 322  ? 82.159  83.880  24.745  1.00 6.17  ? 322  LEU A O     1 
ATOM   2513  C  CB    . LEU A 1 322  ? 83.786  82.198  22.461  1.00 7.31  ? 322  LEU A CB    1 
ATOM   2514  C  CG    . LEU A 1 322  ? 84.232  80.732  22.377  1.00 8.21  ? 322  LEU A CG    1 
ATOM   2515  C  CD1   . LEU A 1 322  ? 83.844  80.116  21.054  1.00 8.21  ? 322  LEU A CD1   1 
ATOM   2516  C  CD2   . LEU A 1 322  ? 85.752  80.646  22.568  1.00 9.71  ? 322  LEU A CD2   1 
ATOM   2517  N  N     . GLN A 1 323  ? 82.275  84.983  22.777  1.00 6.02  ? 323  GLN A N     1 
ATOM   2518  C  CA    . GLN A 1 323  ? 82.448  86.307  23.355  1.00 5.37  ? 323  GLN A CA    1 
ATOM   2519  C  C     . GLN A 1 323  ? 81.593  87.339  22.625  1.00 5.34  ? 323  GLN A C     1 
ATOM   2520  O  O     . GLN A 1 323  ? 81.799  87.580  21.441  1.00 5.83  ? 323  GLN A O     1 
ATOM   2521  C  CB    . GLN A 1 323  ? 83.915  86.716  23.249  1.00 5.15  ? 323  GLN A CB    1 
ATOM   2522  C  CG    . GLN A 1 323  ? 84.215  88.144  23.721  1.00 4.90  ? 323  GLN A CG    1 
ATOM   2523  C  CD    . GLN A 1 323  ? 83.928  88.322  25.200  1.00 6.09  ? 323  GLN A CD    1 
ATOM   2524  O  OE1   . GLN A 1 323  ? 83.106  89.162  25.592  1.00 6.03  ? 323  GLN A OE1   1 
ATOM   2525  N  NE2   . GLN A 1 323  ? 84.588  87.529  26.020  1.00 1.47  ? 323  GLN A NE2   1 
ATOM   2526  N  N     . GLU A 1 324  ? 80.648  87.943  23.339  1.00 4.98  ? 324  GLU A N     1 
ATOM   2527  C  CA    . GLU A 1 324  ? 79.843  89.048  22.806  1.00 5.12  ? 324  GLU A CA    1 
ATOM   2528  C  C     . GLU A 1 324  ? 80.678  90.339  22.768  1.00 4.40  ? 324  GLU A C     1 
ATOM   2529  O  O     . GLU A 1 324  ? 81.595  90.512  23.573  1.00 4.80  ? 324  GLU A O     1 
ATOM   2530  C  CB    . GLU A 1 324  ? 78.558  89.216  23.642  1.00 4.98  ? 324  GLU A CB    1 
ATOM   2531  C  CG    . GLU A 1 324  ? 78.711  89.972  24.970  1.00 5.09  ? 324  GLU A CG    1 
ATOM   2532  C  CD    . GLU A 1 324  ? 79.662  89.326  25.990  1.00 6.77  ? 324  GLU A CD    1 
ATOM   2533  O  OE1   . GLU A 1 324  ? 80.204  90.078  26.831  1.00 7.01  ? 324  GLU A OE1   1 
ATOM   2534  O  OE2   . GLU A 1 324  ? 79.883  88.089  25.971  1.00 6.17  ? 324  GLU A OE2   1 
ATOM   2535  N  N     . PRO A 1 325  ? 80.405  91.235  21.830  1.00 4.59  ? 325  PRO A N     1 
ATOM   2536  C  CA    . PRO A 1 325  ? 81.129  92.517  21.793  1.00 4.44  ? 325  PRO A CA    1 
ATOM   2537  C  C     . PRO A 1 325  ? 80.945  93.377  23.056  1.00 4.12  ? 325  PRO A C     1 
ATOM   2538  O  O     . PRO A 1 325  ? 79.853  93.450  23.637  1.00 4.01  ? 325  PRO A O     1 
ATOM   2539  C  CB    . PRO A 1 325  ? 80.498  93.242  20.604  1.00 4.27  ? 325  PRO A CB    1 
ATOM   2540  C  CG    . PRO A 1 325  ? 79.963  92.146  19.739  1.00 4.97  ? 325  PRO A CG    1 
ATOM   2541  C  CD    . PRO A 1 325  ? 79.468  91.096  20.697  1.00 4.26  ? 325  PRO A CD    1 
ATOM   2542  N  N     . TRP A 1 326  ? 82.028  94.027  23.456  1.00 3.76  ? 326  TRP A N     1 
ATOM   2543  C  CA    . TRP A 1 326  ? 81.959  95.164  24.365  1.00 4.16  ? 326  TRP A CA    1 
ATOM   2544  C  C     . TRP A 1 326  ? 81.681  96.357  23.445  1.00 3.83  ? 326  TRP A C     1 
ATOM   2545  O  O     . TRP A 1 326  ? 82.605  96.984  22.920  1.00 3.26  ? 326  TRP A O     1 
ATOM   2546  C  CB    . TRP A 1 326  ? 83.285  95.357  25.096  1.00 3.81  ? 326  TRP A CB    1 
ATOM   2547  C  CG    . TRP A 1 326  ? 83.613  94.295  26.111  1.00 4.47  ? 326  TRP A CG    1 
ATOM   2548  C  CD1   . TRP A 1 326  ? 83.489  92.941  25.970  1.00 5.19  ? 326  TRP A CD1   1 
ATOM   2549  C  CD2   . TRP A 1 326  ? 84.113  94.513  27.432  1.00 5.48  ? 326  TRP A CD2   1 
ATOM   2550  N  NE1   . TRP A 1 326  ? 83.883  92.306  27.124  1.00 5.64  ? 326  TRP A NE1   1 
ATOM   2551  C  CE2   . TRP A 1 326  ? 84.286  93.245  28.035  1.00 3.61  ? 326  TRP A CE2   1 
ATOM   2552  C  CE3   . TRP A 1 326  ? 84.451  95.657  28.168  1.00 4.43  ? 326  TRP A CE3   1 
ATOM   2553  C  CZ2   . TRP A 1 326  ? 84.769  93.087  29.340  1.00 3.54  ? 326  TRP A CZ2   1 
ATOM   2554  C  CZ3   . TRP A 1 326  ? 84.924  95.499  29.480  1.00 4.97  ? 326  TRP A CZ3   1 
ATOM   2555  C  CH2   . TRP A 1 326  ? 85.088  94.229  30.043  1.00 5.01  ? 326  TRP A CH2   1 
ATOM   2556  N  N     . ASP A 1 327  ? 80.403  96.633  23.242  1.00 3.68  ? 327  ASP A N     1 
ATOM   2557  C  CA    . ASP A 1 327  ? 79.961  97.518  22.161  1.00 4.11  ? 327  ASP A CA    1 
ATOM   2558  C  C     . ASP A 1 327  ? 79.917  98.986  22.594  1.00 4.14  ? 327  ASP A C     1 
ATOM   2559  O  O     . ASP A 1 327  ? 80.101  99.303  23.775  1.00 4.10  ? 327  ASP A O     1 
ATOM   2560  C  CB    . ASP A 1 327  ? 78.600  97.041  21.627  1.00 3.70  ? 327  ASP A CB    1 
ATOM   2561  C  CG    . ASP A 1 327  ? 78.343  97.460  20.170  1.00 4.62  ? 327  ASP A CG    1 
ATOM   2562  O  OD1   . ASP A 1 327  ? 79.175  98.177  19.560  1.00 3.48  ? 327  ASP A OD1   1 
ATOM   2563  O  OD2   . ASP A 1 327  ? 77.319  97.105  19.556  1.00 3.70  ? 327  ASP A OD2   1 
ATOM   2564  N  N     . GLY A 1 328  ? 79.654  99.876  21.640  1.00 4.13  ? 328  GLY A N     1 
ATOM   2565  C  CA    . GLY A 1 328  ? 79.652  101.313 21.894  1.00 4.73  ? 328  GLY A CA    1 
ATOM   2566  C  C     . GLY A 1 328  ? 80.795  101.997 21.162  1.00 4.90  ? 328  GLY A C     1 
ATOM   2567  O  O     . GLY A 1 328  ? 81.727  101.312 20.748  1.00 5.41  ? 328  GLY A O     1 
ATOM   2568  N  N     . PRO A 1 329  ? 80.755  103.326 21.001  1.00 5.05  ? 329  PRO A N     1 
ATOM   2569  C  CA    . PRO A 1 329  ? 81.808  104.031 20.252  1.00 4.78  ? 329  PRO A CA    1 
ATOM   2570  C  C     . PRO A 1 329  ? 83.166  103.757 20.867  1.00 4.81  ? 329  PRO A C     1 
ATOM   2571  O  O     . PRO A 1 329  ? 83.266  103.680 22.101  1.00 4.67  ? 329  PRO A O     1 
ATOM   2572  C  CB    . PRO A 1 329  ? 81.450  105.509 20.437  1.00 4.51  ? 329  PRO A CB    1 
ATOM   2573  C  CG    . PRO A 1 329  ? 79.973  105.483 20.649  1.00 5.19  ? 329  PRO A CG    1 
ATOM   2574  C  CD    . PRO A 1 329  ? 79.744  104.261 21.528  1.00 4.85  ? 329  PRO A CD    1 
ATOM   2575  N  N     . ALA A 1 330  ? 84.193  103.593 20.032  1.00 4.21  ? 330  ALA A N     1 
ATOM   2576  C  CA    . ALA A 1 330  ? 85.534  103.386 20.567  1.00 5.36  ? 330  ALA A CA    1 
ATOM   2577  C  C     . ALA A 1 330  ? 86.612  103.653 19.564  1.00 5.32  ? 330  ALA A C     1 
ATOM   2578  O  O     . ALA A 1 330  ? 86.584  103.130 18.453  1.00 5.59  ? 330  ALA A O     1 
ATOM   2579  C  CB    . ALA A 1 330  ? 85.718  101.951 21.119  1.00 4.42  ? 330  ALA A CB    1 
ATOM   2580  N  N     . LEU A 1 331  ? 87.572  104.456 19.991  1.00 5.20  ? 331  LEU A N     1 
ATOM   2581  C  CA    . LEU A 1 331  ? 88.903  104.390 19.446  1.00 4.84  ? 331  LEU A CA    1 
ATOM   2582  C  C     . LEU A 1 331  ? 89.777  103.906 20.588  1.00 5.35  ? 331  LEU A C     1 
ATOM   2583  O  O     . LEU A 1 331  ? 89.809  104.517 21.668  1.00 5.36  ? 331  LEU A O     1 
ATOM   2584  C  CB    . LEU A 1 331  ? 89.384  105.733 18.929  1.00 4.94  ? 331  LEU A CB    1 
ATOM   2585  C  CG    . LEU A 1 331  ? 90.892  105.867 18.612  1.00 4.53  ? 331  LEU A CG    1 
ATOM   2586  C  CD1   . LEU A 1 331  ? 91.352  104.836 17.626  1.00 4.67  ? 331  LEU A CD1   1 
ATOM   2587  C  CD2   . LEU A 1 331  ? 91.212  107.294 18.105  1.00 6.34  ? 331  LEU A CD2   1 
ATOM   2588  N  N     . LEU A 1 332  ? 90.442  102.787 20.333  1.00 4.21  ? 332  LEU A N     1 
ATOM   2589  C  CA    . LEU A 1 332  ? 91.357  102.168 21.266  1.00 4.85  ? 332  LEU A CA    1 
ATOM   2590  C  C     . LEU A 1 332  ? 92.764  102.379 20.755  1.00 4.74  ? 332  LEU A C     1 
ATOM   2591  O  O     . LEU A 1 332  ? 93.053  102.107 19.583  1.00 4.19  ? 332  LEU A O     1 
ATOM   2592  C  CB    . LEU A 1 332  ? 91.069  100.659 21.358  1.00 4.91  ? 332  LEU A CB    1 
ATOM   2593  C  CG    . LEU A 1 332  ? 89.635  100.217 21.677  1.00 5.63  ? 332  LEU A CG    1 
ATOM   2594  C  CD1   . LEU A 1 332  ? 89.556  98.698  21.801  1.00 7.23  ? 332  LEU A CD1   1 
ATOM   2595  C  CD2   . LEU A 1 332  ? 89.142  100.860 22.956  1.00 6.06  ? 332  LEU A CD2   1 
ATOM   2596  N  N     . VAL A 1 333  ? 93.647  102.849 21.632  1.00 4.41  ? 333  VAL A N     1 
ATOM   2597  C  CA    . VAL A 1 333  ? 95.055  102.976 21.283  1.00 4.51  ? 333  VAL A CA    1 
ATOM   2598  C  C     . VAL A 1 333  ? 95.843  102.261 22.363  1.00 5.02  ? 333  VAL A C     1 
ATOM   2599  O  O     . VAL A 1 333  ? 95.629  102.481 23.574  1.00 4.01  ? 333  VAL A O     1 
ATOM   2600  C  CB    . VAL A 1 333  ? 95.512  104.439 21.165  1.00 4.82  ? 333  VAL A CB    1 
ATOM   2601  C  CG1   . VAL A 1 333  ? 96.961  104.498 20.685  1.00 4.35  ? 333  VAL A CG1   1 
ATOM   2602  C  CG2   . VAL A 1 333  ? 94.585  105.230 20.206  1.00 4.21  ? 333  VAL A CG2   1 
ATOM   2603  N  N     . PHE A 1 334  ? 96.741  101.393 21.941  1.00 4.34  ? 334  PHE A N     1 
ATOM   2604  C  CA    . PHE A 1 334  ? 97.350  100.516 22.911  1.00 5.19  ? 334  PHE A CA    1 
ATOM   2605  C  C     . PHE A 1 334  ? 98.767  100.195 22.564  1.00 4.96  ? 334  PHE A C     1 
ATOM   2606  O  O     . PHE A 1 334  ? 99.180  100.283 21.408  1.00 4.18  ? 334  PHE A O     1 
ATOM   2607  C  CB    . PHE A 1 334  ? 96.557  99.209  23.010  1.00 5.93  ? 334  PHE A CB    1 
ATOM   2608  C  CG    . PHE A 1 334  ? 96.033  98.741  21.689  1.00 8.30  ? 334  PHE A CG    1 
ATOM   2609  C  CD1   . PHE A 1 334  ? 96.861  98.068  20.803  1.00 8.09  ? 334  PHE A CD1   1 
ATOM   2610  C  CD2   . PHE A 1 334  ? 94.725  99.041  21.302  1.00 9.89  ? 334  PHE A CD2   1 
ATOM   2611  C  CE1   . PHE A 1 334  ? 96.381  97.650  19.569  1.00 9.83  ? 334  PHE A CE1   1 
ATOM   2612  C  CE2   . PHE A 1 334  ? 94.237  98.634  20.059  1.00 10.37 ? 334  PHE A CE2   1 
ATOM   2613  C  CZ    . PHE A 1 334  ? 95.072  97.940  19.192  1.00 8.78  ? 334  PHE A CZ    1 
ATOM   2614  N  N     . SER A 1 335  ? 99.497  99.767  23.586  1.00 4.99  ? 335  SER A N     1 
ATOM   2615  C  CA    . SER A 1 335  ? 100.823 99.237  23.386  1.00 4.99  ? 335  SER A CA    1 
ATOM   2616  C  C     . SER A 1 335  ? 101.261 98.271  24.470  1.00 5.58  ? 335  SER A C     1 
ATOM   2617  O  O     . SER A 1 335  ? 100.967 98.438  25.665  1.00 4.60  ? 335  SER A O     1 
ATOM   2618  C  CB    . SER A 1 335  ? 101.862 100.343 23.260  1.00 4.72  ? 335  SER A CB    1 
ATOM   2619  O  OG    . SER A 1 335  ? 103.133 99.754  23.030  1.00 5.06  ? 335  SER A OG    1 
ATOM   2620  N  N     . ASP A 1 336  ? 101.934 97.253  23.942  1.00 5.93  ? 336  ASP A N     1 
ATOM   2621  C  CA    . ASP A 1 336  ? 102.762 96.242  24.564  1.00 7.24  ? 336  ASP A CA    1 
ATOM   2622  C  C     . ASP A 1 336  ? 104.167 96.669  24.964  1.00 6.67  ? 336  ASP A C     1 
ATOM   2623  O  O     . ASP A 1 336  ? 104.851 95.944  25.708  1.00 6.57  ? 336  ASP A O     1 
ATOM   2624  C  CB    . ASP A 1 336  ? 102.996 95.198  23.447  1.00 7.77  ? 336  ASP A CB    1 
ATOM   2625  C  CG    . ASP A 1 336  ? 102.290 93.961  23.730  1.00 10.60 ? 336  ASP A CG    1 
ATOM   2626  O  OD1   . ASP A 1 336  ? 101.466 94.041  24.681  1.00 16.98 ? 336  ASP A OD1   1 
ATOM   2627  O  OD2   . ASP A 1 336  ? 102.494 92.891  23.140  1.00 10.99 ? 336  ASP A OD2   1 
ATOM   2628  N  N     . GLY A 1 337  ? 104.627 97.775  24.387  1.00 6.06  ? 337  GLY A N     1 
ATOM   2629  C  CA    . GLY A 1 337  ? 106.052 98.064  24.305  1.00 6.15  ? 337  GLY A CA    1 
ATOM   2630  C  C     . GLY A 1 337  ? 106.728 97.318  23.154  1.00 6.38  ? 337  GLY A C     1 
ATOM   2631  O  O     . GLY A 1 337  ? 107.893 97.582  22.841  1.00 6.51  ? 337  GLY A O     1 
ATOM   2632  N  N     . LYS A 1 338  ? 105.992 96.390  22.535  1.00 6.24  ? 338  LYS A N     1 
ATOM   2633  C  CA    . LYS A 1 338  ? 106.445 95.600  21.378  1.00 6.46  ? 338  LYS A CA    1 
ATOM   2634  C  C     . LYS A 1 338  ? 105.716 95.990  20.103  1.00 5.87  ? 338  LYS A C     1 
ATOM   2635  O  O     . LYS A 1 338  ? 106.322 96.163  19.055  1.00 5.47  ? 338  LYS A O     1 
ATOM   2636  C  CB    . LYS A 1 338  ? 106.192 94.123  21.619  1.00 6.94  ? 338  LYS A CB    1 
ATOM   2637  C  CG    . LYS A 1 338  ? 107.323 93.426  22.349  1.00 9.92  ? 338  LYS A CG    1 
ATOM   2638  C  CD    . LYS A 1 338  ? 106.735 92.534  23.390  1.00 13.41 ? 338  LYS A CD    1 
ATOM   2639  C  CE    . LYS A 1 338  ? 106.375 91.184  22.815  1.00 12.30 ? 338  LYS A CE    1 
ATOM   2640  N  NZ    . LYS A 1 338  ? 105.282 90.616  23.657  1.00 12.30 ? 338  LYS A NZ    1 
ATOM   2641  N  N     . ILE A 1 339  ? 104.396 96.072  20.222  1.00 5.53  ? 339  ILE A N     1 
ATOM   2642  C  CA    . ILE A 1 339  ? 103.506 96.619  19.214  1.00 6.85  ? 339  ILE A CA    1 
ATOM   2643  C  C     . ILE A 1 339  ? 102.877 97.900  19.767  1.00 6.04  ? 339  ILE A C     1 
ATOM   2644  O  O     . ILE A 1 339  ? 102.680 98.018  20.977  1.00 5.70  ? 339  ILE A O     1 
ATOM   2645  C  CB    . ILE A 1 339  ? 102.436 95.531  18.872  1.00 7.36  ? 339  ILE A CB    1 
ATOM   2646  C  CG1   . ILE A 1 339  ? 102.847 94.786  17.612  1.00 9.97  ? 339  ILE A CG1   1 
ATOM   2647  C  CG2   . ILE A 1 339  ? 101.009 96.065  18.822  1.00 10.40 ? 339  ILE A CG2   1 
ATOM   2648  C  CD1   . ILE A 1 339  ? 103.197 93.364  17.862  1.00 14.42 ? 339  ILE A CD1   1 
ATOM   2649  N  N     . VAL A 1 340  ? 102.594 98.862  18.890  1.00 5.69  ? 340  VAL A N     1 
ATOM   2650  C  CA    . VAL A 1 340  ? 101.726 99.986  19.253  1.00 5.33  ? 340  VAL A CA    1 
ATOM   2651  C  C     . VAL A 1 340  ? 100.693 100.112 18.139  1.00 4.97  ? 340  VAL A C     1 
ATOM   2652  O  O     . VAL A 1 340  ? 101.016 100.021 16.954  1.00 4.44  ? 340  VAL A O     1 
ATOM   2653  C  CB    . VAL A 1 340  ? 102.507 101.322 19.537  1.00 6.10  ? 340  VAL A CB    1 
ATOM   2654  C  CG1   . VAL A 1 340  ? 103.546 101.585 18.509  1.00 6.68  ? 340  VAL A CG1   1 
ATOM   2655  C  CG2   . VAL A 1 340  ? 101.551 102.523 19.626  1.00 5.66  ? 340  VAL A CG2   1 
ATOM   2656  N  N     . GLY A 1 341  ? 99.430  100.248 18.508  1.00 4.06  ? 341  GLY A N     1 
ATOM   2657  C  CA    . GLY A 1 341  ? 98.402  100.201 17.489  1.00 4.48  ? 341  GLY A CA    1 
ATOM   2658  C  C     . GLY A 1 341  ? 97.117  100.828 17.927  1.00 4.40  ? 341  GLY A C     1 
ATOM   2659  O  O     . GLY A 1 341  ? 97.023  101.370 19.031  1.00 3.69  ? 341  GLY A O     1 
ATOM   2660  N  N     . ALA A 1 342  ? 96.129  100.739 17.046  1.00 4.32  ? 342  ALA A N     1 
ATOM   2661  C  CA    . ALA A 1 342  ? 94.843  101.389 17.239  1.00 4.17  ? 342  ALA A CA    1 
ATOM   2662  C  C     . ALA A 1 342  ? 93.741  100.625 16.501  1.00 4.52  ? 342  ALA A C     1 
ATOM   2663  O  O     . ALA A 1 342  ? 94.005  99.953  15.508  1.00 3.75  ? 342  ALA A O     1 
ATOM   2664  C  CB    . ALA A 1 342  ? 94.914  102.854 16.763  1.00 3.95  ? 342  ALA A CB    1 
ATOM   2665  N  N     . GLY A 1 343  ? 92.510  100.719 17.004  1.00 4.67  ? 343  GLY A N     1 
ATOM   2666  C  CA    . GLY A 1 343  ? 91.374  100.102 16.349  1.00 4.23  ? 343  GLY A CA    1 
ATOM   2667  C  C     . GLY A 1 343  ? 90.081  100.796 16.708  1.00 4.69  ? 343  GLY A C     1 
ATOM   2668  O  O     . GLY A 1 343  ? 89.957  101.386 17.788  1.00 4.60  ? 343  GLY A O     1 
ATOM   2669  N  N     . LEU A 1 344  ? 89.119  100.736 15.793  1.00 4.25  ? 344  LEU A N     1 
ATOM   2670  C  CA    . LEU A 1 344  ? 87.808  101.332 16.037  1.00 4.44  ? 344  LEU A CA    1 
ATOM   2671  C  C     . LEU A 1 344  ? 86.769  100.271 16.370  1.00 4.42  ? 344  LEU A C     1 
ATOM   2672  O  O     . LEU A 1 344  ? 86.949  99.100  16.032  1.00 4.42  ? 344  LEU A O     1 
ATOM   2673  C  CB    . LEU A 1 344  ? 87.338  102.132 14.820  1.00 3.99  ? 344  LEU A CB    1 
ATOM   2674  C  CG    . LEU A 1 344  ? 88.061  103.428 14.471  1.00 4.34  ? 344  LEU A CG    1 
ATOM   2675  C  CD1   . LEU A 1 344  ? 87.382  104.079 13.306  1.00 4.76  ? 344  LEU A CD1   1 
ATOM   2676  C  CD2   . LEU A 1 344  ? 88.051  104.384 15.667  1.00 5.59  ? 344  LEU A CD2   1 
ATOM   2677  N  N     . ASP A 1 345  ? 85.672  100.706 16.986  1.00 4.39  ? 345  ASP A N     1 
ATOM   2678  C  CA    . ASP A 1 345  ? 84.493  99.875  17.180  1.00 4.52  ? 345  ASP A CA    1 
ATOM   2679  C  C     . ASP A 1 345  ? 83.870  99.503  15.828  1.00 4.46  ? 345  ASP A C     1 
ATOM   2680  O  O     . ASP A 1 345  ? 84.227  100.074 14.780  1.00 3.43  ? 345  ASP A O     1 
ATOM   2681  C  CB    . ASP A 1 345  ? 83.471  100.609 18.056  1.00 5.27  ? 345  ASP A CB    1 
ATOM   2682  C  CG    . ASP A 1 345  ? 82.717  101.701 17.297  1.00 7.72  ? 345  ASP A CG    1 
ATOM   2683  O  OD1   . ASP A 1 345  ? 83.280  102.823 17.163  1.00 7.46  ? 345  ASP A OD1   1 
ATOM   2684  O  OD2   . ASP A 1 345  ? 81.565  101.514 16.799  1.00 6.86  ? 345  ASP A OD2   1 
ATOM   2685  N  N     . ARG A 1 346  ? 82.906  98.581  15.868  1.00 3.85  ? 346  ARG A N     1 
ATOM   2686  C  CA    . ARG A 1 346  ? 82.317  98.007  14.654  1.00 3.89  ? 346  ARG A CA    1 
ATOM   2687  C  C     . ARG A 1 346  ? 81.656  99.052  13.753  1.00 3.94  ? 346  ARG A C     1 
ATOM   2688  O  O     . ARG A 1 346  ? 81.477  98.812  12.561  1.00 3.34  ? 346  ARG A O     1 
ATOM   2689  C  CB    . ARG A 1 346  ? 81.305  96.917  15.010  1.00 3.73  ? 346  ARG A CB    1 
ATOM   2690  C  CG    . ARG A 1 346  ? 80.104  97.427  15.849  1.00 5.07  ? 346  ARG A CG    1 
ATOM   2691  C  CD    . ARG A 1 346  ? 79.251  96.305  16.459  1.00 3.58  ? 346  ARG A CD    1 
ATOM   2692  N  NE    . ARG A 1 346  ? 78.683  95.404  15.444  1.00 2.34  ? 346  ARG A NE    1 
ATOM   2693  C  CZ    . ARG A 1 346  ? 79.060  94.128  15.260  1.00 4.14  ? 346  ARG A CZ    1 
ATOM   2694  N  NH1   . ARG A 1 346  ? 80.023  93.594  16.007  1.00 3.03  ? 346  ARG A NH1   1 
ATOM   2695  N  NH2   . ARG A 1 346  ? 78.481  93.389  14.324  1.00 1.00  ? 346  ARG A NH2   1 
ATOM   2696  N  N     . ASN A 1 347  ? 81.269  100.183 14.333  1.00 4.02  ? 347  ASN A N     1 
ATOM   2697  C  CA    . ASN A 1 347  ? 80.576  101.237 13.590  1.00 5.25  ? 347  ASN A CA    1 
ATOM   2698  C  C     . ASN A 1 347  ? 81.424  102.492 13.326  1.00 5.24  ? 347  ASN A C     1 
ATOM   2699  O  O     . ASN A 1 347  ? 80.935  103.448 12.705  1.00 5.97  ? 347  ASN A O     1 
ATOM   2700  C  CB    . ASN A 1 347  ? 79.262  101.617 14.293  1.00 5.40  ? 347  ASN A CB    1 
ATOM   2701  C  CG    . ASN A 1 347  ? 78.152  100.609 14.034  1.00 7.98  ? 347  ASN A CG    1 
ATOM   2702  O  OD1   . ASN A 1 347  ? 77.882  100.257 12.882  1.00 10.59 ? 347  ASN A OD1   1 
ATOM   2703  N  ND2   . ASN A 1 347  ? 77.514  100.124 15.105  1.00 7.42  ? 347  ASN A ND2   1 
ATOM   2704  N  N     . GLY A 1 348  ? 82.672  102.486 13.786  1.00 4.59  ? 348  GLY A N     1 
ATOM   2705  C  CA    . GLY A 1 348  ? 83.582  103.619 13.618  1.00 5.00  ? 348  GLY A CA    1 
ATOM   2706  C  C     . GLY A 1 348  ? 82.998  104.917 14.169  1.00 5.17  ? 348  GLY A C     1 
ATOM   2707  O  O     . GLY A 1 348  ? 82.910  105.931 13.462  1.00 5.01  ? 348  GLY A O     1 
ATOM   2708  N  N     . LEU A 1 349  ? 82.542  104.879 15.422  1.00 5.00  ? 349  LEU A N     1 
ATOM   2709  C  CA    . LEU A 1 349  ? 81.874  106.051 15.996  1.00 5.10  ? 349  LEU A CA    1 
ATOM   2710  C  C     . LEU A 1 349  ? 82.822  107.052 16.686  1.00 5.38  ? 349  LEU A C     1 
ATOM   2711  O  O     . LEU A 1 349  ? 82.375  108.031 17.289  1.00 4.62  ? 349  LEU A O     1 
ATOM   2712  C  CB    . LEU A 1 349  ? 80.684  105.638 16.872  1.00 4.86  ? 349  LEU A CB    1 
ATOM   2713  C  CG    . LEU A 1 349  ? 79.625  104.782 16.146  1.00 4.16  ? 349  LEU A CG    1 
ATOM   2714  C  CD1   . LEU A 1 349  ? 78.528  104.203 17.092  1.00 4.38  ? 349  LEU A CD1   1 
ATOM   2715  C  CD2   . LEU A 1 349  ? 78.994  105.553 15.002  1.00 4.00  ? 349  LEU A CD2   1 
ATOM   2716  N  N     . ARG A 1 350  ? 84.126  106.819 16.564  1.00 5.18  ? 350  ARG A N     1 
ATOM   2717  C  CA    . ARG A 1 350  ? 85.119  107.840 16.924  1.00 5.57  ? 350  ARG A CA    1 
ATOM   2718  C  C     . ARG A 1 350  ? 86.021  108.044 15.707  1.00 5.75  ? 350  ARG A C     1 
ATOM   2719  O  O     . ARG A 1 350  ? 86.269  107.097 14.977  1.00 6.80  ? 350  ARG A O     1 
ATOM   2720  C  CB    . ARG A 1 350  ? 85.985  107.416 18.123  1.00 4.75  ? 350  ARG A CB    1 
ATOM   2721  C  CG    . ARG A 1 350  ? 85.293  107.259 19.481  1.00 4.89  ? 350  ARG A CG    1 
ATOM   2722  C  CD    . ARG A 1 350  ? 84.213  108.285 19.837  1.00 4.02  ? 350  ARG A CD    1 
ATOM   2723  N  NE    . ARG A 1 350  ? 84.669  109.676 19.896  1.00 4.77  ? 350  ARG A NE    1 
ATOM   2724  C  CZ    . ARG A 1 350  ? 84.063  110.696 19.287  1.00 4.37  ? 350  ARG A CZ    1 
ATOM   2725  N  NH1   . ARG A 1 350  ? 82.999  110.485 18.512  1.00 1.67  ? 350  ARG A NH1   1 
ATOM   2726  N  NH2   . ARG A 1 350  ? 84.537  111.934 19.417  1.00 4.42  ? 350  ARG A NH2   1 
ATOM   2727  N  N     . PRO A 1 351  ? 86.506  109.257 15.476  1.00 5.18  ? 351  PRO A N     1 
ATOM   2728  C  CA    . PRO A 1 351  ? 87.421  109.491 14.356  1.00 5.40  ? 351  PRO A CA    1 
ATOM   2729  C  C     . PRO A 1 351  ? 88.835  108.993 14.655  1.00 5.27  ? 351  PRO A C     1 
ATOM   2730  O  O     . PRO A 1 351  ? 89.291  109.074 15.795  1.00 5.71  ? 351  PRO A O     1 
ATOM   2731  C  CB    . PRO A 1 351  ? 87.414  111.006 14.221  1.00 5.25  ? 351  PRO A CB    1 
ATOM   2732  C  CG    . PRO A 1 351  ? 87.156  111.493 15.620  1.00 5.52  ? 351  PRO A CG    1 
ATOM   2733  C  CD    . PRO A 1 351  ? 86.193  110.506 16.205  1.00 5.12  ? 351  PRO A CD    1 
ATOM   2734  N  N     . ALA A 1 352  ? 89.503  108.471 13.632  1.00 4.78  ? 352  ALA A N     1 
ATOM   2735  C  CA    . ALA A 1 352  ? 90.919  108.151 13.725  1.00 4.28  ? 352  ALA A CA    1 
ATOM   2736  C  C     . ALA A 1 352  ? 91.614  108.458 12.395  1.00 4.22  ? 352  ALA A C     1 
ATOM   2737  O  O     . ALA A 1 352  ? 91.362  107.797 11.374  1.00 4.38  ? 352  ALA A O     1 
ATOM   2738  C  CB    . ALA A 1 352  ? 91.107  106.689 14.144  1.00 4.58  ? 352  ALA A CB    1 
ATOM   2739  N  N     . ARG A 1 353  ? 92.460  109.491 12.410  1.00 2.81  ? 353  ARG A N     1 
ATOM   2740  C  CA    . ARG A 1 353  ? 93.213  109.923 11.233  1.00 2.53  ? 353  ARG A CA    1 
ATOM   2741  C  C     . ARG A 1 353  ? 94.706  109.629 11.414  1.00 2.28  ? 353  ARG A C     1 
ATOM   2742  O  O     . ARG A 1 353  ? 95.223  109.738 12.529  1.00 1.79  ? 353  ARG A O     1 
ATOM   2743  C  CB    . ARG A 1 353  ? 93.049  111.423 11.047  1.00 1.85  ? 353  ARG A CB    1 
ATOM   2744  C  CG    . ARG A 1 353  ? 91.661  111.808 10.611  1.00 2.95  ? 353  ARG A CG    1 
ATOM   2745  C  CD    . ARG A 1 353  ? 91.507  111.861 9.067   1.00 5.79  ? 353  ARG A CD    1 
ATOM   2746  N  NE    . ARG A 1 353  ? 90.460  112.832 8.893   1.00 12.83 ? 353  ARG A NE    1 
ATOM   2747  C  CZ    . ARG A 1 353  ? 90.547  113.956 8.265   1.00 8.19  ? 353  ARG A CZ    1 
ATOM   2748  N  NH1   . ARG A 1 353  ? 91.621  114.316 7.573   1.00 7.41  ? 353  ARG A NH1   1 
ATOM   2749  N  NH2   . ARG A 1 353  ? 89.482  114.705 8.289   1.00 12.40 ? 353  ARG A NH2   1 
ATOM   2750  N  N     . TYR A 1 354  ? 95.392  109.308 10.320  1.00 2.31  ? 354  TYR A N     1 
ATOM   2751  C  CA    . TYR A 1 354  ? 96.835  109.065 10.389  1.00 3.11  ? 354  TYR A CA    1 
ATOM   2752  C  C     . TYR A 1 354  ? 97.631  109.562 9.199   1.00 3.69  ? 354  TYR A C     1 
ATOM   2753  O  O     . TYR A 1 354  ? 97.116  109.788 8.102   1.00 3.07  ? 354  TYR A O     1 
ATOM   2754  C  CB    . TYR A 1 354  ? 97.163  107.588 10.664  1.00 3.04  ? 354  TYR A CB    1 
ATOM   2755  C  CG    . TYR A 1 354  ? 96.831  106.647 9.530   1.00 3.50  ? 354  TYR A CG    1 
ATOM   2756  C  CD1   . TYR A 1 354  ? 97.757  106.393 8.511   1.00 4.35  ? 354  TYR A CD1   1 
ATOM   2757  C  CD2   . TYR A 1 354  ? 95.608  105.987 9.491   1.00 4.17  ? 354  TYR A CD2   1 
ATOM   2758  C  CE1   . TYR A 1 354  ? 97.452  105.534 7.469   1.00 4.64  ? 354  TYR A CE1   1 
ATOM   2759  C  CE2   . TYR A 1 354  ? 95.295  105.120 8.456   1.00 7.44  ? 354  TYR A CE2   1 
ATOM   2760  C  CZ    . TYR A 1 354  ? 96.221  104.904 7.446   1.00 5.94  ? 354  TYR A CZ    1 
ATOM   2761  O  OH    . TYR A 1 354  ? 95.908  104.038 6.433   1.00 9.03  ? 354  TYR A OH    1 
ATOM   2762  N  N     . CYS A 1 355  ? 98.925  109.632 9.466   1.00 4.43  ? 355  CYS A N     1 
ATOM   2763  C  CA    . CYS A 1 355  ? 99.928  110.276 8.672   1.00 6.29  ? 355  CYS A CA    1 
ATOM   2764  C  C     . CYS A 1 355  ? 101.143 109.378 8.615   1.00 4.42  ? 355  CYS A C     1 
ATOM   2765  O  O     . CYS A 1 355  ? 101.607 109.012 9.671   1.00 2.31  ? 355  CYS A O     1 
ATOM   2766  C  CB    . CYS A 1 355  ? 100.382 111.423 9.570   1.00 7.45  ? 355  CYS A CB    1 
ATOM   2767  S  SG    . CYS A 1 355  ? 100.515 112.889 8.718   1.00 16.48 ? 355  CYS A SG    1 
ATOM   2768  N  N     . ILE A 1 356  ? 101.693 109.064 7.434   1.00 3.67  ? 356  ILE A N     1 
ATOM   2769  C  CA    . ILE A 1 356  ? 102.977 108.332 7.375   1.00 2.94  ? 356  ILE A CA    1 
ATOM   2770  C  C     . ILE A 1 356  ? 104.005 109.079 6.513   1.00 3.37  ? 356  ILE A C     1 
ATOM   2771  O  O     . ILE A 1 356  ? 103.676 109.559 5.419   1.00 3.45  ? 356  ILE A O     1 
ATOM   2772  C  CB    . ILE A 1 356  ? 102.795 106.879 6.860   1.00 3.39  ? 356  ILE A CB    1 
ATOM   2773  C  CG1   . ILE A 1 356  ? 101.778 106.099 7.704   1.00 1.89  ? 356  ILE A CG1   1 
ATOM   2774  C  CG2   . ILE A 1 356  ? 104.141 106.131 6.797   1.00 2.16  ? 356  ILE A CG2   1 
ATOM   2775  C  CD1   . ILE A 1 356  ? 101.201 104.906 6.974   1.00 3.20  ? 356  ILE A CD1   1 
ATOM   2776  N  N     . THR A 1 357  ? 105.237 109.188 7.008   1.00 3.31  ? 357  THR A N     1 
ATOM   2777  C  CA    . THR A 1 357  ? 106.309 109.856 6.264   1.00 3.13  ? 357  THR A CA    1 
ATOM   2778  C  C     . THR A 1 357  ? 107.128 108.892 5.410   1.00 2.90  ? 357  THR A C     1 
ATOM   2779  O  O     . THR A 1 357  ? 106.988 107.668 5.520   1.00 2.35  ? 357  THR A O     1 
ATOM   2780  C  CB    . THR A 1 357  ? 107.277 110.647 7.183   1.00 3.42  ? 357  THR A CB    1 
ATOM   2781  O  OG1   . THR A 1 357  ? 108.185 109.737 7.827   1.00 1.99  ? 357  THR A OG1   1 
ATOM   2782  C  CG2   . THR A 1 357  ? 106.539 111.370 8.310   1.00 4.63  ? 357  THR A CG2   1 
ATOM   2783  N  N     . LYS A 1 358  ? 107.992 109.469 4.576   1.00 3.03  ? 358  LYS A N     1 
ATOM   2784  C  CA    . LYS A 1 358  ? 108.912 108.720 3.728   1.00 3.96  ? 358  LYS A CA    1 
ATOM   2785  C  C     . LYS A 1 358  ? 109.814 107.772 4.536   1.00 4.59  ? 358  LYS A C     1 
ATOM   2786  O  O     . LYS A 1 358  ? 110.389 106.835 3.970   1.00 4.49  ? 358  LYS A O     1 
ATOM   2787  C  CB    . LYS A 1 358  ? 109.786 109.686 2.898   1.00 4.06  ? 358  LYS A CB    1 
ATOM   2788  C  CG    . LYS A 1 358  ? 110.583 110.702 3.738   1.00 4.39  ? 358  LYS A CG    1 
ATOM   2789  C  CD    . LYS A 1 358  ? 111.632 111.478 2.915   1.00 5.23  ? 358  LYS A CD    1 
ATOM   2790  C  CE    . LYS A 1 358  ? 112.369 112.473 3.814   1.00 6.10  ? 358  LYS A CE    1 
ATOM   2791  N  NZ    . LYS A 1 358  ? 113.266 113.398 3.060   1.00 7.61  ? 358  LYS A NZ    1 
ATOM   2792  N  N     . ASP A 1 359  ? 109.953 108.043 5.837   1.00 4.96  ? 359  ASP A N     1 
ATOM   2793  C  CA    . ASP A 1 359  ? 110.813 107.246 6.716   1.00 6.24  ? 359  ASP A CA    1 
ATOM   2794  C  C     . ASP A 1 359  ? 110.006 106.294 7.598   1.00 6.18  ? 359  ASP A C     1 
ATOM   2795  O  O     . ASP A 1 359  ? 110.549 105.724 8.553   1.00 6.78  ? 359  ASP A O     1 
ATOM   2796  C  CB    . ASP A 1 359  ? 111.695 108.137 7.609   1.00 6.81  ? 359  ASP A CB    1 
ATOM   2797  C  CG    . ASP A 1 359  ? 112.493 109.170 6.823   1.00 8.50  ? 359  ASP A CG    1 
ATOM   2798  O  OD1   . ASP A 1 359  ? 113.131 108.820 5.812   1.00 8.92  ? 359  ASP A OD1   1 
ATOM   2799  O  OD2   . ASP A 1 359  ? 112.536 110.370 7.162   1.00 11.32 ? 359  ASP A OD2   1 
ATOM   2800  N  N     . ASP A 1 360  ? 108.720 106.137 7.283   1.00 5.71  ? 360  ASP A N     1 
ATOM   2801  C  CA    . ASP A 1 360  ? 107.808 105.280 8.036   1.00 5.70  ? 360  ASP A CA    1 
ATOM   2802  C  C     . ASP A 1 360  ? 107.573 105.791 9.475   1.00 5.09  ? 360  ASP A C     1 
ATOM   2803  O  O     . ASP A 1 360  ? 107.223 105.027 10.369  1.00 4.81  ? 360  ASP A O     1 
ATOM   2804  C  CB    . ASP A 1 360  ? 108.301 103.816 8.026   1.00 6.60  ? 360  ASP A CB    1 
ATOM   2805  C  CG    . ASP A 1 360  ? 107.732 103.000 6.857   1.00 9.21  ? 360  ASP A CG    1 
ATOM   2806  O  OD1   . ASP A 1 360  ? 106.943 103.545 6.045   1.00 10.80 ? 360  ASP A OD1   1 
ATOM   2807  O  OD2   . ASP A 1 360  ? 108.004 101.789 6.685   1.00 11.48 ? 360  ASP A OD2   1 
ATOM   2808  N  N     . TYR A 1 361  ? 107.806 107.082 9.687   1.00 4.15  ? 361  TYR A N     1 
ATOM   2809  C  CA    . TYR A 1 361  ? 107.390 107.762 10.904  1.00 3.70  ? 361  TYR A CA    1 
ATOM   2810  C  C     . TYR A 1 361  ? 105.880 107.883 10.800  1.00 3.05  ? 361  TYR A C     1 
ATOM   2811  O  O     . TYR A 1 361  ? 105.366 108.245 9.743   1.00 3.03  ? 361  TYR A O     1 
ATOM   2812  C  CB    . TYR A 1 361  ? 108.022 109.157 10.957  1.00 3.69  ? 361  TYR A CB    1 
ATOM   2813  C  CG    . TYR A 1 361  ? 108.122 109.775 12.338  1.00 4.08  ? 361  TYR A CG    1 
ATOM   2814  C  CD1   . TYR A 1 361  ? 109.231 109.532 13.146  1.00 5.64  ? 361  TYR A CD1   1 
ATOM   2815  C  CD2   . TYR A 1 361  ? 107.131 110.635 12.820  1.00 4.89  ? 361  TYR A CD2   1 
ATOM   2816  C  CE1   . TYR A 1 361  ? 109.349 110.104 14.402  1.00 4.32  ? 361  TYR A CE1   1 
ATOM   2817  C  CE2   . TYR A 1 361  ? 107.241 111.214 14.086  1.00 5.19  ? 361  TYR A CE2   1 
ATOM   2818  C  CZ    . TYR A 1 361  ? 108.361 110.939 14.868  1.00 5.91  ? 361  TYR A CZ    1 
ATOM   2819  O  OH    . TYR A 1 361  ? 108.512 111.478 16.133  1.00 6.54  ? 361  TYR A OH    1 
ATOM   2820  N  N     . ILE A 1 362  ? 105.163 107.587 11.875  1.00 2.87  ? 362  ILE A N     1 
ATOM   2821  C  CA    . ILE A 1 362  ? 103.704 107.566 11.791  1.00 2.74  ? 362  ILE A CA    1 
ATOM   2822  C  C     . ILE A 1 362  ? 103.060 108.294 12.958  1.00 3.26  ? 362  ILE A C     1 
ATOM   2823  O  O     . ILE A 1 362  ? 103.502 108.178 14.105  1.00 2.78  ? 362  ILE A O     1 
ATOM   2824  C  CB    . ILE A 1 362  ? 103.161 106.100 11.634  1.00 3.43  ? 362  ILE A CB    1 
ATOM   2825  C  CG1   . ILE A 1 362  ? 101.615 106.079 11.597  1.00 3.43  ? 362  ILE A CG1   1 
ATOM   2826  C  CG2   . ILE A 1 362  ? 103.724 105.152 12.718  1.00 1.45  ? 362  ILE A CG2   1 
ATOM   2827  C  CD1   . ILE A 1 362  ? 101.025 104.748 11.213  1.00 4.92  ? 362  ILE A CD1   1 
ATOM   2828  N  N     . VAL A 1 363  ? 102.012 109.050 12.641  1.00 2.77  ? 363  VAL A N     1 
ATOM   2829  C  CA    . VAL A 1 363  ? 101.261 109.809 13.631  1.00 3.04  ? 363  VAL A CA    1 
ATOM   2830  C  C     . VAL A 1 363  ? 99.786  109.424 13.420  1.00 3.41  ? 363  VAL A C     1 
ATOM   2831  O  O     . VAL A 1 363  ? 99.295  109.462 12.299  1.00 2.31  ? 363  VAL A O     1 
ATOM   2832  C  CB    . VAL A 1 363  ? 101.481 111.341 13.412  1.00 3.13  ? 363  VAL A CB    1 
ATOM   2833  C  CG1   . VAL A 1 363  ? 100.542 112.148 14.276  1.00 4.39  ? 363  VAL A CG1   1 
ATOM   2834  C  CG2   . VAL A 1 363  ? 102.976 111.740 13.683  1.00 2.55  ? 363  VAL A CG2   1 
ATOM   2835  N  N     . LEU A 1 364  ? 99.108  109.006 14.488  1.00 3.28  ? 364  LEU A N     1 
ATOM   2836  C  CA    . LEU A 1 364  ? 97.673  108.731 14.435  1.00 3.50  ? 364  LEU A CA    1 
ATOM   2837  C  C     . LEU A 1 364  ? 96.992  109.464 15.595  1.00 3.79  ? 364  LEU A C     1 
ATOM   2838  O  O     . LEU A 1 364  ? 97.563  109.597 16.674  1.00 2.73  ? 364  LEU A O     1 
ATOM   2839  C  CB    . LEU A 1 364  ? 97.405  107.220 14.529  1.00 3.88  ? 364  LEU A CB    1 
ATOM   2840  C  CG    . LEU A 1 364  ? 95.943  106.745 14.521  1.00 4.46  ? 364  LEU A CG    1 
ATOM   2841  C  CD1   . LEU A 1 364  ? 95.827  105.422 13.765  1.00 4.37  ? 364  LEU A CD1   1 
ATOM   2842  C  CD2   . LEU A 1 364  ? 95.375  106.608 15.949  1.00 4.65  ? 364  LEU A CD2   1 
ATOM   2843  N  N     . GLY A 1 365  ? 95.778  109.950 15.365  1.00 3.45  ? 365  GLY A N     1 
ATOM   2844  C  CA    . GLY A 1 365  ? 95.053  110.616 16.426  1.00 3.69  ? 365  GLY A CA    1 
ATOM   2845  C  C     . GLY A 1 365  ? 93.587  110.840 16.089  1.00 3.66  ? 365  GLY A C     1 
ATOM   2846  O  O     . GLY A 1 365  ? 93.160  110.615 14.947  1.00 3.11  ? 365  GLY A O     1 
ATOM   2847  N  N     . SER A 1 366  ? 92.835  111.318 17.079  1.00 3.50  ? 366  SER A N     1 
ATOM   2848  C  CA    . SER A 1 366  ? 91.442  111.735 16.885  1.00 4.15  ? 366  SER A CA    1 
ATOM   2849  C  C     . SER A 1 366  ? 91.274  112.805 15.806  1.00 3.80  ? 366  SER A C     1 
ATOM   2850  O  O     . SER A 1 366  ? 90.220  112.884 15.189  1.00 3.55  ? 366  SER A O     1 
ATOM   2851  C  CB    . SER A 1 366  ? 90.852  112.243 18.192  1.00 4.76  ? 366  SER A CB    1 
ATOM   2852  O  OG    . SER A 1 366  ? 91.025  111.283 19.219  1.00 6.70  ? 366  SER A OG    1 
ATOM   2853  N  N     . GLU A 1 367  ? 92.298  113.633 15.601  1.00 3.80  ? 367  GLU A N     1 
ATOM   2854  C  CA    . GLU A 1 367  ? 92.262  114.678 14.574  1.00 4.91  ? 367  GLU A CA    1 
ATOM   2855  C  C     . GLU A 1 367  ? 93.526  114.666 13.732  1.00 5.04  ? 367  GLU A C     1 
ATOM   2856  O  O     . GLU A 1 367  ? 94.605  114.337 14.249  1.00 4.34  ? 367  GLU A O     1 
ATOM   2857  C  CB    . GLU A 1 367  ? 92.082  116.072 15.198  1.00 5.12  ? 367  GLU A CB    1 
ATOM   2858  C  CG    . GLU A 1 367  ? 90.700  116.246 15.825  1.00 8.76  ? 367  GLU A CG    1 
ATOM   2859  C  CD    . GLU A 1 367  ? 90.390  117.651 16.316  1.00 10.46 ? 367  GLU A CD    1 
ATOM   2860  O  OE1   . GLU A 1 367  ? 91.079  118.613 15.908  1.00 14.44 ? 367  GLU A OE1   1 
ATOM   2861  O  OE2   . GLU A 1 367  ? 89.416  117.801 17.104  1.00 11.46 ? 367  GLU A OE2   1 
ATOM   2862  N  N     . ALA A 1 368  ? 93.388  115.038 12.457  1.00 4.79  ? 368  ALA A N     1 
ATOM   2863  C  CA    . ALA A 1 368  ? 94.529  115.109 11.537  1.00 6.35  ? 368  ALA A CA    1 
ATOM   2864  C  C     . ALA A 1 368  ? 95.489  116.285 11.772  1.00 7.14  ? 368  ALA A C     1 
ATOM   2865  O  O     . ALA A 1 368  ? 96.702  116.148 11.605  1.00 8.51  ? 368  ALA A O     1 
ATOM   2866  C  CB    . ALA A 1 368  ? 94.057  115.087 10.074  1.00 5.93  ? 368  ALA A CB    1 
ATOM   2867  N  N     . GLY A 1 369  ? 95.007  117.448 12.160  1.00 7.41  ? 369  GLY A N     1 
ATOM   2868  C  CA    . GLY A 1 369  ? 95.990  118.539 12.308  1.00 9.08  ? 369  GLY A CA    1 
ATOM   2869  C  C     . GLY A 1 369  ? 97.291  118.481 13.158  1.00 8.50  ? 369  GLY A C     1 
ATOM   2870  O  O     . GLY A 1 369  ? 98.011  119.464 13.193  1.00 8.36  ? 369  GLY A O     1 
ATOM   2871  N  N     . VAL A 1 370  ? 97.617  117.369 13.815  1.00 8.10  ? 370  VAL A N     1 
ATOM   2872  C  CA    . VAL A 1 370  ? 98.189  117.494 15.166  1.00 8.83  ? 370  VAL A CA    1 
ATOM   2873  C  C     . VAL A 1 370  ? 99.722  117.471 15.440  1.00 8.81  ? 370  VAL A C     1 
ATOM   2874  O  O     . VAL A 1 370  ? 100.175 117.915 16.493  1.00 8.69  ? 370  VAL A O     1 
ATOM   2875  C  CB    . VAL A 1 370  ? 97.388  116.634 16.178  1.00 8.83  ? 370  VAL A CB    1 
ATOM   2876  C  CG1   . VAL A 1 370  ? 97.856  115.193 16.205  1.00 7.30  ? 370  VAL A CG1   1 
ATOM   2877  C  CG2   . VAL A 1 370  ? 97.492  117.222 17.527  1.00 12.49 ? 370  VAL A CG2   1 
ATOM   2878  N  N     . VAL A 1 371  ? 100.507 116.980 14.496  1.00 8.53  ? 371  VAL A N     1 
ATOM   2879  C  CA    . VAL A 1 371  ? 101.953 117.045 14.628  1.00 9.30  ? 371  VAL A CA    1 
ATOM   2880  C  C     . VAL A 1 371  ? 102.450 117.767 13.391  1.00 9.98  ? 371  VAL A C     1 
ATOM   2881  O  O     . VAL A 1 371  ? 102.064 117.418 12.281  1.00 9.84  ? 371  VAL A O     1 
ATOM   2882  C  CB    . VAL A 1 371  ? 102.563 115.622 14.735  1.00 8.65  ? 371  VAL A CB    1 
ATOM   2883  C  CG1   . VAL A 1 371  ? 104.091 115.663 14.661  1.00 8.59  ? 371  VAL A CG1   1 
ATOM   2884  C  CG2   . VAL A 1 371  ? 102.110 114.941 16.028  1.00 7.60  ? 371  VAL A CG2   1 
ATOM   2885  N  N     . ASP A 1 372  ? 103.280 118.788 13.555  1.00 11.69 ? 372  ASP A N     1 
ATOM   2886  C  CA    . ASP A 1 372  ? 103.806 119.411 12.350  1.00 13.04 ? 372  ASP A CA    1 
ATOM   2887  C  C     . ASP A 1 372  ? 105.031 118.675 11.788  1.00 12.90 ? 372  ASP A C     1 
ATOM   2888  O  O     . ASP A 1 372  ? 106.169 118.785 12.272  1.00 13.30 ? 372  ASP A O     1 
ATOM   2889  C  CB    . ASP A 1 372  ? 103.849 120.959 12.371  1.00 14.09 ? 372  ASP A CB    1 
ATOM   2890  C  CG    . ASP A 1 372  ? 104.947 121.518 13.214  1.00 16.55 ? 372  ASP A CG    1 
ATOM   2891  O  OD1   . ASP A 1 372  ? 105.716 122.374 12.688  1.00 18.34 ? 372  ASP A OD1   1 
ATOM   2892  O  OD2   . ASP A 1 372  ? 105.109 121.184 14.408  1.00 20.58 ? 372  ASP A OD2   1 
ATOM   2893  N  N     . LEU A 1 373  ? 104.724 117.871 10.779  1.00 12.46 ? 373  LEU A N     1 
ATOM   2894  C  CA    . LEU A 1 373  ? 105.702 117.197 9.959   1.00 11.36 ? 373  LEU A CA    1 
ATOM   2895  C  C     . LEU A 1 373  ? 105.854 118.029 8.704   1.00 11.16 ? 373  LEU A C     1 
ATOM   2896  O  O     . LEU A 1 373  ? 104.887 118.683 8.272   1.00 10.68 ? 373  LEU A O     1 
ATOM   2897  C  CB    . LEU A 1 373  ? 105.190 115.806 9.582   1.00 11.35 ? 373  LEU A CB    1 
ATOM   2898  C  CG    . LEU A 1 373  ? 104.684 114.909 10.721  1.00 10.47 ? 373  LEU A CG    1 
ATOM   2899  C  CD1   . LEU A 1 373  ? 103.674 113.884 10.185  1.00 11.64 ? 373  LEU A CD1   1 
ATOM   2900  C  CD2   . LEU A 1 373  ? 105.827 114.238 11.436  1.00 10.24 ? 373  LEU A CD2   1 
ATOM   2901  N  N     . PRO A 1 374  ? 107.049 118.005 8.108   1.00 10.49 ? 374  PRO A N     1 
ATOM   2902  C  CA    . PRO A 1 374  ? 107.270 118.664 6.817   1.00 10.40 ? 374  PRO A CA    1 
ATOM   2903  C  C     . PRO A 1 374  ? 106.313 118.075 5.780   1.00 10.28 ? 374  PRO A C     1 
ATOM   2904  O  O     . PRO A 1 374  ? 106.401 116.901 5.414   1.00 9.67  ? 374  PRO A O     1 
ATOM   2905  C  CB    . PRO A 1 374  ? 108.726 118.319 6.489   1.00 10.33 ? 374  PRO A CB    1 
ATOM   2906  C  CG    . PRO A 1 374  ? 109.339 118.056 7.833   1.00 10.28 ? 374  PRO A CG    1 
ATOM   2907  C  CD    . PRO A 1 374  ? 108.273 117.346 8.609   1.00 10.43 ? 374  PRO A CD    1 
ATOM   2908  N  N     . GLU A 1 375  ? 105.383 118.910 5.334   1.00 10.24 ? 375  GLU A N     1 
ATOM   2909  C  CA    . GLU A 1 375  ? 104.296 118.485 4.462   1.00 10.36 ? 375  GLU A CA    1 
ATOM   2910  C  C     . GLU A 1 375  ? 104.826 117.727 3.239   1.00 9.60  ? 375  GLU A C     1 
ATOM   2911  O  O     . GLU A 1 375  ? 104.188 116.778 2.775   1.00 9.28  ? 375  GLU A O     1 
ATOM   2912  C  CB    . GLU A 1 375  ? 103.436 119.699 4.070   1.00 11.02 ? 375  GLU A CB    1 
ATOM   2913  C  CG    . GLU A 1 375  ? 102.833 120.438 5.281   1.00 14.44 ? 375  GLU A CG    1 
ATOM   2914  C  CD    . GLU A 1 375  ? 103.609 121.696 5.723   1.00 19.26 ? 375  GLU A CD    1 
ATOM   2915  O  OE1   . GLU A 1 375  ? 104.869 121.644 5.906   1.00 18.95 ? 375  GLU A OE1   1 
ATOM   2916  O  OE2   . GLU A 1 375  ? 102.952 122.761 5.903   1.00 20.48 ? 375  GLU A OE2   1 
ATOM   2917  N  N     . VAL A 1 376  ? 106.016 118.117 2.773   1.00 8.31  ? 376  VAL A N     1 
ATOM   2918  C  CA    . VAL A 1 376  ? 106.671 117.490 1.626   1.00 7.95  ? 376  VAL A CA    1 
ATOM   2919  C  C     . VAL A 1 376  ? 107.049 116.007 1.806   1.00 7.82  ? 376  VAL A C     1 
ATOM   2920  O  O     . VAL A 1 376  ? 107.096 115.262 0.828   1.00 8.06  ? 376  VAL A O     1 
ATOM   2921  C  CB    . VAL A 1 376  ? 107.906 118.320 1.137   1.00 7.72  ? 376  VAL A CB    1 
ATOM   2922  C  CG1   . VAL A 1 376  ? 109.125 118.139 2.074   1.00 7.32  ? 376  VAL A CG1   1 
ATOM   2923  C  CG2   . VAL A 1 376  ? 108.263 117.981 -0.305  1.00 8.81  ? 376  VAL A CG2   1 
ATOM   2924  N  N     . ASP A 1 377  ? 107.349 115.561 3.021   1.00 7.64  ? 377  ASP A N     1 
ATOM   2925  C  CA    . ASP A 1 377  ? 107.728 114.148 3.137   1.00 7.71  ? 377  ASP A CA    1 
ATOM   2926  C  C     . ASP A 1 377  ? 106.677 113.210 3.688   1.00 6.21  ? 377  ASP A C     1 
ATOM   2927  O  O     . ASP A 1 377  ? 106.982 112.070 4.051   1.00 4.80  ? 377  ASP A O     1 
ATOM   2928  C  CB    . ASP A 1 377  ? 109.089 113.919 3.786   1.00 9.15  ? 377  ASP A CB    1 
ATOM   2929  C  CG    . ASP A 1 377  ? 109.248 114.626 5.082   1.00 12.00 ? 377  ASP A CG    1 
ATOM   2930  O  OD1   . ASP A 1 377  ? 108.393 114.412 5.968   1.00 16.43 ? 377  ASP A OD1   1 
ATOM   2931  O  OD2   . ASP A 1 377  ? 110.231 115.379 5.307   1.00 14.09 ? 377  ASP A OD2   1 
ATOM   2932  N  N     . ILE A 1 378  ? 105.437 113.687 3.716   1.00 4.81  ? 378  ILE A N     1 
ATOM   2933  C  CA    . ILE A 1 378  ? 104.325 112.797 3.996   1.00 3.83  ? 378  ILE A CA    1 
ATOM   2934  C  C     . ILE A 1 378  ? 103.998 112.015 2.733   1.00 3.31  ? 378  ILE A C     1 
ATOM   2935  O  O     . ILE A 1 378  ? 103.850 112.563 1.646   1.00 3.43  ? 378  ILE A O     1 
ATOM   2936  C  CB    . ILE A 1 378  ? 103.113 113.553 4.562   1.00 3.78  ? 378  ILE A CB    1 
ATOM   2937  C  CG1   . ILE A 1 378  ? 103.433 113.999 5.989   1.00 4.84  ? 378  ILE A CG1   1 
ATOM   2938  C  CG2   . ILE A 1 378  ? 101.865 112.665 4.511   1.00 2.36  ? 378  ILE A CG2   1 
ATOM   2939  C  CD1   . ILE A 1 378  ? 102.705 115.266 6.424   1.00 9.15  ? 378  ILE A CD1   1 
ATOM   2940  N  N     . VAL A 1 379  ? 103.880 110.714 2.905   1.00 2.84  ? 379  VAL A N     1 
ATOM   2941  C  CA    . VAL A 1 379  ? 103.793 109.781 1.793   1.00 2.64  ? 379  VAL A CA    1 
ATOM   2942  C  C     . VAL A 1 379  ? 102.364 109.199 1.721   1.00 2.67  ? 379  VAL A C     1 
ATOM   2943  O  O     . VAL A 1 379  ? 101.915 108.735 0.665   1.00 1.57  ? 379  VAL A O     1 
ATOM   2944  C  CB    . VAL A 1 379  ? 104.931 108.749 2.013   1.00 2.96  ? 379  VAL A CB    1 
ATOM   2945  C  CG1   . VAL A 1 379  ? 104.442 107.363 2.379   1.00 2.79  ? 379  VAL A CG1   1 
ATOM   2946  C  CG2   . VAL A 1 379  ? 105.953 108.800 0.930   1.00 3.83  ? 379  VAL A CG2   1 
ATOM   2947  N  N     . GLU A 1 380  ? 101.648 109.278 2.847   1.00 2.25  ? 380  GLU A N     1 
ATOM   2948  C  CA    . GLU A 1 380  ? 100.252 108.852 2.936   1.00 2.92  ? 380  GLU A CA    1 
ATOM   2949  C  C     . GLU A 1 380  ? 99.482  109.621 4.016   1.00 2.94  ? 380  GLU A C     1 
ATOM   2950  O  O     . GLU A 1 380  ? 99.992  109.865 5.125   1.00 2.14  ? 380  GLU A O     1 
ATOM   2951  C  CB    . GLU A 1 380  ? 100.169 107.332 3.213   1.00 3.63  ? 380  GLU A CB    1 
ATOM   2952  C  CG    . GLU A 1 380  ? 98.756  106.762 3.373   1.00 6.68  ? 380  GLU A CG    1 
ATOM   2953  C  CD    . GLU A 1 380  ? 98.716  105.246 3.631   1.00 11.64 ? 380  GLU A CD    1 
ATOM   2954  O  OE1   . GLU A 1 380  ? 97.617  104.727 3.936   1.00 12.33 ? 380  GLU A OE1   1 
ATOM   2955  O  OE2   . GLU A 1 380  ? 99.761  104.563 3.515   1.00 13.26 ? 380  GLU A OE2   1 
ATOM   2956  N  N     . LYS A 1 381  ? 98.242  109.982 3.688   1.00 2.22  ? 381  LYS A N     1 
ATOM   2957  C  CA    . LYS A 1 381  ? 97.273  110.445 4.682   1.00 2.17  ? 381  LYS A CA    1 
ATOM   2958  C  C     . LYS A 1 381  ? 96.075  109.504 4.633   1.00 1.95  ? 381  LYS A C     1 
ATOM   2959  O  O     . LYS A 1 381  ? 95.432  109.354 3.589   1.00 1.00  ? 381  LYS A O     1 
ATOM   2960  C  CB    . LYS A 1 381  ? 96.842  111.896 4.433   1.00 1.97  ? 381  LYS A CB    1 
ATOM   2961  C  CG    . LYS A 1 381  ? 97.992  112.889 4.400   1.00 2.94  ? 381  LYS A CG    1 
ATOM   2962  C  CD    . LYS A 1 381  ? 97.547  114.333 4.473   1.00 3.14  ? 381  LYS A CD    1 
ATOM   2963  C  CE    . LYS A 1 381  ? 98.726  115.194 4.905   1.00 6.21  ? 381  LYS A CE    1 
ATOM   2964  N  NZ    . LYS A 1 381  ? 98.486  116.635 4.782   1.00 8.92  ? 381  LYS A NZ    1 
ATOM   2965  N  N     . GLY A 1 382  ? 95.792  108.873 5.773   1.00 2.10  ? 382  GLY A N     1 
ATOM   2966  C  CA    . GLY A 1 382  ? 94.781  107.828 5.846   1.00 1.97  ? 382  GLY A CA    1 
ATOM   2967  C  C     . GLY A 1 382  ? 93.855  107.976 7.031   1.00 2.17  ? 382  GLY A C     1 
ATOM   2968  O  O     . GLY A 1 382  ? 93.907  108.986 7.751   1.00 2.37  ? 382  GLY A O     1 
ATOM   2969  N  N     . ARG A 1 383  ? 92.987  106.976 7.210   1.00 1.84  ? 383  ARG A N     1 
ATOM   2970  C  CA    . ARG A 1 383  ? 92.034  106.930 8.307   1.00 1.91  ? 383  ARG A CA    1 
ATOM   2971  C  C     . ARG A 1 383  ? 91.667  105.481 8.580   1.00 2.56  ? 383  ARG A C     1 
ATOM   2972  O  O     . ARG A 1 383  ? 91.849  104.599 7.724   1.00 2.41  ? 383  ARG A O     1 
ATOM   2973  C  CB    . ARG A 1 383  ? 90.745  107.712 7.973   1.00 1.00  ? 383  ARG A CB    1 
ATOM   2974  C  CG    . ARG A 1 383  ? 89.941  107.139 6.796   1.00 2.13  ? 383  ARG A CG    1 
ATOM   2975  C  CD    . ARG A 1 383  ? 88.746  107.994 6.357   1.00 2.45  ? 383  ARG A CD    1 
ATOM   2976  N  NE    . ARG A 1 383  ? 87.758  108.072 7.436   1.00 2.14  ? 383  ARG A NE    1 
ATOM   2977  C  CZ    . ARG A 1 383  ? 86.795  107.179 7.661   1.00 4.77  ? 383  ARG A CZ    1 
ATOM   2978  N  NH1   . ARG A 1 383  ? 86.653  106.118 6.865   1.00 1.58  ? 383  ARG A NH1   1 
ATOM   2979  N  NH2   . ARG A 1 383  ? 85.969  107.347 8.693   1.00 5.16  ? 383  ARG A NH2   1 
ATOM   2980  N  N     . LEU A 1 384  ? 91.132  105.251 9.770   1.00 2.50  ? 384  LEU A N     1 
ATOM   2981  C  CA    . LEU A 1 384  ? 90.496  103.984 10.081  1.00 2.82  ? 384  LEU A CA    1 
ATOM   2982  C  C     . LEU A 1 384  ? 89.018  104.036 9.744   1.00 3.44  ? 384  LEU A C     1 
ATOM   2983  O  O     . LEU A 1 384  ? 88.295  104.902 10.226  1.00 3.96  ? 384  LEU A O     1 
ATOM   2984  C  CB    . LEU A 1 384  ? 90.711  103.618 11.550  1.00 2.65  ? 384  LEU A CB    1 
ATOM   2985  C  CG    . LEU A 1 384  ? 92.176  103.478 11.991  1.00 3.68  ? 384  LEU A CG    1 
ATOM   2986  C  CD1   . LEU A 1 384  ? 92.264  103.192 13.497  1.00 1.56  ? 384  LEU A CD1   1 
ATOM   2987  C  CD2   . LEU A 1 384  ? 92.910  102.400 11.183  1.00 6.26  ? 384  LEU A CD2   1 
ATOM   2988  N  N     . ALA A 1 385  ? 88.579  103.117 8.894   1.00 3.86  ? 385  ALA A N     1 
ATOM   2989  C  CA    . ALA A 1 385  ? 87.164  102.946 8.633   1.00 4.31  ? 385  ALA A CA    1 
ATOM   2990  C  C     . ALA A 1 385  ? 86.572  102.040 9.739   1.00 4.87  ? 385  ALA A C     1 
ATOM   2991  O  O     . ALA A 1 385  ? 87.317  101.588 10.611  1.00 4.55  ? 385  ALA A O     1 
ATOM   2992  C  CB    . ALA A 1 385  ? 86.960  102.378 7.226   1.00 4.16  ? 385  ALA A CB    1 
ATOM   2993  N  N     . PRO A 1 386  ? 85.256  101.798 9.740   1.00 4.97  ? 386  PRO A N     1 
ATOM   2994  C  CA    . PRO A 1 386  ? 84.625  101.024 10.816  1.00 5.09  ? 386  PRO A CA    1 
ATOM   2995  C  C     . PRO A 1 386  ? 85.303  99.663  11.002  1.00 4.96  ? 386  PRO A C     1 
ATOM   2996  O  O     . PRO A 1 386  ? 85.558  98.993  10.004  1.00 4.70  ? 386  PRO A O     1 
ATOM   2997  C  CB    . PRO A 1 386  ? 83.192  100.836 10.299  1.00 4.74  ? 386  PRO A CB    1 
ATOM   2998  C  CG    . PRO A 1 386  ? 82.964  102.081 9.469   1.00 5.15  ? 386  PRO A CG    1 
ATOM   2999  C  CD    . PRO A 1 386  ? 84.262  102.215 8.727   1.00 4.93  ? 386  PRO A CD    1 
ATOM   3000  N  N     . GLY A 1 387  ? 85.608  99.299  12.247  1.00 4.75  ? 387  GLY A N     1 
ATOM   3001  C  CA    . GLY A 1 387  ? 86.217  98.016  12.576  1.00 6.08  ? 387  GLY A CA    1 
ATOM   3002  C  C     . GLY A 1 387  ? 87.710  97.883  12.278  1.00 6.40  ? 387  GLY A C     1 
ATOM   3003  O  O     . GLY A 1 387  ? 88.334  96.895  12.675  1.00 6.96  ? 387  GLY A O     1 
ATOM   3004  N  N     . GLN A 1 388  ? 88.291  98.870  11.595  1.00 5.87  ? 388  GLN A N     1 
ATOM   3005  C  CA    . GLN A 1 388  ? 89.680  98.755  11.124  1.00 5.50  ? 388  GLN A CA    1 
ATOM   3006  C  C     . GLN A 1 388  ? 90.720  98.993  12.208  1.00 5.28  ? 388  GLN A C     1 
ATOM   3007  O  O     . GLN A 1 388  ? 90.439  99.646  13.215  1.00 4.19  ? 388  GLN A O     1 
ATOM   3008  C  CB    . GLN A 1 388  ? 89.942  99.705  9.957   1.00 5.67  ? 388  GLN A CB    1 
ATOM   3009  C  CG    . GLN A 1 388  ? 89.206  99.345  8.670   1.00 5.40  ? 388  GLN A CG    1 
ATOM   3010  C  CD    . GLN A 1 388  ? 89.749  100.127 7.470   1.00 8.35  ? 388  GLN A CD    1 
ATOM   3011  O  OE1   . GLN A 1 388  ? 90.251  101.244 7.626   1.00 4.84  ? 388  GLN A OE1   1 
ATOM   3012  N  NE2   . GLN A 1 388  ? 89.650  99.536  6.275   1.00 8.80  ? 388  GLN A NE2   1 
ATOM   3013  N  N     . MET A 1 389  ? 91.921  98.470  11.960  1.00 5.55  ? 389  MET A N     1 
ATOM   3014  C  CA    . MET A 1 389  ? 93.078  98.641  12.837  1.00 5.65  ? 389  MET A CA    1 
ATOM   3015  C  C     . MET A 1 389  ? 94.302  99.014  12.025  1.00 5.20  ? 389  MET A C     1 
ATOM   3016  O  O     . MET A 1 389  ? 94.368  98.763  10.830  1.00 4.63  ? 389  MET A O     1 
ATOM   3017  C  CB    . MET A 1 389  ? 93.423  97.333  13.563  1.00 5.98  ? 389  MET A CB    1 
ATOM   3018  C  CG    . MET A 1 389  ? 92.422  96.866  14.603  1.00 8.98  ? 389  MET A CG    1 
ATOM   3019  S  SD    . MET A 1 389  ? 92.868  95.234  15.251  1.00 13.01 ? 389  MET A SD    1 
ATOM   3020  C  CE    . MET A 1 389  ? 93.210  94.434  13.824  1.00 14.57 ? 389  MET A CE    1 
ATOM   3021  N  N     . ILE A 1 390  ? 95.283  99.597  12.707  1.00 4.67  ? 390  ILE A N     1 
ATOM   3022  C  CA    . ILE A 1 390  ? 96.595  99.835  12.141  1.00 4.78  ? 390  ILE A CA    1 
ATOM   3023  C  C     . ILE A 1 390  ? 97.592  99.666  13.294  1.00 4.99  ? 390  ILE A C     1 
ATOM   3024  O  O     . ILE A 1 390  ? 97.254  99.940  14.464  1.00 5.13  ? 390  ILE A O     1 
ATOM   3025  C  CB    . ILE A 1 390  ? 96.670  101.241 11.480  1.00 4.54  ? 390  ILE A CB    1 
ATOM   3026  C  CG1   . ILE A 1 390  ? 97.966  101.385 10.675  1.00 3.92  ? 390  ILE A CG1   1 
ATOM   3027  C  CG2   . ILE A 1 390  ? 96.517  102.354 12.537  1.00 4.81  ? 390  ILE A CG2   1 
ATOM   3028  C  CD1   . ILE A 1 390  ? 98.028  102.588 9.705   1.00 3.28  ? 390  ILE A CD1   1 
ATOM   3029  N  N     . ALA A 1 391  ? 98.791  99.189  12.993  1.00 5.06  ? 391  ALA A N     1 
ATOM   3030  C  CA    . ALA A 1 391  ? 99.773  98.965  14.056  1.00 5.00  ? 391  ALA A CA    1 
ATOM   3031  C  C     . ALA A 1 391  ? 101.195 99.098  13.580  1.00 5.03  ? 391  ALA A C     1 
ATOM   3032  O  O     . ALA A 1 391  ? 101.461 99.211  12.380  1.00 5.10  ? 391  ALA A O     1 
ATOM   3033  C  CB    . ALA A 1 391  ? 99.569  97.590  14.716  1.00 5.23  ? 391  ALA A CB    1 
ATOM   3034  N  N     . VAL A 1 392  ? 102.099 99.080  14.548  1.00 4.58  ? 392  VAL A N     1 
ATOM   3035  C  CA    . VAL A 1 392  ? 103.522 99.155  14.301  1.00 5.28  ? 392  VAL A CA    1 
ATOM   3036  C  C     . VAL A 1 392  ? 104.217 98.035  15.078  1.00 5.09  ? 392  VAL A C     1 
ATOM   3037  O  O     . VAL A 1 392  ? 103.939 97.817  16.254  1.00 4.92  ? 392  VAL A O     1 
ATOM   3038  C  CB    . VAL A 1 392  ? 104.084 100.516 14.755  1.00 4.82  ? 392  VAL A CB    1 
ATOM   3039  C  CG1   . VAL A 1 392  ? 105.594 100.483 14.758  1.00 7.08  ? 392  VAL A CG1   1 
ATOM   3040  C  CG2   . VAL A 1 392  ? 103.551 101.631 13.853  1.00 5.72  ? 392  VAL A CG2   1 
ATOM   3041  N  N     . ASP A 1 393  ? 105.085 97.299  14.400  1.00 5.59  ? 393  ASP A N     1 
ATOM   3042  C  CA    . ASP A 1 393  ? 105.927 96.345  15.079  1.00 6.46  ? 393  ASP A CA    1 
ATOM   3043  C  C     . ASP A 1 393  ? 107.253 97.046  15.277  1.00 6.56  ? 393  ASP A C     1 
ATOM   3044  O  O     . ASP A 1 393  ? 107.994 97.236  14.316  1.00 6.16  ? 393  ASP A O     1 
ATOM   3045  C  CB    . ASP A 1 393  ? 106.078 95.070  14.251  1.00 6.73  ? 393  ASP A CB    1 
ATOM   3046  C  CG    . ASP A 1 393  ? 106.877 93.991  14.976  1.00 9.13  ? 393  ASP A CG    1 
ATOM   3047  O  OD1   . ASP A 1 393  ? 107.912 94.304  15.623  1.00 6.54  ? 393  ASP A OD1   1 
ATOM   3048  O  OD2   . ASP A 1 393  ? 106.527 92.786  14.951  1.00 12.74 ? 393  ASP A OD2   1 
ATOM   3049  N  N     . LEU A 1 394  ? 107.533 97.437  16.524  1.00 6.90  ? 394  LEU A N     1 
ATOM   3050  C  CA    . LEU A 1 394  ? 108.718 98.235  16.849  1.00 7.80  ? 394  LEU A CA    1 
ATOM   3051  C  C     . LEU A 1 394  ? 110.050 97.546  16.524  1.00 8.15  ? 394  LEU A C     1 
ATOM   3052  O  O     . LEU A 1 394  ? 110.873 98.115  15.817  1.00 7.92  ? 394  LEU A O     1 
ATOM   3053  C  CB    . LEU A 1 394  ? 108.674 98.704  18.306  1.00 7.49  ? 394  LEU A CB    1 
ATOM   3054  C  CG    . LEU A 1 394  ? 107.482 99.625  18.616  1.00 8.12  ? 394  LEU A CG    1 
ATOM   3055  C  CD1   . LEU A 1 394  ? 107.306 99.834  20.116  1.00 9.96  ? 394  LEU A CD1   1 
ATOM   3056  C  CD2   . LEU A 1 394  ? 107.622 100.966 17.882  1.00 7.83  ? 394  LEU A CD2   1 
ATOM   3057  N  N     . ALA A 1 395  ? 110.247 96.323  17.013  1.00 9.04  ? 395  ALA A N     1 
ATOM   3058  C  CA    . ALA A 1 395  ? 111.451 95.547  16.678  1.00 9.12  ? 395  ALA A CA    1 
ATOM   3059  C  C     . ALA A 1 395  ? 111.615 95.267  15.172  1.00 9.65  ? 395  ALA A C     1 
ATOM   3060  O  O     . ALA A 1 395  ? 112.737 95.314  14.637  1.00 9.88  ? 395  ALA A O     1 
ATOM   3061  C  CB    . ALA A 1 395  ? 111.469 94.258  17.461  1.00 9.47  ? 395  ALA A CB    1 
ATOM   3062  N  N     . GLU A 1 396  ? 110.519 94.968  14.475  1.00 9.45  ? 396  GLU A N     1 
ATOM   3063  C  CA    . GLU A 1 396  ? 110.614 94.690  13.033  1.00 10.25 ? 396  GLU A CA    1 
ATOM   3064  C  C     . GLU A 1 396  ? 110.687 95.976  12.193  1.00 9.80  ? 396  GLU A C     1 
ATOM   3065  O  O     . GLU A 1 396  ? 111.016 95.912  11.006  1.00 9.31  ? 396  GLU A O     1 
ATOM   3066  C  CB    . GLU A 1 396  ? 109.466 93.793  12.534  1.00 10.29 ? 396  GLU A CB    1 
ATOM   3067  C  CG    . GLU A 1 396  ? 109.574 92.313  12.894  1.00 13.66 ? 396  GLU A CG    1 
ATOM   3068  C  CD    . GLU A 1 396  ? 108.693 91.420  12.014  1.00 18.85 ? 396  GLU A CD    1 
ATOM   3069  O  OE1   . GLU A 1 396  ? 107.448 91.620  11.975  1.00 20.85 ? 396  GLU A OE1   1 
ATOM   3070  O  OE2   . GLU A 1 396  ? 109.247 90.513  11.337  1.00 21.96 ? 396  GLU A OE2   1 
ATOM   3071  N  N     . GLN A 1 397  ? 110.377 97.127  12.813  1.00 9.80  ? 397  GLN A N     1 
ATOM   3072  C  CA    . GLN A 1 397  ? 110.319 98.429  12.115  1.00 9.82  ? 397  GLN A CA    1 
ATOM   3073  C  C     . GLN A 1 397  ? 109.339 98.359  10.931  1.00 9.18  ? 397  GLN A C     1 
ATOM   3074  O  O     . GLN A 1 397  ? 109.693 98.597  9.771   1.00 9.37  ? 397  GLN A O     1 
ATOM   3075  C  CB    . GLN A 1 397  ? 111.726 98.897  11.670  1.00 10.26 ? 397  GLN A CB    1 
ATOM   3076  C  CG    . GLN A 1 397  ? 112.818 98.658  12.730  1.00 10.96 ? 397  GLN A CG    1 
ATOM   3077  C  CD    . GLN A 1 397  ? 114.022 99.590  12.617  1.00 12.44 ? 397  GLN A CD    1 
ATOM   3078  O  OE1   . GLN A 1 397  ? 114.440 99.968  11.517  1.00 9.03  ? 397  GLN A OE1   1 
ATOM   3079  N  NE2   . GLN A 1 397  ? 114.583 99.962  13.774  1.00 14.01 ? 397  GLN A NE2   1 
ATOM   3080  N  N     . LYS A 1 398  ? 108.099 97.998  11.232  1.00 8.56  ? 398  LYS A N     1 
ATOM   3081  C  CA    . LYS A 1 398  ? 107.119 97.718  10.192  1.00 8.35  ? 398  LYS A CA    1 
ATOM   3082  C  C     . LYS A 1 398  ? 105.791 98.304  10.584  1.00 7.38  ? 398  LYS A C     1 
ATOM   3083  O  O     . LYS A 1 398  ? 105.403 98.230  11.747  1.00 6.85  ? 398  LYS A O     1 
ATOM   3084  C  CB    . LYS A 1 398  ? 106.957 96.210  10.000  1.00 8.95  ? 398  LYS A CB    1 
ATOM   3085  C  CG    . LYS A 1 398  ? 108.071 95.555  9.190   1.00 11.90 ? 398  LYS A CG    1 
ATOM   3086  C  CD    . LYS A 1 398  ? 107.860 94.054  9.106   1.00 15.35 ? 398  LYS A CD    1 
ATOM   3087  C  CE    . LYS A 1 398  ? 108.544 93.464  7.882   1.00 16.95 ? 398  LYS A CE    1 
ATOM   3088  N  NZ    . LYS A 1 398  ? 109.465 92.354  8.280   1.00 19.31 ? 398  LYS A NZ    1 
ATOM   3089  N  N     . ILE A 1 399  ? 105.110 98.903  9.609   1.00 6.61  ? 399  ILE A N     1 
ATOM   3090  C  CA    . ILE A 1 399  ? 103.731 99.343  9.784   1.00 6.31  ? 399  ILE A CA    1 
ATOM   3091  C  C     . ILE A 1 399  ? 102.845 98.220  9.281   1.00 6.51  ? 399  ILE A C     1 
ATOM   3092  O  O     . ILE A 1 399  ? 103.026 97.726  8.154   1.00 5.38  ? 399  ILE A O     1 
ATOM   3093  C  CB    . ILE A 1 399  ? 103.458 100.659 9.001   1.00 6.69  ? 399  ILE A CB    1 
ATOM   3094  C  CG1   . ILE A 1 399  ? 104.248 101.815 9.633   1.00 6.72  ? 399  ILE A CG1   1 
ATOM   3095  C  CG2   . ILE A 1 399  ? 101.939 100.989 8.952   1.00 5.81  ? 399  ILE A CG2   1 
ATOM   3096  C  CD1   . ILE A 1 399  ? 104.540 102.969 8.691   1.00 6.55  ? 399  ILE A CD1   1 
ATOM   3097  N  N     . LEU A 1 400  ? 101.885 97.828  10.120  1.00 6.41  ? 400  LEU A N     1 
ATOM   3098  C  CA    . LEU A 1 400  ? 100.965 96.753  9.776   1.00 6.55  ? 400  LEU A CA    1 
ATOM   3099  C  C     . LEU A 1 400  ? 99.582  97.333  9.517   1.00 6.12  ? 400  LEU A C     1 
ATOM   3100  O  O     . LEU A 1 400  ? 99.029  98.036  10.360  1.00 5.42  ? 400  LEU A O     1 
ATOM   3101  C  CB    . LEU A 1 400  ? 100.952 95.678  10.889  1.00 7.32  ? 400  LEU A CB    1 
ATOM   3102  C  CG    . LEU A 1 400  ? 102.343 95.245  11.396  1.00 8.36  ? 400  LEU A CG    1 
ATOM   3103  C  CD1   . LEU A 1 400  ? 102.252 94.437  12.686  1.00 12.89 ? 400  LEU A CD1   1 
ATOM   3104  C  CD2   . LEU A 1 400  ? 103.104 94.478  10.343  1.00 11.30 ? 400  LEU A CD2   1 
ATOM   3105  N  N     . LYS A 1 401  ? 99.052  97.047  8.331   1.00 5.94  ? 401  LYS A N     1 
ATOM   3106  C  CA    . LYS A 1 401  ? 97.758  97.545  7.893   1.00 6.72  ? 401  LYS A CA    1 
ATOM   3107  C  C     . LYS A 1 401  ? 96.633  96.555  8.232   1.00 6.62  ? 401  LYS A C     1 
ATOM   3108  O  O     . LYS A 1 401  ? 96.885  95.361  8.443   1.00 6.48  ? 401  LYS A O     1 
ATOM   3109  C  CB    . LYS A 1 401  ? 97.789  97.855  6.381   1.00 6.95  ? 401  LYS A CB    1 
ATOM   3110  C  CG    . LYS A 1 401  ? 98.574  99.139  5.993   1.00 8.69  ? 401  LYS A CG    1 
ATOM   3111  C  CD    . LYS A 1 401  ? 97.968  100.427 6.596   1.00 12.82 ? 401  LYS A CD    1 
ATOM   3112  C  CE    . LYS A 1 401  ? 98.514  101.704 5.926   1.00 11.89 ? 401  LYS A CE    1 
ATOM   3113  N  NZ    . LYS A 1 401  ? 98.253  101.771 4.453   1.00 13.59 ? 401  LYS A NZ    1 
ATOM   3114  N  N     . ASN A 1 402  ? 95.405  97.063  8.233   1.00 6.50  ? 402  ASN A N     1 
ATOM   3115  C  CA    . ASN A 1 402  ? 94.202  96.346  8.668   1.00 7.22  ? 402  ASN A CA    1 
ATOM   3116  C  C     . ASN A 1 402  ? 94.113  94.840  8.384   1.00 7.70  ? 402  ASN A C     1 
ATOM   3117  O  O     . ASN A 1 402  ? 94.092  94.031  9.314   1.00 7.66  ? 402  ASN A O     1 
ATOM   3118  C  CB    . ASN A 1 402  ? 92.959  97.060  8.117   1.00 7.26  ? 402  ASN A CB    1 
ATOM   3119  C  CG    . ASN A 1 402  ? 91.660  96.490  8.658   1.00 7.64  ? 402  ASN A CG    1 
ATOM   3120  O  OD1   . ASN A 1 402  ? 91.471  96.353  9.870   1.00 6.43  ? 402  ASN A OD1   1 
ATOM   3121  N  ND2   . ASN A 1 402  ? 90.744  96.184  7.758   1.00 7.35  ? 402  ASN A ND2   1 
ATOM   3122  N  N     . TYR A 1 403  ? 94.031  94.445  7.120   1.00 8.01  ? 403  TYR A N     1 
ATOM   3123  C  CA    . TYR A 1 403  ? 93.745  93.034  6.865   1.00 8.23  ? 403  TYR A CA    1 
ATOM   3124  C  C     . TYR A 1 403  ? 94.984  92.133  7.047   1.00 7.76  ? 403  TYR A C     1 
ATOM   3125  O  O     . TYR A 1 403  ? 94.837  90.976  7.417   1.00 6.62  ? 403  TYR A O     1 
ATOM   3126  C  CB    . TYR A 1 403  ? 92.893  92.801  5.593   1.00 8.80  ? 403  TYR A CB    1 
ATOM   3127  C  CG    . TYR A 1 403  ? 91.428  93.228  5.807   1.00 11.71 ? 403  TYR A CG    1 
ATOM   3128  C  CD1   . TYR A 1 403  ? 90.736  93.970  4.847   1.00 14.34 ? 403  TYR A CD1   1 
ATOM   3129  C  CD2   . TYR A 1 403  ? 90.755  92.926  7.004   1.00 14.79 ? 403  TYR A CD2   1 
ATOM   3130  C  CE1   . TYR A 1 403  ? 89.397  94.392  5.060   1.00 14.91 ? 403  TYR A CE1   1 
ATOM   3131  C  CE2   . TYR A 1 403  ? 89.410  93.340  7.231   1.00 14.48 ? 403  TYR A CE2   1 
ATOM   3132  C  CZ    . TYR A 1 403  ? 88.743  94.076  6.252   1.00 15.65 ? 403  TYR A CZ    1 
ATOM   3133  O  OH    . TYR A 1 403  ? 87.425  94.483  6.471   1.00 15.19 ? 403  TYR A OH    1 
ATOM   3134  N  N     . GLN A 1 404  ? 96.182  92.707  6.906   1.00 6.93  ? 404  GLN A N     1 
ATOM   3135  C  CA    . GLN A 1 404  ? 97.410  92.012  7.286   1.00 7.72  ? 404  GLN A CA    1 
ATOM   3136  C  C     . GLN A 1 404  ? 97.386  91.619  8.768   1.00 7.13  ? 404  GLN A C     1 
ATOM   3137  O  O     . GLN A 1 404  ? 97.732  90.488  9.119   1.00 7.05  ? 404  GLN A O     1 
ATOM   3138  C  CB    . GLN A 1 404  ? 98.682  92.823  6.976   1.00 7.79  ? 404  GLN A CB    1 
ATOM   3139  C  CG    . GLN A 1 404  ? 99.983  92.050  7.310   1.00 10.36 ? 404  GLN A CG    1 
ATOM   3140  C  CD    . GLN A 1 404  ? 101.274 92.894  7.317   1.00 14.45 ? 404  GLN A CD    1 
ATOM   3141  O  OE1   . GLN A 1 404  ? 101.259 94.069  6.973   1.00 17.25 ? 404  GLN A OE1   1 
ATOM   3142  N  NE2   . GLN A 1 404  ? 102.391 92.277  7.717   1.00 15.81 ? 404  GLN A NE2   1 
ATOM   3143  N  N     . ILE A 1 405  ? 96.976  92.552  9.623   1.00 6.66  ? 405  ILE A N     1 
ATOM   3144  C  CA    . ILE A 1 405  ? 96.889  92.298  11.061  1.00 6.35  ? 405  ILE A CA    1 
ATOM   3145  C  C     . ILE A 1 405  ? 95.903  91.170  11.348  1.00 6.24  ? 405  ILE A C     1 
ATOM   3146  O  O     . ILE A 1 405  ? 96.216  90.215  12.067  1.00 6.20  ? 405  ILE A O     1 
ATOM   3147  C  CB    . ILE A 1 405  ? 96.442  93.563  11.830  1.00 6.10  ? 405  ILE A CB    1 
ATOM   3148  C  CG1   . ILE A 1 405  ? 97.477  94.686  11.720  1.00 5.00  ? 405  ILE A CG1   1 
ATOM   3149  C  CG2   . ILE A 1 405  ? 96.206  93.226  13.291  1.00 6.86  ? 405  ILE A CG2   1 
ATOM   3150  C  CD1   . ILE A 1 405  ? 96.914  96.088  12.156  1.00 5.82  ? 405  ILE A CD1   1 
ATOM   3151  N  N     . LYS A 1 406  ? 94.718  91.285  10.769  1.00 5.61  ? 406  LYS A N     1 
ATOM   3152  C  CA    . LYS A 1 406  ? 93.622  90.382  11.095  1.00 6.01  ? 406  LYS A CA    1 
ATOM   3153  C  C     . LYS A 1 406  ? 93.832  88.973  10.540  1.00 5.98  ? 406  LYS A C     1 
ATOM   3154  O  O     . LYS A 1 406  ? 93.493  87.996  11.200  1.00 5.26  ? 406  LYS A O     1 
ATOM   3155  C  CB    . LYS A 1 406  ? 92.294  90.977  10.631  1.00 5.78  ? 406  LYS A CB    1 
ATOM   3156  C  CG    . LYS A 1 406  ? 91.797  92.085  11.573  1.00 6.99  ? 406  LYS A CG    1 
ATOM   3157  C  CD    . LYS A 1 406  ? 91.077  93.182  10.843  1.00 8.58  ? 406  LYS A CD    1 
ATOM   3158  C  CE    . LYS A 1 406  ? 90.441  94.162  11.855  1.00 8.52  ? 406  LYS A CE    1 
ATOM   3159  N  NZ    . LYS A 1 406  ? 89.243  94.817  11.223  1.00 10.92 ? 406  LYS A NZ    1 
ATOM   3160  N  N     . GLN A 1 407  ? 94.412  88.883  9.343   1.00 6.40  ? 407  GLN A N     1 
ATOM   3161  C  CA    . GLN A 1 407  ? 94.725  87.605  8.707   1.00 7.20  ? 407  GLN A CA    1 
ATOM   3162  C  C     . GLN A 1 407  ? 95.751  86.813  9.517   1.00 7.64  ? 407  GLN A C     1 
ATOM   3163  O  O     . GLN A 1 407  ? 95.610  85.601  9.684   1.00 7.23  ? 407  GLN A O     1 
ATOM   3164  C  CB    . GLN A 1 407  ? 95.229  87.833  7.275   1.00 7.35  ? 407  GLN A CB    1 
ATOM   3165  C  CG    . GLN A 1 407  ? 95.408  86.565  6.450   1.00 10.50 ? 407  GLN A CG    1 
ATOM   3166  C  CD    . GLN A 1 407  ? 96.075  86.848  5.113   1.00 16.47 ? 407  GLN A CD    1 
ATOM   3167  O  OE1   . GLN A 1 407  ? 97.109  87.542  5.054   1.00 19.37 ? 407  GLN A OE1   1 
ATOM   3168  N  NE2   . GLN A 1 407  ? 95.491  86.324  4.034   1.00 17.49 ? 407  GLN A NE2   1 
ATOM   3169  N  N     . GLN A 1 408  ? 96.765  87.504  10.038  1.00 8.20  ? 408  GLN A N     1 
ATOM   3170  C  CA    . GLN A 1 408  ? 97.803  86.862  10.850  1.00 9.15  ? 408  GLN A CA    1 
ATOM   3171  C  C     . GLN A 1 408  ? 97.203  86.246  12.116  1.00 8.69  ? 408  GLN A C     1 
ATOM   3172  O  O     . GLN A 1 408  ? 97.540  85.124  12.479  1.00 8.08  ? 408  GLN A O     1 
ATOM   3173  C  CB    . GLN A 1 408  ? 98.919  87.854  11.222  1.00 9.44  ? 408  GLN A CB    1 
ATOM   3174  C  CG    . GLN A 1 408  ? 99.746  88.310  10.029  1.00 13.79 ? 408  GLN A CG    1 
ATOM   3175  C  CD    . GLN A 1 408  ? 101.033 89.039  10.406  1.00 18.27 ? 408  GLN A CD    1 
ATOM   3176  O  OE1   . GLN A 1 408  ? 101.620 88.782  11.464  1.00 20.81 ? 408  GLN A OE1   1 
ATOM   3177  N  NE2   . GLN A 1 408  ? 101.475 89.949  9.537   1.00 18.94 ? 408  GLN A NE2   1 
ATOM   3178  N  N     . ALA A 1 409  ? 96.304  86.974  12.777  1.00 8.20  ? 409  ALA A N     1 
ATOM   3179  C  CA    . ALA A 1 409  ? 95.622  86.426  13.952  1.00 7.96  ? 409  ALA A CA    1 
ATOM   3180  C  C     . ALA A 1 409  ? 94.716  85.247  13.565  1.00 8.10  ? 409  ALA A C     1 
ATOM   3181  O  O     . ALA A 1 409  ? 94.702  84.212  14.245  1.00 8.55  ? 409  ALA A O     1 
ATOM   3182  C  CB    . ALA A 1 409  ? 94.834  87.508  14.670  1.00 7.70  ? 409  ALA A CB    1 
ATOM   3183  N  N     . ALA A 1 410  ? 94.000  85.401  12.449  1.00 7.69  ? 410  ALA A N     1 
ATOM   3184  C  CA    . ALA A 1 410  ? 92.995  84.431  11.993  1.00 7.71  ? 410  ALA A CA    1 
ATOM   3185  C  C     . ALA A 1 410  ? 93.580  83.095  11.524  1.00 8.07  ? 410  ALA A C     1 
ATOM   3186  O  O     . ALA A 1 410  ? 92.941  82.026  11.642  1.00 7.06  ? 410  ALA A O     1 
ATOM   3187  C  CB    . ALA A 1 410  ? 92.149  85.048  10.889  1.00 8.12  ? 410  ALA A CB    1 
ATOM   3188  N  N     . GLN A 1 411  ? 94.801  83.148  11.002  1.00 7.99  ? 411  GLN A N     1 
ATOM   3189  C  CA    . GLN A 1 411  ? 95.442  81.940  10.506  1.00 8.31  ? 411  GLN A CA    1 
ATOM   3190  C  C     . GLN A 1 411  ? 96.105  81.057  11.581  1.00 7.76  ? 411  GLN A C     1 
ATOM   3191  O  O     . GLN A 1 411  ? 96.665  80.014  11.259  1.00 7.58  ? 411  GLN A O     1 
ATOM   3192  C  CB    . GLN A 1 411  ? 96.357  82.226  9.297   1.00 8.59  ? 411  GLN A CB    1 
ATOM   3193  C  CG    . GLN A 1 411  ? 97.638  83.001  9.560   1.00 11.03 ? 411  GLN A CG    1 
ATOM   3194  C  CD    . GLN A 1 411  ? 98.310  83.499  8.270   1.00 13.74 ? 411  GLN A CD    1 
ATOM   3195  O  OE1   . GLN A 1 411  ? 97.751  83.384  7.168   1.00 13.27 ? 411  GLN A OE1   1 
ATOM   3196  N  NE2   . GLN A 1 411  ? 99.513  84.053  8.413   1.00 15.15 ? 411  GLN A NE2   1 
ATOM   3197  N  N     . LYS A 1 412  ? 96.002  81.446  12.849  1.00 7.17  ? 412  LYS A N     1 
ATOM   3198  C  CA    . LYS A 1 412  ? 96.616  80.672  13.933  1.00 6.97  ? 412  LYS A CA    1 
ATOM   3199  C  C     . LYS A 1 412  ? 95.947  79.309  14.190  1.00 6.72  ? 412  LYS A C     1 
ATOM   3200  O  O     . LYS A 1 412  ? 96.607  78.374  14.648  1.00 6.31  ? 412  LYS A O     1 
ATOM   3201  C  CB    . LYS A 1 412  ? 96.667  81.484  15.227  1.00 7.37  ? 412  LYS A CB    1 
ATOM   3202  C  CG    . LYS A 1 412  ? 97.757  82.558  15.279  1.00 7.91  ? 412  LYS A CG    1 
ATOM   3203  C  CD    . LYS A 1 412  ? 97.489  83.548  16.427  1.00 12.18 ? 412  LYS A CD    1 
ATOM   3204  C  CE    . LYS A 1 412  ? 97.704  82.904  17.815  1.00 13.35 ? 412  LYS A CE    1 
ATOM   3205  N  NZ    . LYS A 1 412  ? 97.083  83.679  18.945  1.00 12.92 ? 412  LYS A NZ    1 
ATOM   3206  N  N     . TYR A 1 413  ? 94.648  79.206  13.903  1.00 5.90  ? 413  TYR A N     1 
ATOM   3207  C  CA    . TYR A 1 413  ? 93.886  77.982  14.163  1.00 5.89  ? 413  TYR A CA    1 
ATOM   3208  C  C     . TYR A 1 413  ? 92.928  77.719  13.004  1.00 5.06  ? 413  TYR A C     1 
ATOM   3209  O  O     . TYR A 1 413  ? 92.569  78.657  12.291  1.00 5.51  ? 413  TYR A O     1 
ATOM   3210  C  CB    . TYR A 1 413  ? 93.107  78.101  15.480  1.00 6.14  ? 413  TYR A CB    1 
ATOM   3211  C  CG    . TYR A 1 413  ? 93.988  78.246  16.709  1.00 8.38  ? 413  TYR A CG    1 
ATOM   3212  C  CD1   . TYR A 1 413  ? 94.368  79.503  17.183  1.00 10.21 ? 413  TYR A CD1   1 
ATOM   3213  C  CD2   . TYR A 1 413  ? 94.436  77.123  17.398  1.00 10.39 ? 413  TYR A CD2   1 
ATOM   3214  C  CE1   . TYR A 1 413  ? 95.184  79.634  18.309  1.00 12.58 ? 413  TYR A CE1   1 
ATOM   3215  C  CE2   . TYR A 1 413  ? 95.245  77.244  18.524  1.00 12.77 ? 413  TYR A CE2   1 
ATOM   3216  C  CZ    . TYR A 1 413  ? 95.616  78.489  18.969  1.00 13.79 ? 413  TYR A CZ    1 
ATOM   3217  O  OH    . TYR A 1 413  ? 96.422  78.591  20.085  1.00 17.21 ? 413  TYR A OH    1 
ATOM   3218  N  N     . PRO A 1 414  ? 92.529  76.461  12.798  1.00 4.52  ? 414  PRO A N     1 
ATOM   3219  C  CA    . PRO A 1 414  ? 91.565  76.124  11.747  1.00 3.99  ? 414  PRO A CA    1 
ATOM   3220  C  C     . PRO A 1 414  ? 90.125  76.352  12.217  1.00 3.53  ? 414  PRO A C     1 
ATOM   3221  O  O     . PRO A 1 414  ? 89.304  75.439  12.277  1.00 2.62  ? 414  PRO A O     1 
ATOM   3222  C  CB    . PRO A 1 414  ? 91.855  74.640  11.475  1.00 3.82  ? 414  PRO A CB    1 
ATOM   3223  C  CG    . PRO A 1 414  ? 92.319  74.095  12.830  1.00 4.79  ? 414  PRO A CG    1 
ATOM   3224  C  CD    . PRO A 1 414  ? 93.004  75.253  13.510  1.00 4.17  ? 414  PRO A CD    1 
ATOM   3225  N  N     . TYR A 1 415  ? 89.839  77.600  12.566  1.00 3.16  ? 415  TYR A N     1 
ATOM   3226  C  CA    . TYR A 1 415  ? 88.535  77.988  13.096  1.00 3.26  ? 415  TYR A CA    1 
ATOM   3227  C  C     . TYR A 1 415  ? 87.331  77.454  12.300  1.00 2.89  ? 415  TYR A C     1 
ATOM   3228  O  O     . TYR A 1 415  ? 86.395  76.892  12.886  1.00 2.95  ? 415  TYR A O     1 
ATOM   3229  C  CB    . TYR A 1 415  ? 88.467  79.507  13.199  1.00 3.00  ? 415  TYR A CB    1 
ATOM   3230  C  CG    . TYR A 1 415  ? 89.378  80.108  14.260  1.00 3.63  ? 415  TYR A CG    1 
ATOM   3231  C  CD1   . TYR A 1 415  ? 90.433  80.956  13.903  1.00 3.23  ? 415  TYR A CD1   1 
ATOM   3232  C  CD2   . TYR A 1 415  ? 89.170  79.844  15.618  1.00 3.26  ? 415  TYR A CD2   1 
ATOM   3233  C  CE1   . TYR A 1 415  ? 91.265  81.524  14.872  1.00 3.67  ? 415  TYR A CE1   1 
ATOM   3234  C  CE2   . TYR A 1 415  ? 89.999  80.404  16.604  1.00 3.49  ? 415  TYR A CE2   1 
ATOM   3235  C  CZ    . TYR A 1 415  ? 91.037  81.249  16.226  1.00 4.49  ? 415  TYR A CZ    1 
ATOM   3236  O  OH    . TYR A 1 415  ? 91.848  81.816  17.197  1.00 3.56  ? 415  TYR A OH    1 
ATOM   3237  N  N     . GLY A 1 416  ? 87.371  77.609  10.975  1.00 2.84  ? 416  GLY A N     1 
ATOM   3238  C  CA    . GLY A 1 416  ? 86.286  77.200  10.103  1.00 2.69  ? 416  GLY A CA    1 
ATOM   3239  C  C     . GLY A 1 416  ? 86.053  75.699  10.052  1.00 3.32  ? 416  GLY A C     1 
ATOM   3240  O  O     . GLY A 1 416  ? 84.910  75.251  10.064  1.00 2.67  ? 416  GLY A O     1 
ATOM   3241  N  N     . GLU A 1 417  ? 87.134  74.921  9.996   1.00 4.17  ? 417  GLU A N     1 
ATOM   3242  C  CA    . GLU A 1 417  ? 87.042  73.460  10.096  1.00 4.96  ? 417  GLU A CA    1 
ATOM   3243  C  C     . GLU A 1 417  ? 86.340  73.060  11.397  1.00 4.70  ? 417  GLU A C     1 
ATOM   3244  O  O     . GLU A 1 417  ? 85.476  72.191  11.402  1.00 4.75  ? 417  GLU A O     1 
ATOM   3245  C  CB    . GLU A 1 417  ? 88.438  72.828  10.087  1.00 5.87  ? 417  GLU A CB    1 
ATOM   3246  C  CG    . GLU A 1 417  ? 88.907  72.277  8.753   1.00 9.06  ? 417  GLU A CG    1 
ATOM   3247  C  CD    . GLU A 1 417  ? 90.407  72.004  8.748   1.00 14.76 ? 417  GLU A CD    1 
ATOM   3248  O  OE1   . GLU A 1 417  ? 90.829  70.956  9.301   1.00 15.23 ? 417  GLU A OE1   1 
ATOM   3249  O  OE2   . GLU A 1 417  ? 91.170  72.843  8.201   1.00 16.23 ? 417  GLU A OE2   1 
ATOM   3250  N  N     . TRP A 1 418  ? 86.716  73.710  12.494  1.00 4.49  ? 418  TRP A N     1 
ATOM   3251  C  CA    . TRP A 1 418  ? 86.120  73.440  13.798  1.00 4.74  ? 418  TRP A CA    1 
ATOM   3252  C  C     . TRP A 1 418  ? 84.610  73.658  13.769  1.00 4.93  ? 418  TRP A C     1 
ATOM   3253  O  O     . TRP A 1 418  ? 83.850  72.825  14.249  1.00 4.75  ? 418  TRP A O     1 
ATOM   3254  C  CB    . TRP A 1 418  ? 86.734  74.353  14.857  1.00 4.93  ? 418  TRP A CB    1 
ATOM   3255  C  CG    . TRP A 1 418  ? 88.130  74.018  15.245  1.00 3.78  ? 418  TRP A CG    1 
ATOM   3256  C  CD1   . TRP A 1 418  ? 88.871  72.923  14.866  1.00 4.99  ? 418  TRP A CD1   1 
ATOM   3257  C  CD2   . TRP A 1 418  ? 88.963  74.789  16.098  1.00 4.47  ? 418  TRP A CD2   1 
ATOM   3258  N  NE1   . TRP A 1 418  ? 90.118  72.976  15.445  1.00 5.18  ? 418  TRP A NE1   1 
ATOM   3259  C  CE2   . TRP A 1 418  ? 90.202  74.111  16.209  1.00 5.17  ? 418  TRP A CE2   1 
ATOM   3260  C  CE3   . TRP A 1 418  ? 88.790  75.989  16.799  1.00 2.23  ? 418  TRP A CE3   1 
ATOM   3261  C  CZ2   . TRP A 1 418  ? 91.259  74.602  16.979  1.00 6.09  ? 418  TRP A CZ2   1 
ATOM   3262  C  CZ3   . TRP A 1 418  ? 89.838  76.468  17.572  1.00 5.86  ? 418  TRP A CZ3   1 
ATOM   3263  C  CH2   . TRP A 1 418  ? 91.055  75.776  17.655  1.00 5.03  ? 418  TRP A CH2   1 
ATOM   3264  N  N     . ILE A 1 419  ? 84.194  74.788  13.199  1.00 5.52  ? 419  ILE A N     1 
ATOM   3265  C  CA    . ILE A 1 419  ? 82.782  75.141  13.098  1.00 5.89  ? 419  ILE A CA    1 
ATOM   3266  C  C     . ILE A 1 419  ? 82.042  74.106  12.255  1.00 6.40  ? 419  ILE A C     1 
ATOM   3267  O  O     . ILE A 1 419  ? 80.968  73.637  12.644  1.00 6.10  ? 419  ILE A O     1 
ATOM   3268  C  CB    . ILE A 1 419  ? 82.609  76.583  12.530  1.00 5.98  ? 419  ILE A CB    1 
ATOM   3269  C  CG1   . ILE A 1 419  ? 83.109  77.622  13.545  1.00 5.85  ? 419  ILE A CG1   1 
ATOM   3270  C  CG2   . ILE A 1 419  ? 81.155  76.857  12.187  1.00 6.11  ? 419  ILE A CG2   1 
ATOM   3271  C  CD1   . ILE A 1 419  ? 83.468  78.961  12.934  1.00 4.59  ? 419  ILE A CD1   1 
ATOM   3272  N  N     . LYS A 1 420  ? 82.632  73.722  11.122  1.00 7.14  ? 420  LYS A N     1 
ATOM   3273  C  CA    . LYS A 1 420  ? 82.012  72.746  10.222  1.00 7.89  ? 420  LYS A CA    1 
ATOM   3274  C  C     . LYS A 1 420  ? 81.669  71.450  10.951  1.00 7.75  ? 420  LYS A C     1 
ATOM   3275  O  O     . LYS A 1 420  ? 80.573  70.906  10.787  1.00 8.04  ? 420  LYS A O     1 
ATOM   3276  C  CB    . LYS A 1 420  ? 82.913  72.429  9.017   1.00 8.47  ? 420  LYS A CB    1 
ATOM   3277  C  CG    . LYS A 1 420  ? 83.091  73.583  8.054   1.00 11.17 ? 420  LYS A CG    1 
ATOM   3278  C  CD    . LYS A 1 420  ? 83.364  73.118  6.624   1.00 15.45 ? 420  LYS A CD    1 
ATOM   3279  C  CE    . LYS A 1 420  ? 83.842  74.318  5.774   1.00 17.93 ? 420  LYS A CE    1 
ATOM   3280  N  NZ    . LYS A 1 420  ? 85.264  74.143  5.306   1.00 20.22 ? 420  LYS A NZ    1 
ATOM   3281  N  N     . ILE A 1 421  ? 82.602  70.959  11.754  1.00 7.38  ? 421  ILE A N     1 
ATOM   3282  C  CA    . ILE A 1 421  ? 82.405  69.679  12.424  1.00 7.14  ? 421  ILE A CA    1 
ATOM   3283  C  C     . ILE A 1 421  ? 81.534  69.790  13.694  1.00 6.59  ? 421  ILE A C     1 
ATOM   3284  O  O     . ILE A 1 421  ? 80.675  68.935  13.947  1.00 6.06  ? 421  ILE A O     1 
ATOM   3285  C  CB    . ILE A 1 421  ? 83.774  68.941  12.673  1.00 7.42  ? 421  ILE A CB    1 
ATOM   3286  C  CG1   . ILE A 1 421  ? 83.591  67.719  13.570  1.00 7.80  ? 421  ILE A CG1   1 
ATOM   3287  C  CG2   . ILE A 1 421  ? 84.815  69.856  13.280  1.00 8.92  ? 421  ILE A CG2   1 
ATOM   3288  C  CD1   . ILE A 1 421  ? 84.317  66.495  13.077  1.00 12.11 ? 421  ILE A CD1   1 
ATOM   3289  N  N     . GLN A 1 422  ? 81.723  70.864  14.457  1.00 5.85  ? 422  GLN A N     1 
ATOM   3290  C  CA    . GLN A 1 422  ? 81.152  70.952  15.802  1.00 5.85  ? 422  GLN A CA    1 
ATOM   3291  C  C     . GLN A 1 422  ? 79.804  71.666  15.921  1.00 5.81  ? 422  GLN A C     1 
ATOM   3292  O  O     . GLN A 1 422  ? 79.009  71.315  16.791  1.00 5.86  ? 422  GLN A O     1 
ATOM   3293  C  CB    . GLN A 1 422  ? 82.154  71.582  16.774  1.00 5.79  ? 422  GLN A CB    1 
ATOM   3294  C  CG    . GLN A 1 422  ? 83.458  70.810  16.903  1.00 6.53  ? 422  GLN A CG    1 
ATOM   3295  C  CD    . GLN A 1 422  ? 83.339  69.594  17.786  1.00 7.46  ? 422  GLN A CD    1 
ATOM   3296  O  OE1   . GLN A 1 422  ? 82.421  69.494  18.601  1.00 8.62  ? 422  GLN A OE1   1 
ATOM   3297  N  NE2   . GLN A 1 422  ? 84.268  68.659  17.629  1.00 8.08  ? 422  GLN A NE2   1 
ATOM   3298  N  N     . ARG A 1 423  ? 79.565  72.669  15.073  1.00 5.13  ? 423  ARG A N     1 
ATOM   3299  C  CA    . ARG A 1 423  ? 78.365  73.506  15.177  1.00 5.21  ? 423  ARG A CA    1 
ATOM   3300  C  C     . ARG A 1 423  ? 77.112  72.919  14.522  1.00 5.15  ? 423  ARG A C     1 
ATOM   3301  O  O     . ARG A 1 423  ? 77.176  72.400  13.401  1.00 5.21  ? 423  ARG A O     1 
ATOM   3302  C  CB    . ARG A 1 423  ? 78.621  74.891  14.588  1.00 5.11  ? 423  ARG A CB    1 
ATOM   3303  C  CG    . ARG A 1 423  ? 77.387  75.783  14.630  1.00 5.26  ? 423  ARG A CG    1 
ATOM   3304  C  CD    . ARG A 1 423  ? 77.567  77.130  13.967  1.00 6.47  ? 423  ARG A CD    1 
ATOM   3305  N  NE    . ARG A 1 423  ? 78.511  77.954  14.707  1.00 7.82  ? 423  ARG A NE    1 
ATOM   3306  C  CZ    . ARG A 1 423  ? 78.965  79.129  14.282  1.00 9.22  ? 423  ARG A CZ    1 
ATOM   3307  N  NH1   . ARG A 1 423  ? 78.549  79.628  13.114  1.00 8.09  ? 423  ARG A NH1   1 
ATOM   3308  N  NH2   . ARG A 1 423  ? 79.825  79.810  15.029  1.00 8.02  ? 423  ARG A NH2   1 
ATOM   3309  N  N     . GLN A 1 424  ? 75.986  73.015  15.235  1.00 5.33  ? 424  GLN A N     1 
ATOM   3310  C  CA    . GLN A 1 424  ? 74.659  72.677  14.698  1.00 5.14  ? 424  GLN A CA    1 
ATOM   3311  C  C     . GLN A 1 424  ? 73.849  73.946  14.560  1.00 5.30  ? 424  GLN A C     1 
ATOM   3312  O  O     . GLN A 1 424  ? 73.771  74.736  15.490  1.00 5.47  ? 424  GLN A O     1 
ATOM   3313  C  CB    . GLN A 1 424  ? 73.911  71.700  15.620  1.00 4.74  ? 424  GLN A CB    1 
ATOM   3314  C  CG    . GLN A 1 424  ? 72.433  71.472  15.238  1.00 4.86  ? 424  GLN A CG    1 
ATOM   3315  C  CD    . GLN A 1 424  ? 71.738  70.344  16.031  1.00 7.85  ? 424  GLN A CD    1 
ATOM   3316  O  OE1   . GLN A 1 424  ? 72.113  70.037  17.172  1.00 6.30  ? 424  GLN A OE1   1 
ATOM   3317  N  NE2   . GLN A 1 424  ? 70.717  69.737  15.420  1.00 6.57  ? 424  GLN A NE2   1 
ATOM   3318  N  N     . THR A 1 425  ? 73.243  74.147  13.402  1.00 5.62  ? 425  THR A N     1 
ATOM   3319  C  CA    . THR A 1 425  ? 72.355  75.286  13.209  1.00 6.02  ? 425  THR A CA    1 
ATOM   3320  C  C     . THR A 1 425  ? 70.891  74.830  13.185  1.00 5.91  ? 425  THR A C     1 
ATOM   3321  O  O     . THR A 1 425  ? 70.550  73.862  12.503  1.00 5.48  ? 425  THR A O     1 
ATOM   3322  C  CB    . THR A 1 425  ? 72.729  76.010  11.920  1.00 6.37  ? 425  THR A CB    1 
ATOM   3323  O  OG1   . THR A 1 425  ? 74.051  76.547  12.062  1.00 9.05  ? 425  THR A OG1   1 
ATOM   3324  C  CG2   . THR A 1 425  ? 71.874  77.261  11.741  1.00 7.14  ? 425  THR A CG2   1 
ATOM   3325  N  N     . VAL A 1 426  ? 70.047  75.510  13.957  1.00 5.66  ? 426  VAL A N     1 
ATOM   3326  C  CA    . VAL A 1 426  ? 68.609  75.257  13.934  1.00 6.09  ? 426  VAL A CA    1 
ATOM   3327  C  C     . VAL A 1 426  ? 67.874  76.476  13.365  1.00 6.04  ? 426  VAL A C     1 
ATOM   3328  O  O     . VAL A 1 426  ? 67.960  77.564  13.912  1.00 5.64  ? 426  VAL A O     1 
ATOM   3329  C  CB    . VAL A 1 426  ? 68.064  74.845  15.336  1.00 5.77  ? 426  VAL A CB    1 
ATOM   3330  C  CG1   . VAL A 1 426  ? 66.534  74.859  15.370  1.00 5.82  ? 426  VAL A CG1   1 
ATOM   3331  C  CG2   . VAL A 1 426  ? 68.561  73.441  15.702  1.00 6.37  ? 426  VAL A CG2   1 
ATOM   3332  N  N     . ALA A 1 427  ? 67.170  76.277  12.250  1.00 6.57  ? 427  ALA A N     1 
ATOM   3333  C  CA    . ALA A 1 427  ? 66.331  77.317  11.660  1.00 7.25  ? 427  ALA A CA    1 
ATOM   3334  C  C     . ALA A 1 427  ? 65.255  76.664  10.808  1.00 7.82  ? 427  ALA A C     1 
ATOM   3335  O  O     . ALA A 1 427  ? 65.490  75.621  10.191  1.00 8.10  ? 427  ALA A O     1 
ATOM   3336  C  CB    . ALA A 1 427  ? 67.171  78.297  10.817  1.00 7.10  ? 427  ALA A CB    1 
ATOM   3337  N  N     . SER A 1 428  ? 64.072  77.267  10.775  1.00 8.22  ? 428  SER A N     1 
ATOM   3338  C  CA    . SER A 1 428  ? 62.990  76.737  9.945   1.00 8.91  ? 428  SER A CA    1 
ATOM   3339  C  C     . SER A 1 428  ? 62.172  77.855  9.333   1.00 10.02 ? 428  SER A C     1 
ATOM   3340  O  O     . SER A 1 428  ? 61.675  78.751  10.037  1.00 9.76  ? 428  SER A O     1 
ATOM   3341  C  CB    . SER A 1 428  ? 62.065  75.817  10.745  1.00 8.78  ? 428  SER A CB    1 
ATOM   3342  O  OG    . SER A 1 428  ? 60.906  75.476  9.986   1.00 8.10  ? 428  SER A OG    1 
ATOM   3343  N  N     . ASP A 1 429  ? 62.021  77.795  8.016   1.00 11.17 ? 429  ASP A N     1 
ATOM   3344  C  CA    . ASP A 1 429  ? 61.183  78.760  7.329   1.00 12.59 ? 429  ASP A CA    1 
ATOM   3345  C  C     . ASP A 1 429  ? 59.706  78.416  7.518   1.00 12.76 ? 429  ASP A C     1 
ATOM   3346  O  O     . ASP A 1 429  ? 58.850  79.297  7.487   1.00 13.57 ? 429  ASP A O     1 
ATOM   3347  C  CB    . ASP A 1 429  ? 61.582  78.866  5.851   1.00 12.88 ? 429  ASP A CB    1 
ATOM   3348  C  CG    . ASP A 1 429  ? 62.812  79.772  5.641   1.00 14.83 ? 429  ASP A CG    1 
ATOM   3349  O  OD1   . ASP A 1 429  ? 63.192  80.516  6.577   1.00 15.50 ? 429  ASP A OD1   1 
ATOM   3350  O  OD2   . ASP A 1 429  ? 63.473  79.801  4.582   1.00 16.73 ? 429  ASP A OD2   1 
ATOM   3351  N  N     . SER A 1 430  ? 59.414  77.139  7.749   1.00 12.37 ? 430  SER A N     1 
ATOM   3352  C  CA    . SER A 1 430  ? 58.038  76.721  7.963   1.00 12.10 ? 430  SER A CA    1 
ATOM   3353  C  C     . SER A 1 430  ? 57.654  76.804  9.424   1.00 11.41 ? 430  SER A C     1 
ATOM   3354  O  O     . SER A 1 430  ? 58.491  76.619  10.314  1.00 11.17 ? 430  SER A O     1 
ATOM   3355  C  CB    . SER A 1 430  ? 57.784  75.311  7.427   1.00 12.33 ? 430  SER A CB    1 
ATOM   3356  O  OG    . SER A 1 430  ? 58.977  74.715  6.955   1.00 14.43 ? 430  SER A OG    1 
ATOM   3357  N  N     . PHE A 1 431  ? 56.381  77.114  9.657   1.00 10.57 ? 431  PHE A N     1 
ATOM   3358  C  CA    . PHE A 1 431  ? 55.796  77.072  10.987  1.00 10.24 ? 431  PHE A CA    1 
ATOM   3359  C  C     . PHE A 1 431  ? 54.921  75.823  11.070  1.00 10.56 ? 431  PHE A C     1 
ATOM   3360  O  O     . PHE A 1 431  ? 54.676  75.163  10.056  1.00 10.38 ? 431  PHE A O     1 
ATOM   3361  C  CB    . PHE A 1 431  ? 54.950  78.320  11.247  1.00 9.86  ? 431  PHE A CB    1 
ATOM   3362  C  CG    . PHE A 1 431  ? 55.747  79.597  11.373  1.00 8.97  ? 431  PHE A CG    1 
ATOM   3363  C  CD1   . PHE A 1 431  ? 56.256  80.239  10.245  1.00 7.65  ? 431  PHE A CD1   1 
ATOM   3364  C  CD2   . PHE A 1 431  ? 55.955  80.175  12.615  1.00 7.91  ? 431  PHE A CD2   1 
ATOM   3365  C  CE1   . PHE A 1 431  ? 56.973  81.434  10.362  1.00 8.56  ? 431  PHE A CE1   1 
ATOM   3366  C  CE2   . PHE A 1 431  ? 56.662  81.370  12.739  1.00 7.99  ? 431  PHE A CE2   1 
ATOM   3367  C  CZ    . PHE A 1 431  ? 57.186  81.990  11.614  1.00 7.87  ? 431  PHE A CZ    1 
ATOM   3368  N  N     . ALA A 1 432  ? 54.462  75.494  12.272  1.00 11.18 ? 432  ALA A N     1 
ATOM   3369  C  CA    . ALA A 1 432  ? 53.381  74.529  12.424  1.00 12.34 ? 432  ALA A CA    1 
ATOM   3370  C  C     . ALA A 1 432  ? 52.065  75.276  12.198  1.00 12.89 ? 432  ALA A C     1 
ATOM   3371  O  O     . ALA A 1 432  ? 51.834  76.366  12.771  1.00 13.10 ? 432  ALA A O     1 
ATOM   3372  C  CB    . ALA A 1 432  ? 53.421  73.873  13.810  1.00 12.23 ? 432  ALA A CB    1 
ATOM   3373  N  N     . GLU A 1 433  ? 51.226  74.711  11.341  1.00 13.51 ? 433  GLU A N     1 
ATOM   3374  C  CA    . GLU A 1 433  ? 49.926  75.299  11.017  1.00 14.48 ? 433  GLU A CA    1 
ATOM   3375  C  C     . GLU A 1 433  ? 48.780  74.702  11.840  1.00 14.50 ? 433  GLU A C     1 
ATOM   3376  O  O     . GLU A 1 433  ? 47.765  75.374  12.067  1.00 14.55 ? 433  GLU A O     1 
ATOM   3377  C  CB    . GLU A 1 433  ? 49.618  75.147  9.523   1.00 15.22 ? 433  GLU A CB    1 
ATOM   3378  C  CG    . GLU A 1 433  ? 50.205  76.244  8.646   1.00 16.36 ? 433  GLU A CG    1 
ATOM   3379  C  CD    . GLU A 1 433  ? 50.106  75.908  7.170   1.00 19.00 ? 433  GLU A CD    1 
ATOM   3380  O  OE1   . GLU A 1 433  ? 48.970  75.844  6.633   1.00 20.53 ? 433  GLU A OE1   1 
ATOM   3381  O  OE2   . GLU A 1 433  ? 51.171  75.695  6.549   1.00 20.05 ? 433  GLU A OE2   1 
ATOM   3382  N  N     . LYS A 1 434  ? 48.934  73.443  12.264  1.00 14.35 ? 434  LYS A N     1 
ATOM   3383  C  CA    . LYS A 1 434  ? 47.949  72.801  13.134  1.00 14.17 ? 434  LYS A CA    1 
ATOM   3384  C  C     . LYS A 1 434  ? 47.853  73.551  14.459  1.00 13.74 ? 434  LYS A C     1 
ATOM   3385  O  O     . LYS A 1 434  ? 48.873  73.936  15.049  1.00 13.62 ? 434  LYS A O     1 
ATOM   3386  C  CB    . LYS A 1 434  ? 48.296  71.330  13.374  1.00 14.26 ? 434  LYS A CB    1 
ATOM   3387  C  CG    . LYS A 1 434  ? 47.636  70.387  12.400  1.00 15.56 ? 434  LYS A CG    1 
ATOM   3388  C  CD    . LYS A 1 434  ? 47.819  68.927  12.812  1.00 17.08 ? 434  LYS A CD    1 
ATOM   3389  C  CE    . LYS A 1 434  ? 47.619  67.994  11.624  1.00 18.28 ? 434  LYS A CE    1 
ATOM   3390  N  NZ    . LYS A 1 434  ? 48.841  67.173  11.366  1.00 19.17 ? 434  LYS A NZ    1 
ATOM   3391  N  N     . THR A 1 435  ? 46.628  73.781  14.917  1.00 13.15 ? 435  THR A N     1 
ATOM   3392  C  CA    . THR A 1 435  ? 46.417  74.517  16.159  1.00 13.04 ? 435  THR A CA    1 
ATOM   3393  C  C     . THR A 1 435  ? 46.820  73.678  17.360  1.00 13.24 ? 435  THR A C     1 
ATOM   3394  O  O     . THR A 1 435  ? 46.648  72.459  17.357  1.00 13.10 ? 435  THR A O     1 
ATOM   3395  C  CB    . THR A 1 435  ? 44.948  74.912  16.313  1.00 12.87 ? 435  THR A CB    1 
ATOM   3396  O  OG1   . THR A 1 435  ? 44.127  73.750  16.129  1.00 12.23 ? 435  THR A OG1   1 
ATOM   3397  C  CG2   . THR A 1 435  ? 44.522  75.853  15.200  1.00 11.92 ? 435  THR A CG2   1 
ATOM   3398  N  N     . LEU A 1 436  ? 47.355  74.343  18.379  1.00 13.53 ? 436  LEU A N     1 
ATOM   3399  C  CA    . LEU A 1 436  ? 47.599  73.721  19.674  1.00 14.27 ? 436  LEU A CA    1 
ATOM   3400  C  C     . LEU A 1 436  ? 46.299  73.209  20.312  1.00 14.56 ? 436  LEU A C     1 
ATOM   3401  O  O     . LEU A 1 436  ? 46.251  72.093  20.827  1.00 14.86 ? 436  LEU A O     1 
ATOM   3402  C  CB    . LEU A 1 436  ? 48.283  74.723  20.609  1.00 14.40 ? 436  LEU A CB    1 
ATOM   3403  C  CG    . LEU A 1 436  ? 49.792  74.925  20.471  1.00 14.63 ? 436  LEU A CG    1 
ATOM   3404  C  CD1   . LEU A 1 436  ? 50.247  75.931  21.496  1.00 14.78 ? 436  LEU A CD1   1 
ATOM   3405  C  CD2   . LEU A 1 436  ? 50.563  73.613  20.623  1.00 16.34 ? 436  LEU A CD2   1 
ATOM   3406  N  N     . PHE A 1 437  ? 45.250  74.032  20.267  1.00 15.14 ? 437  PHE A N     1 
ATOM   3407  C  CA    . PHE A 1 437  ? 43.969  73.705  20.902  1.00 15.37 ? 437  PHE A CA    1 
ATOM   3408  C  C     . PHE A 1 437  ? 42.843  73.605  19.884  1.00 15.98 ? 437  PHE A C     1 
ATOM   3409  O  O     . PHE A 1 437  ? 42.945  74.129  18.768  1.00 16.08 ? 437  PHE A O     1 
ATOM   3410  C  CB    . PHE A 1 437  ? 43.605  74.731  21.992  1.00 15.14 ? 437  PHE A CB    1 
ATOM   3411  C  CG    . PHE A 1 437  ? 44.797  75.304  22.724  1.00 14.87 ? 437  PHE A CG    1 
ATOM   3412  C  CD1   . PHE A 1 437  ? 45.219  76.603  22.478  1.00 13.96 ? 437  PHE A CD1   1 
ATOM   3413  C  CD2   . PHE A 1 437  ? 45.493  74.545  23.653  1.00 14.42 ? 437  PHE A CD2   1 
ATOM   3414  C  CE1   . PHE A 1 437  ? 46.321  77.140  23.151  1.00 15.11 ? 437  PHE A CE1   1 
ATOM   3415  C  CE2   . PHE A 1 437  ? 46.596  75.073  24.324  1.00 14.71 ? 437  PHE A CE2   1 
ATOM   3416  C  CZ    . PHE A 1 437  ? 47.010  76.368  24.075  1.00 14.75 ? 437  PHE A CZ    1 
ATOM   3417  N  N     . ASN A 1 438  ? 41.762  72.942  20.281  1.00 16.65 ? 438  ASN A N     1 
ATOM   3418  C  CA    . ASN A 1 438  ? 40.626  72.747  19.393  1.00 17.47 ? 438  ASN A CA    1 
ATOM   3419  C  C     . ASN A 1 438  ? 39.420  73.611  19.756  1.00 17.86 ? 438  ASN A C     1 
ATOM   3420  O  O     . ASN A 1 438  ? 38.645  74.007  18.877  1.00 18.35 ? 438  ASN A O     1 
ATOM   3421  C  CB    . ASN A 1 438  ? 40.262  71.262  19.307  1.00 17.61 ? 438  ASN A CB    1 
ATOM   3422  C  CG    . ASN A 1 438  ? 41.419  70.411  18.786  1.00 18.70 ? 438  ASN A CG    1 
ATOM   3423  O  OD1   . ASN A 1 438  ? 42.191  70.852  17.921  1.00 19.42 ? 438  ASN A OD1   1 
ATOM   3424  N  ND2   . ASN A 1 438  ? 41.552  69.196  19.317  1.00 18.26 ? 438  ASN A ND2   1 
ATOM   3425  N  N     . ASP A 1 439  ? 39.257  73.887  21.047  1.00 17.79 ? 439  ASP A N     1 
ATOM   3426  C  CA    . ASP A 1 439  ? 38.194  74.774  21.488  1.00 17.66 ? 439  ASP A CA    1 
ATOM   3427  C  C     . ASP A 1 439  ? 38.750  76.186  21.526  1.00 17.34 ? 439  ASP A C     1 
ATOM   3428  O  O     . ASP A 1 439  ? 39.790  76.440  22.141  1.00 17.01 ? 439  ASP A O     1 
ATOM   3429  C  CB    . ASP A 1 439  ? 37.650  74.372  22.864  1.00 17.95 ? 439  ASP A CB    1 
ATOM   3430  C  CG    . ASP A 1 439  ? 37.647  72.868  23.079  1.00 19.27 ? 439  ASP A CG    1 
ATOM   3431  O  OD1   . ASP A 1 439  ? 36.657  72.202  22.693  1.00 19.96 ? 439  ASP A OD1   1 
ATOM   3432  O  OD2   . ASP A 1 439  ? 38.593  72.264  23.639  1.00 21.42 ? 439  ASP A OD2   1 
ATOM   3433  N  N     . ALA A 1 440  ? 38.063  77.107  20.856  1.00 16.82 ? 440  ALA A N     1 
ATOM   3434  C  CA    . ALA A 1 440  ? 38.399  78.520  20.990  1.00 15.97 ? 440  ALA A CA    1 
ATOM   3435  C  C     . ALA A 1 440  ? 38.121  78.977  22.429  1.00 15.14 ? 440  ALA A C     1 
ATOM   3436  O  O     . ALA A 1 440  ? 38.622  80.008  22.859  1.00 14.99 ? 440  ALA A O     1 
ATOM   3437  C  CB    . ALA A 1 440  ? 37.621  79.364  19.978  1.00 16.38 ? 440  ALA A CB    1 
ATOM   3438  N  N     . GLN A 1 441  ? 37.327  78.196  23.165  1.00 14.02 ? 441  GLN A N     1 
ATOM   3439  C  CA    . GLN A 1 441  ? 37.091  78.444  24.588  1.00 13.38 ? 441  GLN A CA    1 
ATOM   3440  C  C     . GLN A 1 441  ? 38.389  78.244  25.397  1.00 12.66 ? 441  GLN A C     1 
ATOM   3441  O  O     . GLN A 1 441  ? 38.675  79.011  26.320  1.00 12.54 ? 441  GLN A O     1 
ATOM   3442  C  CB    . GLN A 1 441  ? 35.924  77.581  25.098  1.00 13.64 ? 441  GLN A CB    1 
ATOM   3443  C  CG    . GLN A 1 441  ? 36.022  77.031  26.536  1.00 14.68 ? 441  GLN A CG    1 
ATOM   3444  C  CD    . GLN A 1 441  ? 34.654  76.890  27.208  1.00 16.67 ? 441  GLN A CD    1 
ATOM   3445  O  OE1   . GLN A 1 441  ? 33.894  75.938  26.931  1.00 17.47 ? 441  GLN A OE1   1 
ATOM   3446  N  NE2   . GLN A 1 441  ? 34.329  77.841  28.083  1.00 17.37 ? 441  GLN A NE2   1 
ATOM   3447  N  N     . THR A 1 442  ? 39.168  77.227  25.026  1.00 11.30 ? 442  THR A N     1 
ATOM   3448  C  CA    . THR A 1 442  ? 40.459  76.953  25.650  1.00 9.73  ? 442  THR A CA    1 
ATOM   3449  C  C     . THR A 1 442  ? 41.432  78.091  25.359  1.00 9.19  ? 442  THR A C     1 
ATOM   3450  O  O     . THR A 1 442  ? 42.067  78.622  26.273  1.00 8.47  ? 442  THR A O     1 
ATOM   3451  C  CB    . THR A 1 442  ? 41.032  75.605  25.144  1.00 9.66  ? 442  THR A CB    1 
ATOM   3452  O  OG1   . THR A 1 442  ? 40.259  74.517  25.671  1.00 9.38  ? 442  THR A OG1   1 
ATOM   3453  C  CG2   . THR A 1 442  ? 42.431  75.368  25.705  1.00 8.36  ? 442  THR A CG2   1 
ATOM   3454  N  N     . VAL A 1 443  ? 41.531  78.473  24.091  1.00 8.77  ? 443  VAL A N     1 
ATOM   3455  C  CA    . VAL A 1 443  ? 42.416  79.569  23.683  1.00 8.75  ? 443  VAL A CA    1 
ATOM   3456  C  C     . VAL A 1 443  ? 42.119  80.845  24.473  1.00 8.14  ? 443  VAL A C     1 
ATOM   3457  O  O     . VAL A 1 443  ? 43.032  81.454  25.034  1.00 7.97  ? 443  VAL A O     1 
ATOM   3458  C  CB    . VAL A 1 443  ? 42.318  79.865  22.163  1.00 9.42  ? 443  VAL A CB    1 
ATOM   3459  C  CG1   . VAL A 1 443  ? 43.350  80.918  21.750  1.00 9.54  ? 443  VAL A CG1   1 
ATOM   3460  C  CG2   . VAL A 1 443  ? 42.515  78.585  21.343  1.00 9.97  ? 443  VAL A CG2   1 
ATOM   3461  N  N     . LEU A 1 444  ? 40.846  81.231  24.527  1.00 7.18  ? 444  LEU A N     1 
ATOM   3462  C  CA    . LEU A 1 444  ? 40.431  82.432  25.254  1.00 7.03  ? 444  LEU A CA    1 
ATOM   3463  C  C     . LEU A 1 444  ? 40.744  82.381  26.748  1.00 6.15  ? 444  LEU A C     1 
ATOM   3464  O  O     . LEU A 1 444  ? 41.162  83.383  27.327  1.00 5.53  ? 444  LEU A O     1 
ATOM   3465  C  CB    . LEU A 1 444  ? 38.932  82.684  25.063  1.00 7.21  ? 444  LEU A CB    1 
ATOM   3466  C  CG    . LEU A 1 444  ? 38.455  83.669  23.994  1.00 9.90  ? 444  LEU A CG    1 
ATOM   3467  C  CD1   . LEU A 1 444  ? 38.909  85.104  24.280  1.00 9.51  ? 444  LEU A CD1   1 
ATOM   3468  C  CD2   . LEU A 1 444  ? 38.879  83.234  22.580  1.00 12.94 ? 444  LEU A CD2   1 
ATOM   3469  N  N     . GLN A 1 445  ? 40.513  81.221  27.365  1.00 5.34  ? 445  GLN A N     1 
ATOM   3470  C  CA    . GLN A 1 445  ? 40.773  81.047  28.792  1.00 4.54  ? 445  GLN A CA    1 
ATOM   3471  C  C     . GLN A 1 445  ? 42.262  81.105  29.102  1.00 4.07  ? 445  GLN A C     1 
ATOM   3472  O  O     . GLN A 1 445  ? 42.658  81.698  30.100  1.00 3.34  ? 445  GLN A O     1 
ATOM   3473  C  CB    . GLN A 1 445  ? 40.170  79.738  29.322  1.00 4.47  ? 445  GLN A CB    1 
ATOM   3474  C  CG    . GLN A 1 445  ? 40.070  79.678  30.853  1.00 4.84  ? 445  GLN A CG    1 
ATOM   3475  C  CD    . GLN A 1 445  ? 39.298  78.458  31.357  1.00 5.19  ? 445  GLN A CD    1 
ATOM   3476  O  OE1   . GLN A 1 445  ? 39.572  77.335  30.939  1.00 5.40  ? 445  GLN A OE1   1 
ATOM   3477  N  NE2   . GLN A 1 445  ? 38.345  78.678  32.261  1.00 4.27  ? 445  GLN A NE2   1 
ATOM   3478  N  N     . GLN A 1 446  ? 43.080  80.495  28.246  1.00 3.45  ? 446  GLN A N     1 
ATOM   3479  C  CA    . GLN A 1 446  ? 44.526  80.551  28.420  1.00 3.59  ? 446  GLN A CA    1 
ATOM   3480  C  C     . GLN A 1 446  ? 45.026  81.975  28.212  1.00 3.41  ? 446  GLN A C     1 
ATOM   3481  O  O     . GLN A 1 446  ? 45.879  82.454  28.966  1.00 2.95  ? 446  GLN A O     1 
ATOM   3482  C  CB    . GLN A 1 446  ? 45.240  79.555  27.500  1.00 3.67  ? 446  GLN A CB    1 
ATOM   3483  C  CG    . GLN A 1 446  ? 44.929  78.077  27.843  1.00 3.90  ? 446  GLN A CG    1 
ATOM   3484  C  CD    . GLN A 1 446  ? 45.461  77.654  29.205  1.00 3.59  ? 446  GLN A CD    1 
ATOM   3485  O  OE1   . GLN A 1 446  ? 46.653  77.782  29.473  1.00 4.34  ? 446  GLN A OE1   1 
ATOM   3486  N  NE2   . GLN A 1 446  ? 44.577  77.139  30.063  1.00 2.28  ? 446  GLN A NE2   1 
ATOM   3487  N  N     . GLN A 1 447  ? 44.457  82.663  27.219  1.00 3.21  ? 447  GLN A N     1 
ATOM   3488  C  CA    . GLN A 1 447  ? 44.804  84.067  26.969  1.00 3.24  ? 447  GLN A CA    1 
ATOM   3489  C  C     . GLN A 1 447  ? 44.537  84.936  28.206  1.00 3.24  ? 447  GLN A C     1 
ATOM   3490  O  O     . GLN A 1 447  ? 45.407  85.667  28.665  1.00 2.81  ? 447  GLN A O     1 
ATOM   3491  C  CB    . GLN A 1 447  ? 44.041  84.605  25.755  1.00 3.42  ? 447  GLN A CB    1 
ATOM   3492  C  CG    . GLN A 1 447  ? 44.620  84.140  24.414  1.00 3.46  ? 447  GLN A CG    1 
ATOM   3493  C  CD    . GLN A 1 447  ? 43.775  84.544  23.226  1.00 3.77  ? 447  GLN A CD    1 
ATOM   3494  O  OE1   . GLN A 1 447  ? 42.566  84.723  23.347  1.00 2.52  ? 447  GLN A OE1   1 
ATOM   3495  N  NE2   . GLN A 1 447  ? 44.409  84.675  22.067  1.00 3.11  ? 447  GLN A NE2   1 
ATOM   3496  N  N     . ALA A 1 448  ? 43.330  84.821  28.754  1.00 3.58  ? 448  ALA A N     1 
ATOM   3497  C  CA    . ALA A 1 448  ? 42.935  85.592  29.920  1.00 3.13  ? 448  ALA A CA    1 
ATOM   3498  C  C     . ALA A 1 448  ? 43.883  85.332  31.104  1.00 3.50  ? 448  ALA A C     1 
ATOM   3499  O  O     . ALA A 1 448  ? 44.379  86.279  31.735  1.00 2.45  ? 448  ALA A O     1 
ATOM   3500  C  CB    . ALA A 1 448  ? 41.469  85.275  30.291  1.00 3.58  ? 448  ALA A CB    1 
ATOM   3501  N  N     . ALA A 1 449  ? 44.160  84.057  31.366  1.00 3.37  ? 449  ALA A N     1 
ATOM   3502  C  CA    . ALA A 1 449  ? 44.945  83.642  32.536  1.00 3.55  ? 449  ALA A CA    1 
ATOM   3503  C  C     . ALA A 1 449  ? 46.381  84.098  32.462  1.00 3.72  ? 449  ALA A C     1 
ATOM   3504  O  O     . ALA A 1 449  ? 46.979  84.457  33.478  1.00 3.93  ? 449  ALA A O     1 
ATOM   3505  C  CB    . ALA A 1 449  ? 44.884  82.108  32.709  1.00 3.41  ? 449  ALA A CB    1 
ATOM   3506  N  N     . PHE A 1 450  ? 46.941  84.087  31.263  1.00 4.08  ? 450  PHE A N     1 
ATOM   3507  C  CA    . PHE A 1 450  ? 48.301  84.563  31.077  1.00 4.83  ? 450  PHE A CA    1 
ATOM   3508  C  C     . PHE A 1 450  ? 48.413  86.080  30.815  1.00 4.89  ? 450  PHE A C     1 
ATOM   3509  O  O     . PHE A 1 450  ? 49.492  86.568  30.494  1.00 4.62  ? 450  PHE A O     1 
ATOM   3510  C  CB    . PHE A 1 450  ? 49.026  83.743  30.003  1.00 4.66  ? 450  PHE A CB    1 
ATOM   3511  C  CG    . PHE A 1 450  ? 49.461  82.380  30.478  1.00 5.70  ? 450  PHE A CG    1 
ATOM   3512  C  CD1   . PHE A 1 450  ? 48.732  81.246  30.140  1.00 4.74  ? 450  PHE A CD1   1 
ATOM   3513  C  CD2   . PHE A 1 450  ? 50.604  82.231  31.265  1.00 6.85  ? 450  PHE A CD2   1 
ATOM   3514  C  CE1   . PHE A 1 450  ? 49.133  79.986  30.569  1.00 6.16  ? 450  PHE A CE1   1 
ATOM   3515  C  CE2   . PHE A 1 450  ? 51.006  80.966  31.708  1.00 5.52  ? 450  PHE A CE2   1 
ATOM   3516  C  CZ    . PHE A 1 450  ? 50.273  79.845  31.351  1.00 5.45  ? 450  PHE A CZ    1 
ATOM   3517  N  N     . GLY A 1 451  ? 47.310  86.814  30.969  1.00 4.80  ? 451  GLY A N     1 
ATOM   3518  C  CA    . GLY A 1 451  ? 47.368  88.276  30.951  1.00 5.12  ? 451  GLY A CA    1 
ATOM   3519  C  C     . GLY A 1 451  ? 47.085  89.002  29.644  1.00 5.59  ? 451  GLY A C     1 
ATOM   3520  O  O     . GLY A 1 451  ? 47.296  90.229  29.549  1.00 5.10  ? 451  GLY A O     1 
ATOM   3521  N  N     . TYR A 1 452  ? 46.622  88.259  28.637  1.00 5.55  ? 452  TYR A N     1 
ATOM   3522  C  CA    . TYR A 1 452  ? 46.184  88.860  27.380  1.00 6.46  ? 452  TYR A CA    1 
ATOM   3523  C  C     . TYR A 1 452  ? 44.895  89.640  27.621  1.00 6.76  ? 452  TYR A C     1 
ATOM   3524  O  O     . TYR A 1 452  ? 43.973  89.176  28.304  1.00 7.26  ? 452  TYR A O     1 
ATOM   3525  C  CB    . TYR A 1 452  ? 45.903  87.806  26.313  1.00 5.98  ? 452  TYR A CB    1 
ATOM   3526  C  CG    . TYR A 1 452  ? 47.109  87.096  25.723  1.00 5.53  ? 452  TYR A CG    1 
ATOM   3527  C  CD1   . TYR A 1 452  ? 47.832  86.155  26.470  1.00 6.00  ? 452  TYR A CD1   1 
ATOM   3528  C  CD2   . TYR A 1 452  ? 47.483  87.315  24.398  1.00 6.10  ? 452  TYR A CD2   1 
ATOM   3529  C  CE1   . TYR A 1 452  ? 48.925  85.473  25.915  1.00 5.65  ? 452  TYR A CE1   1 
ATOM   3530  C  CE2   . TYR A 1 452  ? 48.582  86.648  23.829  1.00 6.76  ? 452  TYR A CE2   1 
ATOM   3531  C  CZ    . TYR A 1 452  ? 49.289  85.721  24.591  1.00 7.52  ? 452  TYR A CZ    1 
ATOM   3532  O  OH    . TYR A 1 452  ? 50.363  85.071  24.033  1.00 7.52  ? 452  TYR A OH    1 
ATOM   3533  N  N     . THR A 1 453  ? 44.823  90.801  27.000  1.00 7.10  ? 453  THR A N     1 
ATOM   3534  C  CA    . THR A 1 453  ? 43.738  91.741  27.193  1.00 7.56  ? 453  THR A CA    1 
ATOM   3535  C  C     . THR A 1 453  ? 43.218  92.016  25.766  1.00 7.75  ? 453  THR A C     1 
ATOM   3536  O  O     . THR A 1 453  ? 43.951  91.776  24.799  1.00 7.65  ? 453  THR A O     1 
ATOM   3537  C  CB    . THR A 1 453  ? 44.409  92.950  27.909  1.00 8.88  ? 453  THR A CB    1 
ATOM   3538  O  OG1   . THR A 1 453  ? 43.909  93.089  29.256  1.00 11.29 ? 453  THR A OG1   1 
ATOM   3539  C  CG2   . THR A 1 453  ? 44.209  94.251  27.218  1.00 6.89  ? 453  THR A CG2   1 
ATOM   3540  N  N     . ALA A 1 454  ? 41.971  92.475  25.609  1.00 6.80  ? 454  ALA A N     1 
ATOM   3541  C  CA    . ALA A 1 454  ? 41.416  92.679  24.263  1.00 7.19  ? 454  ALA A CA    1 
ATOM   3542  C  C     . ALA A 1 454  ? 42.305  93.518  23.340  1.00 7.05  ? 454  ALA A C     1 
ATOM   3543  O  O     . ALA A 1 454  ? 42.506  93.159  22.179  1.00 6.75  ? 454  ALA A O     1 
ATOM   3544  C  CB    . ALA A 1 454  ? 39.981  93.225  24.307  1.00 6.62  ? 454  ALA A CB    1 
ATOM   3545  N  N     . GLU A 1 455  ? 42.858  94.613  23.861  1.00 7.46  ? 455  GLU A N     1 
ATOM   3546  C  CA    . GLU A 1 455  ? 43.753  95.468  23.080  1.00 7.74  ? 455  GLU A CA    1 
ATOM   3547  C  C     . GLU A 1 455  ? 45.064  94.768  22.738  1.00 7.77  ? 455  GLU A C     1 
ATOM   3548  O  O     . GLU A 1 455  ? 45.658  95.042  21.696  1.00 8.32  ? 455  GLU A O     1 
ATOM   3549  C  CB    . GLU A 1 455  ? 44.058  96.784  23.807  1.00 7.80  ? 455  GLU A CB    1 
ATOM   3550  C  CG    . GLU A 1 455  ? 42.859  97.714  23.983  1.00 8.36  ? 455  GLU A CG    1 
ATOM   3551  C  CD    . GLU A 1 455  ? 43.147  98.816  25.007  1.00 10.68 ? 455  GLU A CD    1 
ATOM   3552  O  OE1   . GLU A 1 455  ? 43.504  98.474  26.169  1.00 9.99  ? 455  GLU A OE1   1 
ATOM   3553  O  OE2   . GLU A 1 455  ? 43.027  100.017 24.653  1.00 8.12  ? 455  GLU A OE2   1 
ATOM   3554  N  N     . ASP A 1 456  ? 45.511  93.863  23.601  1.00 7.64  ? 456  ASP A N     1 
ATOM   3555  C  CA    . ASP A 1 456  ? 46.726  93.102  23.336  1.00 7.96  ? 456  ASP A CA    1 
ATOM   3556  C  C     . ASP A 1 456  ? 46.621  92.339  22.022  1.00 7.54  ? 456  ASP A C     1 
ATOM   3557  O  O     . ASP A 1 456  ? 47.501  92.434  21.175  1.00 7.87  ? 456  ASP A O     1 
ATOM   3558  C  CB    . ASP A 1 456  ? 47.025  92.137  24.481  1.00 8.03  ? 456  ASP A CB    1 
ATOM   3559  C  CG    . ASP A 1 456  ? 47.515  92.847  25.709  1.00 9.13  ? 456  ASP A CG    1 
ATOM   3560  O  OD1   . ASP A 1 456  ? 48.493  93.615  25.591  1.00 9.38  ? 456  ASP A OD1   1 
ATOM   3561  O  OD2   . ASP A 1 456  ? 47.004  92.689  26.835  1.00 9.46  ? 456  ASP A OD2   1 
ATOM   3562  N  N     . VAL A 1 457  ? 45.546  91.589  21.839  1.00 7.20  ? 457  VAL A N     1 
ATOM   3563  C  CA    . VAL A 1 457  ? 45.415  90.846  20.598  1.00 7.12  ? 457  VAL A CA    1 
ATOM   3564  C  C     . VAL A 1 457  ? 44.948  91.748  19.446  1.00 6.87  ? 457  VAL A C     1 
ATOM   3565  O  O     . VAL A 1 457  ? 45.469  91.647  18.348  1.00 6.04  ? 457  VAL A O     1 
ATOM   3566  C  CB    . VAL A 1 457  ? 44.640  89.475  20.740  1.00 7.52  ? 457  VAL A CB    1 
ATOM   3567  C  CG1   . VAL A 1 457  ? 44.193  89.219  22.157  1.00 8.52  ? 457  VAL A CG1   1 
ATOM   3568  C  CG2   . VAL A 1 457  ? 43.514  89.341  19.757  1.00 7.76  ? 457  VAL A CG2   1 
ATOM   3569  N  N     . GLU A 1 458  ? 44.029  92.665  19.723  1.00 6.50  ? 458  GLU A N     1 
ATOM   3570  C  CA    . GLU A 1 458  ? 43.410  93.462  18.660  1.00 6.96  ? 458  GLU A CA    1 
ATOM   3571  C  C     . GLU A 1 458  ? 44.291  94.596  18.133  1.00 6.75  ? 458  GLU A C     1 
ATOM   3572  O  O     . GLU A 1 458  ? 44.311  94.860  16.927  1.00 6.59  ? 458  GLU A O     1 
ATOM   3573  C  CB    . GLU A 1 458  ? 42.056  93.997  19.111  1.00 7.13  ? 458  GLU A CB    1 
ATOM   3574  C  CG    . GLU A 1 458  ? 40.932  92.968  18.983  1.00 9.02  ? 458  GLU A CG    1 
ATOM   3575  C  CD    . GLU A 1 458  ? 39.735  93.237  19.893  1.00 13.13 ? 458  GLU A CD    1 
ATOM   3576  O  OE1   . GLU A 1 458  ? 39.589  94.379  20.402  1.00 13.80 ? 458  GLU A OE1   1 
ATOM   3577  O  OE2   . GLU A 1 458  ? 38.925  92.293  20.092  1.00 14.96 ? 458  GLU A OE2   1 
ATOM   3578  N  N     . MET A 1 459  ? 44.999  95.263  19.041  1.00 6.60  ? 459  MET A N     1 
ATOM   3579  C  CA    . MET A 1 459  ? 45.826  96.416  18.678  1.00 7.02  ? 459  MET A CA    1 
ATOM   3580  C  C     . MET A 1 459  ? 47.300  96.060  18.521  1.00 6.37  ? 459  MET A C     1 
ATOM   3581  O  O     . MET A 1 459  ? 48.063  96.848  17.968  1.00 6.14  ? 459  MET A O     1 
ATOM   3582  C  CB    . MET A 1 459  ? 45.649  97.557  19.682  1.00 6.98  ? 459  MET A CB    1 
ATOM   3583  C  CG    . MET A 1 459  ? 44.187  97.948  19.868  1.00 9.69  ? 459  MET A CG    1 
ATOM   3584  S  SD    . MET A 1 459  ? 44.073  99.634  20.417  1.00 14.42 ? 459  MET A SD    1 
ATOM   3585  C  CE    . MET A 1 459  ? 42.483  99.942  19.934  1.00 15.81 ? 459  MET A CE    1 
ATOM   3586  N  N     . VAL A 1 460  ? 47.700  94.874  18.979  1.00 6.42  ? 460  VAL A N     1 
ATOM   3587  C  CA    . VAL A 1 460  ? 49.130  94.530  18.975  1.00 7.04  ? 460  VAL A CA    1 
ATOM   3588  C  C     . VAL A 1 460  ? 49.422  93.260  18.155  1.00 6.67  ? 460  VAL A C     1 
ATOM   3589  O  O     . VAL A 1 460  ? 50.050  93.361  17.109  1.00 6.92  ? 460  VAL A O     1 
ATOM   3590  C  CB    . VAL A 1 460  ? 49.762  94.481  20.411  1.00 6.67  ? 460  VAL A CB    1 
ATOM   3591  C  CG1   . VAL A 1 460  ? 51.198  94.008  20.364  1.00 6.99  ? 460  VAL A CG1   1 
ATOM   3592  C  CG2   . VAL A 1 460  ? 49.715  95.876  21.095  1.00 7.07  ? 460  VAL A CG2   1 
ATOM   3593  N  N     . VAL A 1 461  ? 48.961  92.094  18.609  1.00 6.15  ? 461  VAL A N     1 
ATOM   3594  C  CA    . VAL A 1 461  ? 49.227  90.834  17.901  1.00 6.29  ? 461  VAL A CA    1 
ATOM   3595  C  C     . VAL A 1 461  ? 48.678  90.810  16.464  1.00 6.42  ? 461  VAL A C     1 
ATOM   3596  O  O     . VAL A 1 461  ? 49.411  90.499  15.527  1.00 6.88  ? 461  VAL A O     1 
ATOM   3597  C  CB    . VAL A 1 461  ? 48.758  89.585  18.711  1.00 6.77  ? 461  VAL A CB    1 
ATOM   3598  C  CG1   . VAL A 1 461  ? 48.953  88.324  17.915  1.00 6.40  ? 461  VAL A CG1   1 
ATOM   3599  C  CG2   . VAL A 1 461  ? 49.507  89.479  20.029  1.00 6.03  ? 461  VAL A CG2   1 
ATOM   3600  N  N     . VAL A 1 462  ? 47.410  91.163  16.285  1.00 6.31  ? 462  VAL A N     1 
ATOM   3601  C  CA    . VAL A 1 462  ? 46.782  91.132  14.956  1.00 6.60  ? 462  VAL A CA    1 
ATOM   3602  C  C     . VAL A 1 462  ? 47.470  92.019  13.890  1.00 6.47  ? 462  VAL A C     1 
ATOM   3603  O  O     . VAL A 1 462  ? 47.735  91.539  12.780  1.00 6.33  ? 462  VAL A O     1 
ATOM   3604  C  CB    . VAL A 1 462  ? 45.227  91.361  15.011  1.00 7.01  ? 462  VAL A CB    1 
ATOM   3605  C  CG1   . VAL A 1 462  ? 44.667  91.674  13.634  1.00 6.76  ? 462  VAL A CG1   1 
ATOM   3606  C  CG2   . VAL A 1 462  ? 44.505  90.131  15.593  1.00 7.34  ? 462  VAL A CG2   1 
ATOM   3607  N  N     . PRO A 1 463  ? 47.751  93.289  14.201  1.00 6.58  ? 463  PRO A N     1 
ATOM   3608  C  CA    . PRO A 1 463  ? 48.514  94.155  13.282  1.00 6.81  ? 463  PRO A CA    1 
ATOM   3609  C  C     . PRO A 1 463  ? 49.911  93.595  12.934  1.00 6.29  ? 463  PRO A C     1 
ATOM   3610  O  O     . PRO A 1 463  ? 50.306  93.655  11.766  1.00 5.83  ? 463  PRO A O     1 
ATOM   3611  C  CB    . PRO A 1 463  ? 48.641  95.466  14.068  1.00 7.32  ? 463  PRO A CB    1 
ATOM   3612  C  CG    . PRO A 1 463  ? 47.465  95.451  14.990  1.00 7.55  ? 463  PRO A CG    1 
ATOM   3613  C  CD    . PRO A 1 463  ? 47.332  94.022  15.412  1.00 6.34  ? 463  PRO A CD    1 
ATOM   3614  N  N     . MET A 1 464  ? 50.624  93.047  13.916  1.00 5.90  ? 464  MET A N     1 
ATOM   3615  C  CA    . MET A 1 464  ? 51.904  92.353  13.665  1.00 5.87  ? 464  MET A CA    1 
ATOM   3616  C  C     . MET A 1 464  ? 51.775  91.211  12.634  1.00 5.60  ? 464  MET A C     1 
ATOM   3617  O  O     . MET A 1 464  ? 52.574  91.115  11.713  1.00 5.45  ? 464  MET A O     1 
ATOM   3618  C  CB    . MET A 1 464  ? 52.521  91.813  14.968  1.00 5.48  ? 464  MET A CB    1 
ATOM   3619  C  CG    . MET A 1 464  ? 52.977  92.893  15.945  1.00 5.08  ? 464  MET A CG    1 
ATOM   3620  S  SD    . MET A 1 464  ? 53.507  92.213  17.522  1.00 8.64  ? 464  MET A SD    1 
ATOM   3621  C  CE    . MET A 1 464  ? 52.330  92.455  18.351  1.00 11.58 ? 464  MET A CE    1 
ATOM   3622  N  N     . ALA A 1 465  ? 50.758  90.366  12.791  1.00 5.65  ? 465  ALA A N     1 
ATOM   3623  C  CA    . ALA A 1 465  ? 50.494  89.259  11.863  1.00 5.91  ? 465  ALA A CA    1 
ATOM   3624  C  C     . ALA A 1 465  ? 49.904  89.693  10.506  1.00 6.17  ? 465  ALA A C     1 
ATOM   3625  O  O     . ALA A 1 465  ? 50.181  89.085  9.457   1.00 5.62  ? 465  ALA A O     1 
ATOM   3626  C  CB    . ALA A 1 465  ? 49.567  88.224  12.535  1.00 5.95  ? 465  ALA A CB    1 
ATOM   3627  N  N     . SER A 1 466  ? 49.067  90.723  10.520  1.00 6.57  ? 466  SER A N     1 
ATOM   3628  C  CA    . SER A 1 466  ? 48.425  91.160  9.282   1.00 7.26  ? 466  SER A CA    1 
ATOM   3629  C  C     . SER A 1 466  ? 49.274  92.137  8.465   1.00 7.00  ? 466  SER A C     1 
ATOM   3630  O  O     . SER A 1 466  ? 49.185  92.161  7.245   1.00 6.86  ? 466  SER A O     1 
ATOM   3631  C  CB    . SER A 1 466  ? 47.019  91.712  9.538   1.00 7.46  ? 466  SER A CB    1 
ATOM   3632  O  OG    . SER A 1 466  ? 47.089  92.974  10.155  1.00 9.62  ? 466  SER A OG    1 
ATOM   3633  N  N     . GLN A 1 467  ? 50.109  92.921  9.132   1.00 7.37  ? 467  GLN A N     1 
ATOM   3634  C  CA    . GLN A 1 467  ? 50.926  93.933  8.440   1.00 8.03  ? 467  GLN A CA    1 
ATOM   3635  C  C     . GLN A 1 467  ? 52.423  93.630  8.393   1.00 7.17  ? 467  GLN A C     1 
ATOM   3636  O  O     . GLN A 1 467  ? 53.138  94.149  7.528   1.00 6.59  ? 467  GLN A O     1 
ATOM   3637  C  CB    . GLN A 1 467  ? 50.680  95.333  9.015   1.00 8.09  ? 467  GLN A CB    1 
ATOM   3638  C  CG    . GLN A 1 467  ? 49.516  96.044  8.371   1.00 12.53 ? 467  GLN A CG    1 
ATOM   3639  C  CD    . GLN A 1 467  ? 48.344  96.185  9.312   1.00 17.65 ? 467  GLN A CD    1 
ATOM   3640  O  OE1   . GLN A 1 467  ? 48.439  96.875  10.342  1.00 19.95 ? 467  GLN A OE1   1 
ATOM   3641  N  NE2   . GLN A 1 467  ? 47.231  95.537  8.972   1.00 18.88 ? 467  GLN A NE2   1 
ATOM   3642  N  N     . GLY A 1 468  ? 52.897  92.796  9.313   1.00 6.77  ? 468  GLY A N     1 
ATOM   3643  C  CA    . GLY A 1 468  ? 54.318  92.533  9.405   1.00 6.49  ? 468  GLY A CA    1 
ATOM   3644  C  C     . GLY A 1 468  ? 55.101  93.671  10.049  1.00 6.67  ? 468  GLY A C     1 
ATOM   3645  O  O     . GLY A 1 468  ? 56.321  93.739  9.920   1.00 6.53  ? 468  GLY A O     1 
ATOM   3646  N  N     . LYS A 1 469  ? 54.417  94.559  10.760  1.00 6.52  ? 469  LYS A N     1 
ATOM   3647  C  CA    . LYS A 1 469  ? 55.138  95.520  11.607  1.00 6.54  ? 469  LYS A CA    1 
ATOM   3648  C  C     . LYS A 1 469  ? 54.396  95.789  12.903  1.00 5.74  ? 469  LYS A C     1 
ATOM   3649  O  O     . LYS A 1 469  ? 53.176  95.666  12.959  1.00 5.20  ? 469  LYS A O     1 
ATOM   3650  C  CB    . LYS A 1 469  ? 55.445  96.843  10.866  1.00 7.34  ? 469  LYS A CB    1 
ATOM   3651  C  CG    . LYS A 1 469  ? 54.527  97.173  9.701   1.00 9.76  ? 469  LYS A CG    1 
ATOM   3652  C  CD    . LYS A 1 469  ? 54.434  98.688  9.420   1.00 12.74 ? 469  LYS A CD    1 
ATOM   3653  C  CE    . LYS A 1 469  ? 54.818  99.021  7.987   1.00 15.01 ? 469  LYS A CE    1 
ATOM   3654  N  NZ    . LYS A 1 469  ? 55.156  100.491 7.833   1.00 16.48 ? 469  LYS A NZ    1 
ATOM   3655  N  N     . GLU A 1 470  ? 55.144  96.144  13.947  1.00 5.63  ? 470  GLU A N     1 
ATOM   3656  C  CA    . GLU A 1 470  ? 54.536  96.593  15.196  1.00 5.67  ? 470  GLU A CA    1 
ATOM   3657  C  C     . GLU A 1 470  ? 53.734  97.874  14.914  1.00 5.11  ? 470  GLU A C     1 
ATOM   3658  O  O     . GLU A 1 470  ? 54.061  98.619  13.973  1.00 4.93  ? 470  GLU A O     1 
ATOM   3659  C  CB    . GLU A 1 470  ? 55.595  96.790  16.294  1.00 5.99  ? 470  GLU A CB    1 
ATOM   3660  C  CG    . GLU A 1 470  ? 56.543  97.973  16.074  1.00 8.04  ? 470  GLU A CG    1 
ATOM   3661  C  CD    . GLU A 1 470  ? 57.497  98.167  17.239  1.00 9.97  ? 470  GLU A CD    1 
ATOM   3662  O  OE1   . GLU A 1 470  ? 57.018  98.528  18.333  1.00 9.55  ? 470  GLU A OE1   1 
ATOM   3663  O  OE2   . GLU A 1 470  ? 58.721  97.936  17.069  1.00 10.70 ? 470  GLU A OE2   1 
ATOM   3664  N  N     . PRO A 1 471  ? 52.672  98.120  15.677  1.00 4.77  ? 471  PRO A N     1 
ATOM   3665  C  CA    . PRO A 1 471  ? 51.777  99.240  15.362  1.00 5.28  ? 471  PRO A CA    1 
ATOM   3666  C  C     . PRO A 1 471  ? 52.310  100.637 15.745  1.00 5.11  ? 471  PRO A C     1 
ATOM   3667  O  O     . PRO A 1 471  ? 53.049  100.811 16.721  1.00 5.71  ? 471  PRO A O     1 
ATOM   3668  C  CB    . PRO A 1 471  ? 50.509  98.896  16.149  1.00 5.23  ? 471  PRO A CB    1 
ATOM   3669  C  CG    . PRO A 1 471  ? 50.999  98.121  17.340  1.00 4.98  ? 471  PRO A CG    1 
ATOM   3670  C  CD    . PRO A 1 471  ? 52.222  97.383  16.878  1.00 5.41  ? 471  PRO A CD    1 
ATOM   3671  N  N     . THR A 1 472  ? 51.931  101.617 14.937  1.00 5.46  ? 472  THR A N     1 
ATOM   3672  C  CA    . THR A 1 472  ? 52.175  103.026 15.189  1.00 5.11  ? 472  THR A CA    1 
ATOM   3673  C  C     . THR A 1 472  ? 50.946  103.633 15.862  1.00 4.88  ? 472  THR A C     1 
ATOM   3674  O  O     . THR A 1 472  ? 49.812  103.252 15.548  1.00 4.45  ? 472  THR A O     1 
ATOM   3675  C  CB    . THR A 1 472  ? 52.408  103.721 13.846  1.00 5.88  ? 472  THR A CB    1 
ATOM   3676  O  OG1   . THR A 1 472  ? 53.599  103.196 13.253  1.00 8.13  ? 472  THR A OG1   1 
ATOM   3677  C  CG2   . THR A 1 472  ? 52.701  105.239 14.021  1.00 5.99  ? 472  THR A CG2   1 
ATOM   3678  N  N     . PHE A 1 473  ? 51.170  104.584 16.767  1.00 3.38  ? 473  PHE A N     1 
ATOM   3679  C  CA    . PHE A 1 473  ? 50.082  105.330 17.390  1.00 3.23  ? 473  PHE A CA    1 
ATOM   3680  C  C     . PHE A 1 473  ? 50.523  106.812 17.545  1.00 3.25  ? 473  PHE A C     1 
ATOM   3681  O  O     . PHE A 1 473  ? 51.391  107.284 16.802  1.00 2.72  ? 473  PHE A O     1 
ATOM   3682  C  CB    . PHE A 1 473  ? 49.645  104.664 18.714  1.00 2.31  ? 473  PHE A CB    1 
ATOM   3683  C  CG    . PHE A 1 473  ? 48.264  105.062 19.173  1.00 3.11  ? 473  PHE A CG    1 
ATOM   3684  C  CD1   . PHE A 1 473  ? 47.157  104.955 18.316  1.00 2.34  ? 473  PHE A CD1   1 
ATOM   3685  C  CD2   . PHE A 1 473  ? 48.070  105.564 20.467  1.00 3.06  ? 473  PHE A CD2   1 
ATOM   3686  C  CE1   . PHE A 1 473  ? 45.872  105.359 18.723  1.00 2.12  ? 473  PHE A CE1   1 
ATOM   3687  C  CE2   . PHE A 1 473  ? 46.781  105.962 20.901  1.00 2.31  ? 473  PHE A CE2   1 
ATOM   3688  C  CZ    . PHE A 1 473  ? 45.683  105.855 20.025  1.00 2.22  ? 473  PHE A CZ    1 
ATOM   3689  N  N     . CYS A 1 474  ? 49.913  107.541 18.468  1.00 2.64  ? 474  CYS A N     1 
ATOM   3690  C  CA    . CYS A 1 474  ? 50.153  108.981 18.593  1.00 2.29  ? 474  CYS A CA    1 
ATOM   3691  C  C     . CYS A 1 474  ? 49.779  109.414 19.993  1.00 2.41  ? 474  CYS A C     1 
ATOM   3692  O  O     . CYS A 1 474  ? 49.232  108.627 20.753  1.00 2.80  ? 474  CYS A O     1 
ATOM   3693  C  CB    . CYS A 1 474  ? 49.356  109.785 17.556  1.00 1.87  ? 474  CYS A CB    1 
ATOM   3694  S  SG    . CYS A 1 474  ? 47.562  109.686 17.801  1.00 1.22  ? 474  CYS A SG    1 
ATOM   3695  N  N     . MET A 1 475  ? 50.057  110.677 20.321  1.00 2.72  ? 475  MET A N     1 
ATOM   3696  C  CA    . MET A 1 475  ? 49.883  111.191 21.673  1.00 3.49  ? 475  MET A CA    1 
ATOM   3697  C  C     . MET A 1 475  ? 50.683  110.423 22.742  1.00 3.90  ? 475  MET A C     1 
ATOM   3698  O  O     . MET A 1 475  ? 51.325  109.401 22.459  1.00 4.01  ? 475  MET A O     1 
ATOM   3699  C  CB    . MET A 1 475  ? 48.402  111.334 22.028  1.00 3.47  ? 475  MET A CB    1 
ATOM   3700  C  CG    . MET A 1 475  ? 47.760  112.575 21.436  1.00 5.62  ? 475  MET A CG    1 
ATOM   3701  S  SD    . MET A 1 475  ? 48.710  114.113 21.788  1.00 8.94  ? 475  MET A SD    1 
ATOM   3702  C  CE    . MET A 1 475  ? 47.762  114.743 22.993  1.00 12.60 ? 475  MET A CE    1 
ATOM   3703  N  N     . GLY A 1 476  ? 50.665  110.917 23.974  1.00 4.52  ? 476  GLY A N     1 
ATOM   3704  C  CA    . GLY A 1 476  ? 51.538  110.364 24.997  1.00 5.03  ? 476  GLY A CA    1 
ATOM   3705  C  C     . GLY A 1 476  ? 50.952  109.231 25.819  1.00 5.78  ? 476  GLY A C     1 
ATOM   3706  O  O     . GLY A 1 476  ? 49.757  108.934 25.703  1.00 6.48  ? 476  GLY A O     1 
ATOM   3707  N  N     . ASP A 1 477  ? 51.790  108.592 26.642  1.00 5.55  ? 477  ASP A N     1 
ATOM   3708  C  CA    . ASP A 1 477  ? 51.281  107.649 27.631  1.00 5.82  ? 477  ASP A CA    1 
ATOM   3709  C  C     . ASP A 1 477  ? 50.692  108.357 28.823  1.00 5.79  ? 477  ASP A C     1 
ATOM   3710  O  O     . ASP A 1 477  ? 51.351  108.635 29.825  1.00 4.66  ? 477  ASP A O     1 
ATOM   3711  C  CB    . ASP A 1 477  ? 52.288  106.630 28.119  1.00 5.63  ? 477  ASP A CB    1 
ATOM   3712  C  CG    . ASP A 1 477  ? 51.640  105.571 29.028  1.00 6.85  ? 477  ASP A CG    1 
ATOM   3713  O  OD1   . ASP A 1 477  ? 50.387  105.557 29.165  1.00 5.79  ? 477  ASP A OD1   1 
ATOM   3714  O  OD2   . ASP A 1 477  ? 52.304  104.706 29.630  1.00 6.78  ? 477  ASP A OD2   1 
ATOM   3715  N  N     . ASP A 1 478  ? 49.402  108.542 28.645  1.00 5.10  ? 478  ASP A N     1 
ATOM   3716  C  CA    . ASP A 1 478  ? 48.431  109.230 29.450  1.00 6.24  ? 478  ASP A CA    1 
ATOM   3717  C  C     . ASP A 1 478  ? 47.978  108.551 30.744  1.00 5.64  ? 478  ASP A C     1 
ATOM   3718  O  O     . ASP A 1 478  ? 47.097  109.074 31.429  1.00 5.46  ? 478  ASP A O     1 
ATOM   3719  C  CB    . ASP A 1 478  ? 47.159  109.231 28.554  1.00 7.21  ? 478  ASP A CB    1 
ATOM   3720  C  CG    . ASP A 1 478  ? 46.549  110.535 28.501  1.00 8.98  ? 478  ASP A CG    1 
ATOM   3721  O  OD1   . ASP A 1 478  ? 47.294  111.457 28.890  1.00 16.74 ? 478  ASP A OD1   1 
ATOM   3722  O  OD2   . ASP A 1 478  ? 45.379  110.754 28.143  1.00 7.03  ? 478  ASP A OD2   1 
ATOM   3723  N  N     . THR A 1 479  ? 48.492  107.358 31.012  1.00 5.84  ? 479  THR A N     1 
ATOM   3724  C  CA    . THR A 1 479  ? 47.911  106.465 32.019  1.00 5.38  ? 479  THR A CA    1 
ATOM   3725  C  C     . THR A 1 479  ? 48.781  106.341 33.269  1.00 5.21  ? 479  THR A C     1 
ATOM   3726  O  O     . THR A 1 479  ? 49.970  106.641 33.212  1.00 5.39  ? 479  THR A O     1 
ATOM   3727  C  CB    . THR A 1 479  ? 47.653  105.057 31.407  1.00 5.49  ? 479  THR A CB    1 
ATOM   3728  O  OG1   . THR A 1 479  ? 48.902  104.439 31.070  1.00 5.40  ? 479  THR A OG1   1 
ATOM   3729  C  CG2   . THR A 1 479  ? 46.900  105.158 30.057  1.00 4.59  ? 479  THR A CG2   1 
ATOM   3730  N  N     . PRO A 1 480  ? 48.208  105.878 34.387  1.00 4.93  ? 480  PRO A N     1 
ATOM   3731  C  CA    . PRO A 1 480  ? 49.005  105.637 35.601  1.00 4.70  ? 480  PRO A CA    1 
ATOM   3732  C  C     . PRO A 1 480  ? 50.212  104.731 35.322  1.00 4.72  ? 480  PRO A C     1 
ATOM   3733  O  O     . PRO A 1 480  ? 50.089  103.852 34.480  1.00 4.60  ? 480  PRO A O     1 
ATOM   3734  C  CB    . PRO A 1 480  ? 48.012  104.945 36.540  1.00 4.78  ? 480  PRO A CB    1 
ATOM   3735  C  CG    . PRO A 1 480  ? 46.668  105.504 36.115  1.00 5.01  ? 480  PRO A CG    1 
ATOM   3736  C  CD    . PRO A 1 480  ? 46.778  105.586 34.601  1.00 4.85  ? 480  PRO A CD    1 
ATOM   3737  N  N     . LEU A 1 481  ? 51.353  104.977 35.979  1.00 3.67  ? 481  LEU A N     1 
ATOM   3738  C  CA    . LEU A 1 481  ? 52.438  103.986 36.057  1.00 4.19  ? 481  LEU A CA    1 
ATOM   3739  C  C     . LEU A 1 481  ? 51.862  102.632 36.471  1.00 3.89  ? 481  LEU A C     1 
ATOM   3740  O  O     . LEU A 1 481  ? 50.919  102.597 37.254  1.00 4.10  ? 481  LEU A O     1 
ATOM   3741  C  CB    . LEU A 1 481  ? 53.457  104.422 37.124  1.00 3.85  ? 481  LEU A CB    1 
ATOM   3742  C  CG    . LEU A 1 481  ? 54.219  105.721 36.814  1.00 4.75  ? 481  LEU A CG    1 
ATOM   3743  C  CD1   . LEU A 1 481  ? 55.111  106.177 37.985  1.00 3.60  ? 481  LEU A CD1   1 
ATOM   3744  C  CD2   . LEU A 1 481  ? 55.056  105.553 35.532  1.00 3.75  ? 481  LEU A CD2   1 
ATOM   3745  N  N     . ALA A 1 482  ? 52.423  101.524 35.967  1.00 4.18  ? 482  ALA A N     1 
ATOM   3746  C  CA    . ALA A 1 482  ? 51.905  100.191 36.305  1.00 3.60  ? 482  ALA A CA    1 
ATOM   3747  C  C     . ALA A 1 482  ? 51.763  99.991  37.815  1.00 3.35  ? 482  ALA A C     1 
ATOM   3748  O  O     . ALA A 1 482  ? 50.757  99.460  38.277  1.00 2.89  ? 482  ALA A O     1 
ATOM   3749  C  CB    . ALA A 1 482  ? 52.785  99.085  35.705  1.00 3.77  ? 482  ALA A CB    1 
ATOM   3750  N  N     . VAL A 1 483  ? 52.755  100.432 38.586  1.00 2.84  ? 483  VAL A N     1 
ATOM   3751  C  CA    . VAL A 1 483  ? 52.696  100.272 40.042  1.00 3.40  ? 483  VAL A CA    1 
ATOM   3752  C  C     . VAL A 1 483  ? 51.580  101.085 40.723  1.00 3.28  ? 483  VAL A C     1 
ATOM   3753  O  O     . VAL A 1 483  ? 51.147  100.737 41.824  1.00 3.05  ? 483  VAL A O     1 
ATOM   3754  C  CB    . VAL A 1 483  ? 54.066  100.566 40.725  1.00 3.00  ? 483  VAL A CB    1 
ATOM   3755  C  CG1   . VAL A 1 483  ? 54.435  102.052 40.614  1.00 4.23  ? 483  VAL A CG1   1 
ATOM   3756  C  CG2   . VAL A 1 483  ? 54.036  100.149 42.183  1.00 3.56  ? 483  VAL A CG2   1 
ATOM   3757  N  N     . LEU A 1 484  ? 51.146  102.176 40.081  1.00 3.78  ? 484  LEU A N     1 
ATOM   3758  C  CA    . LEU A 1 484  ? 50.103  103.043 40.639  1.00 4.15  ? 484  LEU A CA    1 
ATOM   3759  C  C     . LEU A 1 484  ? 48.710  102.633 40.173  1.00 4.75  ? 484  LEU A C     1 
ATOM   3760  O  O     . LEU A 1 484  ? 47.709  103.028 40.754  1.00 4.14  ? 484  LEU A O     1 
ATOM   3761  C  CB    . LEU A 1 484  ? 50.362  104.512 40.280  1.00 4.18  ? 484  LEU A CB    1 
ATOM   3762  C  CG    . LEU A 1 484  ? 51.744  105.045 40.654  1.00 4.15  ? 484  LEU A CG    1 
ATOM   3763  C  CD1   . LEU A 1 484  ? 51.964  106.475 40.199  1.00 6.44  ? 484  LEU A CD1   1 
ATOM   3764  C  CD2   . LEU A 1 484  ? 51.911  104.932 42.146  1.00 5.55  ? 484  LEU A CD2   1 
ATOM   3765  N  N     . SER A 1 485  ? 48.669  101.843 39.108  1.00 6.08  ? 485  SER A N     1 
ATOM   3766  C  CA    . SER A 1 485  ? 47.413  101.461 38.477  1.00 6.65  ? 485  SER A CA    1 
ATOM   3767  C  C     . SER A 1 485  ? 46.509  100.609 39.379  1.00 7.45  ? 485  SER A C     1 
ATOM   3768  O  O     . SER A 1 485  ? 46.971  99.840  40.214  1.00 7.94  ? 485  SER A O     1 
ATOM   3769  C  CB    . SER A 1 485  ? 47.684  100.761 37.133  1.00 6.34  ? 485  SER A CB    1 
ATOM   3770  O  OG    . SER A 1 485  ? 46.470  100.474 36.464  1.00 6.21  ? 485  SER A OG    1 
ATOM   3771  N  N     . HIS A 1 486  ? 45.208  100.790 39.219  1.00 7.90  ? 486  HIS A N     1 
ATOM   3772  C  CA    . HIS A 1 486  ? 44.232  99.905  39.832  1.00 8.69  ? 486  HIS A CA    1 
ATOM   3773  C  C     . HIS A 1 486  ? 43.916  98.713  38.914  1.00 8.41  ? 486  HIS A C     1 
ATOM   3774  O  O     . HIS A 1 486  ? 43.263  97.746  39.327  1.00 8.47  ? 486  HIS A O     1 
ATOM   3775  C  CB    . HIS A 1 486  ? 42.979  100.701 40.205  1.00 9.27  ? 486  HIS A CB    1 
ATOM   3776  C  CG    . HIS A 1 486  ? 43.214  101.710 41.291  1.00 11.54 ? 486  HIS A CG    1 
ATOM   3777  N  ND1   . HIS A 1 486  ? 43.339  103.061 41.045  1.00 13.73 ? 486  HIS A ND1   1 
ATOM   3778  C  CD2   . HIS A 1 486  ? 43.354  101.560 42.629  1.00 13.37 ? 486  HIS A CD2   1 
ATOM   3779  C  CE1   . HIS A 1 486  ? 43.543  103.700 42.183  1.00 14.06 ? 486  HIS A CE1   1 
ATOM   3780  N  NE2   . HIS A 1 486  ? 43.558  102.811 43.160  1.00 15.78 ? 486  HIS A NE2   1 
ATOM   3781  N  N     . LYS A 1 487  ? 44.391  98.785  37.672  1.00 8.49  ? 487  LYS A N     1 
ATOM   3782  C  CA    . LYS A 1 487  ? 44.230  97.690  36.705  1.00 8.45  ? 487  LYS A CA    1 
ATOM   3783  C  C     . LYS A 1 487  ? 45.375  96.676  36.798  1.00 8.29  ? 487  LYS A C     1 
ATOM   3784  O  O     . LYS A 1 487  ? 46.509  97.052  37.079  1.00 8.13  ? 487  LYS A O     1 
ATOM   3785  C  CB    . LYS A 1 487  ? 44.124  98.239  35.272  1.00 8.47  ? 487  LYS A CB    1 
ATOM   3786  C  CG    . LYS A 1 487  ? 43.028  99.289  35.050  1.00 8.62  ? 487  LYS A CG    1 
ATOM   3787  C  CD    . LYS A 1 487  ? 41.675  98.927  35.668  1.00 9.87  ? 487  LYS A CD    1 
ATOM   3788  C  CE    . LYS A 1 487  ? 40.604  99.944  35.270  1.00 11.17 ? 487  LYS A CE    1 
ATOM   3789  N  NZ    . LYS A 1 487  ? 39.277  99.716  35.941  1.00 12.95 ? 487  LYS A NZ    1 
ATOM   3790  N  N     . PRO A 1 488  ? 45.095  95.395  36.539  1.00 8.53  ? 488  PRO A N     1 
ATOM   3791  C  CA    . PRO A 1 488  ? 46.156  94.391  36.516  1.00 8.49  ? 488  PRO A CA    1 
ATOM   3792  C  C     . PRO A 1 488  ? 47.090  94.634  35.324  1.00 8.65  ? 488  PRO A C     1 
ATOM   3793  O  O     . PRO A 1 488  ? 46.639  95.018  34.235  1.00 9.25  ? 488  PRO A O     1 
ATOM   3794  C  CB    . PRO A 1 488  ? 45.390  93.075  36.338  1.00 8.22  ? 488  PRO A CB    1 
ATOM   3795  C  CG    . PRO A 1 488  ? 44.130  93.461  35.664  1.00 8.18  ? 488  PRO A CG    1 
ATOM   3796  C  CD    . PRO A 1 488  ? 43.778  94.811  36.222  1.00 8.35  ? 488  PRO A CD    1 
ATOM   3797  N  N     . ARG A 1 489  ? 48.382  94.434  35.542  1.00 8.42  ? 489  ARG A N     1 
ATOM   3798  C  CA    . ARG A 1 489  ? 49.382  94.597  34.496  1.00 8.32  ? 489  ARG A CA    1 
ATOM   3799  C  C     . ARG A 1 489  ? 50.353  93.438  34.615  1.00 7.58  ? 489  ARG A C     1 
ATOM   3800  O  O     . ARG A 1 489  ? 50.269  92.650  35.556  1.00 7.90  ? 489  ARG A O     1 
ATOM   3801  C  CB    . ARG A 1 489  ? 50.140  95.936  34.642  1.00 9.23  ? 489  ARG A CB    1 
ATOM   3802  C  CG    . ARG A 1 489  ? 49.246  97.152  34.891  1.00 10.13 ? 489  ARG A CG    1 
ATOM   3803  C  CD    . ARG A 1 489  ? 48.675  97.793  33.628  1.00 12.69 ? 489  ARG A CD    1 
ATOM   3804  N  NE    . ARG A 1 489  ? 49.735  98.459  32.885  1.00 16.16 ? 489  ARG A NE    1 
ATOM   3805  C  CZ    . ARG A 1 489  ? 49.989  99.766  32.923  1.00 16.72 ? 489  ARG A CZ    1 
ATOM   3806  N  NH1   . ARG A 1 489  ? 49.223  100.598 33.641  1.00 18.17 ? 489  ARG A NH1   1 
ATOM   3807  N  NH2   . ARG A 1 489  ? 51.006  100.243 32.219  1.00 15.88 ? 489  ARG A NH2   1 
ATOM   3808  N  N     . LEU A 1 490  ? 51.263  93.356  33.655  1.00 7.20  ? 490  LEU A N     1 
ATOM   3809  C  CA    . LEU A 1 490  ? 52.281  92.324  33.570  1.00 6.51  ? 490  LEU A CA    1 
ATOM   3810  C  C     . LEU A 1 490  ? 53.558  92.828  34.178  1.00 6.44  ? 490  LEU A C     1 
ATOM   3811  O  O     . LEU A 1 490  ? 53.813  94.051  34.204  1.00 5.34  ? 490  LEU A O     1 
ATOM   3812  C  CB    . LEU A 1 490  ? 52.549  91.979  32.095  1.00 6.39  ? 490  LEU A CB    1 
ATOM   3813  C  CG    . LEU A 1 490  ? 51.323  91.633  31.256  1.00 7.97  ? 490  LEU A CG    1 
ATOM   3814  C  CD1   . LEU A 1 490  ? 51.714  91.299  29.823  1.00 9.81  ? 490  LEU A CD1   1 
ATOM   3815  C  CD2   . LEU A 1 490  ? 50.505  90.508  31.880  1.00 7.47  ? 490  LEU A CD2   1 
ATOM   3816  N  N     . LEU A 1 491  ? 54.381  91.895  34.637  1.00 5.79  ? 491  LEU A N     1 
ATOM   3817  C  CA    . LEU A 1 491  ? 55.668  92.254  35.209  1.00 6.60  ? 491  LEU A CA    1 
ATOM   3818  C  C     . LEU A 1 491  ? 56.512  93.076  34.230  1.00 6.27  ? 491  LEU A C     1 
ATOM   3819  O  O     . LEU A 1 491  ? 57.207  93.997  34.633  1.00 7.29  ? 491  LEU A O     1 
ATOM   3820  C  CB    . LEU A 1 491  ? 56.413  91.013  35.704  1.00 6.61  ? 491  LEU A CB    1 
ATOM   3821  C  CG    . LEU A 1 491  ? 57.691  91.246  36.519  1.00 8.78  ? 491  LEU A CG    1 
ATOM   3822  C  CD1   . LEU A 1 491  ? 57.427  92.143  37.744  1.00 8.58  ? 491  LEU A CD1   1 
ATOM   3823  C  CD2   . LEU A 1 491  ? 58.251  89.892  36.944  1.00 8.20  ? 491  LEU A CD2   1 
ATOM   3824  N  N     . TYR A 1 492  ? 56.399  92.785  32.941  1.00 6.45  ? 492  TYR A N     1 
ATOM   3825  C  CA    . TYR A 1 492  ? 57.063  93.574  31.895  1.00 5.85  ? 492  TYR A CA    1 
ATOM   3826  C  C     . TYR A 1 492  ? 56.797  95.074  31.964  1.00 6.11  ? 492  TYR A C     1 
ATOM   3827  O  O     . TYR A 1 492  ? 57.671  95.893  31.613  1.00 5.75  ? 492  TYR A O     1 
ATOM   3828  C  CB    . TYR A 1 492  ? 56.577  93.122  30.529  1.00 5.83  ? 492  TYR A CB    1 
ATOM   3829  C  CG    . TYR A 1 492  ? 56.845  91.686  30.170  1.00 3.94  ? 492  TYR A CG    1 
ATOM   3830  C  CD1   . TYR A 1 492  ? 55.789  90.803  29.993  1.00 5.35  ? 492  TYR A CD1   1 
ATOM   3831  C  CD2   . TYR A 1 492  ? 58.150  91.219  29.942  1.00 4.23  ? 492  TYR A CD2   1 
ATOM   3832  C  CE1   . TYR A 1 492  ? 56.010  89.478  29.622  1.00 4.34  ? 492  TYR A CE1   1 
ATOM   3833  C  CE2   . TYR A 1 492  ? 58.382  89.895  29.570  1.00 3.51  ? 492  TYR A CE2   1 
ATOM   3834  C  CZ    . TYR A 1 492  ? 57.294  89.037  29.399  1.00 5.29  ? 492  TYR A CZ    1 
ATOM   3835  O  OH    . TYR A 1 492  ? 57.476  87.730  29.015  1.00 7.70  ? 492  TYR A OH    1 
ATOM   3836  N  N     . ASP A 1 493  ? 55.593  95.445  32.391  1.00 5.74  ? 493  ASP A N     1 
ATOM   3837  C  CA    . ASP A 1 493  ? 55.199  96.860  32.358  1.00 6.91  ? 493  ASP A CA    1 
ATOM   3838  C  C     . ASP A 1 493  ? 55.926  97.730  33.389  1.00 6.29  ? 493  ASP A C     1 
ATOM   3839  O  O     . ASP A 1 493  ? 55.879  98.961  33.310  1.00 5.97  ? 493  ASP A O     1 
ATOM   3840  C  CB    . ASP A 1 493  ? 53.684  97.020  32.484  1.00 7.01  ? 493  ASP A CB    1 
ATOM   3841  C  CG    . ASP A 1 493  ? 52.924  96.295  31.387  1.00 8.85  ? 493  ASP A CG    1 
ATOM   3842  O  OD1   . ASP A 1 493  ? 53.352  96.343  30.205  1.00 8.96  ? 493  ASP A OD1   1 
ATOM   3843  O  OD2   . ASP A 1 493  ? 51.880  95.644  31.621  1.00 11.58 ? 493  ASP A OD2   1 
ATOM   3844  N  N     . TYR A 1 494  ? 56.595  97.077  34.338  1.00 5.96  ? 494  TYR A N     1 
ATOM   3845  C  CA    . TYR A 1 494  ? 57.349  97.761  35.387  1.00 6.03  ? 494  TYR A CA    1 
ATOM   3846  C  C     . TYR A 1 494  ? 58.780  98.083  34.950  1.00 6.05  ? 494  TYR A C     1 
ATOM   3847  O  O     . TYR A 1 494  ? 59.526  98.754  35.681  1.00 5.59  ? 494  TYR A O     1 
ATOM   3848  C  CB    . TYR A 1 494  ? 57.371  96.906  36.653  1.00 5.73  ? 494  TYR A CB    1 
ATOM   3849  C  CG    . TYR A 1 494  ? 56.012  96.702  37.277  1.00 5.92  ? 494  TYR A CG    1 
ATOM   3850  C  CD1   . TYR A 1 494  ? 55.131  95.737  36.778  1.00 7.64  ? 494  TYR A CD1   1 
ATOM   3851  C  CD2   . TYR A 1 494  ? 55.605  97.455  38.378  1.00 6.54  ? 494  TYR A CD2   1 
ATOM   3852  C  CE1   . TYR A 1 494  ? 53.871  95.530  37.352  1.00 7.19  ? 494  TYR A CE1   1 
ATOM   3853  C  CE2   . TYR A 1 494  ? 54.331  97.259  38.955  1.00 6.55  ? 494  TYR A CE2   1 
ATOM   3854  C  CZ    . TYR A 1 494  ? 53.479  96.294  38.435  1.00 7.54  ? 494  TYR A CZ    1 
ATOM   3855  O  OH    . TYR A 1 494  ? 52.225  96.074  38.993  1.00 8.48  ? 494  TYR A OH    1 
ATOM   3856  N  N     . PHE A 1 495  ? 59.146  97.600  33.762  1.00 6.19  ? 495  PHE A N     1 
ATOM   3857  C  CA    . PHE A 1 495  ? 60.470  97.841  33.177  1.00 6.69  ? 495  PHE A CA    1 
ATOM   3858  C  C     . PHE A 1 495  ? 60.403  98.832  32.019  1.00 6.51  ? 495  PHE A C     1 
ATOM   3859  O  O     . PHE A 1 495  ? 59.660  98.627  31.057  1.00 7.39  ? 495  PHE A O     1 
ATOM   3860  C  CB    . PHE A 1 495  ? 61.104  96.534  32.680  1.00 6.95  ? 495  PHE A CB    1 
ATOM   3861  C  CG    . PHE A 1 495  ? 61.427  95.560  33.773  1.00 6.77  ? 495  PHE A CG    1 
ATOM   3862  C  CD1   . PHE A 1 495  ? 60.428  94.807  34.365  1.00 5.60  ? 495  PHE A CD1   1 
ATOM   3863  C  CD2   . PHE A 1 495  ? 62.746  95.412  34.218  1.00 6.16  ? 495  PHE A CD2   1 
ATOM   3864  C  CE1   . PHE A 1 495  ? 60.731  93.908  35.383  1.00 6.59  ? 495  PHE A CE1   1 
ATOM   3865  C  CE2   . PHE A 1 495  ? 63.057  94.515  35.239  1.00 8.94  ? 495  PHE A CE2   1 
ATOM   3866  C  CZ    . PHE A 1 495  ? 62.049  93.762  35.816  1.00 6.71  ? 495  PHE A CZ    1 
ATOM   3867  N  N     . LYS A 1 496  ? 61.173  99.906  32.126  1.00 5.71  ? 496  LYS A N     1 
ATOM   3868  C  CA    . LYS A 1 496  ? 61.319  100.897 31.062  1.00 5.21  ? 496  LYS A CA    1 
ATOM   3869  C  C     . LYS A 1 496  ? 62.646  100.703 30.328  1.00 5.06  ? 496  LYS A C     1 
ATOM   3870  O  O     . LYS A 1 496  ? 63.702  100.560 30.959  1.00 3.84  ? 496  LYS A O     1 
ATOM   3871  C  CB    . LYS A 1 496  ? 61.245  102.320 31.637  1.00 5.30  ? 496  LYS A CB    1 
ATOM   3872  C  CG    . LYS A 1 496  ? 59.894  102.681 32.295  1.00 7.20  ? 496  LYS A CG    1 
ATOM   3873  C  CD    . LYS A 1 496  ? 58.754  102.532 31.311  1.00 7.82  ? 496  LYS A CD    1 
ATOM   3874  C  CE    . LYS A 1 496  ? 57.412  102.894 31.948  1.00 10.65 ? 496  LYS A CE    1 
ATOM   3875  N  NZ    . LYS A 1 496  ? 56.411  103.252 30.896  1.00 7.71  ? 496  LYS A NZ    1 
ATOM   3876  N  N     . GLN A 1 497  ? 62.588  100.715 28.996  1.00 4.44  ? 497  GLN A N     1 
ATOM   3877  C  CA    . GLN A 1 497  ? 63.783  100.643 28.170  1.00 4.62  ? 497  GLN A CA    1 
ATOM   3878  C  C     . GLN A 1 497  ? 64.707  101.820 28.422  1.00 4.91  ? 497  GLN A C     1 
ATOM   3879  O  O     . GLN A 1 497  ? 64.258  102.963 28.516  1.00 4.38  ? 497  GLN A O     1 
ATOM   3880  C  CB    . GLN A 1 497  ? 63.420  100.569 26.679  1.00 4.92  ? 497  GLN A CB    1 
ATOM   3881  C  CG    . GLN A 1 497  ? 62.648  99.279  26.306  1.00 4.45  ? 497  GLN A CG    1 
ATOM   3882  C  CD    . GLN A 1 497  ? 61.998  99.366  24.948  1.00 4.08  ? 497  GLN A CD    1 
ATOM   3883  O  OE1   . GLN A 1 497  ? 62.395  100.183 24.109  1.00 5.76  ? 497  GLN A OE1   1 
ATOM   3884  N  NE2   . GLN A 1 497  ? 60.956  98.568  24.744  1.00 6.18  ? 497  GLN A NE2   1 
ATOM   3885  N  N     . ARG A 1 498  ? 66.001  101.532 28.558  1.00 5.16  ? 498  ARG A N     1 
ATOM   3886  C  CA    . ARG A 1 498  ? 67.019  102.592 28.552  1.00 5.34  ? 498  ARG A CA    1 
ATOM   3887  C  C     . ARG A 1 498  ? 67.456  102.848 27.106  1.00 5.18  ? 498  ARG A C     1 
ATOM   3888  O  O     . ARG A 1 498  ? 67.231  102.000 26.235  1.00 5.73  ? 498  ARG A O     1 
ATOM   3889  C  CB    . ARG A 1 498  ? 68.218  102.199 29.418  1.00 5.94  ? 498  ARG A CB    1 
ATOM   3890  C  CG    . ARG A 1 498  ? 67.922  102.112 30.940  1.00 7.68  ? 498  ARG A CG    1 
ATOM   3891  C  CD    . ARG A 1 498  ? 69.199  102.245 31.808  1.00 11.30 ? 498  ARG A CD    1 
ATOM   3892  N  NE    . ARG A 1 498  ? 69.781  103.592 31.707  1.00 14.43 ? 498  ARG A NE    1 
ATOM   3893  C  CZ    . ARG A 1 498  ? 70.943  103.888 31.134  1.00 16.68 ? 498  ARG A CZ    1 
ATOM   3894  N  NH1   . ARG A 1 498  ? 71.712  102.939 30.588  1.00 19.54 ? 498  ARG A NH1   1 
ATOM   3895  N  NH2   . ARG A 1 498  ? 71.342  105.143 31.097  1.00 15.50 ? 498  ARG A NH2   1 
ATOM   3896  N  N     . PHE A 1 499  ? 68.100  103.993 26.856  1.00 4.67  ? 499  PHE A N     1 
ATOM   3897  C  CA    . PHE A 1 499  ? 68.449  104.435 25.515  1.00 4.64  ? 499  PHE A CA    1 
ATOM   3898  C  C     . PHE A 1 499  ? 69.649  105.383 25.565  1.00 4.39  ? 499  PHE A C     1 
ATOM   3899  O  O     . PHE A 1 499  ? 69.989  105.932 26.619  1.00 3.92  ? 499  PHE A O     1 
ATOM   3900  C  CB    . PHE A 1 499  ? 67.254  105.193 24.893  1.00 5.22  ? 499  PHE A CB    1 
ATOM   3901  C  CG    . PHE A 1 499  ? 66.740  106.313 25.777  1.00 4.67  ? 499  PHE A CG    1 
ATOM   3902  C  CD1   . PHE A 1 499  ? 67.269  107.595 25.673  1.00 5.51  ? 499  PHE A CD1   1 
ATOM   3903  C  CD2   . PHE A 1 499  ? 65.776  106.059 26.740  1.00 3.01  ? 499  PHE A CD2   1 
ATOM   3904  C  CE1   . PHE A 1 499  ? 66.823  108.638 26.502  1.00 4.76  ? 499  PHE A CE1   1 
ATOM   3905  C  CE2   . PHE A 1 499  ? 65.326  107.077 27.582  1.00 5.29  ? 499  PHE A CE2   1 
ATOM   3906  C  CZ    . PHE A 1 499  ? 65.868  108.374 27.466  1.00 3.78  ? 499  PHE A CZ    1 
ATOM   3907  N  N     . ALA A 1 500  ? 70.263  105.599 24.409  1.00 4.30  ? 500  ALA A N     1 
ATOM   3908  C  CA    . ALA A 1 500  ? 71.445  106.427 24.301  1.00 4.63  ? 500  ALA A CA    1 
ATOM   3909  C  C     . ALA A 1 500  ? 71.074  107.907 24.071  1.00 5.20  ? 500  ALA A C     1 
ATOM   3910  O  O     . ALA A 1 500  ? 70.138  108.187 23.323  1.00 3.93  ? 500  ALA A O     1 
ATOM   3911  C  CB    . ALA A 1 500  ? 72.299  105.921 23.161  1.00 4.87  ? 500  ALA A CB    1 
ATOM   3912  N  N     . GLN A 1 501  ? 71.822  108.829 24.706  1.00 3.73  ? 501  GLN A N     1 
ATOM   3913  C  CA    . GLN A 1 501  ? 71.673  110.265 24.473  1.00 3.52  ? 501  GLN A CA    1 
ATOM   3914  C  C     . GLN A 1 501  ? 72.933  110.967 24.897  1.00 3.34  ? 501  GLN A C     1 
ATOM   3915  O  O     . GLN A 1 501  ? 73.340  110.874 26.065  1.00 3.00  ? 501  GLN A O     1 
ATOM   3916  C  CB    . GLN A 1 501  ? 70.445  110.883 25.199  1.00 3.04  ? 501  GLN A CB    1 
ATOM   3917  C  CG    . GLN A 1 501  ? 70.256  110.495 26.691  1.00 4.67  ? 501  GLN A CG    1 
ATOM   3918  C  CD    . GLN A 1 501  ? 69.026  111.136 27.317  1.00 7.23  ? 501  GLN A CD    1 
ATOM   3919  O  OE1   . GLN A 1 501  ? 68.304  111.898 26.653  1.00 5.45  ? 501  GLN A OE1   1 
ATOM   3920  N  NE2   . GLN A 1 501  ? 68.768  110.808 28.587  1.00 4.03  ? 501  GLN A NE2   1 
ATOM   3921  N  N     . VAL A 1 502  ? 73.549  111.641 23.927  1.00 2.14  ? 502  VAL A N     1 
ATOM   3922  C  CA    . VAL A 1 502  ? 74.751  112.461 24.104  1.00 2.29  ? 502  VAL A CA    1 
ATOM   3923  C  C     . VAL A 1 502  ? 76.048  111.667 24.285  1.00 2.81  ? 502  VAL A C     1 
ATOM   3924  O  O     . VAL A 1 502  ? 76.968  111.815 23.469  1.00 3.32  ? 502  VAL A O     1 
ATOM   3925  C  CB    . VAL A 1 502  ? 74.627  113.511 25.268  1.00 1.94  ? 502  VAL A CB    1 
ATOM   3926  C  CG1   . VAL A 1 502  ? 75.971  114.224 25.452  1.00 1.00  ? 502  VAL A CG1   1 
ATOM   3927  C  CG2   . VAL A 1 502  ? 73.525  114.541 24.992  1.00 1.85  ? 502  VAL A CG2   1 
ATOM   3928  N  N     . THR A 1 503  ? 76.131  110.870 25.359  1.00 3.03  ? 503  THR A N     1 
ATOM   3929  C  CA    . THR A 1 503  ? 77.386  110.180 25.707  1.00 3.23  ? 503  THR A CA    1 
ATOM   3930  C  C     . THR A 1 503  ? 77.677  108.981 24.792  1.00 3.85  ? 503  THR A C     1 
ATOM   3931  O  O     . THR A 1 503  ? 78.817  108.526 24.698  1.00 3.79  ? 503  THR A O     1 
ATOM   3932  C  CB    . THR A 1 503  ? 77.470  109.804 27.215  1.00 3.09  ? 503  THR A CB    1 
ATOM   3933  O  OG1   . THR A 1 503  ? 76.283  109.124 27.626  1.00 3.21  ? 503  THR A OG1   1 
ATOM   3934  C  CG2   . THR A 1 503  ? 77.482  111.082 28.104  1.00 2.95  ? 503  THR A CG2   1 
ATOM   3935  N  N     . ASN A 1 504  ? 76.639  108.469 24.138  1.00 3.93  ? 504  ASN A N     1 
ATOM   3936  C  CA    . ASN A 1 504  ? 76.802  107.549 23.018  1.00 4.94  ? 504  ASN A CA    1 
ATOM   3937  C  C     . ASN A 1 504  ? 75.539  107.660 22.165  1.00 5.15  ? 504  ASN A C     1 
ATOM   3938  O  O     . ASN A 1 504  ? 74.507  108.126 22.661  1.00 4.88  ? 504  ASN A O     1 
ATOM   3939  C  CB    . ASN A 1 504  ? 77.073  106.102 23.472  1.00 4.70  ? 504  ASN A CB    1 
ATOM   3940  C  CG    . ASN A 1 504  ? 75.859  105.447 24.123  1.00 5.33  ? 504  ASN A CG    1 
ATOM   3941  O  OD1   . ASN A 1 504  ? 75.408  105.865 25.187  1.00 9.03  ? 504  ASN A OD1   1 
ATOM   3942  N  ND2   . ASN A 1 504  ? 75.331  104.412 23.483  1.00 5.61  ? 504  ASN A ND2   1 
ATOM   3943  N  N     . PRO A 1 505  ? 75.646  107.345 20.870  1.00 5.02  ? 505  PRO A N     1 
ATOM   3944  C  CA    . PRO A 1 505  ? 74.518  107.527 19.961  1.00 4.68  ? 505  PRO A CA    1 
ATOM   3945  C  C     . PRO A 1 505  ? 73.705  106.250 19.749  1.00 4.77  ? 505  PRO A C     1 
ATOM   3946  O  O     . PRO A 1 505  ? 74.233  105.133 19.821  1.00 4.66  ? 505  PRO A O     1 
ATOM   3947  C  CB    . PRO A 1 505  ? 75.207  107.924 18.664  1.00 4.57  ? 505  PRO A CB    1 
ATOM   3948  C  CG    . PRO A 1 505  ? 76.511  107.116 18.683  1.00 5.22  ? 505  PRO A CG    1 
ATOM   3949  C  CD    . PRO A 1 505  ? 76.854  106.904 20.147  1.00 5.10  ? 505  PRO A CD    1 
ATOM   3950  N  N     . PRO A 1 506  ? 72.416  106.422 19.482  1.00 4.57  ? 506  PRO A N     1 
ATOM   3951  C  CA    . PRO A 1 506  ? 71.617  105.329 18.931  1.00 4.22  ? 506  PRO A CA    1 
ATOM   3952  C  C     . PRO A 1 506  ? 72.148  104.995 17.517  1.00 4.74  ? 506  PRO A C     1 
ATOM   3953  O  O     . PRO A 1 506  ? 72.861  105.819 16.929  1.00 4.51  ? 506  PRO A O     1 
ATOM   3954  C  CB    . PRO A 1 506  ? 70.195  105.916 18.885  1.00 4.08  ? 506  PRO A CB    1 
ATOM   3955  C  CG    . PRO A 1 506  ? 70.375  107.400 18.877  1.00 5.10  ? 506  PRO A CG    1 
ATOM   3956  C  CD    . PRO A 1 506  ? 71.650  107.672 19.649  1.00 4.30  ? 506  PRO A CD    1 
ATOM   3957  N  N     . ILE A 1 507  ? 71.845  103.804 16.999  1.00 5.79  ? 507  ILE A N     1 
ATOM   3958  C  CA    . ILE A 1 507  ? 72.122  103.504 15.590  1.00 6.10  ? 507  ILE A CA    1 
ATOM   3959  C  C     . ILE A 1 507  ? 70.799  103.329 14.846  1.00 6.50  ? 507  ILE A C     1 
ATOM   3960  O  O     . ILE A 1 507  ? 69.736  103.220 15.463  1.00 6.15  ? 507  ILE A O     1 
ATOM   3961  C  CB    . ILE A 1 507  ? 73.086  102.277 15.406  1.00 6.33  ? 507  ILE A CB    1 
ATOM   3962  C  CG1   . ILE A 1 507  ? 72.499  100.992 16.024  1.00 5.45  ? 507  ILE A CG1   1 
ATOM   3963  C  CG2   . ILE A 1 507  ? 74.492  102.580 16.008  1.00 6.12  ? 507  ILE A CG2   1 
ATOM   3964  C  CD1   . ILE A 1 507  ? 73.325  99.719  15.736  1.00 5.78  ? 507  ILE A CD1   1 
ATOM   3965  N  N     . ASP A 1 508  ? 70.871  103.306 13.523  1.00 6.44  ? 508  ASP A N     1 
ATOM   3966  C  CA    . ASP A 1 508  ? 69.681  103.222 12.690  1.00 6.85  ? 508  ASP A CA    1 
ATOM   3967  C  C     . ASP A 1 508  ? 69.398  101.764 12.324  1.00 6.80  ? 508  ASP A C     1 
ATOM   3968  O  O     . ASP A 1 508  ? 70.129  101.188 11.518  1.00 7.09  ? 508  ASP A O     1 
ATOM   3969  C  CB    . ASP A 1 508  ? 69.922  104.050 11.435  1.00 7.16  ? 508  ASP A CB    1 
ATOM   3970  C  CG    . ASP A 1 508  ? 68.662  104.321 10.658  1.00 9.10  ? 508  ASP A CG    1 
ATOM   3971  O  OD1   . ASP A 1 508  ? 67.793  103.432 10.588  1.00 7.36  ? 508  ASP A OD1   1 
ATOM   3972  O  OD2   . ASP A 1 508  ? 68.476  105.409 10.064  1.00 12.09 ? 508  ASP A OD2   1 
ATOM   3973  N  N     . PRO A 1 509  ? 68.335  101.177 12.881  1.00 6.69  ? 509  PRO A N     1 
ATOM   3974  C  CA    . PRO A 1 509  ? 68.037  99.751  12.676  1.00 6.49  ? 509  PRO A CA    1 
ATOM   3975  C  C     . PRO A 1 509  ? 67.553  99.381  11.262  1.00 6.35  ? 509  PRO A C     1 
ATOM   3976  O  O     . PRO A 1 509  ? 67.493  98.195  10.942  1.00 6.02  ? 509  PRO A O     1 
ATOM   3977  C  CB    . PRO A 1 509  ? 66.947  99.475  13.714  1.00 6.57  ? 509  PRO A CB    1 
ATOM   3978  C  CG    . PRO A 1 509  ? 66.227  100.809 13.854  1.00 6.20  ? 509  PRO A CG    1 
ATOM   3979  C  CD    . PRO A 1 509  ? 67.331  101.823 13.746  1.00 6.70  ? 509  PRO A CD    1 
ATOM   3980  N  N     . LEU A 1 510  ? 67.200  100.370 10.452  1.00 6.51  ? 510  LEU A N     1 
ATOM   3981  C  CA    . LEU A 1 510  ? 66.772  100.149 9.071   1.00 6.93  ? 510  LEU A CA    1 
ATOM   3982  C  C     . LEU A 1 510  ? 67.923  100.413 8.117   1.00 6.20  ? 510  LEU A C     1 
ATOM   3983  O  O     . LEU A 1 510  ? 68.388  99.500  7.452   1.00 7.22  ? 510  LEU A O     1 
ATOM   3984  C  CB    . LEU A 1 510  ? 65.603  101.086 8.707   1.00 7.85  ? 510  LEU A CB    1 
ATOM   3985  C  CG    . LEU A 1 510  ? 64.361  101.114 9.597   1.00 10.75 ? 510  LEU A CG    1 
ATOM   3986  C  CD1   . LEU A 1 510  ? 63.370  102.187 9.118   1.00 13.48 ? 510  LEU A CD1   1 
ATOM   3987  C  CD2   . LEU A 1 510  ? 63.714  99.745  9.601   1.00 12.81 ? 510  LEU A CD2   1 
ATOM   3988  N  N     . ARG A 1 511  ? 68.397  101.661 8.078   1.00 5.29  ? 511  ARG A N     1 
ATOM   3989  C  CA    . ARG A 1 511  ? 69.454  102.068 7.152   1.00 5.00  ? 511  ARG A CA    1 
ATOM   3990  C  C     . ARG A 1 511  ? 70.770  101.333 7.391   1.00 4.74  ? 511  ARG A C     1 
ATOM   3991  O  O     . ARG A 1 511  ? 71.493  101.042 6.443   1.00 4.26  ? 511  ARG A O     1 
ATOM   3992  C  CB    . ARG A 1 511  ? 69.690  103.581 7.226   1.00 4.23  ? 511  ARG A CB    1 
ATOM   3993  C  CG    . ARG A 1 511  ? 69.019  104.385 6.142   1.00 6.11  ? 511  ARG A CG    1 
ATOM   3994  C  CD    . ARG A 1 511  ? 67.565  104.724 6.410   1.00 8.28  ? 511  ARG A CD    1 
ATOM   3995  N  NE    . ARG A 1 511  ? 66.679  103.563 6.318   1.00 11.46 ? 511  ARG A NE    1 
ATOM   3996  C  CZ    . ARG A 1 511  ? 65.550  103.516 5.623   1.00 14.49 ? 511  ARG A CZ    1 
ATOM   3997  N  NH1   . ARG A 1 511  ? 65.168  104.551 4.876   1.00 19.76 ? 511  ARG A NH1   1 
ATOM   3998  N  NH2   . ARG A 1 511  ? 64.815  102.411 5.617   1.00 12.80 ? 511  ARG A NH2   1 
ATOM   3999  N  N     . GLU A 1 512  ? 71.067  101.050 8.662   1.00 4.82  ? 512  GLU A N     1 
ATOM   4000  C  CA    . GLU A 1 512  ? 72.318  100.381 9.066   1.00 5.32  ? 512  GLU A CA    1 
ATOM   4001  C  C     . GLU A 1 512  ? 72.079  99.020  9.730   1.00 5.11  ? 512  GLU A C     1 
ATOM   4002  O  O     . GLU A 1 512  ? 72.891  98.540  10.540  1.00 5.25  ? 512  GLU A O     1 
ATOM   4003  C  CB    . GLU A 1 512  ? 73.164  101.317 9.958   1.00 5.71  ? 512  GLU A CB    1 
ATOM   4004  C  CG    . GLU A 1 512  ? 73.635  102.543 9.195   1.00 7.25  ? 512  GLU A CG    1 
ATOM   4005  C  CD    . GLU A 1 512  ? 74.403  103.573 10.026  1.00 12.57 ? 512  GLU A CD    1 
ATOM   4006  O  OE1   . GLU A 1 512  ? 75.217  103.191 10.909  1.00 15.38 ? 512  GLU A OE1   1 
ATOM   4007  O  OE2   . GLU A 1 512  ? 74.205  104.785 9.790   1.00 10.69 ? 512  GLU A OE2   1 
ATOM   4008  N  N     . ASN A 1 513  ? 70.966  98.392  9.367   1.00 4.34  ? 513  ASN A N     1 
ATOM   4009  C  CA    . ASN A 1 513  ? 70.701  97.005  9.733   1.00 4.39  ? 513  ASN A CA    1 
ATOM   4010  C  C     . ASN A 1 513  ? 71.858  96.040  9.449   1.00 4.30  ? 513  ASN A C     1 
ATOM   4011  O  O     . ASN A 1 513  ? 72.031  95.060  10.182  1.00 3.72  ? 513  ASN A O     1 
ATOM   4012  C  CB    . ASN A 1 513  ? 69.432  96.478  9.034   1.00 4.09  ? 513  ASN A CB    1 
ATOM   4013  C  CG    . ASN A 1 513  ? 68.864  95.242  9.730   1.00 6.41  ? 513  ASN A CG    1 
ATOM   4014  O  OD1   . ASN A 1 513  ? 68.283  95.336  10.828  1.00 10.14 ? 513  ASN A OD1   1 
ATOM   4015  N  ND2   . ASN A 1 513  ? 69.081  94.078  9.140   1.00 2.58  ? 513  ASN A ND2   1 
ATOM   4016  N  N     . LEU A 1 514  ? 72.629  96.303  8.384   1.00 3.94  ? 514  LEU A N     1 
ATOM   4017  C  CA    . LEU A 1 514  ? 73.690  95.361  7.943   1.00 4.03  ? 514  LEU A CA    1 
ATOM   4018  C  C     . LEU A 1 514  ? 74.766  95.062  8.986   1.00 3.12  ? 514  LEU A C     1 
ATOM   4019  O  O     . LEU A 1 514  ? 75.513  94.099  8.862   1.00 1.45  ? 514  LEU A O     1 
ATOM   4020  C  CB    . LEU A 1 514  ? 74.369  95.809  6.638   1.00 4.05  ? 514  LEU A CB    1 
ATOM   4021  C  CG    . LEU A 1 514  ? 74.956  97.193  6.247   1.00 7.00  ? 514  LEU A CG    1 
ATOM   4022  C  CD1   . LEU A 1 514  ? 75.084  98.317  7.338   1.00 6.21  ? 514  LEU A CD1   1 
ATOM   4023  C  CD2   . LEU A 1 514  ? 76.253  97.022  5.456   1.00 5.56  ? 514  LEU A CD2   1 
ATOM   4024  N  N     . VAL A 1 515  ? 74.811  95.918  9.996   1.00 3.23  ? 515  VAL A N     1 
ATOM   4025  C  CA    . VAL A 1 515  ? 75.798  95.916  11.066  1.00 4.92  ? 515  VAL A CA    1 
ATOM   4026  C  C     . VAL A 1 515  ? 75.271  95.132  12.308  1.00 5.02  ? 515  VAL A C     1 
ATOM   4027  O  O     . VAL A 1 515  ? 76.038  94.735  13.204  1.00 4.95  ? 515  VAL A O     1 
ATOM   4028  C  CB    . VAL A 1 515  ? 76.141  97.426  11.294  1.00 5.75  ? 515  VAL A CB    1 
ATOM   4029  C  CG1   . VAL A 1 515  ? 75.842  97.914  12.649  1.00 5.97  ? 515  VAL A CG1   1 
ATOM   4030  C  CG2   . VAL A 1 515  ? 77.526  97.820  10.719  1.00 7.16  ? 515  VAL A CG2   1 
ATOM   4031  N  N     . MET A 1 516  ? 73.960  94.886  12.329  1.00 4.43  ? 516  MET A N     1 
ATOM   4032  C  CA    . MET A 1 516  ? 73.276  94.233  13.446  1.00 4.05  ? 516  MET A CA    1 
ATOM   4033  C  C     . MET A 1 516  ? 73.013  92.738  13.211  1.00 4.04  ? 516  MET A C     1 
ATOM   4034  O  O     . MET A 1 516  ? 73.040  92.281  12.082  1.00 3.95  ? 516  MET A O     1 
ATOM   4035  C  CB    . MET A 1 516  ? 71.947  94.941  13.696  1.00 3.80  ? 516  MET A CB    1 
ATOM   4036  C  CG    . MET A 1 516  ? 72.043  96.462  13.673  1.00 5.83  ? 516  MET A CG    1 
ATOM   4037  S  SD    . MET A 1 516  ? 70.557  97.298  14.245  1.00 6.19  ? 516  MET A SD    1 
ATOM   4038  C  CE    . MET A 1 516  ? 69.490  96.849  13.037  1.00 14.23 ? 516  MET A CE    1 
ATOM   4039  N  N     . SER A 1 517  ? 72.737  91.987  14.276  1.00 4.24  ? 517  SER A N     1 
ATOM   4040  C  CA    . SER A 1 517  ? 72.383  90.569  14.146  1.00 5.13  ? 517  SER A CA    1 
ATOM   4041  C  C     . SER A 1 517  ? 71.634  90.075  15.358  1.00 4.98  ? 517  SER A C     1 
ATOM   4042  O  O     . SER A 1 517  ? 71.975  90.407  16.489  1.00 4.85  ? 517  SER A O     1 
ATOM   4043  C  CB    . SER A 1 517  ? 73.611  89.682  13.946  1.00 4.75  ? 517  SER A CB    1 
ATOM   4044  O  OG    . SER A 1 517  ? 73.235  88.302  13.935  1.00 7.68  ? 517  SER A OG    1 
ATOM   4045  N  N     . LEU A 1 518  ? 70.618  89.269  15.101  1.00 5.58  ? 518  LEU A N     1 
ATOM   4046  C  CA    . LEU A 1 518  ? 69.830  88.622  16.157  1.00 6.29  ? 518  LEU A CA    1 
ATOM   4047  C  C     . LEU A 1 518  ? 70.285  87.182  16.475  1.00 6.10  ? 518  LEU A C     1 
ATOM   4048  O  O     . LEU A 1 518  ? 69.639  86.469  17.253  1.00 4.80  ? 518  LEU A O     1 
ATOM   4049  C  CB    . LEU A 1 518  ? 68.352  88.626  15.744  1.00 6.42  ? 518  LEU A CB    1 
ATOM   4050  C  CG    . LEU A 1 518  ? 67.394  89.721  16.244  1.00 8.99  ? 518  LEU A CG    1 
ATOM   4051  C  CD1   . LEU A 1 518  ? 68.018  91.027  16.788  1.00 5.54  ? 518  LEU A CD1   1 
ATOM   4052  C  CD2   . LEU A 1 518  ? 66.270  89.987  15.234  1.00 8.33  ? 518  LEU A CD2   1 
ATOM   4053  N  N     . ALA A 1 519  ? 71.406  86.764  15.890  1.00 6.37  ? 519  ALA A N     1 
ATOM   4054  C  CA    . ALA A 1 519  ? 71.909  85.402  16.086  1.00 6.84  ? 519  ALA A CA    1 
ATOM   4055  C  C     . ALA A 1 519  ? 72.157  85.104  17.565  1.00 7.08  ? 519  ALA A C     1 
ATOM   4056  O  O     . ALA A 1 519  ? 72.542  85.991  18.337  1.00 7.06  ? 519  ALA A O     1 
ATOM   4057  C  CB    . ALA A 1 519  ? 73.198  85.184  15.278  1.00 7.32  ? 519  ALA A CB    1 
ATOM   4058  N  N     . MET A 1 520  ? 71.931  83.854  17.957  1.00 7.16  ? 520  MET A N     1 
ATOM   4059  C  CA    . MET A 1 520  ? 72.184  83.429  19.343  1.00 6.74  ? 520  MET A CA    1 
ATOM   4060  C  C     . MET A 1 520  ? 72.775  82.032  19.379  1.00 6.99  ? 520  MET A C     1 
ATOM   4061  O  O     . MET A 1 520  ? 72.554  81.238  18.458  1.00 7.64  ? 520  MET A O     1 
ATOM   4062  C  CB    . MET A 1 520  ? 70.902  83.486  20.183  1.00 7.24  ? 520  MET A CB    1 
ATOM   4063  C  CG    . MET A 1 520  ? 70.288  84.891  20.315  1.00 5.41  ? 520  MET A CG    1 
ATOM   4064  S  SD    . MET A 1 520  ? 71.333  86.040  21.242  1.00 6.78  ? 520  MET A SD    1 
ATOM   4065  C  CE    . MET A 1 520  ? 70.731  85.768  22.874  1.00 6.99  ? 520  MET A CE    1 
ATOM   4066  N  N     . PHE A 1 521  ? 73.514  81.733  20.447  1.00 6.66  ? 521  PHE A N     1 
ATOM   4067  C  CA    . PHE A 1 521  ? 74.202  80.454  20.591  1.00 7.11  ? 521  PHE A CA    1 
ATOM   4068  C  C     . PHE A 1 521  ? 73.783  79.778  21.876  1.00 7.05  ? 521  PHE A C     1 
ATOM   4069  O  O     . PHE A 1 521  ? 73.716  80.413  22.928  1.00 7.13  ? 521  PHE A O     1 
ATOM   4070  C  CB    . PHE A 1 521  ? 75.708  80.662  20.586  1.00 7.43  ? 521  PHE A CB    1 
ATOM   4071  C  CG    . PHE A 1 521  ? 76.228  81.259  19.316  1.00 8.89  ? 521  PHE A CG    1 
ATOM   4072  C  CD1   . PHE A 1 521  ? 76.247  82.644  19.138  1.00 9.77  ? 521  PHE A CD1   1 
ATOM   4073  C  CD2   . PHE A 1 521  ? 76.684  80.441  18.293  1.00 10.58 ? 521  PHE A CD2   1 
ATOM   4074  C  CE1   . PHE A 1 521  ? 76.730  83.209  17.956  1.00 10.76 ? 521  PHE A CE1   1 
ATOM   4075  C  CE2   . PHE A 1 521  ? 77.168  80.995  17.115  1.00 11.07 ? 521  PHE A CE2   1 
ATOM   4076  C  CZ    . PHE A 1 521  ? 77.195  82.384  16.957  1.00 9.56  ? 521  PHE A CZ    1 
ATOM   4077  N  N     . LEU A 1 522  ? 73.473  78.491  21.761  1.00 7.35  ? 522  LEU A N     1 
ATOM   4078  C  CA    . LEU A 1 522  ? 72.950  77.692  22.856  1.00 7.45  ? 522  LEU A CA    1 
ATOM   4079  C  C     . LEU A 1 522  ? 73.965  76.673  23.355  1.00 7.90  ? 522  LEU A C     1 
ATOM   4080  O  O     . LEU A 1 522  ? 74.597  75.984  22.562  1.00 7.11  ? 522  LEU A O     1 
ATOM   4081  C  CB    . LEU A 1 522  ? 71.684  76.951  22.416  1.00 7.28  ? 522  LEU A CB    1 
ATOM   4082  C  CG    . LEU A 1 522  ? 70.469  77.737  21.919  1.00 7.33  ? 522  LEU A CG    1 
ATOM   4083  C  CD1   . LEU A 1 522  ? 69.374  76.773  21.458  1.00 6.13  ? 522  LEU A CD1   1 
ATOM   4084  C  CD2   . LEU A 1 522  ? 69.926  78.716  22.982  1.00 7.34  ? 522  LEU A CD2   1 
ATOM   4085  N  N     . GLY A 1 523  ? 74.119  76.591  24.673  1.00 8.08  ? 523  GLY A N     1 
ATOM   4086  C  CA    . GLY A 1 523  ? 74.931  75.560  25.282  1.00 8.23  ? 523  GLY A CA    1 
ATOM   4087  C  C     . GLY A 1 523  ? 76.045  76.179  26.096  1.00 9.00  ? 523  GLY A C     1 
ATOM   4088  O  O     . GLY A 1 523  ? 76.037  77.393  26.379  1.00 8.63  ? 523  GLY A O     1 
ATOM   4089  N  N     . LYS A 1 524  ? 77.012  75.357  26.475  1.00 9.09  ? 524  LYS A N     1 
ATOM   4090  C  CA    . LYS A 1 524  ? 78.100  75.861  27.309  1.00 10.31 ? 524  LYS A CA    1 
ATOM   4091  C  C     . LYS A 1 524  ? 79.038  76.804  26.538  1.00 10.85 ? 524  LYS A C     1 
ATOM   4092  O  O     . LYS A 1 524  ? 79.202  76.691  25.310  1.00 10.49 ? 524  LYS A O     1 
ATOM   4093  C  CB    . LYS A 1 524  ? 78.823  74.730  28.064  1.00 10.65 ? 524  LYS A CB    1 
ATOM   4094  C  CG    . LYS A 1 524  ? 79.436  73.647  27.219  1.00 12.31 ? 524  LYS A CG    1 
ATOM   4095  C  CD    . LYS A 1 524  ? 80.507  72.887  28.001  1.00 15.46 ? 524  LYS A CD    1 
ATOM   4096  C  CE    . LYS A 1 524  ? 81.693  73.800  28.321  1.00 17.69 ? 524  LYS A CE    1 
ATOM   4097  N  NZ    . LYS A 1 524  ? 82.616  73.170  29.304  1.00 17.03 ? 524  LYS A NZ    1 
ATOM   4098  N  N     . ARG A 1 525  ? 79.566  77.800  27.248  1.00 11.37 ? 525  ARG A N     1 
ATOM   4099  C  CA    . ARG A 1 525  ? 80.439  78.794  26.636  1.00 12.22 ? 525  ARG A CA    1 
ATOM   4100  C  C     . ARG A 1 525  ? 81.846  78.318  26.864  1.00 12.29 ? 525  ARG A C     1 
ATOM   4101  O  O     . ARG A 1 525  ? 82.200  77.969  28.000  1.00 12.77 ? 525  ARG A O     1 
ATOM   4102  C  CB    . ARG A 1 525  ? 80.245  80.161  27.279  1.00 12.44 ? 525  ARG A CB    1 
ATOM   4103  C  CG    . ARG A 1 525  ? 79.191  81.013  26.632  1.00 15.88 ? 525  ARG A CG    1 
ATOM   4104  C  CD    . ARG A 1 525  ? 79.415  82.500  26.829  1.00 19.22 ? 525  ARG A CD    1 
ATOM   4105  N  NE    . ARG A 1 525  ? 78.131  83.185  26.853  1.00 23.14 ? 525  ARG A NE    1 
ATOM   4106  C  CZ    . ARG A 1 525  ? 77.966  84.492  26.755  1.00 24.92 ? 525  ARG A CZ    1 
ATOM   4107  N  NH1   . ARG A 1 525  ? 79.015  85.311  26.627  1.00 24.95 ? 525  ARG A NH1   1 
ATOM   4108  N  NH2   . ARG A 1 525  ? 76.735  84.984  26.777  1.00 26.52 ? 525  ARG A NH2   1 
ATOM   4109  N  N     . GLY A 1 526  ? 82.639  78.280  25.790  1.00 11.80 ? 526  GLY A N     1 
ATOM   4110  C  CA    . GLY A 1 526  ? 83.984  77.731  25.840  1.00 10.90 ? 526  GLY A CA    1 
ATOM   4111  C  C     . GLY A 1 526  ? 85.043  78.585  26.526  1.00 9.99  ? 526  GLY A C     1 
ATOM   4112  O  O     . GLY A 1 526  ? 84.826  79.773  26.800  1.00 10.66 ? 526  GLY A O     1 
ATOM   4113  N  N     . ASN A 1 527  ? 86.183  77.958  26.808  1.00 9.58  ? 527  ASN A N     1 
ATOM   4114  C  CA    . ASN A 1 527  ? 87.372  78.630  27.318  1.00 9.16  ? 527  ASN A CA    1 
ATOM   4115  C  C     . ASN A 1 527  ? 87.794  79.756  26.371  1.00 9.26  ? 527  ASN A C     1 
ATOM   4116  O  O     . ASN A 1 527  ? 88.223  79.519  25.239  1.00 9.12  ? 527  ASN A O     1 
ATOM   4117  C  CB    . ASN A 1 527  ? 88.510  77.611  27.513  1.00 9.32  ? 527  ASN A CB    1 
ATOM   4118  C  CG    . ASN A 1 527  ? 89.735  78.200  28.207  1.00 8.23  ? 527  ASN A CG    1 
ATOM   4119  O  OD1   . ASN A 1 527  ? 89.961  79.418  28.191  1.00 8.15  ? 527  ASN A OD1   1 
ATOM   4120  N  ND2   . ASN A 1 527  ? 90.537  77.336  28.815  1.00 5.28  ? 527  ASN A ND2   1 
ATOM   4121  N  N     . LEU A 1 528  ? 87.663  80.989  26.839  1.00 9.07  ? 528  LEU A N     1 
ATOM   4122  C  CA    . LEU A 1 528  ? 88.036  82.147  26.029  1.00 9.22  ? 528  LEU A CA    1 
ATOM   4123  C  C     . LEU A 1 528  ? 89.544  82.235  25.771  1.00 9.05  ? 528  LEU A C     1 
ATOM   4124  O  O     . LEU A 1 528  ? 89.974  82.743  24.732  1.00 9.41  ? 528  LEU A O     1 
ATOM   4125  C  CB    . LEU A 1 528  ? 87.525  83.437  26.674  1.00 9.19  ? 528  LEU A CB    1 
ATOM   4126  C  CG    . LEU A 1 528  ? 87.928  84.788  26.048  1.00 9.97  ? 528  LEU A CG    1 
ATOM   4127  C  CD1   . LEU A 1 528  ? 87.282  84.971  24.704  1.00 10.46 ? 528  LEU A CD1   1 
ATOM   4128  C  CD2   . LEU A 1 528  ? 87.578  85.950  26.969  1.00 9.95  ? 528  LEU A CD2   1 
ATOM   4129  N  N     . LEU A 1 529  ? 90.339  81.724  26.702  1.00 8.62  ? 529  LEU A N     1 
ATOM   4130  C  CA    . LEU A 1 529  ? 91.790  81.908  26.648  1.00 8.80  ? 529  LEU A CA    1 
ATOM   4131  C  C     . LEU A 1 529  ? 92.517  80.874  25.781  1.00 9.48  ? 529  LEU A C     1 
ATOM   4132  O  O     . LEU A 1 529  ? 93.595  81.153  25.245  1.00 9.47  ? 529  LEU A O     1 
ATOM   4133  C  CB    . LEU A 1 529  ? 92.372  81.925  28.068  1.00 8.57  ? 529  LEU A CB    1 
ATOM   4134  C  CG    . LEU A 1 529  ? 91.654  82.800  29.114  1.00 8.25  ? 529  LEU A CG    1 
ATOM   4135  C  CD1   . LEU A 1 529  ? 92.314  82.659  30.491  1.00 8.17  ? 529  LEU A CD1   1 
ATOM   4136  C  CD2   . LEU A 1 529  ? 91.630  84.248  28.679  1.00 8.00  ? 529  LEU A CD2   1 
ATOM   4137  N  N     . GLU A 1 530  ? 91.920  79.693  25.646  1.00 9.55  ? 530  GLU A N     1 
ATOM   4138  C  CA    . GLU A 1 530  ? 92.541  78.585  24.932  1.00 10.77 ? 530  GLU A CA    1 
ATOM   4139  C  C     . GLU A 1 530  ? 91.592  78.066  23.874  1.00 10.58 ? 530  GLU A C     1 
ATOM   4140  O  O     . GLU A 1 530  ? 90.669  77.315  24.195  1.00 11.40 ? 530  GLU A O     1 
ATOM   4141  C  CB    . GLU A 1 530  ? 92.867  77.440  25.888  1.00 10.66 ? 530  GLU A CB    1 
ATOM   4142  C  CG    . GLU A 1 530  ? 94.081  77.706  26.734  1.00 12.87 ? 530  GLU A CG    1 
ATOM   4143  C  CD    . GLU A 1 530  ? 95.321  77.033  26.203  1.00 15.49 ? 530  GLU A CD    1 
ATOM   4144  O  OE1   . GLU A 1 530  ? 95.648  77.233  25.004  1.00 17.18 ? 530  GLU A OE1   1 
ATOM   4145  O  OE2   . GLU A 1 530  ? 95.972  76.321  26.996  1.00 14.80 ? 530  GLU A OE2   1 
ATOM   4146  N  N     . PRO A 1 531  ? 91.814  78.470  22.622  1.00 10.24 ? 531  PRO A N     1 
ATOM   4147  C  CA    . PRO A 1 531  ? 90.952  78.052  21.507  1.00 9.31  ? 531  PRO A CA    1 
ATOM   4148  C  C     . PRO A 1 531  ? 91.041  76.551  21.256  1.00 8.42  ? 531  PRO A C     1 
ATOM   4149  O  O     . PRO A 1 531  ? 92.133  76.015  21.135  1.00 7.73  ? 531  PRO A O     1 
ATOM   4150  C  CB    . PRO A 1 531  ? 91.524  78.824  20.314  1.00 9.36  ? 531  PRO A CB    1 
ATOM   4151  C  CG    . PRO A 1 531  ? 92.298  79.949  20.937  1.00 9.91  ? 531  PRO A CG    1 
ATOM   4152  C  CD    . PRO A 1 531  ? 92.893  79.377  22.184  1.00 9.97  ? 531  PRO A CD    1 
ATOM   4153  N  N     . LYS A 1 532  ? 89.889  75.894  21.197  1.00 7.88  ? 532  LYS A N     1 
ATOM   4154  C  CA    . LYS A 1 532  ? 89.822  74.477  20.849  1.00 7.58  ? 532  LYS A CA    1 
ATOM   4155  C  C     . LYS A 1 532  ? 88.530  74.126  20.106  1.00 7.07  ? 532  LYS A C     1 
ATOM   4156  O  O     . LYS A 1 532  ? 87.502  74.805  20.247  1.00 6.11  ? 532  LYS A O     1 
ATOM   4157  C  CB    . LYS A 1 532  ? 89.994  73.578  22.083  1.00 8.07  ? 532  LYS A CB    1 
ATOM   4158  C  CG    . LYS A 1 532  ? 89.798  74.247  23.437  1.00 10.18 ? 532  LYS A CG    1 
ATOM   4159  C  CD    . LYS A 1 532  ? 90.007  73.241  24.574  1.00 11.08 ? 532  LYS A CD    1 
ATOM   4160  C  CE    . LYS A 1 532  ? 90.585  73.913  25.806  1.00 12.04 ? 532  LYS A CE    1 
ATOM   4161  N  NZ    . LYS A 1 532  ? 91.436  72.968  26.581  1.00 14.51 ? 532  LYS A NZ    1 
ATOM   4162  N  N     . ALA A 1 533  ? 88.604  73.057  19.312  1.00 7.11  ? 533  ALA A N     1 
ATOM   4163  C  CA    . ALA A 1 533  ? 87.464  72.528  18.563  1.00 7.19  ? 533  ALA A CA    1 
ATOM   4164  C  C     . ALA A 1 533  ? 86.203  72.391  19.428  1.00 7.36  ? 533  ALA A C     1 
ATOM   4165  O  O     . ALA A 1 533  ? 85.138  72.833  19.026  1.00 6.60  ? 533  ALA A O     1 
ATOM   4166  C  CB    . ALA A 1 533  ? 87.835  71.178  17.926  1.00 7.15  ? 533  ALA A CB    1 
ATOM   4167  N  N     . GLU A 1 534  ? 86.346  71.796  20.619  1.00 8.22  ? 534  GLU A N     1 
ATOM   4168  C  CA    . GLU A 1 534  ? 85.244  71.597  21.582  1.00 8.68  ? 534  GLU A CA    1 
ATOM   4169  C  C     . GLU A 1 534  ? 84.356  72.824  21.768  1.00 8.55  ? 534  GLU A C     1 
ATOM   4170  O  O     . GLU A 1 534  ? 83.133  72.701  21.912  1.00 8.24  ? 534  GLU A O     1 
ATOM   4171  C  CB    . GLU A 1 534  ? 85.809  71.213  22.957  1.00 9.26  ? 534  GLU A CB    1 
ATOM   4172  C  CG    . GLU A 1 534  ? 85.834  69.723  23.278  1.00 11.98 ? 534  GLU A CG    1 
ATOM   4173  C  CD    . GLU A 1 534  ? 86.610  69.402  24.558  1.00 15.55 ? 534  GLU A CD    1 
ATOM   4174  O  OE1   . GLU A 1 534  ? 86.874  70.339  25.364  1.00 17.10 ? 534  GLU A OE1   1 
ATOM   4175  O  OE2   . GLU A 1 534  ? 86.961  68.210  24.764  1.00 17.25 ? 534  GLU A OE2   1 
ATOM   4176  N  N     . SER A 1 535  ? 84.973  74.008  21.760  1.00 8.30  ? 535  SER A N     1 
ATOM   4177  C  CA    . SER A 1 535  ? 84.283  75.250  22.071  1.00 8.39  ? 535  SER A CA    1 
ATOM   4178  C  C     . SER A 1 535  ? 83.323  75.706  20.974  1.00 8.28  ? 535  SER A C     1 
ATOM   4179  O  O     . SER A 1 535  ? 82.502  76.600  21.195  1.00 7.89  ? 535  SER A O     1 
ATOM   4180  C  CB    . SER A 1 535  ? 85.288  76.372  22.350  1.00 8.73  ? 535  SER A CB    1 
ATOM   4181  O  OG    . SER A 1 535  ? 86.218  75.975  23.336  1.00 10.10 ? 535  SER A OG    1 
ATOM   4182  N  N     . ALA A 1 536  ? 83.450  75.104  19.796  1.00 8.14  ? 536  ALA A N     1 
ATOM   4183  C  CA    . ALA A 1 536  ? 82.547  75.388  18.679  1.00 7.98  ? 536  ALA A CA    1 
ATOM   4184  C  C     . ALA A 1 536  ? 81.308  74.493  18.726  1.00 7.89  ? 536  ALA A C     1 
ATOM   4185  O  O     . ALA A 1 536  ? 80.416  74.642  17.897  1.00 7.65  ? 536  ALA A O     1 
ATOM   4186  C  CB    . ALA A 1 536  ? 83.274  75.234  17.338  1.00 7.84  ? 536  ALA A CB    1 
ATOM   4187  N  N     . ARG A 1 537  ? 81.265  73.560  19.678  1.00 7.93  ? 537  ARG A N     1 
ATOM   4188  C  CA    . ARG A 1 537  ? 80.092  72.699  19.857  1.00 8.65  ? 537  ARG A CA    1 
ATOM   4189  C  C     . ARG A 1 537  ? 79.005  73.543  20.486  1.00 8.55  ? 537  ARG A C     1 
ATOM   4190  O  O     . ARG A 1 537  ? 79.114  73.957  21.644  1.00 9.24  ? 537  ARG A O     1 
ATOM   4191  C  CB    . ARG A 1 537  ? 80.399  71.435  20.688  1.00 8.68  ? 537  ARG A CB    1 
ATOM   4192  C  CG    . ARG A 1 537  ? 79.512  70.223  20.325  1.00 10.66 ? 537  ARG A CG    1 
ATOM   4193  C  CD    . ARG A 1 537  ? 79.615  68.985  21.274  1.00 12.82 ? 537  ARG A CD    1 
ATOM   4194  N  NE    . ARG A 1 537  ? 78.808  69.237  22.463  1.00 16.01 ? 537  ARG A NE    1 
ATOM   4195  C  CZ    . ARG A 1 537  ? 78.767  68.501  23.562  1.00 17.41 ? 537  ARG A CZ    1 
ATOM   4196  N  NH1   . ARG A 1 537  ? 79.487  67.387  23.691  1.00 19.51 ? 537  ARG A NH1   1 
ATOM   4197  N  NH2   . ARG A 1 537  ? 77.985  68.898  24.557  1.00 19.42 ? 537  ARG A NH2   1 
ATOM   4198  N  N     . THR A 1 538  ? 77.991  73.851  19.686  1.00 7.89  ? 538  THR A N     1 
ATOM   4199  C  CA    . THR A 1 538  ? 76.933  74.779  20.070  1.00 7.85  ? 538  THR A CA    1 
ATOM   4200  C  C     . THR A 1 538  ? 75.731  74.554  19.154  1.00 7.30  ? 538  THR A C     1 
ATOM   4201  O  O     . THR A 1 538  ? 75.834  73.834  18.161  1.00 7.68  ? 538  THR A O     1 
ATOM   4202  C  CB    . THR A 1 538  ? 77.426  76.271  19.972  1.00 7.96  ? 538  THR A CB    1 
ATOM   4203  O  OG1   . THR A 1 538  ? 76.371  77.139  20.385  1.00 10.23 ? 538  THR A OG1   1 
ATOM   4204  C  CG2   . THR A 1 538  ? 77.658  76.708  18.508  1.00 7.44  ? 538  THR A CG2   1 
ATOM   4205  N  N     . ILE A 1 539  ? 74.591  75.146  19.493  1.00 6.64  ? 539  ILE A N     1 
ATOM   4206  C  CA    . ILE A 1 539  ? 73.486  75.211  18.546  1.00 6.27  ? 539  ILE A CA    1 
ATOM   4207  C  C     . ILE A 1 539  ? 73.295  76.679  18.204  1.00 5.94  ? 539  ILE A C     1 
ATOM   4208  O  O     . ILE A 1 539  ? 73.012  77.487  19.083  1.00 6.16  ? 539  ILE A O     1 
ATOM   4209  C  CB    . ILE A 1 539  ? 72.185  74.586  19.102  1.00 5.94  ? 539  ILE A CB    1 
ATOM   4210  C  CG1   . ILE A 1 539  ? 72.345  73.075  19.278  1.00 6.89  ? 539  ILE A CG1   1 
ATOM   4211  C  CG2   . ILE A 1 539  ? 70.989  74.926  18.179  1.00 5.57  ? 539  ILE A CG2   1 
ATOM   4212  C  CD1   . ILE A 1 539  ? 71.157  72.394  19.935  1.00 7.22  ? 539  ILE A CD1   1 
ATOM   4213  N  N     . LYS A 1 540  ? 73.498  77.027  16.940  1.00 6.05  ? 540  LYS A N     1 
ATOM   4214  C  CA    . LYS A 1 540  ? 73.293  78.412  16.509  1.00 6.41  ? 540  LYS A CA    1 
ATOM   4215  C  C     . LYS A 1 540  ? 71.866  78.611  16.014  1.00 6.34  ? 540  LYS A C     1 
ATOM   4216  O  O     . LYS A 1 540  ? 71.342  77.783  15.259  1.00 6.46  ? 540  LYS A O     1 
ATOM   4217  C  CB    . LYS A 1 540  ? 74.288  78.801  15.423  1.00 6.66  ? 540  LYS A CB    1 
ATOM   4218  C  CG    . LYS A 1 540  ? 74.007  80.156  14.804  1.00 8.10  ? 540  LYS A CG    1 
ATOM   4219  C  CD    . LYS A 1 540  ? 75.172  80.658  13.974  1.00 9.71  ? 540  LYS A CD    1 
ATOM   4220  C  CE    . LYS A 1 540  ? 74.889  82.069  13.432  1.00 9.65  ? 540  LYS A CE    1 
ATOM   4221  N  NZ    . LYS A 1 540  ? 76.013  82.503  12.542  1.00 11.13 ? 540  LYS A NZ    1 
ATOM   4222  N  N     . LEU A 1 541  ? 71.252  79.696  16.480  1.00 6.35  ? 541  LEU A N     1 
ATOM   4223  C  CA    . LEU A 1 541  ? 69.936  80.167  16.057  1.00 6.94  ? 541  LEU A CA    1 
ATOM   4224  C  C     . LEU A 1 541  ? 70.126  81.424  15.220  1.00 7.39  ? 541  LEU A C     1 
ATOM   4225  O  O     . LEU A 1 541  ? 71.014  82.219  15.499  1.00 6.94  ? 541  LEU A O     1 
ATOM   4226  C  CB    . LEU A 1 541  ? 69.100  80.535  17.291  1.00 5.74  ? 541  LEU A CB    1 
ATOM   4227  C  CG    . LEU A 1 541  ? 68.185  79.533  18.003  1.00 7.90  ? 541  LEU A CG    1 
ATOM   4228  C  CD1   . LEU A 1 541  ? 68.337  78.046  17.548  1.00 7.01  ? 541  LEU A CD1   1 
ATOM   4229  C  CD2   . LEU A 1 541  ? 68.270  79.658  19.497  1.00 5.60  ? 541  LEU A CD2   1 
ATOM   4230  N  N     . ARG A 1 542  ? 69.309  81.622  14.190  1.00 8.12  ? 542  ARG A N     1 
ATOM   4231  C  CA    . ARG A 1 542  ? 69.426  82.878  13.456  1.00 9.49  ? 542  ARG A CA    1 
ATOM   4232  C  C     . ARG A 1 542  ? 68.589  84.000  14.100  1.00 9.84  ? 542  ARG A C     1 
ATOM   4233  O  O     . ARG A 1 542  ? 68.725  85.192  13.751  1.00 9.04  ? 542  ARG A O     1 
ATOM   4234  C  CB    . ARG A 1 542  ? 69.120  82.670  11.972  1.00 10.21 ? 542  ARG A CB    1 
ATOM   4235  C  CG    . ARG A 1 542  ? 67.674  82.684  11.591  1.00 12.14 ? 542  ARG A CG    1 
ATOM   4236  C  CD    . ARG A 1 542  ? 67.434  82.168  10.177  1.00 15.95 ? 542  ARG A CD    1 
ATOM   4237  N  NE    . ARG A 1 542  ? 66.098  81.601  10.080  1.00 17.75 ? 542  ARG A NE    1 
ATOM   4238  C  CZ    . ARG A 1 542  ? 65.508  81.243  8.953   1.00 18.31 ? 542  ARG A CZ    1 
ATOM   4239  N  NH1   . ARG A 1 542  ? 66.139  81.380  7.792   1.00 18.64 ? 542  ARG A NH1   1 
ATOM   4240  N  NH2   . ARG A 1 542  ? 64.276  80.748  8.996   1.00 18.01 ? 542  ARG A NH2   1 
ATOM   4241  N  N     . SER A 1 543  ? 67.743  83.597  15.054  1.00 10.06 ? 543  SER A N     1 
ATOM   4242  C  CA    . SER A 1 543  ? 66.797  84.488  15.726  1.00 10.14 ? 543  SER A CA    1 
ATOM   4243  C  C     . SER A 1 543  ? 66.389  83.868  17.063  1.00 9.37  ? 543  SER A C     1 
ATOM   4244  O  O     . SER A 1 543  ? 66.293  82.647  17.161  1.00 9.77  ? 543  SER A O     1 
ATOM   4245  C  CB    . SER A 1 543  ? 65.553  84.655  14.858  1.00 10.72 ? 543  SER A CB    1 
ATOM   4246  O  OG    . SER A 1 543  ? 64.494  85.275  15.579  1.00 11.81 ? 543  SER A OG    1 
ATOM   4247  N  N     . PRO A 1 544  ? 66.114  84.709  18.060  1.00 8.75  ? 544  PRO A N     1 
ATOM   4248  C  CA    . PRO A 1 544  ? 65.695  84.254  19.387  1.00 8.31  ? 544  PRO A CA    1 
ATOM   4249  C  C     . PRO A 1 544  ? 64.259  83.744  19.424  1.00 8.37  ? 544  PRO A C     1 
ATOM   4250  O  O     . PRO A 1 544  ? 63.899  83.041  20.371  1.00 9.24  ? 544  PRO A O     1 
ATOM   4251  C  CB    . PRO A 1 544  ? 65.791  85.538  20.223  1.00 8.86  ? 544  PRO A CB    1 
ATOM   4252  C  CG    . PRO A 1 544  ? 65.478  86.626  19.230  1.00 7.44  ? 544  PRO A CG    1 
ATOM   4253  C  CD    . PRO A 1 544  ? 66.197  86.186  18.002  1.00 8.71  ? 544  PRO A CD    1 
ATOM   4254  N  N     . LEU A 1 545  ? 63.457  84.092  18.422  1.00 7.80  ? 545  LEU A N     1 
ATOM   4255  C  CA    . LEU A 1 545  ? 62.094  83.603  18.354  1.00 7.42  ? 545  LEU A CA    1 
ATOM   4256  C  C     . LEU A 1 545  ? 62.113  82.200  17.762  1.00 7.25  ? 545  LEU A C     1 
ATOM   4257  O  O     . LEU A 1 545  ? 62.327  82.017  16.563  1.00 7.58  ? 545  LEU A O     1 
ATOM   4258  C  CB    . LEU A 1 545  ? 61.207  84.543  17.530  1.00 6.82  ? 545  LEU A CB    1 
ATOM   4259  C  CG    . LEU A 1 545  ? 59.689  84.431  17.759  1.00 7.15  ? 545  LEU A CG    1 
ATOM   4260  C  CD1   . LEU A 1 545  ? 58.974  85.550  17.027  1.00 5.81  ? 545  LEU A CD1   1 
ATOM   4261  C  CD2   . LEU A 1 545  ? 59.128  83.088  17.314  1.00 8.26  ? 545  LEU A CD2   1 
ATOM   4262  N  N     . VAL A 1 546  ? 61.896  81.206  18.606  1.00 7.48  ? 546  VAL A N     1 
ATOM   4263  C  CA    . VAL A 1 546  ? 61.864  79.826  18.137  1.00 7.30  ? 546  VAL A CA    1 
ATOM   4264  C  C     . VAL A 1 546  ? 60.413  79.384  17.957  1.00 7.14  ? 546  VAL A C     1 
ATOM   4265  O  O     . VAL A 1 546  ? 59.594  79.519  18.862  1.00 7.70  ? 546  VAL A O     1 
ATOM   4266  C  CB    . VAL A 1 546  ? 62.715  78.868  19.018  1.00 8.37  ? 546  VAL A CB    1 
ATOM   4267  C  CG1   . VAL A 1 546  ? 64.165  79.362  19.086  1.00 7.11  ? 546  VAL A CG1   1 
ATOM   4268  C  CG2   . VAL A 1 546  ? 62.171  78.758  20.428  1.00 9.77  ? 546  VAL A CG2   1 
ATOM   4269  N  N     . ASN A 1 547  ? 60.081  78.917  16.763  1.00 6.60  ? 547  ASN A N     1 
ATOM   4270  C  CA    . ASN A 1 547  ? 58.730  78.428  16.521  1.00 6.32  ? 547  ASN A CA    1 
ATOM   4271  C  C     . ASN A 1 547  ? 58.645  76.960  16.927  1.00 5.78  ? 547  ASN A C     1 
ATOM   4272  O  O     . ASN A 1 547  ? 59.650  76.409  17.381  1.00 4.99  ? 547  ASN A O     1 
ATOM   4273  C  CB    . ASN A 1 547  ? 58.272  78.722  15.084  1.00 6.34  ? 547  ASN A CB    1 
ATOM   4274  C  CG    . ASN A 1 547  ? 59.024  77.919  14.029  1.00 8.37  ? 547  ASN A CG    1 
ATOM   4275  O  OD1   . ASN A 1 547  ? 59.557  76.830  14.291  1.00 9.31  ? 547  ASN A OD1   1 
ATOM   4276  N  ND2   . ASN A 1 547  ? 59.037  78.445  12.813  1.00 8.33  ? 547  ASN A ND2   1 
ATOM   4277  N  N     . GLU A 1 548  ? 57.462  76.344  16.809  1.00 5.66  ? 548  GLU A N     1 
ATOM   4278  C  CA    . GLU A 1 548  ? 57.251  74.990  17.329  1.00 6.00  ? 548  GLU A CA    1 
ATOM   4279  C  C     . GLU A 1 548  ? 58.182  73.985  16.644  1.00 5.95  ? 548  GLU A C     1 
ATOM   4280  O  O     . GLU A 1 548  ? 58.686  73.068  17.288  1.00 6.02  ? 548  GLU A O     1 
ATOM   4281  C  CB    . GLU A 1 548  ? 55.783  74.521  17.160  1.00 6.69  ? 548  GLU A CB    1 
ATOM   4282  C  CG    . GLU A 1 548  ? 54.733  75.294  17.968  1.00 7.96  ? 548  GLU A CG    1 
ATOM   4283  C  CD    . GLU A 1 548  ? 54.678  74.934  19.450  1.00 9.75  ? 548  GLU A CD    1 
ATOM   4284  O  OE1   . GLU A 1 548  ? 55.480  74.085  19.922  1.00 13.06 ? 548  GLU A OE1   1 
ATOM   4285  O  OE2   . GLU A 1 548  ? 53.820  75.506  20.159  1.00 9.41  ? 548  GLU A OE2   1 
ATOM   4286  N  N     . VAL A 1 549  ? 58.394  74.161  15.338  1.00 5.32  ? 549  VAL A N     1 
ATOM   4287  C  CA    . VAL A 1 549  ? 59.322  73.323  14.579  1.00 5.48  ? 549  VAL A CA    1 
ATOM   4288  C  C     . VAL A 1 549  ? 60.753  73.461  15.111  1.00 4.99  ? 549  VAL A C     1 
ATOM   4289  O  O     . VAL A 1 549  ? 61.432  72.456  15.330  1.00 3.94  ? 549  VAL A O     1 
ATOM   4290  C  CB    . VAL A 1 549  ? 59.269  73.620  13.047  1.00 5.51  ? 549  VAL A CB    1 
ATOM   4291  C  CG1   . VAL A 1 549  ? 60.345  72.836  12.314  1.00 6.46  ? 549  VAL A CG1   1 
ATOM   4292  C  CG2   . VAL A 1 549  ? 57.903  73.234  12.476  1.00 6.33  ? 549  VAL A CG2   1 
ATOM   4293  N  N     . GLU A 1 550  ? 61.197  74.703  15.323  1.00 4.82  ? 550  GLU A N     1 
ATOM   4294  C  CA    . GLU A 1 550  ? 62.549  74.969  15.820  1.00 5.12  ? 550  GLU A CA    1 
ATOM   4295  C  C     . GLU A 1 550  ? 62.741  74.472  17.260  1.00 5.22  ? 550  GLU A C     1 
ATOM   4296  O  O     . GLU A 1 550  ? 63.777  73.883  17.586  1.00 5.05  ? 550  GLU A O     1 
ATOM   4297  C  CB    . GLU A 1 550  ? 62.904  76.461  15.684  1.00 5.18  ? 550  GLU A CB    1 
ATOM   4298  C  CG    . GLU A 1 550  ? 63.083  76.898  14.225  1.00 5.68  ? 550  GLU A CG    1 
ATOM   4299  C  CD    . GLU A 1 550  ? 62.822  78.378  13.982  1.00 10.42 ? 550  GLU A CD    1 
ATOM   4300  O  OE1   . GLU A 1 550  ? 63.200  78.876  12.884  1.00 10.80 ? 550  GLU A OE1   1 
ATOM   4301  O  OE2   . GLU A 1 550  ? 62.259  79.055  14.875  1.00 8.04  ? 550  GLU A OE2   1 
ATOM   4302  N  N     . LEU A 1 551  ? 61.734  74.682  18.105  1.00 5.06  ? 551  LEU A N     1 
ATOM   4303  C  CA    . LEU A 1 551  ? 61.788  74.190  19.476  1.00 5.39  ? 551  LEU A CA    1 
ATOM   4304  C  C     . LEU A 1 551  ? 61.977  72.669  19.544  1.00 5.24  ? 551  LEU A C     1 
ATOM   4305  O  O     . LEU A 1 551  ? 62.774  72.179  20.346  1.00 5.28  ? 551  LEU A O     1 
ATOM   4306  C  CB    . LEU A 1 551  ? 60.557  74.617  20.286  1.00 5.55  ? 551  LEU A CB    1 
ATOM   4307  C  CG    . LEU A 1 551  ? 60.627  74.249  21.786  1.00 4.90  ? 551  LEU A CG    1 
ATOM   4308  C  CD1   . LEU A 1 551  ? 61.656  75.099  22.520  1.00 6.05  ? 551  LEU A CD1   1 
ATOM   4309  C  CD2   . LEU A 1 551  ? 59.266  74.393  22.437  1.00 5.99  ? 551  LEU A CD2   1 
ATOM   4310  N  N     . GLN A 1 552  ? 61.261  71.930  18.700  1.00 5.28  ? 552  GLN A N     1 
ATOM   4311  C  CA    . GLN A 1 552  ? 61.384  70.475  18.682  1.00 5.65  ? 552  GLN A CA    1 
ATOM   4312  C  C     . GLN A 1 552  ? 62.786  70.058  18.212  1.00 5.35  ? 552  GLN A C     1 
ATOM   4313  O  O     . GLN A 1 552  ? 63.390  69.126  18.765  1.00 5.11  ? 552  GLN A O     1 
ATOM   4314  C  CB    . GLN A 1 552  ? 60.288  69.838  17.809  1.00 5.56  ? 552  GLN A CB    1 
ATOM   4315  C  CG    . GLN A 1 552  ? 60.348  68.298  17.724  1.00 7.97  ? 552  GLN A CG    1 
ATOM   4316  C  CD    . GLN A 1 552  ? 60.162  67.614  19.079  1.00 9.40  ? 552  GLN A CD    1 
ATOM   4317  O  OE1   . GLN A 1 552  ? 59.751  68.246  20.062  1.00 9.58  ? 552  GLN A OE1   1 
ATOM   4318  N  NE2   . GLN A 1 552  ? 60.465  66.325  19.130  1.00 11.37 ? 552  GLN A NE2   1 
ATOM   4319  N  N     . ALA A 1 553  ? 63.288  70.763  17.201  1.00 4.71  ? 553  ALA A N     1 
ATOM   4320  C  CA    . ALA A 1 553  ? 64.622  70.526  16.654  1.00 4.86  ? 553  ALA A CA    1 
ATOM   4321  C  C     . ALA A 1 553  ? 65.714  70.757  17.704  1.00 4.71  ? 553  ALA A C     1 
ATOM   4322  O  O     . ALA A 1 553  ? 66.705  70.032  17.744  1.00 5.07  ? 553  ALA A O     1 
ATOM   4323  C  CB    . ALA A 1 553  ? 64.859  71.415  15.438  1.00 4.41  ? 553  ALA A CB    1 
ATOM   4324  N  N     . ILE A 1 554  ? 65.528  71.760  18.549  1.00 4.57  ? 554  ILE A N     1 
ATOM   4325  C  CA    . ILE A 1 554  ? 66.454  72.008  19.654  1.00 5.16  ? 554  ILE A CA    1 
ATOM   4326  C  C     . ILE A 1 554  ? 66.413  70.827  20.646  1.00 5.43  ? 554  ILE A C     1 
ATOM   4327  O  O     . ILE A 1 554  ? 67.460  70.296  21.019  1.00 5.38  ? 554  ILE A O     1 
ATOM   4328  C  CB    . ILE A 1 554  ? 66.153  73.362  20.339  1.00 4.90  ? 554  ILE A CB    1 
ATOM   4329  C  CG1   . ILE A 1 554  ? 66.332  74.517  19.346  1.00 5.07  ? 554  ILE A CG1   1 
ATOM   4330  C  CG2   . ILE A 1 554  ? 67.083  73.588  21.535  1.00 6.37  ? 554  ILE A CG2   1 
ATOM   4331  C  CD1   . ILE A 1 554  ? 65.812  75.876  19.854  1.00 5.14  ? 554  ILE A CD1   1 
ATOM   4332  N  N     . LYS A 1 555  ? 65.202  70.398  21.007  1.00 5.58  ? 555  LYS A N     1 
ATOM   4333  C  CA    . LYS A 1 555  ? 64.980  69.329  21.985  1.00 6.71  ? 555  LYS A CA    1 
ATOM   4334  C  C     . LYS A 1 555  ? 65.617  68.017  21.561  1.00 7.35  ? 555  LYS A C     1 
ATOM   4335  O  O     . LYS A 1 555  ? 66.082  67.246  22.395  1.00 7.30  ? 555  LYS A O     1 
ATOM   4336  C  CB    . LYS A 1 555  ? 63.480  69.122  22.224  1.00 6.18  ? 555  LYS A CB    1 
ATOM   4337  C  CG    . LYS A 1 555  ? 62.848  70.216  23.063  1.00 6.61  ? 555  LYS A CG    1 
ATOM   4338  C  CD    . LYS A 1 555  ? 61.353  70.012  23.184  1.00 6.24  ? 555  LYS A CD    1 
ATOM   4339  C  CE    . LYS A 1 555  ? 60.731  71.105  24.042  1.00 8.20  ? 555  LYS A CE    1 
ATOM   4340  N  NZ    . LYS A 1 555  ? 59.269  70.893  24.219  1.00 8.49  ? 555  LYS A NZ    1 
ATOM   4341  N  N     . THR A 1 556  ? 65.616  67.767  20.255  1.00 8.48  ? 556  THR A N     1 
ATOM   4342  C  CA    . THR A 1 556  ? 66.359  66.652  19.683  1.00 10.05 ? 556  THR A CA    1 
ATOM   4343  C  C     . THR A 1 556  ? 67.839  66.886  19.929  1.00 10.17 ? 556  THR A C     1 
ATOM   4344  O  O     . THR A 1 556  ? 68.481  66.156  20.738  1.00 11.77 ? 556  THR A O     1 
ATOM   4345  C  CB    . THR A 1 556  ? 66.150  66.634  18.182  1.00 10.42 ? 556  THR A CB    1 
ATOM   4346  O  OG1   . THR A 1 556  ? 64.810  66.250  17.888  1.00 11.56 ? 556  THR A OG1   1 
ATOM   4347  C  CG2   . THR A 1 556  ? 67.016  65.569  17.551  1.00 12.67 ? 556  THR A CG2   1 
ATOM   4348  N  N     . GLY A 1 557  ? 68.311  67.975  19.311  1.00 8.74  ? 557  GLY A N     1 
ATOM   4349  C  CA    . GLY A 1 557  ? 69.692  68.260  18.936  1.00 7.75  ? 557  GLY A CA    1 
ATOM   4350  C  C     . GLY A 1 557  ? 70.842  67.560  19.622  1.00 7.10  ? 557  GLY A C     1 
ATOM   4351  O  O     . GLY A 1 557  ? 70.644  66.644  20.409  1.00 6.45  ? 557  GLY A O     1 
ATOM   4352  N  N     . GLN A 1 558  ? 72.061  68.009  19.317  1.00 6.47  ? 558  GLN A N     1 
ATOM   4353  C  CA    . GLN A 1 558  ? 73.276  67.356  19.819  1.00 6.44  ? 558  GLN A CA    1 
ATOM   4354  C  C     . GLN A 1 558  ? 73.585  67.672  21.288  1.00 6.62  ? 558  GLN A C     1 
ATOM   4355  O  O     . GLN A 1 558  ? 74.469  67.065  21.869  1.00 6.41  ? 558  GLN A O     1 
ATOM   4356  C  CB    . GLN A 1 558  ? 74.482  67.728  18.945  1.00 6.43  ? 558  GLN A CB    1 
ATOM   4357  C  CG    . GLN A 1 558  ? 74.826  69.226  19.002  1.00 5.23  ? 558  GLN A CG    1 
ATOM   4358  C  CD    . GLN A 1 558  ? 76.086  69.583  18.236  1.00 6.26  ? 558  GLN A CD    1 
ATOM   4359  O  OE1   . GLN A 1 558  ? 76.847  68.699  17.812  1.00 6.18  ? 558  GLN A OE1   1 
ATOM   4360  N  NE2   . GLN A 1 558  ? 76.310  70.881  18.047  1.00 3.84  ? 558  GLN A NE2   1 
ATOM   4361  N  N     . LEU A 1 559  ? 72.893  68.650  21.868  1.00 7.14  ? 559  LEU A N     1 
ATOM   4362  C  CA    . LEU A 1 559  ? 73.144  69.042  23.261  1.00 7.76  ? 559  LEU A CA    1 
ATOM   4363  C  C     . LEU A 1 559  ? 72.126  68.405  24.213  1.00 7.93  ? 559  LEU A C     1 
ATOM   4364  O  O     . LEU A 1 559  ? 71.018  68.035  23.789  1.00 8.31  ? 559  LEU A O     1 
ATOM   4365  C  CB    . LEU A 1 559  ? 73.168  70.584  23.401  1.00 7.57  ? 559  LEU A CB    1 
ATOM   4366  C  CG    . LEU A 1 559  ? 74.116  71.373  22.480  1.00 6.95  ? 559  LEU A CG    1 
ATOM   4367  C  CD1   . LEU A 1 559  ? 74.115  72.839  22.837  1.00 6.98  ? 559  LEU A CD1   1 
ATOM   4368  C  CD2   . LEU A 1 559  ? 75.540  70.808  22.541  1.00 6.52  ? 559  LEU A CD2   1 
ATOM   4369  N  N     . GLN A 1 560  ? 72.499  68.257  25.484  1.00 8.06  ? 560  GLN A N     1 
ATOM   4370  C  CA    . GLN A 1 560  ? 71.606  67.677  26.494  1.00 8.53  ? 560  GLN A CA    1 
ATOM   4371  C  C     . GLN A 1 560  ? 70.557  68.726  26.869  1.00 8.11  ? 560  GLN A C     1 
ATOM   4372  O  O     . GLN A 1 560  ? 70.903  69.828  27.296  1.00 8.15  ? 560  GLN A O     1 
ATOM   4373  C  CB    . GLN A 1 560  ? 72.386  67.276  27.751  1.00 8.55  ? 560  GLN A CB    1 
ATOM   4374  C  CG    . GLN A 1 560  ? 73.184  65.999  27.652  1.00 11.01 ? 560  GLN A CG    1 
ATOM   4375  C  CD    . GLN A 1 560  ? 73.320  65.279  29.000  1.00 13.28 ? 560  GLN A CD    1 
ATOM   4376  O  OE1   . GLN A 1 560  ? 72.689  65.662  29.998  1.00 13.68 ? 560  GLN A OE1   1 
ATOM   4377  N  NE2   . GLN A 1 560  ? 74.136  64.232  29.024  1.00 14.92 ? 560  GLN A NE2   1 
ATOM   4378  N  N     . VAL A 1 561  ? 69.281  68.398  26.698  1.00 7.89  ? 561  VAL A N     1 
ATOM   4379  C  CA    . VAL A 1 561  ? 68.214  69.368  26.958  1.00 7.62  ? 561  VAL A CA    1 
ATOM   4380  C  C     . VAL A 1 561  ? 67.342  68.900  28.114  1.00 7.74  ? 561  VAL A C     1 
ATOM   4381  O  O     . VAL A 1 561  ? 67.035  67.709  28.237  1.00 6.65  ? 561  VAL A O     1 
ATOM   4382  C  CB    . VAL A 1 561  ? 67.329  69.615  25.714  1.00 7.99  ? 561  VAL A CB    1 
ATOM   4383  C  CG1   . VAL A 1 561  ? 66.287  70.692  26.002  1.00 7.41  ? 561  VAL A CG1   1 
ATOM   4384  C  CG2   . VAL A 1 561  ? 68.174  70.072  24.530  1.00 8.30  ? 561  VAL A CG2   1 
ATOM   4385  N  N     . ALA A 1 562  ? 66.924  69.841  28.948  1.00 7.48  ? 562  ALA A N     1 
ATOM   4386  C  CA    . ALA A 1 562  ? 66.044  69.495  30.047  1.00 7.87  ? 562  ALA A CA    1 
ATOM   4387  C  C     . ALA A 1 562  ? 64.913  70.503  30.175  1.00 8.22  ? 562  ALA A C     1 
ATOM   4388  O  O     . ALA A 1 562  ? 65.113  71.703  30.034  1.00 7.38  ? 562  ALA A O     1 
ATOM   4389  C  CB    . ALA A 1 562  ? 66.822  69.399  31.334  1.00 7.49  ? 562  ALA A CB    1 
ATOM   4390  N  N     . GLU A 1 563  ? 63.721  69.980  30.444  1.00 8.75  ? 563  GLU A N     1 
ATOM   4391  C  CA    . GLU A 1 563  ? 62.534  70.790  30.634  1.00 9.80  ? 563  GLU A CA    1 
ATOM   4392  C  C     . GLU A 1 563  ? 62.400  71.116  32.112  1.00 9.26  ? 563  GLU A C     1 
ATOM   4393  O  O     . GLU A 1 563  ? 62.568  70.239  32.956  1.00 9.49  ? 563  GLU A O     1 
ATOM   4394  C  CB    . GLU A 1 563  ? 61.328  69.987  30.161  1.00 10.64 ? 563  GLU A CB    1 
ATOM   4395  C  CG    . GLU A 1 563  ? 59.961  70.606  30.419  1.00 13.06 ? 563  GLU A CG    1 
ATOM   4396  C  CD    . GLU A 1 563  ? 58.863  69.809  29.739  1.00 15.76 ? 563  GLU A CD    1 
ATOM   4397  O  OE1   . GLU A 1 563  ? 57.944  69.327  30.443  1.00 16.03 ? 563  GLU A OE1   1 
ATOM   4398  O  OE2   . GLU A 1 563  ? 58.941  69.647  28.496  1.00 18.08 ? 563  GLU A OE2   1 
ATOM   4399  N  N     . VAL A 1 564  ? 62.098  72.372  32.414  1.00 8.75  ? 564  VAL A N     1 
ATOM   4400  C  CA    . VAL A 1 564  ? 61.902  72.812  33.793  1.00 8.46  ? 564  VAL A CA    1 
ATOM   4401  C  C     . VAL A 1 564  ? 60.596  73.595  33.914  1.00 7.54  ? 564  VAL A C     1 
ATOM   4402  O  O     . VAL A 1 564  ? 60.410  74.604  33.231  1.00 7.00  ? 564  VAL A O     1 
ATOM   4403  C  CB    . VAL A 1 564  ? 63.081  73.690  34.296  1.00 8.66  ? 564  VAL A CB    1 
ATOM   4404  C  CG1   . VAL A 1 564  ? 62.862  74.094  35.752  1.00 8.96  ? 564  VAL A CG1   1 
ATOM   4405  C  CG2   . VAL A 1 564  ? 64.412  72.952  34.165  1.00 9.40  ? 564  VAL A CG2   1 
ATOM   4406  N  N     . SER A 1 565  ? 59.710  73.118  34.789  1.00 6.74  ? 565  SER A N     1 
ATOM   4407  C  CA    . SER A 1 565  ? 58.364  73.673  34.957  1.00 6.39  ? 565  SER A CA    1 
ATOM   4408  C  C     . SER A 1 565  ? 58.348  74.990  35.727  1.00 6.44  ? 565  SER A C     1 
ATOM   4409  O  O     . SER A 1 565  ? 59.027  75.126  36.753  1.00 6.48  ? 565  SER A O     1 
ATOM   4410  C  CB    . SER A 1 565  ? 57.451  72.647  35.658  1.00 6.17  ? 565  SER A CB    1 
ATOM   4411  O  OG    . SER A 1 565  ? 56.203  73.241  35.979  1.00 4.32  ? 565  SER A OG    1 
ATOM   4412  N  N     . THR A 1 566  ? 57.584  75.961  35.224  1.00 6.21  ? 566  THR A N     1 
ATOM   4413  C  CA    . THR A 1 566  ? 57.337  77.204  35.948  1.00 6.54  ? 566  THR A CA    1 
ATOM   4414  C  C     . THR A 1 566  ? 55.936  77.241  36.531  1.00 6.22  ? 566  THR A C     1 
ATOM   4415  O  O     . THR A 1 566  ? 55.508  78.276  37.020  1.00 5.98  ? 566  THR A O     1 
ATOM   4416  C  CB    . THR A 1 566  ? 57.539  78.459  35.063  1.00 6.69  ? 566  THR A CB    1 
ATOM   4417  O  OG1   . THR A 1 566  ? 56.729  78.343  33.886  1.00 7.15  ? 566  THR A OG1   1 
ATOM   4418  C  CG2   . THR A 1 566  ? 58.981  78.567  34.552  1.00 7.00  ? 566  THR A CG2   1 
ATOM   4419  N  N     . LEU A 1 567  ? 55.217  76.123  36.451  1.00 6.55  ? 567  LEU A N     1 
ATOM   4420  C  CA    . LEU A 1 567  ? 53.900  76.017  37.078  1.00 6.58  ? 567  LEU A CA    1 
ATOM   4421  C  C     . LEU A 1 567  ? 54.037  75.508  38.497  1.00 7.14  ? 567  LEU A C     1 
ATOM   4422  O  O     . LEU A 1 567  ? 55.054  74.906  38.842  1.00 7.29  ? 567  LEU A O     1 
ATOM   4423  C  CB    . LEU A 1 567  ? 52.990  75.067  36.291  1.00 6.71  ? 567  LEU A CB    1 
ATOM   4424  C  CG    . LEU A 1 567  ? 52.647  75.396  34.833  1.00 6.50  ? 567  LEU A CG    1 
ATOM   4425  C  CD1   . LEU A 1 567  ? 51.500  74.502  34.324  1.00 7.09  ? 567  LEU A CD1   1 
ATOM   4426  C  CD2   . LEU A 1 567  ? 52.292  76.870  34.674  1.00 6.31  ? 567  LEU A CD2   1 
ATOM   4427  N  N     . TYR A 1 568  ? 53.009  75.749  39.308  1.00 7.09  ? 568  TYR A N     1 
ATOM   4428  C  CA    . TYR A 1 568  ? 52.907  75.174  40.647  1.00 7.48  ? 568  TYR A CA    1 
ATOM   4429  C  C     . TYR A 1 568  ? 51.454  75.058  41.092  1.00 8.11  ? 568  TYR A C     1 
ATOM   4430  O  O     . TYR A 1 568  ? 50.595  75.798  40.613  1.00 8.15  ? 568  TYR A O     1 
ATOM   4431  C  CB    . TYR A 1 568  ? 53.715  75.977  41.673  1.00 7.24  ? 568  TYR A CB    1 
ATOM   4432  C  CG    . TYR A 1 568  ? 53.302  77.426  41.867  1.00 6.82  ? 568  TYR A CG    1 
ATOM   4433  C  CD1   . TYR A 1 568  ? 52.459  77.789  42.917  1.00 7.67  ? 568  TYR A CD1   1 
ATOM   4434  C  CD2   . TYR A 1 568  ? 53.782  78.437  41.021  1.00 7.33  ? 568  TYR A CD2   1 
ATOM   4435  C  CE1   . TYR A 1 568  ? 52.095  79.131  43.127  1.00 8.38  ? 568  TYR A CE1   1 
ATOM   4436  C  CE2   . TYR A 1 568  ? 53.426  79.788  41.217  1.00 8.00  ? 568  TYR A CE2   1 
ATOM   4437  C  CZ    . TYR A 1 568  ? 52.574  80.120  42.280  1.00 7.37  ? 568  TYR A CZ    1 
ATOM   4438  O  OH    . TYR A 1 568  ? 52.195  81.428  42.505  1.00 7.21  ? 568  TYR A OH    1 
ATOM   4439  N  N     . ASP A 1 569  ? 51.198  74.130  42.010  1.00 8.92  ? 569  ASP A N     1 
ATOM   4440  C  CA    . ASP A 1 569  ? 49.845  73.866  42.503  1.00 10.14 ? 569  ASP A CA    1 
ATOM   4441  C  C     . ASP A 1 569  ? 49.400  74.921  43.503  1.00 10.41 ? 569  ASP A C     1 
ATOM   4442  O  O     . ASP A 1 569  ? 50.188  75.358  44.344  1.00 10.43 ? 569  ASP A O     1 
ATOM   4443  C  CB    . ASP A 1 569  ? 49.770  72.477  43.154  1.00 10.28 ? 569  ASP A CB    1 
ATOM   4444  C  CG    . ASP A 1 569  ? 49.886  71.345  42.140  1.00 11.95 ? 569  ASP A CG    1 
ATOM   4445  O  OD1   . ASP A 1 569  ? 49.868  71.621  40.918  1.00 12.81 ? 569  ASP A OD1   1 
ATOM   4446  O  OD2   . ASP A 1 569  ? 50.007  70.144  42.475  1.00 13.08 ? 569  ASP A OD2   1 
ATOM   4447  N  N     . LEU A 1 570  ? 48.143  75.338  43.399  1.00 11.01 ? 570  LEU A N     1 
ATOM   4448  C  CA    . LEU A 1 570  ? 47.554  76.216  44.404  1.00 11.55 ? 570  LEU A CA    1 
ATOM   4449  C  C     . LEU A 1 570  ? 46.903  75.355  45.468  1.00 12.15 ? 570  LEU A C     1 
ATOM   4450  O  O     . LEU A 1 570  ? 45.690  75.105  45.441  1.00 12.44 ? 570  LEU A O     1 
ATOM   4451  C  CB    . LEU A 1 570  ? 46.543  77.186  43.788  1.00 11.74 ? 570  LEU A CB    1 
ATOM   4452  C  CG    . LEU A 1 570  ? 47.028  78.156  42.708  1.00 11.08 ? 570  LEU A CG    1 
ATOM   4453  C  CD1   . LEU A 1 570  ? 45.852  78.533  41.837  1.00 10.79 ? 570  LEU A CD1   1 
ATOM   4454  C  CD2   . LEU A 1 570  ? 47.710  79.410  43.302  1.00 12.11 ? 570  LEU A CD2   1 
ATOM   4455  N  N     . ASP A 1 571  ? 47.719  74.878  46.400  1.00 12.78 ? 571  ASP A N     1 
ATOM   4456  C  CA    . ASP A 1 571  ? 47.235  73.952  47.422  1.00 13.27 ? 571  ASP A CA    1 
ATOM   4457  C  C     . ASP A 1 571  ? 47.107  74.574  48.814  1.00 13.64 ? 571  ASP A C     1 
ATOM   4458  O  O     . ASP A 1 571  ? 46.892  73.869  49.799  1.00 13.60 ? 571  ASP A O     1 
ATOM   4459  C  CB    . ASP A 1 571  ? 48.071  72.654  47.446  1.00 13.61 ? 571  ASP A CB    1 
ATOM   4460  C  CG    . ASP A 1 571  ? 49.576  72.900  47.607  1.00 13.45 ? 571  ASP A CG    1 
ATOM   4461  O  OD1   . ASP A 1 571  ? 50.014  74.068  47.672  1.00 12.89 ? 571  ASP A OD1   1 
ATOM   4462  O  OD2   . ASP A 1 571  ? 50.401  71.958  47.681  1.00 14.32 ? 571  ASP A OD2   1 
ATOM   4463  N  N     . GLY A 1 572  ? 47.223  75.902  48.874  1.00 14.16 ? 572  GLY A N     1 
ATOM   4464  C  CA    . GLY A 1 572  ? 47.169  76.642  50.126  1.00 14.57 ? 572  GLY A CA    1 
ATOM   4465  C  C     . GLY A 1 572  ? 48.402  76.393  50.976  1.00 14.59 ? 572  GLY A C     1 
ATOM   4466  O  O     . GLY A 1 572  ? 48.329  76.401  52.210  1.00 15.76 ? 572  GLY A O     1 
ATOM   4467  N  N     . VAL A 1 573  ? 49.524  76.136  50.312  1.00 14.24 ? 573  VAL A N     1 
ATOM   4468  C  CA    . VAL A 1 573  ? 50.787  75.838  50.975  1.00 14.05 ? 573  VAL A CA    1 
ATOM   4469  C  C     . VAL A 1 573  ? 51.895  76.434  50.125  1.00 13.76 ? 573  VAL A C     1 
ATOM   4470  O  O     . VAL A 1 573  ? 52.701  77.220  50.627  1.00 14.07 ? 573  VAL A O     1 
ATOM   4471  C  CB    . VAL A 1 573  ? 50.987  74.305  51.214  1.00 14.06 ? 573  VAL A CB    1 
ATOM   4472  C  CG1   . VAL A 1 573  ? 52.477  73.933  51.283  1.00 14.56 ? 573  VAL A CG1   1 
ATOM   4473  C  CG2   . VAL A 1 573  ? 50.279  73.862  52.490  1.00 14.19 ? 573  VAL A CG2   1 
ATOM   4474  N  N     . ASN A 1 574  ? 51.907  76.085  48.834  1.00 13.32 ? 574  ASN A N     1 
ATOM   4475  C  CA    . ASN A 1 574  ? 52.768  76.743  47.854  1.00 12.65 ? 574  ASN A CA    1 
ATOM   4476  C  C     . ASN A 1 574  ? 52.446  78.235  47.701  1.00 12.15 ? 574  ASN A C     1 
ATOM   4477  O  O     . ASN A 1 574  ? 51.285  78.654  47.741  1.00 11.65 ? 574  ASN A O     1 
ATOM   4478  C  CB    . ASN A 1 574  ? 52.655  76.087  46.468  1.00 12.91 ? 574  ASN A CB    1 
ATOM   4479  C  CG    . ASN A 1 574  ? 53.180  74.656  46.426  1.00 13.41 ? 574  ASN A CG    1 
ATOM   4480  O  OD1   . ASN A 1 574  ? 54.104  74.279  47.155  1.00 13.44 ? 574  ASN A OD1   1 
ATOM   4481  N  ND2   . ASN A 1 574  ? 52.593  73.852  45.549  1.00 14.08 ? 574  ASN A ND2   1 
ATOM   4482  N  N     . SER A 1 575  ? 53.500  79.017  47.510  1.00 11.48 ? 575  SER A N     1 
ATOM   4483  C  CA    . SER A 1 575  ? 53.404  80.434  47.201  1.00 10.79 ? 575  SER A CA    1 
ATOM   4484  C  C     . SER A 1 575  ? 54.332  80.644  46.023  1.00 10.32 ? 575  SER A C     1 
ATOM   4485  O  O     . SER A 1 575  ? 55.136  79.755  45.708  1.00 9.81  ? 575  SER A O     1 
ATOM   4486  C  CB    . SER A 1 575  ? 53.892  81.263  48.386  1.00 11.14 ? 575  SER A CB    1 
ATOM   4487  O  OG    . SER A 1 575  ? 55.282  81.054  48.613  1.00 11.11 ? 575  SER A OG    1 
ATOM   4488  N  N     . LEU A 1 576  ? 54.234  81.807  45.373  1.00 9.52  ? 576  LEU A N     1 
ATOM   4489  C  CA    . LEU A 1 576  ? 55.161  82.138  44.305  1.00 8.97  ? 576  LEU A CA    1 
ATOM   4490  C  C     . LEU A 1 576  ? 56.599  82.087  44.832  1.00 8.95  ? 576  LEU A C     1 
ATOM   4491  O  O     . LEU A 1 576  ? 57.490  81.604  44.138  1.00 8.04  ? 576  LEU A O     1 
ATOM   4492  C  CB    . LEU A 1 576  ? 54.847  83.508  43.682  1.00 9.24  ? 576  LEU A CB    1 
ATOM   4493  C  CG    . LEU A 1 576  ? 55.798  84.066  42.613  1.00 8.74  ? 576  LEU A CG    1 
ATOM   4494  C  CD1   . LEU A 1 576  ? 55.893  83.178  41.358  1.00 6.64  ? 576  LEU A CD1   1 
ATOM   4495  C  CD2   . LEU A 1 576  ? 55.386  85.480  42.240  1.00 7.84  ? 576  LEU A CD2   1 
ATOM   4496  N  N     . GLU A 1 577  ? 56.811  82.545  46.066  1.00 8.47  ? 577  GLU A N     1 
ATOM   4497  C  CA    . GLU A 1 577  ? 58.160  82.585  46.623  1.00 9.31  ? 577  GLU A CA    1 
ATOM   4498  C  C     . GLU A 1 577  ? 58.812  81.198  46.773  1.00 8.87  ? 577  GLU A C     1 
ATOM   4499  O  O     . GLU A 1 577  ? 59.976  81.015  46.415  1.00 8.95  ? 577  GLU A O     1 
ATOM   4500  C  CB    . GLU A 1 577  ? 58.220  83.364  47.944  1.00 9.47  ? 577  GLU A CB    1 
ATOM   4501  C  CG    . GLU A 1 577  ? 59.651  83.613  48.404  1.00 11.45 ? 577  GLU A CG    1 
ATOM   4502  C  CD    . GLU A 1 577  ? 59.740  84.413  49.691  1.00 16.01 ? 577  GLU A CD    1 
ATOM   4503  O  OE1   . GLU A 1 577  ? 58.789  84.372  50.502  1.00 15.81 ? 577  GLU A OE1   1 
ATOM   4504  O  OE2   . GLU A 1 577  ? 60.780  85.085  49.889  1.00 18.83 ? 577  GLU A OE2   1 
ATOM   4505  N  N     . ASP A 1 578  ? 58.100  80.212  47.298  1.00 8.94  ? 578  ASP A N     1 
ATOM   4506  C  CA    . ASP A 1 578  ? 58.759  78.908  47.363  1.00 9.23  ? 578  ASP A CA    1 
ATOM   4507  C  C     . ASP A 1 578  ? 58.742  78.171  46.027  1.00 8.64  ? 578  ASP A C     1 
ATOM   4508  O  O     . ASP A 1 578  ? 59.620  77.355  45.775  1.00 8.38  ? 578  ASP A O     1 
ATOM   4509  C  CB    . ASP A 1 578  ? 58.292  78.044  48.525  1.00 10.26 ? 578  ASP A CB    1 
ATOM   4510  C  CG    . ASP A 1 578  ? 56.819  77.902  48.576  1.00 11.95 ? 578  ASP A CG    1 
ATOM   4511  O  OD1   . ASP A 1 578  ? 56.271  78.018  49.693  1.00 17.22 ? 578  ASP A OD1   1 
ATOM   4512  O  OD2   . ASP A 1 578  ? 56.128  77.658  47.566  1.00 13.99 ? 578  ASP A OD2   1 
ATOM   4513  N  N     . ALA A 1 579  ? 57.782  78.493  45.155  1.00 8.01  ? 579  ALA A N     1 
ATOM   4514  C  CA    . ALA A 1 579  ? 57.826  77.976  43.788  1.00 7.59  ? 579  ALA A CA    1 
ATOM   4515  C  C     . ALA A 1 579  ? 59.084  78.477  43.075  1.00 7.09  ? 579  ALA A C     1 
ATOM   4516  O  O     . ALA A 1 579  ? 59.725  77.724  42.344  1.00 6.61  ? 579  ALA A O     1 
ATOM   4517  C  CB    . ALA A 1 579  ? 56.575  78.349  43.005  1.00 7.77  ? 579  ALA A CB    1 
ATOM   4518  N  N     . LEU A 1 580  ? 59.438  79.738  43.319  1.00 6.55  ? 580  LEU A N     1 
ATOM   4519  C  CA    . LEU A 1 580  ? 60.673  80.336  42.817  1.00 7.42  ? 580  LEU A CA    1 
ATOM   4520  C  C     . LEU A 1 580  ? 61.913  79.670  43.406  1.00 6.68  ? 580  LEU A C     1 
ATOM   4521  O  O     . LEU A 1 580  ? 62.887  79.421  42.695  1.00 6.60  ? 580  LEU A O     1 
ATOM   4522  C  CB    . LEU A 1 580  ? 60.705  81.830  43.159  1.00 7.41  ? 580  LEU A CB    1 
ATOM   4523  C  CG    . LEU A 1 580  ? 60.834  83.028  42.214  1.00 10.34 ? 580  LEU A CG    1 
ATOM   4524  C  CD1   . LEU A 1 580  ? 61.148  82.730  40.722  1.00 9.81  ? 580  LEU A CD1   1 
ATOM   4525  C  CD2   . LEU A 1 580  ? 59.572  83.858  42.375  1.00 11.85 ? 580  LEU A CD2   1 
ATOM   4526  N  N     . THR A 1 581  ? 61.883  79.420  44.713  1.00 6.67  ? 581  THR A N     1 
ATOM   4527  C  CA    . THR A 1 581  ? 62.965  78.718  45.414  1.00 7.27  ? 581  THR A CA    1 
ATOM   4528  C  C     . THR A 1 581  ? 63.209  77.326  44.796  1.00 6.72  ? 581  THR A C     1 
ATOM   4529  O  O     . THR A 1 581  ? 64.338  76.949  44.485  1.00 5.63  ? 581  THR A O     1 
ATOM   4530  C  CB    . THR A 1 581  ? 62.603  78.588  46.910  1.00 7.14  ? 581  THR A CB    1 
ATOM   4531  O  OG1   . THR A 1 581  ? 62.765  79.859  47.560  1.00 10.94 ? 581  THR A OG1   1 
ATOM   4532  C  CG2   . THR A 1 581  ? 63.590  77.710  47.650  1.00 9.38  ? 581  THR A CG2   1 
ATOM   4533  N  N     . ASN A 1 582  ? 62.123  76.586  44.612  1.00 5.85  ? 582  ASN A N     1 
ATOM   4534  C  CA    . ASN A 1 582  ? 62.174  75.289  43.965  1.00 6.39  ? 582  ASN A CA    1 
ATOM   4535  C  C     . ASN A 1 582  ? 62.676  75.313  42.518  1.00 5.79  ? 582  ASN A C     1 
ATOM   4536  O  O     . ASN A 1 582  ? 63.397  74.406  42.082  1.00 4.60  ? 582  ASN A O     1 
ATOM   4537  C  CB    . ASN A 1 582  ? 60.791  74.666  44.006  1.00 6.81  ? 582  ASN A CB    1 
ATOM   4538  C  CG    . ASN A 1 582  ? 60.736  73.527  44.932  1.00 11.53 ? 582  ASN A CG    1 
ATOM   4539  O  OD1   . ASN A 1 582  ? 61.194  72.424  44.598  1.00 16.12 ? 582  ASN A OD1   1 
ATOM   4540  N  ND2   . ASN A 1 582  ? 60.227  73.771  46.146  1.00 14.88 ? 582  ASN A ND2   1 
ATOM   4541  N  N     . LEU A 1 583  ? 62.273  76.351  41.793  1.00 5.32  ? 583  LEU A N     1 
ATOM   4542  C  CA    . LEU A 1 583  ? 62.636  76.524  40.397  1.00 5.89  ? 583  LEU A CA    1 
ATOM   4543  C  C     . LEU A 1 583  ? 64.143  76.649  40.321  1.00 5.67  ? 583  LEU A C     1 
ATOM   4544  O  O     . LEU A 1 583  ? 64.798  75.916  39.591  1.00 5.69  ? 583  LEU A O     1 
ATOM   4545  C  CB    . LEU A 1 583  ? 61.964  77.792  39.830  1.00 5.28  ? 583  LEU A CB    1 
ATOM   4546  C  CG    . LEU A 1 583  ? 61.834  78.064  38.316  1.00 7.46  ? 583  LEU A CG    1 
ATOM   4547  C  CD1   . LEU A 1 583  ? 62.213  79.495  37.938  1.00 6.31  ? 583  LEU A CD1   1 
ATOM   4548  C  CD2   . LEU A 1 583  ? 62.579  77.070  37.430  1.00 8.36  ? 583  LEU A CD2   1 
ATOM   4549  N  N     . VAL A 1 584  ? 64.680  77.582  41.100  1.00 6.08  ? 584  VAL A N     1 
ATOM   4550  C  CA    . VAL A 1 584  ? 66.104  77.887  41.103  1.00 6.70  ? 584  VAL A CA    1 
ATOM   4551  C  C     . VAL A 1 584  ? 66.939  76.651  41.499  1.00 6.67  ? 584  VAL A C     1 
ATOM   4552  O  O     . VAL A 1 584  ? 67.950  76.334  40.864  1.00 6.76  ? 584  VAL A O     1 
ATOM   4553  C  CB    . VAL A 1 584  ? 66.358  79.131  42.011  1.00 6.88  ? 584  VAL A CB    1 
ATOM   4554  C  CG1   . VAL A 1 584  ? 67.706  79.086  42.712  1.00 8.85  ? 584  VAL A CG1   1 
ATOM   4555  C  CG2   . VAL A 1 584  ? 66.184  80.407  41.197  1.00 6.56  ? 584  VAL A CG2   1 
ATOM   4556  N  N     . LYS A 1 585  ? 66.486  75.946  42.527  1.00 6.64  ? 585  LYS A N     1 
ATOM   4557  C  CA    . LYS A 1 585  ? 67.187  74.772  43.019  1.00 6.61  ? 585  LYS A CA    1 
ATOM   4558  C  C     . LYS A 1 585  ? 67.162  73.648  41.969  1.00 6.17  ? 585  LYS A C     1 
ATOM   4559  O  O     . LYS A 1 585  ? 68.173  72.974  41.737  1.00 5.94  ? 585  LYS A O     1 
ATOM   4560  C  CB    . LYS A 1 585  ? 66.575  74.314  44.349  1.00 7.01  ? 585  LYS A CB    1 
ATOM   4561  C  CG    . LYS A 1 585  ? 66.906  75.247  45.526  1.00 8.16  ? 585  LYS A CG    1 
ATOM   4562  C  CD    . LYS A 1 585  ? 66.078  74.907  46.759  1.00 9.73  ? 585  LYS A CD    1 
ATOM   4563  C  CE    . LYS A 1 585  ? 66.473  75.751  47.962  1.00 11.49 ? 585  LYS A CE    1 
ATOM   4564  N  NZ    . LYS A 1 585  ? 65.669  75.369  49.175  1.00 12.00 ? 585  LYS A NZ    1 
ATOM   4565  N  N     . THR A 1 586  ? 66.009  73.475  41.328  1.00 5.14  ? 586  THR A N     1 
ATOM   4566  C  CA    . THR A 1 586  ? 65.864  72.526  40.222  1.00 4.93  ? 586  THR A CA    1 
ATOM   4567  C  C     . THR A 1 586  ? 66.806  72.850  39.066  1.00 4.18  ? 586  THR A C     1 
ATOM   4568  O  O     . THR A 1 586  ? 67.481  71.966  38.548  1.00 3.94  ? 586  THR A O     1 
ATOM   4569  C  CB    . THR A 1 586  ? 64.394  72.474  39.734  1.00 4.90  ? 586  THR A CB    1 
ATOM   4570  O  OG1   . THR A 1 586  ? 63.553  72.049  40.817  1.00 4.83  ? 586  THR A OG1   1 
ATOM   4571  C  CG2   . THR A 1 586  ? 64.202  71.383  38.686  1.00 5.67  ? 586  THR A CG2   1 
ATOM   4572  N  N     . ALA A 1 587  ? 66.841  74.118  38.673  1.00 3.99  ? 587  ALA A N     1 
ATOM   4573  C  CA    . ALA A 1 587  ? 67.683  74.565  37.574  1.00 4.55  ? 587  ALA A CA    1 
ATOM   4574  C  C     . ALA A 1 587  ? 69.147  74.259  37.857  1.00 5.00  ? 587  ALA A C     1 
ATOM   4575  O  O     . ALA A 1 587  ? 69.816  73.649  37.024  1.00 5.07  ? 587  ALA A O     1 
ATOM   4576  C  CB    . ALA A 1 587  ? 67.475  76.087  37.308  1.00 3.75  ? 587  ALA A CB    1 
ATOM   4577  N  N     . ILE A 1 588  ? 69.625  74.655  39.043  1.00 5.30  ? 588  ILE A N     1 
ATOM   4578  C  CA    . ILE A 1 588  ? 70.995  74.343  39.483  1.00 5.81  ? 588  ILE A CA    1 
ATOM   4579  C  C     . ILE A 1 588  ? 71.303  72.838  39.411  1.00 6.08  ? 588  ILE A C     1 
ATOM   4580  O  O     . ILE A 1 588  ? 72.298  72.420  38.789  1.00 6.13  ? 588  ILE A O     1 
ATOM   4581  C  CB    . ILE A 1 588  ? 71.247  74.908  40.918  1.00 5.98  ? 588  ILE A CB    1 
ATOM   4582  C  CG1   . ILE A 1 588  ? 71.309  76.446  40.872  1.00 6.54  ? 588  ILE A CG1   1 
ATOM   4583  C  CG2   . ILE A 1 588  ? 72.519  74.303  41.559  1.00 4.89  ? 588  ILE A CG2   1 
ATOM   4584  C  CD1   . ILE A 1 588  ? 71.118  77.120  42.226  1.00 9.25  ? 588  ILE A CD1   1 
ATOM   4585  N  N     . ALA A 1 589  ? 70.443  72.033  40.032  1.00 5.89  ? 589  ALA A N     1 
ATOM   4586  C  CA    . ALA A 1 589  ? 70.612  70.580  40.041  1.00 5.95  ? 589  ALA A CA    1 
ATOM   4587  C  C     . ALA A 1 589  ? 70.643  70.019  38.617  1.00 5.82  ? 589  ALA A C     1 
ATOM   4588  O  O     . ALA A 1 589  ? 71.512  69.206  38.278  1.00 5.74  ? 589  ALA A O     1 
ATOM   4589  C  CB    . ALA A 1 589  ? 69.504  69.918  40.858  1.00 5.83  ? 589  ALA A CB    1 
ATOM   4590  N  N     . THR A 1 590  ? 69.699  70.469  37.794  1.00 5.43  ? 590  THR A N     1 
ATOM   4591  C  CA    . THR A 1 590  ? 69.609  70.060  36.400  1.00 5.76  ? 590  THR A CA    1 
ATOM   4592  C  C     . THR A 1 590  ? 70.879  70.406  35.614  1.00 5.76  ? 590  THR A C     1 
ATOM   4593  O  O     . THR A 1 590  ? 71.372  69.583  34.830  1.00 5.74  ? 590  THR A O     1 
ATOM   4594  C  CB    . THR A 1 590  ? 68.358  70.682  35.755  1.00 6.27  ? 590  THR A CB    1 
ATOM   4595  O  OG1   . THR A 1 590  ? 67.191  70.159  36.409  1.00 6.94  ? 590  THR A OG1   1 
ATOM   4596  C  CG2   . THR A 1 590  ? 68.195  70.201  34.335  1.00 5.47  ? 590  THR A CG2   1 
ATOM   4597  N  N     . VAL A 1 591  ? 71.410  71.607  35.844  1.00 5.52  ? 591  VAL A N     1 
ATOM   4598  C  CA    . VAL A 1 591  ? 72.677  72.024  35.231  1.00 6.09  ? 591  VAL A CA    1 
ATOM   4599  C  C     . VAL A 1 591  ? 73.834  71.174  35.769  1.00 6.96  ? 591  VAL A C     1 
ATOM   4600  O  O     . VAL A 1 591  ? 74.695  70.748  34.999  1.00 7.70  ? 591  VAL A O     1 
ATOM   4601  C  CB    . VAL A 1 591  ? 72.931  73.552  35.382  1.00 5.83  ? 591  VAL A CB    1 
ATOM   4602  C  CG1   . VAL A 1 591  ? 74.322  73.924  34.919  1.00 6.03  ? 591  VAL A CG1   1 
ATOM   4603  C  CG2   . VAL A 1 591  ? 71.895  74.346  34.576  1.00 5.72  ? 591  VAL A CG2   1 
ATOM   4604  N  N     . GLN A 1 592  ? 73.827  70.884  37.072  1.00 7.11  ? 592  GLN A N     1 
ATOM   4605  C  CA    . GLN A 1 592  ? 74.850  70.022  37.672  1.00 7.99  ? 592  GLN A CA    1 
ATOM   4606  C  C     . GLN A 1 592  ? 74.844  68.591  37.112  1.00 7.63  ? 592  GLN A C     1 
ATOM   4607  O  O     . GLN A 1 592  ? 75.888  67.942  37.075  1.00 7.64  ? 592  GLN A O     1 
ATOM   4608  C  CB    . GLN A 1 592  ? 74.724  69.995  39.201  1.00 8.12  ? 592  GLN A CB    1 
ATOM   4609  C  CG    . GLN A 1 592  ? 75.221  71.280  39.860  1.00 10.99 ? 592  GLN A CG    1 
ATOM   4610  C  CD    . GLN A 1 592  ? 74.960  71.325  41.355  1.00 14.97 ? 592  GLN A CD    1 
ATOM   4611  O  OE1   . GLN A 1 592  ? 73.944  70.802  41.833  1.00 16.15 ? 592  GLN A OE1   1 
ATOM   4612  N  NE2   . GLN A 1 592  ? 75.875  71.953  42.100  1.00 14.59 ? 592  GLN A NE2   1 
ATOM   4613  N  N     . ALA A 1 593  ? 73.673  68.122  36.674  1.00 7.12  ? 593  ALA A N     1 
ATOM   4614  C  CA    . ALA A 1 593  ? 73.511  66.785  36.094  1.00 6.99  ? 593  ALA A CA    1 
ATOM   4615  C  C     . ALA A 1 593  ? 73.892  66.708  34.605  1.00 6.57  ? 593  ALA A C     1 
ATOM   4616  O  O     . ALA A 1 593  ? 73.896  65.618  34.016  1.00 6.33  ? 593  ALA A O     1 
ATOM   4617  C  CB    . ALA A 1 593  ? 72.086  66.263  36.316  1.00 6.78  ? 593  ALA A CB    1 
ATOM   4618  N  N     . GLY A 1 594  ? 74.224  67.849  34.008  1.00 5.74  ? 594  GLY A N     1 
ATOM   4619  C  CA    . GLY A 1 594  ? 74.782  67.869  32.664  1.00 5.80  ? 594  GLY A CA    1 
ATOM   4620  C  C     . GLY A 1 594  ? 73.946  68.518  31.571  1.00 5.98  ? 594  GLY A C     1 
ATOM   4621  O  O     . GLY A 1 594  ? 74.348  68.529  30.399  1.00 5.57  ? 594  GLY A O     1 
ATOM   4622  N  N     . ALA A 1 595  ? 72.792  69.068  31.937  1.00 6.05  ? 595  ALA A N     1 
ATOM   4623  C  CA    . ALA A 1 595  ? 71.976  69.801  30.973  1.00 5.99  ? 595  ALA A CA    1 
ATOM   4624  C  C     . ALA A 1 595  ? 72.739  71.025  30.468  1.00 6.24  ? 595  ALA A C     1 
ATOM   4625  O  O     . ALA A 1 595  ? 73.304  71.782  31.267  1.00 5.99  ? 595  ALA A O     1 
ATOM   4626  C  CB    . ALA A 1 595  ? 70.655  70.214  31.594  1.00 5.95  ? 595  ALA A CB    1 
ATOM   4627  N  N     . GLU A 1 596  ? 72.757  71.195  29.144  1.00 6.03  ? 596  GLU A N     1 
ATOM   4628  C  CA    . GLU A 1 596  ? 73.400  72.332  28.487  1.00 6.56  ? 596  GLU A CA    1 
ATOM   4629  C  C     . GLU A 1 596  ? 72.344  73.337  27.971  1.00 6.02  ? 596  GLU A C     1 
ATOM   4630  O  O     . GLU A 1 596  ? 72.665  74.459  27.615  1.00 5.77  ? 596  GLU A O     1 
ATOM   4631  C  CB    . GLU A 1 596  ? 74.378  71.845  27.390  1.00 7.00  ? 596  GLU A CB    1 
ATOM   4632  C  CG    . GLU A 1 596  ? 75.345  70.774  27.919  1.00 10.85 ? 596  GLU A CG    1 
ATOM   4633  C  CD    . GLU A 1 596  ? 76.544  70.409  27.026  1.00 15.97 ? 596  GLU A CD    1 
ATOM   4634  O  OE1   . GLU A 1 596  ? 76.652  70.871  25.879  1.00 17.48 ? 596  GLU A OE1   1 
ATOM   4635  O  OE2   . GLU A 1 596  ? 77.419  69.632  27.495  1.00 18.13 ? 596  GLU A OE2   1 
ATOM   4636  N  N     . ILE A 1 597  ? 71.077  72.925  27.969  1.00 5.38  ? 597  ILE A N     1 
ATOM   4637  C  CA    . ILE A 1 597  ? 69.974  73.812  27.631  1.00 4.74  ? 597  ILE A CA    1 
ATOM   4638  C  C     . ILE A 1 597  ? 68.809  73.543  28.581  1.00 4.43  ? 597  ILE A C     1 
ATOM   4639  O  O     . ILE A 1 597  ? 68.363  72.402  28.704  1.00 3.82  ? 597  ILE A O     1 
ATOM   4640  C  CB    . ILE A 1 597  ? 69.510  73.584  26.172  1.00 4.55  ? 597  ILE A CB    1 
ATOM   4641  C  CG1   . ILE A 1 597  ? 70.624  73.935  25.167  1.00 4.45  ? 597  ILE A CG1   1 
ATOM   4642  C  CG2   . ILE A 1 597  ? 68.225  74.379  25.899  1.00 5.38  ? 597  ILE A CG2   1 
ATOM   4643  C  CD1   . ILE A 1 597  ? 70.255  73.694  23.685  1.00 3.84  ? 597  ILE A CD1   1 
ATOM   4644  N  N     . LEU A 1 598  ? 68.325  74.595  29.243  1.00 4.32  ? 598  LEU A N     1 
ATOM   4645  C  CA    . LEU A 1 598  ? 67.153  74.503  30.108  1.00 4.90  ? 598  LEU A CA    1 
ATOM   4646  C  C     . LEU A 1 598  ? 65.975  75.164  29.425  1.00 5.09  ? 598  LEU A C     1 
ATOM   4647  O  O     . LEU A 1 598  ? 66.047  76.330  29.068  1.00 4.68  ? 598  LEU A O     1 
ATOM   4648  C  CB    . LEU A 1 598  ? 67.396  75.215  31.447  1.00 5.09  ? 598  LEU A CB    1 
ATOM   4649  C  CG    . LEU A 1 598  ? 67.829  74.451  32.701  1.00 6.70  ? 598  LEU A CG    1 
ATOM   4650  C  CD1   . LEU A 1 598  ? 68.789  73.306  32.419  1.00 6.61  ? 598  LEU A CD1   1 
ATOM   4651  C  CD2   . LEU A 1 598  ? 68.390  75.400  33.766  1.00 5.60  ? 598  LEU A CD2   1 
ATOM   4652  N  N     . VAL A 1 599  ? 64.893  74.412  29.246  1.00 5.13  ? 599  VAL A N     1 
ATOM   4653  C  CA    . VAL A 1 599  ? 63.666  74.989  28.706  1.00 5.47  ? 599  VAL A CA    1 
ATOM   4654  C  C     . VAL A 1 599  ? 62.722  75.272  29.871  1.00 5.53  ? 599  VAL A C     1 
ATOM   4655  O  O     . VAL A 1 599  ? 62.207  74.347  30.506  1.00 4.77  ? 599  VAL A O     1 
ATOM   4656  C  CB    . VAL A 1 599  ? 63.008  74.066  27.664  1.00 6.00  ? 599  VAL A CB    1 
ATOM   4657  C  CG1   . VAL A 1 599  ? 61.805  74.766  27.032  1.00 4.71  ? 599  VAL A CG1   1 
ATOM   4658  C  CG2   . VAL A 1 599  ? 64.021  73.646  26.592  1.00 4.43  ? 599  VAL A CG2   1 
ATOM   4659  N  N     . LEU A 1 600  ? 62.533  76.556  30.162  1.00 5.87  ? 600  LEU A N     1 
ATOM   4660  C  CA    . LEU A 1 600  ? 61.670  76.980  31.254  1.00 6.32  ? 600  LEU A CA    1 
ATOM   4661  C  C     . LEU A 1 600  ? 60.276  77.143  30.680  1.00 6.66  ? 600  LEU A C     1 
ATOM   4662  O  O     . LEU A 1 600  ? 60.033  78.077  29.896  1.00 5.55  ? 600  LEU A O     1 
ATOM   4663  C  CB    . LEU A 1 600  ? 62.161  78.303  31.861  1.00 6.57  ? 600  LEU A CB    1 
ATOM   4664  C  CG    . LEU A 1 600  ? 63.647  78.405  32.234  1.00 7.50  ? 600  LEU A CG    1 
ATOM   4665  C  CD1   . LEU A 1 600  ? 63.986  79.801  32.730  1.00 7.77  ? 600  LEU A CD1   1 
ATOM   4666  C  CD2   . LEU A 1 600  ? 64.040  77.345  33.265  1.00 8.13  ? 600  LEU A CD2   1 
ATOM   4667  N  N     . THR A 1 601  ? 59.369  76.245  31.068  1.00 6.33  ? 601  THR A N     1 
ATOM   4668  C  CA    . THR A 1 601  ? 58.058  76.149  30.406  1.00 6.78  ? 601  THR A CA    1 
ATOM   4669  C  C     . THR A 1 601  ? 56.876  76.287  31.345  1.00 6.36  ? 601  THR A C     1 
ATOM   4670  O  O     . THR A 1 601  ? 56.897  75.735  32.451  1.00 6.19  ? 601  THR A O     1 
ATOM   4671  C  CB    . THR A 1 601  ? 57.935  74.810  29.670  1.00 7.22  ? 601  THR A CB    1 
ATOM   4672  O  OG1   . THR A 1 601  ? 58.969  74.713  28.695  1.00 12.62 ? 601  THR A OG1   1 
ATOM   4673  C  CG2   . THR A 1 601  ? 56.760  74.808  28.825  1.00 3.66  ? 601  THR A CG2   1 
ATOM   4674  N  N     . ASP A 1 602  ? 55.854  77.030  30.907  1.00 6.18  ? 602  ASP A N     1 
ATOM   4675  C  CA    . ASP A 1 602  ? 54.566  77.028  31.604  1.00 6.58  ? 602  ASP A CA    1 
ATOM   4676  C  C     . ASP A 1 602  ? 53.536  76.093  30.941  1.00 6.32  ? 602  ASP A C     1 
ATOM   4677  O  O     . ASP A 1 602  ? 52.328  76.174  31.188  1.00 5.43  ? 602  ASP A O     1 
ATOM   4678  C  CB    . ASP A 1 602  ? 54.014  78.444  31.877  1.00 6.63  ? 602  ASP A CB    1 
ATOM   4679  C  CG    . ASP A 1 602  ? 54.167  79.400  30.701  1.00 8.03  ? 602  ASP A CG    1 
ATOM   4680  O  OD1   . ASP A 1 602  ? 54.694  80.521  30.916  1.00 7.41  ? 602  ASP A OD1   1 
ATOM   4681  O  OD2   . ASP A 1 602  ? 53.750  79.144  29.549  1.00 7.86  ? 602  ASP A OD2   1 
ATOM   4682  N  N     . ARG A 1 603  ? 54.052  75.180  30.126  1.00 6.41  ? 603  ARG A N     1 
ATOM   4683  C  CA    . ARG A 1 603  ? 53.277  74.067  29.580  1.00 7.15  ? 603  ARG A CA    1 
ATOM   4684  C  C     . ARG A 1 603  ? 54.050  72.730  29.740  1.00 7.31  ? 603  ARG A C     1 
ATOM   4685  O  O     . ARG A 1 603  ? 54.315  72.036  28.755  1.00 6.85  ? 603  ARG A O     1 
ATOM   4686  C  CB    . ARG A 1 603  ? 52.937  74.340  28.104  1.00 7.35  ? 603  ARG A CB    1 
ATOM   4687  C  CG    . ARG A 1 603  ? 54.082  74.002  27.158  1.00 8.48  ? 603  ARG A CG    1 
ATOM   4688  C  CD    . ARG A 1 603  ? 54.391  75.001  26.116  1.00 9.61  ? 603  ARG A CD    1 
ATOM   4689  N  NE    . ARG A 1 603  ? 53.749  74.656  24.873  1.00 10.06 ? 603  ARG A NE    1 
ATOM   4690  C  CZ    . ARG A 1 603  ? 54.306  74.703  23.663  1.00 8.73  ? 603  ARG A CZ    1 
ATOM   4691  N  NH1   . ARG A 1 603  ? 55.565  75.073  23.477  1.00 7.81  ? 603  ARG A NH1   1 
ATOM   4692  N  NH2   . ARG A 1 603  ? 53.573  74.353  22.625  1.00 5.36  ? 603  ARG A NH2   1 
ATOM   4693  N  N     . PRO A 1 604  ? 54.415  72.369  30.973  1.00 8.22  ? 604  PRO A N     1 
ATOM   4694  C  CA    . PRO A 1 604  ? 55.158  71.122  31.208  1.00 9.18  ? 604  PRO A CA    1 
ATOM   4695  C  C     . PRO A 1 604  ? 54.374  69.888  30.805  1.00 9.94  ? 604  PRO A C     1 
ATOM   4696  O  O     . PRO A 1 604  ? 53.150  69.835  30.979  1.00 9.77  ? 604  PRO A O     1 
ATOM   4697  C  CB    . PRO A 1 604  ? 55.417  71.132  32.720  1.00 9.37  ? 604  PRO A CB    1 
ATOM   4698  C  CG    . PRO A 1 604  ? 54.418  72.071  33.279  1.00 9.34  ? 604  PRO A CG    1 
ATOM   4699  C  CD    . PRO A 1 604  ? 54.189  73.114  32.223  1.00 7.84  ? 604  PRO A CD    1 
ATOM   4700  N  N     . ASN A 1 605  ? 55.092  68.906  30.262  1.00 11.50 ? 605  ASN A N     1 
ATOM   4701  C  CA    . ASN A 1 605  ? 54.505  67.669  29.726  1.00 13.28 ? 605  ASN A CA    1 
ATOM   4702  C  C     . ASN A 1 605  ? 53.453  67.909  28.636  1.00 13.62 ? 605  ASN A C     1 
ATOM   4703  O  O     . ASN A 1 605  ? 52.624  67.031  28.352  1.00 14.32 ? 605  ASN A O     1 
ATOM   4704  C  CB    . ASN A 1 605  ? 53.930  66.758  30.833  1.00 13.60 ? 605  ASN A CB    1 
ATOM   4705  C  CG    . ASN A 1 605  ? 54.785  66.733  32.100  1.00 16.36 ? 605  ASN A CG    1 
ATOM   4706  O  OD1   . ASN A 1 605  ? 56.008  66.541  32.051  1.00 18.35 ? 605  ASN A OD1   1 
ATOM   4707  N  ND2   . ASN A 1 605  ? 54.133  66.902  33.249  1.00 17.86 ? 605  ASN A ND2   1 
ATOM   4708  N  N     . GLY A 1 606  ? 53.504  69.099  28.039  1.00 14.32 ? 606  GLY A N     1 
ATOM   4709  C  CA    . GLY A 1 606  ? 52.515  69.560  27.080  1.00 14.69 ? 606  GLY A CA    1 
ATOM   4710  C  C     . GLY A 1 606  ? 51.134  69.730  27.690  1.00 14.99 ? 606  GLY A C     1 
ATOM   4711  O  O     . GLY A 1 606  ? 50.124  69.600  26.990  1.00 15.36 ? 606  GLY A O     1 
ATOM   4712  N  N     . ALA A 1 607  ? 51.079  69.989  28.996  1.00 14.60 ? 607  ALA A N     1 
ATOM   4713  C  CA    . ALA A 1 607  ? 49.796  70.165  29.675  1.00 14.13 ? 607  ALA A CA    1 
ATOM   4714  C  C     . ALA A 1 607  ? 49.496  71.640  29.935  1.00 13.81 ? 607  ALA A C     1 
ATOM   4715  O  O     . ALA A 1 607  ? 50.395  72.415  30.227  1.00 14.38 ? 607  ALA A O     1 
ATOM   4716  C  CB    . ALA A 1 607  ? 49.739  69.351  30.955  1.00 14.21 ? 607  ALA A CB    1 
ATOM   4717  N  N     . ILE A 1 608  ? 48.222  71.997  29.804  1.00 13.07 ? 608  ILE A N     1 
ATOM   4718  C  CA    . ILE A 1 608  ? 47.704  73.361  29.916  1.00 13.04 ? 608  ILE A CA    1 
ATOM   4719  C  C     . ILE A 1 608  ? 47.602  73.809  31.377  1.00 12.11 ? 608  ILE A C     1 
ATOM   4720  O  O     . ILE A 1 608  ? 47.423  72.971  32.254  1.00 11.62 ? 608  ILE A O     1 
ATOM   4721  C  CB    . ILE A 1 608  ? 46.296  73.359  29.243  1.00 13.44 ? 608  ILE A CB    1 
ATOM   4722  C  CG1   . ILE A 1 608  ? 46.199  74.381  28.125  1.00 13.97 ? 608  ILE A CG1   1 
ATOM   4723  C  CG2   . ILE A 1 608  ? 45.152  73.545  30.245  1.00 14.48 ? 608  ILE A CG2   1 
ATOM   4724  C  CD1   . ILE A 1 608  ? 44.959  74.150  27.296  1.00 14.37 ? 608  ILE A CD1   1 
ATOM   4725  N  N     . LEU A 1 609  ? 47.711  75.120  31.638  1.00 11.34 ? 609  LEU A N     1 
ATOM   4726  C  CA    . LEU A 1 609  ? 47.456  75.669  32.981  1.00 10.22 ? 609  LEU A CA    1 
ATOM   4727  C  C     . LEU A 1 609  ? 46.018  75.404  33.386  1.00 9.82  ? 609  LEU A C     1 
ATOM   4728  O  O     . LEU A 1 609  ? 45.103  75.672  32.607  1.00 9.48  ? 609  LEU A O     1 
ATOM   4729  C  CB    . LEU A 1 609  ? 47.717  77.183  33.026  1.00 10.43 ? 609  LEU A CB    1 
ATOM   4730  C  CG    . LEU A 1 609  ? 47.402  77.970  34.309  1.00 10.03 ? 609  LEU A CG    1 
ATOM   4731  C  CD1   . LEU A 1 609  ? 48.469  77.734  35.386  1.00 11.28 ? 609  LEU A CD1   1 
ATOM   4732  C  CD2   . LEU A 1 609  ? 47.280  79.464  34.031  1.00 8.91  ? 609  LEU A CD2   1 
ATOM   4733  N  N     . THR A 1 610  ? 45.810  74.879  34.593  1.00 9.20  ? 610  THR A N     1 
ATOM   4734  C  CA    . THR A 1 610  ? 44.443  74.699  35.105  1.00 9.05  ? 610  THR A CA    1 
ATOM   4735  C  C     . THR A 1 610  ? 44.096  75.689  36.212  1.00 8.47  ? 610  THR A C     1 
ATOM   4736  O  O     . THR A 1 610  ? 44.957  76.410  36.715  1.00 8.27  ? 610  THR A O     1 
ATOM   4737  C  CB    . THR A 1 610  ? 44.174  73.256  35.602  1.00 9.26  ? 610  THR A CB    1 
ATOM   4738  O  OG1   . THR A 1 610  ? 44.855  73.048  36.845  1.00 9.70  ? 610  THR A OG1   1 
ATOM   4739  C  CG2   . THR A 1 610  ? 44.760  72.206  34.654  1.00 9.79  ? 610  THR A CG2   1 
ATOM   4740  N  N     . GLU A 1 611  ? 42.825  75.696  36.592  1.00 8.20  ? 611  GLU A N     1 
ATOM   4741  C  CA    . GLU A 1 611  ? 42.327  76.535  37.675  1.00 8.29  ? 611  GLU A CA    1 
ATOM   4742  C  C     . GLU A 1 611  ? 42.988  76.222  39.022  1.00 7.93  ? 611  GLU A C     1 
ATOM   4743  O  O     . GLU A 1 611  ? 43.002  77.067  39.914  1.00 8.06  ? 611  GLU A O     1 
ATOM   4744  C  CB    . GLU A 1 611  ? 40.809  76.408  37.789  1.00 8.30  ? 611  GLU A CB    1 
ATOM   4745  C  CG    . GLU A 1 611  ? 40.292  74.976  37.898  1.00 10.38 ? 611  GLU A CG    1 
ATOM   4746  C  CD    . GLU A 1 611  ? 38.810  74.918  38.212  1.00 12.25 ? 611  GLU A CD    1 
ATOM   4747  O  OE1   . GLU A 1 611  ? 38.090  75.886  37.901  1.00 14.67 ? 611  GLU A OE1   1 
ATOM   4748  O  OE2   . GLU A 1 611  ? 38.359  73.907  38.774  1.00 13.67 ? 611  GLU A OE2   1 
ATOM   4749  N  N     . ASN A 1 612  ? 43.529  75.013  39.154  1.00 7.52  ? 612  ASN A N     1 
ATOM   4750  C  CA    . ASN A 1 612  ? 44.185  74.576  40.386  1.00 7.61  ? 612  ASN A CA    1 
ATOM   4751  C  C     . ASN A 1 612  ? 45.686  74.892  40.431  1.00 7.34  ? 612  ASN A C     1 
ATOM   4752  O  O     . ASN A 1 612  ? 46.383  74.488  41.369  1.00 7.37  ? 612  ASN A O     1 
ATOM   4753  C  CB    . ASN A 1 612  ? 43.945  73.075  40.621  1.00 7.56  ? 612  ASN A CB    1 
ATOM   4754  C  CG    . ASN A 1 612  ? 42.485  72.745  40.907  1.00 9.24  ? 612  ASN A CG    1 
ATOM   4755  O  OD1   . ASN A 1 612  ? 41.748  73.548  41.497  1.00 9.97  ? 612  ASN A OD1   1 
ATOM   4756  N  ND2   . ASN A 1 612  ? 42.061  71.543  40.504  1.00 8.93  ? 612  ASN A ND2   1 
ATOM   4757  N  N     . GLN A 1 613  ? 46.176  75.607  39.419  1.00 6.72  ? 613  GLN A N     1 
ATOM   4758  C  CA    . GLN A 1 613  ? 47.593  75.959  39.326  1.00 7.00  ? 613  GLN A CA    1 
ATOM   4759  C  C     . GLN A 1 613  ? 47.781  77.437  39.053  1.00 6.72  ? 613  GLN A C     1 
ATOM   4760  O  O     . GLN A 1 613  ? 46.878  78.105  38.561  1.00 6.76  ? 613  GLN A O     1 
ATOM   4761  C  CB    . GLN A 1 613  ? 48.277  75.197  38.192  1.00 6.84  ? 613  GLN A CB    1 
ATOM   4762  C  CG    . GLN A 1 613  ? 48.278  73.682  38.320  1.00 9.20  ? 613  GLN A CG    1 
ATOM   4763  C  CD    . GLN A 1 613  ? 48.923  73.032  37.113  1.00 11.69 ? 613  GLN A CD    1 
ATOM   4764  O  OE1   . GLN A 1 613  ? 49.995  72.414  37.228  1.00 12.02 ? 613  GLN A OE1   1 
ATOM   4765  N  NE2   . GLN A 1 613  ? 48.282  73.172  35.948  1.00 10.46 ? 613  GLN A NE2   1 
ATOM   4766  N  N     . SER A 1 614  ? 48.971  77.942  39.366  1.00 6.47  ? 614  SER A N     1 
ATOM   4767  C  CA    . SER A 1 614  ? 49.374  79.239  38.869  1.00 5.97  ? 614  SER A CA    1 
ATOM   4768  C  C     . SER A 1 614  ? 50.752  79.109  38.243  1.00 6.06  ? 614  SER A C     1 
ATOM   4769  O  O     . SER A 1 614  ? 51.262  77.995  38.077  1.00 5.83  ? 614  SER A O     1 
ATOM   4770  C  CB    . SER A 1 614  ? 49.348  80.301  39.967  1.00 5.61  ? 614  SER A CB    1 
ATOM   4771  O  OG    . SER A 1 614  ? 49.348  81.583  39.366  1.00 6.70  ? 614  SER A OG    1 
ATOM   4772  N  N     . PHE A 1 615  ? 51.343  80.242  37.883  1.00 5.71  ? 615  PHE A N     1 
ATOM   4773  C  CA    . PHE A 1 615  ? 52.612  80.233  37.169  1.00 6.10  ? 615  PHE A CA    1 
ATOM   4774  C  C     . PHE A 1 615  ? 53.537  81.335  37.657  1.00 6.18  ? 615  PHE A C     1 
ATOM   4775  O  O     . PHE A 1 615  ? 53.090  82.390  38.115  1.00 6.95  ? 615  PHE A O     1 
ATOM   4776  C  CB    . PHE A 1 615  ? 52.389  80.342  35.651  1.00 5.71  ? 615  PHE A CB    1 
ATOM   4777  C  CG    . PHE A 1 615  ? 51.795  81.665  35.200  1.00 5.82  ? 615  PHE A CG    1 
ATOM   4778  C  CD1   . PHE A 1 615  ? 52.615  82.706  34.770  1.00 5.94  ? 615  PHE A CD1   1 
ATOM   4779  C  CD2   . PHE A 1 615  ? 50.415  81.856  35.193  1.00 5.57  ? 615  PHE A CD2   1 
ATOM   4780  C  CE1   . PHE A 1 615  ? 52.068  83.925  34.352  1.00 6.10  ? 615  PHE A CE1   1 
ATOM   4781  C  CE2   . PHE A 1 615  ? 49.855  83.049  34.785  1.00 3.55  ? 615  PHE A CE2   1 
ATOM   4782  C  CZ    . PHE A 1 615  ? 50.668  84.093  34.357  1.00 5.48  ? 615  PHE A CZ    1 
ATOM   4783  N  N     . ILE A 1 616  ? 54.833  81.066  37.554  1.00 6.46  ? 616  ILE A N     1 
ATOM   4784  C  CA    . ILE A 1 616  ? 55.859  82.082  37.704  1.00 6.09  ? 616  ILE A CA    1 
ATOM   4785  C  C     . ILE A 1 616  ? 55.948  82.858  36.385  1.00 6.26  ? 616  ILE A C     1 
ATOM   4786  O  O     . ILE A 1 616  ? 56.278  82.258  35.363  1.00 6.34  ? 616  ILE A O     1 
ATOM   4787  C  CB    . ILE A 1 616  ? 57.211  81.402  38.004  1.00 6.49  ? 616  ILE A CB    1 
ATOM   4788  C  CG1   . ILE A 1 616  ? 57.074  80.434  39.187  1.00 6.60  ? 616  ILE A CG1   1 
ATOM   4789  C  CG2   . ILE A 1 616  ? 58.292  82.442  38.274  1.00 6.03  ? 616  ILE A CG2   1 
ATOM   4790  C  CD1   . ILE A 1 616  ? 58.273  79.494  39.377  1.00 8.51  ? 616  ILE A CD1   1 
ATOM   4791  N  N     . PRO A 1 617  ? 55.672  84.171  36.397  1.00 5.90  ? 617  PRO A N     1 
ATOM   4792  C  CA    . PRO A 1 617  ? 55.800  84.994  35.188  1.00 5.89  ? 617  PRO A CA    1 
ATOM   4793  C  C     . PRO A 1 617  ? 57.153  84.739  34.552  1.00 5.18  ? 617  PRO A C     1 
ATOM   4794  O  O     . PRO A 1 617  ? 58.138  84.722  35.287  1.00 5.24  ? 617  PRO A O     1 
ATOM   4795  C  CB    . PRO A 1 617  ? 55.710  86.419  35.728  1.00 6.21  ? 617  PRO A CB    1 
ATOM   4796  C  CG    . PRO A 1 617  ? 54.784  86.255  36.940  1.00 6.99  ? 617  PRO A CG    1 
ATOM   4797  C  CD    . PRO A 1 617  ? 55.227  84.968  37.557  1.00 5.87  ? 617  PRO A CD    1 
ATOM   4798  N  N     . PRO A 1 618  ? 57.199  84.505  33.238  1.00 5.04  ? 618  PRO A N     1 
ATOM   4799  C  CA    . PRO A 1 618  ? 58.442  84.122  32.564  1.00 4.87  ? 618  PRO A CA    1 
ATOM   4800  C  C     . PRO A 1 618  ? 59.619  85.079  32.802  1.00 4.77  ? 618  PRO A C     1 
ATOM   4801  O  O     . PRO A 1 618  ? 60.753  84.618  32.878  1.00 4.34  ? 618  PRO A O     1 
ATOM   4802  C  CB    . PRO A 1 618  ? 58.050  84.124  31.083  1.00 4.70  ? 618  PRO A CB    1 
ATOM   4803  C  CG    . PRO A 1 618  ? 56.811  84.933  31.032  1.00 5.57  ? 618  PRO A CG    1 
ATOM   4804  C  CD    . PRO A 1 618  ? 56.070  84.568  32.290  1.00 5.07  ? 618  PRO A CD    1 
ATOM   4805  N  N     . LEU A 1 619  ? 59.369  86.378  32.910  1.00 4.81  ? 619  LEU A N     1 
ATOM   4806  C  CA    . LEU A 1 619  ? 60.475  87.321  33.145  1.00 4.89  ? 619  LEU A CA    1 
ATOM   4807  C  C     . LEU A 1 619  ? 61.083  87.121  34.537  1.00 5.17  ? 619  LEU A C     1 
ATOM   4808  O  O     . LEU A 1 619  ? 62.298  87.239  34.729  1.00 5.19  ? 619  LEU A O     1 
ATOM   4809  C  CB    . LEU A 1 619  ? 59.993  88.759  32.966  1.00 4.76  ? 619  LEU A CB    1 
ATOM   4810  C  CG    . LEU A 1 619  ? 61.020  89.850  33.273  1.00 5.33  ? 619  LEU A CG    1 
ATOM   4811  C  CD1   . LEU A 1 619  ? 62.280  89.665  32.406  1.00 4.87  ? 619  LEU A CD1   1 
ATOM   4812  C  CD2   . LEU A 1 619  ? 60.420  91.208  33.072  1.00 3.22  ? 619  LEU A CD2   1 
ATOM   4813  N  N     . LEU A 1 620  ? 60.216  86.821  35.499  1.00 5.19  ? 620  LEU A N     1 
ATOM   4814  C  CA    . LEU A 1 620  ? 60.651  86.537  36.856  1.00 5.03  ? 620  LEU A CA    1 
ATOM   4815  C  C     . LEU A 1 620  ? 61.429  85.216  36.896  1.00 5.21  ? 620  LEU A C     1 
ATOM   4816  O  O     . LEU A 1 620  ? 62.476  85.139  37.530  1.00 5.29  ? 620  LEU A O     1 
ATOM   4817  C  CB    . LEU A 1 620  ? 59.466  86.492  37.820  1.00 4.73  ? 620  LEU A CB    1 
ATOM   4818  C  CG    . LEU A 1 620  ? 59.765  86.156  39.294  1.00 4.31  ? 620  LEU A CG    1 
ATOM   4819  C  CD1   . LEU A 1 620  ? 60.881  87.024  39.903  1.00 6.85  ? 620  LEU A CD1   1 
ATOM   4820  C  CD2   . LEU A 1 620  ? 58.507  86.262  40.102  1.00 5.81  ? 620  LEU A CD2   1 
ATOM   4821  N  N     . ALA A 1 621  ? 60.922  84.207  36.195  1.00 5.24  ? 621  ALA A N     1 
ATOM   4822  C  CA    . ALA A 1 621  ? 61.560  82.888  36.148  1.00 5.38  ? 621  ALA A CA    1 
ATOM   4823  C  C     . ALA A 1 621  ? 62.950  82.972  35.533  1.00 5.10  ? 621  ALA A C     1 
ATOM   4824  O  O     . ALA A 1 621  ? 63.910  82.432  36.092  1.00 4.82  ? 621  ALA A O     1 
ATOM   4825  C  CB    . ALA A 1 621  ? 60.696  81.908  35.358  1.00 5.02  ? 621  ALA A CB    1 
ATOM   4826  N  N     . VAL A 1 622  ? 63.057  83.635  34.375  1.00 4.65  ? 622  VAL A N     1 
ATOM   4827  C  CA    . VAL A 1 622  ? 64.333  83.671  33.669  1.00 4.72  ? 622  VAL A CA    1 
ATOM   4828  C  C     . VAL A 1 622  ? 65.380  84.489  34.418  1.00 4.68  ? 622  VAL A C     1 
ATOM   4829  O  O     . VAL A 1 622  ? 66.537  84.076  34.506  1.00 4.95  ? 622  VAL A O     1 
ATOM   4830  C  CB    . VAL A 1 622  ? 64.205  84.082  32.149  1.00 5.11  ? 622  VAL A CB    1 
ATOM   4831  C  CG1   . VAL A 1 622  ? 63.970  85.586  31.965  1.00 3.12  ? 622  VAL A CG1   1 
ATOM   4832  C  CG2   . VAL A 1 622  ? 65.457  83.649  31.375  1.00 5.66  ? 622  VAL A CG2   1 
ATOM   4833  N  N     . GLY A 1 623  ? 64.963  85.628  34.976  1.00 5.27  ? 623  GLY A N     1 
ATOM   4834  C  CA    . GLY A 1 623  ? 65.843  86.508  35.732  1.00 4.74  ? 623  GLY A CA    1 
ATOM   4835  C  C     . GLY A 1 623  ? 66.394  85.790  36.949  1.00 5.10  ? 623  GLY A C     1 
ATOM   4836  O  O     . GLY A 1 623  ? 67.598  85.825  37.228  1.00 4.93  ? 623  GLY A O     1 
ATOM   4837  N  N     . ALA A 1 624  ? 65.500  85.117  37.665  1.00 4.78  ? 624  ALA A N     1 
ATOM   4838  C  CA    . ALA A 1 624  ? 65.878  84.330  38.823  1.00 4.75  ? 624  ALA A CA    1 
ATOM   4839  C  C     . ALA A 1 624  ? 66.850  83.208  38.454  1.00 4.98  ? 624  ALA A C     1 
ATOM   4840  O  O     . ALA A 1 624  ? 67.886  83.050  39.120  1.00 5.07  ? 624  ALA A O     1 
ATOM   4841  C  CB    . ALA A 1 624  ? 64.639  83.756  39.503  1.00 4.52  ? 624  ALA A CB    1 
ATOM   4842  N  N     . VAL A 1 625  ? 66.556  82.422  37.418  1.00 4.85  ? 625  VAL A N     1 
ATOM   4843  C  CA    . VAL A 1 625  ? 67.512  81.354  37.124  1.00 5.62  ? 625  VAL A CA    1 
ATOM   4844  C  C     . VAL A 1 625  ? 68.841  81.870  36.553  1.00 5.35  ? 625  VAL A C     1 
ATOM   4845  O  O     . VAL A 1 625  ? 69.897  81.338  36.884  1.00 5.29  ? 625  VAL A O     1 
ATOM   4846  C  CB    . VAL A 1 625  ? 66.945  80.038  36.463  1.00 6.64  ? 625  VAL A CB    1 
ATOM   4847  C  CG1   . VAL A 1 625  ? 65.455  80.062  36.221  1.00 8.50  ? 625  VAL A CG1   1 
ATOM   4848  C  CG2   . VAL A 1 625  ? 67.773  79.538  35.265  1.00 5.88  ? 625  VAL A CG2   1 
ATOM   4849  N  N     . HIS A 1 626  ? 68.778  82.923  35.746  1.00 4.81  ? 626  HIS A N     1 
ATOM   4850  C  CA    . HIS A 1 626  ? 69.978  83.602  35.259  1.00 4.84  ? 626  HIS A CA    1 
ATOM   4851  C  C     . HIS A 1 626  ? 70.886  84.022  36.431  1.00 4.65  ? 626  HIS A C     1 
ATOM   4852  O  O     . HIS A 1 626  ? 72.050  83.639  36.497  1.00 4.34  ? 626  HIS A O     1 
ATOM   4853  C  CB    . HIS A 1 626  ? 69.570  84.805  34.401  1.00 4.74  ? 626  HIS A CB    1 
ATOM   4854  C  CG    . HIS A 1 626  ? 70.710  85.688  33.982  1.00 5.11  ? 626  HIS A CG    1 
ATOM   4855  N  ND1   . HIS A 1 626  ? 71.676  85.289  33.084  1.00 5.41  ? 626  HIS A ND1   1 
ATOM   4856  C  CD2   . HIS A 1 626  ? 71.016  86.965  34.318  1.00 5.00  ? 626  HIS A CD2   1 
ATOM   4857  C  CE1   . HIS A 1 626  ? 72.540  86.274  32.898  1.00 4.96  ? 626  HIS A CE1   1 
ATOM   4858  N  NE2   . HIS A 1 626  ? 72.160  87.303  33.635  1.00 6.03  ? 626  HIS A NE2   1 
ATOM   4859  N  N     . HIS A 1 627  ? 70.351  84.790  37.366  1.00 4.75  ? 627  HIS A N     1 
ATOM   4860  C  CA    . HIS A 1 627  ? 71.178  85.262  38.471  1.00 5.01  ? 627  HIS A CA    1 
ATOM   4861  C  C     . HIS A 1 627  ? 71.565  84.202  39.471  1.00 5.00  ? 627  HIS A C     1 
ATOM   4862  O  O     . HIS A 1 627  ? 72.671  84.233  39.996  1.00 4.76  ? 627  HIS A O     1 
ATOM   4863  C  CB    . HIS A 1 627  ? 70.548  86.471  39.149  1.00 5.13  ? 627  HIS A CB    1 
ATOM   4864  C  CG    . HIS A 1 627  ? 70.726  87.726  38.368  1.00 5.83  ? 627  HIS A CG    1 
ATOM   4865  N  ND1   . HIS A 1 627  ? 71.950  88.344  38.242  1.00 7.25  ? 627  HIS A ND1   1 
ATOM   4866  C  CD2   . HIS A 1 627  ? 69.854  88.451  37.625  1.00 6.10  ? 627  HIS A CD2   1 
ATOM   4867  C  CE1   . HIS A 1 627  ? 71.823  89.401  37.454  1.00 7.13  ? 627  HIS A CE1   1 
ATOM   4868  N  NE2   . HIS A 1 627  ? 70.562  89.490  37.075  1.00 6.37  ? 627  HIS A NE2   1 
ATOM   4869  N  N     . HIS A 1 628  ? 70.680  83.240  39.730  1.00 5.05  ? 628  HIS A N     1 
ATOM   4870  C  CA    . HIS A 1 628  ? 71.031  82.193  40.681  1.00 5.65  ? 628  HIS A CA    1 
ATOM   4871  C  C     . HIS A 1 628  ? 72.073  81.216  40.133  1.00 5.58  ? 628  HIS A C     1 
ATOM   4872  O  O     . HIS A 1 628  ? 72.900  80.718  40.884  1.00 5.48  ? 628  HIS A O     1 
ATOM   4873  C  CB    . HIS A 1 628  ? 69.791  81.487  41.245  1.00 5.82  ? 628  HIS A CB    1 
ATOM   4874  C  CG    . HIS A 1 628  ? 69.035  82.316  42.243  1.00 6.85  ? 628  HIS A CG    1 
ATOM   4875  N  ND1   . HIS A 1 628  ? 69.180  82.156  43.609  1.00 10.83 ? 628  HIS A ND1   1 
ATOM   4876  C  CD2   . HIS A 1 628  ? 68.127  83.307  42.077  1.00 6.32  ? 628  HIS A CD2   1 
ATOM   4877  C  CE1   . HIS A 1 628  ? 68.392  83.015  44.238  1.00 8.51  ? 628  HIS A CE1   1 
ATOM   4878  N  NE2   . HIS A 1 628  ? 67.749  83.728  43.332  1.00 8.59  ? 628  HIS A NE2   1 
ATOM   4879  N  N     . LEU A 1 629  ? 72.046  80.971  38.825  1.00 6.04  ? 629  LEU A N     1 
ATOM   4880  C  CA    . LEU A 1 629  ? 73.112  80.229  38.141  1.00 6.37  ? 629  LEU A CA    1 
ATOM   4881  C  C     . LEU A 1 629  ? 74.447  80.991  38.201  1.00 6.37  ? 629  LEU A C     1 
ATOM   4882  O  O     . LEU A 1 629  ? 75.504  80.384  38.329  1.00 6.16  ? 629  LEU A O     1 
ATOM   4883  C  CB    . LEU A 1 629  ? 72.732  79.988  36.670  1.00 6.53  ? 629  LEU A CB    1 
ATOM   4884  C  CG    . LEU A 1 629  ? 72.206  78.635  36.158  1.00 8.93  ? 629  LEU A CG    1 
ATOM   4885  C  CD1   . LEU A 1 629  ? 71.492  77.793  37.203  1.00 10.74 ? 629  LEU A CD1   1 
ATOM   4886  C  CD2   . LEU A 1 629  ? 71.348  78.778  34.895  1.00 8.60  ? 629  LEU A CD2   1 
ATOM   4887  N  N     . ILE A 1 630  ? 74.393  82.317  38.067  1.00 6.04  ? 630  ILE A N     1 
ATOM   4888  C  CA    . ILE A 1 630  ? 75.598  83.146  38.219  1.00 6.61  ? 630  ILE A CA    1 
ATOM   4889  C  C     . ILE A 1 630  ? 76.147  82.947  39.625  1.00 6.45  ? 630  ILE A C     1 
ATOM   4890  O  O     . ILE A 1 630  ? 77.320  82.624  39.811  1.00 6.80  ? 630  ILE A O     1 
ATOM   4891  C  CB    . ILE A 1 630  ? 75.291  84.659  37.920  1.00 6.04  ? 630  ILE A CB    1 
ATOM   4892  C  CG1   . ILE A 1 630  ? 75.201  84.882  36.406  1.00 6.34  ? 630  ILE A CG1   1 
ATOM   4893  C  CG2   . ILE A 1 630  ? 76.348  85.590  38.561  1.00 6.47  ? 630  ILE A CG2   1 
ATOM   4894  C  CD1   . ILE A 1 630  ? 74.451  86.154  36.003  1.00 7.90  ? 630  ILE A CD1   1 
ATOM   4895  N  N     . ARG A 1 631  ? 75.270  83.084  40.614  1.00 6.95  ? 631  ARG A N     1 
ATOM   4896  C  CA    . ARG A 1 631  ? 75.660  82.905  42.011  1.00 7.21  ? 631  ARG A CA    1 
ATOM   4897  C  C     . ARG A 1 631  ? 76.204  81.504  42.315  1.00 7.28  ? 631  ARG A C     1 
ATOM   4898  O  O     . ARG A 1 631  ? 77.077  81.352  43.170  1.00 6.91  ? 631  ARG A O     1 
ATOM   4899  C  CB    . ARG A 1 631  ? 74.499  83.270  42.939  1.00 7.55  ? 631  ARG A CB    1 
ATOM   4900  C  CG    . ARG A 1 631  ? 74.103  84.726  42.862  1.00 8.38  ? 631  ARG A CG    1 
ATOM   4901  C  CD    . ARG A 1 631  ? 73.242  85.215  44.029  1.00 13.27 ? 631  ARG A CD    1 
ATOM   4902  N  NE    . ARG A 1 631  ? 72.088  86.030  43.628  1.00 14.53 ? 631  ARG A NE    1 
ATOM   4903  C  CZ    . ARG A 1 631  ? 72.155  87.290  43.211  1.00 17.15 ? 631  ARG A CZ    1 
ATOM   4904  N  NH1   . ARG A 1 631  ? 73.332  87.908  43.109  1.00 20.97 ? 631  ARG A NH1   1 
ATOM   4905  N  NH2   . ARG A 1 631  ? 71.051  87.946  42.894  1.00 13.79 ? 631  ARG A NH2   1 
ATOM   4906  N  N     . ALA A 1 632  ? 75.704  80.494  41.596  1.00 7.05  ? 632  ALA A N     1 
ATOM   4907  C  CA    . ALA A 1 632  ? 76.151  79.103  41.749  1.00 7.18  ? 632  ALA A CA    1 
ATOM   4908  C  C     . ALA A 1 632  ? 77.440  78.766  40.983  1.00 7.33  ? 632  ALA A C     1 
ATOM   4909  O  O     . ALA A 1 632  ? 77.965  77.641  41.095  1.00 7.13  ? 632  ALA A O     1 
ATOM   4910  C  CB    . ALA A 1 632  ? 75.036  78.148  41.316  1.00 6.88  ? 632  ALA A CB    1 
ATOM   4911  N  N     . GLY A 1 633  ? 77.921  79.712  40.177  1.00 7.22  ? 633  GLY A N     1 
ATOM   4912  C  CA    . GLY A 1 633  ? 79.097  79.482  39.345  1.00 7.32  ? 633  GLY A CA    1 
ATOM   4913  C  C     . GLY A 1 633  ? 78.847  78.562  38.158  1.00 7.26  ? 633  GLY A C     1 
ATOM   4914  O  O     . GLY A 1 633  ? 79.783  77.955  37.618  1.00 6.85  ? 633  GLY A O     1 
ATOM   4915  N  N     . LEU A 1 634  ? 77.580  78.469  37.753  1.00 6.71  ? 634  LEU A N     1 
ATOM   4916  C  CA    . LEU A 1 634  ? 77.146  77.544  36.705  1.00 6.42  ? 634  LEU A CA    1 
ATOM   4917  C  C     . LEU A 1 634  ? 76.634  78.211  35.417  1.00 6.24  ? 634  LEU A C     1 
ATOM   4918  O  O     . LEU A 1 634  ? 76.244  77.515  34.483  1.00 5.76  ? 634  LEU A O     1 
ATOM   4919  C  CB    . LEU A 1 634  ? 76.057  76.610  37.263  1.00 6.66  ? 634  LEU A CB    1 
ATOM   4920  C  CG    . LEU A 1 634  ? 76.445  75.716  38.453  1.00 7.52  ? 634  LEU A CG    1 
ATOM   4921  C  CD1   . LEU A 1 634  ? 75.225  74.965  39.003  1.00 9.88  ? 634  LEU A CD1   1 
ATOM   4922  C  CD2   . LEU A 1 634  ? 77.544  74.714  38.095  1.00 8.39  ? 634  LEU A CD2   1 
ATOM   4923  N  N     . ARG A 1 635  ? 76.658  79.543  35.358  1.00 5.67  ? 635  ARG A N     1 
ATOM   4924  C  CA    . ARG A 1 635  ? 76.024  80.267  34.248  1.00 6.12  ? 635  ARG A CA    1 
ATOM   4925  C  C     . ARG A 1 635  ? 76.566  79.910  32.848  1.00 6.00  ? 635  ARG A C     1 
ATOM   4926  O  O     . ARG A 1 635  ? 75.828  79.922  31.867  1.00 5.65  ? 635  ARG A O     1 
ATOM   4927  C  CB    . ARG A 1 635  ? 76.075  81.788  34.475  1.00 5.89  ? 635  ARG A CB    1 
ATOM   4928  C  CG    . ARG A 1 635  ? 75.170  82.573  33.541  1.00 6.21  ? 635  ARG A CG    1 
ATOM   4929  C  CD    . ARG A 1 635  ? 73.754  82.045  33.543  1.00 7.39  ? 635  ARG A CD    1 
ATOM   4930  N  NE    . ARG A 1 635  ? 72.883  82.677  32.577  1.00 9.04  ? 635  ARG A NE    1 
ATOM   4931  C  CZ    . ARG A 1 635  ? 72.656  82.229  31.346  1.00 9.57  ? 635  ARG A CZ    1 
ATOM   4932  N  NH1   . ARG A 1 635  ? 73.262  81.142  30.892  1.00 10.79 ? 635  ARG A NH1   1 
ATOM   4933  N  NH2   . ARG A 1 635  ? 71.814  82.882  30.566  1.00 9.79  ? 635  ARG A NH2   1 
ATOM   4934  N  N     . LEU A 1 636  ? 77.847  79.593  32.754  1.00 6.29  ? 636  LEU A N     1 
ATOM   4935  C  CA    . LEU A 1 636  ? 78.434  79.333  31.439  1.00 6.96  ? 636  LEU A CA    1 
ATOM   4936  C  C     . LEU A 1 636  ? 78.302  77.862  31.028  1.00 7.00  ? 636  LEU A C     1 
ATOM   4937  O  O     . LEU A 1 636  ? 78.841  77.458  29.990  1.00 6.84  ? 636  LEU A O     1 
ATOM   4938  C  CB    . LEU A 1 636  ? 79.902  79.765  31.413  1.00 7.13  ? 636  LEU A CB    1 
ATOM   4939  C  CG    . LEU A 1 636  ? 80.259  81.236  31.191  1.00 9.47  ? 636  LEU A CG    1 
ATOM   4940  C  CD1   . LEU A 1 636  ? 79.130  82.241  31.450  1.00 9.95  ? 636  LEU A CD1   1 
ATOM   4941  C  CD2   . LEU A 1 636  ? 81.497  81.556  31.995  1.00 10.91 ? 636  LEU A CD2   1 
ATOM   4942  N  N     . LYS A 1 637  ? 77.604  77.077  31.854  1.00 6.37  ? 637  LYS A N     1 
ATOM   4943  C  CA    . LYS A 1 637  ? 77.383  75.654  31.593  1.00 6.74  ? 637  LYS A CA    1 
ATOM   4944  C  C     . LYS A 1 637  ? 76.167  75.396  30.701  1.00 6.17  ? 637  LYS A C     1 
ATOM   4945  O  O     . LYS A 1 637  ? 76.074  74.335  30.079  1.00 5.94  ? 637  LYS A O     1 
ATOM   4946  C  CB    . LYS A 1 637  ? 77.250  74.859  32.907  1.00 6.79  ? 637  LYS A CB    1 
ATOM   4947  C  CG    . LYS A 1 637  ? 78.345  75.118  33.958  1.00 9.08  ? 637  LYS A CG    1 
ATOM   4948  C  CD    . LYS A 1 637  ? 79.733  74.761  33.459  1.00 12.18 ? 637  LYS A CD    1 
ATOM   4949  C  CE    . LYS A 1 637  ? 80.798  74.844  34.593  1.00 15.81 ? 637  LYS A CE    1 
ATOM   4950  N  NZ    . LYS A 1 637  ? 81.946  75.750  34.208  1.00 15.70 ? 637  LYS A NZ    1 
ATOM   4951  N  N     . ALA A 1 638  ? 75.262  76.376  30.607  1.00 5.89  ? 638  ALA A N     1 
ATOM   4952  C  CA    . ALA A 1 638  ? 73.980  76.174  29.918  1.00 5.87  ? 638  ALA A CA    1 
ATOM   4953  C  C     . ALA A 1 638  ? 73.363  77.469  29.394  1.00 5.83  ? 638  ALA A C     1 
ATOM   4954  O  O     . ALA A 1 638  ? 73.735  78.570  29.815  1.00 6.31  ? 638  ALA A O     1 
ATOM   4955  C  CB    . ALA A 1 638  ? 72.993  75.459  30.845  1.00 5.40  ? 638  ALA A CB    1 
ATOM   4956  N  N     . SER A 1 639  ? 72.445  77.320  28.444  1.00 5.56  ? 639  SER A N     1 
ATOM   4957  C  CA    . SER A 1 639  ? 71.636  78.425  27.945  1.00 5.94  ? 639  SER A CA    1 
ATOM   4958  C  C     . SER A 1 639  ? 70.202  78.209  28.389  1.00 5.87  ? 639  SER A C     1 
ATOM   4959  O  O     . SER A 1 639  ? 69.794  77.080  28.673  1.00 5.22  ? 639  SER A O     1 
ATOM   4960  C  CB    . SER A 1 639  ? 71.704  78.507  26.423  1.00 5.71  ? 639  SER A CB    1 
ATOM   4961  O  OG    . SER A 1 639  ? 73.012  78.839  25.990  1.00 7.43  ? 639  SER A OG    1 
ATOM   4962  N  N     . LEU A 1 640  ? 69.444  79.298  28.430  1.00 5.93  ? 640  LEU A N     1 
ATOM   4963  C  CA    . LEU A 1 640  ? 68.064  79.266  28.906  1.00 6.24  ? 640  LEU A CA    1 
ATOM   4964  C  C     . LEU A 1 640  ? 67.118  79.527  27.750  1.00 6.25  ? 640  LEU A C     1 
ATOM   4965  O  O     . LEU A 1 640  ? 67.326  80.446  26.985  1.00 6.66  ? 640  LEU A O     1 
ATOM   4966  C  CB    . LEU A 1 640  ? 67.858  80.313  30.019  1.00 5.88  ? 640  LEU A CB    1 
ATOM   4967  C  CG    . LEU A 1 640  ? 68.850  80.273  31.192  1.00 6.30  ? 640  LEU A CG    1 
ATOM   4968  C  CD1   . LEU A 1 640  ? 68.611  81.441  32.181  1.00 5.22  ? 640  LEU A CD1   1 
ATOM   4969  C  CD2   . LEU A 1 640  ? 68.795  78.937  31.921  1.00 6.06  ? 640  LEU A CD2   1 
ATOM   4970  N  N     . ILE A 1 641  ? 66.093  78.694  27.601  1.00 6.68  ? 641  ILE A N     1 
ATOM   4971  C  CA    . ILE A 1 641  ? 65.028  78.991  26.653  1.00 6.38  ? 641  ILE A CA    1 
ATOM   4972  C  C     . ILE A 1 641  ? 63.729  79.168  27.423  1.00 6.58  ? 641  ILE A C     1 
ATOM   4973  O  O     . ILE A 1 641  ? 63.385  78.342  28.276  1.00 6.78  ? 641  ILE A O     1 
ATOM   4974  C  CB    . ILE A 1 641  ? 64.909  77.881  25.578  1.00 7.07  ? 641  ILE A CB    1 
ATOM   4975  C  CG1   . ILE A 1 641  ? 66.191  77.833  24.723  1.00 7.51  ? 641  ILE A CG1   1 
ATOM   4976  C  CG2   . ILE A 1 641  ? 63.662  78.100  24.698  1.00 5.82  ? 641  ILE A CG2   1 
ATOM   4977  C  CD1   . ILE A 1 641  ? 66.300  76.570  23.863  1.00 8.29  ? 641  ILE A CD1   1 
ATOM   4978  N  N     . VAL A 1 642  ? 63.013  80.253  27.135  1.00 6.68  ? 642  VAL A N     1 
ATOM   4979  C  CA    . VAL A 1 642  ? 61.720  80.474  27.773  1.00 6.70  ? 642  VAL A CA    1 
ATOM   4980  C  C     . VAL A 1 642  ? 60.614  79.988  26.845  1.00 6.71  ? 642  VAL A C     1 
ATOM   4981  O  O     . VAL A 1 642  ? 60.489  80.430  25.693  1.00 7.40  ? 642  VAL A O     1 
ATOM   4982  C  CB    . VAL A 1 642  ? 61.550  81.960  28.264  1.00 7.36  ? 642  VAL A CB    1 
ATOM   4983  C  CG1   . VAL A 1 642  ? 62.001  82.917  27.231  1.00 9.60  ? 642  VAL A CG1   1 
ATOM   4984  C  CG2   . VAL A 1 642  ? 60.106  82.266  28.644  1.00 6.63  ? 642  VAL A CG2   1 
ATOM   4985  N  N     . ASP A 1 643  ? 59.832  79.041  27.341  1.00 6.31  ? 643  ASP A N     1 
ATOM   4986  C  CA    . ASP A 1 643  ? 58.725  78.475  26.579  1.00 6.05  ? 643  ASP A CA    1 
ATOM   4987  C  C     . ASP A 1 643  ? 57.450  78.905  27.288  1.00 5.95  ? 643  ASP A C     1 
ATOM   4988  O  O     . ASP A 1 643  ? 56.992  78.261  28.256  1.00 6.03  ? 643  ASP A O     1 
ATOM   4989  C  CB    . ASP A 1 643  ? 58.868  76.955  26.523  1.00 5.69  ? 643  ASP A CB    1 
ATOM   4990  C  CG    . ASP A 1 643  ? 57.784  76.287  25.712  1.00 6.71  ? 643  ASP A CG    1 
ATOM   4991  O  OD1   . ASP A 1 643  ? 57.333  76.847  24.684  1.00 5.56  ? 643  ASP A OD1   1 
ATOM   4992  O  OD2   . ASP A 1 643  ? 57.330  75.174  26.039  1.00 7.34  ? 643  ASP A OD2   1 
ATOM   4993  N  N     . THR A 1 644  ? 56.890  80.013  26.818  1.00 5.37  ? 644  THR A N     1 
ATOM   4994  C  CA    . THR A 1 644  ? 55.890  80.716  27.601  1.00 5.49  ? 644  THR A CA    1 
ATOM   4995  C  C     . THR A 1 644  ? 54.715  81.267  26.827  1.00 4.89  ? 644  THR A C     1 
ATOM   4996  O  O     . THR A 1 644  ? 54.856  81.776  25.704  1.00 4.37  ? 644  THR A O     1 
ATOM   4997  C  CB    . THR A 1 644  ? 56.530  81.860  28.425  1.00 5.29  ? 644  THR A CB    1 
ATOM   4998  O  OG1   . THR A 1 644  ? 55.537  82.425  29.287  1.00 6.23  ? 644  THR A OG1   1 
ATOM   4999  C  CG2   . THR A 1 644  ? 56.936  83.029  27.536  1.00 6.28  ? 644  THR A CG2   1 
ATOM   5000  N  N     . ALA A 1 645  ? 53.559  81.179  27.478  1.00 4.24  ? 645  ALA A N     1 
ATOM   5001  C  CA    . ALA A 1 645  ? 52.339  81.823  27.017  1.00 4.56  ? 645  ALA A CA    1 
ATOM   5002  C  C     . ALA A 1 645  ? 52.350  83.341  27.231  1.00 4.71  ? 645  ALA A C     1 
ATOM   5003  O  O     . ALA A 1 645  ? 51.670  84.075  26.502  1.00 4.89  ? 645  ALA A O     1 
ATOM   5004  C  CB    . ALA A 1 645  ? 51.148  81.209  27.716  1.00 4.22  ? 645  ALA A CB    1 
ATOM   5005  N  N     . GLN A 1 646  ? 53.083  83.811  28.245  1.00 4.77  ? 646  GLN A N     1 
ATOM   5006  C  CA    . GLN A 1 646  ? 53.107  85.245  28.572  1.00 4.88  ? 646  GLN A CA    1 
ATOM   5007  C  C     . GLN A 1 646  ? 54.246  86.000  27.850  1.00 4.83  ? 646  GLN A C     1 
ATOM   5008  O  O     . GLN A 1 646  ? 55.215  86.474  28.471  1.00 4.80  ? 646  GLN A O     1 
ATOM   5009  C  CB    . GLN A 1 646  ? 53.094  85.485  30.101  1.00 4.67  ? 646  GLN A CB    1 
ATOM   5010  C  CG    . GLN A 1 646  ? 52.790  86.960  30.489  1.00 5.44  ? 646  GLN A CG    1 
ATOM   5011  C  CD    . GLN A 1 646  ? 52.710  87.189  31.999  1.00 7.42  ? 646  GLN A CD    1 
ATOM   5012  O  OE1   . GLN A 1 646  ? 53.731  87.350  32.662  1.00 8.19  ? 646  GLN A OE1   1 
ATOM   5013  N  NE2   . GLN A 1 646  ? 51.495  87.225  32.536  1.00 5.10  ? 646  GLN A NE2   1 
ATOM   5014  N  N     . CYS A 1 647  ? 54.128  86.078  26.523  1.00 5.23  ? 647  CYS A N     1 
ATOM   5015  C  CA    . CYS A 1 647  ? 55.079  86.813  25.693  1.00 5.87  ? 647  CYS A CA    1 
ATOM   5016  C  C     . CYS A 1 647  ? 54.485  86.995  24.307  1.00 5.94  ? 647  CYS A C     1 
ATOM   5017  O  O     . CYS A 1 647  ? 54.211  86.008  23.606  1.00 5.59  ? 647  CYS A O     1 
ATOM   5018  C  CB    . CYS A 1 647  ? 56.434  86.092  25.597  1.00 5.59  ? 647  CYS A CB    1 
ATOM   5019  S  SG    . CYS A 1 647  ? 57.672  86.998  24.639  1.00 7.59  ? 647  CYS A SG    1 
ATOM   5020  N  N     . TRP A 1 648  ? 54.281  88.252  23.908  1.00 5.76  ? 648  TRP A N     1 
ATOM   5021  C  CA    . TRP A 1 648  ? 53.717  88.550  22.584  1.00 5.79  ? 648  TRP A CA    1 
ATOM   5022  C  C     . TRP A 1 648  ? 54.183  89.845  21.959  1.00 6.25  ? 648  TRP A C     1 
ATOM   5023  O  O     . TRP A 1 648  ? 54.171  89.973  20.729  1.00 6.77  ? 648  TRP A O     1 
ATOM   5024  C  CB    . TRP A 1 648  ? 52.189  88.557  22.601  1.00 6.32  ? 648  TRP A CB    1 
ATOM   5025  C  CG    . TRP A 1 648  ? 51.564  89.544  23.530  1.00 6.65  ? 648  TRP A CG    1 
ATOM   5026  C  CD1   . TRP A 1 648  ? 51.284  90.869  23.283  1.00 5.64  ? 648  TRP A CD1   1 
ATOM   5027  C  CD2   . TRP A 1 648  ? 51.098  89.275  24.851  1.00 6.58  ? 648  TRP A CD2   1 
ATOM   5028  N  NE1   . TRP A 1 648  ? 50.679  91.431  24.381  1.00 6.62  ? 648  TRP A NE1   1 
ATOM   5029  C  CE2   . TRP A 1 648  ? 50.550  90.474  25.358  1.00 7.16  ? 648  TRP A CE2   1 
ATOM   5030  C  CE3   . TRP A 1 648  ? 51.090  88.135  25.667  1.00 6.99  ? 648  TRP A CE3   1 
ATOM   5031  C  CZ2   . TRP A 1 648  ? 49.993  90.562  26.635  1.00 7.13  ? 648  TRP A CZ2   1 
ATOM   5032  C  CZ3   . TRP A 1 648  ? 50.540  88.228  26.941  1.00 9.35  ? 648  TRP A CZ3   1 
ATOM   5033  C  CH2   . TRP A 1 648  ? 49.999  89.437  27.407  1.00 6.38  ? 648  TRP A CH2   1 
ATOM   5034  N  N     . SER A 1 649  ? 54.543  90.816  22.788  1.00 5.51  ? 649  SER A N     1 
ATOM   5035  C  CA    . SER A 1 649  ? 55.014  92.084  22.256  1.00 5.96  ? 649  SER A CA    1 
ATOM   5036  C  C     . SER A 1 649  ? 56.530  92.125  22.132  1.00 6.03  ? 649  SER A C     1 
ATOM   5037  O  O     . SER A 1 649  ? 57.267  91.372  22.764  1.00 5.39  ? 649  SER A O     1 
ATOM   5038  C  CB    . SER A 1 649  ? 54.540  93.267  23.107  1.00 6.03  ? 649  SER A CB    1 
ATOM   5039  O  OG    . SER A 1 649  ? 55.285  93.318  24.313  1.00 7.53  ? 649  SER A OG    1 
ATOM   5040  N  N     . THR A 1 650  ? 56.953  93.067  21.307  1.00 5.95  ? 650  THR A N     1 
ATOM   5041  C  CA    . THR A 1 650  ? 58.325  93.444  21.081  1.00 7.19  ? 650  THR A CA    1 
ATOM   5042  C  C     . THR A 1 650  ? 59.110  93.705  22.426  1.00 7.02  ? 650  THR A C     1 
ATOM   5043  O  O     . THR A 1 650  ? 60.218  93.182  22.643  1.00 6.03  ? 650  THR A O     1 
ATOM   5044  C  CB    . THR A 1 650  ? 58.140  94.662  20.123  1.00 8.07  ? 650  THR A CB    1 
ATOM   5045  O  OG1   . THR A 1 650  ? 58.491  94.319  18.760  1.00 11.56 ? 650  THR A OG1   1 
ATOM   5046  C  CG2   . THR A 1 650  ? 58.825  95.832  20.494  1.00 6.63  ? 650  THR A CG2   1 
ATOM   5047  N  N     . HIS A 1 651  ? 58.498  94.465  23.331  1.00 6.27  ? 651  HIS A N     1 
ATOM   5048  C  CA    . HIS A 1 651  ? 59.041  94.740  24.656  1.00 5.76  ? 651  HIS A CA    1 
ATOM   5049  C  C     . HIS A 1 651  ? 59.215  93.459  25.480  1.00 5.83  ? 651  HIS A C     1 
ATOM   5050  O  O     . HIS A 1 651  ? 60.183  93.332  26.216  1.00 6.55  ? 651  HIS A O     1 
ATOM   5051  C  CB    . HIS A 1 651  ? 58.129  95.739  25.387  1.00 5.48  ? 651  HIS A CB    1 
ATOM   5052  C  CG    . HIS A 1 651  ? 58.677  96.218  26.696  1.00 5.99  ? 651  HIS A CG    1 
ATOM   5053  N  ND1   . HIS A 1 651  ? 58.080  95.928  27.905  1.00 7.12  ? 651  HIS A ND1   1 
ATOM   5054  C  CD2   . HIS A 1 651  ? 59.765  96.969  26.983  1.00 3.78  ? 651  HIS A CD2   1 
ATOM   5055  C  CE1   . HIS A 1 651  ? 58.777  96.485  28.883  1.00 4.34  ? 651  HIS A CE1   1 
ATOM   5056  N  NE2   . HIS A 1 651  ? 59.801  97.128  28.347  1.00 7.20  ? 651  HIS A NE2   1 
ATOM   5057  N  N     . HIS A 1 652  ? 58.296  92.502  25.334  1.00 5.54  ? 652  HIS A N     1 
ATOM   5058  C  CA    . HIS A 1 652  ? 58.375  91.240  26.081  1.00 5.64  ? 652  HIS A CA    1 
ATOM   5059  C  C     . HIS A 1 652  ? 59.635  90.460  25.719  1.00 5.56  ? 652  HIS A C     1 
ATOM   5060  O  O     . HIS A 1 652  ? 60.349  89.971  26.601  1.00 4.75  ? 652  HIS A O     1 
ATOM   5061  C  CB    . HIS A 1 652  ? 57.167  90.330  25.792  1.00 5.04  ? 652  HIS A CB    1 
ATOM   5062  C  CG    . HIS A 1 652  ? 55.852  90.904  26.205  1.00 5.38  ? 652  HIS A CG    1 
ATOM   5063  N  ND1   . HIS A 1 652  ? 55.738  92.037  26.990  1.00 7.27  ? 652  HIS A ND1   1 
ATOM   5064  C  CD2   . HIS A 1 652  ? 54.588  90.492  25.952  1.00 4.73  ? 652  HIS A CD2   1 
ATOM   5065  C  CE1   . HIS A 1 652  ? 54.457  92.286  27.210  1.00 6.06  ? 652  HIS A CE1   1 
ATOM   5066  N  NE2   . HIS A 1 652  ? 53.739  91.370  26.582  1.00 5.84  ? 652  HIS A NE2   1 
ATOM   5067  N  N     . PHE A 1 653  ? 59.872  90.315  24.417  1.00 5.91  ? 653  PHE A N     1 
ATOM   5068  C  CA    . PHE A 1 653  ? 61.003  89.524  23.937  1.00 5.79  ? 653  PHE A CA    1 
ATOM   5069  C  C     . PHE A 1 653  ? 62.300  90.175  24.393  1.00 5.58  ? 653  PHE A C     1 
ATOM   5070  O  O     . PHE A 1 653  ? 63.209  89.485  24.823  1.00 5.74  ? 653  PHE A O     1 
ATOM   5071  C  CB    . PHE A 1 653  ? 60.985  89.434  22.412  1.00 5.52  ? 653  PHE A CB    1 
ATOM   5072  C  CG    . PHE A 1 653  ? 59.906  88.529  21.870  1.00 6.15  ? 653  PHE A CG    1 
ATOM   5073  C  CD1   . PHE A 1 653  ? 60.140  87.167  21.704  1.00 4.50  ? 653  PHE A CD1   1 
ATOM   5074  C  CD2   . PHE A 1 653  ? 58.657  89.044  21.528  1.00 4.12  ? 653  PHE A CD2   1 
ATOM   5075  C  CE1   . PHE A 1 653  ? 59.127  86.313  21.194  1.00 6.73  ? 653  PHE A CE1   1 
ATOM   5076  C  CE2   . PHE A 1 653  ? 57.651  88.209  21.025  1.00 5.60  ? 653  PHE A CE2   1 
ATOM   5077  C  CZ    . PHE A 1 653  ? 57.888  86.847  20.855  1.00 4.71  ? 653  PHE A CZ    1 
ATOM   5078  N  N     . ALA A 1 654  ? 62.366  91.509  24.310  1.00 5.15  ? 654  ALA A N     1 
ATOM   5079  C  CA    . ALA A 1 654  ? 63.535  92.255  24.768  1.00 4.37  ? 654  ALA A CA    1 
ATOM   5080  C  C     . ALA A 1 654  ? 63.829  92.094  26.261  1.00 4.61  ? 654  ALA A C     1 
ATOM   5081  O  O     . ALA A 1 654  ? 64.992  91.912  26.636  1.00 4.57  ? 654  ALA A O     1 
ATOM   5082  C  CB    . ALA A 1 654  ? 63.411  93.724  24.409  1.00 4.89  ? 654  ALA A CB    1 
ATOM   5083  N  N     . CYS A 1 655  ? 62.793  92.175  27.106  1.00 4.40  ? 655  CYS A N     1 
ATOM   5084  C  CA    . CYS A 1 655  ? 62.972  92.004  28.562  1.00 4.69  ? 655  CYS A CA    1 
ATOM   5085  C  C     . CYS A 1 655  ? 63.523  90.613  28.840  1.00 5.13  ? 655  CYS A C     1 
ATOM   5086  O  O     . CYS A 1 655  ? 64.491  90.449  29.599  1.00 4.84  ? 655  CYS A O     1 
ATOM   5087  C  CB    . CYS A 1 655  ? 61.654  92.154  29.330  1.00 4.01  ? 655  CYS A CB    1 
ATOM   5088  S  SG    . CYS A 1 655  ? 60.985  93.817  29.445  1.00 6.37  ? 655  CYS A SG    1 
ATOM   5089  N  N     . LEU A 1 656  ? 62.915  89.611  28.202  1.00 4.53  ? 656  LEU A N     1 
ATOM   5090  C  CA    . LEU A 1 656  ? 63.333  88.233  28.407  1.00 5.55  ? 656  LEU A CA    1 
ATOM   5091  C  C     . LEU A 1 656  ? 64.821  88.024  28.075  1.00 5.84  ? 656  LEU A C     1 
ATOM   5092  O  O     . LEU A 1 656  ? 65.577  87.435  28.870  1.00 5.44  ? 656  LEU A O     1 
ATOM   5093  C  CB    . LEU A 1 656  ? 62.440  87.289  27.587  1.00 5.43  ? 656  LEU A CB    1 
ATOM   5094  C  CG    . LEU A 1 656  ? 61.288  86.490  28.221  1.00 8.53  ? 656  LEU A CG    1 
ATOM   5095  C  CD1   . LEU A 1 656  ? 60.825  86.931  29.613  1.00 6.74  ? 656  LEU A CD1   1 
ATOM   5096  C  CD2   . LEU A 1 656  ? 60.106  86.290  27.250  1.00 5.31  ? 656  LEU A CD2   1 
ATOM   5097  N  N     . VAL A 1 657  ? 65.242  88.476  26.899  1.00 5.45  ? 657  VAL A N     1 
ATOM   5098  C  CA    . VAL A 1 657  ? 66.654  88.355  26.519  1.00 5.70  ? 657  VAL A CA    1 
ATOM   5099  C  C     . VAL A 1 657  ? 67.578  89.204  27.417  1.00 5.58  ? 657  VAL A C     1 
ATOM   5100  O  O     . VAL A 1 657  ? 68.647  88.743  27.825  1.00 6.28  ? 657  VAL A O     1 
ATOM   5101  C  CB    . VAL A 1 657  ? 66.859  88.705  25.034  1.00 5.53  ? 657  VAL A CB    1 
ATOM   5102  C  CG1   . VAL A 1 657  ? 68.354  88.770  24.683  1.00 5.94  ? 657  VAL A CG1   1 
ATOM   5103  C  CG2   . VAL A 1 657  ? 66.148  87.685  24.147  1.00 5.79  ? 657  VAL A CG2   1 
ATOM   5104  N  N     . GLY A 1 658  ? 67.161  90.437  27.710  1.00 5.67  ? 658  GLY A N     1 
ATOM   5105  C  CA    . GLY A 1 658  ? 67.888  91.346  28.591  1.00 5.31  ? 658  GLY A CA    1 
ATOM   5106  C  C     . GLY A 1 658  ? 68.219  90.763  29.951  1.00 6.27  ? 658  GLY A C     1 
ATOM   5107  O  O     . GLY A 1 658  ? 69.272  91.086  30.564  1.00 5.31  ? 658  GLY A O     1 
ATOM   5108  N  N     . TYR A 1 659  ? 67.330  89.886  30.419  1.00 5.09  ? 659  TYR A N     1 
ATOM   5109  C  CA    . TYR A 1 659  ? 67.522  89.232  31.701  1.00 5.72  ? 659  TYR A CA    1 
ATOM   5110  C  C     . TYR A 1 659  ? 67.897  87.743  31.610  1.00 5.95  ? 659  TYR A C     1 
ATOM   5111  O  O     . TYR A 1 659  ? 67.692  86.998  32.560  1.00 6.98  ? 659  TYR A O     1 
ATOM   5112  C  CB    . TYR A 1 659  ? 66.306  89.496  32.623  1.00 5.73  ? 659  TYR A CB    1 
ATOM   5113  C  CG    . TYR A 1 659  ? 66.290  90.936  33.073  1.00 4.29  ? 659  TYR A CG    1 
ATOM   5114  C  CD1   . TYR A 1 659  ? 65.551  91.893  32.385  1.00 6.25  ? 659  TYR A CD1   1 
ATOM   5115  C  CD2   . TYR A 1 659  ? 67.081  91.359  34.134  1.00 5.65  ? 659  TYR A CD2   1 
ATOM   5116  C  CE1   . TYR A 1 659  ? 65.569  93.243  32.793  1.00 6.44  ? 659  TYR A CE1   1 
ATOM   5117  C  CE2   . TYR A 1 659  ? 67.099  92.698  34.544  1.00 5.51  ? 659  TYR A CE2   1 
ATOM   5118  C  CZ    . TYR A 1 659  ? 66.348  93.624  33.860  1.00 5.04  ? 659  TYR A CZ    1 
ATOM   5119  O  OH    . TYR A 1 659  ? 66.383  94.945  34.247  1.00 7.63  ? 659  TYR A OH    1 
ATOM   5120  N  N     . GLY A 1 660  ? 68.463  87.300  30.489  1.00 5.69  ? 660  GLY A N     1 
ATOM   5121  C  CA    . GLY A 1 660  ? 69.076  85.971  30.499  1.00 6.45  ? 660  GLY A CA    1 
ATOM   5122  C  C     . GLY A 1 660  ? 68.619  84.943  29.487  1.00 6.05  ? 660  GLY A C     1 
ATOM   5123  O  O     . GLY A 1 660  ? 69.284  83.923  29.349  1.00 6.82  ? 660  GLY A O     1 
ATOM   5124  N  N     . ALA A 1 661  ? 67.504  85.181  28.789  1.00 5.46  ? 661  ALA A N     1 
ATOM   5125  C  CA    . ALA A 1 661  ? 67.028  84.207  27.794  1.00 5.47  ? 661  ALA A CA    1 
ATOM   5126  C  C     . ALA A 1 661  ? 67.853  84.247  26.521  1.00 5.46  ? 661  ALA A C     1 
ATOM   5127  O  O     . ALA A 1 661  ? 68.079  85.308  25.975  1.00 6.05  ? 661  ALA A O     1 
ATOM   5128  C  CB    . ALA A 1 661  ? 65.560  84.414  27.477  1.00 4.88  ? 661  ALA A CB    1 
ATOM   5129  N  N     . SER A 1 662  ? 68.301  83.091  26.050  1.00 6.19  ? 662  SER A N     1 
ATOM   5130  C  CA    . SER A 1 662  ? 68.969  83.005  24.748  1.00 6.62  ? 662  SER A CA    1 
ATOM   5131  C  C     . SER A 1 662  ? 67.947  82.957  23.601  1.00 6.08  ? 662  SER A C     1 
ATOM   5132  O  O     . SER A 1 662  ? 68.233  83.381  22.472  1.00 6.80  ? 662  SER A O     1 
ATOM   5133  C  CB    . SER A 1 662  ? 69.857  81.758  24.685  1.00 6.55  ? 662  SER A CB    1 
ATOM   5134  O  OG    . SER A 1 662  ? 70.918  81.831  25.618  1.00 8.65  ? 662  SER A OG    1 
ATOM   5135  N  N     . ALA A 1 663  ? 66.762  82.426  23.894  1.00 6.35  ? 663  ALA A N     1 
ATOM   5136  C  CA    . ALA A 1 663  ? 65.695  82.261  22.912  1.00 5.81  ? 663  ALA A CA    1 
ATOM   5137  C  C     . ALA A 1 663  ? 64.342  82.106  23.617  1.00 6.51  ? 663  ALA A C     1 
ATOM   5138  O  O     . ALA A 1 663  ? 64.290  81.742  24.807  1.00 5.77  ? 663  ALA A O     1 
ATOM   5139  C  CB    . ALA A 1 663  ? 65.972  81.046  22.004  1.00 6.25  ? 663  ALA A CB    1 
ATOM   5140  N  N     . ILE A 1 664  ? 63.264  82.405  22.876  1.00 6.22  ? 664  ILE A N     1 
ATOM   5141  C  CA    . ILE A 1 664  ? 61.880  82.351  23.374  1.00 6.39  ? 664  ILE A CA    1 
ATOM   5142  C  C     . ILE A 1 664  ? 60.993  81.594  22.383  1.00 5.80  ? 664  ILE A C     1 
ATOM   5143  O  O     . ILE A 1 664  ? 61.020  81.908  21.184  1.00 5.17  ? 664  ILE A O     1 
ATOM   5144  C  CB    . ILE A 1 664  ? 61.252  83.783  23.458  1.00 6.69  ? 664  ILE A CB    1 
ATOM   5145  C  CG1   . ILE A 1 664  ? 62.302  84.931  23.577  1.00 9.21  ? 664  ILE A CG1   1 
ATOM   5146  C  CG2   . ILE A 1 664  ? 59.983  83.805  24.380  1.00 7.46  ? 664  ILE A CG2   1 
ATOM   5147  C  CD1   . ILE A 1 664  ? 63.069  85.089  24.782  1.00 9.24  ? 664  ILE A CD1   1 
ATOM   5148  N  N     . CYS A 1 665  ? 60.204  80.632  22.873  1.00 5.32  ? 665  CYS A N     1 
ATOM   5149  C  CA    . CYS A 1 665  ? 59.078  80.096  22.101  1.00 5.29  ? 665  CYS A CA    1 
ATOM   5150  C  C     . CYS A 1 665  ? 57.785  80.686  22.640  1.00 4.79  ? 665  CYS A C     1 
ATOM   5151  O  O     . CYS A 1 665  ? 57.314  80.285  23.708  1.00 5.01  ? 665  CYS A O     1 
ATOM   5152  C  CB    . CYS A 1 665  ? 59.030  78.561  22.129  1.00 5.53  ? 665  CYS A CB    1 
ATOM   5153  S  SG    . CYS A 1 665  ? 57.659  77.842  21.165  1.00 6.25  ? 665  CYS A SG    1 
ATOM   5154  N  N     . PRO A 1 666  ? 57.212  81.644  21.918  1.00 4.43  ? 666  PRO A N     1 
ATOM   5155  C  CA    . PRO A 1 666  ? 56.020  82.341  22.403  1.00 4.51  ? 666  PRO A CA    1 
ATOM   5156  C  C     . PRO A 1 666  ? 54.813  81.567  21.899  1.00 4.76  ? 666  PRO A C     1 
ATOM   5157  O  O     . PRO A 1 666  ? 54.105  82.018  20.990  1.00 4.24  ? 666  PRO A O     1 
ATOM   5158  C  CB    . PRO A 1 666  ? 56.143  83.722  21.735  1.00 4.76  ? 666  PRO A CB    1 
ATOM   5159  C  CG    . PRO A 1 666  ? 56.765  83.406  20.368  1.00 3.98  ? 666  PRO A CG    1 
ATOM   5160  C  CD    . PRO A 1 666  ? 57.619  82.130  20.586  1.00 4.62  ? 666  PRO A CD    1 
ATOM   5161  N  N     . TYR A 1 667  ? 54.588  80.393  22.493  1.00 4.21  ? 667  TYR A N     1 
ATOM   5162  C  CA    . TYR A 1 667  ? 53.634  79.442  21.931  1.00 4.47  ? 667  TYR A CA    1 
ATOM   5163  C  C     . TYR A 1 667  ? 52.190  79.924  21.898  1.00 4.46  ? 667  TYR A C     1 
ATOM   5164  O  O     . TYR A 1 667  ? 51.486  79.616  20.947  1.00 4.26  ? 667  TYR A O     1 
ATOM   5165  C  CB    . TYR A 1 667  ? 53.724  78.080  22.616  1.00 4.28  ? 667  TYR A CB    1 
ATOM   5166  C  CG    . TYR A 1 667  ? 53.269  78.044  24.059  1.00 5.13  ? 667  TYR A CG    1 
ATOM   5167  C  CD1   . TYR A 1 667  ? 51.923  77.843  24.397  1.00 5.80  ? 667  TYR A CD1   1 
ATOM   5168  C  CD2   . TYR A 1 667  ? 54.189  78.165  25.092  1.00 7.52  ? 667  TYR A CD2   1 
ATOM   5169  C  CE1   . TYR A 1 667  ? 51.508  77.801  25.741  1.00 5.49  ? 667  TYR A CE1   1 
ATOM   5170  C  CE2   . TYR A 1 667  ? 53.787  78.095  26.442  1.00 6.35  ? 667  TYR A CE2   1 
ATOM   5171  C  CZ    . TYR A 1 667  ? 52.457  77.928  26.749  1.00 7.05  ? 667  TYR A CZ    1 
ATOM   5172  O  OH    . TYR A 1 667  ? 52.085  77.863  28.071  1.00 9.56  ? 667  TYR A OH    1 
ATOM   5173  N  N     . LEU A 1 668  ? 51.745  80.653  22.924  1.00 4.76  ? 668  LEU A N     1 
ATOM   5174  C  CA    . LEU A 1 668  ? 50.373  81.183  22.905  1.00 5.60  ? 668  LEU A CA    1 
ATOM   5175  C  C     . LEU A 1 668  ? 50.231  82.357  21.937  1.00 4.86  ? 668  LEU A C     1 
ATOM   5176  O  O     . LEU A 1 668  ? 49.149  82.593  21.410  1.00 5.14  ? 668  LEU A O     1 
ATOM   5177  C  CB    . LEU A 1 668  ? 49.861  81.576  24.296  1.00 5.77  ? 668  LEU A CB    1 
ATOM   5178  C  CG    . LEU A 1 668  ? 48.493  81.027  24.736  1.00 8.46  ? 668  LEU A CG    1 
ATOM   5179  C  CD1   . LEU A 1 668  ? 47.805  81.928  25.744  1.00 9.32  ? 668  LEU A CD1   1 
ATOM   5180  C  CD2   . LEU A 1 668  ? 47.550  80.749  23.571  1.00 10.79 ? 668  LEU A CD2   1 
ATOM   5181  N  N     . ALA A 1 669  ? 51.317  83.079  21.702  1.00 4.61  ? 669  ALA A N     1 
ATOM   5182  C  CA    . ALA A 1 669  ? 51.275  84.208  20.764  1.00 4.49  ? 669  ALA A CA    1 
ATOM   5183  C  C     . ALA A 1 669  ? 51.084  83.655  19.349  1.00 4.25  ? 669  ALA A C     1 
ATOM   5184  O  O     . ALA A 1 669  ? 50.212  84.104  18.603  1.00 4.48  ? 669  ALA A O     1 
ATOM   5185  C  CB    . ALA A 1 669  ? 52.524  85.046  20.873  1.00 4.03  ? 669  ALA A CB    1 
ATOM   5186  N  N     . LEU A 1 670  ? 51.863  82.632  19.011  1.00 4.04  ? 670  LEU A N     1 
ATOM   5187  C  CA    . LEU A 1 670  ? 51.703  81.932  17.741  1.00 3.82  ? 670  LEU A CA    1 
ATOM   5188  C  C     . LEU A 1 670  ? 50.300  81.329  17.623  1.00 3.33  ? 670  LEU A C     1 
ATOM   5189  O  O     . LEU A 1 670  ? 49.653  81.441  16.582  1.00 2.34  ? 670  LEU A O     1 
ATOM   5190  C  CB    . LEU A 1 670  ? 52.792  80.861  17.578  1.00 4.13  ? 670  LEU A CB    1 
ATOM   5191  C  CG    . LEU A 1 670  ? 54.245  81.373  17.614  1.00 4.42  ? 670  LEU A CG    1 
ATOM   5192  C  CD1   . LEU A 1 670  ? 55.196  80.194  17.534  1.00 5.99  ? 670  LEU A CD1   1 
ATOM   5193  C  CD2   . LEU A 1 670  ? 54.531  82.383  16.473  1.00 4.59  ? 670  LEU A CD2   1 
ATOM   5194  N  N     . GLU A 1 671  ? 49.822  80.724  18.706  1.00 3.19  ? 671  GLU A N     1 
ATOM   5195  C  CA    . GLU A 1 671  ? 48.476  80.151  18.703  1.00 3.55  ? 671  GLU A CA    1 
ATOM   5196  C  C     . GLU A 1 671  ? 47.419  81.250  18.526  1.00 3.30  ? 671  GLU A C     1 
ATOM   5197  O  O     . GLU A 1 671  ? 46.446  81.054  17.804  1.00 3.47  ? 671  GLU A O     1 
ATOM   5198  C  CB    . GLU A 1 671  ? 48.231  79.316  19.959  1.00 3.48  ? 671  GLU A CB    1 
ATOM   5199  C  CG    . GLU A 1 671  ? 46.846  78.680  20.042  1.00 4.67  ? 671  GLU A CG    1 
ATOM   5200  C  CD    . GLU A 1 671  ? 46.633  77.543  19.052  1.00 5.85  ? 671  GLU A CD    1 
ATOM   5201  O  OE1   . GLU A 1 671  ? 47.559  77.208  18.281  1.00 7.34  ? 671  GLU A OE1   1 
ATOM   5202  O  OE2   . GLU A 1 671  ? 45.529  76.967  19.053  1.00 7.17  ? 671  GLU A OE2   1 
ATOM   5203  N  N     . SER A 1 672  ? 47.644  82.408  19.149  1.00 3.53  ? 672  SER A N     1 
ATOM   5204  C  CA    . SER A 1 672  ? 46.772  83.572  18.973  1.00 3.92  ? 672  SER A CA    1 
ATOM   5205  C  C     . SER A 1 672  ? 46.652  83.994  17.497  1.00 3.85  ? 672  SER A C     1 
ATOM   5206  O  O     . SER A 1 672  ? 45.557  84.320  17.018  1.00 3.76  ? 672  SER A O     1 
ATOM   5207  C  CB    . SER A 1 672  ? 47.254  84.742  19.827  1.00 3.91  ? 672  SER A CB    1 
ATOM   5208  O  OG    . SER A 1 672  ? 47.178  84.411  21.205  1.00 6.18  ? 672  SER A OG    1 
ATOM   5209  N  N     . VAL A 1 673  ? 47.779  83.968  16.786  1.00 3.47  ? 673  VAL A N     1 
ATOM   5210  C  CA    . VAL A 1 673  ? 47.819  84.295  15.364  1.00 3.36  ? 673  VAL A CA    1 
ATOM   5211  C  C     . VAL A 1 673  ? 47.043  83.246  14.580  1.00 3.78  ? 673  VAL A C     1 
ATOM   5212  O  O     . VAL A 1 673  ? 46.180  83.580  13.745  1.00 3.94  ? 673  VAL A O     1 
ATOM   5213  C  CB    . VAL A 1 673  ? 49.283  84.436  14.858  1.00 3.09  ? 673  VAL A CB    1 
ATOM   5214  C  CG1   . VAL A 1 673  ? 49.339  84.556  13.323  1.00 3.98  ? 673  VAL A CG1   1 
ATOM   5215  C  CG2   . VAL A 1 673  ? 49.957  85.650  15.502  1.00 2.05  ? 673  VAL A CG2   1 
ATOM   5216  N  N     . ARG A 1 674  ? 47.312  81.971  14.867  1.00 3.98  ? 674  ARG A N     1 
ATOM   5217  C  CA    . ARG A 1 674  ? 46.573  80.889  14.216  1.00 4.03  ? 674  ARG A CA    1 
ATOM   5218  C  C     . ARG A 1 674  ? 45.061  81.063  14.388  1.00 4.06  ? 674  ARG A C     1 
ATOM   5219  O  O     . ARG A 1 674  ? 44.304  80.954  13.418  1.00 3.70  ? 674  ARG A O     1 
ATOM   5220  C  CB    . ARG A 1 674  ? 47.001  79.518  14.752  1.00 4.40  ? 674  ARG A CB    1 
ATOM   5221  C  CG    . ARG A 1 674  ? 48.439  79.125  14.430  1.00 4.21  ? 674  ARG A CG    1 
ATOM   5222  C  CD    . ARG A 1 674  ? 48.762  77.651  14.717  1.00 4.90  ? 674  ARG A CD    1 
ATOM   5223  N  NE    . ARG A 1 674  ? 50.195  77.495  14.903  1.00 5.79  ? 674  ARG A NE    1 
ATOM   5224  C  CZ    . ARG A 1 674  ? 50.805  77.427  16.097  1.00 7.67  ? 674  ARG A CZ    1 
ATOM   5225  N  NH1   . ARG A 1 674  ? 50.099  77.458  17.223  1.00 6.51  ? 674  ARG A NH1   1 
ATOM   5226  N  NH2   . ARG A 1 674  ? 52.131  77.324  16.165  1.00 6.38  ? 674  ARG A NH2   1 
ATOM   5227  N  N     . GLN A 1 675  ? 44.630  81.356  15.612  1.00 4.16  ? 675  GLN A N     1 
ATOM   5228  C  CA    . GLN A 1 675  ? 43.200  81.418  15.923  1.00 4.90  ? 675  GLN A CA    1 
ATOM   5229  C  C     . GLN A 1 675  ? 42.521  82.661  15.349  1.00 5.18  ? 675  GLN A C     1 
ATOM   5230  O  O     . GLN A 1 675  ? 41.319  82.641  15.057  1.00 5.12  ? 675  GLN A O     1 
ATOM   5231  C  CB    . GLN A 1 675  ? 42.954  81.301  17.434  1.00 5.20  ? 675  GLN A CB    1 
ATOM   5232  C  CG    . GLN A 1 675  ? 43.321  79.917  18.029  1.00 6.81  ? 675  GLN A CG    1 
ATOM   5233  C  CD    . GLN A 1 675  ? 42.376  78.792  17.626  1.00 8.36  ? 675  GLN A CD    1 
ATOM   5234  O  OE1   . GLN A 1 675  ? 41.272  79.034  17.152  1.00 8.71  ? 675  GLN A OE1   1 
ATOM   5235  N  NE2   . GLN A 1 675  ? 42.817  77.547  17.821  1.00 9.47  ? 675  GLN A NE2   1 
ATOM   5236  N  N     . TRP A 1 676  ? 43.284  83.741  15.205  1.00 5.21  ? 676  TRP A N     1 
ATOM   5237  C  CA    . TRP A 1 676  ? 42.775  84.941  14.563  1.00 5.64  ? 676  TRP A CA    1 
ATOM   5238  C  C     . TRP A 1 676  ? 42.535  84.663  13.080  1.00 5.92  ? 676  TRP A C     1 
ATOM   5239  O  O     . TRP A 1 676  ? 41.454  84.960  12.556  1.00 4.99  ? 676  TRP A O     1 
ATOM   5240  C  CB    . TRP A 1 676  ? 43.744  86.114  14.739  1.00 5.98  ? 676  TRP A CB    1 
ATOM   5241  C  CG    . TRP A 1 676  ? 43.479  87.202  13.751  1.00 6.32  ? 676  TRP A CG    1 
ATOM   5242  C  CD1   . TRP A 1 676  ? 42.461  88.106  13.783  1.00 5.97  ? 676  TRP A CD1   1 
ATOM   5243  C  CD2   . TRP A 1 676  ? 44.229  87.482  12.565  1.00 7.00  ? 676  TRP A CD2   1 
ATOM   5244  N  NE1   . TRP A 1 676  ? 42.536  88.942  12.696  1.00 5.13  ? 676  TRP A NE1   1 
ATOM   5245  C  CE2   . TRP A 1 676  ? 43.610  88.579  11.926  1.00 7.79  ? 676  TRP A CE2   1 
ATOM   5246  C  CE3   . TRP A 1 676  ? 45.361  86.911  11.967  1.00 8.21  ? 676  TRP A CE3   1 
ATOM   5247  C  CZ2   . TRP A 1 676  ? 44.088  89.121  10.720  1.00 8.46  ? 676  TRP A CZ2   1 
ATOM   5248  C  CZ3   . TRP A 1 676  ? 45.841  87.453  10.774  1.00 7.93  ? 676  TRP A CZ3   1 
ATOM   5249  C  CH2   . TRP A 1 676  ? 45.201  88.548  10.164  1.00 8.51  ? 676  TRP A CH2   1 
ATOM   5250  N  N     . TRP A 1 677  ? 43.538  84.080  12.417  1.00 6.28  ? 677  TRP A N     1 
ATOM   5251  C  CA    . TRP A 1 677  ? 43.433  83.713  11.001  1.00 6.81  ? 677  TRP A CA    1 
ATOM   5252  C  C     . TRP A 1 677  ? 42.297  82.711  10.789  1.00 7.78  ? 677  TRP A C     1 
ATOM   5253  O  O     . TRP A 1 677  ? 41.490  82.865  9.864   1.00 7.35  ? 677  TRP A O     1 
ATOM   5254  C  CB    . TRP A 1 677  ? 44.750  83.131  10.480  1.00 6.55  ? 677  TRP A CB    1 
ATOM   5255  C  CG    . TRP A 1 677  ? 44.782  83.008  8.988   1.00 6.08  ? 677  TRP A CG    1 
ATOM   5256  C  CD1   . TRP A 1 677  ? 45.206  83.947  8.102   1.00 6.23  ? 677  TRP A CD1   1 
ATOM   5257  C  CD2   . TRP A 1 677  ? 44.366  81.882  8.209   1.00 7.11  ? 677  TRP A CD2   1 
ATOM   5258  N  NE1   . TRP A 1 677  ? 45.075  83.483  6.814   1.00 7.01  ? 677  TRP A NE1   1 
ATOM   5259  C  CE2   . TRP A 1 677  ? 44.561  82.216  6.850   1.00 7.45  ? 677  TRP A CE2   1 
ATOM   5260  C  CE3   . TRP A 1 677  ? 43.838  80.620  8.520   1.00 7.19  ? 677  TRP A CE3   1 
ATOM   5261  C  CZ2   . TRP A 1 677  ? 44.248  81.337  5.802   1.00 8.27  ? 677  TRP A CZ2   1 
ATOM   5262  C  CZ3   . TRP A 1 677  ? 43.529  79.741  7.474   1.00 8.98  ? 677  TRP A CZ3   1 
ATOM   5263  C  CH2   . TRP A 1 677  ? 43.730  80.112  6.131   1.00 8.54  ? 677  TRP A CH2   1 
ATOM   5264  N  N     . LEU A 1 678  ? 42.264  81.683  11.635  1.00 9.25  ? 678  LEU A N     1 
ATOM   5265  C  CA    . LEU A 1 678  ? 41.143  80.736  11.692  1.00 11.17 ? 678  LEU A CA    1 
ATOM   5266  C  C     . LEU A 1 678  ? 40.117  81.286  12.674  1.00 12.15 ? 678  LEU A C     1 
ATOM   5267  O  O     . LEU A 1 678  ? 40.049  80.849  13.846  1.00 13.66 ? 678  LEU A O     1 
ATOM   5268  C  CB    . LEU A 1 678  ? 41.588  79.357  12.192  1.00 11.09 ? 678  LEU A CB    1 
ATOM   5269  C  CG    . LEU A 1 678  ? 42.728  78.590  11.536  1.00 11.30 ? 678  LEU A CG    1 
ATOM   5270  C  CD1   . LEU A 1 678  ? 43.475  77.819  12.614  1.00 10.67 ? 678  LEU A CD1   1 
ATOM   5271  C  CD2   . LEU A 1 678  ? 42.182  77.662  10.457  1.00 11.64 ? 678  LEU A CD2   1 
ATOM   5272  N  N     . ASP A 1 679  ? 39.372  82.278  12.215  1.00 11.89 ? 679  ASP A N     1 
ATOM   5273  C  CA    . ASP A 1 679  ? 38.210  82.787  12.909  1.00 12.03 ? 679  ASP A CA    1 
ATOM   5274  C  C     . ASP A 1 679  ? 37.319  83.120  11.739  1.00 11.84 ? 679  ASP A C     1 
ATOM   5275  O  O     . ASP A 1 679  ? 37.741  83.825  10.827  1.00 11.93 ? 679  ASP A O     1 
ATOM   5276  C  CB    . ASP A 1 679  ? 38.543  84.050  13.727  1.00 12.10 ? 679  ASP A CB    1 
ATOM   5277  C  CG    . ASP A 1 679  ? 37.362  84.541  14.574  1.00 13.04 ? 679  ASP A CG    1 
ATOM   5278  O  OD1   . ASP A 1 679  ? 36.202  84.419  14.138  1.00 13.23 ? 679  ASP A OD1   1 
ATOM   5279  O  OD2   . ASP A 1 679  ? 37.499  85.082  15.695  1.00 16.49 ? 679  ASP A OD2   1 
ATOM   5280  N  N     . GLU A 1 680  ? 36.099  82.596  11.741  1.00 11.79 ? 680  GLU A N     1 
ATOM   5281  C  CA    . GLU A 1 680  ? 35.200  82.841  10.619  1.00 11.68 ? 680  GLU A CA    1 
ATOM   5282  C  C     . GLU A 1 680  ? 35.005  84.340  10.324  1.00 11.19 ? 680  GLU A C     1 
ATOM   5283  O  O     . GLU A 1 680  ? 34.897  84.726  9.166   1.00 10.74 ? 680  GLU A O     1 
ATOM   5284  C  CB    . GLU A 1 680  ? 33.879  82.074  10.773  1.00 12.39 ? 680  GLU A CB    1 
ATOM   5285  C  CG    . GLU A 1 680  ? 33.037  82.443  11.986  1.00 14.41 ? 680  GLU A CG    1 
ATOM   5286  C  CD    . GLU A 1 680  ? 31.677  82.972  11.581  1.00 17.59 ? 680  GLU A CD    1 
ATOM   5287  O  OE1   . GLU A 1 680  ? 30.804  82.156  11.185  1.00 17.96 ? 680  GLU A OE1   1 
ATOM   5288  O  OE2   . GLU A 1 680  ? 31.494  84.213  11.640  1.00 19.70 ? 680  GLU A OE2   1 
ATOM   5289  N  N     . LYS A 1 681  ? 35.021  85.178  11.364  1.00 10.52 ? 681  LYS A N     1 
ATOM   5290  C  CA    . LYS A 1 681  ? 34.932  86.630  11.201  1.00 10.44 ? 681  LYS A CA    1 
ATOM   5291  C  C     . LYS A 1 681  ? 36.079  87.170  10.358  1.00 9.85  ? 681  LYS A C     1 
ATOM   5292  O  O     . LYS A 1 681  ? 35.873  88.030  9.496   1.00 9.59  ? 681  LYS A O     1 
ATOM   5293  C  CB    . LYS A 1 681  ? 34.941  87.331  12.561  1.00 10.73 ? 681  LYS A CB    1 
ATOM   5294  C  CG    . LYS A 1 681  ? 33.604  87.955  12.941  1.00 12.51 ? 681  LYS A CG    1 
ATOM   5295  C  CD    . LYS A 1 681  ? 33.695  88.586  14.327  1.00 15.80 ? 681  LYS A CD    1 
ATOM   5296  C  CE    . LYS A 1 681  ? 32.920  87.758  15.337  1.00 17.85 ? 681  LYS A CE    1 
ATOM   5297  N  NZ    . LYS A 1 681  ? 33.759  86.619  15.821  1.00 20.13 ? 681  LYS A NZ    1 
ATOM   5298  N  N     . THR A 1 682  ? 37.282  86.663  10.631  1.00 8.96  ? 682  THR A N     1 
ATOM   5299  C  CA    . THR A 1 682  ? 38.474  86.978  9.862   1.00 8.44  ? 682  THR A CA    1 
ATOM   5300  C  C     . THR A 1 682  ? 38.419  86.398  8.454   1.00 8.72  ? 682  THR A C     1 
ATOM   5301  O  O     . THR A 1 682  ? 38.813  87.055  7.502   1.00 8.48  ? 682  THR A O     1 
ATOM   5302  C  CB    . THR A 1 682  ? 39.724  86.414  10.552  1.00 7.92  ? 682  THR A CB    1 
ATOM   5303  O  OG1   . THR A 1 682  ? 39.814  86.910  11.900  1.00 7.48  ? 682  THR A OG1   1 
ATOM   5304  C  CG2   . THR A 1 682  ? 40.975  86.944  9.873   1.00 7.29  ? 682  THR A CG2   1 
ATOM   5305  N  N     . GLN A 1 683  ? 37.975  85.149  8.342   1.00 9.58  ? 683  GLN A N     1 
ATOM   5306  C  CA    . GLN A 1 683  ? 37.901  84.475  7.053   1.00 10.64 ? 683  GLN A CA    1 
ATOM   5307  C  C     . GLN A 1 683  ? 36.856  85.156  6.193   1.00 11.25 ? 683  GLN A C     1 
ATOM   5308  O  O     . GLN A 1 683  ? 37.057  85.335  4.989   1.00 11.46 ? 683  GLN A O     1 
ATOM   5309  C  CB    . GLN A 1 683  ? 37.558  82.993  7.233   1.00 10.88 ? 683  GLN A CB    1 
ATOM   5310  C  CG    . GLN A 1 683  ? 38.671  82.169  7.872   1.00 11.98 ? 683  GLN A CG    1 
ATOM   5311  C  CD    . GLN A 1 683  ? 39.733  81.738  6.872   1.00 13.68 ? 683  GLN A CD    1 
ATOM   5312  O  OE1   . GLN A 1 683  ? 39.443  81.529  5.687   1.00 15.61 ? 683  GLN A OE1   1 
ATOM   5313  N  NE2   . GLN A 1 683  ? 40.957  81.590  7.346   1.00 13.70 ? 683  GLN A NE2   1 
ATOM   5314  N  N     . LYS A 1 684  ? 35.746  85.537  6.828   1.00 11.92 ? 684  LYS A N     1 
ATOM   5315  C  CA    . LYS A 1 684  ? 34.652  86.254  6.168   1.00 12.71 ? 684  LYS A CA    1 
ATOM   5316  C  C     . LYS A 1 684  ? 35.072  87.667  5.750   1.00 12.81 ? 684  LYS A C     1 
ATOM   5317  O  O     . LYS A 1 684  ? 34.707  88.119  4.664   1.00 13.59 ? 684  LYS A O     1 
ATOM   5318  C  CB    . LYS A 1 684  ? 33.411  86.308  7.068   1.00 12.65 ? 684  LYS A CB    1 
ATOM   5319  C  CG    . LYS A 1 684  ? 32.194  85.568  6.525   1.00 14.43 ? 684  LYS A CG    1 
ATOM   5320  C  CD    . LYS A 1 684  ? 31.942  84.243  7.252   1.00 16.40 ? 684  LYS A CD    1 
ATOM   5321  C  CE    . LYS A 1 684  ? 32.112  83.041  6.308   1.00 16.93 ? 684  LYS A CE    1 
ATOM   5322  N  NZ    . LYS A 1 684  ? 30.816  82.431  5.848   1.00 17.64 ? 684  LYS A NZ    1 
ATOM   5323  N  N     . LEU A 1 685  ? 35.830  88.349  6.604   1.00 13.06 ? 685  LEU A N     1 
ATOM   5324  C  CA    . LEU A 1 685  ? 36.376  89.666  6.272   1.00 13.23 ? 685  LEU A CA    1 
ATOM   5325  C  C     . LEU A 1 685  ? 37.230  89.549  5.014   1.00 13.59 ? 685  LEU A C     1 
ATOM   5326  O  O     . LEU A 1 685  ? 36.967  90.225  4.023   1.00 13.37 ? 685  LEU A O     1 
ATOM   5327  C  CB    . LEU A 1 685  ? 37.212  90.236  7.421   1.00 13.21 ? 685  LEU A CB    1 
ATOM   5328  C  CG    . LEU A 1 685  ? 36.610  91.185  8.470   1.00 13.30 ? 685  LEU A CG    1 
ATOM   5329  C  CD1   . LEU A 1 685  ? 37.679  91.690  9.415   1.00 13.73 ? 685  LEU A CD1   1 
ATOM   5330  C  CD2   . LEU A 1 685  ? 35.885  92.364  7.848   1.00 14.77 ? 685  LEU A CD2   1 
ATOM   5331  N  N     . MET A 1 686  ? 38.207  88.638  5.041   1.00 13.79 ? 686  MET A N     1 
ATOM   5332  C  CA    . MET A 1 686  ? 39.166  88.464  3.944   1.00 13.89 ? 686  MET A CA    1 
ATOM   5333  C  C     . MET A 1 686  ? 38.507  88.354  2.561   1.00 14.24 ? 686  MET A C     1 
ATOM   5334  O  O     . MET A 1 686  ? 39.009  88.909  1.578   1.00 14.44 ? 686  MET A O     1 
ATOM   5335  C  CB    . MET A 1 686  ? 40.121  87.295  4.236   1.00 13.88 ? 686  MET A CB    1 
ATOM   5336  C  CG    . MET A 1 686  ? 41.167  87.650  5.283   1.00 12.63 ? 686  MET A CG    1 
ATOM   5337  S  SD    . MET A 1 686  ? 42.680  86.637  5.490   1.00 13.48 ? 686  MET A SD    1 
ATOM   5338  C  CE    . MET A 1 686  ? 42.535  85.378  4.248   1.00 12.22 ? 686  MET A CE    1 
ATOM   5339  N  N     . GLU A 1 687  ? 37.362  87.684  2.494   1.00 14.42 ? 687  GLU A N     1 
ATOM   5340  C  CA    . GLU A 1 687  ? 36.544  87.705  1.279   1.00 14.90 ? 687  GLU A CA    1 
ATOM   5341  C  C     . GLU A 1 687  ? 36.175  89.125  0.789   1.00 14.80 ? 687  GLU A C     1 
ATOM   5342  O  O     . GLU A 1 687  ? 35.514  89.250  -0.239  1.00 15.26 ? 687  GLU A O     1 
ATOM   5343  C  CB    . GLU A 1 687  ? 35.285  86.832  1.434   1.00 15.07 ? 687  GLU A CB    1 
ATOM   5344  C  CG    . GLU A 1 687  ? 35.517  85.405  1.942   1.00 15.71 ? 687  GLU A CG    1 
ATOM   5345  C  CD    . GLU A 1 687  ? 36.351  84.540  1.001   1.00 17.21 ? 687  GLU A CD    1 
ATOM   5346  O  OE1   . GLU A 1 687  ? 35.807  84.063  -0.020  1.00 16.42 ? 687  GLU A OE1   1 
ATOM   5347  O  OE2   . GLU A 1 687  ? 37.557  84.331  1.297   1.00 19.62 ? 687  GLU A OE2   1 
ATOM   5348  N  N     . ASN A 1 688  ? 36.619  90.171  1.507   1.00 15.09 ? 688  ASN A N     1 
ATOM   5349  C  CA    . ASN A 1 688  ? 36.383  91.595  1.153   1.00 15.08 ? 688  ASN A CA    1 
ATOM   5350  C  C     . ASN A 1 688  ? 37.226  92.683  1.886   1.00 15.42 ? 688  ASN A C     1 
ATOM   5351  O  O     . ASN A 1 688  ? 38.042  93.368  1.254   1.00 15.39 ? 688  ASN A O     1 
ATOM   5352  C  CB    . ASN A 1 688  ? 34.880  91.953  1.228   1.00 15.15 ? 688  ASN A CB    1 
ATOM   5353  C  CG    . ASN A 1 688  ? 34.110  91.099  2.247   1.00 15.50 ? 688  ASN A CG    1 
ATOM   5354  O  OD1   . ASN A 1 688  ? 33.421  90.148  1.880   1.00 15.98 ? 688  ASN A OD1   1 
ATOM   5355  N  ND2   . ASN A 1 688  ? 34.234  91.441  3.528   1.00 15.98 ? 688  ASN A ND2   1 
ATOM   5356  N  N     . GLY A 1 689  ? 37.033  92.838  3.204   1.00 15.74 ? 689  GLY A N     1 
ATOM   5357  C  CA    . GLY A 1 689  ? 37.516  93.996  3.957   1.00 15.38 ? 689  GLY A CA    1 
ATOM   5358  C  C     . GLY A 1 689  ? 38.858  93.992  4.687   1.00 15.99 ? 689  GLY A C     1 
ATOM   5359  O  O     . GLY A 1 689  ? 39.317  95.043  5.152   1.00 15.99 ? 689  GLY A O     1 
ATOM   5360  N  N     . ARG A 1 690  ? 39.471  92.824  4.849   1.00 15.93 ? 690  ARG A N     1 
ATOM   5361  C  CA    . ARG A 1 690  ? 40.859  92.756  5.305   1.00 15.79 ? 690  ARG A CA    1 
ATOM   5362  C  C     . ARG A 1 690  ? 41.688  92.206  4.140   1.00 15.76 ? 690  ARG A C     1 
ATOM   5363  O  O     . ARG A 1 690  ? 41.173  91.430  3.324   1.00 15.61 ? 690  ARG A O     1 
ATOM   5364  C  CB    . ARG A 1 690  ? 40.993  91.866  6.561   1.00 15.89 ? 690  ARG A CB    1 
ATOM   5365  C  CG    . ARG A 1 690  ? 41.614  92.545  7.829   1.00 15.97 ? 690  ARG A CG    1 
ATOM   5366  C  CD    . ARG A 1 690  ? 41.086  91.989  9.198   1.00 17.05 ? 690  ARG A CD    1 
ATOM   5367  N  NE    . ARG A 1 690  ? 41.628  92.689  10.386  1.00 19.41 ? 690  ARG A NE    1 
ATOM   5368  C  CZ    . ARG A 1 690  ? 41.552  92.264  11.668  1.00 19.28 ? 690  ARG A CZ    1 
ATOM   5369  N  NH1   . ARG A 1 690  ? 40.935  91.134  12.008  1.00 16.45 ? 690  ARG A NH1   1 
ATOM   5370  N  NH2   . ARG A 1 690  ? 42.094  92.997  12.630  1.00 20.18 ? 690  ARG A NH2   1 
ATOM   5371  N  N     . LEU A 1 691  ? 42.958  92.607  4.062   1.00 16.01 ? 691  LEU A N     1 
ATOM   5372  C  CA    . LEU A 1 691  ? 43.902  92.032  3.101   1.00 16.28 ? 691  LEU A CA    1 
ATOM   5373  C  C     . LEU A 1 691  ? 43.927  90.501  3.216   1.00 16.28 ? 691  LEU A C     1 
ATOM   5374  O  O     . LEU A 1 691  ? 44.466  89.954  4.191   1.00 16.01 ? 691  LEU A O     1 
ATOM   5375  C  CB    . LEU A 1 691  ? 45.323  92.573  3.340   1.00 16.41 ? 691  LEU A CB    1 
ATOM   5376  C  CG    . LEU A 1 691  ? 45.755  93.984  2.913   1.00 17.11 ? 691  LEU A CG    1 
ATOM   5377  C  CD1   . LEU A 1 691  ? 47.258  94.175  3.182   1.00 18.84 ? 691  LEU A CD1   1 
ATOM   5378  C  CD2   . LEU A 1 691  ? 45.422  94.290  1.454   1.00 17.64 ? 691  LEU A CD2   1 
ATOM   5379  N  N     . ASP A 1 692  ? 43.290  89.845  2.247   1.00 16.24 ? 692  ASP A N     1 
ATOM   5380  C  CA    . ASP A 1 692  ? 43.414  88.408  1.980   1.00 16.58 ? 692  ASP A CA    1 
ATOM   5381  C  C     . ASP A 1 692  ? 44.545  88.346  0.979   1.00 16.66 ? 692  ASP A C     1 
ATOM   5382  O  O     . ASP A 1 692  ? 44.344  88.154  -0.229  1.00 16.92 ? 692  ASP A O     1 
ATOM   5383  C  CB    . ASP A 1 692  ? 42.105  87.830  1.387   1.00 16.68 ? 692  ASP A CB    1 
ATOM   5384  C  CG    . ASP A 1 692  ? 42.270  86.418  0.753   1.00 17.25 ? 692  ASP A CG    1 
ATOM   5385  O  OD1   . ASP A 1 692  ? 43.310  85.751  0.952   1.00 19.78 ? 692  ASP A OD1   1 
ATOM   5386  O  OD2   . ASP A 1 692  ? 41.389  85.889  0.037   1.00 16.21 ? 692  ASP A OD2   1 
ATOM   5387  N  N     . ARG A 1 693  ? 45.741  88.569  1.507   1.00 16.14 ? 693  ARG A N     1 
ATOM   5388  C  CA    . ARG A 1 693  ? 46.968  88.539  0.745   1.00 16.05 ? 693  ARG A CA    1 
ATOM   5389  C  C     . ARG A 1 693  ? 47.735  87.670  1.697   1.00 15.84 ? 693  ARG A C     1 
ATOM   5390  O  O     . ARG A 1 693  ? 48.979  87.559  1.656   1.00 16.65 ? 693  ARG A O     1 
ATOM   5391  C  CB    . ARG A 1 693  ? 47.564  89.958  0.657   1.00 16.29 ? 693  ARG A CB    1 
ATOM   5392  C  CG    . ARG A 1 693  ? 48.357  90.261  -0.621  1.00 17.79 ? 693  ARG A CG    1 
ATOM   5393  C  CD    . ARG A 1 693  ? 47.952  91.553  -1.357  1.00 18.99 ? 693  ARG A CD    1 
ATOM   5394  N  NE    . ARG A 1 693  ? 47.712  91.327  -2.790  1.00 21.31 ? 693  ARG A NE    1 
ATOM   5395  C  CZ    . ARG A 1 693  ? 48.524  91.731  -3.776  1.00 21.64 ? 693  ARG A CZ    1 
ATOM   5396  N  NH1   . ARG A 1 693  ? 49.650  92.388  -3.502  1.00 23.01 ? 693  ARG A NH1   1 
ATOM   5397  N  NH2   . ARG A 1 693  ? 48.213  91.476  -5.042  1.00 21.49 ? 693  ARG A NH2   1 
ATOM   5398  N  N     . ILE A 1 694  ? 46.954  87.044  2.583   1.00 14.17 ? 694  ILE A N     1 
ATOM   5399  C  CA    . ILE A 1 694  ? 47.506  86.421  3.755   1.00 12.46 ? 694  ILE A CA    1 
ATOM   5400  C  C     . ILE A 1 694  ? 46.880  85.061  3.959   1.00 10.61 ? 694  ILE A C     1 
ATOM   5401  O  O     . ILE A 1 694  ? 45.726  84.924  4.362   1.00 9.62  ? 694  ILE A O     1 
ATOM   5402  C  CB    . ILE A 1 694  ? 47.346  87.354  4.995   1.00 12.45 ? 694  ILE A CB    1 
ATOM   5403  C  CG1   . ILE A 1 694  ? 47.690  88.794  4.605   1.00 13.34 ? 694  ILE A CG1   1 
ATOM   5404  C  CG2   . ILE A 1 694  ? 48.219  86.894  6.134   1.00 13.20 ? 694  ILE A CG2   1 
ATOM   5405  C  CD1   . ILE A 1 694  ? 48.559  89.546  5.615   1.00 14.52 ? 694  ILE A CD1   1 
ATOM   5406  N  N     . ASP A 1 695  ? 47.669  84.054  3.616   1.00 9.25  ? 695  ASP A N     1 
ATOM   5407  C  CA    . ASP A 1 695  ? 47.410  82.694  4.050   1.00 8.02  ? 695  ASP A CA    1 
ATOM   5408  C  C     . ASP A 1 695  ? 48.027  82.571  5.442   1.00 6.95  ? 695  ASP A C     1 
ATOM   5409  O  O     . ASP A 1 695  ? 48.678  83.514  5.927   1.00 6.66  ? 695  ASP A O     1 
ATOM   5410  C  CB    . ASP A 1 695  ? 48.001  81.685  3.060   1.00 7.84  ? 695  ASP A CB    1 
ATOM   5411  C  CG    . ASP A 1 695  ? 49.481  81.926  2.772   1.00 7.94  ? 695  ASP A CG    1 
ATOM   5412  O  OD1   . ASP A 1 695  ? 49.968  81.445  1.725   1.00 8.19  ? 695  ASP A OD1   1 
ATOM   5413  O  OD2   . ASP A 1 695  ? 50.242  82.566  3.521   1.00 6.28  ? 695  ASP A OD2   1 
ATOM   5414  N  N     . LEU A 1 696  ? 47.835  81.427  6.085   1.00 5.99  ? 696  LEU A N     1 
ATOM   5415  C  CA    . LEU A 1 696  ? 48.351  81.230  7.440   1.00 5.56  ? 696  LEU A CA    1 
ATOM   5416  C  C     . LEU A 1 696  ? 49.889  81.355  7.565   1.00 5.08  ? 696  LEU A C     1 
ATOM   5417  O  O     . LEU A 1 696  ? 50.364  82.040  8.476   1.00 4.60  ? 696  LEU A O     1 
ATOM   5418  C  CB    . LEU A 1 696  ? 47.847  79.902  8.029   1.00 5.46  ? 696  LEU A CB    1 
ATOM   5419  C  CG    . LEU A 1 696  ? 48.225  79.573  9.483   1.00 5.64  ? 696  LEU A CG    1 
ATOM   5420  C  CD1   . LEU A 1 696  ? 47.978  80.753  10.438  1.00 4.17  ? 696  LEU A CD1   1 
ATOM   5421  C  CD2   . LEU A 1 696  ? 47.449  78.351  9.946   1.00 4.24  ? 696  LEU A CD2   1 
ATOM   5422  N  N     . PRO A 1 697  ? 50.666  80.707  6.688   1.00 4.90  ? 697  PRO A N     1 
ATOM   5423  C  CA    . PRO A 1 697  ? 52.133  80.822  6.757   1.00 4.59  ? 697  PRO A CA    1 
ATOM   5424  C  C     . PRO A 1 697  ? 52.603  82.278  6.651   1.00 4.69  ? 697  PRO A C     1 
ATOM   5425  O  O     . PRO A 1 697  ? 53.603  82.618  7.267   1.00 4.06  ? 697  PRO A O     1 
ATOM   5426  C  CB    . PRO A 1 697  ? 52.615  80.004  5.556   1.00 4.68  ? 697  PRO A CB    1 
ATOM   5427  C  CG    . PRO A 1 697  ? 51.493  79.025  5.307   1.00 4.86  ? 697  PRO A CG    1 
ATOM   5428  C  CD    . PRO A 1 697  ? 50.239  79.789  5.610   1.00 4.42  ? 697  PRO A CD    1 
ATOM   5429  N  N     . THR A 1 698  ? 51.891  83.119  5.907   1.00 4.69  ? 698  THR A N     1 
ATOM   5430  C  CA    . THR A 1 698  ? 52.264  84.537  5.817   1.00 4.57  ? 698  THR A CA    1 
ATOM   5431  C  C     . THR A 1 698  ? 51.956  85.298  7.100   1.00 4.02  ? 698  THR A C     1 
ATOM   5432  O  O     . THR A 1 698  ? 52.784  86.076  7.556   1.00 4.24  ? 698  THR A O     1 
ATOM   5433  C  CB    . THR A 1 698  ? 51.632  85.195  4.580   1.00 4.84  ? 698  THR A CB    1 
ATOM   5434  O  OG1   . THR A 1 698  ? 52.114  84.519  3.418   1.00 5.39  ? 698  THR A OG1   1 
ATOM   5435  C  CG2   . THR A 1 698  ? 52.150  86.610  4.377   1.00 4.75  ? 698  THR A CG2   1 
ATOM   5436  N  N     . ALA A 1 699  ? 50.797  85.038  7.700   1.00 3.57  ? 699  ALA A N     1 
ATOM   5437  C  CA    . ALA A 1 699  ? 50.435  85.648  8.969   1.00 3.25  ? 699  ALA A CA    1 
ATOM   5438  C  C     . ALA A 1 699  ? 51.485  85.338  10.039  1.00 3.75  ? 699  ALA A C     1 
ATOM   5439  O  O     . ALA A 1 699  ? 51.940  86.236  10.754  1.00 2.54  ? 699  ALA A O     1 
ATOM   5440  C  CB    . ALA A 1 699  ? 49.080  85.181  9.412   1.00 3.10  ? 699  ALA A CB    1 
ATOM   5441  N  N     . LEU A 1 700  ? 51.876  84.068  10.129  1.00 3.66  ? 700  LEU A N     1 
ATOM   5442  C  CA    . LEU A 1 700  ? 52.902  83.650  11.089  1.00 3.91  ? 700  LEU A CA    1 
ATOM   5443  C  C     . LEU A 1 700  ? 54.256  84.282  10.787  1.00 3.91  ? 700  LEU A C     1 
ATOM   5444  O  O     . LEU A 1 700  ? 54.907  84.800  11.690  1.00 4.32  ? 700  LEU A O     1 
ATOM   5445  C  CB    . LEU A 1 700  ? 52.996  82.118  11.151  1.00 3.25  ? 700  LEU A CB    1 
ATOM   5446  C  CG    . LEU A 1 700  ? 51.782  81.451  11.823  1.00 3.91  ? 700  LEU A CG    1 
ATOM   5447  C  CD1   . LEU A 1 700  ? 51.666  79.980  11.433  1.00 2.94  ? 700  LEU A CD1   1 
ATOM   5448  C  CD2   . LEU A 1 700  ? 51.817  81.589  13.345  1.00 4.46  ? 700  LEU A CD2   1 
ATOM   5449  N  N     . LYS A 1 701  ? 54.658  84.265  9.517   1.00 4.36  ? 701  LYS A N     1 
ATOM   5450  C  CA    . LYS A 1 701  ? 55.911  84.899  9.100   1.00 5.16  ? 701  LYS A CA    1 
ATOM   5451  C  C     . LYS A 1 701  ? 55.907  86.386  9.443   1.00 4.75  ? 701  LYS A C     1 
ATOM   5452  O  O     . LYS A 1 701  ? 56.909  86.906  9.945   1.00 4.42  ? 701  LYS A O     1 
ATOM   5453  C  CB    . LYS A 1 701  ? 56.142  84.722  7.591   1.00 5.64  ? 701  LYS A CB    1 
ATOM   5454  C  CG    . LYS A 1 701  ? 57.603  84.982  7.153   1.00 8.51  ? 701  LYS A CG    1 
ATOM   5455  C  CD    . LYS A 1 701  ? 57.738  85.653  5.778   1.00 12.37 ? 701  LYS A CD    1 
ATOM   5456  C  CE    . LYS A 1 701  ? 56.773  85.099  4.733   1.00 14.34 ? 701  LYS A CE    1 
ATOM   5457  N  NZ    . LYS A 1 701  ? 56.310  86.167  3.783   1.00 15.62 ? 701  LYS A NZ    1 
ATOM   5458  N  N     . ASN A 1 702  ? 54.778  87.052  9.175   1.00 4.28  ? 702  ASN A N     1 
ATOM   5459  C  CA    . ASN A 1 702  ? 54.626  88.479  9.457   1.00 4.40  ? 702  ASN A CA    1 
ATOM   5460  C  C     . ASN A 1 702  ? 54.818  88.722  10.934  1.00 4.55  ? 702  ASN A C     1 
ATOM   5461  O  O     . ASN A 1 702  ? 55.529  89.656  11.328  1.00 4.89  ? 702  ASN A O     1 
ATOM   5462  C  CB    . ASN A 1 702  ? 53.243  89.003  9.027   1.00 3.76  ? 702  ASN A CB    1 
ATOM   5463  C  CG    . ASN A 1 702  ? 53.152  89.313  7.541   1.00 5.08  ? 702  ASN A CG    1 
ATOM   5464  O  OD1   . ASN A 1 702  ? 54.166  89.381  6.846   1.00 4.14  ? 702  ASN A OD1   1 
ATOM   5465  N  ND2   . ASN A 1 702  ? 51.917  89.508  7.043   1.00 3.32  ? 702  ASN A ND2   1 
ATOM   5466  N  N     . TYR A 1 703  ? 54.192  87.880  11.759  1.00 4.48  ? 703  TYR A N     1 
ATOM   5467  C  CA    . TYR A 1 703  ? 54.324  88.029  13.211  1.00 4.61  ? 703  TYR A CA    1 
ATOM   5468  C  C     . TYR A 1 703  ? 55.792  87.992  13.635  1.00 5.07  ? 703  TYR A C     1 
ATOM   5469  O  O     . TYR A 1 703  ? 56.274  88.884  14.363  1.00 5.36  ? 703  TYR A O     1 
ATOM   5470  C  CB    . TYR A 1 703  ? 53.507  86.967  13.982  1.00 4.36  ? 703  TYR A CB    1 
ATOM   5471  C  CG    . TYR A 1 703  ? 53.742  87.072  15.482  1.00 4.26  ? 703  TYR A CG    1 
ATOM   5472  C  CD1   . TYR A 1 703  ? 53.116  88.073  16.228  1.00 3.36  ? 703  TYR A CD1   1 
ATOM   5473  C  CD2   . TYR A 1 703  ? 54.639  86.216  16.136  1.00 4.45  ? 703  TYR A CD2   1 
ATOM   5474  C  CE1   . TYR A 1 703  ? 53.355  88.208  17.600  1.00 4.80  ? 703  TYR A CE1   1 
ATOM   5475  C  CE2   . TYR A 1 703  ? 54.889  86.341  17.514  1.00 3.53  ? 703  TYR A CE2   1 
ATOM   5476  C  CZ    . TYR A 1 703  ? 54.243  87.340  18.228  1.00 3.61  ? 703  TYR A CZ    1 
ATOM   5477  O  OH    . TYR A 1 703  ? 54.463  87.477  19.569  1.00 4.28  ? 703  TYR A OH    1 
ATOM   5478  N  N     . ARG A 1 704  ? 56.509  86.971  13.177  1.00 4.83  ? 704  ARG A N     1 
ATOM   5479  C  CA    . ARG A 1 704  ? 57.917  86.842  13.515  1.00 5.88  ? 704  ARG A CA    1 
ATOM   5480  C  C     . ARG A 1 704  ? 58.756  88.005  12.979  1.00 5.54  ? 704  ARG A C     1 
ATOM   5481  O  O     . ARG A 1 704  ? 59.640  88.496  13.660  1.00 5.33  ? 704  ARG A O     1 
ATOM   5482  C  CB    . ARG A 1 704  ? 58.481  85.515  13.008  1.00 6.14  ? 704  ARG A CB    1 
ATOM   5483  C  CG    . ARG A 1 704  ? 60.000  85.438  13.063  1.00 8.00  ? 704  ARG A CG    1 
ATOM   5484  C  CD    . ARG A 1 704  ? 60.532  84.243  12.294  1.00 13.73 ? 704  ARG A CD    1 
ATOM   5485  N  NE    . ARG A 1 704  ? 60.750  83.161  13.215  1.00 14.20 ? 704  ARG A NE    1 
ATOM   5486  C  CZ    . ARG A 1 704  ? 60.979  81.905  12.872  1.00 15.28 ? 704  ARG A CZ    1 
ATOM   5487  N  NH1   . ARG A 1 704  ? 61.039  81.530  11.596  1.00 13.60 ? 704  ARG A NH1   1 
ATOM   5488  N  NH2   . ARG A 1 704  ? 61.161  81.021  13.833  1.00 14.78 ? 704  ARG A NH2   1 
ATOM   5489  N  N     . GLN A 1 705  ? 58.482  88.431  11.753  1.00 5.94  ? 705  GLN A N     1 
ATOM   5490  C  CA    . GLN A 1 705  ? 59.195  89.569  11.161  1.00 6.54  ? 705  GLN A CA    1 
ATOM   5491  C  C     . GLN A 1 705  ? 58.969  90.839  12.005  1.00 6.32  ? 705  GLN A C     1 
ATOM   5492  O  O     . GLN A 1 705  ? 59.899  91.633  12.224  1.00 5.72  ? 705  GLN A O     1 
ATOM   5493  C  CB    . GLN A 1 705  ? 58.772  89.718  9.691   1.00 7.16  ? 705  GLN A CB    1 
ATOM   5494  C  CG    . GLN A 1 705  ? 58.995  91.091  9.035   1.00 11.45 ? 705  GLN A CG    1 
ATOM   5495  C  CD    . GLN A 1 705  ? 58.290  91.204  7.689   1.00 14.61 ? 705  GLN A CD    1 
ATOM   5496  O  OE1   . GLN A 1 705  ? 58.490  90.359  6.800   1.00 17.82 ? 705  GLN A OE1   1 
ATOM   5497  N  NE2   . GLN A 1 705  ? 57.453  92.239  7.537   1.00 14.33 ? 705  GLN A NE2   1 
ATOM   5498  N  N     . SER A 1 706  ? 57.748  91.004  12.520  1.00 6.03  ? 706  SER A N     1 
ATOM   5499  C  CA    . SER A 1 706  ? 57.417  92.144  13.377  1.00 5.81  ? 706  SER A CA    1 
ATOM   5500  C  C     . SER A 1 706  ? 58.263  92.160  14.648  1.00 5.67  ? 706  SER A C     1 
ATOM   5501  O  O     . SER A 1 706  ? 58.755  93.218  15.059  1.00 5.76  ? 706  SER A O     1 
ATOM   5502  C  CB    . SER A 1 706  ? 55.937  92.104  13.769  1.00 5.71  ? 706  SER A CB    1 
ATOM   5503  O  OG    . SER A 1 706  ? 55.093  92.316  12.656  1.00 6.18  ? 706  SER A OG    1 
ATOM   5504  N  N     . VAL A 1 707  ? 58.410  90.987  15.272  1.00 5.32  ? 707  VAL A N     1 
ATOM   5505  C  CA    . VAL A 1 707  ? 59.193  90.819  16.502  1.00 4.84  ? 707  VAL A CA    1 
ATOM   5506  C  C     . VAL A 1 707  ? 60.685  91.099  16.249  1.00 5.50  ? 707  VAL A C     1 
ATOM   5507  O  O     . VAL A 1 707  ? 61.333  91.870  16.992  1.00 4.33  ? 707  VAL A O     1 
ATOM   5508  C  CB    . VAL A 1 707  ? 59.002  89.399  17.111  1.00 5.00  ? 707  VAL A CB    1 
ATOM   5509  C  CG1   . VAL A 1 707  ? 60.023  89.116  18.242  1.00 4.99  ? 707  VAL A CG1   1 
ATOM   5510  C  CG2   . VAL A 1 707  ? 57.561  89.190  17.608  1.00 4.51  ? 707  VAL A CG2   1 
ATOM   5511  N  N     . GLU A 1 708  ? 61.221  90.486  15.191  1.00 5.43  ? 708  GLU A N     1 
ATOM   5512  C  CA    . GLU A 1 708  ? 62.620  90.707  14.796  1.00 5.27  ? 708  GLU A CA    1 
ATOM   5513  C  C     . GLU A 1 708  ? 62.935  92.193  14.522  1.00 4.99  ? 708  GLU A C     1 
ATOM   5514  O  O     . GLU A 1 708  ? 63.896  92.734  15.052  1.00 4.71  ? 708  GLU A O     1 
ATOM   5515  C  CB    . GLU A 1 708  ? 62.986  89.796  13.621  1.00 5.32  ? 708  GLU A CB    1 
ATOM   5516  C  CG    . GLU A 1 708  ? 63.172  88.351  14.111  1.00 7.12  ? 708  GLU A CG    1 
ATOM   5517  C  CD    . GLU A 1 708  ? 63.166  87.305  13.015  1.00 9.45  ? 708  GLU A CD    1 
ATOM   5518  O  OE1   . GLU A 1 708  ? 63.003  87.645  11.822  1.00 8.81  ? 708  GLU A OE1   1 
ATOM   5519  O  OE2   . GLU A 1 708  ? 63.314  86.122  13.368  1.00 8.76  ? 708  GLU A OE2   1 
ATOM   5520  N  N     . ALA A 1 709  ? 62.114  92.841  13.706  1.00 5.08  ? 709  ALA A N     1 
ATOM   5521  C  CA    . ALA A 1 709  ? 62.219  94.283  13.456  1.00 4.32  ? 709  ALA A CA    1 
ATOM   5522  C  C     . ALA A 1 709  ? 62.157  95.092  14.763  1.00 4.46  ? 709  ALA A C     1 
ATOM   5523  O  O     . ALA A 1 709  ? 62.921  96.047  14.956  1.00 3.93  ? 709  ALA A O     1 
ATOM   5524  C  CB    . ALA A 1 709  ? 61.110  94.717  12.499  1.00 4.66  ? 709  ALA A CB    1 
ATOM   5525  N  N     . GLY A 1 710  ? 61.241  94.704  15.650  1.00 3.87  ? 710  GLY A N     1 
ATOM   5526  C  CA    . GLY A 1 710  ? 61.061  95.364  16.927  1.00 4.39  ? 710  GLY A CA    1 
ATOM   5527  C  C     . GLY A 1 710  ? 62.266  95.194  17.831  1.00 4.73  ? 710  GLY A C     1 
ATOM   5528  O  O     . GLY A 1 710  ? 62.607  96.099  18.606  1.00 4.41  ? 710  GLY A O     1 
ATOM   5529  N  N     . LEU A 1 711  ? 62.917  94.035  17.739  1.00 4.46  ? 711  LEU A N     1 
ATOM   5530  C  CA    . LEU A 1 711  ? 64.137  93.806  18.510  1.00 5.22  ? 711  LEU A CA    1 
ATOM   5531  C  C     . LEU A 1 711  ? 65.310  94.646  18.001  1.00 4.75  ? 711  LEU A C     1 
ATOM   5532  O  O     . LEU A 1 711  ? 66.066  95.184  18.801  1.00 4.71  ? 711  LEU A O     1 
ATOM   5533  C  CB    . LEU A 1 711  ? 64.519  92.328  18.545  1.00 5.10  ? 711  LEU A CB    1 
ATOM   5534  C  CG    . LEU A 1 711  ? 63.728  91.486  19.538  1.00 6.84  ? 711  LEU A CG    1 
ATOM   5535  C  CD1   . LEU A 1 711  ? 64.198  90.020  19.474  1.00 7.71  ? 711  LEU A CD1   1 
ATOM   5536  C  CD2   . LEU A 1 711  ? 63.837  92.077  20.988  1.00 6.99  ? 711  LEU A CD2   1 
ATOM   5537  N  N     . PHE A 1 712  ? 65.458  94.752  16.679  1.00 4.32  ? 712  PHE A N     1 
ATOM   5538  C  CA    . PHE A 1 712  ? 66.489  95.614  16.089  1.00 4.55  ? 712  PHE A CA    1 
ATOM   5539  C  C     . PHE A 1 712  ? 66.258  97.046  16.535  1.00 4.69  ? 712  PHE A C     1 
ATOM   5540  O  O     . PHE A 1 712  ? 67.227  97.768  16.844  1.00 4.44  ? 712  PHE A O     1 
ATOM   5541  C  CB    . PHE A 1 712  ? 66.463  95.570  14.552  1.00 4.46  ? 712  PHE A CB    1 
ATOM   5542  C  CG    . PHE A 1 712  ? 67.066  94.322  13.944  1.00 4.29  ? 712  PHE A CG    1 
ATOM   5543  C  CD1   . PHE A 1 712  ? 66.334  93.574  13.012  1.00 6.33  ? 712  PHE A CD1   1 
ATOM   5544  C  CD2   . PHE A 1 712  ? 68.375  93.939  14.233  1.00 4.17  ? 712  PHE A CD2   1 
ATOM   5545  C  CE1   . PHE A 1 712  ? 66.871  92.420  12.430  1.00 6.16  ? 712  PHE A CE1   1 
ATOM   5546  C  CE2   . PHE A 1 712  ? 68.929  92.775  13.651  1.00 6.13  ? 712  PHE A CE2   1 
ATOM   5547  C  CZ    . PHE A 1 712  ? 68.178  92.028  12.742  1.00 4.60  ? 712  PHE A CZ    1 
ATOM   5548  N  N     . LYS A 1 713  ? 64.983  97.466  16.542  1.00 4.38  ? 713  LYS A N     1 
ATOM   5549  C  CA    . LYS A 1 713  ? 64.631  98.803  17.018  1.00 5.17  ? 713  LYS A CA    1 
ATOM   5550  C  C     . LYS A 1 713  ? 65.079  99.022  18.475  1.00 5.50  ? 713  LYS A C     1 
ATOM   5551  O  O     . LYS A 1 713  ? 65.753  100.013 18.779  1.00 4.94  ? 713  LYS A O     1 
ATOM   5552  C  CB    . LYS A 1 713  ? 63.127  99.118  16.847  1.00 4.88  ? 713  LYS A CB    1 
ATOM   5553  C  CG    . LYS A 1 713  ? 62.726  100.490 17.459  1.00 7.02  ? 713  LYS A CG    1 
ATOM   5554  C  CD    . LYS A 1 713  ? 61.197  100.681 17.599  1.00 8.33  ? 713  LYS A CD    1 
ATOM   5555  C  CE    . LYS A 1 713  ? 60.498  100.747 16.248  1.00 10.48 ? 713  LYS A CE    1 
ATOM   5556  N  NZ    . LYS A 1 713  ? 60.907  101.897 15.383  1.00 11.89 ? 713  LYS A NZ    1 
ATOM   5557  N  N     . ILE A 1 714  ? 64.722  98.100  19.365  1.00 4.99  ? 714  ILE A N     1 
ATOM   5558  C  CA    . ILE A 1 714  ? 65.034  98.289  20.796  1.00 5.34  ? 714  ILE A CA    1 
ATOM   5559  C  C     . ILE A 1 714  ? 66.566  98.348  21.061  1.00 5.47  ? 714  ILE A C     1 
ATOM   5560  O  O     . ILE A 1 714  ? 67.045  99.245  21.775  1.00 5.72  ? 714  ILE A O     1 
ATOM   5561  C  CB    . ILE A 1 714  ? 64.303  97.231  21.649  1.00 4.96  ? 714  ILE A CB    1 
ATOM   5562  C  CG1   . ILE A 1 714  ? 62.788  97.518  21.600  1.00 4.82  ? 714  ILE A CG1   1 
ATOM   5563  C  CG2   . ILE A 1 714  ? 64.849  97.206  23.112  1.00 5.86  ? 714  ILE A CG2   1 
ATOM   5564  C  CD1   . ILE A 1 714  ? 61.927  96.459  22.252  1.00 7.15  ? 714  ILE A CD1   1 
ATOM   5565  N  N     . LEU A 1 715  ? 67.303  97.427  20.450  1.00 5.47  ? 715  LEU A N     1 
ATOM   5566  C  CA    . LEU A 1 715  ? 68.768  97.398  20.503  1.00 6.03  ? 715  LEU A CA    1 
ATOM   5567  C  C     . LEU A 1 715  ? 69.373  98.720  20.035  1.00 5.50  ? 715  LEU A C     1 
ATOM   5568  O  O     . LEU A 1 715  ? 70.233  99.296  20.718  1.00 4.65  ? 715  LEU A O     1 
ATOM   5569  C  CB    . LEU A 1 715  ? 69.329  96.263  19.626  1.00 6.17  ? 715  LEU A CB    1 
ATOM   5570  C  CG    . LEU A 1 715  ? 69.135  94.770  19.939  1.00 9.56  ? 715  LEU A CG    1 
ATOM   5571  C  CD1   . LEU A 1 715  ? 70.388  93.935  19.708  1.00 9.89  ? 715  LEU A CD1   1 
ATOM   5572  C  CD2   . LEU A 1 715  ? 68.464  94.442  21.263  1.00 9.84  ? 715  LEU A CD2   1 
ATOM   5573  N  N     . SER A 1 716  ? 68.895  99.193  18.882  1.00 5.07  ? 716  SER A N     1 
ATOM   5574  C  CA    . SER A 1 716  ? 69.406  100.411 18.255  1.00 5.17  ? 716  SER A CA    1 
ATOM   5575  C  C     . SER A 1 716  ? 69.176  101.663 19.096  1.00 5.59  ? 716  SER A C     1 
ATOM   5576  O  O     . SER A 1 716  ? 69.941  102.637 18.973  1.00 5.70  ? 716  SER A O     1 
ATOM   5577  C  CB    . SER A 1 716  ? 68.788  100.597 16.881  1.00 5.35  ? 716  SER A CB    1 
ATOM   5578  O  OG    . SER A 1 716  ? 67.447  101.040 16.989  1.00 5.32  ? 716  SER A OG    1 
ATOM   5579  N  N     . LYS A 1 717  ? 68.135  101.644 19.935  1.00 4.82  ? 717  LYS A N     1 
ATOM   5580  C  CA    . LYS A 1 717  ? 67.862  102.767 20.828  1.00 5.13  ? 717  LYS A CA    1 
ATOM   5581  C  C     . LYS A 1 717  ? 69.057  103.062 21.720  1.00 4.80  ? 717  LYS A C     1 
ATOM   5582  O  O     . LYS A 1 717  ? 69.285  104.219 22.084  1.00 3.61  ? 717  LYS A O     1 
ATOM   5583  C  CB    . LYS A 1 717  ? 66.637  102.502 21.719  1.00 5.45  ? 717  LYS A CB    1 
ATOM   5584  C  CG    . LYS A 1 717  ? 65.315  102.421 20.945  1.00 5.05  ? 717  LYS A CG    1 
ATOM   5585  C  CD    . LYS A 1 717  ? 64.143  102.277 21.898  1.00 3.54  ? 717  LYS A CD    1 
ATOM   5586  C  CE    . LYS A 1 717  ? 62.861  101.987 21.108  1.00 4.68  ? 717  LYS A CE    1 
ATOM   5587  N  NZ    . LYS A 1 717  ? 61.655  101.790 21.982  1.00 2.96  ? 717  LYS A NZ    1 
ATOM   5588  N  N     . MET A 1 718  ? 69.797  102.010 22.079  1.00 4.65  ? 718  MET A N     1 
ATOM   5589  C  CA    . MET A 1 718  ? 70.998  102.131 22.937  1.00 5.00  ? 718  MET A CA    1 
ATOM   5590  C  C     . MET A 1 718  ? 72.319  102.119 22.144  1.00 4.58  ? 718  MET A C     1 
ATOM   5591  O  O     . MET A 1 718  ? 73.415  102.285 22.723  1.00 4.46  ? 718  MET A O     1 
ATOM   5592  C  CB    . MET A 1 718  ? 70.984  101.054 24.044  1.00 5.43  ? 718  MET A CB    1 
ATOM   5593  C  CG    . MET A 1 718  ? 72.196  101.102 25.009  1.00 7.50  ? 718  MET A CG    1 
ATOM   5594  S  SD    . MET A 1 718  ? 72.437  102.733 25.822  1.00 10.93 ? 718  MET A SD    1 
ATOM   5595  C  CE    . MET A 1 718  ? 71.270  102.480 27.064  1.00 6.39  ? 718  MET A CE    1 
ATOM   5596  N  N     . GLY A 1 719  ? 72.214  101.956 20.826  1.00 4.26  ? 719  GLY A N     1 
ATOM   5597  C  CA    . GLY A 1 719  ? 73.374  101.857 19.945  1.00 4.06  ? 719  GLY A CA    1 
ATOM   5598  C  C     . GLY A 1 719  ? 74.000  100.464 19.891  1.00 3.63  ? 719  GLY A C     1 
ATOM   5599  O  O     . GLY A 1 719  ? 75.168  100.324 19.513  1.00 3.77  ? 719  GLY A O     1 
ATOM   5600  N  N     . ILE A 1 720  ? 73.233  99.442  20.271  1.00 3.80  ? 720  ILE A N     1 
ATOM   5601  C  CA    . ILE A 1 720  ? 73.719  98.056  20.350  1.00 3.76  ? 720  ILE A CA    1 
ATOM   5602  C  C     . ILE A 1 720  ? 73.441  97.308  19.035  1.00 4.34  ? 720  ILE A C     1 
ATOM   5603  O  O     . ILE A 1 720  ? 72.323  97.344  18.527  1.00 4.86  ? 720  ILE A O     1 
ATOM   5604  C  CB    . ILE A 1 720  ? 73.057  97.326  21.560  1.00 4.53  ? 720  ILE A CB    1 
ATOM   5605  C  CG1   . ILE A 1 720  ? 73.496  97.979  22.884  1.00 2.76  ? 720  ILE A CG1   1 
ATOM   5606  C  CG2   . ILE A 1 720  ? 73.453  95.838  21.580  1.00 3.79  ? 720  ILE A CG2   1 
ATOM   5607  C  CD1   . ILE A 1 720  ? 72.710  97.508  24.116  1.00 3.06  ? 720  ILE A CD1   1 
ATOM   5608  N  N     . SER A 1 721  ? 74.453  96.649  18.480  1.00 4.32  ? 721  SER A N     1 
ATOM   5609  C  CA    . SER A 1 721  ? 74.319  95.891  17.220  1.00 5.12  ? 721  SER A CA    1 
ATOM   5610  C  C     . SER A 1 721  ? 73.872  94.427  17.385  1.00 4.84  ? 721  SER A C     1 
ATOM   5611  O  O     . SER A 1 721  ? 73.049  93.932  16.602  1.00 4.69  ? 721  SER A O     1 
ATOM   5612  C  CB    . SER A 1 721  ? 75.651  95.876  16.454  1.00 4.52  ? 721  SER A CB    1 
ATOM   5613  O  OG    . SER A 1 721  ? 75.937  97.122  15.838  1.00 6.69  ? 721  SER A OG    1 
ATOM   5614  N  N     . LEU A 1 722  ? 74.457  93.719  18.347  1.00 4.59  ? 722  LEU A N     1 
ATOM   5615  C  CA    . LEU A 1 722  ? 74.228  92.283  18.455  1.00 4.58  ? 722  LEU A CA    1 
ATOM   5616  C  C     . LEU A 1 722  ? 73.340  91.947  19.630  1.00 5.27  ? 722  LEU A C     1 
ATOM   5617  O  O     . LEU A 1 722  ? 73.580  92.416  20.766  1.00 4.19  ? 722  LEU A O     1 
ATOM   5618  C  CB    . LEU A 1 722  ? 75.559  91.500  18.566  1.00 5.59  ? 722  LEU A CB    1 
ATOM   5619  C  CG    . LEU A 1 722  ? 76.611  91.617  17.441  1.00 6.84  ? 722  LEU A CG    1 
ATOM   5620  C  CD1   . LEU A 1 722  ? 77.687  90.492  17.554  1.00 5.74  ? 722  LEU A CD1   1 
ATOM   5621  C  CD2   . LEU A 1 722  ? 75.945  91.554  16.075  1.00 7.70  ? 722  LEU A CD2   1 
ATOM   5622  N  N     . LEU A 1 723  ? 72.311  91.136  19.362  1.00 5.16  ? 723  LEU A N     1 
ATOM   5623  C  CA    . LEU A 1 723  ? 71.530  90.539  20.461  1.00 5.10  ? 723  LEU A CA    1 
ATOM   5624  C  C     . LEU A 1 723  ? 72.389  89.806  21.480  1.00 5.31  ? 723  LEU A C     1 
ATOM   5625  O  O     . LEU A 1 723  ? 72.074  89.813  22.676  1.00 5.72  ? 723  LEU A O     1 
ATOM   5626  C  CB    . LEU A 1 723  ? 70.431  89.617  19.932  1.00 5.24  ? 723  LEU A CB    1 
ATOM   5627  C  CG    . LEU A 1 723  ? 69.307  89.264  20.924  1.00 5.41  ? 723  LEU A CG    1 
ATOM   5628  C  CD1   . LEU A 1 723  ? 68.505  90.498  21.342  1.00 6.01  ? 723  LEU A CD1   1 
ATOM   5629  C  CD2   . LEU A 1 723  ? 68.387  88.239  20.290  1.00 5.21  ? 723  LEU A CD2   1 
ATOM   5630  N  N     . ALA A 1 724  ? 73.478  89.193  21.020  1.00 5.45  ? 724  ALA A N     1 
ATOM   5631  C  CA    . ALA A 1 724  ? 74.459  88.591  21.930  1.00 6.18  ? 724  ALA A CA    1 
ATOM   5632  C  C     . ALA A 1 724  ? 75.025  89.554  23.008  1.00 5.94  ? 724  ALA A C     1 
ATOM   5633  O  O     . ALA A 1 724  ? 75.244  89.138  24.147  1.00 5.14  ? 724  ALA A O     1 
ATOM   5634  C  CB    . ALA A 1 724  ? 75.583  87.887  21.132  1.00 6.60  ? 724  ALA A CB    1 
ATOM   5635  N  N     . SER A 1 725  ? 75.225  90.837  22.662  1.00 5.63  ? 725  SER A N     1 
ATOM   5636  C  CA    . SER A 1 725  ? 75.662  91.840  23.628  1.00 5.94  ? 725  SER A CA    1 
ATOM   5637  C  C     . SER A 1 725  ? 74.513  92.307  24.531  1.00 6.43  ? 725  SER A C     1 
ATOM   5638  O  O     . SER A 1 725  ? 74.713  92.582  25.706  1.00 6.75  ? 725  SER A O     1 
ATOM   5639  C  CB    . SER A 1 725  ? 76.278  93.071  22.925  1.00 6.58  ? 725  SER A CB    1 
ATOM   5640  O  OG    . SER A 1 725  ? 77.509  92.747  22.302  1.00 8.45  ? 725  SER A OG    1 
ATOM   5641  N  N     . TYR A 1 726  ? 73.323  92.445  23.950  1.00 6.68  ? 726  TYR A N     1 
ATOM   5642  C  CA    . TYR A 1 726  ? 72.128  92.854  24.677  1.00 6.52  ? 726  TYR A CA    1 
ATOM   5643  C  C     . TYR A 1 726  ? 71.707  91.812  25.707  1.00 6.77  ? 726  TYR A C     1 
ATOM   5644  O  O     . TYR A 1 726  ? 71.215  92.170  26.774  1.00 7.46  ? 726  TYR A O     1 
ATOM   5645  C  CB    . TYR A 1 726  ? 71.015  93.092  23.668  1.00 6.30  ? 726  TYR A CB    1 
ATOM   5646  C  CG    . TYR A 1 726  ? 69.745  93.681  24.208  1.00 6.16  ? 726  TYR A CG    1 
ATOM   5647  C  CD1   . TYR A 1 726  ? 69.599  95.063  24.327  1.00 5.63  ? 726  TYR A CD1   1 
ATOM   5648  C  CD2   . TYR A 1 726  ? 68.654  92.856  24.550  1.00 5.47  ? 726  TYR A CD2   1 
ATOM   5649  C  CE1   . TYR A 1 726  ? 68.426  95.619  24.802  1.00 5.37  ? 726  TYR A CE1   1 
ATOM   5650  C  CE2   . TYR A 1 726  ? 67.466  93.410  25.022  1.00 5.33  ? 726  TYR A CE2   1 
ATOM   5651  C  CZ    . TYR A 1 726  ? 67.372  94.792  25.148  1.00 5.81  ? 726  TYR A CZ    1 
ATOM   5652  O  OH    . TYR A 1 726  ? 66.209  95.366  25.588  1.00 7.04  ? 726  TYR A OH    1 
ATOM   5653  N  N     . HIS A 1 727  ? 71.932  90.536  25.375  1.00 6.50  ? 727  HIS A N     1 
ATOM   5654  C  CA    . HIS A 1 727  ? 71.617  89.354  26.204  1.00 6.71  ? 727  HIS A CA    1 
ATOM   5655  C  C     . HIS A 1 727  ? 72.084  89.482  27.668  1.00 7.67  ? 727  HIS A C     1 
ATOM   5656  O  O     . HIS A 1 727  ? 71.284  89.441  28.595  1.00 8.80  ? 727  HIS A O     1 
ATOM   5657  C  CB    . HIS A 1 727  ? 72.192  88.119  25.488  1.00 6.06  ? 727  HIS A CB    1 
ATOM   5658  C  CG    . HIS A 1 727  ? 72.066  86.823  26.223  1.00 6.38  ? 727  HIS A CG    1 
ATOM   5659  N  ND1   . HIS A 1 727  ? 70.927  86.435  26.904  1.00 9.06  ? 727  HIS A ND1   1 
ATOM   5660  C  CD2   . HIS A 1 727  ? 72.927  85.785  26.312  1.00 5.11  ? 727  HIS A CD2   1 
ATOM   5661  C  CE1   . HIS A 1 727  ? 71.110  85.227  27.411  1.00 7.14  ? 727  HIS A CE1   1 
ATOM   5662  N  NE2   . HIS A 1 727  ? 72.309  84.805  27.056  1.00 8.43  ? 727  HIS A NE2   1 
ATOM   5663  N  N     . GLY A 1 728  ? 73.346  89.678  27.949  1.00 7.55  ? 728  GLY A N     1 
ATOM   5664  C  CA    . GLY A 1 728  ? 73.590  89.836  29.399  1.00 10.56 ? 728  GLY A CA    1 
ATOM   5665  C  C     . GLY A 1 728  ? 73.112  91.119  30.122  1.00 9.89  ? 728  GLY A C     1 
ATOM   5666  O  O     . GLY A 1 728  ? 73.143  91.237  31.365  1.00 9.84  ? 728  GLY A O     1 
ATOM   5667  N  N     . ALA A 1 729  ? 72.716  92.099  29.333  1.00 8.95  ? 729  ALA A N     1 
ATOM   5668  C  CA    . ALA A 1 729  ? 72.957  93.477  29.713  1.00 8.79  ? 729  ALA A CA    1 
ATOM   5669  C  C     . ALA A 1 729  ? 71.683  93.925  30.327  1.00 9.33  ? 729  ALA A C     1 
ATOM   5670  O  O     . ALA A 1 729  ? 70.650  93.301  30.195  1.00 10.24 ? 729  ALA A O     1 
ATOM   5671  C  CB    . ALA A 1 729  ? 73.324  94.308  28.501  1.00 8.52  ? 729  ALA A CB    1 
ATOM   5672  N  N     . GLN A 1 730  ? 71.612  94.950  31.090  1.00 9.06  ? 730  GLN A N     1 
ATOM   5673  C  CA    . GLN A 1 730  ? 70.199  94.859  31.576  1.00 8.02  ? 730  GLN A CA    1 
ATOM   5674  C  C     . GLN A 1 730  ? 69.638  96.185  31.240  1.00 6.47  ? 730  GLN A C     1 
ATOM   5675  O  O     . GLN A 1 730  ? 69.566  97.020  32.101  1.00 6.18  ? 730  GLN A O     1 
ATOM   5676  C  CB    . GLN A 1 730  ? 70.120  94.505  33.074  1.00 6.88  ? 730  GLN A CB    1 
ATOM   5677  C  CG    . GLN A 1 730  ? 70.201  93.012  33.363  1.00 7.25  ? 730  GLN A CG    1 
ATOM   5678  C  CD    . GLN A 1 730  ? 70.535  92.686  34.796  1.00 6.39  ? 730  GLN A CD    1 
ATOM   5679  O  OE1   . GLN A 1 730  ? 70.556  93.569  35.672  1.00 7.01  ? 730  GLN A OE1   1 
ATOM   5680  N  NE2   . GLN A 1 730  ? 70.774  91.413  35.053  1.00 6.76  ? 730  GLN A NE2   1 
ATOM   5681  N  N     . ILE A 1 731  ? 69.311  96.367  29.960  1.00 6.21  ? 731  ILE A N     1 
ATOM   5682  C  CA    . ILE A 1 731  ? 69.139  97.720  29.387  1.00 6.44  ? 731  ILE A CA    1 
ATOM   5683  C  C     . ILE A 1 731  ? 67.740  98.271  29.713  1.00 6.81  ? 731  ILE A C     1 
ATOM   5684  O  O     . ILE A 1 731  ? 66.939  98.607  28.827  1.00 7.34  ? 731  ILE A O     1 
ATOM   5685  C  CB    . ILE A 1 731  ? 69.487  97.746  27.853  1.00 6.49  ? 731  ILE A CB    1 
ATOM   5686  C  CG1   . ILE A 1 731  ? 70.825  97.054  27.575  1.00 5.66  ? 731  ILE A CG1   1 
ATOM   5687  C  CG2   . ILE A 1 731  ? 69.523  99.237  27.290  1.00 5.23  ? 731  ILE A CG2   1 
ATOM   5688  C  CD1   . ILE A 1 731  ? 72.067  97.809  28.166  1.00 5.21  ? 731  ILE A CD1   1 
ATOM   5689  N  N     . PHE A 1 732  ? 67.458  98.330  31.012  1.00 6.71  ? 732  PHE A N     1 
ATOM   5690  C  CA    . PHE A 1 732  ? 66.166  98.747  31.526  1.00 6.39  ? 732  PHE A CA    1 
ATOM   5691  C  C     . PHE A 1 732  ? 66.370  99.480  32.845  1.00 6.61  ? 732  PHE A C     1 
ATOM   5692  O  O     . PHE A 1 732  ? 67.432  99.384  33.503  1.00 6.36  ? 732  PHE A O     1 
ATOM   5693  C  CB    . PHE A 1 732  ? 65.224  97.522  31.751  1.00 6.51  ? 732  PHE A CB    1 
ATOM   5694  C  CG    . PHE A 1 732  ? 64.961  96.715  30.509  1.00 5.84  ? 732  PHE A CG    1 
ATOM   5695  C  CD1   . PHE A 1 732  ? 65.808  95.654  30.158  1.00 7.00  ? 732  PHE A CD1   1 
ATOM   5696  C  CD2   . PHE A 1 732  ? 63.885  97.015  29.686  1.00 6.20  ? 732  PHE A CD2   1 
ATOM   5697  C  CE1   . PHE A 1 732  ? 65.589  94.908  28.986  1.00 5.53  ? 732  PHE A CE1   1 
ATOM   5698  C  CE2   . PHE A 1 732  ? 63.638  96.261  28.511  1.00 4.95  ? 732  PHE A CE2   1 
ATOM   5699  C  CZ    . PHE A 1 732  ? 64.497  95.210  28.168  1.00 5.53  ? 732  PHE A CZ    1 
ATOM   5700  N  N     . GLU A 1 733  ? 65.322  100.193 33.226  1.00 6.77  ? 733  GLU A N     1 
ATOM   5701  C  CA    . GLU A 1 733  ? 65.152  100.740 34.547  1.00 6.91  ? 733  GLU A CA    1 
ATOM   5702  C  C     . GLU A 1 733  ? 63.811  100.195 35.040  1.00 6.93  ? 733  GLU A C     1 
ATOM   5703  O  O     . GLU A 1 733  ? 62.826  100.174 34.299  1.00 7.59  ? 733  GLU A O     1 
ATOM   5704  C  CB    . GLU A 1 733  ? 65.124  102.274 34.467  1.00 7.59  ? 733  GLU A CB    1 
ATOM   5705  C  CG    . GLU A 1 733  ? 64.617  102.973 35.721  1.00 8.06  ? 733  GLU A CG    1 
ATOM   5706  C  CD    . GLU A 1 733  ? 64.850  104.478 35.724  1.00 10.71 ? 733  GLU A CD    1 
ATOM   5707  O  OE1   . GLU A 1 733  ? 65.038  105.079 34.642  1.00 11.22 ? 733  GLU A OE1   1 
ATOM   5708  O  OE2   . GLU A 1 733  ? 64.845  105.067 36.836  1.00 12.80 ? 733  GLU A OE2   1 
ATOM   5709  N  N     . ALA A 1 734  ? 63.770  99.740  36.280  1.00 6.42  ? 734  ALA A N     1 
ATOM   5710  C  CA    . ALA A 1 734  ? 62.511  99.274  36.857  1.00 6.56  ? 734  ALA A CA    1 
ATOM   5711  C  C     . ALA A 1 734  ? 61.856  100.396 37.649  1.00 6.37  ? 734  ALA A C     1 
ATOM   5712  O  O     . ALA A 1 734  ? 62.534  101.156 38.342  1.00 5.27  ? 734  ALA A O     1 
ATOM   5713  C  CB    . ALA A 1 734  ? 62.736  98.064  37.723  1.00 6.66  ? 734  ALA A CB    1 
ATOM   5714  N  N     . ILE A 1 735  ? 60.530  100.504 37.513  1.00 5.92  ? 735  ILE A N     1 
ATOM   5715  C  CA    . ILE A 1 735  ? 59.762  101.488 38.253  1.00 5.91  ? 735  ILE A CA    1 
ATOM   5716  C  C     . ILE A 1 735  ? 58.669  100.750 39.018  1.00 6.36  ? 735  ILE A C     1 
ATOM   5717  O  O     . ILE A 1 735  ? 57.734  100.205 38.415  1.00 5.85  ? 735  ILE A O     1 
ATOM   5718  C  CB    . ILE A 1 735  ? 59.150  102.527 37.286  1.00 6.51  ? 735  ILE A CB    1 
ATOM   5719  C  CG1   . ILE A 1 735  ? 60.201  102.939 36.242  1.00 6.85  ? 735  ILE A CG1   1 
ATOM   5720  C  CG2   . ILE A 1 735  ? 58.479  103.702 38.079  1.00 4.89  ? 735  ILE A CG2   1 
ATOM   5721  C  CD1   . ILE A 1 735  ? 60.148  104.362 35.797  1.00 7.84  ? 735  ILE A CD1   1 
ATOM   5722  N  N     . GLY A 1 736  ? 58.819  100.693 40.341  1.00 5.35  ? 736  GLY A N     1 
ATOM   5723  C  CA    . GLY A 1 736  ? 57.820  100.074 41.183  1.00 5.24  ? 736  GLY A CA    1 
ATOM   5724  C  C     . GLY A 1 736  ? 58.099  98.655  41.662  1.00 4.93  ? 736  GLY A C     1 
ATOM   5725  O  O     . GLY A 1 736  ? 57.189  98.020  42.171  1.00 4.72  ? 736  GLY A O     1 
ATOM   5726  N  N     . LEU A 1 737  ? 59.338  98.177  41.518  1.00 4.77  ? 737  LEU A N     1 
ATOM   5727  C  CA    . LEU A 1 737  ? 59.765  96.893  42.097  1.00 4.63  ? 737  LEU A CA    1 
ATOM   5728  C  C     . LEU A 1 737  ? 60.649  97.054  43.354  1.00 4.12  ? 737  LEU A C     1 
ATOM   5729  O  O     . LEU A 1 737  ? 61.655  97.800  43.349  1.00 4.04  ? 737  LEU A O     1 
ATOM   5730  C  CB    . LEU A 1 737  ? 60.500  96.043  41.050  1.00 4.37  ? 737  LEU A CB    1 
ATOM   5731  C  CG    . LEU A 1 737  ? 59.868  95.744  39.688  1.00 7.04  ? 737  LEU A CG    1 
ATOM   5732  C  CD1   . LEU A 1 737  ? 60.749  94.719  38.989  1.00 6.96  ? 737  LEU A CD1   1 
ATOM   5733  C  CD2   . LEU A 1 737  ? 58.410  95.239  39.770  1.00 4.32  ? 737  LEU A CD2   1 
ATOM   5734  N  N     . GLY A 1 738  ? 60.268  96.348  44.415  1.00 3.55  ? 738  GLY A N     1 
ATOM   5735  C  CA    . GLY A 1 738  ? 60.965  96.409  45.697  1.00 3.24  ? 738  GLY A CA    1 
ATOM   5736  C  C     . GLY A 1 738  ? 62.358  95.799  45.626  1.00 3.19  ? 738  GLY A C     1 
ATOM   5737  O  O     . GLY A 1 738  ? 62.649  95.002  44.711  1.00 2.22  ? 738  GLY A O     1 
ATOM   5738  N  N     . ALA A 1 739  ? 63.204  96.148  46.605  1.00 3.01  ? 739  ALA A N     1 
ATOM   5739  C  CA    . ALA A 1 739  ? 64.628  95.819  46.548  1.00 3.39  ? 739  ALA A CA    1 
ATOM   5740  C  C     . ALA A 1 739  ? 64.857  94.312  46.594  1.00 3.93  ? 739  ALA A C     1 
ATOM   5741  O  O     . ALA A 1 739  ? 65.739  93.792  45.890  1.00 3.44  ? 739  ALA A O     1 
ATOM   5742  C  CB    . ALA A 1 739  ? 65.414  96.529  47.682  1.00 3.24  ? 739  ALA A CB    1 
ATOM   5743  N  N     . GLU A 1 740  ? 64.054  93.632  47.410  1.00 3.84  ? 740  GLU A N     1 
ATOM   5744  C  CA    . GLU A 1 740  ? 64.172  92.193  47.594  1.00 4.95  ? 740  GLU A CA    1 
ATOM   5745  C  C     . GLU A 1 740  ? 63.926  91.444  46.278  1.00 4.76  ? 740  GLU A C     1 
ATOM   5746  O  O     . GLU A 1 740  ? 64.712  90.580  45.906  1.00 4.64  ? 740  GLU A O     1 
ATOM   5747  C  CB    . GLU A 1 740  ? 63.234  91.713  48.713  1.00 4.93  ? 740  GLU A CB    1 
ATOM   5748  C  CG    . GLU A 1 740  ? 63.692  92.100  50.131  1.00 8.01  ? 740  GLU A CG    1 
ATOM   5749  C  CD    . GLU A 1 740  ? 63.620  93.606  50.454  1.00 12.12 ? 740  GLU A CD    1 
ATOM   5750  O  OE1   . GLU A 1 740  ? 62.852  94.366  49.777  1.00 10.04 ? 740  GLU A OE1   1 
ATOM   5751  O  OE2   . GLU A 1 740  ? 64.345  94.029  51.402  1.00 10.78 ? 740  GLU A OE2   1 
ATOM   5752  N  N     . LEU A 1 741  ? 62.845  91.795  45.581  1.00 4.81  ? 741  LEU A N     1 
ATOM   5753  C  CA    . LEU A 1 741  ? 62.542  91.226  44.268  1.00 4.91  ? 741  LEU A CA    1 
ATOM   5754  C  C     . LEU A 1 741  ? 63.626  91.543  43.244  1.00 4.92  ? 741  LEU A C     1 
ATOM   5755  O  O     . LEU A 1 741  ? 64.066  90.656  42.510  1.00 4.46  ? 741  LEU A O     1 
ATOM   5756  C  CB    . LEU A 1 741  ? 61.171  91.711  43.776  1.00 5.29  ? 741  LEU A CB    1 
ATOM   5757  C  CG    . LEU A 1 741  ? 60.763  91.514  42.318  1.00 6.78  ? 741  LEU A CG    1 
ATOM   5758  C  CD1   . LEU A 1 741  ? 60.593  90.026  42.026  1.00 7.14  ? 741  LEU A CD1   1 
ATOM   5759  C  CD2   . LEU A 1 741  ? 59.482  92.270  42.004  1.00 7.89  ? 741  LEU A CD2   1 
ATOM   5760  N  N     . VAL A 1 742  ? 64.067  92.806  43.202  1.00 4.71  ? 742  VAL A N     1 
ATOM   5761  C  CA    . VAL A 1 742  ? 65.094  93.202  42.258  1.00 5.02  ? 742  VAL A CA    1 
ATOM   5762  C  C     . VAL A 1 742  ? 66.372  92.399  42.500  1.00 5.19  ? 742  VAL A C     1 
ATOM   5763  O  O     . VAL A 1 742  ? 66.989  91.938  41.548  1.00 4.44  ? 742  VAL A O     1 
ATOM   5764  C  CB    . VAL A 1 742  ? 65.353  94.723  42.276  1.00 5.38  ? 742  VAL A CB    1 
ATOM   5765  C  CG1   . VAL A 1 742  ? 66.658  95.098  41.496  1.00 5.76  ? 742  VAL A CG1   1 
ATOM   5766  C  CG2   . VAL A 1 742  ? 64.139  95.453  41.686  1.00 6.22  ? 742  VAL A CG2   1 
ATOM   5767  N  N     . GLU A 1 743  ? 66.746  92.218  43.764  1.00 5.22  ? 743  GLU A N     1 
ATOM   5768  C  CA    . GLU A 1 743  ? 67.948  91.446  44.108  1.00 6.41  ? 743  GLU A CA    1 
ATOM   5769  C  C     . GLU A 1 743  ? 67.826  89.959  43.712  1.00 6.32  ? 743  GLU A C     1 
ATOM   5770  O  O     . GLU A 1 743  ? 68.805  89.329  43.315  1.00 6.20  ? 743  GLU A O     1 
ATOM   5771  C  CB    . GLU A 1 743  ? 68.257  91.588  45.607  1.00 6.64  ? 743  GLU A CB    1 
ATOM   5772  C  CG    . GLU A 1 743  ? 69.401  90.733  46.138  1.00 9.97  ? 743  GLU A CG    1 
ATOM   5773  C  CD    . GLU A 1 743  ? 70.766  91.005  45.503  1.00 13.26 ? 743  GLU A CD    1 
ATOM   5774  O  OE1   . GLU A 1 743  ? 71.090  92.159  45.130  1.00 12.65 ? 743  GLU A OE1   1 
ATOM   5775  O  OE2   . GLU A 1 743  ? 71.545  90.034  45.411  1.00 16.50 ? 743  GLU A OE2   1 
ATOM   5776  N  N     . TYR A 1 744  ? 66.621  89.411  43.811  1.00 5.94  ? 744  TYR A N     1 
ATOM   5777  C  CA    . TYR A 1 744  ? 66.425  87.990  43.548  1.00 6.35  ? 744  TYR A CA    1 
ATOM   5778  C  C     . TYR A 1 744  ? 66.579  87.651  42.059  1.00 6.01  ? 744  TYR A C     1 
ATOM   5779  O  O     . TYR A 1 744  ? 67.223  86.650  41.704  1.00 6.58  ? 744  TYR A O     1 
ATOM   5780  C  CB    . TYR A 1 744  ? 65.048  87.550  44.075  1.00 6.05  ? 744  TYR A CB    1 
ATOM   5781  C  CG    . TYR A 1 744  ? 64.847  86.061  44.219  1.00 6.56  ? 744  TYR A CG    1 
ATOM   5782  C  CD1   . TYR A 1 744  ? 64.969  85.434  45.455  1.00 7.26  ? 744  TYR A CD1   1 
ATOM   5783  C  CD2   . TYR A 1 744  ? 64.505  85.283  43.116  1.00 7.01  ? 744  TYR A CD2   1 
ATOM   5784  C  CE1   . TYR A 1 744  ? 64.768  84.054  45.591  1.00 8.45  ? 744  TYR A CE1   1 
ATOM   5785  C  CE2   . TYR A 1 744  ? 64.307  83.922  43.238  1.00 6.40  ? 744  TYR A CE2   1 
ATOM   5786  C  CZ    . TYR A 1 744  ? 64.425  83.311  44.463  1.00 6.96  ? 744  TYR A CZ    1 
ATOM   5787  O  OH    . TYR A 1 744  ? 64.225  81.961  44.541  1.00 5.34  ? 744  TYR A OH    1 
ATOM   5788  N  N     . ALA A 1 745  ? 66.023  88.493  41.199  1.00 5.63  ? 745  ALA A N     1 
ATOM   5789  C  CA    . ALA A 1 745  ? 65.885  88.161  39.779  1.00 5.92  ? 745  ALA A CA    1 
ATOM   5790  C  C     . ALA A 1 745  ? 66.405  89.195  38.791  1.00 5.96  ? 745  ALA A C     1 
ATOM   5791  O  O     . ALA A 1 745  ? 66.574  88.881  37.611  1.00 6.25  ? 745  ALA A O     1 
ATOM   5792  C  CB    . ALA A 1 745  ? 64.437  87.842  39.462  1.00 6.03  ? 745  ALA A CB    1 
ATOM   5793  N  N     . PHE A 1 746  ? 66.621  90.426  39.242  1.00 4.95  ? 746  PHE A N     1 
ATOM   5794  C  CA    . PHE A 1 746  ? 67.037  91.486  38.326  1.00 5.24  ? 746  PHE A CA    1 
ATOM   5795  C  C     . PHE A 1 746  ? 68.227  92.291  38.871  1.00 4.86  ? 746  PHE A C     1 
ATOM   5796  O  O     . PHE A 1 746  ? 68.340  93.488  38.607  1.00 4.61  ? 746  PHE A O     1 
ATOM   5797  C  CB    . PHE A 1 746  ? 65.847  92.406  38.007  1.00 4.77  ? 746  PHE A CB    1 
ATOM   5798  C  CG    . PHE A 1 746  ? 64.555  91.665  37.769  1.00 6.00  ? 746  PHE A CG    1 
ATOM   5799  C  CD1   . PHE A 1 746  ? 63.522  91.707  38.716  1.00 4.88  ? 746  PHE A CD1   1 
ATOM   5800  C  CD2   . PHE A 1 746  ? 64.373  90.922  36.612  1.00 5.00  ? 746  PHE A CD2   1 
ATOM   5801  C  CE1   . PHE A 1 746  ? 62.325  91.027  38.486  1.00 7.18  ? 746  PHE A CE1   1 
ATOM   5802  C  CE2   . PHE A 1 746  ? 63.187  90.225  36.377  1.00 6.99  ? 746  PHE A CE2   1 
ATOM   5803  C  CZ    . PHE A 1 746  ? 62.153  90.283  37.299  1.00 6.34  ? 746  PHE A CZ    1 
ATOM   5804  N  N     . ALA A 1 747  ? 69.106  91.613  39.614  1.00 4.91  ? 747  ALA A N     1 
ATOM   5805  C  CA    . ALA A 1 747  ? 70.211  92.242  40.349  1.00 5.04  ? 747  ALA A CA    1 
ATOM   5806  C  C     . ALA A 1 747  ? 71.009  93.209  39.477  1.00 5.21  ? 747  ALA A C     1 
ATOM   5807  O  O     . ALA A 1 747  ? 71.401  92.874  38.355  1.00 5.08  ? 747  ALA A O     1 
ATOM   5808  C  CB    . ALA A 1 747  ? 71.140  91.163  40.958  1.00 5.25  ? 747  ALA A CB    1 
ATOM   5809  N  N     . GLY A 1 748  ? 71.246  94.411  40.001  1.00 5.90  ? 748  GLY A N     1 
ATOM   5810  C  CA    . GLY A 1 748  ? 71.950  95.447  39.265  1.00 5.49  ? 748  GLY A CA    1 
ATOM   5811  C  C     . GLY A 1 748  ? 71.043  96.405  38.500  1.00 5.98  ? 748  GLY A C     1 
ATOM   5812  O  O     . GLY A 1 748  ? 71.516  97.423  38.012  1.00 4.82  ? 748  GLY A O     1 
ATOM   5813  N  N     . THR A 1 749  ? 69.751  96.090  38.387  1.00 5.47  ? 749  THR A N     1 
ATOM   5814  C  CA    . THR A 1 749  ? 68.787  97.027  37.789  1.00 5.89  ? 749  THR A CA    1 
ATOM   5815  C  C     . THR A 1 749  ? 68.440  98.137  38.761  1.00 5.93  ? 749  THR A C     1 
ATOM   5816  O  O     . THR A 1 749  ? 68.076  97.852  39.907  1.00 5.56  ? 749  THR A O     1 
ATOM   5817  C  CB    . THR A 1 749  ? 67.478  96.293  37.394  1.00 6.31  ? 749  THR A CB    1 
ATOM   5818  O  OG1   . THR A 1 749  ? 67.789  95.236  36.481  1.00 7.31  ? 749  THR A OG1   1 
ATOM   5819  C  CG2   . THR A 1 749  ? 66.543  97.223  36.570  1.00 5.72  ? 749  THR A CG2   1 
ATOM   5820  N  N     . THR A 1 750  ? 68.523  99.397  38.334  1.00 5.91  ? 750  THR A N     1 
ATOM   5821  C  CA    . THR A 1 750  ? 67.980  100.449 39.208  1.00 7.17  ? 750  THR A CA    1 
ATOM   5822  C  C     . THR A 1 750  ? 66.448  100.448 39.306  1.00 6.87  ? 750  THR A C     1 
ATOM   5823  O  O     . THR A 1 750  ? 65.710  100.213 38.322  1.00 6.35  ? 750  THR A O     1 
ATOM   5824  C  CB    . THR A 1 750  ? 68.601  101.899 39.038  1.00 8.05  ? 750  THR A CB    1 
ATOM   5825  O  OG1   . THR A 1 750  ? 67.667  102.773 38.386  1.00 11.16 ? 750  THR A OG1   1 
ATOM   5826  C  CG2   . THR A 1 750  ? 69.825  101.910 38.176  1.00 5.85  ? 750  THR A CG2   1 
ATOM   5827  N  N     . SER A 1 751  ? 65.989  100.660 40.531  1.00 6.32  ? 751  SER A N     1 
ATOM   5828  C  CA    . SER A 1 751  ? 64.575  100.638 40.854  1.00 6.10  ? 751  SER A CA    1 
ATOM   5829  C  C     . SER A 1 751  ? 64.439  101.585 42.028  1.00 6.37  ? 751  SER A C     1 
ATOM   5830  O  O     . SER A 1 751  ? 64.462  101.172 43.189  1.00 6.80  ? 751  SER A O     1 
ATOM   5831  C  CB    . SER A 1 751  ? 64.147  99.230  41.266  1.00 5.79  ? 751  SER A CB    1 
ATOM   5832  O  OG    . SER A 1 751  ? 62.740  99.158  41.361  1.00 5.70  ? 751  SER A OG    1 
ATOM   5833  N  N     . ARG A 1 752  ? 64.284  102.855 41.702  1.00 6.04  ? 752  ARG A N     1 
ATOM   5834  C  CA    . ARG A 1 752  ? 64.483  103.941 42.657  1.00 6.58  ? 752  ARG A CA    1 
ATOM   5835  C  C     . ARG A 1 752  ? 63.313  104.251 43.560  1.00 5.77  ? 752  ARG A C     1 
ATOM   5836  O  O     . ARG A 1 752  ? 63.426  105.068 44.485  1.00 6.12  ? 752  ARG A O     1 
ATOM   5837  C  CB    . ARG A 1 752  ? 64.822  105.205 41.892  1.00 6.55  ? 752  ARG A CB    1 
ATOM   5838  C  CG    . ARG A 1 752  ? 66.243  105.255 41.439  1.00 8.29  ? 752  ARG A CG    1 
ATOM   5839  C  CD    . ARG A 1 752  ? 66.538  106.543 40.741  1.00 8.91  ? 752  ARG A CD    1 
ATOM   5840  N  NE    . ARG A 1 752  ? 65.991  106.573 39.384  1.00 9.59  ? 752  ARG A NE    1 
ATOM   5841  C  CZ    . ARG A 1 752  ? 66.100  107.641 38.588  1.00 8.04  ? 752  ARG A CZ    1 
ATOM   5842  N  NH1   . ARG A 1 752  ? 66.712  108.722 39.037  1.00 7.84  ? 752  ARG A NH1   1 
ATOM   5843  N  NH2   . ARG A 1 752  ? 65.614  107.626 37.356  1.00 6.85  ? 752  ARG A NH2   1 
ATOM   5844  N  N     . VAL A 1 753  ? 62.184  103.631 43.272  1.00 5.28  ? 753  VAL A N     1 
ATOM   5845  C  CA    . VAL A 1 753  ? 60.961  103.959 43.978  1.00 5.24  ? 753  VAL A CA    1 
ATOM   5846  C  C     . VAL A 1 753  ? 60.453  102.815 44.881  1.00 5.46  ? 753  VAL A C     1 
ATOM   5847  O  O     . VAL A 1 753  ? 59.373  102.890 45.469  1.00 5.75  ? 753  VAL A O     1 
ATOM   5848  C  CB    . VAL A 1 753  ? 59.950  104.601 42.952  1.00 6.24  ? 753  VAL A CB    1 
ATOM   5849  C  CG1   . VAL A 1 753  ? 59.135  103.574 42.167  1.00 3.59  ? 753  VAL A CG1   1 
ATOM   5850  C  CG2   . VAL A 1 753  ? 59.107  105.658 43.603  1.00 8.62  ? 753  VAL A CG2   1 
ATOM   5851  N  N     . GLY A 1 754  ? 61.258  101.765 45.041  1.00 5.28  ? 754  GLY A N     1 
ATOM   5852  C  CA    . GLY A 1 754  ? 60.829  100.618 45.834  1.00 5.90  ? 754  GLY A CA    1 
ATOM   5853  C  C     . GLY A 1 754  ? 59.613  99.961  45.202  1.00 6.17  ? 754  GLY A C     1 
ATOM   5854  O  O     . GLY A 1 754  ? 59.434  100.026 43.977  1.00 6.08  ? 754  GLY A O     1 
ATOM   5855  N  N     . GLY A 1 755  ? 58.774  99.325  46.018  1.00 6.55  ? 755  GLY A N     1 
ATOM   5856  C  CA    . GLY A 1 755  ? 57.516  98.798  45.517  1.00 6.12  ? 755  GLY A CA    1 
ATOM   5857  C  C     . GLY A 1 755  ? 57.281  97.312  45.730  1.00 6.32  ? 755  GLY A C     1 
ATOM   5858  O  O     . GLY A 1 755  ? 57.414  96.815  46.833  1.00 5.64  ? 755  GLY A O     1 
ATOM   5859  N  N     . LEU A 1 756  ? 56.924  96.617  44.648  1.00 6.25  ? 756  LEU A N     1 
ATOM   5860  C  CA    . LEU A 1 756  ? 56.405  95.246  44.702  1.00 6.82  ? 756  LEU A CA    1 
ATOM   5861  C  C     . LEU A 1 756  ? 57.320  94.263  45.418  1.00 6.45  ? 756  LEU A C     1 
ATOM   5862  O  O     . LEU A 1 756  ? 58.529  94.219  45.141  1.00 5.91  ? 756  LEU A O     1 
ATOM   5863  C  CB    . LEU A 1 756  ? 56.180  94.724  43.280  1.00 7.13  ? 756  LEU A CB    1 
ATOM   5864  C  CG    . LEU A 1 756  ? 54.805  94.826  42.616  1.00 8.66  ? 756  LEU A CG    1 
ATOM   5865  C  CD1   . LEU A 1 756  ? 54.181  96.200  42.694  1.00 11.06 ? 756  LEU A CD1   1 
ATOM   5866  C  CD2   . LEU A 1 756  ? 54.951  94.375  41.190  1.00 10.57 ? 756  LEU A CD2   1 
ATOM   5867  N  N     . THR A 1 757  ? 56.731  93.485  46.322  1.00 5.62  ? 757  THR A N     1 
ATOM   5868  C  CA    . THR A 1 757  ? 57.351  92.267  46.841  1.00 5.54  ? 757  THR A CA    1 
ATOM   5869  C  C     . THR A 1 757  ? 56.985  91.090  45.934  1.00 5.31  ? 757  THR A C     1 
ATOM   5870  O  O     . THR A 1 757  ? 56.118  91.214  45.058  1.00 4.39  ? 757  THR A O     1 
ATOM   5871  C  CB    . THR A 1 757  ? 56.864  91.941  48.270  1.00 5.46  ? 757  THR A CB    1 
ATOM   5872  O  OG1   . THR A 1 757  ? 55.445  91.678  48.241  1.00 5.47  ? 757  THR A OG1   1 
ATOM   5873  C  CG2   . THR A 1 757  ? 57.003  93.132  49.187  1.00 5.72  ? 757  THR A CG2   1 
ATOM   5874  N  N     . ILE A 1 758  ? 57.619  89.939  46.173  1.00 5.37  ? 758  ILE A N     1 
ATOM   5875  C  CA    . ILE A 1 758  ? 57.255  88.699  45.467  1.00 5.44  ? 758  ILE A CA    1 
ATOM   5876  C  C     . ILE A 1 758  ? 55.755  88.392  45.649  1.00 5.08  ? 758  ILE A C     1 
ATOM   5877  O  O     . ILE A 1 758  ? 55.052  88.077  44.679  1.00 4.81  ? 758  ILE A O     1 
ATOM   5878  C  CB    . ILE A 1 758  ? 58.149  87.503  45.924  1.00 5.79  ? 758  ILE A CB    1 
ATOM   5879  C  CG1   . ILE A 1 758  ? 59.612  87.690  45.452  1.00 6.66  ? 758  ILE A CG1   1 
ATOM   5880  C  CG2   . ILE A 1 758  ? 57.573  86.168  45.426  1.00 5.79  ? 758  ILE A CG2   1 
ATOM   5881  C  CD1   . ILE A 1 758  ? 60.638  86.840  46.234  1.00 7.69  ? 758  ILE A CD1   1 
ATOM   5882  N  N     . ALA A 1 759  ? 55.263  88.530  46.878  1.00 4.70  ? 759  ALA A N     1 
ATOM   5883  C  CA    . ALA A 1 759  ? 53.841  88.314  47.172  1.00 4.45  ? 759  ALA A CA    1 
ATOM   5884  C  C     . ALA A 1 759  ? 52.932  89.254  46.374  1.00 4.75  ? 759  ALA A C     1 
ATOM   5885  O  O     . ALA A 1 759  ? 51.869  88.835  45.924  1.00 3.85  ? 759  ALA A O     1 
ATOM   5886  C  CB    . ALA A 1 759  ? 53.567  88.442  48.658  1.00 4.84  ? 759  ALA A CB    1 
ATOM   5887  N  N     . ASP A 1 760  ? 53.350  90.513  46.199  1.00 4.60  ? 760  ASP A N     1 
ATOM   5888  C  CA    . ASP A 1 760  ? 52.584  91.462  45.395  1.00 5.69  ? 760  ASP A CA    1 
ATOM   5889  C  C     . ASP A 1 760  ? 52.499  91.029  43.934  1.00 5.80  ? 760  ASP A C     1 
ATOM   5890  O  O     . ASP A 1 760  ? 51.439  91.172  43.324  1.00 6.13  ? 760  ASP A O     1 
ATOM   5891  C  CB    . ASP A 1 760  ? 53.157  92.874  45.470  1.00 6.08  ? 760  ASP A CB    1 
ATOM   5892  C  CG    . ASP A 1 760  ? 53.119  93.446  46.867  1.00 7.68  ? 760  ASP A CG    1 
ATOM   5893  O  OD1   . ASP A 1 760  ? 52.228  93.054  47.682  1.00 8.50  ? 760  ASP A OD1   1 
ATOM   5894  O  OD2   . ASP A 1 760  ? 53.965  94.281  47.240  1.00 7.13  ? 760  ASP A OD2   1 
ATOM   5895  N  N     . VAL A 1 761  ? 53.592  90.516  43.358  1.00 5.94  ? 761  VAL A N     1 
ATOM   5896  C  CA    . VAL A 1 761  ? 53.493  90.051  41.974  1.00 6.00  ? 761  VAL A CA    1 
ATOM   5897  C  C     . VAL A 1 761  ? 52.541  88.851  41.827  1.00 6.28  ? 761  VAL A C     1 
ATOM   5898  O  O     . VAL A 1 761  ? 51.781  88.776  40.854  1.00 5.98  ? 761  VAL A O     1 
ATOM   5899  C  CB    . VAL A 1 761  ? 54.849  89.901  41.186  1.00 6.88  ? 761  VAL A CB    1 
ATOM   5900  C  CG1   . VAL A 1 761  ? 56.046  90.602  41.863  1.00 5.51  ? 761  VAL A CG1   1 
ATOM   5901  C  CG2   . VAL A 1 761  ? 55.136  88.488  40.779  1.00 6.58  ? 761  VAL A CG2   1 
ATOM   5902  N  N     . ALA A 1 762  ? 52.572  87.940  42.800  1.00 6.09  ? 762  ALA A N     1 
ATOM   5903  C  CA    . ALA A 1 762  ? 51.629  86.825  42.838  1.00 6.63  ? 762  ALA A CA    1 
ATOM   5904  C  C     . ALA A 1 762  ? 50.176  87.310  42.936  1.00 6.80  ? 762  ALA A C     1 
ATOM   5905  O  O     . ALA A 1 762  ? 49.291  86.747  42.293  1.00 7.80  ? 762  ALA A O     1 
ATOM   5906  C  CB    . ALA A 1 762  ? 51.952  85.889  43.990  1.00 6.50  ? 762  ALA A CB    1 
ATOM   5907  N  N     . GLY A 1 763  ? 49.923  88.338  43.741  1.00 6.87  ? 763  GLY A N     1 
ATOM   5908  C  CA    . GLY A 1 763  ? 48.585  88.909  43.842  1.00 7.51  ? 763  GLY A CA    1 
ATOM   5909  C  C     . GLY A 1 763  ? 48.100  89.399  42.474  1.00 8.07  ? 763  GLY A C     1 
ATOM   5910  O  O     . GLY A 1 763  ? 46.948  89.173  42.079  1.00 7.74  ? 763  GLY A O     1 
ATOM   5911  N  N     . GLU A 1 764  ? 49.003  90.023  41.734  1.00 7.93  ? 764  GLU A N     1 
ATOM   5912  C  CA    . GLU A 1 764  ? 48.706  90.510  40.390  1.00 8.78  ? 764  GLU A CA    1 
ATOM   5913  C  C     . GLU A 1 764  ? 48.376  89.408  39.408  1.00 8.06  ? 764  GLU A C     1 
ATOM   5914  O  O     . GLU A 1 764  ? 47.381  89.514  38.693  1.00 7.76  ? 764  GLU A O     1 
ATOM   5915  C  CB    . GLU A 1 764  ? 49.857  91.346  39.836  1.00 8.69  ? 764  GLU A CB    1 
ATOM   5916  C  CG    . GLU A 1 764  ? 49.675  92.830  40.049  1.00 12.25 ? 764  GLU A CG    1 
ATOM   5917  C  CD    . GLU A 1 764  ? 50.165  93.667  38.885  1.00 13.79 ? 764  GLU A CD    1 
ATOM   5918  O  OE1   . GLU A 1 764  ? 49.329  94.311  38.215  1.00 15.21 ? 764  GLU A OE1   1 
ATOM   5919  O  OE2   . GLU A 1 764  ? 51.393  93.703  38.665  1.00 13.45 ? 764  GLU A OE2   1 
ATOM   5920  N  N     . VAL A 1 765  ? 49.199  88.358  39.357  1.00 7.91  ? 765  VAL A N     1 
ATOM   5921  C  CA    . VAL A 1 765  ? 48.876  87.226  38.476  1.00 7.82  ? 765  VAL A CA    1 
ATOM   5922  C  C     . VAL A 1 765  ? 47.535  86.575  38.852  1.00 8.08  ? 765  VAL A C     1 
ATOM   5923  O  O     . VAL A 1 765  ? 46.799  86.116  37.964  1.00 7.60  ? 765  VAL A O     1 
ATOM   5924  C  CB    . VAL A 1 765  ? 50.020  86.163  38.345  1.00 7.89  ? 765  VAL A CB    1 
ATOM   5925  C  CG1   . VAL A 1 765  ? 51.424  86.827  38.315  1.00 7.09  ? 765  VAL A CG1   1 
ATOM   5926  C  CG2   . VAL A 1 765  ? 49.938  85.169  39.408  1.00 9.06  ? 765  VAL A CG2   1 
ATOM   5927  N  N     . MET A 1 766  ? 47.215  86.550  40.154  1.00 7.60  ? 766  MET A N     1 
ATOM   5928  C  CA    . MET A 1 766  ? 45.942  85.993  40.619  1.00 7.65  ? 766  MET A CA    1 
ATOM   5929  C  C     . MET A 1 766  ? 44.709  86.801  40.192  1.00 7.40  ? 766  MET A C     1 
ATOM   5930  O  O     . MET A 1 766  ? 43.616  86.243  40.094  1.00 6.39  ? 766  MET A O     1 
ATOM   5931  C  CB    . MET A 1 766  ? 45.932  85.762  42.134  1.00 7.98  ? 766  MET A CB    1 
ATOM   5932  C  CG    . MET A 1 766  ? 46.782  84.569  42.610  1.00 9.73  ? 766  MET A CG    1 
ATOM   5933  S  SD    . MET A 1 766  ? 46.514  82.999  41.696  1.00 13.13 ? 766  MET A SD    1 
ATOM   5934  C  CE    . MET A 1 766  ? 44.942  82.476  42.298  1.00 11.45 ? 766  MET A CE    1 
ATOM   5935  N  N     . VAL A 1 767  ? 44.877  88.106  39.955  1.00 7.43  ? 767  VAL A N     1 
ATOM   5936  C  CA    . VAL A 1 767  ? 43.788  88.902  39.390  1.00 7.50  ? 767  VAL A CA    1 
ATOM   5937  C  C     . VAL A 1 767  ? 43.417  88.334  38.017  1.00 7.15  ? 767  VAL A C     1 
ATOM   5938  O  O     . VAL A 1 767  ? 42.236  88.108  37.750  1.00 7.15  ? 767  VAL A O     1 
ATOM   5939  C  CB    . VAL A 1 767  ? 44.106  90.427  39.319  1.00 7.50  ? 767  VAL A CB    1 
ATOM   5940  C  CG1   . VAL A 1 767  ? 42.960  91.186  38.641  1.00 6.76  ? 767  VAL A CG1   1 
ATOM   5941  C  CG2   . VAL A 1 767  ? 44.340  90.986  40.726  1.00 7.71  ? 767  VAL A CG2   1 
ATOM   5942  N  N     . PHE A 1 768  ? 44.423  88.077  37.171  1.00 7.04  ? 768  PHE A N     1 
ATOM   5943  C  CA    . PHE A 1 768  ? 44.183  87.450  35.861  1.00 7.09  ? 768  PHE A CA    1 
ATOM   5944  C  C     . PHE A 1 768  ? 43.642  86.019  36.000  1.00 6.98  ? 768  PHE A C     1 
ATOM   5945  O  O     . PHE A 1 768  ? 42.800  85.589  35.204  1.00 6.97  ? 768  PHE A O     1 
ATOM   5946  C  CB    . PHE A 1 768  ? 45.451  87.429  34.995  1.00 6.86  ? 768  PHE A CB    1 
ATOM   5947  C  CG    . PHE A 1 768  ? 45.861  88.779  34.447  1.00 7.96  ? 768  PHE A CG    1 
ATOM   5948  C  CD1   . PHE A 1 768  ? 47.053  89.378  34.870  1.00 6.95  ? 768  PHE A CD1   1 
ATOM   5949  C  CD2   . PHE A 1 768  ? 45.086  89.436  33.486  1.00 7.52  ? 768  PHE A CD2   1 
ATOM   5950  C  CE1   . PHE A 1 768  ? 47.468  90.630  34.351  1.00 8.36  ? 768  PHE A CE1   1 
ATOM   5951  C  CE2   . PHE A 1 768  ? 45.491  90.687  32.974  1.00 6.82  ? 768  PHE A CE2   1 
ATOM   5952  C  CZ    . PHE A 1 768  ? 46.691  91.270  33.402  1.00 6.39  ? 768  PHE A CZ    1 
ATOM   5953  N  N     . HIS A 1 769  ? 44.126  85.278  36.998  1.00 6.66  ? 769  HIS A N     1 
ATOM   5954  C  CA    . HIS A 1 769  ? 43.605  83.938  37.273  1.00 6.29  ? 769  HIS A CA    1 
ATOM   5955  C  C     . HIS A 1 769  ? 42.100  83.979  37.541  1.00 6.47  ? 769  HIS A C     1 
ATOM   5956  O  O     . HIS A 1 769  ? 41.341  83.139  37.035  1.00 5.59  ? 769  HIS A O     1 
ATOM   5957  C  CB    . HIS A 1 769  ? 44.329  83.315  38.466  1.00 6.58  ? 769  HIS A CB    1 
ATOM   5958  C  CG    . HIS A 1 769  ? 44.016  81.866  38.683  1.00 5.73  ? 769  HIS A CG    1 
ATOM   5959  N  ND1   . HIS A 1 769  ? 44.876  80.857  38.308  1.00 5.14  ? 769  HIS A ND1   1 
ATOM   5960  C  CD2   . HIS A 1 769  ? 42.948  81.258  39.251  1.00 5.80  ? 769  HIS A CD2   1 
ATOM   5961  C  CE1   . HIS A 1 769  ? 44.346  79.690  38.627  1.00 5.79  ? 769  HIS A CE1   1 
ATOM   5962  N  NE2   . HIS A 1 769  ? 43.173  79.905  39.197  1.00 6.43  ? 769  HIS A NE2   1 
ATOM   5963  N  N     . GLY A 1 770  ? 41.677  84.969  38.330  1.00 6.52  ? 770  GLY A N     1 
ATOM   5964  C  CA    . GLY A 1 770  ? 40.273  85.137  38.683  1.00 6.35  ? 770  GLY A CA    1 
ATOM   5965  C  C     . GLY A 1 770  ? 39.394  85.569  37.520  1.00 6.20  ? 770  GLY A C     1 
ATOM   5966  O  O     . GLY A 1 770  ? 38.206  85.256  37.490  1.00 5.33  ? 770  GLY A O     1 
ATOM   5967  N  N     . MET A 1 771  ? 39.971  86.310  36.576  1.00 6.09  ? 771  MET A N     1 
ATOM   5968  C  CA    . MET A 1 771  ? 39.260  86.706  35.357  1.00 6.35  ? 771  MET A CA    1 
ATOM   5969  C  C     . MET A 1 771  ? 39.056  85.507  34.423  1.00 6.32  ? 771  MET A C     1 
ATOM   5970  O  O     . MET A 1 771  ? 38.074  85.449  33.671  1.00 6.57  ? 771  MET A O     1 
ATOM   5971  C  CB    . MET A 1 771  ? 40.014  87.823  34.628  1.00 6.39  ? 771  MET A CB    1 
ATOM   5972  C  CG    . MET A 1 771  ? 40.038  89.169  35.372  1.00 6.76  ? 771  MET A CG    1 
ATOM   5973  S  SD    . MET A 1 771  ? 41.342  90.255  34.775  1.00 9.51  ? 771  MET A SD    1 
ATOM   5974  C  CE    . MET A 1 771  ? 40.791  90.482  33.036  1.00 9.13  ? 771  MET A CE    1 
ATOM   5975  N  N     . ALA A 1 772  ? 39.984  84.553  34.479  1.00 6.10  ? 772  ALA A N     1 
ATOM   5976  C  CA    . ALA A 1 772  ? 39.946  83.367  33.619  1.00 5.87  ? 772  ALA A CA    1 
ATOM   5977  C  C     . ALA A 1 772  ? 39.125  82.190  34.161  1.00 5.88  ? 772  ALA A C     1 
ATOM   5978  O  O     . ALA A 1 772  ? 38.438  81.524  33.389  1.00 5.88  ? 772  ALA A O     1 
ATOM   5979  C  CB    . ALA A 1 772  ? 41.352  82.904  33.318  1.00 5.82  ? 772  ALA A CB    1 
ATOM   5980  N  N     . PHE A 1 773  ? 39.219  81.920  35.464  1.00 5.61  ? 773  PHE A N     1 
ATOM   5981  C  CA    . PHE A 1 773  ? 38.686  80.675  36.044  1.00 5.93  ? 773  PHE A CA    1 
ATOM   5982  C  C     . PHE A 1 773  ? 37.531  80.878  37.036  1.00 6.04  ? 773  PHE A C     1 
ATOM   5983  O  O     . PHE A 1 773  ? 36.736  79.943  37.322  1.00 6.43  ? 773  PHE A O     1 
ATOM   5984  C  CB    . PHE A 1 773  ? 39.819  79.892  36.721  1.00 5.88  ? 773  PHE A CB    1 
ATOM   5985  C  CG    . PHE A 1 773  ? 40.941  79.463  35.784  1.00 5.64  ? 773  PHE A CG    1 
ATOM   5986  C  CD1   . PHE A 1 773  ? 42.183  80.091  35.823  1.00 4.44  ? 773  PHE A CD1   1 
ATOM   5987  C  CD2   . PHE A 1 773  ? 40.766  78.403  34.898  1.00 6.11  ? 773  PHE A CD2   1 
ATOM   5988  C  CE1   . PHE A 1 773  ? 43.220  79.674  34.986  1.00 4.41  ? 773  PHE A CE1   1 
ATOM   5989  C  CE2   . PHE A 1 773  ? 41.801  77.986  34.058  1.00 3.86  ? 773  PHE A CE2   1 
ATOM   5990  C  CZ    . PHE A 1 773  ? 43.023  78.610  34.106  1.00 5.01  ? 773  PHE A CZ    1 
ATOM   5991  N  N     . LYS A 1 778  ? 33.320  85.083  27.607  1.00 9.09  ? 778  LYS A N     1 
ATOM   5992  C  CA    . LYS A 1 778  ? 32.893  85.257  26.209  1.00 9.67  ? 778  LYS A CA    1 
ATOM   5993  C  C     . LYS A 1 778  ? 33.976  85.940  25.353  1.00 9.70  ? 778  LYS A C     1 
ATOM   5994  O  O     . LYS A 1 778  ? 34.195  85.587  24.188  1.00 9.76  ? 778  LYS A O     1 
ATOM   5995  C  CB    . LYS A 1 778  ? 31.591  86.072  26.127  1.00 10.24 ? 778  LYS A CB    1 
ATOM   5996  C  CG    . LYS A 1 778  ? 30.363  85.416  26.752  1.00 11.60 ? 778  LYS A CG    1 
ATOM   5997  C  CD    . LYS A 1 778  ? 29.194  86.411  26.845  1.00 14.12 ? 778  LYS A CD    1 
ATOM   5998  C  CE    . LYS A 1 778  ? 28.320  86.140  28.073  1.00 14.55 ? 778  LYS A CE    1 
ATOM   5999  N  NZ    . LYS A 1 778  ? 26.862  86.080  27.729  1.00 15.29 ? 778  LYS A NZ    1 
ATOM   6000  N  N     . LYS A 1 779  ? 34.654  86.913  25.949  1.00 9.53  ? 779  LYS A N     1 
ATOM   6001  C  CA    . LYS A 1 779  ? 35.709  87.671  25.290  1.00 9.37  ? 779  LYS A CA    1 
ATOM   6002  C  C     . LYS A 1 779  ? 36.672  88.207  26.346  1.00 8.91  ? 779  LYS A C     1 
ATOM   6003  O  O     . LYS A 1 779  ? 36.317  88.312  27.520  1.00 9.00  ? 779  LYS A O     1 
ATOM   6004  C  CB    . LYS A 1 779  ? 35.115  88.828  24.486  1.00 9.79  ? 779  LYS A CB    1 
ATOM   6005  C  CG    . LYS A 1 779  ? 34.429  89.900  25.341  1.00 11.49 ? 779  LYS A CG    1 
ATOM   6006  C  CD    . LYS A 1 779  ? 33.142  90.374  24.690  1.00 14.50 ? 779  LYS A CD    1 
ATOM   6007  C  CE    . LYS A 1 779  ? 33.062  91.898  24.682  1.00 16.58 ? 779  LYS A CE    1 
ATOM   6008  N  NZ    . LYS A 1 779  ? 31.820  92.335  23.958  1.00 16.53 ? 779  LYS A NZ    1 
ATOM   6009  N  N     . LEU A 1 780  ? 37.884  88.550  25.928  1.00 8.60  ? 780  LEU A N     1 
ATOM   6010  C  CA    . LEU A 1 780  ? 38.860  89.145  26.836  1.00 8.29  ? 780  LEU A CA    1 
ATOM   6011  C  C     . LEU A 1 780  ? 38.375  90.532  27.276  1.00 8.47  ? 780  LEU A C     1 
ATOM   6012  O  O     . LEU A 1 780  ? 37.667  91.210  26.528  1.00 8.46  ? 780  LEU A O     1 
ATOM   6013  C  CB    . LEU A 1 780  ? 40.228  89.250  26.166  1.00 8.00  ? 780  LEU A CB    1 
ATOM   6014  C  CG    . LEU A 1 780  ? 40.941  87.990  25.665  1.00 7.90  ? 780  LEU A CG    1 
ATOM   6015  C  CD1   . LEU A 1 780  ? 42.203  88.395  24.906  1.00 6.11  ? 780  LEU A CD1   1 
ATOM   6016  C  CD2   . LEU A 1 780  ? 41.303  87.046  26.810  1.00 7.46  ? 780  LEU A CD2   1 
ATOM   6017  N  N     . GLU A 1 781  ? 38.741  90.935  28.489  1.00 8.22  ? 781  GLU A N     1 
ATOM   6018  C  CA    . GLU A 1 781  ? 38.427  92.273  28.965  1.00 8.68  ? 781  GLU A CA    1 
ATOM   6019  C  C     . GLU A 1 781  ? 39.221  93.326  28.181  1.00 8.00  ? 781  GLU A C     1 
ATOM   6020  O  O     . GLU A 1 781  ? 40.395  93.136  27.881  1.00 5.91  ? 781  GLU A O     1 
ATOM   6021  C  CB    . GLU A 1 781  ? 38.716  92.411  30.463  1.00 8.97  ? 781  GLU A CB    1 
ATOM   6022  C  CG    . GLU A 1 781  ? 37.572  93.056  31.236  1.00 13.48 ? 781  GLU A CG    1 
ATOM   6023  C  CD    . GLU A 1 781  ? 37.705  92.891  32.739  1.00 17.19 ? 781  GLU A CD    1 
ATOM   6024  O  OE1   . GLU A 1 781  ? 37.464  91.760  33.256  1.00 19.79 ? 781  GLU A OE1   1 
ATOM   6025  O  OE2   . GLU A 1 781  ? 38.035  93.903  33.403  1.00 17.62 ? 781  GLU A OE2   1 
ATOM   6026  N  N     . ASN A 1 782  ? 38.543  94.412  27.825  1.00 7.73  ? 782  ASN A N     1 
ATOM   6027  C  CA    . ASN A 1 782  ? 39.195  95.577  27.243  1.00 7.79  ? 782  ASN A CA    1 
ATOM   6028  C  C     . ASN A 1 782  ? 39.379  96.628  28.330  1.00 7.88  ? 782  ASN A C     1 
ATOM   6029  O  O     . ASN A 1 782  ? 38.403  97.189  28.841  1.00 7.47  ? 782  ASN A O     1 
ATOM   6030  C  CB    . ASN A 1 782  ? 38.362  96.128  26.085  1.00 7.57  ? 782  ASN A CB    1 
ATOM   6031  C  CG    . ASN A 1 782  ? 39.094  97.179  25.292  1.00 8.06  ? 782  ASN A CG    1 
ATOM   6032  O  OD1   . ASN A 1 782  ? 39.779  98.022  25.858  1.00 6.20  ? 782  ASN A OD1   1 
ATOM   6033  N  ND2   . ASN A 1 782  ? 38.937  97.149  23.969  1.00 7.93  ? 782  ASN A ND2   1 
ATOM   6034  N  N     . PHE A 1 783  ? 40.633  96.861  28.705  1.00 8.20  ? 783  PHE A N     1 
ATOM   6035  C  CA    . PHE A 1 783  ? 40.942  97.864  29.707  1.00 8.64  ? 783  PHE A CA    1 
ATOM   6036  C  C     . PHE A 1 783  ? 41.147  99.200  29.030  1.00 8.97  ? 783  PHE A C     1 
ATOM   6037  O  O     . PHE A 1 783  ? 41.024  99.340  27.805  1.00 8.60  ? 783  PHE A O     1 
ATOM   6038  C  CB    . PHE A 1 783  ? 42.149  97.443  30.557  1.00 9.14  ? 783  PHE A CB    1 
ATOM   6039  C  CG    . PHE A 1 783  ? 41.865  96.255  31.435  1.00 10.80 ? 783  PHE A CG    1 
ATOM   6040  C  CD1   . PHE A 1 783  ? 42.231  94.969  31.034  1.00 12.36 ? 783  PHE A CD1   1 
ATOM   6041  C  CD2   . PHE A 1 783  ? 41.164  96.407  32.632  1.00 13.31 ? 783  PHE A CD2   1 
ATOM   6042  C  CE1   . PHE A 1 783  ? 41.946  93.852  31.837  1.00 12.53 ? 783  PHE A CE1   1 
ATOM   6043  C  CE2   . PHE A 1 783  ? 40.868  95.296  33.436  1.00 13.31 ? 783  PHE A CE2   1 
ATOM   6044  C  CZ    . PHE A 1 783  ? 41.263  94.016  33.033  1.00 12.49 ? 783  PHE A CZ    1 
ATOM   6045  N  N     . GLY A 1 784  ? 41.423  100.219 29.805  1.00 8.64  ? 784  GLY A N     1 
ATOM   6046  C  CA    . GLY A 1 784  ? 41.414  101.517 29.167  1.00 9.96  ? 784  GLY A CA    1 
ATOM   6047  C  C     . GLY A 1 784  ? 42.606  101.877 28.302  1.00 9.08  ? 784  GLY A C     1 
ATOM   6048  O  O     . GLY A 1 784  ? 42.649  103.002 27.862  1.00 9.10  ? 784  GLY A O     1 
ATOM   6049  N  N     . PHE A 1 785  ? 43.525  100.936 28.043  1.00 9.18  ? 785  PHE A N     1 
ATOM   6050  C  CA    . PHE A 1 785  ? 44.953  101.281 27.930  1.00 8.72  ? 785  PHE A CA    1 
ATOM   6051  C  C     . PHE A 1 785  ? 45.384  102.215 26.789  1.00 8.93  ? 785  PHE A C     1 
ATOM   6052  O  O     . PHE A 1 785  ? 46.144  103.165 27.045  1.00 9.06  ? 785  PHE A O     1 
ATOM   6053  C  CB    . PHE A 1 785  ? 45.873  100.043 27.972  1.00 8.73  ? 785  PHE A CB    1 
ATOM   6054  C  CG    . PHE A 1 785  ? 45.764  99.212  29.240  1.00 8.95  ? 785  PHE A CG    1 
ATOM   6055  C  CD1   . PHE A 1 785  ? 45.666  97.823  29.151  1.00 8.61  ? 785  PHE A CD1   1 
ATOM   6056  C  CD2   . PHE A 1 785  ? 45.806  99.807  30.515  1.00 7.76  ? 785  PHE A CD2   1 
ATOM   6057  C  CE1   . PHE A 1 785  ? 45.583  97.027  30.308  1.00 10.73 ? 785  PHE A CE1   1 
ATOM   6058  C  CE2   . PHE A 1 785  ? 45.727  99.033  31.682  1.00 10.68 ? 785  PHE A CE2   1 
ATOM   6059  C  CZ    . PHE A 1 785  ? 45.612  97.631  31.582  1.00 10.81 ? 785  PHE A CZ    1 
ATOM   6060  N  N     . VAL A 1 786  ? 44.932  101.942 25.562  1.00 8.55  ? 786  VAL A N     1 
ATOM   6061  C  CA    . VAL A 1 786  ? 45.380  102.692 24.383  1.00 9.41  ? 786  VAL A CA    1 
ATOM   6062  C  C     . VAL A 1 786  ? 44.572  103.982 24.106  1.00 10.01 ? 786  VAL A C     1 
ATOM   6063  O  O     . VAL A 1 786  ? 45.139  105.043 23.816  1.00 10.18 ? 786  VAL A O     1 
ATOM   6064  C  CB    . VAL A 1 786  ? 45.439  101.788 23.103  1.00 9.04  ? 786  VAL A CB    1 
ATOM   6065  C  CG1   . VAL A 1 786  ? 45.949  102.573 21.885  1.00 8.33  ? 786  VAL A CG1   1 
ATOM   6066  C  CG2   . VAL A 1 786  ? 46.331  100.580 23.340  1.00 9.07  ? 786  VAL A CG2   1 
ATOM   6067  N  N     . ASN A 1 787  ? 43.250  103.863 24.195  1.00 11.07 ? 787  ASN A N     1 
ATOM   6068  C  CA    . ASN A 1 787  ? 42.295  104.947 23.971  1.00 12.00 ? 787  ASN A CA    1 
ATOM   6069  C  C     . ASN A 1 787  ? 41.367  104.937 25.192  1.00 12.05 ? 787  ASN A C     1 
ATOM   6070  O  O     . ASN A 1 787  ? 41.039  103.862 25.714  1.00 10.82 ? 787  ASN A O     1 
ATOM   6071  C  CB    . ASN A 1 787  ? 41.445  104.638 22.724  1.00 12.82 ? 787  ASN A CB    1 
ATOM   6072  C  CG    . ASN A 1 787  ? 41.749  105.549 21.532  1.00 15.12 ? 787  ASN A CG    1 
ATOM   6073  O  OD1   . ASN A 1 787  ? 41.701  106.789 21.645  1.00 17.16 ? 787  ASN A OD1   1 
ATOM   6074  N  ND2   . ASN A 1 787  ? 42.018  104.930 20.358  1.00 13.82 ? 787  ASN A ND2   1 
ATOM   6075  N  N     . TYR A 1 788  ? 40.944  106.118 25.646  1.00 12.33 ? 788  TYR A N     1 
ATOM   6076  C  CA    . TYR A 1 788  ? 39.992  106.225 26.764  1.00 12.79 ? 788  TYR A CA    1 
ATOM   6077  C  C     . TYR A 1 788  ? 38.726  105.418 26.476  1.00 12.84 ? 788  TYR A C     1 
ATOM   6078  O  O     . TYR A 1 788  ? 38.228  105.427 25.348  1.00 13.20 ? 788  TYR A O     1 
ATOM   6079  C  CB    . TYR A 1 788  ? 39.658  107.699 27.055  1.00 13.02 ? 788  TYR A CB    1 
ATOM   6080  C  CG    . TYR A 1 788  ? 38.449  107.925 27.957  1.00 13.83 ? 788  TYR A CG    1 
ATOM   6081  C  CD1   . TYR A 1 788  ? 38.577  107.944 29.353  1.00 15.18 ? 788  TYR A CD1   1 
ATOM   6082  C  CD2   . TYR A 1 788  ? 37.188  108.128 27.413  1.00 13.90 ? 788  TYR A CD2   1 
ATOM   6083  C  CE1   . TYR A 1 788  ? 37.457  108.153 30.183  1.00 16.20 ? 788  TYR A CE1   1 
ATOM   6084  C  CE2   . TYR A 1 788  ? 36.065  108.339 28.229  1.00 16.06 ? 788  TYR A CE2   1 
ATOM   6085  C  CZ    . TYR A 1 788  ? 36.209  108.355 29.608  1.00 17.14 ? 788  TYR A CZ    1 
ATOM   6086  O  OH    . TYR A 1 788  ? 35.095  108.566 30.405  1.00 18.71 ? 788  TYR A OH    1 
ATOM   6087  N  N     . ARG A 1 789  ? 38.247  104.700 27.496  1.00 12.76 ? 789  ARG A N     1 
ATOM   6088  C  CA    . ARG A 1 789  ? 36.982  103.958 27.486  1.00 12.96 ? 789  ARG A CA    1 
ATOM   6089  C  C     . ARG A 1 789  ? 36.281  104.361 28.771  1.00 13.08 ? 789  ARG A C     1 
ATOM   6090  O  O     . ARG A 1 789  ? 36.956  104.588 29.778  1.00 13.03 ? 789  ARG A O     1 
ATOM   6091  C  CB    . ARG A 1 789  ? 37.227  102.444 27.599  1.00 13.11 ? 789  ARG A CB    1 
ATOM   6092  C  CG    . ARG A 1 789  ? 37.228  101.676 26.317  1.00 14.21 ? 789  ARG A CG    1 
ATOM   6093  C  CD    . ARG A 1 789  ? 36.919  100.181 26.469  1.00 16.37 ? 789  ARG A CD    1 
ATOM   6094  N  NE    . ARG A 1 789  ? 36.825  99.542  25.151  1.00 16.18 ? 789  ARG A NE    1 
ATOM   6095  C  CZ    . ARG A 1 789  ? 35.771  98.888  24.701  1.00 17.01 ? 789  ARG A CZ    1 
ATOM   6096  N  NH1   . ARG A 1 789  ? 34.683  98.761  25.450  1.00 18.22 ? 789  ARG A NH1   1 
ATOM   6097  N  NH2   . ARG A 1 789  ? 35.801  98.353  23.484  1.00 18.63 ? 789  ARG A NH2   1 
ATOM   6098  N  N     . PRO A 1 790  ? 34.948  104.427 28.767  1.00 13.17 ? 790  PRO A N     1 
ATOM   6099  C  CA    . PRO A 1 790  ? 34.180  104.712 29.990  1.00 13.26 ? 790  PRO A CA    1 
ATOM   6100  C  C     . PRO A 1 790  ? 34.629  103.986 31.276  1.00 13.32 ? 790  PRO A C     1 
ATOM   6101  O  O     . PRO A 1 790  ? 35.036  104.684 32.210  1.00 14.72 ? 790  PRO A O     1 
ATOM   6102  C  CB    . PRO A 1 790  ? 32.749  104.346 29.582  1.00 13.34 ? 790  PRO A CB    1 
ATOM   6103  C  CG    . PRO A 1 790  ? 32.723  104.742 28.140  1.00 13.06 ? 790  PRO A CG    1 
ATOM   6104  C  CD    . PRO A 1 790  ? 34.060  104.303 27.594  1.00 12.94 ? 790  PRO A CD    1 
ATOM   6105  N  N     . GLY A 1 791  ? 34.595  102.658 31.350  1.00 12.60 ? 791  GLY A N     1 
ATOM   6106  C  CA    . GLY A 1 791  ? 35.008  102.002 32.592  1.00 11.55 ? 791  GLY A CA    1 
ATOM   6107  C  C     . GLY A 1 791  ? 36.463  101.554 32.719  1.00 11.13 ? 791  GLY A C     1 
ATOM   6108  O  O     . GLY A 1 791  ? 36.805  100.745 33.600  1.00 11.35 ? 791  GLY A O     1 
ATOM   6109  N  N     . GLY A 1 792  ? 37.326  102.051 31.842  1.00 10.23 ? 792  GLY A N     1 
ATOM   6110  C  CA    . GLY A 1 792  ? 38.685  101.537 31.747  1.00 9.12  ? 792  GLY A CA    1 
ATOM   6111  C  C     . GLY A 1 792  ? 39.762  102.273 32.519  1.00 8.74  ? 792  GLY A C     1 
ATOM   6112  O  O     . GLY A 1 792  ? 39.490  103.108 33.389  1.00 8.51  ? 792  GLY A O     1 
ATOM   6113  N  N     . GLU A 1 793  ? 41.010  101.966 32.182  1.00 8.10  ? 793  GLU A N     1 
ATOM   6114  C  CA    . GLU A 1 793  ? 42.139  102.678 32.748  1.00 7.39  ? 793  GLU A CA    1 
ATOM   6115  C  C     . GLU A 1 793  ? 41.925  104.173 32.580  1.00 7.71  ? 793  GLU A C     1 
ATOM   6116  O  O     . GLU A 1 793  ? 41.330  104.629 31.583  1.00 7.25  ? 793  GLU A O     1 
ATOM   6117  C  CB    . GLU A 1 793  ? 43.448  102.235 32.092  1.00 7.22  ? 793  GLU A CB    1 
ATOM   6118  C  CG    . GLU A 1 793  ? 44.704  102.879 32.665  1.00 7.63  ? 793  GLU A CG    1 
ATOM   6119  C  CD    . GLU A 1 793  ? 44.957  102.497 34.118  1.00 8.50  ? 793  GLU A CD    1 
ATOM   6120  O  OE1   . GLU A 1 793  ? 44.249  103.031 35.006  1.00 7.62  ? 793  GLU A OE1   1 
ATOM   6121  O  OE2   . GLU A 1 793  ? 45.859  101.656 34.373  1.00 8.20  ? 793  GLU A OE2   1 
ATOM   6122  N  N     . TYR A 1 794  ? 42.399  104.926 33.567  1.00 6.89  ? 794  TYR A N     1 
ATOM   6123  C  CA    . TYR A 1 794  ? 42.337  106.372 33.526  1.00 7.30  ? 794  TYR A CA    1 
ATOM   6124  C  C     . TYR A 1 794  ? 43.309  106.953 32.496  1.00 7.35  ? 794  TYR A C     1 
ATOM   6125  O  O     . TYR A 1 794  ? 44.458  106.502 32.366  1.00 7.46  ? 794  TYR A O     1 
ATOM   6126  C  CB    . TYR A 1 794  ? 42.644  106.955 34.910  1.00 7.39  ? 794  TYR A CB    1 
ATOM   6127  C  CG    . TYR A 1 794  ? 42.679  108.468 34.937  1.00 7.84  ? 794  TYR A CG    1 
ATOM   6128  C  CD1   . TYR A 1 794  ? 41.501  109.213 34.907  1.00 10.98 ? 794  TYR A CD1   1 
ATOM   6129  C  CD2   . TYR A 1 794  ? 43.885  109.152 34.977  1.00 10.10 ? 794  TYR A CD2   1 
ATOM   6130  C  CE1   . TYR A 1 794  ? 41.526  110.619 34.919  1.00 8.88  ? 794  TYR A CE1   1 
ATOM   6131  C  CE2   . TYR A 1 794  ? 43.920  110.550 34.986  1.00 10.93 ? 794  TYR A CE2   1 
ATOM   6132  C  CZ    . TYR A 1 794  ? 42.717  111.269 34.962  1.00 10.33 ? 794  TYR A CZ    1 
ATOM   6133  O  OH    . TYR A 1 794  ? 42.734  112.644 34.977  1.00 11.70 ? 794  TYR A OH    1 
ATOM   6134  N  N     . HIS A 1 795  ? 42.846  107.968 31.780  1.00 7.13  ? 795  HIS A N     1 
ATOM   6135  C  CA    . HIS A 1 795  ? 43.710  108.740 30.900  1.00 7.87  ? 795  HIS A CA    1 
ATOM   6136  C  C     . HIS A 1 795  ? 43.622  110.196 31.337  1.00 8.57  ? 795  HIS A C     1 
ATOM   6137  O  O     . HIS A 1 795  ? 42.518  110.702 31.562  1.00 8.78  ? 795  HIS A O     1 
ATOM   6138  C  CB    . HIS A 1 795  ? 43.244  108.610 29.441  1.00 7.70  ? 795  HIS A CB    1 
ATOM   6139  C  CG    . HIS A 1 795  ? 43.573  107.294 28.805  1.00 5.69  ? 795  HIS A CG    1 
ATOM   6140  N  ND1   . HIS A 1 795  ? 44.605  107.144 27.905  1.00 2.51  ? 795  HIS A ND1   1 
ATOM   6141  C  CD2   . HIS A 1 795  ? 42.994  106.076 28.919  1.00 5.37  ? 795  HIS A CD2   1 
ATOM   6142  C  CE1   . HIS A 1 795  ? 44.651  105.894 27.491  1.00 4.06  ? 795  HIS A CE1   1 
ATOM   6143  N  NE2   . HIS A 1 795  ? 43.687  105.220 28.096  1.00 3.35  ? 795  HIS A NE2   1 
ATOM   6144  N  N     . MET A 1 796  ? 44.770  110.866 31.454  1.00 9.19  ? 796  MET A N     1 
ATOM   6145  C  CA    . MET A 1 796  ? 44.818  112.280 31.831  1.00 11.06 ? 796  MET A CA    1 
ATOM   6146  C  C     . MET A 1 796  ? 44.118  113.199 30.833  1.00 11.71 ? 796  MET A C     1 
ATOM   6147  O  O     . MET A 1 796  ? 43.546  114.226 31.225  1.00 12.32 ? 796  MET A O     1 
ATOM   6148  C  CB    . MET A 1 796  ? 46.271  112.749 32.022  1.00 11.63 ? 796  MET A CB    1 
ATOM   6149  C  CG    . MET A 1 796  ? 46.857  112.357 33.375  1.00 15.30 ? 796  MET A CG    1 
ATOM   6150  S  SD    . MET A 1 796  ? 46.202  113.312 34.794  1.00 21.60 ? 796  MET A SD    1 
ATOM   6151  C  CE    . MET A 1 796  ? 45.651  114.778 34.051  1.00 18.08 ? 796  MET A CE    1 
ATOM   6152  N  N     . ASN A 1 797  ? 44.194  112.824 29.555  1.00 11.95 ? 797  ASN A N     1 
ATOM   6153  C  CA    . ASN A 1 797  ? 43.511  113.500 28.458  1.00 12.36 ? 797  ASN A CA    1 
ATOM   6154  C  C     . ASN A 1 797  ? 42.377  112.644 27.915  1.00 12.25 ? 797  ASN A C     1 
ATOM   6155  O  O     . ASN A 1 797  ? 42.518  111.429 27.775  1.00 12.98 ? 797  ASN A O     1 
ATOM   6156  C  CB    . ASN A 1 797  ? 44.491  113.829 27.330  1.00 12.67 ? 797  ASN A CB    1 
ATOM   6157  C  CG    . ASN A 1 797  ? 45.745  114.470 27.831  1.00 15.30 ? 797  ASN A CG    1 
ATOM   6158  O  OD1   . ASN A 1 797  ? 45.710  115.585 28.358  1.00 18.17 ? 797  ASN A OD1   1 
ATOM   6159  N  ND2   . ASN A 1 797  ? 46.872  113.766 27.694  1.00 15.18 ? 797  ASN A ND2   1 
ATOM   6160  N  N     . SER A 1 798  ? 41.240  113.275 27.655  1.00 11.56 ? 798  SER A N     1 
ATOM   6161  C  CA    . SER A 1 798  ? 40.075  112.626 27.065  1.00 10.54 ? 798  SER A CA    1 
ATOM   6162  C  C     . SER A 1 798  ? 39.248  113.701 26.360  1.00 10.37 ? 798  SER A C     1 
ATOM   6163  O  O     . SER A 1 798  ? 39.389  114.885 26.688  1.00 10.30 ? 798  SER A O     1 
ATOM   6164  C  CB    . SER A 1 798  ? 39.245  111.917 28.140  1.00 10.44 ? 798  SER A CB    1 
ATOM   6165  O  OG    . SER A 1 798  ? 38.503  112.845 28.913  1.00 10.86 ? 798  SER A OG    1 
ATOM   6166  N  N     . PRO A 1 799  ? 38.429  113.309 25.375  1.00 10.36 ? 799  PRO A N     1 
ATOM   6167  C  CA    . PRO A 1 799  ? 37.584  114.259 24.635  1.00 10.23 ? 799  PRO A CA    1 
ATOM   6168  C  C     . PRO A 1 799  ? 36.726  115.193 25.494  1.00 10.54 ? 799  PRO A C     1 
ATOM   6169  O  O     . PRO A 1 799  ? 36.748  116.399 25.239  1.00 9.98  ? 799  PRO A O     1 
ATOM   6170  C  CB    . PRO A 1 799  ? 36.703  113.340 23.771  1.00 10.45 ? 799  PRO A CB    1 
ATOM   6171  C  CG    . PRO A 1 799  ? 37.593  112.160 23.505  1.00 10.00 ? 799  PRO A CG    1 
ATOM   6172  C  CD    . PRO A 1 799  ? 38.314  111.942 24.820  1.00 9.81  ? 799  PRO A CD    1 
ATOM   6173  N  N     . GLU A 1 800  ? 35.999  114.671 26.481  1.00 10.83 ? 800  GLU A N     1 
ATOM   6174  C  CA    . GLU A 1 800  ? 35.147  115.523 27.313  1.00 11.64 ? 800  GLU A CA    1 
ATOM   6175  C  C     . GLU A 1 800  ? 35.952  116.562 28.118  1.00 11.24 ? 800  GLU A C     1 
ATOM   6176  O  O     . GLU A 1 800  ? 35.610  117.744 28.112  1.00 11.64 ? 800  GLU A O     1 
ATOM   6177  C  CB    . GLU A 1 800  ? 34.225  114.691 28.218  1.00 12.04 ? 800  GLU A CB    1 
ATOM   6178  C  CG    . GLU A 1 800  ? 34.897  113.456 28.805  1.00 14.30 ? 800  GLU A CG    1 
ATOM   6179  C  CD    . GLU A 1 800  ? 34.649  112.216 27.969  1.00 16.56 ? 800  GLU A CD    1 
ATOM   6180  O  OE1   . GLU A 1 800  ? 35.470  111.938 27.048  1.00 13.42 ? 800  GLU A OE1   1 
ATOM   6181  O  OE2   . GLU A 1 800  ? 33.618  111.534 28.226  1.00 17.82 ? 800  GLU A OE2   1 
ATOM   6182  N  N     . MET A 1 801  ? 37.028  116.130 28.774  1.00 11.25 ? 801  MET A N     1 
ATOM   6183  C  CA    . MET A 1 801  ? 37.927  117.045 29.483  1.00 11.15 ? 801  MET A CA    1 
ATOM   6184  C  C     . MET A 1 801  ? 38.392  118.139 28.505  1.00 10.12 ? 801  MET A C     1 
ATOM   6185  O  O     . MET A 1 801  ? 38.366  119.332 28.821  1.00 9.23  ? 801  MET A O     1 
ATOM   6186  C  CB    . MET A 1 801  ? 39.122  116.248 30.039  1.00 12.44 ? 801  MET A CB    1 
ATOM   6187  C  CG    . MET A 1 801  ? 40.328  117.049 30.568  1.00 15.48 ? 801  MET A CG    1 
ATOM   6188  S  SD    . MET A 1 801  ? 41.512  117.641 29.338  1.00 24.78 ? 801  MET A SD    1 
ATOM   6189  C  CE    . MET A 1 801  ? 41.733  116.238 28.329  1.00 20.88 ? 801  MET A CE    1 
ATOM   6190  N  N     . SER A 1 802  ? 38.782  117.710 27.305  1.00 8.79  ? 802  SER A N     1 
ATOM   6191  C  CA    . SER A 1 802  ? 39.304  118.608 26.282  1.00 8.54  ? 802  SER A CA    1 
ATOM   6192  C  C     . SER A 1 802  ? 38.276  119.664 25.869  1.00 8.25  ? 802  SER A C     1 
ATOM   6193  O  O     . SER A 1 802  ? 38.613  120.837 25.687  1.00 8.21  ? 802  SER A O     1 
ATOM   6194  C  CB    . SER A 1 802  ? 39.745  117.803 25.055  1.00 8.29  ? 802  SER A CB    1 
ATOM   6195  O  OG    . SER A 1 802  ? 40.917  117.051 25.343  1.00 8.76  ? 802  SER A OG    1 
ATOM   6196  N  N     . LYS A 1 803  ? 37.028  119.243 25.727  1.00 8.63  ? 803  LYS A N     1 
ATOM   6197  C  CA    . LYS A 1 803  ? 35.988  120.135 25.229  1.00 9.29  ? 803  LYS A CA    1 
ATOM   6198  C  C     . LYS A 1 803  ? 35.602  121.201 26.259  1.00 9.67  ? 803  LYS A C     1 
ATOM   6199  O  O     . LYS A 1 803  ? 35.362  122.352 25.892  1.00 10.18 ? 803  LYS A O     1 
ATOM   6200  C  CB    . LYS A 1 803  ? 34.777  119.335 24.748  1.00 9.34  ? 803  LYS A CB    1 
ATOM   6201  C  CG    . LYS A 1 803  ? 35.044  118.623 23.420  1.00 8.98  ? 803  LYS A CG    1 
ATOM   6202  C  CD    . LYS A 1 803  ? 33.933  117.630 23.087  1.00 8.80  ? 803  LYS A CD    1 
ATOM   6203  C  CE    . LYS A 1 803  ? 34.489  116.467 22.253  1.00 8.44  ? 803  LYS A CE    1 
ATOM   6204  N  NZ    . LYS A 1 803  ? 33.392  115.535 21.877  1.00 8.14  ? 803  LYS A NZ    1 
ATOM   6205  N  N     . SER A 1 804  ? 35.572  120.840 27.539  1.00 9.68  ? 804  SER A N     1 
ATOM   6206  C  CA    . SER A 1 804  ? 35.301  121.853 28.560  1.00 10.82 ? 804  SER A CA    1 
ATOM   6207  C  C     . SER A 1 804  ? 36.427  122.890 28.699  1.00 10.42 ? 804  SER A C     1 
ATOM   6208  O  O     . SER A 1 804  ? 36.143  124.063 28.945  1.00 10.49 ? 804  SER A O     1 
ATOM   6209  C  CB    . SER A 1 804  ? 34.908  121.244 29.914  1.00 10.94 ? 804  SER A CB    1 
ATOM   6210  O  OG    . SER A 1 804  ? 35.423  119.936 30.055  1.00 14.66 ? 804  SER A OG    1 
ATOM   6211  N  N     . LEU A 1 805  ? 37.686  122.484 28.515  1.00 10.27 ? 805  LEU A N     1 
ATOM   6212  C  CA    . LEU A 1 805  ? 38.784  123.450 28.582  1.00 10.48 ? 805  LEU A CA    1 
ATOM   6213  C  C     . LEU A 1 805  ? 38.639  124.471 27.455  1.00 11.24 ? 805  LEU A C     1 
ATOM   6214  O  O     . LEU A 1 805  ? 38.748  125.678 27.679  1.00 11.01 ? 805  LEU A O     1 
ATOM   6215  C  CB    . LEU A 1 805  ? 40.163  122.771 28.517  1.00 9.95  ? 805  LEU A CB    1 
ATOM   6216  C  CG    . LEU A 1 805  ? 41.405  123.702 28.488  1.00 9.59  ? 805  LEU A CG    1 
ATOM   6217  C  CD1   . LEU A 1 805  ? 41.588  124.446 29.816  1.00 7.92  ? 805  LEU A CD1   1 
ATOM   6218  C  CD2   . LEU A 1 805  ? 42.673  122.962 28.144  1.00 8.06  ? 805  LEU A CD2   1 
ATOM   6219  N  N     . HIS A 1 806  ? 38.364  123.969 26.252  1.00 12.31 ? 806  HIS A N     1 
ATOM   6220  C  CA    . HIS A 1 806  ? 38.380  124.784 25.027  1.00 13.14 ? 806  HIS A CA    1 
ATOM   6221  C  C     . HIS A 1 806  ? 37.289  125.847 25.058  1.00 12.91 ? 806  HIS A C     1 
ATOM   6222  O  O     . HIS A 1 806  ? 37.478  126.979 24.570  1.00 12.77 ? 806  HIS A O     1 
ATOM   6223  C  CB    . HIS A 1 806  ? 38.261  123.885 23.766  1.00 13.36 ? 806  HIS A CB    1 
ATOM   6224  C  CG    . HIS A 1 806  ? 38.321  124.640 22.469  1.00 13.81 ? 806  HIS A CG    1 
ATOM   6225  N  ND1   . HIS A 1 806  ? 39.322  125.546 22.175  1.00 14.13 ? 806  HIS A ND1   1 
ATOM   6226  C  CD2   . HIS A 1 806  ? 37.497  124.628 21.395  1.00 13.64 ? 806  HIS A CD2   1 
ATOM   6227  C  CE1   . HIS A 1 806  ? 39.109  126.058 20.975  1.00 15.50 ? 806  HIS A CE1   1 
ATOM   6228  N  NE2   . HIS A 1 806  ? 38.006  125.519 20.482  1.00 15.35 ? 806  HIS A NE2   1 
ATOM   6229  N  N     . LYS A 1 807  ? 36.165  125.485 25.667  1.00 12.97 ? 807  LYS A N     1 
ATOM   6230  C  CA    . LYS A 1 807  ? 35.043  126.387 25.778  1.00 13.67 ? 807  LYS A CA    1 
ATOM   6231  C  C     . LYS A 1 807  ? 35.260  127.402 26.893  1.00 13.79 ? 807  LYS A C     1 
ATOM   6232  O  O     . LYS A 1 807  ? 34.858  128.555 26.753  1.00 13.64 ? 807  LYS A O     1 
ATOM   6233  C  CB    . LYS A 1 807  ? 33.736  125.613 25.957  1.00 13.84 ? 807  LYS A CB    1 
ATOM   6234  C  CG    . LYS A 1 807  ? 33.386  124.776 24.714  1.00 15.39 ? 807  LYS A CG    1 
ATOM   6235  C  CD    . LYS A 1 807  ? 31.957  124.263 24.777  1.00 16.58 ? 807  LYS A CD    1 
ATOM   6236  C  CE    . LYS A 1 807  ? 31.921  122.750 24.672  1.00 17.59 ? 807  LYS A CE    1 
ATOM   6237  N  NZ    . LYS A 1 807  ? 30.602  122.209 25.099  1.00 18.60 ? 807  LYS A NZ    1 
ATOM   6238  N  N     . ALA A 1 808  ? 35.904  126.980 27.982  1.00 13.68 ? 808  ALA A N     1 
ATOM   6239  C  CA    . ALA A 1 808  ? 36.259  127.903 29.062  1.00 14.01 ? 808  ALA A CA    1 
ATOM   6240  C  C     . ALA A 1 808  ? 37.149  129.017 28.514  1.00 14.16 ? 808  ALA A C     1 
ATOM   6241  O  O     . ALA A 1 808  ? 36.902  130.204 28.730  1.00 14.55 ? 808  ALA A O     1 
ATOM   6242  C  CB    . ALA A 1 808  ? 36.965  127.171 30.188  1.00 13.53 ? 808  ALA A CB    1 
ATOM   6243  N  N     . VAL A 1 809  ? 38.154  128.605 27.762  1.00 14.33 ? 809  VAL A N     1 
ATOM   6244  C  CA    . VAL A 1 809  ? 39.159  129.495 27.207  1.00 14.60 ? 809  VAL A CA    1 
ATOM   6245  C  C     . VAL A 1 809  ? 38.652  130.388 26.038  1.00 15.16 ? 809  VAL A C     1 
ATOM   6246  O  O     . VAL A 1 809  ? 39.127  131.524 25.855  1.00 15.22 ? 809  VAL A O     1 
ATOM   6247  C  CB    . VAL A 1 809  ? 40.414  128.650 26.908  1.00 14.67 ? 809  VAL A CB    1 
ATOM   6248  C  CG1   . VAL A 1 809  ? 40.878  128.756 25.469  1.00 14.51 ? 809  VAL A CG1   1 
ATOM   6249  C  CG2   . VAL A 1 809  ? 41.485  128.950 27.912  1.00 13.19 ? 809  VAL A CG2   1 
ATOM   6250  N  N     . ALA A 1 810  ? 37.672  129.893 25.280  1.00 15.48 ? 810  ALA A N     1 
ATOM   6251  C  CA    . ALA A 1 810  ? 37.058  130.673 24.191  1.00 16.25 ? 810  ALA A CA    1 
ATOM   6252  C  C     . ALA A 1 810  ? 35.999  131.654 24.696  1.00 16.73 ? 810  ALA A C     1 
ATOM   6253  O  O     . ALA A 1 810  ? 35.518  132.516 23.940  1.00 17.09 ? 810  ALA A O     1 
ATOM   6254  C  CB    . ALA A 1 810  ? 36.458  129.752 23.130  1.00 16.17 ? 810  ALA A CB    1 
ATOM   6255  N  N     . ALA A 1 811  ? 35.632  131.519 25.971  1.00 17.31 ? 811  ALA A N     1 
ATOM   6256  C  CA    . ALA A 1 811  ? 34.591  132.344 26.569  1.00 17.78 ? 811  ALA A CA    1 
ATOM   6257  C  C     . ALA A 1 811  ? 35.102  133.688 27.109  1.00 18.26 ? 811  ALA A C     1 
ATOM   6258  O  O     . ALA A 1 811  ? 34.330  134.637 27.177  1.00 18.39 ? 811  ALA A O     1 
ATOM   6259  C  CB    . ALA A 1 811  ? 33.847  131.566 27.650  1.00 17.71 ? 811  ALA A CB    1 
ATOM   6260  N  N     . TYR A 1 812  ? 36.374  133.745 27.522  1.00 18.99 ? 812  TYR A N     1 
ATOM   6261  C  CA    . TYR A 1 812  ? 37.103  134.995 27.862  1.00 19.85 ? 812  TYR A CA    1 
ATOM   6262  C  C     . TYR A 1 812  ? 38.237  134.679 28.827  1.00 20.19 ? 812  TYR A C     1 
ATOM   6263  O  O     . TYR A 1 812  ? 38.139  133.742 29.621  1.00 20.78 ? 812  TYR A O     1 
ATOM   6264  C  CB    . TYR A 1 812  ? 36.193  136.096 28.448  1.00 20.22 ? 812  TYR A CB    1 
ATOM   6265  C  CG    . TYR A 1 812  ? 36.849  137.458 28.731  1.00 21.45 ? 812  TYR A CG    1 
ATOM   6266  C  CD1   . TYR A 1 812  ? 37.754  138.047 27.828  1.00 22.77 ? 812  TYR A CD1   1 
ATOM   6267  C  CD2   . TYR A 1 812  ? 36.539  138.164 29.894  1.00 21.97 ? 812  TYR A CD2   1 
ATOM   6268  C  CE1   . TYR A 1 812  ? 38.341  139.295 28.093  1.00 21.64 ? 812  TYR A CE1   1 
ATOM   6269  C  CE2   . TYR A 1 812  ? 37.118  139.402 30.168  1.00 22.38 ? 812  TYR A CE2   1 
ATOM   6270  C  CZ    . TYR A 1 812  ? 38.019  139.966 29.268  1.00 23.23 ? 812  TYR A CZ    1 
ATOM   6271  O  OH    . TYR A 1 812  ? 38.575  141.207 29.551  1.00 23.40 ? 812  TYR A OH    1 
ATOM   6272  N  N     . ASP A 1 825  ? 31.547  127.656 35.592  1.00 15.79 ? 825  ASP A N     1 
ATOM   6273  C  CA    . ASP A 1 825  ? 32.225  127.929 34.339  1.00 15.74 ? 825  ASP A CA    1 
ATOM   6274  C  C     . ASP A 1 825  ? 32.528  126.588 33.671  1.00 15.90 ? 825  ASP A C     1 
ATOM   6275  O  O     . ASP A 1 825  ? 32.386  125.523 34.283  1.00 16.02 ? 825  ASP A O     1 
ATOM   6276  C  CB    . ASP A 1 825  ? 33.526  128.724 34.588  1.00 15.57 ? 825  ASP A CB    1 
ATOM   6277  C  CG    . ASP A 1 825  ? 33.857  129.718 33.444  1.00 15.98 ? 825  ASP A CG    1 
ATOM   6278  O  OD1   . ASP A 1 825  ? 34.678  129.387 32.541  1.00 15.11 ? 825  ASP A OD1   1 
ATOM   6279  O  OD2   . ASP A 1 825  ? 33.355  130.859 33.367  1.00 14.47 ? 825  ASP A OD2   1 
ATOM   6280  N  N     . HIS A 1 826  ? 32.928  126.648 32.409  1.00 15.75 ? 826  HIS A N     1 
ATOM   6281  C  CA    . HIS A 1 826  ? 33.497  125.494 31.736  1.00 15.58 ? 826  HIS A CA    1 
ATOM   6282  C  C     . HIS A 1 826  ? 34.807  125.054 32.405  1.00 15.46 ? 826  HIS A C     1 
ATOM   6283  O  O     . HIS A 1 826  ? 35.137  123.866 32.376  1.00 15.26 ? 826  HIS A O     1 
ATOM   6284  C  CB    . HIS A 1 826  ? 33.766  125.823 30.271  1.00 15.46 ? 826  HIS A CB    1 
ATOM   6285  C  CG    . HIS A 1 826  ? 32.531  126.000 29.443  1.00 15.74 ? 826  HIS A CG    1 
ATOM   6286  N  ND1   . HIS A 1 826  ? 31.748  124.942 29.038  1.00 15.59 ? 826  HIS A ND1   1 
ATOM   6287  C  CD2   . HIS A 1 826  ? 31.962  127.112 28.919  1.00 16.45 ? 826  HIS A CD2   1 
ATOM   6288  C  CE1   . HIS A 1 826  ? 30.738  125.394 28.315  1.00 17.23 ? 826  HIS A CE1   1 
ATOM   6289  N  NE2   . HIS A 1 826  ? 30.847  126.708 28.223  1.00 17.84 ? 826  HIS A NE2   1 
ATOM   6290  N  N     . TYR A 1 827  ? 35.547  126.004 32.993  1.00 15.44 ? 827  TYR A N     1 
ATOM   6291  C  CA    . TYR A 1 827  ? 36.855  125.710 33.608  1.00 15.53 ? 827  TYR A CA    1 
ATOM   6292  C  C     . TYR A 1 827  ? 36.763  124.905 34.899  1.00 16.02 ? 827  TYR A C     1 
ATOM   6293  O  O     . TYR A 1 827  ? 37.696  124.164 35.242  1.00 15.99 ? 827  TYR A O     1 
ATOM   6294  C  CB    . TYR A 1 827  ? 37.695  126.981 33.858  1.00 14.93 ? 827  TYR A CB    1 
ATOM   6295  C  CG    . TYR A 1 827  ? 39.177  126.691 34.111  1.00 14.63 ? 827  TYR A CG    1 
ATOM   6296  C  CD1   . TYR A 1 827  ? 40.039  126.377 33.051  1.00 12.82 ? 827  TYR A CD1   1 
ATOM   6297  C  CD2   . TYR A 1 827  ? 39.716  126.716 35.409  1.00 14.67 ? 827  TYR A CD2   1 
ATOM   6298  C  CE1   . TYR A 1 827  ? 41.392  126.095 33.266  1.00 12.97 ? 827  TYR A CE1   1 
ATOM   6299  C  CE2   . TYR A 1 827  ? 41.085  126.430 35.638  1.00 13.11 ? 827  TYR A CE2   1 
ATOM   6300  C  CZ    . TYR A 1 827  ? 41.912  126.129 34.553  1.00 13.84 ? 827  TYR A CZ    1 
ATOM   6301  O  OH    . TYR A 1 827  ? 43.255  125.841 34.729  1.00 13.52 ? 827  TYR A OH    1 
ATOM   6302  N  N     . GLU A 1 828  ? 35.660  125.070 35.620  1.00 16.55 ? 828  GLU A N     1 
ATOM   6303  C  CA    . GLU A 1 828  ? 35.475  124.399 36.901  1.00 17.40 ? 828  GLU A CA    1 
ATOM   6304  C  C     . GLU A 1 828  ? 35.043  122.958 36.659  1.00 17.54 ? 828  GLU A C     1 
ATOM   6305  O  O     . GLU A 1 828  ? 35.420  122.057 37.409  1.00 17.99 ? 828  GLU A O     1 
ATOM   6306  C  CB    . GLU A 1 828  ? 34.469  125.159 37.787  1.00 17.74 ? 828  GLU A CB    1 
ATOM   6307  C  CG    . GLU A 1 828  ? 35.120  126.154 38.757  1.00 19.48 ? 828  GLU A CG    1 
ATOM   6308  C  CD    . GLU A 1 828  ? 34.102  126.943 39.583  1.00 21.93 ? 828  GLU A CD    1 
ATOM   6309  O  OE1   . GLU A 1 828  ? 33.382  126.321 40.403  1.00 22.82 ? 828  GLU A OE1   1 
ATOM   6310  O  OE2   . GLU A 1 828  ? 34.018  128.190 39.424  1.00 23.17 ? 828  GLU A OE2   1 
ATOM   6311  N  N     . LEU A 1 829  ? 34.276  122.740 35.592  1.00 17.52 ? 829  LEU A N     1 
ATOM   6312  C  CA    . LEU A 1 829  ? 33.970  121.381 35.139  1.00 17.57 ? 829  LEU A CA    1 
ATOM   6313  C  C     . LEU A 1 829  ? 35.248  120.674 34.672  1.00 17.21 ? 829  LEU A C     1 
ATOM   6314  O  O     . LEU A 1 829  ? 35.476  119.502 34.994  1.00 17.80 ? 829  LEU A O     1 
ATOM   6315  C  CB    . LEU A 1 829  ? 32.909  121.390 34.026  1.00 17.15 ? 829  LEU A CB    1 
ATOM   6316  C  CG    . LEU A 1 829  ? 31.444  121.099 34.384  1.00 18.20 ? 829  LEU A CG    1 
ATOM   6317  C  CD1   . LEU A 1 829  ? 30.685  120.589 33.150  1.00 18.10 ? 829  LEU A CD1   1 
ATOM   6318  C  CD2   . LEU A 1 829  ? 31.283  120.117 35.562  1.00 18.13 ? 829  LEU A CD2   1 
ATOM   6319  N  N     . TYR A 1 830  ? 36.093  121.398 33.941  1.00 16.79 ? 830  TYR A N     1 
ATOM   6320  C  CA    . TYR A 1 830  ? 37.372  120.870 33.475  1.00 15.82 ? 830  TYR A CA    1 
ATOM   6321  C  C     . TYR A 1 830  ? 38.306  120.565 34.644  1.00 16.46 ? 830  TYR A C     1 
ATOM   6322  O  O     . TYR A 1 830  ? 39.083  119.598 34.615  1.00 16.39 ? 830  TYR A O     1 
ATOM   6323  C  CB    . TYR A 1 830  ? 38.039  121.870 32.511  1.00 15.28 ? 830  TYR A CB    1 
ATOM   6324  C  CG    . TYR A 1 830  ? 39.549  121.734 32.421  1.00 12.19 ? 830  TYR A CG    1 
ATOM   6325  C  CD1   . TYR A 1 830  ? 40.131  120.719 31.655  1.00 9.05  ? 830  TYR A CD1   1 
ATOM   6326  C  CD2   . TYR A 1 830  ? 40.395  122.598 33.115  1.00 9.54  ? 830  TYR A CD2   1 
ATOM   6327  C  CE1   . TYR A 1 830  ? 41.514  120.570 31.577  1.00 9.16  ? 830  TYR A CE1   1 
ATOM   6328  C  CE2   . TYR A 1 830  ? 41.798  122.448 33.040  1.00 9.02  ? 830  TYR A CE2   1 
ATOM   6329  C  CZ    . TYR A 1 830  ? 42.342  121.435 32.263  1.00 8.65  ? 830  TYR A CZ    1 
ATOM   6330  O  OH    . TYR A 1 830  ? 43.715  121.271 32.172  1.00 9.25  ? 830  TYR A OH    1 
ATOM   6331  N  N     . ARG A 1 831  ? 38.226  121.409 35.665  1.00 16.89 ? 831  ARG A N     1 
ATOM   6332  C  CA    . ARG A 1 831  ? 39.161  121.398 36.784  1.00 17.52 ? 831  ARG A CA    1 
ATOM   6333  C  C     . ARG A 1 831  ? 38.961  120.182 37.695  1.00 17.98 ? 831  ARG A C     1 
ATOM   6334  O  O     . ARG A 1 831  ? 39.926  119.668 38.298  1.00 18.39 ? 831  ARG A O     1 
ATOM   6335  C  CB    . ARG A 1 831  ? 39.019  122.722 37.552  1.00 17.88 ? 831  ARG A CB    1 
ATOM   6336  C  CG    . ARG A 1 831  ? 39.904  122.898 38.775  1.00 18.05 ? 831  ARG A CG    1 
ATOM   6337  C  CD    . ARG A 1 831  ? 41.254  123.481 38.489  1.00 18.24 ? 831  ARG A CD    1 
ATOM   6338  N  NE    . ARG A 1 831  ? 42.289  122.654 39.106  1.00 19.52 ? 831  ARG A NE    1 
ATOM   6339  C  CZ    . ARG A 1 831  ? 43.501  122.479 38.600  1.00 16.90 ? 831  ARG A CZ    1 
ATOM   6340  N  NH1   . ARG A 1 831  ? 43.837  123.099 37.476  1.00 16.22 ? 831  ARG A NH1   1 
ATOM   6341  N  NH2   . ARG A 1 831  ? 44.376  121.697 39.227  1.00 16.94 ? 831  ARG A NH2   1 
ATOM   6342  N  N     . GLN A 1 832  ? 37.712  119.736 37.772  1.00 18.39 ? 832  GLN A N     1 
ATOM   6343  C  CA    . GLN A 1 832  ? 37.297  118.604 38.586  1.00 18.77 ? 832  GLN A CA    1 
ATOM   6344  C  C     . GLN A 1 832  ? 37.393  117.284 37.819  1.00 18.95 ? 832  GLN A C     1 
ATOM   6345  O  O     . GLN A 1 832  ? 37.401  116.219 38.431  1.00 18.99 ? 832  GLN A O     1 
ATOM   6346  C  CB    . GLN A 1 832  ? 35.853  118.794 39.069  1.00 19.23 ? 832  GLN A CB    1 
ATOM   6347  C  CG    . GLN A 1 832  ? 35.634  119.864 40.149  1.00 19.23 ? 832  GLN A CG    1 
ATOM   6348  C  CD    . GLN A 1 832  ? 34.157  120.000 40.531  1.00 20.66 ? 832  GLN A CD    1 
ATOM   6349  O  OE1   . GLN A 1 832  ? 33.326  119.182 40.113  1.00 21.22 ? 832  GLN A OE1   1 
ATOM   6350  N  NE2   . GLN A 1 832  ? 33.829  121.025 41.326  1.00 19.78 ? 832  GLN A NE2   1 
ATOM   6351  N  N     . TYR A 1 833  ? 37.434  117.337 36.485  1.00 19.24 ? 833  TYR A N     1 
ATOM   6352  C  CA    . TYR A 1 833  ? 37.813  116.149 35.723  1.00 18.72 ? 833  TYR A CA    1 
ATOM   6353  C  C     . TYR A 1 833  ? 39.199  115.710 36.221  1.00 18.48 ? 833  TYR A C     1 
ATOM   6354  O  O     . TYR A 1 833  ? 39.425  114.518 36.454  1.00 18.78 ? 833  TYR A O     1 
ATOM   6355  C  CB    . TYR A 1 833  ? 37.823  116.407 34.206  1.00 19.05 ? 833  TYR A CB    1 
ATOM   6356  C  CG    . TYR A 1 833  ? 36.494  116.109 33.506  1.00 20.05 ? 833  TYR A CG    1 
ATOM   6357  C  CD1   . TYR A 1 833  ? 35.638  117.147 33.110  1.00 19.97 ? 833  TYR A CD1   1 
ATOM   6358  C  CD2   . TYR A 1 833  ? 36.096  114.786 33.227  1.00 21.31 ? 833  TYR A CD2   1 
ATOM   6359  C  CE1   . TYR A 1 833  ? 34.414  116.881 32.465  1.00 20.25 ? 833  TYR A CE1   1 
ATOM   6360  C  CE2   . TYR A 1 833  ? 34.870  114.512 32.583  1.00 21.24 ? 833  TYR A CE2   1 
ATOM   6361  C  CZ    . TYR A 1 833  ? 34.039  115.568 32.207  1.00 20.18 ? 833  TYR A CZ    1 
ATOM   6362  O  OH    . TYR A 1 833  ? 32.839  115.317 31.574  1.00 21.25 ? 833  TYR A OH    1 
ATOM   6363  N  N     . LEU A 1 834  ? 40.093  116.684 36.428  1.00 17.38 ? 834  LEU A N     1 
ATOM   6364  C  CA    . LEU A 1 834  ? 41.482  116.428 36.821  1.00 16.60 ? 834  LEU A CA    1 
ATOM   6365  C  C     . LEU A 1 834  ? 41.667  115.985 38.267  1.00 16.50 ? 834  LEU A C     1 
ATOM   6366  O  O     . LEU A 1 834  ? 42.582  115.204 38.564  1.00 16.49 ? 834  LEU A O     1 
ATOM   6367  C  CB    . LEU A 1 834  ? 42.367  117.663 36.581  1.00 16.38 ? 834  LEU A CB    1 
ATOM   6368  C  CG    . LEU A 1 834  ? 42.738  118.164 35.179  1.00 15.41 ? 834  LEU A CG    1 
ATOM   6369  C  CD1   . LEU A 1 834  ? 43.951  119.082 35.275  1.00 14.71 ? 834  LEU A CD1   1 
ATOM   6370  C  CD2   . LEU A 1 834  ? 43.026  117.049 34.189  1.00 13.90 ? 834  LEU A CD2   1 
ATOM   6371  N  N     . LYS A 1 835  ? 40.838  116.502 39.171  1.00 16.28 ? 835  LYS A N     1 
ATOM   6372  C  CA    . LYS A 1 835  ? 41.011  116.227 40.597  1.00 16.11 ? 835  LYS A CA    1 
ATOM   6373  C  C     . LYS A 1 835  ? 40.354  114.921 41.037  1.00 16.12 ? 835  LYS A C     1 
ATOM   6374  O  O     . LYS A 1 835  ? 40.676  114.374 42.108  1.00 16.60 ? 835  LYS A O     1 
ATOM   6375  C  CB    . LYS A 1 835  ? 40.527  117.414 41.451  1.00 16.43 ? 835  LYS A CB    1 
ATOM   6376  C  CG    . LYS A 1 835  ? 41.629  118.477 41.697  1.00 16.27 ? 835  LYS A CG    1 
ATOM   6377  C  CD    . LYS A 1 835  ? 41.379  119.269 42.976  1.00 17.54 ? 835  LYS A CD    1 
ATOM   6378  C  CE    . LYS A 1 835  ? 42.192  120.570 43.011  1.00 18.67 ? 835  LYS A CE    1 
ATOM   6379  N  NZ    . LYS A 1 835  ? 41.370  121.757 42.572  1.00 19.98 ? 835  LYS A NZ    1 
ATOM   6380  N  N     . ASP A 1 836  ? 39.439  114.415 40.214  1.00 15.44 ? 836  ASP A N     1 
ATOM   6381  C  CA    . ASP A 1 836  ? 38.795  113.130 40.485  1.00 14.81 ? 836  ASP A CA    1 
ATOM   6382  C  C     . ASP A 1 836  ? 39.674  111.962 40.016  1.00 13.91 ? 836  ASP A C     1 
ATOM   6383  O  O     . ASP A 1 836  ? 39.305  110.797 40.144  1.00 14.06 ? 836  ASP A O     1 
ATOM   6384  C  CB    . ASP A 1 836  ? 37.406  113.085 39.843  1.00 15.01 ? 836  ASP A CB    1 
ATOM   6385  C  CG    . ASP A 1 836  ? 36.409  114.030 40.524  1.00 16.55 ? 836  ASP A CG    1 
ATOM   6386  O  OD1   . ASP A 1 836  ? 36.807  114.783 41.453  1.00 17.50 ? 836  ASP A OD1   1 
ATOM   6387  O  OD2   . ASP A 1 836  ? 35.200  114.086 40.195  1.00 18.77 ? 836  ASP A OD2   1 
ATOM   6388  N  N     . ARG A 1 837  ? 40.847  112.310 39.489  1.00 12.96 ? 837  ARG A N     1 
ATOM   6389  C  CA    . ARG A 1 837  ? 41.836  111.380 38.959  1.00 11.83 ? 837  ARG A CA    1 
ATOM   6390  C  C     . ARG A 1 837  ? 42.279  110.378 40.054  1.00 10.78 ? 837  ARG A C     1 
ATOM   6391  O  O     . ARG A 1 837  ? 42.378  110.751 41.231  1.00 9.78  ? 837  ARG A O     1 
ATOM   6392  C  CB    . ARG A 1 837  ? 42.992  112.229 38.368  1.00 12.44 ? 837  ARG A CB    1 
ATOM   6393  C  CG    . ARG A 1 837  ? 44.445  111.780 38.511  1.00 13.31 ? 837  ARG A CG    1 
ATOM   6394  C  CD    . ARG A 1 837  ? 45.318  112.661 39.420  1.00 14.82 ? 837  ARG A CD    1 
ATOM   6395  N  NE    . ARG A 1 837  ? 46.232  113.556 38.710  1.00 14.87 ? 837  ARG A NE    1 
ATOM   6396  C  CZ    . ARG A 1 837  ? 46.868  114.594 39.274  1.00 18.77 ? 837  ARG A CZ    1 
ATOM   6397  N  NH1   . ARG A 1 837  ? 46.710  114.890 40.563  1.00 21.35 ? 837  ARG A NH1   1 
ATOM   6398  N  NH2   . ARG A 1 837  ? 47.678  115.353 38.551  1.00 22.34 ? 837  ARG A NH2   1 
ATOM   6399  N  N     . PRO A 1 838  ? 42.511  109.110 39.680  1.00 9.72  ? 838  PRO A N     1 
ATOM   6400  C  CA    . PRO A 1 838  ? 43.228  108.179 40.559  1.00 8.50  ? 838  PRO A CA    1 
ATOM   6401  C  C     . PRO A 1 838  ? 44.709  108.568 40.543  1.00 6.99  ? 838  PRO A C     1 
ATOM   6402  O  O     . PRO A 1 838  ? 45.109  109.341 39.699  1.00 5.54  ? 838  PRO A O     1 
ATOM   6403  C  CB    . PRO A 1 838  ? 43.039  106.837 39.860  1.00 8.83  ? 838  PRO A CB    1 
ATOM   6404  C  CG    . PRO A 1 838  ? 42.961  107.189 38.428  1.00 8.80  ? 838  PRO A CG    1 
ATOM   6405  C  CD    . PRO A 1 838  ? 42.153  108.470 38.398  1.00 10.02 ? 838  PRO A CD    1 
ATOM   6406  N  N     . VAL A 1 839  ? 45.509  108.058 41.466  1.00 6.21  ? 839  VAL A N     1 
ATOM   6407  C  CA    . VAL A 1 839  ? 46.943  108.324 41.434  1.00 5.91  ? 839  VAL A CA    1 
ATOM   6408  C  C     . VAL A 1 839  ? 47.497  107.867 40.055  1.00 5.56  ? 839  VAL A C     1 
ATOM   6409  O  O     . VAL A 1 839  ? 47.187  106.759 39.596  1.00 4.78  ? 839  VAL A O     1 
ATOM   6410  C  CB    . VAL A 1 839  ? 47.644  107.646 42.631  1.00 5.92  ? 839  VAL A CB    1 
ATOM   6411  C  CG1   . VAL A 1 839  ? 49.103  107.423 42.358  1.00 8.57  ? 839  VAL A CG1   1 
ATOM   6412  C  CG2   . VAL A 1 839  ? 47.462  108.509 43.903  1.00 5.98  ? 839  VAL A CG2   1 
ATOM   6413  N  N     . THR A 1 840  ? 48.277  108.738 39.411  1.00 4.70  ? 840  THR A N     1 
ATOM   6414  C  CA    . THR A 1 840  ? 48.724  108.544 38.025  1.00 5.05  ? 840  THR A CA    1 
ATOM   6415  C  C     . THR A 1 840  ? 50.231  108.753 37.833  1.00 4.91  ? 840  THR A C     1 
ATOM   6416  O  O     . THR A 1 840  ? 50.889  107.961 37.152  1.00 5.00  ? 840  THR A O     1 
ATOM   6417  C  CB    . THR A 1 840  ? 47.933  109.495 37.081  1.00 5.14  ? 840  THR A CB    1 
ATOM   6418  O  OG1   . THR A 1 840  ? 46.534  109.188 37.161  1.00 6.61  ? 840  THR A OG1   1 
ATOM   6419  C  CG2   . THR A 1 840  ? 48.267  109.233 35.597  1.00 6.05  ? 840  THR A CG2   1 
ATOM   6420  N  N     . ALA A 1 841  ? 50.757  109.848 38.391  1.00 4.59  ? 841  ALA A N     1 
ATOM   6421  C  CA    . ALA A 1 841  ? 52.172  110.166 38.303  1.00 4.18  ? 841  ALA A CA    1 
ATOM   6422  C  C     . ALA A 1 841  ? 52.803  110.126 39.689  1.00 3.95  ? 841  ALA A C     1 
ATOM   6423  O  O     . ALA A 1 841  ? 52.100  110.203 40.697  1.00 3.35  ? 841  ALA A O     1 
ATOM   6424  C  CB    . ALA A 1 841  ? 52.361  111.553 37.667  1.00 5.31  ? 841  ALA A CB    1 
ATOM   6425  N  N     . LEU A 1 842  ? 54.131  110.024 39.748  1.00 3.14  ? 842  LEU A N     1 
ATOM   6426  C  CA    . LEU A 1 842  ? 54.825  110.046 41.031  1.00 3.22  ? 842  LEU A CA    1 
ATOM   6427  C  C     . LEU A 1 842  ? 54.468  111.261 41.881  1.00 2.64  ? 842  LEU A C     1 
ATOM   6428  O  O     . LEU A 1 842  ? 54.232  111.120 43.065  1.00 2.28  ? 842  LEU A O     1 
ATOM   6429  C  CB    . LEU A 1 842  ? 56.345  109.956 40.840  1.00 2.99  ? 842  LEU A CB    1 
ATOM   6430  C  CG    . LEU A 1 842  ? 56.841  108.616 40.285  1.00 3.74  ? 842  LEU A CG    1 
ATOM   6431  C  CD1   . LEU A 1 842  ? 58.348  108.690 40.006  1.00 3.65  ? 842  LEU A CD1   1 
ATOM   6432  C  CD2   . LEU A 1 842  ? 56.510  107.473 41.244  1.00 5.95  ? 842  LEU A CD2   1 
ATOM   6433  N  N     . ARG A 1 843  ? 54.408  112.450 41.274  1.00 3.17  ? 843  ARG A N     1 
ATOM   6434  C  CA    . ARG A 1 843  ? 54.051  113.676 42.015  1.00 3.25  ? 843  ARG A CA    1 
ATOM   6435  C  C     . ARG A 1 843  ? 52.679  113.622 42.710  1.00 3.23  ? 843  ARG A C     1 
ATOM   6436  O  O     . ARG A 1 843  ? 52.439  114.361 43.674  1.00 2.67  ? 843  ARG A O     1 
ATOM   6437  C  CB    . ARG A 1 843  ? 54.151  114.920 41.119  1.00 4.52  ? 843  ARG A CB    1 
ATOM   6438  C  CG    . ARG A 1 843  ? 52.930  115.159 40.229  1.00 5.44  ? 843  ARG A CG    1 
ATOM   6439  C  CD    . ARG A 1 843  ? 53.159  116.126 39.073  1.00 8.18  ? 843  ARG A CD    1 
ATOM   6440  N  NE    . ARG A 1 843  ? 53.679  115.278 38.037  1.00 16.53 ? 843  ARG A NE    1 
ATOM   6441  C  CZ    . ARG A 1 843  ? 53.201  115.103 36.826  1.00 12.25 ? 843  ARG A CZ    1 
ATOM   6442  N  NH1   . ARG A 1 843  ? 52.164  115.782 36.334  1.00 14.42 ? 843  ARG A NH1   1 
ATOM   6443  N  NH2   . ARG A 1 843  ? 53.832  114.231 36.095  1.00 11.64 ? 843  ARG A NH2   1 
ATOM   6444  N  N     . ASP A 1 844  ? 51.801  112.735 42.239  1.00 3.17  ? 844  ASP A N     1 
ATOM   6445  C  CA    . ASP A 1 844  ? 50.480  112.527 42.855  1.00 4.14  ? 844  ASP A CA    1 
ATOM   6446  C  C     . ASP A 1 844  ? 50.570  111.949 44.271  1.00 4.39  ? 844  ASP A C     1 
ATOM   6447  O  O     . ASP A 1 844  ? 49.590  111.985 45.013  1.00 3.90  ? 844  ASP A O     1 
ATOM   6448  C  CB    . ASP A 1 844  ? 49.601  111.578 42.020  1.00 3.84  ? 844  ASP A CB    1 
ATOM   6449  C  CG    . ASP A 1 844  ? 49.209  112.157 40.651  1.00 5.20  ? 844  ASP A CG    1 
ATOM   6450  O  OD1   . ASP A 1 844  ? 49.371  113.371 40.416  1.00 4.84  ? 844  ASP A OD1   1 
ATOM   6451  O  OD2   . ASP A 1 844  ? 48.732  111.441 39.746  1.00 4.69  ? 844  ASP A OD2   1 
ATOM   6452  N  N     . LEU A 1 845  ? 51.720  111.373 44.616  1.00 4.63  ? 845  LEU A N     1 
ATOM   6453  C  CA    . LEU A 1 845  ? 51.921  110.797 45.957  1.00 4.93  ? 845  LEU A CA    1 
ATOM   6454  C  C     . LEU A 1 845  ? 52.406  111.827 46.958  1.00 4.84  ? 845  LEU A C     1 
ATOM   6455  O  O     . LEU A 1 845  ? 52.539  111.530 48.153  1.00 4.98  ? 845  LEU A O     1 
ATOM   6456  C  CB    . LEU A 1 845  ? 52.917  109.642 45.903  1.00 5.22  ? 845  LEU A CB    1 
ATOM   6457  C  CG    . LEU A 1 845  ? 52.628  108.512 44.906  1.00 7.34  ? 845  LEU A CG    1 
ATOM   6458  C  CD1   . LEU A 1 845  ? 53.737  107.465 44.951  1.00 7.07  ? 845  LEU A CD1   1 
ATOM   6459  C  CD2   . LEU A 1 845  ? 51.284  107.883 45.197  1.00 6.79  ? 845  LEU A CD2   1 
ATOM   6460  N  N     . LEU A 1 846  ? 52.681  113.032 46.464  1.00 4.90  ? 846  LEU A N     1 
ATOM   6461  C  CA    . LEU A 1 846  ? 53.230  114.107 47.281  1.00 5.17  ? 846  LEU A CA    1 
ATOM   6462  C  C     . LEU A 1 846  ? 52.221  115.206 47.566  1.00 5.70  ? 846  LEU A C     1 
ATOM   6463  O  O     . LEU A 1 846  ? 51.224  115.374 46.841  1.00 5.31  ? 846  LEU A O     1 
ATOM   6464  C  CB    . LEU A 1 846  ? 54.469  114.694 46.607  1.00 4.40  ? 846  LEU A CB    1 
ATOM   6465  C  CG    . LEU A 1 846  ? 55.570  113.689 46.239  1.00 4.93  ? 846  LEU A CG    1 
ATOM   6466  C  CD1   . LEU A 1 846  ? 56.683  114.370 45.458  1.00 3.41  ? 846  LEU A CD1   1 
ATOM   6467  C  CD2   . LEU A 1 846  ? 56.149  112.983 47.466  1.00 5.26  ? 846  LEU A CD2   1 
ATOM   6468  N  N     . ASP A 1 847  ? 52.492  115.948 48.633  1.00 6.10  ? 847  ASP A N     1 
ATOM   6469  C  CA    . ASP A 1 847  ? 51.701  117.098 49.030  1.00 6.95  ? 847  ASP A CA    1 
ATOM   6470  C  C     . ASP A 1 847  ? 52.665  118.119 49.623  1.00 6.83  ? 847  ASP A C     1 
ATOM   6471  O  O     . ASP A 1 847  ? 53.852  117.816 49.811  1.00 6.37  ? 847  ASP A O     1 
ATOM   6472  C  CB    . ASP A 1 847  ? 50.649  116.696 50.059  1.00 7.66  ? 847  ASP A CB    1 
ATOM   6473  C  CG    . ASP A 1 847  ? 49.562  117.749 50.233  1.00 10.34 ? 847  ASP A CG    1 
ATOM   6474  O  OD1   . ASP A 1 847  ? 49.588  118.778 49.505  1.00 12.27 ? 847  ASP A OD1   1 
ATOM   6475  O  OD2   . ASP A 1 847  ? 48.649  117.639 51.088  1.00 12.09 ? 847  ASP A OD2   1 
ATOM   6476  N  N     . PHE A 1 848  ? 52.165  119.325 49.892  1.00 7.03  ? 848  PHE A N     1 
ATOM   6477  C  CA    . PHE A 1 848  ? 52.991  120.411 50.424  1.00 7.62  ? 848  PHE A CA    1 
ATOM   6478  C  C     . PHE A 1 848  ? 53.083  120.344 51.929  1.00 7.57  ? 848  PHE A C     1 
ATOM   6479  O  O     . PHE A 1 848  ? 52.133  119.954 52.603  1.00 7.72  ? 848  PHE A O     1 
ATOM   6480  C  CB    . PHE A 1 848  ? 52.471  121.793 49.983  1.00 7.51  ? 848  PHE A CB    1 
ATOM   6481  C  CG    . PHE A 1 848  ? 52.233  121.907 48.502  1.00 8.82  ? 848  PHE A CG    1 
ATOM   6482  C  CD1   . PHE A 1 848  ? 50.957  122.149 48.008  1.00 10.70 ? 848  PHE A CD1   1 
ATOM   6483  C  CD2   . PHE A 1 848  ? 53.281  121.743 47.599  1.00 9.04  ? 848  PHE A CD2   1 
ATOM   6484  C  CE1   . PHE A 1 848  ? 50.734  122.237 46.622  1.00 9.81  ? 848  PHE A CE1   1 
ATOM   6485  C  CE2   . PHE A 1 848  ? 53.069  121.823 46.229  1.00 10.14 ? 848  PHE A CE2   1 
ATOM   6486  C  CZ    . PHE A 1 848  ? 51.798  122.069 45.734  1.00 10.34 ? 848  PHE A CZ    1 
ATOM   6487  N  N     . ASN A 1 849  ? 54.242  120.735 52.447  1.00 7.93  ? 849  ASN A N     1 
ATOM   6488  C  CA    . ASN A 1 849  ? 54.454  120.915 53.887  1.00 7.87  ? 849  ASN A CA    1 
ATOM   6489  C  C     . ASN A 1 849  ? 55.073  122.297 54.080  1.00 7.47  ? 849  ASN A C     1 
ATOM   6490  O  O     . ASN A 1 849  ? 56.290  122.448 54.083  1.00 6.75  ? 849  ASN A O     1 
ATOM   6491  C  CB    . ASN A 1 849  ? 55.389  119.829 54.426  1.00 8.11  ? 849  ASN A CB    1 
ATOM   6492  C  CG    . ASN A 1 849  ? 55.403  119.752 55.949  1.00 10.10 ? 849  ASN A CG    1 
ATOM   6493  O  OD1   . ASN A 1 849  ? 54.469  120.194 56.634  1.00 13.14 ? 849  ASN A OD1   1 
ATOM   6494  N  ND2   . ASN A 1 849  ? 56.476  119.181 56.488  1.00 11.56 ? 849  ASN A ND2   1 
ATOM   6495  N  N     . ALA A 1 850  ? 54.222  123.304 54.218  1.00 7.72  ? 850  ALA A N     1 
ATOM   6496  C  CA    . ALA A 1 850  ? 54.677  124.691 54.282  1.00 7.65  ? 850  ALA A CA    1 
ATOM   6497  C  C     . ALA A 1 850  ? 55.546  124.944 55.510  1.00 7.50  ? 850  ALA A C     1 
ATOM   6498  O  O     . ALA A 1 850  ? 55.255  124.439 56.598  1.00 7.54  ? 850  ALA A O     1 
ATOM   6499  C  CB    . ALA A 1 850  ? 53.489  125.638 54.263  1.00 7.59  ? 850  ALA A CB    1 
ATOM   6500  N  N     . ASP A 1 851  ? 56.622  125.704 55.315  1.00 7.59  ? 851  ASP A N     1 
ATOM   6501  C  CA    . ASP A 1 851  ? 57.458  126.181 56.419  1.00 7.75  ? 851  ASP A CA    1 
ATOM   6502  C  C     . ASP A 1 851  ? 57.194  127.638 56.803  1.00 7.84  ? 851  ASP A C     1 
ATOM   6503  O  O     . ASP A 1 851  ? 57.892  128.191 57.655  1.00 7.44  ? 851  ASP A O     1 
ATOM   6504  C  CB    . ASP A 1 851  ? 58.952  125.951 56.140  1.00 7.55  ? 851  ASP A CB    1 
ATOM   6505  C  CG    . ASP A 1 851  ? 59.520  126.896 55.081  1.00 7.95  ? 851  ASP A CG    1 
ATOM   6506  O  OD1   . ASP A 1 851  ? 58.753  127.527 54.316  1.00 8.20  ? 851  ASP A OD1   1 
ATOM   6507  O  OD2   . ASP A 1 851  ? 60.750  127.056 54.935  1.00 8.32  ? 851  ASP A OD2   1 
ATOM   6508  N  N     . GLN A 1 852  ? 56.186  128.247 56.181  1.00 8.00  ? 852  GLN A N     1 
ATOM   6509  C  CA    . GLN A 1 852  ? 55.831  129.640 56.451  1.00 8.48  ? 852  GLN A CA    1 
ATOM   6510  C  C     . GLN A 1 852  ? 54.298  129.854 56.385  1.00 7.93  ? 852  GLN A C     1 
ATOM   6511  O  O     . GLN A 1 852  ? 53.608  129.112 55.679  1.00 7.72  ? 852  GLN A O     1 
ATOM   6512  C  CB    . GLN A 1 852  ? 56.559  130.539 55.455  1.00 8.74  ? 852  GLN A CB    1 
ATOM   6513  C  CG    . GLN A 1 852  ? 57.943  131.003 55.943  1.00 12.91 ? 852  GLN A CG    1 
ATOM   6514  C  CD    . GLN A 1 852  ? 58.794  131.556 54.822  1.00 16.25 ? 852  GLN A CD    1 
ATOM   6515  O  OE1   . GLN A 1 852  ? 58.267  132.162 53.894  1.00 18.54 ? 852  GLN A OE1   1 
ATOM   6516  N  NE2   . GLN A 1 852  ? 60.115  131.355 54.904  1.00 17.45 ? 852  GLN A NE2   1 
ATOM   6517  N  N     . PRO A 1 853  ? 53.758  130.838 57.114  1.00 7.51  ? 853  PRO A N     1 
ATOM   6518  C  CA    . PRO A 1 853  ? 52.311  131.114 57.039  1.00 7.19  ? 853  PRO A CA    1 
ATOM   6519  C  C     . PRO A 1 853  ? 51.911  131.659 55.664  1.00 6.70  ? 853  PRO A C     1 
ATOM   6520  O  O     . PRO A 1 853  ? 52.715  132.338 55.023  1.00 6.70  ? 853  PRO A O     1 
ATOM   6521  C  CB    . PRO A 1 853  ? 52.079  132.196 58.109  1.00 7.16  ? 853  PRO A CB    1 
ATOM   6522  C  CG    . PRO A 1 853  ? 53.352  132.312 58.883  1.00 7.79  ? 853  PRO A CG    1 
ATOM   6523  C  CD    . PRO A 1 853  ? 54.454  131.752 58.040  1.00 7.40  ? 853  PRO A CD    1 
ATOM   6524  N  N     . ALA A 1 854  ? 50.684  131.384 55.236  1.00 6.27  ? 854  ALA A N     1 
ATOM   6525  C  CA    . ALA A 1 854  ? 50.165  131.922 53.984  1.00 5.76  ? 854  ALA A CA    1 
ATOM   6526  C  C     . ALA A 1 854  ? 50.267  133.458 53.950  1.00 5.84  ? 854  ALA A C     1 
ATOM   6527  O  O     . ALA A 1 854  ? 50.139  134.118 54.983  1.00 4.61  ? 854  ALA A O     1 
ATOM   6528  C  CB    . ALA A 1 854  ? 48.723  131.492 53.801  1.00 6.30  ? 854  ALA A CB    1 
ATOM   6529  N  N     . ILE A 1 855  ? 50.523  134.016 52.766  1.00 5.19  ? 855  ILE A N     1 
ATOM   6530  C  CA    . ILE A 1 855  ? 50.474  135.468 52.580  1.00 4.92  ? 855  ILE A CA    1 
ATOM   6531  C  C     . ILE A 1 855  ? 49.290  135.835 51.685  1.00 5.07  ? 855  ILE A C     1 
ATOM   6532  O  O     . ILE A 1 855  ? 48.703  134.956 51.048  1.00 4.71  ? 855  ILE A O     1 
ATOM   6533  C  CB    . ILE A 1 855  ? 51.821  136.015 52.017  1.00 4.66  ? 855  ILE A CB    1 
ATOM   6534  C  CG1   . ILE A 1 855  ? 52.136  135.413 50.642  1.00 4.77  ? 855  ILE A CG1   1 
ATOM   6535  C  CG2   . ILE A 1 855  ? 52.965  135.783 53.018  1.00 4.17  ? 855  ILE A CG2   1 
ATOM   6536  C  CD1   . ILE A 1 855  ? 53.274  136.092 49.915  1.00 4.10  ? 855  ILE A CD1   1 
ATOM   6537  N  N     . SER A 1 856  ? 48.945  137.117 51.624  1.00 5.10  ? 856  SER A N     1 
ATOM   6538  C  CA    . SER A 1 856  ? 47.864  137.569 50.745  1.00 6.22  ? 856  SER A CA    1 
ATOM   6539  C  C     . SER A 1 856  ? 48.271  137.559 49.269  1.00 6.76  ? 856  SER A C     1 
ATOM   6540  O  O     . SER A 1 856  ? 49.435  137.833 48.933  1.00 7.26  ? 856  SER A O     1 
ATOM   6541  C  CB    . SER A 1 856  ? 47.377  138.957 51.157  1.00 6.44  ? 856  SER A CB    1 
ATOM   6542  O  OG    . SER A 1 856  ? 48.093  139.954 50.456  1.00 7.43  ? 856  SER A OG    1 
ATOM   6543  N  N     . LEU A 1 857  ? 47.311  137.249 48.397  1.00 7.08  ? 857  LEU A N     1 
ATOM   6544  C  CA    . LEU A 1 857  ? 47.554  137.124 46.956  1.00 7.79  ? 857  LEU A CA    1 
ATOM   6545  C  C     . LEU A 1 857  ? 48.223  138.355 46.350  1.00 7.91  ? 857  LEU A C     1 
ATOM   6546  O  O     . LEU A 1 857  ? 49.068  138.227 45.476  1.00 7.31  ? 857  LEU A O     1 
ATOM   6547  C  CB    . LEU A 1 857  ? 46.243  136.860 46.208  1.00 8.16  ? 857  LEU A CB    1 
ATOM   6548  C  CG    . LEU A 1 857  ? 45.977  135.551 45.458  1.00 8.84  ? 857  LEU A CG    1 
ATOM   6549  C  CD1   . LEU A 1 857  ? 44.857  135.764 44.451  1.00 9.88  ? 857  LEU A CD1   1 
ATOM   6550  C  CD2   . LEU A 1 857  ? 47.204  134.924 44.791  1.00 7.88  ? 857  LEU A CD2   1 
ATOM   6551  N  N     . GLU A 1 858  ? 47.847  139.542 46.825  1.00 7.94  ? 858  GLU A N     1 
ATOM   6552  C  CA    . GLU A 1 858  ? 48.363  140.797 46.262  1.00 8.49  ? 858  GLU A CA    1 
ATOM   6553  C  C     . GLU A 1 858  ? 49.892  140.947 46.400  1.00 8.13  ? 858  GLU A C     1 
ATOM   6554  O  O     . GLU A 1 858  ? 50.517  141.713 45.659  1.00 8.37  ? 858  GLU A O     1 
ATOM   6555  C  CB    . GLU A 1 858  ? 47.623  142.008 46.852  1.00 8.95  ? 858  GLU A CB    1 
ATOM   6556  C  CG    . GLU A 1 858  ? 46.293  141.671 47.525  1.00 11.44 ? 858  GLU A CG    1 
ATOM   6557  C  CD    . GLU A 1 858  ? 45.091  141.716 46.582  1.00 14.80 ? 858  GLU A CD    1 
ATOM   6558  O  OE1   . GLU A 1 858  ? 44.973  140.817 45.707  1.00 15.04 ? 858  GLU A OE1   1 
ATOM   6559  O  OE2   . GLU A 1 858  ? 44.244  142.643 46.733  1.00 15.68 ? 858  GLU A OE2   1 
ATOM   6560  N  N     . GLU A 1 859  ? 50.480  140.200 47.335  1.00 7.30  ? 859  GLU A N     1 
ATOM   6561  C  CA    . GLU A 1 859  ? 51.929  140.186 47.544  1.00 7.01  ? 859  GLU A CA    1 
ATOM   6562  C  C     . GLU A 1 859  ? 52.675  139.304 46.525  1.00 6.33  ? 859  GLU A C     1 
ATOM   6563  O  O     . GLU A 1 859  ? 53.882  139.439 46.340  1.00 5.93  ? 859  GLU A O     1 
ATOM   6564  C  CB    . GLU A 1 859  ? 52.260  139.749 48.982  1.00 7.15  ? 859  GLU A CB    1 
ATOM   6565  C  CG    . GLU A 1 859  ? 51.584  140.581 50.072  1.00 9.64  ? 859  GLU A CG    1 
ATOM   6566  C  CD    . GLU A 1 859  ? 52.032  140.196 51.474  1.00 13.16 ? 859  GLU A CD    1 
ATOM   6567  O  OE1   . GLU A 1 859  ? 51.166  140.082 52.384  1.00 14.86 ? 859  GLU A OE1   1 
ATOM   6568  O  OE2   . GLU A 1 859  ? 53.257  140.012 51.673  1.00 14.97 ? 859  GLU A OE2   1 
ATOM   6569  N  N     . VAL A 1 860  ? 51.951  138.410 45.863  1.00 5.66  ? 860  VAL A N     1 
ATOM   6570  C  CA    . VAL A 1 860  ? 52.563  137.436 44.957  1.00 5.57  ? 860  VAL A CA    1 
ATOM   6571  C  C     . VAL A 1 860  ? 52.865  138.046 43.583  1.00 5.78  ? 860  VAL A C     1 
ATOM   6572  O  O     . VAL A 1 860  ? 52.100  138.873 43.101  1.00 5.52  ? 860  VAL A O     1 
ATOM   6573  C  CB    . VAL A 1 860  ? 51.666  136.180 44.843  1.00 5.69  ? 860  VAL A CB    1 
ATOM   6574  C  CG1   . VAL A 1 860  ? 52.165  135.211 43.757  1.00 4.89  ? 860  VAL A CG1   1 
ATOM   6575  C  CG2   . VAL A 1 860  ? 51.595  135.484 46.199  1.00 5.03  ? 860  VAL A CG2   1 
ATOM   6576  N  N     . GLU A 1 861  ? 53.977  137.634 42.966  1.00 6.07  ? 861  GLU A N     1 
ATOM   6577  C  CA    . GLU A 1 861  ? 54.363  138.121 41.643  1.00 6.61  ? 861  GLU A CA    1 
ATOM   6578  C  C     . GLU A 1 861  ? 53.224  137.962 40.614  1.00 6.95  ? 861  GLU A C     1 
ATOM   6579  O  O     . GLU A 1 861  ? 52.413  137.018 40.711  1.00 6.77  ? 861  GLU A O     1 
ATOM   6580  C  CB    . GLU A 1 861  ? 55.645  137.428 41.161  1.00 6.86  ? 861  GLU A CB    1 
ATOM   6581  C  CG    . GLU A 1 861  ? 55.508  135.929 40.903  1.00 8.50  ? 861  GLU A CG    1 
ATOM   6582  C  CD    . GLU A 1 861  ? 56.762  135.306 40.300  1.00 10.04 ? 861  GLU A CD    1 
ATOM   6583  O  OE1   . GLU A 1 861  ? 56.837  134.068 40.281  1.00 9.45  ? 861  GLU A OE1   1 
ATOM   6584  O  OE2   . GLU A 1 861  ? 57.676  136.041 39.846  1.00 11.95 ? 861  GLU A OE2   1 
ATOM   6585  N  N     . SER A 1 862  ? 53.170  138.879 39.642  1.00 6.39  ? 862  SER A N     1 
ATOM   6586  C  CA    . SER A 1 862  ? 52.065  138.941 38.673  1.00 6.35  ? 862  SER A CA    1 
ATOM   6587  C  C     . SER A 1 862  ? 52.052  137.745 37.716  1.00 6.06  ? 862  SER A C     1 
ATOM   6588  O  O     . SER A 1 862  ? 53.047  137.045 37.576  1.00 5.44  ? 862  SER A O     1 
ATOM   6589  C  CB    . SER A 1 862  ? 52.133  140.234 37.858  1.00 6.74  ? 862  SER A CB    1 
ATOM   6590  O  OG    . SER A 1 862  ? 53.040  140.095 36.765  1.00 6.99  ? 862  SER A OG    1 
ATOM   6591  N  N     . VAL A 1 863  ? 50.912  137.535 37.064  1.00 5.78  ? 863  VAL A N     1 
ATOM   6592  C  CA    . VAL A 1 863  ? 50.763  136.509 36.044  1.00 6.62  ? 863  VAL A CA    1 
ATOM   6593  C  C     . VAL A 1 863  ? 51.699  136.817 34.864  1.00 6.45  ? 863  VAL A C     1 
ATOM   6594  O  O     . VAL A 1 863  ? 52.222  135.915 34.225  1.00 5.62  ? 863  VAL A O     1 
ATOM   6595  C  CB    . VAL A 1 863  ? 49.275  136.392 35.595  1.00 6.45  ? 863  VAL A CB    1 
ATOM   6596  C  CG1   . VAL A 1 863  ? 49.144  135.600 34.341  1.00 9.12  ? 863  VAL A CG1   1 
ATOM   6597  C  CG2   . VAL A 1 863  ? 48.458  135.724 36.675  1.00 8.17  ? 863  VAL A CG2   1 
ATOM   6598  N  N     . GLU A 1 864  ? 51.951  138.101 34.627  1.00 6.86  ? 864  GLU A N     1 
ATOM   6599  C  CA    . GLU A 1 864  ? 52.793  138.532 33.508  1.00 7.93  ? 864  GLU A CA    1 
ATOM   6600  C  C     . GLU A 1 864  ? 54.217  138.043 33.682  1.00 7.79  ? 864  GLU A C     1 
ATOM   6601  O  O     . GLU A 1 864  ? 54.841  137.565 32.725  1.00 7.51  ? 864  GLU A O     1 
ATOM   6602  C  CB    . GLU A 1 864  ? 52.729  140.051 33.342  1.00 9.09  ? 864  GLU A CB    1 
ATOM   6603  C  CG    . GLU A 1 864  ? 51.463  140.519 32.625  1.00 12.03 ? 864  GLU A CG    1 
ATOM   6604  C  CD    . GLU A 1 864  ? 50.222  140.576 33.516  1.00 18.66 ? 864  GLU A CD    1 
ATOM   6605  O  OE1   . GLU A 1 864  ? 50.348  140.796 34.757  1.00 19.58 ? 864  GLU A OE1   1 
ATOM   6606  O  OE2   . GLU A 1 864  ? 49.096  140.414 32.962  1.00 21.12 ? 864  GLU A OE2   1 
ATOM   6607  N  N     . SER A 1 865  ? 54.693  138.108 34.922  1.00 7.48  ? 865  SER A N     1 
ATOM   6608  C  CA    . SER A 1 865  ? 55.991  137.568 35.306  1.00 8.39  ? 865  SER A CA    1 
ATOM   6609  C  C     . SER A 1 865  ? 56.088  136.027 35.208  1.00 7.76  ? 865  SER A C     1 
ATOM   6610  O  O     . SER A 1 865  ? 57.100  135.498 34.751  1.00 8.44  ? 865  SER A O     1 
ATOM   6611  C  CB    . SER A 1 865  ? 56.368  138.058 36.716  1.00 8.65  ? 865  SER A CB    1 
ATOM   6612  O  OG    . SER A 1 865  ? 57.635  137.535 37.087  1.00 12.38 ? 865  SER A OG    1 
ATOM   6613  N  N     . ILE A 1 866  ? 55.040  135.316 35.619  1.00 6.60  ? 866  ILE A N     1 
ATOM   6614  C  CA    . ILE A 1 866  ? 55.082  133.849 35.712  1.00 5.44  ? 866  ILE A CA    1 
ATOM   6615  C  C     . ILE A 1 866  ? 55.068  133.197 34.330  1.00 5.39  ? 866  ILE A C     1 
ATOM   6616  O  O     . ILE A 1 866  ? 55.805  132.258 34.037  1.00 5.29  ? 866  ILE A O     1 
ATOM   6617  C  CB    . ILE A 1 866  ? 53.914  133.346 36.594  1.00 5.33  ? 866  ILE A CB    1 
ATOM   6618  C  CG1   . ILE A 1 866  ? 54.203  133.703 38.067  1.00 4.33  ? 866  ILE A CG1   1 
ATOM   6619  C  CG2   . ILE A 1 866  ? 53.653  131.821 36.387  1.00 4.00  ? 866  ILE A CG2   1 
ATOM   6620  C  CD1   . ILE A 1 866  ? 52.977  133.782 38.948  1.00 3.66  ? 866  ILE A CD1   1 
ATOM   6621  N  N     . VAL A 1 867  ? 54.216  133.743 33.486  1.00 5.62  ? 867  VAL A N     1 
ATOM   6622  C  CA    . VAL A 1 867  ? 54.015  133.297 32.115  1.00 6.41  ? 867  VAL A CA    1 
ATOM   6623  C  C     . VAL A 1 867  ? 55.316  133.356 31.283  1.00 5.76  ? 867  VAL A C     1 
ATOM   6624  O  O     . VAL A 1 867  ? 55.482  132.607 30.309  1.00 5.32  ? 867  VAL A O     1 
ATOM   6625  C  CB    . VAL A 1 867  ? 52.842  134.163 31.563  1.00 6.96  ? 867  VAL A CB    1 
ATOM   6626  C  CG1   . VAL A 1 867  ? 53.137  134.811 30.247  1.00 9.16  ? 867  VAL A CG1   1 
ATOM   6627  C  CG2   . VAL A 1 867  ? 51.535  133.407 31.622  1.00 7.45  ? 867  VAL A CG2   1 
ATOM   6628  N  N     . LYS A 1 868  ? 56.253  134.215 31.689  1.00 5.49  ? 868  LYS A N     1 
ATOM   6629  C  CA    . LYS A 1 868  ? 57.567  134.270 31.044  1.00 6.01  ? 868  LYS A CA    1 
ATOM   6630  C  C     . LYS A 1 868  ? 58.378  132.972 31.163  1.00 5.35  ? 868  LYS A C     1 
ATOM   6631  O  O     . LYS A 1 868  ? 59.346  132.775 30.423  1.00 5.68  ? 868  LYS A O     1 
ATOM   6632  C  CB    . LYS A 1 868  ? 58.386  135.461 31.561  1.00 6.56  ? 868  LYS A CB    1 
ATOM   6633  C  CG    . LYS A 1 868  ? 57.753  136.793 31.204  1.00 9.48  ? 868  LYS A CG    1 
ATOM   6634  C  CD    . LYS A 1 868  ? 58.733  137.959 31.339  1.00 13.69 ? 868  LYS A CD    1 
ATOM   6635  C  CE    . LYS A 1 868  ? 58.385  139.061 30.334  1.00 16.52 ? 868  LYS A CE    1 
ATOM   6636  N  NZ    . LYS A 1 868  ? 57.969  140.304 31.044  1.00 17.71 ? 868  LYS A NZ    1 
ATOM   6637  N  N     . ARG A 1 869  ? 57.979  132.092 32.077  1.00 4.59  ? 869  ARG A N     1 
ATOM   6638  C  CA    . ARG A 1 869  ? 58.686  130.835 32.309  1.00 4.74  ? 869  ARG A CA    1 
ATOM   6639  C  C     . ARG A 1 869  ? 58.089  129.691 31.496  1.00 5.03  ? 869  ARG A C     1 
ATOM   6640  O  O     . ARG A 1 869  ? 58.574  128.575 31.573  1.00 4.86  ? 869  ARG A O     1 
ATOM   6641  C  CB    . ARG A 1 869  ? 58.640  130.451 33.802  1.00 4.06  ? 869  ARG A CB    1 
ATOM   6642  C  CG    . ARG A 1 869  ? 59.407  131.382 34.730  1.00 5.88  ? 869  ARG A CG    1 
ATOM   6643  C  CD    . ARG A 1 869  ? 59.355  130.935 36.186  1.00 4.50  ? 869  ARG A CD    1 
ATOM   6644  N  NE    . ARG A 1 869  ? 60.000  131.861 37.108  1.00 6.48  ? 869  ARG A NE    1 
ATOM   6645  C  CZ    . ARG A 1 869  ? 61.271  131.795 37.498  1.00 7.14  ? 869  ARG A CZ    1 
ATOM   6646  N  NH1   . ARG A 1 869  ? 62.071  130.851 37.028  1.00 7.15  ? 869  ARG A NH1   1 
ATOM   6647  N  NH2   . ARG A 1 869  ? 61.748  132.690 38.365  1.00 6.99  ? 869  ARG A NH2   1 
ATOM   6648  N  N     . PHE A 1 870  ? 57.017  129.976 30.756  1.00 5.61  ? 870  PHE A N     1 
ATOM   6649  C  CA    . PHE A 1 870  ? 56.261  128.956 30.039  1.00 6.08  ? 870  PHE A CA    1 
ATOM   6650  C  C     . PHE A 1 870  ? 56.721  128.856 28.598  1.00 6.49  ? 870  PHE A C     1 
ATOM   6651  O  O     . PHE A 1 870  ? 56.956  129.878 27.951  1.00 6.51  ? 870  PHE A O     1 
ATOM   6652  C  CB    . PHE A 1 870  ? 54.760  129.276 30.060  1.00 6.19  ? 870  PHE A CB    1 
ATOM   6653  C  CG    . PHE A 1 870  ? 54.107  129.202 31.436  1.00 5.33  ? 870  PHE A CG    1 
ATOM   6654  C  CD1   . PHE A 1 870  ? 52.809  129.671 31.610  1.00 2.59  ? 870  PHE A CD1   1 
ATOM   6655  C  CD2   . PHE A 1 870  ? 54.765  128.653 32.536  1.00 4.33  ? 870  PHE A CD2   1 
ATOM   6656  C  CE1   . PHE A 1 870  ? 52.171  129.611 32.863  1.00 4.27  ? 870  PHE A CE1   1 
ATOM   6657  C  CE2   . PHE A 1 870  ? 54.130  128.586 33.794  1.00 4.35  ? 870  PHE A CE2   1 
ATOM   6658  C  CZ    . PHE A 1 870  ? 52.846  129.075 33.958  1.00 2.81  ? 870  PHE A CZ    1 
ATOM   6659  N  N     . CYS A 1 871  ? 56.832  127.617 28.109  1.00 7.25  ? 871  CYS A N     1 
ATOM   6660  C  CA    . CYS A 1 871  ? 57.200  127.319 26.732  1.00 7.99  ? 871  CYS A CA    1 
ATOM   6661  C  C     . CYS A 1 871  ? 56.192  126.369 26.168  1.00 8.25  ? 871  CYS A C     1 
ATOM   6662  O  O     . CYS A 1 871  ? 55.724  125.436 26.818  1.00 7.90  ? 871  CYS A O     1 
ATOM   6663  C  CB    . CYS A 1 871  ? 58.558  126.610 26.623  1.00 8.70  ? 871  CYS A CB    1 
ATOM   6664  S  SG    . CYS A 1 871  ? 59.892  127.534 27.389  1.00 12.29 ? 871  CYS A SG    1 
ATOM   6665  N  N     . THR A 1 872  ? 55.880  126.595 24.919  1.00 8.28  ? 872  THR A N     1 
ATOM   6666  C  CA    . THR A 1 872  ? 55.022  125.680 24.228  1.00 9.65  ? 872  THR A CA    1 
ATOM   6667  C  C     . THR A 1 872  ? 55.861  124.519 23.614  1.00 10.72 ? 872  THR A C     1 
ATOM   6668  O  O     . THR A 1 872  ? 55.404  123.374 23.504  1.00 11.85 ? 872  THR A O     1 
ATOM   6669  C  CB    . THR A 1 872  ? 54.181  126.571 23.313  1.00 10.01 ? 872  THR A CB    1 
ATOM   6670  O  OG1   . THR A 1 872  ? 52.774  126.328 23.513  1.00 11.24 ? 872  THR A OG1   1 
ATOM   6671  C  CG2   . THR A 1 872  ? 54.520  126.490 21.917  1.00 7.44  ? 872  THR A CG2   1 
ATOM   6672  N  N     . GLY A 1 873  ? 57.108  124.737 23.260  1.00 9.63  ? 873  GLY A N     1 
ATOM   6673  C  CA    . GLY A 1 873  ? 57.824  123.508 22.902  1.00 12.19 ? 873  GLY A CA    1 
ATOM   6674  C  C     . GLY A 1 873  ? 57.514  122.824 21.552  1.00 10.49 ? 873  GLY A C     1 
ATOM   6675  O  O     . GLY A 1 873  ? 56.482  123.037 20.918  1.00 10.03 ? 873  GLY A O     1 
ATOM   6676  N  N     . GLY A 1 874  ? 58.462  122.002 21.125  1.00 10.85 ? 874  GLY A N     1 
ATOM   6677  C  CA    . GLY A 1 874  ? 58.680  121.772 19.710  1.00 9.32  ? 874  GLY A CA    1 
ATOM   6678  C  C     . GLY A 1 874  ? 57.798  120.725 19.126  1.00 9.49  ? 874  GLY A C     1 
ATOM   6679  O  O     . GLY A 1 874  ? 58.074  119.552 19.301  1.00 11.49 ? 874  GLY A O     1 
ATOM   6680  N  N     . MET A 1 875  ? 56.734  121.140 18.463  1.00 8.33  ? 875  MET A N     1 
ATOM   6681  C  CA    . MET A 1 875  ? 55.886  120.248 17.688  1.00 8.14  ? 875  MET A CA    1 
ATOM   6682  C  C     . MET A 1 875  ? 56.048  120.645 16.226  1.00 7.70  ? 875  MET A C     1 
ATOM   6683  O  O     . MET A 1 875  ? 55.821  121.816 15.857  1.00 7.43  ? 875  MET A O     1 
ATOM   6684  C  CB    . MET A 1 875  ? 54.449  120.352 18.208  1.00 8.65  ? 875  MET A CB    1 
ATOM   6685  C  CG    . MET A 1 875  ? 54.447  120.222 19.753  1.00 10.02 ? 875  MET A CG    1 
ATOM   6686  S  SD    . MET A 1 875  ? 52.869  120.398 20.513  1.00 12.01 ? 875  MET A SD    1 
ATOM   6687  C  CE    . MET A 1 875  ? 52.761  122.168 20.713  1.00 8.12  ? 875  MET A CE    1 
ATOM   6688  N  N     . SER A 1 876  ? 56.524  119.708 15.405  1.00 7.04  ? 876  SER A N     1 
ATOM   6689  C  CA    . SER A 1 876  ? 56.932  120.077 14.040  1.00 7.55  ? 876  SER A CA    1 
ATOM   6690  C  C     . SER A 1 876  ? 55.788  120.643 13.240  1.00 7.21  ? 876  SER A C     1 
ATOM   6691  O  O     . SER A 1 876  ? 54.622  120.252 13.425  1.00 5.60  ? 876  SER A O     1 
ATOM   6692  C  CB    . SER A 1 876  ? 57.522  118.884 13.267  1.00 7.01  ? 876  SER A CB    1 
ATOM   6693  O  OG    . SER A 1 876  ? 56.499  117.955 12.944  1.00 8.11  ? 876  SER A OG    1 
ATOM   6694  N  N     . LEU A 1 877  ? 56.136  121.563 12.352  1.00 7.40  ? 877  LEU A N     1 
ATOM   6695  C  CA    . LEU A 1 877  ? 55.231  121.950 11.295  1.00 9.49  ? 877  LEU A CA    1 
ATOM   6696  C  C     . LEU A 1 877  ? 54.727  120.732 10.452  1.00 10.37 ? 877  LEU A C     1 
ATOM   6697  O  O     . LEU A 1 877  ? 53.549  120.587 10.209  1.00 14.19 ? 877  LEU A O     1 
ATOM   6698  C  CB    . LEU A 1 877  ? 55.780  123.144 10.464  1.00 8.75  ? 877  LEU A CB    1 
ATOM   6699  C  CG    . LEU A 1 877  ? 54.528  123.747 9.842   1.00 10.66 ? 877  LEU A CG    1 
ATOM   6700  C  CD1   . LEU A 1 877  ? 54.233  125.149 10.312  1.00 9.22  ? 877  LEU A CD1   1 
ATOM   6701  C  CD2   . LEU A 1 877  ? 54.557  123.623 8.339   1.00 12.18 ? 877  LEU A CD2   1 
ATOM   6702  N  N     . GLY A 1 878  ? 55.505  119.771 10.061  1.00 11.08 ? 878  GLY A N     1 
ATOM   6703  C  CA    . GLY A 1 878  ? 54.743  118.575 9.581   1.00 8.55  ? 878  GLY A CA    1 
ATOM   6704  C  C     . GLY A 1 878  ? 53.633  117.891 10.450  1.00 8.10  ? 878  GLY A C     1 
ATOM   6705  O  O     . GLY A 1 878  ? 52.501  117.573 9.967   1.00 6.44  ? 878  GLY A O     1 
ATOM   6706  N  N     . ALA A 1 879  ? 53.937  117.610 11.723  1.00 6.15  ? 879  ALA A N     1 
ATOM   6707  C  CA    . ALA A 1 879  ? 52.949  117.011 12.639  1.00 5.39  ? 879  ALA A CA    1 
ATOM   6708  C  C     . ALA A 1 879  ? 51.678  117.873 12.816  1.00 4.74  ? 879  ALA A C     1 
ATOM   6709  O  O     . ALA A 1 879  ? 50.543  117.365 12.775  1.00 4.01  ? 879  ALA A O     1 
ATOM   6710  C  CB    . ALA A 1 879  ? 53.592  116.729 14.015  1.00 4.90  ? 879  ALA A CB    1 
ATOM   6711  N  N     . LEU A 1 880  ? 51.896  119.170 13.023  1.00 3.75  ? 880  LEU A N     1 
ATOM   6712  C  CA    . LEU A 1 880  ? 50.836  120.168 13.146  1.00 3.14  ? 880  LEU A CA    1 
ATOM   6713  C  C     . LEU A 1 880  ? 50.591  120.867 11.809  1.00 3.27  ? 880  LEU A C     1 
ATOM   6714  O  O     . LEU A 1 880  ? 51.521  121.033 11.015  1.00 2.43  ? 880  LEU A O     1 
ATOM   6715  C  CB    . LEU A 1 880  ? 51.259  121.227 14.172  1.00 3.44  ? 880  LEU A CB    1 
ATOM   6716  C  CG    . LEU A 1 880  ? 51.391  120.862 15.651  1.00 4.58  ? 880  LEU A CG    1 
ATOM   6717  C  CD1   . LEU A 1 880  ? 51.558  122.167 16.503  1.00 5.40  ? 880  LEU A CD1   1 
ATOM   6718  C  CD2   . LEU A 1 880  ? 50.181  120.001 16.142  1.00 3.11  ? 880  LEU A CD2   1 
ATOM   6719  N  N     . SER A 1 881  ? 49.349  121.288 11.590  1.00 2.42  ? 881  SER A N     1 
ATOM   6720  C  CA    . SER A 1 881  ? 48.991  122.223 10.526  1.00 2.78  ? 881  SER A CA    1 
ATOM   6721  C  C     . SER A 1 881  ? 49.643  123.576 10.800  1.00 3.04  ? 881  SER A C     1 
ATOM   6722  O  O     . SER A 1 881  ? 49.947  123.917 11.952  1.00 3.01  ? 881  SER A O     1 
ATOM   6723  C  CB    . SER A 1 881  ? 47.463  122.413 10.476  1.00 2.48  ? 881  SER A CB    1 
ATOM   6724  O  OG    . SER A 1 881  ? 46.963  122.996 11.678  1.00 2.41  ? 881  SER A OG    1 
ATOM   6725  N  N     . ARG A 1 882  ? 49.860  124.347 9.750   1.00 3.36  ? 882  ARG A N     1 
ATOM   6726  C  CA    . ARG A 1 882  ? 50.453  125.663 9.933   1.00 3.82  ? 882  ARG A CA    1 
ATOM   6727  C  C     . ARG A 1 882  ? 49.507  126.565 10.749  1.00 3.52  ? 882  ARG A C     1 
ATOM   6728  O  O     . ARG A 1 882  ? 49.966  127.426 11.506  1.00 3.40  ? 882  ARG A O     1 
ATOM   6729  C  CB    . ARG A 1 882  ? 50.882  126.276 8.586   1.00 3.93  ? 882  ARG A CB    1 
ATOM   6730  C  CG    . ARG A 1 882  ? 49.777  126.716 7.661   1.00 5.67  ? 882  ARG A CG    1 
ATOM   6731  C  CD    . ARG A 1 882  ? 50.303  127.402 6.410   1.00 6.09  ? 882  ARG A CD    1 
ATOM   6732  N  NE    . ARG A 1 882  ? 51.130  128.574 6.727   1.00 7.84  ? 882  ARG A NE    1 
ATOM   6733  C  CZ    . ARG A 1 882  ? 51.728  129.342 5.816   1.00 7.37  ? 882  ARG A CZ    1 
ATOM   6734  N  NH1   . ARG A 1 882  ? 51.620  129.062 4.517   1.00 3.60  ? 882  ARG A NH1   1 
ATOM   6735  N  NH2   . ARG A 1 882  ? 52.435  130.392 6.208   1.00 3.98  ? 882  ARG A NH2   1 
ATOM   6736  N  N     . GLU A 1 883  ? 48.203  126.319 10.627  1.00 2.91  ? 883  GLU A N     1 
ATOM   6737  C  CA    . GLU A 1 883  ? 47.197  127.032 11.423  1.00 2.92  ? 883  GLU A CA    1 
ATOM   6738  C  C     . GLU A 1 883  ? 47.446  126.825 12.920  1.00 2.50  ? 883  GLU A C     1 
ATOM   6739  O  O     . GLU A 1 883  ? 47.552  127.794 13.673  1.00 2.05  ? 883  GLU A O     1 
ATOM   6740  C  CB    . GLU A 1 883  ? 45.769  126.574 11.045  1.00 3.26  ? 883  GLU A CB    1 
ATOM   6741  C  CG    . GLU A 1 883  ? 45.243  127.099 9.702   1.00 3.66  ? 883  GLU A CG    1 
ATOM   6742  C  CD    . GLU A 1 883  ? 45.770  126.335 8.485   1.00 4.53  ? 883  GLU A CD    1 
ATOM   6743  O  OE1   . GLU A 1 883  ? 46.548  125.364 8.633   1.00 1.75  ? 883  GLU A OE1   1 
ATOM   6744  O  OE2   . GLU A 1 883  ? 45.421  126.726 7.353   1.00 7.17  ? 883  GLU A OE2   1 
ATOM   6745  N  N     . ALA A 1 884  ? 47.577  125.569 13.349  1.00 3.06  ? 884  ALA A N     1 
ATOM   6746  C  CA    . ALA A 1 884  ? 47.786  125.277 14.771  1.00 3.44  ? 884  ALA A CA    1 
ATOM   6747  C  C     . ALA A 1 884  ? 49.178  125.687 15.239  1.00 4.23  ? 884  ALA A C     1 
ATOM   6748  O  O     . ALA A 1 884  ? 49.345  126.193 16.363  1.00 4.89  ? 884  ALA A O     1 
ATOM   6749  C  CB    . ALA A 1 884  ? 47.557  123.808 15.057  1.00 3.47  ? 884  ALA A CB    1 
ATOM   6750  N  N     . HIS A 1 885  ? 50.172  125.475 14.377  1.00 4.10  ? 885  HIS A N     1 
ATOM   6751  C  CA    . HIS A 1 885  ? 51.564  125.822 14.684  1.00 4.30  ? 885  HIS A CA    1 
ATOM   6752  C  C     . HIS A 1 885  ? 51.762  127.339 14.862  1.00 4.50  ? 885  HIS A C     1 
ATOM   6753  O  O     . HIS A 1 885  ? 52.303  127.794 15.882  1.00 4.18  ? 885  HIS A O     1 
ATOM   6754  C  CB    . HIS A 1 885  ? 52.474  125.273 13.578  1.00 4.59  ? 885  HIS A CB    1 
ATOM   6755  C  CG    . HIS A 1 885  ? 53.928  125.248 13.933  1.00 4.63  ? 885  HIS A CG    1 
ATOM   6756  N  ND1   . HIS A 1 885  ? 54.615  124.076 14.178  1.00 6.05  ? 885  HIS A ND1   1 
ATOM   6757  C  CD2   . HIS A 1 885  ? 54.833  126.249 14.057  1.00 3.42  ? 885  HIS A CD2   1 
ATOM   6758  C  CE1   . HIS A 1 885  ? 55.883  124.358 14.446  1.00 3.57  ? 885  HIS A CE1   1 
ATOM   6759  N  NE2   . HIS A 1 885  ? 56.036  125.670 14.386  1.00 5.75  ? 885  HIS A NE2   1 
ATOM   6760  N  N     . GLU A 1 886  ? 51.318  128.114 13.874  1.00 4.06  ? 886  GLU A N     1 
ATOM   6761  C  CA    . GLU A 1 886  ? 51.445  129.575 13.931  1.00 4.50  ? 886  GLU A CA    1 
ATOM   6762  C  C     . GLU A 1 886  ? 50.626  130.220 15.058  1.00 4.23  ? 886  GLU A C     1 
ATOM   6763  O  O     . GLU A 1 886  ? 51.088  131.165 15.698  1.00 4.18  ? 886  GLU A O     1 
ATOM   6764  C  CB    . GLU A 1 886  ? 51.110  130.218 12.585  1.00 4.35  ? 886  GLU A CB    1 
ATOM   6765  C  CG    . GLU A 1 886  ? 52.105  129.854 11.481  1.00 7.08  ? 886  GLU A CG    1 
ATOM   6766  C  CD    . GLU A 1 886  ? 51.600  130.105 10.066  1.00 7.88  ? 886  GLU A CD    1 
ATOM   6767  O  OE1   . GLU A 1 886  ? 50.522  130.716 9.894   1.00 8.45  ? 886  GLU A OE1   1 
ATOM   6768  O  OE2   . GLU A 1 886  ? 52.307  129.687 9.117   1.00 8.76  ? 886  GLU A OE2   1 
ATOM   6769  N  N     . THR A 1 887  ? 49.426  129.695 15.306  1.00 4.13  ? 887  THR A N     1 
ATOM   6770  C  CA    . THR A 1 887  ? 48.553  130.221 16.355  1.00 4.35  ? 887  THR A CA    1 
ATOM   6771  C  C     . THR A 1 887  ? 49.263  130.184 17.707  1.00 4.17  ? 887  THR A C     1 
ATOM   6772  O  O     . THR A 1 887  ? 49.235  131.172 18.450  1.00 4.77  ? 887  THR A O     1 
ATOM   6773  C  CB    . THR A 1 887  ? 47.193  129.454 16.391  1.00 4.37  ? 887  THR A CB    1 
ATOM   6774  O  OG1   . THR A 1 887  ? 46.446  129.768 15.203  1.00 5.51  ? 887  THR A OG1   1 
ATOM   6775  C  CG2   . THR A 1 887  ? 46.279  129.976 17.516  1.00 3.80  ? 887  THR A CG2   1 
ATOM   6776  N  N     . LEU A 1 888  ? 49.920  129.066 18.001  1.00 3.92  ? 888  LEU A N     1 
ATOM   6777  C  CA    . LEU A 1 888  ? 50.702  128.912 19.233  1.00 4.44  ? 888  LEU A CA    1 
ATOM   6778  C  C     . LEU A 1 888  ? 51.816  129.952 19.320  1.00 4.49  ? 888  LEU A C     1 
ATOM   6779  O  O     . LEU A 1 888  ? 51.981  130.607 20.360  1.00 4.80  ? 888  LEU A O     1 
ATOM   6780  C  CB    . LEU A 1 888  ? 51.297  127.501 19.346  1.00 4.00  ? 888  LEU A CB    1 
ATOM   6781  C  CG    . LEU A 1 888  ? 50.346  126.328 19.635  1.00 4.28  ? 888  LEU A CG    1 
ATOM   6782  C  CD1   . LEU A 1 888  ? 51.147  125.011 19.742  1.00 2.63  ? 888  LEU A CD1   1 
ATOM   6783  C  CD2   . LEU A 1 888  ? 49.496  126.573 20.924  1.00 1.76  ? 888  LEU A CD2   1 
ATOM   6784  N  N     . ALA A 1 889  ? 52.568  130.106 18.228  1.00 4.19  ? 889  ALA A N     1 
ATOM   6785  C  CA    . ALA A 1 889  ? 53.660  131.074 18.171  1.00 4.83  ? 889  ALA A CA    1 
ATOM   6786  C  C     . ALA A 1 889  ? 53.181  132.485 18.470  1.00 4.37  ? 889  ALA A C     1 
ATOM   6787  O  O     . ALA A 1 889  ? 53.774  133.188 19.303  1.00 4.78  ? 889  ALA A O     1 
ATOM   6788  C  CB    . ALA A 1 889  ? 54.361  131.025 16.814  1.00 4.98  ? 889  ALA A CB    1 
ATOM   6789  N  N     . ILE A 1 890  ? 52.095  132.900 17.819  1.00 3.91  ? 890  ILE A N     1 
ATOM   6790  C  CA    . ILE A 1 890  ? 51.552  134.243 18.071  1.00 3.38  ? 890  ILE A CA    1 
ATOM   6791  C  C     . ILE A 1 890  ? 51.146  134.401 19.541  1.00 3.30  ? 890  ILE A C     1 
ATOM   6792  O  O     . ILE A 1 890  ? 51.419  135.422 20.159  1.00 2.92  ? 890  ILE A O     1 
ATOM   6793  C  CB    . ILE A 1 890  ? 50.382  134.566 17.121  1.00 3.41  ? 890  ILE A CB    1 
ATOM   6794  C  CG1   . ILE A 1 890  ? 50.904  134.576 15.675  1.00 5.14  ? 890  ILE A CG1   1 
ATOM   6795  C  CG2   . ILE A 1 890  ? 49.739  135.911 17.494  1.00 2.36  ? 890  ILE A CG2   1 
ATOM   6796  C  CD1   . ILE A 1 890  ? 49.830  134.603 14.603  1.00 4.96  ? 890  ILE A CD1   1 
ATOM   6797  N  N     . ALA A 1 891  ? 50.514  133.380 20.101  1.00 2.72  ? 891  ALA A N     1 
ATOM   6798  C  CA    . ALA A 1 891  ? 50.120  133.436 21.507  1.00 3.38  ? 891  ALA A CA    1 
ATOM   6799  C  C     . ALA A 1 891  ? 51.316  133.557 22.454  1.00 3.64  ? 891  ALA A C     1 
ATOM   6800  O  O     . ALA A 1 891  ? 51.304  134.383 23.361  1.00 3.78  ? 891  ALA A O     1 
ATOM   6801  C  CB    . ALA A 1 891  ? 49.280  132.220 21.872  1.00 2.77  ? 891  ALA A CB    1 
ATOM   6802  N  N     . MET A 1 892  ? 52.341  132.727 22.264  1.00 3.49  ? 892  MET A N     1 
ATOM   6803  C  CA    . MET A 1 892  ? 53.493  132.775 23.164  1.00 4.12  ? 892  MET A CA    1 
ATOM   6804  C  C     . MET A 1 892  ? 54.240  134.095 23.063  1.00 4.21  ? 892  MET A C     1 
ATOM   6805  O  O     . MET A 1 892  ? 54.650  134.669 24.087  1.00 4.89  ? 892  MET A O     1 
ATOM   6806  C  CB    . MET A 1 892  ? 54.414  131.566 22.979  1.00 4.20  ? 892  MET A CB    1 
ATOM   6807  C  CG    . MET A 1 892  ? 53.693  130.214 23.218  1.00 4.97  ? 892  MET A CG    1 
ATOM   6808  S  SD    . MET A 1 892  ? 52.606  130.209 24.703  1.00 6.94  ? 892  MET A SD    1 
ATOM   6809  C  CE    . MET A 1 892  ? 53.853  129.705 25.982  1.00 3.57  ? 892  MET A CE    1 
ATOM   6810  N  N     . ASN A 1 893  ? 54.364  134.619 21.849  1.00 3.73  ? 893  ASN A N     1 
ATOM   6811  C  CA    . ASN A 1 893  ? 55.019  135.917 21.662  1.00 3.78  ? 893  ASN A CA    1 
ATOM   6812  C  C     . ASN A 1 893  ? 54.256  137.091 22.302  1.00 4.05  ? 893  ASN A C     1 
ATOM   6813  O  O     . ASN A 1 893  ? 54.864  138.016 22.876  1.00 3.40  ? 893  ASN A O     1 
ATOM   6814  C  CB    . ASN A 1 893  ? 55.304  136.158 20.175  1.00 3.58  ? 893  ASN A CB    1 
ATOM   6815  C  CG    . ASN A 1 893  ? 56.358  135.208 19.632  1.00 4.76  ? 893  ASN A CG    1 
ATOM   6816  O  OD1   . ASN A 1 893  ? 57.247  134.786 20.369  1.00 4.51  ? 893  ASN A OD1   1 
ATOM   6817  N  ND2   . ASN A 1 893  ? 56.242  134.833 18.358  1.00 3.45  ? 893  ASN A ND2   1 
ATOM   6818  N  N     . ARG A 1 894  ? 52.927  137.038 22.220  1.00 3.48  ? 894  ARG A N     1 
ATOM   6819  C  CA    . ARG A 1 894  ? 52.070  138.015 22.891  1.00 3.64  ? 894  ARG A CA    1 
ATOM   6820  C  C     . ARG A 1 894  ? 52.326  138.006 24.397  1.00 4.13  ? 894  ARG A C     1 
ATOM   6821  O  O     . ARG A 1 894  ? 52.341  139.059 25.044  1.00 4.12  ? 894  ARG A O     1 
ATOM   6822  C  CB    . ARG A 1 894  ? 50.607  137.665 22.635  1.00 3.59  ? 894  ARG A CB    1 
ATOM   6823  C  CG    . ARG A 1 894  ? 50.029  138.310 21.394  1.00 2.97  ? 894  ARG A CG    1 
ATOM   6824  C  CD    . ARG A 1 894  ? 48.505  138.302 21.352  1.00 3.47  ? 894  ARG A CD    1 
ATOM   6825  N  NE    . ARG A 1 894  ? 48.027  138.313 19.977  1.00 2.54  ? 894  ARG A NE    1 
ATOM   6826  C  CZ    . ARG A 1 894  ? 46.801  138.002 19.598  1.00 2.37  ? 894  ARG A CZ    1 
ATOM   6827  N  NH1   . ARG A 1 894  ? 45.878  137.639 20.491  1.00 2.97  ? 894  ARG A NH1   1 
ATOM   6828  N  NH2   . ARG A 1 894  ? 46.494  138.061 18.314  1.00 1.94  ? 894  ARG A NH2   1 
ATOM   6829  N  N     . LEU A 1 895  ? 52.541  136.804 24.940  1.00 4.19  ? 895  LEU A N     1 
ATOM   6830  C  CA    . LEU A 1 895  ? 52.765  136.600 26.368  1.00 4.48  ? 895  LEU A CA    1 
ATOM   6831  C  C     . LEU A 1 895  ? 54.147  137.058 26.842  1.00 5.03  ? 895  LEU A C     1 
ATOM   6832  O  O     . LEU A 1 895  ? 54.345  137.319 28.026  1.00 5.22  ? 895  LEU A O     1 
ATOM   6833  C  CB    . LEU A 1 895  ? 52.580  135.126 26.716  1.00 4.30  ? 895  LEU A CB    1 
ATOM   6834  C  CG    . LEU A 1 895  ? 51.167  134.518 26.700  1.00 4.15  ? 895  LEU A CG    1 
ATOM   6835  C  CD1   . LEU A 1 895  ? 51.241  132.987 26.714  1.00 2.14  ? 895  LEU A CD1   1 
ATOM   6836  C  CD2   . LEU A 1 895  ? 50.314  134.994 27.873  1.00 5.21  ? 895  LEU A CD2   1 
ATOM   6837  N  N     . GLY A 1 896  ? 55.099  137.158 25.920  1.00 4.75  ? 896  GLY A N     1 
ATOM   6838  C  CA    . GLY A 1 896  ? 56.486  137.351 26.291  1.00 5.22  ? 896  GLY A CA    1 
ATOM   6839  C  C     . GLY A 1 896  ? 57.093  136.020 26.695  1.00 5.38  ? 896  GLY A C     1 
ATOM   6840  O  O     . GLY A 1 896  ? 58.102  135.971 27.379  1.00 5.60  ? 896  GLY A O     1 
ATOM   6841  N  N     . ALA A 1 897  ? 56.446  134.930 26.300  1.00 5.19  ? 897  ALA A N     1 
ATOM   6842  C  CA    . ALA A 1 897  ? 56.966  133.588 26.573  1.00 4.64  ? 897  ALA A CA    1 
ATOM   6843  C  C     . ALA A 1 897  ? 57.656  133.069 25.312  1.00 4.46  ? 897  ALA A C     1 
ATOM   6844  O  O     . ALA A 1 897  ? 58.151  133.863 24.505  1.00 4.78  ? 897  ALA A O     1 
ATOM   6845  C  CB    . ALA A 1 897  ? 55.842  132.670 27.011  1.00 4.18  ? 897  ALA A CB    1 
ATOM   6846  N  N     . LYS A 1 898  ? 57.711  131.753 25.140  1.00 3.90  ? 898  LYS A N     1 
ATOM   6847  C  CA    . LYS A 1 898  ? 58.417  131.175 23.998  1.00 4.88  ? 898  LYS A CA    1 
ATOM   6848  C  C     . LYS A 1 898  ? 57.621  130.025 23.385  1.00 4.51  ? 898  LYS A C     1 
ATOM   6849  O  O     . LYS A 1 898  ? 57.009  129.234 24.108  1.00 4.61  ? 898  LYS A O     1 
ATOM   6850  C  CB    . LYS A 1 898  ? 59.815  130.676 24.421  1.00 4.86  ? 898  LYS A CB    1 
ATOM   6851  C  CG    . LYS A 1 898  ? 60.786  131.813 24.847  1.00 5.81  ? 898  LYS A CG    1 
ATOM   6852  C  CD    . LYS A 1 898  ? 62.228  131.334 25.132  1.00 6.30  ? 898  LYS A CD    1 
ATOM   6853  C  CE    . LYS A 1 898  ? 62.288  130.198 26.179  1.00 6.67  ? 898  LYS A CE    1 
ATOM   6854  N  NZ    . LYS A 1 898  ? 61.995  130.697 27.568  1.00 6.54  ? 898  LYS A NZ    1 
ATOM   6855  N  N     . SER A 1 899  ? 57.600  129.966 22.056  1.00 4.53  ? 899  SER A N     1 
ATOM   6856  C  CA    . SER A 1 899  ? 57.220  128.764 21.340  1.00 4.63  ? 899  SER A CA    1 
ATOM   6857  C  C     . SER A 1 899  ? 58.459  128.190 20.638  1.00 5.13  ? 899  SER A C     1 
ATOM   6858  O  O     . SER A 1 899  ? 59.525  128.823 20.597  1.00 4.54  ? 899  SER A O     1 
ATOM   6859  C  CB    . SER A 1 899  ? 56.090  129.035 20.340  1.00 5.02  ? 899  SER A CB    1 
ATOM   6860  O  OG    . SER A 1 899  ? 56.518  129.839 19.242  1.00 4.41  ? 899  SER A OG    1 
ATOM   6861  N  N     . ASN A 1 900  ? 58.296  126.997 20.073  1.00 5.33  ? 900  ASN A N     1 
ATOM   6862  C  CA    . ASN A 1 900  ? 59.419  126.214 19.555  1.00 6.19  ? 900  ASN A CA    1 
ATOM   6863  C  C     . ASN A 1 900  ? 59.057  125.665 18.186  1.00 6.33  ? 900  ASN A C     1 
ATOM   6864  O  O     . ASN A 1 900  ? 58.005  125.063 18.025  1.00 6.41  ? 900  ASN A O     1 
ATOM   6865  C  CB    . ASN A 1 900  ? 59.710  125.084 20.549  1.00 6.07  ? 900  ASN A CB    1 
ATOM   6866  C  CG    . ASN A 1 900  ? 60.929  124.255 20.201  1.00 6.93  ? 900  ASN A CG    1 
ATOM   6867  O  OD1   . ASN A 1 900  ? 61.240  124.008 19.036  1.00 7.41  ? 900  ASN A OD1   1 
ATOM   6868  N  ND2   . ASN A 1 900  ? 61.586  123.746 21.239  1.00 7.05  ? 900  ASN A ND2   1 
ATOM   6869  N  N     . SER A 1 901  ? 59.893  125.928 17.189  1.00 7.08  ? 901  SER A N     1 
ATOM   6870  C  CA    . SER A 1 901  ? 59.726  125.306 15.899  1.00 8.55  ? 901  SER A CA    1 
ATOM   6871  C  C     . SER A 1 901  ? 60.391  123.973 16.101  1.00 10.72 ? 901  SER A C     1 
ATOM   6872  O  O     . SER A 1 901  ? 61.654  123.890 15.971  1.00 13.00 ? 901  SER A O     1 
ATOM   6873  C  CB    . SER A 1 901  ? 60.623  125.941 14.887  1.00 8.01  ? 901  SER A CB    1 
ATOM   6874  O  OG    . SER A 1 901  ? 61.888  125.285 15.042  1.00 7.46  ? 901  SER A OG    1 
ATOM   6875  N  N     . GLY A 1 902  ? 59.624  122.962 16.426  1.00 9.11  ? 902  GLY A N     1 
ATOM   6876  C  CA    . GLY A 1 902  ? 60.089  121.596 16.329  1.00 7.44  ? 902  GLY A CA    1 
ATOM   6877  C  C     . GLY A 1 902  ? 60.917  121.353 15.069  1.00 6.57  ? 902  GLY A C     1 
ATOM   6878  O  O     . GLY A 1 902  ? 61.551  122.250 14.518  1.00 5.03  ? 902  GLY A O     1 
ATOM   6879  N  N     . GLU A 1 903  ? 60.923  120.114 14.612  1.00 6.42  ? 903  GLU A N     1 
ATOM   6880  C  CA    . GLU A 1 903  ? 61.947  119.686 13.673  1.00 6.32  ? 903  GLU A CA    1 
ATOM   6881  C  C     . GLU A 1 903  ? 61.607  119.717 12.179  1.00 5.93  ? 903  GLU A C     1 
ATOM   6882  O  O     . GLU A 1 903  ? 62.273  119.049 11.399  1.00 6.10  ? 903  GLU A O     1 
ATOM   6883  C  CB    . GLU A 1 903  ? 62.522  118.337 14.108  1.00 5.68  ? 903  GLU A CB    1 
ATOM   6884  C  CG    . GLU A 1 903  ? 61.578  117.149 13.987  1.00 8.34  ? 903  GLU A CG    1 
ATOM   6885  C  CD    . GLU A 1 903  ? 62.093  115.967 14.787  1.00 11.59 ? 903  GLU A CD    1 
ATOM   6886  O  OE1   . GLU A 1 903  ? 61.512  115.664 15.851  1.00 15.93 ? 903  GLU A OE1   1 
ATOM   6887  O  OE2   . GLU A 1 903  ? 63.103  115.350 14.390  1.00 15.29 ? 903  GLU A OE2   1 
ATOM   6888  N  N     . GLY A 1 904  ? 60.622  120.519 11.781  1.00 6.20  ? 904  GLY A N     1 
ATOM   6889  C  CA    . GLY A 1 904  ? 60.268  120.686 10.375  1.00 6.34  ? 904  GLY A CA    1 
ATOM   6890  C  C     . GLY A 1 904  ? 60.701  121.984 9.693   1.00 6.78  ? 904  GLY A C     1 
ATOM   6891  O  O     . GLY A 1 904  ? 60.140  122.357 8.669   1.00 7.13  ? 904  GLY A O     1 
ATOM   6892  N  N     . GLY A 1 905  ? 61.663  122.691 10.267  1.00 6.47  ? 905  GLY A N     1 
ATOM   6893  C  CA    . GLY A 1 905  ? 62.029  124.004 9.781   1.00 7.13  ? 905  GLY A CA    1 
ATOM   6894  C  C     . GLY A 1 905  ? 60.944  125.033 10.028  1.00 7.16  ? 905  GLY A C     1 
ATOM   6895  O  O     . GLY A 1 905  ? 60.042  124.802 10.830  1.00 7.63  ? 905  GLY A O     1 
ATOM   6896  N  N     . GLU A 1 906  ? 61.036  126.158 9.329   1.00 6.55  ? 906  GLU A N     1 
ATOM   6897  C  CA    . GLU A 1 906  ? 60.087  127.259 9.485   1.00 6.54  ? 906  GLU A CA    1 
ATOM   6898  C  C     . GLU A 1 906  ? 60.057  128.120 8.227   1.00 6.89  ? 906  GLU A C     1 
ATOM   6899  O  O     . GLU A 1 906  ? 61.091  128.412 7.614   1.00 7.01  ? 906  GLU A O     1 
ATOM   6900  C  CB    . GLU A 1 906  ? 60.391  128.127 10.736  1.00 7.16  ? 906  GLU A CB    1 
ATOM   6901  C  CG    . GLU A 1 906  ? 59.277  129.154 11.062  1.00 5.75  ? 906  GLU A CG    1 
ATOM   6902  C  CD    . GLU A 1 906  ? 59.069  129.389 12.557  1.00 5.81  ? 906  GLU A CD    1 
ATOM   6903  O  OE1   . GLU A 1 906  ? 58.641  128.451 13.279  1.00 5.16  ? 906  GLU A OE1   1 
ATOM   6904  O  OE2   . GLU A 1 906  ? 59.333  130.520 13.027  1.00 4.77  ? 906  GLU A OE2   1 
ATOM   6905  N  N     . ASP A 1 907  ? 58.849  128.505 7.844   1.00 6.09  ? 907  ASP A N     1 
ATOM   6906  C  CA    . ASP A 1 907  ? 58.627  129.405 6.745   1.00 6.36  ? 907  ASP A CA    1 
ATOM   6907  C  C     . ASP A 1 907  ? 59.175  130.808 7.109   1.00 6.11  ? 907  ASP A C     1 
ATOM   6908  O  O     . ASP A 1 907  ? 58.876  131.347 8.178   1.00 5.68  ? 907  ASP A O     1 
ATOM   6909  C  CB    . ASP A 1 907  ? 57.128  129.451 6.467   1.00 6.50  ? 907  ASP A CB    1 
ATOM   6910  C  CG    . ASP A 1 907  ? 56.798  130.127 5.180   1.00 7.89  ? 907  ASP A CG    1 
ATOM   6911  O  OD1   . ASP A 1 907  ? 55.749  129.753 4.615   1.00 8.15  ? 907  ASP A OD1   1 
ATOM   6912  O  OD2   . ASP A 1 907  ? 57.509  131.028 4.674   1.00 5.97  ? 907  ASP A OD2   1 
ATOM   6913  N  N     . VAL A 1 908  ? 60.012  131.344 6.223   1.00 6.07  ? 908  VAL A N     1 
ATOM   6914  C  CA    . VAL A 1 908  ? 60.673  132.646 6.369   1.00 6.96  ? 908  VAL A CA    1 
ATOM   6915  C  C     . VAL A 1 908  ? 59.661  133.810 6.516   1.00 6.32  ? 908  VAL A C     1 
ATOM   6916  O  O     . VAL A 1 908  ? 59.948  134.800 7.175   1.00 5.88  ? 908  VAL A O     1 
ATOM   6917  C  CB    . VAL A 1 908  ? 61.647  132.908 5.163   1.00 6.97  ? 908  VAL A CB    1 
ATOM   6918  C  CG1   . VAL A 1 908  ? 62.176  134.300 5.161   1.00 10.20 ? 908  VAL A CG1   1 
ATOM   6919  C  CG2   . VAL A 1 908  ? 62.810  131.956 5.203   1.00 8.34  ? 908  VAL A CG2   1 
ATOM   6920  N  N     . VAL A 1 909  ? 58.468  133.670 5.952   1.00 6.22  ? 909  VAL A N     1 
ATOM   6921  C  CA    . VAL A 1 909  ? 57.470  134.747 6.043   1.00 6.56  ? 909  VAL A CA    1 
ATOM   6922  C  C     . VAL A 1 909  ? 57.138  135.112 7.503   1.00 6.93  ? 909  VAL A C     1 
ATOM   6923  O  O     . VAL A 1 909  ? 56.710  136.229 7.801   1.00 6.94  ? 909  VAL A O     1 
ATOM   6924  C  CB    . VAL A 1 909  ? 56.204  134.418 5.261   1.00 6.33  ? 909  VAL A CB    1 
ATOM   6925  C  CG1   . VAL A 1 909  ? 55.375  133.344 5.972   1.00 7.61  ? 909  VAL A CG1   1 
ATOM   6926  C  CG2   . VAL A 1 909  ? 55.374  135.688 5.035   1.00 7.55  ? 909  VAL A CG2   1 
ATOM   6927  N  N     . ARG A 1 910  ? 57.383  134.159 8.395   1.00 6.75  ? 910  ARG A N     1 
ATOM   6928  C  CA    . ARG A 1 910  ? 57.087  134.290 9.815   1.00 7.40  ? 910  ARG A CA    1 
ATOM   6929  C  C     . ARG A 1 910  ? 58.095  135.102 10.621  1.00 7.68  ? 910  ARG A C     1 
ATOM   6930  O  O     . ARG A 1 910  ? 57.862  135.409 11.804  1.00 6.81  ? 910  ARG A O     1 
ATOM   6931  C  CB    . ARG A 1 910  ? 57.107  132.906 10.411  1.00 7.02  ? 910  ARG A CB    1 
ATOM   6932  C  CG    . ARG A 1 910  ? 55.866  132.144 10.294  1.00 8.16  ? 910  ARG A CG    1 
ATOM   6933  C  CD    . ARG A 1 910  ? 55.711  131.410 11.600  1.00 11.75 ? 910  ARG A CD    1 
ATOM   6934  N  NE    . ARG A 1 910  ? 55.536  130.034 11.374  1.00 8.28  ? 910  ARG A NE    1 
ATOM   6935  C  CZ    . ARG A 1 910  ? 55.326  129.109 12.313  1.00 7.90  ? 910  ARG A CZ    1 
ATOM   6936  N  NH1   . ARG A 1 910  ? 55.285  129.379 13.621  1.00 5.48  ? 910  ARG A NH1   1 
ATOM   6937  N  NH2   . ARG A 1 910  ? 55.147  127.888 11.895  1.00 4.57  ? 910  ARG A NH2   1 
ATOM   6938  N  N     . TYR A 1 911  ? 59.234  135.397 10.007  1.00 8.50  ? 911  TYR A N     1 
ATOM   6939  C  CA    . TYR A 1 911  ? 60.304  136.120 10.684  1.00 9.74  ? 911  TYR A CA    1 
ATOM   6940  C  C     . TYR A 1 911  ? 59.920  137.594 10.884  1.00 10.66 ? 911  TYR A C     1 
ATOM   6941  O  O     . TYR A 1 911  ? 60.453  138.278 11.756  1.00 11.98 ? 911  TYR A O     1 
ATOM   6942  C  CB    . TYR A 1 911  ? 61.641  135.929 9.928   1.00 9.59  ? 911  TYR A CB    1 
ATOM   6943  C  CG    . TYR A 1 911  ? 62.097  134.458 9.852   1.00 9.67  ? 911  TYR A CG    1 
ATOM   6944  C  CD1   . TYR A 1 911  ? 63.132  134.053 8.998   1.00 9.96  ? 911  TYR A CD1   1 
ATOM   6945  C  CD2   . TYR A 1 911  ? 61.496  133.484 10.646  1.00 10.44 ? 911  TYR A CD2   1 
ATOM   6946  C  CE1   . TYR A 1 911  ? 63.537  132.703 8.938   1.00 11.65 ? 911  TYR A CE1   1 
ATOM   6947  C  CE2   . TYR A 1 911  ? 61.897  132.155 10.597  1.00 11.10 ? 911  TYR A CE2   1 
ATOM   6948  C  CZ    . TYR A 1 911  ? 62.915  131.772 9.754   1.00 11.96 ? 911  TYR A CZ    1 
ATOM   6949  O  OH    . TYR A 1 911  ? 63.270  130.433 9.729   1.00 16.09 ? 911  TYR A OH    1 
ATOM   6950  N  N     . LEU A 1 912  ? 58.953  138.062 10.109  1.00 11.07 ? 912  LEU A N     1 
ATOM   6951  C  CA    . LEU A 1 912  ? 58.547  139.472 10.144  1.00 11.94 ? 912  LEU A CA    1 
ATOM   6952  C  C     . LEU A 1 912  ? 57.310  139.716 11.021  1.00 11.58 ? 912  LEU A C     1 
ATOM   6953  O  O     . LEU A 1 912  ? 56.388  138.892 11.047  1.00 11.81 ? 912  LEU A O     1 
ATOM   6954  C  CB    . LEU A 1 912  ? 58.267  139.940 8.715   1.00 12.25 ? 912  LEU A CB    1 
ATOM   6955  C  CG    . LEU A 1 912  ? 59.415  140.341 7.775   1.00 14.48 ? 912  LEU A CG    1 
ATOM   6956  C  CD1   . LEU A 1 912  ? 59.257  141.814 7.430   1.00 14.48 ? 912  LEU A CD1   1 
ATOM   6957  C  CD2   . LEU A 1 912  ? 60.801  140.082 8.344   1.00 16.86 ? 912  LEU A CD2   1 
ATOM   6958  N  N     . THR A 1 913  ? 57.282  140.856 11.710  1.00 10.99 ? 913  THR A N     1 
ATOM   6959  C  CA    . THR A 1 913  ? 56.137  141.249 12.527  1.00 10.81 ? 913  THR A CA    1 
ATOM   6960  C  C     . THR A 1 913  ? 54.958  141.643 11.642  1.00 10.73 ? 913  THR A C     1 
ATOM   6961  O  O     . THR A 1 913  ? 55.152  142.260 10.591  1.00 10.46 ? 913  THR A O     1 
ATOM   6962  C  CB    . THR A 1 913  ? 56.542  142.418 13.454  1.00 10.76 ? 913  THR A CB    1 
ATOM   6963  O  OG1   . THR A 1 913  ? 57.562  141.956 14.341  1.00 12.27 ? 913  THR A OG1   1 
ATOM   6964  C  CG2   . THR A 1 913  ? 55.421  142.792 14.414  1.00 10.69 ? 913  THR A CG2   1 
ATOM   6965  N  N     . LEU A 1 914  ? 53.743  141.294 12.066  1.00 10.29 ? 914  LEU A N     1 
ATOM   6966  C  CA    . LEU A 1 914  ? 52.559  141.594 11.275  1.00 10.76 ? 914  LEU A CA    1 
ATOM   6967  C  C     . LEU A 1 914  ? 52.253  143.081 11.261  1.00 11.05 ? 914  LEU A C     1 
ATOM   6968  O  O     . LEU A 1 914  ? 52.241  143.732 12.309  1.00 10.45 ? 914  LEU A O     1 
ATOM   6969  C  CB    . LEU A 1 914  ? 51.345  140.780 11.725  1.00 10.78 ? 914  LEU A CB    1 
ATOM   6970  C  CG    . LEU A 1 914  ? 51.367  139.274 11.426  1.00 12.79 ? 914  LEU A CG    1 
ATOM   6971  C  CD1   . LEU A 1 914  ? 50.012  138.696 11.786  1.00 15.02 ? 914  LEU A CD1   1 
ATOM   6972  C  CD2   . LEU A 1 914  ? 51.698  138.968 9.979   1.00 13.04 ? 914  LEU A CD2   1 
ATOM   6973  N  N     . ASP A 1 915  ? 52.027  143.589 10.049  1.00 11.10 ? 915  ASP A N     1 
ATOM   6974  C  CA    . ASP A 1 915  ? 51.851  145.008 9.745   1.00 11.92 ? 915  ASP A CA    1 
ATOM   6975  C  C     . ASP A 1 915  ? 50.477  145.347 9.224   1.00 11.09 ? 915  ASP A C     1 
ATOM   6976  O  O     . ASP A 1 915  ? 50.053  146.502 9.248   1.00 10.57 ? 915  ASP A O     1 
ATOM   6977  C  CB    . ASP A 1 915  ? 52.805  145.383 8.612   1.00 12.73 ? 915  ASP A CB    1 
ATOM   6978  C  CG    . ASP A 1 915  ? 53.935  146.207 9.087   1.00 15.41 ? 915  ASP A CG    1 
ATOM   6979  O  OD1   . ASP A 1 915  ? 53.656  147.120 9.895   1.00 18.94 ? 915  ASP A OD1   1 
ATOM   6980  O  OD2   . ASP A 1 915  ? 55.125  146.003 8.737   1.00 18.92 ? 915  ASP A OD2   1 
ATOM   6981  N  N     . ASP A 1 916  ? 49.790  144.324 8.741   1.00 10.59 ? 916  ASP A N     1 
ATOM   6982  C  CA    . ASP A 1 916  ? 48.709  144.515 7.799   1.00 10.24 ? 916  ASP A CA    1 
ATOM   6983  C  C     . ASP A 1 916  ? 47.415  143.870 8.292   1.00 9.68  ? 916  ASP A C     1 
ATOM   6984  O  O     . ASP A 1 916  ? 46.585  143.422 7.496   1.00 9.21  ? 916  ASP A O     1 
ATOM   6985  C  CB    . ASP A 1 916  ? 49.134  143.924 6.453   1.00 10.89 ? 916  ASP A CB    1 
ATOM   6986  C  CG    . ASP A 1 916  ? 49.553  142.458 6.553   1.00 11.00 ? 916  ASP A CG    1 
ATOM   6987  O  OD1   . ASP A 1 916  ? 49.587  141.875 7.674   1.00 12.37 ? 916  ASP A OD1   1 
ATOM   6988  O  OD2   . ASP A 1 916  ? 49.872  141.794 5.539   1.00 12.45 ? 916  ASP A OD2   1 
ATOM   6989  N  N     . VAL A 1 917  ? 47.244  143.845 9.609   1.00 8.68  ? 917  VAL A N     1 
ATOM   6990  C  CA    . VAL A 1 917  ? 46.033  143.302 10.205  1.00 8.51  ? 917  VAL A CA    1 
ATOM   6991  C  C     . VAL A 1 917  ? 44.901  144.306 10.060  1.00 8.65  ? 917  VAL A C     1 
ATOM   6992  O  O     . VAL A 1 917  ? 45.049  145.463 10.450  1.00 8.91  ? 917  VAL A O     1 
ATOM   6993  C  CB    . VAL A 1 917  ? 46.240  142.904 11.690  1.00 8.14  ? 917  VAL A CB    1 
ATOM   6994  C  CG1   . VAL A 1 917  ? 44.989  142.251 12.258  1.00 7.44  ? 917  VAL A CG1   1 
ATOM   6995  C  CG2   . VAL A 1 917  ? 47.437  141.973 11.822  1.00 6.82  ? 917  VAL A CG2   1 
ATOM   6996  N  N     . ASP A 1 918  ? 43.786  143.856 9.482   1.00 8.90  ? 918  ASP A N     1 
ATOM   6997  C  CA    . ASP A 1 918  ? 42.575  144.668 9.380   1.00 9.25  ? 918  ASP A CA    1 
ATOM   6998  C  C     . ASP A 1 918  ? 41.757  144.708 10.683  1.00 9.42  ? 918  ASP A C     1 
ATOM   6999  O  O     . ASP A 1 918  ? 42.148  144.107 11.678  1.00 9.28  ? 918  ASP A O     1 
ATOM   7000  C  CB    . ASP A 1 918  ? 41.716  144.277 8.155   1.00 9.20  ? 918  ASP A CB    1 
ATOM   7001  C  CG    . ASP A 1 918  ? 41.096  142.867 8.247   1.00 9.71  ? 918  ASP A CG    1 
ATOM   7002  O  OD1   . ASP A 1 918  ? 40.961  142.274 9.349   1.00 8.92  ? 918  ASP A OD1   1 
ATOM   7003  O  OD2   . ASP A 1 918  ? 40.687  142.283 7.221   1.00 9.12  ? 918  ASP A OD2   1 
ATOM   7004  N  N     . SER A 1 919  ? 40.629  145.420 10.669  1.00 9.90  ? 919  SER A N     1 
ATOM   7005  C  CA    . SER A 1 919  ? 39.819  145.591 11.877  1.00 10.51 ? 919  SER A CA    1 
ATOM   7006  C  C     . SER A 1 919  ? 39.060  144.332 12.324  1.00 10.87 ? 919  SER A C     1 
ATOM   7007  O  O     . SER A 1 919  ? 38.573  144.264 13.460  1.00 11.48 ? 919  SER A O     1 
ATOM   7008  C  CB    . SER A 1 919  ? 38.877  146.797 11.753  1.00 10.77 ? 919  SER A CB    1 
ATOM   7009  O  OG    . SER A 1 919  ? 38.184  146.812 10.516  1.00 11.72 ? 919  SER A OG    1 
ATOM   7010  N  N     . GLU A 1 920  ? 38.961  143.339 11.441  1.00 10.47 ? 920  GLU A N     1 
ATOM   7011  C  CA    . GLU A 1 920  ? 38.356  142.048 11.789  1.00 10.35 ? 920  GLU A CA    1 
ATOM   7012  C  C     . GLU A 1 920  ? 39.386  141.017 12.288  1.00 9.36  ? 920  GLU A C     1 
ATOM   7013  O  O     . GLU A 1 920  ? 39.038  139.855 12.568  1.00 9.17  ? 920  GLU A O     1 
ATOM   7014  C  CB    . GLU A 1 920  ? 37.564  141.491 10.604  1.00 10.71 ? 920  GLU A CB    1 
ATOM   7015  C  CG    . GLU A 1 920  ? 36.348  142.329 10.235  1.00 12.87 ? 920  GLU A CG    1 
ATOM   7016  C  CD    . GLU A 1 920  ? 35.862  142.036 8.834   1.00 15.64 ? 920  GLU A CD    1 
ATOM   7017  O  OE1   . GLU A 1 920  ? 34.984  141.166 8.696   1.00 17.49 ? 920  GLU A OE1   1 
ATOM   7018  O  OE2   . GLU A 1 920  ? 36.362  142.668 7.872   1.00 17.46 ? 920  GLU A OE2   1 
ATOM   7019  N  N     . GLY A 1 921  ? 40.642  141.447 12.410  1.00 8.30  ? 921  GLY A N     1 
ATOM   7020  C  CA    . GLY A 1 921  ? 41.712  140.583 12.893  1.00 7.29  ? 921  GLY A CA    1 
ATOM   7021  C  C     . GLY A 1 921  ? 42.341  139.663 11.852  1.00 6.65  ? 921  GLY A C     1 
ATOM   7022  O  O     . GLY A 1 921  ? 42.974  138.662 12.203  1.00 6.34  ? 921  GLY A O     1 
ATOM   7023  N  N     . ASN A 1 922  ? 42.167  139.993 10.577  1.00 6.35  ? 922  ASN A N     1 
ATOM   7024  C  CA    . ASN A 1 922  ? 42.727  139.200 9.485   1.00 6.81  ? 922  ASN A CA    1 
ATOM   7025  C  C     . ASN A 1 922  ? 43.930  139.865 8.830   1.00 6.80  ? 922  ASN A C     1 
ATOM   7026  O  O     . ASN A 1 922  ? 43.982  141.095 8.713   1.00 6.97  ? 922  ASN A O     1 
ATOM   7027  C  CB    . ASN A 1 922  ? 41.647  138.896 8.443   1.00 7.00  ? 922  ASN A CB    1 
ATOM   7028  C  CG    . ASN A 1 922  ? 40.526  138.054 9.008   1.00 7.83  ? 922  ASN A CG    1 
ATOM   7029  O  OD1   . ASN A 1 922  ? 40.765  137.015 9.623   1.00 9.43  ? 922  ASN A OD1   1 
ATOM   7030  N  ND2   . ASN A 1 922  ? 39.292  138.508 8.823   1.00 8.66  ? 922  ASN A ND2   1 
ATOM   7031  N  N     . SER A 1 923  ? 44.892  139.052 8.401   1.00 6.88  ? 923  SER A N     1 
ATOM   7032  C  CA    . SER A 1 923  ? 46.076  139.570 7.730   1.00 7.16  ? 923  SER A CA    1 
ATOM   7033  C  C     . SER A 1 923  ? 46.276  138.876 6.388   1.00 7.61  ? 923  SER A C     1 
ATOM   7034  O  O     . SER A 1 923  ? 46.309  137.652 6.330   1.00 7.74  ? 923  SER A O     1 
ATOM   7035  C  CB    . SER A 1 923  ? 47.318  139.383 8.602   1.00 6.90  ? 923  SER A CB    1 
ATOM   7036  O  OG    . SER A 1 923  ? 48.502  139.390 7.815   1.00 7.68  ? 923  SER A OG    1 
ATOM   7037  N  N     . PRO A 1 924  ? 46.421  139.654 5.317   1.00 7.94  ? 924  PRO A N     1 
ATOM   7038  C  CA    . PRO A 1 924  ? 46.719  139.101 3.990   1.00 8.17  ? 924  PRO A CA    1 
ATOM   7039  C  C     . PRO A 1 924  ? 48.022  138.298 3.937   1.00 8.17  ? 924  PRO A C     1 
ATOM   7040  O  O     . PRO A 1 924  ? 48.138  137.436 3.071   1.00 8.92  ? 924  PRO A O     1 
ATOM   7041  C  CB    . PRO A 1 924  ? 46.806  140.351 3.107   1.00 7.85  ? 924  PRO A CB    1 
ATOM   7042  C  CG    . PRO A 1 924  ? 45.961  141.356 3.825   1.00 8.58  ? 924  PRO A CG    1 
ATOM   7043  C  CD    . PRO A 1 924  ? 46.280  141.121 5.273   1.00 8.44  ? 924  PRO A CD    1 
ATOM   7044  N  N     . THR A 1 925  ? 48.963  138.580 4.843   1.00 7.94  ? 925  THR A N     1 
ATOM   7045  C  CA    . THR A 1 925  ? 50.200  137.822 4.980   1.00 8.63  ? 925  THR A CA    1 
ATOM   7046  C  C     . THR A 1 925  ? 49.983  136.389 5.497   1.00 8.34  ? 925  THR A C     1 
ATOM   7047  O  O     . THR A 1 925  ? 50.635  135.457 5.018   1.00 8.65  ? 925  THR A O     1 
ATOM   7048  C  CB    . THR A 1 925  ? 51.188  138.588 5.885   1.00 8.70  ? 925  THR A CB    1 
ATOM   7049  O  OG1   . THR A 1 925  ? 51.392  139.898 5.342   1.00 9.06  ? 925  THR A OG1   1 
ATOM   7050  C  CG2   . THR A 1 925  ? 52.593  137.963 5.844   1.00 9.29  ? 925  THR A CG2   1 
ATOM   7051  N  N     . LEU A 1 926  ? 49.083  136.212 6.470   1.00 7.56  ? 926  LEU A N     1 
ATOM   7052  C  CA    . LEU A 1 926  ? 48.791  134.875 7.021   1.00 6.82  ? 926  LEU A CA    1 
ATOM   7053  C  C     . LEU A 1 926  ? 47.279  134.734 7.062   1.00 6.68  ? 926  LEU A C     1 
ATOM   7054  O  O     . LEU A 1 926  ? 46.669  134.792 8.132   1.00 6.05  ? 926  LEU A O     1 
ATOM   7055  C  CB    . LEU A 1 926  ? 49.412  134.692 8.420   1.00 6.59  ? 926  LEU A CB    1 
ATOM   7056  C  CG    . LEU A 1 926  ? 50.948  134.744 8.556   1.00 6.47  ? 926  LEU A CG    1 
ATOM   7057  C  CD1   . LEU A 1 926  ? 51.360  134.826 10.015  1.00 6.33  ? 926  LEU A CD1   1 
ATOM   7058  C  CD2   . LEU A 1 926  ? 51.643  133.564 7.876   1.00 7.00  ? 926  LEU A CD2   1 
ATOM   7059  N  N     . PRO A 1 927  ? 46.667  134.570 5.884   1.00 6.97  ? 927  PRO A N     1 
ATOM   7060  C  CA    . PRO A 1 927  ? 45.213  134.730 5.741   1.00 6.78  ? 927  PRO A CA    1 
ATOM   7061  C  C     . PRO A 1 927  ? 44.410  133.559 6.308   1.00 6.75  ? 927  PRO A C     1 
ATOM   7062  O  O     . PRO A 1 927  ? 43.201  133.704 6.508   1.00 6.43  ? 927  PRO A O     1 
ATOM   7063  C  CB    . PRO A 1 927  ? 45.018  134.836 4.221   1.00 7.32  ? 927  PRO A CB    1 
ATOM   7064  C  CG    . PRO A 1 927  ? 46.169  134.082 3.639   1.00 7.95  ? 927  PRO A CG    1 
ATOM   7065  C  CD    . PRO A 1 927  ? 47.314  134.187 4.615   1.00 7.11  ? 927  PRO A CD    1 
ATOM   7066  N  N     . HIS A 1 928  ? 45.086  132.437 6.557   1.00 6.25  ? 928  HIS A N     1 
ATOM   7067  C  CA    . HIS A 1 928  ? 44.499  131.231 7.158   1.00 6.60  ? 928  HIS A CA    1 
ATOM   7068  C  C     . HIS A 1 928  ? 44.337  131.312 8.696   1.00 6.48  ? 928  HIS A C     1 
ATOM   7069  O  O     . HIS A 1 928  ? 43.775  130.401 9.317   1.00 6.61  ? 928  HIS A O     1 
ATOM   7070  C  CB    . HIS A 1 928  ? 45.386  130.030 6.825   1.00 6.32  ? 928  HIS A CB    1 
ATOM   7071  C  CG    . HIS A 1 928  ? 46.835  130.275 7.112   1.00 5.46  ? 928  HIS A CG    1 
ATOM   7072  N  ND1   . HIS A 1 928  ? 47.670  130.909 6.219   1.00 6.31  ? 928  HIS A ND1   1 
ATOM   7073  C  CD2   . HIS A 1 928  ? 47.578  130.035 8.218   1.00 4.29  ? 928  HIS A CD2   1 
ATOM   7074  C  CE1   . HIS A 1 928  ? 48.871  131.035 6.756   1.00 4.20  ? 928  HIS A CE1   1 
ATOM   7075  N  NE2   . HIS A 1 928  ? 48.844  130.501 7.962   1.00 4.38  ? 928  HIS A NE2   1 
ATOM   7076  N  N     . LEU A 1 929  ? 44.851  132.382 9.298   1.00 5.85  ? 929  LEU A N     1 
ATOM   7077  C  CA    . LEU A 1 929  ? 44.735  132.614 10.742  1.00 5.76  ? 929  LEU A CA    1 
ATOM   7078  C  C     . LEU A 1 929  ? 43.607  133.590 11.097  1.00 5.71  ? 929  LEU A C     1 
ATOM   7079  O  O     . LEU A 1 929  ? 43.106  134.304 10.236  1.00 5.22  ? 929  LEU A O     1 
ATOM   7080  C  CB    . LEU A 1 929  ? 46.055  133.141 11.306  1.00 5.51  ? 929  LEU A CB    1 
ATOM   7081  C  CG    . LEU A 1 929  ? 47.282  132.264 11.087  1.00 5.08  ? 929  LEU A CG    1 
ATOM   7082  C  CD1   . LEU A 1 929  ? 48.519  132.986 11.635  1.00 6.73  ? 929  LEU A CD1   1 
ATOM   7083  C  CD2   . LEU A 1 929  ? 47.130  130.884 11.749  1.00 3.10  ? 929  LEU A CD2   1 
ATOM   7084  N  N     . HIS A 1 930  ? 43.246  133.625 12.380  1.00 5.83  ? 930  HIS A N     1 
ATOM   7085  C  CA    . HIS A 1 930  ? 42.126  134.438 12.860  1.00 6.61  ? 930  HIS A CA    1 
ATOM   7086  C  C     . HIS A 1 930  ? 42.499  135.146 14.152  1.00 5.63  ? 930  HIS A C     1 
ATOM   7087  O  O     . HIS A 1 930  ? 43.367  134.676 14.890  1.00 4.60  ? 930  HIS A O     1 
ATOM   7088  C  CB    . HIS A 1 930  ? 40.906  133.561 13.146  1.00 7.48  ? 930  HIS A CB    1 
ATOM   7089  C  CG    . HIS A 1 930  ? 40.463  132.722 11.987  1.00 10.65 ? 930  HIS A CG    1 
ATOM   7090  N  ND1   . HIS A 1 930  ? 40.764  131.380 11.884  1.00 12.77 ? 930  HIS A ND1   1 
ATOM   7091  C  CD2   . HIS A 1 930  ? 39.728  133.030 10.889  1.00 13.98 ? 930  HIS A CD2   1 
ATOM   7092  C  CE1   . HIS A 1 930  ? 40.245  130.899 10.768  1.00 13.38 ? 930  HIS A CE1   1 
ATOM   7093  N  NE2   . HIS A 1 930  ? 39.609  131.877 10.147  1.00 15.33 ? 930  HIS A NE2   1 
ATOM   7094  N  N     . GLY A 1 931  ? 41.822  136.258 14.427  1.00 4.73  ? 931  GLY A N     1 
ATOM   7095  C  CA    . GLY A 1 931  ? 41.955  136.944 15.704  1.00 5.15  ? 931  GLY A CA    1 
ATOM   7096  C  C     . GLY A 1 931  ? 43.332  137.558 15.912  1.00 5.01  ? 931  GLY A C     1 
ATOM   7097  O  O     . GLY A 1 931  ? 43.870  137.532 17.016  1.00 5.33  ? 931  GLY A O     1 
ATOM   7098  N  N     . LEU A 1 932  ? 43.900  138.102 14.840  1.00 4.70  ? 932  LEU A N     1 
ATOM   7099  C  CA    . LEU A 1 932  ? 45.228  138.699 14.877  1.00 4.79  ? 932  LEU A CA    1 
ATOM   7100  C  C     . LEU A 1 932  ? 45.185  140.174 15.277  1.00 5.22  ? 932  LEU A C     1 
ATOM   7101  O  O     . LEU A 1 932  ? 44.124  140.785 15.285  1.00 4.12  ? 932  LEU A O     1 
ATOM   7102  C  CB    . LEU A 1 932  ? 45.908  138.542 13.516  1.00 4.75  ? 932  LEU A CB    1 
ATOM   7103  C  CG    . LEU A 1 932  ? 46.062  137.100 13.009  1.00 5.61  ? 932  LEU A CG    1 
ATOM   7104  C  CD1   . LEU A 1 932  ? 46.772  137.064 11.671  1.00 8.20  ? 932  LEU A CD1   1 
ATOM   7105  C  CD2   . LEU A 1 932  ? 46.798  136.255 14.027  1.00 5.85  ? 932  LEU A CD2   1 
ATOM   7106  N  N     . GLN A 1 933  ? 46.353  140.719 15.613  1.00 6.08  ? 933  GLN A N     1 
ATOM   7107  C  CA    . GLN A 1 933  ? 46.528  142.155 15.847  1.00 7.41  ? 933  GLN A CA    1 
ATOM   7108  C  C     . GLN A 1 933  ? 47.908  142.610 15.363  1.00 7.18  ? 933  GLN A C     1 
ATOM   7109  O  O     . GLN A 1 933  ? 48.841  141.819 15.307  1.00 6.80  ? 933  GLN A O     1 
ATOM   7110  C  CB    . GLN A 1 933  ? 46.313  142.517 17.324  1.00 7.73  ? 933  GLN A CB    1 
ATOM   7111  C  CG    . GLN A 1 933  ? 47.050  141.643 18.317  1.00 11.57 ? 933  GLN A CG    1 
ATOM   7112  C  CD    . GLN A 1 933  ? 46.609  141.871 19.757  1.00 16.54 ? 933  GLN A CD    1 
ATOM   7113  O  OE1   . GLN A 1 933  ? 47.328  142.507 20.530  1.00 19.07 ? 933  GLN A OE1   1 
ATOM   7114  N  NE2   . GLN A 1 933  ? 45.440  141.335 20.126  1.00 18.26 ? 933  GLN A NE2   1 
ATOM   7115  N  N     . ASN A 1 934  ? 48.020  143.887 15.010  1.00 7.91  ? 934  ASN A N     1 
ATOM   7116  C  CA    . ASN A 1 934  ? 49.240  144.447 14.404  1.00 8.88  ? 934  ASN A CA    1 
ATOM   7117  C  C     . ASN A 1 934  ? 50.596  144.171 15.079  1.00 9.57  ? 934  ASN A C     1 
ATOM   7118  O  O     . ASN A 1 934  ? 51.557  143.813 14.402  1.00 11.36 ? 934  ASN A O     1 
ATOM   7119  C  CB    . ASN A 1 934  ? 49.048  145.928 14.040  1.00 8.58  ? 934  ASN A CB    1 
ATOM   7120  C  CG    . ASN A 1 934  ? 48.328  146.098 12.723  1.00 8.83  ? 934  ASN A CG    1 
ATOM   7121  O  OD1   . ASN A 1 934  ? 48.655  145.437 11.738  1.00 8.21  ? 934  ASN A OD1   1 
ATOM   7122  N  ND2   . ASN A 1 934  ? 47.332  146.976 12.697  1.00 9.69  ? 934  ASN A ND2   1 
ATOM   7123  N  N     . GLY A 1 935  ? 50.719  144.256 16.390  1.00 9.98  ? 935  GLY A N     1 
ATOM   7124  C  CA    . GLY A 1 935  ? 52.004  143.776 16.948  1.00 9.16  ? 935  GLY A CA    1 
ATOM   7125  C  C     . GLY A 1 935  ? 52.456  142.307 16.766  1.00 8.74  ? 935  GLY A C     1 
ATOM   7126  O  O     . GLY A 1 935  ? 53.607  141.959 17.074  1.00 7.79  ? 935  GLY A O     1 
ATOM   7127  N  N     . ASP A 1 936  ? 51.576  141.435 16.272  1.00 8.03  ? 936  ASP A N     1 
ATOM   7128  C  CA    . ASP A 1 936  ? 51.811  139.984 16.318  1.00 6.79  ? 936  ASP A CA    1 
ATOM   7129  C  C     . ASP A 1 936  ? 52.984  139.475 15.483  1.00 6.95  ? 936  ASP A C     1 
ATOM   7130  O  O     . ASP A 1 936  ? 53.300  140.018 14.430  1.00 7.45  ? 936  ASP A O     1 
ATOM   7131  C  CB    . ASP A 1 936  ? 50.582  139.208 15.850  1.00 6.89  ? 936  ASP A CB    1 
ATOM   7132  C  CG    . ASP A 1 936  ? 49.462  139.174 16.878  1.00 6.17  ? 936  ASP A CG    1 
ATOM   7133  O  OD1   . ASP A 1 936  ? 49.690  139.487 18.065  1.00 5.07  ? 936  ASP A OD1   1 
ATOM   7134  O  OD2   . ASP A 1 936  ? 48.315  138.784 16.575  1.00 3.84  ? 936  ASP A OD2   1 
ATOM   7135  N  N     . THR A 1 937  ? 53.596  138.398 15.947  1.00 6.08  ? 937  THR A N     1 
ATOM   7136  C  CA    . THR A 1 937  ? 54.564  137.691 15.123  1.00 5.79  ? 937  THR A CA    1 
ATOM   7137  C  C     . THR A 1 937  ? 54.467  136.207 15.372  1.00 5.23  ? 937  THR A C     1 
ATOM   7138  O  O     . THR A 1 937  ? 54.340  135.766 16.520  1.00 5.16  ? 937  THR A O     1 
ATOM   7139  C  CB    . THR A 1 937  ? 56.006  138.235 15.364  1.00 5.52  ? 937  THR A CB    1 
ATOM   7140  O  OG1   . THR A 1 937  ? 56.966  137.424 14.663  1.00 6.39  ? 937  THR A OG1   1 
ATOM   7141  C  CG2   . THR A 1 937  ? 56.399  138.149 16.836  1.00 6.25  ? 937  THR A CG2   1 
ATOM   7142  N  N     . ALA A 1 938  ? 54.515  135.436 14.286  1.00 4.35  ? 938  ALA A N     1 
ATOM   7143  C  CA    . ALA A 1 938  ? 54.495  133.982 14.373  1.00 4.11  ? 938  ALA A CA    1 
ATOM   7144  C  C     . ALA A 1 938  ? 55.904  133.377 14.407  1.00 4.03  ? 938  ALA A C     1 
ATOM   7145  O  O     . ALA A 1 938  ? 56.067  132.160 14.300  1.00 3.68  ? 938  ALA A O     1 
ATOM   7146  C  CB    . ALA A 1 938  ? 53.675  133.389 13.219  1.00 4.24  ? 938  ALA A CB    1 
ATOM   7147  N  N     . ASN A 1 939  ? 56.926  134.216 14.562  1.00 4.35  ? 939  ASN A N     1 
ATOM   7148  C  CA    . ASN A 1 939  ? 58.309  133.704 14.647  1.00 4.94  ? 939  ASN A CA    1 
ATOM   7149  C  C     . ASN A 1 939  ? 58.495  132.806 15.891  1.00 5.07  ? 939  ASN A C     1 
ATOM   7150  O  O     . ASN A 1 939  ? 58.191  133.253 16.997  1.00 5.64  ? 939  ASN A O     1 
ATOM   7151  C  CB    . ASN A 1 939  ? 59.298  134.891 14.681  1.00 5.02  ? 939  ASN A CB    1 
ATOM   7152  C  CG    . ASN A 1 939  ? 60.767  134.448 14.628  1.00 6.65  ? 939  ASN A CG    1 
ATOM   7153  O  OD1   . ASN A 1 939  ? 61.142  133.643 13.796  1.00 6.85  ? 939  ASN A OD1   1 
ATOM   7154  N  ND2   . ASN A 1 939  ? 61.598  135.003 15.509  1.00 10.58 ? 939  ASN A ND2   1 
ATOM   7155  N  N     . SER A 1 940  ? 58.982  131.569 15.715  1.00 4.54  ? 940  SER A N     1 
ATOM   7156  C  CA    . SER A 1 940  ? 59.310  130.683 16.842  1.00 4.92  ? 940  SER A CA    1 
ATOM   7157  C  C     . SER A 1 940  ? 60.572  131.216 17.541  1.00 4.93  ? 940  SER A C     1 
ATOM   7158  O  O     . SER A 1 940  ? 61.632  131.308 16.919  1.00 4.63  ? 940  SER A O     1 
ATOM   7159  C  CB    . SER A 1 940  ? 59.547  129.234 16.387  1.00 5.49  ? 940  SER A CB    1 
ATOM   7160  O  OG    . SER A 1 940  ? 58.394  128.667 15.767  1.00 5.96  ? 940  SER A OG    1 
ATOM   7161  N  N     . ALA A 1 941  ? 60.438  131.543 18.829  1.00 4.31  ? 941  ALA A N     1 
ATOM   7162  C  CA    . ALA A 1 941  ? 61.535  132.033 19.650  1.00 4.86  ? 941  ALA A CA    1 
ATOM   7163  C  C     . ALA A 1 941  ? 62.645  131.002 19.750  1.00 4.93  ? 941  ALA A C     1 
ATOM   7164  O  O     . ALA A 1 941  ? 63.826  131.366 19.737  1.00 4.54  ? 941  ALA A O     1 
ATOM   7165  C  CB    . ALA A 1 941  ? 61.037  132.416 21.048  1.00 4.32  ? 941  ALA A CB    1 
ATOM   7166  N  N     . ILE A 1 942  ? 62.258  129.733 19.899  1.00 4.47  ? 942  ILE A N     1 
ATOM   7167  C  CA    . ILE A 1 942  ? 63.200  128.618 19.924  1.00 4.55  ? 942  ILE A CA    1 
ATOM   7168  C  C     . ILE A 1 942  ? 63.204  127.947 18.553  1.00 5.14  ? 942  ILE A C     1 
ATOM   7169  O  O     . ILE A 1 942  ? 62.157  127.533 18.071  1.00 4.66  ? 942  ILE A O     1 
ATOM   7170  C  CB    . ILE A 1 942  ? 62.825  127.580 21.011  1.00 5.02  ? 942  ILE A CB    1 
ATOM   7171  C  CG1   . ILE A 1 942  ? 62.798  128.223 22.407  1.00 4.91  ? 942  ILE A CG1   1 
ATOM   7172  C  CG2   . ILE A 1 942  ? 63.818  126.422 21.002  1.00 3.73  ? 942  ILE A CG2   1 
ATOM   7173  C  CD1   . ILE A 1 942  ? 61.804  127.595 23.334  1.00 6.05  ? 942  ILE A CD1   1 
ATOM   7174  N  N     . LYS A 1 943  ? 64.387  127.839 17.944  1.00 5.53  ? 943  LYS A N     1 
ATOM   7175  C  CA    . LYS A 1 943  ? 64.549  127.052 16.717  1.00 5.20  ? 943  LYS A CA    1 
ATOM   7176  C  C     . LYS A 1 943  ? 65.244  125.728 17.028  1.00 5.69  ? 943  LYS A C     1 
ATOM   7177  O  O     . LYS A 1 943  ? 66.283  125.703 17.690  1.00 5.83  ? 943  LYS A O     1 
ATOM   7178  C  CB    . LYS A 1 943  ? 65.326  127.840 15.662  1.00 5.08  ? 943  LYS A CB    1 
ATOM   7179  C  CG    . LYS A 1 943  ? 64.566  129.050 15.054  1.00 6.05  ? 943  LYS A CG    1 
ATOM   7180  C  CD    . LYS A 1 943  ? 63.141  128.695 14.684  1.00 7.55  ? 943  LYS A CD    1 
ATOM   7181  C  CE    . LYS A 1 943  ? 62.498  129.675 13.702  1.00 7.50  ? 943  LYS A CE    1 
ATOM   7182  N  NZ    . LYS A 1 943  ? 62.327  131.042 14.267  1.00 8.29  ? 943  LYS A NZ    1 
ATOM   7183  N  N     . GLN A 1 944  ? 64.677  124.636 16.535  1.00 5.60  ? 944  GLN A N     1 
ATOM   7184  C  CA    . GLN A 1 944  ? 65.169  123.319 16.866  1.00 5.94  ? 944  GLN A CA    1 
ATOM   7185  C  C     . GLN A 1 944  ? 66.144  122.752 15.840  1.00 5.59  ? 944  GLN A C     1 
ATOM   7186  O  O     . GLN A 1 944  ? 66.003  122.967 14.628  1.00 5.48  ? 944  GLN A O     1 
ATOM   7187  C  CB    . GLN A 1 944  ? 64.013  122.362 17.132  1.00 6.62  ? 944  GLN A CB    1 
ATOM   7188  C  CG    . GLN A 1 944  ? 64.397  121.124 17.947  1.00 8.85  ? 944  GLN A CG    1 
ATOM   7189  C  CD    . GLN A 1 944  ? 63.189  120.232 18.262  1.00 10.71 ? 944  GLN A CD    1 
ATOM   7190  O  OE1   . GLN A 1 944  ? 62.619  119.615 17.359  1.00 12.85 ? 944  GLN A OE1   1 
ATOM   7191  N  NE2   . GLN A 1 944  ? 62.829  120.138 19.531  1.00 9.30  ? 944  GLN A NE2   1 
ATOM   7192  N  N     . ILE A 1 945  ? 67.163  122.077 16.362  1.00 5.16  ? 945  ILE A N     1 
ATOM   7193  C  CA    . ILE A 1 945  ? 68.127  121.341 15.546  1.00 5.06  ? 945  ILE A CA    1 
ATOM   7194  C  C     . ILE A 1 945  ? 68.005  119.874 15.928  1.00 4.98  ? 945  ILE A C     1 
ATOM   7195  O  O     . ILE A 1 945  ? 68.423  119.463 17.019  1.00 4.84  ? 945  ILE A O     1 
ATOM   7196  C  CB    . ILE A 1 945  ? 69.598  121.873 15.736  1.00 4.95  ? 945  ILE A CB    1 
ATOM   7197  C  CG1   . ILE A 1 945  ? 69.729  123.360 15.333  1.00 4.81  ? 945  ILE A CG1   1 
ATOM   7198  C  CG2   . ILE A 1 945  ? 70.574  121.057 14.867  1.00 4.08  ? 945  ILE A CG2   1 
ATOM   7199  C  CD1   . ILE A 1 945  ? 69.529  124.356 16.472  1.00 7.59  ? 945  ILE A CD1   1 
ATOM   7200  N  N     . ALA A 1 946  ? 67.423  119.093 15.019  1.00 4.66  ? 946  ALA A N     1 
ATOM   7201  C  CA    . ALA A 1 946  ? 67.217  117.669 15.234  1.00 4.62  ? 946  ALA A CA    1 
ATOM   7202  C  C     . ALA A 1 946  ? 68.038  116.846 14.224  1.00 4.38  ? 946  ALA A C     1 
ATOM   7203  O  O     . ALA A 1 946  ? 68.662  117.417 13.314  1.00 3.79  ? 946  ALA A O     1 
ATOM   7204  C  CB    . ALA A 1 946  ? 65.702  117.339 15.139  1.00 5.69  ? 946  ALA A CB    1 
ATOM   7205  N  N     . SER A 1 947  ? 68.042  115.518 14.379  1.00 3.77  ? 947  SER A N     1 
ATOM   7206  C  CA    . SER A 1 947  ? 68.944  114.650 13.607  1.00 4.24  ? 947  SER A CA    1 
ATOM   7207  C  C     . SER A 1 947  ? 68.719  114.747 12.090  1.00 4.03  ? 947  SER A C     1 
ATOM   7208  O  O     . SER A 1 947  ? 69.649  114.528 11.324  1.00 3.73  ? 947  SER A O     1 
ATOM   7209  C  CB    . SER A 1 947  ? 68.806  113.190 14.040  1.00 4.13  ? 947  SER A CB    1 
ATOM   7210  O  OG    . SER A 1 947  ? 67.477  112.747 13.780  1.00 4.44  ? 947  SER A OG    1 
ATOM   7211  N  N     . GLY A 1 948  ? 67.494  115.078 11.674  1.00 4.20  ? 948  GLY A N     1 
ATOM   7212  C  CA    . GLY A 1 948  ? 67.176  115.212 10.252  1.00 4.60  ? 948  GLY A CA    1 
ATOM   7213  C  C     . GLY A 1 948  ? 67.634  116.527 9.613   1.00 4.54  ? 948  GLY A C     1 
ATOM   7214  O  O     . GLY A 1 948  ? 67.774  116.639 8.369   1.00 3.14  ? 948  GLY A O     1 
ATOM   7215  N  N     . ARG A 1 949  ? 67.845  117.523 10.467  1.00 3.99  ? 949  ARG A N     1 
ATOM   7216  C  CA    . ARG A 1 949  ? 68.251  118.885 10.043  1.00 4.13  ? 949  ARG A CA    1 
ATOM   7217  C  C     . ARG A 1 949  ? 67.319  119.552 9.014   1.00 4.09  ? 949  ARG A C     1 
ATOM   7218  O  O     . ARG A 1 949  ? 67.755  120.426 8.262   1.00 4.00  ? 949  ARG A O     1 
ATOM   7219  C  CB    . ARG A 1 949  ? 69.720  118.890 9.539   1.00 4.40  ? 949  ARG A CB    1 
ATOM   7220  C  CG    . ARG A 1 949  ? 70.728  118.269 10.536  1.00 5.47  ? 949  ARG A CG    1 
ATOM   7221  C  CD    . ARG A 1 949  ? 70.943  119.158 11.780  1.00 5.88  ? 949  ARG A CD    1 
ATOM   7222  N  NE    . ARG A 1 949  ? 71.531  118.476 12.939  1.00 6.31  ? 949  ARG A NE    1 
ATOM   7223  C  CZ    . ARG A 1 949  ? 72.820  118.528 13.284  1.00 7.59  ? 949  ARG A CZ    1 
ATOM   7224  N  NH1   . ARG A 1 949  ? 73.705  119.181 12.532  1.00 5.87  ? 949  ARG A NH1   1 
ATOM   7225  N  NH2   . ARG A 1 949  ? 73.234  117.897 14.381  1.00 4.73  ? 949  ARG A NH2   1 
ATOM   7226  N  N     . PHE A 1 950  ? 66.038  119.176 9.000   1.00 3.92  ? 950  PHE A N     1 
ATOM   7227  C  CA    . PHE A 1 950  ? 65.136  119.674 7.973   1.00 4.76  ? 950  PHE A CA    1 
ATOM   7228  C  C     . PHE A 1 950  ? 65.050  121.197 7.999   1.00 5.43  ? 950  PHE A C     1 
ATOM   7229  O  O     . PHE A 1 950  ? 65.252  121.875 6.981   1.00 6.22  ? 950  PHE A O     1 
ATOM   7230  C  CB    . PHE A 1 950  ? 63.744  119.015 8.074   1.00 3.66  ? 950  PHE A CB    1 
ATOM   7231  C  CG    . PHE A 1 950  ? 63.783  117.529 7.858   1.00 4.41  ? 950  PHE A CG    1 
ATOM   7232  C  CD1   . PHE A 1 950  ? 63.299  116.659 8.816   1.00 5.27  ? 950  PHE A CD1   1 
ATOM   7233  C  CD2   . PHE A 1 950  ? 64.324  117.006 6.684   1.00 4.61  ? 950  PHE A CD2   1 
ATOM   7234  C  CE1   . PHE A 1 950  ? 63.381  115.256 8.616   1.00 4.85  ? 950  PHE A CE1   1 
ATOM   7235  C  CE2   . PHE A 1 950  ? 64.405  115.629 6.482   1.00 6.06  ? 950  PHE A CE2   1 
ATOM   7236  C  CZ    . PHE A 1 950  ? 63.934  114.755 7.461   1.00 4.89  ? 950  PHE A CZ    1 
ATOM   7237  N  N     . GLY A 1 951  ? 64.788  121.770 9.153   1.00 5.11  ? 951  GLY A N     1 
ATOM   7238  C  CA    . GLY A 1 951  ? 64.801  123.233 9.164   1.00 8.54  ? 951  GLY A CA    1 
ATOM   7239  C  C     . GLY A 1 951  ? 66.017  124.028 8.644   1.00 8.13  ? 951  GLY A C     1 
ATOM   7240  O  O     . GLY A 1 951  ? 65.913  125.208 8.244   1.00 7.61  ? 951  GLY A O     1 
ATOM   7241  N  N     . VAL A 1 952  ? 67.168  123.371 8.664   1.00 7.43  ? 952  VAL A N     1 
ATOM   7242  C  CA    . VAL A 1 952  ? 68.316  124.011 9.292   1.00 6.70  ? 952  VAL A CA    1 
ATOM   7243  C  C     . VAL A 1 952  ? 69.230  124.802 8.359   1.00 6.83  ? 952  VAL A C     1 
ATOM   7244  O  O     . VAL A 1 952  ? 70.167  124.289 7.761   1.00 7.04  ? 952  VAL A O     1 
ATOM   7245  C  CB    . VAL A 1 952  ? 69.016  123.040 10.256  1.00 6.74  ? 952  VAL A CB    1 
ATOM   7246  C  CG1   . VAL A 1 952  ? 70.094  123.754 11.115  1.00 5.85  ? 952  VAL A CG1   1 
ATOM   7247  C  CG2   . VAL A 1 952  ? 67.955  122.395 11.168  1.00 6.57  ? 952  VAL A CG2   1 
ATOM   7248  N  N     . THR A 1 953  ? 68.946  126.096 8.338   1.00 5.73  ? 953  THR A N     1 
ATOM   7249  C  CA    . THR A 1 953  ? 69.492  127.054 7.400   1.00 6.45  ? 953  THR A CA    1 
ATOM   7250  C  C     . THR A 1 953  ? 70.107  128.219 8.213   1.00 5.08  ? 953  THR A C     1 
ATOM   7251  O  O     . THR A 1 953  ? 69.695  128.419 9.344   1.00 4.30  ? 953  THR A O     1 
ATOM   7252  C  CB    . THR A 1 953  ? 68.240  127.468 6.634   1.00 7.53  ? 953  THR A CB    1 
ATOM   7253  O  OG1   . THR A 1 953  ? 68.278  126.946 5.292   1.00 11.00 ? 953  THR A OG1   1 
ATOM   7254  C  CG2   . THR A 1 953  ? 68.041  128.911 6.589   1.00 3.90  ? 953  THR A CG2   1 
ATOM   7255  N  N     . PRO A 1 954  ? 71.086  128.975 7.691   1.00 5.31  ? 954  PRO A N     1 
ATOM   7256  C  CA    . PRO A 1 954  ? 71.665  130.074 8.473   1.00 5.05  ? 954  PRO A CA    1 
ATOM   7257  C  C     . PRO A 1 954  ? 70.612  131.092 8.913   1.00 4.99  ? 954  PRO A C     1 
ATOM   7258  O  O     . PRO A 1 954  ? 70.588  131.472 10.086  1.00 5.29  ? 954  PRO A O     1 
ATOM   7259  C  CB    . PRO A 1 954  ? 72.672  130.709 7.498   1.00 5.05  ? 954  PRO A CB    1 
ATOM   7260  C  CG    . PRO A 1 954  ? 73.054  129.527 6.611   1.00 5.69  ? 954  PRO A CG    1 
ATOM   7261  C  CD    . PRO A 1 954  ? 71.719  128.883 6.357   1.00 4.88  ? 954  PRO A CD    1 
ATOM   7262  N  N     . GLU A 1 955  ? 69.735  131.497 8.002   1.00 4.58  ? 955  GLU A N     1 
ATOM   7263  C  CA    . GLU A 1 955  ? 68.706  132.475 8.323   1.00 5.09  ? 955  GLU A CA    1 
ATOM   7264  C  C     . GLU A 1 955  ? 67.788  131.929 9.443   1.00 4.61  ? 955  GLU A C     1 
ATOM   7265  O  O     . GLU A 1 955  ? 67.418  132.643 10.368  1.00 4.92  ? 955  GLU A O     1 
ATOM   7266  C  CB    . GLU A 1 955  ? 67.928  132.811 7.053   1.00 5.24  ? 955  GLU A CB    1 
ATOM   7267  C  CG    . GLU A 1 955  ? 66.735  133.717 7.248   1.00 7.91  ? 955  GLU A CG    1 
ATOM   7268  C  CD    . GLU A 1 955  ? 66.226  134.284 5.934   1.00 12.60 ? 955  GLU A CD    1 
ATOM   7269  O  OE1   . GLU A 1 955  ? 65.520  135.315 6.003   1.00 12.53 ? 955  GLU A OE1   1 
ATOM   7270  O  OE2   . GLU A 1 955  ? 66.544  133.706 4.848   1.00 11.58 ? 955  GLU A OE2   1 
ATOM   7271  N  N     . TYR A 1 956  ? 67.451  130.652 9.360   1.00 4.05  ? 956  TYR A N     1 
ATOM   7272  C  CA    . TYR A 1 956  ? 66.619  129.995 10.375  1.00 4.09  ? 956  TYR A CA    1 
ATOM   7273  C  C     . TYR A 1 956  ? 67.300  130.098 11.731  1.00 3.85  ? 956  TYR A C     1 
ATOM   7274  O  O     . TYR A 1 956  ? 66.676  130.479 12.716  1.00 3.95  ? 956  TYR A O     1 
ATOM   7275  C  CB    . TYR A 1 956  ? 66.457  128.541 9.948   1.00 3.80  ? 956  TYR A CB    1 
ATOM   7276  C  CG    . TYR A 1 956  ? 65.855  127.533 10.917  1.00 4.66  ? 956  TYR A CG    1 
ATOM   7277  C  CD1   . TYR A 1 956  ? 64.474  127.315 10.963  1.00 3.51  ? 956  TYR A CD1   1 
ATOM   7278  C  CD2   . TYR A 1 956  ? 66.671  126.712 11.686  1.00 5.89  ? 956  TYR A CD2   1 
ATOM   7279  C  CE1   . TYR A 1 956  ? 63.927  126.342 11.783  1.00 4.40  ? 956  TYR A CE1   1 
ATOM   7280  C  CE2   . TYR A 1 956  ? 66.126  125.729 12.515  1.00 5.11  ? 956  TYR A CE2   1 
ATOM   7281  C  CZ    . TYR A 1 956  ? 64.760  125.549 12.555  1.00 4.77  ? 956  TYR A CZ    1 
ATOM   7282  O  OH    . TYR A 1 956  ? 64.214  124.566 13.369  1.00 5.43  ? 956  TYR A OH    1 
ATOM   7283  N  N     . LEU A 1 957  ? 68.588  129.766 11.776  1.00 3.18  ? 957  LEU A N     1 
ATOM   7284  C  CA    . LEU A 1 957  ? 69.344  129.847 13.018  1.00 4.49  ? 957  LEU A CA    1 
ATOM   7285  C  C     . LEU A 1 957  ? 69.498  131.254 13.583  1.00 5.15  ? 957  LEU A C     1 
ATOM   7286  O  O     . LEU A 1 957  ? 69.513  131.412 14.802  1.00 5.97  ? 957  LEU A O     1 
ATOM   7287  C  CB    . LEU A 1 957  ? 70.713  129.160 12.895  1.00 4.50  ? 957  LEU A CB    1 
ATOM   7288  C  CG    . LEU A 1 957  ? 70.685  127.641 12.605  1.00 5.06  ? 957  LEU A CG    1 
ATOM   7289  C  CD1   . LEU A 1 957  ? 72.102  127.125 12.369  1.00 4.31  ? 957  LEU A CD1   1 
ATOM   7290  C  CD2   . LEU A 1 957  ? 70.020  126.847 13.744  1.00 4.07  ? 957  LEU A CD2   1 
ATOM   7291  N  N     . MET A 1 958  ? 69.609  132.268 12.716  1.00 4.92  ? 958  MET A N     1 
ATOM   7292  C  CA    . MET A 1 958  ? 69.690  133.669 13.162  1.00 5.08  ? 958  MET A CA    1 
ATOM   7293  C  C     . MET A 1 958  ? 68.342  134.231 13.640  1.00 5.93  ? 958  MET A C     1 
ATOM   7294  O  O     . MET A 1 958  ? 68.296  135.265 14.313  1.00 5.48  ? 958  MET A O     1 
ATOM   7295  C  CB    . MET A 1 958  ? 70.262  134.568 12.056  1.00 4.57  ? 958  MET A CB    1 
ATOM   7296  C  CG    . MET A 1 958  ? 71.669  134.172 11.572  1.00 4.92  ? 958  MET A CG    1 
ATOM   7297  S  SD    . MET A 1 958  ? 72.830  133.758 12.916  1.00 4.74  ? 958  MET A SD    1 
ATOM   7298  C  CE    . MET A 1 958  ? 73.163  135.481 13.561  1.00 4.26  ? 958  MET A CE    1 
ATOM   7299  N  N     . SER A 1 959  ? 67.250  133.553 13.286  1.00 5.88  ? 959  SER A N     1 
ATOM   7300  C  CA    . SER A 1 959  ? 65.913  134.033 13.633  1.00 7.25  ? 959  SER A CA    1 
ATOM   7301  C  C     . SER A 1 959  ? 65.483  133.586 15.030  1.00 7.94  ? 959  SER A C     1 
ATOM   7302  O  O     . SER A 1 959  ? 64.501  134.094 15.563  1.00 9.56  ? 959  SER A O     1 
ATOM   7303  C  CB    . SER A 1 959  ? 64.877  133.560 12.605  1.00 6.54  ? 959  SER A CB    1 
ATOM   7304  O  OG    . SER A 1 959  ? 64.530  132.214 12.888  1.00 7.63  ? 959  SER A OG    1 
ATOM   7305  N  N     . GLY A 1 960  ? 66.203  132.631 15.602  1.00 8.04  ? 960  GLY A N     1 
ATOM   7306  C  CA    . GLY A 1 960  ? 65.947  132.172 16.952  1.00 9.01  ? 960  GLY A CA    1 
ATOM   7307  C  C     . GLY A 1 960  ? 66.551  133.026 18.054  1.00 9.34  ? 960  GLY A C     1 
ATOM   7308  O  O     . GLY A 1 960  ? 67.691  133.487 17.947  1.00 9.82  ? 960  GLY A O     1 
ATOM   7309  N  N     . LYS A 1 961  ? 65.760  133.262 19.102  1.00 9.25  ? 961  LYS A N     1 
ATOM   7310  C  CA    . LYS A 1 961  ? 66.250  133.789 20.380  1.00 9.06  ? 961  LYS A CA    1 
ATOM   7311  C  C     . LYS A 1 961  ? 67.038  132.658 21.054  1.00 8.17  ? 961  LYS A C     1 
ATOM   7312  O  O     . LYS A 1 961  ? 67.996  132.888 21.776  1.00 8.23  ? 961  LYS A O     1 
ATOM   7313  C  CB    . LYS A 1 961  ? 65.063  134.133 21.290  1.00 9.30  ? 961  LYS A CB    1 
ATOM   7314  C  CG    . LYS A 1 961  ? 64.231  135.329 20.857  1.00 11.67 ? 961  LYS A CG    1 
ATOM   7315  C  CD    . LYS A 1 961  ? 63.164  135.637 21.920  1.00 16.23 ? 961  LYS A CD    1 
ATOM   7316  C  CE    . LYS A 1 961  ? 61.861  136.167 21.296  1.00 16.22 ? 961  LYS A CE    1 
ATOM   7317  N  NZ    . LYS A 1 961  ? 60.945  136.775 22.305  1.00 18.92 ? 961  LYS A NZ    1 
ATOM   7318  N  N     . GLN A 1 962  ? 66.597  131.433 20.826  1.00 7.50  ? 962  GLN A N     1 
ATOM   7319  C  CA    . GLN A 1 962  ? 67.220  130.267 21.424  1.00 7.88  ? 962  GLN A CA    1 
ATOM   7320  C  C     . GLN A 1 962  ? 67.275  129.181 20.387  1.00 7.96  ? 962  GLN A C     1 
ATOM   7321  O  O     . GLN A 1 962  ? 66.463  129.148 19.457  1.00 8.86  ? 962  GLN A O     1 
ATOM   7322  C  CB    . GLN A 1 962  ? 66.414  129.771 22.628  1.00 7.50  ? 962  GLN A CB    1 
ATOM   7323  C  CG    . GLN A 1 962  ? 66.296  130.805 23.767  1.00 7.66  ? 962  GLN A CG    1 
ATOM   7324  C  CD    . GLN A 1 962  ? 65.812  130.194 25.077  1.00 8.65  ? 962  GLN A CD    1 
ATOM   7325  O  OE1   . GLN A 1 962  ? 65.420  129.025 25.129  1.00 6.77  ? 962  GLN A OE1   1 
ATOM   7326  N  NE2   . GLN A 1 962  ? 65.815  131.000 26.128  1.00 9.28  ? 962  GLN A NE2   1 
ATOM   7327  N  N     . LEU A 1 963  ? 68.240  128.295 20.565  1.00 7.24  ? 963  LEU A N     1 
ATOM   7328  C  CA    . LEU A 1 963  ? 68.444  127.163 19.679  1.00 7.47  ? 963  LEU A CA    1 
ATOM   7329  C  C     . LEU A 1 963  ? 68.440  125.901 20.548  1.00 7.56  ? 963  LEU A C     1 
ATOM   7330  O  O     . LEU A 1 963  ? 69.121  125.847 21.577  1.00 9.24  ? 963  LEU A O     1 
ATOM   7331  C  CB    . LEU A 1 963  ? 69.756  127.325 18.899  1.00 6.34  ? 963  LEU A CB    1 
ATOM   7332  C  CG    . LEU A 1 963  ? 69.857  128.647 18.109  1.00 7.81  ? 963  LEU A CG    1 
ATOM   7333  C  CD1   . LEU A 1 963  ? 71.225  128.838 17.489  1.00 6.37  ? 963  LEU A CD1   1 
ATOM   7334  C  CD2   . LEU A 1 963  ? 68.748  128.700 17.031  1.00 6.10  ? 963  LEU A CD2   1 
ATOM   7335  N  N     . GLU A 1 964  ? 67.635  124.923 20.168  1.00 7.18  ? 964  GLU A N     1 
ATOM   7336  C  CA    . GLU A 1 964  ? 67.500  123.676 20.936  1.00 7.23  ? 964  GLU A CA    1 
ATOM   7337  C  C     . GLU A 1 964  ? 68.030  122.481 20.147  1.00 7.02  ? 964  GLU A C     1 
ATOM   7338  O  O     . GLU A 1 964  ? 67.564  122.232 19.044  1.00 8.26  ? 964  GLU A O     1 
ATOM   7339  C  CB    . GLU A 1 964  ? 66.022  123.458 21.296  1.00 7.31  ? 964  GLU A CB    1 
ATOM   7340  C  CG    . GLU A 1 964  ? 65.684  122.106 21.918  1.00 9.15  ? 964  GLU A CG    1 
ATOM   7341  C  CD    . GLU A 1 964  ? 64.432  122.186 22.774  1.00 12.11 ? 964  GLU A CD    1 
ATOM   7342  O  OE1   . GLU A 1 964  ? 63.358  121.800 22.274  1.00 12.59 ? 964  GLU A OE1   1 
ATOM   7343  O  OE2   . GLU A 1 964  ? 64.529  122.620 23.944  1.00 14.21 ? 964  GLU A OE2   1 
ATOM   7344  N  N     . ILE A 1 965  ? 69.005  121.761 20.706  1.00 6.76  ? 965  ILE A N     1 
ATOM   7345  C  CA    . ILE A 1 965  ? 69.474  120.498 20.139  1.00 6.10  ? 965  ILE A CA    1 
ATOM   7346  C  C     . ILE A 1 965  ? 68.593  119.395 20.738  1.00 6.32  ? 965  ILE A C     1 
ATOM   7347  O  O     . ILE A 1 965  ? 68.646  119.133 21.940  1.00 5.40  ? 965  ILE A O     1 
ATOM   7348  C  CB    . ILE A 1 965  ? 70.975  120.230 20.488  1.00 6.45  ? 965  ILE A CB    1 
ATOM   7349  C  CG1   . ILE A 1 965  ? 71.891  121.329 19.915  1.00 7.31  ? 965  ILE A CG1   1 
ATOM   7350  C  CG2   . ILE A 1 965  ? 71.407  118.855 19.949  1.00 6.32  ? 965  ILE A CG2   1 
ATOM   7351  C  CD1   . ILE A 1 965  ? 73.260  121.455 20.615  1.00 7.32  ? 965  ILE A CD1   1 
ATOM   7352  N  N     . LYS A 1 966  ? 67.805  118.756 19.886  1.00 6.22  ? 966  LYS A N     1 
ATOM   7353  C  CA    . LYS A 1 966  ? 66.850  117.761 20.315  1.00 7.05  ? 966  LYS A CA    1 
ATOM   7354  C  C     . LYS A 1 966  ? 67.516  116.413 20.226  1.00 6.69  ? 966  LYS A C     1 
ATOM   7355  O  O     . LYS A 1 966  ? 67.707  115.887 19.128  1.00 6.07  ? 966  LYS A O     1 
ATOM   7356  C  CB    . LYS A 1 966  ? 65.622  117.770 19.407  1.00 7.64  ? 966  LYS A CB    1 
ATOM   7357  C  CG    . LYS A 1 966  ? 64.621  116.668 19.719  1.00 9.12  ? 966  LYS A CG    1 
ATOM   7358  C  CD    . LYS A 1 966  ? 63.996  116.175 18.424  1.00 11.91 ? 966  LYS A CD    1 
ATOM   7359  C  CE    . LYS A 1 966  ? 63.170  114.927 18.640  1.00 11.53 ? 966  LYS A CE    1 
ATOM   7360  N  NZ    . LYS A 1 966  ? 63.097  114.165 17.360  1.00 14.66 ? 966  LYS A NZ    1 
ATOM   7361  N  N     . MET A 1 967  ? 67.870  115.855 21.377  1.00 6.57  ? 967  MET A N     1 
ATOM   7362  C  CA    . MET A 1 967  ? 68.477  114.526 21.410  1.00 6.91  ? 967  MET A CA    1 
ATOM   7363  C  C     . MET A 1 967  ? 67.420  113.423 21.445  1.00 7.34  ? 967  MET A C     1 
ATOM   7364  O  O     . MET A 1 967  ? 67.631  112.311 20.907  1.00 7.79  ? 967  MET A O     1 
ATOM   7365  C  CB    . MET A 1 967  ? 69.412  114.383 22.618  1.00 7.17  ? 967  MET A CB    1 
ATOM   7366  C  CG    . MET A 1 967  ? 70.524  115.445 22.697  1.00 6.24  ? 967  MET A CG    1 
ATOM   7367  S  SD    . MET A 1 967  ? 71.506  115.504 21.200  1.00 8.49  ? 967  MET A SD    1 
ATOM   7368  C  CE    . MET A 1 967  ? 72.194  113.774 21.158  1.00 5.58  ? 967  MET A CE    1 
ATOM   7369  N  N     . ALA A 1 968  ? 66.287  113.716 22.077  1.00 6.79  ? 968  ALA A N     1 
ATOM   7370  C  CA    . ALA A 1 968  ? 65.254  112.694 22.296  1.00 6.49  ? 968  ALA A CA    1 
ATOM   7371  C  C     . ALA A 1 968  ? 63.980  113.352 22.756  1.00 6.53  ? 968  ALA A C     1 
ATOM   7372  O  O     . ALA A 1 968  ? 64.025  114.391 23.404  1.00 5.86  ? 968  ALA A O     1 
ATOM   7373  C  CB    . ALA A 1 968  ? 65.716  111.682 23.368  1.00 5.52  ? 968  ALA A CB    1 
ATOM   7374  N  N     . GLN A 1 969  ? 62.853  112.730 22.422  1.00 6.56  ? 969  GLN A N     1 
ATOM   7375  C  CA    . GLN A 1 969  ? 61.564  113.134 22.953  1.00 7.14  ? 969  GLN A CA    1 
ATOM   7376  C  C     . GLN A 1 969  ? 60.985  111.972 23.752  1.00 6.24  ? 969  GLN A C     1 
ATOM   7377  O  O     . GLN A 1 969  ? 61.313  110.816 23.501  1.00 6.04  ? 969  GLN A O     1 
ATOM   7378  C  CB    . GLN A 1 969  ? 60.610  113.576 21.832  1.00 8.11  ? 969  GLN A CB    1 
ATOM   7379  C  CG    . GLN A 1 969  ? 60.228  112.500 20.837  1.00 9.88  ? 969  GLN A CG    1 
ATOM   7380  C  CD    . GLN A 1 969  ? 59.316  113.067 19.741  1.00 13.42 ? 969  GLN A CD    1 
ATOM   7381  O  OE1   . GLN A 1 969  ? 59.741  113.218 18.592  1.00 17.40 ? 969  GLN A OE1   1 
ATOM   7382  N  NE2   . GLN A 1 969  ? 58.076  113.398 20.100  1.00 12.31 ? 969  GLN A NE2   1 
ATOM   7383  N  N     . GLY A 1 970  ? 60.133  112.301 24.713  1.00 6.19  ? 970  GLY A N     1 
ATOM   7384  C  CA    . GLY A 1 970  ? 59.644  111.338 25.691  1.00 5.50  ? 970  GLY A CA    1 
ATOM   7385  C  C     . GLY A 1 970  ? 58.878  110.170 25.108  1.00 5.20  ? 970  GLY A C     1 
ATOM   7386  O  O     . GLY A 1 970  ? 58.932  109.059 25.644  1.00 4.90  ? 970  GLY A O     1 
ATOM   7387  N  N     . ALA A 1 971  ? 58.159  110.411 24.017  1.00 4.21  ? 971  ALA A N     1 
ATOM   7388  C  CA    . ALA A 1 971  ? 57.350  109.360 23.410  1.00 4.95  ? 971  ALA A CA    1 
ATOM   7389  C  C     . ALA A 1 971  ? 58.206  108.276 22.758  1.00 5.27  ? 971  ALA A C     1 
ATOM   7390  O  O     . ALA A 1 971  ? 57.862  107.097 22.815  1.00 5.81  ? 971  ALA A O     1 
ATOM   7391  C  CB    . ALA A 1 971  ? 56.360  109.944 22.429  1.00 4.85  ? 971  ALA A CB    1 
ATOM   7392  N  N     . LYS A 1 972  ? 59.351  108.649 22.196  1.00 5.29  ? 972  LYS A N     1 
ATOM   7393  C  CA    . LYS A 1 972  ? 60.179  107.637 21.533  1.00 5.11  ? 972  LYS A CA    1 
ATOM   7394  C  C     . LYS A 1 972  ? 61.682  107.893 21.657  1.00 4.52  ? 972  LYS A C     1 
ATOM   7395  O  O     . LYS A 1 972  ? 62.354  108.081 20.653  1.00 3.96  ? 972  LYS A O     1 
ATOM   7396  C  CB    . LYS A 1 972  ? 59.759  107.466 20.056  1.00 4.79  ? 972  LYS A CB    1 
ATOM   7397  C  CG    . LYS A 1 972  ? 59.728  108.778 19.251  1.00 6.43  ? 972  LYS A CG    1 
ATOM   7398  C  CD    . LYS A 1 972  ? 59.345  108.505 17.781  1.00 8.31  ? 972  LYS A CD    1 
ATOM   7399  C  CE    . LYS A 1 972  ? 59.363  109.772 16.960  1.00 9.48  ? 972  LYS A CE    1 
ATOM   7400  N  NZ    . LYS A 1 972  ? 58.129  110.553 17.139  1.00 10.77 ? 972  LYS A NZ    1 
ATOM   7401  N  N     . PRO A 1 973  ? 62.216  107.845 22.881  1.00 5.86  ? 973  PRO A N     1 
ATOM   7402  C  CA    . PRO A 1 973  ? 63.608  108.259 23.110  1.00 6.44  ? 973  PRO A CA    1 
ATOM   7403  C  C     . PRO A 1 973  ? 64.692  107.444 22.358  1.00 7.85  ? 973  PRO A C     1 
ATOM   7404  O  O     . PRO A 1 973  ? 65.699  107.997 21.979  1.00 9.32  ? 973  PRO A O     1 
ATOM   7405  C  CB    . PRO A 1 973  ? 63.771  108.185 24.637  1.00 6.17  ? 973  PRO A CB    1 
ATOM   7406  C  CG    . PRO A 1 973  ? 62.663  107.245 25.117  1.00 4.97  ? 973  PRO A CG    1 
ATOM   7407  C  CD    . PRO A 1 973  ? 61.551  107.388 24.123  1.00 5.44  ? 973  PRO A CD    1 
ATOM   7408  N  N     . GLY A 1 974  ? 64.564  106.181 22.057  1.00 8.46  ? 974  GLY A N     1 
ATOM   7409  C  CA    . GLY A 1 974  ? 65.729  105.748 21.242  1.00 9.78  ? 974  GLY A CA    1 
ATOM   7410  C  C     . GLY A 1 974  ? 65.880  106.151 19.737  1.00 8.51  ? 974  GLY A C     1 
ATOM   7411  O  O     . GLY A 1 974  ? 66.803  105.679 19.033  1.00 6.87  ? 974  GLY A O     1 
ATOM   7412  N  N     . GLU A 1 975  ? 64.979  106.995 19.238  1.00 7.11  ? 975  GLU A N     1 
ATOM   7413  C  CA    . GLU A 1 975  ? 64.648  106.973 17.805  1.00 7.29  ? 975  GLU A CA    1 
ATOM   7414  C  C     . GLU A 1 975  ? 64.604  108.349 17.208  1.00 7.03  ? 975  GLU A C     1 
ATOM   7415  O  O     . GLU A 1 975  ? 64.596  109.339 17.939  1.00 7.24  ? 975  GLU A O     1 
ATOM   7416  C  CB    . GLU A 1 975  ? 63.274  106.332 17.597  1.00 6.86  ? 975  GLU A CB    1 
ATOM   7417  C  CG    . GLU A 1 975  ? 63.079  105.040 18.366  1.00 7.58  ? 975  GLU A CG    1 
ATOM   7418  C  CD    . GLU A 1 975  ? 61.680  104.499 18.257  1.00 10.13 ? 975  GLU A CD    1 
ATOM   7419  O  OE1   . GLU A 1 975  ? 61.207  104.264 17.107  1.00 13.18 ? 975  GLU A OE1   1 
ATOM   7420  O  OE2   . GLU A 1 975  ? 61.062  104.287 19.322  1.00 9.73  ? 975  GLU A OE2   1 
ATOM   7421  N  N     . GLY A 1 976  ? 64.529  108.409 15.878  1.00 7.26  ? 976  GLY A N     1 
ATOM   7422  C  CA    . GLY A 1 976  ? 64.410  109.691 15.187  1.00 7.41  ? 976  GLY A CA    1 
ATOM   7423  C  C     . GLY A 1 976  ? 62.965  110.118 15.018  1.00 7.87  ? 976  GLY A C     1 
ATOM   7424  O  O     . GLY A 1 976  ? 62.034  109.308 15.191  1.00 7.43  ? 976  GLY A O     1 
ATOM   7425  N  N     . GLY A 1 977  ? 62.761  111.386 14.669  1.00 7.84  ? 977  GLY A N     1 
ATOM   7426  C  CA    . GLY A 1 977  ? 61.425  111.850 14.331  1.00 8.29  ? 977  GLY A CA    1 
ATOM   7427  C  C     . GLY A 1 977  ? 60.834  111.054 13.187  1.00 8.84  ? 977  GLY A C     1 
ATOM   7428  O  O     . GLY A 1 977  ? 61.538  110.328 12.463  1.00 9.55  ? 977  GLY A O     1 
ATOM   7429  N  N     . GLN A 1 978  ? 59.518  111.171 13.040  1.00 8.70  ? 978  GLN A N     1 
ATOM   7430  C  CA    . GLN A 1 978  ? 58.759  110.345 12.146  1.00 10.03 ? 978  GLN A CA    1 
ATOM   7431  C  C     . GLN A 1 978  ? 57.653  111.214 11.547  1.00 9.34  ? 978  GLN A C     1 
ATOM   7432  O  O     . GLN A 1 978  ? 56.844  111.741 12.299  1.00 10.16 ? 978  GLN A O     1 
ATOM   7433  C  CB    . GLN A 1 978  ? 58.095  109.276 13.023  1.00 10.86 ? 978  GLN A CB    1 
ATOM   7434  C  CG    . GLN A 1 978  ? 57.742  108.004 12.393  1.00 13.79 ? 978  GLN A CG    1 
ATOM   7435  C  CD    . GLN A 1 978  ? 57.266  106.990 13.453  1.00 17.03 ? 978  GLN A CD    1 
ATOM   7436  O  OE1   . GLN A 1 978  ? 56.263  106.308 13.255  1.00 18.21 ? 978  GLN A OE1   1 
ATOM   7437  N  NE2   . GLN A 1 978  ? 57.988  106.908 14.576  1.00 16.57 ? 978  GLN A NE2   1 
ATOM   7438  N  N     . LEU A 1 979  ? 57.601  111.355 10.223  1.00 8.49  ? 979  LEU A N     1 
ATOM   7439  C  CA    . LEU A 1 979  ? 56.474  112.021 9.567   1.00 7.81  ? 979  LEU A CA    1 
ATOM   7440  C  C     . LEU A 1 979  ? 55.973  111.150 8.436   1.00 7.95  ? 979  LEU A C     1 
ATOM   7441  O  O     . LEU A 1 979  ? 56.700  110.926 7.457   1.00 7.68  ? 979  LEU A O     1 
ATOM   7442  C  CB    . LEU A 1 979  ? 56.845  113.428 9.053   1.00 7.48  ? 979  LEU A CB    1 
ATOM   7443  C  CG    . LEU A 1 979  ? 55.661  114.309 8.597   1.00 6.58  ? 979  LEU A CG    1 
ATOM   7444  C  CD1   . LEU A 1 979  ? 54.706  114.628 9.759   1.00 6.28  ? 979  LEU A CD1   1 
ATOM   7445  C  CD2   . LEU A 1 979  ? 56.120  115.613 7.954   1.00 6.63  ? 979  LEU A CD2   1 
ATOM   7446  N  N     . PRO A 1 980  ? 54.757  110.604 8.584   1.00 7.90  ? 980  PRO A N     1 
ATOM   7447  C  CA    . PRO A 1 980  ? 54.164  109.763 7.530   1.00 7.58  ? 980  PRO A CA    1 
ATOM   7448  C  C     . PRO A 1 980  ? 54.141  110.493 6.181   1.00 6.92  ? 980  PRO A C     1 
ATOM   7449  O  O     . PRO A 1 980  ? 53.894  111.699 6.153   1.00 6.61  ? 980  PRO A O     1 
ATOM   7450  C  CB    . PRO A 1 980  ? 52.735  109.512 8.038   1.00 7.77  ? 980  PRO A CB    1 
ATOM   7451  C  CG    . PRO A 1 980  ? 52.845  109.632 9.510   1.00 8.75  ? 980  PRO A CG    1 
ATOM   7452  C  CD    . PRO A 1 980  ? 53.889  110.706 9.775   1.00 7.39  ? 980  PRO A CD    1 
ATOM   7453  N  N     . GLY A 1 981  ? 54.421  109.775 5.101   1.00 7.21  ? 981  GLY A N     1 
ATOM   7454  C  CA    . GLY A 1 981  ? 54.454  110.342 3.764   1.00 6.29  ? 981  GLY A CA    1 
ATOM   7455  C  C     . GLY A 1 981  ? 53.203  111.126 3.395   1.00 6.42  ? 981  GLY A C     1 
ATOM   7456  O  O     . GLY A 1 981  ? 53.305  112.165 2.757   1.00 6.10  ? 981  GLY A O     1 
ATOM   7457  N  N     . LYS A 1 982  ? 52.029  110.630 3.794   1.00 6.21  ? 982  LYS A N     1 
ATOM   7458  C  CA    . LYS A 1 982  ? 50.766  111.322 3.518   1.00 6.45  ? 982  LYS A CA    1 
ATOM   7459  C  C     . LYS A 1 982  ? 50.728  112.763 4.032   1.00 6.25  ? 982  LYS A C     1 
ATOM   7460  O  O     . LYS A 1 982  ? 50.051  113.601 3.459   1.00 5.41  ? 982  LYS A O     1 
ATOM   7461  C  CB    . LYS A 1 982  ? 49.576  110.546 4.090   1.00 7.23  ? 982  LYS A CB    1 
ATOM   7462  C  CG    . LYS A 1 982  ? 49.033  109.527 3.133   1.00 9.58  ? 982  LYS A CG    1 
ATOM   7463  C  CD    . LYS A 1 982  ? 47.597  109.115 3.495   1.00 14.95 ? 982  LYS A CD    1 
ATOM   7464  C  CE    . LYS A 1 982  ? 47.569  107.903 4.418   1.00 15.75 ? 982  LYS A CE    1 
ATOM   7465  N  NZ    . LYS A 1 982  ? 46.835  106.767 3.733   1.00 16.18 ? 982  LYS A NZ    1 
ATOM   7466  N  N     . LYS A 1 983  ? 51.474  113.049 5.092   1.00 6.00  ? 983  LYS A N     1 
ATOM   7467  C  CA    . LYS A 1 983  ? 51.537  114.397 5.649   1.00 6.12  ? 983  LYS A CA    1 
ATOM   7468  C  C     . LYS A 1 983  ? 52.668  115.246 5.030   1.00 6.55  ? 983  LYS A C     1 
ATOM   7469  O  O     . LYS A 1 983  ? 52.847  116.411 5.401   1.00 6.26  ? 983  LYS A O     1 
ATOM   7470  C  CB    . LYS A 1 983  ? 51.695  114.325 7.185   1.00 6.57  ? 983  LYS A CB    1 
ATOM   7471  C  CG    . LYS A 1 983  ? 50.589  113.521 7.871   1.00 5.45  ? 983  LYS A CG    1 
ATOM   7472  C  CD    . LYS A 1 983  ? 50.712  113.533 9.410   1.00 6.64  ? 983  LYS A CD    1 
ATOM   7473  C  CE    . LYS A 1 983  ? 50.110  114.783 10.035  1.00 6.82  ? 983  LYS A CE    1 
ATOM   7474  N  NZ    . LYS A 1 983  ? 50.116  114.770 11.544  1.00 4.85  ? 983  LYS A NZ    1 
ATOM   7475  N  N     . VAL A 1 984  ? 53.448  114.668 4.111   1.00 6.37  ? 984  VAL A N     1 
ATOM   7476  C  CA    . VAL A 1 984  ? 54.486  115.457 3.430   1.00 6.25  ? 984  VAL A CA    1 
ATOM   7477  C  C     . VAL A 1 984  ? 53.916  116.108 2.161   1.00 5.91  ? 984  VAL A C     1 
ATOM   7478  O  O     . VAL A 1 984  ? 54.085  115.627 1.029   1.00 4.61  ? 984  VAL A O     1 
ATOM   7479  C  CB    . VAL A 1 984  ? 55.792  114.667 3.157   1.00 6.70  ? 984  VAL A CB    1 
ATOM   7480  C  CG1   . VAL A 1 984  ? 56.904  115.619 2.589   1.00 6.47  ? 984  VAL A CG1   1 
ATOM   7481  C  CG2   . VAL A 1 984  ? 56.278  113.969 4.415   1.00 7.09  ? 984  VAL A CG2   1 
ATOM   7482  N  N     . SER A 1 985  ? 53.208  117.205 2.380   1.00 5.30  ? 985  SER A N     1 
ATOM   7483  C  CA    . SER A 1 985  ? 52.605  117.964 1.298   1.00 4.79  ? 985  SER A CA    1 
ATOM   7484  C  C     . SER A 1 985  ? 53.709  118.673 0.510   1.00 4.53  ? 985  SER A C     1 
ATOM   7485  O  O     . SER A 1 985  ? 54.872  118.615 0.877   1.00 3.83  ? 985  SER A O     1 
ATOM   7486  C  CB    . SER A 1 985  ? 51.658  118.984 1.894   1.00 5.01  ? 985  SER A CB    1 
ATOM   7487  O  OG    . SER A 1 985  ? 52.398  119.933 2.638   1.00 4.21  ? 985  SER A OG    1 
ATOM   7488  N  N     . GLU A 1 986  ? 53.343  119.344 -0.572  1.00 4.76  ? 986  GLU A N     1 
ATOM   7489  C  CA    . GLU A 1 986  ? 54.306  120.158 -1.323  1.00 5.40  ? 986  GLU A CA    1 
ATOM   7490  C  C     . GLU A 1 986  ? 54.862  121.261 -0.434  1.00 5.24  ? 986  GLU A C     1 
ATOM   7491  O  O     . GLU A 1 986  ? 56.053  121.565 -0.486  1.00 5.16  ? 986  GLU A O     1 
ATOM   7492  C  CB    . GLU A 1 986  ? 53.669  120.733 -2.604  1.00 5.70  ? 986  GLU A CB    1 
ATOM   7493  C  CG    . GLU A 1 986  ? 53.309  119.632 -3.609  1.00 9.69  ? 986  GLU A CG    1 
ATOM   7494  C  CD    . GLU A 1 986  ? 53.221  120.117 -5.050  1.00 16.30 ? 986  GLU A CD    1 
ATOM   7495  O  OE1   . GLU A 1 986  ? 52.324  119.627 -5.796  1.00 17.40 ? 986  GLU A OE1   1 
ATOM   7496  O  OE2   . GLU A 1 986  ? 54.055  120.975 -5.450  1.00 21.05 ? 986  GLU A OE2   1 
ATOM   7497  N  N     . TYR A 1 987  ? 54.000  121.838 0.401   1.00 4.54  ? 987  TYR A N     1 
ATOM   7498  C  CA    . TYR A 1 987  ? 54.435  122.837 1.369   1.00 5.45  ? 987  TYR A CA    1 
ATOM   7499  C  C     . TYR A 1 987  ? 55.506  122.307 2.335   1.00 5.22  ? 987  TYR A C     1 
ATOM   7500  O  O     . TYR A 1 987  ? 56.537  122.949 2.507   1.00 5.89  ? 987  TYR A O     1 
ATOM   7501  C  CB    . TYR A 1 987  ? 53.228  123.433 2.118   1.00 4.96  ? 987  TYR A CB    1 
ATOM   7502  C  CG    . TYR A 1 987  ? 53.577  124.545 3.087   1.00 6.97  ? 987  TYR A CG    1 
ATOM   7503  C  CD1   . TYR A 1 987  ? 53.474  124.350 4.455   1.00 5.74  ? 987  TYR A CD1   1 
ATOM   7504  C  CD2   . TYR A 1 987  ? 53.980  125.807 2.626   1.00 6.45  ? 987  TYR A CD2   1 
ATOM   7505  C  CE1   . TYR A 1 987  ? 53.771  125.400 5.363   1.00 8.35  ? 987  TYR A CE1   1 
ATOM   7506  C  CE2   . TYR A 1 987  ? 54.276  126.834 3.511   1.00 8.42  ? 987  TYR A CE2   1 
ATOM   7507  C  CZ    . TYR A 1 987  ? 54.171  126.622 4.877   1.00 5.74  ? 987  TYR A CZ    1 
ATOM   7508  O  OH    . TYR A 1 987  ? 54.470  127.638 5.749   1.00 8.12  ? 987  TYR A OH    1 
ATOM   7509  N  N     . ILE A 1 988  ? 55.263  121.143 2.946   1.00 5.68  ? 988  ILE A N     1 
ATOM   7510  C  CA    . ILE A 1 988  ? 56.214  120.514 3.876   1.00 5.13  ? 988  ILE A CA    1 
ATOM   7511  C  C     . ILE A 1 988  ? 57.518  120.159 3.167   1.00 5.77  ? 988  ILE A C     1 
ATOM   7512  O  O     . ILE A 1 988  ? 58.608  120.382 3.722   1.00 5.54  ? 988  ILE A O     1 
ATOM   7513  C  CB    . ILE A 1 988  ? 55.620  119.232 4.543   1.00 5.09  ? 988  ILE A CB    1 
ATOM   7514  C  CG1   . ILE A 1 988  ? 54.317  119.533 5.307   1.00 5.31  ? 988  ILE A CG1   1 
ATOM   7515  C  CG2   . ILE A 1 988  ? 56.654  118.569 5.475   1.00 4.67  ? 988  ILE A CG2   1 
ATOM   7516  C  CD1   . ILE A 1 988  ? 54.409  120.678 6.313   1.00 5.91  ? 988  ILE A CD1   1 
ATOM   7517  N  N     . ALA A 1 989  ? 57.400  119.610 1.951   1.00 5.19  ? 989  ALA A N     1 
ATOM   7518  C  CA    . ALA A 1 989  ? 58.579  119.223 1.165   1.00 5.87  ? 989  ALA A CA    1 
ATOM   7519  C  C     . ALA A 1 989  ? 59.453  120.431 0.855   1.00 5.54  ? 989  ALA A C     1 
ATOM   7520  O  O     . ALA A 1 989  ? 60.667  120.341 0.914   1.00 5.46  ? 989  ALA A O     1 
ATOM   7521  C  CB    . ALA A 1 989  ? 58.178  118.450 -0.133  1.00 4.95  ? 989  ALA A CB    1 
ATOM   7522  N  N     . MET A 1 990  ? 58.827  121.564 0.545   1.00 6.98  ? 990  MET A N     1 
ATOM   7523  C  CA    . MET A 1 990  ? 59.539  122.826 0.339   1.00 7.02  ? 990  MET A CA    1 
ATOM   7524  C  C     . MET A 1 990  ? 60.303  123.263 1.596   1.00 6.84  ? 990  MET A C     1 
ATOM   7525  O  O     . MET A 1 990  ? 61.504  123.540 1.532   1.00 7.35  ? 990  MET A O     1 
ATOM   7526  C  CB    . MET A 1 990  ? 58.560  123.912 -0.110  1.00 7.59  ? 990  MET A CB    1 
ATOM   7527  C  CG    . MET A 1 990  ? 59.196  125.272 -0.416  1.00 11.42 ? 990  MET A CG    1 
ATOM   7528  S  SD    . MET A 1 990  ? 59.330  126.348 1.035   1.00 19.36 ? 990  MET A SD    1 
ATOM   7529  C  CE    . MET A 1 990  ? 57.524  126.942 1.068   1.00 14.72 ? 990  MET A CE    1 
ATOM   7530  N  N     . LEU A 1 991  ? 59.627  123.308 2.741   1.00 6.31  ? 991  LEU A N     1 
ATOM   7531  C  CA    . LEU A 1 991  ? 60.280  123.711 3.991   1.00 6.47  ? 991  LEU A CA    1 
ATOM   7532  C  C     . LEU A 1 991  ? 61.468  122.804 4.306   1.00 5.58  ? 991  LEU A C     1 
ATOM   7533  O  O     . LEU A 1 991  ? 62.525  123.259 4.758   1.00 5.40  ? 991  LEU A O     1 
ATOM   7534  C  CB    . LEU A 1 991  ? 59.286  123.674 5.164   1.00 6.96  ? 991  LEU A CB    1 
ATOM   7535  C  CG    . LEU A 1 991  ? 58.199  124.747 5.298   1.00 7.91  ? 991  LEU A CG    1 
ATOM   7536  C  CD1   . LEU A 1 991  ? 57.254  124.757 4.147   1.00 13.33 ? 991  LEU A CD1   1 
ATOM   7537  C  CD2   . LEU A 1 991  ? 57.412  124.498 6.561   1.00 9.58  ? 991  LEU A CD2   1 
ATOM   7538  N  N     . ARG A 1 992  ? 61.284  121.510 4.075   1.00 5.11  ? 992  ARG A N     1 
ATOM   7539  C  CA    . ARG A 1 992  ? 62.270  120.519 4.478   1.00 5.24  ? 992  ARG A CA    1 
ATOM   7540  C  C     . ARG A 1 992  ? 63.312  120.190 3.393   1.00 5.54  ? 992  ARG A C     1 
ATOM   7541  O  O     . ARG A 1 992  ? 64.263  119.423 3.651   1.00 5.14  ? 992  ARG A O     1 
ATOM   7542  C  CB    . ARG A 1 992  ? 61.568  119.236 4.932   1.00 4.82  ? 992  ARG A CB    1 
ATOM   7543  C  CG    . ARG A 1 992  ? 60.598  119.450 6.101   1.00 4.16  ? 992  ARG A CG    1 
ATOM   7544  C  CD    . ARG A 1 992  ? 60.132  118.135 6.788   1.00 6.07  ? 992  ARG A CD    1 
ATOM   7545  N  NE    . ARG A 1 992  ? 59.226  118.430 7.910   1.00 4.20  ? 992  ARG A NE    1 
ATOM   7546  C  CZ    . ARG A 1 992  ? 59.044  117.645 8.957   1.00 4.41  ? 992  ARG A CZ    1 
ATOM   7547  N  NH1   . ARG A 1 992  ? 59.695  116.479 9.057   1.00 4.16  ? 992  ARG A NH1   1 
ATOM   7548  N  NH2   . ARG A 1 992  ? 58.195  118.010 9.905   1.00 5.58  ? 992  ARG A NH2   1 
ATOM   7549  N  N     . ARG A 1 993  ? 63.105  120.741 2.199   1.00 5.66  ? 993  ARG A N     1 
ATOM   7550  C  CA    . ARG A 1 993  ? 63.893  120.408 0.997   1.00 6.63  ? 993  ARG A CA    1 
ATOM   7551  C  C     . ARG A 1 993  ? 63.978  118.882 0.793   1.00 6.74  ? 993  ARG A C     1 
ATOM   7552  O  O     . ARG A 1 993  ? 65.064  118.282 0.759   1.00 6.89  ? 993  ARG A O     1 
ATOM   7553  C  CB    . ARG A 1 993  ? 65.278  121.076 1.058   1.00 7.49  ? 993  ARG A CB    1 
ATOM   7554  C  CG    . ARG A 1 993  ? 65.228  122.603 0.970   1.00 8.38  ? 993  ARG A CG    1 
ATOM   7555  C  CD    . ARG A 1 993  ? 65.172  123.343 2.322   1.00 11.89 ? 993  ARG A CD    1 
ATOM   7556  N  NE    . ARG A 1 993  ? 65.595  124.748 2.161   1.00 12.47 ? 993  ARG A NE    1 
ATOM   7557  C  CZ    . ARG A 1 993  ? 65.174  125.764 2.905   1.00 14.46 ? 993  ARG A CZ    1 
ATOM   7558  N  NH1   . ARG A 1 993  ? 64.283  125.575 3.885   1.00 15.69 ? 993  ARG A NH1   1 
ATOM   7559  N  NH2   . ARG A 1 993  ? 65.627  126.990 2.652   1.00 14.37 ? 993  ARG A NH2   1 
ATOM   7560  N  N     . SER A 1 994  ? 62.812  118.252 0.723   1.00 6.55  ? 994  SER A N     1 
ATOM   7561  C  CA    . SER A 1 994  ? 62.712  116.802 0.550   1.00 6.57  ? 994  SER A CA    1 
ATOM   7562  C  C     . SER A 1 994  ? 61.662  116.548 -0.527  1.00 6.52  ? 994  SER A C     1 
ATOM   7563  O  O     . SER A 1 994  ? 61.207  117.482 -1.161  1.00 6.01  ? 994  SER A O     1 
ATOM   7564  C  CB    . SER A 1 994  ? 62.324  116.110 1.868   1.00 6.29  ? 994  SER A CB    1 
ATOM   7565  O  OG    . SER A 1 994  ? 61.012  116.479 2.270   1.00 5.60  ? 994  SER A OG    1 
ATOM   7566  N  N     . LYS A 1 995  ? 61.303  115.286 -0.753  1.00 6.65  ? 995  LYS A N     1 
ATOM   7567  C  CA    . LYS A 1 995  ? 60.437  114.949 -1.883  1.00 7.06  ? 995  LYS A CA    1 
ATOM   7568  C  C     . LYS A 1 995  ? 58.970  114.828 -1.435  1.00 7.44  ? 995  LYS A C     1 
ATOM   7569  O  O     . LYS A 1 995  ? 58.696  114.179 -0.423  1.00 6.89  ? 995  LYS A O     1 
ATOM   7570  C  CB    . LYS A 1 995  ? 60.918  113.666 -2.557  1.00 7.18  ? 995  LYS A CB    1 
ATOM   7571  C  CG    . LYS A 1 995  ? 62.271  113.802 -3.260  1.00 7.68  ? 995  LYS A CG    1 
ATOM   7572  C  CD    . LYS A 1 995  ? 62.146  114.561 -4.574  1.00 9.98  ? 995  LYS A CD    1 
ATOM   7573  C  CE    . LYS A 1 995  ? 63.413  114.413 -5.419  1.00 11.39 ? 995  LYS A CE    1 
ATOM   7574  N  NZ    . LYS A 1 995  ? 63.603  115.556 -6.382  1.00 10.22 ? 995  LYS A NZ    1 
ATOM   7575  N  N     . PRO A 1 996  ? 58.043  115.466 -2.155  1.00 7.93  ? 996  PRO A N     1 
ATOM   7576  C  CA    . PRO A 1 996  ? 56.627  115.483 -1.746  1.00 9.06  ? 996  PRO A CA    1 
ATOM   7577  C  C     . PRO A 1 996  ? 56.001  114.182 -1.194  1.00 10.08 ? 996  PRO A C     1 
ATOM   7578  O  O     . PRO A 1 996  ? 55.546  114.195 -0.066  1.00 11.67 ? 996  PRO A O     1 
ATOM   7579  C  CB    . PRO A 1 996  ? 55.903  116.018 -2.994  1.00 9.14  ? 996  PRO A CB    1 
ATOM   7580  C  CG    . PRO A 1 996  ? 56.906  116.954 -3.591  1.00 8.93  ? 996  PRO A CG    1 
ATOM   7581  C  CD    . PRO A 1 996  ? 58.262  116.291 -3.365  1.00 7.65  ? 996  PRO A CD    1 
ATOM   7582  N  N     . GLY A 1 997  ? 55.972  113.064 -1.872  1.00 10.25 ? 997  GLY A N     1 
ATOM   7583  C  CA    . GLY A 1 997  ? 55.166  112.008 -1.216  1.00 10.53 ? 997  GLY A CA    1 
ATOM   7584  C  C     . GLY A 1 997  ? 55.828  111.143 -0.132  1.00 9.65  ? 997  GLY A C     1 
ATOM   7585  O  O     . GLY A 1 997  ? 55.256  110.144 0.342   1.00 8.11  ? 997  GLY A O     1 
ATOM   7586  N  N     . VAL A 1 998  ? 57.043  111.513 0.261   1.00 8.61  ? 998  VAL A N     1 
ATOM   7587  C  CA    . VAL A 1 998  ? 57.940  110.523 0.840   1.00 7.55  ? 998  VAL A CA    1 
ATOM   7588  C  C     . VAL A 1 998  ? 58.022  110.558 2.372   1.00 7.23  ? 998  VAL A C     1 
ATOM   7589  O  O     . VAL A 1 998  ? 58.318  111.595 2.969   1.00 7.32  ? 998  VAL A O     1 
ATOM   7590  C  CB    . VAL A 1 998  ? 59.334  110.590 0.151   1.00 7.20  ? 998  VAL A CB    1 
ATOM   7591  C  CG1   . VAL A 1 998  ? 60.311  109.659 0.817   1.00 6.28  ? 998  VAL A CG1   1 
ATOM   7592  C  CG2   . VAL A 1 998  ? 59.197  110.248 -1.350  1.00 7.90  ? 998  VAL A CG2   1 
ATOM   7593  N  N     . THR A 1 999  ? 57.749  109.415 2.998   1.00 6.85  ? 999  THR A N     1 
ATOM   7594  C  CA    . THR A 1 999  ? 57.894  109.280 4.449   1.00 7.23  ? 999  THR A CA    1 
ATOM   7595  C  C     . THR A 1 999  ? 59.284  109.702 4.926   1.00 7.28  ? 999  THR A C     1 
ATOM   7596  O  O     . THR A 1 999  ? 60.303  109.223 4.408   1.00 6.77  ? 999  THR A O     1 
ATOM   7597  C  CB    . THR A 1 999  ? 57.628  107.830 4.867   1.00 7.39  ? 999  THR A CB    1 
ATOM   7598  O  OG1   . THR A 1 999  ? 56.266  107.507 4.583   1.00 7.50  ? 999  THR A OG1   1 
ATOM   7599  C  CG2   . THR A 1 999  ? 57.734  107.689 6.394   1.00 7.22  ? 999  THR A CG2   1 
ATOM   7600  N  N     . LEU A 1 1000 ? 59.306  110.587 5.921   1.00 7.21  ? 1000 LEU A N     1 
ATOM   7601  C  CA    . LEU A 1 1000 ? 60.540  111.002 6.572   1.00 7.71  ? 1000 LEU A CA    1 
ATOM   7602  C  C     . LEU A 1 1000 ? 60.736  110.338 7.943   1.00 8.78  ? 1000 LEU A C     1 
ATOM   7603  O  O     . LEU A 1 1000 ? 60.117  110.741 8.942   1.00 9.11  ? 1000 LEU A O     1 
ATOM   7604  C  CB    . LEU A 1 1000 ? 60.594  112.543 6.702   1.00 7.17  ? 1000 LEU A CB    1 
ATOM   7605  C  CG    . LEU A 1 1000 ? 60.578  113.327 5.381   1.00 7.16  ? 1000 LEU A CG    1 
ATOM   7606  C  CD1   . LEU A 1 1000 ? 60.373  114.831 5.651   1.00 7.33  ? 1000 LEU A CD1   1 
ATOM   7607  C  CD2   . LEU A 1 1000 ? 61.853  113.093 4.593   1.00 6.09  ? 1000 LEU A CD2   1 
ATOM   7608  N  N     . ILE A 1 1001 ? 61.595  109.321 7.976   1.00 8.48  ? 1001 ILE A N     1 
ATOM   7609  C  CA    . ILE A 1 1001 ? 62.083  108.762 9.226   1.00 8.48  ? 1001 ILE A CA    1 
ATOM   7610  C  C     . ILE A 1 1001 ? 63.488  109.288 9.424   1.00 7.91  ? 1001 ILE A C     1 
ATOM   7611  O  O     . ILE A 1 1001 ? 64.435  108.885 8.723   1.00 7.00  ? 1001 ILE A O     1 
ATOM   7612  C  CB    . ILE A 1 1001 ? 62.113  107.229 9.180   1.00 9.03  ? 1001 ILE A CB    1 
ATOM   7613  C  CG1   . ILE A 1 1001 ? 60.767  106.671 8.672   1.00 9.77  ? 1001 ILE A CG1   1 
ATOM   7614  C  CG2   . ILE A 1 1001 ? 62.540  106.657 10.551  1.00 9.61  ? 1001 ILE A CG2   1 
ATOM   7615  C  CD1   . ILE A 1 1001 ? 60.735  105.165 8.596   1.00 12.57 ? 1001 ILE A CD1   1 
ATOM   7616  N  N     . SER A 1 1002 ? 63.621  110.177 10.398  1.00 7.83  ? 1002 SER A N     1 
ATOM   7617  C  CA    . SER A 1 1002 ? 64.875  110.869 10.651  1.00 6.87  ? 1002 SER A CA    1 
ATOM   7618  C  C     . SER A 1 1002 ? 65.862  109.862 11.239  1.00 6.60  ? 1002 SER A C     1 
ATOM   7619  O  O     . SER A 1 1002 ? 65.444  108.863 11.845  1.00 6.70  ? 1002 SER A O     1 
ATOM   7620  C  CB    . SER A 1 1002 ? 64.627  112.014 11.626  1.00 7.26  ? 1002 SER A CB    1 
ATOM   7621  O  OG    . SER A 1 1002 ? 63.874  113.058 11.002  1.00 8.16  ? 1002 SER A OG    1 
ATOM   7622  N  N     . PRO A 1 1003 ? 67.168  110.099 11.095  1.00 6.14  ? 1003 PRO A N     1 
ATOM   7623  C  CA    . PRO A 1 1003 ? 68.155  109.192 11.720  1.00 5.64  ? 1003 PRO A CA    1 
ATOM   7624  C  C     . PRO A 1 1003 ? 67.975  109.226 13.242  1.00 5.64  ? 1003 PRO A C     1 
ATOM   7625  O  O     . PRO A 1 1003 ? 67.752  110.317 13.772  1.00 5.71  ? 1003 PRO A O     1 
ATOM   7626  C  CB    . PRO A 1 1003 ? 69.505  109.819 11.355  1.00 5.68  ? 1003 PRO A CB    1 
ATOM   7627  C  CG    . PRO A 1 1003 ? 69.204  110.706 10.156  1.00 5.95  ? 1003 PRO A CG    1 
ATOM   7628  C  CD    . PRO A 1 1003 ? 67.802  111.207 10.361  1.00 6.04  ? 1003 PRO A CD    1 
ATOM   7629  N  N     . PRO A 1 1004 ? 68.025  108.087 13.931  1.00 5.35  ? 1004 PRO A N     1 
ATOM   7630  C  CA    . PRO A 1 1004 ? 68.048  108.095 15.406  1.00 5.44  ? 1004 PRO A CA    1 
ATOM   7631  C  C     . PRO A 1 1004 ? 69.128  109.022 16.005  1.00 6.07  ? 1004 PRO A C     1 
ATOM   7632  O  O     . PRO A 1 1004 ? 68.749  109.882 16.822  1.00 6.03  ? 1004 PRO A O     1 
ATOM   7633  C  CB    . PRO A 1 1004 ? 68.279  106.618 15.761  1.00 5.76  ? 1004 PRO A CB    1 
ATOM   7634  C  CG    . PRO A 1 1004 ? 67.584  105.901 14.629  1.00 4.48  ? 1004 PRO A CG    1 
ATOM   7635  C  CD    . PRO A 1 1004 ? 67.990  106.713 13.384  1.00 5.20  ? 1004 PRO A CD    1 
ATOM   7636  N  N     . PRO A 1 1005 ? 70.403  108.919 15.621  1.00 5.27  ? 1005 PRO A N     1 
ATOM   7637  C  CA    . PRO A 1 1005 ? 71.393  109.844 16.179  1.00 4.57  ? 1005 PRO A CA    1 
ATOM   7638  C  C     . PRO A 1 1005 ? 71.532  111.114 15.340  1.00 4.62  ? 1005 PRO A C     1 
ATOM   7639  O  O     . PRO A 1 1005 ? 71.179  111.112 14.162  1.00 5.62  ? 1005 PRO A O     1 
ATOM   7640  C  CB    . PRO A 1 1005 ? 72.690  109.050 16.064  1.00 3.50  ? 1005 PRO A CB    1 
ATOM   7641  C  CG    . PRO A 1 1005 ? 72.519  108.285 14.723  1.00 3.92  ? 1005 PRO A CG    1 
ATOM   7642  C  CD    . PRO A 1 1005 ? 71.026  108.002 14.631  1.00 5.25  ? 1005 PRO A CD    1 
ATOM   7643  N  N     . HIS A 1 1006 ? 72.061  112.173 15.940  1.00 4.89  ? 1006 HIS A N     1 
ATOM   7644  C  CA    . HIS A 1 1006 ? 72.696  113.252 15.187  1.00 4.31  ? 1006 HIS A CA    1 
ATOM   7645  C  C     . HIS A 1 1006 ? 74.019  112.638 14.702  1.00 4.24  ? 1006 HIS A C     1 
ATOM   7646  O  O     . HIS A 1 1006 ? 74.783  112.110 15.509  1.00 3.61  ? 1006 HIS A O     1 
ATOM   7647  C  CB    . HIS A 1 1006 ? 72.990  114.450 16.097  1.00 4.49  ? 1006 HIS A CB    1 
ATOM   7648  C  CG    . HIS A 1 1006 ? 71.771  115.210 16.540  1.00 4.80  ? 1006 HIS A CG    1 
ATOM   7649  N  ND1   . HIS A 1 1006 ? 71.460  116.457 16.052  1.00 5.92  ? 1006 HIS A ND1   1 
ATOM   7650  C  CD2   . HIS A 1 1006 ? 70.816  114.919 17.457  1.00 5.93  ? 1006 HIS A CD2   1 
ATOM   7651  C  CE1   . HIS A 1 1006 ? 70.352  116.894 16.622  1.00 6.34  ? 1006 HIS A CE1   1 
ATOM   7652  N  NE2   . HIS A 1 1006 ? 69.944  115.985 17.487  1.00 7.65  ? 1006 HIS A NE2   1 
ATOM   7653  N  N     . HIS A 1 1007 ? 74.298  112.677 13.405  1.00 3.50  ? 1007 HIS A N     1 
ATOM   7654  C  CA    . HIS A 1 1007 ? 75.531  112.036 12.927  1.00 4.31  ? 1007 HIS A CA    1 
ATOM   7655  C  C     . HIS A 1 1007 ? 76.771  112.882 13.224  1.00 5.14  ? 1007 HIS A C     1 
ATOM   7656  O  O     . HIS A 1 1007 ? 77.927  112.510 12.939  1.00 5.54  ? 1007 HIS A O     1 
ATOM   7657  C  CB    . HIS A 1 1007 ? 75.401  111.637 11.468  1.00 4.68  ? 1007 HIS A CB    1 
ATOM   7658  C  CG    . HIS A 1 1007 ? 74.608  110.380 11.300  1.00 3.67  ? 1007 HIS A CG    1 
ATOM   7659  N  ND1   . HIS A 1 1007 ? 75.064  109.154 11.741  1.00 6.34  ? 1007 HIS A ND1   1 
ATOM   7660  C  CD2   . HIS A 1 1007 ? 73.371  110.168 10.796  1.00 6.37  ? 1007 HIS A CD2   1 
ATOM   7661  C  CE1   . HIS A 1 1007 ? 74.147  108.234 11.487  1.00 7.12  ? 1007 HIS A CE1   1 
ATOM   7662  N  NE2   . HIS A 1 1007 ? 73.112  108.823 10.910  1.00 6.94  ? 1007 HIS A NE2   1 
ATOM   7663  N  N     . ASP A 1 1008 ? 76.425  113.981 13.860  1.00 5.06  ? 1008 ASP A N     1 
ATOM   7664  C  CA    . ASP A 1 1008 ? 77.205  115.048 14.413  1.00 6.48  ? 1008 ASP A CA    1 
ATOM   7665  C  C     . ASP A 1 1008 ? 77.653  114.839 15.856  1.00 5.83  ? 1008 ASP A C     1 
ATOM   7666  O  O     . ASP A 1 1008 ? 78.458  115.617 16.401  1.00 5.92  ? 1008 ASP A O     1 
ATOM   7667  C  CB    . ASP A 1 1008 ? 76.201  116.231 14.499  1.00 6.78  ? 1008 ASP A CB    1 
ATOM   7668  C  CG    . ASP A 1 1008 ? 76.768  117.361 13.919  1.00 9.87  ? 1008 ASP A CG    1 
ATOM   7669  O  OD1   . ASP A 1 1008 ? 77.949  117.099 13.561  1.00 16.99 ? 1008 ASP A OD1   1 
ATOM   7670  O  OD2   . ASP A 1 1008 ? 76.239  118.463 13.749  1.00 9.22  ? 1008 ASP A OD2   1 
ATOM   7671  N  N     . ILE A 1 1009 ? 77.026  113.876 16.513  1.00 5.53  ? 1009 ILE A N     1 
ATOM   7672  C  CA    . ILE A 1 1009 ? 77.147  113.734 17.968  1.00 4.83  ? 1009 ILE A CA    1 
ATOM   7673  C  C     . ILE A 1 1009 ? 77.226  112.273 18.382  1.00 4.46  ? 1009 ILE A C     1 
ATOM   7674  O  O     . ILE A 1 1009 ? 76.195  111.617 18.589  1.00 4.12  ? 1009 ILE A O     1 
ATOM   7675  C  CB    . ILE A 1 1009 ? 75.948  114.409 18.713  1.00 4.90  ? 1009 ILE A CB    1 
ATOM   7676  C  CG1   . ILE A 1 1009 ? 75.671  115.834 18.216  1.00 5.38  ? 1009 ILE A CG1   1 
ATOM   7677  C  CG2   . ILE A 1 1009 ? 76.203  114.421 20.258  1.00 4.57  ? 1009 ILE A CG2   1 
ATOM   7678  C  CD1   . ILE A 1 1009 ? 74.379  116.453 18.828  1.00 8.34  ? 1009 ILE A CD1   1 
ATOM   7679  N  N     . TYR A 1 1010 ? 78.451  111.774 18.522  1.00 4.14  ? 1010 TYR A N     1 
ATOM   7680  C  CA    . TYR A 1 1010 ? 78.671  110.381 18.908  1.00 4.20  ? 1010 TYR A CA    1 
ATOM   7681  C  C     . TYR A 1 1010 ? 79.295  110.287 20.299  1.00 4.17  ? 1010 TYR A C     1 
ATOM   7682  O  O     . TYR A 1 1010 ? 79.644  109.197 20.766  1.00 4.06  ? 1010 TYR A O     1 
ATOM   7683  C  CB    . TYR A 1 1010 ? 79.571  109.667 17.891  1.00 4.00  ? 1010 TYR A CB    1 
ATOM   7684  C  CG    . TYR A 1 1010 ? 79.009  109.458 16.494  1.00 4.91  ? 1010 TYR A CG    1 
ATOM   7685  C  CD1   . TYR A 1 1010 ? 79.874  109.181 15.436  1.00 5.46  ? 1010 TYR A CD1   1 
ATOM   7686  C  CD2   . TYR A 1 1010 ? 77.649  109.520 16.223  1.00 5.02  ? 1010 TYR A CD2   1 
ATOM   7687  C  CE1   . TYR A 1 1010 ? 79.426  108.982 14.159  1.00 6.81  ? 1010 TYR A CE1   1 
ATOM   7688  C  CE2   . TYR A 1 1010 ? 77.173  109.309 14.906  1.00 5.73  ? 1010 TYR A CE2   1 
ATOM   7689  C  CZ    . TYR A 1 1010 ? 78.073  109.026 13.895  1.00 6.91  ? 1010 TYR A CZ    1 
ATOM   7690  O  OH    . TYR A 1 1010 ? 77.660  108.820 12.586  1.00 7.84  ? 1010 TYR A OH    1 
ATOM   7691  N  N     . SER A 1 1011 ? 79.429  111.436 20.965  1.00 4.59  ? 1011 SER A N     1 
ATOM   7692  C  CA    . SER A 1 1011 ? 80.110  111.509 22.253  1.00 4.38  ? 1011 SER A CA    1 
ATOM   7693  C  C     . SER A 1 1011 ? 79.819  112.879 22.900  1.00 4.76  ? 1011 SER A C     1 
ATOM   7694  O  O     . SER A 1 1011 ? 79.283  113.774 22.249  1.00 4.66  ? 1011 SER A O     1 
ATOM   7695  C  CB    . SER A 1 1011 ? 81.621  111.391 22.029  1.00 4.61  ? 1011 SER A CB    1 
ATOM   7696  O  OG    . SER A 1 1011 ? 82.044  112.559 21.321  1.00 4.60  ? 1011 SER A OG    1 
ATOM   7697  N  N     . ILE A 1 1012 ? 80.176  113.042 24.172  1.00 4.42  ? 1012 ILE A N     1 
ATOM   7698  C  CA    . ILE A 1 1012 ? 80.044  114.352 24.820  1.00 4.74  ? 1012 ILE A CA    1 
ATOM   7699  C  C     . ILE A 1 1012 ? 80.858  115.464 24.117  1.00 4.11  ? 1012 ILE A C     1 
ATOM   7700  O  O     . ILE A 1 1012 ? 80.357  116.583 23.939  1.00 3.73  ? 1012 ILE A O     1 
ATOM   7701  C  CB    . ILE A 1 1012 ? 80.367  114.286 26.366  1.00 4.59  ? 1012 ILE A CB    1 
ATOM   7702  C  CG1   . ILE A 1 1012 ? 80.055  115.636 27.056  1.00 4.61  ? 1012 ILE A CG1   1 
ATOM   7703  C  CG2   . ILE A 1 1012 ? 81.812  113.893 26.625  1.00 5.60  ? 1012 ILE A CG2   1 
ATOM   7704  C  CD1   . ILE A 1 1012 ? 78.619  116.161 26.865  1.00 5.89  ? 1012 ILE A CD1   1 
ATOM   7705  N  N     . GLU A 1 1013 ? 82.092  115.166 23.712  1.00 4.33  ? 1013 GLU A N     1 
ATOM   7706  C  CA    . GLU A 1 1013 ? 82.915  116.186 23.054  1.00 4.89  ? 1013 GLU A CA    1 
ATOM   7707  C  C     . GLU A 1 1013 ? 82.328  116.599 21.698  1.00 4.24  ? 1013 GLU A C     1 
ATOM   7708  O  O     . GLU A 1 1013 ? 82.534  117.737 21.258  1.00 4.40  ? 1013 GLU A O     1 
ATOM   7709  C  CB    . GLU A 1 1013 ? 84.420  115.783 22.970  1.00 5.18  ? 1013 GLU A CB    1 
ATOM   7710  C  CG    . GLU A 1 1013 ? 84.755  114.564 22.096  1.00 5.97  ? 1013 GLU A CG    1 
ATOM   7711  C  CD    . GLU A 1 1013 ? 84.625  113.232 22.831  1.00 8.48  ? 1013 GLU A CD    1 
ATOM   7712  O  OE1   . GLU A 1 1013 ? 83.945  113.191 23.880  1.00 7.75  ? 1013 GLU A OE1   1 
ATOM   7713  O  OE2   . GLU A 1 1013 ? 85.219  112.213 22.369  1.00 9.19  ? 1013 GLU A OE2   1 
ATOM   7714  N  N     . ASP A 1 1014 ? 81.599  115.687 21.041  1.00 3.83  ? 1014 ASP A N     1 
ATOM   7715  C  CA    . ASP A 1 1014 ? 80.970  116.001 19.757  1.00 3.83  ? 1014 ASP A CA    1 
ATOM   7716  C  C     . ASP A 1 1014 ? 79.767  116.919 20.012  1.00 3.99  ? 1014 ASP A C     1 
ATOM   7717  O  O     . ASP A 1 1014 ? 79.501  117.811 19.223  1.00 3.39  ? 1014 ASP A O     1 
ATOM   7718  C  CB    . ASP A 1 1014 ? 80.470  114.752 19.023  1.00 4.04  ? 1014 ASP A CB    1 
ATOM   7719  C  CG    . ASP A 1 1014 ? 81.570  113.847 18.520  1.00 6.13  ? 1014 ASP A CG    1 
ATOM   7720  O  OD1   . ASP A 1 1014 ? 82.796  114.172 18.568  1.00 8.32  ? 1014 ASP A OD1   1 
ATOM   7721  O  OD2   . ASP A 1 1014 ? 81.270  112.733 18.032  1.00 8.71  ? 1014 ASP A OD2   1 
ATOM   7722  N  N     . LEU A 1 1015 ? 79.041  116.694 21.114  1.00 3.68  ? 1015 LEU A N     1 
ATOM   7723  C  CA    . LEU A 1 1015 ? 77.970  117.612 21.517  1.00 4.30  ? 1015 LEU A CA    1 
ATOM   7724  C  C     . LEU A 1 1015 ? 78.561  118.994 21.798  1.00 3.89  ? 1015 LEU A C     1 
ATOM   7725  O  O     . LEU A 1 1015 ? 77.969  120.009 21.417  1.00 3.73  ? 1015 LEU A O     1 
ATOM   7726  C  CB    . LEU A 1 1015 ? 77.254  117.131 22.785  1.00 4.08  ? 1015 LEU A CB    1 
ATOM   7727  C  CG    . LEU A 1 1015 ? 75.843  117.617 23.202  1.00 8.58  ? 1015 LEU A CG    1 
ATOM   7728  C  CD1   . LEU A 1 1015 ? 75.751  118.093 24.648  1.00 7.27  ? 1015 LEU A CD1   1 
ATOM   7729  C  CD2   . LEU A 1 1015 ? 75.098  118.551 22.258  1.00 6.51  ? 1015 LEU A CD2   1 
ATOM   7730  N  N     . ALA A 1 1016 ? 79.711  119.026 22.474  1.00 3.27  ? 1016 ALA A N     1 
ATOM   7731  C  CA    . ALA A 1 1016 ? 80.352  120.298 22.787  1.00 3.49  ? 1016 ALA A CA    1 
ATOM   7732  C  C     . ALA A 1 1016 ? 80.709  121.011 21.477  1.00 3.42  ? 1016 ALA A C     1 
ATOM   7733  O  O     . ALA A 1 1016 ? 80.596  122.228 21.377  1.00 3.62  ? 1016 ALA A O     1 
ATOM   7734  C  CB    . ALA A 1 1016 ? 81.577  120.098 23.664  1.00 3.43  ? 1016 ALA A CB    1 
ATOM   7735  N  N     . GLN A 1 1017 ? 81.103  120.242 20.469  1.00 3.01  ? 1017 GLN A N     1 
ATOM   7736  C  CA    . GLN A 1 1017 ? 81.367  120.809 19.156  1.00 3.23  ? 1017 GLN A CA    1 
ATOM   7737  C  C     . GLN A 1 1017 ? 80.100  121.399 18.517  1.00 3.08  ? 1017 GLN A C     1 
ATOM   7738  O  O     . GLN A 1 1017 ? 80.159  122.505 17.976  1.00 3.70  ? 1017 GLN A O     1 
ATOM   7739  C  CB    . GLN A 1 1017 ? 82.030  119.803 18.203  1.00 3.06  ? 1017 GLN A CB    1 
ATOM   7740  C  CG    . GLN A 1 1017 ? 82.311  120.409 16.810  1.00 3.21  ? 1017 GLN A CG    1 
ATOM   7741  C  CD    . GLN A 1 1017 ? 83.354  121.513 16.883  1.00 5.51  ? 1017 GLN A CD    1 
ATOM   7742  O  OE1   . GLN A 1 1017 ? 84.413  121.323 17.484  1.00 6.15  ? 1017 GLN A OE1   1 
ATOM   7743  N  NE2   . GLN A 1 1017 ? 83.052  122.669 16.300  1.00 3.96  ? 1017 GLN A NE2   1 
ATOM   7744  N  N     . LEU A 1 1018 ? 78.970  120.688 18.563  1.00 3.05  ? 1018 LEU A N     1 
ATOM   7745  C  CA    . LEU A 1 1018 ? 77.731  121.266 17.994  1.00 3.38  ? 1018 LEU A CA    1 
ATOM   7746  C  C     . LEU A 1 1018 ? 77.305  122.525 18.748  1.00 3.65  ? 1018 LEU A C     1 
ATOM   7747  O  O     . LEU A 1 1018 ? 76.903  123.522 18.134  1.00 3.58  ? 1018 LEU A O     1 
ATOM   7748  C  CB    . LEU A 1 1018 ? 76.571  120.274 17.927  1.00 3.09  ? 1018 LEU A CB    1 
ATOM   7749  C  CG    . LEU A 1 1018 ? 75.285  120.833 17.294  1.00 4.85  ? 1018 LEU A CG    1 
ATOM   7750  C  CD1   . LEU A 1 1018 ? 75.537  121.256 15.817  1.00 6.03  ? 1018 LEU A CD1   1 
ATOM   7751  C  CD2   . LEU A 1 1018 ? 74.163  119.826 17.369  1.00 6.26  ? 1018 LEU A CD2   1 
ATOM   7752  N  N     . ILE A 1 1019 ? 77.371  122.496 20.074  1.00 3.22  ? 1019 ILE A N     1 
ATOM   7753  C  CA    . ILE A 1 1019 ? 77.038  123.715 20.844  1.00 3.41  ? 1019 ILE A CA    1 
ATOM   7754  C  C     . ILE A 1 1019 ? 77.969  124.890 20.444  1.00 3.51  ? 1019 ILE A C     1 
ATOM   7755  O  O     . ILE A 1 1019 ? 77.528  126.038 20.261  1.00 4.08  ? 1019 ILE A O     1 
ATOM   7756  C  CB    . ILE A 1 1019 ? 77.136  123.435 22.356  1.00 3.07  ? 1019 ILE A CB    1 
ATOM   7757  C  CG1   . ILE A 1 1019 ? 76.032  122.461 22.778  1.00 2.96  ? 1019 ILE A CG1   1 
ATOM   7758  C  CG2   . ILE A 1 1019 ? 77.064  124.751 23.174  1.00 3.67  ? 1019 ILE A CG2   1 
ATOM   7759  C  CD1   . ILE A 1 1019 ? 76.228  121.901 24.184  1.00 3.45  ? 1019 ILE A CD1   1 
ATOM   7760  N  N     . TYR A 1 1020 ? 79.254  124.591 20.302  1.00 3.71  ? 1020 TYR A N     1 
ATOM   7761  C  CA    . TYR A 1 1020 ? 80.222  125.558 19.778  1.00 4.34  ? 1020 TYR A CA    1 
ATOM   7762  C  C     . TYR A 1 1020 ? 79.824  126.105 18.406  1.00 4.17  ? 1020 TYR A C     1 
ATOM   7763  O  O     . TYR A 1 1020 ? 79.906  127.312 18.183  1.00 4.40  ? 1020 TYR A O     1 
ATOM   7764  C  CB    . TYR A 1 1020 ? 81.586  124.894 19.694  1.00 3.91  ? 1020 TYR A CB    1 
ATOM   7765  C  CG    . TYR A 1 1020 ? 82.763  125.796 19.396  1.00 6.00  ? 1020 TYR A CG    1 
ATOM   7766  C  CD1   . TYR A 1 1020 ? 83.575  126.261 20.427  1.00 5.04  ? 1020 TYR A CD1   1 
ATOM   7767  C  CD2   . TYR A 1 1020 ? 83.104  126.130 18.075  1.00 7.12  ? 1020 TYR A CD2   1 
ATOM   7768  C  CE1   . TYR A 1 1020 ? 84.693  127.053 20.165  1.00 8.16  ? 1020 TYR A CE1   1 
ATOM   7769  C  CE2   . TYR A 1 1020 ? 84.219  126.939 17.803  1.00 7.76  ? 1020 TYR A CE2   1 
ATOM   7770  C  CZ    . TYR A 1 1020 ? 85.011  127.383 18.854  1.00 8.48  ? 1020 TYR A CZ    1 
ATOM   7771  O  OH    . TYR A 1 1020 ? 86.124  128.165 18.608  1.00 10.20 ? 1020 TYR A OH    1 
ATOM   7772  N  N     . ASP A 1 1021 ? 79.423  125.219 17.493  1.00 3.74  ? 1021 ASP A N     1 
ATOM   7773  C  CA    . ASP A 1 1021 ? 78.994  125.623 16.146  1.00 3.86  ? 1021 ASP A CA    1 
ATOM   7774  C  C     . ASP A 1 1021 ? 77.797  126.589 16.214  1.00 4.01  ? 1021 ASP A C     1 
ATOM   7775  O  O     . ASP A 1 1021 ? 77.714  127.551 15.433  1.00 3.48  ? 1021 ASP A O     1 
ATOM   7776  C  CB    . ASP A 1 1021 ? 78.563  124.409 15.311  1.00 3.62  ? 1021 ASP A CB    1 
ATOM   7777  C  CG    . ASP A 1 1021 ? 79.701  123.475 14.959  1.00 4.73  ? 1021 ASP A CG    1 
ATOM   7778  O  OD1   . ASP A 1 1021 ? 80.892  123.849 15.092  1.00 5.06  ? 1021 ASP A OD1   1 
ATOM   7779  O  OD2   . ASP A 1 1021 ? 79.471  122.318 14.538  1.00 6.90  ? 1021 ASP A OD2   1 
ATOM   7780  N  N     . LEU A 1 1022 ? 76.859  126.317 17.125  1.00 3.52  ? 1022 LEU A N     1 
ATOM   7781  C  CA    . LEU A 1 1022 ? 75.670  127.176 17.278  1.00 3.54  ? 1022 LEU A CA    1 
ATOM   7782  C  C     . LEU A 1 1022 ? 76.009  128.539 17.928  1.00 4.37  ? 1022 LEU A C     1 
ATOM   7783  O  O     . LEU A 1 1022 ? 75.568  129.587 17.458  1.00 3.93  ? 1022 LEU A O     1 
ATOM   7784  C  CB    . LEU A 1 1022 ? 74.552  126.436 18.037  1.00 4.40  ? 1022 LEU A CB    1 
ATOM   7785  C  CG    . LEU A 1 1022 ? 73.971  125.181 17.377  1.00 5.26  ? 1022 LEU A CG    1 
ATOM   7786  C  CD1   . LEU A 1 1022 ? 72.939  124.537 18.286  1.00 7.28  ? 1022 LEU A CD1   1 
ATOM   7787  C  CD2   . LEU A 1 1022 ? 73.350  125.493 15.993  1.00 7.61  ? 1022 LEU A CD2   1 
ATOM   7788  N  N     . HIS A 1 1023 ? 76.825  128.524 18.988  1.00 4.56  ? 1023 HIS A N     1 
ATOM   7789  C  CA    . HIS A 1 1023 ? 77.345  129.759 19.578  1.00 5.25  ? 1023 HIS A CA    1 
ATOM   7790  C  C     . HIS A 1 1023 ? 78.203  130.533 18.539  1.00 4.94  ? 1023 HIS A C     1 
ATOM   7791  O  O     . HIS A 1 1023 ? 78.289  131.753 18.565  1.00 4.45  ? 1023 HIS A O     1 
ATOM   7792  C  CB    . HIS A 1 1023 ? 78.203  129.469 20.821  1.00 5.54  ? 1023 HIS A CB    1 
ATOM   7793  C  CG    . HIS A 1 1023 ? 77.425  129.100 22.062  1.00 5.91  ? 1023 HIS A CG    1 
ATOM   7794  N  ND1   . HIS A 1 1023 ? 76.240  129.711 22.429  1.00 7.61  ? 1023 HIS A ND1   1 
ATOM   7795  C  CD2   . HIS A 1 1023 ? 77.715  128.224 23.058  1.00 5.15  ? 1023 HIS A CD2   1 
ATOM   7796  C  CE1   . HIS A 1 1023 ? 75.816  129.203 23.579  1.00 4.53  ? 1023 HIS A CE1   1 
ATOM   7797  N  NE2   . HIS A 1 1023 ? 76.688  128.290 23.975  1.00 5.77  ? 1023 HIS A NE2   1 
ATOM   7798  N  N     . GLN A 1 1024 ? 78.854  129.799 17.644  1.00 4.57  ? 1024 GLN A N     1 
ATOM   7799  C  CA    . GLN A 1 1024 ? 79.639  130.423 16.580  1.00 4.63  ? 1024 GLN A CA    1 
ATOM   7800  C  C     . GLN A 1 1024 ? 78.755  131.246 15.622  1.00 3.69  ? 1024 GLN A C     1 
ATOM   7801  O  O     . GLN A 1 1024 ? 79.019  132.435 15.377  1.00 3.65  ? 1024 GLN A O     1 
ATOM   7802  C  CB    . GLN A 1 1024 ? 80.431  129.353 15.812  1.00 4.44  ? 1024 GLN A CB    1 
ATOM   7803  C  CG    . GLN A 1 1024 ? 81.459  129.917 14.853  1.00 6.53  ? 1024 GLN A CG    1 
ATOM   7804  C  CD    . GLN A 1 1024 ? 82.758  130.341 15.544  1.00 9.81  ? 1024 GLN A CD    1 
ATOM   7805  O  OE1   . GLN A 1 1024 ? 82.770  130.681 16.742  1.00 9.68  ? 1024 GLN A OE1   1 
ATOM   7806  N  NE2   . GLN A 1 1024 ? 83.847  130.338 14.787  1.00 9.70  ? 1024 GLN A NE2   1 
ATOM   7807  N  N     . ILE A 1 1025 ? 77.722  130.620 15.073  1.00 3.04  ? 1025 ILE A N     1 
ATOM   7808  C  CA    . ILE A 1 1025 ? 76.884  131.314 14.092  1.00 2.90  ? 1025 ILE A CA    1 
ATOM   7809  C  C     . ILE A 1 1025 ? 76.048  132.419 14.737  1.00 3.25  ? 1025 ILE A C     1 
ATOM   7810  O  O     . ILE A 1 1025 ? 75.896  133.495 14.168  1.00 3.11  ? 1025 ILE A O     1 
ATOM   7811  C  CB    . ILE A 1 1025 ? 76.005  130.342 13.267  1.00 2.18  ? 1025 ILE A CB    1 
ATOM   7812  C  CG1   . ILE A 1 1025 ? 75.541  131.031 11.960  1.00 3.01  ? 1025 ILE A CG1   1 
ATOM   7813  C  CG2   . ILE A 1 1025 ? 74.839  129.761 14.091  1.00 1.00  ? 1025 ILE A CG2   1 
ATOM   7814  C  CD1   . ILE A 1 1025 ? 74.688  130.127 11.030  1.00 3.65  ? 1025 ILE A CD1   1 
ATOM   7815  N  N     . ASN A 1 1026 ? 75.540  132.147 15.935  1.00 3.33  ? 1026 ASN A N     1 
ATOM   7816  C  CA    . ASN A 1 1026 ? 74.657  133.083 16.632  1.00 5.40  ? 1026 ASN A CA    1 
ATOM   7817  C  C     . ASN A 1 1026 ? 75.111  133.218 18.093  1.00 5.68  ? 1026 ASN A C     1 
ATOM   7818  O  O     . ASN A 1 1026 ? 74.587  132.542 18.974  1.00 6.86  ? 1026 ASN A O     1 
ATOM   7819  C  CB    . ASN A 1 1026 ? 73.186  132.606 16.533  1.00 5.57  ? 1026 ASN A CB    1 
ATOM   7820  C  CG    . ASN A 1 1026 ? 72.181  133.671 17.012  1.00 6.76  ? 1026 ASN A CG    1 
ATOM   7821  O  OD1   . ASN A 1 1026 ? 72.567  134.710 17.537  1.00 7.32  ? 1026 ASN A OD1   1 
ATOM   7822  N  ND2   . ASN A 1 1026 ? 70.890  133.404 16.809  1.00 8.31  ? 1026 ASN A ND2   1 
ATOM   7823  N  N     . PRO A 1 1027 ? 76.110  134.059 18.350  1.00 6.19  ? 1027 PRO A N     1 
ATOM   7824  C  CA    . PRO A 1 1027 ? 76.676  134.172 19.700  1.00 6.90  ? 1027 PRO A CA    1 
ATOM   7825  C  C     . PRO A 1 1027 ? 75.691  134.729 20.734  1.00 7.43  ? 1027 PRO A C     1 
ATOM   7826  O  O     . PRO A 1 1027 ? 75.908  134.494 21.927  1.00 6.51  ? 1027 PRO A O     1 
ATOM   7827  C  CB    . PRO A 1 1027 ? 77.888  135.088 19.517  1.00 6.81  ? 1027 PRO A CB    1 
ATOM   7828  C  CG    . PRO A 1 1027 ? 77.608  135.849 18.270  1.00 7.32  ? 1027 PRO A CG    1 
ATOM   7829  C  CD    . PRO A 1 1027 ? 76.800  134.928 17.384  1.00 6.54  ? 1027 PRO A CD    1 
ATOM   7830  N  N     . GLU A 1 1028 ? 74.625  135.396 20.278  1.00 7.58  ? 1028 GLU A N     1 
ATOM   7831  C  CA    . GLU A 1 1028 ? 73.583  135.893 21.179  1.00 8.45  ? 1028 GLU A CA    1 
ATOM   7832  C  C     . GLU A 1 1028 ? 72.516  134.862 21.603  1.00 7.73  ? 1028 GLU A C     1 
ATOM   7833  O  O     . GLU A 1 1028 ? 71.751  135.120 22.523  1.00 7.87  ? 1028 GLU A O     1 
ATOM   7834  C  CB    . GLU A 1 1028 ? 72.926  137.168 20.631  1.00 8.95  ? 1028 GLU A CB    1 
ATOM   7835  C  CG    . GLU A 1 1028 ? 73.215  138.400 21.495  1.00 14.49 ? 1028 GLU A CG    1 
ATOM   7836  C  CD    . GLU A 1 1028 ? 72.288  138.550 22.729  1.00 21.02 ? 1028 GLU A CD    1 
ATOM   7837  O  OE1   . GLU A 1 1028 ? 71.654  139.636 22.874  1.00 23.46 ? 1028 GLU A OE1   1 
ATOM   7838  O  OE2   . GLU A 1 1028 ? 72.197  137.611 23.576  1.00 22.73 ? 1028 GLU A OE2   1 
ATOM   7839  N  N     . ALA A 1 1029 ? 72.460  133.706 20.954  1.00 6.77  ? 1029 ALA A N     1 
ATOM   7840  C  CA    . ALA A 1 1029 ? 71.408  132.755 21.269  1.00 6.99  ? 1029 ALA A CA    1 
ATOM   7841  C  C     . ALA A 1 1029 ? 71.838  131.754 22.342  1.00 6.78  ? 1029 ALA A C     1 
ATOM   7842  O  O     . ALA A 1 1029 ? 72.931  131.174 22.269  1.00 5.64  ? 1029 ALA A O     1 
ATOM   7843  C  CB    . ALA A 1 1029 ? 70.912  132.031 19.993  1.00 6.60  ? 1029 ALA A CB    1 
ATOM   7844  N  N     . GLN A 1 1030 ? 70.974  131.550 23.339  1.00 6.47  ? 1030 GLN A N     1 
ATOM   7845  C  CA    . GLN A 1 1030 ? 71.208  130.488 24.314  1.00 6.57  ? 1030 GLN A CA    1 
ATOM   7846  C  C     . GLN A 1 1030 ? 70.957  129.143 23.637  1.00 6.56  ? 1030 GLN A C     1 
ATOM   7847  O  O     . GLN A 1 1030 ? 70.045  129.011 22.811  1.00 5.79  ? 1030 GLN A O     1 
ATOM   7848  C  CB    . GLN A 1 1030 ? 70.315  130.647 25.556  1.00 7.02  ? 1030 GLN A CB    1 
ATOM   7849  C  CG    . GLN A 1 1030 ? 70.922  131.605 26.605  1.00 9.12  ? 1030 GLN A CG    1 
ATOM   7850  C  CD    . GLN A 1 1030 ? 70.076  131.806 27.859  1.00 12.72 ? 1030 GLN A CD    1 
ATOM   7851  O  OE1   . GLN A 1 1030 ? 68.856  131.923 27.780  1.00 15.66 ? 1030 GLN A OE1   1 
ATOM   7852  N  NE2   . GLN A 1 1030 ? 70.742  131.912 29.023  1.00 15.60 ? 1030 GLN A NE2   1 
ATOM   7853  N  N     . VAL A 1 1031 ? 71.779  128.152 23.975  1.00 5.86  ? 1031 VAL A N     1 
ATOM   7854  C  CA    . VAL A 1 1031 ? 71.645  126.826 23.378  1.00 5.79  ? 1031 VAL A CA    1 
ATOM   7855  C  C     . VAL A 1 1031 ? 71.062  125.883 24.411  1.00 5.63  ? 1031 VAL A C     1 
ATOM   7856  O  O     . VAL A 1 1031 ? 71.603  125.750 25.513  1.00 5.96  ? 1031 VAL A O     1 
ATOM   7857  C  CB    . VAL A 1 1031 ? 72.999  126.299 22.881  1.00 5.84  ? 1031 VAL A CB    1 
ATOM   7858  C  CG1   . VAL A 1 1031 ? 72.897  124.860 22.409  1.00 5.10  ? 1031 VAL A CG1   1 
ATOM   7859  C  CG2   . VAL A 1 1031 ? 73.516  127.183 21.746  1.00 5.77  ? 1031 VAL A CG2   1 
ATOM   7860  N  N     . SER A 1 1032 ? 69.950  125.245 24.085  1.00 5.64  ? 1032 SER A N     1 
ATOM   7861  C  CA    . SER A 1 1032 ? 69.465  124.195 24.979  1.00 6.34  ? 1032 SER A CA    1 
ATOM   7862  C  C     . SER A 1 1032 ? 69.708  122.809 24.396  1.00 5.60  ? 1032 SER A C     1 
ATOM   7863  O  O     . SER A 1 1032 ? 69.885  122.669 23.189  1.00 5.44  ? 1032 SER A O     1 
ATOM   7864  C  CB    . SER A 1 1032 ? 68.004  124.400 25.357  1.00 6.57  ? 1032 SER A CB    1 
ATOM   7865  O  OG    . SER A 1 1032 ? 67.182  124.049 24.290  1.00 11.08 ? 1032 SER A OG    1 
ATOM   7866  N  N     . VAL A 1 1033 ? 69.726  121.816 25.285  1.00 5.23  ? 1033 VAL A N     1 
ATOM   7867  C  CA    . VAL A 1 1033 ? 69.854  120.411 24.949  1.00 4.99  ? 1033 VAL A CA    1 
ATOM   7868  C  C     . VAL A 1 1033 ? 68.658  119.687 25.586  1.00 5.60  ? 1033 VAL A C     1 
ATOM   7869  O  O     . VAL A 1 1033 ? 68.471  119.711 26.813  1.00 4.92  ? 1033 VAL A O     1 
ATOM   7870  C  CB    . VAL A 1 1033 ? 71.184  119.800 25.471  1.00 5.42  ? 1033 VAL A CB    1 
ATOM   7871  C  CG1   . VAL A 1 1033 ? 71.314  118.324 25.033  1.00 3.68  ? 1033 VAL A CG1   1 
ATOM   7872  C  CG2   . VAL A 1 1033 ? 72.385  120.589 24.966  1.00 4.23  ? 1033 VAL A CG2   1 
ATOM   7873  N  N     . LYS A 1 1034 ? 67.846  119.080 24.726  1.00 5.32  ? 1034 LYS A N     1 
ATOM   7874  C  CA    . LYS A 1 1034 ? 66.629  118.380 25.142  1.00 5.65  ? 1034 LYS A CA    1 
ATOM   7875  C  C     . LYS A 1 1034 ? 66.967  116.914 25.297  1.00 5.79  ? 1034 LYS A C     1 
ATOM   7876  O  O     . LYS A 1 1034 ? 67.372  116.253 24.343  1.00 5.41  ? 1034 LYS A O     1 
ATOM   7877  C  CB    . LYS A 1 1034 ? 65.510  118.583 24.111  1.00 4.89  ? 1034 LYS A CB    1 
ATOM   7878  C  CG    . LYS A 1 1034 ? 64.219  117.781 24.337  1.00 5.82  ? 1034 LYS A CG    1 
ATOM   7879  C  CD    . LYS A 1 1034 ? 63.089  118.295 23.409  1.00 7.95  ? 1034 LYS A CD    1 
ATOM   7880  C  CE    . LYS A 1 1034 ? 61.771  117.521 23.600  1.00 8.65  ? 1034 LYS A CE    1 
ATOM   7881  N  NZ    . LYS A 1 1034 ? 60.671  118.073 22.740  1.00 8.97  ? 1034 LYS A NZ    1 
ATOM   7882  N  N     . LEU A 1 1035 ? 66.812  116.448 26.532  1.00 6.47  ? 1035 LEU A N     1 
ATOM   7883  C  CA    . LEU A 1 1035 ? 67.063  115.077 26.946  1.00 6.24  ? 1035 LEU A CA    1 
ATOM   7884  C  C     . LEU A 1 1035 ? 65.775  114.431 27.429  1.00 6.48  ? 1035 LEU A C     1 
ATOM   7885  O  O     . LEU A 1 1035 ? 64.806  115.124 27.732  1.00 6.12  ? 1035 LEU A O     1 
ATOM   7886  C  CB    . LEU A 1 1035 ? 68.041  115.081 28.107  1.00 6.80  ? 1035 LEU A CB    1 
ATOM   7887  C  CG    . LEU A 1 1035 ? 69.396  115.767 27.881  1.00 6.25  ? 1035 LEU A CG    1 
ATOM   7888  C  CD1   . LEU A 1 1035 ? 70.140  115.844 29.217  1.00 4.39  ? 1035 LEU A CD1   1 
ATOM   7889  C  CD2   . LEU A 1 1035 ? 70.197  115.029 26.833  1.00 4.57  ? 1035 LEU A CD2   1 
ATOM   7890  N  N     . VAL A 1 1036 ? 65.775  113.101 27.518  1.00 5.68  ? 1036 VAL A N     1 
ATOM   7891  C  CA    . VAL A 1 1036 ? 64.645  112.396 28.122  1.00 5.19  ? 1036 VAL A CA    1 
ATOM   7892  C  C     . VAL A 1 1036 ? 65.011  111.717 29.444  1.00 4.67  ? 1036 VAL A C     1 
ATOM   7893  O  O     . VAL A 1 1036 ? 66.096  111.115 29.588  1.00 3.50  ? 1036 VAL A O     1 
ATOM   7894  C  CB    . VAL A 1 1036 ? 64.004  111.400 27.118  1.00 4.88  ? 1036 VAL A CB    1 
ATOM   7895  C  CG1   . VAL A 1 1036 ? 62.966  110.480 27.788  1.00 4.78  ? 1036 VAL A CG1   1 
ATOM   7896  C  CG2   . VAL A 1 1036 ? 63.334  112.187 26.003  1.00 4.83  ? 1036 VAL A CG2   1 
ATOM   7897  N  N     . ALA A 1 1037 ? 64.096  111.797 30.408  1.00 4.55  ? 1037 ALA A N     1 
ATOM   7898  C  CA    . ALA A 1 1037 ? 64.343  111.203 31.729  1.00 4.81  ? 1037 ALA A CA    1 
ATOM   7899  C  C     . ALA A 1 1037 ? 64.621  109.714 31.631  1.00 4.51  ? 1037 ALA A C     1 
ATOM   7900  O  O     . ALA A 1 1037 ? 63.902  108.981 30.944  1.00 5.27  ? 1037 ALA A O     1 
ATOM   7901  C  CB    . ALA A 1 1037 ? 63.167  111.464 32.672  1.00 5.24  ? 1037 ALA A CB    1 
ATOM   7902  N  N     . GLU A 1 1038 ? 65.681  109.288 32.312  1.00 4.45  ? 1038 GLU A N     1 
ATOM   7903  C  CA    . GLU A 1 1038 ? 66.010  107.885 32.558  1.00 4.85  ? 1038 GLU A CA    1 
ATOM   7904  C  C     . GLU A 1 1038 ? 67.180  107.926 33.530  1.00 4.74  ? 1038 GLU A C     1 
ATOM   7905  O  O     . GLU A 1 1038 ? 67.906  108.922 33.578  1.00 4.04  ? 1038 GLU A O     1 
ATOM   7906  C  CB    . GLU A 1 1038 ? 66.437  107.148 31.266  1.00 4.35  ? 1038 GLU A CB    1 
ATOM   7907  C  CG    . GLU A 1 1038 ? 67.673  107.745 30.591  1.00 6.33  ? 1038 GLU A CG    1 
ATOM   7908  C  CD    . GLU A 1 1038 ? 68.288  106.878 29.499  1.00 7.15  ? 1038 GLU A CD    1 
ATOM   7909  O  OE1   . GLU A 1 1038 ? 67.921  105.687 29.339  1.00 5.18  ? 1038 GLU A OE1   1 
ATOM   7910  O  OE2   . GLU A 1 1038 ? 69.124  107.428 28.761  1.00 7.37  ? 1038 GLU A OE2   1 
ATOM   7911  N  N     . ILE A 1 1039 ? 67.355  106.870 34.321  1.00 4.99  ? 1039 ILE A N     1 
ATOM   7912  C  CA    . ILE A 1 1039 ? 68.549  106.772 35.185  1.00 5.59  ? 1039 ILE A CA    1 
ATOM   7913  C  C     . ILE A 1 1039 ? 69.791  107.000 34.309  1.00 5.24  ? 1039 ILE A C     1 
ATOM   7914  O  O     . ILE A 1 1039 ? 69.840  106.511 33.188  1.00 5.69  ? 1039 ILE A O     1 
ATOM   7915  C  CB    . ILE A 1 1039 ? 68.608  105.411 35.964  1.00 5.77  ? 1039 ILE A CB    1 
ATOM   7916  C  CG1   . ILE A 1 1039 ? 69.773  105.403 36.972  1.00 7.76  ? 1039 ILE A CG1   1 
ATOM   7917  C  CG2   . ILE A 1 1039 ? 68.710  104.208 35.019  1.00 5.66  ? 1039 ILE A CG2   1 
ATOM   7918  C  CD1   . ILE A 1 1039 ? 69.484  106.165 38.289  1.00 9.37  ? 1039 ILE A CD1   1 
ATOM   7919  N  N     . GLY A 1 1040 ? 70.758  107.767 34.802  1.00 5.39  ? 1040 GLY A N     1 
ATOM   7920  C  CA    . GLY A 1 1040 ? 71.927  108.134 34.003  1.00 5.85  ? 1040 GLY A CA    1 
ATOM   7921  C  C     . GLY A 1 1040 ? 71.876  109.536 33.412  1.00 5.60  ? 1040 GLY A C     1 
ATOM   7922  O  O     . GLY A 1 1040 ? 72.918  110.088 33.025  1.00 5.98  ? 1040 GLY A O     1 
ATOM   7923  N  N     . ILE A 1 1041 ? 70.679  110.128 33.345  1.00 5.57  ? 1041 ILE A N     1 
ATOM   7924  C  CA    . ILE A 1 1041 ? 70.541  111.514 32.838  1.00 5.42  ? 1041 ILE A CA    1 
ATOM   7925  C  C     . ILE A 1 1041 ? 71.347  112.514 33.677  1.00 6.08  ? 1041 ILE A C     1 
ATOM   7926  O  O     . ILE A 1 1041 ? 71.830  113.518 33.150  1.00 5.32  ? 1041 ILE A O     1 
ATOM   7927  C  CB    . ILE A 1 1041 ? 69.035  111.965 32.733  1.00 4.88  ? 1041 ILE A CB    1 
ATOM   7928  C  CG1   . ILE A 1 1041 ? 68.902  113.265 31.911  1.00 3.81  ? 1041 ILE A CG1   1 
ATOM   7929  C  CG2   . ILE A 1 1041 ? 68.377  112.150 34.122  1.00 4.93  ? 1041 ILE A CG2   1 
ATOM   7930  C  CD1   . ILE A 1 1041 ? 67.462  113.673 31.599  1.00 4.59  ? 1041 ILE A CD1   1 
ATOM   7931  N  N     . GLY A 1 1042 ? 71.478  112.256 34.981  1.00 6.14  ? 1042 GLY A N     1 
ATOM   7932  C  CA    . GLY A 1 1042 ? 72.200  113.185 35.850  1.00 6.52  ? 1042 GLY A CA    1 
ATOM   7933  C  C     . GLY A 1 1042 ? 73.653  113.370 35.402  1.00 6.84  ? 1042 GLY A C     1 
ATOM   7934  O  O     . GLY A 1 1042 ? 74.111  114.472 35.189  1.00 6.53  ? 1042 GLY A O     1 
ATOM   7935  N  N     . THR A 1 1043 ? 74.344  112.249 35.241  1.00 7.67  ? 1043 THR A N     1 
ATOM   7936  C  CA    . THR A 1 1043 ? 75.702  112.154 34.717  1.00 8.41  ? 1043 THR A CA    1 
ATOM   7937  C  C     . THR A 1 1043 ? 75.823  112.794 33.345  1.00 7.72  ? 1043 THR A C     1 
ATOM   7938  O  O     . THR A 1 1043 ? 76.718  113.624 33.106  1.00 7.48  ? 1043 THR A O     1 
ATOM   7939  C  CB    . THR A 1 1043 ? 76.037  110.636 34.637  1.00 8.82  ? 1043 THR A CB    1 
ATOM   7940  O  OG1   . THR A 1 1043 ? 76.249  110.149 35.967  1.00 11.99 ? 1043 THR A OG1   1 
ATOM   7941  C  CG2   . THR A 1 1043 ? 77.346  110.381 33.959  1.00 11.44 ? 1043 THR A CG2   1 
ATOM   7942  N  N     . ILE A 1 1044 ? 74.917  112.398 32.447  1.00 6.70  ? 1044 ILE A N     1 
ATOM   7943  C  CA    . ILE A 1 1044 ? 74.823  112.998 31.128  1.00 6.81  ? 1044 ILE A CA    1 
ATOM   7944  C  C     . ILE A 1 1044 ? 74.709  114.519 31.199  1.00 6.53  ? 1044 ILE A C     1 
ATOM   7945  O  O     . ILE A 1 1044 ? 75.400  115.225 30.466  1.00 6.04  ? 1044 ILE A O     1 
ATOM   7946  C  CB    . ILE A 1 1044 ? 73.660  112.378 30.321  1.00 6.58  ? 1044 ILE A CB    1 
ATOM   7947  C  CG1   . ILE A 1 1044 ? 74.032  110.948 29.901  1.00 6.83  ? 1044 ILE A CG1   1 
ATOM   7948  C  CG2   . ILE A 1 1044 ? 73.345  113.224 29.080  1.00 6.41  ? 1044 ILE A CG2   1 
ATOM   7949  C  CD1   . ILE A 1 1044 ? 72.824  110.066 29.560  1.00 7.75  ? 1044 ILE A CD1   1 
ATOM   7950  N  N     . ALA A 1 1045 ? 73.850  115.014 32.094  1.00 6.47  ? 1045 ALA A N     1 
ATOM   7951  C  CA    . ALA A 1 1045 ? 73.595  116.447 32.199  1.00 6.13  ? 1045 ALA A CA    1 
ATOM   7952  C  C     . ALA A 1 1045 ? 74.810  117.223 32.705  1.00 5.79  ? 1045 ALA A C     1 
ATOM   7953  O  O     . ALA A 1 1045 ? 75.032  118.358 32.286  1.00 5.02  ? 1045 ALA A O     1 
ATOM   7954  C  CB    . ALA A 1 1045 ? 72.380  116.717 33.078  1.00 6.85  ? 1045 ALA A CB    1 
ATOM   7955  N  N     . ALA A 1 1046 ? 75.583  116.614 33.607  1.00 5.30  ? 1046 ALA A N     1 
ATOM   7956  C  CA    . ALA A 1 1046 ? 76.851  117.205 34.055  1.00 4.63  ? 1046 ALA A CA    1 
ATOM   7957  C  C     . ALA A 1 1046 ? 77.792  117.383 32.867  1.00 4.43  ? 1046 ALA A C     1 
ATOM   7958  O  O     . ALA A 1 1046 ? 78.415  118.425 32.711  1.00 4.60  ? 1046 ALA A O     1 
ATOM   7959  C  CB    . ALA A 1 1046 ? 77.533  116.347 35.164  1.00 4.50  ? 1046 ALA A CB    1 
ATOM   7960  N  N     . GLY A 1 1047 ? 77.909  116.351 32.044  1.00 5.03  ? 1047 GLY A N     1 
ATOM   7961  C  CA    . GLY A 1 1047 ? 78.644  116.475 30.788  1.00 5.42  ? 1047 GLY A CA    1 
ATOM   7962  C  C     . GLY A 1 1047 ? 78.131  117.634 29.934  1.00 5.08  ? 1047 GLY A C     1 
ATOM   7963  O  O     . GLY A 1 1047 ? 78.931  118.430 29.461  1.00 5.78  ? 1047 GLY A O     1 
ATOM   7964  N  N     . VAL A 1 1048 ? 76.812  117.721 29.742  1.00 4.47  ? 1048 VAL A N     1 
ATOM   7965  C  CA    . VAL A 1 1048 ? 76.202  118.768 28.915  1.00 5.03  ? 1048 VAL A CA    1 
ATOM   7966  C  C     . VAL A 1 1048 ? 76.549  120.173 29.418  1.00 4.26  ? 1048 VAL A C     1 
ATOM   7967  O  O     . VAL A 1 1048 ? 76.861  121.079 28.626  1.00 4.59  ? 1048 VAL A O     1 
ATOM   7968  C  CB    . VAL A 1 1048 ? 74.651  118.591 28.761  1.00 5.60  ? 1048 VAL A CB    1 
ATOM   7969  C  CG1   . VAL A 1 1048 ? 74.009  119.785 28.056  1.00 4.40  ? 1048 VAL A CG1   1 
ATOM   7970  C  CG2   . VAL A 1 1048 ? 74.328  117.319 27.974  1.00 5.15  ? 1048 VAL A CG2   1 
ATOM   7971  N  N     . ALA A 1 1049 ? 76.523  120.343 30.733  1.00 4.02  ? 1049 ALA A N     1 
ATOM   7972  C  CA    . ALA A 1 1049 ? 76.933  121.595 31.362  1.00 4.17  ? 1049 ALA A CA    1 
ATOM   7973  C  C     . ALA A 1 1049 ? 78.419  121.920 31.097  1.00 4.23  ? 1049 ALA A C     1 
ATOM   7974  O  O     . ALA A 1 1049 ? 78.773  123.054 30.807  1.00 3.67  ? 1049 ALA A O     1 
ATOM   7975  C  CB    . ALA A 1 1049 ? 76.637  121.547 32.890  1.00 4.23  ? 1049 ALA A CB    1 
ATOM   7976  N  N     . LYS A 1 1050 ? 79.280  120.911 31.187  1.00 4.99  ? 1050 LYS A N     1 
ATOM   7977  C  CA    . LYS A 1 1050 ? 80.711  121.081 30.893  1.00 4.84  ? 1050 LYS A CA    1 
ATOM   7978  C  C     . LYS A 1 1050 ? 80.945  121.379 29.404  1.00 5.33  ? 1050 LYS A C     1 
ATOM   7979  O  O     . LYS A 1 1050 ? 81.948  121.968 29.032  1.00 6.43  ? 1050 LYS A O     1 
ATOM   7980  C  CB    . LYS A 1 1050 ? 81.464  119.829 31.322  1.00 4.40  ? 1050 LYS A CB    1 
ATOM   7981  C  CG    . LYS A 1 1050 ? 81.563  119.680 32.854  1.00 4.87  ? 1050 LYS A CG    1 
ATOM   7982  C  CD    . LYS A 1 1050 ? 82.345  118.418 33.245  1.00 6.53  ? 1050 LYS A CD    1 
ATOM   7983  C  CE    . LYS A 1 1050 ? 83.842  118.583 33.091  1.00 7.15  ? 1050 LYS A CE    1 
ATOM   7984  N  NZ    . LYS A 1 1050 ? 84.576  117.427 33.694  1.00 8.14  ? 1050 LYS A NZ    1 
ATOM   7985  N  N     . ALA A 1 1051 ? 79.974  120.997 28.585  1.00 4.61  ? 1051 ALA A N     1 
ATOM   7986  C  CA    . ALA A 1 1051 ? 79.998  121.189 27.144  1.00 5.19  ? 1051 ALA A CA    1 
ATOM   7987  C  C     . ALA A 1 1051 ? 79.504  122.578 26.736  1.00 4.16  ? 1051 ALA A C     1 
ATOM   7988  O  O     . ALA A 1 1051 ? 79.366  122.836 25.547  1.00 5.76  ? 1051 ALA A O     1 
ATOM   7989  C  CB    . ALA A 1 1051 ? 79.131  120.105 26.468  1.00 3.94  ? 1051 ALA A CB    1 
ATOM   7990  N  N     . ASN A 1 1052 ? 79.233  123.446 27.713  1.00 3.05  ? 1052 ASN A N     1 
ATOM   7991  C  CA    . ASN A 1 1052 ? 78.881  124.857 27.472  1.00 3.02  ? 1052 ASN A CA    1 
ATOM   7992  C  C     . ASN A 1 1052 ? 77.436  125.167 27.024  1.00 2.77  ? 1052 ASN A C     1 
ATOM   7993  O  O     . ASN A 1 1052 ? 77.163  126.253 26.477  1.00 2.90  ? 1052 ASN A O     1 
ATOM   7994  C  CB    . ASN A 1 1052 ? 79.876  125.501 26.487  1.00 2.39  ? 1052 ASN A CB    1 
ATOM   7995  C  CG    . ASN A 1 1052 ? 80.252  126.919 26.869  1.00 4.82  ? 1052 ASN A CG    1 
ATOM   7996  O  OD1   . ASN A 1 1052 ? 80.521  127.755 25.995  1.00 9.33  ? 1052 ASN A OD1   1 
ATOM   7997  N  ND2   . ASN A 1 1052 ? 80.307  127.198 28.161  1.00 1.98  ? 1052 ASN A ND2   1 
ATOM   7998  N  N     . ALA A 1 1053 ? 76.531  124.216 27.232  1.00 2.52  ? 1053 ALA A N     1 
ATOM   7999  C  CA    . ALA A 1 1053 ? 75.096  124.458 27.047  1.00 3.24  ? 1053 ALA A CA    1 
ATOM   8000  C  C     . ALA A 1 1053 ? 74.631  125.542 28.020  1.00 3.90  ? 1053 ALA A C     1 
ATOM   8001  O  O     . ALA A 1 1053 ? 75.193  125.673 29.121  1.00 4.00  ? 1053 ALA A O     1 
ATOM   8002  C  CB    . ALA A 1 1053 ? 74.305  123.191 27.287  1.00 2.88  ? 1053 ALA A CB    1 
ATOM   8003  N  N     . ASP A 1 1054 ? 73.608  126.288 27.613  1.00 4.07  ? 1054 ASP A N     1 
ATOM   8004  C  CA    . ASP A 1 1054 ? 72.986  127.317 28.443  1.00 5.10  ? 1054 ASP A CA    1 
ATOM   8005  C  C     . ASP A 1 1054 ? 71.769  126.788 29.180  1.00 5.44  ? 1054 ASP A C     1 
ATOM   8006  O  O     . ASP A 1 1054 ? 71.447  127.266 30.274  1.00 5.39  ? 1054 ASP A O     1 
ATOM   8007  C  CB    . ASP A 1 1054 ? 72.538  128.483 27.582  1.00 4.72  ? 1054 ASP A CB    1 
ATOM   8008  C  CG    . ASP A 1 1054 ? 73.679  129.107 26.848  1.00 6.96  ? 1054 ASP A CG    1 
ATOM   8009  O  OD1   . ASP A 1 1054 ? 74.469  129.840 27.492  1.00 6.87  ? 1054 ASP A OD1   1 
ATOM   8010  O  OD2   . ASP A 1 1054 ? 73.871  128.887 25.631  1.00 7.54  ? 1054 ASP A OD2   1 
ATOM   8011  N  N     . ILE A 1 1055 ? 71.109  125.806 28.570  1.00 5.36  ? 1055 ILE A N     1 
ATOM   8012  C  CA    . ILE A 1 1055 ? 69.851  125.246 29.077  1.00 6.01  ? 1055 ILE A CA    1 
ATOM   8013  C  C     . ILE A 1 1055 ? 69.801  123.739 28.877  1.00 5.84  ? 1055 ILE A C     1 
ATOM   8014  O  O     . ILE A 1 1055 ? 70.298  123.212 27.865  1.00 6.02  ? 1055 ILE A O     1 
ATOM   8015  C  CB    . ILE A 1 1055 ? 68.653  125.890 28.324  1.00 6.41  ? 1055 ILE A CB    1 
ATOM   8016  C  CG1   . ILE A 1 1055 ? 68.657  127.419 28.488  1.00 5.48  ? 1055 ILE A CG1   1 
ATOM   8017  C  CG2   . ILE A 1 1055 ? 67.293  125.265 28.742  1.00 6.84  ? 1055 ILE A CG2   1 
ATOM   8018  C  CD1   . ILE A 1 1055 ? 67.965  128.150 27.350  1.00 8.37  ? 1055 ILE A CD1   1 
ATOM   8019  N  N     . ILE A 1 1056 ? 69.169  123.049 29.819  1.00 5.44  ? 1056 ILE A N     1 
ATOM   8020  C  CA    . ILE A 1 1056 ? 68.872  121.638 29.654  1.00 5.63  ? 1056 ILE A CA    1 
ATOM   8021  C  C     . ILE A 1 1056 ? 67.390  121.415 29.863  1.00 5.87  ? 1056 ILE A C     1 
ATOM   8022  O  O     . ILE A 1 1056 ? 66.833  121.790 30.893  1.00 6.33  ? 1056 ILE A O     1 
ATOM   8023  C  CB    . ILE A 1 1056 ? 69.698  120.741 30.618  1.00 5.10  ? 1056 ILE A CB    1 
ATOM   8024  C  CG1   . ILE A 1 1056 ? 71.197  120.935 30.371  1.00 6.06  ? 1056 ILE A CG1   1 
ATOM   8025  C  CG2   . ILE A 1 1056 ? 69.280  119.211 30.452  1.00 5.95  ? 1056 ILE A CG2   1 
ATOM   8026  C  CD1   . ILE A 1 1056 ? 72.120  120.329 31.460  1.00 8.48  ? 1056 ILE A CD1   1 
ATOM   8027  N  N     . GLN A 1 1057 ? 66.761  120.824 28.855  1.00 5.87  ? 1057 GLN A N     1 
ATOM   8028  C  CA    . GLN A 1 1057 ? 65.379  120.378 28.955  1.00 7.32  ? 1057 GLN A CA    1 
ATOM   8029  C  C     . GLN A 1 1057 ? 65.318  118.907 29.340  1.00 6.39  ? 1057 GLN A C     1 
ATOM   8030  O  O     . GLN A 1 1057 ? 65.946  118.064 28.702  1.00 6.18  ? 1057 GLN A O     1 
ATOM   8031  C  CB    . GLN A 1 1057 ? 64.615  120.602 27.643  1.00 7.36  ? 1057 GLN A CB    1 
ATOM   8032  C  CG    . GLN A 1 1057 ? 63.175  120.016 27.711  1.00 11.20 ? 1057 GLN A CG    1 
ATOM   8033  C  CD    . GLN A 1 1057 ? 62.223  120.694 26.775  1.00 15.51 ? 1057 GLN A CD    1 
ATOM   8034  O  OE1   . GLN A 1 1057 ? 62.270  121.916 26.607  1.00 15.66 ? 1057 GLN A OE1   1 
ATOM   8035  N  NE2   . GLN A 1 1057 ? 61.326  119.913 26.171  1.00 17.71 ? 1057 GLN A NE2   1 
ATOM   8036  N  N     . ILE A 1 1058 ? 64.570  118.617 30.401  1.00 6.40  ? 1058 ILE A N     1 
ATOM   8037  C  CA    . ILE A 1 1058 ? 64.259  117.247 30.772  1.00 5.69  ? 1058 ILE A CA    1 
ATOM   8038  C  C     . ILE A 1 1058 ? 62.808  116.914 30.352  1.00 5.80  ? 1058 ILE A C     1 
ATOM   8039  O  O     . ILE A 1 1058 ? 61.863  117.477 30.897  1.00 5.80  ? 1058 ILE A O     1 
ATOM   8040  C  CB    . ILE A 1 1058 ? 64.455  117.032 32.296  1.00 5.80  ? 1058 ILE A CB    1 
ATOM   8041  C  CG1   . ILE A 1 1058 ? 65.900  117.318 32.735  1.00 6.70  ? 1058 ILE A CG1   1 
ATOM   8042  C  CG2   . ILE A 1 1058 ? 64.119  115.584 32.648  1.00 5.13  ? 1058 ILE A CG2   1 
ATOM   8043  C  CD1   . ILE A 1 1058 ? 66.086  118.534 33.688  1.00 7.10  ? 1058 ILE A CD1   1 
ATOM   8044  N  N     . SER A 1 1059 ? 62.638  116.018 29.381  1.00 5.99  ? 1059 SER A N     1 
ATOM   8045  C  CA    . SER A 1 1059 ? 61.305  115.540 28.972  1.00 6.88  ? 1059 SER A CA    1 
ATOM   8046  C  C     . SER A 1 1059 ? 60.900  114.227 29.616  1.00 6.83  ? 1059 SER A C     1 
ATOM   8047  O  O     . SER A 1 1059 ? 61.684  113.288 29.642  1.00 6.27  ? 1059 SER A O     1 
ATOM   8048  C  CB    . SER A 1 1059 ? 61.248  115.336 27.459  1.00 7.06  ? 1059 SER A CB    1 
ATOM   8049  O  OG    . SER A 1 1059 ? 61.454  116.565 26.812  1.00 8.50  ? 1059 SER A OG    1 
ATOM   8050  N  N     . GLY A 1 1060 ? 59.659  114.165 30.092  1.00 7.16  ? 1060 GLY A N     1 
ATOM   8051  C  CA    . GLY A 1 1060 ? 59.108  112.970 30.702  1.00 7.09  ? 1060 GLY A CA    1 
ATOM   8052  C  C     . GLY A 1 1060 ? 58.615  111.948 29.699  1.00 7.62  ? 1060 GLY A C     1 
ATOM   8053  O  O     . GLY A 1 1060 ? 58.277  112.329 28.577  1.00 7.63  ? 1060 GLY A O     1 
ATOM   8054  N  N     . HIS A 1 1061 ? 58.580  110.672 30.115  1.00 7.43  ? 1061 HIS A N     1 
ATOM   8055  C  CA    . HIS A 1 1061 ? 58.111  109.525 29.305  1.00 8.47  ? 1061 HIS A CA    1 
ATOM   8056  C  C     . HIS A 1 1061 ? 56.698  109.749 28.777  1.00 8.56  ? 1061 HIS A C     1 
ATOM   8057  O  O     . HIS A 1 1061 ? 56.231  109.086 27.856  1.00 8.40  ? 1061 HIS A O     1 
ATOM   8058  C  CB    . HIS A 1 1061 ? 58.095  108.256 30.166  1.00 7.90  ? 1061 HIS A CB    1 
ATOM   8059  C  CG    . HIS A 1 1061 ? 56.901  108.139 31.072  1.00 8.43  ? 1061 HIS A CG    1 
ATOM   8060  N  ND1   . HIS A 1 1061 ? 56.720  108.935 32.187  1.00 8.54  ? 1061 HIS A ND1   1 
ATOM   8061  C  CD2   . HIS A 1 1061 ? 55.832  107.306 31.031  1.00 8.90  ? 1061 HIS A CD2   1 
ATOM   8062  C  CE1   . HIS A 1 1061 ? 55.586  108.603 32.783  1.00 9.65  ? 1061 HIS A CE1   1 
ATOM   8063  N  NE2   . HIS A 1 1061 ? 55.025  107.620 32.097  1.00 8.87  ? 1061 HIS A NE2   1 
ATOM   8064  N  N     . ASP A 1 1062 ? 56.076  110.723 29.414  1.00 8.36  ? 1062 ASP A N     1 
ATOM   8065  C  CA    . ASP A 1 1062 ? 54.710  111.184 29.285  1.00 9.37  ? 1062 ASP A CA    1 
ATOM   8066  C  C     . ASP A 1 1062 ? 54.244  111.890 28.001  1.00 8.20  ? 1062 ASP A C     1 
ATOM   8067  O  O     . ASP A 1 1062 ? 53.046  111.880 27.651  1.00 7.51  ? 1062 ASP A O     1 
ATOM   8068  C  CB    . ASP A 1 1062 ? 54.586  112.250 30.401  1.00 10.46 ? 1062 ASP A CB    1 
ATOM   8069  C  CG    . ASP A 1 1062 ? 53.455  111.982 31.224  1.00 12.59 ? 1062 ASP A CG    1 
ATOM   8070  O  OD1   . ASP A 1 1062 ? 52.867  110.949 30.869  1.00 16.13 ? 1062 ASP A OD1   1 
ATOM   8071  O  OD2   . ASP A 1 1062 ? 53.069  112.660 32.197  1.00 15.27 ? 1062 ASP A OD2   1 
ATOM   8072  N  N     . GLY A 1 1063 ? 55.182  112.566 27.358  1.00 7.44  ? 1063 GLY A N     1 
ATOM   8073  C  CA    . GLY A 1 1063 ? 54.862  113.620 26.417  1.00 6.50  ? 1063 GLY A CA    1 
ATOM   8074  C  C     . GLY A 1 1063 ? 54.228  113.140 25.143  1.00 6.33  ? 1063 GLY A C     1 
ATOM   8075  O  O     . GLY A 1 1063 ? 54.365  111.972 24.760  1.00 5.65  ? 1063 GLY A O     1 
ATOM   8076  N  N     . GLY A 1 1064 ? 53.550  114.070 24.479  1.00 5.82  ? 1064 GLY A N     1 
ATOM   8077  C  CA    . GLY A 1 1064 ? 52.826  113.787 23.254  1.00 5.79  ? 1064 GLY A CA    1 
ATOM   8078  C  C     . GLY A 1 1064 ? 53.722  113.575 22.051  1.00 5.45  ? 1064 GLY A C     1 
ATOM   8079  O  O     . GLY A 1 1064 ? 54.943  113.737 22.123  1.00 5.10  ? 1064 GLY A O     1 
ATOM   8080  N  N     . THR A 1 1065 ? 53.085  113.196 20.945  1.00 5.91  ? 1065 THR A N     1 
ATOM   8081  C  CA    . THR A 1 1065 ? 53.752  112.941 19.670  1.00 6.01  ? 1065 THR A CA    1 
ATOM   8082  C  C     . THR A 1 1065 ? 52.722  112.853 18.552  1.00 5.50  ? 1065 THR A C     1 
ATOM   8083  O  O     . THR A 1 1065 ? 51.593  112.448 18.780  1.00 5.28  ? 1065 THR A O     1 
ATOM   8084  C  CB    . THR A 1 1065 ? 54.566  111.630 19.734  1.00 5.90  ? 1065 THR A CB    1 
ATOM   8085  O  OG1   . THR A 1 1065 ? 55.080  111.319 18.435  1.00 6.72  ? 1065 THR A OG1   1 
ATOM   8086  C  CG2   . THR A 1 1065 ? 53.653  110.411 20.111  1.00 5.16  ? 1065 THR A CG2   1 
ATOM   8087  N  N     . GLY A 1 1066 ? 53.111  113.229 17.337  1.00 5.71  ? 1066 GLY A N     1 
ATOM   8088  C  CA    . GLY A 1 1066 ? 52.205  113.083 16.213  1.00 5.51  ? 1066 GLY A CA    1 
ATOM   8089  C  C     . GLY A 1 1066 ? 52.267  111.706 15.575  1.00 4.70  ? 1066 GLY A C     1 
ATOM   8090  O  O     . GLY A 1 1066 ? 51.406  111.367 14.755  1.00 4.63  ? 1066 GLY A O     1 
ATOM   8091  N  N     . ALA A 1 1067 ? 53.300  110.937 15.916  1.00 4.10  ? 1067 ALA A N     1 
ATOM   8092  C  CA    . ALA A 1 1067 ? 53.474  109.572 15.409  1.00 4.59  ? 1067 ALA A CA    1 
ATOM   8093  C  C     . ALA A 1 1067 ? 54.659  108.912 16.087  1.00 4.88  ? 1067 ALA A C     1 
ATOM   8094  O  O     . ALA A 1 1067 ? 55.773  109.416 15.980  1.00 4.12  ? 1067 ALA A O     1 
ATOM   8095  C  CB    . ALA A 1 1067 ? 53.718  109.572 13.852  1.00 4.87  ? 1067 ALA A CB    1 
ATOM   8096  N  N     . SER A 1 1068 ? 54.424  107.763 16.728  1.00 5.08  ? 1068 SER A N     1 
ATOM   8097  C  CA    . SER A 1 1068 ? 55.494  106.965 17.367  1.00 5.63  ? 1068 SER A CA    1 
ATOM   8098  C  C     . SER A 1 1068 ? 55.034  105.518 17.432  1.00 5.96  ? 1068 SER A C     1 
ATOM   8099  O  O     . SER A 1 1068 ? 53.826  105.244 17.469  1.00 5.70  ? 1068 SER A O     1 
ATOM   8100  C  CB    . SER A 1 1068 ? 55.769  107.430 18.818  1.00 5.24  ? 1068 SER A CB    1 
ATOM   8101  O  OG    . SER A 1 1068 ? 56.364  108.731 18.887  1.00 7.33  ? 1068 SER A OG    1 
ATOM   8102  N  N     . PRO A 1 1069 ? 55.972  104.576 17.527  1.00 6.34  ? 1069 PRO A N     1 
ATOM   8103  C  CA    . PRO A 1 1069 ? 55.587  103.190 17.796  1.00 5.86  ? 1069 PRO A CA    1 
ATOM   8104  C  C     . PRO A 1 1069 ? 54.835  103.134 19.131  1.00 5.45  ? 1069 PRO A C     1 
ATOM   8105  O  O     . PRO A 1 1069 ? 55.233  103.827 20.077  1.00 5.26  ? 1069 PRO A O     1 
ATOM   8106  C  CB    . PRO A 1 1069 ? 56.940  102.464 17.921  1.00 6.10  ? 1069 PRO A CB    1 
ATOM   8107  C  CG    . PRO A 1 1069 ? 57.893  103.335 17.161  1.00 6.37  ? 1069 PRO A CG    1 
ATOM   8108  C  CD    . PRO A 1 1069 ? 57.437  104.742 17.443  1.00 5.81  ? 1069 PRO A CD    1 
ATOM   8109  N  N     . LEU A 1 1070 ? 53.761  102.347 19.189  1.00 4.55  ? 1070 LEU A N     1 
ATOM   8110  C  CA    . LEU A 1 1070 ? 52.995  102.185 20.421  1.00 4.92  ? 1070 LEU A CA    1 
ATOM   8111  C  C     . LEU A 1 1070 ? 53.843  101.588 21.541  1.00 4.67  ? 1070 LEU A C     1 
ATOM   8112  O  O     . LEU A 1 1070 ? 53.701  101.964 22.694  1.00 4.23  ? 1070 LEU A O     1 
ATOM   8113  C  CB    . LEU A 1 1070 ? 51.746  101.331 20.179  1.00 4.07  ? 1070 LEU A CB    1 
ATOM   8114  C  CG    . LEU A 1 1070 ? 50.792  101.098 21.363  1.00 6.23  ? 1070 LEU A CG    1 
ATOM   8115  C  CD1   . LEU A 1 1070 ? 50.201  102.399 21.933  1.00 5.10  ? 1070 LEU A CD1   1 
ATOM   8116  C  CD2   . LEU A 1 1070 ? 49.695  100.121 20.972  1.00 2.68  ? 1070 LEU A CD2   1 
ATOM   8117  N  N     . SER A 1 1071 ? 54.731  100.660 21.191  1.00 4.83  ? 1071 SER A N     1 
ATOM   8118  C  CA    . SER A 1 1071 ? 55.654  100.086 22.170  1.00 5.09  ? 1071 SER A CA    1 
ATOM   8119  C  C     . SER A 1 1071 ? 56.520  101.161 22.823  1.00 4.61  ? 1071 SER A C     1 
ATOM   8120  O  O     . SER A 1 1071 ? 56.750  101.140 24.031  1.00 5.50  ? 1071 SER A O     1 
ATOM   8121  C  CB    . SER A 1 1071 ? 56.525  99.018  21.500  1.00 4.58  ? 1071 SER A CB    1 
ATOM   8122  O  OG    . SER A 1 1071 ? 57.400  99.628  20.557  1.00 5.86  ? 1071 SER A OG    1 
ATOM   8123  N  N     . SER A 1 1072 ? 56.977  102.122 22.028  1.00 4.98  ? 1072 SER A N     1 
ATOM   8124  C  CA    . SER A 1 1072 ? 57.855  103.181 22.516  1.00 4.68  ? 1072 SER A CA    1 
ATOM   8125  C  C     . SER A 1 1072 ? 57.092  104.119 23.431  1.00 5.06  ? 1072 SER A C     1 
ATOM   8126  O  O     . SER A 1 1072 ? 57.601  104.513 24.512  1.00 4.36  ? 1072 SER A O     1 
ATOM   8127  C  CB    . SER A 1 1072 ? 58.454  103.963 21.343  1.00 5.15  ? 1072 SER A CB    1 
ATOM   8128  O  OG    . SER A 1 1072 ? 59.208  103.099 20.515  1.00 4.57  ? 1072 SER A OG    1 
ATOM   8129  N  N     . ILE A 1 1073 ? 55.860  104.446 23.031  1.00 4.04  ? 1073 ILE A N     1 
ATOM   8130  C  CA    . ILE A 1 1073 ? 54.977  105.265 23.879  1.00 4.28  ? 1073 ILE A CA    1 
ATOM   8131  C  C     . ILE A 1 1073 ? 54.768  104.623 25.265  1.00 4.04  ? 1073 ILE A C     1 
ATOM   8132  O  O     . ILE A 1 1073 ? 54.724  105.326 26.285  1.00 4.15  ? 1073 ILE A O     1 
ATOM   8133  C  CB    . ILE A 1 1073 ? 53.591  105.515 23.188  1.00 4.01  ? 1073 ILE A CB    1 
ATOM   8134  C  CG1   . ILE A 1 1073 ? 53.742  106.489 22.000  1.00 4.22  ? 1073 ILE A CG1   1 
ATOM   8135  C  CG2   . ILE A 1 1073 ? 52.528  106.017 24.227  1.00 5.25  ? 1073 ILE A CG2   1 
ATOM   8136  C  CD1   . ILE A 1 1073 ? 52.593  106.403 20.948  1.00 5.04  ? 1073 ILE A CD1   1 
ATOM   8137  N  N     . LYS A 1 1074 ? 54.603  103.294 25.294  1.00 3.87  ? 1074 LYS A N     1 
ATOM   8138  C  CA    . LYS A 1 1074 ? 54.281  102.599 26.533  1.00 4.15  ? 1074 LYS A CA    1 
ATOM   8139  C  C     . LYS A 1 1074 ? 55.509  102.147 27.351  1.00 4.47  ? 1074 LYS A C     1 
ATOM   8140  O  O     . LYS A 1 1074 ? 55.418  101.939 28.567  1.00 4.09  ? 1074 LYS A O     1 
ATOM   8141  C  CB    . LYS A 1 1074 ? 53.363  101.401 26.236  1.00 4.64  ? 1074 LYS A CB    1 
ATOM   8142  C  CG    . LYS A 1 1074 ? 51.977  101.800 25.681  1.00 4.68  ? 1074 LYS A CG    1 
ATOM   8143  C  CD    . LYS A 1 1074 ? 51.227  102.703 26.689  1.00 7.14  ? 1074 LYS A CD    1 
ATOM   8144  C  CE    . LYS A 1 1074 ? 49.791  103.015 26.240  1.00 7.59  ? 1074 LYS A CE    1 
ATOM   8145  N  NZ    . LYS A 1 1074 ? 48.984  103.676 27.321  1.00 8.24  ? 1074 LYS A NZ    1 
ATOM   8146  N  N     . HIS A 1 1075 ? 56.660  101.994 26.702  1.00 4.32  ? 1075 HIS A N     1 
ATOM   8147  C  CA    . HIS A 1 1075 ? 57.765  101.260 27.331  1.00 3.96  ? 1075 HIS A CA    1 
ATOM   8148  C  C     . HIS A 1 1075 ? 59.164  101.916 27.395  1.00 4.14  ? 1075 HIS A C     1 
ATOM   8149  O  O     . HIS A 1 1075 ? 60.066  101.367 28.015  1.00 4.16  ? 1075 HIS A O     1 
ATOM   8150  C  CB    . HIS A 1 1075 ? 57.884  99.882  26.667  1.00 3.85  ? 1075 HIS A CB    1 
ATOM   8151  C  CG    . HIS A 1 1075 ? 56.664  99.024  26.814  1.00 3.70  ? 1075 HIS A CG    1 
ATOM   8152  N  ND1   . HIS A 1 1075 ? 56.109  98.726  28.038  1.00 4.57  ? 1075 HIS A ND1   1 
ATOM   8153  C  CD2   . HIS A 1 1075 ? 55.898  98.394  25.889  1.00 4.11  ? 1075 HIS A CD2   1 
ATOM   8154  C  CE1   . HIS A 1 1075 ? 55.052  97.952  27.866  1.00 4.77  ? 1075 HIS A CE1   1 
ATOM   8155  N  NE2   . HIS A 1 1075 ? 54.909  97.725  26.570  1.00 6.31  ? 1075 HIS A NE2   1 
ATOM   8156  N  N     . ALA A 1 1076 ? 59.355  103.070 26.781  1.00 4.10  ? 1076 ALA A N     1 
ATOM   8157  C  CA    . ALA A 1 1076 ? 60.691  103.678 26.757  1.00 5.23  ? 1076 ALA A CA    1 
ATOM   8158  C  C     . ALA A 1 1076 ? 60.642  105.089 27.302  1.00 5.49  ? 1076 ALA A C     1 
ATOM   8159  O  O     . ALA A 1 1076 ? 59.902  105.934 26.779  1.00 6.47  ? 1076 ALA A O     1 
ATOM   8160  C  CB    . ALA A 1 1076 ? 61.266  103.661 25.332  1.00 4.54  ? 1076 ALA A CB    1 
ATOM   8161  N  N     . GLY A 1 1077 ? 61.437  105.338 28.339  1.00 5.04  ? 1077 GLY A N     1 
ATOM   8162  C  CA    . GLY A 1 1077 ? 61.498  106.630 28.996  1.00 5.31  ? 1077 GLY A CA    1 
ATOM   8163  C  C     . GLY A 1 1077 ? 60.925  106.585 30.406  1.00 5.41  ? 1077 GLY A C     1 
ATOM   8164  O  O     . GLY A 1 1077 ? 60.029  105.782 30.685  1.00 4.83  ? 1077 GLY A O     1 
ATOM   8165  N  N     . SER A 1 1078 ? 61.429  107.462 31.280  1.00 5.58  ? 1078 SER A N     1 
ATOM   8166  C  CA    . SER A 1 1078 ? 61.025  107.501 32.689  1.00 5.73  ? 1078 SER A CA    1 
ATOM   8167  C  C     . SER A 1 1078 ? 60.301  108.805 33.042  1.00 5.57  ? 1078 SER A C     1 
ATOM   8168  O  O     . SER A 1 1078 ? 60.355  109.761 32.271  1.00 5.33  ? 1078 SER A O     1 
ATOM   8169  C  CB    . SER A 1 1078 ? 62.260  107.313 33.589  1.00 5.86  ? 1078 SER A CB    1 
ATOM   8170  O  OG    . SER A 1 1078 ? 62.892  106.067 33.315  1.00 9.34  ? 1078 SER A OG    1 
ATOM   8171  N  N     . PRO A 1 1079 ? 59.632  108.857 34.207  1.00 5.91  ? 1079 PRO A N     1 
ATOM   8172  C  CA    . PRO A 1 1079 ? 58.949  110.079 34.662  1.00 5.31  ? 1079 PRO A CA    1 
ATOM   8173  C  C     . PRO A 1 1079 ? 59.875  111.275 34.775  1.00 5.64  ? 1079 PRO A C     1 
ATOM   8174  O  O     . PRO A 1 1079 ? 61.041  111.120 35.182  1.00 5.25  ? 1079 PRO A O     1 
ATOM   8175  C  CB    . PRO A 1 1079 ? 58.474  109.700 36.069  1.00 5.54  ? 1079 PRO A CB    1 
ATOM   8176  C  CG    . PRO A 1 1079 ? 58.320  108.218 36.017  1.00 5.04  ? 1079 PRO A CG    1 
ATOM   8177  C  CD    . PRO A 1 1079 ? 59.448  107.748 35.163  1.00 5.13  ? 1079 PRO A CD    1 
ATOM   8178  N  N     . TRP A 1 1080 ? 59.366  112.464 34.449  1.00 5.59  ? 1080 TRP A N     1 
ATOM   8179  C  CA    . TRP A 1 1080 ? 60.172  113.665 34.628  1.00 5.55  ? 1080 TRP A CA    1 
ATOM   8180  C  C     . TRP A 1 1080 ? 60.530  113.942 36.078  1.00 5.79  ? 1080 TRP A C     1 
ATOM   8181  O  O     . TRP A 1 1080 ? 61.591  114.523 36.335  1.00 6.35  ? 1080 TRP A O     1 
ATOM   8182  C  CB    . TRP A 1 1080 ? 59.584  114.909 33.933  1.00 5.85  ? 1080 TRP A CB    1 
ATOM   8183  C  CG    . TRP A 1 1080 ? 58.252  115.398 34.452  1.00 5.91  ? 1080 TRP A CG    1 
ATOM   8184  C  CD1   . TRP A 1 1080 ? 57.032  115.249 33.853  1.00 5.93  ? 1080 TRP A CD1   1 
ATOM   8185  C  CD2   . TRP A 1 1080 ? 58.019  116.159 35.651  1.00 5.21  ? 1080 TRP A CD2   1 
ATOM   8186  N  NE1   . TRP A 1 1080 ? 56.048  115.846 34.616  1.00 4.72  ? 1080 TRP A NE1   1 
ATOM   8187  C  CE2   . TRP A 1 1080 ? 56.625  116.407 35.729  1.00 6.30  ? 1080 TRP A CE2   1 
ATOM   8188  C  CE3   . TRP A 1 1080 ? 58.845  116.651 36.672  1.00 6.15  ? 1080 TRP A CE3   1 
ATOM   8189  C  CZ2   . TRP A 1 1080 ? 56.045  117.124 36.783  1.00 6.21  ? 1080 TRP A CZ2   1 
ATOM   8190  C  CZ3   . TRP A 1 1080 ? 58.273  117.352 37.728  1.00 3.93  ? 1080 TRP A CZ3   1 
ATOM   8191  C  CH2   . TRP A 1 1080 ? 56.886  117.584 37.782  1.00 4.87  ? 1080 TRP A CH2   1 
ATOM   8192  N  N     . GLU A 1 1081 ? 59.681  113.523 37.028  1.00 4.91  ? 1081 GLU A N     1 
ATOM   8193  C  CA    . GLU A 1 1081 ? 60.006  113.732 38.452  1.00 5.21  ? 1081 GLU A CA    1 
ATOM   8194  C  C     . GLU A 1 1081 ? 61.380  113.135 38.764  1.00 4.87  ? 1081 GLU A C     1 
ATOM   8195  O  O     . GLU A 1 1081 ? 62.174  113.728 39.460  1.00 4.49  ? 1081 GLU A O     1 
ATOM   8196  C  CB    . GLU A 1 1081 ? 58.958  113.114 39.384  1.00 5.17  ? 1081 GLU A CB    1 
ATOM   8197  C  CG    . GLU A 1 1081 ? 57.590  113.783 39.325  1.00 5.01  ? 1081 GLU A CG    1 
ATOM   8198  C  CD    . GLU A 1 1081 ? 56.616  113.120 38.367  1.00 4.12  ? 1081 GLU A CD    1 
ATOM   8199  O  OE1   . GLU A 1 1081 ? 57.018  112.573 37.323  1.00 4.84  ? 1081 GLU A OE1   1 
ATOM   8200  O  OE2   . GLU A 1 1081 ? 55.417  113.191 38.650  1.00 4.95  ? 1081 GLU A OE2   1 
ATOM   8201  N  N     . LEU A 1 1082 ? 61.625  111.943 38.249  1.00 4.96  ? 1082 LEU A N     1 
ATOM   8202  C  CA    . LEU A 1 1082 ? 62.911  111.300 38.423  1.00 5.39  ? 1082 LEU A CA    1 
ATOM   8203  C  C     . LEU A 1 1082 ? 64.011  112.014 37.658  1.00 5.04  ? 1082 LEU A C     1 
ATOM   8204  O  O     . LEU A 1 1082 ? 65.136  112.100 38.137  1.00 5.19  ? 1082 LEU A O     1 
ATOM   8205  C  CB    . LEU A 1 1082 ? 62.829  109.842 37.962  1.00 4.95  ? 1082 LEU A CB    1 
ATOM   8206  C  CG    . LEU A 1 1082 ? 61.960  108.943 38.850  1.00 5.19  ? 1082 LEU A CG    1 
ATOM   8207  C  CD1   . LEU A 1 1082 ? 61.836  107.569 38.193  1.00 5.26  ? 1082 LEU A CD1   1 
ATOM   8208  C  CD2   . LEU A 1 1082 ? 62.547  108.837 40.252  1.00 6.03  ? 1082 LEU A CD2   1 
ATOM   8209  N  N     . GLY A 1 1083 ? 63.696  112.489 36.450  1.00 4.94  ? 1083 GLY A N     1 
ATOM   8210  C  CA    . GLY A 1 1083 ? 64.686  113.134 35.607  1.00 4.72  ? 1083 GLY A CA    1 
ATOM   8211  C  C     . GLY A 1 1083 ? 65.153  114.482 36.125  1.00 4.86  ? 1083 GLY A C     1 
ATOM   8212  O  O     . GLY A 1 1083 ? 66.356  114.727 36.196  1.00 4.29  ? 1083 GLY A O     1 
ATOM   8213  N  N     . VAL A 1 1084 ? 64.195  115.347 36.480  1.00 4.89  ? 1084 VAL A N     1 
ATOM   8214  C  CA    . VAL A 1 1084 ? 64.458  116.739 36.891  1.00 4.10  ? 1084 VAL A CA    1 
ATOM   8215  C  C     . VAL A 1 1084 ? 65.234  116.735 38.191  1.00 4.73  ? 1084 VAL A C     1 
ATOM   8216  O  O     . VAL A 1 1084 ? 66.222  117.421 38.401  1.00 4.73  ? 1084 VAL A O     1 
ATOM   8217  C  CB    . VAL A 1 1084 ? 63.105  117.495 37.075  1.00 3.98  ? 1084 VAL A CB    1 
ATOM   8218  C  CG1   . VAL A 1 1084 ? 63.283  118.863 37.777  1.00 2.74  ? 1084 VAL A CG1   1 
ATOM   8219  C  CG2   . VAL A 1 1084 ? 62.389  117.645 35.720  1.00 2.86  ? 1084 VAL A CG2   1 
ATOM   8220  N  N     . THR A 1 1085 ? 64.723  115.931 39.084  1.00 4.66  ? 1085 THR A N     1 
ATOM   8221  C  CA    . THR A 1 1085 ? 65.297  115.713 40.371  1.00 5.46  ? 1085 THR A CA    1 
ATOM   8222  C  C     . THR A 1 1085 ? 66.765  115.157 40.290  1.00 5.39  ? 1085 THR A C     1 
ATOM   8223  O  O     . THR A 1 1085 ? 67.671  115.701 40.940  1.00 4.55  ? 1085 THR A O     1 
ATOM   8224  C  CB    . THR A 1 1085 ? 64.229  114.800 41.003  1.00 5.87  ? 1085 THR A CB    1 
ATOM   8225  O  OG1   . THR A 1 1085 ? 63.726  115.351 42.226  1.00 9.58  ? 1085 THR A OG1   1 
ATOM   8226  C  CG2   . THR A 1 1085 ? 64.615  113.398 41.179  1.00 2.31  ? 1085 THR A CG2   1 
ATOM   8227  N  N     . GLU A 1 1086 ? 66.999  114.131 39.466  1.00 5.17  ? 1086 GLU A N     1 
ATOM   8228  C  CA    . GLU A 1 1086 ? 68.350  113.584 39.262  1.00 5.46  ? 1086 GLU A CA    1 
ATOM   8229  C  C     . GLU A 1 1086 ? 69.304  114.617 38.627  1.00 5.18  ? 1086 GLU A C     1 
ATOM   8230  O  O     . GLU A 1 1086 ? 70.439  114.776 39.059  1.00 4.94  ? 1086 GLU A O     1 
ATOM   8231  C  CB    . GLU A 1 1086 ? 68.313  112.301 38.407  1.00 5.43  ? 1086 GLU A CB    1 
ATOM   8232  C  CG    . GLU A 1 1086 ? 69.690  111.673 38.133  1.00 6.99  ? 1086 GLU A CG    1 
ATOM   8233  C  CD    . GLU A 1 1086 ? 69.621  110.477 37.188  1.00 11.25 ? 1086 GLU A CD    1 
ATOM   8234  O  OE1   . GLU A 1 1086 ? 70.654  110.133 36.562  1.00 8.88  ? 1086 GLU A OE1   1 
ATOM   8235  O  OE2   . GLU A 1 1086 ? 68.527  109.873 37.078  1.00 12.14 ? 1086 GLU A OE2   1 
ATOM   8236  N  N     . VAL A 1 1087 ? 68.834  115.331 37.615  1.00 4.63  ? 1087 VAL A N     1 
ATOM   8237  C  CA    . VAL A 1 1087 ? 69.680  116.354 37.000  1.00 4.21  ? 1087 VAL A CA    1 
ATOM   8238  C  C     . VAL A 1 1087 ? 70.003  117.489 37.978  1.00 4.31  ? 1087 VAL A C     1 
ATOM   8239  O  O     . VAL A 1 1087 ? 71.174  117.871 38.108  1.00 3.81  ? 1087 VAL A O     1 
ATOM   8240  C  CB    . VAL A 1 1087 ? 69.087  116.882 35.681  1.00 4.16  ? 1087 VAL A CB    1 
ATOM   8241  C  CG1   . VAL A 1 1087 ? 69.875  118.097 35.176  1.00 2.73  ? 1087 VAL A CG1   1 
ATOM   8242  C  CG2   . VAL A 1 1087 ? 69.100  115.778 34.648  1.00 3.63  ? 1087 VAL A CG2   1 
ATOM   8243  N  N     . HIS A 1 1088 ? 68.984  117.982 38.681  1.00 3.88  ? 1088 HIS A N     1 
ATOM   8244  C  CA    . HIS A 1 1088 ? 69.177  119.053 39.659  1.00 5.09  ? 1088 HIS A CA    1 
ATOM   8245  C  C     . HIS A 1 1088 ? 70.198  118.653 40.719  1.00 4.82  ? 1088 HIS A C     1 
ATOM   8246  O  O     . HIS A 1 1088 ? 71.148  119.395 40.993  1.00 4.84  ? 1088 HIS A O     1 
ATOM   8247  C  CB    . HIS A 1 1088 ? 67.843  119.448 40.323  1.00 4.76  ? 1088 HIS A CB    1 
ATOM   8248  C  CG    . HIS A 1 1088 ? 67.987  120.512 41.365  1.00 4.40  ? 1088 HIS A CG    1 
ATOM   8249  N  ND1   . HIS A 1 1088 ? 68.388  121.794 41.063  1.00 3.70  ? 1088 HIS A ND1   1 
ATOM   8250  C  CD2   . HIS A 1 1088 ? 67.779  120.486 42.703  1.00 2.64  ? 1088 HIS A CD2   1 
ATOM   8251  C  CE1   . HIS A 1 1088 ? 68.441  122.509 42.174  1.00 4.81  ? 1088 HIS A CE1   1 
ATOM   8252  N  NE2   . HIS A 1 1088 ? 68.074  121.738 43.184  1.00 4.85  ? 1088 HIS A NE2   1 
ATOM   8253  N  N     . ARG A 1 1089 ? 69.997  117.479 41.309  1.00 5.11  ? 1089 ARG A N     1 
ATOM   8254  C  CA    . ARG A 1 1089 ? 70.918  116.953 42.330  1.00 4.88  ? 1089 ARG A CA    1 
ATOM   8255  C  C     . ARG A 1 1089 ? 72.347  116.848 41.816  1.00 4.45  ? 1089 ARG A C     1 
ATOM   8256  O  O     . ARG A 1 1089 ? 73.260  117.367 42.444  1.00 3.97  ? 1089 ARG A O     1 
ATOM   8257  C  CB    . ARG A 1 1089 ? 70.475  115.569 42.826  1.00 5.47  ? 1089 ARG A CB    1 
ATOM   8258  C  CG    . ARG A 1 1089 ? 71.422  115.007 43.902  1.00 7.71  ? 1089 ARG A CG    1 
ATOM   8259  C  CD    . ARG A 1 1089 ? 71.079  113.599 44.427  1.00 12.32 ? 1089 ARG A CD    1 
ATOM   8260  N  NE    . ARG A 1 1089 ? 69.649  113.329 44.326  1.00 16.51 ? 1089 ARG A NE    1 
ATOM   8261  C  CZ    . ARG A 1 1089 ? 68.891  112.865 45.315  1.00 17.61 ? 1089 ARG A CZ    1 
ATOM   8262  N  NH1   . ARG A 1 1089 ? 69.423  112.597 46.513  1.00 21.77 ? 1089 ARG A NH1   1 
ATOM   8263  N  NH2   . ARG A 1 1089 ? 67.591  112.661 45.109  1.00 13.78 ? 1089 ARG A NH2   1 
ATOM   8264  N  N     . VAL A 1 1090 ? 72.532  116.154 40.689  1.00 4.58  ? 1090 VAL A N     1 
ATOM   8265  C  CA    . VAL A 1 1090 ? 73.873  115.915 40.138  1.00 4.26  ? 1090 VAL A CA    1 
ATOM   8266  C  C     . VAL A 1 1090 ? 74.597  117.203 39.788  1.00 4.08  ? 1090 VAL A C     1 
ATOM   8267  O  O     . VAL A 1 1090 ? 75.787  117.340 40.104  1.00 3.93  ? 1090 VAL A O     1 
ATOM   8268  C  CB    . VAL A 1 1090 ? 73.851  114.910 38.937  1.00 5.04  ? 1090 VAL A CB    1 
ATOM   8269  C  CG1   . VAL A 1 1090 ? 75.241  114.780 38.297  1.00 4.33  ? 1090 VAL A CG1   1 
ATOM   8270  C  CG2   . VAL A 1 1090 ? 73.394  113.517 39.434  1.00 4.68  ? 1090 VAL A CG2   1 
ATOM   8271  N  N     . LEU A 1 1091 ? 73.886  118.157 39.186  1.00 3.28  ? 1091 LEU A N     1 
ATOM   8272  C  CA    . LEU A 1 1091 ? 74.482  119.471 38.853  1.00 3.68  ? 1091 LEU A CA    1 
ATOM   8273  C  C     . LEU A 1 1091 ? 74.912  120.233 40.098  1.00 3.91  ? 1091 LEU A C     1 
ATOM   8274  O  O     . LEU A 1 1091 ? 76.018  120.770 40.150  1.00 3.52  ? 1091 LEU A O     1 
ATOM   8275  C  CB    . LEU A 1 1091 ? 73.537  120.333 38.013  1.00 2.75  ? 1091 LEU A CB    1 
ATOM   8276  C  CG    . LEU A 1 1091 ? 73.333  119.896 36.552  1.00 5.02  ? 1091 LEU A CG    1 
ATOM   8277  C  CD1   . LEU A 1 1091 ? 72.262  120.756 35.883  1.00 4.31  ? 1091 LEU A CD1   1 
ATOM   8278  C  CD2   . LEU A 1 1091 ? 74.634  119.938 35.740  1.00 5.50  ? 1091 LEU A CD2   1 
ATOM   8279  N  N     . MET A 1 1092 ? 74.040  120.263 41.109  1.00 4.23  ? 1092 MET A N     1 
ATOM   8280  C  CA    . MET A 1 1092 ? 74.359  120.939 42.363  1.00 4.95  ? 1092 MET A CA    1 
ATOM   8281  C  C     . MET A 1 1092 ? 75.568  120.297 43.031  1.00 4.55  ? 1092 MET A C     1 
ATOM   8282  O  O     . MET A 1 1092 ? 76.453  120.989 43.508  1.00 4.78  ? 1092 MET A O     1 
ATOM   8283  C  CB    . MET A 1 1092 ? 73.158  120.870 43.314  1.00 5.92  ? 1092 MET A CB    1 
ATOM   8284  C  CG    . MET A 1 1092 ? 71.980  121.667 42.816  1.00 7.28  ? 1092 MET A CG    1 
ATOM   8285  S  SD    . MET A 1 1092 ? 72.086  123.268 43.449  1.00 14.39 ? 1092 MET A SD    1 
ATOM   8286  C  CE    . MET A 1 1092 ? 71.122  122.977 44.889  1.00 10.48 ? 1092 MET A CE    1 
ATOM   8287  N  N     . GLU A 1 1093 ? 75.605  118.969 43.063  1.00 4.54  ? 1093 GLU A N     1 
ATOM   8288  C  CA    . GLU A 1 1093 ? 76.698  118.281 43.751  1.00 5.10  ? 1093 GLU A CA    1 
ATOM   8289  C  C     . GLU A 1 1093 ? 78.036  118.469 43.035  1.00 4.59  ? 1093 GLU A C     1 
ATOM   8290  O  O     . GLU A 1 1093 ? 79.063  118.465 43.677  1.00 4.69  ? 1093 GLU A O     1 
ATOM   8291  C  CB    . GLU A 1 1093 ? 76.365  116.793 43.995  1.00 5.13  ? 1093 GLU A CB    1 
ATOM   8292  C  CG    . GLU A 1 1093 ? 75.165  116.608 44.940  1.00 7.07  ? 1093 GLU A CG    1 
ATOM   8293  C  CD    . GLU A 1 1093 ? 75.394  117.210 46.324  1.00 10.20 ? 1093 GLU A CD    1 
ATOM   8294  O  OE1   . GLU A 1 1093 ? 75.184  118.448 46.534  1.00 12.55 ? 1093 GLU A OE1   1 
ATOM   8295  O  OE2   . GLU A 1 1093 ? 75.806  116.450 47.212  1.00 9.28  ? 1093 GLU A OE2   1 
ATOM   8296  N  N     . ASN A 1 1094 ? 78.003  118.637 41.712  1.00 4.35  ? 1094 ASN A N     1 
ATOM   8297  C  CA    . ASN A 1 1094 ? 79.197  118.949 40.928  1.00 4.27  ? 1094 ASN A CA    1 
ATOM   8298  C  C     . ASN A 1 1094 ? 79.523  120.444 40.838  1.00 4.48  ? 1094 ASN A C     1 
ATOM   8299  O  O     . ASN A 1 1094 ? 80.467  120.808 40.143  1.00 4.28  ? 1094 ASN A O     1 
ATOM   8300  C  CB    . ASN A 1 1094 ? 79.073  118.398 39.507  1.00 3.79  ? 1094 ASN A CB    1 
ATOM   8301  C  CG    . ASN A 1 1094 ? 79.368  116.915 39.426  1.00 4.84  ? 1094 ASN A CG    1 
ATOM   8302  O  OD1   . ASN A 1 1094 ? 80.520  116.501 39.472  1.00 5.68  ? 1094 ASN A OD1   1 
ATOM   8303  N  ND2   . ASN A 1 1094 ? 78.330  116.116 39.313  1.00 2.24  ? 1094 ASN A ND2   1 
ATOM   8304  N  N     . GLN A 1 1095 ? 78.743  121.299 41.510  1.00 4.53  ? 1095 GLN A N     1 
ATOM   8305  C  CA    . GLN A 1 1095 ? 78.925  122.760 41.437  1.00 5.23  ? 1095 GLN A CA    1 
ATOM   8306  C  C     . GLN A 1 1095 ? 78.826  123.269 39.989  1.00 4.88  ? 1095 GLN A C     1 
ATOM   8307  O  O     . GLN A 1 1095 ? 79.607  124.124 39.549  1.00 5.05  ? 1095 GLN A O     1 
ATOM   8308  C  CB    . GLN A 1 1095 ? 80.242  123.209 42.110  1.00 6.08  ? 1095 GLN A CB    1 
ATOM   8309  C  CG    . GLN A 1 1095 ? 80.346  122.757 43.588  1.00 9.97  ? 1095 GLN A CG    1 
ATOM   8310  C  CD    . GLN A 1 1095 ? 80.924  123.815 44.510  1.00 15.70 ? 1095 GLN A CD    1 
ATOM   8311  O  OE1   . GLN A 1 1095 ? 81.921  124.479 44.180  1.00 18.85 ? 1095 GLN A OE1   1 
ATOM   8312  N  NE2   . GLN A 1 1095 ? 80.320  123.964 45.681  1.00 18.83 ? 1095 GLN A NE2   1 
ATOM   8313  N  N     . LEU A 1 1096 ? 77.874  122.706 39.253  1.00 4.03  ? 1096 LEU A N     1 
ATOM   8314  C  CA    . LEU A 1 1096 ? 77.631  123.071 37.864  1.00 3.79  ? 1096 LEU A CA    1 
ATOM   8315  C  C     . LEU A 1 1096 ? 76.230  123.686 37.692  1.00 3.85  ? 1096 LEU A C     1 
ATOM   8316  O  O     . LEU A 1 1096 ? 75.847  124.032 36.579  1.00 2.92  ? 1096 LEU A O     1 
ATOM   8317  C  CB    . LEU A 1 1096 ? 77.726  121.820 36.981  1.00 4.03  ? 1096 LEU A CB    1 
ATOM   8318  C  CG    . LEU A 1 1096 ? 79.105  121.177 36.745  1.00 4.45  ? 1096 LEU A CG    1 
ATOM   8319  C  CD1   . LEU A 1 1096 ? 78.934  119.870 35.979  1.00 3.54  ? 1096 LEU A CD1   1 
ATOM   8320  C  CD2   . LEU A 1 1096 ? 80.005  122.143 35.968  1.00 2.84  ? 1096 LEU A CD2   1 
ATOM   8321  N  N     . ARG A 1 1097 ? 75.461  123.793 38.782  1.00 3.68  ? 1097 ARG A N     1 
ATOM   8322  C  CA    . ARG A 1 1097 ? 74.038  124.140 38.657  1.00 3.89  ? 1097 ARG A CA    1 
ATOM   8323  C  C     . ARG A 1 1097 ? 73.790  125.536 38.077  1.00 4.14  ? 1097 ARG A C     1 
ATOM   8324  O  O     . ARG A 1 1097 ? 72.799  125.745 37.360  1.00 3.98  ? 1097 ARG A O     1 
ATOM   8325  C  CB    . ARG A 1 1097 ? 73.289  123.949 39.987  1.00 4.12  ? 1097 ARG A CB    1 
ATOM   8326  C  CG    . ARG A 1 1097 ? 71.755  124.157 39.909  1.00 3.23  ? 1097 ARG A CG    1 
ATOM   8327  C  CD    . ARG A 1 1097 ? 71.035  123.145 38.996  1.00 2.32  ? 1097 ARG A CD    1 
ATOM   8328  N  NE    . ARG A 1 1097 ? 69.593  123.401 38.901  1.00 3.35  ? 1097 ARG A NE    1 
ATOM   8329  C  CZ    . ARG A 1 1097 ? 69.019  124.347 38.150  1.00 3.81  ? 1097 ARG A CZ    1 
ATOM   8330  N  NH1   . ARG A 1 1097 ? 69.754  125.178 37.428  1.00 3.84  ? 1097 ARG A NH1   1 
ATOM   8331  N  NH2   . ARG A 1 1097 ? 67.690  124.481 38.150  1.00 2.24  ? 1097 ARG A NH2   1 
ATOM   8332  N  N     . ASP A 1 1098 ? 74.692  126.474 38.360  1.00 4.73  ? 1098 ASP A N     1 
ATOM   8333  C  CA    . ASP A 1 1098 ? 74.582  127.843 37.846  1.00 5.65  ? 1098 ASP A CA    1 
ATOM   8334  C  C     . ASP A 1 1098 ? 74.841  127.931 36.337  1.00 5.55  ? 1098 ASP A C     1 
ATOM   8335  O  O     . ASP A 1 1098 ? 74.477  128.933 35.703  1.00 5.63  ? 1098 ASP A O     1 
ATOM   8336  C  CB    . ASP A 1 1098 ? 75.563  128.775 38.566  1.00 6.02  ? 1098 ASP A CB    1 
ATOM   8337  C  CG    . ASP A 1 1098 ? 77.026  128.400 38.306  1.00 9.33  ? 1098 ASP A CG    1 
ATOM   8338  O  OD1   . ASP A 1 1098 ? 77.363  127.195 38.303  1.00 9.05  ? 1098 ASP A OD1   1 
ATOM   8339  O  OD2   . ASP A 1 1098 ? 77.921  129.246 38.105  1.00 16.13 ? 1098 ASP A OD2   1 
ATOM   8340  N  N     . ARG A 1 1099 ? 75.478  126.904 35.774  1.00 4.91  ? 1099 ARG A N     1 
ATOM   8341  C  CA    . ARG A 1 1099 ? 75.833  126.914 34.343  1.00 5.39  ? 1099 ARG A CA    1 
ATOM   8342  C  C     . ARG A 1 1099 ? 74.650  126.789 33.394  1.00 4.86  ? 1099 ARG A C     1 
ATOM   8343  O  O     . ARG A 1 1099 ? 74.729  127.233 32.245  1.00 4.09  ? 1099 ARG A O     1 
ATOM   8344  C  CB    . ARG A 1 1099 ? 76.889  125.851 34.023  1.00 5.62  ? 1099 ARG A CB    1 
ATOM   8345  C  CG    . ARG A 1 1099 ? 78.193  126.100 34.825  1.00 7.75  ? 1099 ARG A CG    1 
ATOM   8346  C  CD    . ARG A 1 1099 ? 79.429  125.478 34.231  1.00 10.62 ? 1099 ARG A CD    1 
ATOM   8347  N  NE    . ARG A 1 1099 ? 80.550  125.439 35.184  1.00 11.25 ? 1099 ARG A NE    1 
ATOM   8348  C  CZ    . ARG A 1 1099 ? 81.731  124.883 34.921  1.00 11.30 ? 1099 ARG A CZ    1 
ATOM   8349  N  NH1   . ARG A 1 1099 ? 81.949  124.339 33.732  1.00 12.02 ? 1099 ARG A NH1   1 
ATOM   8350  N  NH2   . ARG A 1 1099 ? 82.699  124.882 35.844  1.00 13.40 ? 1099 ARG A NH2   1 
ATOM   8351  N  N     . VAL A 1 1100 ? 73.562  126.191 33.870  1.00 4.47  ? 1100 VAL A N     1 
ATOM   8352  C  CA    . VAL A 1 1100 ? 72.406  125.920 33.014  1.00 4.73  ? 1100 VAL A CA    1 
ATOM   8353  C  C     . VAL A 1 1100 ? 71.076  126.246 33.700  1.00 5.12  ? 1100 VAL A C     1 
ATOM   8354  O  O     . VAL A 1 1100 ? 70.921  126.054 34.926  1.00 4.73  ? 1100 VAL A O     1 
ATOM   8355  C  CB    . VAL A 1 1100 ? 72.356  124.421 32.468  1.00 4.87  ? 1100 VAL A CB    1 
ATOM   8356  C  CG1   . VAL A 1 1100 ? 73.602  124.064 31.619  1.00 3.97  ? 1100 VAL A CG1   1 
ATOM   8357  C  CG2   . VAL A 1 1100 ? 72.189  123.405 33.593  1.00 5.07  ? 1100 VAL A CG2   1 
ATOM   8358  N  N     . LEU A 1 1101 ? 70.134  126.754 32.905  1.00 5.27  ? 1101 LEU A N     1 
ATOM   8359  C  CA    . LEU A 1 1101 ? 68.711  126.804 33.286  1.00 6.24  ? 1101 LEU A CA    1 
ATOM   8360  C  C     . LEU A 1 1101 ? 68.054  125.445 32.992  1.00 5.62  ? 1101 LEU A C     1 
ATOM   8361  O  O     . LEU A 1 1101 ? 68.340  124.834 31.952  1.00 5.96  ? 1101 LEU A O     1 
ATOM   8362  C  CB    . LEU A 1 1101 ? 68.031  127.954 32.534  1.00 6.70  ? 1101 LEU A CB    1 
ATOM   8363  C  CG    . LEU A 1 1101 ? 66.535  128.251 32.267  1.00 9.74  ? 1101 LEU A CG    1 
ATOM   8364  C  CD1   . LEU A 1 1101 ? 65.603  127.068 32.038  1.00 11.37 ? 1101 LEU A CD1   1 
ATOM   8365  C  CD2   . LEU A 1 1101 ? 65.945  129.304 33.198  1.00 10.38 ? 1101 LEU A CD2   1 
ATOM   8366  N  N     . LEU A 1 1102 ? 67.221  124.949 33.911  1.00 5.29  ? 1102 LEU A N     1 
ATOM   8367  C  CA    . LEU A 1 1102 ? 66.501  123.674 33.702  1.00 5.19  ? 1102 LEU A CA    1 
ATOM   8368  C  C     . LEU A 1 1102 ? 65.040  123.880 33.318  1.00 5.91  ? 1102 LEU A C     1 
ATOM   8369  O  O     . LEU A 1 1102 ? 64.308  124.616 33.981  1.00 5.43  ? 1102 LEU A O     1 
ATOM   8370  C  CB    . LEU A 1 1102 ? 66.571  122.744 34.937  1.00 5.46  ? 1102 LEU A CB    1 
ATOM   8371  C  CG    . LEU A 1 1102 ? 67.943  122.277 35.449  1.00 4.12  ? 1102 LEU A CG    1 
ATOM   8372  C  CD1   . LEU A 1 1102 ? 67.767  121.234 36.560  1.00 4.69  ? 1102 LEU A CD1   1 
ATOM   8373  C  CD2   . LEU A 1 1102 ? 68.773  121.690 34.295  1.00 3.58  ? 1102 LEU A CD2   1 
ATOM   8374  N  N     . ARG A 1 1103 ? 64.639  123.220 32.239  1.00 5.45  ? 1103 ARG A N     1 
ATOM   8375  C  CA    . ARG A 1 1103 ? 63.273  123.283 31.736  1.00 6.00  ? 1103 ARG A CA    1 
ATOM   8376  C  C     . ARG A 1 1103 ? 62.713  121.869 31.845  1.00 5.28  ? 1103 ARG A C     1 
ATOM   8377  O  O     . ARG A 1 1103 ? 63.476  120.910 31.714  1.00 5.99  ? 1103 ARG A O     1 
ATOM   8378  C  CB    . ARG A 1 1103 ? 63.308  123.734 30.276  1.00 6.50  ? 1103 ARG A CB    1 
ATOM   8379  C  CG    . ARG A 1 1103 ? 61.964  124.080 29.636  1.00 7.86  ? 1103 ARG A CG    1 
ATOM   8380  C  CD    . ARG A 1 1103 ? 62.050  125.411 28.878  1.00 14.94 ? 1103 ARG A CD    1 
ATOM   8381  N  NE    . ARG A 1 1103 ? 62.694  125.234 27.602  1.00 16.32 ? 1103 ARG A NE    1 
ATOM   8382  C  CZ    . ARG A 1 1103 ? 63.545  126.063 26.994  1.00 12.90 ? 1103 ARG A CZ    1 
ATOM   8383  N  NH1   . ARG A 1 1103 ? 63.958  127.235 27.489  1.00 10.68 ? 1103 ARG A NH1   1 
ATOM   8384  N  NH2   . ARG A 1 1103 ? 63.976  125.678 25.821  1.00 12.61 ? 1103 ARG A NH2   1 
ATOM   8385  N  N     . ALA A 1 1104 ? 61.408  121.734 32.107  1.00 4.52  ? 1104 ALA A N     1 
ATOM   8386  C  CA    . ALA A 1 1104 ? 60.772  120.421 32.195  1.00 4.36  ? 1104 ALA A CA    1 
ATOM   8387  C  C     . ALA A 1 1104 ? 59.476  120.341 31.397  1.00 4.45  ? 1104 ALA A C     1 
ATOM   8388  O  O     . ALA A 1 1104 ? 58.753  121.337 31.260  1.00 3.76  ? 1104 ALA A O     1 
ATOM   8389  C  CB    . ALA A 1 1104 ? 60.501  120.053 33.661  1.00 4.42  ? 1104 ALA A CB    1 
ATOM   8390  N  N     . ASP A 1 1105 ? 59.211  119.165 30.824  1.00 4.55  ? 1105 ASP A N     1 
ATOM   8391  C  CA    . ASP A 1 1105 ? 57.908  118.898 30.200  1.00 5.08  ? 1105 ASP A CA    1 
ATOM   8392  C  C     . ASP A 1 1105 ? 57.534  117.435 30.286  1.00 4.95  ? 1105 ASP A C     1 
ATOM   8393  O  O     . ASP A 1 1105 ? 58.358  116.611 30.697  1.00 5.15  ? 1105 ASP A O     1 
ATOM   8394  C  CB    . ASP A 1 1105 ? 57.797  119.479 28.766  1.00 5.29  ? 1105 ASP A CB    1 
ATOM   8395  C  CG    . ASP A 1 1105 ? 58.464  118.618 27.694  1.00 7.08  ? 1105 ASP A CG    1 
ATOM   8396  O  OD1   . ASP A 1 1105 ? 58.805  117.438 27.941  1.00 7.58  ? 1105 ASP A OD1   1 
ATOM   8397  O  OD2   . ASP A 1 1105 ? 58.676  119.048 26.529  1.00 10.21 ? 1105 ASP A OD2   1 
ATOM   8398  N  N     . GLY A 1 1106 ? 56.276  117.144 29.941  1.00 5.29  ? 1106 GLY A N     1 
ATOM   8399  C  CA    . GLY A 1 1106 ? 55.706  115.808 29.971  1.00 4.84  ? 1106 GLY A CA    1 
ATOM   8400  C  C     . GLY A 1 1106 ? 54.460  115.823 30.847  1.00 5.37  ? 1106 GLY A C     1 
ATOM   8401  O  O     . GLY A 1 1106 ? 54.568  115.685 32.067  1.00 5.65  ? 1106 GLY A O     1 
ATOM   8402  N  N     . GLY A 1 1107 ? 53.282  115.996 30.240  1.00 4.55  ? 1107 GLY A N     1 
ATOM   8403  C  CA    . GLY A 1 1107 ? 52.030  115.945 30.972  1.00 4.66  ? 1107 GLY A CA    1 
ATOM   8404  C  C     . GLY A 1 1107 ? 51.762  117.129 31.897  1.00 4.14  ? 1107 GLY A C     1 
ATOM   8405  O  O     . GLY A 1 1107 ? 50.996  116.998 32.864  1.00 3.63  ? 1107 GLY A O     1 
ATOM   8406  N  N     . LEU A 1 1108 ? 52.390  118.270 31.623  1.00 4.07  ? 1108 LEU A N     1 
ATOM   8407  C  CA    . LEU A 1 1108 ? 52.140  119.469 32.416  1.00 4.60  ? 1108 LEU A CA    1 
ATOM   8408  C  C     . LEU A 1 1108 ? 50.824  120.080 31.936  1.00 4.49  ? 1108 LEU A C     1 
ATOM   8409  O  O     . LEU A 1 1108 ? 50.612  120.257 30.743  1.00 3.73  ? 1108 LEU A O     1 
ATOM   8410  C  CB    . LEU A 1 1108 ? 53.300  120.484 32.329  1.00 4.37  ? 1108 LEU A CB    1 
ATOM   8411  C  CG    . LEU A 1 1108 ? 54.707  120.032 32.773  1.00 5.20  ? 1108 LEU A CG    1 
ATOM   8412  C  CD1   . LEU A 1 1108 ? 55.711  121.222 32.820  1.00 5.82  ? 1108 LEU A CD1   1 
ATOM   8413  C  CD2   . LEU A 1 1108 ? 54.654  119.292 34.128  1.00 3.54  ? 1108 LEU A CD2   1 
ATOM   8414  N  N     . LYS A 1 1109 ? 49.943  120.408 32.871  1.00 4.61  ? 1109 LYS A N     1 
ATOM   8415  C  CA    . LYS A 1 1109 ? 48.632  120.929 32.512  1.00 5.32  ? 1109 LYS A CA    1 
ATOM   8416  C  C     . LYS A 1 1109 ? 48.223  122.101 33.363  1.00 5.33  ? 1109 LYS A C     1 
ATOM   8417  O  O     . LYS A 1 1109 ? 47.460  122.958 32.936  1.00 5.84  ? 1109 LYS A O     1 
ATOM   8418  C  CB    . LYS A 1 1109 ? 47.581  119.844 32.712  1.00 5.60  ? 1109 LYS A CB    1 
ATOM   8419  C  CG    . LYS A 1 1109 ? 47.620  118.753 31.684  1.00 8.17  ? 1109 LYS A CG    1 
ATOM   8420  C  CD    . LYS A 1 1109 ? 47.079  117.493 32.293  1.00 13.90 ? 1109 LYS A CD    1 
ATOM   8421  C  CE    . LYS A 1 1109 ? 46.076  116.860 31.405  1.00 13.31 ? 1109 LYS A CE    1 
ATOM   8422  N  NZ    . LYS A 1 1109 ? 44.737  117.349 31.810  1.00 18.60 ? 1109 LYS A NZ    1 
ATOM   8423  N  N     . THR A 1 1110 ? 48.745  122.129 34.579  1.00 4.83  ? 1110 THR A N     1 
ATOM   8424  C  CA    . THR A 1 1110 ? 48.100  122.811 35.667  1.00 4.44  ? 1110 THR A CA    1 
ATOM   8425  C  C     . THR A 1 1110 ? 49.154  123.605 36.493  1.00 3.98  ? 1110 THR A C     1 
ATOM   8426  O  O     . THR A 1 1110 ? 50.313  123.215 36.553  1.00 2.71  ? 1110 THR A O     1 
ATOM   8427  C  CB    . THR A 1 1110 ? 47.460  121.653 36.439  1.00 5.47  ? 1110 THR A CB    1 
ATOM   8428  O  OG1   . THR A 1 1110 ? 46.024  121.633 36.271  1.00 7.97  ? 1110 THR A OG1   1 
ATOM   8429  C  CG2   . THR A 1 1110 ? 47.748  121.672 37.864  1.00 3.75  ? 1110 THR A CG2   1 
ATOM   8430  N  N     . GLY A 1 1111 ? 48.739  124.708 37.114  1.00 3.83  ? 1111 GLY A N     1 
ATOM   8431  C  CA    . GLY A 1 1111 ? 49.567  125.435 38.070  1.00 4.22  ? 1111 GLY A CA    1 
ATOM   8432  C  C     . GLY A 1 1111 ? 50.203  124.549 39.137  1.00 3.63  ? 1111 GLY A C     1 
ATOM   8433  O  O     . GLY A 1 1111 ? 51.342  124.756 39.534  1.00 3.30  ? 1111 GLY A O     1 
ATOM   8434  N  N     . TRP A 1 1112 ? 49.462  123.545 39.593  1.00 3.35  ? 1112 TRP A N     1 
ATOM   8435  C  CA    . TRP A 1 1112 ? 49.966  122.599 40.586  1.00 3.79  ? 1112 TRP A CA    1 
ATOM   8436  C  C     . TRP A 1 1112 ? 51.123  121.765 40.017  1.00 3.50  ? 1112 TRP A C     1 
ATOM   8437  O  O     . TRP A 1 1112 ? 52.113  121.508 40.719  1.00 3.37  ? 1112 TRP A O     1 
ATOM   8438  C  CB    . TRP A 1 1112 ? 48.813  121.719 41.100  1.00 4.15  ? 1112 TRP A CB    1 
ATOM   8439  C  CG    . TRP A 1 1112 ? 49.203  120.693 42.123  1.00 4.25  ? 1112 TRP A CG    1 
ATOM   8440  C  CD1   . TRP A 1 1112 ? 49.239  120.853 43.477  1.00 5.05  ? 1112 TRP A CD1   1 
ATOM   8441  C  CD2   . TRP A 1 1112 ? 49.589  119.343 41.866  1.00 4.63  ? 1112 TRP A CD2   1 
ATOM   8442  N  NE1   . TRP A 1 1112 ? 49.650  119.688 44.077  1.00 7.20  ? 1112 TRP A NE1   1 
ATOM   8443  C  CE2   . TRP A 1 1112 ? 49.869  118.741 43.109  1.00 6.24  ? 1112 TRP A CE2   1 
ATOM   8444  C  CE3   . TRP A 1 1112 ? 49.734  118.574 40.698  1.00 6.05  ? 1112 TRP A CE3   1 
ATOM   8445  C  CZ2   . TRP A 1 1112 ? 50.261  117.398 43.230  1.00 6.80  ? 1112 TRP A CZ2   1 
ATOM   8446  C  CZ3   . TRP A 1 1112 ? 50.127  117.244 40.815  1.00 6.81  ? 1112 TRP A CZ3   1 
ATOM   8447  C  CH2   . TRP A 1 1112 ? 50.396  116.676 42.078  1.00 6.28  ? 1112 TRP A CH2   1 
ATOM   8448  N  N     . ASP A 1 1113 ? 50.999  121.360 38.747  1.00 2.97  ? 1113 ASP A N     1 
ATOM   8449  C  CA    . ASP A 1 1113 ? 52.061  120.633 38.042  1.00 2.89  ? 1113 ASP A CA    1 
ATOM   8450  C  C     . ASP A 1 1113 ? 53.319  121.509 37.987  1.00 2.37  ? 1113 ASP A C     1 
ATOM   8451  O  O     . ASP A 1 1113 ? 54.440  121.025 38.175  1.00 2.13  ? 1113 ASP A O     1 
ATOM   8452  C  CB    . ASP A 1 1113 ? 51.679  120.310 36.578  1.00 2.70  ? 1113 ASP A CB    1 
ATOM   8453  C  CG    . ASP A 1 1113 ? 50.603  119.249 36.438  1.00 5.40  ? 1113 ASP A CG    1 
ATOM   8454  O  OD1   . ASP A 1 1113 ? 50.539  118.332 37.278  1.00 4.79  ? 1113 ASP A OD1   1 
ATOM   8455  O  OD2   . ASP A 1 1113 ? 49.774  119.249 35.483  1.00 6.43  ? 1113 ASP A OD2   1 
ATOM   8456  N  N     . VAL A 1 1114 ? 53.118  122.793 37.683  1.00 1.80  ? 1114 VAL A N     1 
ATOM   8457  C  CA    . VAL A 1 1114 ? 54.213  123.753 37.564  1.00 1.57  ? 1114 VAL A CA    1 
ATOM   8458  C  C     . VAL A 1 1114 ? 54.936  123.894 38.906  1.00 1.87  ? 1114 VAL A C     1 
ATOM   8459  O  O     . VAL A 1 1114 ? 56.163  123.861 38.946  1.00 1.73  ? 1114 VAL A O     1 
ATOM   8460  C  CB    . VAL A 1 1114 ? 53.706  125.147 37.053  1.00 1.21  ? 1114 VAL A CB    1 
ATOM   8461  C  CG1   . VAL A 1 1114 ? 54.771  126.261 37.238  1.00 1.00  ? 1114 VAL A CG1   1 
ATOM   8462  C  CG2   . VAL A 1 1114 ? 53.285  125.046 35.578  1.00 2.21  ? 1114 VAL A CG2   1 
ATOM   8463  N  N     . VAL A 1 1115 ? 54.164  124.051 39.983  1.00 1.81  ? 1115 VAL A N     1 
ATOM   8464  C  CA    . VAL A 1 1115 ? 54.729  124.217 41.331  1.00 2.40  ? 1115 VAL A CA    1 
ATOM   8465  C  C     . VAL A 1 1115 ? 55.519  122.972 41.761  1.00 2.42  ? 1115 VAL A C     1 
ATOM   8466  O  O     . VAL A 1 1115 ? 56.614  123.087 42.318  1.00 2.74  ? 1115 VAL A O     1 
ATOM   8467  C  CB    . VAL A 1 1115 ? 53.650  124.640 42.339  1.00 2.36  ? 1115 VAL A CB    1 
ATOM   8468  C  CG1   . VAL A 1 1115 ? 54.140  124.530 43.789  1.00 3.49  ? 1115 VAL A CG1   1 
ATOM   8469  C  CG2   . VAL A 1 1115 ? 53.224  126.084 42.050  1.00 3.01  ? 1115 VAL A CG2   1 
ATOM   8470  N  N     . MET A 1 1116 ? 54.983  121.790 41.446  1.00 2.16  ? 1116 MET A N     1 
ATOM   8471  C  CA    . MET A 1 1116 ? 55.681  120.527 41.670  1.00 2.42  ? 1116 MET A CA    1 
ATOM   8472  C  C     . MET A 1 1116 ? 57.000  120.467 40.883  1.00 2.58  ? 1116 MET A C     1 
ATOM   8473  O  O     . MET A 1 1116 ? 58.033  120.110 41.443  1.00 2.42  ? 1116 MET A O     1 
ATOM   8474  C  CB    . MET A 1 1116 ? 54.793  119.328 41.288  1.00 2.17  ? 1116 MET A CB    1 
ATOM   8475  C  CG    . MET A 1 1116 ? 53.725  118.976 42.308  1.00 4.18  ? 1116 MET A CG    1 
ATOM   8476  S  SD    . MET A 1 1116 ? 54.314  118.810 44.039  1.00 8.93  ? 1116 MET A SD    1 
ATOM   8477  C  CE    . MET A 1 1116 ? 55.158  117.507 43.909  1.00 5.40  ? 1116 MET A CE    1 
ATOM   8478  N  N     . ALA A 1 1117 ? 56.955  120.824 39.595  1.00 2.40  ? 1117 ALA A N     1 
ATOM   8479  C  CA    . ALA A 1 1117 ? 58.159  120.851 38.767  1.00 2.62  ? 1117 ALA A CA    1 
ATOM   8480  C  C     . ALA A 1 1117 ? 59.155  121.882 39.312  1.00 3.05  ? 1117 ALA A C     1 
ATOM   8481  O  O     . ALA A 1 1117 ? 60.361  121.624 39.347  1.00 3.20  ? 1117 ALA A O     1 
ATOM   8482  C  CB    . ALA A 1 1117 ? 57.823  121.142 37.322  1.00 2.16  ? 1117 ALA A CB    1 
ATOM   8483  N  N     . ALA A 1 1118 ? 58.652  123.038 39.749  1.00 2.67  ? 1118 ALA A N     1 
ATOM   8484  C  CA    . ALA A 1 1118 ? 59.525  124.043 40.358  1.00 2.78  ? 1118 ALA A CA    1 
ATOM   8485  C  C     . ALA A 1 1118 ? 60.235  123.512 41.601  1.00 2.70  ? 1118 ALA A C     1 
ATOM   8486  O  O     . ALA A 1 1118 ? 61.459  123.659 41.722  1.00 2.83  ? 1118 ALA A O     1 
ATOM   8487  C  CB    . ALA A 1 1118 ? 58.742  125.348 40.695  1.00 1.85  ? 1118 ALA A CB    1 
ATOM   8488  N  N     . LEU A 1 1119 ? 59.478  122.912 42.521  1.00 2.15  ? 1119 LEU A N     1 
ATOM   8489  C  CA    . LEU A 1 1119 ? 60.050  122.394 43.779  1.00 2.55  ? 1119 LEU A CA    1 
ATOM   8490  C  C     . LEU A 1 1119 ? 61.173  121.374 43.515  1.00 3.22  ? 1119 LEU A C     1 
ATOM   8491  O  O     . LEU A 1 1119 ? 62.172  121.326 44.251  1.00 2.04  ? 1119 LEU A O     1 
ATOM   8492  C  CB    . LEU A 1 1119 ? 58.954  121.788 44.691  1.00 2.27  ? 1119 LEU A CB    1 
ATOM   8493  C  CG    . LEU A 1 1119 ? 58.009  122.815 45.346  1.00 2.24  ? 1119 LEU A CG    1 
ATOM   8494  C  CD1   . LEU A 1 1119 ? 56.799  122.155 46.025  1.00 2.65  ? 1119 LEU A CD1   1 
ATOM   8495  C  CD2   . LEU A 1 1119 ? 58.744  123.752 46.344  1.00 1.39  ? 1119 LEU A CD2   1 
ATOM   8496  N  N     . MET A 1 1120 ? 61.004  120.597 42.446  1.00 2.84  ? 1120 MET A N     1 
ATOM   8497  C  CA    . MET A 1 1120 ? 61.970  119.563 42.038  1.00 4.49  ? 1120 MET A CA    1 
ATOM   8498  C  C     . MET A 1 1120 ? 63.186  120.086 41.271  1.00 4.49  ? 1120 MET A C     1 
ATOM   8499  O  O     . MET A 1 1120 ? 64.118  119.317 40.985  1.00 5.11  ? 1120 MET A O     1 
ATOM   8500  C  CB    . MET A 1 1120 ? 61.266  118.435 41.255  1.00 4.20  ? 1120 MET A CB    1 
ATOM   8501  C  CG    . MET A 1 1120 ? 60.442  117.552 42.215  1.00 4.97  ? 1120 MET A CG    1 
ATOM   8502  S  SD    . MET A 1 1120 ? 59.519  116.277 41.406  1.00 7.06  ? 1120 MET A SD    1 
ATOM   8503  C  CE    . MET A 1 1120 ? 57.909  116.455 42.153  1.00 9.78  ? 1120 MET A CE    1 
ATOM   8504  N  N     . GLY A 1 1121 ? 63.182  121.389 40.974  1.00 4.92  ? 1121 GLY A N     1 
ATOM   8505  C  CA    . GLY A 1 1121 ? 64.352  122.089 40.455  1.00 5.02  ? 1121 GLY A CA    1 
ATOM   8506  C  C     . GLY A 1 1121 ? 64.211  122.707 39.064  1.00 5.19  ? 1121 GLY A C     1 
ATOM   8507  O  O     . GLY A 1 1121 ? 65.170  123.315 38.558  1.00 4.58  ? 1121 GLY A O     1 
ATOM   8508  N  N     . ALA A 1 1122 ? 63.029  122.571 38.451  1.00 4.51  ? 1122 ALA A N     1 
ATOM   8509  C  CA    . ALA A 1 1122 ? 62.776  123.147 37.125  1.00 4.48  ? 1122 ALA A CA    1 
ATOM   8510  C  C     . ALA A 1 1122 ? 62.467  124.645 37.208  1.00 4.47  ? 1122 ALA A C     1 
ATOM   8511  O  O     . ALA A 1 1122 ? 61.650  125.072 38.032  1.00 4.98  ? 1122 ALA A O     1 
ATOM   8512  C  CB    . ALA A 1 1122 ? 61.638  122.392 36.398  1.00 3.94  ? 1122 ALA A CB    1 
ATOM   8513  N  N     . GLU A 1 1123 ? 63.124  125.435 36.354  1.00 3.89  ? 1123 GLU A N     1 
ATOM   8514  C  CA    . GLU A 1 1123 ? 62.921  126.890 36.318  1.00 3.78  ? 1123 GLU A CA    1 
ATOM   8515  C  C     . GLU A 1 1123 ? 61.962  127.331 35.222  1.00 3.60  ? 1123 GLU A C     1 
ATOM   8516  O  O     . GLU A 1 1123 ? 61.469  128.472 35.233  1.00 3.84  ? 1123 GLU A O     1 
ATOM   8517  C  CB    . GLU A 1 1123 ? 64.261  127.606 36.106  1.00 2.75  ? 1123 GLU A CB    1 
ATOM   8518  C  CG    . GLU A 1 1123 ? 65.278  127.363 37.212  1.00 4.35  ? 1123 GLU A CG    1 
ATOM   8519  C  CD    . GLU A 1 1123 ? 66.693  127.546 36.717  1.00 5.39  ? 1123 GLU A CD    1 
ATOM   8520  O  OE1   . GLU A 1 1123 ? 67.150  128.704 36.673  1.00 3.53  ? 1123 GLU A OE1   1 
ATOM   8521  O  OE2   . GLU A 1 1123 ? 67.329  126.537 36.350  1.00 5.46  ? 1123 GLU A OE2   1 
ATOM   8522  N  N     . GLU A 1 1124 ? 61.754  126.456 34.247  1.00 4.06  ? 1124 GLU A N     1 
ATOM   8523  C  CA    . GLU A 1 1124 ? 60.848  126.738 33.136  1.00 3.83  ? 1124 GLU A CA    1 
ATOM   8524  C  C     . GLU A 1 1124 ? 60.055  125.487 32.813  1.00 3.89  ? 1124 GLU A C     1 
ATOM   8525  O  O     . GLU A 1 1124 ? 60.463  124.377 33.160  1.00 3.27  ? 1124 GLU A O     1 
ATOM   8526  C  CB    . GLU A 1 1124 ? 61.604  127.217 31.884  1.00 4.12  ? 1124 GLU A CB    1 
ATOM   8527  C  CG    . GLU A 1 1124 ? 62.069  128.669 31.950  1.00 3.98  ? 1124 GLU A CG    1 
ATOM   8528  C  CD    . GLU A 1 1124 ? 62.610  129.194 30.623  1.00 5.96  ? 1124 GLU A CD    1 
ATOM   8529  O  OE1   . GLU A 1 1124 ? 62.455  128.533 29.569  1.00 5.42  ? 1124 GLU A OE1   1 
ATOM   8530  O  OE2   . GLU A 1 1124 ? 63.188  130.290 30.621  1.00 7.21  ? 1124 GLU A OE2   1 
ATOM   8531  N  N     . TYR A 1 1125 ? 58.923  125.684 32.135  1.00 4.26  ? 1125 TYR A N     1 
ATOM   8532  C  CA    . TYR A 1 1125 ? 57.868  124.653 32.041  1.00 4.62  ? 1125 TYR A CA    1 
ATOM   8533  C  C     . TYR A 1 1125 ? 57.326  124.603 30.604  1.00 4.86  ? 1125 TYR A C     1 
ATOM   8534  O  O     . TYR A 1 1125 ? 56.924  125.631 30.033  1.00 5.84  ? 1125 TYR A O     1 
ATOM   8535  C  CB    . TYR A 1 1125 ? 56.775  124.909 33.115  1.00 4.38  ? 1125 TYR A CB    1 
ATOM   8536  C  CG    . TYR A 1 1125 ? 57.436  125.366 34.403  1.00 3.42  ? 1125 TYR A CG    1 
ATOM   8537  C  CD1   . TYR A 1 1125 ? 57.568  126.725 34.679  1.00 3.03  ? 1125 TYR A CD1   1 
ATOM   8538  C  CD2   . TYR A 1 1125 ? 58.009  124.452 35.291  1.00 3.48  ? 1125 TYR A CD2   1 
ATOM   8539  C  CE1   . TYR A 1 1125 ? 58.246  127.178 35.821  1.00 4.58  ? 1125 TYR A CE1   1 
ATOM   8540  C  CE2   . TYR A 1 1125 ? 58.711  124.896 36.452  1.00 3.77  ? 1125 TYR A CE2   1 
ATOM   8541  C  CZ    . TYR A 1 1125 ? 58.822  126.267 36.694  1.00 3.48  ? 1125 TYR A CZ    1 
ATOM   8542  O  OH    . TYR A 1 1125 ? 59.471  126.767 37.816  1.00 4.61  ? 1125 TYR A OH    1 
ATOM   8543  N  N     . GLY A 1 1126 ? 57.377  123.412 30.015  1.00 4.65  ? 1126 GLY A N     1 
ATOM   8544  C  CA    . GLY A 1 1126 ? 56.941  123.194 28.647  1.00 4.56  ? 1126 GLY A CA    1 
ATOM   8545  C  C     . GLY A 1 1126 ? 55.605  122.468 28.564  1.00 4.95  ? 1126 GLY A C     1 
ATOM   8546  O  O     . GLY A 1 1126 ? 55.285  121.629 29.411  1.00 4.76  ? 1126 GLY A O     1 
ATOM   8547  N  N     . PHE A 1 1127 ? 54.840  122.812 27.526  1.00 4.72  ? 1127 PHE A N     1 
ATOM   8548  C  CA    . PHE A 1 1127 ? 53.462  122.376 27.342  1.00 4.95  ? 1127 PHE A CA    1 
ATOM   8549  C  C     . PHE A 1 1127 ? 53.247  122.049 25.865  1.00 5.61  ? 1127 PHE A C     1 
ATOM   8550  O  O     . PHE A 1 1127 ? 53.373  122.948 25.003  1.00 5.52  ? 1127 PHE A O     1 
ATOM   8551  C  CB    . PHE A 1 1127 ? 52.509  123.521 27.724  1.00 5.37  ? 1127 PHE A CB    1 
ATOM   8552  C  CG    . PHE A 1 1127 ? 52.639  123.970 29.147  1.00 5.41  ? 1127 PHE A CG    1 
ATOM   8553  C  CD1   . PHE A 1 1127 ? 53.560  124.955 29.502  1.00 3.89  ? 1127 PHE A CD1   1 
ATOM   8554  C  CD2   . PHE A 1 1127 ? 51.844  123.396 30.138  1.00 4.25  ? 1127 PHE A CD2   1 
ATOM   8555  C  CE1   . PHE A 1 1127 ? 53.678  125.368 30.841  1.00 4.48  ? 1127 PHE A CE1   1 
ATOM   8556  C  CE2   . PHE A 1 1127 ? 51.959  123.807 31.478  1.00 4.60  ? 1127 PHE A CE2   1 
ATOM   8557  C  CZ    . PHE A 1 1127 ? 52.871  124.792 31.825  1.00 3.93  ? 1127 PHE A CZ    1 
ATOM   8558  N  N     . GLY A 1 1128 ? 52.900  120.793 25.567  1.00 4.57  ? 1128 GLY A N     1 
ATOM   8559  C  CA    . GLY A 1 1128 ? 52.582  120.413 24.203  1.00 4.47  ? 1128 GLY A CA    1 
ATOM   8560  C  C     . GLY A 1 1128 ? 51.110  120.066 24.013  1.00 4.81  ? 1128 GLY A C     1 
ATOM   8561  O  O     . GLY A 1 1128 ? 50.330  120.900 23.547  1.00 3.89  ? 1128 GLY A O     1 
ATOM   8562  N  N     . SER A 1 1129 ? 50.745  118.833 24.382  1.00 3.91  ? 1129 SER A N     1 
ATOM   8563  C  CA    . SER A 1 1129 ? 49.373  118.345 24.228  1.00 5.05  ? 1129 SER A CA    1 
ATOM   8564  C  C     . SER A 1 1129 ? 48.339  119.321 24.760  1.00 4.72  ? 1129 SER A C     1 
ATOM   8565  O  O     . SER A 1 1129 ? 47.343  119.614 24.081  1.00 3.79  ? 1129 SER A O     1 
ATOM   8566  C  CB    . SER A 1 1129 ? 49.207  116.984 24.916  1.00 5.59  ? 1129 SER A CB    1 
ATOM   8567  O  OG    . SER A 1 1129 ? 50.143  116.065 24.376  1.00 5.63  ? 1129 SER A OG    1 
ATOM   8568  N  N     . ILE A 1 1130 ? 48.574  119.845 25.970  1.00 4.56  ? 1130 ILE A N     1 
ATOM   8569  C  CA    . ILE A 1 1130 ? 47.582  120.736 26.592  1.00 5.19  ? 1130 ILE A CA    1 
ATOM   8570  C  C     . ILE A 1 1130 ? 47.373  122.041 25.788  1.00 4.65  ? 1130 ILE A C     1 
ATOM   8571  O  O     . ILE A 1 1130 ? 46.264  122.581 25.711  1.00 4.13  ? 1130 ILE A O     1 
ATOM   8572  C  CB    . ILE A 1 1130 ? 47.939  121.051 28.067  1.00 5.33  ? 1130 ILE A CB    1 
ATOM   8573  C  CG1   . ILE A 1 1130 ? 48.745  119.889 28.726  1.00 9.26  ? 1130 ILE A CG1   1 
ATOM   8574  C  CG2   . ILE A 1 1130 ? 46.607  121.336 28.838  1.00 6.27  ? 1130 ILE A CG2   1 
ATOM   8575  C  CD1   . ILE A 1 1130 ? 50.319  119.474 28.156  1.00 1.70  ? 1130 ILE A CD1   1 
ATOM   8576  N  N     . ALA A 1 1131 ? 48.457  122.540 25.207  1.00 4.18  ? 1131 ALA A N     1 
ATOM   8577  C  CA    . ALA A 1 1131 ? 48.403  123.739 24.373  1.00 4.32  ? 1131 ALA A CA    1 
ATOM   8578  C  C     . ALA A 1 1131 ? 47.572  123.486 23.116  1.00 3.63  ? 1131 ALA A C     1 
ATOM   8579  O  O     . ALA A 1 1131 ? 46.813  124.365 22.693  1.00 2.74  ? 1131 ALA A O     1 
ATOM   8580  C  CB    . ALA A 1 1131 ? 49.817  124.187 23.995  1.00 4.42  ? 1131 ALA A CB    1 
ATOM   8581  N  N     . MET A 1 1132 ? 47.721  122.289 22.536  1.00 3.47  ? 1132 MET A N     1 
ATOM   8582  C  CA    . MET A 1 1132 ? 46.910  121.867 21.378  1.00 3.25  ? 1132 MET A CA    1 
ATOM   8583  C  C     . MET A 1 1132 ? 45.430  121.799 21.743  1.00 3.21  ? 1132 MET A C     1 
ATOM   8584  O  O     . MET A 1 1132 ? 44.568  122.168 20.949  1.00 2.44  ? 1132 MET A O     1 
ATOM   8585  C  CB    . MET A 1 1132 ? 47.355  120.494 20.867  1.00 3.91  ? 1132 MET A CB    1 
ATOM   8586  C  CG    . MET A 1 1132 ? 48.665  120.514 20.057  1.00 3.47  ? 1132 MET A CG    1 
ATOM   8587  S  SD    . MET A 1 1132 ? 49.451  118.932 19.962  1.00 6.68  ? 1132 MET A SD    1 
ATOM   8588  C  CE    . MET A 1 1132 ? 48.202  118.057 18.928  1.00 3.03  ? 1132 MET A CE    1 
ATOM   8589  N  N     . ILE A 1 1133 ? 45.134  121.285 22.937  1.00 3.00  ? 1133 ILE A N     1 
ATOM   8590  C  CA    . ILE A 1 1133 ? 43.751  121.252 23.404  1.00 3.15  ? 1133 ILE A CA    1 
ATOM   8591  C  C     . ILE A 1 1133 ? 43.168  122.672 23.521  1.00 2.68  ? 1133 ILE A C     1 
ATOM   8592  O  O     . ILE A 1 1133 ? 42.041  122.928 23.115  1.00 2.25  ? 1133 ILE A O     1 
ATOM   8593  C  CB    . ILE A 1 1133 ? 43.639  120.454 24.734  1.00 3.29  ? 1133 ILE A CB    1 
ATOM   8594  C  CG1   . ILE A 1 1133 ? 43.919  118.962 24.472  1.00 3.17  ? 1133 ILE A CG1   1 
ATOM   8595  C  CG2   . ILE A 1 1133 ? 42.258  120.676 25.391  1.00 3.09  ? 1133 ILE A CG2   1 
ATOM   8596  C  CD1   . ILE A 1 1133 ? 44.193  118.154 25.720  1.00 4.75  ? 1133 ILE A CD1   1 
ATOM   8597  N  N     . ALA A 1 1134 ? 43.958  123.598 24.059  1.00 3.26  ? 1134 ALA A N     1 
ATOM   8598  C  CA    . ALA A 1 1134 ? 43.524  124.985 24.180  1.00 4.20  ? 1134 ALA A CA    1 
ATOM   8599  C  C     . ALA A 1 1134 ? 43.141  125.591 22.824  1.00 4.60  ? 1134 ALA A C     1 
ATOM   8600  O  O     . ALA A 1 1134 ? 42.308  126.511 22.754  1.00 4.63  ? 1134 ALA A O     1 
ATOM   8601  C  CB    . ALA A 1 1134 ? 44.607  125.810 24.871  1.00 3.87  ? 1134 ALA A CB    1 
ATOM   8602  N  N     . GLU A 1 1135 ? 43.756  125.045 21.771  1.00 5.10  ? 1135 GLU A N     1 
ATOM   8603  C  CA    . GLU A 1 1135 ? 43.524  125.404 20.369  1.00 6.31  ? 1135 GLU A CA    1 
ATOM   8604  C  C     . GLU A 1 1135 ? 42.417  124.592 19.705  1.00 6.19  ? 1135 GLU A C     1 
ATOM   8605  O  O     . GLU A 1 1135 ? 42.180  124.784 18.516  1.00 7.30  ? 1135 GLU A O     1 
ATOM   8606  C  CB    . GLU A 1 1135 ? 44.773  125.099 19.544  1.00 6.89  ? 1135 GLU A CB    1 
ATOM   8607  C  CG    . GLU A 1 1135 ? 45.870  126.120 19.620  1.00 9.01  ? 1135 GLU A CG    1 
ATOM   8608  C  CD    . GLU A 1 1135 ? 46.939  125.895 18.570  1.00 10.35 ? 1135 GLU A CD    1 
ATOM   8609  O  OE1   . GLU A 1 1135 ? 47.401  124.748 18.346  1.00 11.00 ? 1135 GLU A OE1   1 
ATOM   8610  O  OE2   . GLU A 1 1135 ? 47.366  126.891 18.006  1.00 12.09 ? 1135 GLU A OE2   1 
ATOM   8611  N  N     . GLY A 1 1136 ? 41.778  123.671 20.425  1.00 5.25  ? 1136 GLY A N     1 
ATOM   8612  C  CA    . GLY A 1 1136 ? 40.667  122.915 19.855  1.00 4.48  ? 1136 GLY A CA    1 
ATOM   8613  C  C     . GLY A 1 1136 ? 40.866  121.422 19.628  1.00 4.00  ? 1136 GLY A C     1 
ATOM   8614  O  O     . GLY A 1 1136 ? 39.952  120.757 19.148  1.00 3.76  ? 1136 GLY A O     1 
ATOM   8615  N  N     . CYS A 1 1137 ? 42.041  120.892 19.954  1.00 3.26  ? 1137 CYS A N     1 
ATOM   8616  C  CA    . CYS A 1 1137 ? 42.266  119.439 19.911  1.00 3.36  ? 1137 CYS A CA    1 
ATOM   8617  C  C     . CYS A 1 1137 ? 41.235  118.737 20.799  1.00 3.54  ? 1137 CYS A C     1 
ATOM   8618  O  O     . CYS A 1 1137 ? 40.977  119.175 21.924  1.00 4.23  ? 1137 CYS A O     1 
ATOM   8619  C  CB    . CYS A 1 1137 ? 43.705  119.093 20.335  1.00 2.48  ? 1137 CYS A CB    1 
ATOM   8620  S  SG    . CYS A 1 1137 ? 44.021  117.368 20.783  1.00 2.64  ? 1137 CYS A SG    1 
ATOM   8621  N  N     . ILE A 1 1138 ? 40.599  117.697 20.265  1.00 3.27  ? 1138 ILE A N     1 
ATOM   8622  C  CA    . ILE A 1 1138 ? 39.588  116.930 21.008  1.00 3.09  ? 1138 ILE A CA    1 
ATOM   8623  C  C     . ILE A 1 1138 ? 40.069  115.509 21.364  1.00 3.23  ? 1138 ILE A C     1 
ATOM   8624  O  O     . ILE A 1 1138 ? 39.270  114.619 21.622  1.00 2.17  ? 1138 ILE A O     1 
ATOM   8625  C  CB    . ILE A 1 1138 ? 38.217  116.896 20.244  1.00 3.62  ? 1138 ILE A CB    1 
ATOM   8626  C  CG1   . ILE A 1 1138 ? 38.382  116.410 18.797  1.00 2.61  ? 1138 ILE A CG1   1 
ATOM   8627  C  CG2   . ILE A 1 1138 ? 37.541  118.261 20.290  1.00 2.58  ? 1138 ILE A CG2   1 
ATOM   8628  C  CD1   . ILE A 1 1138 ? 37.070  116.004 18.136  1.00 4.63  ? 1138 ILE A CD1   1 
ATOM   8629  N  N     . MET A 1 1139 ? 41.388  115.310 21.361  1.00 3.54  ? 1139 MET A N     1 
ATOM   8630  C  CA    . MET A 1 1139 ? 41.976  114.027 21.711  1.00 3.86  ? 1139 MET A CA    1 
ATOM   8631  C  C     . MET A 1 1139 ? 41.377  112.863 20.898  1.00 4.17  ? 1139 MET A C     1 
ATOM   8632  O  O     . MET A 1 1139 ? 41.053  111.812 21.456  1.00 3.37  ? 1139 MET A O     1 
ATOM   8633  C  CB    . MET A 1 1139 ? 41.833  113.777 23.230  1.00 5.01  ? 1139 MET A CB    1 
ATOM   8634  C  CG    . MET A 1 1139 ? 42.760  114.646 24.082  1.00 5.81  ? 1139 MET A CG    1 
ATOM   8635  S  SD    . MET A 1 1139 ? 44.536  114.414 23.713  1.00 12.01 ? 1139 MET A SD    1 
ATOM   8636  C  CE    . MET A 1 1139 ? 44.649  112.756 23.697  1.00 6.69  ? 1139 MET A CE    1 
ATOM   8637  N  N     . ALA A 1 1140 ? 41.191  113.072 19.589  1.00 3.27  ? 1140 ALA A N     1 
ATOM   8638  C  CA    . ALA A 1 1140 ? 40.763  111.987 18.694  1.00 2.84  ? 1140 ALA A CA    1 
ATOM   8639  C  C     . ALA A 1 1140 ? 41.841  110.900 18.586  1.00 2.94  ? 1140 ALA A C     1 
ATOM   8640  O  O     . ALA A 1 1140 ? 41.541  109.748 18.288  1.00 2.73  ? 1140 ALA A O     1 
ATOM   8641  C  CB    . ALA A 1 1140 ? 40.430  112.538 17.313  1.00 2.61  ? 1140 ALA A CB    1 
ATOM   8642  N  N     . ARG A 1 1141 ? 43.099  111.277 18.831  1.00 2.59  ? 1141 ARG A N     1 
ATOM   8643  C  CA    . ARG A 1 1141 ? 44.231  110.347 18.740  1.00 3.02  ? 1141 ARG A CA    1 
ATOM   8644  C  C     . ARG A 1 1141 ? 44.319  109.667 17.367  1.00 3.00  ? 1141 ARG A C     1 
ATOM   8645  O  O     . ARG A 1 1141 ? 44.532  108.447 17.266  1.00 2.03  ? 1141 ARG A O     1 
ATOM   8646  C  CB    . ARG A 1 1141 ? 44.213  109.308 19.878  1.00 3.53  ? 1141 ARG A CB    1 
ATOM   8647  C  CG    . ARG A 1 1141 ? 44.596  109.892 21.243  1.00 5.86  ? 1141 ARG A CG    1 
ATOM   8648  C  CD    . ARG A 1 1141 ? 44.715  108.877 22.374  1.00 7.30  ? 1141 ARG A CD    1 
ATOM   8649  N  NE    . ARG A 1 1141 ? 44.152  109.396 23.626  1.00 7.57  ? 1141 ARG A NE    1 
ATOM   8650  C  CZ    . ARG A 1 1141 ? 44.828  109.522 24.769  1.00 9.61  ? 1141 ARG A CZ    1 
ATOM   8651  N  NH1   . ARG A 1 1141 ? 46.119  109.184 24.836  1.00 6.72  ? 1141 ARG A NH1   1 
ATOM   8652  N  NH2   . ARG A 1 1141 ? 44.211  109.998 25.847  1.00 6.90  ? 1141 ARG A NH2   1 
ATOM   8653  N  N     . VAL A 1 1142 ? 44.178  110.482 16.322  1.00 2.59  ? 1142 VAL A N     1 
ATOM   8654  C  CA    . VAL A 1 1142 ? 44.407  110.029 14.962  1.00 2.91  ? 1142 VAL A CA    1 
ATOM   8655  C  C     . VAL A 1 1142 ? 45.462  110.916 14.262  1.00 2.95  ? 1142 VAL A C     1 
ATOM   8656  O  O     . VAL A 1 1142 ? 45.414  111.107 13.035  1.00 2.26  ? 1142 VAL A O     1 
ATOM   8657  C  CB    . VAL A 1 1142 ? 43.071  109.932 14.148  1.00 3.14  ? 1142 VAL A CB    1 
ATOM   8658  C  CG1   . VAL A 1 1142 ? 42.100  108.901 14.779  1.00 3.95  ? 1142 VAL A CG1   1 
ATOM   8659  C  CG2   . VAL A 1 1142 ? 42.404  111.321 13.994  1.00 3.22  ? 1142 VAL A CG2   1 
ATOM   8660  N  N     . CYS A 1 1143 ? 46.415  111.438 15.041  1.00 2.82  ? 1143 CYS A N     1 
ATOM   8661  C  CA    . CYS A 1 1143 ? 47.388  112.420 14.532  1.00 4.12  ? 1143 CYS A CA    1 
ATOM   8662  C  C     . CYS A 1 1143 ? 48.271  111.834 13.424  1.00 4.58  ? 1143 CYS A C     1 
ATOM   8663  O  O     . CYS A 1 1143 ? 48.661  112.538 12.496  1.00 4.69  ? 1143 CYS A O     1 
ATOM   8664  C  CB    . CYS A 1 1143 ? 48.304  112.959 15.642  1.00 3.78  ? 1143 CYS A CB    1 
ATOM   8665  S  SG    . CYS A 1 1143 ? 47.569  113.338 17.256  1.00 5.50  ? 1143 CYS A SG    1 
ATOM   8666  N  N     . HIS A 1 1144 ? 48.593  110.552 13.550  1.00 4.85  ? 1144 HIS A N     1 
ATOM   8667  C  CA    . HIS A 1 1144 ? 49.527  109.868 12.654  1.00 5.68  ? 1144 HIS A CA    1 
ATOM   8668  C  C     . HIS A 1 1144 ? 48.842  109.493 11.333  1.00 6.19  ? 1144 HIS A C     1 
ATOM   8669  O  O     . HIS A 1 1144 ? 49.492  109.080 10.371  1.00 6.19  ? 1144 HIS A O     1 
ATOM   8670  C  CB    . HIS A 1 1144 ? 50.102  108.618 13.358  1.00 5.36  ? 1144 HIS A CB    1 
ATOM   8671  C  CG    . HIS A 1 1144 ? 49.067  107.626 13.803  1.00 6.07  ? 1144 HIS A CG    1 
ATOM   8672  N  ND1   . HIS A 1 1144 ? 48.099  107.928 14.738  1.00 7.53  ? 1144 HIS A ND1   1 
ATOM   8673  C  CD2   . HIS A 1 1144 ? 48.846  106.336 13.439  1.00 5.66  ? 1144 HIS A CD2   1 
ATOM   8674  C  CE1   . HIS A 1 1144 ? 47.330  106.867 14.930  1.00 7.15  ? 1144 HIS A CE1   1 
ATOM   8675  N  NE2   . HIS A 1 1144 ? 47.761  105.890 14.154  1.00 4.33  ? 1144 HIS A NE2   1 
ATOM   8676  N  N     . THR A 1 1145 ? 47.525  109.713 11.313  1.00 5.30  ? 1145 THR A N     1 
ATOM   8677  C  CA    . THR A 1 1145 ? 46.581  109.286 10.300  1.00 6.63  ? 1145 THR A CA    1 
ATOM   8678  C  C     . THR A 1 1145 ? 46.285  110.369 9.233   1.00 5.68  ? 1145 THR A C     1 
ATOM   8679  O  O     . THR A 1 1145 ? 45.789  110.070 8.143   1.00 4.53  ? 1145 THR A O     1 
ATOM   8680  C  CB    . THR A 1 1145 ? 45.277  108.864 11.093  1.00 6.83  ? 1145 THR A CB    1 
ATOM   8681  O  OG1   . THR A 1 1145 ? 44.981  107.518 10.833  1.00 11.00 ? 1145 THR A OG1   1 
ATOM   8682  C  CG2   . THR A 1 1145 ? 44.009  109.617 10.666  1.00 7.04  ? 1145 THR A CG2   1 
ATOM   8683  N  N     . ASN A 1 1146 ? 46.604  111.620 9.564   1.00 5.38  ? 1146 ASN A N     1 
ATOM   8684  C  CA    . ASN A 1 1146 ? 46.301  112.798 8.728   1.00 4.86  ? 1146 ASN A CA    1 
ATOM   8685  C  C     . ASN A 1 1146 ? 44.824  113.197 8.674   1.00 5.02  ? 1146 ASN A C     1 
ATOM   8686  O  O     . ASN A 1 1146 ? 44.459  114.105 7.918   1.00 5.38  ? 1146 ASN A O     1 
ATOM   8687  C  CB    . ASN A 1 1146 ? 46.872  112.677 7.298   1.00 5.62  ? 1146 ASN A CB    1 
ATOM   8688  C  CG    . ASN A 1 1146 ? 47.153  114.032 6.662   1.00 2.95  ? 1146 ASN A CG    1 
ATOM   8689  O  OD1   . ASN A 1 1146 ? 47.414  115.003 7.356   1.00 4.44  ? 1146 ASN A OD1   1 
ATOM   8690  N  ND2   . ASN A 1 1146 ? 47.073  114.103 5.352   1.00 1.59  ? 1146 ASN A ND2   1 
ATOM   8691  N  N     . ASN A 1 1147 ? 43.987  112.528 9.472   1.00 4.61  ? 1147 ASN A N     1 
ATOM   8692  C  CA    . ASN A 1 1147 ? 42.529  112.747 9.459   1.00 5.07  ? 1147 ASN A CA    1 
ATOM   8693  C  C     . ASN A 1 1147 ? 42.009  113.523 10.669  1.00 3.99  ? 1147 ASN A C     1 
ATOM   8694  O  O     . ASN A 1 1147 ? 40.825  113.451 10.984  1.00 3.17  ? 1147 ASN A O     1 
ATOM   8695  C  CB    . ASN A 1 1147 ? 41.759  111.415 9.312   1.00 6.21  ? 1147 ASN A CB    1 
ATOM   8696  C  CG    . ASN A 1 1147 ? 42.124  110.661 8.032   1.00 10.75 ? 1147 ASN A CG    1 
ATOM   8697  O  OD1   . ASN A 1 1147 ? 42.435  111.272 6.999   1.00 15.89 ? 1147 ASN A OD1   1 
ATOM   8698  N  ND2   . ASN A 1 1147 ? 42.104  109.322 8.096   1.00 14.00 ? 1147 ASN A ND2   1 
ATOM   8699  N  N     . CYS A 1 1148 ? 42.884  114.273 11.339  1.00 2.96  ? 1148 CYS A N     1 
ATOM   8700  C  CA    . CYS A 1 1148 ? 42.463  115.093 12.481  1.00 2.58  ? 1148 CYS A CA    1 
ATOM   8701  C  C     . CYS A 1 1148 ? 41.146  115.846 12.193  1.00 2.59  ? 1148 CYS A C     1 
ATOM   8702  O  O     . CYS A 1 1148 ? 41.089  116.650 11.271  1.00 1.80  ? 1148 CYS A O     1 
ATOM   8703  C  CB    . CYS A 1 1148 ? 43.568  116.082 12.886  1.00 2.68  ? 1148 CYS A CB    1 
ATOM   8704  S  SG    . CYS A 1 1148 ? 43.002  117.171 14.236  1.00 2.55  ? 1148 CYS A SG    1 
ATOM   8705  N  N     . PRO A 1 1149 ? 40.086  115.564 12.960  1.00 2.98  ? 1149 PRO A N     1 
ATOM   8706  C  CA    . PRO A 1 1149 ? 38.765  116.132 12.680  1.00 2.94  ? 1149 PRO A CA    1 
ATOM   8707  C  C     . PRO A 1 1149 ? 38.653  117.642 12.880  1.00 2.82  ? 1149 PRO A C     1 
ATOM   8708  O  O     . PRO A 1 1149 ? 37.664  118.243 12.458  1.00 1.85  ? 1149 PRO A O     1 
ATOM   8709  C  CB    . PRO A 1 1149 ? 37.853  115.398 13.669  1.00 3.87  ? 1149 PRO A CB    1 
ATOM   8710  C  CG    . PRO A 1 1149 ? 38.780  115.031 14.805  1.00 2.82  ? 1149 PRO A CG    1 
ATOM   8711  C  CD    . PRO A 1 1149 ? 40.058  114.656 14.127  1.00 2.98  ? 1149 PRO A CD    1 
ATOM   8712  N  N     . VAL A 1 1150 ? 39.680  118.236 13.452  1.00 2.53  ? 1150 VAL A N     1 
ATOM   8713  C  CA    . VAL A 1 1150 ? 39.592  119.551 14.041  1.00 3.51  ? 1150 VAL A CA    1 
ATOM   8714  C  C     . VAL A 1 1150 ? 40.683  120.454 13.425  1.00 3.71  ? 1150 VAL A C     1 
ATOM   8715  O  O     . VAL A 1 1150 ? 40.878  121.623 13.805  1.00 4.09  ? 1150 VAL A O     1 
ATOM   8716  C  CB    . VAL A 1 1150 ? 39.596  119.336 15.602  1.00 4.38  ? 1150 VAL A CB    1 
ATOM   8717  C  CG1   . VAL A 1 1150 ? 40.944  119.449 16.276  1.00 4.12  ? 1150 VAL A CG1   1 
ATOM   8718  C  CG2   . VAL A 1 1150 ? 38.434  119.982 16.294  1.00 5.78  ? 1150 VAL A CG2   1 
ATOM   8719  N  N     . GLY A 1 1151 ? 41.371  119.887 12.435  1.00 3.72  ? 1151 GLY A N     1 
ATOM   8720  C  CA    . GLY A 1 1151 ? 42.356  120.596 11.639  1.00 3.85  ? 1151 GLY A CA    1 
ATOM   8721  C  C     . GLY A 1 1151 ? 43.626  120.987 12.368  1.00 4.01  ? 1151 GLY A C     1 
ATOM   8722  O  O     . GLY A 1 1151 ? 44.283  121.952 11.973  1.00 4.87  ? 1151 GLY A O     1 
ATOM   8723  N  N     . VAL A 1 1152 ? 43.967  120.235 13.416  1.00 3.19  ? 1152 VAL A N     1 
ATOM   8724  C  CA    . VAL A 1 1152 ? 45.159  120.497 14.202  1.00 2.99  ? 1152 VAL A CA    1 
ATOM   8725  C  C     . VAL A 1 1152 ? 46.396  119.689 13.754  1.00 3.00  ? 1152 VAL A C     1 
ATOM   8726  O  O     . VAL A 1 1152 ? 47.465  120.270 13.529  1.00 3.36  ? 1152 VAL A O     1 
ATOM   8727  C  CB    . VAL A 1 1152 ? 44.864  120.342 15.742  1.00 2.92  ? 1152 VAL A CB    1 
ATOM   8728  C  CG1   . VAL A 1 1152 ? 46.149  120.282 16.560  1.00 2.30  ? 1152 VAL A CG1   1 
ATOM   8729  C  CG2   . VAL A 1 1152 ? 43.994  121.530 16.225  1.00 2.18  ? 1152 VAL A CG2   1 
ATOM   8730  N  N     . ALA A 1 1153 ? 46.256  118.361 13.659  1.00 3.20  ? 1153 ALA A N     1 
ATOM   8731  C  CA    . ALA A 1 1153 ? 47.392  117.482 13.355  1.00 3.20  ? 1153 ALA A CA    1 
ATOM   8732  C  C     . ALA A 1 1153 ? 47.253  116.854 11.973  1.00 2.73  ? 1153 ALA A C     1 
ATOM   8733  O  O     . ALA A 1 1153 ? 47.447  115.638 11.797  1.00 1.87  ? 1153 ALA A O     1 
ATOM   8734  C  CB    . ALA A 1 1153 ? 47.523  116.401 14.423  1.00 2.23  ? 1153 ALA A CB    1 
ATOM   8735  N  N     . THR A 1 1154 ? 46.901  117.687 11.007  1.00 3.64  ? 1154 THR A N     1 
ATOM   8736  C  CA    . THR A 1 1154 ? 46.667  117.234 9.631   1.00 3.65  ? 1154 THR A CA    1 
ATOM   8737  C  C     . THR A 1 1154 ? 47.182  118.265 8.636   1.00 4.15  ? 1154 THR A C     1 
ATOM   8738  O  O     . THR A 1 1154 ? 47.233  119.478 8.928   1.00 3.92  ? 1154 THR A O     1 
ATOM   8739  C  CB    . THR A 1 1154 ? 45.154  116.918 9.391   1.00 3.53  ? 1154 THR A CB    1 
ATOM   8740  O  OG1   . THR A 1 1154 ? 44.904  116.672 8.000   1.00 3.11  ? 1154 THR A OG1   1 
ATOM   8741  C  CG2   . THR A 1 1154 ? 44.248  118.111 9.685   1.00 5.51  ? 1154 THR A CG2   1 
ATOM   8742  N  N     . GLN A 1 1155 ? 47.584  117.773 7.468   1.00 4.32  ? 1155 GLN A N     1 
ATOM   8743  C  CA    . GLN A 1 1155 ? 47.921  118.649 6.350   1.00 4.35  ? 1155 GLN A CA    1 
ATOM   8744  C  C     . GLN A 1 1155 ? 46.811  118.732 5.299   1.00 4.12  ? 1155 GLN A C     1 
ATOM   8745  O  O     . GLN A 1 1155 ? 46.958  119.432 4.295   1.00 4.05  ? 1155 GLN A O     1 
ATOM   8746  C  CB    . GLN A 1 1155 ? 49.251  118.229 5.701   1.00 4.24  ? 1155 GLN A CB    1 
ATOM   8747  C  CG    . GLN A 1 1155 ? 50.447  118.259 6.650   1.00 4.43  ? 1155 GLN A CG    1 
ATOM   8748  C  CD    . GLN A 1 1155 ? 50.629  119.632 7.326   1.00 1.00  ? 1155 GLN A CD    1 
ATOM   8749  O  OE1   . GLN A 1 1155 ? 50.391  120.662 6.712   1.00 2.91  ? 1155 GLN A OE1   1 
ATOM   8750  N  NE2   . GLN A 1 1155 ? 51.053  119.630 8.586   1.00 1.35  ? 1155 GLN A NE2   1 
ATOM   8751  N  N     . GLN A 1 1156 ? 45.693  118.039 5.514   1.00 4.20  ? 1156 GLN A N     1 
ATOM   8752  C  CA    . GLN A 1 1156 ? 44.623  118.092 4.527   1.00 4.06  ? 1156 GLN A CA    1 
ATOM   8753  C  C     . GLN A 1 1156 ? 44.007  119.493 4.507   1.00 4.29  ? 1156 GLN A C     1 
ATOM   8754  O  O     . GLN A 1 1156 ? 43.499  119.957 5.524   1.00 3.72  ? 1156 GLN A O     1 
ATOM   8755  C  CB    . GLN A 1 1156 ? 43.553  117.045 4.827   1.00 4.68  ? 1156 GLN A CB    1 
ATOM   8756  C  CG    . GLN A 1 1156 ? 43.973  115.606 4.512   1.00 5.58  ? 1156 GLN A CG    1 
ATOM   8757  C  CD    . GLN A 1 1156 ? 42.798  114.641 4.523   1.00 8.21  ? 1156 GLN A CD    1 
ATOM   8758  O  OE1   . GLN A 1 1156 ? 41.779  114.884 3.867   1.00 10.67 ? 1156 GLN A OE1   1 
ATOM   8759  N  NE2   . GLN A 1 1156 ? 42.930  113.552 5.271   1.00 6.26  ? 1156 GLN A NE2   1 
ATOM   8760  N  N     . GLU A 1 1157 ? 44.026  120.143 3.343   1.00 4.38  ? 1157 GLU A N     1 
ATOM   8761  C  CA    . GLU A 1 1157 ? 43.557  121.520 3.228   1.00 4.84  ? 1157 GLU A CA    1 
ATOM   8762  C  C     . GLU A 1 1157 ? 42.133  121.676 3.744   1.00 4.15  ? 1157 GLU A C     1 
ATOM   8763  O  O     . GLU A 1 1157 ? 41.817  122.666 4.400   1.00 3.38  ? 1157 GLU A O     1 
ATOM   8764  C  CB    . GLU A 1 1157 ? 43.643  122.038 1.781   1.00 4.99  ? 1157 GLU A CB    1 
ATOM   8765  C  CG    . GLU A 1 1157 ? 45.060  122.357 1.294   1.00 9.93  ? 1157 GLU A CG    1 
ATOM   8766  C  CD    . GLU A 1 1157 ? 45.137  122.449 -0.227  1.00 14.80 ? 1157 GLU A CD    1 
ATOM   8767  O  OE1   . GLU A 1 1157 ? 44.178  122.935 -0.843  1.00 15.73 ? 1157 GLU A OE1   1 
ATOM   8768  O  OE2   . GLU A 1 1157 ? 46.156  122.024 -0.814  1.00 19.11 ? 1157 GLU A OE2   1 
ATOM   8769  N  N     . ARG A 1 1158 ? 41.282  120.698 3.445   1.00 3.68  ? 1158 ARG A N     1 
ATOM   8770  C  CA    . ARG A 1 1158 ? 39.867  120.790 3.786   1.00 3.80  ? 1158 ARG A CA    1 
ATOM   8771  C  C     . ARG A 1 1158 ? 39.554  120.481 5.267   1.00 3.94  ? 1158 ARG A C     1 
ATOM   8772  O  O     . ARG A 1 1158 ? 38.456  120.800 5.750   1.00 4.61  ? 1158 ARG A O     1 
ATOM   8773  C  CB    . ARG A 1 1158 ? 39.021  119.925 2.836   1.00 4.02  ? 1158 ARG A CB    1 
ATOM   8774  C  CG    . ARG A 1 1158 ? 38.948  120.449 1.383   1.00 4.39  ? 1158 ARG A CG    1 
ATOM   8775  C  CD    . ARG A 1 1158 ? 38.572  119.380 0.332   1.00 6.91  ? 1158 ARG A CD    1 
ATOM   8776  N  NE    . ARG A 1 1158 ? 38.737  119.843 -1.049  1.00 7.82  ? 1158 ARG A NE    1 
ATOM   8777  C  CZ    . ARG A 1 1158 ? 39.907  120.029 -1.679  1.00 9.09  ? 1158 ARG A CZ    1 
ATOM   8778  N  NH1   . ARG A 1 1158 ? 41.059  119.786 -1.074  1.00 6.04  ? 1158 ARG A NH1   1 
ATOM   8779  N  NH2   . ARG A 1 1158 ? 39.914  120.465 -2.943  1.00 10.83 ? 1158 ARG A NH2   1 
ATOM   8780  N  N     . LEU A 1 1159 ? 40.483  119.831 5.965   1.00 3.10  ? 1159 LEU A N     1 
ATOM   8781  C  CA    . LEU A 1 1159 ? 40.366  119.646 7.419   1.00 2.92  ? 1159 LEU A CA    1 
ATOM   8782  C  C     . LEU A 1 1159 ? 40.975  120.846 8.139   1.00 3.03  ? 1159 LEU A C     1 
ATOM   8783  O  O     . LEU A 1 1159 ? 40.462  121.270 9.163   1.00 3.05  ? 1159 LEU A O     1 
ATOM   8784  C  CB    . LEU A 1 1159 ? 41.041  118.347 7.894   1.00 2.56  ? 1159 LEU A CB    1 
ATOM   8785  C  CG    . LEU A 1 1159 ? 40.380  117.033 7.468   1.00 3.13  ? 1159 LEU A CG    1 
ATOM   8786  C  CD1   . LEU A 1 1159 ? 41.198  115.859 7.971   1.00 3.06  ? 1159 LEU A CD1   1 
ATOM   8787  C  CD2   . LEU A 1 1159 ? 38.920  116.929 7.956   1.00 1.00  ? 1159 LEU A CD2   1 
ATOM   8788  N  N     . ARG A 1 1160 ? 42.071  121.379 7.596   1.00 3.13  ? 1160 ARG A N     1 
ATOM   8789  C  CA    . ARG A 1 1160 ? 42.691  122.616 8.091   1.00 4.00  ? 1160 ARG A CA    1 
ATOM   8790  C  C     . ARG A 1 1160 ? 41.718  123.788 8.137   1.00 3.76  ? 1160 ARG A C     1 
ATOM   8791  O  O     . ARG A 1 1160 ? 41.769  124.606 9.054   1.00 4.25  ? 1160 ARG A O     1 
ATOM   8792  C  CB    . ARG A 1 1160 ? 43.859  123.018 7.199   1.00 3.91  ? 1160 ARG A CB    1 
ATOM   8793  C  CG    . ARG A 1 1160 ? 45.078  122.152 7.335   1.00 5.37  ? 1160 ARG A CG    1 
ATOM   8794  C  CD    . ARG A 1 1160 ? 46.331  122.949 7.170   1.00 10.46 ? 1160 ARG A CD    1 
ATOM   8795  N  NE    . ARG A 1 1160 ? 46.706  123.026 5.786   1.00 10.77 ? 1160 ARG A NE    1 
ATOM   8796  C  CZ    . ARG A 1 1160 ? 46.937  124.124 5.096   1.00 13.19 ? 1160 ARG A CZ    1 
ATOM   8797  N  NH1   . ARG A 1 1160 ? 46.834  125.344 5.621   1.00 14.42 ? 1160 ARG A NH1   1 
ATOM   8798  N  NH2   . ARG A 1 1160 ? 47.265  123.987 3.827   1.00 13.99 ? 1160 ARG A NH2   1 
ATOM   8799  N  N     . GLN A 1 1161 ? 40.848  123.879 7.135   1.00 4.41  ? 1161 GLN A N     1 
ATOM   8800  C  CA    . GLN A 1 1161 ? 39.790  124.898 7.101   1.00 5.33  ? 1161 GLN A CA    1 
ATOM   8801  C  C     . GLN A 1 1161 ? 38.814  124.854 8.294   1.00 4.94  ? 1161 GLN A C     1 
ATOM   8802  O  O     . GLN A 1 1161 ? 38.155  125.860 8.585   1.00 4.54  ? 1161 GLN A O     1 
ATOM   8803  C  CB    . GLN A 1 1161 ? 39.033  124.852 5.769   1.00 5.96  ? 1161 GLN A CB    1 
ATOM   8804  C  CG    . GLN A 1 1161 ? 39.958  125.107 4.586   1.00 10.44 ? 1161 GLN A CG    1 
ATOM   8805  C  CD    . GLN A 1 1161 ? 39.322  124.884 3.225   1.00 15.25 ? 1161 GLN A CD    1 
ATOM   8806  O  OE1   . GLN A 1 1161 ? 38.329  124.153 3.085   1.00 18.71 ? 1161 GLN A OE1   1 
ATOM   8807  N  NE2   . GLN A 1 1161 ? 39.908  125.507 2.208   1.00 17.93 ? 1161 GLN A NE2   1 
ATOM   8808  N  N     . ARG A 1 1162 ? 38.743  123.706 8.976   1.00 4.62  ? 1162 ARG A N     1 
ATOM   8809  C  CA    . ARG A 1 1162 ? 37.925  123.538 10.193  1.00 5.00  ? 1162 ARG A CA    1 
ATOM   8810  C  C     . ARG A 1 1162 ? 38.598  124.113 11.452  1.00 5.28  ? 1162 ARG A C     1 
ATOM   8811  O  O     . ARG A 1 1162 ? 37.942  124.303 12.500  1.00 5.70  ? 1162 ARG A O     1 
ATOM   8812  C  CB    . ARG A 1 1162 ? 37.633  122.053 10.470  1.00 4.62  ? 1162 ARG A CB    1 
ATOM   8813  C  CG    . ARG A 1 1162 ? 36.856  121.296 9.431   1.00 4.20  ? 1162 ARG A CG    1 
ATOM   8814  C  CD    . ARG A 1 1162 ? 36.648  119.838 9.844   1.00 2.66  ? 1162 ARG A CD    1 
ATOM   8815  N  NE    . ARG A 1 1162 ? 35.818  119.063 8.926   1.00 3.26  ? 1162 ARG A NE    1 
ATOM   8816  C  CZ    . ARG A 1 1162 ? 35.530  117.778 9.117   1.00 3.52  ? 1162 ARG A CZ    1 
ATOM   8817  N  NH1   . ARG A 1 1162 ? 36.007  117.139 10.180  1.00 1.00  ? 1162 ARG A NH1   1 
ATOM   8818  N  NH2   . ARG A 1 1162 ? 34.762  117.134 8.249   1.00 2.94  ? 1162 ARG A NH2   1 
ATOM   8819  N  N     . PHE A 1 1163 ? 39.902  124.358 11.378  1.00 5.30  ? 1163 PHE A N     1 
ATOM   8820  C  CA    . PHE A 1 1163 ? 40.620  124.911 12.519  1.00 5.71  ? 1163 PHE A CA    1 
ATOM   8821  C  C     . PHE A 1 1163 ? 39.973  126.223 12.967  1.00 6.82  ? 1163 PHE A C     1 
ATOM   8822  O  O     . PHE A 1 1163 ? 39.920  127.212 12.229  1.00 5.88  ? 1163 PHE A O     1 
ATOM   8823  C  CB    . PHE A 1 1163 ? 42.105  125.119 12.214  1.00 5.43  ? 1163 PHE A CB    1 
ATOM   8824  C  CG    . PHE A 1 1163 ? 42.876  125.702 13.358  1.00 4.46  ? 1163 PHE A CG    1 
ATOM   8825  C  CD1   . PHE A 1 1163 ? 43.315  124.894 14.405  1.00 4.42  ? 1163 PHE A CD1   1 
ATOM   8826  C  CD2   . PHE A 1 1163 ? 43.155  127.065 13.405  1.00 4.59  ? 1163 PHE A CD2   1 
ATOM   8827  C  CE1   . PHE A 1 1163 ? 44.022  125.442 15.481  1.00 4.13  ? 1163 PHE A CE1   1 
ATOM   8828  C  CE2   . PHE A 1 1163 ? 43.873  127.618 14.477  1.00 2.62  ? 1163 PHE A CE2   1 
ATOM   8829  C  CZ    . PHE A 1 1163 ? 44.302  126.810 15.505  1.00 4.25  ? 1163 PHE A CZ    1 
ATOM   8830  N  N     . LYS A 1 1164 ? 39.416  126.171 14.168  1.00 8.35  ? 1164 LYS A N     1 
ATOM   8831  C  CA    . LYS A 1 1164 ? 39.035  127.346 14.912  1.00 10.05 ? 1164 LYS A CA    1 
ATOM   8832  C  C     . LYS A 1 1164 ? 40.156  127.340 15.919  1.00 10.93 ? 1164 LYS A C     1 
ATOM   8833  O  O     . LYS A 1 1164 ? 40.820  126.309 16.139  1.00 13.29 ? 1164 LYS A O     1 
ATOM   8834  C  CB    . LYS A 1 1164 ? 37.664  127.188 15.605  1.00 10.01 ? 1164 LYS A CB    1 
ATOM   8835  C  CG    . LYS A 1 1164 ? 36.765  126.083 15.052  1.00 10.50 ? 1164 LYS A CG    1 
ATOM   8836  C  CD    . LYS A 1 1164 ? 35.528  125.832 15.940  1.00 12.02 ? 1164 LYS A CD    1 
ATOM   8837  C  CE    . LYS A 1 1164 ? 35.762  124.670 16.927  1.00 13.48 ? 1164 LYS A CE    1 
ATOM   8838  N  NZ    . LYS A 1 1164 ? 34.557  124.352 17.794  1.00 14.92 ? 1164 LYS A NZ    1 
ATOM   8839  N  N     . GLY A 1 1165 ? 40.393  128.463 16.553  1.00 10.81 ? 1165 GLY A N     1 
ATOM   8840  C  CA    . GLY A 1 1165 ? 41.625  128.564 17.296  1.00 8.82  ? 1165 GLY A CA    1 
ATOM   8841  C  C     . GLY A 1 1165 ? 42.111  129.942 16.966  1.00 7.97  ? 1165 GLY A C     1 
ATOM   8842  O  O     . GLY A 1 1165 ? 42.287  130.293 15.788  1.00 6.73  ? 1165 GLY A O     1 
ATOM   8843  N  N     . VAL A 1 1166 ? 42.264  130.732 18.019  1.00 7.39  ? 1166 VAL A N     1 
ATOM   8844  C  CA    . VAL A 1 1166 ? 42.757  132.092 17.914  1.00 7.23  ? 1166 VAL A CA    1 
ATOM   8845  C  C     . VAL A 1 1166 ? 43.797  132.226 19.014  1.00 6.19  ? 1166 VAL A C     1 
ATOM   8846  O  O     . VAL A 1 1166 ? 43.647  131.625 20.081  1.00 5.85  ? 1166 VAL A O     1 
ATOM   8847  C  CB    . VAL A 1 1166 ? 41.650  133.160 18.066  1.00 7.04  ? 1166 VAL A CB    1 
ATOM   8848  C  CG1   . VAL A 1 1166 ? 40.682  133.122 16.886  1.00 8.98  ? 1166 VAL A CG1   1 
ATOM   8849  C  CG2   . VAL A 1 1166 ? 40.892  133.022 19.393  1.00 8.04  ? 1166 VAL A CG2   1 
ATOM   8850  N  N     . PRO A 1 1167 ? 44.845  133.001 18.757  1.00 5.65  ? 1167 PRO A N     1 
ATOM   8851  C  CA    . PRO A 1 1167 ? 45.950  133.124 19.709  1.00 5.25  ? 1167 PRO A CA    1 
ATOM   8852  C  C     . PRO A 1 1167 ? 45.453  133.535 21.095  1.00 5.41  ? 1167 PRO A C     1 
ATOM   8853  O  O     . PRO A 1 1167 ? 46.019  133.069 22.093  1.00 5.39  ? 1167 PRO A O     1 
ATOM   8854  C  CB    . PRO A 1 1167 ? 46.844  134.201 19.086  1.00 5.70  ? 1167 PRO A CB    1 
ATOM   8855  C  CG    . PRO A 1 1167 ? 46.504  134.168 17.594  1.00 5.35  ? 1167 PRO A CG    1 
ATOM   8856  C  CD    . PRO A 1 1167 ? 45.046  133.827 17.547  1.00 5.54  ? 1167 PRO A CD    1 
ATOM   8857  N  N     . GLY A 1 1168 ? 44.408  134.352 21.141  1.00 5.24  ? 1168 GLY A N     1 
ATOM   8858  C  CA    . GLY A 1 1168 ? 43.837  134.862 22.382  1.00 6.62  ? 1168 GLY A CA    1 
ATOM   8859  C  C     . GLY A 1 1168 ? 43.379  133.790 23.357  1.00 6.71  ? 1168 GLY A C     1 
ATOM   8860  O  O     . GLY A 1 1168 ? 43.504  133.965 24.574  1.00 6.70  ? 1168 GLY A O     1 
ATOM   8861  N  N     . GLN A 1 1169 ? 42.878  132.679 22.821  1.00 6.54  ? 1169 GLN A N     1 
ATOM   8862  C  CA    . GLN A 1 1169 ? 42.450  131.531 23.623  1.00 6.64  ? 1169 GLN A CA    1 
ATOM   8863  C  C     . GLN A 1 1169 ? 43.634  130.861 24.314  1.00 5.99  ? 1169 GLN A C     1 
ATOM   8864  O  O     . GLN A 1 1169 ? 43.505  130.399 25.456  1.00 5.46  ? 1169 GLN A O     1 
ATOM   8865  C  CB    . GLN A 1 1169 ? 41.789  130.451 22.751  1.00 6.76  ? 1169 GLN A CB    1 
ATOM   8866  C  CG    . GLN A 1 1169 ? 40.480  130.798 22.092  1.00 9.83  ? 1169 GLN A CG    1 
ATOM   8867  C  CD    . GLN A 1 1169 ? 40.132  129.797 20.974  1.00 11.24 ? 1169 GLN A CD    1 
ATOM   8868  O  OE1   . GLN A 1 1169 ? 40.885  128.835 20.716  1.00 12.10 ? 1169 GLN A OE1   1 
ATOM   8869  N  NE2   . GLN A 1 1169 ? 39.004  130.013 20.332  1.00 13.56 ? 1169 GLN A NE2   1 
ATOM   8870  N  N     . VAL A 1 1170 ? 44.767  130.739 23.623  1.00 5.41  ? 1170 VAL A N     1 
ATOM   8871  C  CA    . VAL A 1 1170 ? 45.889  130.088 24.289  1.00 5.44  ? 1170 VAL A CA    1 
ATOM   8872  C  C     . VAL A 1 1170 ? 46.566  131.032 25.270  1.00 4.80  ? 1170 VAL A C     1 
ATOM   8873  O  O     . VAL A 1 1170 ? 46.973  130.606 26.336  1.00 4.23  ? 1170 VAL A O     1 
ATOM   8874  C  CB    . VAL A 1 1170 ? 46.823  129.181 23.384  1.00 6.76  ? 1170 VAL A CB    1 
ATOM   8875  C  CG1   . VAL A 1 1170 ? 46.369  129.103 21.914  1.00 7.48  ? 1170 VAL A CG1   1 
ATOM   8876  C  CG2   . VAL A 1 1170 ? 48.329  129.436 23.575  1.00 4.57  ? 1170 VAL A CG2   1 
ATOM   8877  N  N     . VAL A 1 1171 ? 46.581  132.327 24.946  1.00 4.65  ? 1171 VAL A N     1 
ATOM   8878  C  CA    . VAL A 1 1171 ? 46.948  133.361 25.917  1.00 4.55  ? 1171 VAL A CA    1 
ATOM   8879  C  C     . VAL A 1 1171 ? 46.138  133.211 27.216  1.00 5.21  ? 1171 VAL A C     1 
ATOM   8880  O  O     . VAL A 1 1171 ? 46.715  133.132 28.307  1.00 4.55  ? 1171 VAL A O     1 
ATOM   8881  C  CB    . VAL A 1 1171 ? 46.783  134.787 25.327  1.00 4.76  ? 1171 VAL A CB    1 
ATOM   8882  C  CG1   . VAL A 1 1171 ? 46.924  135.858 26.417  1.00 4.46  ? 1171 VAL A CG1   1 
ATOM   8883  C  CG2   . VAL A 1 1171 ? 47.818  135.020 24.216  1.00 3.44  ? 1171 VAL A CG2   1 
ATOM   8884  N  N     . ASN A 1 1172 ? 44.813  133.129 27.085  1.00 5.55  ? 1172 ASN A N     1 
ATOM   8885  C  CA    . ASN A 1 1172 ? 43.912  132.962 28.222  1.00 6.08  ? 1172 ASN A CA    1 
ATOM   8886  C  C     . ASN A 1 1172 ? 44.233  131.698 29.025  1.00 5.97  ? 1172 ASN A C     1 
ATOM   8887  O  O     . ASN A 1 1172 ? 44.227  131.729 30.249  1.00 5.40  ? 1172 ASN A O     1 
ATOM   8888  C  CB    . ASN A 1 1172 ? 42.465  132.872 27.745  1.00 6.78  ? 1172 ASN A CB    1 
ATOM   8889  C  CG    . ASN A 1 1172 ? 41.893  134.206 27.291  1.00 8.44  ? 1172 ASN A CG    1 
ATOM   8890  O  OD1   . ASN A 1 1172 ? 42.396  135.281 27.622  1.00 10.77 ? 1172 ASN A OD1   1 
ATOM   8891  N  ND2   . ASN A 1 1172 ? 40.810  134.134 26.526  1.00 10.20 ? 1172 ASN A ND2   1 
ATOM   8892  N  N     . PHE A 1 1173 ? 44.511  130.591 28.330  1.00 5.89  ? 1173 PHE A N     1 
ATOM   8893  C  CA    . PHE A 1 1173 ? 44.858  129.343 28.995  1.00 5.87  ? 1173 PHE A CA    1 
ATOM   8894  C  C     . PHE A 1 1173 ? 46.039  129.574 29.944  1.00 5.66  ? 1173 PHE A C     1 
ATOM   8895  O  O     . PHE A 1 1173 ? 45.986  129.208 31.113  1.00 5.53  ? 1173 PHE A O     1 
ATOM   8896  C  CB    . PHE A 1 1173 ? 45.231  128.236 27.994  1.00 6.68  ? 1173 PHE A CB    1 
ATOM   8897  C  CG    . PHE A 1 1173 ? 45.766  127.000 28.659  1.00 7.21  ? 1173 PHE A CG    1 
ATOM   8898  C  CD1   . PHE A 1 1173 ? 44.917  126.177 29.382  1.00 8.18  ? 1173 PHE A CD1   1 
ATOM   8899  C  CD2   . PHE A 1 1173 ? 47.116  126.689 28.610  1.00 9.64  ? 1173 PHE A CD2   1 
ATOM   8900  C  CE1   . PHE A 1 1173 ? 45.397  125.048 30.028  1.00 8.52  ? 1173 PHE A CE1   1 
ATOM   8901  C  CE2   . PHE A 1 1173 ? 47.615  125.552 29.266  1.00 11.06 ? 1173 PHE A CE2   1 
ATOM   8902  C  CZ    . PHE A 1 1173 ? 46.737  124.735 29.974  1.00 9.82  ? 1173 PHE A CZ    1 
ATOM   8903  N  N     . PHE A 1 1174 ? 47.094  130.200 29.436  1.00 4.77  ? 1174 PHE A N     1 
ATOM   8904  C  CA    . PHE A 1 1174 ? 48.305  130.353 30.215  1.00 4.51  ? 1174 PHE A CA    1 
ATOM   8905  C  C     . PHE A 1 1174 ? 48.146  131.328 31.377  1.00 4.32  ? 1174 PHE A C     1 
ATOM   8906  O  O     . PHE A 1 1174 ? 48.781  131.162 32.419  1.00 3.77  ? 1174 PHE A O     1 
ATOM   8907  C  CB    . PHE A 1 1174 ? 49.493  130.649 29.307  1.00 4.63  ? 1174 PHE A CB    1 
ATOM   8908  C  CG    . PHE A 1 1174 ? 50.008  129.412 28.581  1.00 5.43  ? 1174 PHE A CG    1 
ATOM   8909  C  CD1   . PHE A 1 1174 ? 49.964  129.326 27.197  1.00 4.76  ? 1174 PHE A CD1   1 
ATOM   8910  C  CD2   . PHE A 1 1174 ? 50.492  128.318 29.306  1.00 6.51  ? 1174 PHE A CD2   1 
ATOM   8911  C  CE1   . PHE A 1 1174 ? 50.429  128.157 26.525  1.00 6.15  ? 1174 PHE A CE1   1 
ATOM   8912  C  CE2   . PHE A 1 1174 ? 50.951  127.156 28.661  1.00 6.25  ? 1174 PHE A CE2   1 
ATOM   8913  C  CZ    . PHE A 1 1174 ? 50.916  127.075 27.267  1.00 5.69  ? 1174 PHE A CZ    1 
ATOM   8914  N  N     . TYR A 1 1175 ? 47.273  132.317 31.214  1.00 4.05  ? 1175 TYR A N     1 
ATOM   8915  C  CA    . TYR A 1 1175 ? 46.934  133.183 32.330  1.00 5.02  ? 1175 TYR A CA    1 
ATOM   8916  C  C     . TYR A 1 1175 ? 46.175  132.383 33.422  1.00 5.44  ? 1175 TYR A C     1 
ATOM   8917  O  O     . TYR A 1 1175 ? 46.463  132.524 34.609  1.00 5.36  ? 1175 TYR A O     1 
ATOM   8918  C  CB    . TYR A 1 1175 ? 46.188  134.452 31.843  1.00 4.88  ? 1175 TYR A CB    1 
ATOM   8919  C  CG    . TYR A 1 1175 ? 47.085  135.504 31.169  1.00 6.29  ? 1175 TYR A CG    1 
ATOM   8920  C  CD1   . TYR A 1 1175 ? 46.595  136.338 30.163  1.00 9.27  ? 1175 TYR A CD1   1 
ATOM   8921  C  CD2   . TYR A 1 1175 ? 48.413  135.678 31.554  1.00 8.64  ? 1175 TYR A CD2   1 
ATOM   8922  C  CE1   . TYR A 1 1175 ? 47.409  137.315 29.556  1.00 10.25 ? 1175 TYR A CE1   1 
ATOM   8923  C  CE2   . TYR A 1 1175 ? 49.236  136.655 30.956  1.00 11.36 ? 1175 TYR A CE2   1 
ATOM   8924  C  CZ    . TYR A 1 1175 ? 48.725  137.464 29.958  1.00 12.70 ? 1175 TYR A CZ    1 
ATOM   8925  O  OH    . TYR A 1 1175 ? 49.542  138.423 29.374  1.00 16.11 ? 1175 TYR A OH    1 
ATOM   8926  N  N     . PHE A 1 1176 ? 45.256  131.503 33.029  1.00 5.30  ? 1176 PHE A N     1 
ATOM   8927  C  CA    . PHE A 1 1176 ? 44.603  130.611 34.004  1.00 5.89  ? 1176 PHE A CA    1 
ATOM   8928  C  C     . PHE A 1 1176 ? 45.615  129.806 34.848  1.00 5.38  ? 1176 PHE A C     1 
ATOM   8929  O  O     . PHE A 1 1176 ? 45.467  129.737 36.063  1.00 4.47  ? 1176 PHE A O     1 
ATOM   8930  C  CB    . PHE A 1 1176 ? 43.621  129.628 33.339  1.00 6.16  ? 1176 PHE A CB    1 
ATOM   8931  C  CG    . PHE A 1 1176 ? 42.362  130.268 32.765  1.00 8.67  ? 1176 PHE A CG    1 
ATOM   8932  C  CD1   . PHE A 1 1176 ? 41.564  129.547 31.869  1.00 9.92  ? 1176 PHE A CD1   1 
ATOM   8933  C  CD2   . PHE A 1 1176 ? 41.971  131.557 33.117  1.00 10.87 ? 1176 PHE A CD2   1 
ATOM   8934  C  CE1   . PHE A 1 1176 ? 40.398  130.088 31.327  1.00 10.10 ? 1176 PHE A CE1   1 
ATOM   8935  C  CE2   . PHE A 1 1176 ? 40.791  132.120 32.578  1.00 13.98 ? 1176 PHE A CE2   1 
ATOM   8936  C  CZ    . PHE A 1 1176 ? 40.010  131.376 31.676  1.00 12.50 ? 1176 PHE A CZ    1 
ATOM   8937  N  N     . ILE A 1 1177 ? 46.611  129.197 34.199  1.00 5.22  ? 1177 ILE A N     1 
ATOM   8938  C  CA    . ILE A 1 1177 ? 47.617  128.364 34.894  1.00 5.67  ? 1177 ILE A CA    1 
ATOM   8939  C  C     . ILE A 1 1177 ? 48.484  129.229 35.823  1.00 4.98  ? 1177 ILE A C     1 
ATOM   8940  O  O     . ILE A 1 1177 ? 48.787  128.849 36.945  1.00 4.93  ? 1177 ILE A O     1 
ATOM   8941  C  CB    . ILE A 1 1177 ? 48.520  127.628 33.866  1.00 5.98  ? 1177 ILE A CB    1 
ATOM   8942  C  CG1   . ILE A 1 1177 ? 47.762  126.527 33.115  1.00 7.76  ? 1177 ILE A CG1   1 
ATOM   8943  C  CG2   . ILE A 1 1177 ? 49.767  127.023 34.529  1.00 7.82  ? 1177 ILE A CG2   1 
ATOM   8944  C  CD1   . ILE A 1 1177 ? 46.524  126.069 33.772  1.00 8.46  ? 1177 ILE A CD1   1 
ATOM   8945  N  N     . ALA A 1 1178 ? 48.881  130.390 35.332  1.00 4.87  ? 1178 ALA A N     1 
ATOM   8946  C  CA    . ALA A 1 1178 ? 49.695  131.326 36.109  1.00 4.61  ? 1178 ALA A CA    1 
ATOM   8947  C  C     . ALA A 1 1178 ? 48.949  131.831 37.357  1.00 4.34  ? 1178 ALA A C     1 
ATOM   8948  O  O     . ALA A 1 1178 ? 49.542  131.952 38.428  1.00 4.54  ? 1178 ALA A O     1 
ATOM   8949  C  CB    . ALA A 1 1178 ? 50.162  132.475 35.232  1.00 4.22  ? 1178 ALA A CB    1 
ATOM   8950  N  N     . GLU A 1 1179 ? 47.649  132.074 37.234  1.00 3.81  ? 1179 GLU A N     1 
ATOM   8951  C  CA    . GLU A 1 1179 ? 46.844  132.455 38.384  1.00 4.68  ? 1179 GLU A CA    1 
ATOM   8952  C  C     . GLU A 1 1179 ? 46.807  131.349 39.441  1.00 3.95  ? 1179 GLU A C     1 
ATOM   8953  O  O     . GLU A 1 1179 ? 46.865  131.630 40.637  1.00 2.48  ? 1179 GLU A O     1 
ATOM   8954  C  CB    . GLU A 1 1179 ? 45.417  132.826 37.969  1.00 5.35  ? 1179 GLU A CB    1 
ATOM   8955  C  CG    . GLU A 1 1179 ? 45.193  134.310 37.747  1.00 9.39  ? 1179 GLU A CG    1 
ATOM   8956  C  CD    . GLU A 1 1179 ? 45.283  135.146 39.021  1.00 12.64 ? 1179 GLU A CD    1 
ATOM   8957  O  OE1   . GLU A 1 1179 ? 44.235  135.494 39.612  1.00 15.23 ? 1179 GLU A OE1   1 
ATOM   8958  O  OE2   . GLU A 1 1179 ? 46.406  135.480 39.424  1.00 13.34 ? 1179 GLU A OE2   1 
ATOM   8959  N  N     . GLU A 1 1180 ? 46.705  130.101 38.978  1.00 3.39  ? 1180 GLU A N     1 
ATOM   8960  C  CA    . GLU A 1 1180 ? 46.797  128.939 39.860  1.00 4.08  ? 1180 GLU A CA    1 
ATOM   8961  C  C     . GLU A 1 1180 ? 48.163  128.892 40.563  1.00 3.37  ? 1180 GLU A C     1 
ATOM   8962  O  O     . GLU A 1 1180 ? 48.246  128.613 41.762  1.00 2.62  ? 1180 GLU A O     1 
ATOM   8963  C  CB    . GLU A 1 1180 ? 46.560  127.641 39.065  1.00 4.31  ? 1180 GLU A CB    1 
ATOM   8964  C  CG    . GLU A 1 1180 ? 46.251  126.447 39.947  1.00 8.35  ? 1180 GLU A CG    1 
ATOM   8965  C  CD    . GLU A 1 1180 ? 46.080  125.137 39.175  1.00 13.76 ? 1180 GLU A CD    1 
ATOM   8966  O  OE1   . GLU A 1 1180 ? 45.695  125.165 37.964  1.00 15.86 ? 1180 GLU A OE1   1 
ATOM   8967  O  OE2   . GLU A 1 1180 ? 46.356  124.074 39.793  1.00 13.61 ? 1180 GLU A OE2   1 
ATOM   8968  N  N     . VAL A 1 1181 ? 49.235  129.148 39.812  1.00 3.13  ? 1181 VAL A N     1 
ATOM   8969  C  CA    . VAL A 1 1181 ? 50.559  129.249 40.420  1.00 3.13  ? 1181 VAL A CA    1 
ATOM   8970  C  C     . VAL A 1 1181 ? 50.574  130.306 41.550  1.00 3.46  ? 1181 VAL A C     1 
ATOM   8971  O  O     . VAL A 1 1181 ? 51.124  130.049 42.636  1.00 3.41  ? 1181 VAL A O     1 
ATOM   8972  C  CB    . VAL A 1 1181 ? 51.672  129.534 39.375  1.00 3.37  ? 1181 VAL A CB    1 
ATOM   8973  C  CG1   . VAL A 1 1181 ? 53.000  129.792 40.061  1.00 3.45  ? 1181 VAL A CG1   1 
ATOM   8974  C  CG2   . VAL A 1 1181 ? 51.817  128.361 38.393  1.00 3.21  ? 1181 VAL A CG2   1 
ATOM   8975  N  N     . ARG A 1 1182 ? 49.947  131.461 41.320  1.00 3.08  ? 1182 ARG A N     1 
ATOM   8976  C  CA    . ARG A 1 1182 ? 49.931  132.530 42.327  1.00 3.69  ? 1182 ARG A CA    1 
ATOM   8977  C  C     . ARG A 1 1182 ? 49.208  132.113 43.614  1.00 4.05  ? 1182 ARG A C     1 
ATOM   8978  O  O     . ARG A 1 1182 ? 49.666  132.424 44.718  1.00 3.70  ? 1182 ARG A O     1 
ATOM   8979  C  CB    . ARG A 1 1182 ? 49.301  133.819 41.782  1.00 4.01  ? 1182 ARG A CB    1 
ATOM   8980  C  CG    . ARG A 1 1182 ? 50.086  134.507 40.658  1.00 4.17  ? 1182 ARG A CG    1 
ATOM   8981  C  CD    . ARG A 1 1182 ? 49.463  135.821 40.186  1.00 5.15  ? 1182 ARG A CD    1 
ATOM   8982  N  NE    . ARG A 1 1182 ? 49.711  136.918 41.126  1.00 5.13  ? 1182 ARG A NE    1 
ATOM   8983  C  CZ    . ARG A 1 1182 ? 48.773  137.645 41.736  1.00 6.67  ? 1182 ARG A CZ    1 
ATOM   8984  N  NH1   . ARG A 1 1182 ? 47.468  137.422 41.534  1.00 6.68  ? 1182 ARG A NH1   1 
ATOM   8985  N  NH2   . ARG A 1 1182 ? 49.142  138.609 42.567  1.00 4.08  ? 1182 ARG A NH2   1 
ATOM   8986  N  N     . SER A 1 1183 ? 48.086  131.407 43.476  1.00 3.94  ? 1183 SER A N     1 
ATOM   8987  C  CA    . SER A 1 1183 ? 47.337  130.968 44.650  1.00 4.17  ? 1183 SER A CA    1 
ATOM   8988  C  C     . SER A 1 1183 ? 48.178  130.000 45.472  1.00 3.47  ? 1183 SER A C     1 
ATOM   8989  O  O     . SER A 1 1183 ? 48.146  130.054 46.689  1.00 2.59  ? 1183 SER A O     1 
ATOM   8990  C  CB    . SER A 1 1183 ? 46.011  130.319 44.258  1.00 4.49  ? 1183 SER A CB    1 
ATOM   8991  O  OG    . SER A 1 1183 ? 46.262  129.046 43.691  1.00 8.86  ? 1183 SER A OG    1 
ATOM   8992  N  N     . LEU A 1 1184 ? 48.943  129.136 44.793  1.00 3.08  ? 1184 LEU A N     1 
ATOM   8993  C  CA    . LEU A 1 1184 ? 49.808  128.162 45.464  1.00 2.87  ? 1184 LEU A CA    1 
ATOM   8994  C  C     . LEU A 1 1184 ? 51.003  128.815 46.186  1.00 2.51  ? 1184 LEU A C     1 
ATOM   8995  O  O     . LEU A 1 1184 ? 51.307  128.452 47.336  1.00 2.29  ? 1184 LEU A O     1 
ATOM   8996  C  CB    . LEU A 1 1184 ? 50.281  127.077 44.482  1.00 2.80  ? 1184 LEU A CB    1 
ATOM   8997  C  CG    . LEU A 1 1184 ? 49.207  126.059 44.081  1.00 4.12  ? 1184 LEU A CG    1 
ATOM   8998  C  CD1   . LEU A 1 1184 ? 49.709  125.128 42.997  1.00 5.44  ? 1184 LEU A CD1   1 
ATOM   8999  C  CD2   . LEU A 1 1184 ? 48.652  125.259 45.273  1.00 5.87  ? 1184 LEU A CD2   1 
ATOM   9000  N  N     . LEU A 1 1185 ? 51.653  129.779 45.525  1.00 1.73  ? 1185 LEU A N     1 
ATOM   9001  C  CA    . LEU A 1 1185 ? 52.704  130.589 46.162  1.00 2.44  ? 1185 LEU A CA    1 
ATOM   9002  C  C     . LEU A 1 1185 ? 52.189  131.271 47.422  1.00 2.01  ? 1185 LEU A C     1 
ATOM   9003  O  O     . LEU A 1 1185 ? 52.825  131.188 48.469  1.00 2.13  ? 1185 LEU A O     1 
ATOM   9004  C  CB    . LEU A 1 1185 ? 53.280  131.635 45.203  1.00 2.08  ? 1185 LEU A CB    1 
ATOM   9005  C  CG    . LEU A 1 1185 ? 54.144  131.104 44.058  1.00 2.60  ? 1185 LEU A CG    1 
ATOM   9006  C  CD1   . LEU A 1 1185 ? 54.434  132.235 43.044  1.00 3.19  ? 1185 LEU A CD1   1 
ATOM   9007  C  CD2   . LEU A 1 1185 ? 55.441  130.502 44.600  1.00 2.10  ? 1185 LEU A CD2   1 
ATOM   9008  N  N     . ALA A 1 1186 ? 51.017  131.907 47.325  1.00 2.38  ? 1186 ALA A N     1 
ATOM   9009  C  CA    . ALA A 1 1186 ? 50.428  132.616 48.462  1.00 2.17  ? 1186 ALA A CA    1 
ATOM   9010  C  C     . ALA A 1 1186 ? 50.195  131.650 49.625  1.00 2.64  ? 1186 ALA A C     1 
ATOM   9011  O  O     . ALA A 1 1186 ? 50.494  131.959 50.783  1.00 2.21  ? 1186 ALA A O     1 
ATOM   9012  C  CB    . ALA A 1 1186 ? 49.121  133.301 48.052  1.00 2.67  ? 1186 ALA A CB    1 
ATOM   9013  N  N     . HIS A 1 1187 ? 49.668  130.472 49.305  1.00 2.48  ? 1187 HIS A N     1 
ATOM   9014  C  CA    . HIS A 1 1187 ? 49.476  129.430 50.294  1.00 2.95  ? 1187 HIS A CA    1 
ATOM   9015  C  C     . HIS A 1 1187 ? 50.793  129.036 50.979  1.00 2.67  ? 1187 HIS A C     1 
ATOM   9016  O  O     . HIS A 1 1187 ? 50.824  128.846 52.187  1.00 2.56  ? 1187 HIS A O     1 
ATOM   9017  C  CB    . HIS A 1 1187 ? 48.809  128.211 49.651  1.00 3.46  ? 1187 HIS A CB    1 
ATOM   9018  C  CG    . HIS A 1 1187 ? 48.729  127.028 50.562  1.00 5.30  ? 1187 HIS A CG    1 
ATOM   9019  N  ND1   . HIS A 1 1187 ? 49.511  125.906 50.393  1.00 7.06  ? 1187 HIS A ND1   1 
ATOM   9020  C  CD2   . HIS A 1 1187 ? 47.983  126.804 51.670  1.00 6.84  ? 1187 HIS A CD2   1 
ATOM   9021  C  CE1   . HIS A 1 1187 ? 49.240  125.036 51.350  1.00 7.93  ? 1187 HIS A CE1   1 
ATOM   9022  N  NE2   . HIS A 1 1187 ? 48.316  125.557 52.138  1.00 8.17  ? 1187 HIS A NE2   1 
ATOM   9023  N  N     . LEU A 1 1188 ? 51.876  128.941 50.205  1.00 2.65  ? 1188 LEU A N     1 
ATOM   9024  C  CA    . LEU A 1 1188 ? 53.184  128.539 50.733  1.00 2.90  ? 1188 LEU A CA    1 
ATOM   9025  C  C     . LEU A 1 1188 ? 53.913  129.661 51.462  1.00 2.90  ? 1188 LEU A C     1 
ATOM   9026  O  O     . LEU A 1 1188 ? 54.876  129.405 52.193  1.00 2.81  ? 1188 LEU A O     1 
ATOM   9027  C  CB    . LEU A 1 1188 ? 54.081  127.967 49.628  1.00 2.53  ? 1188 LEU A CB    1 
ATOM   9028  C  CG    . LEU A 1 1188 ? 53.700  126.648 48.944  1.00 2.89  ? 1188 LEU A CG    1 
ATOM   9029  C  CD1   . LEU A 1 1188 ? 54.587  126.409 47.732  1.00 2.70  ? 1188 LEU A CD1   1 
ATOM   9030  C  CD2   . LEU A 1 1188 ? 53.777  125.470 49.903  1.00 4.58  ? 1188 LEU A CD2   1 
ATOM   9031  N  N     . GLY A 1 1189 ? 53.437  130.891 51.266  1.00 3.11  ? 1189 GLY A N     1 
ATOM   9032  C  CA    . GLY A 1 1189 ? 53.981  132.072 51.926  1.00 2.81  ? 1189 GLY A CA    1 
ATOM   9033  C  C     . GLY A 1 1189 ? 55.166  132.696 51.205  1.00 2.95  ? 1189 GLY A C     1 
ATOM   9034  O  O     . GLY A 1 1189 ? 55.948  133.425 51.817  1.00 2.22  ? 1189 GLY A O     1 
ATOM   9035  N  N     . TYR A 1 1190 ? 55.303  132.403 49.913  1.00 3.05  ? 1190 TYR A N     1 
ATOM   9036  C  CA    . TYR A 1 1190 ? 56.370  132.967 49.086  1.00 4.14  ? 1190 TYR A CA    1 
ATOM   9037  C  C     . TYR A 1 1190 ? 55.831  133.875 47.967  1.00 4.60  ? 1190 TYR A C     1 
ATOM   9038  O  O     . TYR A 1 1190 ? 54.782  133.608 47.389  1.00 4.40  ? 1190 TYR A O     1 
ATOM   9039  C  CB    . TYR A 1 1190 ? 57.264  131.854 48.513  1.00 3.83  ? 1190 TYR A CB    1 
ATOM   9040  C  CG    . TYR A 1 1190 ? 58.054  131.132 49.581  1.00 5.33  ? 1190 TYR A CG    1 
ATOM   9041  C  CD1   . TYR A 1 1190 ? 57.687  129.858 50.006  1.00 5.59  ? 1190 TYR A CD1   1 
ATOM   9042  C  CD2   . TYR A 1 1190 ? 59.151  131.748 50.204  1.00 6.22  ? 1190 TYR A CD2   1 
ATOM   9043  C  CE1   . TYR A 1 1190 ? 58.415  129.191 51.001  1.00 6.95  ? 1190 TYR A CE1   1 
ATOM   9044  C  CE2   . TYR A 1 1190 ? 59.873  131.098 51.195  1.00 7.57  ? 1190 TYR A CE2   1 
ATOM   9045  C  CZ    . TYR A 1 1190 ? 59.502  129.820 51.594  1.00 7.58  ? 1190 TYR A CZ    1 
ATOM   9046  O  OH    . TYR A 1 1190 ? 60.217  129.182 52.592  1.00 6.95  ? 1190 TYR A OH    1 
ATOM   9047  N  N     . ARG A 1 1191 ? 56.571  134.939 47.661  1.00 5.03  ? 1191 ARG A N     1 
ATOM   9048  C  CA    . ARG A 1 1191 ? 56.135  135.942 46.690  1.00 5.67  ? 1191 ARG A CA    1 
ATOM   9049  C  C     . ARG A 1 1191 ? 56.388  135.533 45.226  1.00 5.94  ? 1191 ARG A C     1 
ATOM   9050  O  O     . ARG A 1 1191 ? 55.774  136.073 44.298  1.00 5.52  ? 1191 ARG A O     1 
ATOM   9051  C  CB    . ARG A 1 1191 ? 56.816  137.275 47.003  1.00 5.68  ? 1191 ARG A CB    1 
ATOM   9052  C  CG    . ARG A 1 1191 ? 56.158  137.993 48.159  1.00 8.58  ? 1191 ARG A CG    1 
ATOM   9053  C  CD    . ARG A 1 1191 ? 57.068  138.796 49.053  1.00 12.13 ? 1191 ARG A CD    1 
ATOM   9054  N  NE    . ARG A 1 1191 ? 56.464  138.931 50.388  1.00 16.48 ? 1191 ARG A NE    1 
ATOM   9055  C  CZ    . ARG A 1 1191 ? 56.999  138.446 51.514  1.00 18.23 ? 1191 ARG A CZ    1 
ATOM   9056  N  NH1   . ARG A 1 1191 ? 58.161  137.793 51.482  1.00 20.22 ? 1191 ARG A NH1   1 
ATOM   9057  N  NH2   . ARG A 1 1191 ? 56.377  138.608 52.674  1.00 18.32 ? 1191 ARG A NH2   1 
ATOM   9058  N  N     . SER A 1 1192 ? 57.268  134.558 45.026  1.00 6.45  ? 1192 SER A N     1 
ATOM   9059  C  CA    . SER A 1 1192 ? 57.834  134.324 43.707  1.00 7.37  ? 1192 SER A CA    1 
ATOM   9060  C  C     . SER A 1 1192 ? 58.283  132.888 43.504  1.00 7.26  ? 1192 SER A C     1 
ATOM   9061  O  O     . SER A 1 1192 ? 58.785  132.248 44.423  1.00 7.57  ? 1192 SER A O     1 
ATOM   9062  C  CB    . SER A 1 1192 ? 59.029  135.276 43.499  1.00 7.55  ? 1192 SER A CB    1 
ATOM   9063  O  OG    . SER A 1 1192 ? 59.744  134.939 42.334  1.00 11.23 ? 1192 SER A OG    1 
ATOM   9064  N  N     . LEU A 1 1193 ? 58.083  132.395 42.285  1.00 7.35  ? 1193 LEU A N     1 
ATOM   9065  C  CA    . LEU A 1 1193 ? 58.608  131.110 41.849  1.00 7.91  ? 1193 LEU A CA    1 
ATOM   9066  C  C     . LEU A 1 1193 ? 60.111  131.001 42.119  1.00 8.00  ? 1193 LEU A C     1 
ATOM   9067  O  O     . LEU A 1 1193 ? 60.617  129.937 42.497  1.00 7.32  ? 1193 LEU A O     1 
ATOM   9068  C  CB    . LEU A 1 1193 ? 58.300  130.919 40.361  1.00 8.29  ? 1193 LEU A CB    1 
ATOM   9069  C  CG    . LEU A 1 1193 ? 57.482  129.705 39.889  1.00 8.67  ? 1193 LEU A CG    1 
ATOM   9070  C  CD1   . LEU A 1 1193 ? 56.557  129.092 40.930  1.00 7.60  ? 1193 LEU A CD1   1 
ATOM   9071  C  CD2   . LEU A 1 1193 ? 56.726  129.983 38.597  1.00 9.01  ? 1193 LEU A CD2   1 
ATOM   9072  N  N     . ASP A 1 1194 ? 60.808  132.126 41.963  1.00 7.93  ? 1194 ASP A N     1 
ATOM   9073  C  CA    . ASP A 1 1194 ? 62.231  132.205 42.246  1.00 8.53  ? 1194 ASP A CA    1 
ATOM   9074  C  C     . ASP A 1 1194 ? 62.583  131.787 43.680  1.00 7.93  ? 1194 ASP A C     1 
ATOM   9075  O  O     . ASP A 1 1194 ? 63.678  131.263 43.925  1.00 8.56  ? 1194 ASP A O     1 
ATOM   9076  C  CB    . ASP A 1 1194 ? 62.731  133.631 41.983  1.00 9.21  ? 1194 ASP A CB    1 
ATOM   9077  C  CG    . ASP A 1 1194 ? 64.241  133.741 42.069  1.00 11.97 ? 1194 ASP A CG    1 
ATOM   9078  O  OD1   . ASP A 1 1194 ? 64.746  134.142 43.147  1.00 13.85 ? 1194 ASP A OD1   1 
ATOM   9079  O  OD2   . ASP A 1 1194 ? 64.999  133.433 41.118  1.00 16.23 ? 1194 ASP A OD2   1 
ATOM   9080  N  N     . ASP A 1 1195 ? 61.674  132.022 44.621  1.00 7.01  ? 1195 ASP A N     1 
ATOM   9081  C  CA    . ASP A 1 1195 ? 61.913  131.679 46.020  1.00 6.71  ? 1195 ASP A CA    1 
ATOM   9082  C  C     . ASP A 1 1195 ? 61.755  130.205 46.337  1.00 6.34  ? 1195 ASP A C     1 
ATOM   9083  O  O     . ASP A 1 1195 ? 62.230  129.748 47.382  1.00 6.76  ? 1195 ASP A O     1 
ATOM   9084  C  CB    . ASP A 1 1195 ? 60.988  132.468 46.963  1.00 7.26  ? 1195 ASP A CB    1 
ATOM   9085  C  CG    . ASP A 1 1195 ? 61.086  133.969 46.771  1.00 8.98  ? 1195 ASP A CG    1 
ATOM   9086  O  OD1   . ASP A 1 1195 ? 62.223  134.489 46.595  1.00 9.77  ? 1195 ASP A OD1   1 
ATOM   9087  O  OD2   . ASP A 1 1195 ? 60.069  134.705 46.794  1.00 10.14 ? 1195 ASP A OD2   1 
ATOM   9088  N  N     . ILE A 1 1196 ? 61.062  129.463 45.475  1.00 5.31  ? 1196 ILE A N     1 
ATOM   9089  C  CA    . ILE A 1 1196 ? 60.745  128.068 45.791  1.00 4.85  ? 1196 ILE A CA    1 
ATOM   9090  C  C     . ILE A 1 1196 ? 61.426  126.999 44.922  1.00 4.25  ? 1196 ILE A C     1 
ATOM   9091  O  O     . ILE A 1 1196 ? 61.386  125.812 45.266  1.00 3.70  ? 1196 ILE A O     1 
ATOM   9092  C  CB    . ILE A 1 1196 ? 59.199  127.833 45.853  1.00 5.11  ? 1196 ILE A CB    1 
ATOM   9093  C  CG1   . ILE A 1 1196 ? 58.582  127.822 44.459  1.00 4.86  ? 1196 ILE A CG1   1 
ATOM   9094  C  CG2   . ILE A 1 1196 ? 58.535  128.867 46.785  1.00 4.84  ? 1196 ILE A CG2   1 
ATOM   9095  C  CD1   . ILE A 1 1196 ? 57.236  127.032 44.373  1.00 6.14  ? 1196 ILE A CD1   1 
ATOM   9096  N  N     . ILE A 1 1197 ? 62.035  127.397 43.810  1.00 3.64  ? 1197 ILE A N     1 
ATOM   9097  C  CA    . ILE A 1 1197 ? 62.680  126.403 42.944  1.00 4.16  ? 1197 ILE A CA    1 
ATOM   9098  C  C     . ILE A 1 1197 ? 63.703  125.597 43.747  1.00 3.64  ? 1197 ILE A C     1 
ATOM   9099  O  O     . ILE A 1 1197 ? 64.536  126.166 44.469  1.00 4.30  ? 1197 ILE A O     1 
ATOM   9100  C  CB    . ILE A 1 1197 ? 63.294  127.037 41.673  1.00 4.87  ? 1197 ILE A CB    1 
ATOM   9101  C  CG1   . ILE A 1 1197 ? 62.191  127.703 40.832  1.00 5.81  ? 1197 ILE A CG1   1 
ATOM   9102  C  CG2   . ILE A 1 1197 ? 64.055  125.980 40.841  1.00 2.51  ? 1197 ILE A CG2   1 
ATOM   9103  C  CD1   . ILE A 1 1197 ? 62.700  128.785 39.938  1.00 8.92  ? 1197 ILE A CD1   1 
ATOM   9104  N  N     . GLY A 1 1198 ? 63.591  124.277 43.659  1.00 2.83  ? 1198 GLY A N     1 
ATOM   9105  C  CA    . GLY A 1 1198 ? 64.477  123.364 44.365  1.00 3.02  ? 1198 GLY A CA    1 
ATOM   9106  C  C     . GLY A 1 1198 ? 64.201  123.141 45.850  1.00 2.75  ? 1198 GLY A C     1 
ATOM   9107  O  O     . GLY A 1 1198 ? 64.945  122.423 46.514  1.00 2.77  ? 1198 GLY A O     1 
ATOM   9108  N  N     . ARG A 1 1199 ? 63.152  123.753 46.385  1.00 2.99  ? 1199 ARG A N     1 
ATOM   9109  C  CA    . ARG A 1 1199 ? 62.831  123.622 47.820  1.00 3.21  ? 1199 ARG A CA    1 
ATOM   9110  C  C     . ARG A 1 1199 ? 62.080  122.322 48.131  1.00 3.65  ? 1199 ARG A C     1 
ATOM   9111  O  O     . ARG A 1 1199 ? 60.915  122.340 48.534  1.00 2.90  ? 1199 ARG A O     1 
ATOM   9112  C  CB    . ARG A 1 1199 ? 62.041  124.842 48.330  1.00 3.59  ? 1199 ARG A CB    1 
ATOM   9113  C  CG    . ARG A 1 1199 ? 62.893  126.114 48.439  1.00 4.16  ? 1199 ARG A CG    1 
ATOM   9114  C  CD    . ARG A 1 1199 ? 63.966  126.049 49.542  1.00 4.84  ? 1199 ARG A CD    1 
ATOM   9115  N  NE    . ARG A 1 1199 ? 63.357  125.664 50.806  1.00 2.88  ? 1199 ARG A NE    1 
ATOM   9116  C  CZ    . ARG A 1 1199 ? 62.659  126.482 51.565  1.00 4.48  ? 1199 ARG A CZ    1 
ATOM   9117  N  NH1   . ARG A 1 1199 ? 62.501  127.762 51.204  1.00 4.04  ? 1199 ARG A NH1   1 
ATOM   9118  N  NH2   . ARG A 1 1199 ? 62.116  126.024 52.694  1.00 3.03  ? 1199 ARG A NH2   1 
ATOM   9119  N  N     . THR A 1 1200 ? 62.761  121.195 47.939  1.00 4.29  ? 1200 THR A N     1 
ATOM   9120  C  CA    . THR A 1 1200 ? 62.141  119.879 48.080  1.00 5.65  ? 1200 THR A CA    1 
ATOM   9121  C  C     . THR A 1 1200 ? 61.815  119.562 49.545  1.00 5.37  ? 1200 THR A C     1 
ATOM   9122  O  O     . THR A 1 1200 ? 60.994  118.695 49.839  1.00 5.36  ? 1200 THR A O     1 
ATOM   9123  C  CB    . THR A 1 1200 ? 63.034  118.800 47.413  1.00 6.23  ? 1200 THR A CB    1 
ATOM   9124  O  OG1   . THR A 1 1200 ? 62.255  117.624 47.147  1.00 12.46 ? 1200 THR A OG1   1 
ATOM   9125  C  CG2   . THR A 1 1200 ? 64.079  118.316 48.353  1.00 5.55  ? 1200 THR A CG2   1 
ATOM   9126  N  N     . ASP A 1 1201 ? 62.424  120.316 50.458  1.00 4.83  ? 1201 ASP A N     1 
ATOM   9127  C  CA    . ASP A 1 1201 ? 62.014  120.297 51.857  1.00 4.48  ? 1201 ASP A CA    1 
ATOM   9128  C  C     . ASP A 1 1201 ? 60.543  120.728 52.075  1.00 4.05  ? 1201 ASP A C     1 
ATOM   9129  O  O     . ASP A 1 1201 ? 59.984  120.475 53.136  1.00 2.89  ? 1201 ASP A O     1 
ATOM   9130  C  CB    . ASP A 1 1201 ? 62.967  121.155 52.697  1.00 4.64  ? 1201 ASP A CB    1 
ATOM   9131  C  CG    . ASP A 1 1201 ? 62.957  122.618 52.283  1.00 5.46  ? 1201 ASP A CG    1 
ATOM   9132  O  OD1   . ASP A 1 1201 ? 63.473  122.967 51.190  1.00 7.57  ? 1201 ASP A OD1   1 
ATOM   9133  O  OD2   . ASP A 1 1201 ? 62.432  123.486 52.990  1.00 7.09  ? 1201 ASP A OD2   1 
ATOM   9134  N  N     . LEU A 1 1202 ? 59.917  121.380 51.085  1.00 3.36  ? 1202 LEU A N     1 
ATOM   9135  C  CA    . LEU A 1 1202 ? 58.496  121.746 51.220  1.00 3.20  ? 1202 LEU A CA    1 
ATOM   9136  C  C     . LEU A 1 1202 ? 57.559  120.634 50.737  1.00 3.64  ? 1202 LEU A C     1 
ATOM   9137  O  O     . LEU A 1 1202 ? 56.332  120.830 50.641  1.00 3.46  ? 1202 LEU A O     1 
ATOM   9138  C  CB    . LEU A 1 1202 ? 58.167  123.066 50.510  1.00 3.04  ? 1202 LEU A CB    1 
ATOM   9139  C  CG    . LEU A 1 1202 ? 58.954  124.306 50.938  1.00 3.39  ? 1202 LEU A CG    1 
ATOM   9140  C  CD1   . LEU A 1 1202 ? 58.645  125.486 50.030  1.00 1.25  ? 1202 LEU A CD1   1 
ATOM   9141  C  CD2   . LEU A 1 1202 ? 58.672  124.634 52.408  1.00 1.17  ? 1202 LEU A CD2   1 
ATOM   9142  N  N     . LEU A 1 1203 ? 58.142  119.477 50.436  1.00 3.48  ? 1203 LEU A N     1 
ATOM   9143  C  CA    . LEU A 1 1203 ? 57.385  118.309 50.015  1.00 4.02  ? 1203 LEU A CA    1 
ATOM   9144  C  C     . LEU A 1 1203 ? 57.299  117.250 51.111  1.00 4.00  ? 1203 LEU A C     1 
ATOM   9145  O  O     . LEU A 1 1203 ? 58.257  117.031 51.858  1.00 3.26  ? 1203 LEU A O     1 
ATOM   9146  C  CB    . LEU A 1 1203 ? 58.003  117.688 48.750  1.00 4.02  ? 1203 LEU A CB    1 
ATOM   9147  C  CG    . LEU A 1 1203 ? 57.901  118.504 47.454  1.00 5.31  ? 1203 LEU A CG    1 
ATOM   9148  C  CD1   . LEU A 1 1203 ? 58.598  117.810 46.320  1.00 5.25  ? 1203 LEU A CD1   1 
ATOM   9149  C  CD2   . LEU A 1 1203 ? 56.441  118.765 47.094  1.00 8.12  ? 1203 LEU A CD2   1 
ATOM   9150  N  N     . LYS A 1 1204 ? 56.154  116.574 51.156  1.00 3.59  ? 1204 LYS A N     1 
ATOM   9151  C  CA    . LYS A 1 1204 ? 55.920  115.455 52.055  1.00 4.06  ? 1204 LYS A CA    1 
ATOM   9152  C  C     . LYS A 1 1204 ? 55.077  114.410 51.332  1.00 4.19  ? 1204 LYS A C     1 
ATOM   9153  O  O     . LYS A 1 1204 ? 54.397  114.727 50.350  1.00 3.67  ? 1204 LYS A O     1 
ATOM   9154  C  CB    . LYS A 1 1204 ? 55.203  115.913 53.329  1.00 3.89  ? 1204 LYS A CB    1 
ATOM   9155  C  CG    . LYS A 1 1204 ? 53.751  116.343 53.116  1.00 5.12  ? 1204 LYS A CG    1 
ATOM   9156  C  CD    . LYS A 1 1204 ? 53.002  116.446 54.437  1.00 8.36  ? 1204 LYS A CD    1 
ATOM   9157  C  CE    . LYS A 1 1204 ? 51.620  117.027 54.223  1.00 10.17 ? 1204 LYS A CE    1 
ATOM   9158  N  NZ    . LYS A 1 1204 ? 50.620  116.325 55.068  1.00 13.14 ? 1204 LYS A NZ    1 
ATOM   9159  N  N     . VAL A 1 1205 ? 55.106  113.181 51.833  1.00 4.39  ? 1205 VAL A N     1 
ATOM   9160  C  CA    . VAL A 1 1205 ? 54.301  112.107 51.269  1.00 4.61  ? 1205 VAL A CA    1 
ATOM   9161  C  C     . VAL A 1 1205 ? 52.853  112.268 51.747  1.00 4.89  ? 1205 VAL A C     1 
ATOM   9162  O  O     . VAL A 1 1205 ? 52.613  112.468 52.947  1.00 3.94  ? 1205 VAL A O     1 
ATOM   9163  C  CB    . VAL A 1 1205 ? 54.864  110.716 51.654  1.00 4.96  ? 1205 VAL A CB    1 
ATOM   9164  C  CG1   . VAL A 1 1205 ? 53.945  109.583 51.156  1.00 4.64  ? 1205 VAL A CG1   1 
ATOM   9165  C  CG2   . VAL A 1 1205 ? 56.288  110.535 51.095  1.00 5.05  ? 1205 VAL A CG2   1 
ATOM   9166  N  N     . ARG A 1 1206 ? 51.906  112.201 50.802  1.00 4.90  ? 1206 ARG A N     1 
ATOM   9167  C  CA    . ARG A 1 1206 ? 50.468  112.251 51.101  1.00 6.12  ? 1206 ARG A CA    1 
ATOM   9168  C  C     . ARG A 1 1206 ? 50.024  111.062 51.939  1.00 6.30  ? 1206 ARG A C     1 
ATOM   9169  O  O     . ARG A 1 1206 ? 50.343  109.916 51.616  1.00 6.21  ? 1206 ARG A O     1 
ATOM   9170  C  CB    . ARG A 1 1206 ? 49.657  112.215 49.807  1.00 6.65  ? 1206 ARG A CB    1 
ATOM   9171  C  CG    . ARG A 1 1206 ? 49.468  113.530 49.102  1.00 8.51  ? 1206 ARG A CG    1 
ATOM   9172  C  CD    . ARG A 1 1206 ? 48.694  113.402 47.774  1.00 10.07 ? 1206 ARG A CD    1 
ATOM   9173  N  NE    . ARG A 1 1206 ? 47.295  113.079 48.022  1.00 11.94 ? 1206 ARG A NE    1 
ATOM   9174  C  CZ    . ARG A 1 1206 ? 46.358  112.947 47.079  1.00 12.85 ? 1206 ARG A CZ    1 
ATOM   9175  N  NH1   . ARG A 1 1206 ? 46.653  113.101 45.790  1.00 12.17 ? 1206 ARG A NH1   1 
ATOM   9176  N  NH2   . ARG A 1 1206 ? 45.117  112.650 47.436  1.00 11.29 ? 1206 ARG A NH2   1 
ATOM   9177  N  N     . SER A 1 1207 ? 49.254  111.324 52.987  1.00 7.08  ? 1207 SER A N     1 
ATOM   9178  C  CA    . SER A 1 1207 ? 48.789  110.260 53.878  1.00 7.93  ? 1207 SER A CA    1 
ATOM   9179  C  C     . SER A 1 1207 ? 47.435  109.644 53.484  1.00 8.72  ? 1207 SER A C     1 
ATOM   9180  O  O     . SER A 1 1207 ? 47.029  108.621 54.048  1.00 8.80  ? 1207 SER A O     1 
ATOM   9181  C  CB    . SER A 1 1207 ? 48.763  110.740 55.333  1.00 8.35  ? 1207 SER A CB    1 
ATOM   9182  O  OG    . SER A 1 1207 ? 47.891  111.840 55.513  1.00 8.52  ? 1207 SER A OG    1 
ATOM   9183  N  N     . ASP A 1 1208 ? 46.739  110.254 52.526  1.00 9.12  ? 1208 ASP A N     1 
ATOM   9184  C  CA    . ASP A 1 1208 ? 45.386  109.796 52.176  1.00 10.47 ? 1208 ASP A CA    1 
ATOM   9185  C  C     . ASP A 1 1208 ? 45.386  108.883 50.947  1.00 10.39 ? 1208 ASP A C     1 
ATOM   9186  O  O     . ASP A 1 1208 ? 44.356  108.693 50.305  1.00 10.81 ? 1208 ASP A O     1 
ATOM   9187  C  CB    . ASP A 1 1208 ? 44.419  110.983 51.999  1.00 10.65 ? 1208 ASP A CB    1 
ATOM   9188  C  CG    . ASP A 1 1208 ? 44.909  111.999 50.965  1.00 12.63 ? 1208 ASP A CG    1 
ATOM   9189  O  OD1   . ASP A 1 1208 ? 46.126  112.088 50.725  1.00 14.56 ? 1208 ASP A OD1   1 
ATOM   9190  O  OD2   . ASP A 1 1208 ? 44.151  112.760 50.337  1.00 15.81 ? 1208 ASP A OD2   1 
ATOM   9191  N  N     . VAL A 1 1209 ? 46.556  108.331 50.632  1.00 10.47 ? 1209 VAL A N     1 
ATOM   9192  C  CA    . VAL A 1 1209 ? 46.770  107.540 49.427  1.00 10.07 ? 1209 VAL A CA    1 
ATOM   9193  C  C     . VAL A 1 1209 ? 47.102  106.097 49.801  1.00 10.35 ? 1209 VAL A C     1 
ATOM   9194  O  O     . VAL A 1 1209 ? 48.044  105.838 50.544  1.00 10.51 ? 1209 VAL A O     1 
ATOM   9195  C  CB    . VAL A 1 1209 ? 47.913  108.156 48.578  1.00 10.09 ? 1209 VAL A CB    1 
ATOM   9196  C  CG1   . VAL A 1 1209 ? 48.359  107.211 47.458  1.00 9.18  ? 1209 VAL A CG1   1 
ATOM   9197  C  CG2   . VAL A 1 1209 ? 47.491  109.519 48.021  1.00 9.48  ? 1209 VAL A CG2   1 
ATOM   9198  N  N     . GLN A 1 1210 ? 46.320  105.160 49.289  1.00 10.74 ? 1210 GLN A N     1 
ATOM   9199  C  CA    . GLN A 1 1210 ? 46.600  103.745 49.476  1.00 11.07 ? 1210 GLN A CA    1 
ATOM   9200  C  C     . GLN A 1 1210 ? 46.666  103.112 48.097  1.00 10.58 ? 1210 GLN A C     1 
ATOM   9201  O  O     . GLN A 1 1210 ? 45.720  103.213 47.310  1.00 10.82 ? 1210 GLN A O     1 
ATOM   9202  C  CB    . GLN A 1 1210 ? 45.523  103.084 50.343  1.00 11.69 ? 1210 GLN A CB    1 
ATOM   9203  C  CG    . GLN A 1 1210 ? 46.050  102.034 51.341  1.00 14.01 ? 1210 GLN A CG    1 
ATOM   9204  C  CD    . GLN A 1 1210 ? 46.784  102.629 52.567  1.00 16.71 ? 1210 GLN A CD    1 
ATOM   9205  O  OE1   . GLN A 1 1210 ? 46.230  102.654 53.671  1.00 17.60 ? 1210 GLN A OE1   1 
ATOM   9206  N  NE2   . GLN A 1 1210 ? 48.032  103.072 52.373  1.00 15.77 ? 1210 GLN A NE2   1 
ATOM   9207  N  N     . LEU A 1 1211 ? 47.806  102.504 47.789  1.00 10.14 ? 1211 LEU A N     1 
ATOM   9208  C  CA    . LEU A 1 1211 ? 48.010  101.890 46.487  1.00 9.78  ? 1211 LEU A CA    1 
ATOM   9209  C  C     . LEU A 1 1211 ? 47.381  100.511 46.457  1.00 10.08 ? 1211 LEU A C     1 
ATOM   9210  O  O     . LEU A 1 1211 ? 47.354  99.798  47.466  1.00 10.47 ? 1211 LEU A O     1 
ATOM   9211  C  CB    . LEU A 1 1211 ? 49.493  101.810 46.139  1.00 9.24  ? 1211 LEU A CB    1 
ATOM   9212  C  CG    . LEU A 1 1211 ? 50.279  103.114 46.046  1.00 9.07  ? 1211 LEU A CG    1 
ATOM   9213  C  CD1   . LEU A 1 1211 ? 51.718  102.786 45.706  1.00 9.97  ? 1211 LEU A CD1   1 
ATOM   9214  C  CD2   . LEU A 1 1211 ? 49.680  104.054 45.000  1.00 8.50  ? 1211 LEU A CD2   1 
ATOM   9215  N  N     . SER A 1 1212 ? 46.878  100.153 45.286  1.00 9.98  ? 1212 SER A N     1 
ATOM   9216  C  CA    . SER A 1 1212 ? 46.207  98.882  45.048  1.00 10.41 ? 1212 SER A CA    1 
ATOM   9217  C  C     . SER A 1 1212 ? 47.118  97.658  45.187  1.00 9.83  ? 1212 SER A C     1 
ATOM   9218  O  O     . SER A 1 1212 ? 46.781  96.695  45.878  1.00 10.59 ? 1212 SER A O     1 
ATOM   9219  C  CB    . SER A 1 1212 ? 45.605  98.912  43.639  1.00 10.09 ? 1212 SER A CB    1 
ATOM   9220  O  OG    . SER A 1 1212 ? 44.201  98.959  43.725  1.00 12.43 ? 1212 SER A OG    1 
ATOM   9221  N  N     . LYS A 1 1213 ? 48.272  97.729  44.534  1.00 9.67  ? 1213 LYS A N     1 
ATOM   9222  C  CA    . LYS A 1 1213 ? 49.173  96.595  44.350  1.00 9.52  ? 1213 LYS A CA    1 
ATOM   9223  C  C     . LYS A 1 1213 ? 50.261  96.408  45.405  1.00 9.05  ? 1213 LYS A C     1 
ATOM   9224  O  O     . LYS A 1 1213 ? 50.751  95.295  45.573  1.00 9.13  ? 1213 LYS A O     1 
ATOM   9225  C  CB    . LYS A 1 1213 ? 49.838  96.692  42.983  1.00 8.64  ? 1213 LYS A CB    1 
ATOM   9226  C  CG    . LYS A 1 1213 ? 48.846  96.681  41.844  1.00 9.73  ? 1213 LYS A CG    1 
ATOM   9227  C  CD    . LYS A 1 1213 ? 49.475  97.245  40.593  1.00 7.53  ? 1213 LYS A CD    1 
ATOM   9228  C  CE    . LYS A 1 1213 ? 48.444  97.222  39.466  1.00 9.73  ? 1213 LYS A CE    1 
ATOM   9229  N  NZ    . LYS A 1 1213 ? 49.103  97.064  38.166  1.00 6.34  ? 1213 LYS A NZ    1 
ATOM   9230  N  N     . THR A 1 1214 ? 50.651  97.493  46.073  1.00 8.72  ? 1214 THR A N     1 
ATOM   9231  C  CA    . THR A 1 1214 ? 51.692  97.456  47.101  1.00 8.77  ? 1214 THR A CA    1 
ATOM   9232  C  C     . THR A 1 1214 ? 51.362  98.361  48.264  1.00 8.22  ? 1214 THR A C     1 
ATOM   9233  O  O     . THR A 1 1214 ? 50.556  99.277  48.133  1.00 8.32  ? 1214 THR A O     1 
ATOM   9234  C  CB    . THR A 1 1214 ? 53.058  97.934  46.560  1.00 8.75  ? 1214 THR A CB    1 
ATOM   9235  O  OG1   . THR A 1 1214 ? 52.971  98.264  45.170  1.00 11.97 ? 1214 THR A OG1   1 
ATOM   9236  C  CG2   . THR A 1 1214 ? 54.034  96.839  46.604  1.00 7.66  ? 1214 THR A CG2   1 
ATOM   9237  N  N     . GLN A 1 1215 ? 52.046  98.124  49.380  1.00 8.35  ? 1215 GLN A N     1 
ATOM   9238  C  CA    . GLN A 1 1215 ? 51.933  98.958  50.576  1.00 8.46  ? 1215 GLN A CA    1 
ATOM   9239  C  C     . GLN A 1 1215 ? 52.290  100.415 50.271  1.00 8.40  ? 1215 GLN A C     1 
ATOM   9240  O  O     . GLN A 1 1215 ? 51.471  101.307 50.469  1.00 8.55  ? 1215 GLN A O     1 
ATOM   9241  C  CB    . GLN A 1 1215 ? 52.815  98.401  51.710  1.00 8.67  ? 1215 GLN A CB    1 
ATOM   9242  C  CG    . GLN A 1 1215 ? 52.239  98.595  53.119  1.00 10.79 ? 1215 GLN A CG    1 
ATOM   9243  C  CD    . GLN A 1 1215 ? 51.239  97.509  53.516  1.00 13.79 ? 1215 GLN A CD    1 
ATOM   9244  O  OE1   . GLN A 1 1215 ? 51.517  96.690  54.406  1.00 15.42 ? 1215 GLN A OE1   1 
ATOM   9245  N  NE2   . GLN A 1 1215 ? 50.075  97.506  52.873  1.00 14.58 ? 1215 GLN A NE2   1 
ATOM   9246  N  N     . ASN A 1 1216 ? 53.494  100.651 49.755  1.00 7.88  ? 1216 ASN A N     1 
ATOM   9247  C  CA    . ASN A 1 1216 ? 53.966  102.019 49.521  1.00 8.24  ? 1216 ASN A CA    1 
ATOM   9248  C  C     . ASN A 1 1216 ? 55.164  102.060 48.591  1.00 7.93  ? 1216 ASN A C     1 
ATOM   9249  O  O     . ASN A 1 1216 ? 55.814  101.043 48.347  1.00 8.25  ? 1216 ASN A O     1 
ATOM   9250  C  CB    . ASN A 1 1216 ? 54.336  102.701 50.848  1.00 8.71  ? 1216 ASN A CB    1 
ATOM   9251  C  CG    . ASN A 1 1216 ? 55.267  101.846 51.705  1.00 10.39 ? 1216 ASN A CG    1 
ATOM   9252  O  OD1   . ASN A 1 1216 ? 54.859  101.287 52.719  1.00 13.10 ? 1216 ASN A OD1   1 
ATOM   9253  N  ND2   . ASN A 1 1216 ? 56.517  101.727 51.282  1.00 12.44 ? 1216 ASN A ND2   1 
ATOM   9254  N  N     . LEU A 1 1217 ? 55.444  103.243 48.068  1.00 7.38  ? 1217 LEU A N     1 
ATOM   9255  C  CA    . LEU A 1 1217 ? 56.670  103.492 47.337  1.00 7.45  ? 1217 LEU A CA    1 
ATOM   9256  C  C     . LEU A 1 1217 ? 57.722  104.124 48.280  1.00 7.76  ? 1217 LEU A C     1 
ATOM   9257  O  O     . LEU A 1 1217 ? 57.383  104.592 49.370  1.00 7.70  ? 1217 LEU A O     1 
ATOM   9258  C  CB    . LEU A 1 1217 ? 56.370  104.387 46.135  1.00 7.31  ? 1217 LEU A CB    1 
ATOM   9259  C  CG    . LEU A 1 1217 ? 56.155  103.693 44.775  1.00 8.35  ? 1217 LEU A CG    1 
ATOM   9260  C  CD1   . LEU A 1 1217 ? 55.501  102.319 44.826  1.00 7.40  ? 1217 LEU A CD1   1 
ATOM   9261  C  CD2   . LEU A 1 1217 ? 55.445  104.629 43.810  1.00 8.05  ? 1217 LEU A CD2   1 
ATOM   9262  N  N     . THR A 1 1218 ? 58.989  104.093 47.872  1.00 7.51  ? 1218 THR A N     1 
ATOM   9263  C  CA    . THR A 1 1218 ? 60.068  104.782 48.580  1.00 7.62  ? 1218 THR A CA    1 
ATOM   9264  C  C     . THR A 1 1218 ? 60.378  106.050 47.784  1.00 7.13  ? 1218 THR A C     1 
ATOM   9265  O  O     . THR A 1 1218 ? 60.674  105.970 46.597  1.00 6.47  ? 1218 THR A O     1 
ATOM   9266  C  CB    . THR A 1 1218 ? 61.311  103.867 48.666  1.00 7.79  ? 1218 THR A CB    1 
ATOM   9267  O  OG1   . THR A 1 1218 ? 60.939  102.616 49.264  1.00 8.85  ? 1218 THR A OG1   1 
ATOM   9268  C  CG2   . THR A 1 1218 ? 62.332  104.429 49.645  1.00 9.00  ? 1218 THR A CG2   1 
ATOM   9269  N  N     . LEU A 1 1219 ? 60.280  107.220 48.409  1.00 6.87  ? 1219 LEU A N     1 
ATOM   9270  C  CA    . LEU A 1 1219 ? 60.431  108.459 47.637  1.00 6.83  ? 1219 LEU A CA    1 
ATOM   9271  C  C     . LEU A 1 1219 ? 61.610  109.355 48.028  1.00 6.72  ? 1219 LEU A C     1 
ATOM   9272  O  O     . LEU A 1 1219 ? 61.597  110.551 47.742  1.00 5.77  ? 1219 LEU A O     1 
ATOM   9273  C  CB    . LEU A 1 1219 ? 59.107  109.245 47.593  1.00 7.47  ? 1219 LEU A CB    1 
ATOM   9274  C  CG    . LEU A 1 1219 ? 57.898  108.498 47.007  1.00 7.65  ? 1219 LEU A CG    1 
ATOM   9275  C  CD1   . LEU A 1 1219 ? 56.614  109.222 47.367  1.00 9.27  ? 1219 LEU A CD1   1 
ATOM   9276  C  CD2   . LEU A 1 1219 ? 58.013  108.344 45.481  1.00 8.43  ? 1219 LEU A CD2   1 
ATOM   9277  N  N     . ASP A 1 1220 ? 62.636  108.782 48.657  1.00 6.84  ? 1220 ASP A N     1 
ATOM   9278  C  CA    . ASP A 1 1220 ? 63.879  109.532 48.913  1.00 7.07  ? 1220 ASP A CA    1 
ATOM   9279  C  C     . ASP A 1 1220 ? 64.432  110.180 47.646  1.00 6.97  ? 1220 ASP A C     1 
ATOM   9280  O  O     . ASP A 1 1220 ? 64.929  111.306 47.682  1.00 6.91  ? 1220 ASP A O     1 
ATOM   9281  C  CB    . ASP A 1 1220 ? 64.956  108.621 49.524  1.00 7.11  ? 1220 ASP A CB    1 
ATOM   9282  C  CG    . ASP A 1 1220 ? 64.597  108.134 50.906  1.00 7.52  ? 1220 ASP A CG    1 
ATOM   9283  O  OD1   . ASP A 1 1220 ? 63.779  108.778 51.600  1.00 9.10  ? 1220 ASP A OD1   1 
ATOM   9284  O  OD2   . ASP A 1 1220 ? 65.096  107.105 51.401  1.00 9.59  ? 1220 ASP A OD2   1 
ATOM   9285  N  N     . CYS A 1 1221 ? 64.321  109.476 46.520  1.00 7.05  ? 1221 CYS A N     1 
ATOM   9286  C  CA    . CYS A 1 1221 ? 64.793  109.981 45.238  1.00 7.23  ? 1221 CYS A CA    1 
ATOM   9287  C  C     . CYS A 1 1221 ? 64.233  111.357 44.917  1.00 7.00  ? 1221 CYS A C     1 
ATOM   9288  O  O     . CYS A 1 1221 ? 64.895  112.145 44.236  1.00 7.10  ? 1221 CYS A O     1 
ATOM   9289  C  CB    . CYS A 1 1221 ? 64.472  109.011 44.089  1.00 7.36  ? 1221 CYS A CB    1 
ATOM   9290  S  SG    . CYS A 1 1221 ? 62.725  108.591 43.902  1.00 12.03 ? 1221 CYS A SG    1 
ATOM   9291  N  N     . LEU A 1 1222 ? 63.026  111.642 45.401  1.00 5.76  ? 1222 LEU A N     1 
ATOM   9292  C  CA    . LEU A 1 1222 ? 62.398  112.935 45.165  1.00 5.46  ? 1222 LEU A CA    1 
ATOM   9293  C  C     . LEU A 1 1222 ? 62.560  113.909 46.334  1.00 5.35  ? 1222 LEU A C     1 
ATOM   9294  O  O     . LEU A 1 1222 ? 62.526  115.119 46.142  1.00 6.10  ? 1222 LEU A O     1 
ATOM   9295  C  CB    . LEU A 1 1222 ? 60.908  112.760 44.833  1.00 5.62  ? 1222 LEU A CB    1 
ATOM   9296  C  CG    . LEU A 1 1222 ? 60.551  111.859 43.638  1.00 4.99  ? 1222 LEU A CG    1 
ATOM   9297  C  CD1   . LEU A 1 1222 ? 59.042  111.820 43.426  1.00 6.67  ? 1222 LEU A CD1   1 
ATOM   9298  C  CD2   . LEU A 1 1222 ? 61.268  112.269 42.347  1.00 4.66  ? 1222 LEU A CD2   1 
ATOM   9299  N  N     . LEU A 1 1223 ? 62.719  113.384 47.542  1.00 4.85  ? 1223 LEU A N     1 
ATOM   9300  C  CA    . LEU A 1 1223 ? 62.767  114.230 48.724  1.00 5.19  ? 1223 LEU A CA    1 
ATOM   9301  C  C     . LEU A 1 1223 ? 64.195  114.635 49.115  1.00 5.18  ? 1223 LEU A C     1 
ATOM   9302  O  O     . LEU A 1 1223 ? 64.401  115.731 49.632  1.00 5.52  ? 1223 LEU A O     1 
ATOM   9303  C  CB    . LEU A 1 1223 ? 62.072  113.550 49.897  1.00 5.01  ? 1223 LEU A CB    1 
ATOM   9304  C  CG    . LEU A 1 1223 ? 60.616  113.104 49.687  1.00 5.78  ? 1223 LEU A CG    1 
ATOM   9305  C  CD1   . LEU A 1 1223 ? 60.137  112.355 50.904  1.00 4.36  ? 1223 LEU A CD1   1 
ATOM   9306  C  CD2   . LEU A 1 1223 ? 59.701  114.294 49.394  1.00 7.26  ? 1223 LEU A CD2   1 
ATOM   9307  N  N     . ASN A 1 1224 ? 65.158  113.747 48.885  1.00 4.55  ? 1224 ASN A N     1 
ATOM   9308  C  CA    . ASN A 1 1224 ? 66.524  113.983 49.340  1.00 5.04  ? 1224 ASN A CA    1 
ATOM   9309  C  C     . ASN A 1 1224 ? 67.350  114.727 48.292  1.00 6.01  ? 1224 ASN A C     1 
ATOM   9310  O  O     . ASN A 1 1224 ? 68.165  114.119 47.579  1.00 5.68  ? 1224 ASN A O     1 
ATOM   9311  C  CB    . ASN A 1 1224 ? 67.210  112.669 49.757  1.00 4.33  ? 1224 ASN A CB    1 
ATOM   9312  C  CG    . ASN A 1 1224 ? 66.552  112.012 50.983  1.00 4.12  ? 1224 ASN A CG    1 
ATOM   9313  O  OD1   . ASN A 1 1224 ? 65.644  112.568 51.601  1.00 2.17  ? 1224 ASN A OD1   1 
ATOM   9314  N  ND2   . ASN A 1 1224 ? 67.013  110.824 51.323  1.00 1.80  ? 1224 ASN A ND2   1 
ATOM   9315  N  N     . LEU A 1 1225 ? 67.112  116.033 48.195  1.00 6.62  ? 1225 LEU A N     1 
ATOM   9316  C  CA    . LEU A 1 1225 ? 67.871  116.920 47.318  1.00 8.03  ? 1225 LEU A CA    1 
ATOM   9317  C  C     . LEU A 1 1225 ? 68.675  117.897 48.184  1.00 8.51  ? 1225 LEU A C     1 
ATOM   9318  O  O     . LEU A 1 1225 ? 68.332  118.102 49.348  1.00 8.16  ? 1225 LEU A O     1 
ATOM   9319  C  CB    . LEU A 1 1225 ? 66.944  117.672 46.350  1.00 8.09  ? 1225 LEU A CB    1 
ATOM   9320  C  CG    . LEU A 1 1225 ? 66.008  116.888 45.411  1.00 9.77  ? 1225 LEU A CG    1 
ATOM   9321  C  CD1   . LEU A 1 1225 ? 65.254  117.832 44.489  1.00 13.36 ? 1225 LEU A CD1   1 
ATOM   9322  C  CD2   . LEU A 1 1225 ? 66.736  115.865 44.559  1.00 13.26 ? 1225 LEU A CD2   1 
ATOM   9323  N  N     . PRO A 1 1226 ? 69.733  118.507 47.646  1.00 9.33  ? 1226 PRO A N     1 
ATOM   9324  C  CA    . PRO A 1 1226 ? 70.570  119.395 48.467  1.00 10.04 ? 1226 PRO A CA    1 
ATOM   9325  C  C     . PRO A 1 1226 ? 69.749  120.556 49.000  1.00 10.44 ? 1226 PRO A C     1 
ATOM   9326  O  O     . PRO A 1 1226 ? 68.804  121.009 48.330  1.00 9.93  ? 1226 PRO A O     1 
ATOM   9327  C  CB    . PRO A 1 1226 ? 71.651  119.868 47.482  1.00 10.81 ? 1226 PRO A CB    1 
ATOM   9328  C  CG    . PRO A 1 1226 ? 71.673  118.825 46.430  1.00 9.71  ? 1226 PRO A CG    1 
ATOM   9329  C  CD    . PRO A 1 1226 ? 70.232  118.417 46.263  1.00 9.34  ? 1226 PRO A CD    1 
ATOM   9330  N  N     . ASP A 1 1227 ? 70.069  120.981 50.220  1.00 10.98 ? 1227 ASP A N     1 
ATOM   9331  C  CA    . ASP A 1 1227 ? 69.386  122.083 50.887  1.00 11.65 ? 1227 ASP A CA    1 
ATOM   9332  C  C     . ASP A 1 1227 ? 69.551  123.336 50.041  1.00 11.70 ? 1227 ASP A C     1 
ATOM   9333  O  O     . ASP A 1 1227 ? 70.609  123.581 49.474  1.00 12.02 ? 1227 ASP A O     1 
ATOM   9334  C  CB    . ASP A 1 1227 ? 69.958  122.299 52.300  1.00 12.27 ? 1227 ASP A CB    1 
ATOM   9335  C  CG    . ASP A 1 1227 ? 69.113  123.238 53.158  1.00 13.62 ? 1227 ASP A CG    1 
ATOM   9336  O  OD1   . ASP A 1 1227 ? 68.406  124.110 52.622  1.00 13.74 ? 1227 ASP A OD1   1 
ATOM   9337  O  OD2   . ASP A 1 1227 ? 69.094  123.181 54.412  1.00 18.07 ? 1227 ASP A OD2   1 
ATOM   9338  N  N     . THR A 1 1228 ? 68.494  124.138 49.978  1.00 11.30 ? 1228 THR A N     1 
ATOM   9339  C  CA    . THR A 1 1228 ? 68.431  125.239 49.039  1.00 10.60 ? 1228 THR A CA    1 
ATOM   9340  C  C     . THR A 1 1228 ? 67.698  126.433 49.715  1.00 10.37 ? 1228 THR A C     1 
ATOM   9341  O  O     . THR A 1 1228 ? 67.386  127.459 49.101  1.00 9.47  ? 1228 THR A O     1 
ATOM   9342  C  CB    . THR A 1 1228 ? 67.836  124.649 47.711  1.00 10.94 ? 1228 THR A CB    1 
ATOM   9343  O  OG1   . THR A 1 1228 ? 68.714  124.908 46.611  1.00 13.35 ? 1228 THR A OG1   1 
ATOM   9344  C  CG2   . THR A 1 1228 ? 66.507  125.184 47.320  1.00 7.38  ? 1228 THR A CG2   1 
ATOM   9345  N  N     . LYS A 1 1229 ? 67.484  126.295 51.020  1.00 10.74 ? 1229 LYS A N     1 
ATOM   9346  C  CA    . LYS A 1 1229 ? 66.935  127.369 51.859  1.00 11.94 ? 1229 LYS A CA    1 
ATOM   9347  C  C     . LYS A 1 1229 ? 67.777  128.643 51.787  1.00 12.34 ? 1229 LYS A C     1 
ATOM   9348  O  O     . LYS A 1 1229 ? 67.257  129.763 51.641  1.00 12.47 ? 1229 LYS A O     1 
ATOM   9349  C  CB    . LYS A 1 1229 ? 66.895  126.916 53.320  1.00 11.96 ? 1229 LYS A CB    1 
ATOM   9350  C  CG    . LYS A 1 1229 ? 65.598  126.252 53.743  1.00 14.24 ? 1229 LYS A CG    1 
ATOM   9351  C  CD    . LYS A 1 1229 ? 65.813  125.342 54.966  1.00 16.35 ? 1229 LYS A CD    1 
ATOM   9352  C  CE    . LYS A 1 1229 ? 65.077  124.007 54.791  1.00 17.64 ? 1229 LYS A CE    1 
ATOM   9353  N  NZ    . LYS A 1 1229 ? 65.048  123.168 56.044  1.00 17.38 ? 1229 LYS A NZ    1 
ATOM   9354  N  N     . GLN A 1 1230 ? 69.083  128.459 51.911  1.00 13.06 ? 1230 GLN A N     1 
ATOM   9355  C  CA    . GLN A 1 1230 ? 69.990  129.575 52.081  1.00 14.17 ? 1230 GLN A CA    1 
ATOM   9356  C  C     . GLN A 1 1230 ? 70.844  129.798 50.844  1.00 14.14 ? 1230 GLN A C     1 
ATOM   9357  O  O     . GLN A 1 1230 ? 71.136  130.934 50.477  1.00 14.94 ? 1230 GLN A O     1 
ATOM   9358  C  CB    . GLN A 1 1230 ? 70.847  129.363 53.328  1.00 14.58 ? 1230 GLN A CB    1 
ATOM   9359  C  CG    . GLN A 1 1230 ? 70.189  129.892 54.592  1.00 16.29 ? 1230 GLN A CG    1 
ATOM   9360  C  CD    . GLN A 1 1230 ? 70.192  128.889 55.750  1.00 19.56 ? 1230 GLN A CD    1 
ATOM   9361  O  OE1   . GLN A 1 1230 ? 69.512  127.853 55.691  1.00 20.20 ? 1230 GLN A OE1   1 
ATOM   9362  N  NE2   . GLN A 1 1230 ? 70.944  129.205 56.813  1.00 19.94 ? 1230 GLN A NE2   1 
ATOM   9363  N  N     . ASN A 1 1231 ? 71.215  128.710 50.186  1.00 13.94 ? 1231 ASN A N     1 
ATOM   9364  C  CA    . ASN A 1 1231 ? 72.072  128.797 49.019  1.00 13.65 ? 1231 ASN A CA    1 
ATOM   9365  C  C     . ASN A 1 1231 ? 71.281  128.735 47.711  1.00 12.22 ? 1231 ASN A C     1 
ATOM   9366  O  O     . ASN A 1 1231 ? 70.768  127.681 47.322  1.00 12.35 ? 1231 ASN A O     1 
ATOM   9367  C  CB    . ASN A 1 1231 ? 73.183  127.753 49.111  1.00 14.62 ? 1231 ASN A CB    1 
ATOM   9368  C  CG    . ASN A 1 1231 ? 74.139  128.032 50.273  1.00 16.54 ? 1231 ASN A CG    1 
ATOM   9369  O  OD1   . ASN A 1 1231 ? 74.608  129.163 50.456  1.00 21.10 ? 1231 ASN A OD1   1 
ATOM   9370  N  ND2   . ASN A 1 1231 ? 74.409  127.007 51.080  1.00 18.64 ? 1231 ASN A ND2   1 
ATOM   9371  N  N     . ARG A 1 1232 ? 71.190  129.879 47.043  1.00 10.68 ? 1232 ARG A N     1 
ATOM   9372  C  CA    . ARG A 1 1232 ? 70.289  130.045 45.908  1.00 9.89  ? 1232 ARG A CA    1 
ATOM   9373  C  C     . ARG A 1 1232 ? 70.981  130.737 44.746  1.00 9.24  ? 1232 ARG A C     1 
ATOM   9374  O  O     . ARG A 1 1232 ? 70.328  131.105 43.776  1.00 8.52  ? 1232 ARG A O     1 
ATOM   9375  C  CB    . ARG A 1 1232 ? 69.105  130.934 46.299  1.00 10.07 ? 1232 ARG A CB    1 
ATOM   9376  C  CG    . ARG A 1 1232 ? 68.222  130.482 47.436  1.00 10.36 ? 1232 ARG A CG    1 
ATOM   9377  C  CD    . ARG A 1 1232 ? 66.730  130.568 47.099  1.00 10.46 ? 1232 ARG A CD    1 
ATOM   9378  N  NE    . ARG A 1 1232 ? 66.331  129.197 47.120  1.00 13.95 ? 1232 ARG A NE    1 
ATOM   9379  C  CZ    . ARG A 1 1232 ? 65.581  128.554 46.281  1.00 9.57  ? 1232 ARG A CZ    1 
ATOM   9380  N  NH1   . ARG A 1 1232 ? 64.940  129.106 45.240  1.00 8.55  ? 1232 ARG A NH1   1 
ATOM   9381  N  NH2   . ARG A 1 1232 ? 65.441  127.293 46.558  1.00 12.54 ? 1232 ARG A NH2   1 
ATOM   9382  N  N     . GLN A 1 1233 ? 72.289  130.944 44.849  1.00 9.46  ? 1233 GLN A N     1 
ATOM   9383  C  CA    . GLN A 1 1233 ? 73.004  131.717 43.839  1.00 10.08 ? 1233 GLN A CA    1 
ATOM   9384  C  C     . GLN A 1 1233 ? 73.045  130.993 42.474  1.00 9.41  ? 1233 GLN A C     1 
ATOM   9385  O  O     . GLN A 1 1233 ? 73.242  131.629 41.439  1.00 9.57  ? 1233 GLN A O     1 
ATOM   9386  C  CB    . GLN A 1 1233 ? 74.405  132.126 44.341  1.00 11.00 ? 1233 GLN A CB    1 
ATOM   9387  C  CG    . GLN A 1 1233 ? 74.385  133.009 45.599  1.00 14.08 ? 1233 GLN A CG    1 
ATOM   9388  C  CD    . GLN A 1 1233 ? 75.670  133.795 45.803  1.00 19.69 ? 1233 GLN A CD    1 
ATOM   9389  O  OE1   . GLN A 1 1233 ? 76.603  133.700 44.989  1.00 24.51 ? 1233 GLN A OE1   1 
ATOM   9390  N  NE2   . GLN A 1 1233 ? 75.734  134.570 46.894  1.00 20.88 ? 1233 GLN A NE2   1 
ATOM   9391  N  N     . TRP A 1 1234 ? 72.797  129.680 42.484  1.00 9.06  ? 1234 TRP A N     1 
ATOM   9392  C  CA    . TRP A 1 1234 ? 72.745  128.860 41.257  1.00 8.90  ? 1234 TRP A CA    1 
ATOM   9393  C  C     . TRP A 1 1234 ? 71.596  129.272 40.330  1.00 8.90  ? 1234 TRP A C     1 
ATOM   9394  O  O     . TRP A 1 1234 ? 71.581  128.900 39.150  1.00 8.97  ? 1234 TRP A O     1 
ATOM   9395  C  CB    . TRP A 1 1234 ? 72.667  127.362 41.589  1.00 8.39  ? 1234 TRP A CB    1 
ATOM   9396  C  CG    . TRP A 1 1234 ? 71.625  127.046 42.596  1.00 8.21  ? 1234 TRP A CG    1 
ATOM   9397  C  CD1   . TRP A 1 1234 ? 71.769  127.030 43.961  1.00 9.25  ? 1234 TRP A CD1   1 
ATOM   9398  C  CD2   . TRP A 1 1234 ? 70.256  126.748 42.337  1.00 7.11  ? 1234 TRP A CD2   1 
ATOM   9399  N  NE1   . TRP A 1 1234 ? 70.571  126.725 44.561  1.00 7.94  ? 1234 TRP A NE1   1 
ATOM   9400  C  CE2   . TRP A 1 1234 ? 69.623  126.548 43.591  1.00 8.07  ? 1234 TRP A CE2   1 
ATOM   9401  C  CE3   . TRP A 1 1234 ? 69.493  126.610 41.170  1.00 5.57  ? 1234 TRP A CE3   1 
ATOM   9402  C  CZ2   . TRP A 1 1234 ? 68.263  126.231 43.705  1.00 6.68  ? 1234 TRP A CZ2   1 
ATOM   9403  C  CZ3   . TRP A 1 1234 ? 68.159  126.305 41.282  1.00 5.72  ? 1234 TRP A CZ3   1 
ATOM   9404  C  CH2   . TRP A 1 1234 ? 67.554  126.110 42.543  1.00 5.46  ? 1234 TRP A CH2   1 
ATOM   9405  N  N     . LEU A 1 1235 ? 70.641  130.041 40.862  1.00 8.68  ? 1235 LEU A N     1 
ATOM   9406  C  CA    . LEU A 1 1235 ? 69.565  130.639 40.057  1.00 9.41  ? 1235 LEU A CA    1 
ATOM   9407  C  C     . LEU A 1 1235 ? 70.049  131.780 39.124  1.00 9.66  ? 1235 LEU A C     1 
ATOM   9408  O  O     . LEU A 1 1235 ? 69.353  132.177 38.165  1.00 9.16  ? 1235 LEU A O     1 
ATOM   9409  C  CB    . LEU A 1 1235 ? 68.477  131.182 40.984  1.00 9.42  ? 1235 LEU A CB    1 
ATOM   9410  C  CG    . LEU A 1 1235 ? 67.166  130.443 41.286  1.00 10.32 ? 1235 LEU A CG    1 
ATOM   9411  C  CD1   . LEU A 1 1235 ? 66.757  129.296 40.320  1.00 7.72  ? 1235 LEU A CD1   1 
ATOM   9412  C  CD2   . LEU A 1 1235 ? 67.072  130.040 42.762  1.00 10.99 ? 1235 LEU A CD2   1 
ATOM   9413  N  N     . ASN A 1 1236 ? 71.223  132.320 39.421  1.00 9.80  ? 1236 ASN A N     1 
ATOM   9414  C  CA    . ASN A 1 1236 ? 71.780  133.398 38.618  1.00 10.99 ? 1236 ASN A CA    1 
ATOM   9415  C  C     . ASN A 1 1236 ? 72.627  132.828 37.469  1.00 10.98 ? 1236 ASN A C     1 
ATOM   9416  O  O     . ASN A 1 1236 ? 73.673  132.211 37.705  1.00 11.16 ? 1236 ASN A O     1 
ATOM   9417  C  CB    . ASN A 1 1236 ? 72.583  134.344 39.510  1.00 11.62 ? 1236 ASN A CB    1 
ATOM   9418  C  CG    . ASN A 1 1236 ? 71.726  134.977 40.627  1.00 13.87 ? 1236 ASN A CG    1 
ATOM   9419  O  OD1   . ASN A 1 1236 ? 70.589  135.407 40.393  1.00 16.54 ? 1236 ASN A OD1   1 
ATOM   9420  N  ND2   . ASN A 1 1236 ? 72.273  135.027 41.837  1.00 14.33 ? 1236 ASN A ND2   1 
ATOM   9421  N  N     . HIS A 1 1237 ? 72.148  132.990 36.236  1.00 10.42 ? 1237 HIS A N     1 
ATOM   9422  C  CA    . HIS A 1 1237 ? 72.852  132.467 35.056  1.00 10.34 ? 1237 HIS A CA    1 
ATOM   9423  C  C     . HIS A 1 1237 ? 73.442  133.581 34.210  1.00 10.87 ? 1237 HIS A C     1 
ATOM   9424  O  O     . HIS A 1 1237 ? 72.886  134.671 34.137  1.00 10.53 ? 1237 HIS A O     1 
ATOM   9425  C  CB    . HIS A 1 1237 ? 71.908  131.648 34.180  1.00 9.58  ? 1237 HIS A CB    1 
ATOM   9426  C  CG    . HIS A 1 1237 ? 71.158  130.602 34.927  1.00 8.71  ? 1237 HIS A CG    1 
ATOM   9427  N  ND1   . HIS A 1 1237 ? 71.790  129.558 35.563  1.00 5.66  ? 1237 HIS A ND1   1 
ATOM   9428  C  CD2   . HIS A 1 1237 ? 69.830  130.443 35.156  1.00 7.42  ? 1237 HIS A CD2   1 
ATOM   9429  C  CE1   . HIS A 1 1237 ? 70.882  128.787 36.138  1.00 6.93  ? 1237 HIS A CE1   1 
ATOM   9430  N  NE2   . HIS A 1 1237 ? 69.685  129.306 35.910  1.00 6.17  ? 1237 HIS A NE2   1 
ATOM   9431  N  N     . GLU A 1 1238 ? 74.556  133.285 33.552  1.00 11.24 ? 1238 GLU A N     1 
ATOM   9432  C  CA    . GLU A 1 1238 ? 75.144  134.225 32.606  1.00 11.69 ? 1238 GLU A CA    1 
ATOM   9433  C  C     . GLU A 1 1238 ? 74.195  134.293 31.398  1.00 11.09 ? 1238 GLU A C     1 
ATOM   9434  O  O     . GLU A 1 1238 ? 73.544  133.299 31.090  1.00 11.36 ? 1238 GLU A O     1 
ATOM   9435  C  CB    . GLU A 1 1238 ? 76.574  133.767 32.275  1.00 12.00 ? 1238 GLU A CB    1 
ATOM   9436  C  CG    . GLU A 1 1238 ? 77.005  133.799 30.821  1.00 14.32 ? 1238 GLU A CG    1 
ATOM   9437  C  CD    . GLU A 1 1238 ? 78.506  133.603 30.663  1.00 14.99 ? 1238 GLU A CD    1 
ATOM   9438  O  OE1   . GLU A 1 1238 ? 79.229  134.608 30.506  1.00 16.42 ? 1238 GLU A OE1   1 
ATOM   9439  O  OE2   . GLU A 1 1238 ? 78.965  132.446 30.704  1.00 13.73 ? 1238 GLU A OE2   1 
ATOM   9440  N  N     . PRO A 1 1239 ? 74.065  135.455 30.748  1.00 10.63 ? 1239 PRO A N     1 
ATOM   9441  C  CA    . PRO A 1 1239 ? 73.119  135.606 29.622  1.00 10.16 ? 1239 PRO A CA    1 
ATOM   9442  C  C     . PRO A 1 1239 ? 73.237  134.522 28.535  1.00 9.43  ? 1239 PRO A C     1 
ATOM   9443  O  O     . PRO A 1 1239 ? 72.217  133.890 28.196  1.00 9.56  ? 1239 PRO A O     1 
ATOM   9444  C  CB    . PRO A 1 1239 ? 73.441  137.013 29.073  1.00 10.32 ? 1239 PRO A CB    1 
ATOM   9445  C  CG    . PRO A 1 1239 ? 73.958  137.744 30.250  1.00 10.89 ? 1239 PRO A CG    1 
ATOM   9446  C  CD    . PRO A 1 1239 ? 74.762  136.722 31.049  1.00 10.92 ? 1239 PRO A CD    1 
ATOM   9447  N  N     . VAL A 1 1240 ? 74.443  134.315 28.000  1.00 7.62  ? 1240 VAL A N     1 
ATOM   9448  C  CA    . VAL A 1 1240 ? 74.732  133.238 27.058  1.00 6.04  ? 1240 VAL A CA    1 
ATOM   9449  C  C     . VAL A 1 1240 ? 76.224  132.968 27.212  1.00 5.41  ? 1240 VAL A C     1 
ATOM   9450  O  O     . VAL A 1 1240 ? 77.010  133.916 27.317  1.00 4.03  ? 1240 VAL A O     1 
ATOM   9451  C  CB    . VAL A 1 1240 ? 74.484  133.616 25.557  1.00 6.79  ? 1240 VAL A CB    1 
ATOM   9452  C  CG1   . VAL A 1 1240 ? 74.904  132.467 24.616  1.00 5.26  ? 1240 VAL A CG1   1 
ATOM   9453  C  CG2   . VAL A 1 1240 ? 73.039  133.981 25.285  1.00 8.82  ? 1240 VAL A CG2   1 
ATOM   9454  N  N     . HIS A 1 1241 ? 76.602  131.687 27.221  1.00 3.71  ? 1241 HIS A N     1 
ATOM   9455  C  CA    . HIS A 1 1241 ? 78.012  131.298 27.306  1.00 3.54  ? 1241 HIS A CA    1 
ATOM   9456  C  C     . HIS A 1 1241 ? 78.778  131.586 26.011  1.00 3.22  ? 1241 HIS A C     1 
ATOM   9457  O  O     . HIS A 1 1241 ? 78.248  131.406 24.915  1.00 2.82  ? 1241 HIS A O     1 
ATOM   9458  C  CB    . HIS A 1 1241 ? 78.141  129.807 27.639  1.00 3.08  ? 1241 HIS A CB    1 
ATOM   9459  C  CG    . HIS A 1 1241 ? 77.527  129.414 28.949  1.00 2.47  ? 1241 HIS A CG    1 
ATOM   9460  N  ND1   . HIS A 1 1241 ? 77.681  130.151 30.103  1.00 1.61  ? 1241 HIS A ND1   1 
ATOM   9461  C  CD2   . HIS A 1 1241 ? 76.755  128.351 29.283  1.00 1.03  ? 1241 HIS A CD2   1 
ATOM   9462  C  CE1   . HIS A 1 1241 ? 77.026  129.561 31.089  1.00 2.50  ? 1241 HIS A CE1   1 
ATOM   9463  N  NE2   . HIS A 1 1241 ? 76.473  128.457 30.619  1.00 1.00  ? 1241 HIS A NE2   1 
ATOM   9464  N  N     . SER A 1 1242 ? 80.034  132.001 26.162  1.00 3.14  ? 1242 SER A N     1 
ATOM   9465  C  CA    . SER A 1 1242 ? 80.911  132.366 25.044  1.00 3.71  ? 1242 SER A CA    1 
ATOM   9466  C  C     . SER A 1 1242 ? 81.750  131.183 24.541  1.00 3.53  ? 1242 SER A C     1 
ATOM   9467  O  O     . SER A 1 1242 ? 82.063  130.260 25.299  1.00 2.87  ? 1242 SER A O     1 
ATOM   9468  C  CB    . SER A 1 1242 ? 81.853  133.515 25.467  1.00 3.53  ? 1242 SER A CB    1 
ATOM   9469  O  OG    . SER A 1 1242 ? 82.759  133.826 24.412  1.00 4.65  ? 1242 SER A OG    1 
ATOM   9470  N  N     . ASN A 1 1243 ? 82.116  131.234 23.262  1.00 4.07  ? 1243 ASN A N     1 
ATOM   9471  C  CA    . ASN A 1 1243 ? 83.106  130.335 22.691  1.00 4.60  ? 1243 ASN A CA    1 
ATOM   9472  C  C     . ASN A 1 1243 ? 84.539  130.721 23.065  1.00 4.79  ? 1243 ASN A C     1 
ATOM   9473  O  O     . ASN A 1 1243 ? 85.471  129.950 22.807  1.00 5.62  ? 1243 ASN A O     1 
ATOM   9474  C  CB    . ASN A 1 1243 ? 82.996  130.308 21.154  1.00 5.02  ? 1243 ASN A CB    1 
ATOM   9475  C  CG    . ASN A 1 1243 ? 81.940  129.328 20.647  1.00 4.94  ? 1243 ASN A CG    1 
ATOM   9476  O  OD1   . ASN A 1 1243 ? 81.391  128.550 21.413  1.00 4.38  ? 1243 ASN A OD1   1 
ATOM   9477  N  ND2   . ASN A 1 1243 ? 81.650  129.382 19.355  1.00 2.84  ? 1243 ASN A ND2   1 
ATOM   9478  N  N     . GLY A 1 1244 ? 84.722  131.902 23.657  1.00 4.58  ? 1244 GLY A N     1 
ATOM   9479  C  CA    . GLY A 1 1244 ? 86.049  132.488 23.803  1.00 4.55  ? 1244 GLY A CA    1 
ATOM   9480  C  C     . GLY A 1 1244 ? 86.565  133.095 22.489  1.00 5.27  ? 1244 GLY A C     1 
ATOM   9481  O  O     . GLY A 1 1244 ? 85.827  133.136 21.491  1.00 4.49  ? 1244 GLY A O     1 
ATOM   9482  N  N     . PRO A 1 1245 ? 87.820  133.560 22.472  1.00 5.81  ? 1245 PRO A N     1 
ATOM   9483  C  CA    . PRO A 1 1245 ? 88.389  134.208 21.284  1.00 6.26  ? 1245 PRO A CA    1 
ATOM   9484  C  C     . PRO A 1 1245 ? 88.444  133.234 20.131  1.00 6.90  ? 1245 PRO A C     1 
ATOM   9485  O  O     . PRO A 1 1245 ? 88.864  132.087 20.297  1.00 6.87  ? 1245 PRO A O     1 
ATOM   9486  C  CB    . PRO A 1 1245 ? 89.818  134.571 21.716  1.00 6.37  ? 1245 PRO A CB    1 
ATOM   9487  C  CG    . PRO A 1 1245 ? 89.797  134.536 23.189  1.00 6.38  ? 1245 PRO A CG    1 
ATOM   9488  C  CD    . PRO A 1 1245 ? 88.785  133.507 23.586  1.00 5.79  ? 1245 PRO A CD    1 
ATOM   9489  N  N     . VAL A 1 1246 ? 88.029  133.698 18.964  1.00 6.77  ? 1246 VAL A N     1 
ATOM   9490  C  CA    . VAL A 1 1246 ? 87.861  132.820 17.833  1.00 7.42  ? 1246 VAL A CA    1 
ATOM   9491  C  C     . VAL A 1 1246 ? 88.414  133.518 16.573  1.00 6.97  ? 1246 VAL A C     1 
ATOM   9492  O  O     . VAL A 1 1246 ? 88.294  134.724 16.440  1.00 6.73  ? 1246 VAL A O     1 
ATOM   9493  C  CB    . VAL A 1 1246 ? 86.351  132.430 17.786  1.00 8.02  ? 1246 VAL A CB    1 
ATOM   9494  C  CG1   . VAL A 1 1246 ? 85.600  132.986 16.598  1.00 7.20  ? 1246 VAL A CG1   1 
ATOM   9495  C  CG2   . VAL A 1 1246 ? 86.140  130.943 18.053  1.00 8.94  ? 1246 VAL A CG2   1 
ATOM   9496  N  N     . LEU A 1 1247 ? 89.051  132.763 15.675  1.00 6.92  ? 1247 LEU A N     1 
ATOM   9497  C  CA    . LEU A 1 1247 ? 89.627  133.349 14.451  1.00 7.19  ? 1247 LEU A CA    1 
ATOM   9498  C  C     . LEU A 1 1247 ? 88.636  134.226 13.681  1.00 6.93  ? 1247 LEU A C     1 
ATOM   9499  O  O     . LEU A 1 1247 ? 89.018  135.285 13.193  1.00 6.42  ? 1247 LEU A O     1 
ATOM   9500  C  CB    . LEU A 1 1247 ? 90.220  132.269 13.532  1.00 7.34  ? 1247 LEU A CB    1 
ATOM   9501  C  CG    . LEU A 1 1247 ? 90.809  132.742 12.190  1.00 7.71  ? 1247 LEU A CG    1 
ATOM   9502  C  CD1   . LEU A 1 1247 ? 92.059  133.624 12.361  1.00 7.41  ? 1247 LEU A CD1   1 
ATOM   9503  C  CD2   . LEU A 1 1247 ? 91.120  131.525 11.343  1.00 7.43  ? 1247 LEU A CD2   1 
ATOM   9504  N  N     . ASP A 1 1248 ? 87.364  133.804 13.604  1.00 7.09  ? 1248 ASP A N     1 
ATOM   9505  C  CA    . ASP A 1 1248 ? 86.328  134.585 12.901  1.00 7.25  ? 1248 ASP A CA    1 
ATOM   9506  C  C     . ASP A 1 1248 ? 86.182  135.996 13.498  1.00 6.96  ? 1248 ASP A C     1 
ATOM   9507  O  O     . ASP A 1 1248 ? 85.775  136.912 12.792  1.00 7.51  ? 1248 ASP A O     1 
ATOM   9508  C  CB    . ASP A 1 1248 ? 84.959  133.880 12.899  1.00 7.55  ? 1248 ASP A CB    1 
ATOM   9509  C  CG    . ASP A 1 1248 ? 84.777  132.886 11.730  1.00 10.84 ? 1248 ASP A CG    1 
ATOM   9510  O  OD1   . ASP A 1 1248 ? 85.701  132.079 11.447  1.00 11.85 ? 1248 ASP A OD1   1 
ATOM   9511  O  OD2   . ASP A 1 1248 ? 83.716  132.820 11.049  1.00 11.16 ? 1248 ASP A OD2   1 
ATOM   9512  N  N     . ASP A 1 1249 ? 86.516  136.176 14.778  1.00 6.31  ? 1249 ASP A N     1 
ATOM   9513  C  CA    . ASP A 1 1249 ? 86.458  137.505 15.397  1.00 6.08  ? 1249 ASP A CA    1 
ATOM   9514  C  C     . ASP A 1 1249 ? 87.470  138.480 14.752  1.00 6.52  ? 1249 ASP A C     1 
ATOM   9515  O  O     . ASP A 1 1249 ? 87.182  139.669 14.590  1.00 6.54  ? 1249 ASP A O     1 
ATOM   9516  C  CB    . ASP A 1 1249 ? 86.710  137.447 16.915  1.00 5.90  ? 1249 ASP A CB    1 
ATOM   9517  C  CG    . ASP A 1 1249 ? 85.661  136.635 17.690  1.00 6.50  ? 1249 ASP A CG    1 
ATOM   9518  O  OD1   . ASP A 1 1249 ? 84.501  136.479 17.237  1.00 3.86  ? 1249 ASP A OD1   1 
ATOM   9519  O  OD2   . ASP A 1 1249 ? 85.925  136.131 18.812  1.00 7.32  ? 1249 ASP A OD2   1 
ATOM   9520  N  N     . ASP A 1 1250 ? 88.655  137.961 14.425  1.00 6.76  ? 1250 ASP A N     1 
ATOM   9521  C  CA    . ASP A 1 1250 ? 89.695  138.696 13.729  1.00 7.48  ? 1250 ASP A CA    1 
ATOM   9522  C  C     . ASP A 1 1250 ? 89.290  138.979 12.288  1.00 6.82  ? 1250 ASP A C     1 
ATOM   9523  O  O     . ASP A 1 1250 ? 89.516  140.080 11.795  1.00 6.55  ? 1250 ASP A O     1 
ATOM   9524  C  CB    . ASP A 1 1250 ? 91.034  137.939 13.777  1.00 7.87  ? 1250 ASP A CB    1 
ATOM   9525  C  CG    . ASP A 1 1250 ? 91.526  137.698 15.207  1.00 10.67 ? 1250 ASP A CG    1 
ATOM   9526  O  OD1   . ASP A 1 1250 ? 91.350  138.593 16.064  1.00 11.57 ? 1250 ASP A OD1   1 
ATOM   9527  O  OD2   . ASP A 1 1250 ? 92.104  136.640 15.567  1.00 13.49 ? 1250 ASP A OD2   1 
ATOM   9528  N  N     . ILE A 1 1251 ? 88.697  137.993 11.617  1.00 6.48  ? 1251 ILE A N     1 
ATOM   9529  C  CA    . ILE A 1 1251 ? 88.170  138.202 10.264  1.00 6.39  ? 1251 ILE A CA    1 
ATOM   9530  C  C     . ILE A 1 1251 ? 87.110  139.305 10.286  1.00 5.91  ? 1251 ILE A C     1 
ATOM   9531  O  O     . ILE A 1 1251 ? 87.223  140.280 9.548   1.00 5.84  ? 1251 ILE A O     1 
ATOM   9532  C  CB    . ILE A 1 1251 ? 87.630  136.888 9.636   1.00 6.33  ? 1251 ILE A CB    1 
ATOM   9533  C  CG1   . ILE A 1 1251 ? 88.775  135.899 9.385   1.00 6.92  ? 1251 ILE A CG1   1 
ATOM   9534  C  CG2   . ILE A 1 1251 ? 86.886  137.174 8.331   1.00 6.49  ? 1251 ILE A CG2   1 
ATOM   9535  C  CD1   . ILE A 1 1251 ? 88.321  134.441 9.240   1.00 5.81  ? 1251 ILE A CD1   1 
ATOM   9536  N  N     . LEU A 1 1252 ? 86.123  139.180 11.168  1.00 5.85  ? 1252 LEU A N     1 
ATOM   9537  C  CA    . LEU A 1 1252 ? 85.050  140.189 11.289  1.00 6.50  ? 1252 LEU A CA    1 
ATOM   9538  C  C     . LEU A 1 1252 ? 85.492  141.579 11.737  1.00 6.71  ? 1252 LEU A C     1 
ATOM   9539  O  O     . LEU A 1 1252 ? 84.825  142.575 11.443  1.00 6.86  ? 1252 LEU A O     1 
ATOM   9540  C  CB    . LEU A 1 1252 ? 83.945  139.691 12.221  1.00 6.76  ? 1252 LEU A CB    1 
ATOM   9541  C  CG    . LEU A 1 1252 ? 82.942  138.747 11.548  1.00 7.14  ? 1252 LEU A CG    1 
ATOM   9542  C  CD1   . LEU A 1 1252 ? 82.125  138.033 12.591  1.00 7.00  ? 1252 LEU A CD1   1 
ATOM   9543  C  CD2   . LEU A 1 1252 ? 82.032  139.536 10.606  1.00 6.75  ? 1252 LEU A CD2   1 
ATOM   9544  N  N     . ALA A 1 1253 ? 86.599  141.654 12.465  1.00 6.47  ? 1253 ALA A N     1 
ATOM   9545  C  CA    . ALA A 1 1253 ? 87.102  142.944 12.917  1.00 6.42  ? 1253 ALA A CA    1 
ATOM   9546  C  C     . ALA A 1 1253 ? 87.790  143.699 11.777  1.00 6.53  ? 1253 ALA A C     1 
ATOM   9547  O  O     . ALA A 1 1253 ? 87.947  144.912 11.853  1.00 6.55  ? 1253 ALA A O     1 
ATOM   9548  C  CB    . ALA A 1 1253 ? 88.048  142.767 14.101  1.00 6.60  ? 1253 ALA A CB    1 
ATOM   9549  N  N     . ASP A 1 1254 ? 88.196  142.978 10.729  1.00 6.12  ? 1254 ASP A N     1 
ATOM   9550  C  CA    . ASP A 1 1254 ? 88.914  143.579 9.598   1.00 6.32  ? 1254 ASP A CA    1 
ATOM   9551  C  C     . ASP A 1 1254 ? 88.000  144.552 8.857   1.00 5.88  ? 1254 ASP A C     1 
ATOM   9552  O  O     . ASP A 1 1254 ? 86.920  144.166 8.389   1.00 5.53  ? 1254 ASP A O     1 
ATOM   9553  C  CB    . ASP A 1 1254 ? 89.440  142.492 8.642   1.00 6.39  ? 1254 ASP A CB    1 
ATOM   9554  C  CG    . ASP A 1 1254 ? 90.384  143.039 7.573   1.00 8.35  ? 1254 ASP A CG    1 
ATOM   9555  O  OD1   . ASP A 1 1254 ? 90.041  144.037 6.901   1.00 8.58  ? 1254 ASP A OD1   1 
ATOM   9556  O  OD2   . ASP A 1 1254 ? 91.496  142.521 7.318   1.00 9.57  ? 1254 ASP A OD2   1 
ATOM   9557  N  N     . PRO A 1 1255 ? 88.417  145.811 8.772   1.00 6.12  ? 1255 PRO A N     1 
ATOM   9558  C  CA    . PRO A 1 1255 ? 87.631  146.845 8.075   1.00 6.16  ? 1255 PRO A CA    1 
ATOM   9559  C  C     . PRO A 1 1255 ? 87.230  146.487 6.627   1.00 5.84  ? 1255 PRO A C     1 
ATOM   9560  O  O     . PRO A 1 1255 ? 86.143  146.890 6.202   1.00 6.12  ? 1255 PRO A O     1 
ATOM   9561  C  CB    . PRO A 1 1255 ? 88.551  148.086 8.110   1.00 6.46  ? 1255 PRO A CB    1 
ATOM   9562  C  CG    . PRO A 1 1255 ? 89.884  147.581 8.552   1.00 6.66  ? 1255 PRO A CG    1 
ATOM   9563  C  CD    . PRO A 1 1255 ? 89.651  146.363 9.367   1.00 6.14  ? 1255 PRO A CD    1 
ATOM   9564  N  N     . ASP A 1 1256 ? 88.069  145.759 5.890   1.00 5.26  ? 1256 ASP A N     1 
ATOM   9565  C  CA    . ASP A 1 1256 ? 87.702  145.347 4.535   1.00 5.18  ? 1256 ASP A CA    1 
ATOM   9566  C  C     . ASP A 1 1256 ? 86.553  144.341 4.537   1.00 5.03  ? 1256 ASP A C     1 
ATOM   9567  O  O     . ASP A 1 1256 ? 85.770  144.324 3.582   1.00 4.71  ? 1256 ASP A O     1 
ATOM   9568  C  CB    . ASP A 1 1256 ? 88.874  144.743 3.768   1.00 5.35  ? 1256 ASP A CB    1 
ATOM   9569  C  CG    . ASP A 1 1256 ? 90.006  145.702 3.572   1.00 7.44  ? 1256 ASP A CG    1 
ATOM   9570  O  OD1   . ASP A 1 1256 ? 89.781  146.927 3.386   1.00 8.80  ? 1256 ASP A OD1   1 
ATOM   9571  O  OD2   . ASP A 1 1256 ? 91.183  145.302 3.586   1.00 9.61  ? 1256 ASP A OD2   1 
ATOM   9572  N  N     . ILE A 1 1257 ? 86.479  143.508 5.589   1.00 4.32  ? 1257 ILE A N     1 
ATOM   9573  C  CA    . ILE A 1 1257 ? 85.413  142.519 5.739   1.00 4.71  ? 1257 ILE A CA    1 
ATOM   9574  C  C     . ILE A 1 1257 ? 84.125  143.210 6.126   1.00 5.05  ? 1257 ILE A C     1 
ATOM   9575  O  O     . ILE A 1 1257 ? 83.066  142.895 5.584   1.00 5.10  ? 1257 ILE A O     1 
ATOM   9576  C  CB    . ILE A 1 1257 ? 85.773  141.414 6.766   1.00 4.44  ? 1257 ILE A CB    1 
ATOM   9577  C  CG1   . ILE A 1 1257 ? 86.918  140.547 6.245   1.00 4.63  ? 1257 ILE A CG1   1 
ATOM   9578  C  CG2   . ILE A 1 1257 ? 84.553  140.501 7.092   1.00 5.40  ? 1257 ILE A CG2   1 
ATOM   9579  C  CD1   . ILE A 1 1257 ? 86.586  139.781 4.973   1.00 4.27  ? 1257 ILE A CD1   1 
ATOM   9580  N  N     . GLN A 1 1258 ? 84.221  144.154 7.062   1.00 4.95  ? 1258 GLN A N     1 
ATOM   9581  C  CA    . GLN A 1 1258 ? 83.067  144.933 7.466   1.00 5.54  ? 1258 GLN A CA    1 
ATOM   9582  C  C     . GLN A 1 1258 ? 82.477  145.666 6.257   1.00 5.57  ? 1258 GLN A C     1 
ATOM   9583  O  O     . GLN A 1 1258 ? 81.262  145.683 6.075   1.00 5.66  ? 1258 GLN A O     1 
ATOM   9584  C  CB    . GLN A 1 1258 ? 83.444  145.908 8.595   1.00 5.85  ? 1258 GLN A CB    1 
ATOM   9585  C  CG    . GLN A 1 1258 ? 83.539  145.242 9.973   1.00 7.20  ? 1258 GLN A CG    1 
ATOM   9586  C  CD    . GLN A 1 1258 ? 82.203  144.667 10.415  1.00 11.01 ? 1258 GLN A CD    1 
ATOM   9587  O  OE1   . GLN A 1 1258 ? 81.173  145.335 10.289  1.00 12.90 ? 1258 GLN A OE1   1 
ATOM   9588  N  NE2   . GLN A 1 1258 ? 82.208  143.428 10.914  1.00 10.74 ? 1258 GLN A NE2   1 
ATOM   9589  N  N     . GLU A 1 1259 ? 83.350  146.249 5.434   1.00 5.54  ? 1259 GLU A N     1 
ATOM   9590  C  CA    . GLU A 1 1259 ? 82.948  146.931 4.203   1.00 5.83  ? 1259 GLU A CA    1 
ATOM   9591  C  C     . GLU A 1 1259 ? 82.247  145.975 3.228   1.00 5.71  ? 1259 GLU A C     1 
ATOM   9592  O  O     . GLU A 1 1259 ? 81.196  146.299 2.685   1.00 6.09  ? 1259 GLU A O     1 
ATOM   9593  C  CB    . GLU A 1 1259 ? 84.172  147.565 3.544   1.00 5.96  ? 1259 GLU A CB    1 
ATOM   9594  C  CG    . GLU A 1 1259 ? 83.915  148.234 2.210   1.00 7.95  ? 1259 GLU A CG    1 
ATOM   9595  C  CD    . GLU A 1 1259 ? 85.167  148.885 1.640   1.00 10.63 ? 1259 GLU A CD    1 
ATOM   9596  O  OE1   . GLU A 1 1259 ? 85.949  148.198 0.953   1.00 13.44 ? 1259 GLU A OE1   1 
ATOM   9597  O  OE2   . GLU A 1 1259 ? 85.371  150.081 1.889   1.00 10.56 ? 1259 GLU A OE2   1 
ATOM   9598  N  N     . ALA A 1 1260 ? 82.830  144.802 3.011   1.00 5.49  ? 1260 ALA A N     1 
ATOM   9599  C  CA    . ALA A 1 1260 ? 82.225  143.799 2.142   1.00 5.78  ? 1260 ALA A CA    1 
ATOM   9600  C  C     . ALA A 1 1260 ? 80.825  143.370 2.636   1.00 6.18  ? 1260 ALA A C     1 
ATOM   9601  O  O     . ALA A 1 1260 ? 79.903  143.247 1.834   1.00 6.36  ? 1260 ALA A O     1 
ATOM   9602  C  CB    . ALA A 1 1260 ? 83.152  142.595 1.988   1.00 6.00  ? 1260 ALA A CB    1 
ATOM   9603  N  N     . ILE A 1 1261 ? 80.651  143.176 3.944   1.00 5.89  ? 1261 ILE A N     1 
ATOM   9604  C  CA    . ILE A 1 1261 ? 79.330  142.814 4.476   1.00 5.88  ? 1261 ILE A CA    1 
ATOM   9605  C  C     . ILE A 1 1261 ? 78.318  143.937 4.280   1.00 6.05  ? 1261 ILE A C     1 
ATOM   9606  O  O     . ILE A 1 1261 ? 77.223  143.700 3.764   1.00 6.45  ? 1261 ILE A O     1 
ATOM   9607  C  CB    . ILE A 1 1261 ? 79.412  142.439 5.974   1.00 6.06  ? 1261 ILE A CB    1 
ATOM   9608  C  CG1   . ILE A 1 1261 ? 80.222  141.163 6.170   1.00 5.25  ? 1261 ILE A CG1   1 
ATOM   9609  C  CG2   . ILE A 1 1261 ? 78.002  142.323 6.603   1.00 5.57  ? 1261 ILE A CG2   1 
ATOM   9610  C  CD1   . ILE A 1 1261 ? 80.580  140.954 7.621   1.00 8.06  ? 1261 ILE A CD1   1 
ATOM   9611  N  N     . ASN A 1 1262 ? 78.695  145.154 4.676   1.00 5.33  ? 1262 ASN A N     1 
ATOM   9612  C  CA    . ASN A 1 1262 ? 77.782  146.277 4.751   1.00 5.65  ? 1262 ASN A CA    1 
ATOM   9613  C  C     . ASN A 1 1262 ? 77.542  147.002 3.438   1.00 5.89  ? 1262 ASN A C     1 
ATOM   9614  O  O     . ASN A 1 1262 ? 76.487  147.624 3.255   1.00 5.37  ? 1262 ASN A O     1 
ATOM   9615  C  CB    . ASN A 1 1262 ? 78.274  147.276 5.810   1.00 6.12  ? 1262 ASN A CB    1 
ATOM   9616  C  CG    . ASN A 1 1262 ? 78.208  146.706 7.206   1.00 6.88  ? 1262 ASN A CG    1 
ATOM   9617  O  OD1   . ASN A 1 1262 ? 77.200  146.119 7.589   1.00 7.52  ? 1262 ASN A OD1   1 
ATOM   9618  N  ND2   . ASN A 1 1262 ? 79.286  146.850 7.966   1.00 7.84  ? 1262 ASN A ND2   1 
ATOM   9619  N  N     . HIS A 1 1263 ? 78.536  146.968 2.552   1.00 5.28  ? 1263 HIS A N     1 
ATOM   9620  C  CA    . HIS A 1 1263 ? 78.442  147.640 1.264   1.00 5.52  ? 1263 HIS A CA    1 
ATOM   9621  C  C     . HIS A 1 1263 ? 78.401  146.665 0.085   1.00 5.40  ? 1263 HIS A C     1 
ATOM   9622  O  O     . HIS A 1 1263 ? 78.268  147.087 -1.058  1.00 5.01  ? 1263 HIS A O     1 
ATOM   9623  C  CB    . HIS A 1 1263 ? 79.577  148.663 1.114   1.00 5.63  ? 1263 HIS A CB    1 
ATOM   9624  C  CG    . HIS A 1 1263 ? 79.491  149.797 2.090   1.00 7.26  ? 1263 HIS A CG    1 
ATOM   9625  N  ND1   . HIS A 1 1263 ? 79.964  149.706 3.384   1.00 8.54  ? 1263 HIS A ND1   1 
ATOM   9626  C  CD2   . HIS A 1 1263 ? 78.971  151.039 1.966   1.00 6.89  ? 1263 HIS A CD2   1 
ATOM   9627  C  CE1   . HIS A 1 1263 ? 79.738  150.846 4.012   1.00 9.06  ? 1263 HIS A CE1   1 
ATOM   9628  N  NE2   . HIS A 1 1263 ? 79.140  151.672 3.173   1.00 9.26  ? 1263 HIS A NE2   1 
ATOM   9629  N  N     . GLN A 1 1264 ? 78.506  145.365 0.376   1.00 6.12  ? 1264 GLN A N     1 
ATOM   9630  C  CA    . GLN A 1 1264 ? 78.358  144.302 -0.628  1.00 7.05  ? 1264 GLN A CA    1 
ATOM   9631  C  C     . GLN A 1 1264 ? 79.451  144.377 -1.703  1.00 7.49  ? 1264 GLN A C     1 
ATOM   9632  O  O     . GLN A 1 1264 ? 79.219  144.184 -2.899  1.00 7.65  ? 1264 GLN A O     1 
ATOM   9633  C  CB    . GLN A 1 1264 ? 76.943  144.286 -1.214  1.00 7.17  ? 1264 GLN A CB    1 
ATOM   9634  C  CG    . GLN A 1 1264 ? 75.879  144.116 -0.131  1.00 8.51  ? 1264 GLN A CG    1 
ATOM   9635  C  CD    . GLN A 1 1264 ? 74.487  143.988 -0.681  1.00 8.52  ? 1264 GLN A CD    1 
ATOM   9636  O  OE1   . GLN A 1 1264 ? 73.987  142.886 -0.844  1.00 9.44  ? 1264 GLN A OE1   1 
ATOM   9637  N  NE2   . GLN A 1 1264 ? 73.846  145.108 -0.940  1.00 9.52  ? 1264 GLN A NE2   1 
ATOM   9638  N  N     . THR A 1 1265 ? 80.643  144.679 -1.212  1.00 7.59  ? 1265 THR A N     1 
ATOM   9639  C  CA    . THR A 1 1265 ? 81.859  144.858 -1.975  1.00 7.99  ? 1265 THR A CA    1 
ATOM   9640  C  C     . THR A 1 1265 ? 82.548  143.492 -2.073  1.00 7.23  ? 1265 THR A C     1 
ATOM   9641  O  O     . THR A 1 1265 ? 82.102  142.519 -1.461  1.00 7.16  ? 1265 THR A O     1 
ATOM   9642  C  CB    . THR A 1 1265 ? 82.720  145.867 -1.201  1.00 7.98  ? 1265 THR A CB    1 
ATOM   9643  O  OG1   . THR A 1 1265 ? 82.434  147.191 -1.670  1.00 11.61 ? 1265 THR A OG1   1 
ATOM   9644  C  CG2   . THR A 1 1265 ? 84.197  145.724 -1.503  1.00 11.38 ? 1265 THR A CG2   1 
ATOM   9645  N  N     . THR A 1 1266 ? 83.609  143.422 -2.860  1.00 6.78  ? 1266 THR A N     1 
ATOM   9646  C  CA    . THR A 1 1266 ? 84.445  142.236 -2.956  1.00 7.35  ? 1266 THR A CA    1 
ATOM   9647  C  C     . THR A 1 1266 ? 85.623  142.348 -1.977  1.00 7.11  ? 1266 THR A C     1 
ATOM   9648  O  O     . THR A 1 1266 ? 86.258  143.403 -1.878  1.00 6.18  ? 1266 THR A O     1 
ATOM   9649  C  CB    . THR A 1 1266 ? 84.946  142.110 -4.402  1.00 7.68  ? 1266 THR A CB    1 
ATOM   9650  O  OG1   . THR A 1 1266 ? 83.830  141.796 -5.248  1.00 9.90  ? 1266 THR A OG1   1 
ATOM   9651  C  CG2   . THR A 1 1266 ? 85.868  140.901 -4.564  1.00 8.58  ? 1266 THR A CG2   1 
ATOM   9652  N  N     . ALA A 1 1267 ? 85.904  141.271 -1.247  1.00 6.23  ? 1267 ALA A N     1 
ATOM   9653  C  CA    . ALA A 1 1267 ? 87.067  141.237 -0.365  1.00 6.24  ? 1267 ALA A CA    1 
ATOM   9654  C  C     . ALA A 1 1267 ? 87.746  139.872 -0.364  1.00 5.86  ? 1267 ALA A C     1 
ATOM   9655  O  O     . ALA A 1 1267 ? 87.103  138.836 -0.572  1.00 5.53  ? 1267 ALA A O     1 
ATOM   9656  C  CB    . ALA A 1 1267 ? 86.687  141.657 1.058   1.00 6.55  ? 1267 ALA A CB    1 
ATOM   9657  N  N     . THR A 1 1268 ? 89.057  139.891 -0.144  1.00 5.84  ? 1268 THR A N     1 
ATOM   9658  C  CA    . THR A 1 1268 ? 89.870  138.679 -0.075  1.00 6.51  ? 1268 THR A CA    1 
ATOM   9659  C  C     . THR A 1 1268 ? 90.839  138.803 1.094   1.00 5.89  ? 1268 THR A C     1 
ATOM   9660  O  O     . THR A 1 1268 ? 91.470  139.849 1.283   1.00 4.53  ? 1268 THR A O     1 
ATOM   9661  C  CB    . THR A 1 1268 ? 90.678  138.475 -1.391  1.00 7.48  ? 1268 THR A CB    1 
ATOM   9662  O  OG1   . THR A 1 1268 ? 89.784  138.427 -2.517  1.00 9.57  ? 1268 THR A OG1   1 
ATOM   9663  C  CG2   . THR A 1 1268 ? 91.325  137.098 -1.415  1.00 8.75  ? 1268 THR A CG2   1 
ATOM   9664  N  N     . LYS A 1 1269 ? 90.958  137.724 1.861   1.00 5.39  ? 1269 LYS A N     1 
ATOM   9665  C  CA    . LYS A 1 1269 ? 91.883  137.655 2.987   1.00 5.73  ? 1269 LYS A CA    1 
ATOM   9666  C  C     . LYS A 1 1269 ? 92.518  136.262 3.022   1.00 6.04  ? 1269 LYS A C     1 
ATOM   9667  O  O     . LYS A 1 1269 ? 91.945  135.296 2.502   1.00 5.63  ? 1269 LYS A O     1 
ATOM   9668  C  CB    . LYS A 1 1269 ? 91.137  137.910 4.303   1.00 6.03  ? 1269 LYS A CB    1 
ATOM   9669  C  CG    . LYS A 1 1269 ? 90.525  139.315 4.454   1.00 5.77  ? 1269 LYS A CG    1 
ATOM   9670  C  CD    . LYS A 1 1269 ? 91.590  140.376 4.642   1.00 7.00  ? 1269 LYS A CD    1 
ATOM   9671  C  CE    . LYS A 1 1269 ? 91.144  141.727 4.066   1.00 8.42  ? 1269 LYS A CE    1 
ATOM   9672  N  NZ    . LYS A 1 1269 ? 91.969  142.855 4.571   1.00 6.16  ? 1269 LYS A NZ    1 
ATOM   9673  N  N     . THR A 1 1270 ? 93.687  136.164 3.642   1.00 5.86  ? 1270 THR A N     1 
ATOM   9674  C  CA    . THR A 1 1270 ? 94.431  134.911 3.715   1.00 6.95  ? 1270 THR A CA    1 
ATOM   9675  C  C     . THR A 1 1270 ? 94.906  134.688 5.150   1.00 6.84  ? 1270 THR A C     1 
ATOM   9676  O  O     . THR A 1 1270 ? 95.422  135.610 5.774   1.00 6.52  ? 1270 THR A O     1 
ATOM   9677  C  CB    . THR A 1 1270 ? 95.632  134.991 2.743   1.00 7.89  ? 1270 THR A CB    1 
ATOM   9678  O  OG1   . THR A 1 1270 ? 95.137  135.110 1.395   1.00 8.84  ? 1270 THR A OG1   1 
ATOM   9679  C  CG2   . THR A 1 1270 ? 96.436  133.679 2.744   1.00 6.40  ? 1270 THR A CG2   1 
ATOM   9680  N  N     . TYR A 1 1271 ? 94.740  133.468 5.664   1.00 6.88  ? 1271 TYR A N     1 
ATOM   9681  C  CA    . TYR A 1 1271 ? 95.122  133.156 7.046   1.00 7.13  ? 1271 TYR A CA    1 
ATOM   9682  C  C     . TYR A 1 1271 ? 95.747  131.764 7.197   1.00 7.58  ? 1271 TYR A C     1 
ATOM   9683  O  O     . TYR A 1 1271 ? 95.385  130.827 6.491   1.00 7.34  ? 1271 TYR A O     1 
ATOM   9684  C  CB    . TYR A 1 1271 ? 93.898  133.234 7.997   1.00 6.59  ? 1271 TYR A CB    1 
ATOM   9685  C  CG    . TYR A 1 1271 ? 93.120  134.527 7.933   1.00 6.82  ? 1271 TYR A CG    1 
ATOM   9686  C  CD1   . TYR A 1 1271 ? 91.993  134.631 7.116   1.00 7.54  ? 1271 TYR A CD1   1 
ATOM   9687  C  CD2   . TYR A 1 1271 ? 93.508  135.647 8.678   1.00 7.77  ? 1271 TYR A CD2   1 
ATOM   9688  C  CE1   . TYR A 1 1271 ? 91.269  135.805 7.031   1.00 7.70  ? 1271 TYR A CE1   1 
ATOM   9689  C  CE2   . TYR A 1 1271 ? 92.788  136.843 8.604   1.00 7.07  ? 1271 TYR A CE2   1 
ATOM   9690  C  CZ    . TYR A 1 1271 ? 91.661  136.910 7.779   1.00 8.84  ? 1271 TYR A CZ    1 
ATOM   9691  O  OH    . TYR A 1 1271 ? 90.922  138.075 7.671   1.00 7.51  ? 1271 TYR A OH    1 
ATOM   9692  N  N     . ARG A 1 1272 ? 96.651  131.635 8.160   1.00 7.58  ? 1272 ARG A N     1 
ATOM   9693  C  CA    . ARG A 1 1272 ? 97.149  130.329 8.602   1.00 8.60  ? 1272 ARG A CA    1 
ATOM   9694  C  C     . ARG A 1 1272 ? 96.123  129.685 9.569   1.00 8.41  ? 1272 ARG A C     1 
ATOM   9695  O  O     . ARG A 1 1272 ? 95.511  130.378 10.392  1.00 7.84  ? 1272 ARG A O     1 
ATOM   9696  C  CB    . ARG A 1 1272 ? 98.532  130.531 9.243   1.00 9.24  ? 1272 ARG A CB    1 
ATOM   9697  C  CG    . ARG A 1 1272 ? 99.325  129.288 9.546   1.00 13.20 ? 1272 ARG A CG    1 
ATOM   9698  C  CD    . ARG A 1 1272 ? 100.386 128.909 8.508   1.00 16.89 ? 1272 ARG A CD    1 
ATOM   9699  N  NE    . ARG A 1 1272 ? 100.223 127.492 8.170   1.00 20.35 ? 1272 ARG A NE    1 
ATOM   9700  C  CZ    . ARG A 1 1272 ? 100.588 126.912 7.026   1.00 19.86 ? 1272 ARG A CZ    1 
ATOM   9701  N  NH1   . ARG A 1 1272 ? 101.171 127.615 6.052   1.00 20.72 ? 1272 ARG A NH1   1 
ATOM   9702  N  NH2   . ARG A 1 1272 ? 100.367 125.612 6.867   1.00 18.87 ? 1272 ARG A NH2   1 
ATOM   9703  N  N     . LEU A 1 1273 ? 95.909  128.378 9.430   1.00 7.40  ? 1273 LEU A N     1 
ATOM   9704  C  CA    . LEU A 1 1273 ? 94.975  127.617 10.265  1.00 8.09  ? 1273 LEU A CA    1 
ATOM   9705  C  C     . LEU A 1 1273 ? 95.664  126.520 11.065  1.00 7.34  ? 1273 LEU A C     1 
ATOM   9706  O  O     . LEU A 1 1273 ? 96.656  125.945 10.606  1.00 6.80  ? 1273 LEU A O     1 
ATOM   9707  C  CB    . LEU A 1 1273 ? 93.920  126.919 9.382   1.00 8.85  ? 1273 LEU A CB    1 
ATOM   9708  C  CG    . LEU A 1 1273 ? 92.647  127.685 9.085   1.00 9.50  ? 1273 LEU A CG    1 
ATOM   9709  C  CD1   . LEU A 1 1273 ? 91.522  126.774 8.610   1.00 9.79  ? 1273 LEU A CD1   1 
ATOM   9710  C  CD2   . LEU A 1 1273 ? 92.235  128.500 10.296  1.00 12.55 ? 1273 LEU A CD2   1 
ATOM   9711  N  N     . VAL A 1 1274 ? 95.115  126.206 12.244  1.00 6.93  ? 1274 VAL A N     1 
ATOM   9712  C  CA    . VAL A 1 1274 ? 95.494  124.994 12.985  1.00 6.12  ? 1274 VAL A CA    1 
ATOM   9713  C  C     . VAL A 1 1274 ? 94.224  124.250 13.422  1.00 6.51  ? 1274 VAL A C     1 
ATOM   9714  O  O     . VAL A 1 1274 ? 93.123  124.790 13.330  1.00 5.99  ? 1274 VAL A O     1 
ATOM   9715  C  CB    . VAL A 1 1274 ? 96.407  125.274 14.226  1.00 6.39  ? 1274 VAL A CB    1 
ATOM   9716  C  CG1   . VAL A 1 1274 ? 97.824  125.709 13.803  1.00 6.00  ? 1274 VAL A CG1   1 
ATOM   9717  C  CG2   . VAL A 1 1274 ? 95.774  126.272 15.193  1.00 5.31  ? 1274 VAL A CG2   1 
ATOM   9718  N  N     . ASN A 1 1275 ? 94.375  123.010 13.889  1.00 6.62  ? 1275 ASN A N     1 
ATOM   9719  C  CA    . ASN A 1 1275 ? 93.203  122.151 14.158  1.00 7.19  ? 1275 ASN A CA    1 
ATOM   9720  C  C     . ASN A 1 1275 ? 92.290  122.723 15.248  1.00 7.08  ? 1275 ASN A C     1 
ATOM   9721  O  O     . ASN A 1 1275 ? 91.106  122.386 15.324  1.00 7.50  ? 1275 ASN A O     1 
ATOM   9722  C  CB    . ASN A 1 1275 ? 93.664  120.744 14.531  1.00 7.71  ? 1275 ASN A CB    1 
ATOM   9723  C  CG    . ASN A 1 1275 ? 94.136  120.654 15.965  1.00 7.55  ? 1275 ASN A CG    1 
ATOM   9724  O  OD1   . ASN A 1 1275 ? 93.428  120.126 16.830  1.00 13.01 ? 1275 ASN A OD1   1 
ATOM   9725  N  ND2   . ASN A 1 1275 ? 95.309  121.185 16.235  1.00 7.74  ? 1275 ASN A ND2   1 
ATOM   9726  N  N     . THR A 1 1276 ? 92.849  123.593 16.089  1.00 7.07  ? 1276 THR A N     1 
ATOM   9727  C  CA    . THR A 1 1276 ? 92.093  124.211 17.179  1.00 7.01  ? 1276 THR A CA    1 
ATOM   9728  C  C     . THR A 1 1276 ? 91.240  125.373 16.671  1.00 7.41  ? 1276 THR A C     1 
ATOM   9729  O  O     . THR A 1 1276 ? 90.505  125.992 17.455  1.00 8.21  ? 1276 THR A O     1 
ATOM   9730  C  CB    . THR A 1 1276 ? 93.026  124.677 18.321  1.00 6.99  ? 1276 THR A CB    1 
ATOM   9731  O  OG1   . THR A 1 1276 ? 94.111  125.435 17.781  1.00 7.24  ? 1276 THR A OG1   1 
ATOM   9732  C  CG2   . THR A 1 1276 ? 93.730  123.487 18.986  1.00 6.93  ? 1276 THR A CG2   1 
ATOM   9733  N  N     . ASP A 1 1277 ? 91.373  125.681 15.376  1.00 6.62  ? 1277 ASP A N     1 
ATOM   9734  C  CA    . ASP A 1 1277 ? 90.528  126.659 14.704  1.00 6.76  ? 1277 ASP A CA    1 
ATOM   9735  C  C     . ASP A 1 1277 ? 89.319  125.927 14.143  1.00 6.48  ? 1277 ASP A C     1 
ATOM   9736  O  O     . ASP A 1 1277 ? 89.395  125.332 13.052  1.00 6.22  ? 1277 ASP A O     1 
ATOM   9737  C  CB    . ASP A 1 1277 ? 91.279  127.352 13.573  1.00 6.74  ? 1277 ASP A CB    1 
ATOM   9738  C  CG    . ASP A 1 1277 ? 92.337  128.289 14.069  1.00 6.51  ? 1277 ASP A CG    1 
ATOM   9739  O  OD1   . ASP A 1 1277 ? 92.065  129.026 15.035  1.00 5.41  ? 1277 ASP A OD1   1 
ATOM   9740  O  OD2   . ASP A 1 1277 ? 93.470  128.353 13.553  1.00 5.35  ? 1277 ASP A OD2   1 
ATOM   9741  N  N     . ARG A 1 1278 ? 88.230  125.968 14.912  1.00 5.87  ? 1278 ARG A N     1 
ATOM   9742  C  CA    . ARG A 1 1278 ? 86.999  125.232 14.629  1.00 6.94  ? 1278 ARG A CA    1 
ATOM   9743  C  C     . ARG A 1 1278 ? 85.909  126.132 14.051  1.00 6.95  ? 1278 ARG A C     1 
ATOM   9744  O  O     . ARG A 1 1278 ? 85.840  127.329 14.380  1.00 6.64  ? 1278 ARG A O     1 
ATOM   9745  C  CB    . ARG A 1 1278 ? 86.477  124.589 15.918  1.00 7.45  ? 1278 ARG A CB    1 
ATOM   9746  C  CG    . ARG A 1 1278 ? 87.202  123.298 16.296  1.00 9.33  ? 1278 ARG A CG    1 
ATOM   9747  C  CD    . ARG A 1 1278 ? 87.846  123.302 17.658  1.00 11.48 ? 1278 ARG A CD    1 
ATOM   9748  N  NE    . ARG A 1 1278 ? 86.921  123.528 18.767  1.00 14.70 ? 1278 ARG A NE    1 
ATOM   9749  C  CZ    . ARG A 1 1278 ? 87.246  124.196 19.875  1.00 16.32 ? 1278 ARG A CZ    1 
ATOM   9750  N  NH1   . ARG A 1 1278 ? 88.474  124.709 20.032  1.00 20.03 ? 1278 ARG A NH1   1 
ATOM   9751  N  NH2   . ARG A 1 1278 ? 86.359  124.347 20.835  1.00 15.64 ? 1278 ARG A NH2   1 
ATOM   9752  N  N     . THR A 1 1279 ? 85.056  125.546 13.209  1.00 6.74  ? 1279 THR A N     1 
ATOM   9753  C  CA    . THR A 1 1279 ? 83.884  126.253 12.660  1.00 7.30  ? 1279 THR A CA    1 
ATOM   9754  C  C     . THR A 1 1279 ? 84.291  127.553 11.946  1.00 7.03  ? 1279 THR A C     1 
ATOM   9755  O  O     . THR A 1 1279 ? 83.642  128.612 12.101  1.00 6.61  ? 1279 THR A O     1 
ATOM   9756  C  CB    . THR A 1 1279 ? 82.852  126.555 13.789  1.00 7.23  ? 1279 THR A CB    1 
ATOM   9757  O  OG1   . THR A 1 1279 ? 82.900  125.526 14.786  1.00 7.64  ? 1279 THR A OG1   1 
ATOM   9758  C  CG2   . THR A 1 1279 ? 81.422  126.456 13.241  1.00 8.01  ? 1279 THR A CG2   1 
ATOM   9759  N  N     . VAL A 1 1280 ? 85.365  127.504 11.172  1.00 7.32  ? 1280 VAL A N     1 
ATOM   9760  C  CA    . VAL A 1 1280 ? 85.780  128.759 10.535  1.00 8.03  ? 1280 VAL A CA    1 
ATOM   9761  C  C     . VAL A 1 1280 ? 84.891  129.158 9.365   1.00 7.47  ? 1280 VAL A C     1 
ATOM   9762  O  O     . VAL A 1 1280 ? 84.436  128.294 8.605   1.00 7.29  ? 1280 VAL A O     1 
ATOM   9763  C  CB    . VAL A 1 1280 ? 87.319  128.881 10.254  1.00 9.12  ? 1280 VAL A CB    1 
ATOM   9764  C  CG1   . VAL A 1 1280 ? 88.057  127.688 10.684  1.00 9.20  ? 1280 VAL A CG1   1 
ATOM   9765  C  CG2   . VAL A 1 1280 ? 87.617  129.276 8.834   1.00 9.09  ? 1280 VAL A CG2   1 
ATOM   9766  N  N     . GLY A 1 1281 ? 84.607  130.459 9.286   1.00 7.07  ? 1281 GLY A N     1 
ATOM   9767  C  CA    . GLY A 1 1281 ? 83.704  131.042 8.303   1.00 6.53  ? 1281 GLY A CA    1 
ATOM   9768  C  C     . GLY A 1 1281 ? 82.274  131.204 8.807   1.00 6.31  ? 1281 GLY A C     1 
ATOM   9769  O  O     . GLY A 1 1281 ? 81.530  132.045 8.317   1.00 6.20  ? 1281 GLY A O     1 
ATOM   9770  N  N     . THR A 1 1282 ? 81.912  130.413 9.809   1.00 5.50  ? 1282 THR A N     1 
ATOM   9771  C  CA    . THR A 1 1282 ? 80.526  130.286 10.263  1.00 5.66  ? 1282 THR A CA    1 
ATOM   9772  C  C     . THR A 1 1282 ? 80.005  131.538 10.969  1.00 5.42  ? 1282 THR A C     1 
ATOM   9773  O  O     . THR A 1 1282 ? 78.835  131.881 10.835  1.00 5.23  ? 1282 THR A O     1 
ATOM   9774  C  CB    . THR A 1 1282 ? 80.405  129.044 11.181  1.00 5.65  ? 1282 THR A CB    1 
ATOM   9775  O  OG1   . THR A 1 1282 ? 80.733  127.877 10.414  1.00 4.65  ? 1282 THR A OG1   1 
ATOM   9776  C  CG2   . THR A 1 1282 ? 78.954  128.804 11.646  1.00 5.63  ? 1282 THR A CG2   1 
ATOM   9777  N  N     . ARG A 1 1283 ? 80.862  132.214 11.730  1.00 5.18  ? 1283 ARG A N     1 
ATOM   9778  C  CA    . ARG A 1 1283 ? 80.437  133.447 12.391  1.00 5.64  ? 1283 ARG A CA    1 
ATOM   9779  C  C     . ARG A 1 1283 ? 80.189  134.580 11.372  1.00 5.04  ? 1283 ARG A C     1 
ATOM   9780  O  O     . ARG A 1 1283 ? 79.246  135.385 11.518  1.00 5.60  ? 1283 ARG A O     1 
ATOM   9781  C  CB    . ARG A 1 1283 ? 81.449  133.878 13.453  1.00 5.46  ? 1283 ARG A CB    1 
ATOM   9782  C  CG    . ARG A 1 1283 ? 80.948  134.999 14.320  1.00 5.19  ? 1283 ARG A CG    1 
ATOM   9783  C  CD    . ARG A 1 1283 ? 81.632  135.064 15.670  1.00 7.53  ? 1283 ARG A CD    1 
ATOM   9784  N  NE    . ARG A 1 1283 ? 81.075  134.102 16.629  1.00 5.60  ? 1283 ARG A NE    1 
ATOM   9785  C  CZ    . ARG A 1 1283 ? 81.516  133.980 17.877  1.00 8.01  ? 1283 ARG A CZ    1 
ATOM   9786  N  NH1   . ARG A 1 1283 ? 82.521  134.748 18.303  1.00 5.86  ? 1283 ARG A NH1   1 
ATOM   9787  N  NH2   . ARG A 1 1283 ? 80.961  133.093 18.702  1.00 6.35  ? 1283 ARG A NH2   1 
ATOM   9788  N  N     . LEU A 1 1284 ? 81.022  134.627 10.339  1.00 4.32  ? 1284 LEU A N     1 
ATOM   9789  C  CA    . LEU A 1 1284 ? 80.786  135.521 9.203   1.00 4.62  ? 1284 LEU A CA    1 
ATOM   9790  C  C     . LEU A 1 1284 ? 79.476  135.180 8.478   1.00 4.93  ? 1284 LEU A C     1 
ATOM   9791  O  O     . LEU A 1 1284 ? 78.725  136.083 8.079   1.00 4.02  ? 1284 LEU A O     1 
ATOM   9792  C  CB    . LEU A 1 1284 ? 81.973  135.467 8.227   1.00 4.95  ? 1284 LEU A CB    1 
ATOM   9793  C  CG    . LEU A 1 1284 ? 81.867  136.117 6.844   1.00 5.97  ? 1284 LEU A CG    1 
ATOM   9794  C  CD1   . LEU A 1 1284 ? 81.609  137.609 6.936   1.00 6.48  ? 1284 LEU A CD1   1 
ATOM   9795  C  CD2   . LEU A 1 1284 ? 83.156  135.872 6.037   1.00 8.40  ? 1284 LEU A CD2   1 
ATOM   9796  N  N     . SER A 1 1285 ? 79.193  133.887 8.302   1.00 5.16  ? 1285 SER A N     1 
ATOM   9797  C  CA    . SER A 1 1285 ? 77.928  133.494 7.663   1.00 6.35  ? 1285 SER A CA    1 
ATOM   9798  C  C     . SER A 1 1285 ? 76.736  134.009 8.436   1.00 5.50  ? 1285 SER A C     1 
ATOM   9799  O  O     . SER A 1 1285 ? 75.831  134.573 7.851   1.00 5.90  ? 1285 SER A O     1 
ATOM   9800  C  CB    . SER A 1 1285 ? 77.802  131.987 7.507   1.00 6.67  ? 1285 SER A CB    1 
ATOM   9801  O  OG    . SER A 1 1285 ? 78.832  131.530 6.653   1.00 12.62 ? 1285 SER A OG    1 
ATOM   9802  N  N     . GLY A 1 1286 ? 76.755  133.827 9.752   1.00 5.09  ? 1286 GLY A N     1 
ATOM   9803  C  CA    . GLY A 1 1286 ? 75.701  134.332 10.611  1.00 4.68  ? 1286 GLY A CA    1 
ATOM   9804  C  C     . GLY A 1 1286 ? 75.490  135.835 10.522  1.00 4.66  ? 1286 GLY A C     1 
ATOM   9805  O  O     . GLY A 1 1286 ? 74.360  136.325 10.528  1.00 4.30  ? 1286 GLY A O     1 
ATOM   9806  N  N     . ALA A 1 1287 ? 76.592  136.569 10.439  1.00 4.22  ? 1287 ALA A N     1 
ATOM   9807  C  CA    . ALA A 1 1287 ? 76.561  138.020 10.317  1.00 4.05  ? 1287 ALA A CA    1 
ATOM   9808  C  C     . ALA A 1 1287 ? 75.881  138.437 9.018   1.00 3.87  ? 1287 ALA A C     1 
ATOM   9809  O  O     . ALA A 1 1287 ? 75.039  139.326 9.015   1.00 3.89  ? 1287 ALA A O     1 
ATOM   9810  C  CB    . ALA A 1 1287 ? 77.974  138.590 10.380  1.00 3.66  ? 1287 ALA A CB    1 
ATOM   9811  N  N     . ILE A 1 1288 ? 76.240  137.772 7.927   1.00 3.50  ? 1288 ILE A N     1 
ATOM   9812  C  CA    . ILE A 1 1288 ? 75.615  138.029 6.636   1.00 4.36  ? 1288 ILE A CA    1 
ATOM   9813  C  C     . ILE A 1 1288 ? 74.139  137.636 6.698   1.00 4.61  ? 1288 ILE A C     1 
ATOM   9814  O  O     . ILE A 1 1288 ? 73.278  138.436 6.335   1.00 5.33  ? 1288 ILE A O     1 
ATOM   9815  C  CB    . ILE A 1 1288 ? 76.354  137.258 5.500   1.00 4.18  ? 1288 ILE A CB    1 
ATOM   9816  C  CG1   . ILE A 1 1288 ? 77.792  137.761 5.364   1.00 3.66  ? 1288 ILE A CG1   1 
ATOM   9817  C  CG2   . ILE A 1 1288 ? 75.579  137.344 4.152   1.00 3.63  ? 1288 ILE A CG2   1 
ATOM   9818  C  CD1   . ILE A 1 1288 ? 78.707  136.869 4.473   1.00 4.28  ? 1288 ILE A CD1   1 
ATOM   9819  N  N     . ALA A 1 1289 ? 73.849  136.428 7.176   1.00 5.03  ? 1289 ALA A N     1 
ATOM   9820  C  CA    . ALA A 1 1289 ? 72.462  135.947 7.262   1.00 5.36  ? 1289 ALA A CA    1 
ATOM   9821  C  C     . ALA A 1 1289 ? 71.562  136.843 8.121   1.00 5.84  ? 1289 ALA A C     1 
ATOM   9822  O  O     . ALA A 1 1289 ? 70.388  137.045 7.793   1.00 6.26  ? 1289 ALA A O     1 
ATOM   9823  C  CB    . ALA A 1 1289 ? 72.418  134.477 7.771   1.00 5.54  ? 1289 ALA A CB    1 
ATOM   9824  N  N     . LYS A 1 1290 ? 72.110  137.369 9.216   1.00 5.86  ? 1290 LYS A N     1 
ATOM   9825  C  CA    . LYS A 1 1290 ? 71.371  138.254 10.106  1.00 6.66  ? 1290 LYS A CA    1 
ATOM   9826  C  C     . LYS A 1 1290 ? 70.950  139.519 9.344   1.00 6.64  ? 1290 LYS A C     1 
ATOM   9827  O  O     . LYS A 1 1290 ? 69.842  140.018 9.536   1.00 6.51  ? 1290 LYS A O     1 
ATOM   9828  C  CB    . LYS A 1 1290 ? 72.202  138.601 11.355  1.00 6.71  ? 1290 LYS A CB    1 
ATOM   9829  C  CG    . LYS A 1 1290 ? 71.482  139.433 12.422  1.00 8.94  ? 1290 LYS A CG    1 
ATOM   9830  C  CD    . LYS A 1 1290 ? 72.489  139.941 13.464  1.00 11.18 ? 1290 LYS A CD    1 
ATOM   9831  C  CE    . LYS A 1 1290 ? 71.836  140.812 14.528  1.00 13.88 ? 1290 LYS A CE    1 
ATOM   9832  N  NZ    . LYS A 1 1290 ? 72.610  140.784 15.811  1.00 15.82 ? 1290 LYS A NZ    1 
ATOM   9833  N  N     . LYS A 1 1291 ? 71.809  139.987 8.443   1.00 6.52  ? 1291 LYS A N     1 
ATOM   9834  C  CA    . LYS A 1 1291 ? 71.536  141.207 7.692   1.00 7.28  ? 1291 LYS A CA    1 
ATOM   9835  C  C     . LYS A 1 1291 ? 70.719  140.958 6.430   1.00 7.28  ? 1291 LYS A C     1 
ATOM   9836  O  O     . LYS A 1 1291 ? 69.848  141.758 6.104   1.00 6.82  ? 1291 LYS A O     1 
ATOM   9837  C  CB    . LYS A 1 1291 ? 72.838  141.927 7.312   1.00 7.41  ? 1291 LYS A CB    1 
ATOM   9838  C  CG    . LYS A 1 1291 ? 73.103  143.217 8.085   1.00 10.15 ? 1291 LYS A CG    1 
ATOM   9839  C  CD    . LYS A 1 1291 ? 74.343  143.092 9.015   1.00 12.94 ? 1291 LYS A CD    1 
ATOM   9840  C  CE    . LYS A 1 1291 ? 74.046  142.269 10.321  1.00 14.89 ? 1291 LYS A CE    1 
ATOM   9841  N  NZ    . LYS A 1 1291 ? 75.140  141.281 10.771  1.00 6.73  ? 1291 LYS A NZ    1 
ATOM   9842  N  N     . TYR A 1 1292 ? 70.996  139.852 5.732   1.00 6.54  ? 1292 TYR A N     1 
ATOM   9843  C  CA    . TYR A 1 1292 ? 70.490  139.671 4.362   1.00 7.06  ? 1292 TYR A CA    1 
ATOM   9844  C  C     . TYR A 1 1292 ? 69.645  138.407 4.118   1.00 6.71  ? 1292 TYR A C     1 
ATOM   9845  O  O     . TYR A 1 1292 ? 69.157  138.193 3.003   1.00 7.37  ? 1292 TYR A O     1 
ATOM   9846  C  CB    . TYR A 1 1292 ? 71.656  139.661 3.355   1.00 6.80  ? 1292 TYR A CB    1 
ATOM   9847  C  CG    . TYR A 1 1292 ? 72.467  140.939 3.283   1.00 6.58  ? 1292 TYR A CG    1 
ATOM   9848  C  CD1   . TYR A 1 1292 ? 73.708  141.031 3.906   1.00 7.43  ? 1292 TYR A CD1   1 
ATOM   9849  C  CD2   . TYR A 1 1292 ? 72.010  142.043 2.564   1.00 7.03  ? 1292 TYR A CD2   1 
ATOM   9850  C  CE1   . TYR A 1 1292 ? 74.470  142.211 3.838   1.00 6.11  ? 1292 TYR A CE1   1 
ATOM   9851  C  CE2   . TYR A 1 1292 ? 72.760  143.218 2.487   1.00 7.77  ? 1292 TYR A CE2   1 
ATOM   9852  C  CZ    . TYR A 1 1292 ? 73.994  143.288 3.123   1.00 7.48  ? 1292 TYR A CZ    1 
ATOM   9853  O  OH    . TYR A 1 1292 ? 74.745  144.453 3.039   1.00 8.80  ? 1292 TYR A OH    1 
ATOM   9854  N  N     . GLY A 1 1293 ? 69.493  137.575 5.136   1.00 6.48  ? 1293 GLY A N     1 
ATOM   9855  C  CA    . GLY A 1 1293 ? 68.902  136.257 4.968   1.00 5.77  ? 1293 GLY A CA    1 
ATOM   9856  C  C     . GLY A 1 1293 ? 69.863  135.347 4.226   1.00 5.52  ? 1293 GLY A C     1 
ATOM   9857  O  O     . GLY A 1 1293 ? 71.061  135.658 4.129   1.00 5.11  ? 1293 GLY A O     1 
ATOM   9858  N  N     . ASN A 1 1294 ? 69.344  134.235 3.698   1.00 4.50  ? 1294 ASN A N     1 
ATOM   9859  C  CA    . ASN A 1 1294 ? 70.173  133.230 3.020   1.00 4.68  ? 1294 ASN A CA    1 
ATOM   9860  C  C     . ASN A 1 1294 ? 70.608  133.695 1.622   1.00 4.33  ? 1294 ASN A C     1 
ATOM   9861  O  O     . ASN A 1 1294 ? 71.668  133.310 1.134   1.00 4.65  ? 1294 ASN A O     1 
ATOM   9862  C  CB    . ASN A 1 1294 ? 69.423  131.888 2.867   1.00 4.27  ? 1294 ASN A CB    1 
ATOM   9863  C  CG    . ASN A 1 1294 ? 69.140  131.181 4.201   1.00 5.22  ? 1294 ASN A CG    1 
ATOM   9864  O  OD1   . ASN A 1 1294 ? 69.925  131.250 5.145   1.00 4.46  ? 1294 ASN A OD1   1 
ATOM   9865  N  ND2   . ASN A 1 1294 ? 68.013  130.468 4.258   1.00 1.97  ? 1294 ASN A ND2   1 
ATOM   9866  N  N     . ASN A 1 1295 ? 69.783  134.523 0.994   1.00 4.64  ? 1295 ASN A N     1 
ATOM   9867  C  CA    . ASN A 1 1295 ? 69.924  134.798 -0.433  1.00 5.16  ? 1295 ASN A CA    1 
ATOM   9868  C  C     . ASN A 1 1295 ? 70.008  136.270 -0.812  1.00 5.18  ? 1295 ASN A C     1 
ATOM   9869  O  O     . ASN A 1 1295 ? 70.023  136.601 -2.000  1.00 5.96  ? 1295 ASN A O     1 
ATOM   9870  C  CB    . ASN A 1 1295 ? 68.759  134.164 -1.197  1.00 6.03  ? 1295 ASN A CB    1 
ATOM   9871  C  CG    . ASN A 1 1295 ? 68.593  132.695 -0.894  1.00 8.25  ? 1295 ASN A CG    1 
ATOM   9872  O  OD1   . ASN A 1 1295 ? 69.518  131.902 -1.061  1.00 10.72 ? 1295 ASN A OD1   1 
ATOM   9873  N  ND2   . ASN A 1 1295 ? 67.401  132.323 -0.437  1.00 12.95 ? 1295 ASN A ND2   1 
ATOM   9874  N  N     . GLY A 1 1296 ? 70.056  137.159 0.172   1.00 4.62  ? 1296 GLY A N     1 
ATOM   9875  C  CA    . GLY A 1 1296 ? 70.041  138.592 -0.130  1.00 4.94  ? 1296 GLY A CA    1 
ATOM   9876  C  C     . GLY A 1 1296 ? 71.383  139.236 -0.455  1.00 4.91  ? 1296 GLY A C     1 
ATOM   9877  O  O     . GLY A 1 1296 ? 71.436  140.237 -1.188  1.00 4.05  ? 1296 GLY A O     1 
ATOM   9878  N  N     . PHE A 1 1297 ? 72.453  138.685 0.113   1.00 4.59  ? 1297 PHE A N     1 
ATOM   9879  C  CA    . PHE A 1 1297 ? 73.819  139.219 -0.051  1.00 5.50  ? 1297 PHE A CA    1 
ATOM   9880  C  C     . PHE A 1 1297 ? 74.284  139.228 -1.512  1.00 5.83  ? 1297 PHE A C     1 
ATOM   9881  O  O     . PHE A 1 1297 ? 74.186  138.212 -2.199  1.00 6.28  ? 1297 PHE A O     1 
ATOM   9882  C  CB    . PHE A 1 1297 ? 74.799  138.384 0.788   1.00 4.26  ? 1297 PHE A CB    1 
ATOM   9883  C  CG    . PHE A 1 1297 ? 76.198  138.967 0.904   1.00 4.94  ? 1297 PHE A CG    1 
ATOM   9884  C  CD1   . PHE A 1 1297 ? 76.396  140.288 1.290   1.00 2.35  ? 1297 PHE A CD1   1 
ATOM   9885  C  CD2   . PHE A 1 1297 ? 77.314  138.157 0.687   1.00 4.24  ? 1297 PHE A CD2   1 
ATOM   9886  C  CE1   . PHE A 1 1297 ? 77.690  140.814 1.399   1.00 6.45  ? 1297 PHE A CE1   1 
ATOM   9887  C  CE2   . PHE A 1 1297 ? 78.611  138.659 0.808   1.00 4.47  ? 1297 PHE A CE2   1 
ATOM   9888  C  CZ    . PHE A 1 1297 ? 78.802  139.997 1.169   1.00 5.36  ? 1297 PHE A CZ    1 
ATOM   9889  N  N     . GLU A 1 1298 ? 74.808  140.367 -1.961  1.00 6.52  ? 1298 GLU A N     1 
ATOM   9890  C  CA    . GLU A 1 1298 ? 75.316  140.519 -3.326  1.00 7.41  ? 1298 GLU A CA    1 
ATOM   9891  C  C     . GLU A 1 1298 ? 76.832  140.757 -3.356  1.00 7.58  ? 1298 GLU A C     1 
ATOM   9892  O  O     . GLU A 1 1298 ? 77.419  140.982 -4.423  1.00 7.40  ? 1298 GLU A O     1 
ATOM   9893  C  CB    . GLU A 1 1298 ? 74.594  141.669 -4.038  1.00 8.29  ? 1298 GLU A CB    1 
ATOM   9894  C  CG    . GLU A 1 1298 ? 73.141  141.376 -4.397  1.00 10.56 ? 1298 GLU A CG    1 
ATOM   9895  C  CD    . GLU A 1 1298 ? 72.417  142.597 -4.946  1.00 15.19 ? 1298 GLU A CD    1 
ATOM   9896  O  OE1   . GLU A 1 1298 ? 73.051  143.422 -5.654  1.00 17.07 ? 1298 GLU A OE1   1 
ATOM   9897  O  OE2   . GLU A 1 1298 ? 71.206  142.750 -4.666  1.00 17.95 ? 1298 GLU A OE2   1 
ATOM   9898  N  N     . GLY A 1 1299 ? 77.459  140.737 -2.183  1.00 7.46  ? 1299 GLY A N     1 
ATOM   9899  C  CA    . GLY A 1 1299 ? 78.897  140.888 -2.089  1.00 7.51  ? 1299 GLY A CA    1 
ATOM   9900  C  C     . GLY A 1 1299 ? 79.618  139.585 -2.384  1.00 7.62  ? 1299 GLY A C     1 
ATOM   9901  O  O     . GLY A 1 1299 ? 79.014  138.566 -2.756  1.00 6.93  ? 1299 GLY A O     1 
ATOM   9902  N  N     . ASN A 1 1300 ? 80.925  139.606 -2.177  1.00 7.52  ? 1300 ASN A N     1 
ATOM   9903  C  CA    . ASN A 1 1300 ? 81.752  138.474 -2.536  1.00 8.34  ? 1300 ASN A CA    1 
ATOM   9904  C  C     . ASN A 1 1300 ? 82.964  138.446 -1.608  1.00 7.71  ? 1300 ASN A C     1 
ATOM   9905  O  O     . ASN A 1 1300 ? 83.821  139.316 -1.684  1.00 8.10  ? 1300 ASN A O     1 
ATOM   9906  C  CB    . ASN A 1 1300 ? 82.141  138.646 -4.018  1.00 8.89  ? 1300 ASN A CB    1 
ATOM   9907  C  CG    . ASN A 1 1300 ? 83.023  137.537 -4.544  1.00 12.12 ? 1300 ASN A CG    1 
ATOM   9908  O  OD1   . ASN A 1 1300 ? 83.385  136.602 -3.824  1.00 15.16 ? 1300 ASN A OD1   1 
ATOM   9909  N  ND2   . ASN A 1 1300 ? 83.377  137.637 -5.829  1.00 14.75 ? 1300 ASN A ND2   1 
ATOM   9910  N  N     . ILE A 1 1301 ? 83.013  137.476 -0.699  1.00 7.34  ? 1301 ILE A N     1 
ATOM   9911  C  CA    . ILE A 1 1301 ? 84.143  137.357 0.215   1.00 6.29  ? 1301 ILE A CA    1 
ATOM   9912  C  C     . ILE A 1 1301 ? 84.873  136.047 -0.042  1.00 6.34  ? 1301 ILE A C     1 
ATOM   9913  O  O     . ILE A 1 1301 ? 84.275  134.973 -0.034  1.00 6.89  ? 1301 ILE A O     1 
ATOM   9914  C  CB    . ILE A 1 1301 ? 83.692  137.482 1.708   1.00 6.52  ? 1301 ILE A CB    1 
ATOM   9915  C  CG1   . ILE A 1 1301 ? 83.094  138.877 1.978   1.00 4.98  ? 1301 ILE A CG1   1 
ATOM   9916  C  CG2   . ILE A 1 1301 ? 84.878  137.217 2.651   1.00 5.38  ? 1301 ILE A CG2   1 
ATOM   9917  C  CD1   . ILE A 1 1301 ? 82.357  139.030 3.305   1.00 7.09  ? 1301 ILE A CD1   1 
ATOM   9918  N  N     . THR A 1 1302 ? 86.162  136.150 -0.305  1.00 6.12  ? 1302 THR A N     1 
ATOM   9919  C  CA    . THR A 1 1302 ? 87.006  134.974 -0.449  1.00 5.63  ? 1302 THR A CA    1 
ATOM   9920  C  C     . THR A 1 1302 ? 87.951  134.906 0.727   1.00 5.07  ? 1302 THR A C     1 
ATOM   9921  O  O     . THR A 1 1302 ? 88.716  135.842 0.971   1.00 4.46  ? 1302 THR A O     1 
ATOM   9922  C  CB    . THR A 1 1302 ? 87.794  135.015 -1.764  1.00 5.53  ? 1302 THR A CB    1 
ATOM   9923  O  OG1   . THR A 1 1302 ? 86.880  135.046 -2.870  1.00 7.70  ? 1302 THR A OG1   1 
ATOM   9924  C  CG2   . THR A 1 1302 ? 88.556  133.710 -1.971  1.00 6.51  ? 1302 THR A CG2   1 
ATOM   9925  N  N     . LEU A 1 1303 ? 87.896  133.791 1.449   1.00 4.62  ? 1303 LEU A N     1 
ATOM   9926  C  CA    . LEU A 1 1303 ? 88.846  133.523 2.513   1.00 5.33  ? 1303 LEU A CA    1 
ATOM   9927  C  C     . LEU A 1 1303 ? 89.767  132.366 2.098   1.00 5.34  ? 1303 LEU A C     1 
ATOM   9928  O  O     . LEU A 1 1303 ? 89.296  131.277 1.737   1.00 5.53  ? 1303 LEU A O     1 
ATOM   9929  C  CB    . LEU A 1 1303 ? 88.113  133.226 3.838   1.00 5.21  ? 1303 LEU A CB    1 
ATOM   9930  C  CG    . LEU A 1 1303 ? 87.086  134.266 4.338   1.00 6.42  ? 1303 LEU A CG    1 
ATOM   9931  C  CD1   . LEU A 1 1303 ? 86.408  133.794 5.635   1.00 7.10  ? 1303 LEU A CD1   1 
ATOM   9932  C  CD2   . LEU A 1 1303 ? 87.703  135.661 4.526   1.00 6.69  ? 1303 LEU A CD2   1 
ATOM   9933  N  N     . ASN A 1 1304 ? 91.069  132.623 2.118   1.00 5.21  ? 1304 ASN A N     1 
ATOM   9934  C  CA    . ASN A 1 1304 ? 92.067  131.612 1.811   1.00 5.54  ? 1304 ASN A CA    1 
ATOM   9935  C  C     . ASN A 1 1304 ? 92.728  131.150 3.116   1.00 5.61  ? 1304 ASN A C     1 
ATOM   9936  O  O     . ASN A 1 1304 ? 93.172  131.980 3.915   1.00 5.93  ? 1304 ASN A O     1 
ATOM   9937  C  CB    . ASN A 1 1304 ? 93.122  132.157 0.837   1.00 5.37  ? 1304 ASN A CB    1 
ATOM   9938  C  CG    . ASN A 1 1304 ? 92.519  132.696 -0.478  1.00 7.35  ? 1304 ASN A CG    1 
ATOM   9939  O  OD1   . ASN A 1 1304 ? 92.026  131.940 -1.322  1.00 9.50  ? 1304 ASN A OD1   1 
ATOM   9940  N  ND2   . ASN A 1 1304 ? 92.584  133.997 -0.655  1.00 7.73  ? 1304 ASN A ND2   1 
ATOM   9941  N  N     . PHE A 1 1305 ? 92.792  129.839 3.331   1.00 4.53  ? 1305 PHE A N     1 
ATOM   9942  C  CA    . PHE A 1 1305 ? 93.443  129.285 4.519   1.00 4.49  ? 1305 PHE A CA    1 
ATOM   9943  C  C     . PHE A 1 1305 ? 94.550  128.287 4.159   1.00 4.73  ? 1305 PHE A C     1 
ATOM   9944  O  O     . PHE A 1 1305 ? 94.479  127.629 3.109   1.00 4.50  ? 1305 PHE A O     1 
ATOM   9945  C  CB    . PHE A 1 1305 ? 92.419  128.599 5.426   1.00 3.42  ? 1305 PHE A CB    1 
ATOM   9946  C  CG    . PHE A 1 1305 ? 91.296  129.499 5.848   1.00 5.77  ? 1305 PHE A CG    1 
ATOM   9947  C  CD1   . PHE A 1 1305 ? 90.097  129.504 5.147   1.00 4.92  ? 1305 PHE A CD1   1 
ATOM   9948  C  CD2   . PHE A 1 1305 ? 91.458  130.392 6.912   1.00 5.79  ? 1305 PHE A CD2   1 
ATOM   9949  C  CE1   . PHE A 1 1305 ? 89.055  130.356 5.513   1.00 6.12  ? 1305 PHE A CE1   1 
ATOM   9950  C  CE2   . PHE A 1 1305 ? 90.435  131.242 7.283   1.00 5.95  ? 1305 PHE A CE2   1 
ATOM   9951  C  CZ    . PHE A 1 1305 ? 89.228  131.229 6.584   1.00 6.47  ? 1305 PHE A CZ    1 
ATOM   9952  N  N     . GLN A 1 1306 ? 95.543  128.164 5.049   1.00 4.31  ? 1306 GLN A N     1 
ATOM   9953  C  CA    . GLN A 1 1306 ? 96.611  127.171 4.912   1.00 4.99  ? 1306 GLN A CA    1 
ATOM   9954  C  C     . GLN A 1 1306 ? 96.787  126.427 6.250   1.00 4.68  ? 1306 GLN A C     1 
ATOM   9955  O  O     . GLN A 1 1306 ? 96.921  127.051 7.308   1.00 3.65  ? 1306 GLN A O     1 
ATOM   9956  C  CB    . GLN A 1 1306 ? 97.941  127.841 4.529   1.00 5.79  ? 1306 GLN A CB    1 
ATOM   9957  C  CG    . GLN A 1 1306 ? 98.055  128.338 3.059   1.00 9.25  ? 1306 GLN A CG    1 
ATOM   9958  C  CD    . GLN A 1 1306 ? 99.461  128.823 2.707   1.00 13.61 ? 1306 GLN A CD    1 
ATOM   9959  O  OE1   . GLN A 1 1306 ? 100.436 128.075 2.852   1.00 15.57 ? 1306 GLN A OE1   1 
ATOM   9960  N  NE2   . GLN A 1 1306 ? 99.571  130.076 2.250   1.00 16.10 ? 1306 GLN A NE2   1 
ATOM   9961  N  N     . GLY A 1 1307 ? 96.800  125.101 6.197   1.00 4.78  ? 1307 GLY A N     1 
ATOM   9962  C  CA    . GLY A 1 1307 ? 97.021  124.292 7.396   1.00 5.34  ? 1307 GLY A CA    1 
ATOM   9963  C  C     . GLY A 1 1307 ? 96.018  123.163 7.554   1.00 6.07  ? 1307 GLY A C     1 
ATOM   9964  O  O     . GLY A 1 1307 ? 95.384  122.742 6.573   1.00 5.91  ? 1307 GLY A O     1 
ATOM   9965  N  N     . ALA A 1 1308 ? 95.880  122.665 8.783   1.00 6.02  ? 1308 ALA A N     1 
ATOM   9966  C  CA    . ALA A 1 1308 ? 94.842  121.684 9.113   1.00 6.63  ? 1308 ALA A CA    1 
ATOM   9967  C  C     . ALA A 1 1308 ? 93.660  122.346 9.812   1.00 7.26  ? 1308 ALA A C     1 
ATOM   9968  O  O     . ALA A 1 1308 ? 93.793  122.829 10.938  1.00 7.70  ? 1308 ALA A O     1 
ATOM   9969  C  CB    . ALA A 1 1308 ? 95.408  120.585 9.977   1.00 6.82  ? 1308 ALA A CB    1 
ATOM   9970  N  N     . ALA A 1 1309 ? 92.507  122.356 9.151   1.00 6.14  ? 1309 ALA A N     1 
ATOM   9971  C  CA    . ALA A 1 1309 ? 91.312  122.968 9.714   1.00 6.56  ? 1309 ALA A CA    1 
ATOM   9972  C  C     . ALA A 1 1309 ? 90.713  122.067 10.803  1.00 6.77  ? 1309 ALA A C     1 
ATOM   9973  O  O     . ALA A 1 1309 ? 90.664  120.852 10.655  1.00 7.11  ? 1309 ALA A O     1 
ATOM   9974  C  CB    . ALA A 1 1309 ? 90.281  123.215 8.617   1.00 6.12  ? 1309 ALA A CB    1 
ATOM   9975  N  N     . GLY A 1 1310 ? 90.250  122.669 11.893  1.00 6.80  ? 1310 GLY A N     1 
ATOM   9976  C  CA    . GLY A 1 1310 ? 89.462  121.940 12.874  1.00 6.50  ? 1310 GLY A CA    1 
ATOM   9977  C  C     . GLY A 1 1310 ? 88.060  121.569 12.408  1.00 6.48  ? 1310 GLY A C     1 
ATOM   9978  O  O     . GLY A 1 1310 ? 87.652  121.901 11.272  1.00 6.60  ? 1310 GLY A O     1 
ATOM   9979  N  N     . GLN A 1 1311 ? 87.329  120.869 13.284  1.00 6.02  ? 1311 GLN A N     1 
ATOM   9980  C  CA    . GLN A 1 1311 ? 85.926  120.456 13.041  1.00 5.92  ? 1311 GLN A CA    1 
ATOM   9981  C  C     . GLN A 1 1311 ? 85.087  121.586 12.455  1.00 6.09  ? 1311 GLN A C     1 
ATOM   9982  O  O     . GLN A 1 1311 ? 85.290  122.746 12.821  1.00 4.92  ? 1311 GLN A O     1 
ATOM   9983  C  CB    . GLN A 1 1311 ? 85.238  120.016 14.350  1.00 5.54  ? 1311 GLN A CB    1 
ATOM   9984  C  CG    . GLN A 1 1311 ? 85.921  118.933 15.192  1.00 7.59  ? 1311 GLN A CG    1 
ATOM   9985  C  CD    . GLN A 1 1311 ? 85.983  117.609 14.462  1.00 11.01 ? 1311 GLN A CD    1 
ATOM   9986  O  OE1   . GLN A 1 1311 ? 86.591  117.537 13.413  1.00 10.11 ? 1311 GLN A OE1   1 
ATOM   9987  N  NE2   . GLN A 1 1311 ? 85.359  116.552 15.022  1.00 14.63 ? 1311 GLN A NE2   1 
ATOM   9988  N  N     . SER A 1 1312 ? 84.149  121.234 11.567  1.00 5.18  ? 1312 SER A N     1 
ATOM   9989  C  CA    . SER A 1 1312 ? 83.102  122.144 11.080  1.00 5.32  ? 1312 SER A CA    1 
ATOM   9990  C  C     . SER A 1 1312 ? 83.593  123.299 10.195  1.00 5.37  ? 1312 SER A C     1 
ATOM   9991  O  O     . SER A 1 1312 ? 83.008  124.393 10.193  1.00 4.95  ? 1312 SER A O     1 
ATOM   9992  C  CB    . SER A 1 1312 ? 82.246  122.667 12.263  1.00 5.04  ? 1312 SER A CB    1 
ATOM   9993  O  OG    . SER A 1 1312 ? 81.631  121.590 12.957  1.00 6.61  ? 1312 SER A OG    1 
ATOM   9994  N  N     . PHE A 1 1313 ? 84.645  123.046 9.423   1.00 5.40  ? 1313 PHE A N     1 
ATOM   9995  C  CA    . PHE A 1 1313 ? 85.149  124.042 8.483   1.00 5.95  ? 1313 PHE A CA    1 
ATOM   9996