data_1OH7
# 
_entry.id   1OH7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.331 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OH7         
PDBE  EBI-12755    
WWPDB D_1290012755 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1E3M unspecified 'THE CRYSTAL STRUCTURE OF E. COLI MUTS BINDING TO DNA WITH A G:T MISMATCH'        
PDB 1NG9 unspecified 'E.COLI MUTS R697A: AN ATPASE-ASYMMETRY MUTANT'                                   
PDB 1OH5 unspecified 'THE CRYSTAL STRUCTURE OF E. COLI MUTS BINDING TO DNA WITH A C:A MISMATCH'        
PDB 1OH6 unspecified 'THE CRYSTAL STRUCTURE OF E. COLI MUTS BINDING TO DNA WITH AN A:A MISMATCH'       
PDB 1OH8 unspecified 'THE CRYSTAL STRUCTURE OF E. COLI MUTS BINDING TO DNA WITH AN UNPAIRED THYMIDINE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OH7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Natrajan, G.'       1 
'Lamers, M.H.'       2 
'Enzlin, J.H.'       3 
'Winterwerp, H.H.K.' 4 
'Perrakis, A.'       5 
'Sixma, T.K.'        6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structures of E. Coli DNA Mismatch Repair Enzyme Muts in Complex with Different Mismatches: A Common Recognition Mode for Diverse Substrates
;
'Nucleic Acids Res.' 31  4814 ? 2003 NARHAD UK 0305-1048 0389 ? 12907723 10.1093/NAR/GKG677 
1       'The Crystal Structure of DNA Mismatch Repair Protein Muts Binding to a G X T Mismatch' Nature               407 711  ? 
2000 NATUAS UK 0028-0836 0006 ? 11048711 10.1038/35037523   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Natrajan, G.'       1  ? 
primary 'Lamers, M.H.'       2  ? 
primary 'Enzlin, J.H.'       3  ? 
primary 'Winterwerp, H.H.K.' 4  ? 
primary 'Perrakis, A.'       5  ? 
primary 'Sixma, T.K.'        6  ? 
1       'Lamers, M.H.'       7  ? 
1       'Perrakis, A.'       8  ? 
1       'Enzlin, J.H.'       9  ? 
1       'Winterwerp, H.H.'   10 ? 
1       'De Wind, N.'        11 ? 
1       'Sixma, T.K.'        12 ? 
# 
_cell.entry_id           1OH7 
_cell.length_a           89.413 
_cell.length_b           91.810 
_cell.length_c           260.444 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OH7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA MISMATCH REPAIR PROTEIN MUTS'                                                                     89604.359 
2  ? ? 'RESIDUES 1-800' ?                                 
2 polymer     syn 
;5'-D(*AP*GP*CP*TP*GP*CP*CP*AP*GP*GP *CP*AP*CP*CP*AP*GP*TP*GP*TP*CP*AP*GP*CP*GP*TP *CP*CP*TP*AP*T)-3'
;
9184.905  1  ? ? ?                'G\:G MISMATCH DNA TOP STRAND'    
3 polymer     syn 
;5'-D(*AP*TP*AP*GP*GP*AP*CP*GP*CP*TP *GP*AP*CP*AP*CP*TP*GP*GP*TP*GP*CP*GP*TP*GP*GP *CP*AP*GP*CP*T)-3'
;
9304.978  1  ? ? ?                'G\:G MISMATCH DNA BOTTOM STRAND' 
4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                                                             427.201   
1  ? ? ?                ?                                 
5 non-polymer syn 'MAGNESIUM ION'                                                                                        24.305    
1  ? ? ?                ?                                 
6 water       nat water                                                                                                  18.015    
89 ? ? ?                ?                                 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MUTS, FDV, B2733' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSAIENFDAHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPYHAVENYL
AKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEP
ADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCL
LQYAKDTQRTTLPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRV
LLERQQTIGALQDFTAGLQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEF
AELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG
QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLAE
RAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYV
PAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIK
ALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESIS
;
;MSAIENFDAHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKRGASAGEPIPMAGIPYHAVENYL
AKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEP
ADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCL
LQYAKDTQRTTLPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRV
LLERQQTIGALQDFTAGLQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEF
AELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG
QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAELDVLVNLAE
RAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYV
PAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIK
ALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESIS
;
A,B ? 
2 polydeoxyribonucleotide no no 
;(DA)(DG)(DC)(DT)(DG)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DC)(DA)(DG)(DT)(DG)(DT)(DC)
(DA)(DG)(DC)(DG)(DT)(DC)(DC)(DT)(DA)(DT)
;
AGCTGCCAGGCACCAGTGTCAGCGTCCTAT E   ? 
3 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DG)(DG)(DA)(DC)(DG)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DT)(DG)(DG)(DT)(DG)
(DC)(DG)(DT)(DG)(DG)(DC)(DA)(DG)(DC)(DT)
;
ATAGGACGCTGACACTGGTGCGTGGCAGCT F   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   ILE n 
1 5   GLU n 
1 6   ASN n 
1 7   PHE n 
1 8   ASP n 
1 9   ALA n 
1 10  HIS n 
1 11  THR n 
1 12  PRO n 
1 13  MET n 
1 14  MET n 
1 15  GLN n 
1 16  GLN n 
1 17  TYR n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  LYS n 
1 22  ALA n 
1 23  GLN n 
1 24  HIS n 
1 25  PRO n 
1 26  GLU n 
1 27  ILE n 
1 28  LEU n 
1 29  LEU n 
1 30  PHE n 
1 31  TYR n 
1 32  ARG n 
1 33  MET n 
1 34  GLY n 
1 35  ASP n 
1 36  PHE n 
1 37  TYR n 
1 38  GLU n 
1 39  LEU n 
1 40  PHE n 
1 41  TYR n 
1 42  ASP n 
1 43  ASP n 
1 44  ALA n 
1 45  LYS n 
1 46  ARG n 
1 47  ALA n 
1 48  SER n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  ASP n 
1 53  ILE n 
1 54  SER n 
1 55  LEU n 
1 56  THR n 
1 57  LYS n 
1 58  ARG n 
1 59  GLY n 
1 60  ALA n 
1 61  SER n 
1 62  ALA n 
1 63  GLY n 
1 64  GLU n 
1 65  PRO n 
1 66  ILE n 
1 67  PRO n 
1 68  MET n 
1 69  ALA n 
1 70  GLY n 
1 71  ILE n 
1 72  PRO n 
1 73  TYR n 
1 74  HIS n 
1 75  ALA n 
1 76  VAL n 
1 77  GLU n 
1 78  ASN n 
1 79  TYR n 
1 80  LEU n 
1 81  ALA n 
1 82  LYS n 
1 83  LEU n 
1 84  VAL n 
1 85  ASN n 
1 86  GLN n 
1 87  GLY n 
1 88  GLU n 
1 89  SER n 
1 90  VAL n 
1 91  ALA n 
1 92  ILE n 
1 93  CYS n 
1 94  GLU n 
1 95  GLN n 
1 96  ILE n 
1 97  GLY n 
1 98  ASP n 
1 99  PRO n 
1 100 ALA n 
1 101 THR n 
1 102 SER n 
1 103 LYS n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 GLU n 
1 108 ARG n 
1 109 LYS n 
1 110 VAL n 
1 111 VAL n 
1 112 ARG n 
1 113 ILE n 
1 114 VAL n 
1 115 THR n 
1 116 PRO n 
1 117 GLY n 
1 118 THR n 
1 119 ILE n 
1 120 SER n 
1 121 ASP n 
1 122 GLU n 
1 123 ALA n 
1 124 LEU n 
1 125 LEU n 
1 126 GLN n 
1 127 GLU n 
1 128 ARG n 
1 129 GLN n 
1 130 ASP n 
1 131 ASN n 
1 132 LEU n 
1 133 LEU n 
1 134 ALA n 
1 135 ALA n 
1 136 ILE n 
1 137 TRP n 
1 138 GLN n 
1 139 ASP n 
1 140 SER n 
1 141 LYS n 
1 142 GLY n 
1 143 PHE n 
1 144 GLY n 
1 145 TYR n 
1 146 ALA n 
1 147 THR n 
1 148 LEU n 
1 149 ASP n 
1 150 ILE n 
1 151 SER n 
1 152 SER n 
1 153 GLY n 
1 154 ARG n 
1 155 PHE n 
1 156 ARG n 
1 157 LEU n 
1 158 SER n 
1 159 GLU n 
1 160 PRO n 
1 161 ALA n 
1 162 ASP n 
1 163 ARG n 
1 164 GLU n 
1 165 THR n 
1 166 MET n 
1 167 ALA n 
1 168 ALA n 
1 169 GLU n 
1 170 LEU n 
1 171 GLN n 
1 172 ARG n 
1 173 THR n 
1 174 ASN n 
1 175 PRO n 
1 176 ALA n 
1 177 GLU n 
1 178 LEU n 
1 179 LEU n 
1 180 TYR n 
1 181 ALA n 
1 182 GLU n 
1 183 ASP n 
1 184 PHE n 
1 185 ALA n 
1 186 GLU n 
1 187 MET n 
1 188 SER n 
1 189 LEU n 
1 190 ILE n 
1 191 GLU n 
1 192 GLY n 
1 193 ARG n 
1 194 ARG n 
1 195 GLY n 
1 196 LEU n 
1 197 ARG n 
1 198 ARG n 
1 199 ARG n 
1 200 PRO n 
1 201 LEU n 
1 202 TRP n 
1 203 GLU n 
1 204 PHE n 
1 205 GLU n 
1 206 ILE n 
1 207 ASP n 
1 208 THR n 
1 209 ALA n 
1 210 ARG n 
1 211 GLN n 
1 212 GLN n 
1 213 LEU n 
1 214 ASN n 
1 215 LEU n 
1 216 GLN n 
1 217 PHE n 
1 218 GLY n 
1 219 THR n 
1 220 ARG n 
1 221 ASP n 
1 222 LEU n 
1 223 VAL n 
1 224 GLY n 
1 225 PHE n 
1 226 GLY n 
1 227 VAL n 
1 228 GLU n 
1 229 ASN n 
1 230 ALA n 
1 231 PRO n 
1 232 ARG n 
1 233 GLY n 
1 234 LEU n 
1 235 CYS n 
1 236 ALA n 
1 237 ALA n 
1 238 GLY n 
1 239 CYS n 
1 240 LEU n 
1 241 LEU n 
1 242 GLN n 
1 243 TYR n 
1 244 ALA n 
1 245 LYS n 
1 246 ASP n 
1 247 THR n 
1 248 GLN n 
1 249 ARG n 
1 250 THR n 
1 251 THR n 
1 252 LEU n 
1 253 PRO n 
1 254 HIS n 
1 255 ILE n 
1 256 ARG n 
1 257 SER n 
1 258 ILE n 
1 259 THR n 
1 260 MET n 
1 261 GLU n 
1 262 ARG n 
1 263 GLU n 
1 264 GLN n 
1 265 ASP n 
1 266 SER n 
1 267 ILE n 
1 268 ILE n 
1 269 MET n 
1 270 ASP n 
1 271 ALA n 
1 272 ALA n 
1 273 THR n 
1 274 ARG n 
1 275 ARG n 
1 276 ASN n 
1 277 LEU n 
1 278 GLU n 
1 279 ILE n 
1 280 THR n 
1 281 GLN n 
1 282 ASN n 
1 283 LEU n 
1 284 ALA n 
1 285 GLY n 
1 286 GLY n 
1 287 ALA n 
1 288 GLU n 
1 289 ASN n 
1 290 THR n 
1 291 LEU n 
1 292 ALA n 
1 293 SER n 
1 294 VAL n 
1 295 LEU n 
1 296 ASP n 
1 297 CYS n 
1 298 THR n 
1 299 VAL n 
1 300 THR n 
1 301 PRO n 
1 302 MET n 
1 303 GLY n 
1 304 SER n 
1 305 ARG n 
1 306 MET n 
1 307 LEU n 
1 308 LYS n 
1 309 ARG n 
1 310 TRP n 
1 311 LEU n 
1 312 HIS n 
1 313 MET n 
1 314 PRO n 
1 315 VAL n 
1 316 ARG n 
1 317 ASP n 
1 318 THR n 
1 319 ARG n 
1 320 VAL n 
1 321 LEU n 
1 322 LEU n 
1 323 GLU n 
1 324 ARG n 
1 325 GLN n 
1 326 GLN n 
1 327 THR n 
1 328 ILE n 
1 329 GLY n 
1 330 ALA n 
1 331 LEU n 
1 332 GLN n 
1 333 ASP n 
1 334 PHE n 
1 335 THR n 
1 336 ALA n 
1 337 GLY n 
1 338 LEU n 
1 339 GLN n 
1 340 PRO n 
1 341 VAL n 
1 342 LEU n 
1 343 ARG n 
1 344 GLN n 
1 345 VAL n 
1 346 GLY n 
1 347 ASP n 
1 348 LEU n 
1 349 GLU n 
1 350 ARG n 
1 351 ILE n 
1 352 LEU n 
1 353 ALA n 
1 354 ARG n 
1 355 LEU n 
1 356 ALA n 
1 357 LEU n 
1 358 ARG n 
1 359 THR n 
1 360 ALA n 
1 361 ARG n 
1 362 PRO n 
1 363 ARG n 
1 364 ASP n 
1 365 LEU n 
1 366 ALA n 
1 367 ARG n 
1 368 MET n 
1 369 ARG n 
1 370 HIS n 
1 371 ALA n 
1 372 PHE n 
1 373 GLN n 
1 374 GLN n 
1 375 LEU n 
1 376 PRO n 
1 377 GLU n 
1 378 LEU n 
1 379 ARG n 
1 380 ALA n 
1 381 GLN n 
1 382 LEU n 
1 383 GLU n 
1 384 THR n 
1 385 VAL n 
1 386 ASP n 
1 387 SER n 
1 388 ALA n 
1 389 PRO n 
1 390 VAL n 
1 391 GLN n 
1 392 ALA n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 LYS n 
1 397 MET n 
1 398 GLY n 
1 399 GLU n 
1 400 PHE n 
1 401 ALA n 
1 402 GLU n 
1 403 LEU n 
1 404 ARG n 
1 405 ASP n 
1 406 LEU n 
1 407 LEU n 
1 408 GLU n 
1 409 ARG n 
1 410 ALA n 
1 411 ILE n 
1 412 ILE n 
1 413 ASP n 
1 414 THR n 
1 415 PRO n 
1 416 PRO n 
1 417 VAL n 
1 418 LEU n 
1 419 VAL n 
1 420 ARG n 
1 421 ASP n 
1 422 GLY n 
1 423 GLY n 
1 424 VAL n 
1 425 ILE n 
1 426 ALA n 
1 427 SER n 
1 428 GLY n 
1 429 TYR n 
1 430 ASN n 
1 431 GLU n 
1 432 GLU n 
1 433 LEU n 
1 434 ASP n 
1 435 GLU n 
1 436 TRP n 
1 437 ARG n 
1 438 ALA n 
1 439 LEU n 
1 440 ALA n 
1 441 ASP n 
1 442 GLY n 
1 443 ALA n 
1 444 THR n 
1 445 ASP n 
1 446 TYR n 
1 447 LEU n 
1 448 GLU n 
1 449 ARG n 
1 450 LEU n 
1 451 GLU n 
1 452 VAL n 
1 453 ARG n 
1 454 GLU n 
1 455 ARG n 
1 456 GLU n 
1 457 ARG n 
1 458 THR n 
1 459 GLY n 
1 460 LEU n 
1 461 ASP n 
1 462 THR n 
1 463 LEU n 
1 464 LYS n 
1 465 VAL n 
1 466 GLY n 
1 467 PHE n 
1 468 ASN n 
1 469 ALA n 
1 470 VAL n 
1 471 HIS n 
1 472 GLY n 
1 473 TYR n 
1 474 TYR n 
1 475 ILE n 
1 476 GLN n 
1 477 ILE n 
1 478 SER n 
1 479 ARG n 
1 480 GLY n 
1 481 GLN n 
1 482 SER n 
1 483 HIS n 
1 484 LEU n 
1 485 ALA n 
1 486 PRO n 
1 487 ILE n 
1 488 ASN n 
1 489 TYR n 
1 490 MET n 
1 491 ARG n 
1 492 ARG n 
1 493 GLN n 
1 494 THR n 
1 495 LEU n 
1 496 LYS n 
1 497 ASN n 
1 498 ALA n 
1 499 GLU n 
1 500 ARG n 
1 501 TYR n 
1 502 ILE n 
1 503 ILE n 
1 504 PRO n 
1 505 GLU n 
1 506 LEU n 
1 507 LYS n 
1 508 GLU n 
1 509 TYR n 
1 510 GLU n 
1 511 ASP n 
1 512 LYS n 
1 513 VAL n 
1 514 LEU n 
1 515 THR n 
1 516 SER n 
1 517 LYS n 
1 518 GLY n 
1 519 LYS n 
1 520 ALA n 
1 521 LEU n 
1 522 ALA n 
1 523 LEU n 
1 524 GLU n 
1 525 LYS n 
1 526 GLN n 
1 527 LEU n 
1 528 TYR n 
1 529 GLU n 
1 530 GLU n 
1 531 LEU n 
1 532 PHE n 
1 533 ASP n 
1 534 LEU n 
1 535 LEU n 
1 536 LEU n 
1 537 PRO n 
1 538 HIS n 
1 539 LEU n 
1 540 GLU n 
1 541 ALA n 
1 542 LEU n 
1 543 GLN n 
1 544 GLN n 
1 545 SER n 
1 546 ALA n 
1 547 SER n 
1 548 ALA n 
1 549 LEU n 
1 550 ALA n 
1 551 GLU n 
1 552 LEU n 
1 553 ASP n 
1 554 VAL n 
1 555 LEU n 
1 556 VAL n 
1 557 ASN n 
1 558 LEU n 
1 559 ALA n 
1 560 GLU n 
1 561 ARG n 
1 562 ALA n 
1 563 TYR n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 TYR n 
1 568 THR n 
1 569 CYS n 
1 570 PRO n 
1 571 THR n 
1 572 PHE n 
1 573 ILE n 
1 574 ASP n 
1 575 LYS n 
1 576 PRO n 
1 577 GLY n 
1 578 ILE n 
1 579 ARG n 
1 580 ILE n 
1 581 THR n 
1 582 GLU n 
1 583 GLY n 
1 584 ARG n 
1 585 HIS n 
1 586 PRO n 
1 587 VAL n 
1 588 VAL n 
1 589 GLU n 
1 590 GLN n 
1 591 VAL n 
1 592 LEU n 
1 593 ASN n 
1 594 GLU n 
1 595 PRO n 
1 596 PHE n 
1 597 ILE n 
1 598 ALA n 
1 599 ASN n 
1 600 PRO n 
1 601 LEU n 
1 602 ASN n 
1 603 LEU n 
1 604 SER n 
1 605 PRO n 
1 606 GLN n 
1 607 ARG n 
1 608 ARG n 
1 609 MET n 
1 610 LEU n 
1 611 ILE n 
1 612 ILE n 
1 613 THR n 
1 614 GLY n 
1 615 PRO n 
1 616 ASN n 
1 617 MET n 
1 618 GLY n 
1 619 GLY n 
1 620 LYS n 
1 621 SER n 
1 622 THR n 
1 623 TYR n 
1 624 MET n 
1 625 ARG n 
1 626 GLN n 
1 627 THR n 
1 628 ALA n 
1 629 LEU n 
1 630 ILE n 
1 631 ALA n 
1 632 LEU n 
1 633 MET n 
1 634 ALA n 
1 635 TYR n 
1 636 ILE n 
1 637 GLY n 
1 638 SER n 
1 639 TYR n 
1 640 VAL n 
1 641 PRO n 
1 642 ALA n 
1 643 GLN n 
1 644 LYS n 
1 645 VAL n 
1 646 GLU n 
1 647 ILE n 
1 648 GLY n 
1 649 PRO n 
1 650 ILE n 
1 651 ASP n 
1 652 ARG n 
1 653 ILE n 
1 654 PHE n 
1 655 THR n 
1 656 ARG n 
1 657 VAL n 
1 658 GLY n 
1 659 ALA n 
1 660 ALA n 
1 661 ASP n 
1 662 ASP n 
1 663 LEU n 
1 664 ALA n 
1 665 SER n 
1 666 GLY n 
1 667 ARG n 
1 668 SER n 
1 669 THR n 
1 670 PHE n 
1 671 MET n 
1 672 VAL n 
1 673 GLU n 
1 674 MET n 
1 675 THR n 
1 676 GLU n 
1 677 THR n 
1 678 ALA n 
1 679 ASN n 
1 680 ILE n 
1 681 LEU n 
1 682 HIS n 
1 683 ASN n 
1 684 ALA n 
1 685 THR n 
1 686 GLU n 
1 687 TYR n 
1 688 SER n 
1 689 LEU n 
1 690 VAL n 
1 691 LEU n 
1 692 MET n 
1 693 ASP n 
1 694 GLU n 
1 695 ILE n 
1 696 GLY n 
1 697 ARG n 
1 698 GLY n 
1 699 THR n 
1 700 SER n 
1 701 THR n 
1 702 TYR n 
1 703 ASP n 
1 704 GLY n 
1 705 LEU n 
1 706 SER n 
1 707 LEU n 
1 708 ALA n 
1 709 TRP n 
1 710 ALA n 
1 711 CYS n 
1 712 ALA n 
1 713 GLU n 
1 714 ASN n 
1 715 LEU n 
1 716 ALA n 
1 717 ASN n 
1 718 LYS n 
1 719 ILE n 
1 720 LYS n 
1 721 ALA n 
1 722 LEU n 
1 723 THR n 
1 724 LEU n 
1 725 PHE n 
1 726 ALA n 
1 727 THR n 
1 728 HIS n 
1 729 TYR n 
1 730 PHE n 
1 731 GLU n 
1 732 LEU n 
1 733 THR n 
1 734 GLN n 
1 735 LEU n 
1 736 PRO n 
1 737 GLU n 
1 738 LYS n 
1 739 MET n 
1 740 GLU n 
1 741 GLY n 
1 742 VAL n 
1 743 ALA n 
1 744 ASN n 
1 745 VAL n 
1 746 HIS n 
1 747 LEU n 
1 748 ASP n 
1 749 ALA n 
1 750 LEU n 
1 751 GLU n 
1 752 HIS n 
1 753 GLY n 
1 754 ASP n 
1 755 THR n 
1 756 ILE n 
1 757 ALA n 
1 758 PHE n 
1 759 MET n 
1 760 HIS n 
1 761 SER n 
1 762 VAL n 
1 763 GLN n 
1 764 ASP n 
1 765 GLY n 
1 766 ALA n 
1 767 ALA n 
1 768 SER n 
1 769 LYS n 
1 770 SER n 
1 771 TYR n 
1 772 GLY n 
1 773 LEU n 
1 774 ALA n 
1 775 VAL n 
1 776 ALA n 
1 777 ALA n 
1 778 LEU n 
1 779 ALA n 
1 780 GLY n 
1 781 VAL n 
1 782 PRO n 
1 783 LYS n 
1 784 GLU n 
1 785 VAL n 
1 786 ILE n 
1 787 LYS n 
1 788 ARG n 
1 789 ALA n 
1 790 ARG n 
1 791 GLN n 
1 792 LYS n 
1 793 LEU n 
1 794 ARG n 
1 795 GLU n 
1 796 LEU n 
1 797 GLU n 
1 798 SER n 
1 799 ILE n 
1 800 SER n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DC  n 
2 7   DC  n 
2 8   DA  n 
2 9   DG  n 
2 10  DG  n 
2 11  DC  n 
2 12  DA  n 
2 13  DC  n 
2 14  DC  n 
2 15  DA  n 
2 16  DG  n 
2 17  DT  n 
2 18  DG  n 
2 19  DT  n 
2 20  DC  n 
2 21  DA  n 
2 22  DG  n 
2 23  DC  n 
2 24  DG  n 
2 25  DT  n 
2 26  DC  n 
2 27  DC  n 
2 28  DT  n 
2 29  DA  n 
2 30  DT  n 
3 1   DA  n 
3 2   DT  n 
3 3   DA  n 
3 4   DG  n 
3 5   DG  n 
3 6   DA  n 
3 7   DC  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DG  n 
3 12  DA  n 
3 13  DC  n 
3 14  DA  n 
3 15  DC  n 
3 16  DT  n 
3 17  DG  n 
3 18  DG  n 
3 19  DT  n 
3 20  DG  n 
3 21  DC  n 
3 22  DG  n 
3 23  DT  n 
3 24  DG  n 
3 25  DG  n 
3 26  DC  n 
3 27  DA  n 
3 28  DG  n 
3 29  DC  n 
3 30  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'B834 DE3' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              PLYSS 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834 DE3' 
_entity_src_gen.pdbx_host_org_variant              PLYSS 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET3D 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PM800 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 'CHEMICALLY SYNTHESIZED' 
3 1 sample ? ? 'synthetic construct' ? 32630 'CHEMICALLY SYNTHESIZED' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MUTS_ECOLI 1 ? ? P23909 ? 
2 PDB 1OH7       2 ? ? 1OH7   ? 
3 PDB 1OH7       3 ? ? 1OH7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OH7 A 1 ? 800 ? P23909 1 ? 800 ? 1 800 
2 1 1OH7 B 1 ? 800 ? P23909 1 ? 800 ? 1 800 
3 2 1OH7 E 1 ? 30  ? 1OH7   1 ? 30  ? 1 30  
4 3 1OH7 F 1 ? 30  ? 1OH7   1 ? 30  ? 1 30  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1OH7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   52.2 
_exptl_crystal.description           'STRUCTURE DETERMINED BY RIGID BODY REFINEMENT USING REFMAC5' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '12-14 % PEG 6000, 150-300 MM NACL 25 MM HEPES PH 7-8, 10 MM MGCL2, 100-150 MICROM ADP' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-09-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GE220 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OH7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   68892 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.2 
_reflns.pdbx_Rmerge_I_obs            0.10400 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.500 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   60.5 
_reflns_shell.Rmerge_I_obs           0.62800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.080 
_reflns_shell.pdbx_redundancy        2.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OH7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     66988 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    91.5 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.228 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.900 
_refine.ls_number_reflns_R_free                  1330 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.B_iso_mean                               20.80 
_refine.aniso_B[1][1]                            -3.98000 
_refine.aniso_B[2][2]                            8.17000 
_refine.aniso_B[3][3]                            -4.19000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1E3M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.551 
_refine.pdbx_overall_ESU_R_Free                  0.315 
_refine.overall_SU_ML                            0.276 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12171 
_refine_hist.pdbx_number_atoms_nucleic_acid   716 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             89 
_refine_hist.number_atoms_total               13004 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014 0.021 ? 13213 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002 0.020 ? 11954 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.498 2.044 ? 18033 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.862 3.000 ? 27738 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.905 5.000 ? 1536  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.077 0.200 ? 2012  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004 0.020 ? 14152 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002 0.020 ? 2511  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.206 0.200 ? 2789  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.221 0.200 ? 14011 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088 0.200 ? 7963  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.191 0.200 ? 207   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.237 0.200 ? 27    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.237 0.200 ? 116   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.075 0.200 ? 6     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.481 1.500 ? 7676  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.919 2.000 ? 12329 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.376 3.000 ? 5537  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.313 4.500 ? 5704  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             3177 
_refine_ls_shell.R_factor_R_work                  0.3410 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4100 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1OH7 
_struct.title                     'THE CRYSTAL STRUCTURE OF E. COLI MUTS BINDING TO DNA WITH A G:G MISMATCH' 
_struct.pdbx_descriptor           'DNA MISMATCH REPAIR PROTEIN MUTS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OH7 
_struct_keywords.pdbx_keywords   'DNA BINDING' 
_struct_keywords.text            'DNA BINDING, MISMATCH RECOGNITION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 6   ? HIS A 10  ? ASN A 6   HIS A 10  5 ? 5  
HELX_P HELX_P2  2  THR A 11  ? ALA A 22  ? THR A 11  ALA A 22  1 ? 12 
HELX_P HELX_P3  3  TYR A 41  ? LEU A 51  ? TYR A 41  LEU A 51  1 ? 11 
HELX_P HELX_P4  4  ALA A 75  ? ASN A 85  ? ALA A 75  ASN A 85  1 ? 11 
HELX_P HELX_P5  5  ASP A 98  ? SER A 102 ? ASP A 98  SER A 102 5 ? 5  
HELX_P HELX_P6  6  ASP A 121 ? LEU A 125 ? ASP A 121 LEU A 125 5 ? 5  
HELX_P HELX_P7  7  ASP A 162 ? ASN A 174 ? ASP A 162 ASN A 174 1 ? 13 
HELX_P HELX_P8  8  GLU A 186 ? ILE A 190 ? GLU A 186 ILE A 190 5 ? 5  
HELX_P HELX_P9  9  PRO A 200 ? PHE A 204 ? PRO A 200 PHE A 204 5 ? 5  
HELX_P HELX_P10 10 GLU A 205 ? GLY A 218 ? GLU A 205 GLY A 218 1 ? 14 
HELX_P HELX_P11 11 LEU A 222 ? GLY A 226 ? LEU A 222 GLY A 226 5 ? 5  
HELX_P HELX_P12 12 ALA A 230 ? ARG A 249 ? ALA A 230 ARG A 249 1 ? 20 
HELX_P HELX_P13 13 ARG A 262 ? ASP A 265 ? ARG A 262 ASP A 265 5 ? 4  
HELX_P HELX_P14 14 ASP A 270 ? LEU A 277 ? ASP A 270 LEU A 277 1 ? 8  
HELX_P HELX_P15 15 THR A 290 ? ASP A 296 ? THR A 290 ASP A 296 1 ? 7  
HELX_P HELX_P16 16 THR A 300 ? MET A 313 ? THR A 300 MET A 313 1 ? 14 
HELX_P HELX_P17 17 ASP A 317 ? LEU A 331 ? ASP A 317 LEU A 331 1 ? 15 
HELX_P HELX_P18 18 PHE A 334 ? GLN A 344 ? PHE A 334 GLN A 344 1 ? 11 
HELX_P HELX_P19 19 ASP A 347 ? LEU A 357 ? ASP A 347 LEU A 357 1 ? 11 
HELX_P HELX_P20 20 ARG A 361 ? GLN A 374 ? ARG A 361 GLN A 374 1 ? 14 
HELX_P HELX_P21 21 GLN A 374 ? THR A 384 ? GLN A 374 THR A 384 1 ? 11 
HELX_P HELX_P22 22 SER A 387 ? MET A 397 ? SER A 387 MET A 397 1 ? 11 
HELX_P HELX_P23 23 PHE A 400 ? ARG A 409 ? PHE A 400 ARG A 409 1 ? 10 
HELX_P HELX_P24 24 ASN A 430 ? ALA A 440 ? ASN A 430 ALA A 440 1 ? 11 
HELX_P HELX_P25 25 THR A 444 ? GLY A 459 ? THR A 444 GLY A 459 1 ? 16 
HELX_P HELX_P26 26 ARG A 479 ? HIS A 483 ? ARG A 479 HIS A 483 1 ? 5  
HELX_P HELX_P27 27 ILE A 503 ? LEU A 536 ? ILE A 503 LEU A 536 1 ? 34 
HELX_P HELX_P28 28 HIS A 538 ? LEU A 565 ? HIS A 538 LEU A 565 1 ? 28 
HELX_P HELX_P29 29 VAL A 587 ? LEU A 592 ? VAL A 587 LEU A 592 1 ? 6  
HELX_P HELX_P30 30 GLY A 619 ? TYR A 635 ? GLY A 619 TYR A 635 1 ? 17 
HELX_P HELX_P31 31 PHE A 670 ? ALA A 684 ? PHE A 670 ALA A 684 1 ? 15 
HELX_P HELX_P32 32 TYR A 702 ? LYS A 718 ? TYR A 702 LYS A 718 1 ? 17 
HELX_P HELX_P33 33 TYR A 729 ? THR A 733 ? TYR A 729 THR A 733 5 ? 5  
HELX_P HELX_P34 34 GLN A 734 ? MET A 739 ? GLN A 734 MET A 739 1 ? 6  
HELX_P HELX_P35 35 TYR A 771 ? ALA A 779 ? TYR A 771 ALA A 779 1 ? 9  
HELX_P HELX_P36 36 PRO A 782 ? SER A 800 ? PRO A 782 SER A 800 1 ? 19 
HELX_P HELX_P37 37 ARG B 19  ? HIS B 24  ? ARG B 19  HIS B 24  1 ? 6  
HELX_P HELX_P38 38 ASP B 43  ? LEU B 51  ? ASP B 43  LEU B 51  1 ? 9  
HELX_P HELX_P39 39 VAL B 76  ? ASN B 85  ? VAL B 76  ASN B 85  1 ? 10 
HELX_P HELX_P40 40 ASP B 162 ? ASN B 174 ? ASP B 162 ASN B 174 1 ? 13 
HELX_P HELX_P41 41 GLU B 186 ? ILE B 190 ? GLU B 186 ILE B 190 5 ? 5  
HELX_P HELX_P42 42 PRO B 200 ? PHE B 204 ? PRO B 200 PHE B 204 5 ? 5  
HELX_P HELX_P43 43 GLU B 205 ? GLY B 218 ? GLU B 205 GLY B 218 1 ? 14 
HELX_P HELX_P44 44 LEU B 222 ? GLY B 226 ? LEU B 222 GLY B 226 5 ? 5  
HELX_P HELX_P45 45 ALA B 230 ? ARG B 249 ? ALA B 230 ARG B 249 1 ? 20 
HELX_P HELX_P46 46 ARG B 262 ? ASP B 265 ? ARG B 262 ASP B 265 5 ? 4  
HELX_P HELX_P47 47 ASP B 270 ? LEU B 277 ? ASP B 270 LEU B 277 1 ? 8  
HELX_P HELX_P48 48 THR B 290 ? ASP B 296 ? THR B 290 ASP B 296 1 ? 7  
HELX_P HELX_P49 49 THR B 300 ? MET B 313 ? THR B 300 MET B 313 1 ? 14 
HELX_P HELX_P50 50 ASP B 317 ? GLN B 332 ? ASP B 317 GLN B 332 1 ? 16 
HELX_P HELX_P51 51 PHE B 334 ? GLY B 346 ? PHE B 334 GLY B 346 1 ? 13 
HELX_P HELX_P52 52 ASP B 347 ? LEU B 357 ? ASP B 347 LEU B 357 1 ? 11 
HELX_P HELX_P53 53 ARG B 361 ? GLU B 383 ? ARG B 361 GLU B 383 1 ? 23 
HELX_P HELX_P54 54 SER B 387 ? GLY B 398 ? SER B 387 GLY B 398 1 ? 12 
HELX_P HELX_P55 55 PHE B 400 ? ILE B 411 ? PHE B 400 ILE B 411 1 ? 12 
HELX_P HELX_P56 56 ASN B 430 ? GLY B 459 ? ASN B 430 GLY B 459 1 ? 30 
HELX_P HELX_P57 57 GLN B 481 ? ALA B 485 ? GLN B 481 ALA B 485 5 ? 5  
HELX_P HELX_P58 58 ILE B 503 ? LEU B 536 ? ILE B 503 LEU B 536 1 ? 34 
HELX_P HELX_P59 59 HIS B 538 ? LEU B 565 ? HIS B 538 LEU B 565 1 ? 28 
HELX_P HELX_P60 60 VAL B 587 ? LEU B 592 ? VAL B 587 LEU B 592 1 ? 6  
HELX_P HELX_P61 61 GLY B 618 ? TYR B 635 ? GLY B 618 TYR B 635 1 ? 18 
HELX_P HELX_P62 62 THR B 669 ? ALA B 684 ? THR B 669 ALA B 684 1 ? 16 
HELX_P HELX_P63 63 SER B 700 ? LYS B 718 ? SER B 700 LYS B 718 1 ? 19 
HELX_P HELX_P64 64 TYR B 729 ? THR B 733 ? TYR B 729 THR B 733 5 ? 5  
HELX_P HELX_P65 65 GLN B 734 ? MET B 739 ? GLN B 734 MET B 739 1 ? 6  
HELX_P HELX_P66 66 TYR B 771 ? LEU B 778 ? TYR B 771 LEU B 778 1 ? 8  
HELX_P HELX_P67 67 PRO B 782 ? ILE B 799 ? PRO B 782 ILE B 799 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A SER 621 OG  ? ? ? 1_555 F MG  .  MG ? ? A SER 621  A MG  1802 1_555 ? ? ? ? ? ? ?               2.162 ? ? 
metalc2  metalc ? ? E ADP .   O2B ? ? ? 1_555 F MG  .  MG ? ? A ADP 1801 A MG  1802 1_555 ? ? ? ? ? ? ?               2.102 ? ? 
metalc3  metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH .  O  ? ? A MG  1802 A HOH 2033 1_555 ? ? ? ? ? ? ?               2.152 ? ? 
metalc4  metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH .  O  ? ? A MG  1802 A HOH 2034 1_555 ? ? ? ? ? ? ?               2.170 ? ? 
metalc5  metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH .  O  ? ? A MG  1802 A HOH 2045 1_555 ? ? ? ? ? ? ?               2.143 ? ? 
metalc6  metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH .  O  ? ? A MG  1802 A HOH 2046 1_555 ? ? ? ? ? ? ?               2.169 ? ? 
hydrog1  hydrog ? ? C DA  1   N1  ? ? ? 1_555 D DT  30 N3 ? ? E DA  1    F DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog2  hydrog ? ? C DA  1   N6  ? ? ? 1_555 D DT  30 O4 ? ? E DA  1    F DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog3  hydrog ? ? C DG  2   N1  ? ? ? 1_555 D DC  29 N3 ? ? E DG  2    F DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog4  hydrog ? ? C DG  2   N2  ? ? ? 1_555 D DC  29 O2 ? ? E DG  2    F DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog5  hydrog ? ? C DG  2   O6  ? ? ? 1_555 D DC  29 N4 ? ? E DG  2    F DC  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog6  hydrog ? ? C DC  3   N3  ? ? ? 1_555 D DG  28 N1 ? ? E DC  3    F DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog7  hydrog ? ? C DC  3   N4  ? ? ? 1_555 D DG  28 O6 ? ? E DC  3    F DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog8  hydrog ? ? C DC  3   O2  ? ? ? 1_555 D DG  28 N2 ? ? E DC  3    F DG  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog9  hydrog ? ? C DT  4   N3  ? ? ? 1_555 D DA  27 N1 ? ? E DT  4    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog10 hydrog ? ? C DT  4   O4  ? ? ? 1_555 D DA  27 N6 ? ? E DT  4    F DA  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog11 hydrog ? ? C DG  5   N1  ? ? ? 1_555 D DC  26 N3 ? ? E DG  5    F DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog12 hydrog ? ? C DG  5   N2  ? ? ? 1_555 D DC  26 O2 ? ? E DG  5    F DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog13 hydrog ? ? C DG  5   O6  ? ? ? 1_555 D DC  26 N4 ? ? E DG  5    F DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog14 hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  25 N1 ? ? E DC  6    F DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog15 hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  25 O6 ? ? E DC  6    F DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog16 hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  25 N2 ? ? E DC  6    F DG  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog17 hydrog ? ? C DC  7   N3  ? ? ? 1_555 D DG  24 N1 ? ? E DC  7    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog18 hydrog ? ? C DC  7   N4  ? ? ? 1_555 D DG  24 O6 ? ? E DC  7    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog19 hydrog ? ? C DC  7   O2  ? ? ? 1_555 D DG  24 N2 ? ? E DC  7    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog20 hydrog ? ? C DA  8   N1  ? ? ? 1_555 D DT  23 N3 ? ? E DA  8    F DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog21 hydrog ? ? C DA  8   N6  ? ? ? 1_555 D DT  23 O4 ? ? E DA  8    F DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog22 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DG  22 O6 ? ? E DG  9    F DG  22   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? ? 
hydrog23 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  21 N3 ? ? E DG  10   F DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog24 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  21 O2 ? ? E DG  10   F DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog25 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  21 N4 ? ? E DG  10   F DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog26 hydrog ? ? C DC  11  N3  ? ? ? 1_555 D DG  20 N1 ? ? E DC  11   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog27 hydrog ? ? C DC  11  N4  ? ? ? 1_555 D DG  20 O6 ? ? E DC  11   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog28 hydrog ? ? C DC  11  O2  ? ? ? 1_555 D DG  20 N2 ? ? E DC  11   F DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog29 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  19 N3 ? ? E DA  12   F DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog30 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  19 O4 ? ? E DA  12   F DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog31 hydrog ? ? C DC  13  N3  ? ? ? 1_555 D DG  18 N1 ? ? E DC  13   F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog32 hydrog ? ? C DC  13  N4  ? ? ? 1_555 D DG  18 O6 ? ? E DC  13   F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog33 hydrog ? ? C DC  13  O2  ? ? ? 1_555 D DG  18 N2 ? ? E DC  13   F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog34 hydrog ? ? C DC  14  N3  ? ? ? 1_555 D DG  17 N1 ? ? E DC  14   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog35 hydrog ? ? C DC  14  N4  ? ? ? 1_555 D DG  17 O6 ? ? E DC  14   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog36 hydrog ? ? C DC  14  O2  ? ? ? 1_555 D DG  17 N2 ? ? E DC  14   F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog37 hydrog ? ? C DA  15  N1  ? ? ? 1_555 D DT  16 N3 ? ? E DA  15   F DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog38 hydrog ? ? C DA  15  N6  ? ? ? 1_555 D DT  16 O4 ? ? E DA  15   F DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog39 hydrog ? ? C DG  16  N1  ? ? ? 1_555 D DC  15 N3 ? ? E DG  16   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog40 hydrog ? ? C DG  16  N2  ? ? ? 1_555 D DC  15 O2 ? ? E DG  16   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog41 hydrog ? ? C DG  16  O6  ? ? ? 1_555 D DC  15 N4 ? ? E DG  16   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog42 hydrog ? ? C DT  17  N3  ? ? ? 1_555 D DA  14 N1 ? ? E DT  17   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
hydrog43 hydrog ? ? C DT  17  O4  ? ? ? 1_555 D DA  14 N6 ? ? E DT  17   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 6 ? 
AC ? 7 ? 
AD ? 4 ? 
AE ? 4 ? 
BA ? 5 ? 
BB ? 6 ? 
BC ? 4 ? 
BD ? 4 ? 
BE ? 6 ? 
BF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BA 4 5 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? parallel      
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BD 1 2 ? parallel      
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BE 1 2 ? parallel      
BE 2 3 ? parallel      
BE 3 4 ? parallel      
BE 4 5 ? parallel      
BE 5 6 ? anti-parallel 
BF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 68  ? PRO A 72  ? MET A 68  PRO A 72  
AA 2 PHE A 36  ? PHE A 40  ? PHE A 36  PHE A 40  
AA 3 LEU A 28  ? MET A 33  ? LEU A 28  MET A 33  
AA 4 VAL A 90  ? GLN A 95  ? VAL A 90  GLN A 95  
AA 5 ARG A 108 ? VAL A 114 ? ARG A 108 VAL A 114 
AB 1 LEU A 196 ? ARG A 199 ? LEU A 196 ARG A 199 
AB 2 GLU A 177 ? ALA A 181 ? GLU A 177 ALA A 181 
AB 3 LEU A 133 ? GLN A 138 ? LEU A 133 GLN A 138 
AB 4 PHE A 143 ? LEU A 148 ? PHE A 143 LEU A 148 
AB 5 PHE A 155 ? SER A 158 ? PHE A 155 SER A 158 
AB 6 THR A 259 ? MET A 260 ? THR A 259 MET A 260 
AC 1 ILE A 268 ? MET A 269 ? ILE A 268 MET A 269 
AC 2 ARG A 652 ? VAL A 657 ? ARG A 652 VAL A 657 
AC 3 LEU A 689 ? ASP A 693 ? LEU A 689 ASP A 693 
AC 4 LEU A 722 ? ALA A 726 ? LEU A 722 ALA A 726 
AC 5 MET A 609 ? THR A 613 ? MET A 609 THR A 613 
AC 6 VAL A 742 ? LEU A 750 ? VAL A 742 LEU A 750 
AC 7 ALA A 757 ? ASP A 764 ? ALA A 757 ASP A 764 
AD 1 LYS A 464 ? ASN A 468 ? LYS A 464 ASN A 468 
AD 2 GLY A 472 ? SER A 478 ? GLY A 472 SER A 478 
AD 3 ALA A 498 ? ILE A 502 ? ALA A 498 ILE A 502 
AD 4 MET A 490 ? LEU A 495 ? MET A 490 LEU A 495 
AE 1 PRO A 570 ? PHE A 572 ? PRO A 570 PHE A 572 
AE 2 LYS A 644 ? ILE A 647 ? LYS A 644 ILE A 647 
AE 3 ILE A 578 ? GLY A 583 ? ILE A 578 GLY A 583 
AE 4 ASN A 599 ? LEU A 603 ? ASN A 599 LEU A 603 
BA 1 GLY B 70  ? PRO B 72  ? GLY B 70  PRO B 72  
BA 2 PHE B 36  ? GLU B 38  ? PHE B 36  GLU B 38  
BA 3 LEU B 28  ? ARG B 32  ? LEU B 28  ARG B 32  
BA 4 VAL B 90  ? CYS B 93  ? VAL B 90  CYS B 93  
BA 5 VAL B 110 ? VAL B 114 ? VAL B 110 VAL B 114 
BB 1 LEU B 196 ? ARG B 199 ? LEU B 196 ARG B 199 
BB 2 GLU B 177 ? ALA B 181 ? GLU B 177 ALA B 181 
BB 3 LEU B 133 ? GLN B 138 ? LEU B 133 GLN B 138 
BB 4 PHE B 143 ? LEU B 148 ? PHE B 143 LEU B 148 
BB 5 PHE B 155 ? SER B 158 ? PHE B 155 SER B 158 
BB 6 THR B 259 ? MET B 260 ? THR B 259 MET B 260 
BC 1 LYS B 464 ? ASN B 468 ? LYS B 464 ASN B 468 
BC 2 GLY B 472 ? SER B 478 ? GLY B 472 SER B 478 
BC 3 ALA B 498 ? ILE B 502 ? ALA B 498 ILE B 502 
BC 4 MET B 490 ? THR B 494 ? MET B 490 THR B 494 
BD 1 THR B 571 ? PHE B 572 ? THR B 571 PHE B 572 
BD 2 LYS B 644 ? ILE B 647 ? LYS B 644 ILE B 647 
BD 3 ILE B 578 ? GLY B 583 ? ILE B 578 GLY B 583 
BD 4 ASN B 599 ? LEU B 603 ? ASN B 599 LEU B 603 
BE 1 ILE B 653 ? ARG B 656 ? ILE B 653 ARG B 656 
BE 2 LEU B 689 ? ASP B 693 ? LEU B 689 ASP B 693 
BE 3 LEU B 722 ? ALA B 726 ? LEU B 722 ALA B 726 
BE 4 MET B 609 ? THR B 613 ? MET B 609 THR B 613 
BE 5 VAL B 742 ? LEU B 747 ? VAL B 742 LEU B 747 
BE 6 VAL B 762 ? ASP B 764 ? VAL B 762 ASP B 764 
BF 1 LEU B 750 ? HIS B 752 ? LEU B 750 HIS B 752 
BF 2 THR B 755 ? ALA B 757 ? THR B 755 ALA B 757 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 71  ? N ILE A 71  O TYR A 37  ? O TYR A 37  
AA 2 3 N GLU A 38  ? N GLU A 38  O TYR A 31  ? O TYR A 31  
AA 3 4 N PHE A 30  ? N PHE A 30  O ALA A 91  ? O ALA A 91  
AA 4 5 N GLU A 94  ? N GLU A 94  O LYS A 109 ? O LYS A 109 
AB 1 2 N ARG A 197 ? N ARG A 197 O LEU A 178 ? O LEU A 178 
AB 2 3 N LEU A 179 ? N LEU A 179 O ALA A 134 ? O ALA A 134 
AB 3 4 N TRP A 137 ? N TRP A 137 O GLY A 144 ? O GLY A 144 
AB 4 5 N THR A 147 ? N THR A 147 O ARG A 156 ? O ARG A 156 
AB 5 6 N LEU A 157 ? N LEU A 157 O THR A 259 ? O THR A 259 
AC 1 2 O ILE A 268 ? O ILE A 268 N ILE A 653 ? N ILE A 653 
AC 2 3 N PHE A 654 ? N PHE A 654 O LEU A 689 ? O LEU A 689 
AC 3 4 N VAL A 690 ? N VAL A 690 O LEU A 722 ? O LEU A 722 
AC 4 5 N PHE A 725 ? N PHE A 725 O LEU A 610 ? O LEU A 610 
AC 5 6 N ILE A 611 ? N ILE A 611 O ALA A 743 ? O ALA A 743 
AC 6 7 N LEU A 750 ? N LEU A 750 O ALA A 757 ? O ALA A 757 
AD 1 2 N ASN A 468 ? N ASN A 468 O GLY A 472 ? O GLY A 472 
AD 2 3 N ILE A 477 ? N ILE A 477 O GLU A 499 ? O GLU A 499 
AD 3 4 N ILE A 502 ? N ILE A 502 O MET A 490 ? O MET A 490 
AE 1 2 N THR A 571 ? N THR A 571 O VAL A 645 ? O VAL A 645 
AE 2 3 N GLU A 646 ? N GLU A 646 O ARG A 579 ? O ARG A 579 
AE 3 4 N GLY A 583 ? N GLY A 583 O ASN A 599 ? O ASN A 599 
BA 1 2 N ILE B 71  ? N ILE B 71  O TYR B 37  ? O TYR B 37  
BA 2 3 N GLU B 38  ? N GLU B 38  O TYR B 31  ? O TYR B 31  
BA 3 4 N PHE B 30  ? N PHE B 30  O ALA B 91  ? O ALA B 91  
BA 4 5 O ILE B 92  ? O ILE B 92  N VAL B 111 ? N VAL B 111 
BB 1 2 N ARG B 197 ? N ARG B 197 O LEU B 178 ? O LEU B 178 
BB 2 3 N LEU B 179 ? N LEU B 179 O ALA B 134 ? O ALA B 134 
BB 3 4 N TRP B 137 ? N TRP B 137 O GLY B 144 ? O GLY B 144 
BB 4 5 N THR B 147 ? N THR B 147 O ARG B 156 ? O ARG B 156 
BB 5 6 N LEU B 157 ? N LEU B 157 O THR B 259 ? O THR B 259 
BC 1 2 N ASN B 468 ? N ASN B 468 O GLY B 472 ? O GLY B 472 
BC 2 3 N ILE B 477 ? N ILE B 477 O GLU B 499 ? O GLU B 499 
BC 3 4 N ILE B 502 ? N ILE B 502 O MET B 490 ? O MET B 490 
BD 1 2 N THR B 571 ? N THR B 571 O VAL B 645 ? O VAL B 645 
BD 2 3 N GLU B 646 ? N GLU B 646 O ARG B 579 ? O ARG B 579 
BD 3 4 N GLY B 583 ? N GLY B 583 O ASN B 599 ? O ASN B 599 
BE 1 2 N PHE B 654 ? N PHE B 654 O LEU B 689 ? O LEU B 689 
BE 2 3 N VAL B 690 ? N VAL B 690 O LEU B 722 ? O LEU B 722 
BE 3 4 N PHE B 725 ? N PHE B 725 O LEU B 610 ? O LEU B 610 
BE 4 5 N ILE B 611 ? N ILE B 611 O ALA B 743 ? O ALA B 743 
BE 5 6 N HIS B 746 ? N HIS B 746 O GLN B 763 ? O GLN B 763 
BF 1 2 N HIS B 752 ? N HIS B 752 O THR B 755 ? O THR B 755 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A1802'  
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADP A1801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  SER A 621 ? SER A 621  . ? 1_555 ? 
2  AC1 7  ASP A 693 ? ASP A 693  . ? 1_555 ? 
3  AC1 7  ADP E .   ? ADP A 1801 . ? 1_555 ? 
4  AC1 7  HOH G .   ? HOH A 2033 . ? 1_555 ? 
5  AC1 7  HOH G .   ? HOH A 2034 . ? 1_555 ? 
6  AC1 7  HOH G .   ? HOH A 2045 . ? 1_555 ? 
7  AC1 7  HOH G .   ? HOH A 2046 . ? 1_555 ? 
8  AC2 15 LEU A 592 ? LEU A 592  . ? 1_555 ? 
9  AC2 15 PHE A 596 ? PHE A 596  . ? 1_555 ? 
10 AC2 15 ILE A 597 ? ILE A 597  . ? 1_555 ? 
11 AC2 15 PRO A 615 ? PRO A 615  . ? 1_555 ? 
12 AC2 15 ASN A 616 ? ASN A 616  . ? 1_555 ? 
13 AC2 15 MET A 617 ? MET A 617  . ? 1_555 ? 
14 AC2 15 GLY A 618 ? GLY A 618  . ? 1_555 ? 
15 AC2 15 GLY A 619 ? GLY A 619  . ? 1_555 ? 
16 AC2 15 LYS A 620 ? LYS A 620  . ? 1_555 ? 
17 AC2 15 SER A 621 ? SER A 621  . ? 1_555 ? 
18 AC2 15 THR A 622 ? THR A 622  . ? 1_555 ? 
19 AC2 15 HIS A 760 ? HIS A 760  . ? 1_555 ? 
20 AC2 15 MG  F .   ? MG  A 1802 . ? 1_555 ? 
21 AC2 15 HOH G .   ? HOH A 2045 . ? 1_555 ? 
22 AC2 15 HOH G .   ? HOH A 2046 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OH7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OH7 
_atom_sites.fract_transf_matrix[1][1]   0.011184 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010892 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003839 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 2   ? 56.978  10.667  19.730  1.00 6.76  ? 2    SER A N     1 
ATOM   2     C  CA    . SER A 1 2   ? 55.530  10.360  20.004  1.00 7.85  ? 2    SER A CA    1 
ATOM   3     C  C     . SER A 1 2   ? 55.326  8.898   20.471  1.00 8.06  ? 2    SER A C     1 
ATOM   4     O  O     . SER A 1 2   ? 55.294  7.971   19.660  1.00 8.02  ? 2    SER A O     1 
ATOM   5     C  CB    . SER A 1 2   ? 54.686  10.645  18.747  1.00 8.06  ? 2    SER A CB    1 
ATOM   6     O  OG    . SER A 1 2   ? 53.339  10.226  18.891  1.00 7.50  ? 2    SER A OG    1 
ATOM   7     N  N     . ALA A 1 3   ? 55.183  8.703   21.776  1.00 8.20  ? 3    ALA A N     1 
ATOM   8     C  CA    . ALA A 1 3   ? 55.224  7.370   22.377  1.00 8.52  ? 3    ALA A CA    1 
ATOM   9     C  C     . ALA A 1 3   ? 54.256  6.390   21.752  1.00 9.25  ? 3    ALA A C     1 
ATOM   10    O  O     . ALA A 1 3   ? 53.064  6.670   21.647  1.00 9.34  ? 3    ALA A O     1 
ATOM   11    C  CB    . ALA A 1 3   ? 54.950  7.455   23.861  1.00 8.19  ? 3    ALA A CB    1 
ATOM   12    N  N     . ILE A 1 4   ? 54.783  5.239   21.344  1.00 10.05 ? 4    ILE A N     1 
ATOM   13    C  CA    . ILE A 1 4   ? 53.962  4.088   21.006  1.00 11.11 ? 4    ILE A CA    1 
ATOM   14    C  C     . ILE A 1 4   ? 53.333  3.601   22.291  1.00 12.19 ? 4    ILE A C     1 
ATOM   15    O  O     . ILE A 1 4   ? 54.051  3.298   23.235  1.00 12.66 ? 4    ILE A O     1 
ATOM   16    C  CB    . ILE A 1 4   ? 54.818  2.976   20.382  1.00 11.18 ? 4    ILE A CB    1 
ATOM   17    C  CG1   . ILE A 1 4   ? 55.120  3.317   18.915  1.00 10.92 ? 4    ILE A CG1   1 
ATOM   18    C  CG2   . ILE A 1 4   ? 54.114  1.635   20.500  1.00 11.27 ? 4    ILE A CG2   1 
ATOM   19    C  CD1   . ILE A 1 4   ? 56.286  2.578   18.322  1.00 10.22 ? 4    ILE A CD1   1 
ATOM   20    N  N     . GLU A 1 5   ? 52.002  3.517   22.316  1.00 13.42 ? 5    GLU A N     1 
ATOM   21    C  CA    . GLU A 1 5   ? 51.241  3.264   23.544  1.00 14.29 ? 5    GLU A CA    1 
ATOM   22    C  C     . GLU A 1 5   ? 50.342  2.068   23.433  1.00 14.60 ? 5    GLU A C     1 
ATOM   23    O  O     . GLU A 1 5   ? 49.148  2.169   23.650  1.00 14.62 ? 5    GLU A O     1 
ATOM   24    C  CB    . GLU A 1 5   ? 50.373  4.465   23.880  1.00 14.61 ? 5    GLU A CB    1 
ATOM   25    C  CG    . GLU A 1 5   ? 51.168  5.674   24.322  1.00 16.05 ? 5    GLU A CG    1 
ATOM   26    C  CD    . GLU A 1 5   ? 50.282  6.805   24.742  1.00 16.45 ? 5    GLU A CD    1 
ATOM   27    O  OE1   . GLU A 1 5   ? 49.130  6.514   25.098  1.00 18.72 ? 5    GLU A OE1   1 
ATOM   28    O  OE2   . GLU A 1 5   ? 50.735  7.966   24.725  1.00 16.83 ? 5    GLU A OE2   1 
ATOM   29    N  N     . ASN A 1 6   ? 50.921  0.935   23.073  1.00 15.62 ? 6    ASN A N     1 
ATOM   30    C  CA    . ASN A 1 6   ? 50.246  -0.356  23.204  1.00 16.40 ? 6    ASN A CA    1 
ATOM   31    C  C     . ASN A 1 6   ? 49.805  -0.674  24.649  1.00 16.57 ? 6    ASN A C     1 
ATOM   32    O  O     . ASN A 1 6   ? 50.258  -0.054  25.608  1.00 16.55 ? 6    ASN A O     1 
ATOM   33    C  CB    . ASN A 1 6   ? 51.129  -1.484  22.651  1.00 16.64 ? 6    ASN A CB    1 
ATOM   34    C  CG    . ASN A 1 6   ? 52.531  -1.492  23.250  1.00 17.89 ? 6    ASN A CG    1 
ATOM   35    O  OD1   . ASN A 1 6   ? 53.175  -0.442  23.378  1.00 19.21 ? 6    ASN A OD1   1 
ATOM   36    N  ND2   . ASN A 1 6   ? 53.019  -2.682  23.603  1.00 18.54 ? 6    ASN A ND2   1 
ATOM   37    N  N     . PHE A 1 7   ? 48.899  -1.642  24.773  1.00 16.96 ? 7    PHE A N     1 
ATOM   38    C  CA    . PHE A 1 7   ? 48.356  -2.097  26.061  1.00 17.02 ? 7    PHE A CA    1 
ATOM   39    C  C     . PHE A 1 7   ? 49.377  -2.294  27.194  1.00 17.14 ? 7    PHE A C     1 
ATOM   40    O  O     . PHE A 1 7   ? 49.116  -1.895  28.318  1.00 17.43 ? 7    PHE A O     1 
ATOM   41    C  CB    . PHE A 1 7   ? 47.577  -3.405  25.861  1.00 16.98 ? 7    PHE A CB    1 
ATOM   42    C  CG    . PHE A 1 7   ? 46.667  -3.737  27.005  1.00 17.09 ? 7    PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1 7   ? 45.412  -3.121  27.113  1.00 16.40 ? 7    PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1 7   ? 47.072  -4.635  27.996  1.00 16.09 ? 7    PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1 7   ? 44.580  -3.404  28.172  1.00 15.71 ? 7    PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1 7   ? 46.246  -4.920  29.063  1.00 16.01 ? 7    PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1 7   ? 44.991  -4.306  29.150  1.00 16.35 ? 7    PHE A CZ    1 
ATOM   48    N  N     . ASP A 1 8   ? 50.524  -2.899  26.906  1.00 17.43 ? 8    ASP A N     1 
ATOM   49    C  CA    . ASP A 1 8   ? 51.554  -3.135  27.935  1.00 17.79 ? 8    ASP A CA    1 
ATOM   50    C  C     . ASP A 1 8   ? 52.360  -1.902  28.345  1.00 17.86 ? 8    ASP A C     1 
ATOM   51    O  O     . ASP A 1 8   ? 52.945  -1.892  29.433  1.00 17.88 ? 8    ASP A O     1 
ATOM   52    C  CB    . ASP A 1 8   ? 52.546  -4.223  27.495  1.00 17.63 ? 8    ASP A CB    1 
ATOM   53    C  CG    . ASP A 1 8   ? 51.871  -5.496  27.127  1.00 18.04 ? 8    ASP A CG    1 
ATOM   54    O  OD1   . ASP A 1 8   ? 50.867  -5.859  27.769  1.00 19.25 ? 8    ASP A OD1   1 
ATOM   55    O  OD2   . ASP A 1 8   ? 52.264  -6.206  26.194  1.00 21.10 ? 8    ASP A OD2   1 
ATOM   56    N  N     . ALA A 1 9   ? 52.433  -0.894  27.472  1.00 18.09 ? 9    ALA A N     1 
ATOM   57    C  CA    . ALA A 1 9   ? 53.098  0.377   27.811  1.00 18.40 ? 9    ALA A CA    1 
ATOM   58    C  C     . ALA A 1 9   ? 52.383  1.104   28.954  1.00 18.54 ? 9    ALA A C     1 
ATOM   59    O  O     . ALA A 1 9   ? 52.954  2.006   29.580  1.00 18.44 ? 9    ALA A O     1 
ATOM   60    C  CB    . ALA A 1 9   ? 53.197  1.294   26.590  1.00 18.28 ? 9    ALA A CB    1 
ATOM   61    N  N     . HIS A 1 10  ? 51.141  0.689   29.224  1.00 18.55 ? 10   HIS A N     1 
ATOM   62    C  CA    . HIS A 1 10  ? 50.291  1.354   30.205  1.00 18.29 ? 10   HIS A CA    1 
ATOM   63    C  C     . HIS A 1 10  ? 50.319  0.739   31.587  1.00 18.04 ? 10   HIS A C     1 
ATOM   64    O  O     . HIS A 1 10  ? 50.631  -0.430  31.764  1.00 18.28 ? 10   HIS A O     1 
ATOM   65    C  CB    . HIS A 1 10  ? 48.868  1.405   29.681  1.00 18.20 ? 10   HIS A CB    1 
ATOM   66    C  CG    . HIS A 1 10  ? 48.695  2.393   28.584  1.00 18.22 ? 10   HIS A CG    1 
ATOM   67    N  ND1   . HIS A 1 10  ? 49.245  3.650   28.642  1.00 17.63 ? 10   HIS A ND1   1 
ATOM   68    C  CD2   . HIS A 1 10  ? 48.082  2.302   27.382  1.00 19.27 ? 10   HIS A CD2   1 
ATOM   69    C  CE1   . HIS A 1 10  ? 48.960  4.301   27.530  1.00 18.81 ? 10   HIS A CE1   1 
ATOM   70    N  NE2   . HIS A 1 10  ? 48.256  3.505   26.747  1.00 17.90 ? 10   HIS A NE2   1 
ATOM   71    N  N     . THR A 1 11  ? 50.010  1.566   32.572  1.00 17.93 ? 11   THR A N     1 
ATOM   72    C  CA    . THR A 1 11  ? 49.891  1.113   33.938  1.00 17.77 ? 11   THR A CA    1 
ATOM   73    C  C     . THR A 1 11  ? 48.524  0.442   34.070  1.00 17.90 ? 11   THR A C     1 
ATOM   74    O  O     . THR A 1 11  ? 47.648  0.635   33.210  1.00 17.44 ? 11   THR A O     1 
ATOM   75    C  CB    . THR A 1 11  ? 50.019  2.312   34.895  1.00 17.96 ? 11   THR A CB    1 
ATOM   76    O  OG1   . THR A 1 11  ? 49.092  3.343   34.530  1.00 17.92 ? 11   THR A OG1   1 
ATOM   77    C  CG2   . THR A 1 11  ? 51.371  2.977   34.735  1.00 17.52 ? 11   THR A CG2   1 
ATOM   78    N  N     . PRO A 1 12  ? 48.329  -0.366  35.112  1.00 17.91 ? 12   PRO A N     1 
ATOM   79    C  CA    . PRO A 1 12  ? 47.016  -0.984  35.339  1.00 17.98 ? 12   PRO A CA    1 
ATOM   80    C  C     . PRO A 1 12  ? 45.879  0.033   35.308  1.00 17.90 ? 12   PRO A C     1 
ATOM   81    O  O     . PRO A 1 12  ? 44.810  -0.239  34.794  1.00 17.98 ? 12   PRO A O     1 
ATOM   82    C  CB    . PRO A 1 12  ? 47.161  -1.614  36.722  1.00 17.84 ? 12   PRO A CB    1 
ATOM   83    C  CG    . PRO A 1 12  ? 48.612  -1.866  36.862  1.00 17.97 ? 12   PRO A CG    1 
ATOM   84    C  CD    . PRO A 1 12  ? 49.320  -0.779  36.127  1.00 17.79 ? 12   PRO A CD    1 
ATOM   85    N  N     . MET A 1 13  ? 46.136  1.221   35.823  1.00 18.56 ? 13   MET A N     1 
ATOM   86    C  CA    . MET A 1 13  ? 45.108  2.258   35.931  1.00 19.11 ? 13   MET A CA    1 
ATOM   87    C  C     . MET A 1 13  ? 44.739  2.802   34.559  1.00 18.68 ? 13   MET A C     1 
ATOM   88    O  O     . MET A 1 13  ? 43.566  2.942   34.259  1.00 18.29 ? 13   MET A O     1 
ATOM   89    C  CB    . MET A 1 13  ? 45.602  3.389   36.832  1.00 19.44 ? 13   MET A CB    1 
ATOM   90    C  CG    . MET A 1 13  ? 44.893  4.711   36.689  1.00 21.49 ? 13   MET A CG    1 
ATOM   91    S  SD    . MET A 1 13  ? 45.799  5.981   37.546  1.00 25.83 ? 13   MET A SD    1 
ATOM   92    C  CE    . MET A 1 13  ? 45.207  7.500   36.675  1.00 25.24 ? 13   MET A CE    1 
ATOM   93    N  N     . MET A 1 14  ? 45.750  3.105   33.750  1.00 18.54 ? 14   MET A N     1 
ATOM   94    C  CA    . MET A 1 14  ? 45.545  3.695   32.438  1.00 18.89 ? 14   MET A CA    1 
ATOM   95    C  C     . MET A 1 14  ? 44.996  2.691   31.454  1.00 18.78 ? 14   MET A C     1 
ATOM   96    O  O     . MET A 1 14  ? 44.244  3.066   30.548  1.00 18.67 ? 14   MET A O     1 
ATOM   97    C  CB    . MET A 1 14  ? 46.850  4.304   31.906  1.00 19.40 ? 14   MET A CB    1 
ATOM   98    C  CG    . MET A 1 14  ? 47.296  5.568   32.655  1.00 20.06 ? 14   MET A CG    1 
ATOM   99    S  SD    . MET A 1 14  ? 45.904  6.679   33.057  1.00 22.33 ? 14   MET A SD    1 
ATOM   100   C  CE    . MET A 1 14  ? 45.342  7.107   31.439  1.00 21.82 ? 14   MET A CE    1 
ATOM   101   N  N     . GLN A 1 15  ? 45.364  1.420   31.634  1.00 18.45 ? 15   GLN A N     1 
ATOM   102   C  CA    . GLN A 1 15  ? 44.751  0.346   30.884  1.00 18.15 ? 15   GLN A CA    1 
ATOM   103   C  C     . GLN A 1 15  ? 43.249  0.380   31.106  1.00 18.43 ? 15   GLN A C     1 
ATOM   104   O  O     . GLN A 1 15  ? 42.477  0.497   30.154  1.00 18.40 ? 15   GLN A O     1 
ATOM   105   C  CB    . GLN A 1 15  ? 45.296  -1.007  31.322  1.00 18.53 ? 15   GLN A CB    1 
ATOM   106   C  CG    . GLN A 1 15  ? 46.585  -1.467  30.621  1.00 17.65 ? 15   GLN A CG    1 
ATOM   107   C  CD    . GLN A 1 15  ? 47.347  -2.482  31.449  1.00 15.88 ? 15   GLN A CD    1 
ATOM   108   O  OE1   . GLN A 1 15  ? 48.560  -2.661  31.291  1.00 14.13 ? 15   GLN A OE1   1 
ATOM   109   N  NE2   . GLN A 1 15  ? 46.641  -3.127  32.355  1.00 14.28 ? 15   GLN A NE2   1 
ATOM   110   N  N     . GLN A 1 16  ? 42.836  0.287   32.366  1.00 18.76 ? 16   GLN A N     1 
ATOM   111   C  CA    . GLN A 1 16  ? 41.416  0.305   32.707  1.00 19.32 ? 16   GLN A CA    1 
ATOM   112   C  C     . GLN A 1 16  ? 40.694  1.577   32.232  1.00 20.08 ? 16   GLN A C     1 
ATOM   113   O  O     . GLN A 1 16  ? 39.527  1.533   31.804  1.00 20.58 ? 16   GLN A O     1 
ATOM   114   C  CB    . GLN A 1 16  ? 41.226  0.146   34.217  1.00 19.31 ? 16   GLN A CB    1 
ATOM   115   C  CG    . GLN A 1 16  ? 39.762  0.363   34.690  1.00 19.23 ? 16   GLN A CG    1 
ATOM   116   C  CD    . GLN A 1 16  ? 39.590  0.170   36.178  1.00 18.28 ? 16   GLN A CD    1 
ATOM   117   O  OE1   . GLN A 1 16  ? 40.481  0.481   36.938  1.00 15.49 ? 16   GLN A OE1   1 
ATOM   118   N  NE2   . GLN A 1 16  ? 38.448  -0.372  36.589  1.00 21.61 ? 16   GLN A NE2   1 
ATOM   119   N  N     . TYR A 1 17  ? 41.375  2.712   32.318  1.00 20.84 ? 17   TYR A N     1 
ATOM   120   C  CA    . TYR A 1 17  ? 40.783  3.968   31.911  1.00 21.32 ? 17   TYR A CA    1 
ATOM   121   C  C     . TYR A 1 17  ? 40.548  3.970   30.407  1.00 22.00 ? 17   TYR A C     1 
ATOM   122   O  O     . TYR A 1 17  ? 39.573  4.558   29.943  1.00 22.46 ? 17   TYR A O     1 
ATOM   123   C  CB    . TYR A 1 17  ? 41.671  5.134   32.296  1.00 21.36 ? 17   TYR A CB    1 
ATOM   124   C  CG    . TYR A 1 17  ? 41.272  6.405   31.612  1.00 22.31 ? 17   TYR A CG    1 
ATOM   125   C  CD1   . TYR A 1 17  ? 40.309  7.254   32.165  1.00 23.09 ? 17   TYR A CD1   1 
ATOM   126   C  CD2   . TYR A 1 17  ? 41.820  6.746   30.398  1.00 22.61 ? 17   TYR A CD2   1 
ATOM   127   C  CE1   . TYR A 1 17  ? 39.914  8.415   31.521  1.00 23.46 ? 17   TYR A CE1   1 
ATOM   128   C  CE2   . TYR A 1 17  ? 41.439  7.909   29.751  1.00 25.10 ? 17   TYR A CE2   1 
ATOM   129   C  CZ    . TYR A 1 17  ? 40.491  8.741   30.315  1.00 24.78 ? 17   TYR A CZ    1 
ATOM   130   O  OH    . TYR A 1 17  ? 40.135  9.890   29.648  1.00 26.78 ? 17   TYR A OH    1 
ATOM   131   N  N     . LEU A 1 18  ? 41.426  3.323   29.639  1.00 22.34 ? 18   LEU A N     1 
ATOM   132   C  CA    . LEU A 1 18  ? 41.292  3.347   28.183  1.00 22.69 ? 18   LEU A CA    1 
ATOM   133   C  C     . LEU A 1 18  ? 40.196  2.401   27.638  1.00 23.61 ? 18   LEU A C     1 
ATOM   134   O  O     . LEU A 1 18  ? 39.579  2.716   26.623  1.00 23.68 ? 18   LEU A O     1 
ATOM   135   C  CB    . LEU A 1 18  ? 42.637  3.108   27.497  1.00 22.25 ? 18   LEU A CB    1 
ATOM   136   C  CG    . LEU A 1 18  ? 43.771  4.121   27.750  1.00 21.90 ? 18   LEU A CG    1 
ATOM   137   C  CD1   . LEU A 1 18  ? 45.108  3.486   27.402  1.00 22.40 ? 18   LEU A CD1   1 
ATOM   138   C  CD2   . LEU A 1 18  ? 43.632  5.445   27.005  1.00 19.75 ? 18   LEU A CD2   1 
ATOM   139   N  N     . ARG A 1 19  ? 39.948  1.254   28.285  1.00 24.67 ? 19   ARG A N     1 
ATOM   140   C  CA    . ARG A 1 19  ? 38.841  0.359   27.868  1.00 25.22 ? 19   ARG A CA    1 
ATOM   141   C  C     . ARG A 1 19  ? 37.517  1.112   27.988  1.00 24.79 ? 19   ARG A C     1 
ATOM   142   O  O     . ARG A 1 19  ? 36.639  1.020   27.123  1.00 24.68 ? 19   ARG A O     1 
ATOM   143   C  CB    . ARG A 1 19  ? 38.732  -0.912  28.734  1.00 25.44 ? 19   ARG A CB    1 
ATOM   144   C  CG    . ARG A 1 19  ? 39.932  -1.851  28.758  1.00 27.72 ? 19   ARG A CG    1 
ATOM   145   C  CD    . ARG A 1 19  ? 39.620  -3.253  29.343  1.00 30.84 ? 19   ARG A CD    1 
ATOM   146   N  NE    . ARG A 1 19  ? 40.240  -3.491  30.663  1.00 33.97 ? 19   ARG A NE    1 
ATOM   147   C  CZ    . ARG A 1 19  ? 39.725  -3.130  31.860  1.00 35.75 ? 19   ARG A CZ    1 
ATOM   148   N  NH1   . ARG A 1 19  ? 38.552  -2.493  31.956  1.00 36.85 ? 19   ARG A NH1   1 
ATOM   149   N  NH2   . ARG A 1 19  ? 40.396  -3.406  32.982  1.00 35.46 ? 19   ARG A NH2   1 
ATOM   150   N  N     . LEU A 1 20  ? 37.387  1.843   29.091  1.00 24.64 ? 20   LEU A N     1 
ATOM   151   C  CA    . LEU A 1 20  ? 36.157  2.562   29.405  1.00 24.41 ? 20   LEU A CA    1 
ATOM   152   C  C     . LEU A 1 20  ? 36.043  3.794   28.551  1.00 23.61 ? 20   LEU A C     1 
ATOM   153   O  O     . LEU A 1 20  ? 34.965  4.144   28.134  1.00 23.08 ? 20   LEU A O     1 
ATOM   154   C  CB    . LEU A 1 20  ? 36.101  2.949   30.884  1.00 24.58 ? 20   LEU A CB    1 
ATOM   155   C  CG    . LEU A 1 20  ? 36.090  1.746   31.846  1.00 25.15 ? 20   LEU A CG    1 
ATOM   156   C  CD1   . LEU A 1 20  ? 36.591  2.156   33.228  1.00 26.00 ? 20   LEU A CD1   1 
ATOM   157   C  CD2   . LEU A 1 20  ? 34.705  1.143   31.933  1.00 24.84 ? 20   LEU A CD2   1 
ATOM   158   N  N     . LYS A 1 21  ? 37.165  4.431   28.265  1.00 23.43 ? 21   LYS A N     1 
ATOM   159   C  CA    . LYS A 1 21  ? 37.165  5.613   27.416  1.00 23.06 ? 21   LYS A CA    1 
ATOM   160   C  C     . LYS A 1 21  ? 36.700  5.251   26.042  1.00 23.76 ? 21   LYS A C     1 
ATOM   161   O  O     . LYS A 1 21  ? 36.033  6.033   25.394  1.00 24.43 ? 21   LYS A O     1 
ATOM   162   C  CB    . LYS A 1 21  ? 38.555  6.208   27.305  1.00 22.58 ? 21   LYS A CB    1 
ATOM   163   C  CG    . LYS A 1 21  ? 38.640  7.403   26.358  1.00 20.65 ? 21   LYS A CG    1 
ATOM   164   C  CD    . LYS A 1 21  ? 37.853  8.609   26.880  1.00 17.33 ? 21   LYS A CD    1 
ATOM   165   C  CE    . LYS A 1 21  ? 37.874  9.758   25.903  1.00 14.02 ? 21   LYS A CE    1 
ATOM   166   N  NZ    . LYS A 1 21  ? 36.702  10.618  26.097  1.00 12.42 ? 21   LYS A NZ    1 
ATOM   167   N  N     . ALA A 1 22  ? 37.066  4.057   25.597  1.00 24.77 ? 22   ALA A N     1 
ATOM   168   C  CA    . ALA A 1 22  ? 36.766  3.589   24.248  1.00 25.00 ? 22   ALA A CA    1 
ATOM   169   C  C     . ALA A 1 22  ? 35.328  3.087   24.123  1.00 25.70 ? 22   ALA A C     1 
ATOM   170   O  O     . ALA A 1 22  ? 34.886  2.806   23.024  1.00 26.09 ? 22   ALA A O     1 
ATOM   171   C  CB    . ALA A 1 22  ? 37.745  2.513   23.845  1.00 24.79 ? 22   ALA A CB    1 
ATOM   172   N  N     . GLN A 1 23  ? 34.612  2.947   25.238  1.00 26.66 ? 23   GLN A N     1 
ATOM   173   C  CA    . GLN A 1 23  ? 33.158  2.759   25.216  1.00 27.28 ? 23   GLN A CA    1 
ATOM   174   C  C     . GLN A 1 23  ? 32.517  4.057   24.745  1.00 27.24 ? 23   GLN A C     1 
ATOM   175   O  O     . GLN A 1 23  ? 31.416  4.030   24.196  1.00 27.42 ? 23   GLN A O     1 
ATOM   176   C  CB    . GLN A 1 23  ? 32.578  2.455   26.609  1.00 27.64 ? 23   GLN A CB    1 
ATOM   177   C  CG    . GLN A 1 23  ? 32.507  1.008   27.109  1.00 29.20 ? 23   GLN A CG    1 
ATOM   178   C  CD    . GLN A 1 23  ? 31.864  0.928   28.535  1.00 31.01 ? 23   GLN A CD    1 
ATOM   179   O  OE1   . GLN A 1 23  ? 30.860  1.600   28.821  1.00 29.64 ? 23   GLN A OE1   1 
ATOM   180   N  NE2   . GLN A 1 23  ? 32.457  0.114   29.416  1.00 32.37 ? 23   GLN A NE2   1 
ATOM   181   N  N     . HIS A 1 24  ? 33.172  5.194   25.016  1.00 27.27 ? 24   HIS A N     1 
ATOM   182   C  CA    . HIS A 1 24  ? 32.639  6.547   24.653  1.00 27.26 ? 24   HIS A CA    1 
ATOM   183   C  C     . HIS A 1 24  ? 33.773  7.513   24.330  1.00 26.22 ? 24   HIS A C     1 
ATOM   184   O  O     . HIS A 1 24  ? 34.105  8.389   25.147  1.00 25.25 ? 24   HIS A O     1 
ATOM   185   C  CB    . HIS A 1 24  ? 31.749  7.155   25.757  1.00 27.67 ? 24   HIS A CB    1 
ATOM   186   C  CG    . HIS A 1 24  ? 31.332  6.171   26.789  1.00 28.11 ? 24   HIS A CG    1 
ATOM   187   N  ND1   . HIS A 1 24  ? 32.247  5.458   27.531  1.00 28.52 ? 24   HIS A ND1   1 
ATOM   188   C  CD2   . HIS A 1 24  ? 30.107  5.745   27.174  1.00 27.77 ? 24   HIS A CD2   1 
ATOM   189   C  CE1   . HIS A 1 24  ? 31.601  4.640   28.339  1.00 29.48 ? 24   HIS A CE1   1 
ATOM   190   N  NE2   . HIS A 1 24  ? 30.302  4.797   28.146  1.00 29.08 ? 24   HIS A NE2   1 
ATOM   191   N  N     . PRO A 1 25  ? 34.386  7.290   23.160  1.00 25.36 ? 25   PRO A N     1 
ATOM   192   C  CA    . PRO A 1 25  ? 35.504  8.106   22.665  1.00 24.76 ? 25   PRO A CA    1 
ATOM   193   C  C     . PRO A 1 25  ? 35.163  9.537   22.227  1.00 24.10 ? 25   PRO A C     1 
ATOM   194   O  O     . PRO A 1 25  ? 36.059  10.375  22.191  1.00 23.63 ? 25   PRO A O     1 
ATOM   195   C  CB    . PRO A 1 25  ? 36.023  7.286   21.466  1.00 24.78 ? 25   PRO A CB    1 
ATOM   196   C  CG    . PRO A 1 25  ? 34.898  6.420   21.026  1.00 24.45 ? 25   PRO A CG    1 
ATOM   197   C  CD    . PRO A 1 25  ? 34.077  6.174   22.239  1.00 25.20 ? 25   PRO A CD    1 
ATOM   198   N  N     . GLU A 1 26  ? 33.906  9.809   21.898  1.00 23.69 ? 26   GLU A N     1 
ATOM   199   C  CA    . GLU A 1 26  ? 33.515  11.144  21.405  1.00 23.56 ? 26   GLU A CA    1 
ATOM   200   C  C     . GLU A 1 26  ? 33.252  12.139  22.546  1.00 22.11 ? 26   GLU A C     1 
ATOM   201   O  O     . GLU A 1 26  ? 33.218  13.340  22.302  1.00 22.00 ? 26   GLU A O     1 
ATOM   202   C  CB    . GLU A 1 26  ? 32.280  11.069  20.453  1.00 23.81 ? 26   GLU A CB    1 
ATOM   203   C  CG    . GLU A 1 26  ? 32.602  11.023  18.947  1.00 25.68 ? 26   GLU A CG    1 
ATOM   204   C  CD    . GLU A 1 26  ? 31.377  10.714  18.047  1.00 30.00 ? 26   GLU A CD    1 
ATOM   205   O  OE1   . GLU A 1 26  ? 30.237  10.469  18.539  1.00 31.55 ? 26   GLU A OE1   1 
ATOM   206   O  OE2   . GLU A 1 26  ? 31.541  10.709  16.803  1.00 33.12 ? 26   GLU A OE2   1 
ATOM   207   N  N     . ILE A 1 27  ? 33.083  11.644  23.771  1.00 20.83 ? 27   ILE A N     1 
ATOM   208   C  CA    . ILE A 1 27  ? 32.572  12.461  24.880  1.00 20.32 ? 27   ILE A CA    1 
ATOM   209   C  C     . ILE A 1 27  ? 33.417  12.420  26.168  1.00 19.87 ? 27   ILE A C     1 
ATOM   210   O  O     . ILE A 1 27  ? 34.132  11.445  26.435  1.00 19.88 ? 27   ILE A O     1 
ATOM   211   C  CB    . ILE A 1 27  ? 31.097  12.079  25.226  1.00 20.29 ? 27   ILE A CB    1 
ATOM   212   C  CG1   . ILE A 1 27  ? 30.986  10.667  25.758  1.00 19.36 ? 27   ILE A CG1   1 
ATOM   213   C  CG2   . ILE A 1 27  ? 30.173  12.238  24.028  1.00 19.78 ? 27   ILE A CG2   1 
ATOM   214   C  CD1   . ILE A 1 27  ? 29.973  10.594  26.830  1.00 20.83 ? 27   ILE A CD1   1 
ATOM   215   N  N     . LEU A 1 28  ? 33.299  13.482  26.966  1.00 18.58 ? 28   LEU A N     1 
ATOM   216   C  CA    . LEU A 1 28  ? 34.072  13.621  28.186  1.00 17.79 ? 28   LEU A CA    1 
ATOM   217   C  C     . LEU A 1 28  ? 33.749  12.463  29.116  1.00 16.94 ? 28   LEU A C     1 
ATOM   218   O  O     . LEU A 1 28  ? 32.607  12.028  29.177  1.00 16.28 ? 28   LEU A O     1 
ATOM   219   C  CB    . LEU A 1 28  ? 33.752  14.951  28.890  1.00 17.99 ? 28   LEU A CB    1 
ATOM   220   C  CG    . LEU A 1 28  ? 34.122  16.233  28.138  1.00 19.45 ? 28   LEU A CG    1 
ATOM   221   C  CD1   . LEU A 1 28  ? 33.445  17.458  28.742  1.00 19.87 ? 28   LEU A CD1   1 
ATOM   222   C  CD2   . LEU A 1 28  ? 35.644  16.417  28.095  1.00 21.05 ? 28   LEU A CD2   1 
ATOM   223   N  N     . LEU A 1 29  ? 34.765  11.994  29.840  1.00 16.37 ? 29   LEU A N     1 
ATOM   224   C  CA    . LEU A 1 29  ? 34.636  10.925  30.809  1.00 15.84 ? 29   LEU A CA    1 
ATOM   225   C  C     . LEU A 1 29  ? 35.181  11.400  32.150  1.00 15.99 ? 29   LEU A C     1 
ATOM   226   O  O     . LEU A 1 29  ? 36.324  11.820  32.252  1.00 15.73 ? 29   LEU A O     1 
ATOM   227   C  CB    . LEU A 1 29  ? 35.361  9.662   30.340  1.00 15.59 ? 29   LEU A CB    1 
ATOM   228   C  CG    . LEU A 1 29  ? 35.369  8.446   31.304  1.00 14.66 ? 29   LEU A CG    1 
ATOM   229   C  CD1   . LEU A 1 29  ? 34.036  7.794   31.320  1.00 16.07 ? 29   LEU A CD1   1 
ATOM   230   C  CD2   . LEU A 1 29  ? 36.405  7.427   30.916  1.00 12.76 ? 29   LEU A CD2   1 
ATOM   231   N  N     . PHE A 1 30  ? 34.331  11.350  33.171  1.00 16.41 ? 30   PHE A N     1 
ATOM   232   C  CA    . PHE A 1 30  ? 34.731  11.630  34.540  1.00 16.85 ? 30   PHE A CA    1 
ATOM   233   C  C     . PHE A 1 30  ? 35.126  10.266  35.095  1.00 17.32 ? 30   PHE A C     1 
ATOM   234   O  O     . PHE A 1 30  ? 34.342  9.346   35.007  1.00 18.02 ? 30   PHE A O     1 
ATOM   235   C  CB    . PHE A 1 30  ? 33.551  12.194  35.348  1.00 16.56 ? 30   PHE A CB    1 
ATOM   236   C  CG    . PHE A 1 30  ? 33.313  13.668  35.192  1.00 15.74 ? 30   PHE A CG    1 
ATOM   237   C  CD1   . PHE A 1 30  ? 33.920  14.419  34.214  1.00 17.31 ? 30   PHE A CD1   1 
ATOM   238   C  CD2   . PHE A 1 30  ? 32.421  14.306  36.034  1.00 17.99 ? 30   PHE A CD2   1 
ATOM   239   C  CE1   . PHE A 1 30  ? 33.664  15.796  34.100  1.00 17.80 ? 30   PHE A CE1   1 
ATOM   240   C  CE2   . PHE A 1 30  ? 32.161  15.706  35.927  1.00 17.42 ? 30   PHE A CE2   1 
ATOM   241   C  CZ    . PHE A 1 30  ? 32.783  16.435  34.968  1.00 16.28 ? 30   PHE A CZ    1 
ATOM   242   N  N     . TYR A 1 31  ? 36.313  10.151  35.684  1.00 17.79 ? 31   TYR A N     1 
ATOM   243   C  CA    . TYR A 1 31  ? 36.862  8.866   36.135  1.00 18.08 ? 31   TYR A CA    1 
ATOM   244   C  C     . TYR A 1 31  ? 37.177  8.906   37.638  1.00 18.28 ? 31   TYR A C     1 
ATOM   245   O  O     . TYR A 1 31  ? 38.118  9.559   38.083  1.00 17.89 ? 31   TYR A O     1 
ATOM   246   C  CB    . TYR A 1 31  ? 38.101  8.520   35.305  1.00 18.17 ? 31   TYR A CB    1 
ATOM   247   C  CG    . TYR A 1 31  ? 38.788  7.201   35.606  1.00 17.90 ? 31   TYR A CG    1 
ATOM   248   C  CD1   . TYR A 1 31  ? 38.425  6.031   34.958  1.00 17.18 ? 31   TYR A CD1   1 
ATOM   249   C  CD2   . TYR A 1 31  ? 39.849  7.148   36.501  1.00 19.48 ? 31   TYR A CD2   1 
ATOM   250   C  CE1   . TYR A 1 31  ? 39.091  4.820   35.222  1.00 17.81 ? 31   TYR A CE1   1 
ATOM   251   C  CE2   . TYR A 1 31  ? 40.519  5.964   36.766  1.00 20.52 ? 31   TYR A CE2   1 
ATOM   252   C  CZ    . TYR A 1 31  ? 40.141  4.796   36.126  1.00 19.69 ? 31   TYR A CZ    1 
ATOM   253   O  OH    . TYR A 1 31  ? 40.829  3.626   36.429  1.00 20.47 ? 31   TYR A OH    1 
ATOM   254   N  N     . ARG A 1 32  ? 36.365  8.187   38.409  1.00 18.81 ? 32   ARG A N     1 
ATOM   255   C  CA    . ARG A 1 32  ? 36.472  8.173   39.856  1.00 18.75 ? 32   ARG A CA    1 
ATOM   256   C  C     . ARG A 1 32  ? 37.820  7.656   40.299  1.00 19.40 ? 32   ARG A C     1 
ATOM   257   O  O     . ARG A 1 32  ? 38.168  6.521   40.018  1.00 18.78 ? 32   ARG A O     1 
ATOM   258   C  CB    . ARG A 1 32  ? 35.375  7.297   40.456  1.00 18.40 ? 32   ARG A CB    1 
ATOM   259   C  CG    . ARG A 1 32  ? 35.174  7.471   41.959  1.00 17.74 ? 32   ARG A CG    1 
ATOM   260   C  CD    . ARG A 1 32  ? 34.756  8.892   42.378  1.00 15.76 ? 32   ARG A CD    1 
ATOM   261   N  NE    . ARG A 1 32  ? 34.460  9.008   43.814  1.00 14.18 ? 32   ARG A NE    1 
ATOM   262   C  CZ    . ARG A 1 32  ? 33.246  8.946   44.350  1.00 12.27 ? 32   ARG A CZ    1 
ATOM   263   N  NH1   . ARG A 1 32  ? 32.180  8.770   43.584  1.00 13.89 ? 32   ARG A NH1   1 
ATOM   264   N  NH2   . ARG A 1 32  ? 33.093  9.083   45.657  1.00 9.89  ? 32   ARG A NH2   1 
ATOM   265   N  N     . MET A 1 33  ? 38.587  8.531   40.951  1.00 20.58 ? 33   MET A N     1 
ATOM   266   C  CA    . MET A 1 33  ? 39.821  8.167   41.658  1.00 21.24 ? 33   MET A CA    1 
ATOM   267   C  C     . MET A 1 33  ? 39.691  8.610   43.112  1.00 20.92 ? 33   MET A C     1 
ATOM   268   O  O     . MET A 1 33  ? 39.956  9.757   43.440  1.00 20.89 ? 33   MET A O     1 
ATOM   269   C  CB    . MET A 1 33  ? 41.019  8.884   41.033  1.00 21.95 ? 33   MET A CB    1 
ATOM   270   C  CG    . MET A 1 33  ? 41.503  8.302   39.706  1.00 25.05 ? 33   MET A CG    1 
ATOM   271   S  SD    . MET A 1 33  ? 42.880  7.134   39.911  1.00 31.69 ? 33   MET A SD    1 
ATOM   272   C  CE    . MET A 1 33  ? 44.163  8.207   40.611  1.00 30.16 ? 33   MET A CE    1 
ATOM   273   N  N     . GLY A 1 34  ? 39.293  7.707   43.996  1.00 20.72 ? 34   GLY A N     1 
ATOM   274   C  CA    . GLY A 1 34  ? 39.120  8.065   45.389  1.00 20.28 ? 34   GLY A CA    1 
ATOM   275   C  C     . GLY A 1 34  ? 38.131  9.200   45.484  1.00 20.05 ? 34   GLY A C     1 
ATOM   276   O  O     . GLY A 1 34  ? 37.029  9.079   44.992  1.00 19.81 ? 34   GLY A O     1 
ATOM   277   N  N     . ASP A 1 35  ? 38.540  10.323  46.063  1.00 19.93 ? 35   ASP A N     1 
ATOM   278   C  CA    . ASP A 1 35  ? 37.630  11.454  46.294  1.00 19.69 ? 35   ASP A CA    1 
ATOM   279   C  C     . ASP A 1 35  ? 37.458  12.354  45.084  1.00 19.15 ? 35   ASP A C     1 
ATOM   280   O  O     . ASP A 1 35  ? 36.660  13.272  45.131  1.00 19.67 ? 35   ASP A O     1 
ATOM   281   C  CB    . ASP A 1 35  ? 38.123  12.318  47.458  1.00 19.91 ? 35   ASP A CB    1 
ATOM   282   C  CG    . ASP A 1 35  ? 37.128  12.398  48.604  1.00 21.11 ? 35   ASP A CG    1 
ATOM   283   O  OD1   . ASP A 1 35  ? 36.627  11.325  49.034  1.00 22.49 ? 35   ASP A OD1   1 
ATOM   284   O  OD2   . ASP A 1 35  ? 36.823  13.493  49.150  1.00 22.76 ? 35   ASP A OD2   1 
ATOM   285   N  N     . PHE A 1 36  ? 38.191  12.103  44.008  1.00 18.33 ? 36   PHE A N     1 
ATOM   286   C  CA    . PHE A 1 36  ? 38.161  12.972  42.856  1.00 17.62 ? 36   PHE A CA    1 
ATOM   287   C  C     . PHE A 1 36  ? 37.586  12.295  41.643  1.00 17.20 ? 36   PHE A C     1 
ATOM   288   O  O     . PHE A 1 36  ? 37.791  11.110  41.414  1.00 17.62 ? 36   PHE A O     1 
ATOM   289   C  CB    . PHE A 1 36  ? 39.561  13.450  42.535  1.00 17.60 ? 36   PHE A CB    1 
ATOM   290   C  CG    . PHE A 1 36  ? 40.000  14.623  43.360  1.00 17.93 ? 36   PHE A CG    1 
ATOM   291   C  CD1   . PHE A 1 36  ? 40.534  14.429  44.635  1.00 18.00 ? 36   PHE A CD1   1 
ATOM   292   C  CD2   . PHE A 1 36  ? 39.883  15.917  42.865  1.00 17.81 ? 36   PHE A CD2   1 
ATOM   293   C  CE1   . PHE A 1 36  ? 40.951  15.507  45.395  1.00 19.03 ? 36   PHE A CE1   1 
ATOM   294   C  CE2   . PHE A 1 36  ? 40.306  17.013  43.622  1.00 19.42 ? 36   PHE A CE2   1 
ATOM   295   C  CZ    . PHE A 1 36  ? 40.837  16.808  44.888  1.00 19.44 ? 36   PHE A CZ    1 
ATOM   296   N  N     . TYR A 1 37  ? 36.836  13.062  40.877  1.00 16.63 ? 37   TYR A N     1 
ATOM   297   C  CA    . TYR A 1 37  ? 36.495  12.690  39.532  1.00 16.73 ? 37   TYR A CA    1 
ATOM   298   C  C     . TYR A 1 37  ? 37.574  13.330  38.656  1.00 16.87 ? 37   TYR A C     1 
ATOM   299   O  O     . TYR A 1 37  ? 37.845  14.522  38.757  1.00 16.86 ? 37   TYR A O     1 
ATOM   300   C  CB    . TYR A 1 37  ? 35.107  13.218  39.178  1.00 16.94 ? 37   TYR A CB    1 
ATOM   301   C  CG    . TYR A 1 37  ? 33.925  12.391  39.661  1.00 16.42 ? 37   TYR A CG    1 
ATOM   302   C  CD1   . TYR A 1 37  ? 33.732  11.090  39.219  1.00 16.57 ? 37   TYR A CD1   1 
ATOM   303   C  CD2   . TYR A 1 37  ? 32.975  12.943  40.511  1.00 17.11 ? 37   TYR A CD2   1 
ATOM   304   C  CE1   . TYR A 1 37  ? 32.633  10.344  39.617  1.00 18.31 ? 37   TYR A CE1   1 
ATOM   305   C  CE2   . TYR A 1 37  ? 31.871  12.220  40.932  1.00 18.53 ? 37   TYR A CE2   1 
ATOM   306   C  CZ    . TYR A 1 37  ? 31.688  10.901  40.483  1.00 19.80 ? 37   TYR A CZ    1 
ATOM   307   O  OH    . TYR A 1 37  ? 30.580  10.153  40.901  1.00 16.09 ? 37   TYR A OH    1 
ATOM   308   N  N     . GLU A 1 38  ? 38.180  12.539  37.785  1.00 17.05 ? 38   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 38  ? 39.334  12.994  37.038  1.00 17.62 ? 38   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 38  ? 39.225  12.704  35.566  1.00 17.65 ? 38   GLU A C     1 
ATOM   311   O  O     . GLU A 1 38  ? 38.645  11.711  35.158  1.00 18.46 ? 38   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 38  ? 40.606  12.363  37.588  1.00 17.63 ? 38   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 38  ? 41.158  13.137  38.773  1.00 19.30 ? 38   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 38  ? 42.182  12.353  39.544  1.00 22.70 ? 38   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 38  ? 42.715  11.358  38.991  1.00 26.13 ? 38   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 38  ? 42.442  12.715  40.712  1.00 24.92 ? 38   GLU A OE2   1 
ATOM   317   N  N     . LEU A 1 39  ? 39.824  13.584  34.777  1.00 17.33 ? 39   LEU A N     1 
ATOM   318   C  CA    . LEU A 1 39  ? 39.833  13.484  33.326  1.00 16.73 ? 39   LEU A CA    1 
ATOM   319   C  C     . LEU A 1 39  ? 41.270  13.391  32.843  1.00 15.98 ? 39   LEU A C     1 
ATOM   320   O  O     . LEU A 1 39  ? 42.193  13.808  33.538  1.00 15.01 ? 39   LEU A O     1 
ATOM   321   C  CB    . LEU A 1 39  ? 39.191  14.728  32.752  1.00 16.83 ? 39   LEU A CB    1 
ATOM   322   C  CG    . LEU A 1 39  ? 37.728  14.843  33.121  1.00 17.71 ? 39   LEU A CG    1 
ATOM   323   C  CD1   . LEU A 1 39  ? 37.479  16.080  34.014  1.00 18.17 ? 39   LEU A CD1   1 
ATOM   324   C  CD2   . LEU A 1 39  ? 36.905  14.892  31.854  1.00 18.83 ? 39   LEU A CD2   1 
ATOM   325   N  N     . PHE A 1 40  ? 41.471  12.809  31.668  1.00 15.57 ? 40   PHE A N     1 
ATOM   326   C  CA    . PHE A 1 40  ? 42.831  12.647  31.155  1.00 15.50 ? 40   PHE A CA    1 
ATOM   327   C  C     . PHE A 1 40  ? 42.938  12.992  29.673  1.00 15.60 ? 40   PHE A C     1 
ATOM   328   O  O     . PHE A 1 40  ? 41.941  13.110  28.969  1.00 15.52 ? 40   PHE A O     1 
ATOM   329   C  CB    . PHE A 1 40  ? 43.373  11.229  31.403  1.00 15.54 ? 40   PHE A CB    1 
ATOM   330   C  CG    . PHE A 1 40  ? 43.302  10.769  32.830  1.00 14.35 ? 40   PHE A CG    1 
ATOM   331   C  CD1   . PHE A 1 40  ? 44.197  11.208  33.769  1.00 15.47 ? 40   PHE A CD1   1 
ATOM   332   C  CD2   . PHE A 1 40  ? 42.366  9.854   33.216  1.00 15.45 ? 40   PHE A CD2   1 
ATOM   333   C  CE1   . PHE A 1 40  ? 44.134  10.746  35.086  1.00 15.24 ? 40   PHE A CE1   1 
ATOM   334   C  CE2   . PHE A 1 40  ? 42.297  9.395   34.538  1.00 15.87 ? 40   PHE A CE2   1 
ATOM   335   C  CZ    . PHE A 1 40  ? 43.178  9.849   35.462  1.00 14.70 ? 40   PHE A CZ    1 
ATOM   336   N  N     . TYR A 1 41  ? 44.172  13.154  29.217  1.00 16.18 ? 41   TYR A N     1 
ATOM   337   C  CA    . TYR A 1 41  ? 44.468  13.499  27.833  1.00 16.96 ? 41   TYR A CA    1 
ATOM   338   C  C     . TYR A 1 41  ? 43.639  14.713  27.360  1.00 17.47 ? 41   TYR A C     1 
ATOM   339   O  O     . TYR A 1 41  ? 43.520  15.664  28.099  1.00 17.61 ? 41   TYR A O     1 
ATOM   340   C  CB    . TYR A 1 41  ? 44.305  12.250  26.974  1.00 16.59 ? 41   TYR A CB    1 
ATOM   341   C  CG    . TYR A 1 41  ? 45.234  11.140  27.404  1.00 17.92 ? 41   TYR A CG    1 
ATOM   342   C  CD1   . TYR A 1 41  ? 46.604  11.230  27.197  1.00 19.66 ? 41   TYR A CD1   1 
ATOM   343   C  CD2   . TYR A 1 41  ? 44.744  9.984   28.039  1.00 20.69 ? 41   TYR A CD2   1 
ATOM   344   C  CE1   . TYR A 1 41  ? 47.467  10.172  27.594  1.00 21.08 ? 41   TYR A CE1   1 
ATOM   345   C  CE2   . TYR A 1 41  ? 45.591  8.947   28.443  1.00 19.52 ? 41   TYR A CE2   1 
ATOM   346   C  CZ    . TYR A 1 41  ? 46.939  9.040   28.211  1.00 20.62 ? 41   TYR A CZ    1 
ATOM   347   O  OH    . TYR A 1 41  ? 47.764  8.008   28.601  1.00 22.57 ? 41   TYR A OH    1 
ATOM   348   N  N     . ASP A 1 42  ? 43.061  14.683  26.162  1.00 18.73 ? 42   ASP A N     1 
ATOM   349   C  CA    . ASP A 1 42  ? 42.314  15.830  25.628  1.00 19.58 ? 42   ASP A CA    1 
ATOM   350   C  C     . ASP A 1 42  ? 41.086  16.177  26.434  1.00 19.59 ? 42   ASP A C     1 
ATOM   351   O  O     . ASP A 1 42  ? 40.720  17.348  26.485  1.00 19.88 ? 42   ASP A O     1 
ATOM   352   C  CB    . ASP A 1 42  ? 41.881  15.587  24.190  1.00 20.21 ? 42   ASP A CB    1 
ATOM   353   C  CG    . ASP A 1 42  ? 43.039  15.174  23.301  1.00 24.13 ? 42   ASP A CG    1 
ATOM   354   O  OD1   . ASP A 1 42  ? 43.697  16.108  22.737  1.00 27.72 ? 42   ASP A OD1   1 
ATOM   355   O  OD2   . ASP A 1 42  ? 43.367  13.951  23.144  1.00 25.42 ? 42   ASP A OD2   1 
ATOM   356   N  N     . ASP A 1 43  ? 40.437  15.178  27.035  1.00 19.59 ? 43   ASP A N     1 
ATOM   357   C  CA    . ASP A 1 43  ? 39.296  15.431  27.924  1.00 19.94 ? 43   ASP A CA    1 
ATOM   358   C  C     . ASP A 1 43  ? 39.674  16.443  29.034  1.00 19.84 ? 43   ASP A C     1 
ATOM   359   O  O     . ASP A 1 43  ? 38.918  17.347  29.361  1.00 20.13 ? 43   ASP A O     1 
ATOM   360   C  CB    . ASP A 1 43  ? 38.814  14.123  28.589  1.00 20.30 ? 43   ASP A CB    1 
ATOM   361   C  CG    . ASP A 1 43  ? 37.962  13.235  27.663  1.00 20.84 ? 43   ASP A CG    1 
ATOM   362   O  OD1   . ASP A 1 43  ? 37.855  13.474  26.433  1.00 20.44 ? 43   ASP A OD1   1 
ATOM   363   O  OD2   . ASP A 1 43  ? 37.376  12.230  28.114  1.00 20.74 ? 43   ASP A OD2   1 
ATOM   364   N  N     . ALA A 1 44  ? 40.849  16.251  29.616  1.00 19.44 ? 44   ALA A N     1 
ATOM   365   C  CA    . ALA A 1 44  ? 41.351  17.096  30.660  1.00 19.29 ? 44   ALA A CA    1 
ATOM   366   C  C     . ALA A 1 44  ? 41.586  18.513  30.140  1.00 19.80 ? 44   ALA A C     1 
ATOM   367   O  O     . ALA A 1 44  ? 41.335  19.483  30.838  1.00 19.33 ? 44   ALA A O     1 
ATOM   368   C  CB    . ALA A 1 44  ? 42.648  16.511  31.204  1.00 19.05 ? 44   ALA A CB    1 
ATOM   369   N  N     . LYS A 1 45  ? 42.097  18.630  28.925  1.00 20.65 ? 45   LYS A N     1 
ATOM   370   C  CA    . LYS A 1 45  ? 42.387  19.944  28.350  1.00 21.68 ? 45   LYS A CA    1 
ATOM   371   C  C     . LYS A 1 45  ? 41.095  20.702  28.069  1.00 22.16 ? 45   LYS A C     1 
ATOM   372   O  O     . LYS A 1 45  ? 41.046  21.923  28.223  1.00 22.09 ? 45   LYS A O     1 
ATOM   373   C  CB    . LYS A 1 45  ? 43.226  19.805  27.071  1.00 21.99 ? 45   LYS A CB    1 
ATOM   374   C  CG    . LYS A 1 45  ? 44.625  19.199  27.323  1.00 22.92 ? 45   LYS A CG    1 
ATOM   375   C  CD    . LYS A 1 45  ? 45.202  18.430  26.125  1.00 23.05 ? 45   LYS A CD    1 
ATOM   376   C  CE    . LYS A 1 45  ? 46.540  19.001  25.656  1.00 23.76 ? 45   LYS A CE    1 
ATOM   377   N  NZ    . LYS A 1 45  ? 47.626  18.001  25.544  1.00 23.96 ? 45   LYS A NZ    1 
ATOM   378   N  N     . ARG A 1 46  ? 40.047  19.967  27.684  1.00 22.68 ? 46   ARG A N     1 
ATOM   379   C  CA    . ARG A 1 46  ? 38.751  20.568  27.386  1.00 23.06 ? 46   ARG A CA    1 
ATOM   380   C  C     . ARG A 1 46  ? 38.056  20.995  28.667  1.00 22.50 ? 46   ARG A C     1 
ATOM   381   O  O     . ARG A 1 46  ? 37.671  22.152  28.810  1.00 21.77 ? 46   ARG A O     1 
ATOM   382   C  CB    . ARG A 1 46  ? 37.861  19.599  26.611  1.00 23.62 ? 46   ARG A CB    1 
ATOM   383   C  CG    . ARG A 1 46  ? 37.718  19.974  25.151  1.00 26.12 ? 46   ARG A CG    1 
ATOM   384   C  CD    . ARG A 1 46  ? 37.039  18.920  24.275  1.00 29.31 ? 46   ARG A CD    1 
ATOM   385   N  NE    . ARG A 1 46  ? 35.754  19.409  23.765  1.00 32.31 ? 46   ARG A NE    1 
ATOM   386   C  CZ    . ARG A 1 46  ? 34.557  18.851  23.989  1.00 34.35 ? 46   ARG A CZ    1 
ATOM   387   N  NH1   . ARG A 1 46  ? 34.412  17.738  24.727  1.00 34.62 ? 46   ARG A NH1   1 
ATOM   388   N  NH2   . ARG A 1 46  ? 33.483  19.425  23.459  1.00 34.97 ? 46   ARG A NH2   1 
ATOM   389   N  N     . ALA A 1 47  ? 37.890  20.044  29.585  1.00 21.85 ? 47   ALA A N     1 
ATOM   390   C  CA    . ALA A 1 47  ? 37.375  20.333  30.915  1.00 21.56 ? 47   ALA A CA    1 
ATOM   391   C  C     . ALA A 1 47  ? 38.065  21.564  31.497  1.00 21.68 ? 47   ALA A C     1 
ATOM   392   O  O     . ALA A 1 47  ? 37.434  22.417  32.113  1.00 22.05 ? 47   ALA A O     1 
ATOM   393   C  CB    . ALA A 1 47  ? 37.580  19.153  31.815  1.00 21.35 ? 47   ALA A CB    1 
ATOM   394   N  N     . SER A 1 48  ? 39.363  21.664  31.288  1.00 21.55 ? 48   SER A N     1 
ATOM   395   C  CA    . SER A 1 48  ? 40.125  22.771  31.818  1.00 21.79 ? 48   SER A CA    1 
ATOM   396   C  C     . SER A 1 48  ? 39.663  24.104  31.239  1.00 22.00 ? 48   SER A C     1 
ATOM   397   O  O     . SER A 1 48  ? 39.559  25.090  31.959  1.00 21.50 ? 48   SER A O     1 
ATOM   398   C  CB    . SER A 1 48  ? 41.608  22.562  31.540  1.00 21.80 ? 48   SER A CB    1 
ATOM   399   O  OG    . SER A 1 48  ? 42.277  23.794  31.498  1.00 22.53 ? 48   SER A OG    1 
ATOM   400   N  N     . GLN A 1 49  ? 39.394  24.127  29.938  1.00 22.42 ? 49   GLN A N     1 
ATOM   401   C  CA    . GLN A 1 49  ? 38.869  25.328  29.279  1.00 22.76 ? 49   GLN A CA    1 
ATOM   402   C  C     . GLN A 1 49  ? 37.406  25.611  29.614  1.00 22.20 ? 49   GLN A C     1 
ATOM   403   O  O     . GLN A 1 49  ? 37.056  26.746  29.824  1.00 22.81 ? 49   GLN A O     1 
ATOM   404   C  CB    . GLN A 1 49  ? 39.013  25.230  27.757  1.00 23.25 ? 49   GLN A CB    1 
ATOM   405   C  CG    . GLN A 1 49  ? 40.396  25.591  27.191  1.00 25.19 ? 49   GLN A CG    1 
ATOM   406   C  CD    . GLN A 1 49  ? 40.620  25.020  25.767  1.00 29.13 ? 49   GLN A CD    1 
ATOM   407   O  OE1   . GLN A 1 49  ? 41.309  25.638  24.942  1.00 31.18 ? 49   GLN A OE1   1 
ATOM   408   N  NE2   . GLN A 1 49  ? 40.043  23.840  25.487  1.00 30.38 ? 49   GLN A NE2   1 
ATOM   409   N  N     . LEU A 1 50  ? 36.556  24.589  29.657  1.00 22.04 ? 50   LEU A N     1 
ATOM   410   C  CA    . LEU A 1 50  ? 35.099  24.764  29.885  1.00 21.49 ? 50   LEU A CA    1 
ATOM   411   C  C     . LEU A 1 50  ? 34.747  25.016  31.336  1.00 21.23 ? 50   LEU A C     1 
ATOM   412   O  O     . LEU A 1 50  ? 34.006  25.939  31.644  1.00 20.99 ? 50   LEU A O     1 
ATOM   413   C  CB    . LEU A 1 50  ? 34.309  23.516  29.460  1.00 20.95 ? 50   LEU A CB    1 
ATOM   414   C  CG    . LEU A 1 50  ? 34.456  23.085  28.014  1.00 18.96 ? 50   LEU A CG    1 
ATOM   415   C  CD1   . LEU A 1 50  ? 34.243  21.571  27.895  1.00 18.51 ? 50   LEU A CD1   1 
ATOM   416   C  CD2   . LEU A 1 50  ? 33.496  23.850  27.152  1.00 16.49 ? 50   LEU A CD2   1 
ATOM   417   N  N     . LEU A 1 51  ? 35.274  24.152  32.206  1.00 21.15 ? 51   LEU A N     1 
ATOM   418   C  CA    . LEU A 1 51  ? 35.006  24.170  33.646  1.00 20.70 ? 51   LEU A CA    1 
ATOM   419   C  C     . LEU A 1 51  ? 35.935  25.087  34.462  1.00 20.68 ? 51   LEU A C     1 
ATOM   420   O  O     . LEU A 1 51  ? 35.885  25.058  35.679  1.00 20.93 ? 51   LEU A O     1 
ATOM   421   C  CB    . LEU A 1 51  ? 35.111  22.756  34.210  1.00 20.34 ? 51   LEU A CB    1 
ATOM   422   C  CG    . LEU A 1 51  ? 34.524  21.606  33.389  1.00 20.64 ? 51   LEU A CG    1 
ATOM   423   C  CD1   . LEU A 1 51  ? 34.775  20.251  34.043  1.00 20.57 ? 51   LEU A CD1   1 
ATOM   424   C  CD2   . LEU A 1 51  ? 33.063  21.817  33.197  1.00 20.74 ? 51   LEU A CD2   1 
ATOM   425   N  N     . ASP A 1 52  ? 36.781  25.882  33.811  1.00 20.57 ? 52   ASP A N     1 
ATOM   426   C  CA    . ASP A 1 52  ? 37.671  26.801  34.515  1.00 20.50 ? 52   ASP A CA    1 
ATOM   427   C  C     . ASP A 1 52  ? 38.379  26.105  35.692  1.00 20.00 ? 52   ASP A C     1 
ATOM   428   O  O     . ASP A 1 52  ? 38.247  26.505  36.849  1.00 20.57 ? 52   ASP A O     1 
ATOM   429   C  CB    . ASP A 1 52  ? 36.886  28.036  34.980  1.00 20.92 ? 52   ASP A CB    1 
ATOM   430   C  CG    . ASP A 1 52  ? 37.800  29.205  35.441  1.00 22.40 ? 52   ASP A CG    1 
ATOM   431   O  OD1   . ASP A 1 52  ? 38.737  29.577  34.690  1.00 22.96 ? 52   ASP A OD1   1 
ATOM   432   O  OD2   . ASP A 1 52  ? 37.635  29.811  36.539  1.00 22.67 ? 52   ASP A OD2   1 
ATOM   433   N  N     . ILE A 1 53  ? 39.111  25.044  35.384  1.00 19.24 ? 53   ILE A N     1 
ATOM   434   C  CA    . ILE A 1 53  ? 39.969  24.377  36.359  1.00 18.70 ? 53   ILE A CA    1 
ATOM   435   C  C     . ILE A 1 53  ? 41.358  24.118  35.790  1.00 18.78 ? 53   ILE A C     1 
ATOM   436   O  O     . ILE A 1 53  ? 41.560  24.123  34.577  1.00 18.93 ? 53   ILE A O     1 
ATOM   437   C  CB    . ILE A 1 53  ? 39.350  23.051  36.816  1.00 18.60 ? 53   ILE A CB    1 
ATOM   438   C  CG1   . ILE A 1 53  ? 39.224  22.054  35.651  1.00 17.38 ? 53   ILE A CG1   1 
ATOM   439   C  CG2   . ILE A 1 53  ? 38.009  23.312  37.479  1.00 18.85 ? 53   ILE A CG2   1 
ATOM   440   C  CD1   . ILE A 1 53  ? 38.365  20.856  35.982  1.00 17.60 ? 53   ILE A CD1   1 
ATOM   441   N  N     . SER A 1 54  ? 42.311  23.880  36.679  1.00 18.82 ? 54   SER A N     1 
ATOM   442   C  CA    . SER A 1 54  ? 43.701  23.684  36.294  1.00 19.07 ? 54   SER A CA    1 
ATOM   443   C  C     . SER A 1 54  ? 43.949  22.396  35.493  1.00 19.46 ? 54   SER A C     1 
ATOM   444   O  O     . SER A 1 54  ? 43.451  21.301  35.811  1.00 19.22 ? 54   SER A O     1 
ATOM   445   C  CB    . SER A 1 54  ? 44.625  23.723  37.526  1.00 19.01 ? 54   SER A CB    1 
ATOM   446   O  OG    . SER A 1 54  ? 45.607  24.736  37.398  1.00 19.47 ? 54   SER A OG    1 
ATOM   447   N  N     . LEU A 1 55  ? 44.732  22.574  34.437  1.00 20.32 ? 55   LEU A N     1 
ATOM   448   C  CA    . LEU A 1 55  ? 45.275  21.485  33.658  1.00 20.69 ? 55   LEU A CA    1 
ATOM   449   C  C     . LEU A 1 55  ? 46.650  21.188  34.231  1.00 20.99 ? 55   LEU A C     1 
ATOM   450   O  O     . LEU A 1 55  ? 47.544  22.012  34.197  1.00 20.70 ? 55   LEU A O     1 
ATOM   451   C  CB    . LEU A 1 55  ? 45.353  21.865  32.171  1.00 20.38 ? 55   LEU A CB    1 
ATOM   452   C  CG    . LEU A 1 55  ? 46.097  20.856  31.291  1.00 20.98 ? 55   LEU A CG    1 
ATOM   453   C  CD1   . LEU A 1 55  ? 45.354  19.516  31.245  1.00 19.67 ? 55   LEU A CD1   1 
ATOM   454   C  CD2   . LEU A 1 55  ? 46.339  21.428  29.896  1.00 21.01 ? 55   LEU A CD2   1 
ATOM   455   N  N     . THR A 1 56  ? 46.792  19.989  34.759  1.00 22.09 ? 56   THR A N     1 
ATOM   456   C  CA    . THR A 1 56  ? 48.022  19.539  35.378  1.00 22.98 ? 56   THR A CA    1 
ATOM   457   C  C     . THR A 1 56  ? 48.456  18.203  34.726  1.00 24.72 ? 56   THR A C     1 
ATOM   458   O  O     . THR A 1 56  ? 47.992  17.869  33.634  1.00 24.60 ? 56   THR A O     1 
ATOM   459   C  CB    . THR A 1 56  ? 47.793  19.457  36.903  1.00 22.52 ? 56   THR A CB    1 
ATOM   460   O  OG1   . THR A 1 56  ? 48.964  19.003  37.576  1.00 22.23 ? 56   THR A OG1   1 
ATOM   461   C  CG2   . THR A 1 56  ? 46.724  18.453  37.262  1.00 21.53 ? 56   THR A CG2   1 
ATOM   462   N  N     . LYS A 1 57  ? 49.385  17.488  35.359  1.00 26.85 ? 57   LYS A N     1 
ATOM   463   C  CA    . LYS A 1 57  ? 49.976  16.281  34.799  1.00 28.57 ? 57   LYS A CA    1 
ATOM   464   C  C     . LYS A 1 57  ? 49.877  15.140  35.810  1.00 29.41 ? 57   LYS A C     1 
ATOM   465   O  O     . LYS A 1 57  ? 49.318  15.302  36.889  1.00 29.50 ? 57   LYS A O     1 
ATOM   466   C  CB    . LYS A 1 57  ? 51.457  16.491  34.365  1.00 28.78 ? 57   LYS A CB    1 
ATOM   467   C  CG    . LYS A 1 57  ? 51.994  17.955  34.353  1.00 31.41 ? 57   LYS A CG    1 
ATOM   468   C  CD    . LYS A 1 57  ? 52.717  18.365  33.027  1.00 33.98 ? 57   LYS A CD    1 
ATOM   469   C  CE    . LYS A 1 57  ? 51.768  19.103  32.028  1.00 35.83 ? 57   LYS A CE    1 
ATOM   470   N  NZ    . LYS A 1 57  ? 51.174  20.415  32.540  1.00 35.39 ? 57   LYS A NZ    1 
ATOM   471   N  N     . ARG A 1 58  ? 50.439  13.997  35.425  1.00 30.51 ? 58   ARG A N     1 
ATOM   472   C  CA    . ARG A 1 58  ? 50.461  12.788  36.223  1.00 31.12 ? 58   ARG A CA    1 
ATOM   473   C  C     . ARG A 1 58  ? 51.679  11.938  35.826  1.00 31.85 ? 58   ARG A C     1 
ATOM   474   O  O     . ARG A 1 58  ? 51.753  11.420  34.697  1.00 32.07 ? 58   ARG A O     1 
ATOM   475   C  CB    . ARG A 1 58  ? 49.188  12.012  35.969  1.00 31.15 ? 58   ARG A CB    1 
ATOM   476   C  CG    . ARG A 1 58  ? 49.071  10.791  36.805  1.00 32.00 ? 58   ARG A CG    1 
ATOM   477   C  CD    . ARG A 1 58  ? 47.677  10.186  36.811  1.00 33.12 ? 58   ARG A CD    1 
ATOM   478   N  NE    . ARG A 1 58  ? 47.209  9.964   38.173  1.00 33.78 ? 58   ARG A NE    1 
ATOM   479   C  CZ    . ARG A 1 58  ? 47.767  9.122   39.044  1.00 33.60 ? 58   ARG A CZ    1 
ATOM   480   N  NH1   . ARG A 1 58  ? 48.831  8.392   38.727  1.00 34.57 ? 58   ARG A NH1   1 
ATOM   481   N  NH2   . ARG A 1 58  ? 47.253  9.006   40.254  1.00 33.96 ? 58   ARG A NH2   1 
ATOM   482   N  N     . GLY A 1 59  ? 52.627  11.803  36.755  1.00 32.48 ? 59   GLY A N     1 
ATOM   483   C  CA    . GLY A 1 59  ? 53.898  11.123  36.507  1.00 33.00 ? 59   GLY A CA    1 
ATOM   484   C  C     . GLY A 1 59  ? 53.859  9.766   35.793  1.00 33.32 ? 59   GLY A C     1 
ATOM   485   O  O     . GLY A 1 59  ? 52.879  9.016   35.894  1.00 33.34 ? 59   GLY A O     1 
ATOM   486   N  N     . ALA A 1 60  ? 54.944  9.459   35.076  1.00 33.44 ? 60   ALA A N     1 
ATOM   487   C  CA    . ALA A 1 60  ? 55.028  8.257   34.242  1.00 33.46 ? 60   ALA A CA    1 
ATOM   488   C  C     . ALA A 1 60  ? 56.474  7.701   34.158  1.00 33.63 ? 60   ALA A C     1 
ATOM   489   O  O     . ALA A 1 60  ? 57.394  8.385   33.698  1.00 33.45 ? 60   ALA A O     1 
ATOM   490   C  CB    . ALA A 1 60  ? 54.450  8.535   32.846  1.00 33.28 ? 60   ALA A CB    1 
ATOM   491   N  N     . SER A 1 61  ? 56.646  6.456   34.626  1.00 33.83 ? 61   SER A N     1 
ATOM   492   C  CA    . SER A 1 61  ? 57.938  5.744   34.659  1.00 33.74 ? 61   SER A CA    1 
ATOM   493   C  C     . SER A 1 61  ? 58.556  5.576   33.265  1.00 33.73 ? 61   SER A C     1 
ATOM   494   O  O     . SER A 1 61  ? 59.786  5.523   33.117  1.00 33.86 ? 61   SER A O     1 
ATOM   495   C  CB    . SER A 1 61  ? 57.747  4.355   35.296  1.00 33.72 ? 61   SER A CB    1 
ATOM   496   O  OG    . SER A 1 61  ? 58.982  3.708   35.563  1.00 33.62 ? 61   SER A OG    1 
ATOM   497   N  N     . ALA A 1 62  ? 57.686  5.475   32.258  1.00 33.65 ? 62   ALA A N     1 
ATOM   498   C  CA    . ALA A 1 62  ? 58.082  5.333   30.863  1.00 33.33 ? 62   ALA A CA    1 
ATOM   499   C  C     . ALA A 1 62  ? 57.273  6.300   29.979  1.00 33.08 ? 62   ALA A C     1 
ATOM   500   O  O     . ALA A 1 62  ? 56.038  6.225   29.927  1.00 32.81 ? 62   ALA A O     1 
ATOM   501   C  CB    . ALA A 1 62  ? 57.879  3.887   30.405  1.00 33.24 ? 62   ALA A CB    1 
ATOM   502   N  N     . GLY A 1 63  ? 57.986  7.226   29.327  1.00 32.57 ? 63   GLY A N     1 
ATOM   503   C  CA    . GLY A 1 63  ? 57.444  8.030   28.242  1.00 31.96 ? 63   GLY A CA    1 
ATOM   504   C  C     . GLY A 1 63  ? 56.801  9.349   28.648  1.00 31.47 ? 63   GLY A C     1 
ATOM   505   O  O     . GLY A 1 63  ? 57.274  10.048  29.555  1.00 31.20 ? 63   GLY A O     1 
ATOM   506   N  N     . GLU A 1 64  ? 55.700  9.669   27.965  1.00 30.67 ? 64   GLU A N     1 
ATOM   507   C  CA    . GLU A 1 64  ? 55.028  10.968  28.068  1.00 29.94 ? 64   GLU A CA    1 
ATOM   508   C  C     . GLU A 1 64  ? 54.216  11.101  29.386  1.00 28.87 ? 64   GLU A C     1 
ATOM   509   O  O     . GLU A 1 64  ? 53.651  10.100  29.871  1.00 28.67 ? 64   GLU A O     1 
ATOM   510   C  CB    . GLU A 1 64  ? 54.102  11.171  26.841  1.00 30.04 ? 64   GLU A CB    1 
ATOM   511   C  CG    . GLU A 1 64  ? 54.805  11.093  25.472  1.00 31.08 ? 64   GLU A CG    1 
ATOM   512   C  CD    . GLU A 1 64  ? 53.848  10.990  24.282  1.00 32.11 ? 64   GLU A CD    1 
ATOM   513   O  OE1   . GLU A 1 64  ? 52.722  10.477  24.452  1.00 34.08 ? 64   GLU A OE1   1 
ATOM   514   O  OE2   . GLU A 1 64  ? 54.218  11.412  23.163  1.00 32.35 ? 64   GLU A OE2   1 
ATOM   515   N  N     . PRO A 1 65  ? 54.170  12.309  29.975  1.00 27.44 ? 65   PRO A N     1 
ATOM   516   C  CA    . PRO A 1 65  ? 53.255  12.569  31.085  1.00 26.36 ? 65   PRO A CA    1 
ATOM   517   C  C     . PRO A 1 65  ? 51.822  12.670  30.588  1.00 25.21 ? 65   PRO A C     1 
ATOM   518   O  O     . PRO A 1 65  ? 51.583  12.861  29.394  1.00 24.70 ? 65   PRO A O     1 
ATOM   519   C  CB    . PRO A 1 65  ? 53.745  13.912  31.648  1.00 26.41 ? 65   PRO A CB    1 
ATOM   520   C  CG    . PRO A 1 65  ? 55.058  14.131  31.052  1.00 26.75 ? 65   PRO A CG    1 
ATOM   521   C  CD    . PRO A 1 65  ? 54.990  13.505  29.689  1.00 27.52 ? 65   PRO A CD    1 
ATOM   522   N  N     . ILE A 1 66  ? 50.881  12.527  31.513  1.00 24.07 ? 66   ILE A N     1 
ATOM   523   C  CA    . ILE A 1 66  ? 49.465  12.501  31.187  1.00 23.17 ? 66   ILE A CA    1 
ATOM   524   C  C     . ILE A 1 66  ? 48.758  13.796  31.642  1.00 23.10 ? 66   ILE A C     1 
ATOM   525   O  O     . ILE A 1 66  ? 48.728  14.110  32.844  1.00 22.56 ? 66   ILE A O     1 
ATOM   526   C  CB    . ILE A 1 66  ? 48.828  11.282  31.839  1.00 22.81 ? 66   ILE A CB    1 
ATOM   527   C  CG1   . ILE A 1 66  ? 49.253  10.013  31.090  1.00 21.74 ? 66   ILE A CG1   1 
ATOM   528   C  CG2   . ILE A 1 66  ? 47.299  11.426  31.896  1.00 22.58 ? 66   ILE A CG2   1 
ATOM   529   C  CD1   . ILE A 1 66  ? 49.325  8.791   31.976  1.00 20.61 ? 66   ILE A CD1   1 
ATOM   530   N  N     . PRO A 1 67  ? 48.196  14.549  30.690  1.00 22.66 ? 67   PRO A N     1 
ATOM   531   C  CA    . PRO A 1 67  ? 47.397  15.725  31.040  1.00 22.38 ? 67   PRO A CA    1 
ATOM   532   C  C     . PRO A 1 67  ? 46.236  15.307  31.923  1.00 22.08 ? 67   PRO A C     1 
ATOM   533   O  O     . PRO A 1 67  ? 45.647  14.282  31.667  1.00 21.99 ? 67   PRO A O     1 
ATOM   534   C  CB    . PRO A 1 67  ? 46.931  16.248  29.680  1.00 22.32 ? 67   PRO A CB    1 
ATOM   535   C  CG    . PRO A 1 67  ? 47.949  15.736  28.713  1.00 22.32 ? 67   PRO A CG    1 
ATOM   536   C  CD    . PRO A 1 67  ? 48.306  14.380  29.228  1.00 22.54 ? 67   PRO A CD    1 
ATOM   537   N  N     . MET A 1 68  ? 45.928  16.078  32.956  1.00 22.02 ? 68   MET A N     1 
ATOM   538   C  CA    . MET A 1 68  ? 44.944  15.656  33.941  1.00 21.99 ? 68   MET A CA    1 
ATOM   539   C  C     . MET A 1 68  ? 44.233  16.839  34.593  1.00 21.08 ? 68   MET A C     1 
ATOM   540   O  O     . MET A 1 68  ? 44.829  17.848  34.879  1.00 21.32 ? 68   MET A O     1 
ATOM   541   C  CB    . MET A 1 68  ? 45.608  14.771  34.996  1.00 22.42 ? 68   MET A CB    1 
ATOM   542   C  CG    . MET A 1 68  ? 44.636  14.044  35.900  1.00 24.37 ? 68   MET A CG    1 
ATOM   543   S  SD    . MET A 1 68  ? 44.990  14.318  37.642  1.00 31.25 ? 68   MET A SD    1 
ATOM   544   C  CE    . MET A 1 68  ? 44.368  15.892  37.872  1.00 31.37 ? 68   MET A CE    1 
ATOM   545   N  N     . ALA A 1 69  ? 42.935  16.704  34.777  1.00 20.28 ? 69   ALA A N     1 
ATOM   546   C  CA    . ALA A 1 69  ? 42.127  17.685  35.459  1.00 19.97 ? 69   ALA A CA    1 
ATOM   547   C  C     . ALA A 1 69  ? 41.146  16.926  36.341  1.00 19.48 ? 69   ALA A C     1 
ATOM   548   O  O     . ALA A 1 69  ? 40.975  15.744  36.167  1.00 19.55 ? 69   ALA A O     1 
ATOM   549   C  CB    . ALA A 1 69  ? 41.398  18.533  34.444  1.00 20.15 ? 69   ALA A CB    1 
ATOM   550   N  N     . GLY A 1 70  ? 40.499  17.586  37.283  1.00 19.13 ? 70   GLY A N     1 
ATOM   551   C  CA    . GLY A 1 70  ? 39.600  16.874  38.161  1.00 19.17 ? 70   GLY A CA    1 
ATOM   552   C  C     . GLY A 1 70  ? 38.938  17.735  39.202  1.00 19.39 ? 70   GLY A C     1 
ATOM   553   O  O     . GLY A 1 70  ? 39.388  18.844  39.497  1.00 19.78 ? 70   GLY A O     1 
ATOM   554   N  N     . ILE A 1 71  ? 37.869  17.199  39.775  1.00 19.60 ? 71   ILE A N     1 
ATOM   555   C  CA    . ILE A 1 71  ? 37.066  17.894  40.774  1.00 20.05 ? 71   ILE A CA    1 
ATOM   556   C  C     . ILE A 1 71  ? 36.704  16.926  41.896  1.00 20.14 ? 71   ILE A C     1 
ATOM   557   O  O     . ILE A 1 71  ? 36.616  15.746  41.663  1.00 20.22 ? 71   ILE A O     1 
ATOM   558   C  CB    . ILE A 1 71  ? 35.810  18.463  40.081  1.00 20.16 ? 71   ILE A CB    1 
ATOM   559   C  CG1   . ILE A 1 71  ? 35.062  17.386  39.293  1.00 20.73 ? 71   ILE A CG1   1 
ATOM   560   C  CG2   . ILE A 1 71  ? 36.215  19.546  39.097  1.00 20.94 ? 71   ILE A CG2   1 
ATOM   561   C  CD1   . ILE A 1 71  ? 33.693  17.803  38.899  1.00 21.48 ? 71   ILE A CD1   1 
ATOM   562   N  N     . PRO A 1 72  ? 36.507  17.391  43.120  1.00 20.65 ? 72   PRO A N     1 
ATOM   563   C  CA    . PRO A 1 72  ? 36.187  16.466  44.210  1.00 20.67 ? 72   PRO A CA    1 
ATOM   564   C  C     . PRO A 1 72  ? 34.767  15.988  44.068  1.00 21.09 ? 72   PRO A C     1 
ATOM   565   O  O     . PRO A 1 72  ? 33.960  16.708  43.504  1.00 21.18 ? 72   PRO A O     1 
ATOM   566   C  CB    . PRO A 1 72  ? 36.362  17.318  45.455  1.00 20.39 ? 72   PRO A CB    1 
ATOM   567   C  CG    . PRO A 1 72  ? 36.073  18.675  45.011  1.00 20.61 ? 72   PRO A CG    1 
ATOM   568   C  CD    . PRO A 1 72  ? 36.552  18.788  43.584  1.00 20.70 ? 72   PRO A CD    1 
ATOM   569   N  N     . TYR A 1 73  ? 34.467  14.795  44.571  1.00 21.79 ? 73   TYR A N     1 
ATOM   570   C  CA    . TYR A 1 73  ? 33.246  14.065  44.201  1.00 21.94 ? 73   TYR A CA    1 
ATOM   571   C  C     . TYR A 1 73  ? 32.009  14.851  44.593  1.00 22.04 ? 73   TYR A C     1 
ATOM   572   O  O     . TYR A 1 73  ? 30.999  14.850  43.884  1.00 21.64 ? 73   TYR A O     1 
ATOM   573   C  CB    . TYR A 1 73  ? 33.225  12.668  44.848  1.00 22.11 ? 73   TYR A CB    1 
ATOM   574   C  CG    . TYR A 1 73  ? 32.928  12.624  46.352  1.00 21.98 ? 73   TYR A CG    1 
ATOM   575   C  CD1   . TYR A 1 73  ? 33.921  12.893  47.282  1.00 22.71 ? 73   TYR A CD1   1 
ATOM   576   C  CD2   . TYR A 1 73  ? 31.663  12.276  46.833  1.00 22.20 ? 73   TYR A CD2   1 
ATOM   577   C  CE1   . TYR A 1 73  ? 33.671  12.841  48.665  1.00 23.66 ? 73   TYR A CE1   1 
ATOM   578   C  CE2   . TYR A 1 73  ? 31.393  12.206  48.218  1.00 22.52 ? 73   TYR A CE2   1 
ATOM   579   C  CZ    . TYR A 1 73  ? 32.409  12.493  49.135  1.00 24.01 ? 73   TYR A CZ    1 
ATOM   580   O  OH    . TYR A 1 73  ? 32.200  12.451  50.515  1.00 22.15 ? 73   TYR A OH    1 
ATOM   581   N  N     . HIS A 1 74  ? 32.128  15.539  45.728  1.00 22.30 ? 74   HIS A N     1 
ATOM   582   C  CA    . HIS A 1 74  ? 31.041  16.331  46.322  1.00 22.34 ? 74   HIS A CA    1 
ATOM   583   C  C     . HIS A 1 74  ? 30.746  17.661  45.604  1.00 22.35 ? 74   HIS A C     1 
ATOM   584   O  O     . HIS A 1 74  ? 29.970  18.449  46.120  1.00 23.43 ? 74   HIS A O     1 
ATOM   585   C  CB    . HIS A 1 74  ? 31.347  16.606  47.805  1.00 21.91 ? 74   HIS A CB    1 
ATOM   586   C  CG    . HIS A 1 74  ? 32.578  17.434  48.017  1.00 21.95 ? 74   HIS A CG    1 
ATOM   587   N  ND1   . HIS A 1 74  ? 33.841  16.889  48.041  1.00 22.42 ? 74   HIS A ND1   1 
ATOM   588   C  CD2   . HIS A 1 74  ? 32.742  18.764  48.202  1.00 23.36 ? 74   HIS A CD2   1 
ATOM   589   C  CE1   . HIS A 1 74  ? 34.733  17.846  48.220  1.00 22.41 ? 74   HIS A CE1   1 
ATOM   590   N  NE2   . HIS A 1 74  ? 34.093  18.994  48.321  1.00 23.15 ? 74   HIS A NE2   1 
ATOM   591   N  N     . ALA A 1 75  ? 31.350  17.914  44.440  1.00 22.14 ? 75   ALA A N     1 
ATOM   592   C  CA    . ALA A 1 75  ? 31.120  19.146  43.666  1.00 21.94 ? 75   ALA A CA    1 
ATOM   593   C  C     . ALA A 1 75  ? 30.611  18.848  42.247  1.00 22.30 ? 75   ALA A C     1 
ATOM   594   O  O     . ALA A 1 75  ? 30.452  19.758  41.426  1.00 22.44 ? 75   ALA A O     1 
ATOM   595   C  CB    . ALA A 1 75  ? 32.395  19.959  43.599  1.00 21.65 ? 75   ALA A CB    1 
ATOM   596   N  N     . VAL A 1 76  ? 30.315  17.578  41.988  1.00 22.53 ? 76   VAL A N     1 
ATOM   597   C  CA    . VAL A 1 76  ? 30.057  17.082  40.653  1.00 22.95 ? 76   VAL A CA    1 
ATOM   598   C  C     . VAL A 1 76  ? 28.853  17.757  39.985  1.00 23.30 ? 76   VAL A C     1 
ATOM   599   O  O     . VAL A 1 76  ? 28.940  18.177  38.850  1.00 22.92 ? 76   VAL A O     1 
ATOM   600   C  CB    . VAL A 1 76  ? 29.914  15.513  40.670  1.00 22.99 ? 76   VAL A CB    1 
ATOM   601   C  CG1   . VAL A 1 76  ? 28.576  15.062  41.249  1.00 23.08 ? 76   VAL A CG1   1 
ATOM   602   C  CG2   . VAL A 1 76  ? 30.115  14.939  39.296  1.00 22.77 ? 76   VAL A CG2   1 
ATOM   603   N  N     . GLU A 1 77  ? 27.748  17.881  40.707  1.00 24.35 ? 77   GLU A N     1 
ATOM   604   C  CA    . GLU A 1 77  ? 26.477  18.326  40.129  1.00 25.17 ? 77   GLU A CA    1 
ATOM   605   C  C     . GLU A 1 77  ? 26.594  19.740  39.572  1.00 25.29 ? 77   GLU A C     1 
ATOM   606   O  O     . GLU A 1 77  ? 25.975  20.079  38.560  1.00 25.64 ? 77   GLU A O     1 
ATOM   607   C  CB    . GLU A 1 77  ? 25.350  18.262  41.182  1.00 25.65 ? 77   GLU A CB    1 
ATOM   608   C  CG    . GLU A 1 77  ? 23.984  17.869  40.612  1.00 27.61 ? 77   GLU A CG    1 
ATOM   609   C  CD    . GLU A 1 77  ? 22.788  18.473  41.358  1.00 29.07 ? 77   GLU A CD    1 
ATOM   610   O  OE1   . GLU A 1 77  ? 22.970  19.095  42.451  1.00 29.75 ? 77   GLU A OE1   1 
ATOM   611   O  OE2   . GLU A 1 77  ? 21.654  18.313  40.828  1.00 28.59 ? 77   GLU A OE2   1 
ATOM   612   N  N     . ASN A 1 78  ? 27.386  20.557  40.254  1.00 25.64 ? 78   ASN A N     1 
ATOM   613   C  CA    . ASN A 1 78  ? 27.672  21.931  39.846  1.00 25.80 ? 78   ASN A CA    1 
ATOM   614   C  C     . ASN A 1 78  ? 28.342  21.958  38.468  1.00 25.65 ? 78   ASN A C     1 
ATOM   615   O  O     . ASN A 1 78  ? 27.918  22.687  37.569  1.00 25.84 ? 78   ASN A O     1 
ATOM   616   C  CB    . ASN A 1 78  ? 28.573  22.592  40.901  1.00 25.94 ? 78   ASN A CB    1 
ATOM   617   C  CG    . ASN A 1 78  ? 28.572  24.100  40.811  1.00 26.29 ? 78   ASN A CG    1 
ATOM   618   O  OD1   . ASN A 1 78  ? 29.572  24.729  40.408  1.00 24.98 ? 78   ASN A OD1   1 
ATOM   619   N  ND2   . ASN A 1 78  ? 27.455  24.698  41.204  1.00 26.35 ? 78   ASN A ND2   1 
ATOM   620   N  N     . TYR A 1 79  ? 29.380  21.142  38.318  1.00 25.44 ? 79   TYR A N     1 
ATOM   621   C  CA    . TYR A 1 79  ? 30.145  21.059  37.080  1.00 25.16 ? 79   TYR A CA    1 
ATOM   622   C  C     . TYR A 1 79  ? 29.376  20.409  35.946  1.00 25.24 ? 79   TYR A C     1 
ATOM   623   O  O     . TYR A 1 79  ? 29.551  20.775  34.791  1.00 25.88 ? 79   TYR A O     1 
ATOM   624   C  CB    . TYR A 1 79  ? 31.472  20.347  37.337  1.00 24.97 ? 79   TYR A CB    1 
ATOM   625   C  CG    . TYR A 1 79  ? 32.442  21.234  38.110  1.00 24.60 ? 79   TYR A CG    1 
ATOM   626   C  CD1   . TYR A 1 79  ? 33.031  22.325  37.504  1.00 23.69 ? 79   TYR A CD1   1 
ATOM   627   C  CD2   . TYR A 1 79  ? 32.741  20.993  39.444  1.00 23.48 ? 79   TYR A CD2   1 
ATOM   628   C  CE1   . TYR A 1 79  ? 33.896  23.128  38.184  1.00 24.48 ? 79   TYR A CE1   1 
ATOM   629   C  CE2   . TYR A 1 79  ? 33.609  21.796  40.135  1.00 23.11 ? 79   TYR A CE2   1 
ATOM   630   C  CZ    . TYR A 1 79  ? 34.184  22.862  39.501  1.00 23.74 ? 79   TYR A CZ    1 
ATOM   631   O  OH    . TYR A 1 79  ? 35.044  23.691  40.166  1.00 22.20 ? 79   TYR A OH    1 
ATOM   632   N  N     . LEU A 1 80  ? 28.507  19.464  36.271  1.00 25.28 ? 80   LEU A N     1 
ATOM   633   C  CA    . LEU A 1 80  ? 27.658  18.821  35.275  1.00 25.00 ? 80   LEU A CA    1 
ATOM   634   C  C     . LEU A 1 80  ? 26.671  19.798  34.679  1.00 25.07 ? 80   LEU A C     1 
ATOM   635   O  O     . LEU A 1 80  ? 26.312  19.680  33.514  1.00 25.29 ? 80   LEU A O     1 
ATOM   636   C  CB    . LEU A 1 80  ? 26.874  17.683  35.915  1.00 25.02 ? 80   LEU A CB    1 
ATOM   637   C  CG    . LEU A 1 80  ? 27.682  16.472  36.344  1.00 24.74 ? 80   LEU A CG    1 
ATOM   638   C  CD1   . LEU A 1 80  ? 26.713  15.459  36.937  1.00 25.87 ? 80   LEU A CD1   1 
ATOM   639   C  CD2   . LEU A 1 80  ? 28.456  15.861  35.191  1.00 24.34 ? 80   LEU A CD2   1 
ATOM   640   N  N     . ALA A 1 81  ? 26.206  20.736  35.501  1.00 25.35 ? 81   ALA A N     1 
ATOM   641   C  CA    . ALA A 1 81  ? 25.333  21.824  35.053  1.00 25.37 ? 81   ALA A CA    1 
ATOM   642   C  C     . ALA A 1 81  ? 26.053  22.775  34.080  1.00 25.69 ? 81   ALA A C     1 
ATOM   643   O  O     . ALA A 1 81  ? 25.486  23.143  33.061  1.00 26.04 ? 81   ALA A O     1 
ATOM   644   C  CB    . ALA A 1 81  ? 24.795  22.584  36.242  1.00 25.23 ? 81   ALA A CB    1 
ATOM   645   N  N     . LYS A 1 82  ? 27.296  23.155  34.378  1.00 25.79 ? 82   LYS A N     1 
ATOM   646   C  CA    . LYS A 1 82  ? 28.099  23.953  33.448  1.00 25.96 ? 82   LYS A CA    1 
ATOM   647   C  C     . LYS A 1 82  ? 28.275  23.244  32.096  1.00 26.03 ? 82   LYS A C     1 
ATOM   648   O  O     . LYS A 1 82  ? 28.353  23.901  31.059  1.00 25.82 ? 82   LYS A O     1 
ATOM   649   C  CB    . LYS A 1 82  ? 29.473  24.283  34.049  1.00 26.22 ? 82   LYS A CB    1 
ATOM   650   C  CG    . LYS A 1 82  ? 29.445  25.182  35.312  1.00 27.24 ? 82   LYS A CG    1 
ATOM   651   C  CD    . LYS A 1 82  ? 30.554  26.281  35.342  1.00 28.46 ? 82   LYS A CD    1 
ATOM   652   C  CE    . LYS A 1 82  ? 31.659  25.991  36.400  1.00 29.31 ? 82   LYS A CE    1 
ATOM   653   N  NZ    . LYS A 1 82  ? 32.798  26.992  36.406  1.00 28.22 ? 82   LYS A NZ    1 
ATOM   654   N  N     . LEU A 1 83  ? 28.313  21.909  32.107  1.00 26.10 ? 83   LEU A N     1 
ATOM   655   C  CA    . LEU A 1 83  ? 28.539  21.123  30.889  1.00 26.21 ? 83   LEU A CA    1 
ATOM   656   C  C     . LEU A 1 83  ? 27.283  20.826  30.092  1.00 26.27 ? 83   LEU A C     1 
ATOM   657   O  O     . LEU A 1 83  ? 27.324  20.727  28.867  1.00 26.45 ? 83   LEU A O     1 
ATOM   658   C  CB    . LEU A 1 83  ? 29.201  19.793  31.223  1.00 26.16 ? 83   LEU A CB    1 
ATOM   659   C  CG    . LEU A 1 83  ? 30.646  19.924  31.670  1.00 27.24 ? 83   LEU A CG    1 
ATOM   660   C  CD1   . LEU A 1 83  ? 31.134  18.621  32.347  1.00 27.85 ? 83   LEU A CD1   1 
ATOM   661   C  CD2   . LEU A 1 83  ? 31.570  20.347  30.502  1.00 27.13 ? 83   LEU A CD2   1 
ATOM   662   N  N     . VAL A 1 84  ? 26.163  20.645  30.766  1.00 26.33 ? 84   VAL A N     1 
ATOM   663   C  CA    . VAL A 1 84  ? 24.965  20.301  30.038  1.00 26.33 ? 84   VAL A CA    1 
ATOM   664   C  C     . VAL A 1 84  ? 24.342  21.583  29.509  1.00 26.00 ? 84   VAL A C     1 
ATOM   665   O  O     . VAL A 1 84  ? 23.675  21.574  28.476  1.00 25.89 ? 84   VAL A O     1 
ATOM   666   C  CB    . VAL A 1 84  ? 24.010  19.443  30.880  1.00 26.59 ? 84   VAL A CB    1 
ATOM   667   C  CG1   . VAL A 1 84  ? 22.907  20.282  31.535  1.00 26.91 ? 84   VAL A CG1   1 
ATOM   668   C  CG2   . VAL A 1 84  ? 23.435  18.335  30.002  1.00 26.75 ? 84   VAL A CG2   1 
ATOM   669   N  N     . ASN A 1 85  ? 24.618  22.693  30.183  1.00 25.72 ? 85   ASN A N     1 
ATOM   670   C  CA    . ASN A 1 85  ? 24.227  24.009  29.666  1.00 25.92 ? 85   ASN A CA    1 
ATOM   671   C  C     . ASN A 1 85  ? 25.006  24.411  28.415  1.00 25.16 ? 85   ASN A C     1 
ATOM   672   O  O     . ASN A 1 85  ? 24.648  25.381  27.761  1.00 25.14 ? 85   ASN A O     1 
ATOM   673   C  CB    . ASN A 1 85  ? 24.360  25.101  30.740  1.00 26.08 ? 85   ASN A CB    1 
ATOM   674   C  CG    . ASN A 1 85  ? 23.516  24.809  31.987  1.00 27.43 ? 85   ASN A CG    1 
ATOM   675   O  OD1   . ASN A 1 85  ? 22.495  24.105  31.924  1.00 29.25 ? 85   ASN A OD1   1 
ATOM   676   N  ND2   . ASN A 1 85  ? 23.955  25.331  33.132  1.00 28.92 ? 85   ASN A ND2   1 
ATOM   677   N  N     . GLN A 1 86  ? 26.058  23.663  28.081  1.00 24.47 ? 86   GLN A N     1 
ATOM   678   C  CA    . GLN A 1 86  ? 26.883  23.956  26.903  1.00 23.60 ? 86   GLN A CA    1 
ATOM   679   C  C     . GLN A 1 86  ? 26.728  22.914  25.807  1.00 22.87 ? 86   GLN A C     1 
ATOM   680   O  O     . GLN A 1 86  ? 27.396  22.997  24.773  1.00 22.39 ? 86   GLN A O     1 
ATOM   681   C  CB    . GLN A 1 86  ? 28.350  24.070  27.321  1.00 23.68 ? 86   GLN A CB    1 
ATOM   682   C  CG    . GLN A 1 86  ? 28.608  25.237  28.271  1.00 23.46 ? 86   GLN A CG    1 
ATOM   683   C  CD    . GLN A 1 86  ? 30.069  25.429  28.601  1.00 23.11 ? 86   GLN A CD    1 
ATOM   684   O  OE1   . GLN A 1 86  ? 30.913  25.250  27.740  1.00 24.04 ? 86   GLN A OE1   1 
ATOM   685   N  NE2   . GLN A 1 86  ? 30.368  25.814  29.838  1.00 22.67 ? 86   GLN A NE2   1 
ATOM   686   N  N     . GLY A 1 87  ? 25.845  21.942  26.040  1.00 22.10 ? 87   GLY A N     1 
ATOM   687   C  CA    . GLY A 1 87  ? 25.526  20.920  25.062  1.00 21.54 ? 87   GLY A CA    1 
ATOM   688   C  C     . GLY A 1 87  ? 26.428  19.714  25.158  1.00 21.06 ? 87   GLY A C     1 
ATOM   689   O  O     . GLY A 1 87  ? 26.449  18.908  24.238  1.00 20.66 ? 87   GLY A O     1 
ATOM   690   N  N     . GLU A 1 88  ? 27.154  19.585  26.272  1.00 20.90 ? 88   GLU A N     1 
ATOM   691   C  CA    . GLU A 1 88  ? 28.164  18.521  26.452  1.00 20.81 ? 88   GLU A CA    1 
ATOM   692   C  C     . GLU A 1 88  ? 27.625  17.306  27.178  1.00 19.86 ? 88   GLU A C     1 
ATOM   693   O  O     . GLU A 1 88  ? 26.887  17.431  28.137  1.00 19.14 ? 88   GLU A O     1 
ATOM   694   C  CB    . GLU A 1 88  ? 29.363  19.033  27.255  1.00 21.08 ? 88   GLU A CB    1 
ATOM   695   C  CG    . GLU A 1 88  ? 30.048  20.257  26.669  1.00 22.57 ? 88   GLU A CG    1 
ATOM   696   C  CD    . GLU A 1 88  ? 31.044  19.910  25.580  1.00 24.35 ? 88   GLU A CD    1 
ATOM   697   O  OE1   . GLU A 1 88  ? 31.548  20.857  24.945  1.00 27.13 ? 88   GLU A OE1   1 
ATOM   698   O  OE2   . GLU A 1 88  ? 31.332  18.706  25.357  1.00 25.90 ? 88   GLU A OE2   1 
ATOM   699   N  N     . SER A 1 89  ? 28.027  16.125  26.736  1.00 19.38 ? 89   SER A N     1 
ATOM   700   C  CA    . SER A 1 89  ? 27.704  14.908  27.472  1.00 19.04 ? 89   SER A CA    1 
ATOM   701   C  C     . SER A 1 89  ? 28.880  14.483  28.330  1.00 18.79 ? 89   SER A C     1 
ATOM   702   O  O     . SER A 1 89  ? 30.021  14.771  27.985  1.00 18.91 ? 89   SER A O     1 
ATOM   703   C  CB    . SER A 1 89  ? 27.321  13.802  26.516  1.00 18.87 ? 89   SER A CB    1 
ATOM   704   O  OG    . SER A 1 89  ? 26.416  14.301  25.549  1.00 18.89 ? 89   SER A OG    1 
ATOM   705   N  N     . VAL A 1 90  ? 28.599  13.844  29.466  1.00 18.74 ? 90   VAL A N     1 
ATOM   706   C  CA    . VAL A 1 90  ? 29.631  13.218  30.269  1.00 18.93 ? 90   VAL A CA    1 
ATOM   707   C  C     . VAL A 1 90  ? 29.279  11.788  30.615  1.00 19.16 ? 90   VAL A C     1 
ATOM   708   O  O     . VAL A 1 90  ? 28.201  11.507  31.130  1.00 19.38 ? 90   VAL A O     1 
ATOM   709   C  CB    . VAL A 1 90  ? 29.835  13.900  31.599  1.00 19.05 ? 90   VAL A CB    1 
ATOM   710   C  CG1   . VAL A 1 90  ? 31.153  13.447  32.181  1.00 19.87 ? 90   VAL A CG1   1 
ATOM   711   C  CG2   . VAL A 1 90  ? 29.833  15.395  31.468  1.00 19.54 ? 90   VAL A CG2   1 
ATOM   712   N  N     . ALA A 1 91  ? 30.205  10.878  30.365  1.00 19.40 ? 91   ALA A N     1 
ATOM   713   C  CA    . ALA A 1 91  ? 30.123  9.556   30.954  1.00 19.33 ? 91   ALA A CA    1 
ATOM   714   C  C     . ALA A 1 91  ? 30.676  9.641   32.368  1.00 19.41 ? 91   ALA A C     1 
ATOM   715   O  O     . ALA A 1 91  ? 31.793  10.094  32.565  1.00 19.38 ? 91   ALA A O     1 
ATOM   716   C  CB    . ALA A 1 91  ? 30.888  8.560   30.123  1.00 19.58 ? 91   ALA A CB    1 
ATOM   717   N  N     . ILE A 1 92  ? 29.865  9.248   33.343  1.00 19.40 ? 92   ILE A N     1 
ATOM   718   C  CA    . ILE A 1 92  ? 30.277  9.160   34.725  1.00 19.81 ? 92   ILE A CA    1 
ATOM   719   C  C     . ILE A 1 92  ? 30.744  7.713   35.061  1.00 20.77 ? 92   ILE A C     1 
ATOM   720   O  O     . ILE A 1 92  ? 29.976  6.746   34.998  1.00 20.95 ? 92   ILE A O     1 
ATOM   721   C  CB    . ILE A 1 92  ? 29.129  9.549   35.645  1.00 19.44 ? 92   ILE A CB    1 
ATOM   722   C  CG1   . ILE A 1 92  ? 28.400  10.801  35.164  1.00 20.31 ? 92   ILE A CG1   1 
ATOM   723   C  CG2   . ILE A 1 92  ? 29.649  9.797   37.027  1.00 20.49 ? 92   ILE A CG2   1 
ATOM   724   C  CD1   . ILE A 1 92  ? 29.143  12.101  35.399  1.00 21.32 ? 92   ILE A CD1   1 
ATOM   725   N  N     . CYS A 1 93  ? 32.007  7.588   35.448  1.00 21.48 ? 93   CYS A N     1 
ATOM   726   C  CA    . CYS A 1 93  ? 32.614  6.320   35.815  1.00 21.90 ? 93   CYS A CA    1 
ATOM   727   C  C     . CYS A 1 93  ? 32.738  6.279   37.324  1.00 21.58 ? 93   CYS A C     1 
ATOM   728   O  O     . CYS A 1 93  ? 33.275  7.220   37.903  1.00 22.06 ? 93   CYS A O     1 
ATOM   729   C  CB    . CYS A 1 93  ? 34.012  6.250   35.212  1.00 21.82 ? 93   CYS A CB    1 
ATOM   730   S  SG    . CYS A 1 93  ? 34.885  4.758   35.654  1.00 25.94 ? 93   CYS A SG    1 
ATOM   731   N  N     . GLU A 1 94  ? 32.253  5.211   37.963  1.00 21.08 ? 94   GLU A N     1 
ATOM   732   C  CA    . GLU A 1 94  ? 32.363  5.049   39.426  1.00 20.43 ? 94   GLU A CA    1 
ATOM   733   C  C     . GLU A 1 94  ? 33.149  3.800   39.774  1.00 19.80 ? 94   GLU A C     1 
ATOM   734   O  O     . GLU A 1 94  ? 33.433  2.972   38.914  1.00 19.51 ? 94   GLU A O     1 
ATOM   735   C  CB    . GLU A 1 94  ? 30.988  4.959   40.107  1.00 20.22 ? 94   GLU A CB    1 
ATOM   736   C  CG    . GLU A 1 94  ? 30.022  6.082   39.765  1.00 20.76 ? 94   GLU A CG    1 
ATOM   737   C  CD    . GLU A 1 94  ? 30.271  7.389   40.502  1.00 20.67 ? 94   GLU A CD    1 
ATOM   738   O  OE1   . GLU A 1 94  ? 31.185  7.490   41.340  1.00 20.00 ? 94   GLU A OE1   1 
ATOM   739   O  OE2   . GLU A 1 94  ? 29.523  8.338   40.229  1.00 21.50 ? 94   GLU A OE2   1 
ATOM   740   N  N     . GLN A 1 95  ? 33.480  3.676   41.053  1.00 19.28 ? 95   GLN A N     1 
ATOM   741   C  CA    . GLN A 1 95  ? 34.167  2.506   41.564  1.00 19.16 ? 95   GLN A CA    1 
ATOM   742   C  C     . GLN A 1 95  ? 33.135  1.551   42.092  1.00 19.42 ? 95   GLN A C     1 
ATOM   743   O  O     . GLN A 1 95  ? 32.363  1.923   42.924  1.00 19.28 ? 95   GLN A O     1 
ATOM   744   C  CB    . GLN A 1 95  ? 35.119  2.922   42.671  1.00 18.65 ? 95   GLN A CB    1 
ATOM   745   C  CG    . GLN A 1 95  ? 36.174  3.882   42.173  1.00 17.95 ? 95   GLN A CG    1 
ATOM   746   C  CD    . GLN A 1 95  ? 37.043  4.476   43.260  1.00 17.09 ? 95   GLN A CD    1 
ATOM   747   O  OE1   . GLN A 1 95  ? 38.115  4.991   42.975  1.00 16.82 ? 95   GLN A OE1   1 
ATOM   748   N  NE2   . GLN A 1 95  ? 36.580  4.428   44.490  1.00 16.30 ? 95   GLN A NE2   1 
ATOM   749   N  N     . ILE A 1 96  ? 33.100  0.331   41.582  1.00 20.79 ? 96   ILE A N     1 
ATOM   750   C  CA    . ILE A 1 96  ? 32.177  -0.692  42.080  1.00 21.80 ? 96   ILE A CA    1 
ATOM   751   C  C     . ILE A 1 96  ? 32.792  -1.491  43.203  1.00 22.53 ? 96   ILE A C     1 
ATOM   752   O  O     . ILE A 1 96  ? 32.148  -1.767  44.209  1.00 22.75 ? 96   ILE A O     1 
ATOM   753   C  CB    . ILE A 1 96  ? 31.782  -1.704  40.980  1.00 21.95 ? 96   ILE A CB    1 
ATOM   754   C  CG1   . ILE A 1 96  ? 31.399  -1.007  39.673  1.00 22.27 ? 96   ILE A CG1   1 
ATOM   755   C  CG2   . ILE A 1 96  ? 30.635  -2.588  41.492  1.00 22.30 ? 96   ILE A CG2   1 
ATOM   756   C  CD1   . ILE A 1 96  ? 30.217  -0.042  39.810  1.00 23.67 ? 96   ILE A CD1   1 
ATOM   757   N  N     . GLY A 1 97  ? 34.037  -1.894  42.998  1.00 23.52 ? 97   GLY A N     1 
ATOM   758   C  CA    . GLY A 1 97  ? 34.697  -2.806  43.895  1.00 24.36 ? 97   GLY A CA    1 
ATOM   759   C  C     . GLY A 1 97  ? 35.025  -2.242  45.267  1.00 25.37 ? 97   GLY A C     1 
ATOM   760   O  O     . GLY A 1 97  ? 34.394  -1.300  45.765  1.00 25.83 ? 97   GLY A O     1 
ATOM   761   N  N     . ASP A 1 98  ? 36.029  -2.864  45.876  1.00 26.19 ? 98   ASP A N     1 
ATOM   762   C  CA    . ASP A 1 98  ? 36.445  -2.591  47.234  1.00 26.61 ? 98   ASP A CA    1 
ATOM   763   C  C     . ASP A 1 98  ? 37.975  -2.659  47.251  1.00 26.88 ? 98   ASP A C     1 
ATOM   764   O  O     . ASP A 1 98  ? 38.535  -3.757  47.187  1.00 27.24 ? 98   ASP A O     1 
ATOM   765   C  CB    . ASP A 1 98  ? 35.863  -3.657  48.157  1.00 26.79 ? 98   ASP A CB    1 
ATOM   766   C  CG    . ASP A 1 98  ? 36.439  -3.594  49.551  1.00 27.22 ? 98   ASP A CG    1 
ATOM   767   O  OD1   . ASP A 1 98  ? 35.905  -4.293  50.434  1.00 27.57 ? 98   ASP A OD1   1 
ATOM   768   O  OD2   . ASP A 1 98  ? 37.416  -2.871  49.855  1.00 27.13 ? 98   ASP A OD2   1 
ATOM   769   N  N     . PRO A 1 99  ? 38.656  -1.512  47.342  1.00 26.85 ? 99   PRO A N     1 
ATOM   770   C  CA    . PRO A 1 99  ? 40.127  -1.474  47.221  1.00 26.67 ? 99   PRO A CA    1 
ATOM   771   C  C     . PRO A 1 99  ? 40.879  -2.489  48.093  1.00 26.40 ? 99   PRO A C     1 
ATOM   772   O  O     . PRO A 1 99  ? 41.982  -2.878  47.710  1.00 26.49 ? 99   PRO A O     1 
ATOM   773   C  CB    . PRO A 1 99  ? 40.473  -0.053  47.669  1.00 26.62 ? 99   PRO A CB    1 
ATOM   774   C  CG    . PRO A 1 99  ? 39.228  0.736   47.423  1.00 26.42 ? 99   PRO A CG    1 
ATOM   775   C  CD    . PRO A 1 99  ? 38.087  -0.176  47.626  1.00 26.63 ? 99   PRO A CD    1 
ATOM   776   N  N     . ALA A 1 100 ? 40.296  -2.879  49.227  1.00 26.13 ? 100  ALA A N     1 
ATOM   777   C  CA    . ALA A 1 100 ? 40.917  -3.807  50.183  1.00 26.37 ? 100  ALA A CA    1 
ATOM   778   C  C     . ALA A 1 100 ? 40.900  -5.287  49.757  1.00 26.39 ? 100  ALA A C     1 
ATOM   779   O  O     . ALA A 1 100 ? 41.771  -6.059  50.164  1.00 26.56 ? 100  ALA A O     1 
ATOM   780   C  CB    . ALA A 1 100 ? 40.262  -3.655  51.575  1.00 26.24 ? 100  ALA A CB    1 
ATOM   781   N  N     . THR A 1 101 ? 39.895  -5.682  48.979  1.00 26.29 ? 101  THR A N     1 
ATOM   782   C  CA    . THR A 1 101 ? 39.844  -7.007  48.363  1.00 26.12 ? 101  THR A CA    1 
ATOM   783   C  C     . THR A 1 101 ? 40.144  -6.891  46.870  1.00 26.37 ? 101  THR A C     1 
ATOM   784   O  O     . THR A 1 101 ? 39.435  -7.460  46.039  1.00 26.62 ? 101  THR A O     1 
ATOM   785   C  CB    . THR A 1 101 ? 38.451  -7.627  48.565  1.00 26.05 ? 101  THR A CB    1 
ATOM   786   O  OG1   . THR A 1 101 ? 37.457  -6.816  47.919  1.00 25.25 ? 101  THR A OG1   1 
ATOM   787   C  CG2   . THR A 1 101 ? 38.055  -7.626  50.039  1.00 25.63 ? 101  THR A CG2   1 
ATOM   788   N  N     . SER A 1 102 ? 41.196  -6.151  46.533  1.00 26.48 ? 102  SER A N     1 
ATOM   789   C  CA    . SER A 1 102 ? 41.485  -5.808  45.145  1.00 26.48 ? 102  SER A CA    1 
ATOM   790   C  C     . SER A 1 102 ? 42.980  -5.606  44.966  1.00 26.65 ? 102  SER A C     1 
ATOM   791   O  O     . SER A 1 102 ? 43.543  -4.595  45.411  1.00 26.69 ? 102  SER A O     1 
ATOM   792   C  CB    . SER A 1 102 ? 40.740  -4.526  44.744  1.00 26.53 ? 102  SER A CB    1 
ATOM   793   O  OG    . SER A 1 102 ? 39.513  -4.809  44.097  1.00 26.31 ? 102  SER A OG    1 
ATOM   794   N  N     . LYS A 1 103 ? 43.617  -6.574  44.310  1.00 26.83 ? 103  LYS A N     1 
ATOM   795   C  CA    . LYS A 1 103 ? 45.059  -6.530  44.077  1.00 26.91 ? 103  LYS A CA    1 
ATOM   796   C  C     . LYS A 1 103 ? 45.397  -5.337  43.193  1.00 26.48 ? 103  LYS A C     1 
ATOM   797   O  O     . LYS A 1 103 ? 46.170  -4.466  43.596  1.00 26.66 ? 103  LYS A O     1 
ATOM   798   C  CB    . LYS A 1 103 ? 45.576  -7.832  43.435  1.00 27.03 ? 103  LYS A CB    1 
ATOM   799   C  CG    . LYS A 1 103 ? 46.991  -7.708  42.807  1.00 27.77 ? 103  LYS A CG    1 
ATOM   800   C  CD    . LYS A 1 103 ? 47.779  -9.032  42.818  1.00 28.20 ? 103  LYS A CD    1 
ATOM   801   C  CE    . LYS A 1 103 ? 49.177  -8.878  42.196  1.00 27.48 ? 103  LYS A CE    1 
ATOM   802   N  NZ    . LYS A 1 103 ? 50.216  -9.587  42.995  1.00 26.60 ? 103  LYS A NZ    1 
ATOM   803   N  N     . GLY A 1 104 ? 44.814  -5.312  41.995  1.00 25.87 ? 104  GLY A N     1 
ATOM   804   C  CA    . GLY A 1 104 ? 45.032  -4.232  41.045  1.00 25.29 ? 104  GLY A CA    1 
ATOM   805   C  C     . GLY A 1 104 ? 44.084  -3.082  41.315  1.00 24.81 ? 104  GLY A C     1 
ATOM   806   O  O     . GLY A 1 104 ? 43.618  -2.904  42.449  1.00 25.10 ? 104  GLY A O     1 
ATOM   807   N  N     . PRO A 1 105 ? 43.810  -2.273  40.297  1.00 24.09 ? 105  PRO A N     1 
ATOM   808   C  CA    . PRO A 1 105 ? 42.730  -1.290  40.385  1.00 23.50 ? 105  PRO A CA    1 
ATOM   809   C  C     . PRO A 1 105 ? 41.375  -1.922  40.700  1.00 23.07 ? 105  PRO A C     1 
ATOM   810   O  O     . PRO A 1 105 ? 40.997  -2.954  40.141  1.00 23.46 ? 105  PRO A O     1 
ATOM   811   C  CB    . PRO A 1 105 ? 42.706  -0.667  38.992  1.00 23.17 ? 105  PRO A CB    1 
ATOM   812   C  CG    . PRO A 1 105 ? 44.062  -0.826  38.508  1.00 23.77 ? 105  PRO A CG    1 
ATOM   813   C  CD    . PRO A 1 105 ? 44.530  -2.168  39.018  1.00 24.15 ? 105  PRO A CD    1 
ATOM   814   N  N     . VAL A 1 106 ? 40.669  -1.298  41.628  1.00 22.36 ? 106  VAL A N     1 
ATOM   815   C  CA    . VAL A 1 106 ? 39.272  -1.583  41.874  1.00 21.76 ? 106  VAL A CA    1 
ATOM   816   C  C     . VAL A 1 106 ? 38.492  -1.582  40.556  1.00 21.29 ? 106  VAL A C     1 
ATOM   817   O  O     . VAL A 1 106 ? 38.946  -1.045  39.551  1.00 20.96 ? 106  VAL A O     1 
ATOM   818   C  CB    . VAL A 1 106 ? 38.716  -0.553  42.891  1.00 21.87 ? 106  VAL A CB    1 
ATOM   819   C  CG1   . VAL A 1 106 ? 38.580  0.831   42.264  1.00 21.66 ? 106  VAL A CG1   1 
ATOM   820   C  CG2   . VAL A 1 106 ? 37.408  -1.013  43.497  1.00 22.21 ? 106  VAL A CG2   1 
ATOM   821   N  N     . GLU A 1 107 ? 37.330  -2.222  40.565  1.00 21.36 ? 107  GLU A N     1 
ATOM   822   C  CA    . GLU A 1 107 ? 36.507  -2.383  39.370  1.00 21.46 ? 107  GLU A CA    1 
ATOM   823   C  C     . GLU A 1 107 ? 35.780  -1.092  39.155  1.00 21.38 ? 107  GLU A C     1 
ATOM   824   O  O     . GLU A 1 107 ? 35.470  -0.393  40.130  1.00 21.43 ? 107  GLU A O     1 
ATOM   825   C  CB    . GLU A 1 107 ? 35.490  -3.514  39.544  1.00 21.72 ? 107  GLU A CB    1 
ATOM   826   C  CG    . GLU A 1 107 ? 35.175  -4.295  38.276  1.00 22.47 ? 107  GLU A CG    1 
ATOM   827   C  CD    . GLU A 1 107 ? 33.795  -4.964  38.304  1.00 23.89 ? 107  GLU A CD    1 
ATOM   828   O  OE1   . GLU A 1 107 ? 33.111  -4.951  39.367  1.00 22.29 ? 107  GLU A OE1   1 
ATOM   829   O  OE2   . GLU A 1 107 ? 33.400  -5.518  37.245  1.00 24.82 ? 107  GLU A OE2   1 
ATOM   830   N  N     . ARG A 1 108 ? 35.509  -0.779  37.885  1.00 21.07 ? 108  ARG A N     1 
ATOM   831   C  CA    . ARG A 1 108 ? 34.892  0.492   37.515  1.00 20.53 ? 108  ARG A CA    1 
ATOM   832   C  C     . ARG A 1 108 ? 33.964  0.390   36.288  1.00 20.42 ? 108  ARG A C     1 
ATOM   833   O  O     . ARG A 1 108 ? 34.390  -0.037  35.213  1.00 20.32 ? 108  ARG A O     1 
ATOM   834   C  CB    . ARG A 1 108 ? 35.984  1.510   37.217  1.00 20.23 ? 108  ARG A CB    1 
ATOM   835   C  CG    . ARG A 1 108 ? 36.861  1.899   38.372  1.00 19.69 ? 108  ARG A CG    1 
ATOM   836   C  CD    . ARG A 1 108 ? 37.640  3.188   38.078  1.00 19.57 ? 108  ARG A CD    1 
ATOM   837   N  NE    . ARG A 1 108 ? 38.276  3.765   39.264  1.00 18.85 ? 108  ARG A NE    1 
ATOM   838   C  CZ    . ARG A 1 108 ? 39.412  3.342   39.804  1.00 17.13 ? 108  ARG A CZ    1 
ATOM   839   N  NH1   . ARG A 1 108 ? 40.064  2.326   39.288  1.00 17.86 ? 108  ARG A NH1   1 
ATOM   840   N  NH2   . ARG A 1 108 ? 39.897  3.941   40.874  1.00 15.87 ? 108  ARG A NH2   1 
ATOM   841   N  N     . LYS A 1 109 ? 32.707  0.804   36.444  1.00 20.16 ? 109  LYS A N     1 
ATOM   842   C  CA    . LYS A 1 109 ? 31.764  0.852   35.326  1.00 20.04 ? 109  LYS A CA    1 
ATOM   843   C  C     . LYS A 1 109 ? 31.341  2.297   35.034  1.00 20.02 ? 109  LYS A C     1 
ATOM   844   O  O     . LYS A 1 109 ? 31.324  3.146   35.923  1.00 20.28 ? 109  LYS A O     1 
ATOM   845   C  CB    . LYS A 1 109 ? 30.510  0.020   35.642  1.00 20.01 ? 109  LYS A CB    1 
ATOM   846   C  CG    . LYS A 1 109 ? 30.684  -1.505  35.585  1.00 20.47 ? 109  LYS A CG    1 
ATOM   847   C  CD    . LYS A 1 109 ? 29.458  -2.260  36.211  1.00 21.36 ? 109  LYS A CD    1 
ATOM   848   C  CE    . LYS A 1 109 ? 28.784  -3.243  35.217  1.00 22.03 ? 109  LYS A CE    1 
ATOM   849   N  NZ    . LYS A 1 109 ? 29.386  -4.621  35.261  1.00 22.48 ? 109  LYS A NZ    1 
ATOM   850   N  N     . VAL A 1 110 ? 30.989  2.589   33.790  1.00 19.91 ? 110  VAL A N     1 
ATOM   851   C  CA    . VAL A 1 110 ? 30.212  3.786   33.554  1.00 19.76 ? 110  VAL A CA    1 
ATOM   852   C  C     . VAL A 1 110 ? 28.810  3.403   33.996  1.00 19.32 ? 110  VAL A C     1 
ATOM   853   O  O     . VAL A 1 110 ? 28.228  2.440   33.506  1.00 19.44 ? 110  VAL A O     1 
ATOM   854   C  CB    . VAL A 1 110 ? 30.285  4.271   32.101  1.00 20.07 ? 110  VAL A CB    1 
ATOM   855   C  CG1   . VAL A 1 110 ? 29.274  5.389   31.861  1.00 20.71 ? 110  VAL A CG1   1 
ATOM   856   C  CG2   . VAL A 1 110 ? 31.696  4.775   31.783  1.00 19.85 ? 110  VAL A CG2   1 
ATOM   857   N  N     . VAL A 1 111 ? 28.319  4.110   34.996  1.00 19.15 ? 111  VAL A N     1 
ATOM   858   C  CA    . VAL A 1 111 ? 26.988  3.885   35.552  1.00 18.95 ? 111  VAL A CA    1 
ATOM   859   C  C     . VAL A 1 111 ? 25.946  4.775   34.885  1.00 19.10 ? 111  VAL A C     1 
ATOM   860   O  O     . VAL A 1 111 ? 24.778  4.432   34.885  1.00 19.21 ? 111  VAL A O     1 
ATOM   861   C  CB    . VAL A 1 111 ? 26.936  4.118   37.095  1.00 18.72 ? 111  VAL A CB    1 
ATOM   862   C  CG1   . VAL A 1 111 ? 27.607  2.988   37.811  1.00 18.71 ? 111  VAL A CG1   1 
ATOM   863   C  CG2   . VAL A 1 111 ? 27.580  5.422   37.491  1.00 18.80 ? 111  VAL A CG2   1 
ATOM   864   N  N     . ARG A 1 112 ? 26.374  5.897   34.298  1.00 19.19 ? 112  ARG A N     1 
ATOM   865   C  CA    . ARG A 1 112 ? 25.445  6.905   33.786  1.00 18.76 ? 112  ARG A CA    1 
ATOM   866   C  C     . ARG A 1 112 ? 26.126  7.792   32.759  1.00 17.67 ? 112  ARG A C     1 
ATOM   867   O  O     . ARG A 1 112 ? 27.331  7.991   32.836  1.00 17.62 ? 112  ARG A O     1 
ATOM   868   C  CB    . ARG A 1 112 ? 24.941  7.739   34.959  1.00 19.08 ? 112  ARG A CB    1 
ATOM   869   C  CG    . ARG A 1 112 ? 24.517  9.193   34.641  1.00 22.36 ? 112  ARG A CG    1 
ATOM   870   C  CD    . ARG A 1 112 ? 23.553  9.834   35.701  1.00 25.91 ? 112  ARG A CD    1 
ATOM   871   N  NE    . ARG A 1 112 ? 24.194  10.699  36.728  1.00 28.44 ? 112  ARG A NE    1 
ATOM   872   C  CZ    . ARG A 1 112 ? 24.862  10.284  37.830  1.00 29.04 ? 112  ARG A CZ    1 
ATOM   873   N  NH1   . ARG A 1 112 ? 25.039  8.982   38.094  1.00 28.98 ? 112  ARG A NH1   1 
ATOM   874   N  NH2   . ARG A 1 112 ? 25.367  11.196  38.672  1.00 28.70 ? 112  ARG A NH2   1 
ATOM   875   N  N     . ILE A 1 113 ? 25.363  8.294   31.784  1.00 16.20 ? 113  ILE A N     1 
ATOM   876   C  CA    . ILE A 1 113 ? 25.820  9.377   30.916  1.00 15.30 ? 113  ILE A CA    1 
ATOM   877   C  C     . ILE A 1 113 ? 24.829  10.567  30.884  1.00 14.58 ? 113  ILE A C     1 
ATOM   878   O  O     . ILE A 1 113 ? 23.658  10.433  30.537  1.00 13.70 ? 113  ILE A O     1 
ATOM   879   C  CB    . ILE A 1 113 ? 26.071  8.885   29.494  1.00 15.41 ? 113  ILE A CB    1 
ATOM   880   C  CG1   . ILE A 1 113 ? 26.914  7.612   29.488  1.00 14.20 ? 113  ILE A CG1   1 
ATOM   881   C  CG2   . ILE A 1 113 ? 26.764  10.009  28.641  1.00 14.98 ? 113  ILE A CG2   1 
ATOM   882   C  CD1   . ILE A 1 113 ? 26.828  6.887   28.172  1.00 13.39 ? 113  ILE A CD1   1 
ATOM   883   N  N     . VAL A 1 114 ? 25.328  11.741  31.231  1.00 13.91 ? 114  VAL A N     1 
ATOM   884   C  CA    . VAL A 1 114 ? 24.514  12.945  31.253  1.00 13.46 ? 114  VAL A CA    1 
ATOM   885   C  C     . VAL A 1 114 ? 24.580  13.523  29.848  1.00 13.30 ? 114  VAL A C     1 
ATOM   886   O  O     . VAL A 1 114 ? 25.655  13.720  29.326  1.00 12.54 ? 114  VAL A O     1 
ATOM   887   C  CB    . VAL A 1 114 ? 25.039  13.922  32.329  1.00 13.10 ? 114  VAL A CB    1 
ATOM   888   C  CG1   . VAL A 1 114 ? 24.175  15.143  32.460  1.00 13.28 ? 114  VAL A CG1   1 
ATOM   889   C  CG2   . VAL A 1 114 ? 25.112  13.211  33.666  1.00 13.11 ? 114  VAL A CG2   1 
ATOM   890   N  N     . THR A 1 115 ? 23.430  13.707  29.209  1.00 13.74 ? 115  THR A N     1 
ATOM   891   C  CA    . THR A 1 115 ? 23.374  14.321  27.890  1.00 14.59 ? 115  THR A CA    1 
ATOM   892   C  C     . THR A 1 115 ? 22.201  15.288  27.879  1.00 15.55 ? 115  THR A C     1 
ATOM   893   O  O     . THR A 1 115 ? 21.277  15.106  28.656  1.00 15.03 ? 115  THR A O     1 
ATOM   894   C  CB    . THR A 1 115 ? 23.218  13.262  26.774  1.00 14.68 ? 115  THR A CB    1 
ATOM   895   O  OG1   . THR A 1 115 ? 21.871  12.779  26.739  1.00 14.96 ? 115  THR A OG1   1 
ATOM   896   C  CG2   . THR A 1 115 ? 24.060  11.989  27.052  1.00 14.44 ? 115  THR A CG2   1 
ATOM   897   N  N     . PRO A 1 116 ? 22.220  16.301  27.000  1.00 16.99 ? 116  PRO A N     1 
ATOM   898   C  CA    . PRO A 1 116 ? 21.251  17.399  27.075  1.00 17.57 ? 116  PRO A CA    1 
ATOM   899   C  C     . PRO A 1 116 ? 19.827  16.921  26.968  1.00 18.54 ? 116  PRO A C     1 
ATOM   900   O  O     . PRO A 1 116 ? 18.918  17.578  27.490  1.00 18.43 ? 116  PRO A O     1 
ATOM   901   C  CB    . PRO A 1 116 ? 21.637  18.294  25.885  1.00 17.85 ? 116  PRO A CB    1 
ATOM   902   C  CG    . PRO A 1 116 ? 23.064  17.994  25.609  1.00 16.73 ? 116  PRO A CG    1 
ATOM   903   C  CD    . PRO A 1 116 ? 23.154  16.508  25.872  1.00 17.31 ? 116  PRO A CD    1 
ATOM   904   N  N     . GLY A 1 117 ? 19.648  15.754  26.350  1.00 19.55 ? 117  GLY A N     1 
ATOM   905   C  CA    . GLY A 1 117 ? 18.326  15.202  26.121  1.00 19.93 ? 117  GLY A CA    1 
ATOM   906   C  C     . GLY A 1 117 ? 17.831  14.216  27.153  1.00 20.26 ? 117  GLY A C     1 
ATOM   907   O  O     . GLY A 1 117 ? 16.637  13.926  27.162  1.00 20.41 ? 117  GLY A O     1 
ATOM   908   N  N     . THR A 1 118 ? 18.722  13.703  27.998  1.00 20.62 ? 118  THR A N     1 
ATOM   909   C  CA    . THR A 1 118 ? 18.367  12.639  28.937  1.00 21.31 ? 118  THR A CA    1 
ATOM   910   C  C     . THR A 1 118 ? 18.541  13.055  30.381  1.00 21.98 ? 118  THR A C     1 
ATOM   911   O  O     . THR A 1 118 ? 18.659  12.189  31.247  1.00 22.26 ? 118  THR A O     1 
ATOM   912   C  CB    . THR A 1 118 ? 19.233  11.355  28.682  1.00 21.64 ? 118  THR A CB    1 
ATOM   913   O  OG1   . THR A 1 118 ? 20.640  11.656  28.762  1.00 21.39 ? 118  THR A OG1   1 
ATOM   914   C  CG2   . THR A 1 118 ? 19.039  10.830  27.271  1.00 21.08 ? 118  THR A CG2   1 
ATOM   915   N  N     . ILE A 1 119 ? 18.575  14.363  30.647  1.00 22.31 ? 119  ILE A N     1 
ATOM   916   C  CA    . ILE A 1 119 ? 18.654  14.833  32.011  1.00 22.69 ? 119  ILE A CA    1 
ATOM   917   C  C     . ILE A 1 119 ? 17.269  14.801  32.640  1.00 23.08 ? 119  ILE A C     1 
ATOM   918   O  O     . ILE A 1 119 ? 16.261  15.197  32.019  1.00 23.08 ? 119  ILE A O     1 
ATOM   919   C  CB    . ILE A 1 119 ? 19.241  16.266  32.143  1.00 22.86 ? 119  ILE A CB    1 
ATOM   920   C  CG1   . ILE A 1 119 ? 18.217  17.300  31.742  1.00 23.29 ? 119  ILE A CG1   1 
ATOM   921   C  CG2   . ILE A 1 119 ? 20.528  16.406  31.367  1.00 23.58 ? 119  ILE A CG2   1 
ATOM   922   C  CD1   . ILE A 1 119 ? 18.784  18.615  31.392  1.00 26.01 ? 119  ILE A CD1   1 
ATOM   923   N  N     . SER A 1 120 ? 17.247  14.352  33.893  1.00 23.18 ? 120  SER A N     1 
ATOM   924   C  CA    . SER A 1 120 ? 16.039  14.309  34.691  1.00 23.05 ? 120  SER A CA    1 
ATOM   925   C  C     . SER A 1 120 ? 16.158  15.079  36.004  1.00 23.38 ? 120  SER A C     1 
ATOM   926   O  O     . SER A 1 120 ? 15.167  15.198  36.717  1.00 24.03 ? 120  SER A O     1 
ATOM   927   C  CB    . SER A 1 120 ? 15.676  12.856  34.988  1.00 22.49 ? 120  SER A CB    1 
ATOM   928   O  OG    . SER A 1 120 ? 16.694  12.266  35.757  1.00 21.73 ? 120  SER A OG    1 
ATOM   929   N  N     . ASP A 1 121 ? 17.336  15.597  36.344  1.00 23.68 ? 121  ASP A N     1 
ATOM   930   C  CA    . ASP A 1 121 ? 17.518  16.246  37.647  1.00 23.99 ? 121  ASP A CA    1 
ATOM   931   C  C     . ASP A 1 121 ? 16.941  17.673  37.702  1.00 23.74 ? 121  ASP A C     1 
ATOM   932   O  O     . ASP A 1 121 ? 16.946  18.426  36.729  1.00 23.38 ? 121  ASP A O     1 
ATOM   933   C  CB    . ASP A 1 121 ? 18.997  16.246  38.074  1.00 24.71 ? 121  ASP A CB    1 
ATOM   934   C  CG    . ASP A 1 121 ? 19.509  14.844  38.479  1.00 25.56 ? 121  ASP A CG    1 
ATOM   935   O  OD1   . ASP A 1 121 ? 18.739  14.038  39.067  1.00 26.45 ? 121  ASP A OD1   1 
ATOM   936   O  OD2   . ASP A 1 121 ? 20.684  14.479  38.248  1.00 26.09 ? 121  ASP A OD2   1 
ATOM   937   N  N     . GLU A 1 122 ? 16.417  18.024  38.863  1.00 23.55 ? 122  GLU A N     1 
ATOM   938   C  CA    . GLU A 1 122 ? 15.740  19.287  39.026  1.00 23.23 ? 122  GLU A CA    1 
ATOM   939   C  C     . GLU A 1 122 ? 16.662  20.473  38.744  1.00 23.21 ? 122  GLU A C     1 
ATOM   940   O  O     . GLU A 1 122 ? 16.237  21.463  38.167  1.00 23.48 ? 122  GLU A O     1 
ATOM   941   C  CB    . GLU A 1 122 ? 15.199  19.376  40.431  1.00 23.02 ? 122  GLU A CB    1 
ATOM   942   C  CG    . GLU A 1 122 ? 14.141  20.440  40.574  1.00 22.95 ? 122  GLU A CG    1 
ATOM   943   C  CD    . GLU A 1 122 ? 13.530  20.464  41.949  1.00 22.08 ? 122  GLU A CD    1 
ATOM   944   O  OE1   . GLU A 1 122 ? 14.218  20.153  42.951  1.00 21.16 ? 122  GLU A OE1   1 
ATOM   945   O  OE2   . GLU A 1 122 ? 12.347  20.807  42.021  1.00 23.92 ? 122  GLU A OE2   1 
ATOM   946   N  N     . ALA A 1 123 ? 17.922  20.359  39.147  1.00 23.24 ? 123  ALA A N     1 
ATOM   947   C  CA    . ALA A 1 123 ? 18.904  21.434  38.977  1.00 23.12 ? 123  ALA A CA    1 
ATOM   948   C  C     . ALA A 1 123 ? 19.291  21.733  37.510  1.00 22.95 ? 123  ALA A C     1 
ATOM   949   O  O     . ALA A 1 123 ? 19.632  22.875  37.169  1.00 23.62 ? 123  ALA A O     1 
ATOM   950   C  CB    . ALA A 1 123 ? 20.161  21.113  39.795  1.00 23.06 ? 123  ALA A CB    1 
ATOM   951   N  N     . LEU A 1 124 ? 19.231  20.716  36.655  1.00 22.53 ? 124  LEU A N     1 
ATOM   952   C  CA    . LEU A 1 124 ? 19.658  20.817  35.260  1.00 21.99 ? 124  LEU A CA    1 
ATOM   953   C  C     . LEU A 1 124 ? 18.518  21.067  34.273  1.00 21.54 ? 124  LEU A C     1 
ATOM   954   O  O     . LEU A 1 124 ? 18.757  21.133  33.074  1.00 21.13 ? 124  LEU A O     1 
ATOM   955   C  CB    . LEU A 1 124 ? 20.393  19.535  34.834  1.00 22.27 ? 124  LEU A CB    1 
ATOM   956   C  CG    . LEU A 1 124 ? 21.357  18.810  35.797  1.00 22.52 ? 124  LEU A CG    1 
ATOM   957   C  CD1   . LEU A 1 124 ? 21.354  17.298  35.524  1.00 23.98 ? 124  LEU A CD1   1 
ATOM   958   C  CD2   . LEU A 1 124 ? 22.756  19.333  35.662  1.00 21.74 ? 124  LEU A CD2   1 
ATOM   959   N  N     . LEU A 1 125 ? 17.291  21.204  34.769  1.00 21.47 ? 125  LEU A N     1 
ATOM   960   C  CA    . LEU A 1 125 ? 16.117  21.415  33.916  1.00 21.40 ? 125  LEU A CA    1 
ATOM   961   C  C     . LEU A 1 125 ? 15.425  22.767  34.118  1.00 21.40 ? 125  LEU A C     1 
ATOM   962   O  O     . LEU A 1 125 ? 15.538  23.379  35.184  1.00 21.51 ? 125  LEU A O     1 
ATOM   963   C  CB    . LEU A 1 125 ? 15.094  20.341  34.217  1.00 21.19 ? 125  LEU A CB    1 
ATOM   964   C  CG    . LEU A 1 125 ? 15.335  18.958  33.657  1.00 21.69 ? 125  LEU A CG    1 
ATOM   965   C  CD1   . LEU A 1 125 ? 14.294  18.016  34.244  1.00 21.40 ? 125  LEU A CD1   1 
ATOM   966   C  CD2   . LEU A 1 125 ? 15.284  18.951  32.116  1.00 21.46 ? 125  LEU A CD2   1 
ATOM   967   N  N     . GLN A 1 126 ? 14.671  23.195  33.108  1.00 21.68 ? 126  GLN A N     1 
ATOM   968   C  CA    . GLN A 1 126 ? 13.773  24.360  33.231  1.00 22.05 ? 126  GLN A CA    1 
ATOM   969   C  C     . GLN A 1 126 ? 12.377  23.868  33.630  1.00 22.06 ? 126  GLN A C     1 
ATOM   970   O  O     . GLN A 1 126 ? 11.796  23.006  32.960  1.00 22.14 ? 126  GLN A O     1 
ATOM   971   C  CB    . GLN A 1 126 ? 13.667  25.159  31.918  1.00 22.18 ? 126  GLN A CB    1 
ATOM   972   C  CG    . GLN A 1 126 ? 14.954  25.291  31.076  1.00 23.40 ? 126  GLN A CG    1 
ATOM   973   C  CD    . GLN A 1 126 ? 15.764  26.533  31.431  1.00 26.12 ? 126  GLN A CD    1 
ATOM   974   O  OE1   . GLN A 1 126 ? 16.301  26.642  32.543  1.00 27.50 ? 126  GLN A OE1   1 
ATOM   975   N  NE2   . GLN A 1 126 ? 15.856  27.471  30.488  1.00 27.59 ? 126  GLN A NE2   1 
ATOM   976   N  N     . GLU A 1 127 ? 11.833  24.421  34.709  1.00 22.23 ? 127  GLU A N     1 
ATOM   977   C  CA    . GLU A 1 127 ? 10.539  23.984  35.235  1.00 22.27 ? 127  GLU A CA    1 
ATOM   978   C  C     . GLU A 1 127 ? 9.415   24.001  34.198  1.00 22.11 ? 127  GLU A C     1 
ATOM   979   O  O     . GLU A 1 127 ? 8.750   22.983  34.009  1.00 22.02 ? 127  GLU A O     1 
ATOM   980   C  CB    . GLU A 1 127 ? 10.123  24.861  36.404  1.00 22.58 ? 127  GLU A CB    1 
ATOM   981   C  CG    . GLU A 1 127 ? 10.378  24.261  37.775  1.00 23.61 ? 127  GLU A CG    1 
ATOM   982   C  CD    . GLU A 1 127 ? 10.463  25.338  38.845  1.00 24.82 ? 127  GLU A CD    1 
ATOM   983   O  OE1   . GLU A 1 127 ? 9.626   26.265  38.831  1.00 23.91 ? 127  GLU A OE1   1 
ATOM   984   O  OE2   . GLU A 1 127 ? 11.385  25.272  39.683  1.00 27.31 ? 127  GLU A OE2   1 
ATOM   985   N  N     . ARG A 1 128 ? 9.220   25.146  33.533  1.00 21.87 ? 128  ARG A N     1 
ATOM   986   C  CA    . ARG A 1 128 ? 8.052   25.381  32.664  1.00 21.84 ? 128  ARG A CA    1 
ATOM   987   C  C     . ARG A 1 128 ? 8.259   25.032  31.166  1.00 21.96 ? 128  ARG A C     1 
ATOM   988   O  O     . ARG A 1 128 ? 7.518   25.519  30.292  1.00 22.09 ? 128  ARG A O     1 
ATOM   989   C  CB    . ARG A 1 128 ? 7.618   26.855  32.779  1.00 21.77 ? 128  ARG A CB    1 
ATOM   990   C  CG    . ARG A 1 128 ? 7.167   27.289  34.160  1.00 21.63 ? 128  ARG A CG    1 
ATOM   991   C  CD    . ARG A 1 128 ? 6.607   28.728  34.231  1.00 21.70 ? 128  ARG A CD    1 
ATOM   992   N  NE    . ARG A 1 128 ? 5.414   28.796  35.093  1.00 21.98 ? 128  ARG A NE    1 
ATOM   993   C  CZ    . ARG A 1 128 ? 4.144   28.997  34.686  1.00 20.29 ? 128  ARG A CZ    1 
ATOM   994   N  NH1   . ARG A 1 128 ? 3.837   29.185  33.405  1.00 20.01 ? 128  ARG A NH1   1 
ATOM   995   N  NH2   . ARG A 1 128 ? 3.162   28.997  35.581  1.00 18.36 ? 128  ARG A NH2   1 
ATOM   996   N  N     . GLN A 1 129 ? 9.241   24.180  30.863  1.00 21.76 ? 129  GLN A N     1 
ATOM   997   C  CA    . GLN A 1 129 ? 9.652   23.943  29.479  1.00 21.40 ? 129  GLN A CA    1 
ATOM   998   C  C     . GLN A 1 129 ? 10.115  22.524  29.295  1.00 20.67 ? 129  GLN A C     1 
ATOM   999   O  O     . GLN A 1 129 ? 10.981  22.054  30.009  1.00 21.11 ? 129  GLN A O     1 
ATOM   1000  C  CB    . GLN A 1 129 ? 10.802  24.878  29.099  1.00 21.81 ? 129  GLN A CB    1 
ATOM   1001  C  CG    . GLN A 1 129 ? 10.457  26.360  29.206  1.00 23.44 ? 129  GLN A CG    1 
ATOM   1002  C  CD    . GLN A 1 129 ? 11.275  27.174  28.269  1.00 25.25 ? 129  GLN A CD    1 
ATOM   1003  O  OE1   . GLN A 1 129 ? 12.337  27.688  28.636  1.00 26.94 ? 129  GLN A OE1   1 
ATOM   1004  N  NE2   . GLN A 1 129 ? 10.808  27.283  27.041  1.00 27.20 ? 129  GLN A NE2   1 
ATOM   1005  N  N     . ASP A 1 130 ? 9.554   21.846  28.314  1.00 19.82 ? 130  ASP A N     1 
ATOM   1006  C  CA    . ASP A 1 130 ? 9.914   20.476  28.058  1.00 19.01 ? 130  ASP A CA    1 
ATOM   1007  C  C     . ASP A 1 130 ? 11.361  20.382  27.570  1.00 18.65 ? 130  ASP A C     1 
ATOM   1008  O  O     . ASP A 1 130 ? 11.884  21.314  26.957  1.00 18.69 ? 130  ASP A O     1 
ATOM   1009  C  CB    . ASP A 1 130 ? 8.994   19.899  26.992  1.00 19.04 ? 130  ASP A CB    1 
ATOM   1010  C  CG    . ASP A 1 130 ? 7.652   19.512  27.532  1.00 19.94 ? 130  ASP A CG    1 
ATOM   1011  O  OD1   . ASP A 1 130 ? 7.620   18.508  28.295  1.00 18.97 ? 130  ASP A OD1   1 
ATOM   1012  O  OD2   . ASP A 1 130 ? 6.592   20.157  27.241  1.00 21.01 ? 130  ASP A OD2   1 
ATOM   1013  N  N     . ASN A 1 131 ? 11.982  19.232  27.831  1.00 17.68 ? 131  ASN A N     1 
ATOM   1014  C  CA    . ASN A 1 131 ? 13.332  18.942  27.399  1.00 16.83 ? 131  ASN A CA    1 
ATOM   1015  C  C     . ASN A 1 131 ? 13.356  17.533  26.823  1.00 16.33 ? 131  ASN A C     1 
ATOM   1016  O  O     . ASN A 1 131 ? 13.456  16.570  27.571  1.00 15.85 ? 131  ASN A O     1 
ATOM   1017  C  CB    . ASN A 1 131 ? 14.275  19.048  28.583  1.00 16.88 ? 131  ASN A CB    1 
ATOM   1018  C  CG    . ASN A 1 131 ? 15.709  19.166  28.165  1.00 16.96 ? 131  ASN A CG    1 
ATOM   1019  O  OD1   . ASN A 1 131 ? 16.199  20.260  27.894  1.00 15.81 ? 131  ASN A OD1   1 
ATOM   1020  N  ND2   . ASN A 1 131 ? 16.402  18.025  28.105  1.00 19.92 ? 131  ASN A ND2   1 
ATOM   1021  N  N     . LEU A 1 132 ? 13.248  17.425  25.495  1.00 15.67 ? 132  LEU A N     1 
ATOM   1022  C  CA    . LEU A 1 132 ? 13.020  16.144  24.830  1.00 15.47 ? 132  LEU A CA    1 
ATOM   1023  C  C     . LEU A 1 132 ? 14.291  15.588  24.198  1.00 15.46 ? 132  LEU A C     1 
ATOM   1024  O  O     . LEU A 1 132 ? 15.191  16.353  23.763  1.00 15.49 ? 132  LEU A O     1 
ATOM   1025  C  CB    . LEU A 1 132 ? 12.015  16.272  23.702  1.00 15.26 ? 132  LEU A CB    1 
ATOM   1026  C  CG    . LEU A 1 132 ? 10.605  16.786  23.959  1.00 15.93 ? 132  LEU A CG    1 
ATOM   1027  C  CD1   . LEU A 1 132 ? 9.805   16.793  22.641  1.00 15.03 ? 132  LEU A CD1   1 
ATOM   1028  C  CD2   . LEU A 1 132 ? 9.925   15.975  25.009  1.00 15.05 ? 132  LEU A CD2   1 
ATOM   1029  N  N     . LEU A 1 133 ? 14.346  14.254  24.167  1.00 14.65 ? 133  LEU A N     1 
ATOM   1030  C  CA    . LEU A 1 133 ? 15.272  13.508  23.333  1.00 13.95 ? 133  LEU A CA    1 
ATOM   1031  C  C     . LEU A 1 133 ? 14.499  13.079  22.129  1.00 13.63 ? 133  LEU A C     1 
ATOM   1032  O  O     . LEU A 1 133 ? 13.435  12.497  22.274  1.00 12.90 ? 133  LEU A O     1 
ATOM   1033  C  CB    . LEU A 1 133 ? 15.769  12.263  24.049  1.00 13.83 ? 133  LEU A CB    1 
ATOM   1034  C  CG    . LEU A 1 133 ? 16.716  11.419  23.203  1.00 14.14 ? 133  LEU A CG    1 
ATOM   1035  C  CD1   . LEU A 1 133 ? 18.026  12.184  22.991  1.00 14.96 ? 133  LEU A CD1   1 
ATOM   1036  C  CD2   . LEU A 1 133 ? 16.951  10.072  23.834  1.00 14.01 ? 133  LEU A CD2   1 
ATOM   1037  N  N     . ALA A 1 134 ? 15.046  13.353  20.946  1.00 14.04 ? 134  ALA A N     1 
ATOM   1038  C  CA    . ALA A 1 134 ? 14.458  12.940  19.671  1.00 14.50 ? 134  ALA A CA    1 
ATOM   1039  C  C     . ALA A 1 134 ? 15.415  12.068  18.857  1.00 14.90 ? 134  ALA A C     1 
ATOM   1040  O  O     . ALA A 1 134 ? 16.627  12.237  18.948  1.00 15.81 ? 134  ALA A O     1 
ATOM   1041  C  CB    . ALA A 1 134 ? 14.105  14.167  18.855  1.00 14.61 ? 134  ALA A CB    1 
ATOM   1042  N  N     . ALA A 1 135 ? 14.873  11.155  18.049  1.00 14.71 ? 135  ALA A N     1 
ATOM   1043  C  CA    . ALA A 1 135 ? 15.634  10.504  16.994  1.00 14.00 ? 135  ALA A CA    1 
ATOM   1044  C  C     . ALA A 1 135 ? 14.975  10.778  15.667  1.00 14.28 ? 135  ALA A C     1 
ATOM   1045  O  O     . ALA A 1 135 ? 13.749  10.805  15.526  1.00 13.61 ? 135  ALA A O     1 
ATOM   1046  C  CB    . ALA A 1 135 ? 15.716  9.023   17.238  1.00 14.06 ? 135  ALA A CB    1 
ATOM   1047  N  N     . ILE A 1 136 ? 15.788  10.990  14.661  1.00 15.36 ? 136  ILE A N     1 
ATOM   1048  C  CA    . ILE A 1 136 ? 15.259  11.210  13.323  1.00 16.48 ? 136  ILE A CA    1 
ATOM   1049  C  C     . ILE A 1 136 ? 15.984  10.302  12.336  1.00 17.47 ? 136  ILE A C     1 
ATOM   1050  O  O     . ILE A 1 136 ? 17.125  9.874   12.558  1.00 17.12 ? 136  ILE A O     1 
ATOM   1051  C  CB    . ILE A 1 136 ? 15.416  12.682  12.959  1.00 16.42 ? 136  ILE A CB    1 
ATOM   1052  C  CG1   . ILE A 1 136 ? 14.646  13.028  11.690  1.00 16.46 ? 136  ILE A CG1   1 
ATOM   1053  C  CG2   . ILE A 1 136 ? 16.898  13.054  12.826  1.00 17.21 ? 136  ILE A CG2   1 
ATOM   1054  C  CD1   . ILE A 1 136 ? 14.713  14.534  11.385  1.00 17.27 ? 136  ILE A CD1   1 
ATOM   1055  N  N     . TRP A 1 137 ? 15.312  9.985   11.249  1.00 19.16 ? 137  TRP A N     1 
ATOM   1056  C  CA    . TRP A 1 137 ? 15.970  9.248   10.170  1.00 20.80 ? 137  TRP A CA    1 
ATOM   1057  C  C     . TRP A 1 137 ? 15.161  9.360   8.902   1.00 20.95 ? 137  TRP A C     1 
ATOM   1058  O  O     . TRP A 1 137 ? 13.961  9.564   8.964   1.00 21.19 ? 137  TRP A O     1 
ATOM   1059  C  CB    . TRP A 1 137 ? 16.197  7.808   10.586  1.00 21.63 ? 137  TRP A CB    1 
ATOM   1060  C  CG    . TRP A 1 137 ? 15.286  6.829   9.990   1.00 24.61 ? 137  TRP A CG    1 
ATOM   1061  C  CD1   . TRP A 1 137 ? 13.931  6.781   10.121  1.00 26.44 ? 137  TRP A CD1   1 
ATOM   1062  C  CD2   . TRP A 1 137 ? 15.659  5.721   9.185   1.00 28.46 ? 137  TRP A CD2   1 
ATOM   1063  N  NE1   . TRP A 1 137 ? 13.433  5.714   9.420   1.00 29.53 ? 137  TRP A NE1   1 
ATOM   1064  C  CE2   . TRP A 1 137 ? 14.476  5.033   8.846   1.00 30.66 ? 137  TRP A CE2   1 
ATOM   1065  C  CE3   . TRP A 1 137 ? 16.883  5.227   8.716   1.00 31.34 ? 137  TRP A CE3   1 
ATOM   1066  C  CZ2   . TRP A 1 137 ? 14.474  3.866   8.054   1.00 32.87 ? 137  TRP A CZ2   1 
ATOM   1067  C  CZ3   . TRP A 1 137 ? 16.886  4.049   7.918   1.00 33.44 ? 137  TRP A CZ3   1 
ATOM   1068  C  CH2   . TRP A 1 137 ? 15.688  3.391   7.599   1.00 32.80 ? 137  TRP A CH2   1 
ATOM   1069  N  N     . GLN A 1 138 ? 15.834  9.261   7.763   1.00 21.92 ? 138  GLN A N     1 
ATOM   1070  C  CA    . GLN A 1 138 ? 15.226  9.470   6.447   1.00 22.51 ? 138  GLN A CA    1 
ATOM   1071  C  C     . GLN A 1 138 ? 15.248  8.185   5.596   1.00 24.09 ? 138  GLN A C     1 
ATOM   1072  O  O     . GLN A 1 138 ? 16.173  7.356   5.655   1.00 23.87 ? 138  GLN A O     1 
ATOM   1073  C  CB    . GLN A 1 138 ? 15.929  10.616  5.697   1.00 21.97 ? 138  GLN A CB    1 
ATOM   1074  C  CG    . GLN A 1 138 ? 15.132  11.251  4.560   1.00 20.49 ? 138  GLN A CG    1 
ATOM   1075  C  CD    . GLN A 1 138 ? 15.908  12.348  3.800   1.00 20.19 ? 138  GLN A CD    1 
ATOM   1076  O  OE1   . GLN A 1 138 ? 16.911  12.887  4.290   1.00 16.62 ? 138  GLN A OE1   1 
ATOM   1077  N  NE2   . GLN A 1 138 ? 15.438  12.668  2.596   1.00 18.92 ? 138  GLN A NE2   1 
ATOM   1078  N  N     . ASP A 1 139 ? 14.189  8.059   4.810   1.00 26.03 ? 139  ASP A N     1 
ATOM   1079  C  CA    . ASP A 1 139 ? 13.949  6.938   3.932   1.00 27.76 ? 139  ASP A CA    1 
ATOM   1080  C  C     . ASP A 1 139 ? 14.020  7.450   2.524   1.00 28.74 ? 139  ASP A C     1 
ATOM   1081  O  O     . ASP A 1 139 ? 14.135  8.659   2.284   1.00 29.55 ? 139  ASP A O     1 
ATOM   1082  C  CB    . ASP A 1 139 ? 12.547  6.368   4.168   1.00 28.13 ? 139  ASP A CB    1 
ATOM   1083  C  CG    . ASP A 1 139 ? 12.574  4.899   4.411   1.00 29.38 ? 139  ASP A CG    1 
ATOM   1084  O  OD1   . ASP A 1 139 ? 12.531  4.166   3.412   1.00 32.11 ? 139  ASP A OD1   1 
ATOM   1085  O  OD2   . ASP A 1 139 ? 12.675  4.390   5.556   1.00 31.16 ? 139  ASP A OD2   1 
ATOM   1086  N  N     . SER A 1 140 ? 13.914  6.528   1.580   1.00 29.36 ? 140  SER A N     1 
ATOM   1087  C  CA    . SER A 1 140 ? 13.863  6.905   0.173   1.00 29.73 ? 140  SER A CA    1 
ATOM   1088  C  C     . SER A 1 140 ? 12.496  7.550   -0.166  1.00 29.36 ? 140  SER A C     1 
ATOM   1089  O  O     . SER A 1 140 ? 12.284  7.965   -1.294  1.00 29.92 ? 140  SER A O     1 
ATOM   1090  C  CB    . SER A 1 140 ? 14.184  5.691   -0.745  1.00 30.08 ? 140  SER A CB    1 
ATOM   1091  O  OG    . SER A 1 140 ? 15.035  4.704   -0.121  1.00 30.68 ? 140  SER A OG    1 
ATOM   1092  N  N     . LYS A 1 141 ? 11.577  7.630   0.803   1.00 28.93 ? 141  LYS A N     1 
ATOM   1093  C  CA    . LYS A 1 141 ? 10.267  8.290   0.601   1.00 28.29 ? 141  LYS A CA    1 
ATOM   1094  C  C     . LYS A 1 141 ? 9.791   9.220   1.737   1.00 26.76 ? 141  LYS A C     1 
ATOM   1095  O  O     . LYS A 1 141 ? 8.843   9.968   1.545   1.00 26.36 ? 141  LYS A O     1 
ATOM   1096  C  CB    . LYS A 1 141 ? 9.149   7.248   0.344   1.00 28.82 ? 141  LYS A CB    1 
ATOM   1097  C  CG    . LYS A 1 141 ? 9.577   5.915   -0.330  1.00 29.91 ? 141  LYS A CG    1 
ATOM   1098  C  CD    . LYS A 1 141 ? 9.954   4.857   0.725   1.00 31.73 ? 141  LYS A CD    1 
ATOM   1099  C  CE    . LYS A 1 141 ? 10.915  3.770   0.173   1.00 32.63 ? 141  LYS A CE    1 
ATOM   1100  N  NZ    . LYS A 1 141 ? 11.821  3.179   1.212   1.00 31.11 ? 141  LYS A NZ    1 
ATOM   1101  N  N     . GLY A 1 142 ? 10.404  9.174   2.914   1.00 25.29 ? 142  GLY A N     1 
ATOM   1102  C  CA    . GLY A 1 142 ? 9.876   9.945   4.036   1.00 24.15 ? 142  GLY A CA    1 
ATOM   1103  C  C     . GLY A 1 142 ? 10.803  10.089  5.230   1.00 22.90 ? 142  GLY A C     1 
ATOM   1104  O  O     . GLY A 1 142 ? 11.993  9.924   5.112   1.00 23.25 ? 142  GLY A O     1 
ATOM   1105  N  N     . PHE A 1 143 ? 10.256  10.436  6.378   1.00 21.39 ? 143  PHE A N     1 
ATOM   1106  C  CA    . PHE A 1 143 ? 11.045  10.571  7.595   1.00 20.67 ? 143  PHE A CA    1 
ATOM   1107  C  C     . PHE A 1 143 ? 10.458  9.711   8.698   1.00 19.81 ? 143  PHE A C     1 
ATOM   1108  O  O     . PHE A 1 143 ? 9.282   9.408   8.711   1.00 20.03 ? 143  PHE A O     1 
ATOM   1109  C  CB    . PHE A 1 143 ? 11.109  12.047  8.049   1.00 20.63 ? 143  PHE A CB    1 
ATOM   1110  C  CG    . PHE A 1 143 ? 11.701  12.945  7.022   1.00 19.07 ? 143  PHE A CG    1 
ATOM   1111  C  CD1   . PHE A 1 143 ? 13.050  13.231  7.038   1.00 17.65 ? 143  PHE A CD1   1 
ATOM   1112  C  CD2   . PHE A 1 143 ? 10.919  13.436  5.991   1.00 18.47 ? 143  PHE A CD2   1 
ATOM   1113  C  CE1   . PHE A 1 143 ? 13.608  14.028  6.061   1.00 18.05 ? 143  PHE A CE1   1 
ATOM   1114  C  CE2   . PHE A 1 143 ? 11.459  14.246  5.019   1.00 18.15 ? 143  PHE A CE2   1 
ATOM   1115  C  CZ    . PHE A 1 143 ? 12.811  14.542  5.046   1.00 19.04 ? 143  PHE A CZ    1 
ATOM   1116  N  N     . GLY A 1 144 ? 11.303  9.296   9.614   1.00 18.86 ? 144  GLY A N     1 
ATOM   1117  C  CA    . GLY A 1 144 ? 10.847  8.654   10.827  1.00 18.17 ? 144  GLY A CA    1 
ATOM   1118  C  C     . GLY A 1 144 ? 11.359  9.560   11.904  1.00 16.98 ? 144  GLY A C     1 
ATOM   1119  O  O     . GLY A 1 144 ? 12.470  10.049  11.784  1.00 16.66 ? 144  GLY A O     1 
ATOM   1120  N  N     . TYR A 1 145 ? 10.547  9.785   12.923  1.00 15.85 ? 145  TYR A N     1 
ATOM   1121  C  CA    . TYR A 1 145 ? 10.847  10.734  13.980  1.00 15.21 ? 145  TYR A CA    1 
ATOM   1122  C  C     . TYR A 1 145 ? 10.277  10.167  15.264  1.00 15.43 ? 145  TYR A C     1 
ATOM   1123  O  O     . TYR A 1 145 ? 9.336   9.366   15.234  1.00 16.74 ? 145  TYR A O     1 
ATOM   1124  C  CB    . TYR A 1 145 ? 10.199  12.095  13.675  1.00 14.97 ? 145  TYR A CB    1 
ATOM   1125  C  CG    . TYR A 1 145 ? 10.668  13.177  14.610  1.00 13.37 ? 145  TYR A CG    1 
ATOM   1126  C  CD1   . TYR A 1 145 ? 12.008  13.550  14.648  1.00 11.49 ? 145  TYR A CD1   1 
ATOM   1127  C  CD2   . TYR A 1 145 ? 9.804   13.791  15.465  1.00 13.90 ? 145  TYR A CD2   1 
ATOM   1128  C  CE1   . TYR A 1 145 ? 12.465  14.468  15.509  1.00 12.49 ? 145  TYR A CE1   1 
ATOM   1129  C  CE2   . TYR A 1 145 ? 10.256  14.769  16.342  1.00 16.24 ? 145  TYR A CE2   1 
ATOM   1130  C  CZ    . TYR A 1 145 ? 11.592  15.098  16.365  1.00 15.97 ? 145  TYR A CZ    1 
ATOM   1131  O  OH    . TYR A 1 145 ? 12.054  16.096  17.215  1.00 17.82 ? 145  TYR A OH    1 
ATOM   1132  N  N     . ALA A 1 146 ? 10.828  10.550  16.397  1.00 15.06 ? 146  ALA A N     1 
ATOM   1133  C  CA    . ALA A 1 146 ? 10.382  9.978   17.670  1.00 15.48 ? 146  ALA A CA    1 
ATOM   1134  C  C     . ALA A 1 146 ? 10.894  10.846  18.772  1.00 15.88 ? 146  ALA A C     1 
ATOM   1135  O  O     . ALA A 1 146 ? 12.055  11.261  18.745  1.00 15.79 ? 146  ALA A O     1 
ATOM   1136  C  CB    . ALA A 1 146 ? 10.899  8.522   17.875  1.00 15.44 ? 146  ALA A CB    1 
ATOM   1137  N  N     . THR A 1 147 ? 10.033  11.132  19.737  1.00 16.45 ? 147  THR A N     1 
ATOM   1138  C  CA    . THR A 1 147 ? 10.448  11.904  20.882  1.00 17.32 ? 147  THR A CA    1 
ATOM   1139  C  C     . THR A 1 147 ? 10.178  11.114  22.150  1.00 18.22 ? 147  THR A C     1 
ATOM   1140  O  O     . THR A 1 147 ? 9.229   10.359  22.245  1.00 18.44 ? 147  THR A O     1 
ATOM   1141  C  CB    . THR A 1 147 ? 9.735   13.252  20.912  1.00 17.08 ? 147  THR A CB    1 
ATOM   1142  O  OG1   . THR A 1 147 ? 8.323   13.049  20.909  1.00 17.27 ? 147  THR A OG1   1 
ATOM   1143  C  CG2   . THR A 1 147 ? 9.988   14.040  19.631  1.00 16.96 ? 147  THR A CG2   1 
ATOM   1144  N  N     . LEU A 1 148 ? 11.073  11.260  23.107  1.00 18.99 ? 148  LEU A N     1 
ATOM   1145  C  CA    . LEU A 1 148 ? 10.887  10.709  24.429  1.00 19.11 ? 148  LEU A CA    1 
ATOM   1146  C  C     . LEU A 1 148 ? 11.210  11.835  25.362  1.00 18.65 ? 148  LEU A C     1 
ATOM   1147  O  O     . LEU A 1 148 ? 12.131  12.561  25.127  1.00 18.23 ? 148  LEU A O     1 
ATOM   1148  C  CB    . LEU A 1 148 ? 11.858  9.551   24.693  1.00 19.30 ? 148  LEU A CB    1 
ATOM   1149  C  CG    . LEU A 1 148 ? 11.911  9.194   26.183  1.00 19.13 ? 148  LEU A CG    1 
ATOM   1150  C  CD1   . LEU A 1 148 ? 10.640  8.430   26.537  1.00 15.81 ? 148  LEU A CD1   1 
ATOM   1151  C  CD2   . LEU A 1 148 ? 13.189  8.426   26.537  1.00 20.25 ? 148  LEU A CD2   1 
ATOM   1152  N  N     . ASP A 1 149 ? 10.441  11.975  26.415  1.00 19.32 ? 149  ASP A N     1 
ATOM   1153  C  CA    . ASP A 1 149 ? 10.758  12.921  27.452  1.00 20.23 ? 149  ASP A CA    1 
ATOM   1154  C  C     . ASP A 1 149 ? 11.018  12.067  28.685  1.00 20.46 ? 149  ASP A C     1 
ATOM   1155  O  O     . ASP A 1 149 ? 10.087  11.544  29.281  1.00 20.29 ? 149  ASP A O     1 
ATOM   1156  C  CB    . ASP A 1 149 ? 9.611   13.885  27.630  1.00 20.45 ? 149  ASP A CB    1 
ATOM   1157  C  CG    . ASP A 1 149 ? 9.430   14.318  29.044  1.00 21.65 ? 149  ASP A CG    1 
ATOM   1158  O  OD1   . ASP A 1 149 ? 10.427  14.720  29.679  1.00 23.44 ? 149  ASP A OD1   1 
ATOM   1159  O  OD2   . ASP A 1 149 ? 8.312   14.295  29.592  1.00 23.74 ? 149  ASP A OD2   1 
ATOM   1160  N  N     . ILE A 1 150 ? 12.299  11.943  29.036  1.00 20.79 ? 150  ILE A N     1 
ATOM   1161  C  CA    . ILE A 1 150 ? 12.766  10.948  29.975  1.00 21.16 ? 150  ILE A CA    1 
ATOM   1162  C  C     . ILE A 1 150 ? 12.218  11.145  31.383  1.00 21.80 ? 150  ILE A C     1 
ATOM   1163  O  O     . ILE A 1 150 ? 12.047  10.172  32.147  1.00 21.15 ? 150  ILE A O     1 
ATOM   1164  C  CB    . ILE A 1 150 ? 14.312  10.928  29.987  1.00 21.30 ? 150  ILE A CB    1 
ATOM   1165  C  CG1   . ILE A 1 150 ? 14.820  9.593   30.554  1.00 20.49 ? 150  ILE A CG1   1 
ATOM   1166  C  CG2   . ILE A 1 150 ? 14.891  12.124  30.751  1.00 20.77 ? 150  ILE A CG2   1 
ATOM   1167  C  CD1   . ILE A 1 150 ? 16.029  9.062   29.820  1.00 19.23 ? 150  ILE A CD1   1 
ATOM   1168  N  N     . SER A 1 151 ? 11.947  12.404  31.715  1.00 22.45 ? 151  SER A N     1 
ATOM   1169  C  CA    . SER A 1 151 ? 11.455  12.747  33.030  1.00 23.26 ? 151  SER A CA    1 
ATOM   1170  C  C     . SER A 1 151 ? 9.923   12.796  33.075  1.00 23.55 ? 151  SER A C     1 
ATOM   1171  O  O     . SER A 1 151 ? 9.358   13.482  33.913  1.00 24.07 ? 151  SER A O     1 
ATOM   1172  C  CB    . SER A 1 151 ? 12.089  14.045  33.537  1.00 23.15 ? 151  SER A CB    1 
ATOM   1173  O  OG    . SER A 1 151 ? 11.580  15.158  32.856  1.00 24.56 ? 151  SER A OG    1 
ATOM   1174  N  N     . SER A 1 152 ? 9.261   12.053  32.187  1.00 23.83 ? 152  SER A N     1 
ATOM   1175  C  CA    . SER A 1 152 ? 7.834   11.738  32.352  1.00 23.80 ? 152  SER A CA    1 
ATOM   1176  C  C     . SER A 1 152 ? 7.376   10.415  31.711  1.00 23.45 ? 152  SER A C     1 
ATOM   1177  O  O     . SER A 1 152 ? 6.371   9.855   32.119  1.00 23.86 ? 152  SER A O     1 
ATOM   1178  C  CB    . SER A 1 152 ? 6.959   12.893  31.873  1.00 23.70 ? 152  SER A CB    1 
ATOM   1179  O  OG    . SER A 1 152 ? 6.720   12.797  30.488  1.00 24.42 ? 152  SER A OG    1 
ATOM   1180  N  N     . GLY A 1 153 ? 8.105   9.918   30.723  1.00 23.58 ? 153  GLY A N     1 
ATOM   1181  C  CA    . GLY A 1 153 ? 7.848   8.613   30.139  1.00 23.57 ? 153  GLY A CA    1 
ATOM   1182  C  C     . GLY A 1 153 ? 7.055   8.744   28.867  1.00 23.74 ? 153  GLY A C     1 
ATOM   1183  O  O     . GLY A 1 153 ? 6.666   7.737   28.271  1.00 24.93 ? 153  GLY A O     1 
ATOM   1184  N  N     . ARG A 1 154 ? 6.807   9.986   28.461  1.00 23.59 ? 154  ARG A N     1 
ATOM   1185  C  CA    . ARG A 1 154 ? 5.993   10.292  27.294  1.00 23.42 ? 154  ARG A CA    1 
ATOM   1186  C  C     . ARG A 1 154 ? 6.843   9.919   26.110  1.00 22.43 ? 154  ARG A C     1 
ATOM   1187  O  O     . ARG A 1 154 ? 7.876   10.516  25.915  1.00 22.33 ? 154  ARG A O     1 
ATOM   1188  C  CB    . ARG A 1 154 ? 5.633   11.793  27.277  1.00 23.51 ? 154  ARG A CB    1 
ATOM   1189  C  CG    . ARG A 1 154 ? 4.580   12.252  26.248  1.00 25.90 ? 154  ARG A CG    1 
ATOM   1190  C  CD    . ARG A 1 154 ? 4.447   13.805  26.109  1.00 30.12 ? 154  ARG A CD    1 
ATOM   1191  N  NE    . ARG A 1 154 ? 4.853   14.470  27.359  1.00 34.26 ? 154  ARG A NE    1 
ATOM   1192  C  CZ    . ARG A 1 154 ? 5.922   15.259  27.517  1.00 36.65 ? 154  ARG A CZ    1 
ATOM   1193  N  NH1   . ARG A 1 154 ? 6.717   15.582  26.490  1.00 38.41 ? 154  ARG A NH1   1 
ATOM   1194  N  NH2   . ARG A 1 154 ? 6.186   15.748  28.722  1.00 37.44 ? 154  ARG A NH2   1 
ATOM   1195  N  N     . PHE A 1 155 ? 6.402   8.924   25.334  1.00 21.59 ? 155  PHE A N     1 
ATOM   1196  C  CA    . PHE A 1 155 ? 7.185   8.333   24.232  1.00 20.30 ? 155  PHE A CA    1 
ATOM   1197  C  C     . PHE A 1 155 ? 6.293   8.408   23.014  1.00 19.62 ? 155  PHE A C     1 
ATOM   1198  O  O     . PHE A 1 155 ? 5.188   7.950   23.060  1.00 19.75 ? 155  PHE A O     1 
ATOM   1199  C  CB    . PHE A 1 155 ? 7.512   6.861   24.575  1.00 20.30 ? 155  PHE A CB    1 
ATOM   1200  C  CG    . PHE A 1 155 ? 8.633   6.237   23.762  1.00 18.72 ? 155  PHE A CG    1 
ATOM   1201  C  CD1   . PHE A 1 155 ? 9.371   6.957   22.829  1.00 16.80 ? 155  PHE A CD1   1 
ATOM   1202  C  CD2   . PHE A 1 155 ? 8.939   4.892   23.956  1.00 17.29 ? 155  PHE A CD2   1 
ATOM   1203  C  CE1   . PHE A 1 155 ? 10.383  6.341   22.124  1.00 17.34 ? 155  PHE A CE1   1 
ATOM   1204  C  CE2   . PHE A 1 155 ? 9.937   4.274   23.250  1.00 15.39 ? 155  PHE A CE2   1 
ATOM   1205  C  CZ    . PHE A 1 155 ? 10.672  4.996   22.343  1.00 16.82 ? 155  PHE A CZ    1 
ATOM   1206  N  N     . ARG A 1 156 ? 6.755   9.035   21.943  1.00 19.35 ? 156  ARG A N     1 
ATOM   1207  C  CA    . ARG A 1 156 ? 5.917   9.354   20.785  1.00 18.76 ? 156  ARG A CA    1 
ATOM   1208  C  C     . ARG A 1 156 ? 6.646   9.024   19.500  1.00 17.82 ? 156  ARG A C     1 
ATOM   1209  O  O     . ARG A 1 156 ? 7.869   8.986   19.456  1.00 16.70 ? 156  ARG A O     1 
ATOM   1210  C  CB    . ARG A 1 156 ? 5.514   10.847  20.774  1.00 19.09 ? 156  ARG A CB    1 
ATOM   1211  C  CG    . ARG A 1 156 ? 4.403   11.254  21.776  1.00 20.91 ? 156  ARG A CG    1 
ATOM   1212  C  CD    . ARG A 1 156 ? 3.150   10.320  21.749  1.00 23.63 ? 156  ARG A CD    1 
ATOM   1213  N  NE    . ARG A 1 156 ? 2.059   10.760  22.628  1.00 24.61 ? 156  ARG A NE    1 
ATOM   1214  C  CZ    . ARG A 1 156 ? 1.916   10.417  23.914  1.00 24.50 ? 156  ARG A CZ    1 
ATOM   1215  N  NH1   . ARG A 1 156 ? 2.768   9.603   24.513  1.00 24.72 ? 156  ARG A NH1   1 
ATOM   1216  N  NH2   . ARG A 1 156 ? 0.900   10.893  24.609  1.00 24.95 ? 156  ARG A NH2   1 
ATOM   1217  N  N     . LEU A 1 157 ? 5.857   8.837   18.444  1.00 17.37 ? 157  LEU A N     1 
ATOM   1218  C  CA    . LEU A 1 157 ? 6.324   8.284   17.173  1.00 16.64 ? 157  LEU A CA    1 
ATOM   1219  C  C     . LEU A 1 157 ? 5.550   8.920   16.015  1.00 15.74 ? 157  LEU A C     1 
ATOM   1220  O  O     . LEU A 1 157 ? 4.380   9.210   16.140  1.00 14.88 ? 157  LEU A O     1 
ATOM   1221  C  CB    . LEU A 1 157 ? 6.131   6.771   17.240  1.00 16.41 ? 157  LEU A CB    1 
ATOM   1222  C  CG    . LEU A 1 157 ? 6.341   5.876   16.037  1.00 16.59 ? 157  LEU A CG    1 
ATOM   1223  C  CD1   . LEU A 1 157 ? 6.503   4.431   16.567  1.00 17.71 ? 157  LEU A CD1   1 
ATOM   1224  C  CD2   . LEU A 1 157 ? 5.183   5.958   15.038  1.00 15.92 ? 157  LEU A CD2   1 
ATOM   1225  N  N     . SER A 1 158 ? 6.211   9.187   14.903  1.00 15.82 ? 158  SER A N     1 
ATOM   1226  C  CA    . SER A 1 158 ? 5.535   9.810   13.760  1.00 16.20 ? 158  SER A CA    1 
ATOM   1227  C  C     . SER A 1 158 ? 6.336   9.674   12.497  1.00 16.43 ? 158  SER A C     1 
ATOM   1228  O  O     . SER A 1 158 ? 7.533   9.440   12.535  1.00 16.98 ? 158  SER A O     1 
ATOM   1229  C  CB    . SER A 1 158 ? 5.224   11.297  14.007  1.00 16.14 ? 158  SER A CB    1 
ATOM   1230  O  OG    . SER A 1 158 ? 6.379   12.027  14.356  1.00 17.65 ? 158  SER A OG    1 
ATOM   1231  N  N     . GLU A 1 159 ? 5.660   9.844   11.373  1.00 17.17 ? 159  GLU A N     1 
ATOM   1232  C  CA    . GLU A 1 159 ? 6.223   9.545   10.063  1.00 17.96 ? 159  GLU A CA    1 
ATOM   1233  C  C     . GLU A 1 159 ? 5.905   10.701  9.125   1.00 18.03 ? 159  GLU A C     1 
ATOM   1234  O  O     . GLU A 1 159 ? 5.127   10.506  8.199   1.00 18.52 ? 159  GLU A O     1 
ATOM   1235  C  CB    . GLU A 1 159 ? 5.630   8.225   9.495   1.00 17.75 ? 159  GLU A CB    1 
ATOM   1236  C  CG    . GLU A 1 159 ? 6.119   6.932   10.164  1.00 19.42 ? 159  GLU A CG    1 
ATOM   1237  C  CD    . GLU A 1 159 ? 5.469   5.675   9.569   1.00 23.07 ? 159  GLU A CD    1 
ATOM   1238  O  OE1   . GLU A 1 159 ? 4.477   5.834   8.840   1.00 25.83 ? 159  GLU A OE1   1 
ATOM   1239  O  OE2   . GLU A 1 159 ? 5.913   4.519   9.825   1.00 24.37 ? 159  GLU A OE2   1 
ATOM   1240  N  N     . PRO A 1 160 ? 6.498   11.882  9.339   1.00 17.74 ? 160  PRO A N     1 
ATOM   1241  C  CA    . PRO A 1 160 ? 6.199   13.052  8.513   1.00 17.98 ? 160  PRO A CA    1 
ATOM   1242  C  C     . PRO A 1 160 ? 6.445   12.731  7.060   1.00 17.72 ? 160  PRO A C     1 
ATOM   1243  O  O     . PRO A 1 160 ? 7.428   12.091  6.778   1.00 18.09 ? 160  PRO A O     1 
ATOM   1244  C  CB    . PRO A 1 160 ? 7.211   14.118  9.016   1.00 17.95 ? 160  PRO A CB    1 
ATOM   1245  C  CG    . PRO A 1 160 ? 7.504   13.729  10.383  1.00 17.40 ? 160  PRO A CG    1 
ATOM   1246  C  CD    . PRO A 1 160 ? 7.516   12.212  10.348  1.00 18.21 ? 160  PRO A CD    1 
ATOM   1247  N  N     . ALA A 1 161 ? 5.597   13.205  6.163   1.00 17.72 ? 161  ALA A N     1 
ATOM   1248  C  CA    . ALA A 1 161 ? 5.621   12.754  4.770   1.00 17.65 ? 161  ALA A CA    1 
ATOM   1249  C  C     . ALA A 1 161 ? 6.667   13.427  3.876   1.00 17.21 ? 161  ALA A C     1 
ATOM   1250  O  O     . ALA A 1 161 ? 6.932   12.942  2.774   1.00 16.98 ? 161  ALA A O     1 
ATOM   1251  C  CB    . ALA A 1 161 ? 4.222   12.903  4.149   1.00 17.65 ? 161  ALA A CB    1 
ATOM   1252  N  N     . ASP A 1 162 ? 7.250   14.533  4.336   1.00 17.04 ? 162  ASP A N     1 
ATOM   1253  C  CA    . ASP A 1 162 ? 8.120   15.355  3.480   1.00 16.68 ? 162  ASP A CA    1 
ATOM   1254  C  C     . ASP A 1 162 ? 8.955   16.366  4.250   1.00 16.24 ? 162  ASP A C     1 
ATOM   1255  O  O     . ASP A 1 162 ? 8.803   16.567  5.451   1.00 15.70 ? 162  ASP A O     1 
ATOM   1256  C  CB    . ASP A 1 162 ? 7.293   16.081  2.410   1.00 16.89 ? 162  ASP A CB    1 
ATOM   1257  C  CG    . ASP A 1 162 ? 6.099   16.822  2.995   1.00 19.00 ? 162  ASP A CG    1 
ATOM   1258  O  OD1   . ASP A 1 162 ? 5.010   16.777  2.377   1.00 21.20 ? 162  ASP A OD1   1 
ATOM   1259  O  OD2   . ASP A 1 162 ? 6.144   17.455  4.080   1.00 21.03 ? 162  ASP A OD2   1 
ATOM   1260  N  N     . ARG A 1 163 ? 9.861   16.997  3.532   1.00 16.39 ? 163  ARG A N     1 
ATOM   1261  C  CA    . ARG A 1 163 ? 10.740  17.970  4.125   1.00 16.72 ? 163  ARG A CA    1 
ATOM   1262  C  C     . ARG A 1 163 ? 9.992   19.000  4.990   1.00 16.97 ? 163  ARG A C     1 
ATOM   1263  O  O     . ARG A 1 163 ? 10.345  19.206  6.147   1.00 16.05 ? 163  ARG A O     1 
ATOM   1264  C  CB    . ARG A 1 163 ? 11.541  18.651  3.033   1.00 16.80 ? 163  ARG A CB    1 
ATOM   1265  C  CG    . ARG A 1 163 ? 12.666  19.490  3.564   1.00 18.59 ? 163  ARG A CG    1 
ATOM   1266  C  CD    . ARG A 1 163 ? 13.019  20.748  2.711   1.00 20.66 ? 163  ARG A CD    1 
ATOM   1267  N  NE    . ARG A 1 163 ? 14.212  21.370  3.268   1.00 21.84 ? 163  ARG A NE    1 
ATOM   1268  C  CZ    . ARG A 1 163 ? 14.227  22.073  4.393   1.00 23.74 ? 163  ARG A CZ    1 
ATOM   1269  N  NH1   . ARG A 1 163 ? 13.100  22.320  5.062   1.00 24.54 ? 163  ARG A NH1   1 
ATOM   1270  N  NH2   . ARG A 1 163 ? 15.376  22.563  4.842   1.00 24.35 ? 163  ARG A NH2   1 
ATOM   1271  N  N     . GLU A 1 164 ? 8.952   19.648  4.460   1.00 17.67 ? 164  GLU A N     1 
ATOM   1272  C  CA    . GLU A 1 164 ? 8.358   20.770  5.218   1.00 17.96 ? 164  GLU A CA    1 
ATOM   1273  C  C     . GLU A 1 164 ? 7.561   20.287  6.458   1.00 16.50 ? 164  GLU A C     1 
ATOM   1274  O  O     . GLU A 1 164 ? 7.733   20.812  7.538   1.00 16.45 ? 164  GLU A O     1 
ATOM   1275  C  CB    . GLU A 1 164 ? 7.621   21.801  4.331   1.00 18.78 ? 164  GLU A CB    1 
ATOM   1276  C  CG    . GLU A 1 164 ? 7.583   21.521  2.814   1.00 22.66 ? 164  GLU A CG    1 
ATOM   1277  C  CD    . GLU A 1 164 ? 8.786   22.020  1.979   1.00 27.37 ? 164  GLU A CD    1 
ATOM   1278  O  OE1   . GLU A 1 164 ? 8.969   23.273  1.807   1.00 29.79 ? 164  GLU A OE1   1 
ATOM   1279  O  OE2   . GLU A 1 164 ? 9.511   21.147  1.419   1.00 28.31 ? 164  GLU A OE2   1 
ATOM   1280  N  N     . THR A 1 165 ? 6.788   19.222  6.357   1.00 15.58 ? 165  THR A N     1 
ATOM   1281  C  CA    . THR A 1 165 ? 6.243   18.570  7.585   1.00 14.88 ? 165  THR A CA    1 
ATOM   1282  C  C     . THR A 1 165 ? 7.305   18.093  8.623   1.00 13.65 ? 165  THR A C     1 
ATOM   1283  O  O     . THR A 1 165 ? 7.054   18.066  9.830   1.00 13.13 ? 165  THR A O     1 
ATOM   1284  C  CB    . THR A 1 165 ? 5.345   17.357  7.220   1.00 15.17 ? 165  THR A CB    1 
ATOM   1285  O  OG1   . THR A 1 165 ? 4.379   17.728  6.225   1.00 15.00 ? 165  THR A OG1   1 
ATOM   1286  C  CG2   . THR A 1 165 ? 4.487   16.933  8.436   1.00 16.25 ? 165  THR A CG2   1 
ATOM   1287  N  N     . MET A 1 166 ? 8.483   17.697  8.159   1.00 12.34 ? 166  MET A N     1 
ATOM   1288  C  CA    . MET A 1 166 ? 9.542   17.279  9.069   1.00 11.26 ? 166  MET A CA    1 
ATOM   1289  C  C     . MET A 1 166 ? 10.090  18.467  9.801   1.00 9.86  ? 166  MET A C     1 
ATOM   1290  O  O     . MET A 1 166 ? 10.247  18.445  10.995  1.00 8.63  ? 166  MET A O     1 
ATOM   1291  C  CB    . MET A 1 166 ? 10.678  16.562  8.310   1.00 11.84 ? 166  MET A CB    1 
ATOM   1292  C  CG    . MET A 1 166 ? 11.702  15.880  9.207   1.00 12.11 ? 166  MET A CG    1 
ATOM   1293  S  SD    . MET A 1 166 ? 10.879  14.836  10.357  1.00 17.59 ? 166  MET A SD    1 
ATOM   1294  C  CE    . MET A 1 166 ? 11.289  15.626  11.934  1.00 16.18 ? 166  MET A CE    1 
ATOM   1295  N  N     . ALA A 1 167 ? 10.391  19.511  9.041   1.00 10.16 ? 167  ALA A N     1 
ATOM   1296  C  CA    . ALA A 1 167 ? 10.806  20.815  9.564   1.00 9.51  ? 167  ALA A CA    1 
ATOM   1297  C  C     . ALA A 1 167 ? 9.822   21.348  10.600  1.00 9.74  ? 167  ALA A C     1 
ATOM   1298  O  O     . ALA A 1 167 ? 10.222  21.742  11.689  1.00 8.83  ? 167  ALA A O     1 
ATOM   1299  C  CB    . ALA A 1 167 ? 10.928  21.767  8.438   1.00 9.42  ? 167  ALA A CB    1 
ATOM   1300  N  N     . ALA A 1 168 ? 8.536   21.323  10.276  1.00 10.40 ? 168  ALA A N     1 
ATOM   1301  C  CA    . ALA A 1 168 ? 7.510   21.768  11.209  1.00 11.91 ? 168  ALA A CA    1 
ATOM   1302  C  C     . ALA A 1 168 ? 7.499   20.954  12.491  1.00 13.14 ? 168  ALA A C     1 
ATOM   1303  O  O     . ALA A 1 168 ? 7.233   21.489  13.555  1.00 13.38 ? 168  ALA A O     1 
ATOM   1304  C  CB    . ALA A 1 168 ? 6.146   21.714  10.561  1.00 12.31 ? 168  ALA A CB    1 
ATOM   1305  N  N     . GLU A 1 169 ? 7.797   19.662  12.392  1.00 14.69 ? 169  GLU A N     1 
ATOM   1306  C  CA    . GLU A 1 169 ? 7.907   18.816  13.564  1.00 15.54 ? 169  GLU A CA    1 
ATOM   1307  C  C     . GLU A 1 169 ? 9.118   19.121  14.417  1.00 15.65 ? 169  GLU A C     1 
ATOM   1308  O  O     . GLU A 1 169 ? 9.017   19.113  15.641  1.00 15.95 ? 169  GLU A O     1 
ATOM   1309  C  CB    . GLU A 1 169 ? 7.939   17.361  13.157  1.00 16.29 ? 169  GLU A CB    1 
ATOM   1310  C  CG    . GLU A 1 169 ? 6.567   16.826  12.849  1.00 18.89 ? 169  GLU A CG    1 
ATOM   1311  C  CD    . GLU A 1 169 ? 5.838   16.413  14.106  1.00 23.58 ? 169  GLU A CD    1 
ATOM   1312  O  OE1   . GLU A 1 169 ? 4.835   17.126  14.452  1.00 25.56 ? 169  GLU A OE1   1 
ATOM   1313  O  OE2   . GLU A 1 169 ? 6.286   15.402  14.731  1.00 21.58 ? 169  GLU A OE2   1 
ATOM   1314  N  N     . LEU A 1 170 ? 10.269  19.372  13.812  1.00 16.04 ? 170  LEU A N     1 
ATOM   1315  C  CA    . LEU A 1 170 ? 11.447  19.738  14.616  1.00 17.00 ? 170  LEU A CA    1 
ATOM   1316  C  C     . LEU A 1 170 ? 11.235  21.061  15.341  1.00 17.70 ? 170  LEU A C     1 
ATOM   1317  O  O     . LEU A 1 170 ? 11.720  21.259  16.433  1.00 18.15 ? 170  LEU A O     1 
ATOM   1318  C  CB    . LEU A 1 170 ? 12.712  19.843  13.756  1.00 16.94 ? 170  LEU A CB    1 
ATOM   1319  C  CG    . LEU A 1 170 ? 13.265  18.545  13.189  1.00 16.89 ? 170  LEU A CG    1 
ATOM   1320  C  CD1   . LEU A 1 170 ? 14.459  18.864  12.342  1.00 15.49 ? 170  LEU A CD1   1 
ATOM   1321  C  CD2   . LEU A 1 170 ? 13.622  17.544  14.306  1.00 16.82 ? 170  LEU A CD2   1 
ATOM   1322  N  N     . GLN A 1 171 ? 10.512  21.971  14.713  1.00 18.90 ? 171  GLN A N     1 
ATOM   1323  C  CA    . GLN A 1 171 ? 10.244  23.265  15.300  1.00 19.88 ? 171  GLN A CA    1 
ATOM   1324  C  C     . GLN A 1 171 ? 9.308   23.027  16.477  1.00 20.37 ? 171  GLN A C     1 
ATOM   1325  O  O     . GLN A 1 171 ? 9.557   23.536  17.561  1.00 21.59 ? 171  GLN A O     1 
ATOM   1326  C  CB    . GLN A 1 171 ? 9.650   24.226  14.248  1.00 19.88 ? 171  GLN A CB    1 
ATOM   1327  C  CG    . GLN A 1 171 ? 9.311   25.590  14.764  1.00 20.71 ? 171  GLN A CG    1 
ATOM   1328  C  CD    . GLN A 1 171 ? 9.784   26.716  13.840  1.00 23.85 ? 171  GLN A CD    1 
ATOM   1329  O  OE1   . GLN A 1 171 ? 8.965   27.476  13.285  1.00 21.59 ? 171  GLN A OE1   1 
ATOM   1330  N  NE2   . GLN A 1 171 ? 11.112  26.838  13.686  1.00 25.26 ? 171  GLN A NE2   1 
ATOM   1331  N  N     . ARG A 1 172 ? 8.275   22.207  16.278  1.00 20.40 ? 172  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1 172 ? 7.284   21.928  17.317  1.00 20.51 ? 172  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1 172 ? 7.868   21.226  18.560  1.00 21.27 ? 172  ARG A C     1 
ATOM   1334  O  O     . ARG A 1 172 ? 7.653   21.666  19.677  1.00 21.58 ? 172  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1 172 ? 6.147   21.085  16.746  1.00 20.05 ? 172  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1 172 ? 4.966   20.857  17.696  1.00 18.96 ? 172  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1 172 ? 3.870   19.996  17.069  1.00 19.53 ? 172  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1 172 ? 4.336   18.633  16.878  1.00 19.47 ? 172  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1 172 ? 4.373   17.718  17.834  1.00 19.95 ? 172  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1 172 ? 3.935   17.992  19.053  1.00 18.47 ? 172  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1 172 ? 4.843   16.503  17.564  1.00 22.46 ? 172  ARG A NH2   1 
ATOM   1342  N  N     . THR A 1 173 ? 8.571   20.121  18.368  1.00 21.85 ? 173  THR A N     1 
ATOM   1343  C  CA    . THR A 1 173 ? 9.151   19.388  19.495  1.00 22.41 ? 173  THR A CA    1 
ATOM   1344  C  C     . THR A 1 173 ? 10.394  20.062  20.122  1.00 22.69 ? 173  THR A C     1 
ATOM   1345  O  O     . THR A 1 173 ? 10.608  19.939  21.337  1.00 22.92 ? 173  THR A O     1 
ATOM   1346  C  CB    . THR A 1 173 ? 9.467   17.938  19.080  1.00 22.40 ? 173  THR A CB    1 
ATOM   1347  O  OG1   . THR A 1 173 ? 10.297  17.917  17.915  1.00 21.76 ? 173  THR A OG1   1 
ATOM   1348  C  CG2   . THR A 1 173 ? 8.206   17.251  18.638  1.00 22.91 ? 173  THR A CG2   1 
ATOM   1349  N  N     . ASN A 1 174 ? 11.180  20.775  19.301  1.00 22.72 ? 174  ASN A N     1 
ATOM   1350  C  CA    . ASN A 1 174 ? 12.398  21.483  19.732  1.00 22.49 ? 174  ASN A CA    1 
ATOM   1351  C  C     . ASN A 1 174 ? 13.306  20.617  20.613  1.00 22.61 ? 174  ASN A C     1 
ATOM   1352  O  O     . ASN A 1 174 ? 13.581  20.974  21.761  1.00 22.82 ? 174  ASN A O     1 
ATOM   1353  C  CB    . ASN A 1 174 ? 12.020  22.769  20.473  1.00 22.26 ? 174  ASN A CB    1 
ATOM   1354  C  CG    . ASN A 1 174 ? 13.228  23.643  20.814  1.00 22.05 ? 174  ASN A CG    1 
ATOM   1355  O  OD1   . ASN A 1 174 ? 13.234  24.316  21.834  1.00 21.57 ? 174  ASN A OD1   1 
ATOM   1356  N  ND2   . ASN A 1 174 ? 14.246  23.625  19.974  1.00 20.38 ? 174  ASN A ND2   1 
ATOM   1357  N  N     . PRO A 1 175 ? 13.753  19.469  20.108  1.00 22.34 ? 175  PRO A N     1 
ATOM   1358  C  CA    . PRO A 1 175 ? 14.499  18.532  20.952  1.00 22.24 ? 175  PRO A CA    1 
ATOM   1359  C  C     . PRO A 1 175 ? 15.765  19.177  21.521  1.00 22.09 ? 175  PRO A C     1 
ATOM   1360  O  O     . PRO A 1 175 ? 16.360  20.023  20.867  1.00 21.71 ? 175  PRO A O     1 
ATOM   1361  C  CB    . PRO A 1 175 ? 14.802  17.349  20.013  1.00 21.99 ? 175  PRO A CB    1 
ATOM   1362  C  CG    . PRO A 1 175 ? 14.636  17.861  18.674  1.00 22.44 ? 175  PRO A CG    1 
ATOM   1363  C  CD    . PRO A 1 175 ? 13.603  18.971  18.734  1.00 22.61 ? 175  PRO A CD    1 
ATOM   1364  N  N     . ALA A 1 176 ? 16.126  18.838  22.755  1.00 21.79 ? 176  ALA A N     1 
ATOM   1365  C  CA    . ALA A 1 176 ? 17.390  19.313  23.319  1.00 21.36 ? 176  ALA A CA    1 
ATOM   1366  C  C     . ALA A 1 176 ? 18.544  18.489  22.764  1.00 21.19 ? 176  ALA A C     1 
ATOM   1367  O  O     . ALA A 1 176 ? 19.700  18.929  22.812  1.00 22.13 ? 176  ALA A O     1 
ATOM   1368  C  CB    . ALA A 1 176 ? 17.366  19.254  24.846  1.00 21.16 ? 176  ALA A CB    1 
ATOM   1369  N  N     . GLU A 1 177 ? 18.228  17.297  22.248  1.00 20.13 ? 177  GLU A N     1 
ATOM   1370  C  CA    . GLU A 1 177 ? 19.223  16.402  21.668  1.00 19.39 ? 177  GLU A CA    1 
ATOM   1371  C  C     . GLU A 1 177 ? 18.576  15.617  20.541  1.00 18.47 ? 177  GLU A C     1 
ATOM   1372  O  O     . GLU A 1 177 ? 17.463  15.124  20.688  1.00 18.77 ? 177  GLU A O     1 
ATOM   1373  C  CB    . GLU A 1 177 ? 19.757  15.472  22.746  1.00 19.43 ? 177  GLU A CB    1 
ATOM   1374  C  CG    . GLU A 1 177 ? 20.913  14.577  22.321  1.00 21.22 ? 177  GLU A CG    1 
ATOM   1375  C  CD    . GLU A 1 177 ? 21.564  13.835  23.495  1.00 22.60 ? 177  GLU A CD    1 
ATOM   1376  O  OE1   . GLU A 1 177 ? 20.904  13.709  24.551  1.00 24.43 ? 177  GLU A OE1   1 
ATOM   1377  O  OE2   . GLU A 1 177 ? 22.738  13.395  23.369  1.00 20.65 ? 177  GLU A OE2   1 
ATOM   1378  N  N     . LEU A 1 178 ? 19.245  15.542  19.398  1.00 17.47 ? 178  LEU A N     1 
ATOM   1379  C  CA    . LEU A 1 178 ? 18.711  14.857  18.218  1.00 16.93 ? 178  LEU A CA    1 
ATOM   1380  C  C     . LEU A 1 178 ? 19.665  13.750  17.718  1.00 16.37 ? 178  LEU A C     1 
ATOM   1381  O  O     . LEU A 1 178 ? 20.752  14.043  17.216  1.00 16.20 ? 178  LEU A O     1 
ATOM   1382  C  CB    . LEU A 1 178 ? 18.483  15.881  17.096  1.00 16.77 ? 178  LEU A CB    1 
ATOM   1383  C  CG    . LEU A 1 178 ? 17.273  15.739  16.155  1.00 16.83 ? 178  LEU A CG    1 
ATOM   1384  C  CD1   . LEU A 1 178 ? 17.575  16.345  14.796  1.00 15.84 ? 178  LEU A CD1   1 
ATOM   1385  C  CD2   . LEU A 1 178 ? 16.784  14.291  15.980  1.00 18.07 ? 178  LEU A CD2   1 
ATOM   1386  N  N     . LEU A 1 179 ? 19.263  12.487  17.835  1.00 15.72 ? 179  LEU A N     1 
ATOM   1387  C  CA    . LEU A 1 179 ? 20.076  11.380  17.300  1.00 15.47 ? 179  LEU A CA    1 
ATOM   1388  C  C     . LEU A 1 179 ? 19.661  11.255  15.880  1.00 15.42 ? 179  LEU A C     1 
ATOM   1389  O  O     . LEU A 1 179 ? 18.470  11.284  15.610  1.00 16.71 ? 179  LEU A O     1 
ATOM   1390  C  CB    . LEU A 1 179 ? 19.778  10.072  17.998  1.00 15.24 ? 179  LEU A CB    1 
ATOM   1391  C  CG    . LEU A 1 179 ? 19.501  10.133  19.497  1.00 16.04 ? 179  LEU A CG    1 
ATOM   1392  C  CD1   . LEU A 1 179 ? 19.144  8.742   19.984  1.00 16.17 ? 179  LEU A CD1   1 
ATOM   1393  C  CD2   . LEU A 1 179 ? 20.687  10.714  20.235  1.00 15.51 ? 179  LEU A CD2   1 
ATOM   1394  N  N     . TYR A 1 180 ? 20.593  11.141  14.946  1.00 14.86 ? 180  TYR A N     1 
ATOM   1395  C  CA    . TYR A 1 180 ? 20.192  11.117  13.536  1.00 14.15 ? 180  TYR A CA    1 
ATOM   1396  C  C     . TYR A 1 180 ? 21.048  10.141  12.852  1.00 14.13 ? 180  TYR A C     1 
ATOM   1397  O  O     . TYR A 1 180 ? 22.177  9.979   13.234  1.00 14.24 ? 180  TYR A O     1 
ATOM   1398  C  CB    . TYR A 1 180 ? 20.257  12.521  12.876  1.00 13.79 ? 180  TYR A CB    1 
ATOM   1399  C  CG    . TYR A 1 180 ? 21.628  12.952  12.424  1.00 11.91 ? 180  TYR A CG    1 
ATOM   1400  C  CD1   . TYR A 1 180 ? 22.458  13.677  13.252  1.00 10.32 ? 180  TYR A CD1   1 
ATOM   1401  C  CD2   . TYR A 1 180 ? 22.101  12.594  11.180  1.00 11.09 ? 180  TYR A CD2   1 
ATOM   1402  C  CE1   . TYR A 1 180 ? 23.725  14.054  12.836  1.00 11.56 ? 180  TYR A CE1   1 
ATOM   1403  C  CE2   . TYR A 1 180 ? 23.351  12.950  10.755  1.00 11.10 ? 180  TYR A CE2   1 
ATOM   1404  C  CZ    . TYR A 1 180 ? 24.170  13.692  11.573  1.00 12.57 ? 180  TYR A CZ    1 
ATOM   1405  O  OH    . TYR A 1 180 ? 25.443  14.043  11.127  1.00 11.63 ? 180  TYR A OH    1 
ATOM   1406  N  N     . ALA A 1 181 ? 20.507  9.496   11.828  1.00 15.30 ? 181  ALA A N     1 
ATOM   1407  C  CA    . ALA A 1 181 ? 21.179  8.370   11.152  1.00 15.66 ? 181  ALA A CA    1 
ATOM   1408  C  C     . ALA A 1 181 ? 22.343  8.815   10.255  1.00 16.03 ? 181  ALA A C     1 
ATOM   1409  O  O     . ALA A 1 181 ? 22.253  9.808   9.573   1.00 16.20 ? 181  ALA A O     1 
ATOM   1410  C  CB    . ALA A 1 181 ? 20.167  7.566   10.338  1.00 15.02 ? 181  ALA A CB    1 
ATOM   1411  N  N     . GLU A 1 182 ? 23.406  8.020   10.207  1.00 17.12 ? 182  GLU A N     1 
ATOM   1412  C  CA    . GLU A 1 182 ? 24.593  8.365   9.429   1.00 17.70 ? 182  GLU A CA    1 
ATOM   1413  C  C     . GLU A 1 182 ? 24.318  8.716   7.955   1.00 18.43 ? 182  GLU A C     1 
ATOM   1414  O  O     . GLU A 1 182 ? 25.088  9.471   7.375   1.00 18.81 ? 182  GLU A O     1 
ATOM   1415  C  CB    . GLU A 1 182 ? 25.659  7.261   9.514   1.00 17.68 ? 182  GLU A CB    1 
ATOM   1416  C  CG    . GLU A 1 182 ? 25.599  6.225   8.406   1.00 17.95 ? 182  GLU A CG    1 
ATOM   1417  C  CD    . GLU A 1 182 ? 26.459  5.005   8.685   1.00 18.58 ? 182  GLU A CD    1 
ATOM   1418  O  OE1   . GLU A 1 182 ? 27.464  4.810   7.957   1.00 20.33 ? 182  GLU A OE1   1 
ATOM   1419  O  OE2   . GLU A 1 182 ? 26.127  4.231   9.619   1.00 17.13 ? 182  GLU A OE2   1 
ATOM   1420  N  N     . ASP A 1 183 ? 23.253  8.174   7.355   1.00 18.68 ? 183  ASP A N     1 
ATOM   1421  C  CA    . ASP A 1 183 ? 22.969  8.384   5.922   1.00 18.96 ? 183  ASP A CA    1 
ATOM   1422  C  C     . ASP A 1 183 ? 21.820  9.376   5.642   1.00 19.17 ? 183  ASP A C     1 
ATOM   1423  O  O     . ASP A 1 183 ? 21.240  9.412   4.549   1.00 18.78 ? 183  ASP A O     1 
ATOM   1424  C  CB    . ASP A 1 183 ? 22.642  7.056   5.266   1.00 19.22 ? 183  ASP A CB    1 
ATOM   1425  C  CG    . ASP A 1 183 ? 21.232  6.584   5.575   1.00 19.78 ? 183  ASP A CG    1 
ATOM   1426  O  OD1   . ASP A 1 183 ? 20.651  7.019   6.590   1.00 20.10 ? 183  ASP A OD1   1 
ATOM   1427  O  OD2   . ASP A 1 183 ? 20.624  5.773   4.854   1.00 22.08 ? 183  ASP A OD2   1 
ATOM   1428  N  N     . PHE A 1 184 ? 21.493  10.173  6.646   1.00 19.49 ? 184  PHE A N     1 
ATOM   1429  C  CA    . PHE A 1 184 ? 20.466  11.187  6.527   1.00 19.70 ? 184  PHE A CA    1 
ATOM   1430  C  C     . PHE A 1 184 ? 20.871  12.139  5.386   1.00 20.15 ? 184  PHE A C     1 
ATOM   1431  O  O     . PHE A 1 184 ? 21.939  12.747  5.435   1.00 20.35 ? 184  PHE A O     1 
ATOM   1432  C  CB    . PHE A 1 184 ? 20.363  11.911  7.872   1.00 19.74 ? 184  PHE A CB    1 
ATOM   1433  C  CG    . PHE A 1 184 ? 19.115  12.731  8.044   1.00 19.29 ? 184  PHE A CG    1 
ATOM   1434  C  CD1   . PHE A 1 184 ? 17.925  12.125  8.399   1.00 19.36 ? 184  PHE A CD1   1 
ATOM   1435  C  CD2   . PHE A 1 184 ? 19.152  14.116  7.906   1.00 18.56 ? 184  PHE A CD2   1 
ATOM   1436  C  CE1   . PHE A 1 184 ? 16.786  12.874  8.574   1.00 20.93 ? 184  PHE A CE1   1 
ATOM   1437  C  CE2   . PHE A 1 184 ? 18.020  14.881  8.078   1.00 18.95 ? 184  PHE A CE2   1 
ATOM   1438  C  CZ    . PHE A 1 184 ? 16.840  14.278  8.407   1.00 21.06 ? 184  PHE A CZ    1 
ATOM   1439  N  N     . ALA A 1 185 ? 20.037  12.229  4.348   1.00 20.57 ? 185  ALA A N     1 
ATOM   1440  C  CA    . ALA A 1 185 ? 20.316  13.071  3.184   1.00 20.89 ? 185  ALA A CA    1 
ATOM   1441  C  C     . ALA A 1 185 ? 20.073  14.582  3.417   1.00 21.62 ? 185  ALA A C     1 
ATOM   1442  O  O     . ALA A 1 185 ? 20.953  15.408  3.124   1.00 21.89 ? 185  ALA A O     1 
ATOM   1443  C  CB    . ALA A 1 185 ? 19.511  12.588  1.978   1.00 20.67 ? 185  ALA A CB    1 
ATOM   1444  N  N     . GLU A 1 186 ? 18.891  14.938  3.925   1.00 21.90 ? 186  GLU A N     1 
ATOM   1445  C  CA    . GLU A 1 186 ? 18.480  16.336  4.010   1.00 22.12 ? 186  GLU A CA    1 
ATOM   1446  C  C     . GLU A 1 186 ? 19.011  16.944  5.290   1.00 22.02 ? 186  GLU A C     1 
ATOM   1447  O  O     . GLU A 1 186 ? 18.278  17.120  6.252   1.00 22.08 ? 186  GLU A O     1 
ATOM   1448  C  CB    . GLU A 1 186 ? 16.955  16.490  3.903   1.00 22.20 ? 186  GLU A CB    1 
ATOM   1449  C  CG    . GLU A 1 186 ? 16.486  16.770  2.482   1.00 23.29 ? 186  GLU A CG    1 
ATOM   1450  C  CD    . GLU A 1 186 ? 16.585  18.251  2.137   1.00 24.03 ? 186  GLU A CD    1 
ATOM   1451  O  OE1   . GLU A 1 186 ? 17.515  18.652  1.407   1.00 23.51 ? 186  GLU A OE1   1 
ATOM   1452  O  OE2   . GLU A 1 186 ? 15.733  19.020  2.618   1.00 24.72 ? 186  GLU A OE2   1 
ATOM   1453  N  N     . MET A 1 187 ? 20.299  17.287  5.264   1.00 21.94 ? 187  MET A N     1 
ATOM   1454  C  CA    . MET A 1 187 ? 21.005  17.787  6.426   1.00 21.88 ? 187  MET A CA    1 
ATOM   1455  C  C     . MET A 1 187 ? 20.615  19.198  6.746   1.00 21.85 ? 187  MET A C     1 
ATOM   1456  O  O     . MET A 1 187 ? 20.905  19.673  7.835   1.00 22.75 ? 187  MET A O     1 
ATOM   1457  C  CB    . MET A 1 187 ? 22.508  17.728  6.205   1.00 21.96 ? 187  MET A CB    1 
ATOM   1458  C  CG    . MET A 1 187 ? 23.066  16.305  6.121   1.00 22.69 ? 187  MET A CG    1 
ATOM   1459  S  SD    . MET A 1 187 ? 22.754  15.298  7.592   1.00 23.39 ? 187  MET A SD    1 
ATOM   1460  C  CE    . MET A 1 187 ? 23.411  16.303  8.882   1.00 23.72 ? 187  MET A CE    1 
ATOM   1461  N  N     . SER A 1 188 ? 19.948  19.882  5.829   1.00 21.23 ? 188  SER A N     1 
ATOM   1462  C  CA    . SER A 1 188 ? 19.591  21.264  6.072   1.00 20.68 ? 188  SER A CA    1 
ATOM   1463  C  C     . SER A 1 188 ? 18.380  21.405  7.006   1.00 21.03 ? 188  SER A C     1 
ATOM   1464  O  O     . SER A 1 188 ? 17.977  22.515  7.326   1.00 21.16 ? 188  SER A O     1 
ATOM   1465  C  CB    . SER A 1 188 ? 19.352  21.970  4.749   1.00 20.58 ? 188  SER A CB    1 
ATOM   1466  O  OG    . SER A 1 188 ? 18.052  21.733  4.272   1.00 19.38 ? 188  SER A OG    1 
ATOM   1467  N  N     . LEU A 1 189 ? 17.797  20.288  7.442   1.00 21.23 ? 189  LEU A N     1 
ATOM   1468  C  CA    . LEU A 1 189 ? 16.776  20.307  8.492   1.00 21.35 ? 189  LEU A CA    1 
ATOM   1469  C  C     . LEU A 1 189 ? 17.368  20.346  9.909   1.00 21.56 ? 189  LEU A C     1 
ATOM   1470  O  O     . LEU A 1 189 ? 16.646  20.558  10.870  1.00 21.29 ? 189  LEU A O     1 
ATOM   1471  C  CB    . LEU A 1 189 ? 15.886  19.056  8.377   1.00 21.36 ? 189  LEU A CB    1 
ATOM   1472  C  CG    . LEU A 1 189 ? 15.000  18.892  7.136   1.00 21.50 ? 189  LEU A CG    1 
ATOM   1473  C  CD1   . LEU A 1 189 ? 14.418  17.461  6.972   1.00 19.34 ? 189  LEU A CD1   1 
ATOM   1474  C  CD2   . LEU A 1 189 ? 13.880  19.900  7.189   1.00 22.10 ? 189  LEU A CD2   1 
ATOM   1475  N  N     . ILE A 1 190 ? 18.684  20.185  10.018  1.00 22.41 ? 190  ILE A N     1 
ATOM   1476  C  CA    . ILE A 1 190 ? 19.329  19.563  11.179  1.00 22.76 ? 190  ILE A CA    1 
ATOM   1477  C  C     . ILE A 1 190 ? 20.715  20.144  11.459  1.00 23.24 ? 190  ILE A C     1 
ATOM   1478  O  O     . ILE A 1 190 ? 21.082  20.323  12.608  1.00 22.27 ? 190  ILE A O     1 
ATOM   1479  C  CB    . ILE A 1 190 ? 19.387  18.006  10.919  1.00 22.91 ? 190  ILE A CB    1 
ATOM   1480  C  CG1   . ILE A 1 190 ? 18.402  17.297  11.818  1.00 24.46 ? 190  ILE A CG1   1 
ATOM   1481  C  CG2   . ILE A 1 190 ? 20.769  17.362  11.111  1.00 22.13 ? 190  ILE A CG2   1 
ATOM   1482  C  CD1   . ILE A 1 190 ? 17.113  17.061  11.147  1.00 26.03 ? 190  ILE A CD1   1 
ATOM   1483  N  N     . GLU A 1 191 ? 21.499  20.357  10.407  1.00 24.39 ? 191  GLU A N     1 
ATOM   1484  C  CA    . GLU A 1 191 ? 22.662  21.221  10.464  1.00 26.03 ? 191  GLU A CA    1 
ATOM   1485  C  C     . GLU A 1 191 ? 22.265  22.486  11.236  1.00 26.22 ? 191  GLU A C     1 
ATOM   1486  O  O     . GLU A 1 191 ? 21.188  23.051  11.015  1.00 26.07 ? 191  GLU A O     1 
ATOM   1487  C  CB    . GLU A 1 191 ? 23.133  21.626  9.051   1.00 26.71 ? 191  GLU A CB    1 
ATOM   1488  C  CG    . GLU A 1 191 ? 23.788  20.516  8.230   1.00 29.53 ? 191  GLU A CG    1 
ATOM   1489  C  CD    . GLU A 1 191 ? 25.321  20.512  8.273   1.00 33.06 ? 191  GLU A CD    1 
ATOM   1490  O  OE1   . GLU A 1 191 ? 25.947  21.495  7.788   1.00 32.78 ? 191  GLU A OE1   1 
ATOM   1491  O  OE2   . GLU A 1 191 ? 25.898  19.501  8.787   1.00 35.37 ? 191  GLU A OE2   1 
ATOM   1492  N  N     . GLY A 1 192 ? 23.114  22.912  12.161  1.00 26.36 ? 192  GLY A N     1 
ATOM   1493  C  CA    . GLY A 1 192 ? 22.809  24.089  12.955  1.00 26.95 ? 192  GLY A CA    1 
ATOM   1494  C  C     . GLY A 1 192 ? 21.781  23.888  14.055  1.00 26.93 ? 192  GLY A C     1 
ATOM   1495  O  O     . GLY A 1 192 ? 21.146  24.844  14.473  1.00 26.84 ? 192  GLY A O     1 
ATOM   1496  N  N     . ARG A 1 193 ? 21.655  22.655  14.542  1.00 27.04 ? 193  ARG A N     1 
ATOM   1497  C  CA    . ARG A 1 193 ? 20.791  22.331  15.667  1.00 26.88 ? 193  ARG A CA    1 
ATOM   1498  C  C     . ARG A 1 193 ? 21.619  21.916  16.879  1.00 27.07 ? 193  ARG A C     1 
ATOM   1499  O  O     . ARG A 1 193 ? 22.619  21.199  16.760  1.00 27.14 ? 193  ARG A O     1 
ATOM   1500  C  CB    . ARG A 1 193 ? 19.846  21.194  15.306  1.00 26.69 ? 193  ARG A CB    1 
ATOM   1501  C  CG    . ARG A 1 193 ? 18.624  21.644  14.521  1.00 26.03 ? 193  ARG A CG    1 
ATOM   1502  C  CD    . ARG A 1 193 ? 17.370  20.895  14.864  1.00 24.09 ? 193  ARG A CD    1 
ATOM   1503  N  NE    . ARG A 1 193 ? 17.055  20.958  16.288  1.00 22.08 ? 193  ARG A NE    1 
ATOM   1504  C  CZ    . ARG A 1 193 ? 15.998  21.557  16.804  1.00 19.32 ? 193  ARG A CZ    1 
ATOM   1505  N  NH1   . ARG A 1 193 ? 15.824  21.542  18.107  1.00 17.80 ? 193  ARG A NH1   1 
ATOM   1506  N  NH2   . ARG A 1 193 ? 15.112  22.175  16.041  1.00 20.88 ? 193  ARG A NH2   1 
ATOM   1507  N  N     . ARG A 1 194 ? 21.175  22.355  18.054  1.00 26.96 ? 194  ARG A N     1 
ATOM   1508  C  CA    . ARG A 1 194 ? 21.855  22.012  19.297  1.00 26.39 ? 194  ARG A CA    1 
ATOM   1509  C  C     . ARG A 1 194 ? 21.673  20.556  19.615  1.00 25.76 ? 194  ARG A C     1 
ATOM   1510  O  O     . ARG A 1 194 ? 20.623  19.996  19.360  1.00 26.44 ? 194  ARG A O     1 
ATOM   1511  C  CB    . ARG A 1 194 ? 21.322  22.844  20.463  1.00 26.26 ? 194  ARG A CB    1 
ATOM   1512  C  CG    . ARG A 1 194 ? 20.005  22.359  21.061  1.00 25.49 ? 194  ARG A CG    1 
ATOM   1513  C  CD    . ARG A 1 194 ? 19.207  23.460  21.688  1.00 24.08 ? 194  ARG A CD    1 
ATOM   1514  N  NE    . ARG A 1 194 ? 17.797  23.143  21.900  1.00 22.93 ? 194  ARG A NE    1 
ATOM   1515  C  CZ    . ARG A 1 194 ? 17.221  23.001  23.100  1.00 24.63 ? 194  ARG A CZ    1 
ATOM   1516  N  NH1   . ARG A 1 194 ? 17.926  23.095  24.249  1.00 24.95 ? 194  ARG A NH1   1 
ATOM   1517  N  NH2   . ARG A 1 194 ? 15.924  22.741  23.160  1.00 24.77 ? 194  ARG A NH2   1 
ATOM   1518  N  N     . GLY A 1 195 ? 22.702  19.969  20.201  1.00 25.22 ? 195  GLY A N     1 
ATOM   1519  C  CA    . GLY A 1 195 ? 22.647  18.618  20.704  1.00 24.68 ? 195  GLY A CA    1 
ATOM   1520  C  C     . GLY A 1 195 ? 22.605  17.550  19.646  1.00 24.09 ? 195  GLY A C     1 
ATOM   1521  O  O     . GLY A 1 195 ? 22.040  16.515  19.875  1.00 25.00 ? 195  GLY A O     1 
ATOM   1522  N  N     . LEU A 1 196 ? 23.239  17.774  18.510  1.00 23.60 ? 196  LEU A N     1 
ATOM   1523  C  CA    . LEU A 1 196 ? 23.170  16.846  17.385  1.00 23.02 ? 196  LEU A CA    1 
ATOM   1524  C  C     . LEU A 1 196 ? 24.096  15.627  17.564  1.00 22.75 ? 196  LEU A C     1 
ATOM   1525  O  O     . LEU A 1 196 ? 25.257  15.775  17.964  1.00 22.21 ? 196  LEU A O     1 
ATOM   1526  C  CB    . LEU A 1 196 ? 23.500  17.592  16.088  1.00 22.96 ? 196  LEU A CB    1 
ATOM   1527  C  CG    . LEU A 1 196 ? 22.900  16.989  14.827  1.00 22.82 ? 196  LEU A CG    1 
ATOM   1528  C  CD1   . LEU A 1 196 ? 21.408  17.147  14.820  1.00 23.81 ? 196  LEU A CD1   1 
ATOM   1529  C  CD2   . LEU A 1 196 ? 23.480  17.622  13.603  1.00 22.34 ? 196  LEU A CD2   1 
ATOM   1530  N  N     . ARG A 1 197 ? 23.589  14.429  17.262  1.00 22.08 ? 197  ARG A N     1 
ATOM   1531  C  CA    . ARG A 1 197 ? 24.326  13.202  17.564  1.00 21.83 ? 197  ARG A CA    1 
ATOM   1532  C  C     . ARG A 1 197 ? 24.232  12.212  16.426  1.00 21.30 ? 197  ARG A C     1 
ATOM   1533  O  O     . ARG A 1 197 ? 23.258  11.473  16.305  1.00 21.77 ? 197  ARG A O     1 
ATOM   1534  C  CB    . ARG A 1 197 ? 23.814  12.553  18.847  1.00 21.84 ? 197  ARG A CB    1 
ATOM   1535  C  CG    . ARG A 1 197 ? 23.951  13.424  20.099  1.00 22.65 ? 197  ARG A CG    1 
ATOM   1536  C  CD    . ARG A 1 197 ? 25.380  13.592  20.626  1.00 23.21 ? 197  ARG A CD    1 
ATOM   1537  N  NE    . ARG A 1 197 ? 25.409  14.243  21.947  1.00 25.14 ? 197  ARG A NE    1 
ATOM   1538  C  CZ    . ARG A 1 197 ? 25.503  15.572  22.181  1.00 26.62 ? 197  ARG A CZ    1 
ATOM   1539  N  NH1   . ARG A 1 197 ? 25.584  16.472  21.197  1.00 27.03 ? 197  ARG A NH1   1 
ATOM   1540  N  NH2   . ARG A 1 197 ? 25.525  16.013  23.430  1.00 27.23 ? 197  ARG A NH2   1 
ATOM   1541  N  N     . ARG A 1 198 ? 25.254  12.190  15.593  1.00 20.39 ? 198  ARG A N     1 
ATOM   1542  C  CA    . ARG A 1 198 ? 25.312  11.234  14.494  1.00 19.98 ? 198  ARG A CA    1 
ATOM   1543  C  C     . ARG A 1 198 ? 25.347  9.779   15.017  1.00 19.51 ? 198  ARG A C     1 
ATOM   1544  O  O     . ARG A 1 198 ? 26.153  9.444   15.873  1.00 18.82 ? 198  ARG A O     1 
ATOM   1545  C  CB    . ARG A 1 198 ? 26.550  11.509  13.656  1.00 19.62 ? 198  ARG A CB    1 
ATOM   1546  C  CG    . ARG A 1 198 ? 26.478  11.044  12.231  1.00 19.64 ? 198  ARG A CG    1 
ATOM   1547  C  CD    . ARG A 1 198 ? 27.728  11.402  11.459  1.00 19.60 ? 198  ARG A CD    1 
ATOM   1548  N  NE    . ARG A 1 198 ? 27.902  10.702  10.186  1.00 19.52 ? 198  ARG A NE    1 
ATOM   1549  C  CZ    . ARG A 1 198 ? 27.192  10.917  9.084   1.00 18.40 ? 198  ARG A CZ    1 
ATOM   1550  N  NH1   . ARG A 1 198 ? 26.197  11.783  9.076   1.00 22.24 ? 198  ARG A NH1   1 
ATOM   1551  N  NH2   . ARG A 1 198 ? 27.458  10.251  7.983   1.00 16.41 ? 198  ARG A NH2   1 
ATOM   1552  N  N     . ARG A 1 199 ? 24.463  8.937   14.489  1.00 18.83 ? 199  ARG A N     1 
ATOM   1553  C  CA    . ARG A 1 199 ? 24.370  7.544   14.889  1.00 18.22 ? 199  ARG A CA    1 
ATOM   1554  C  C     . ARG A 1 199 ? 24.638  6.608   13.719  1.00 18.20 ? 199  ARG A C     1 
ATOM   1555  O  O     . ARG A 1 199 ? 24.414  6.970   12.564  1.00 17.85 ? 199  ARG A O     1 
ATOM   1556  C  CB    . ARG A 1 199 ? 22.996  7.265   15.458  1.00 18.10 ? 199  ARG A CB    1 
ATOM   1557  C  CG    . ARG A 1 199 ? 22.595  8.196   16.588  1.00 17.40 ? 199  ARG A CG    1 
ATOM   1558  C  CD    . ARG A 1 199 ? 23.631  8.344   17.690  1.00 17.28 ? 199  ARG A CD    1 
ATOM   1559  N  NE    . ARG A 1 199 ? 23.718  7.122   18.464  1.00 18.57 ? 199  ARG A NE    1 
ATOM   1560  C  CZ    . ARG A 1 199 ? 24.570  6.892   19.449  1.00 18.50 ? 199  ARG A CZ    1 
ATOM   1561  N  NH1   . ARG A 1 199 ? 25.447  7.802   19.846  1.00 18.89 ? 199  ARG A NH1   1 
ATOM   1562  N  NH2   . ARG A 1 199 ? 24.513  5.728   20.070  1.00 18.64 ? 199  ARG A NH2   1 
ATOM   1563  N  N     . PRO A 1 200 ? 25.175  5.428   14.020  1.00 18.29 ? 200  PRO A N     1 
ATOM   1564  C  CA    . PRO A 1 200 ? 25.292  4.338   13.041  1.00 18.61 ? 200  PRO A CA    1 
ATOM   1565  C  C     . PRO A 1 200 ? 23.961  3.754   12.601  1.00 18.87 ? 200  PRO A C     1 
ATOM   1566  O  O     . PRO A 1 200 ? 23.029  3.598   13.376  1.00 18.24 ? 200  PRO A O     1 
ATOM   1567  C  CB    . PRO A 1 200 ? 26.077  3.265   13.795  1.00 18.89 ? 200  PRO A CB    1 
ATOM   1568  C  CG    . PRO A 1 200 ? 26.735  3.997   14.929  1.00 18.86 ? 200  PRO A CG    1 
ATOM   1569  C  CD    . PRO A 1 200 ? 25.790  5.073   15.310  1.00 18.24 ? 200  PRO A CD    1 
ATOM   1570  N  N     . LEU A 1 201 ? 23.906  3.404   11.331  1.00 19.91 ? 201  LEU A N     1 
ATOM   1571  C  CA    . LEU A 1 201 ? 22.715  2.820   10.724  1.00 20.73 ? 201  LEU A CA    1 
ATOM   1572  C  C     . LEU A 1 201 ? 22.181  1.551   11.420  1.00 21.13 ? 201  LEU A C     1 
ATOM   1573  O  O     . LEU A 1 201 ? 21.000  1.277   11.340  1.00 21.53 ? 201  LEU A O     1 
ATOM   1574  C  CB    . LEU A 1 201 ? 22.988  2.512   9.237   1.00 20.80 ? 201  LEU A CB    1 
ATOM   1575  C  CG    . LEU A 1 201 ? 21.999  3.121   8.250   1.00 21.97 ? 201  LEU A CG    1 
ATOM   1576  C  CD1   . LEU A 1 201 ? 22.408  2.892   6.816   1.00 22.15 ? 201  LEU A CD1   1 
ATOM   1577  C  CD2   . LEU A 1 201 ? 20.626  2.540   8.502   1.00 24.12 ? 201  LEU A CD2   1 
ATOM   1578  N  N     . TRP A 1 202 ? 23.025  0.754   12.066  1.00 21.90 ? 202  TRP A N     1 
ATOM   1579  C  CA    . TRP A 1 202 ? 22.506  -0.457  12.697  1.00 22.63 ? 202  TRP A CA    1 
ATOM   1580  C  C     . TRP A 1 202 ? 21.503  -0.160  13.825  1.00 22.53 ? 202  TRP A C     1 
ATOM   1581  O  O     . TRP A 1 202 ? 20.626  -0.986  14.090  1.00 23.39 ? 202  TRP A O     1 
ATOM   1582  C  CB    . TRP A 1 202 ? 23.613  -1.434  13.151  1.00 22.84 ? 202  TRP A CB    1 
ATOM   1583  C  CG    . TRP A 1 202 ? 24.606  -0.873  14.112  1.00 25.29 ? 202  TRP A CG    1 
ATOM   1584  C  CD1   . TRP A 1 202 ? 25.836  -0.339  13.811  1.00 26.47 ? 202  TRP A CD1   1 
ATOM   1585  C  CD2   . TRP A 1 202 ? 24.476  -0.797  15.539  1.00 27.59 ? 202  TRP A CD2   1 
ATOM   1586  N  NE1   . TRP A 1 202 ? 26.463  0.077   14.963  1.00 26.96 ? 202  TRP A NE1   1 
ATOM   1587  C  CE2   . TRP A 1 202 ? 25.654  -0.187  16.037  1.00 27.30 ? 202  TRP A CE2   1 
ATOM   1588  C  CE3   . TRP A 1 202 ? 23.476  -1.164  16.450  1.00 28.19 ? 202  TRP A CE3   1 
ATOM   1589  C  CZ2   . TRP A 1 202 ? 25.860  0.051   17.399  1.00 27.62 ? 202  TRP A CZ2   1 
ATOM   1590  C  CZ3   . TRP A 1 202 ? 23.679  -0.920  17.800  1.00 28.71 ? 202  TRP A CZ3   1 
ATOM   1591  C  CH2   . TRP A 1 202 ? 24.866  -0.317  18.260  1.00 28.23 ? 202  TRP A CH2   1 
ATOM   1592  N  N     . GLU A 1 203 ? 21.605  1.013   14.458  1.00 22.17 ? 203  GLU A N     1 
ATOM   1593  C  CA    . GLU A 1 203 ? 20.688  1.412   15.542  1.00 21.68 ? 203  GLU A CA    1 
ATOM   1594  C  C     . GLU A 1 203 ? 19.276  1.697   15.048  1.00 20.98 ? 203  GLU A C     1 
ATOM   1595  O  O     . GLU A 1 203 ? 18.333  1.751   15.833  1.00 20.92 ? 203  GLU A O     1 
ATOM   1596  C  CB    . GLU A 1 203 ? 21.239  2.624   16.319  1.00 21.71 ? 203  GLU A CB    1 
ATOM   1597  C  CG    . GLU A 1 203 ? 22.511  2.274   17.100  1.00 22.83 ? 203  GLU A CG    1 
ATOM   1598  C  CD    . GLU A 1 203 ? 23.201  3.454   17.769  1.00 22.06 ? 203  GLU A CD    1 
ATOM   1599  O  OE1   . GLU A 1 203 ? 22.642  4.553   17.750  1.00 19.06 ? 203  GLU A OE1   1 
ATOM   1600  O  OE2   . GLU A 1 203 ? 24.315  3.263   18.321  1.00 22.44 ? 203  GLU A OE2   1 
ATOM   1601  N  N     . PHE A 1 204 ? 19.135  1.868   13.746  1.00 20.42 ? 204  PHE A N     1 
ATOM   1602  C  CA    . PHE A 1 204 ? 17.826  2.092   13.149  1.00 20.73 ? 204  PHE A CA    1 
ATOM   1603  C  C     . PHE A 1 204 ? 17.252  0.842   12.459  1.00 20.45 ? 204  PHE A C     1 
ATOM   1604  O  O     . PHE A 1 204 ? 16.201  0.924   11.845  1.00 20.04 ? 204  PHE A O     1 
ATOM   1605  C  CB    . PHE A 1 204 ? 17.901  3.274   12.160  1.00 20.85 ? 204  PHE A CB    1 
ATOM   1606  C  CG    . PHE A 1 204 ? 18.178  4.612   12.818  1.00 20.86 ? 204  PHE A CG    1 
ATOM   1607  C  CD1   . PHE A 1 204 ? 19.437  4.926   13.270  1.00 21.16 ? 204  PHE A CD1   1 
ATOM   1608  C  CD2   . PHE A 1 204 ? 17.176  5.550   12.973  1.00 22.64 ? 204  PHE A CD2   1 
ATOM   1609  C  CE1   . PHE A 1 204 ? 19.699  6.143   13.861  1.00 21.88 ? 204  PHE A CE1   1 
ATOM   1610  C  CE2   . PHE A 1 204 ? 17.428  6.783   13.572  1.00 22.84 ? 204  PHE A CE2   1 
ATOM   1611  C  CZ    . PHE A 1 204 ? 18.702  7.069   14.015  1.00 23.73 ? 204  PHE A CZ    1 
ATOM   1612  N  N     . GLU A 1 205 ? 17.930  -0.304  12.571  1.00 20.50 ? 205  GLU A N     1 
ATOM   1613  C  CA    . GLU A 1 205 ? 17.435  -1.558  12.007  1.00 20.61 ? 205  GLU A CA    1 
ATOM   1614  C  C     . GLU A 1 205 ? 16.079  -1.877  12.646  1.00 20.01 ? 205  GLU A C     1 
ATOM   1615  O  O     . GLU A 1 205 ? 15.906  -1.781  13.861  1.00 19.74 ? 205  GLU A O     1 
ATOM   1616  C  CB    . GLU A 1 205 ? 18.483  -2.687  12.174  1.00 21.18 ? 205  GLU A CB    1 
ATOM   1617  C  CG    . GLU A 1 205 ? 17.979  -4.150  12.120  1.00 23.56 ? 205  GLU A CG    1 
ATOM   1618  C  CD    . GLU A 1 205 ? 17.439  -4.578  10.755  1.00 26.82 ? 205  GLU A CD    1 
ATOM   1619  O  OE1   . GLU A 1 205 ? 18.011  -4.146  9.723   1.00 30.20 ? 205  GLU A OE1   1 
ATOM   1620  O  OE2   . GLU A 1 205 ? 16.442  -5.348  10.703  1.00 25.86 ? 205  GLU A OE2   1 
ATOM   1621  N  N     . ILE A 1 206 ? 15.106  -2.218  11.812  1.00 19.70 ? 206  ILE A N     1 
ATOM   1622  C  CA    . ILE A 1 206 ? 13.734  -2.477  12.271  1.00 19.64 ? 206  ILE A CA    1 
ATOM   1623  C  C     . ILE A 1 206 ? 13.516  -3.749  13.180  1.00 19.86 ? 206  ILE A C     1 
ATOM   1624  O  O     . ILE A 1 206 ? 12.747  -3.673  14.130  1.00 19.63 ? 206  ILE A O     1 
ATOM   1625  C  CB    . ILE A 1 206 ? 12.766  -2.443  11.048  1.00 19.18 ? 206  ILE A CB    1 
ATOM   1626  C  CG1   . ILE A 1 206 ? 11.300  -2.522  11.465  1.00 20.13 ? 206  ILE A CG1   1 
ATOM   1627  C  CG2   . ILE A 1 206 ? 13.039  -3.576  10.118  1.00 19.38 ? 206  ILE A CG2   1 
ATOM   1628  C  CD1   . ILE A 1 206 ? 10.804  -1.407  12.330  1.00 20.30 ? 206  ILE A CD1   1 
ATOM   1629  N  N     . ASP A 1 207 ? 14.168  -4.894  12.923  1.00 20.14 ? 207  ASP A N     1 
ATOM   1630  C  CA    . ASP A 1 207 ? 13.932  -6.113  13.755  1.00 20.18 ? 207  ASP A CA    1 
ATOM   1631  C  C     . ASP A 1 207 ? 14.439  -5.911  15.171  1.00 20.19 ? 207  ASP A C     1 
ATOM   1632  O  O     . ASP A 1 207 ? 13.852  -6.405  16.122  1.00 19.80 ? 207  ASP A O     1 
ATOM   1633  C  CB    . ASP A 1 207 ? 14.594  -7.361  13.176  1.00 19.86 ? 207  ASP A CB    1 
ATOM   1634  C  CG    . ASP A 1 207 ? 13.990  -7.786  11.856  1.00 21.51 ? 207  ASP A CG    1 
ATOM   1635  O  OD1   . ASP A 1 207 ? 12.847  -7.342  11.539  1.00 22.41 ? 207  ASP A OD1   1 
ATOM   1636  O  OD2   . ASP A 1 207 ? 14.592  -8.570  11.068  1.00 22.03 ? 207  ASP A OD2   1 
ATOM   1637  N  N     . THR A 1 208 ? 15.545  -5.190  15.287  1.00 20.61 ? 208  THR A N     1 
ATOM   1638  C  CA    . THR A 1 208 ? 16.090  -4.778  16.579  1.00 21.22 ? 208  THR A CA    1 
ATOM   1639  C  C     . THR A 1 208 ? 15.211  -3.746  17.301  1.00 21.12 ? 208  THR A C     1 
ATOM   1640  O  O     . THR A 1 208 ? 15.149  -3.731  18.511  1.00 21.48 ? 208  THR A O     1 
ATOM   1641  C  CB    . THR A 1 208 ? 17.503  -4.210  16.345  1.00 21.38 ? 208  THR A CB    1 
ATOM   1642  O  OG1   . THR A 1 208 ? 18.347  -5.281  15.926  1.00 22.09 ? 208  THR A OG1   1 
ATOM   1643  C  CG2   . THR A 1 208 ? 18.164  -3.692  17.622  1.00 21.45 ? 208  THR A CG2   1 
ATOM   1644  N  N     . ALA A 1 209 ? 14.534  -2.879  16.570  1.00 21.21 ? 209  ALA A N     1 
ATOM   1645  C  CA    . ALA A 1 209 ? 13.655  -1.901  17.212  1.00 21.26 ? 209  ALA A CA    1 
ATOM   1646  C  C     . ALA A 1 209 ? 12.422  -2.626  17.749  1.00 20.88 ? 209  ALA A C     1 
ATOM   1647  O  O     . ALA A 1 209 ? 11.969  -2.378  18.872  1.00 21.54 ? 209  ALA A O     1 
ATOM   1648  C  CB    . ALA A 1 209 ? 13.250  -0.779  16.228  1.00 20.80 ? 209  ALA A CB    1 
ATOM   1649  N  N     . ARG A 1 210 ? 11.871  -3.522  16.952  1.00 20.02 ? 210  ARG A N     1 
ATOM   1650  C  CA    . ARG A 1 210 ? 10.707  -4.254  17.409  1.00 19.84 ? 210  ARG A CA    1 
ATOM   1651  C  C     . ARG A 1 210 ? 11.092  -5.014  18.670  1.00 19.98 ? 210  ARG A C     1 
ATOM   1652  O  O     . ARG A 1 210 ? 10.354  -5.004  19.638  1.00 19.98 ? 210  ARG A O     1 
ATOM   1653  C  CB    . ARG A 1 210 ? 10.184  -5.188  16.333  1.00 19.05 ? 210  ARG A CB    1 
ATOM   1654  C  CG    . ARG A 1 210 ? 9.688   -4.465  15.136  1.00 17.33 ? 210  ARG A CG    1 
ATOM   1655  C  CD    . ARG A 1 210 ? 8.731   -5.268  14.321  1.00 17.65 ? 210  ARG A CD    1 
ATOM   1656  N  NE    . ARG A 1 210 ? 8.309   -4.527  13.140  1.00 16.73 ? 210  ARG A NE    1 
ATOM   1657  C  CZ    . ARG A 1 210 ? 7.132   -3.950  12.990  1.00 15.39 ? 210  ARG A CZ    1 
ATOM   1658  N  NH1   . ARG A 1 210 ? 6.225   -4.022  13.947  1.00 15.99 ? 210  ARG A NH1   1 
ATOM   1659  N  NH2   . ARG A 1 210 ? 6.865   -3.292  11.872  1.00 14.84 ? 210  ARG A NH2   1 
ATOM   1660  N  N     . GLN A 1 211 ? 12.278  -5.606  18.656  1.00 20.21 ? 211  GLN A N     1 
ATOM   1661  C  CA    . GLN A 1 211 ? 12.837  -6.305  19.807  1.00 21.00 ? 211  GLN A CA    1 
ATOM   1662  C  C     . GLN A 1 211 ? 13.020  -5.399  21.050  1.00 20.95 ? 211  GLN A C     1 
ATOM   1663  O  O     . GLN A 1 211 ? 12.356  -5.595  22.041  1.00 21.76 ? 211  GLN A O     1 
ATOM   1664  C  CB    . GLN A 1 211 ? 14.144  -6.988  19.388  1.00 21.36 ? 211  GLN A CB    1 
ATOM   1665  C  CG    . GLN A 1 211 ? 14.501  -8.193  20.198  1.00 22.58 ? 211  GLN A CG    1 
ATOM   1666  C  CD    . GLN A 1 211 ? 15.521  -7.862  21.273  1.00 24.91 ? 211  GLN A CD    1 
ATOM   1667  O  OE1   . GLN A 1 211 ? 16.630  -7.375  20.977  1.00 25.53 ? 211  GLN A OE1   1 
ATOM   1668  N  NE2   . GLN A 1 211 ? 15.155  -8.118  22.528  1.00 25.83 ? 211  GLN A NE2   1 
ATOM   1669  N  N     . GLN A 1 212 ? 13.896  -4.409  21.031  1.00 20.97 ? 212  GLN A N     1 
ATOM   1670  C  CA    . GLN A 1 212 ? 13.943  -3.449  22.150  1.00 21.26 ? 212  GLN A CA    1 
ATOM   1671  C  C     . GLN A 1 212 ? 12.575  -3.010  22.692  1.00 20.03 ? 212  GLN A C     1 
ATOM   1672  O  O     . GLN A 1 212 ? 12.327  -3.129  23.900  1.00 20.26 ? 212  GLN A O     1 
ATOM   1673  C  CB    . GLN A 1 212 ? 14.773  -2.194  21.800  1.00 21.76 ? 212  GLN A CB    1 
ATOM   1674  C  CG    . GLN A 1 212 ? 16.289  -2.436  21.751  1.00 24.28 ? 212  GLN A CG    1 
ATOM   1675  C  CD    . GLN A 1 212 ? 16.761  -3.416  22.829  1.00 27.82 ? 212  GLN A CD    1 
ATOM   1676  O  OE1   . GLN A 1 212 ? 17.182  -2.984  23.915  1.00 31.17 ? 212  GLN A OE1   1 
ATOM   1677  N  NE2   . GLN A 1 212 ? 16.671  -4.730  22.544  1.00 26.48 ? 212  GLN A NE2   1 
ATOM   1678  N  N     . LEU A 1 213 ? 11.690  -2.523  21.821  1.00 18.29 ? 213  LEU A N     1 
ATOM   1679  C  CA    . LEU A 1 213 ? 10.430  -1.946  22.294  1.00 17.10 ? 213  LEU A CA    1 
ATOM   1680  C  C     . LEU A 1 213 ? 9.461   -2.989  22.918  1.00 15.61 ? 213  LEU A C     1 
ATOM   1681  O  O     . LEU A 1 213 ? 8.890   -2.753  23.986  1.00 15.29 ? 213  LEU A O     1 
ATOM   1682  C  CB    . LEU A 1 213 ? 9.766   -1.117  21.194  1.00 17.12 ? 213  LEU A CB    1 
ATOM   1683  C  CG    . LEU A 1 213 ? 10.604  0.035   20.619  1.00 17.27 ? 213  LEU A CG    1 
ATOM   1684  C  CD1   . LEU A 1 213 ? 10.104  0.426   19.262  1.00 17.62 ? 213  LEU A CD1   1 
ATOM   1685  C  CD2   . LEU A 1 213 ? 10.579  1.231   21.506  1.00 16.67 ? 213  LEU A CD2   1 
ATOM   1686  N  N     . ASN A 1 214 ? 9.283   -4.135  22.270  1.00 13.93 ? 214  ASN A N     1 
ATOM   1687  C  CA    . ASN A 1 214 ? 8.546   -5.267  22.885  1.00 12.58 ? 214  ASN A CA    1 
ATOM   1688  C  C     . ASN A 1 214 ? 9.155   -5.678  24.234  1.00 11.41 ? 214  ASN A C     1 
ATOM   1689  O  O     . ASN A 1 214 ? 8.491   -5.701  25.253  1.00 10.31 ? 214  ASN A O     1 
ATOM   1690  C  CB    . ASN A 1 214 ? 8.464   -6.457  21.922  1.00 11.83 ? 214  ASN A CB    1 
ATOM   1691  C  CG    . ASN A 1 214 ? 7.509   -6.199  20.756  1.00 12.07 ? 214  ASN A CG    1 
ATOM   1692  O  OD1   . ASN A 1 214 ? 6.288   -6.210  20.921  1.00 10.82 ? 214  ASN A OD1   1 
ATOM   1693  N  ND2   . ASN A 1 214 ? 8.065   -5.953  19.573  1.00 10.98 ? 214  ASN A ND2   1 
ATOM   1694  N  N     . LEU A 1 215 ? 10.441  -5.940  24.250  1.00 11.53 ? 215  LEU A N     1 
ATOM   1695  C  CA    . LEU A 1 215 ? 11.143  -6.226  25.500  1.00 12.52 ? 215  LEU A CA    1 
ATOM   1696  C  C     . LEU A 1 215 ? 10.741  -5.258  26.582  1.00 12.38 ? 215  LEU A C     1 
ATOM   1697  O  O     . LEU A 1 215 ? 10.302  -5.668  27.658  1.00 11.83 ? 215  LEU A O     1 
ATOM   1698  C  CB    . LEU A 1 215 ? 12.657  -6.093  25.297  1.00 13.02 ? 215  LEU A CB    1 
ATOM   1699  C  CG    . LEU A 1 215 ? 13.456  -6.352  26.568  1.00 14.69 ? 215  LEU A CG    1 
ATOM   1700  C  CD1   . LEU A 1 215 ? 13.374  -7.878  26.921  1.00 16.73 ? 215  LEU A CD1   1 
ATOM   1701  C  CD2   . LEU A 1 215 ? 14.912  -5.855  26.379  1.00 14.97 ? 215  LEU A CD2   1 
ATOM   1702  N  N     . GLN A 1 216 ? 10.891  -3.966  26.236  1.00 12.94 ? 216  GLN A N     1 
ATOM   1703  C  CA    . GLN A 1 216 ? 10.774  -2.839  27.131  1.00 12.42 ? 216  GLN A CA    1 
ATOM   1704  C  C     . GLN A 1 216 ? 9.370   -2.787  27.654  1.00 13.50 ? 216  GLN A C     1 
ATOM   1705  O  O     . GLN A 1 216 ? 9.161   -2.697  28.860  1.00 13.39 ? 216  GLN A O     1 
ATOM   1706  C  CB    . GLN A 1 216 ? 11.098  -1.552  26.367  1.00 12.79 ? 216  GLN A CB    1 
ATOM   1707  C  CG    . GLN A 1 216 ? 10.726  -0.246  27.075  1.00 10.62 ? 216  GLN A CG    1 
ATOM   1708  C  CD    . GLN A 1 216 ? 11.349  -0.146  28.444  1.00 9.73  ? 216  GLN A CD    1 
ATOM   1709  O  OE1   . GLN A 1 216 ? 12.561  -0.408  28.632  1.00 8.13  ? 216  GLN A OE1   1 
ATOM   1710  N  NE2   . GLN A 1 216 ? 10.531  0.192   29.416  1.00 10.34 ? 216  GLN A NE2   1 
ATOM   1711  N  N     . PHE A 1 217 ? 8.407   -2.851  26.739  1.00 14.43 ? 217  PHE A N     1 
ATOM   1712  C  CA    . PHE A 1 217 ? 6.988   -2.762  27.077  1.00 15.73 ? 217  PHE A CA    1 
ATOM   1713  C  C     . PHE A 1 217 ? 6.418   -4.073  27.643  1.00 16.57 ? 217  PHE A C     1 
ATOM   1714  O  O     . PHE A 1 217 ? 5.275   -4.105  28.108  1.00 16.29 ? 217  PHE A O     1 
ATOM   1715  C  CB    . PHE A 1 217 ? 6.208   -2.372  25.827  1.00 15.89 ? 217  PHE A CB    1 
ATOM   1716  C  CG    . PHE A 1 217 ? 6.596   -1.028  25.256  1.00 18.26 ? 217  PHE A CG    1 
ATOM   1717  C  CD1   . PHE A 1 217 ? 6.858   0.067   26.090  1.00 20.35 ? 217  PHE A CD1   1 
ATOM   1718  C  CD2   . PHE A 1 217 ? 6.678   -0.843  23.884  1.00 19.22 ? 217  PHE A CD2   1 
ATOM   1719  C  CE1   . PHE A 1 217 ? 7.204   1.322   25.550  1.00 21.07 ? 217  PHE A CE1   1 
ATOM   1720  C  CE2   . PHE A 1 217 ? 7.026   0.415   23.342  1.00 20.50 ? 217  PHE A CE2   1 
ATOM   1721  C  CZ    . PHE A 1 217 ? 7.283   1.493   24.181  1.00 20.62 ? 217  PHE A CZ    1 
ATOM   1722  N  N     . GLY A 1 218 ? 7.210   -5.151  27.582  1.00 17.17 ? 218  GLY A N     1 
ATOM   1723  C  CA    . GLY A 1 218 ? 6.786   -6.453  28.037  1.00 17.61 ? 218  GLY A CA    1 
ATOM   1724  C  C     . GLY A 1 218 ? 5.679   -7.043  27.205  1.00 18.45 ? 218  GLY A C     1 
ATOM   1725  O  O     . GLY A 1 218 ? 4.754   -7.605  27.777  1.00 19.09 ? 218  GLY A O     1 
ATOM   1726  N  N     . THR A 1 219 ? 5.756   -6.898  25.875  1.00 19.15 ? 219  THR A N     1 
ATOM   1727  C  CA    . THR A 1 219 ? 4.740   -7.423  24.947  1.00 19.43 ? 219  THR A CA    1 
ATOM   1728  C  C     . THR A 1 219 ? 5.377   -8.334  23.922  1.00 19.96 ? 219  THR A C     1 
ATOM   1729  O  O     . THR A 1 219 ? 6.600   -8.360  23.794  1.00 20.60 ? 219  THR A O     1 
ATOM   1730  C  CB    . THR A 1 219 ? 4.017   -6.284  24.165  1.00 19.41 ? 219  THR A CB    1 
ATOM   1731  O  OG1   . THR A 1 219 ? 4.974   -5.414  23.540  1.00 18.51 ? 219  THR A OG1   1 
ATOM   1732  C  CG2   . THR A 1 219 ? 3.240   -5.378  25.082  1.00 19.90 ? 219  THR A CG2   1 
ATOM   1733  N  N     . ARG A 1 220 ? 4.529   -9.042  23.179  1.00 19.92 ? 220  ARG A N     1 
ATOM   1734  C  CA    . ARG A 1 220 ? 4.948   -9.886  22.078  1.00 20.43 ? 220  ARG A CA    1 
ATOM   1735  C  C     . ARG A 1 220 ? 4.988   -9.080  20.781  1.00 19.81 ? 220  ARG A C     1 
ATOM   1736  O  O     . ARG A 1 220 ? 5.897   -9.242  19.970  1.00 20.07 ? 220  ARG A O     1 
ATOM   1737  C  CB    . ARG A 1 220 ? 3.972   -11.067 21.893  1.00 21.31 ? 220  ARG A CB    1 
ATOM   1738  C  CG    . ARG A 1 220 ? 3.624   -11.896 23.161  1.00 24.53 ? 220  ARG A CG    1 
ATOM   1739  C  CD    . ARG A 1 220 ? 4.700   -12.930 23.604  1.00 28.90 ? 220  ARG A CD    1 
ATOM   1740  N  NE    . ARG A 1 220 ? 5.227   -12.657 24.957  1.00 32.77 ? 220  ARG A NE    1 
ATOM   1741  C  CZ    . ARG A 1 220 ? 4.536   -12.816 26.101  1.00 35.33 ? 220  ARG A CZ    1 
ATOM   1742  N  NH1   . ARG A 1 220 ? 3.271   -13.261 26.086  1.00 36.48 ? 220  ARG A NH1   1 
ATOM   1743  N  NH2   . ARG A 1 220 ? 5.113   -12.532 27.269  1.00 35.31 ? 220  ARG A NH2   1 
ATOM   1744  N  N     . ASP A 1 221 ? 3.966   -8.247  20.576  1.00 19.22 ? 221  ASP A N     1 
ATOM   1745  C  CA    . ASP A 1 221 ? 3.866   -7.330  19.423  1.00 18.26 ? 221  ASP A CA    1 
ATOM   1746  C  C     . ASP A 1 221 ? 3.395   -5.928  19.866  1.00 17.55 ? 221  ASP A C     1 
ATOM   1747  O  O     . ASP A 1 221 ? 2.936   -5.738  20.995  1.00 17.70 ? 221  ASP A O     1 
ATOM   1748  C  CB    . ASP A 1 221 ? 2.919   -7.906  18.361  1.00 17.86 ? 221  ASP A CB    1 
ATOM   1749  C  CG    . ASP A 1 221 ? 1.450   -7.815  18.762  1.00 17.80 ? 221  ASP A CG    1 
ATOM   1750  O  OD1   . ASP A 1 221 ? 1.150   -7.275  19.837  1.00 18.65 ? 221  ASP A OD1   1 
ATOM   1751  O  OD2   . ASP A 1 221 ? 0.506   -8.245  18.073  1.00 17.46 ? 221  ASP A OD2   1 
ATOM   1752  N  N     . LEU A 1 222 ? 3.486   -4.961  18.968  1.00 16.61 ? 222  LEU A N     1 
ATOM   1753  C  CA    . LEU A 1 222 ? 3.114   -3.577  19.275  1.00 16.35 ? 222  LEU A CA    1 
ATOM   1754  C  C     . LEU A 1 222 ? 1.715   -3.191  18.764  1.00 16.56 ? 222  LEU A C     1 
ATOM   1755  O  O     . LEU A 1 222 ? 1.416   -2.016  18.587  1.00 16.61 ? 222  LEU A O     1 
ATOM   1756  C  CB    . LEU A 1 222 ? 4.164   -2.627  18.696  1.00 15.83 ? 222  LEU A CB    1 
ATOM   1757  C  CG    . LEU A 1 222 ? 5.569   -2.927  19.227  1.00 14.46 ? 222  LEU A CG    1 
ATOM   1758  C  CD1   . LEU A 1 222 ? 6.653   -2.241  18.421  1.00 14.15 ? 222  LEU A CD1   1 
ATOM   1759  C  CD2   . LEU A 1 222 ? 5.678   -2.546  20.680  1.00 13.31 ? 222  LEU A CD2   1 
ATOM   1760  N  N     . VAL A 1 223 ? 0.863   -4.181  18.527  1.00 16.38 ? 223  VAL A N     1 
ATOM   1761  C  CA    . VAL A 1 223 ? -0.475  -3.922  18.016  1.00 16.37 ? 223  VAL A CA    1 
ATOM   1762  C  C     . VAL A 1 223 ? -1.317  -3.037  18.965  1.00 17.16 ? 223  VAL A C     1 
ATOM   1763  O  O     . VAL A 1 223 ? -2.033  -2.143  18.503  1.00 17.70 ? 223  VAL A O     1 
ATOM   1764  C  CB    . VAL A 1 223 ? -1.209  -5.253  17.670  1.00 15.81 ? 223  VAL A CB    1 
ATOM   1765  C  CG1   . VAL A 1 223 ? -2.670  -5.027  17.421  1.00 15.10 ? 223  VAL A CG1   1 
ATOM   1766  C  CG2   . VAL A 1 223 ? -0.589  -5.889  16.434  1.00 15.07 ? 223  VAL A CG2   1 
ATOM   1767  N  N     . GLY A 1 224 ? -1.230  -3.273  20.276  1.00 17.73 ? 224  GLY A N     1 
ATOM   1768  C  CA    . GLY A 1 224 ? -2.060  -2.569  21.246  1.00 17.87 ? 224  GLY A CA    1 
ATOM   1769  C  C     . GLY A 1 224 ? -1.717  -1.087  21.361  1.00 18.25 ? 224  GLY A C     1 
ATOM   1770  O  O     . GLY A 1 224 ? -2.511  -0.297  21.850  1.00 18.54 ? 224  GLY A O     1 
ATOM   1771  N  N     . PHE A 1 225 ? -0.518  -0.728  20.906  1.00 18.55 ? 225  PHE A N     1 
ATOM   1772  C  CA    . PHE A 1 225 ? -0.005  0.636   20.919  1.00 18.20 ? 225  PHE A CA    1 
ATOM   1773  C  C     . PHE A 1 225 ? -0.256  1.412   19.606  1.00 18.42 ? 225  PHE A C     1 
ATOM   1774  O  O     . PHE A 1 225 ? -0.056  2.625   19.535  1.00 18.09 ? 225  PHE A O     1 
ATOM   1775  C  CB    . PHE A 1 225 ? 1.485   0.566   21.209  1.00 18.10 ? 225  PHE A CB    1 
ATOM   1776  C  CG    . PHE A 1 225 ? 1.820   0.015   22.587  1.00 17.21 ? 225  PHE A CG    1 
ATOM   1777  C  CD1   . PHE A 1 225 ? 1.330   0.625   23.738  1.00 17.35 ? 225  PHE A CD1   1 
ATOM   1778  C  CD2   . PHE A 1 225 ? 2.664   -1.068  22.727  1.00 16.16 ? 225  PHE A CD2   1 
ATOM   1779  C  CE1   . PHE A 1 225 ? 1.656   0.152   24.995  1.00 16.46 ? 225  PHE A CE1   1 
ATOM   1780  C  CE2   . PHE A 1 225 ? 2.998   -1.551  23.976  1.00 16.99 ? 225  PHE A CE2   1 
ATOM   1781  C  CZ    . PHE A 1 225 ? 2.485   -0.943  25.111  1.00 17.91 ? 225  PHE A CZ    1 
ATOM   1782  N  N     . GLY A 1 226 ? -0.714  0.710   18.575  1.00 18.93 ? 226  GLY A N     1 
ATOM   1783  C  CA    . GLY A 1 226 ? -1.042  1.327   17.298  1.00 19.35 ? 226  GLY A CA    1 
ATOM   1784  C  C     . GLY A 1 226 ? 0.173   1.697   16.460  1.00 19.62 ? 226  GLY A C     1 
ATOM   1785  O  O     . GLY A 1 226 ? 0.137   2.650   15.683  1.00 19.42 ? 226  GLY A O     1 
ATOM   1786  N  N     . VAL A 1 227 ? 1.253   0.939   16.610  1.00 20.05 ? 227  VAL A N     1 
ATOM   1787  C  CA    . VAL A 1 227 ? 2.464   1.209   15.847  1.00 20.38 ? 227  VAL A CA    1 
ATOM   1788  C  C     . VAL A 1 227 ? 3.065   0.007   15.132  1.00 20.47 ? 227  VAL A C     1 
ATOM   1789  O  O     . VAL A 1 227 ? 4.155   0.144   14.609  1.00 20.83 ? 227  VAL A O     1 
ATOM   1790  C  CB    . VAL A 1 227 ? 3.565   1.850   16.721  1.00 20.49 ? 227  VAL A CB    1 
ATOM   1791  C  CG1   . VAL A 1 227 ? 3.136   3.239   17.150  1.00 21.09 ? 227  VAL A CG1   1 
ATOM   1792  C  CG2   . VAL A 1 227 ? 3.924   0.956   17.948  1.00 20.04 ? 227  VAL A CG2   1 
ATOM   1793  N  N     . GLU A 1 228 ? 2.408   -1.152  15.088  1.00 20.27 ? 228  GLU A N     1 
ATOM   1794  C  CA    . GLU A 1 228 ? 3.013   -2.277  14.379  1.00 20.58 ? 228  GLU A CA    1 
ATOM   1795  C  C     . GLU A 1 228 ? 3.042   -1.913  12.907  1.00 20.79 ? 228  GLU A C     1 
ATOM   1796  O  O     . GLU A 1 228 ? 3.991   -2.200  12.215  1.00 20.72 ? 228  GLU A O     1 
ATOM   1797  C  CB    . GLU A 1 228 ? 2.252   -3.590  14.616  1.00 21.16 ? 228  GLU A CB    1 
ATOM   1798  C  CG    . GLU A 1 228 ? 2.927   -4.862  14.090  1.00 20.45 ? 228  GLU A CG    1 
ATOM   1799  C  CD    . GLU A 1 228 ? 3.824   -5.537  15.117  1.00 20.05 ? 228  GLU A CD    1 
ATOM   1800  O  OE1   . GLU A 1 228 ? 4.073   -4.909  16.160  1.00 18.04 ? 228  GLU A OE1   1 
ATOM   1801  O  OE2   . GLU A 1 228 ? 4.301   -6.688  14.875  1.00 19.61 ? 228  GLU A OE2   1 
ATOM   1802  N  N     . ASN A 1 229 ? 1.950   -1.302  12.457  1.00 21.74 ? 229  ASN A N     1 
ATOM   1803  C  CA    . ASN A 1 229 ? 1.806   -0.513  11.210  1.00 21.68 ? 229  ASN A CA    1 
ATOM   1804  C  C     . ASN A 1 229 ? 3.016   0.339   10.733  1.00 22.03 ? 229  ASN A C     1 
ATOM   1805  O  O     . ASN A 1 229 ? 3.102   0.656   9.550   1.00 22.38 ? 229  ASN A O     1 
ATOM   1806  C  CB    . ASN A 1 229 ? 0.668   0.525   11.444  1.00 21.50 ? 229  ASN A CB    1 
ATOM   1807  C  CG    . ASN A 1 229 ? -0.607  0.196   10.724  1.00 21.58 ? 229  ASN A CG    1 
ATOM   1808  O  OD1   . ASN A 1 229 ? -0.593  -0.036  9.542   1.00 25.35 ? 229  ASN A OD1   1 
ATOM   1809  N  ND2   . ASN A 1 229 ? -1.728  0.235   11.422  1.00 19.18 ? 229  ASN A ND2   1 
ATOM   1810  N  N     . ALA A 1 230 ? 3.907   0.758   11.636  1.00 21.71 ? 230  ALA A N     1 
ATOM   1811  C  CA    . ALA A 1 230 ? 4.704   1.955   11.394  1.00 21.84 ? 230  ALA A CA    1 
ATOM   1812  C  C     . ALA A 1 230 ? 6.220   1.771   11.427  1.00 21.75 ? 230  ALA A C     1 
ATOM   1813  O  O     . ALA A 1 230 ? 6.882   2.406   12.242  1.00 21.99 ? 230  ALA A O     1 
ATOM   1814  C  CB    . ALA A 1 230 ? 4.293   3.025   12.410  1.00 21.89 ? 230  ALA A CB    1 
ATOM   1815  N  N     . PRO A 1 231 ? 6.790   0.980   10.517  1.00 21.09 ? 231  PRO A N     1 
ATOM   1816  C  CA    . PRO A 1 231 ? 8.233   0.699   10.561  1.00 20.57 ? 231  PRO A CA    1 
ATOM   1817  C  C     . PRO A 1 231 ? 9.156   1.912   10.425  1.00 20.01 ? 231  PRO A C     1 
ATOM   1818  O  O     . PRO A 1 231 ? 10.183  1.870   11.087  1.00 20.19 ? 231  PRO A O     1 
ATOM   1819  C  CB    . PRO A 1 231 ? 8.454   -0.307  9.422   1.00 20.10 ? 231  PRO A CB    1 
ATOM   1820  C  CG    . PRO A 1 231 ? 7.292   -0.175  8.551   1.00 20.64 ? 231  PRO A CG    1 
ATOM   1821  C  CD    . PRO A 1 231 ? 6.139   0.306   9.389   1.00 21.12 ? 231  PRO A CD    1 
ATOM   1822  N  N     . ARG A 1 232 ? 8.840   2.932   9.632   1.00 19.57 ? 232  ARG A N     1 
ATOM   1823  C  CA    . ARG A 1 232 ? 9.709   4.125   9.577   1.00 19.73 ? 232  ARG A CA    1 
ATOM   1824  C  C     . ARG A 1 232 ? 9.935   4.703   10.969  1.00 18.87 ? 232  ARG A C     1 
ATOM   1825  O  O     . ARG A 1 232 ? 11.060  4.787   11.441  1.00 18.97 ? 232  ARG A O     1 
ATOM   1826  C  CB    . ARG A 1 232 ? 9.112   5.239   8.716   1.00 20.26 ? 232  ARG A CB    1 
ATOM   1827  C  CG    . ARG A 1 232 ? 9.769   5.442   7.385   1.00 22.79 ? 232  ARG A CG    1 
ATOM   1828  C  CD    . ARG A 1 232 ? 9.416   6.772   6.749   1.00 26.84 ? 232  ARG A CD    1 
ATOM   1829  N  NE    . ARG A 1 232 ? 8.286   6.665   5.824   1.00 31.02 ? 232  ARG A NE    1 
ATOM   1830  C  CZ    . ARG A 1 232 ? 7.369   7.624   5.615   1.00 34.47 ? 232  ARG A CZ    1 
ATOM   1831  N  NH1   . ARG A 1 232 ? 7.422   8.810   6.240   1.00 33.65 ? 232  ARG A NH1   1 
ATOM   1832  N  NH2   . ARG A 1 232 ? 6.377   7.394   4.756   1.00 36.87 ? 232  ARG A NH2   1 
ATOM   1833  N  N     . GLY A 1 233 ? 8.847   5.091   11.615  1.00 17.92 ? 233  GLY A N     1 
ATOM   1834  C  CA    . GLY A 1 233 ? 8.887   5.597   12.967  1.00 17.48 ? 233  GLY A CA    1 
ATOM   1835  C  C     . GLY A 1 233 ? 9.500   4.668   13.996  1.00 16.95 ? 233  GLY A C     1 
ATOM   1836  O  O     . GLY A 1 233 ? 10.285  5.106   14.828  1.00 17.24 ? 233  GLY A O     1 
ATOM   1837  N  N     . LEU A 1 234 ? 9.153   3.391   13.949  1.00 16.69 ? 234  LEU A N     1 
ATOM   1838  C  CA    . LEU A 1 234 ? 9.694   2.400   14.894  1.00 15.94 ? 234  LEU A CA    1 
ATOM   1839  C  C     . LEU A 1 234 ? 11.210  2.393   14.929  1.00 15.32 ? 234  LEU A C     1 
ATOM   1840  O  O     . LEU A 1 234 ? 11.789  2.354   15.995  1.00 14.68 ? 234  LEU A O     1 
ATOM   1841  C  CB    . LEU A 1 234 ? 9.176   0.993   14.565  1.00 16.22 ? 234  LEU A CB    1 
ATOM   1842  C  CG    . LEU A 1 234 ? 7.779   0.604   15.078  1.00 15.90 ? 234  LEU A CG    1 
ATOM   1843  C  CD1   . LEU A 1 234 ? 7.436   -0.801  14.650  1.00 14.95 ? 234  LEU A CD1   1 
ATOM   1844  C  CD2   . LEU A 1 234 ? 7.677   0.725   16.595  1.00 15.50 ? 234  LEU A CD2   1 
ATOM   1845  N  N     . CYS A 1 235 ? 11.845  2.428   13.762  1.00 15.62 ? 235  CYS A N     1 
ATOM   1846  C  CA    . CYS A 1 235 ? 13.305  2.615   13.641  1.00 16.05 ? 235  CYS A CA    1 
ATOM   1847  C  C     . CYS A 1 235 ? 13.895  3.909   14.302  1.00 16.66 ? 235  CYS A C     1 
ATOM   1848  O  O     . CYS A 1 235 ? 14.989  3.891   14.837  1.00 17.24 ? 235  CYS A O     1 
ATOM   1849  C  CB    . CYS A 1 235 ? 13.691  2.645   12.174  1.00 16.31 ? 235  CYS A CB    1 
ATOM   1850  S  SG    . CYS A 1 235 ? 13.330  1.147   11.217  1.00 16.39 ? 235  CYS A SG    1 
ATOM   1851  N  N     . ALA A 1 236 ? 13.217  5.042   14.286  1.00 16.55 ? 236  ALA A N     1 
ATOM   1852  C  CA    . ALA A 1 236 ? 13.738  6.117   15.131  1.00 17.13 ? 236  ALA A CA    1 
ATOM   1853  C  C     . ALA A 1 236 ? 13.534  5.782   16.615  1.00 16.97 ? 236  ALA A C     1 
ATOM   1854  O  O     . ALA A 1 236 ? 14.419  6.011   17.436  1.00 17.11 ? 236  ALA A O     1 
ATOM   1855  C  CB    . ALA A 1 236 ? 13.121  7.489   14.772  1.00 16.97 ? 236  ALA A CB    1 
ATOM   1856  N  N     . ALA A 1 237 ? 12.365  5.257   16.954  1.00 17.07 ? 237  ALA A N     1 
ATOM   1857  C  CA    . ALA A 1 237 ? 12.053  4.870   18.327  1.00 17.61 ? 237  ALA A CA    1 
ATOM   1858  C  C     . ALA A 1 237 ? 13.051  3.842   18.903  1.00 18.20 ? 237  ALA A C     1 
ATOM   1859  O  O     . ALA A 1 237 ? 13.531  3.987   20.033  1.00 18.83 ? 237  ALA A O     1 
ATOM   1860  C  CB    . ALA A 1 237 ? 10.627  4.336   18.387  1.00 17.89 ? 237  ALA A CB    1 
ATOM   1861  N  N     . GLY A 1 238 ? 13.378  2.820   18.114  1.00 18.59 ? 238  GLY A N     1 
ATOM   1862  C  CA    . GLY A 1 238 ? 14.450  1.895   18.429  1.00 18.73 ? 238  GLY A CA    1 
ATOM   1863  C  C     . GLY A 1 238 ? 15.789  2.513   18.785  1.00 18.73 ? 238  GLY A C     1 
ATOM   1864  O  O     . GLY A 1 238 ? 16.329  2.225   19.833  1.00 19.22 ? 238  GLY A O     1 
ATOM   1865  N  N     . CYS A 1 239 ? 16.359  3.306   17.893  1.00 19.74 ? 239  CYS A N     1 
ATOM   1866  C  CA    . CYS A 1 239 ? 17.551  4.143   18.206  1.00 20.47 ? 239  CYS A CA    1 
ATOM   1867  C  C     . CYS A 1 239 ? 17.423  4.998   19.447  1.00 20.53 ? 239  CYS A C     1 
ATOM   1868  O  O     . CYS A 1 239 ? 18.372  5.157   20.184  1.00 20.15 ? 239  CYS A O     1 
ATOM   1869  C  CB    . CYS A 1 239 ? 17.841  5.126   17.072  1.00 20.79 ? 239  CYS A CB    1 
ATOM   1870  S  SG    . CYS A 1 239 ? 19.257  6.218   17.369  1.00 22.34 ? 239  CYS A SG    1 
ATOM   1871  N  N     . LEU A 1 240 ? 16.244  5.569   19.659  1.00 21.39 ? 240  LEU A N     1 
ATOM   1872  C  CA    . LEU A 1 240 ? 16.055  6.538   20.733  1.00 21.90 ? 240  LEU A CA    1 
ATOM   1873  C  C     . LEU A 1 240 ? 16.095  5.818   22.070  1.00 21.87 ? 240  LEU A C     1 
ATOM   1874  O  O     . LEU A 1 240 ? 16.756  6.272   22.999  1.00 20.99 ? 240  LEU A O     1 
ATOM   1875  C  CB    . LEU A 1 240 ? 14.726  7.275   20.559  1.00 22.24 ? 240  LEU A CB    1 
ATOM   1876  C  CG    . LEU A 1 240 ? 14.452  8.355   21.595  1.00 23.45 ? 240  LEU A CG    1 
ATOM   1877  C  CD1   . LEU A 1 240 ? 13.555  9.454   21.031  1.00 25.13 ? 240  LEU A CD1   1 
ATOM   1878  C  CD2   . LEU A 1 240 ? 13.793  7.717   22.758  1.00 25.38 ? 240  LEU A CD2   1 
ATOM   1879  N  N     . LEU A 1 241 ? 15.379  4.696   22.135  1.00 21.62 ? 241  LEU A N     1 
ATOM   1880  C  CA    . LEU A 1 241 ? 15.304  3.893   23.333  1.00 21.68 ? 241  LEU A CA    1 
ATOM   1881  C  C     . LEU A 1 241 ? 16.633  3.192   23.646  1.00 21.86 ? 241  LEU A C     1 
ATOM   1882  O  O     . LEU A 1 241 ? 17.005  3.078   24.813  1.00 22.02 ? 241  LEU A O     1 
ATOM   1883  C  CB    . LEU A 1 241 ? 14.174  2.864   23.209  1.00 21.82 ? 241  LEU A CB    1 
ATOM   1884  C  CG    . LEU A 1 241 ? 14.142  1.771   24.284  1.00 20.12 ? 241  LEU A CG    1 
ATOM   1885  C  CD1   . LEU A 1 241 ? 13.631  2.362   25.586  1.00 18.41 ? 241  LEU A CD1   1 
ATOM   1886  C  CD2   . LEU A 1 241 ? 13.298  0.607   23.823  1.00 20.02 ? 241  LEU A CD2   1 
ATOM   1887  N  N     . GLN A 1 242 ? 17.346  2.727   22.626  1.00 21.98 ? 242  GLN A N     1 
ATOM   1888  C  CA    . GLN A 1 242 ? 18.680  2.129   22.837  1.00 22.33 ? 242  GLN A CA    1 
ATOM   1889  C  C     . GLN A 1 242 ? 19.611  3.104   23.521  1.00 21.91 ? 242  GLN A C     1 
ATOM   1890  O  O     . GLN A 1 242 ? 20.425  2.708   24.353  1.00 22.44 ? 242  GLN A O     1 
ATOM   1891  C  CB    . GLN A 1 242 ? 19.320  1.695   21.524  1.00 22.49 ? 242  GLN A CB    1 
ATOM   1892  C  CG    . GLN A 1 242 ? 18.851  0.320   21.059  1.00 25.45 ? 242  GLN A CG    1 
ATOM   1893  C  CD    . GLN A 1 242 ? 19.671  -0.211  19.884  1.00 28.35 ? 242  GLN A CD    1 
ATOM   1894  O  OE1   . GLN A 1 242 ? 19.164  -0.299  18.747  1.00 27.37 ? 242  GLN A OE1   1 
ATOM   1895  N  NE2   . GLN A 1 242 ? 20.950  -0.551  20.152  1.00 28.72 ? 242  GLN A NE2   1 
ATOM   1896  N  N     . TYR A 1 243 ? 19.475  4.375   23.152  1.00 21.11 ? 243  TYR A N     1 
ATOM   1897  C  CA    . TYR A 1 243 ? 20.241  5.465   23.714  1.00 20.41 ? 243  TYR A CA    1 
ATOM   1898  C  C     . TYR A 1 243 ? 19.802  5.730   25.147  1.00 20.61 ? 243  TYR A C     1 
ATOM   1899  O  O     . TYR A 1 243 ? 20.631  5.774   26.064  1.00 20.87 ? 243  TYR A O     1 
ATOM   1900  C  CB    . TYR A 1 243 ? 20.007  6.715   22.861  1.00 20.38 ? 243  TYR A CB    1 
ATOM   1901  C  CG    . TYR A 1 243 ? 21.015  7.805   23.022  1.00 18.88 ? 243  TYR A CG    1 
ATOM   1902  C  CD1   . TYR A 1 243 ? 22.257  7.706   22.422  1.00 20.47 ? 243  TYR A CD1   1 
ATOM   1903  C  CD2   . TYR A 1 243 ? 20.730  8.935   23.764  1.00 18.46 ? 243  TYR A CD2   1 
ATOM   1904  C  CE1   . TYR A 1 243 ? 23.199  8.711   22.552  1.00 20.21 ? 243  TYR A CE1   1 
ATOM   1905  C  CE2   . TYR A 1 243 ? 21.655  9.960   23.892  1.00 18.27 ? 243  TYR A CE2   1 
ATOM   1906  C  CZ    . TYR A 1 243 ? 22.881  9.838   23.288  1.00 18.57 ? 243  TYR A CZ    1 
ATOM   1907  O  OH    . TYR A 1 243 ? 23.803  10.824  23.402  1.00 17.60 ? 243  TYR A OH    1 
ATOM   1908  N  N     . ALA A 1 244 ? 18.499  5.920   25.353  1.00 20.56 ? 244  ALA A N     1 
ATOM   1909  C  CA    . ALA A 1 244 ? 17.982  6.250   26.680  1.00 20.47 ? 244  ALA A CA    1 
ATOM   1910  C  C     . ALA A 1 244 ? 18.524  5.244   27.665  1.00 20.80 ? 244  ALA A C     1 
ATOM   1911  O  O     . ALA A 1 244 ? 19.022  5.627   28.713  1.00 21.50 ? 244  ALA A O     1 
ATOM   1912  C  CB    . ALA A 1 244 ? 16.478  6.218   26.705  1.00 20.27 ? 244  ALA A CB    1 
ATOM   1913  N  N     . LYS A 1 245 ? 18.413  3.963   27.299  1.00 20.56 ? 245  LYS A N     1 
ATOM   1914  C  CA    . LYS A 1 245 ? 18.906  2.842   28.071  1.00 20.25 ? 245  LYS A CA    1 
ATOM   1915  C  C     . LYS A 1 245 ? 20.374  2.990   28.365  1.00 19.75 ? 245  LYS A C     1 
ATOM   1916  O  O     . LYS A 1 245 ? 20.787  2.912   29.492  1.00 19.90 ? 245  LYS A O     1 
ATOM   1917  C  CB    . LYS A 1 245 ? 18.719  1.543   27.282  1.00 20.80 ? 245  LYS A CB    1 
ATOM   1918  C  CG    . LYS A 1 245 ? 17.321  0.941   27.317  1.00 21.90 ? 245  LYS A CG    1 
ATOM   1919  C  CD    . LYS A 1 245 ? 17.217  -0.246  26.352  1.00 23.60 ? 245  LYS A CD    1 
ATOM   1920  C  CE    . LYS A 1 245 ? 17.496  -1.591  27.035  1.00 24.24 ? 245  LYS A CE    1 
ATOM   1921  N  NZ    . LYS A 1 245 ? 16.219  -2.247  27.418  1.00 26.96 ? 245  LYS A NZ    1 
ATOM   1922  N  N     . ASP A 1 246 ? 21.175  3.179   27.327  1.00 19.80 ? 246  ASP A N     1 
ATOM   1923  C  CA    . ASP A 1 246 ? 22.632  3.321   27.470  1.00 19.21 ? 246  ASP A CA    1 
ATOM   1924  C  C     . ASP A 1 246 ? 23.084  4.548   28.300  1.00 18.43 ? 246  ASP A C     1 
ATOM   1925  O  O     . ASP A 1 246 ? 24.142  4.514   28.942  1.00 18.63 ? 246  ASP A O     1 
ATOM   1926  C  CB    . ASP A 1 246 ? 23.285  3.363   26.089  1.00 19.18 ? 246  ASP A CB    1 
ATOM   1927  C  CG    . ASP A 1 246 ? 24.791  3.363   26.169  1.00 20.52 ? 246  ASP A CG    1 
ATOM   1928  O  OD1   . ASP A 1 246 ? 25.309  2.667   27.060  1.00 21.86 ? 246  ASP A OD1   1 
ATOM   1929  O  OD2   . ASP A 1 246 ? 25.540  4.027   25.417  1.00 20.04 ? 246  ASP A OD2   1 
ATOM   1930  N  N     . THR A 1 247 ? 22.308  5.626   28.308  1.00 17.53 ? 247  THR A N     1 
ATOM   1931  C  CA    . THR A 1 247 ? 22.678  6.780   29.147  1.00 17.11 ? 247  THR A CA    1 
ATOM   1932  C  C     . THR A 1 247 ? 22.274  6.592   30.614  1.00 16.89 ? 247  THR A C     1 
ATOM   1933  O  O     . THR A 1 247 ? 22.943  7.105   31.494  1.00 16.96 ? 247  THR A O     1 
ATOM   1934  C  CB    . THR A 1 247 ? 22.104  8.117   28.614  1.00 16.68 ? 247  THR A CB    1 
ATOM   1935  O  OG1   . THR A 1 247 ? 20.683  8.061   28.604  1.00 17.67 ? 247  THR A OG1   1 
ATOM   1936  C  CG2   . THR A 1 247 ? 22.505  8.392   27.160  1.00 14.58 ? 247  THR A CG2   1 
ATOM   1937  N  N     . GLN A 1 248 ? 21.209  5.832   30.871  1.00 16.77 ? 248  GLN A N     1 
ATOM   1938  C  CA    . GLN A 1 248 ? 20.668  5.648   32.212  1.00 16.37 ? 248  GLN A CA    1 
ATOM   1939  C  C     . GLN A 1 248 ? 21.259  4.435   32.911  1.00 16.58 ? 248  GLN A C     1 
ATOM   1940  O  O     . GLN A 1 248 ? 21.506  4.467   34.125  1.00 16.66 ? 248  GLN A O     1 
ATOM   1941  C  CB    . GLN A 1 248 ? 19.150  5.495   32.144  1.00 16.55 ? 248  GLN A CB    1 
ATOM   1942  C  CG    . GLN A 1 248 ? 18.314  6.811   31.970  1.00 16.72 ? 248  GLN A CG    1 
ATOM   1943  C  CD    . GLN A 1 248 ? 19.087  8.102   32.180  1.00 15.95 ? 248  GLN A CD    1 
ATOM   1944  O  OE1   . GLN A 1 248 ? 19.690  8.637   31.247  1.00 16.84 ? 248  GLN A OE1   1 
ATOM   1945  N  NE2   . GLN A 1 248 ? 19.050  8.610   33.389  1.00 14.99 ? 248  GLN A NE2   1 
ATOM   1946  N  N     . ARG A 1 249 ? 21.459  3.360   32.150  1.00 16.64 ? 249  ARG A N     1 
ATOM   1947  C  CA    . ARG A 1 249 ? 21.952  2.079   32.661  1.00 16.63 ? 249  ARG A CA    1 
ATOM   1948  C  C     . ARG A 1 249 ? 21.274  1.623   33.925  1.00 17.29 ? 249  ARG A C     1 
ATOM   1949  O  O     . ARG A 1 249 ? 21.928  1.239   34.880  1.00 17.87 ? 249  ARG A O     1 
ATOM   1950  C  CB    . ARG A 1 249 ? 23.454  2.137   32.848  1.00 16.40 ? 249  ARG A CB    1 
ATOM   1951  C  CG    . ARG A 1 249 ? 24.120  2.517   31.540  1.00 15.47 ? 249  ARG A CG    1 
ATOM   1952  C  CD    . ARG A 1 249 ? 25.610  2.316   31.487  1.00 12.88 ? 249  ARG A CD    1 
ATOM   1953  N  NE    . ARG A 1 249 ? 26.065  2.352   30.107  1.00 9.78  ? 249  ARG A NE    1 
ATOM   1954  C  CZ    . ARG A 1 249 ? 27.309  2.127   29.728  1.00 9.64  ? 249  ARG A CZ    1 
ATOM   1955  N  NH1   . ARG A 1 249 ? 28.256  1.908   30.630  1.00 7.85  ? 249  ARG A NH1   1 
ATOM   1956  N  NH2   . ARG A 1 249 ? 27.616  2.132   28.434  1.00 9.88  ? 249  ARG A NH2   1 
ATOM   1957  N  N     . THR A 1 250 ? 19.949  1.745   33.919  1.00 18.04 ? 250  THR A N     1 
ATOM   1958  C  CA    . THR A 1 250 ? 19.052  1.161   34.916  1.00 18.40 ? 250  THR A CA    1 
ATOM   1959  C  C     . THR A 1 250 ? 17.798  0.810   34.145  1.00 18.71 ? 250  THR A C     1 
ATOM   1960  O  O     . THR A 1 250 ? 17.699  1.142   32.970  1.00 19.44 ? 250  THR A O     1 
ATOM   1961  C  CB    . THR A 1 250 ? 18.743  2.127   36.173  1.00 18.65 ? 250  THR A CB    1 
ATOM   1962  O  OG1   . THR A 1 250 ? 18.140  3.376   35.794  1.00 16.68 ? 250  THR A OG1   1 
ATOM   1963  C  CG2   . THR A 1 250 ? 20.020  2.545   36.873  1.00 18.55 ? 250  THR A CG2   1 
ATOM   1964  N  N     . THR A 1 251 ? 16.845  0.123   34.760  1.00 18.97 ? 251  THR A N     1 
ATOM   1965  C  CA    . THR A 1 251 ? 15.595  -0.152  34.054  1.00 19.03 ? 251  THR A CA    1 
ATOM   1966  C  C     . THR A 1 251 ? 14.862  1.170   34.036  1.00 18.61 ? 251  THR A C     1 
ATOM   1967  O  O     . THR A 1 251 ? 15.227  2.053   34.790  1.00 19.44 ? 251  THR A O     1 
ATOM   1968  C  CB    . THR A 1 251 ? 14.762  -1.288  34.713  1.00 19.04 ? 251  THR A CB    1 
ATOM   1969  O  OG1   . THR A 1 251 ? 14.543  -0.993  36.092  1.00 18.56 ? 251  THR A OG1   1 
ATOM   1970  C  CG2   . THR A 1 251 ? 15.534  -2.636  34.706  1.00 18.71 ? 251  THR A CG2   1 
ATOM   1971  N  N     . LEU A 1 252 ? 13.875  1.317   33.156  1.00 18.03 ? 252  LEU A N     1 
ATOM   1972  C  CA    . LEU A 1 252 ? 13.148  2.577   32.983  1.00 17.44 ? 252  LEU A CA    1 
ATOM   1973  C  C     . LEU A 1 252 ? 11.638  2.347   33.041  1.00 16.53 ? 252  LEU A C     1 
ATOM   1974  O  O     . LEU A 1 252 ? 10.965  2.500   32.031  1.00 16.16 ? 252  LEU A O     1 
ATOM   1975  C  CB    . LEU A 1 252 ? 13.528  3.177   31.640  1.00 17.66 ? 252  LEU A CB    1 
ATOM   1976  C  CG    . LEU A 1 252 ? 15.041  3.345   31.391  1.00 19.14 ? 252  LEU A CG    1 
ATOM   1977  C  CD1   . LEU A 1 252 ? 15.388  3.220   29.928  1.00 18.41 ? 252  LEU A CD1   1 
ATOM   1978  C  CD2   . LEU A 1 252 ? 15.541  4.669   31.903  1.00 21.02 ? 252  LEU A CD2   1 
ATOM   1979  N  N     . PRO A 1 253 ? 11.110  1.947   34.205  1.00 15.87 ? 253  PRO A N     1 
ATOM   1980  C  CA    . PRO A 1 253 ? 9.715   1.482   34.321  1.00 15.67 ? 253  PRO A CA    1 
ATOM   1981  C  C     . PRO A 1 253 ? 8.662   2.498   33.959  1.00 16.30 ? 253  PRO A C     1 
ATOM   1982  O  O     . PRO A 1 253 ? 7.514   2.085   33.789  1.00 15.54 ? 253  PRO A O     1 
ATOM   1983  C  CB    . PRO A 1 253 ? 9.566   1.130   35.803  1.00 15.22 ? 253  PRO A CB    1 
ATOM   1984  C  CG    . PRO A 1 253 ? 10.671  1.790   36.476  1.00 14.83 ? 253  PRO A CG    1 
ATOM   1985  C  CD    . PRO A 1 253 ? 11.806  1.879   35.498  1.00 15.62 ? 253  PRO A CD    1 
ATOM   1986  N  N     . HIS A 1 254 ? 9.040   3.782   33.881  1.00 17.17 ? 254  HIS A N     1 
ATOM   1987  C  CA    . HIS A 1 254 ? 8.111   4.858   33.544  1.00 17.59 ? 254  HIS A CA    1 
ATOM   1988  C  C     . HIS A 1 254 ? 7.852   5.019   32.048  1.00 18.20 ? 254  HIS A C     1 
ATOM   1989  O  O     . HIS A 1 254 ? 6.934   5.721   31.642  1.00 17.82 ? 254  HIS A O     1 
ATOM   1990  C  CB    . HIS A 1 254 ? 8.576   6.169   34.169  1.00 17.91 ? 254  HIS A CB    1 
ATOM   1991  C  CG    . HIS A 1 254 ? 9.896   6.670   33.674  1.00 18.81 ? 254  HIS A CG    1 
ATOM   1992  N  ND1   . HIS A 1 254 ? 10.894  5.843   33.215  1.00 21.03 ? 254  HIS A ND1   1 
ATOM   1993  C  CD2   . HIS A 1 254 ? 10.384  7.927   33.582  1.00 20.16 ? 254  HIS A CD2   1 
ATOM   1994  C  CE1   . HIS A 1 254 ? 11.941  6.567   32.863  1.00 19.93 ? 254  HIS A CE1   1 
ATOM   1995  N  NE2   . HIS A 1 254 ? 11.654  7.838   33.066  1.00 19.11 ? 254  HIS A NE2   1 
ATOM   1996  N  N     . ILE A 1 255 ? 8.669   4.358   31.239  1.00 19.92 ? 255  ILE A N     1 
ATOM   1997  C  CA    . ILE A 1 255 ? 8.522   4.313   29.778  1.00 21.02 ? 255  ILE A CA    1 
ATOM   1998  C  C     . ILE A 1 255 ? 7.834   3.002   29.483  1.00 22.07 ? 255  ILE A C     1 
ATOM   1999  O  O     . ILE A 1 255 ? 8.468   2.019   29.122  1.00 22.41 ? 255  ILE A O     1 
ATOM   2000  C  CB    . ILE A 1 255 ? 9.892   4.331   29.092  1.00 21.04 ? 255  ILE A CB    1 
ATOM   2001  C  CG1   . ILE A 1 255 ? 10.752  5.501   29.629  1.00 21.08 ? 255  ILE A CG1   1 
ATOM   2002  C  CG2   . ILE A 1 255 ? 9.734   4.382   27.569  1.00 21.67 ? 255  ILE A CG2   1 
ATOM   2003  C  CD1   . ILE A 1 255 ? 11.910  5.887   28.723  1.00 20.37 ? 255  ILE A CD1   1 
ATOM   2004  N  N     . ARG A 1 256 ? 6.525   3.012   29.660  1.00 23.16 ? 256  ARG A N     1 
ATOM   2005  C  CA    . ARG A 1 256 ? 5.727   1.813   29.613  1.00 23.78 ? 256  ARG A CA    1 
ATOM   2006  C  C     . ARG A 1 256 ? 4.844   1.747   28.366  1.00 23.84 ? 256  ARG A C     1 
ATOM   2007  O  O     . ARG A 1 256 ? 4.088   0.782   28.198  1.00 23.63 ? 256  ARG A O     1 
ATOM   2008  C  CB    . ARG A 1 256 ? 4.864   1.770   30.858  1.00 24.34 ? 256  ARG A CB    1 
ATOM   2009  C  CG    . ARG A 1 256 ? 3.642   2.664   30.788  1.00 26.56 ? 256  ARG A CG    1 
ATOM   2010  C  CD    . ARG A 1 256 ? 2.854   2.789   32.099  1.00 30.16 ? 256  ARG A CD    1 
ATOM   2011  N  NE    . ARG A 1 256 ? 3.700   2.768   33.297  1.00 33.22 ? 256  ARG A NE    1 
ATOM   2012  C  CZ    . ARG A 1 256 ? 3.976   1.677   34.026  1.00 35.74 ? 256  ARG A CZ    1 
ATOM   2013  N  NH1   . ARG A 1 256 ? 3.503   0.471   33.692  1.00 36.87 ? 256  ARG A NH1   1 
ATOM   2014  N  NH2   . ARG A 1 256 ? 4.758   1.791   35.098  1.00 37.00 ? 256  ARG A NH2   1 
ATOM   2015  N  N     . SER A 1 257 ? 4.971   2.760   27.496  1.00 23.91 ? 257  SER A N     1 
ATOM   2016  C  CA    . SER A 1 257 ? 4.150   2.890   26.296  1.00 23.63 ? 257  SER A CA    1 
ATOM   2017  C  C     . SER A 1 257 ? 4.676   3.884   25.240  1.00 23.83 ? 257  SER A C     1 
ATOM   2018  O  O     . SER A 1 257 ? 5.427   4.806   25.538  1.00 24.35 ? 257  SER A O     1 
ATOM   2019  C  CB    . SER A 1 257 ? 2.751   3.296   26.717  1.00 23.19 ? 257  SER A CB    1 
ATOM   2020  O  OG    . SER A 1 257 ? 2.135   4.062   25.715  1.00 24.05 ? 257  SER A OG    1 
ATOM   2021  N  N     . ILE A 1 258 ? 4.248   3.681   23.995  1.00 24.32 ? 258  ILE A N     1 
ATOM   2022  C  CA    . ILE A 1 258 ? 4.504   4.610   22.886  1.00 23.94 ? 258  ILE A CA    1 
ATOM   2023  C  C     . ILE A 1 258 ? 3.225   4.845   22.085  1.00 23.95 ? 258  ILE A C     1 
ATOM   2024  O  O     . ILE A 1 258 ? 2.426   3.902   21.872  1.00 23.51 ? 258  ILE A O     1 
ATOM   2025  C  CB    . ILE A 1 258 ? 5.607   4.051   21.968  1.00 24.34 ? 258  ILE A CB    1 
ATOM   2026  C  CG1   . ILE A 1 258 ? 6.075   5.098   20.958  1.00 24.19 ? 258  ILE A CG1   1 
ATOM   2027  C  CG2   . ILE A 1 258 ? 5.160   2.767   21.251  1.00 23.96 ? 258  ILE A CG2   1 
ATOM   2028  C  CD1   . ILE A 1 258 ? 7.248   4.584   20.106  1.00 24.38 ? 258  ILE A CD1   1 
ATOM   2029  N  N     . THR A 1 259 ? 3.035   6.095   21.642  1.00 23.74 ? 259  THR A N     1 
ATOM   2030  C  CA    . THR A 1 259 ? 1.869   6.472   20.832  1.00 23.91 ? 259  THR A CA    1 
ATOM   2031  C  C     . THR A 1 259 ? 2.286   7.057   19.515  1.00 23.69 ? 259  THR A C     1 
ATOM   2032  O  O     . THR A 1 259 ? 3.277   7.744   19.436  1.00 23.46 ? 259  THR A O     1 
ATOM   2033  C  CB    . THR A 1 259 ? 0.974   7.496   21.556  1.00 23.81 ? 259  THR A CB    1 
ATOM   2034  O  OG1   . THR A 1 259 ? 0.765   7.091   22.913  1.00 25.17 ? 259  THR A OG1   1 
ATOM   2035  C  CG2   . THR A 1 259 ? -0.425  7.521   20.957  1.00 22.74 ? 259  THR A CG2   1 
ATOM   2036  N  N     . MET A 1 260 ? 1.493   6.798   18.487  1.00 24.30 ? 260  MET A N     1 
ATOM   2037  C  CA    . MET A 1 260 ? 1.721   7.377   17.178  1.00 24.63 ? 260  MET A CA    1 
ATOM   2038  C  C     . MET A 1 260 ? 0.927   8.666   16.993  1.00 24.47 ? 260  MET A C     1 
ATOM   2039  O  O     . MET A 1 260 ? -0.257  8.691   17.233  1.00 24.40 ? 260  MET A O     1 
ATOM   2040  C  CB    . MET A 1 260 ? 1.323   6.412   16.087  1.00 24.76 ? 260  MET A CB    1 
ATOM   2041  C  CG    . MET A 1 260 ? 1.555   7.010   14.731  1.00 26.86 ? 260  MET A CG    1 
ATOM   2042  S  SD    . MET A 1 260 ? 1.861   5.795   13.496  1.00 33.18 ? 260  MET A SD    1 
ATOM   2043  C  CE    . MET A 1 260 ? 2.317   6.889   12.059  1.00 34.46 ? 260  MET A CE    1 
ATOM   2044  N  N     . GLU A 1 261 ? 1.599   9.726   16.555  1.00 24.93 ? 261  GLU A N     1 
ATOM   2045  C  CA    . GLU A 1 261 ? 0.949   10.978  16.194  1.00 25.48 ? 261  GLU A CA    1 
ATOM   2046  C  C     . GLU A 1 261 ? 0.711   10.962  14.675  1.00 25.10 ? 261  GLU A C     1 
ATOM   2047  O  O     . GLU A 1 261 ? 1.639   11.101  13.889  1.00 25.52 ? 261  GLU A O     1 
ATOM   2048  C  CB    . GLU A 1 261 ? 1.778   12.217  16.661  1.00 25.94 ? 261  GLU A CB    1 
ATOM   2049  C  CG    . GLU A 1 261 ? 2.743   11.973  17.835  1.00 27.32 ? 261  GLU A CG    1 
ATOM   2050  C  CD    . GLU A 1 261 ? 2.784   13.099  18.877  1.00 29.77 ? 261  GLU A CD    1 
ATOM   2051  O  OE1   . GLU A 1 261 ? 3.622   14.030  18.723  1.00 28.95 ? 261  GLU A OE1   1 
ATOM   2052  O  OE2   . GLU A 1 261 ? 2.001   13.029  19.876  1.00 30.35 ? 261  GLU A OE2   1 
ATOM   2053  N  N     . ARG A 1 262 ? -0.530  10.752  14.271  1.00 25.03 ? 262  ARG A N     1 
ATOM   2054  C  CA    . ARG A 1 262 ? -0.903  10.770  12.865  1.00 25.50 ? 262  ARG A CA    1 
ATOM   2055  C  C     . ARG A 1 262 ? -1.132  12.192  12.328  1.00 25.74 ? 262  ARG A C     1 
ATOM   2056  O  O     . ARG A 1 262 ? -1.465  13.099  13.095  1.00 26.46 ? 262  ARG A O     1 
ATOM   2057  C  CB    . ARG A 1 262 ? -2.189  9.974   12.694  1.00 26.06 ? 262  ARG A CB    1 
ATOM   2058  C  CG    . ARG A 1 262 ? -2.033  8.446   12.726  1.00 26.62 ? 262  ARG A CG    1 
ATOM   2059  C  CD    . ARG A 1 262 ? -3.199  7.693   13.393  1.00 28.42 ? 262  ARG A CD    1 
ATOM   2060  N  NE    . ARG A 1 262 ? -2.705  6.523   14.122  1.00 31.28 ? 262  ARG A NE    1 
ATOM   2061  C  CZ    . ARG A 1 262 ? -2.390  5.338   13.571  1.00 31.91 ? 262  ARG A CZ    1 
ATOM   2062  N  NH1   . ARG A 1 262 ? -2.541  5.126   12.260  1.00 32.90 ? 262  ARG A NH1   1 
ATOM   2063  N  NH2   . ARG A 1 262 ? -1.930  4.353   14.346  1.00 31.25 ? 262  ARG A NH2   1 
ATOM   2064  N  N     . GLU A 1 263 ? -0.965  12.390  11.019  1.00 25.92 ? 263  GLU A N     1 
ATOM   2065  C  CA    . GLU A 1 263 ? -1.377  13.646  10.348  1.00 26.16 ? 263  GLU A CA    1 
ATOM   2066  C  C     . GLU A 1 263 ? -2.799  14.063  10.754  1.00 25.93 ? 263  GLU A C     1 
ATOM   2067  O  O     . GLU A 1 263 ? -3.061  15.212  11.070  1.00 26.10 ? 263  GLU A O     1 
ATOM   2068  C  CB    . GLU A 1 263 ? -1.396  13.468  8.814   1.00 26.59 ? 263  GLU A CB    1 
ATOM   2069  C  CG    . GLU A 1 263 ? -0.061  13.523  8.065   1.00 28.17 ? 263  GLU A CG    1 
ATOM   2070  C  CD    . GLU A 1 263 ? -0.204  13.199  6.562   1.00 30.48 ? 263  GLU A CD    1 
ATOM   2071  O  OE1   . GLU A 1 263 ? -1.256  13.518  5.940   1.00 28.36 ? 263  GLU A OE1   1 
ATOM   2072  O  OE2   . GLU A 1 263 ? 0.752   12.613  5.989   1.00 33.70 ? 263  GLU A OE2   1 
ATOM   2073  N  N     . GLN A 1 264 ? -3.696  13.083  10.762  1.00 25.64 ? 264  GLN A N     1 
ATOM   2074  C  CA    . GLN A 1 264 ? -5.142  13.283  10.758  1.00 25.37 ? 264  GLN A CA    1 
ATOM   2075  C  C     . GLN A 1 264 ? -5.771  13.573  12.139  1.00 24.58 ? 264  GLN A C     1 
ATOM   2076  O  O     . GLN A 1 264 ? -6.964  13.894  12.226  1.00 23.87 ? 264  GLN A O     1 
ATOM   2077  C  CB    . GLN A 1 264 ? -5.813  12.030  10.160  1.00 25.87 ? 264  GLN A CB    1 
ATOM   2078  C  CG    . GLN A 1 264 ? -5.015  11.298  9.015   1.00 27.78 ? 264  GLN A CG    1 
ATOM   2079  C  CD    . GLN A 1 264 ? -4.163  10.093  9.515   1.00 30.58 ? 264  GLN A CD    1 
ATOM   2080  O  OE1   . GLN A 1 264 ? -2.940  10.037  9.278   1.00 30.86 ? 264  GLN A OE1   1 
ATOM   2081  N  NE2   . GLN A 1 264 ? -4.809  9.146   10.216  1.00 31.28 ? 264  GLN A NE2   1 
ATOM   2082  N  N     . ASP A 1 265 ? -4.980  13.440  13.206  1.00 23.58 ? 265  ASP A N     1 
ATOM   2083  C  CA    . ASP A 1 265 ? -5.464  13.630  14.572  1.00 22.86 ? 265  ASP A CA    1 
ATOM   2084  C  C     . ASP A 1 265 ? -5.250  15.026  15.078  1.00 21.92 ? 265  ASP A C     1 
ATOM   2085  O  O     . ASP A 1 265 ? -5.786  15.397  16.107  1.00 21.91 ? 265  ASP A O     1 
ATOM   2086  C  CB    . ASP A 1 265 ? -4.728  12.705  15.537  1.00 23.15 ? 265  ASP A CB    1 
ATOM   2087  C  CG    . ASP A 1 265 ? -4.977  11.231  15.257  1.00 24.00 ? 265  ASP A CG    1 
ATOM   2088  O  OD1   . ASP A 1 265 ? -6.078  10.841  14.778  1.00 23.95 ? 265  ASP A OD1   1 
ATOM   2089  O  OD2   . ASP A 1 265 ? -4.098  10.386  15.502  1.00 26.11 ? 265  ASP A OD2   1 
ATOM   2090  N  N     . SER A 1 266 ? -4.435  15.787  14.370  1.00 21.15 ? 266  SER A N     1 
ATOM   2091  C  CA    . SER A 1 266 ? -4.036  17.109  14.797  1.00 20.26 ? 266  SER A CA    1 
ATOM   2092  C  C     . SER A 1 266 ? -4.095  18.064  13.621  1.00 20.03 ? 266  SER A C     1 
ATOM   2093  O  O     . SER A 1 266 ? -3.926  17.646  12.479  1.00 19.30 ? 266  SER A O     1 
ATOM   2094  C  CB    . SER A 1 266 ? -2.604  17.052  15.269  1.00 19.87 ? 266  SER A CB    1 
ATOM   2095  O  OG    . SER A 1 266 ? -1.791  16.959  14.110  1.00 19.35 ? 266  SER A OG    1 
ATOM   2096  N  N     . ILE A 1 267 ? -4.303  19.350  13.888  1.00 20.08 ? 267  ILE A N     1 
ATOM   2097  C  CA    . ILE A 1 267 ? -4.032  20.366  12.858  1.00 20.70 ? 267  ILE A CA    1 
ATOM   2098  C  C     . ILE A 1 267 ? -2.527  20.511  12.743  1.00 20.61 ? 267  ILE A C     1 
ATOM   2099  O  O     . ILE A 1 267 ? -1.846  20.706  13.742  1.00 20.93 ? 267  ILE A O     1 
ATOM   2100  C  CB    . ILE A 1 267 ? -4.626  21.753  13.200  1.00 20.74 ? 267  ILE A CB    1 
ATOM   2101  C  CG1   . ILE A 1 267 ? -6.146  21.693  13.287  1.00 20.24 ? 267  ILE A CG1   1 
ATOM   2102  C  CG2   . ILE A 1 267 ? -4.217  22.760  12.146  1.00 21.49 ? 267  ILE A CG2   1 
ATOM   2103  C  CD1   . ILE A 1 267 ? -6.734  22.884  13.994  1.00 20.64 ? 267  ILE A CD1   1 
ATOM   2104  N  N     . ILE A 1 268 ? -2.009  20.415  11.533  1.00 20.60 ? 268  ILE A N     1 
ATOM   2105  C  CA    . ILE A 1 268 ? -0.572  20.483  11.337  1.00 20.93 ? 268  ILE A CA    1 
ATOM   2106  C  C     . ILE A 1 268 ? -0.243  21.884  10.863  1.00 20.15 ? 268  ILE A C     1 
ATOM   2107  O  O     . ILE A 1 268 ? -0.553  22.227  9.746   1.00 19.93 ? 268  ILE A O     1 
ATOM   2108  C  CB    . ILE A 1 268 ? -0.035  19.437  10.296  1.00 20.82 ? 268  ILE A CB    1 
ATOM   2109  C  CG1   . ILE A 1 268 ? -0.829  18.123  10.302  1.00 22.53 ? 268  ILE A CG1   1 
ATOM   2110  C  CG2   . ILE A 1 268 ? 1.423   19.159  10.582  1.00 20.80 ? 268  ILE A CG2   1 
ATOM   2111  C  CD1   . ILE A 1 268 ? -0.692  17.295  8.974   1.00 23.86 ? 268  ILE A CD1   1 
ATOM   2112  N  N     . MET A 1 269 ? 0.385   22.686  11.703  1.00 19.83 ? 269  MET A N     1 
ATOM   2113  C  CA    . MET A 1 269 ? 0.792   24.023  11.280  1.00 20.28 ? 269  MET A CA    1 
ATOM   2114  C  C     . MET A 1 269 ? 2.170   23.935  10.700  1.00 19.90 ? 269  MET A C     1 
ATOM   2115  O  O     . MET A 1 269 ? 2.975   23.148  11.191  1.00 20.71 ? 269  MET A O     1 
ATOM   2116  C  CB    . MET A 1 269 ? 0.790   24.977  12.454  1.00 20.49 ? 269  MET A CB    1 
ATOM   2117  C  CG    . MET A 1 269 ? -0.568  25.155  13.063  1.00 21.13 ? 269  MET A CG    1 
ATOM   2118  S  SD    . MET A 1 269 ? -0.350  25.891  14.639  1.00 24.98 ? 269  MET A SD    1 
ATOM   2119  C  CE    . MET A 1 269 ? -1.778  25.203  15.489  1.00 26.85 ? 269  MET A CE    1 
ATOM   2120  N  N     . ASP A 1 270 ? 2.443   24.701  9.642   1.00 19.55 ? 270  ASP A N     1 
ATOM   2121  C  CA    . ASP A 1 270 ? 3.775   24.662  9.021   1.00 19.14 ? 270  ASP A CA    1 
ATOM   2122  C  C     . ASP A 1 270 ? 4.736   25.509  9.858   1.00 18.63 ? 270  ASP A C     1 
ATOM   2123  O  O     . ASP A 1 270 ? 4.362   25.954  10.926  1.00 18.48 ? 270  ASP A O     1 
ATOM   2124  C  CB    . ASP A 1 270 ? 3.751   25.000  7.510   1.00 18.93 ? 270  ASP A CB    1 
ATOM   2125  C  CG    . ASP A 1 270 ? 3.297   26.421  7.198   1.00 19.58 ? 270  ASP A CG    1 
ATOM   2126  O  OD1   . ASP A 1 270 ? 3.022   27.217  8.121   1.00 20.40 ? 270  ASP A OD1   1 
ATOM   2127  O  OD2   . ASP A 1 270 ? 3.189   26.835  6.016   1.00 19.48 ? 270  ASP A OD2   1 
ATOM   2128  N  N     . ALA A 1 271 ? 5.971   25.695  9.408   1.00 18.56 ? 271  ALA A N     1 
ATOM   2129  C  CA    . ALA A 1 271 ? 6.992   26.298  10.257  1.00 18.33 ? 271  ALA A CA    1 
ATOM   2130  C  C     . ALA A 1 271 ? 6.792   27.799  10.335  1.00 18.22 ? 271  ALA A C     1 
ATOM   2131  O  O     . ALA A 1 271 ? 6.856   28.365  11.425  1.00 18.86 ? 271  ALA A O     1 
ATOM   2132  C  CB    . ALA A 1 271 ? 8.388   25.954  9.769   1.00 18.38 ? 271  ALA A CB    1 
ATOM   2133  N  N     . ALA A 1 272 ? 6.528   28.433  9.196   1.00 17.67 ? 272  ALA A N     1 
ATOM   2134  C  CA    . ALA A 1 272 ? 6.115   29.839  9.158   1.00 17.30 ? 272  ALA A CA    1 
ATOM   2135  C  C     . ALA A 1 272 ? 4.908   30.111  10.043  1.00 17.13 ? 272  ALA A C     1 
ATOM   2136  O  O     . ALA A 1 272 ? 4.852   31.124  10.718  1.00 17.77 ? 272  ALA A O     1 
ATOM   2137  C  CB    . ALA A 1 272 ? 5.800   30.257  7.737   1.00 17.20 ? 272  ALA A CB    1 
ATOM   2138  N  N     . THR A 1 273 ? 3.941   29.204  10.063  1.00 16.88 ? 273  THR A N     1 
ATOM   2139  C  CA    . THR A 1 273 ? 2.711   29.440  10.825  1.00 16.34 ? 273  THR A CA    1 
ATOM   2140  C  C     . THR A 1 273 ? 3.003   29.561  12.324  1.00 17.11 ? 273  THR A C     1 
ATOM   2141  O  O     . THR A 1 273 ? 2.575   30.515  12.985  1.00 16.93 ? 273  THR A O     1 
ATOM   2142  C  CB    . THR A 1 273 ? 1.680   28.344  10.522  1.00 15.43 ? 273  THR A CB    1 
ATOM   2143  O  OG1   . THR A 1 273 ? 1.163   28.535  9.204   1.00 12.20 ? 273  THR A OG1   1 
ATOM   2144  C  CG2   . THR A 1 273 ? 0.451   28.473  11.386  1.00 15.11 ? 273  THR A CG2   1 
ATOM   2145  N  N     . ARG A 1 274 ? 3.758   28.594  12.827  1.00 17.85 ? 274  ARG A N     1 
ATOM   2146  C  CA    . ARG A 1 274 ? 4.158   28.527  14.227  1.00 18.77 ? 274  ARG A CA    1 
ATOM   2147  C  C     . ARG A 1 274 ? 4.930   29.774  14.684  1.00 19.04 ? 274  ARG A C     1 
ATOM   2148  O  O     . ARG A 1 274 ? 4.799   30.202  15.822  1.00 19.21 ? 274  ARG A O     1 
ATOM   2149  C  CB    . ARG A 1 274 ? 5.021   27.279  14.414  1.00 19.20 ? 274  ARG A CB    1 
ATOM   2150  C  CG    . ARG A 1 274 ? 4.764   26.472  15.667  1.00 20.63 ? 274  ARG A CG    1 
ATOM   2151  C  CD    . ARG A 1 274 ? 5.214   25.011  15.525  1.00 23.62 ? 274  ARG A CD    1 
ATOM   2152  N  NE    . ARG A 1 274 ? 4.095   24.066  15.639  1.00 24.29 ? 274  ARG A NE    1 
ATOM   2153  C  CZ    . ARG A 1 274 ? 3.806   23.109  14.777  1.00 23.64 ? 274  ARG A CZ    1 
ATOM   2154  N  NH1   . ARG A 1 274 ? 4.530   22.924  13.692  1.00 23.11 ? 274  ARG A NH1   1 
ATOM   2155  N  NH2   . ARG A 1 274 ? 2.760   22.330  15.001  1.00 24.90 ? 274  ARG A NH2   1 
ATOM   2156  N  N     . ARG A 1 275 ? 5.728   30.339  13.782  1.00 19.57 ? 275  ARG A N     1 
ATOM   2157  C  CA    . ARG A 1 275 ? 6.519   31.547  14.033  1.00 20.14 ? 275  ARG A CA    1 
ATOM   2158  C  C     . ARG A 1 275 ? 5.663   32.836  13.961  1.00 19.75 ? 275  ARG A C     1 
ATOM   2159  O  O     . ARG A 1 275 ? 5.782   33.747  14.786  1.00 19.25 ? 275  ARG A O     1 
ATOM   2160  C  CB    . ARG A 1 275 ? 7.630   31.673  12.973  1.00 20.61 ? 275  ARG A CB    1 
ATOM   2161  C  CG    . ARG A 1 275 ? 8.981   31.033  13.281  1.00 23.01 ? 275  ARG A CG    1 
ATOM   2162  C  CD    . ARG A 1 275 ? 10.033  31.214  12.113  1.00 26.79 ? 275  ARG A CD    1 
ATOM   2163  N  NE    . ARG A 1 275 ? 9.579   30.598  10.849  1.00 28.88 ? 275  ARG A NE    1 
ATOM   2164  C  CZ    . ARG A 1 275 ? 10.224  30.644  9.684   1.00 29.48 ? 275  ARG A CZ    1 
ATOM   2165  N  NH1   . ARG A 1 275 ? 11.391  31.275  9.583   1.00 30.56 ? 275  ARG A NH1   1 
ATOM   2166  N  NH2   . ARG A 1 275 ? 9.695   30.049  8.611   1.00 28.84 ? 275  ARG A NH2   1 
ATOM   2167  N  N     . ASN A 1 276 ? 4.824   32.901  12.940  1.00 19.28 ? 276  ASN A N     1 
ATOM   2168  C  CA    . ASN A 1 276 ? 4.034   34.078  12.650  1.00 19.39 ? 276  ASN A CA    1 
ATOM   2169  C  C     . ASN A 1 276 ? 2.982   34.349  13.742  1.00 19.30 ? 276  ASN A C     1 
ATOM   2170  O  O     . ASN A 1 276 ? 2.519   35.481  13.914  1.00 19.79 ? 276  ASN A O     1 
ATOM   2171  C  CB    . ASN A 1 276 ? 3.384   33.895  11.265  1.00 19.59 ? 276  ASN A CB    1 
ATOM   2172  C  CG    . ASN A 1 276 ? 2.691   35.159  10.744  1.00 19.84 ? 276  ASN A CG    1 
ATOM   2173  O  OD1   . ASN A 1 276 ? 3.325   36.201  10.565  1.00 19.94 ? 276  ASN A OD1   1 
ATOM   2174  N  ND2   . ASN A 1 276 ? 1.390   35.052  10.470  1.00 19.18 ? 276  ASN A ND2   1 
ATOM   2175  N  N     . LEU A 1 277 ? 2.617   33.310  14.482  1.00 19.31 ? 277  LEU A N     1 
ATOM   2176  C  CA    . LEU A 1 277 ? 1.594   33.392  15.516  1.00 19.20 ? 277  LEU A CA    1 
ATOM   2177  C  C     . LEU A 1 277 ? 2.209   33.496  16.919  1.00 19.58 ? 277  LEU A C     1 
ATOM   2178  O  O     . LEU A 1 277 ? 1.488   33.688  17.910  1.00 18.81 ? 277  LEU A O     1 
ATOM   2179  C  CB    . LEU A 1 277 ? 0.707   32.160  15.444  1.00 19.24 ? 277  LEU A CB    1 
ATOM   2180  C  CG    . LEU A 1 277 ? -0.065  31.932  14.148  1.00 19.20 ? 277  LEU A CG    1 
ATOM   2181  C  CD1   . LEU A 1 277 ? -1.057  30.757  14.343  1.00 17.36 ? 277  LEU A CD1   1 
ATOM   2182  C  CD2   . LEU A 1 277 ? -0.775  33.237  13.680  1.00 17.86 ? 277  LEU A CD2   1 
ATOM   2183  N  N     . GLU A 1 278 ? 3.535   33.348  17.007  1.00 19.72 ? 278  GLU A N     1 
ATOM   2184  C  CA    . GLU A 1 278 ? 4.242   33.670  18.232  1.00 19.99 ? 278  GLU A CA    1 
ATOM   2185  C  C     . GLU A 1 278 ? 3.572   32.860  19.358  1.00 19.81 ? 278  GLU A C     1 
ATOM   2186  O  O     . GLU A 1 278 ? 3.186   33.395  20.381  1.00 19.39 ? 278  GLU A O     1 
ATOM   2187  C  CB    . GLU A 1 278 ? 4.211   35.214  18.488  1.00 20.17 ? 278  GLU A CB    1 
ATOM   2188  C  CG    . GLU A 1 278 ? 4.920   36.075  17.430  1.00 20.97 ? 278  GLU A CG    1 
ATOM   2189  C  CD    . GLU A 1 278 ? 4.956   37.590  17.736  1.00 23.12 ? 278  GLU A CD    1 
ATOM   2190  O  OE1   . GLU A 1 278 ? 3.883   38.239  17.732  1.00 25.57 ? 278  GLU A OE1   1 
ATOM   2191  O  OE2   . GLU A 1 278 ? 6.058   38.162  17.947  1.00 21.73 ? 278  GLU A OE2   1 
ATOM   2192  N  N     . ILE A 1 279 ? 3.440   31.554  19.149  1.00 19.96 ? 279  ILE A N     1 
ATOM   2193  C  CA    . ILE A 1 279 ? 2.690   30.698  20.062  1.00 19.95 ? 279  ILE A CA    1 
ATOM   2194  C  C     . ILE A 1 279 ? 3.359   30.579  21.434  1.00 20.01 ? 279  ILE A C     1 
ATOM   2195  O  O     . ILE A 1 279 ? 2.674   30.686  22.448  1.00 20.94 ? 279  ILE A O     1 
ATOM   2196  C  CB    . ILE A 1 279 ? 2.434   29.319  19.411  1.00 20.16 ? 279  ILE A CB    1 
ATOM   2197  C  CG1   . ILE A 1 279 ? 1.561   29.499  18.161  1.00 20.79 ? 279  ILE A CG1   1 
ATOM   2198  C  CG2   . ILE A 1 279 ? 1.798   28.328  20.414  1.00 19.92 ? 279  ILE A CG2   1 
ATOM   2199  C  CD1   . ILE A 1 279 ? 1.547   28.305  17.234  1.00 22.09 ? 279  ILE A CD1   1 
ATOM   2200  N  N     . THR A 1 280 ? 4.674   30.366  21.466  1.00 20.03 ? 280  THR A N     1 
ATOM   2201  C  CA    . THR A 1 280 ? 5.461   30.344  22.718  1.00 20.14 ? 280  THR A CA    1 
ATOM   2202  C  C     . THR A 1 280 ? 6.791   31.081  22.631  1.00 20.29 ? 280  THR A C     1 
ATOM   2203  O  O     . THR A 1 280 ? 7.417   31.348  23.645  1.00 20.09 ? 280  THR A O     1 
ATOM   2204  C  CB    . THR A 1 280 ? 5.784   28.891  23.152  1.00 20.15 ? 280  THR A CB    1 
ATOM   2205  O  OG1   . THR A 1 280 ? 6.379   28.196  22.060  1.00 20.40 ? 280  THR A OG1   1 
ATOM   2206  C  CG2   . THR A 1 280 ? 4.525   28.100  23.474  1.00 19.91 ? 280  THR A CG2   1 
ATOM   2207  N  N     . GLN A 1 281 ? 7.246   31.351  21.418  1.00 21.20 ? 281  GLN A N     1 
ATOM   2208  C  CA    . GLN A 1 281 ? 8.418   32.187  21.178  1.00 21.90 ? 281  GLN A CA    1 
ATOM   2209  C  C     . GLN A 1 281 ? 8.035   33.313  20.223  1.00 21.87 ? 281  GLN A C     1 
ATOM   2210  O  O     . GLN A 1 281 ? 7.477   33.035  19.157  1.00 21.91 ? 281  GLN A O     1 
ATOM   2211  C  CB    . GLN A 1 281 ? 9.516   31.344  20.545  1.00 22.38 ? 281  GLN A CB    1 
ATOM   2212  C  CG    . GLN A 1 281 ? 10.913  31.937  20.661  1.00 24.10 ? 281  GLN A CG    1 
ATOM   2213  C  CD    . GLN A 1 281 ? 11.946  31.088  19.945  1.00 26.14 ? 281  GLN A CD    1 
ATOM   2214  O  OE1   . GLN A 1 281 ? 12.306  31.381  18.803  1.00 26.31 ? 281  GLN A OE1   1 
ATOM   2215  N  NE2   . GLN A 1 281 ? 12.393  30.012  20.597  1.00 25.94 ? 281  GLN A NE2   1 
ATOM   2216  N  N     . ASN A 1 282 ? 8.298   34.569  20.604  1.00 21.72 ? 282  ASN A N     1 
ATOM   2217  C  CA    . ASN A 1 282 ? 7.990   35.705  19.726  1.00 21.96 ? 282  ASN A CA    1 
ATOM   2218  C  C     . ASN A 1 282 ? 9.009   35.774  18.606  1.00 22.26 ? 282  ASN A C     1 
ATOM   2219  O  O     . ASN A 1 282 ? 9.926   34.947  18.556  1.00 22.16 ? 282  ASN A O     1 
ATOM   2220  C  CB    . ASN A 1 282 ? 7.826   37.051  20.482  1.00 21.81 ? 282  ASN A CB    1 
ATOM   2221  C  CG    . ASN A 1 282 ? 9.075   37.500  21.220  1.00 21.61 ? 282  ASN A CG    1 
ATOM   2222  O  OD1   . ASN A 1 282 ? 8.990   37.983  22.347  1.00 20.07 ? 282  ASN A OD1   1 
ATOM   2223  N  ND2   . ASN A 1 282 ? 10.229  37.379  20.582  1.00 21.93 ? 282  ASN A ND2   1 
ATOM   2224  N  N     . LEU A 1 283 ? 8.857   36.744  17.707  1.00 22.56 ? 283  LEU A N     1 
ATOM   2225  C  CA    . LEU A 1 283 ? 9.635   36.727  16.462  1.00 22.81 ? 283  LEU A CA    1 
ATOM   2226  C  C     . LEU A 1 283 ? 11.093  37.097  16.673  1.00 23.20 ? 283  LEU A C     1 
ATOM   2227  O  O     . LEU A 1 283 ? 11.930  36.753  15.841  1.00 23.72 ? 283  LEU A O     1 
ATOM   2228  C  CB    . LEU A 1 283 ? 8.974   37.569  15.361  1.00 22.65 ? 283  LEU A CB    1 
ATOM   2229  C  CG    . LEU A 1 283 ? 7.769   36.836  14.724  1.00 22.64 ? 283  LEU A CG    1 
ATOM   2230  C  CD1   . LEU A 1 283 ? 6.754   37.801  14.165  1.00 22.18 ? 283  LEU A CD1   1 
ATOM   2231  C  CD2   . LEU A 1 283 ? 8.205   35.789  13.642  1.00 22.35 ? 283  LEU A CD2   1 
ATOM   2232  N  N     . ALA A 1 284 ? 11.386  37.768  17.789  1.00 23.30 ? 284  ALA A N     1 
ATOM   2233  C  CA    . ALA A 1 284 ? 12.752  38.077  18.199  1.00 23.34 ? 284  ALA A CA    1 
ATOM   2234  C  C     . ALA A 1 284 ? 13.377  37.007  19.122  1.00 23.59 ? 284  ALA A C     1 
ATOM   2235  O  O     . ALA A 1 284 ? 14.474  37.211  19.650  1.00 23.27 ? 284  ALA A O     1 
ATOM   2236  C  CB    . ALA A 1 284 ? 12.781  39.440  18.875  1.00 23.16 ? 284  ALA A CB    1 
ATOM   2237  N  N     . GLY A 1 285 ? 12.681  35.889  19.328  1.00 23.88 ? 285  GLY A N     1 
ATOM   2238  C  CA    . GLY A 1 285 ? 13.215  34.764  20.084  1.00 24.29 ? 285  GLY A CA    1 
ATOM   2239  C  C     . GLY A 1 285 ? 12.819  34.658  21.553  1.00 24.83 ? 285  GLY A C     1 
ATOM   2240  O  O     . GLY A 1 285 ? 13.012  33.607  22.166  1.00 25.66 ? 285  GLY A O     1 
ATOM   2241  N  N     . GLY A 1 286 ? 12.281  35.724  22.137  1.00 24.86 ? 286  GLY A N     1 
ATOM   2242  C  CA    . GLY A 1 286 ? 11.917  35.726  23.549  1.00 24.71 ? 286  GLY A CA    1 
ATOM   2243  C  C     . GLY A 1 286 ? 10.497  35.257  23.784  1.00 24.75 ? 286  GLY A C     1 
ATOM   2244  O  O     . GLY A 1 286 ? 9.817   34.897  22.838  1.00 24.63 ? 286  GLY A O     1 
ATOM   2245  N  N     . ALA A 1 287 ? 10.052  35.284  25.041  1.00 24.82 ? 287  ALA A N     1 
ATOM   2246  C  CA    . ALA A 1 287 ? 8.746   34.742  25.433  1.00 25.09 ? 287  ALA A CA    1 
ATOM   2247  C  C     . ALA A 1 287 ? 7.747   35.816  25.911  1.00 25.34 ? 287  ALA A C     1 
ATOM   2248  O  O     . ALA A 1 287 ? 6.645   35.487  26.340  1.00 25.42 ? 287  ALA A O     1 
ATOM   2249  C  CB    . ALA A 1 287 ? 8.923   33.669  26.500  1.00 24.84 ? 287  ALA A CB    1 
ATOM   2250  N  N     . GLU A 1 288 ? 8.127   37.089  25.819  1.00 25.32 ? 288  GLU A N     1 
ATOM   2251  C  CA    . GLU A 1 288 ? 7.189   38.204  26.011  1.00 25.40 ? 288  GLU A CA    1 
ATOM   2252  C  C     . GLU A 1 288 ? 6.159   38.194  24.880  1.00 24.47 ? 288  GLU A C     1 
ATOM   2253  O  O     . GLU A 1 288 ? 6.454   37.738  23.784  1.00 24.34 ? 288  GLU A O     1 
ATOM   2254  C  CB    . GLU A 1 288 ? 7.916   39.569  25.982  1.00 25.68 ? 288  GLU A CB    1 
ATOM   2255  C  CG    . GLU A 1 288 ? 9.273   39.619  26.684  1.00 27.63 ? 288  GLU A CG    1 
ATOM   2256  C  CD    . GLU A 1 288 ? 10.473  39.366  25.758  1.00 29.84 ? 288  GLU A CD    1 
ATOM   2257  O  OE1   . GLU A 1 288 ? 10.380  39.617  24.528  1.00 30.86 ? 288  GLU A OE1   1 
ATOM   2258  O  OE2   . GLU A 1 288 ? 11.527  38.910  26.271  1.00 30.58 ? 288  GLU A OE2   1 
ATOM   2259  N  N     . ASN A 1 289 ? 4.961   38.713  25.135  1.00 23.61 ? 289  ASN A N     1 
ATOM   2260  C  CA    . ASN A 1 289 ? 3.988   38.950  24.065  1.00 22.82 ? 289  ASN A CA    1 
ATOM   2261  C  C     . ASN A 1 289 ? 3.748   37.745  23.117  1.00 21.74 ? 289  ASN A C     1 
ATOM   2262  O  O     . ASN A 1 289 ? 3.667   37.903  21.896  1.00 21.99 ? 289  ASN A O     1 
ATOM   2263  C  CB    . ASN A 1 289 ? 4.431   40.171  23.241  1.00 22.90 ? 289  ASN A CB    1 
ATOM   2264  C  CG    . ASN A 1 289 ? 4.627   41.430  24.097  1.00 23.97 ? 289  ASN A CG    1 
ATOM   2265  O  OD1   . ASN A 1 289 ? 3.958   41.620  25.123  1.00 24.63 ? 289  ASN A OD1   1 
ATOM   2266  N  ND2   . ASN A 1 289 ? 5.537   42.306  23.661  1.00 24.32 ? 289  ASN A ND2   1 
ATOM   2267  N  N     . THR A 1 290 ? 3.661   36.546  23.680  1.00 20.09 ? 290  THR A N     1 
ATOM   2268  C  CA    . THR A 1 290 ? 3.264   35.375  22.922  1.00 18.98 ? 290  THR A CA    1 
ATOM   2269  C  C     . THR A 1 290 ? 1.832   34.988  23.262  1.00 18.80 ? 290  THR A C     1 
ATOM   2270  O  O     . THR A 1 290 ? 1.202   35.609  24.109  1.00 17.71 ? 290  THR A O     1 
ATOM   2271  C  CB    . THR A 1 290 ? 4.185   34.204  23.232  1.00 18.81 ? 290  THR A CB    1 
ATOM   2272  O  OG1   . THR A 1 290 ? 4.199   33.956  24.638  1.00 17.47 ? 290  THR A OG1   1 
ATOM   2273  C  CG2   . THR A 1 290 ? 5.645   34.533  22.886  1.00 18.87 ? 290  THR A CG2   1 
ATOM   2274  N  N     . LEU A 1 291 ? 1.328   33.939  22.607  1.00 18.69 ? 291  LEU A N     1 
ATOM   2275  C  CA    . LEU A 1 291 ? 0.034   33.372  22.962  1.00 18.35 ? 291  LEU A CA    1 
ATOM   2276  C  C     . LEU A 1 291 ? 0.115   32.926  24.382  1.00 17.96 ? 291  LEU A C     1 
ATOM   2277  O  O     . LEU A 1 291 ? -0.795  33.155  25.153  1.00 17.14 ? 291  LEU A O     1 
ATOM   2278  C  CB    . LEU A 1 291 ? -0.355  32.180  22.077  1.00 18.32 ? 291  LEU A CB    1 
ATOM   2279  C  CG    . LEU A 1 291 ? -1.848  31.813  22.161  1.00 18.73 ? 291  LEU A CG    1 
ATOM   2280  C  CD1   . LEU A 1 291 ? -2.684  32.868  21.461  1.00 20.37 ? 291  LEU A CD1   1 
ATOM   2281  C  CD2   . LEU A 1 291 ? -2.145  30.445  21.579  1.00 18.03 ? 291  LEU A CD2   1 
ATOM   2282  N  N     . ALA A 1 292 ? 1.238   32.313  24.722  1.00 18.44 ? 292  ALA A N     1 
ATOM   2283  C  CA    . ALA A 1 292 ? 1.364   31.602  25.985  1.00 18.81 ? 292  ALA A CA    1 
ATOM   2284  C  C     . ALA A 1 292 ? 1.498   32.573  27.139  1.00 18.52 ? 292  ALA A C     1 
ATOM   2285  O  O     . ALA A 1 292 ? 0.884   32.389  28.159  1.00 18.36 ? 292  ALA A O     1 
ATOM   2286  C  CB    . ALA A 1 292 ? 2.545   30.629  25.936  1.00 18.81 ? 292  ALA A CB    1 
ATOM   2287  N  N     . SER A 1 293 ? 2.294   33.616  26.984  1.00 19.14 ? 293  SER A N     1 
ATOM   2288  C  CA    . SER A 1 293 ? 2.322   34.699  27.990  1.00 19.83 ? 293  SER A CA    1 
ATOM   2289  C  C     . SER A 1 293 ? 0.910   35.115  28.428  1.00 20.19 ? 293  SER A C     1 
ATOM   2290  O  O     . SER A 1 293 ? 0.653   35.258  29.620  1.00 21.32 ? 293  SER A O     1 
ATOM   2291  C  CB    . SER A 1 293 ? 3.023   35.929  27.444  1.00 19.49 ? 293  SER A CB    1 
ATOM   2292  O  OG    . SER A 1 293 ? 2.392   36.285  26.245  1.00 19.63 ? 293  SER A OG    1 
ATOM   2293  N  N     . VAL A 1 294 ? 0.008   35.292  27.468  1.00 20.05 ? 294  VAL A N     1 
ATOM   2294  C  CA    . VAL A 1 294 ? -1.393  35.562  27.760  1.00 20.25 ? 294  VAL A CA    1 
ATOM   2295  C  C     . VAL A 1 294 ? -2.132  34.388  28.445  1.00 20.02 ? 294  VAL A C     1 
ATOM   2296  O  O     . VAL A 1 294 ? -2.567  34.506  29.576  1.00 19.74 ? 294  VAL A O     1 
ATOM   2297  C  CB    . VAL A 1 294 ? -2.136  35.997  26.477  1.00 20.30 ? 294  VAL A CB    1 
ATOM   2298  C  CG1   . VAL A 1 294 ? -3.636  35.871  26.643  1.00 21.04 ? 294  VAL A CG1   1 
ATOM   2299  C  CG2   . VAL A 1 294 ? -1.774  37.432  26.131  1.00 20.76 ? 294  VAL A CG2   1 
ATOM   2300  N  N     . LEU A 1 295 ? -2.280  33.266  27.761  1.00 20.29 ? 295  LEU A N     1 
ATOM   2301  C  CA    . LEU A 1 295 ? -3.113  32.177  28.259  1.00 20.63 ? 295  LEU A CA    1 
ATOM   2302  C  C     . LEU A 1 295 ? -2.588  31.421  29.479  1.00 20.95 ? 295  LEU A C     1 
ATOM   2303  O  O     . LEU A 1 295 ? -3.378  30.942  30.290  1.00 20.98 ? 295  LEU A O     1 
ATOM   2304  C  CB    . LEU A 1 295 ? -3.344  31.168  27.163  1.00 20.68 ? 295  LEU A CB    1 
ATOM   2305  C  CG    . LEU A 1 295 ? -4.137  31.630  25.956  1.00 21.80 ? 295  LEU A CG    1 
ATOM   2306  C  CD1   . LEU A 1 295 ? -4.332  30.414  25.051  1.00 22.15 ? 295  LEU A CD1   1 
ATOM   2307  C  CD2   . LEU A 1 295 ? -5.481  32.256  26.323  1.00 21.86 ? 295  LEU A CD2   1 
ATOM   2308  N  N     . ASP A 1 296 ? -1.272  31.312  29.602  1.00 21.31 ? 296  ASP A N     1 
ATOM   2309  C  CA    . ASP A 1 296 ? -0.643  30.440  30.598  1.00 22.02 ? 296  ASP A CA    1 
ATOM   2310  C  C     . ASP A 1 296 ? -0.510  31.099  31.996  1.00 22.20 ? 296  ASP A C     1 
ATOM   2311  O  O     . ASP A 1 296 ? 0.427   31.879  32.257  1.00 22.46 ? 296  ASP A O     1 
ATOM   2312  C  CB    . ASP A 1 296 ? 0.719   29.953  30.067  1.00 22.27 ? 296  ASP A CB    1 
ATOM   2313  C  CG    . ASP A 1 296 ? 1.448   29.005  31.022  1.00 23.89 ? 296  ASP A CG    1 
ATOM   2314  O  OD1   . ASP A 1 296 ? 0.850   28.545  32.034  1.00 24.14 ? 296  ASP A OD1   1 
ATOM   2315  O  OD2   . ASP A 1 296 ? 2.648   28.673  30.825  1.00 25.04 ? 296  ASP A OD2   1 
ATOM   2316  N  N     . CYS A 1 297 ? -1.464  30.773  32.874  1.00 21.72 ? 297  CYS A N     1 
ATOM   2317  C  CA    . CYS A 1 297 ? -1.412  31.132  34.288  1.00 21.44 ? 297  CYS A CA    1 
ATOM   2318  C  C     . CYS A 1 297 ? -1.637  29.956  35.181  1.00 21.20 ? 297  CYS A C     1 
ATOM   2319  O  O     . CYS A 1 297 ? -2.071  30.093  36.322  1.00 20.96 ? 297  CYS A O     1 
ATOM   2320  C  CB    . CYS A 1 297 ? -2.471  32.160  34.601  1.00 21.72 ? 297  CYS A CB    1 
ATOM   2321  S  SG    . CYS A 1 297 ? -2.190  33.619  33.650  1.00 20.98 ? 297  CYS A SG    1 
ATOM   2322  N  N     . THR A 1 298 ? -1.330  28.795  34.630  1.00 21.44 ? 298  THR A N     1 
ATOM   2323  C  CA    . THR A 1 298 ? -1.293  27.528  35.334  1.00 20.95 ? 298  THR A CA    1 
ATOM   2324  C  C     . THR A 1 298 ? -0.463  27.675  36.595  1.00 21.22 ? 298  THR A C     1 
ATOM   2325  O  O     . THR A 1 298 ? 0.416   28.530  36.677  1.00 21.94 ? 298  THR A O     1 
ATOM   2326  C  CB    . THR A 1 298 ? -0.636  26.480  34.419  1.00 21.09 ? 298  THR A CB    1 
ATOM   2327  O  OG1   . THR A 1 298 ? 0.732   26.821  34.161  1.00 20.13 ? 298  THR A OG1   1 
ATOM   2328  C  CG2   . THR A 1 298 ? -1.261  26.455  33.013  1.00 21.15 ? 298  THR A CG2   1 
ATOM   2329  N  N     . VAL A 1 299 ? -0.722  26.832  37.576  1.00 21.38 ? 299  VAL A N     1 
ATOM   2330  C  CA    . VAL A 1 299 ? -0.051  26.941  38.865  1.00 21.26 ? 299  VAL A CA    1 
ATOM   2331  C  C     . VAL A 1 299 ? 0.915   25.790  39.196  1.00 21.08 ? 299  VAL A C     1 
ATOM   2332  O  O     . VAL A 1 299 ? 1.465   25.768  40.293  1.00 21.49 ? 299  VAL A O     1 
ATOM   2333  C  CB    . VAL A 1 299 ? -1.104  27.098  40.019  1.00 21.70 ? 299  VAL A CB    1 
ATOM   2334  C  CG1   . VAL A 1 299 ? -1.962  28.372  39.829  1.00 20.62 ? 299  VAL A CG1   1 
ATOM   2335  C  CG2   . VAL A 1 299 ? -1.994  25.841  40.162  1.00 20.78 ? 299  VAL A CG2   1 
ATOM   2336  N  N     . THR A 1 300 ? 1.096   24.830  38.288  1.00 20.72 ? 300  THR A N     1 
ATOM   2337  C  CA    . THR A 1 300 ? 2.131   23.790  38.433  1.00 20.41 ? 300  THR A CA    1 
ATOM   2338  C  C     . THR A 1 300 ? 2.945   23.773  37.164  1.00 20.79 ? 300  THR A C     1 
ATOM   2339  O  O     . THR A 1 300 ? 2.388   23.991  36.081  1.00 20.98 ? 300  THR A O     1 
ATOM   2340  C  CB    . THR A 1 300 ? 1.554   22.339  38.674  1.00 20.68 ? 300  THR A CB    1 
ATOM   2341  O  OG1   . THR A 1 300 ? 0.974   21.782  37.471  1.00 18.42 ? 300  THR A OG1   1 
ATOM   2342  C  CG2   . THR A 1 300 ? 0.421   22.342  39.698  1.00 20.36 ? 300  THR A CG2   1 
ATOM   2343  N  N     . PRO A 1 301 ? 4.241   23.480  37.268  1.00 20.77 ? 301  PRO A N     1 
ATOM   2344  C  CA    . PRO A 1 301 ? 5.108   23.385  36.083  1.00 20.77 ? 301  PRO A CA    1 
ATOM   2345  C  C     . PRO A 1 301 ? 4.573   22.423  35.014  1.00 20.71 ? 301  PRO A C     1 
ATOM   2346  O  O     . PRO A 1 301 ? 4.538   22.764  33.835  1.00 20.80 ? 301  PRO A O     1 
ATOM   2347  C  CB    . PRO A 1 301 ? 6.423   22.852  36.660  1.00 20.95 ? 301  PRO A CB    1 
ATOM   2348  C  CG    . PRO A 1 301 ? 6.415   23.310  38.065  1.00 21.14 ? 301  PRO A CG    1 
ATOM   2349  C  CD    . PRO A 1 301 ? 4.982   23.191  38.510  1.00 20.81 ? 301  PRO A CD    1 
ATOM   2350  N  N     . MET A 1 302 ? 4.144   21.242  35.438  1.00 20.62 ? 302  MET A N     1 
ATOM   2351  C  CA    . MET A 1 302 ? 3.623   20.248  34.524  1.00 21.04 ? 302  MET A CA    1 
ATOM   2352  C  C     . MET A 1 302 ? 2.379   20.732  33.762  1.00 20.35 ? 302  MET A C     1 
ATOM   2353  O  O     . MET A 1 302 ? 2.211   20.445  32.587  1.00 20.27 ? 302  MET A O     1 
ATOM   2354  C  CB    . MET A 1 302 ? 3.353   18.939  35.271  1.00 21.60 ? 302  MET A CB    1 
ATOM   2355  C  CG    . MET A 1 302 ? 2.288   19.033  36.329  1.00 23.23 ? 302  MET A CG    1 
ATOM   2356  S  SD    . MET A 1 302 ? 2.134   17.510  37.234  1.00 26.56 ? 302  MET A SD    1 
ATOM   2357  C  CE    . MET A 1 302 ? 0.920   18.084  38.427  1.00 28.09 ? 302  MET A CE    1 
ATOM   2358  N  N     . GLY A 1 303 ? 1.518   21.473  34.427  1.00 20.35 ? 303  GLY A N     1 
ATOM   2359  C  CA    . GLY A 1 303 ? 0.378   22.098  33.767  1.00 20.37 ? 303  GLY A CA    1 
ATOM   2360  C  C     . GLY A 1 303 ? 0.759   23.167  32.748  1.00 19.92 ? 303  GLY A C     1 
ATOM   2361  O  O     . GLY A 1 303 ? 0.100   23.325  31.740  1.00 19.96 ? 303  GLY A O     1 
ATOM   2362  N  N     . SER A 1 304 ? 1.829   23.896  32.988  1.00 19.86 ? 304  SER A N     1 
ATOM   2363  C  CA    . SER A 1 304 ? 2.294   24.845  31.982  1.00 20.40 ? 304  SER A CA    1 
ATOM   2364  C  C     . SER A 1 304 ? 2.923   24.145  30.753  1.00 20.34 ? 304  SER A C     1 
ATOM   2365  O  O     . SER A 1 304 ? 2.768   24.600  29.623  1.00 21.11 ? 304  SER A O     1 
ATOM   2366  C  CB    . SER A 1 304 ? 3.263   25.858  32.582  1.00 19.99 ? 304  SER A CB    1 
ATOM   2367  O  OG    . SER A 1 304 ? 4.405   25.907  31.785  1.00 20.60 ? 304  SER A OG    1 
ATOM   2368  N  N     . ARG A 1 305 ? 3.631   23.047  30.952  1.00 20.32 ? 305  ARG A N     1 
ATOM   2369  C  CA    . ARG A 1 305 ? 4.204   22.328  29.809  1.00 20.02 ? 305  ARG A CA    1 
ATOM   2370  C  C     . ARG A 1 305 ? 3.113   21.702  28.946  1.00 20.03 ? 305  ARG A C     1 
ATOM   2371  O  O     . ARG A 1 305 ? 3.169   21.815  27.723  1.00 20.20 ? 305  ARG A O     1 
ATOM   2372  C  CB    . ARG A 1 305 ? 5.187   21.274  30.281  1.00 19.80 ? 305  ARG A CB    1 
ATOM   2373  C  CG    . ARG A 1 305 ? 6.427   21.860  30.875  1.00 21.25 ? 305  ARG A CG    1 
ATOM   2374  C  CD    . ARG A 1 305 ? 7.346   20.833  31.484  1.00 24.20 ? 305  ARG A CD    1 
ATOM   2375  N  NE    . ARG A 1 305 ? 6.949   20.451  32.847  1.00 26.39 ? 305  ARG A NE    1 
ATOM   2376  C  CZ    . ARG A 1 305 ? 7.091   19.238  33.367  1.00 27.73 ? 305  ARG A CZ    1 
ATOM   2377  N  NH1   . ARG A 1 305 ? 7.605   18.247  32.655  1.00 31.75 ? 305  ARG A NH1   1 
ATOM   2378  N  NH2   . ARG A 1 305 ? 6.712   18.997  34.600  1.00 27.17 ? 305  ARG A NH2   1 
ATOM   2379  N  N     . MET A 1 306 ? 2.126   21.061  29.587  1.00 19.96 ? 306  MET A N     1 
ATOM   2380  C  CA    . MET A 1 306 ? 0.955   20.483  28.900  1.00 19.88 ? 306  MET A CA    1 
ATOM   2381  C  C     . MET A 1 306 ? 0.189   21.483  28.021  1.00 19.93 ? 306  MET A C     1 
ATOM   2382  O  O     . MET A 1 306 ? -0.213  21.181  26.878  1.00 19.85 ? 306  MET A O     1 
ATOM   2383  C  CB    . MET A 1 306 ? -0.002  19.902  29.918  1.00 19.46 ? 306  MET A CB    1 
ATOM   2384  C  CG    . MET A 1 306 ? -1.118  19.130  29.282  1.00 20.50 ? 306  MET A CG    1 
ATOM   2385  S  SD    . MET A 1 306 ? -1.909  18.013  30.441  1.00 21.60 ? 306  MET A SD    1 
ATOM   2386  C  CE    . MET A 1 306 ? -0.752  16.655  30.309  1.00 23.46 ? 306  MET A CE    1 
ATOM   2387  N  N     . LEU A 1 307 ? -0.019  22.671  28.581  1.00 19.77 ? 307  LEU A N     1 
ATOM   2388  C  CA    . LEU A 1 307 ? -0.660  23.774  27.884  1.00 19.15 ? 307  LEU A CA    1 
ATOM   2389  C  C     . LEU A 1 307 ? 0.127   24.101  26.648  1.00 18.07 ? 307  LEU A C     1 
ATOM   2390  O  O     . LEU A 1 307 ? -0.444  24.186  25.569  1.00 18.26 ? 307  LEU A O     1 
ATOM   2391  C  CB    . LEU A 1 307 ? -0.744  24.986  28.799  1.00 19.46 ? 307  LEU A CB    1 
ATOM   2392  C  CG    . LEU A 1 307 ? -1.463  26.224  28.283  1.00 21.29 ? 307  LEU A CG    1 
ATOM   2393  C  CD1   . LEU A 1 307 ? -2.843  25.911  27.798  1.00 22.70 ? 307  LEU A CD1   1 
ATOM   2394  C  CD2   . LEU A 1 307 ? -1.534  27.260  29.394  1.00 23.59 ? 307  LEU A CD2   1 
ATOM   2395  N  N     . LYS A 1 308 ? 1.440   24.238  26.780  1.00 17.14 ? 308  LYS A N     1 
ATOM   2396  C  CA    . LYS A 1 308 ? 2.278   24.566  25.631  1.00 16.93 ? 308  LYS A CA    1 
ATOM   2397  C  C     . LYS A 1 308 ? 2.280   23.497  24.538  1.00 16.83 ? 308  LYS A C     1 
ATOM   2398  O  O     . LYS A 1 308 ? 2.444   23.824  23.361  1.00 17.02 ? 308  LYS A O     1 
ATOM   2399  C  CB    . LYS A 1 308 ? 3.709   24.884  26.054  1.00 17.36 ? 308  LYS A CB    1 
ATOM   2400  C  CG    . LYS A 1 308 ? 3.867   26.237  26.784  1.00 17.62 ? 308  LYS A CG    1 
ATOM   2401  C  CD    . LYS A 1 308 ? 5.199   26.311  27.518  1.00 18.34 ? 308  LYS A CD    1 
ATOM   2402  C  CE    . LYS A 1 308 ? 5.202   27.454  28.534  1.00 20.57 ? 308  LYS A CE    1 
ATOM   2403  N  NZ    . LYS A 1 308 ? 6.555   28.086  28.791  1.00 20.77 ? 308  LYS A NZ    1 
ATOM   2404  N  N     . ARG A 1 309 ? 2.083   22.232  24.908  1.00 16.70 ? 309  ARG A N     1 
ATOM   2405  C  CA    . ARG A 1 309 ? 1.988   21.152  23.932  1.00 16.08 ? 309  ARG A CA    1 
ATOM   2406  C  C     . ARG A 1 309 ? 0.650   21.161  23.198  1.00 16.52 ? 309  ARG A C     1 
ATOM   2407  O  O     . ARG A 1 309 ? 0.601   20.902  21.993  1.00 17.13 ? 309  ARG A O     1 
ATOM   2408  C  CB    . ARG A 1 309 ? 2.135   19.815  24.612  1.00 15.96 ? 309  ARG A CB    1 
ATOM   2409  C  CG    . ARG A 1 309 ? 3.506   19.558  25.135  1.00 15.08 ? 309  ARG A CG    1 
ATOM   2410  C  CD    . ARG A 1 309 ? 3.749   18.089  25.447  1.00 13.07 ? 309  ARG A CD    1 
ATOM   2411  N  NE    . ARG A 1 309 ? 2.884   17.592  26.520  1.00 10.03 ? 309  ARG A NE    1 
ATOM   2412  C  CZ    . ARG A 1 309 ? 3.089   17.805  27.813  1.00 6.89  ? 309  ARG A CZ    1 
ATOM   2413  N  NH1   . ARG A 1 309 ? 4.132   18.522  28.225  1.00 6.01  ? 309  ARG A NH1   1 
ATOM   2414  N  NH2   . ARG A 1 309 ? 2.250   17.294  28.710  1.00 5.24  ? 309  ARG A NH2   1 
ATOM   2415  N  N     . TRP A 1 310 ? -0.437  21.423  23.915  1.00 16.14 ? 310  TRP A N     1 
ATOM   2416  C  CA    . TRP A 1 310 ? -1.734  21.526  23.266  1.00 16.04 ? 310  TRP A CA    1 
ATOM   2417  C  C     . TRP A 1 310 ? -1.699  22.735  22.336  1.00 16.45 ? 310  TRP A C     1 
ATOM   2418  O  O     . TRP A 1 310 ? -1.933  22.580  21.140  1.00 16.91 ? 310  TRP A O     1 
ATOM   2419  C  CB    . TRP A 1 310 ? -2.872  21.732  24.251  1.00 16.14 ? 310  TRP A CB    1 
ATOM   2420  C  CG    . TRP A 1 310 ? -3.128  20.681  25.244  1.00 15.75 ? 310  TRP A CG    1 
ATOM   2421  C  CD1   . TRP A 1 310 ? -2.394  19.586  25.491  1.00 17.34 ? 310  TRP A CD1   1 
ATOM   2422  C  CD2   . TRP A 1 310 ? -4.233  20.634  26.140  1.00 17.05 ? 310  TRP A CD2   1 
ATOM   2423  N  NE1   . TRP A 1 310 ? -2.960  18.842  26.500  1.00 17.05 ? 310  TRP A NE1   1 
ATOM   2424  C  CE2   . TRP A 1 310 ? -4.095  19.466  26.918  1.00 16.13 ? 310  TRP A CE2   1 
ATOM   2425  C  CE3   . TRP A 1 310 ? -5.330  21.473  26.377  1.00 17.28 ? 310  TRP A CE3   1 
ATOM   2426  C  CZ2   . TRP A 1 310 ? -4.992  19.115  27.905  1.00 16.72 ? 310  TRP A CZ2   1 
ATOM   2427  C  CZ3   . TRP A 1 310 ? -6.241  21.111  27.351  1.00 17.86 ? 310  TRP A CZ3   1 
ATOM   2428  C  CH2   . TRP A 1 310 ? -6.067  19.945  28.103  1.00 18.14 ? 310  TRP A CH2   1 
ATOM   2429  N  N     . LEU A 1 311 ? -1.428  23.938  22.862  1.00 16.44 ? 311  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1 311 ? -1.308  25.141  21.996  1.00 16.70 ? 311  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1 311 ? -0.602  24.808  20.664  1.00 17.20 ? 311  LEU A C     1 
ATOM   2432  O  O     . LEU A 1 311 ? -1.029  25.229  19.597  1.00 16.46 ? 311  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1 311 ? -0.515  26.271  22.695  1.00 16.51 ? 311  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1 311 ? -1.136  27.332  23.607  1.00 14.08 ? 311  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1 311 ? -2.613  27.164  23.840  1.00 14.92 ? 311  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1 311 ? -0.415  27.350  24.916  1.00 13.61 ? 311  LEU A CD2   1 
ATOM   2437  N  N     . HIS A 1 312 ? 0.471   24.022  20.766  1.00 18.57 ? 312  HIS A N     1 
ATOM   2438  C  CA    . HIS A 1 312 ? 1.287   23.611  19.621  1.00 19.31 ? 312  HIS A CA    1 
ATOM   2439  C  C     . HIS A 1 312 ? 0.714   22.477  18.786  1.00 19.84 ? 312  HIS A C     1 
ATOM   2440  O  O     . HIS A 1 312 ? 1.060   22.343  17.619  1.00 19.71 ? 312  HIS A O     1 
ATOM   2441  C  CB    . HIS A 1 312 ? 2.706   23.247  20.079  1.00 19.57 ? 312  HIS A CB    1 
ATOM   2442  C  CG    . HIS A 1 312 ? 3.638   24.412  20.031  1.00 19.93 ? 312  HIS A CG    1 
ATOM   2443  N  ND1   . HIS A 1 312 ? 3.842   25.242  21.109  1.00 20.30 ? 312  HIS A ND1   1 
ATOM   2444  C  CD2   . HIS A 1 312 ? 4.359   24.932  19.009  1.00 20.59 ? 312  HIS A CD2   1 
ATOM   2445  C  CE1   . HIS A 1 312 ? 4.662   26.218  20.757  1.00 20.36 ? 312  HIS A CE1   1 
ATOM   2446  N  NE2   . HIS A 1 312 ? 4.989   26.053  19.489  1.00 21.52 ? 312  HIS A NE2   1 
ATOM   2447  N  N     . MET A 1 313 ? -0.154  21.672  19.381  1.00 20.78 ? 313  MET A N     1 
ATOM   2448  C  CA    . MET A 1 313 ? -0.734  20.518  18.703  1.00 21.87 ? 313  MET A CA    1 
ATOM   2449  C  C     . MET A 1 313 ? -2.249  20.388  18.942  1.00 21.76 ? 313  MET A C     1 
ATOM   2450  O  O     . MET A 1 313 ? -2.681  19.613  19.811  1.00 22.05 ? 313  MET A O     1 
ATOM   2451  C  CB    . MET A 1 313 ? -0.037  19.254  19.181  1.00 22.09 ? 313  MET A CB    1 
ATOM   2452  C  CG    . MET A 1 313 ? -0.540  18.036  18.479  1.00 24.14 ? 313  MET A CG    1 
ATOM   2453  S  SD    . MET A 1 313 ? 0.797   17.039  17.974  1.00 28.13 ? 313  MET A SD    1 
ATOM   2454  C  CE    . MET A 1 313 ? 0.901   16.059  19.529  1.00 26.61 ? 313  MET A CE    1 
ATOM   2455  N  N     . PRO A 1 314 ? -3.042  21.138  18.175  1.00 21.57 ? 314  PRO A N     1 
ATOM   2456  C  CA    . PRO A 1 314 ? -4.499  21.112  18.307  1.00 21.53 ? 314  PRO A CA    1 
ATOM   2457  C  C     . PRO A 1 314 ? -5.089  19.784  17.860  1.00 21.52 ? 314  PRO A C     1 
ATOM   2458  O  O     . PRO A 1 314 ? -4.740  19.303  16.778  1.00 21.59 ? 314  PRO A O     1 
ATOM   2459  C  CB    . PRO A 1 314 ? -4.962  22.252  17.370  1.00 21.43 ? 314  PRO A CB    1 
ATOM   2460  C  CG    . PRO A 1 314 ? -3.788  23.073  17.120  1.00 21.64 ? 314  PRO A CG    1 
ATOM   2461  C  CD    . PRO A 1 314 ? -2.622  22.095  17.135  1.00 21.97 ? 314  PRO A CD    1 
ATOM   2462  N  N     . VAL A 1 315 ? -5.954  19.198  18.677  1.00 21.63 ? 315  VAL A N     1 
ATOM   2463  C  CA    . VAL A 1 315 ? -6.561  17.916  18.338  1.00 21.87 ? 315  VAL A CA    1 
ATOM   2464  C  C     . VAL A 1 315 ? -7.742  18.152  17.396  1.00 21.32 ? 315  VAL A C     1 
ATOM   2465  O  O     . VAL A 1 315 ? -8.327  19.247  17.371  1.00 22.17 ? 315  VAL A O     1 
ATOM   2466  C  CB    . VAL A 1 315 ? -6.992  17.080  19.587  1.00 22.52 ? 315  VAL A CB    1 
ATOM   2467  C  CG1   . VAL A 1 315 ? -6.960  15.474  19.274  1.00 24.54 ? 315  VAL A CG1   1 
ATOM   2468  C  CG2   . VAL A 1 315 ? -6.105  17.365  20.782  1.00 22.83 ? 315  VAL A CG2   1 
ATOM   2469  N  N     . ARG A 1 316 ? -8.065  17.146  16.588  1.00 20.20 ? 316  ARG A N     1 
ATOM   2470  C  CA    . ARG A 1 316 ? -9.181  17.244  15.661  1.00 19.62 ? 316  ARG A CA    1 
ATOM   2471  C  C     . ARG A 1 316 ? -10.409 16.515  16.165  1.00 20.44 ? 316  ARG A C     1 
ATOM   2472  O  O     . ARG A 1 316 ? -11.487 16.627  15.581  1.00 20.71 ? 316  ARG A O     1 
ATOM   2473  C  CB    . ARG A 1 316 ? -8.784  16.690  14.312  1.00 18.76 ? 316  ARG A CB    1 
ATOM   2474  C  CG    . ARG A 1 316 ? -7.644  17.437  13.716  1.00 16.78 ? 316  ARG A CG    1 
ATOM   2475  C  CD    . ARG A 1 316 ? -7.423  17.171  12.275  1.00 15.01 ? 316  ARG A CD    1 
ATOM   2476  N  NE    . ARG A 1 316 ? -8.648  17.371  11.544  1.00 13.70 ? 316  ARG A NE    1 
ATOM   2477  C  CZ    . ARG A 1 316 ? -8.807  17.064  10.281  1.00 14.68 ? 316  ARG A CZ    1 
ATOM   2478  N  NH1   . ARG A 1 316 ? -7.809  16.552  9.580   1.00 14.42 ? 316  ARG A NH1   1 
ATOM   2479  N  NH2   . ARG A 1 316 ? -9.983  17.285  9.705   1.00 17.66 ? 316  ARG A NH2   1 
ATOM   2480  N  N     . ASP A 1 317 ? -10.250 15.799  17.272  1.00 21.22 ? 317  ASP A N     1 
ATOM   2481  C  CA    . ASP A 1 317 ? -11.266 14.872  17.764  1.00 21.35 ? 317  ASP A CA    1 
ATOM   2482  C  C     . ASP A 1 317 ? -12.403 15.678  18.419  1.00 21.28 ? 317  ASP A C     1 
ATOM   2483  O  O     . ASP A 1 317 ? -12.220 16.265  19.484  1.00 20.72 ? 317  ASP A O     1 
ATOM   2484  C  CB    . ASP A 1 317 ? -10.613 13.892  18.751  1.00 21.18 ? 317  ASP A CB    1 
ATOM   2485  C  CG    . ASP A 1 317 ? -11.572 12.873  19.284  1.00 20.85 ? 317  ASP A CG    1 
ATOM   2486  O  OD1   . ASP A 1 317 ? -12.776 13.015  19.028  1.00 20.05 ? 317  ASP A OD1   1 
ATOM   2487  O  OD2   . ASP A 1 317 ? -11.214 11.897  19.979  1.00 21.19 ? 317  ASP A OD2   1 
ATOM   2488  N  N     . THR A 1 318 ? -13.573 15.674  17.777  1.00 21.32 ? 318  THR A N     1 
ATOM   2489  C  CA    . THR A 1 318 ? -14.712 16.446  18.255  1.00 21.54 ? 318  THR A CA    1 
ATOM   2490  C  C     . THR A 1 318 ? -15.086 16.100  19.683  1.00 22.20 ? 318  THR A C     1 
ATOM   2491  O  O     . THR A 1 318 ? -15.269 16.996  20.500  1.00 22.98 ? 318  THR A O     1 
ATOM   2492  C  CB    . THR A 1 318 ? -15.937 16.314  17.335  1.00 21.47 ? 318  THR A CB    1 
ATOM   2493  O  OG1   . THR A 1 318 ? -15.542 15.965  16.004  1.00 20.43 ? 318  THR A OG1   1 
ATOM   2494  C  CG2   . THR A 1 318 ? -16.579 17.677  17.137  1.00 21.84 ? 318  THR A CG2   1 
ATOM   2495  N  N     . ARG A 1 319 ? -15.189 14.810  19.985  1.00 22.79 ? 319  ARG A N     1 
ATOM   2496  C  CA    . ARG A 1 319 ? -15.423 14.333  21.357  1.00 22.98 ? 319  ARG A CA    1 
ATOM   2497  C  C     . ARG A 1 319 ? -14.507 15.017  22.395  1.00 22.85 ? 319  ARG A C     1 
ATOM   2498  O  O     . ARG A 1 319 ? -14.981 15.754  23.279  1.00 23.27 ? 319  ARG A O     1 
ATOM   2499  C  CB    . ARG A 1 319 ? -15.223 12.819  21.407  1.00 23.45 ? 319  ARG A CB    1 
ATOM   2500  C  CG    . ARG A 1 319 ? -15.996 12.114  22.507  1.00 24.55 ? 319  ARG A CG    1 
ATOM   2501  C  CD    . ARG A 1 319 ? -17.254 11.419  21.993  1.00 26.07 ? 319  ARG A CD    1 
ATOM   2502  N  NE    . ARG A 1 319 ? -17.693 10.341  22.869  1.00 26.79 ? 319  ARG A NE    1 
ATOM   2503  C  CZ    . ARG A 1 319 ? -18.849 9.699   22.753  1.00 26.53 ? 319  ARG A CZ    1 
ATOM   2504  N  NH1   . ARG A 1 319 ? -19.724 10.011  21.793  1.00 24.95 ? 319  ARG A NH1   1 
ATOM   2505  N  NH2   . ARG A 1 319 ? -19.131 8.731   23.620  1.00 27.95 ? 319  ARG A NH2   1 
ATOM   2506  N  N     . VAL A 1 320 ? -13.200 14.797  22.265  1.00 22.10 ? 320  VAL A N     1 
ATOM   2507  C  CA    . VAL A 1 320 ? -12.208 15.383  23.176  1.00 21.51 ? 320  VAL A CA    1 
ATOM   2508  C  C     . VAL A 1 320 ? -12.420 16.909  23.333  1.00 21.15 ? 320  VAL A C     1 
ATOM   2509  O  O     . VAL A 1 320 ? -12.275 17.451  24.427  1.00 21.26 ? 320  VAL A O     1 
ATOM   2510  C  CB    . VAL A 1 320 ? -10.742 15.091  22.678  1.00 21.14 ? 320  VAL A CB    1 
ATOM   2511  C  CG1   . VAL A 1 320 ? -9.728  15.942  23.404  1.00 20.06 ? 320  VAL A CG1   1 
ATOM   2512  C  CG2   . VAL A 1 320 ? -10.393 13.613  22.844  1.00 21.06 ? 320  VAL A CG2   1 
ATOM   2513  N  N     . LEU A 1 321 ? -12.752 17.585  22.239  1.00 20.36 ? 321  LEU A N     1 
ATOM   2514  C  CA    . LEU A 1 321 ? -12.865 19.037  22.240  1.00 20.30 ? 321  LEU A CA    1 
ATOM   2515  C  C     . LEU A 1 321 ? -14.080 19.517  23.022  1.00 20.29 ? 321  LEU A C     1 
ATOM   2516  O  O     . LEU A 1 321 ? -13.985 20.412  23.855  1.00 19.78 ? 321  LEU A O     1 
ATOM   2517  C  CB    . LEU A 1 321 ? -12.984 19.563  20.809  1.00 20.47 ? 321  LEU A CB    1 
ATOM   2518  C  CG    . LEU A 1 321 ? -11.739 19.461  19.936  1.00 19.24 ? 321  LEU A CG    1 
ATOM   2519  C  CD1   . LEU A 1 321 ? -12.178 19.589  18.485  1.00 18.09 ? 321  LEU A CD1   1 
ATOM   2520  C  CD2   . LEU A 1 321 ? -10.687 20.491  20.332  1.00 17.63 ? 321  LEU A CD2   1 
ATOM   2521  N  N     . LEU A 1 322 ? -15.227 18.918  22.717  1.00 20.32 ? 322  LEU A N     1 
ATOM   2522  C  CA    . LEU A 1 322 ? -16.456 19.164  23.459  1.00 20.23 ? 322  LEU A CA    1 
ATOM   2523  C  C     . LEU A 1 322 ? -16.226 18.915  24.941  1.00 20.47 ? 322  LEU A C     1 
ATOM   2524  O  O     . LEU A 1 322 ? -16.685 19.683  25.784  1.00 20.62 ? 322  LEU A O     1 
ATOM   2525  C  CB    . LEU A 1 322 ? -17.580 18.245  22.945  1.00 19.84 ? 322  LEU A CB    1 
ATOM   2526  C  CG    . LEU A 1 322 ? -18.047 18.502  21.509  1.00 18.82 ? 322  LEU A CG    1 
ATOM   2527  C  CD1   . LEU A 1 322 ? -19.204 17.602  21.179  1.00 18.52 ? 322  LEU A CD1   1 
ATOM   2528  C  CD2   . LEU A 1 322 ? -18.433 19.963  21.299  1.00 18.59 ? 322  LEU A CD2   1 
ATOM   2529  N  N     . GLU A 1 323 ? -15.521 17.828  25.246  1.00 20.62 ? 323  GLU A N     1 
ATOM   2530  C  CA    . GLU A 1 323 ? -15.285 17.429  26.623  1.00 20.73 ? 323  GLU A CA    1 
ATOM   2531  C  C     . GLU A 1 323 ? -14.562 18.541  27.380  1.00 20.67 ? 323  GLU A C     1 
ATOM   2532  O  O     . GLU A 1 323 ? -14.916 18.869  28.509  1.00 20.37 ? 323  GLU A O     1 
ATOM   2533  C  CB    . GLU A 1 323 ? -14.461 16.143  26.663  1.00 20.64 ? 323  GLU A CB    1 
ATOM   2534  C  CG    . GLU A 1 323 ? -14.966 15.120  27.654  1.00 21.56 ? 323  GLU A CG    1 
ATOM   2535  C  CD    . GLU A 1 323 ? -15.107 13.719  27.070  1.00 21.52 ? 323  GLU A CD    1 
ATOM   2536  O  OE1   . GLU A 1 323 ? -14.074 13.152  26.663  1.00 21.20 ? 323  GLU A OE1   1 
ATOM   2537  O  OE2   . GLU A 1 323 ? -16.241 13.185  27.051  1.00 19.89 ? 323  GLU A OE2   1 
ATOM   2538  N  N     . ARG A 1 324 ? -13.545 19.102  26.737  1.00 20.76 ? 324  ARG A N     1 
ATOM   2539  C  CA    . ARG A 1 324 ? -12.684 20.105  27.342  1.00 21.02 ? 324  ARG A CA    1 
ATOM   2540  C  C     . ARG A 1 324 ? -13.417 21.431  27.535  1.00 21.10 ? 324  ARG A C     1 
ATOM   2541  O  O     . ARG A 1 324 ? -13.256 22.087  28.572  1.00 21.06 ? 324  ARG A O     1 
ATOM   2542  C  CB    . ARG A 1 324 ? -11.477 20.352  26.451  1.00 21.32 ? 324  ARG A CB    1 
ATOM   2543  C  CG    . ARG A 1 324 ? -10.389 19.292  26.512  1.00 21.51 ? 324  ARG A CG    1 
ATOM   2544  C  CD    . ARG A 1 324 ? -9.220  19.642  25.614  1.00 22.40 ? 324  ARG A CD    1 
ATOM   2545  N  NE    . ARG A 1 324 ? -8.353  18.507  25.315  1.00 23.68 ? 324  ARG A NE    1 
ATOM   2546  C  CZ    . ARG A 1 324 ? -7.278  18.564  24.532  1.00 20.98 ? 324  ARG A CZ    1 
ATOM   2547  N  NH1   . ARG A 1 324 ? -6.924  19.702  23.930  1.00 20.41 ? 324  ARG A NH1   1 
ATOM   2548  N  NH2   . ARG A 1 324 ? -6.564  17.469  24.343  1.00 20.43 ? 324  ARG A NH2   1 
ATOM   2549  N  N     . GLN A 1 325 ? -14.195 21.808  26.513  1.00 20.87 ? 325  GLN A N     1 
ATOM   2550  C  CA    . GLN A 1 325 ? -15.073 22.966  26.533  1.00 20.72 ? 325  GLN A CA    1 
ATOM   2551  C  C     . GLN A 1 325 ? -16.079 22.892  27.658  1.00 20.95 ? 325  GLN A C     1 
ATOM   2552  O  O     . GLN A 1 325 ? -16.473 23.929  28.217  1.00 21.17 ? 325  GLN A O     1 
ATOM   2553  C  CB    . GLN A 1 325 ? -15.882 23.056  25.242  1.00 20.74 ? 325  GLN A CB    1 
ATOM   2554  C  CG    . GLN A 1 325 ? -15.134 23.468  23.998  1.00 20.05 ? 325  GLN A CG    1 
ATOM   2555  C  CD    . GLN A 1 325 ? -16.057 23.513  22.797  1.00 18.95 ? 325  GLN A CD    1 
ATOM   2556  O  OE1   . GLN A 1 325 ? -17.231 23.144  22.891  1.00 17.06 ? 325  GLN A OE1   1 
ATOM   2557  N  NE2   . GLN A 1 325 ? -15.538 23.976  21.671  1.00 19.55 ? 325  GLN A NE2   1 
ATOM   2558  N  N     . GLN A 1 326 ? -16.532 21.668  27.937  1.00 21.13 ? 326  GLN A N     1 
ATOM   2559  C  CA    . GLN A 1 326 ? -17.575 21.406  28.931  1.00 20.92 ? 326  GLN A CA    1 
ATOM   2560  C  C     . GLN A 1 326 ? -16.958 21.669  30.291  1.00 20.23 ? 326  GLN A C     1 
ATOM   2561  O  O     . GLN A 1 326 ? -17.565 22.258  31.166  1.00 18.91 ? 326  GLN A O     1 
ATOM   2562  C  CB    . GLN A 1 326 ? -18.064 19.942  28.857  1.00 21.24 ? 326  GLN A CB    1 
ATOM   2563  C  CG    . GLN A 1 326 ? -19.170 19.614  27.822  1.00 23.03 ? 326  GLN A CG    1 
ATOM   2564  C  CD    . GLN A 1 326 ? -19.360 18.056  27.533  1.00 24.08 ? 326  GLN A CD    1 
ATOM   2565  O  OE1   . GLN A 1 326 ? -18.914 17.189  28.322  1.00 22.47 ? 326  GLN A OE1   1 
ATOM   2566  N  NE2   . GLN A 1 326 ? -20.027 17.735  26.406  1.00 21.39 ? 326  GLN A NE2   1 
ATOM   2567  N  N     . THR A 1 327 ? -15.719 21.222  30.425  1.00 20.50 ? 327  THR A N     1 
ATOM   2568  C  CA    . THR A 1 327 ? -15.001 21.200  31.685  1.00 21.02 ? 327  THR A CA    1 
ATOM   2569  C  C     . THR A 1 327 ? -14.710 22.624  32.080  1.00 21.26 ? 327  THR A C     1 
ATOM   2570  O  O     . THR A 1 327 ? -14.769 22.994  33.240  1.00 20.96 ? 327  THR A O     1 
ATOM   2571  C  CB    . THR A 1 327 ? -13.685 20.405  31.505  1.00 21.14 ? 327  THR A CB    1 
ATOM   2572  O  OG1   . THR A 1 327 ? -13.978 19.045  31.147  1.00 21.10 ? 327  THR A OG1   1 
ATOM   2573  C  CG2   . THR A 1 327 ? -12.935 20.273  32.809  1.00 21.98 ? 327  THR A CG2   1 
ATOM   2574  N  N     . ILE A 1 328 ? -14.416 23.420  31.064  1.00 22.07 ? 328  ILE A N     1 
ATOM   2575  C  CA    . ILE A 1 328 ? -14.042 24.806  31.228  1.00 22.18 ? 328  ILE A CA    1 
ATOM   2576  C  C     . ILE A 1 328 ? -15.216 25.602  31.736  1.00 22.48 ? 328  ILE A C     1 
ATOM   2577  O  O     . ILE A 1 328 ? -15.014 26.529  32.516  1.00 23.45 ? 328  ILE A O     1 
ATOM   2578  C  CB    . ILE A 1 328 ? -13.528 25.361  29.887  1.00 22.18 ? 328  ILE A CB    1 
ATOM   2579  C  CG1   . ILE A 1 328 ? -12.053 24.996  29.721  1.00 22.19 ? 328  ILE A CG1   1 
ATOM   2580  C  CG2   . ILE A 1 328 ? -13.705 26.886  29.787  1.00 22.90 ? 328  ILE A CG2   1 
ATOM   2581  C  CD1   . ILE A 1 328 ? -11.592 24.979  28.280  1.00 23.26 ? 328  ILE A CD1   1 
ATOM   2582  N  N     . GLY A 1 329 ? -16.426 25.255  31.293  1.00 22.18 ? 329  GLY A N     1 
ATOM   2583  C  CA    . GLY A 1 329 ? -17.628 25.969  31.684  1.00 22.28 ? 329  GLY A CA    1 
ATOM   2584  C  C     . GLY A 1 329 ? -18.149 25.530  33.039  1.00 22.25 ? 329  GLY A C     1 
ATOM   2585  O  O     . GLY A 1 329 ? -18.760 26.309  33.759  1.00 22.56 ? 329  GLY A O     1 
ATOM   2586  N  N     . ALA A 1 330 ? -17.894 24.275  33.379  1.00 22.31 ? 330  ALA A N     1 
ATOM   2587  C  CA    . ALA A 1 330 ? -18.306 23.683  34.644  1.00 22.16 ? 330  ALA A CA    1 
ATOM   2588  C  C     . ALA A 1 330 ? -17.483 24.238  35.786  1.00 21.98 ? 330  ALA A C     1 
ATOM   2589  O  O     . ALA A 1 330 ? -17.963 24.359  36.911  1.00 22.46 ? 330  ALA A O     1 
ATOM   2590  C  CB    . ALA A 1 330 ? -18.136 22.159  34.579  1.00 22.05 ? 330  ALA A CB    1 
ATOM   2591  N  N     . LEU A 1 331 ? -16.241 24.573  35.483  1.00 21.93 ? 331  LEU A N     1 
ATOM   2592  C  CA    . LEU A 1 331 ? -15.258 24.926  36.488  1.00 22.05 ? 331  LEU A CA    1 
ATOM   2593  C  C     . LEU A 1 331 ? -15.080 26.434  36.624  1.00 22.71 ? 331  LEU A C     1 
ATOM   2594  O  O     . LEU A 1 331 ? -14.305 26.889  37.456  1.00 22.44 ? 331  LEU A O     1 
ATOM   2595  C  CB    . LEU A 1 331 ? -13.909 24.287  36.125  1.00 21.91 ? 331  LEU A CB    1 
ATOM   2596  C  CG    . LEU A 1 331 ? -13.763 22.777  36.335  1.00 20.00 ? 331  LEU A CG    1 
ATOM   2597  C  CD1   . LEU A 1 331 ? -12.566 22.225  35.569  1.00 19.27 ? 331  LEU A CD1   1 
ATOM   2598  C  CD2   . LEU A 1 331 ? -13.621 22.458  37.792  1.00 19.28 ? 331  LEU A CD2   1 
ATOM   2599  N  N     . GLN A 1 332 ? -15.791 27.205  35.804  1.00 23.99 ? 332  GLN A N     1 
ATOM   2600  C  CA    . GLN A 1 332 ? -15.710 28.675  35.828  1.00 24.86 ? 332  GLN A CA    1 
ATOM   2601  C  C     . GLN A 1 332 ? -15.590 29.246  37.245  1.00 24.55 ? 332  GLN A C     1 
ATOM   2602  O  O     . GLN A 1 332 ? -14.740 30.104  37.504  1.00 23.95 ? 332  GLN A O     1 
ATOM   2603  C  CB    . GLN A 1 332 ? -16.939 29.295  35.146  1.00 25.55 ? 332  GLN A CB    1 
ATOM   2604  C  CG    . GLN A 1 332 ? -16.689 30.677  34.511  1.00 27.85 ? 332  GLN A CG    1 
ATOM   2605  C  CD    . GLN A 1 332 ? -16.251 30.569  33.048  1.00 31.05 ? 332  GLN A CD    1 
ATOM   2606  O  OE1   . GLN A 1 332 ? -16.821 31.226  32.163  1.00 32.98 ? 332  GLN A OE1   1 
ATOM   2607  N  NE2   . GLN A 1 332 ? -15.254 29.726  32.792  1.00 31.20 ? 332  GLN A NE2   1 
ATOM   2608  N  N     . ASP A 1 333 ? -16.441 28.747  38.142  1.00 24.44 ? 333  ASP A N     1 
ATOM   2609  C  CA    . ASP A 1 333 ? -16.579 29.287  39.499  1.00 24.54 ? 333  ASP A CA    1 
ATOM   2610  C  C     . ASP A 1 333 ? -15.532 28.782  40.462  1.00 24.00 ? 333  ASP A C     1 
ATOM   2611  O  O     . ASP A 1 333 ? -15.183 29.442  41.437  1.00 23.71 ? 333  ASP A O     1 
ATOM   2612  C  CB    . ASP A 1 333 ? -17.934 28.887  40.076  1.00 24.76 ? 333  ASP A CB    1 
ATOM   2613  C  CG    . ASP A 1 333 ? -19.047 29.773  39.607  1.00 25.79 ? 333  ASP A CG    1 
ATOM   2614  O  OD1   . ASP A 1 333 ? -18.820 30.606  38.694  1.00 26.51 ? 333  ASP A OD1   1 
ATOM   2615  O  OD2   . ASP A 1 333 ? -20.189 29.696  40.112  1.00 27.41 ? 333  ASP A OD2   1 
ATOM   2616  N  N     . PHE A 1 334 ? -15.050 27.588  40.180  1.00 23.76 ? 334  PHE A N     1 
ATOM   2617  C  CA    . PHE A 1 334 ? -14.274 26.822  41.134  1.00 23.28 ? 334  PHE A CA    1 
ATOM   2618  C  C     . PHE A 1 334 ? -12.791 27.142  41.032  1.00 22.27 ? 334  PHE A C     1 
ATOM   2619  O  O     . PHE A 1 334 ? -11.995 26.540  41.742  1.00 22.11 ? 334  PHE A O     1 
ATOM   2620  C  CB    . PHE A 1 334 ? -14.514 25.325  40.890  1.00 23.41 ? 334  PHE A CB    1 
ATOM   2621  C  CG    . PHE A 1 334 ? -15.951 24.912  41.047  1.00 24.62 ? 334  PHE A CG    1 
ATOM   2622  C  CD1   . PHE A 1 334 ? -16.897 25.226  40.066  1.00 25.64 ? 334  PHE A CD1   1 
ATOM   2623  C  CD2   . PHE A 1 334 ? -16.362 24.206  42.179  1.00 26.71 ? 334  PHE A CD2   1 
ATOM   2624  C  CE1   . PHE A 1 334 ? -18.224 24.845  40.199  1.00 26.81 ? 334  PHE A CE1   1 
ATOM   2625  C  CE2   . PHE A 1 334 ? -17.704 23.822  42.335  1.00 27.53 ? 334  PHE A CE2   1 
ATOM   2626  C  CZ    . PHE A 1 334 ? -18.637 24.144  41.342  1.00 27.93 ? 334  PHE A CZ    1 
ATOM   2627  N  N     . THR A 1 335 ? -12.406 28.086  40.172  1.00 21.25 ? 335  THR A N     1 
ATOM   2628  C  CA    . THR A 1 335 ? -10.975 28.283  39.925  1.00 20.31 ? 335  THR A CA    1 
ATOM   2629  C  C     . THR A 1 335 ? -10.259 28.836  41.165  1.00 19.94 ? 335  THR A C     1 
ATOM   2630  O  O     . THR A 1 335 ? -9.270  28.247  41.605  1.00 18.94 ? 335  THR A O     1 
ATOM   2631  C  CB    . THR A 1 335 ? -10.689 29.123  38.653  1.00 20.06 ? 335  THR A CB    1 
ATOM   2632  O  OG1   . THR A 1 335 ? -11.129 30.471  38.813  1.00 19.20 ? 335  THR A OG1   1 
ATOM   2633  C  CG2   . THR A 1 335 ? -11.468 28.593  37.458  1.00 19.11 ? 335  THR A CG2   1 
ATOM   2634  N  N     . ALA A 1 336 ? -10.796 29.901  41.769  1.00 19.28 ? 336  ALA A N     1 
ATOM   2635  C  CA    . ALA A 1 336 ? -10.138 30.512  42.926  1.00 19.06 ? 336  ALA A CA    1 
ATOM   2636  C  C     . ALA A 1 336 ? -9.957  29.560  44.131  1.00 18.99 ? 336  ALA A C     1 
ATOM   2637  O  O     . ALA A 1 336 ? -9.046  29.767  44.941  1.00 18.66 ? 336  ALA A O     1 
ATOM   2638  C  CB    . ALA A 1 336 ? -10.858 31.790  43.347  1.00 19.03 ? 336  ALA A CB    1 
ATOM   2639  N  N     . GLY A 1 337 ? -10.799 28.525  44.243  1.00 18.77 ? 337  GLY A N     1 
ATOM   2640  C  CA    . GLY A 1 337 ? -10.641 27.499  45.270  1.00 18.72 ? 337  GLY A CA    1 
ATOM   2641  C  C     . GLY A 1 337 ? -9.672  26.370  44.916  1.00 18.83 ? 337  GLY A C     1 
ATOM   2642  O  O     . GLY A 1 337 ? -8.941  25.873  45.771  1.00 18.90 ? 337  GLY A O     1 
ATOM   2643  N  N     . LEU A 1 338 ? -9.670  25.969  43.647  1.00 18.88 ? 338  LEU A N     1 
ATOM   2644  C  CA    . LEU A 1 338 ? -8.873  24.839  43.155  1.00 18.53 ? 338  LEU A CA    1 
ATOM   2645  C  C     . LEU A 1 338 ? -7.414  25.209  42.929  1.00 18.49 ? 338  LEU A C     1 
ATOM   2646  O  O     . LEU A 1 338 ? -6.526  24.401  43.163  1.00 18.70 ? 338  LEU A O     1 
ATOM   2647  C  CB    . LEU A 1 338 ? -9.456  24.328  41.834  1.00 18.33 ? 338  LEU A CB    1 
ATOM   2648  C  CG    . LEU A 1 338 ? -10.725 23.469  41.956  1.00 18.61 ? 338  LEU A CG    1 
ATOM   2649  C  CD1   . LEU A 1 338 ? -11.520 23.479  40.667  1.00 18.10 ? 338  LEU A CD1   1 
ATOM   2650  C  CD2   . LEU A 1 338 ? -10.379 22.039  42.340  1.00 18.96 ? 338  LEU A CD2   1 
ATOM   2651  N  N     . GLN A 1 339 ? -7.167  26.442  42.484  1.00 18.50 ? 339  GLN A N     1 
ATOM   2652  C  CA    . GLN A 1 339 ? -5.839  26.856  42.022  1.00 17.77 ? 339  GLN A CA    1 
ATOM   2653  C  C     . GLN A 1 339 ? -4.812  26.921  43.150  1.00 17.92 ? 339  GLN A C     1 
ATOM   2654  O  O     . GLN A 1 339 ? -3.747  26.333  43.033  1.00 18.51 ? 339  GLN A O     1 
ATOM   2655  C  CB    . GLN A 1 339 ? -5.909  28.177  41.250  1.00 17.44 ? 339  GLN A CB    1 
ATOM   2656  C  CG    . GLN A 1 339 ? -6.498  28.039  39.838  1.00 16.20 ? 339  GLN A CG    1 
ATOM   2657  C  CD    . GLN A 1 339 ? -6.048  29.135  38.890  1.00 13.30 ? 339  GLN A CD    1 
ATOM   2658  O  OE1   . GLN A 1 339 ? -5.761  28.872  37.724  1.00 11.69 ? 339  GLN A OE1   1 
ATOM   2659  N  NE2   . GLN A 1 339 ? -5.970  30.349  39.390  1.00 10.69 ? 339  GLN A NE2   1 
ATOM   2660  N  N     . PRO A 1 340 ? -5.109  27.596  44.252  1.00 17.98 ? 340  PRO A N     1 
ATOM   2661  C  CA    . PRO A 1 340 ? -4.204  27.548  45.405  1.00 18.13 ? 340  PRO A CA    1 
ATOM   2662  C  C     . PRO A 1 340 ? -3.879  26.113  45.831  1.00 18.54 ? 340  PRO A C     1 
ATOM   2663  O  O     . PRO A 1 340 ? -2.731  25.863  46.196  1.00 18.83 ? 340  PRO A O     1 
ATOM   2664  C  CB    . PRO A 1 340 ? -4.993  28.257  46.496  1.00 17.73 ? 340  PRO A CB    1 
ATOM   2665  C  CG    . PRO A 1 340 ? -5.905  29.146  45.769  1.00 17.55 ? 340  PRO A CG    1 
ATOM   2666  C  CD    . PRO A 1 340 ? -6.295  28.420  44.530  1.00 17.82 ? 340  PRO A CD    1 
ATOM   2667  N  N     . VAL A 1 341 ? -4.849  25.198  45.766  1.00 18.88 ? 341  VAL A N     1 
ATOM   2668  C  CA    . VAL A 1 341 ? -4.627  23.826  46.215  1.00 19.37 ? 341  VAL A CA    1 
ATOM   2669  C  C     . VAL A 1 341 ? -3.800  23.020  45.227  1.00 19.78 ? 341  VAL A C     1 
ATOM   2670  O  O     . VAL A 1 341 ? -2.944  22.225  45.645  1.00 20.05 ? 341  VAL A O     1 
ATOM   2671  C  CB    . VAL A 1 341 ? -5.939  23.078  46.467  1.00 19.63 ? 341  VAL A CB    1 
ATOM   2672  C  CG1   . VAL A 1 341 ? -5.666  21.638  46.892  1.00 19.27 ? 341  VAL A CG1   1 
ATOM   2673  C  CG2   . VAL A 1 341 ? -6.776  23.807  47.537  1.00 19.48 ? 341  VAL A CG2   1 
ATOM   2674  N  N     . LEU A 1 342 ? -4.043  23.225  43.932  1.00 19.85 ? 342  LEU A N     1 
ATOM   2675  C  CA    . LEU A 1 342 ? -3.331  22.480  42.894  1.00 19.99 ? 342  LEU A CA    1 
ATOM   2676  C  C     . LEU A 1 342 ? -1.891  22.900  42.821  1.00 20.51 ? 342  LEU A C     1 
ATOM   2677  O  O     . LEU A 1 342 ? -1.055  22.153  42.311  1.00 19.59 ? 342  LEU A O     1 
ATOM   2678  C  CB    . LEU A 1 342 ? -3.925  22.733  41.521  1.00 20.10 ? 342  LEU A CB    1 
ATOM   2679  C  CG    . LEU A 1 342 ? -5.122  21.911  41.102  1.00 20.59 ? 342  LEU A CG    1 
ATOM   2680  C  CD1   . LEU A 1 342 ? -5.736  22.577  39.908  1.00 20.03 ? 342  LEU A CD1   1 
ATOM   2681  C  CD2   . LEU A 1 342 ? -4.701  20.474  40.785  1.00 21.16 ? 342  LEU A CD2   1 
ATOM   2682  N  N     . ARG A 1 343 ? -1.618  24.125  43.280  1.00 21.22 ? 343  ARG A N     1 
ATOM   2683  C  CA    . ARG A 1 343 ? -0.287  24.686  43.219  1.00 21.82 ? 343  ARG A CA    1 
ATOM   2684  C  C     . ARG A 1 343 ? 0.592   23.906  44.168  1.00 22.41 ? 343  ARG A C     1 
ATOM   2685  O  O     . ARG A 1 343 ? 1.768   23.695  43.911  1.00 23.03 ? 343  ARG A O     1 
ATOM   2686  C  CB    . ARG A 1 343 ? -0.321  26.150  43.609  1.00 22.16 ? 343  ARG A CB    1 
ATOM   2687  C  CG    . ARG A 1 343 ? 1.038   26.789  43.886  1.00 22.83 ? 343  ARG A CG    1 
ATOM   2688  C  CD    . ARG A 1 343 ? 0.920   28.259  44.244  1.00 24.99 ? 343  ARG A CD    1 
ATOM   2689  N  NE    . ARG A 1 343 ? 0.968   29.089  43.043  1.00 28.03 ? 343  ARG A NE    1 
ATOM   2690  C  CZ    . ARG A 1 343 ? -0.041  29.806  42.538  1.00 30.45 ? 343  ARG A CZ    1 
ATOM   2691  N  NH1   . ARG A 1 343 ? -1.247  29.836  43.125  1.00 30.88 ? 343  ARG A NH1   1 
ATOM   2692  N  NH2   . ARG A 1 343 ? 0.167   30.511  41.419  1.00 30.82 ? 343  ARG A NH2   1 
ATOM   2693  N  N     . GLN A 1 344 ? 0.010   23.469  45.273  1.00 22.89 ? 344  GLN A N     1 
ATOM   2694  C  CA    . GLN A 1 344 ? 0.737   22.652  46.240  1.00 23.12 ? 344  GLN A CA    1 
ATOM   2695  C  C     . GLN A 1 344 ? 0.975   21.193  45.750  1.00 23.04 ? 344  GLN A C     1 
ATOM   2696  O  O     . GLN A 1 344 ? 1.575   20.376  46.449  1.00 23.51 ? 344  GLN A O     1 
ATOM   2697  C  CB    . GLN A 1 344 ? -0.010  22.668  47.575  1.00 23.10 ? 344  GLN A CB    1 
ATOM   2698  C  CG    . GLN A 1 344 ? -0.304  24.088  48.138  1.00 24.07 ? 344  GLN A CG    1 
ATOM   2699  C  CD    . GLN A 1 344 ? 0.945   24.842  48.576  1.00 24.28 ? 344  GLN A CD    1 
ATOM   2700  O  OE1   . GLN A 1 344 ? 1.860   24.259  49.182  1.00 24.43 ? 344  GLN A OE1   1 
ATOM   2701  N  NE2   . GLN A 1 344 ? 0.990   26.135  48.269  1.00 22.88 ? 344  GLN A NE2   1 
ATOM   2702  N  N     . VAL A 1 345 ? 0.514   20.839  44.561  1.00 22.57 ? 345  VAL A N     1 
ATOM   2703  C  CA    . VAL A 1 345 ? 0.888   19.537  44.026  1.00 22.51 ? 345  VAL A CA    1 
ATOM   2704  C  C     . VAL A 1 345 ? 2.296   19.643  43.418  1.00 22.00 ? 345  VAL A C     1 
ATOM   2705  O  O     . VAL A 1 345 ? 3.081   18.698  43.467  1.00 22.31 ? 345  VAL A O     1 
ATOM   2706  C  CB    . VAL A 1 345 ? -0.160  19.005  43.027  1.00 22.35 ? 345  VAL A CB    1 
ATOM   2707  C  CG1   . VAL A 1 345 ? 0.360   17.815  42.276  1.00 22.31 ? 345  VAL A CG1   1 
ATOM   2708  C  CG2   . VAL A 1 345 ? -1.415  18.635  43.767  1.00 22.64 ? 345  VAL A CG2   1 
ATOM   2709  N  N     . GLY A 1 346 ? 2.619   20.806  42.874  1.00 21.40 ? 346  GLY A N     1 
ATOM   2710  C  CA    . GLY A 1 346 ? 3.927   21.024  42.293  1.00 20.85 ? 346  GLY A CA    1 
ATOM   2711  C  C     . GLY A 1 346 ? 4.127   20.176  41.047  1.00 20.25 ? 346  GLY A C     1 
ATOM   2712  O  O     . GLY A 1 346 ? 3.172   19.786  40.373  1.00 20.06 ? 346  GLY A O     1 
ATOM   2713  N  N     . ASP A 1 347 ? 5.389   19.884  40.766  1.00 19.62 ? 347  ASP A N     1 
ATOM   2714  C  CA    . ASP A 1 347 ? 5.784   19.108  39.615  1.00 19.01 ? 347  ASP A CA    1 
ATOM   2715  C  C     . ASP A 1 347 ? 5.868   17.639  39.980  1.00 18.51 ? 347  ASP A C     1 
ATOM   2716  O  O     . ASP A 1 347 ? 6.933   17.038  39.995  1.00 18.02 ? 347  ASP A O     1 
ATOM   2717  C  CB    . ASP A 1 347 ? 7.123   19.640  39.107  1.00 19.21 ? 347  ASP A CB    1 
ATOM   2718  C  CG    . ASP A 1 347 ? 7.403   19.243  37.690  1.00 18.92 ? 347  ASP A CG    1 
ATOM   2719  O  OD1   . ASP A 1 347 ? 6.711   18.347  37.189  1.00 17.21 ? 347  ASP A OD1   1 
ATOM   2720  O  OD2   . ASP A 1 347 ? 8.300   19.768  37.006  1.00 18.76 ? 347  ASP A OD2   1 
ATOM   2721  N  N     . LEU A 1 348 ? 4.717   17.057  40.254  1.00 18.68 ? 348  LEU A N     1 
ATOM   2722  C  CA    . LEU A 1 348 ? 4.631   15.651  40.615  1.00 19.24 ? 348  LEU A CA    1 
ATOM   2723  C  C     . LEU A 1 348 ? 5.166   14.738  39.539  1.00 19.25 ? 348  LEU A C     1 
ATOM   2724  O  O     . LEU A 1 348 ? 5.678   13.661  39.839  1.00 19.14 ? 348  LEU A O     1 
ATOM   2725  C  CB    . LEU A 1 348 ? 3.175   15.268  40.874  1.00 19.79 ? 348  LEU A CB    1 
ATOM   2726  C  CG    . LEU A 1 348 ? 2.856   13.841  41.355  1.00 20.94 ? 348  LEU A CG    1 
ATOM   2727  C  CD1   . LEU A 1 348 ? 3.736   13.426  42.532  1.00 21.50 ? 348  LEU A CD1   1 
ATOM   2728  C  CD2   . LEU A 1 348 ? 1.382   13.761  41.755  1.00 21.89 ? 348  LEU A CD2   1 
ATOM   2729  N  N     . GLU A 1 349 ? 5.021   15.159  38.284  1.00 19.64 ? 349  GLU A N     1 
ATOM   2730  C  CA    . GLU A 1 349 ? 5.321   14.301  37.145  1.00 19.62 ? 349  GLU A CA    1 
ATOM   2731  C  C     . GLU A 1 349 ? 6.811   14.048  37.054  1.00 19.91 ? 349  GLU A C     1 
ATOM   2732  O  O     . GLU A 1 349 ? 7.249   12.921  36.766  1.00 20.42 ? 349  GLU A O     1 
ATOM   2733  C  CB    . GLU A 1 349 ? 4.758   14.894  35.842  1.00 19.55 ? 349  GLU A CB    1 
ATOM   2734  C  CG    . GLU A 1 349 ? 5.777   15.181  34.743  1.00 20.07 ? 349  GLU A CG    1 
ATOM   2735  C  CD    . GLU A 1 349 ? 5.147   15.543  33.408  1.00 19.09 ? 349  GLU A CD    1 
ATOM   2736  O  OE1   . GLU A 1 349 ? 3.957   15.226  33.216  1.00 20.18 ? 349  GLU A OE1   1 
ATOM   2737  O  OE2   . GLU A 1 349 ? 5.848   16.128  32.551  1.00 15.67 ? 349  GLU A OE2   1 
ATOM   2738  N  N     . ARG A 1 350 ? 7.601   15.086  37.288  1.00 19.86 ? 350  ARG A N     1 
ATOM   2739  C  CA    . ARG A 1 350 ? 9.044   14.909  37.241  1.00 20.14 ? 350  ARG A CA    1 
ATOM   2740  C  C     . ARG A 1 350 ? 9.588   14.123  38.437  1.00 20.63 ? 350  ARG A C     1 
ATOM   2741  O  O     . ARG A 1 350 ? 10.572  13.402  38.312  1.00 20.87 ? 350  ARG A O     1 
ATOM   2742  C  CB    . ARG A 1 350 ? 9.742   16.242  37.078  1.00 19.77 ? 350  ARG A CB    1 
ATOM   2743  C  CG    . ARG A 1 350 ? 9.907   16.555  35.612  1.00 19.76 ? 350  ARG A CG    1 
ATOM   2744  C  CD    . ARG A 1 350 ? 10.430  17.922  35.339  1.00 19.14 ? 350  ARG A CD    1 
ATOM   2745  N  NE    . ARG A 1 350 ? 10.399  18.222  33.917  1.00 18.48 ? 350  ARG A NE    1 
ATOM   2746  C  CZ    . ARG A 1 350 ? 10.756  19.384  33.393  1.00 16.45 ? 350  ARG A CZ    1 
ATOM   2747  N  NH1   . ARG A 1 350 ? 11.186  20.360  34.186  1.00 16.93 ? 350  ARG A NH1   1 
ATOM   2748  N  NH2   . ARG A 1 350 ? 10.679  19.569  32.078  1.00 14.44 ? 350  ARG A NH2   1 
ATOM   2749  N  N     . ILE A 1 351 ? 8.922   14.248  39.580  1.00 21.04 ? 351  ILE A N     1 
ATOM   2750  C  CA    . ILE A 1 351 ? 9.302   13.548  40.801  1.00 21.04 ? 351  ILE A CA    1 
ATOM   2751  C  C     . ILE A 1 351 ? 9.131   12.038  40.632  1.00 21.35 ? 351  ILE A C     1 
ATOM   2752  O  O     . ILE A 1 351 ? 9.982   11.271  41.050  1.00 21.72 ? 351  ILE A O     1 
ATOM   2753  C  CB    . ILE A 1 351 ? 8.457   14.101  41.968  1.00 21.04 ? 351  ILE A CB    1 
ATOM   2754  C  CG1   . ILE A 1 351 ? 8.915   15.524  42.285  1.00 21.23 ? 351  ILE A CG1   1 
ATOM   2755  C  CG2   . ILE A 1 351 ? 8.552   13.221  43.198  1.00 21.95 ? 351  ILE A CG2   1 
ATOM   2756  C  CD1   . ILE A 1 351 ? 8.133   16.227  43.336  1.00 21.01 ? 351  ILE A CD1   1 
ATOM   2757  N  N     . LEU A 1 352 ? 8.050   11.620  39.983  1.00 21.72 ? 352  LEU A N     1 
ATOM   2758  C  CA    . LEU A 1 352 ? 7.778   10.202  39.755  1.00 21.75 ? 352  LEU A CA    1 
ATOM   2759  C  C     . LEU A 1 352 ? 8.734   9.648   38.749  1.00 22.10 ? 352  LEU A C     1 
ATOM   2760  O  O     . LEU A 1 352 ? 9.004   8.445   38.723  1.00 22.73 ? 352  LEU A O     1 
ATOM   2761  C  CB    . LEU A 1 352 ? 6.374   10.010  39.214  1.00 21.63 ? 352  LEU A CB    1 
ATOM   2762  C  CG    . LEU A 1 352 ? 5.245   10.453  40.135  1.00 21.33 ? 352  LEU A CG    1 
ATOM   2763  C  CD1   . LEU A 1 352 ? 3.980   10.558  39.319  1.00 20.98 ? 352  LEU A CD1   1 
ATOM   2764  C  CD2   . LEU A 1 352 ? 5.087   9.471   41.296  1.00 20.61 ? 352  LEU A CD2   1 
ATOM   2765  N  N     . ALA A 1 353 ? 9.206   10.523  37.878  1.00 22.47 ? 353  ALA A N     1 
ATOM   2766  C  CA    . ALA A 1 353 ? 10.245  10.152  36.936  1.00 22.95 ? 353  ALA A CA    1 
ATOM   2767  C  C     . ALA A 1 353 ? 11.525  9.844   37.673  1.00 22.47 ? 353  ALA A C     1 
ATOM   2768  O  O     . ALA A 1 353 ? 12.155  8.833   37.409  1.00 22.74 ? 353  ALA A O     1 
ATOM   2769  C  CB    . ALA A 1 353 ? 10.484  11.260  35.950  1.00 23.48 ? 353  ALA A CB    1 
ATOM   2770  N  N     . ARG A 1 354 ? 11.897  10.725  38.595  1.00 21.81 ? 354  ARG A N     1 
ATOM   2771  C  CA    . ARG A 1 354 ? 13.074  10.526  39.424  1.00 21.36 ? 354  ARG A CA    1 
ATOM   2772  C  C     . ARG A 1 354 ? 12.869  9.354   40.366  1.00 20.69 ? 354  ARG A C     1 
ATOM   2773  O  O     . ARG A 1 354 ? 13.822  8.727   40.774  1.00 20.72 ? 354  ARG A O     1 
ATOM   2774  C  CB    . ARG A 1 354 ? 13.368  11.768  40.242  1.00 21.71 ? 354  ARG A CB    1 
ATOM   2775  C  CG    . ARG A 1 354 ? 14.345  12.735  39.602  1.00 23.65 ? 354  ARG A CG    1 
ATOM   2776  C  CD    . ARG A 1 354 ? 14.616  13.972  40.467  1.00 26.91 ? 354  ARG A CD    1 
ATOM   2777  N  NE    . ARG A 1 354 ? 14.203  15.216  39.793  1.00 30.92 ? 354  ARG A NE    1 
ATOM   2778  C  CZ    . ARG A 1 354 ? 13.220  16.042  40.184  1.00 32.81 ? 354  ARG A CZ    1 
ATOM   2779  N  NH1   . ARG A 1 354 ? 12.505  15.789  41.264  1.00 32.56 ? 354  ARG A NH1   1 
ATOM   2780  N  NH2   . ARG A 1 354 ? 12.947  17.138  39.470  1.00 34.62 ? 354  ARG A NH2   1 
ATOM   2781  N  N     . LEU A 1 355 ? 11.621  9.069   40.716  1.00 19.75 ? 355  LEU A N     1 
ATOM   2782  C  CA    . LEU A 1 355 ? 11.283  7.862   41.440  1.00 18.80 ? 355  LEU A CA    1 
ATOM   2783  C  C     . LEU A 1 355 ? 11.539  6.618   40.597  1.00 18.65 ? 355  LEU A C     1 
ATOM   2784  O  O     . LEU A 1 355 ? 12.055  5.647   41.113  1.00 19.03 ? 355  LEU A O     1 
ATOM   2785  C  CB    . LEU A 1 355 ? 9.827   7.904   41.869  1.00 18.67 ? 355  LEU A CB    1 
ATOM   2786  C  CG    . LEU A 1 355 ? 9.284   6.708   42.629  1.00 18.26 ? 355  LEU A CG    1 
ATOM   2787  C  CD1   . LEU A 1 355 ? 9.859   6.658   44.015  1.00 19.11 ? 355  LEU A CD1   1 
ATOM   2788  C  CD2   . LEU A 1 355 ? 7.771   6.731   42.689  1.00 17.79 ? 355  LEU A CD2   1 
ATOM   2789  N  N     . ALA A 1 356 ? 11.194  6.631   39.310  1.00 18.31 ? 356  ALA A N     1 
ATOM   2790  C  CA    . ALA A 1 356 ? 11.382  5.441   38.450  1.00 18.01 ? 356  ALA A CA    1 
ATOM   2791  C  C     . ALA A 1 356 ? 12.829  5.211   38.049  1.00 17.46 ? 356  ALA A C     1 
ATOM   2792  O  O     . ALA A 1 356 ? 13.253  4.074   37.773  1.00 17.11 ? 356  ALA A O     1 
ATOM   2793  C  CB    . ALA A 1 356 ? 10.539  5.548   37.198  1.00 18.53 ? 356  ALA A CB    1 
ATOM   2794  N  N     . LEU A 1 357 ? 13.588  6.300   37.997  1.00 16.88 ? 357  LEU A N     1 
ATOM   2795  C  CA    . LEU A 1 357 ? 15.020  6.203   37.768  1.00 16.26 ? 357  LEU A CA    1 
ATOM   2796  C  C     . LEU A 1 357 ? 15.742  5.951   39.083  1.00 16.57 ? 357  LEU A C     1 
ATOM   2797  O  O     . LEU A 1 357 ? 16.935  5.776   39.093  1.00 16.87 ? 357  LEU A O     1 
ATOM   2798  C  CB    . LEU A 1 357 ? 15.543  7.466   37.108  1.00 15.78 ? 357  LEU A CB    1 
ATOM   2799  C  CG    . LEU A 1 357 ? 15.018  7.757   35.704  1.00 14.04 ? 357  LEU A CG    1 
ATOM   2800  C  CD1   . LEU A 1 357 ? 15.307  9.219   35.324  1.00 12.51 ? 357  LEU A CD1   1 
ATOM   2801  C  CD2   . LEU A 1 357 ? 15.637  6.803   34.707  1.00 12.89 ? 357  LEU A CD2   1 
ATOM   2802  N  N     . ARG A 1 358 ? 15.013  5.952   40.197  1.00 17.08 ? 358  ARG A N     1 
ATOM   2803  C  CA    . ARG A 1 358 ? 15.571  5.631   41.500  1.00 17.40 ? 358  ARG A CA    1 
ATOM   2804  C  C     . ARG A 1 358 ? 16.572  6.681   41.971  1.00 17.84 ? 358  ARG A C     1 
ATOM   2805  O  O     . ARG A 1 358 ? 17.404  6.417   42.831  1.00 18.01 ? 358  ARG A O     1 
ATOM   2806  C  CB    . ARG A 1 358 ? 16.217  4.242   41.468  1.00 17.41 ? 358  ARG A CB    1 
ATOM   2807  C  CG    . ARG A 1 358 ? 15.384  3.190   42.132  1.00 18.13 ? 358  ARG A CG    1 
ATOM   2808  C  CD    . ARG A 1 358 ? 15.690  1.799   41.679  1.00 21.12 ? 358  ARG A CD    1 
ATOM   2809  N  NE    . ARG A 1 358 ? 14.567  0.918   41.949  1.00 24.46 ? 358  ARG A NE    1 
ATOM   2810  C  CZ    . ARG A 1 358 ? 14.340  0.281   43.094  1.00 28.11 ? 358  ARG A CZ    1 
ATOM   2811  N  NH1   . ARG A 1 358 ? 15.174  0.388   44.133  1.00 29.73 ? 358  ARG A NH1   1 
ATOM   2812  N  NH2   . ARG A 1 358 ? 13.254  -0.481  43.200  1.00 29.60 ? 358  ARG A NH2   1 
ATOM   2813  N  N     . THR A 1 359 ? 16.475  7.882   41.416  1.00 18.32 ? 359  THR A N     1 
ATOM   2814  C  CA    . THR A 1 359 ? 17.384  8.959   41.767  1.00 18.52 ? 359  THR A CA    1 
ATOM   2815  C  C     . THR A 1 359 ? 16.742  9.977   42.696  1.00 19.13 ? 359  THR A C     1 
ATOM   2816  O  O     . THR A 1 359 ? 17.434  10.887  43.154  1.00 19.75 ? 359  THR A O     1 
ATOM   2817  C  CB    . THR A 1 359 ? 17.894  9.656   40.509  1.00 18.28 ? 359  THR A CB    1 
ATOM   2818  O  OG1   . THR A 1 359 ? 16.796  9.984   39.667  1.00 17.47 ? 359  THR A OG1   1 
ATOM   2819  C  CG2   . THR A 1 359 ? 18.727  8.707   39.658  1.00 18.05 ? 359  THR A CG2   1 
ATOM   2820  N  N     . ALA A 1 360 ? 15.457  9.798   43.023  1.00 19.37 ? 360  ALA A N     1 
ATOM   2821  C  CA    . ALA A 1 360 ? 14.717  10.784  43.814  1.00 19.32 ? 360  ALA A CA    1 
ATOM   2822  C  C     . ALA A 1 360 ? 15.362  11.002  45.170  1.00 19.86 ? 360  ALA A C     1 
ATOM   2823  O  O     . ALA A 1 360 ? 15.743  10.053  45.867  1.00 19.76 ? 360  ALA A O     1 
ATOM   2824  C  CB    . ALA A 1 360 ? 13.303  10.372  43.991  1.00 19.25 ? 360  ALA A CB    1 
ATOM   2825  N  N     . ARG A 1 361 ? 15.487  12.271  45.528  1.00 20.33 ? 361  ARG A N     1 
ATOM   2826  C  CA    . ARG A 1 361 ? 16.104  12.666  46.779  1.00 20.77 ? 361  ARG A CA    1 
ATOM   2827  C  C     . ARG A 1 361 ? 15.026  12.770  47.872  1.00 21.20 ? 361  ARG A C     1 
ATOM   2828  O  O     . ARG A 1 361 ? 13.829  12.579  47.595  1.00 21.48 ? 361  ARG A O     1 
ATOM   2829  C  CB    . ARG A 1 361 ? 16.826  13.990  46.587  1.00 20.85 ? 361  ARG A CB    1 
ATOM   2830  C  CG    . ARG A 1 361 ? 17.672  14.093  45.327  1.00 20.71 ? 361  ARG A CG    1 
ATOM   2831  C  CD    . ARG A 1 361 ? 18.516  15.363  45.325  1.00 20.17 ? 361  ARG A CD    1 
ATOM   2832  N  NE    . ARG A 1 361 ? 19.207  15.621  44.059  1.00 18.32 ? 361  ARG A NE    1 
ATOM   2833  C  CZ    . ARG A 1 361 ? 20.525  15.694  43.909  1.00 17.47 ? 361  ARG A CZ    1 
ATOM   2834  N  NH1   . ARG A 1 361 ? 21.329  15.496  44.939  1.00 19.28 ? 361  ARG A NH1   1 
ATOM   2835  N  NH2   . ARG A 1 361 ? 21.055  15.948  42.721  1.00 16.93 ? 361  ARG A NH2   1 
ATOM   2836  N  N     . PRO A 1 362 ? 15.441  12.998  49.116  1.00 21.32 ? 362  PRO A N     1 
ATOM   2837  C  CA    . PRO A 1 362 ? 14.499  13.150  50.220  1.00 21.69 ? 362  PRO A CA    1 
ATOM   2838  C  C     . PRO A 1 362 ? 13.442  14.222  50.015  1.00 22.21 ? 362  PRO A C     1 
ATOM   2839  O  O     . PRO A 1 362 ? 12.277  13.966  50.319  1.00 22.67 ? 362  PRO A O     1 
ATOM   2840  C  CB    . PRO A 1 362 ? 15.407  13.518  51.388  1.00 21.92 ? 362  PRO A CB    1 
ATOM   2841  C  CG    . PRO A 1 362 ? 16.693  12.852  51.061  1.00 21.84 ? 362  PRO A CG    1 
ATOM   2842  C  CD    . PRO A 1 362 ? 16.832  13.043  49.590  1.00 21.49 ? 362  PRO A CD    1 
ATOM   2843  N  N     . ARG A 1 363 ? 13.825  15.395  49.522  1.00 22.49 ? 363  ARG A N     1 
ATOM   2844  C  CA    . ARG A 1 363 ? 12.863  16.483  49.333  1.00 22.69 ? 363  ARG A CA    1 
ATOM   2845  C  C     . ARG A 1 363 ? 11.918  16.177  48.189  1.00 23.13 ? 363  ARG A C     1 
ATOM   2846  O  O     . ARG A 1 363 ? 10.835  16.774  48.096  1.00 23.64 ? 363  ARG A O     1 
ATOM   2847  C  CB    . ARG A 1 363 ? 13.573  17.806  49.088  1.00 22.61 ? 363  ARG A CB    1 
ATOM   2848  C  CG    . ARG A 1 363 ? 14.355  18.259  50.299  1.00 23.10 ? 363  ARG A CG    1 
ATOM   2849  C  CD    . ARG A 1 363 ? 14.734  19.727  50.307  1.00 24.14 ? 363  ARG A CD    1 
ATOM   2850  N  NE    . ARG A 1 363 ? 15.713  19.985  51.366  1.00 25.34 ? 363  ARG A NE    1 
ATOM   2851  C  CZ    . ARG A 1 363 ? 16.040  21.182  51.845  1.00 24.33 ? 363  ARG A CZ    1 
ATOM   2852  N  NH1   . ARG A 1 363 ? 15.474  22.282  51.380  1.00 24.36 ? 363  ARG A NH1   1 
ATOM   2853  N  NH2   . ARG A 1 363 ? 16.943  21.272  52.810  1.00 24.40 ? 363  ARG A NH2   1 
ATOM   2854  N  N     . ASP A 1 364 ? 12.328  15.252  47.316  1.00 22.88 ? 364  ASP A N     1 
ATOM   2855  C  CA    . ASP A 1 364 ? 11.443  14.736  46.290  1.00 22.73 ? 364  ASP A CA    1 
ATOM   2856  C  C     . ASP A 1 364 ? 10.352  13.851  46.894  1.00 22.24 ? 364  ASP A C     1 
ATOM   2857  O  O     . ASP A 1 364 ? 9.193   13.969  46.526  1.00 22.29 ? 364  ASP A O     1 
ATOM   2858  C  CB    . ASP A 1 364 ? 12.242  14.006  45.205  1.00 23.16 ? 364  ASP A CB    1 
ATOM   2859  C  CG    . ASP A 1 364 ? 12.977  14.966  44.282  1.00 24.10 ? 364  ASP A CG    1 
ATOM   2860  O  OD1   . ASP A 1 364 ? 12.353  15.984  43.901  1.00 26.21 ? 364  ASP A OD1   1 
ATOM   2861  O  OD2   . ASP A 1 364 ? 14.157  14.807  43.883  1.00 23.77 ? 364  ASP A OD2   1 
ATOM   2862  N  N     . LEU A 1 365 ? 10.694  12.983  47.833  1.00 21.71 ? 365  LEU A N     1 
ATOM   2863  C  CA    . LEU A 1 365 ? 9.651   12.231  48.505  1.00 21.60 ? 365  LEU A CA    1 
ATOM   2864  C  C     . LEU A 1 365 ? 8.811   13.123  49.385  1.00 21.87 ? 365  LEU A C     1 
ATOM   2865  O  O     . LEU A 1 365 ? 7.643   12.849  49.582  1.00 21.42 ? 365  LEU A O     1 
ATOM   2866  C  CB    . LEU A 1 365 ? 10.234  11.089  49.316  1.00 21.50 ? 365  LEU A CB    1 
ATOM   2867  C  CG    . LEU A 1 365 ? 10.982  10.048  48.491  1.00 21.27 ? 365  LEU A CG    1 
ATOM   2868  C  CD1   . LEU A 1 365 ? 11.193  8.800   49.326  1.00 22.36 ? 365  LEU A CD1   1 
ATOM   2869  C  CD2   . LEU A 1 365 ? 10.259  9.700   47.217  1.00 20.73 ? 365  LEU A CD2   1 
ATOM   2870  N  N     . ALA A 1 366 ? 9.400   14.196  49.907  1.00 22.71 ? 366  ALA A N     1 
ATOM   2871  C  CA    . ALA A 1 366 ? 8.664   15.165  50.736  1.00 23.13 ? 366  ALA A CA    1 
ATOM   2872  C  C     . ALA A 1 366 ? 7.578   15.804  49.914  1.00 23.30 ? 366  ALA A C     1 
ATOM   2873  O  O     . ALA A 1 366 ? 6.418   15.719  50.256  1.00 23.66 ? 366  ALA A O     1 
ATOM   2874  C  CB    . ALA A 1 366 ? 9.593   16.259  51.291  1.00 23.07 ? 366  ALA A CB    1 
ATOM   2875  N  N     . ARG A 1 367 ? 7.963   16.427  48.810  1.00 23.56 ? 367  ARG A N     1 
ATOM   2876  C  CA    . ARG A 1 367 ? 6.999   17.083  47.936  1.00 23.70 ? 367  ARG A CA    1 
ATOM   2877  C  C     . ARG A 1 367 ? 5.976   16.110  47.345  1.00 22.72 ? 367  ARG A C     1 
ATOM   2878  O  O     . ARG A 1 367 ? 4.860   16.505  47.033  1.00 22.50 ? 367  ARG A O     1 
ATOM   2879  C  CB    . ARG A 1 367 ? 7.723   17.860  46.838  1.00 24.20 ? 367  ARG A CB    1 
ATOM   2880  C  CG    . ARG A 1 367 ? 8.482   19.073  47.385  1.00 25.90 ? 367  ARG A CG    1 
ATOM   2881  C  CD    . ARG A 1 367 ? 9.086   19.976  46.305  1.00 28.65 ? 367  ARG A CD    1 
ATOM   2882  N  NE    . ARG A 1 367 ? 10.442  19.548  45.935  1.00 30.49 ? 367  ARG A NE    1 
ATOM   2883  C  CZ    . ARG A 1 367 ? 10.871  19.248  44.700  1.00 30.90 ? 367  ARG A CZ    1 
ATOM   2884  N  NH1   . ARG A 1 367 ? 10.070  19.314  43.632  1.00 29.96 ? 367  ARG A NH1   1 
ATOM   2885  N  NH2   . ARG A 1 367 ? 12.137  18.867  44.536  1.00 32.13 ? 367  ARG A NH2   1 
ATOM   2886  N  N     . MET A 1 368 ? 6.339   14.843  47.224  1.00 22.12 ? 368  MET A N     1 
ATOM   2887  C  CA    . MET A 1 368 ? 5.386   13.819  46.790  1.00 22.08 ? 368  MET A CA    1 
ATOM   2888  C  C     . MET A 1 368 ? 4.358   13.573  47.885  1.00 21.73 ? 368  MET A C     1 
ATOM   2889  O  O     . MET A 1 368 ? 3.168   13.512  47.621  1.00 22.03 ? 368  MET A O     1 
ATOM   2890  C  CB    . MET A 1 368 ? 6.103   12.514  46.443  1.00 21.96 ? 368  MET A CB    1 
ATOM   2891  C  CG    . MET A 1 368 ? 5.217   11.477  45.773  1.00 22.79 ? 368  MET A CG    1 
ATOM   2892  S  SD    . MET A 1 368 ? 5.923   9.829   45.825  1.00 22.79 ? 368  MET A SD    1 
ATOM   2893  C  CE    . MET A 1 368 ? 7.404   10.094  44.957  1.00 21.90 ? 368  MET A CE    1 
ATOM   2894  N  N     . ARG A 1 369 ? 4.837   13.429  49.115  1.00 21.47 ? 369  ARG A N     1 
ATOM   2895  C  CA    . ARG A 1 369 ? 3.998   13.297  50.304  1.00 20.92 ? 369  ARG A CA    1 
ATOM   2896  C  C     . ARG A 1 369 ? 3.054   14.483  50.425  1.00 20.59 ? 369  ARG A C     1 
ATOM   2897  O  O     . ARG A 1 369 ? 1.844   14.310  50.602  1.00 19.90 ? 369  ARG A O     1 
ATOM   2898  C  CB    . ARG A 1 369 ? 4.897   13.235  51.536  1.00 20.99 ? 369  ARG A CB    1 
ATOM   2899  C  CG    . ARG A 1 369 ? 4.204   13.103  52.882  1.00 21.15 ? 369  ARG A CG    1 
ATOM   2900  C  CD    . ARG A 1 369 ? 5.180   13.094  54.028  1.00 20.69 ? 369  ARG A CD    1 
ATOM   2901  N  NE    . ARG A 1 369 ? 5.919   14.355  54.114  1.00 20.26 ? 369  ARG A NE    1 
ATOM   2902  C  CZ    . ARG A 1 369 ? 7.076   14.509  54.753  1.00 19.94 ? 369  ARG A CZ    1 
ATOM   2903  N  NH1   . ARG A 1 369 ? 7.669   15.707  54.792  1.00 19.97 ? 369  ARG A NH1   1 
ATOM   2904  N  NH2   . ARG A 1 369 ? 7.647   13.474  55.365  1.00 18.62 ? 369  ARG A NH2   1 
ATOM   2905  N  N     . HIS A 1 370 ? 3.623   15.682  50.310  1.00 20.51 ? 370  HIS A N     1 
ATOM   2906  C  CA    . HIS A 1 370 ? 2.860   16.928  50.307  1.00 20.79 ? 370  HIS A CA    1 
ATOM   2907  C  C     . HIS A 1 370 ? 1.799   16.963  49.222  1.00 21.23 ? 370  HIS A C     1 
ATOM   2908  O  O     . HIS A 1 370 ? 0.743   17.560  49.419  1.00 22.00 ? 370  HIS A O     1 
ATOM   2909  C  CB    . HIS A 1 370 ? 3.784   18.135  50.129  1.00 20.82 ? 370  HIS A CB    1 
ATOM   2910  C  CG    . HIS A 1 370 ? 3.119   19.450  50.406  1.00 21.30 ? 370  HIS A CG    1 
ATOM   2911  N  ND1   . HIS A 1 370 ? 3.087   20.022  51.661  1.00 22.01 ? 370  HIS A ND1   1 
ATOM   2912  C  CD2   . HIS A 1 370 ? 2.449   20.295  49.591  1.00 21.68 ? 370  HIS A CD2   1 
ATOM   2913  C  CE1   . HIS A 1 370 ? 2.428   21.167  51.603  1.00 22.70 ? 370  HIS A CE1   1 
ATOM   2914  N  NE2   . HIS A 1 370 ? 2.034   21.358  50.356  1.00 22.53 ? 370  HIS A NE2   1 
ATOM   2915  N  N     . ALA A 1 371 ? 2.075   16.340  48.078  1.00 21.30 ? 371  ALA A N     1 
ATOM   2916  C  CA    . ALA A 1 371 ? 1.121   16.320  46.980  1.00 21.44 ? 371  ALA A CA    1 
ATOM   2917  C  C     . ALA A 1 371 ? -0.085  15.471  47.365  1.00 21.63 ? 371  ALA A C     1 
ATOM   2918  O  O     . ALA A 1 371 ? -1.226  15.927  47.299  1.00 21.72 ? 371  ALA A O     1 
ATOM   2919  C  CB    . ALA A 1 371 ? 1.764   15.803  45.717  1.00 21.45 ? 371  ALA A CB    1 
ATOM   2920  N  N     . PHE A 1 372 ? 0.176   14.246  47.797  1.00 21.63 ? 372  PHE A N     1 
ATOM   2921  C  CA    . PHE A 1 372 ? -0.877  13.365  48.285  1.00 21.48 ? 372  PHE A CA    1 
ATOM   2922  C  C     . PHE A 1 372 ? -1.778  14.041  49.315  1.00 21.25 ? 372  PHE A C     1 
ATOM   2923  O  O     . PHE A 1 372 ? -2.945  13.677  49.460  1.00 21.03 ? 372  PHE A O     1 
ATOM   2924  C  CB    . PHE A 1 372 ? -0.260  12.127  48.934  1.00 21.71 ? 372  PHE A CB    1 
ATOM   2925  C  CG    . PHE A 1 372 ? 0.631   11.325  48.027  1.00 21.79 ? 372  PHE A CG    1 
ATOM   2926  C  CD1   . PHE A 1 372 ? 0.439   11.310  46.653  1.00 21.76 ? 372  PHE A CD1   1 
ATOM   2927  C  CD2   . PHE A 1 372 ? 1.659   10.556  48.569  1.00 21.69 ? 372  PHE A CD2   1 
ATOM   2928  C  CE1   . PHE A 1 372 ? 1.267   10.548  45.838  1.00 23.17 ? 372  PHE A CE1   1 
ATOM   2929  C  CE2   . PHE A 1 372 ? 2.482   9.784   47.763  1.00 21.54 ? 372  PHE A CE2   1 
ATOM   2930  C  CZ    . PHE A 1 372 ? 2.291   9.779   46.401  1.00 22.42 ? 372  PHE A CZ    1 
ATOM   2931  N  N     . GLN A 1 373 ? -1.231  15.006  50.052  1.00 21.14 ? 373  GLN A N     1 
ATOM   2932  C  CA    . GLN A 1 373 ? -1.979  15.644  51.146  1.00 21.06 ? 373  GLN A CA    1 
ATOM   2933  C  C     . GLN A 1 373 ? -3.028  16.639  50.649  1.00 20.81 ? 373  GLN A C     1 
ATOM   2934  O  O     . GLN A 1 373 ? -3.966  16.953  51.371  1.00 20.83 ? 373  GLN A O     1 
ATOM   2935  C  CB    . GLN A 1 373 ? -1.027  16.291  52.161  1.00 21.13 ? 373  GLN A CB    1 
ATOM   2936  C  CG    . GLN A 1 373 ? -0.390  15.263  53.108  1.00 20.35 ? 373  GLN A CG    1 
ATOM   2937  C  CD    . GLN A 1 373 ? 0.774   15.807  53.899  1.00 20.48 ? 373  GLN A CD    1 
ATOM   2938  O  OE1   . GLN A 1 373 ? 1.216   16.944  53.686  1.00 21.40 ? 373  GLN A OE1   1 
ATOM   2939  N  NE2   . GLN A 1 373 ? 1.280   14.999  54.823  1.00 20.42 ? 373  GLN A NE2   1 
ATOM   2940  N  N     . GLN A 1 374 ? -2.864  17.099  49.408  1.00 20.72 ? 374  GLN A N     1 
ATOM   2941  C  CA    . GLN A 1 374 ? -3.830  17.961  48.713  1.00 20.31 ? 374  GLN A CA    1 
ATOM   2942  C  C     . GLN A 1 374 ? -4.922  17.196  47.991  1.00 19.91 ? 374  GLN A C     1 
ATOM   2943  O  O     . GLN A 1 374 ? -5.855  17.824  47.479  1.00 20.08 ? 374  GLN A O     1 
ATOM   2944  C  CB    . GLN A 1 374 ? -3.134  18.805  47.637  1.00 20.37 ? 374  GLN A CB    1 
ATOM   2945  C  CG    . GLN A 1 374 ? -1.790  19.388  48.033  1.00 21.02 ? 374  GLN A CG    1 
ATOM   2946  C  CD    . GLN A 1 374 ? -1.836  20.022  49.387  1.00 21.77 ? 374  GLN A CD    1 
ATOM   2947  O  OE1   . GLN A 1 374 ? -2.332  21.137  49.531  1.00 22.75 ? 374  GLN A OE1   1 
ATOM   2948  N  NE2   . GLN A 1 374 ? -1.347  19.310  50.395  1.00 22.49 ? 374  GLN A NE2   1 
ATOM   2949  N  N     . LEU A 1 375 ? -4.790  15.870  47.889  1.00 19.15 ? 375  LEU A N     1 
ATOM   2950  C  CA    . LEU A 1 375 ? -5.717  15.082  47.081  1.00 18.86 ? 375  LEU A CA    1 
ATOM   2951  C  C     . LEU A 1 375 ? -7.127  15.025  47.630  1.00 18.76 ? 375  LEU A C     1 
ATOM   2952  O  O     . LEU A 1 375 ? -8.073  15.045  46.832  1.00 18.84 ? 375  LEU A O     1 
ATOM   2953  C  CB    . LEU A 1 375 ? -5.196  13.672  46.826  1.00 19.05 ? 375  LEU A CB    1 
ATOM   2954  C  CG    . LEU A 1 375 ? -4.012  13.536  45.859  1.00 19.63 ? 375  LEU A CG    1 
ATOM   2955  C  CD1   . LEU A 1 375 ? -3.911  12.082  45.373  1.00 19.47 ? 375  LEU A CD1   1 
ATOM   2956  C  CD2   . LEU A 1 375 ? -4.102  14.501  44.683  1.00 20.47 ? 375  LEU A CD2   1 
ATOM   2957  N  N     . PRO A 1 376 ? -7.282  14.932  48.959  1.00 18.67 ? 376  PRO A N     1 
ATOM   2958  C  CA    . PRO A 1 376 ? -8.602  14.962  49.597  1.00 18.61 ? 376  PRO A CA    1 
ATOM   2959  C  C     . PRO A 1 376 ? -9.345  16.258  49.357  1.00 18.92 ? 376  PRO A C     1 
ATOM   2960  O  O     . PRO A 1 376 ? -10.512 16.215  49.007  1.00 18.80 ? 376  PRO A O     1 
ATOM   2961  C  CB    . PRO A 1 376 ? -8.275  14.838  51.092  1.00 18.53 ? 376  PRO A CB    1 
ATOM   2962  C  CG    . PRO A 1 376 ? -6.912  14.320  51.174  1.00 17.99 ? 376  PRO A CG    1 
ATOM   2963  C  CD    . PRO A 1 376 ? -6.213  14.784  49.965  1.00 18.83 ? 376  PRO A CD    1 
ATOM   2964  N  N     . GLU A 1 377 ? -8.666  17.380  49.563  1.00 19.30 ? 377  GLU A N     1 
ATOM   2965  C  CA    . GLU A 1 377 ? -9.238  18.693  49.358  1.00 19.75 ? 377  GLU A CA    1 
ATOM   2966  C  C     . GLU A 1 377 ? -9.591  18.929  47.899  1.00 20.38 ? 377  GLU A C     1 
ATOM   2967  O  O     . GLU A 1 377 ? -10.589 19.578  47.589  1.00 19.98 ? 377  GLU A O     1 
ATOM   2968  C  CB    . GLU A 1 377 ? -8.249  19.747  49.816  1.00 19.88 ? 377  GLU A CB    1 
ATOM   2969  C  CG    . GLU A 1 377 ? -8.725  21.186  49.643  1.00 20.36 ? 377  GLU A CG    1 
ATOM   2970  C  CD    . GLU A 1 377 ? -9.885  21.539  50.539  1.00 19.66 ? 377  GLU A CD    1 
ATOM   2971  O  OE1   . GLU A 1 377 ? -9.815  21.263  51.762  1.00 19.38 ? 377  GLU A OE1   1 
ATOM   2972  O  OE2   . GLU A 1 377 ? -10.868 22.088  50.006  1.00 20.48 ? 377  GLU A OE2   1 
ATOM   2973  N  N     . LEU A 1 378 ? -8.770  18.413  46.994  1.00 21.60 ? 378  LEU A N     1 
ATOM   2974  C  CA    . LEU A 1 378 ? -9.118  18.449  45.571  1.00 22.43 ? 378  LEU A CA    1 
ATOM   2975  C  C     . LEU A 1 378 ? -10.336 17.555  45.286  1.00 22.66 ? 378  LEU A C     1 
ATOM   2976  O  O     . LEU A 1 378 ? -11.233 17.956  44.549  1.00 22.71 ? 378  LEU A O     1 
ATOM   2977  C  CB    . LEU A 1 378 ? -7.938  18.030  44.701  1.00 22.70 ? 378  LEU A CB    1 
ATOM   2978  C  CG    . LEU A 1 378 ? -6.801  19.035  44.582  1.00 23.59 ? 378  LEU A CG    1 
ATOM   2979  C  CD1   . LEU A 1 378 ? -5.779  18.447  43.657  1.00 24.04 ? 378  LEU A CD1   1 
ATOM   2980  C  CD2   . LEU A 1 378 ? -7.269  20.418  44.072  1.00 24.46 ? 378  LEU A CD2   1 
ATOM   2981  N  N     . ARG A 1 379 ? -10.381 16.369  45.895  1.00 22.93 ? 379  ARG A N     1 
ATOM   2982  C  CA    . ARG A 1 379 ? -11.530 15.462  45.730  1.00 23.18 ? 379  ARG A CA    1 
ATOM   2983  C  C     . ARG A 1 379 ? -12.857 16.093  46.205  1.00 23.34 ? 379  ARG A C     1 
ATOM   2984  O  O     . ARG A 1 379 ? -13.881 15.981  45.533  1.00 23.67 ? 379  ARG A O     1 
ATOM   2985  C  CB    . ARG A 1 379 ? -11.280 14.133  46.459  1.00 23.19 ? 379  ARG A CB    1 
ATOM   2986  C  CG    . ARG A 1 379 ? -10.464 13.128  45.657  1.00 23.40 ? 379  ARG A CG    1 
ATOM   2987  C  CD    . ARG A 1 379 ? -10.109 11.847  46.411  1.00 23.54 ? 379  ARG A CD    1 
ATOM   2988  N  NE    . ARG A 1 379 ? -11.284 11.045  46.769  1.00 23.15 ? 379  ARG A NE    1 
ATOM   2989  C  CZ    . ARG A 1 379 ? -12.041 10.373  45.904  1.00 24.12 ? 379  ARG A CZ    1 
ATOM   2990  N  NH1   . ARG A 1 379 ? -11.788 10.394  44.602  1.00 24.99 ? 379  ARG A NH1   1 
ATOM   2991  N  NH2   . ARG A 1 379 ? -13.080 9.676   46.337  1.00 25.62 ? 379  ARG A NH2   1 
ATOM   2992  N  N     . ALA A 1 380 ? -12.820 16.779  47.344  1.00 23.40 ? 380  ALA A N     1 
ATOM   2993  C  CA    . ALA A 1 380 ? -14.011 17.384  47.937  1.00 23.34 ? 380  ALA A CA    1 
ATOM   2994  C  C     . ALA A 1 380 ? -14.526 18.555  47.110  1.00 23.42 ? 380  ALA A C     1 
ATOM   2995  O  O     . ALA A 1 380 ? -15.726 18.716  46.962  1.00 23.63 ? 380  ALA A O     1 
ATOM   2996  C  CB    . ALA A 1 380 ? -13.727 17.834  49.378  1.00 23.13 ? 380  ALA A CB    1 
ATOM   2997  N  N     . GLN A 1 381 ? -13.622 19.370  46.570  1.00 23.55 ? 381  GLN A N     1 
ATOM   2998  C  CA    . GLN A 1 381 ? -14.028 20.510  45.751  1.00 23.34 ? 381  GLN A CA    1 
ATOM   2999  C  C     . GLN A 1 381 ? -14.656 20.020  44.470  1.00 23.76 ? 381  GLN A C     1 
ATOM   3000  O  O     . GLN A 1 381 ? -15.700 20.506  44.045  1.00 23.54 ? 381  GLN A O     1 
ATOM   3001  C  CB    . GLN A 1 381 ? -12.835 21.401  45.425  1.00 23.03 ? 381  GLN A CB    1 
ATOM   3002  C  CG    . GLN A 1 381 ? -12.402 22.249  46.591  1.00 22.49 ? 381  GLN A CG    1 
ATOM   3003  C  CD    . GLN A 1 381 ? -11.571 23.429  46.182  1.00 22.03 ? 381  GLN A CD    1 
ATOM   3004  O  OE1   . GLN A 1 381 ? -11.945 24.173  45.290  1.00 23.53 ? 381  GLN A OE1   1 
ATOM   3005  N  NE2   . GLN A 1 381 ? -10.441 23.610  46.838  1.00 21.95 ? 381  GLN A NE2   1 
ATOM   3006  N  N     . LEU A 1 382 ? -14.021 19.020  43.874  1.00 24.58 ? 382  LEU A N     1 
ATOM   3007  C  CA    . LEU A 1 382 ? -14.427 18.522  42.572  1.00 25.09 ? 382  LEU A CA    1 
ATOM   3008  C  C     . LEU A 1 382 ? -15.676 17.648  42.599  1.00 25.70 ? 382  LEU A C     1 
ATOM   3009  O  O     . LEU A 1 382 ? -16.238 17.393  41.547  1.00 25.57 ? 382  LEU A O     1 
ATOM   3010  C  CB    . LEU A 1 382 ? -13.271 17.763  41.913  1.00 25.12 ? 382  LEU A CB    1 
ATOM   3011  C  CG    . LEU A 1 382 ? -12.038 18.541  41.426  1.00 24.87 ? 382  LEU A CG    1 
ATOM   3012  C  CD1   . LEU A 1 382 ? -11.154 17.573  40.653  1.00 24.05 ? 382  LEU A CD1   1 
ATOM   3013  C  CD2   . LEU A 1 382 ? -12.385 19.760  40.568  1.00 24.16 ? 382  LEU A CD2   1 
ATOM   3014  N  N     . GLU A 1 383 ? -16.116 17.186  43.772  1.00 26.82 ? 383  GLU A N     1 
ATOM   3015  C  CA    . GLU A 1 383 ? -17.322 16.346  43.840  1.00 27.76 ? 383  GLU A CA    1 
ATOM   3016  C  C     . GLU A 1 383 ? -18.551 17.121  43.388  1.00 28.27 ? 383  GLU A C     1 
ATOM   3017  O  O     . GLU A 1 383 ? -19.397 16.609  42.646  1.00 28.13 ? 383  GLU A O     1 
ATOM   3018  C  CB    . GLU A 1 383 ? -17.557 15.796  45.246  1.00 27.88 ? 383  GLU A CB    1 
ATOM   3019  C  CG    . GLU A 1 383 ? -18.548 14.635  45.272  1.00 29.03 ? 383  GLU A CG    1 
ATOM   3020  C  CD    . GLU A 1 383 ? -18.562 13.890  46.600  1.00 30.93 ? 383  GLU A CD    1 
ATOM   3021  O  OE1   . GLU A 1 383 ? -19.036 14.468  47.598  1.00 31.35 ? 383  GLU A OE1   1 
ATOM   3022  O  OE2   . GLU A 1 383 ? -18.097 12.725  46.654  1.00 32.63 ? 383  GLU A OE2   1 
ATOM   3023  N  N     . THR A 1 384 ? -18.615 18.369  43.836  1.00 29.12 ? 384  THR A N     1 
ATOM   3024  C  CA    . THR A 1 384 ? -19.735 19.268  43.555  1.00 29.80 ? 384  THR A CA    1 
ATOM   3025  C  C     . THR A 1 384 ? -19.803 19.750  42.093  1.00 29.87 ? 384  THR A C     1 
ATOM   3026  O  O     . THR A 1 384 ? -20.855 20.202  41.652  1.00 29.69 ? 384  THR A O     1 
ATOM   3027  C  CB    . THR A 1 384 ? -19.669 20.494  44.508  1.00 30.15 ? 384  THR A CB    1 
ATOM   3028  O  OG1   . THR A 1 384 ? -18.394 21.157  44.384  1.00 30.21 ? 384  THR A OG1   1 
ATOM   3029  C  CG2   . THR A 1 384 ? -19.725 20.050  45.991  1.00 30.38 ? 384  THR A CG2   1 
ATOM   3030  N  N     . VAL A 1 385 ? -18.699 19.658  41.349  1.00 30.03 ? 385  VAL A N     1 
ATOM   3031  C  CA    . VAL A 1 385 ? -18.689 20.096  39.951  1.00 30.35 ? 385  VAL A CA    1 
ATOM   3032  C  C     . VAL A 1 385 ? -19.383 19.085  39.040  1.00 30.53 ? 385  VAL A C     1 
ATOM   3033  O  O     . VAL A 1 385 ? -18.855 18.003  38.776  1.00 30.47 ? 385  VAL A O     1 
ATOM   3034  C  CB    . VAL A 1 385 ? -17.276 20.342  39.420  1.00 30.49 ? 385  VAL A CB    1 
ATOM   3035  C  CG1   . VAL A 1 385 ? -17.312 20.641  37.916  1.00 30.87 ? 385  VAL A CG1   1 
ATOM   3036  C  CG2   . VAL A 1 385 ? -16.618 21.498  40.163  1.00 30.74 ? 385  VAL A CG2   1 
ATOM   3037  N  N     . ASP A 1 386 ? -20.570 19.456  38.560  1.00 30.66 ? 386  ASP A N     1 
ATOM   3038  C  CA    . ASP A 1 386 ? -21.356 18.596  37.675  1.00 30.50 ? 386  ASP A CA    1 
ATOM   3039  C  C     . ASP A 1 386 ? -20.789 18.644  36.252  1.00 29.62 ? 386  ASP A C     1 
ATOM   3040  O  O     . ASP A 1 386 ? -21.029 19.600  35.502  1.00 30.05 ? 386  ASP A O     1 
ATOM   3041  C  CB    . ASP A 1 386 ? -22.831 19.011  37.678  1.00 30.76 ? 386  ASP A CB    1 
ATOM   3042  C  CG    . ASP A 1 386 ? -23.506 18.748  36.352  1.00 32.29 ? 386  ASP A CG    1 
ATOM   3043  O  OD1   . ASP A 1 386 ? -23.310 17.635  35.809  1.00 34.18 ? 386  ASP A OD1   1 
ATOM   3044  O  OD2   . ASP A 1 386 ? -24.221 19.599  35.767  1.00 34.58 ? 386  ASP A OD2   1 
ATOM   3045  N  N     . SER A 1 387 ? -20.050 17.596  35.899  1.00 28.20 ? 387  SER A N     1 
ATOM   3046  C  CA    . SER A 1 387 ? -19.397 17.462  34.602  1.00 26.84 ? 387  SER A CA    1 
ATOM   3047  C  C     . SER A 1 387 ? -18.786 16.072  34.612  1.00 25.90 ? 387  SER A C     1 
ATOM   3048  O  O     . SER A 1 387 ? -17.978 15.777  35.472  1.00 26.05 ? 387  SER A O     1 
ATOM   3049  C  CB    . SER A 1 387 ? -18.310 18.533  34.441  1.00 26.74 ? 387  SER A CB    1 
ATOM   3050  O  OG    . SER A 1 387 ? -17.495 18.334  33.299  1.00 26.61 ? 387  SER A OG    1 
ATOM   3051  N  N     . ALA A 1 388 ? -19.184 15.204  33.694  1.00 24.78 ? 388  ALA A N     1 
ATOM   3052  C  CA    . ALA A 1 388 ? -18.605 13.857  33.645  1.00 24.10 ? 388  ALA A CA    1 
ATOM   3053  C  C     . ALA A 1 388 ? -17.070 13.844  33.405  1.00 23.22 ? 388  ALA A C     1 
ATOM   3054  O  O     . ALA A 1 388 ? -16.358 13.021  33.986  1.00 22.92 ? 388  ALA A O     1 
ATOM   3055  C  CB    . ALA A 1 388 ? -19.340 12.978  32.602  1.00 23.99 ? 388  ALA A CB    1 
ATOM   3056  N  N     . PRO A 1 389 ? -16.573 14.718  32.531  1.00 22.17 ? 389  PRO A N     1 
ATOM   3057  C  CA    . PRO A 1 389 ? -15.129 14.905  32.335  1.00 21.48 ? 389  PRO A CA    1 
ATOM   3058  C  C     . PRO A 1 389 ? -14.352 15.304  33.581  1.00 20.71 ? 389  PRO A C     1 
ATOM   3059  O  O     . PRO A 1 389 ? -13.240 14.840  33.773  1.00 20.07 ? 389  PRO A O     1 
ATOM   3060  C  CB    . PRO A 1 389 ? -15.082 16.051  31.333  1.00 21.60 ? 389  PRO A CB    1 
ATOM   3061  C  CG    . PRO A 1 389 ? -16.317 15.898  30.584  1.00 21.91 ? 389  PRO A CG    1 
ATOM   3062  C  CD    . PRO A 1 389 ? -17.345 15.541  31.586  1.00 22.19 ? 389  PRO A CD    1 
ATOM   3063  N  N     . VAL A 1 390 ? -14.926 16.168  34.405  1.00 20.22 ? 390  VAL A N     1 
ATOM   3064  C  CA    . VAL A 1 390 ? -14.250 16.600  35.617  1.00 19.91 ? 390  VAL A CA    1 
ATOM   3065  C  C     . VAL A 1 390 ? -14.179 15.440  36.588  1.00 19.34 ? 390  VAL A C     1 
ATOM   3066  O  O     . VAL A 1 390 ? -13.197 15.301  37.303  1.00 19.36 ? 390  VAL A O     1 
ATOM   3067  C  CB    . VAL A 1 390 ? -14.949 17.803  36.289  1.00 20.08 ? 390  VAL A CB    1 
ATOM   3068  C  CG1   . VAL A 1 390 ? -14.248 18.174  37.596  1.00 20.29 ? 390  VAL A CG1   1 
ATOM   3069  C  CG2   . VAL A 1 390 ? -14.955 19.003  35.364  1.00 19.87 ? 390  VAL A CG2   1 
ATOM   3070  N  N     . GLN A 1 391 ? -15.215 14.602  36.586  1.00 18.93 ? 391  GLN A N     1 
ATOM   3071  C  CA    . GLN A 1 391 ? -15.312 13.449  37.486  1.00 18.36 ? 391  GLN A CA    1 
ATOM   3072  C  C     . GLN A 1 391 ? -14.350 12.339  37.092  1.00 18.48 ? 391  GLN A C     1 
ATOM   3073  O  O     . GLN A 1 391 ? -13.850 11.627  37.956  1.00 18.53 ? 391  GLN A O     1 
ATOM   3074  C  CB    . GLN A 1 391 ? -16.748 12.916  37.524  1.00 18.00 ? 391  GLN A CB    1 
ATOM   3075  C  CG    . GLN A 1 391 ? -17.765 13.903  38.107  1.00 16.93 ? 391  GLN A CG    1 
ATOM   3076  C  CD    . GLN A 1 391 ? -17.476 14.258  39.555  1.00 16.07 ? 391  GLN A CD    1 
ATOM   3077  O  OE1   . GLN A 1 391 ? -17.389 13.386  40.410  1.00 16.32 ? 391  GLN A OE1   1 
ATOM   3078  N  NE2   . GLN A 1 391 ? -17.312 15.536  39.825  1.00 15.72 ? 391  GLN A NE2   1 
ATOM   3079  N  N     . ALA A 1 392 ? -14.086 12.200  35.793  1.00 18.66 ? 392  ALA A N     1 
ATOM   3080  C  CA    . ALA A 1 392 ? -13.105 11.232  35.301  1.00 19.06 ? 392  ALA A CA    1 
ATOM   3081  C  C     . ALA A 1 392 ? -11.687 11.648  35.710  1.00 19.59 ? 392  ALA A C     1 
ATOM   3082  O  O     . ALA A 1 392 ? -10.846 10.800  35.995  1.00 19.57 ? 392  ALA A O     1 
ATOM   3083  C  CB    . ALA A 1 392 ? -13.213 11.087  33.786  1.00 18.62 ? 392  ALA A CB    1 
ATOM   3084  N  N     . LEU A 1 393 ? -11.455 12.961  35.748  1.00 20.36 ? 393  LEU A N     1 
ATOM   3085  C  CA    . LEU A 1 393 ? -10.189 13.546  36.164  1.00 20.97 ? 393  LEU A CA    1 
ATOM   3086  C  C     . LEU A 1 393 ? -10.056 13.605  37.686  1.00 21.72 ? 393  LEU A C     1 
ATOM   3087  O  O     . LEU A 1 393 ? -8.945  13.667  38.221  1.00 22.33 ? 393  LEU A O     1 
ATOM   3088  C  CB    . LEU A 1 393 ? -10.060 14.961  35.611  1.00 21.16 ? 393  LEU A CB    1 
ATOM   3089  C  CG    . LEU A 1 393 ? -9.792  15.106  34.117  1.00 20.49 ? 393  LEU A CG    1 
ATOM   3090  C  CD1   . LEU A 1 393 ? -10.054 16.536  33.692  1.00 19.61 ? 393  LEU A CD1   1 
ATOM   3091  C  CD2   . LEU A 1 393 ? -8.374  14.713  33.793  1.00 20.71 ? 393  LEU A CD2   1 
ATOM   3092  N  N     . ARG A 1 394 ? -11.188 13.621  38.376  1.00 22.07 ? 394  ARG A N     1 
ATOM   3093  C  CA    . ARG A 1 394 ? -11.225 13.462  39.821  1.00 22.34 ? 394  ARG A CA    1 
ATOM   3094  C  C     . ARG A 1 394 ? -10.832 12.029  40.158  1.00 22.56 ? 394  ARG A C     1 
ATOM   3095  O  O     . ARG A 1 394 ? -10.169 11.771  41.152  1.00 22.82 ? 394  ARG A O     1 
ATOM   3096  C  CB    . ARG A 1 394 ? -12.647 13.746  40.322  1.00 22.41 ? 394  ARG A CB    1 
ATOM   3097  C  CG    . ARG A 1 394 ? -12.790 13.974  41.813  1.00 22.68 ? 394  ARG A CG    1 
ATOM   3098  C  CD    . ARG A 1 394 ? -14.197 14.409  42.225  1.00 23.41 ? 394  ARG A CD    1 
ATOM   3099  N  NE    . ARG A 1 394 ? -15.012 13.325  42.779  1.00 24.31 ? 394  ARG A NE    1 
ATOM   3100  C  CZ    . ARG A 1 394 ? -14.877 12.829  44.005  1.00 25.22 ? 394  ARG A CZ    1 
ATOM   3101  N  NH1   . ARG A 1 394 ? -13.946 13.293  44.819  1.00 26.64 ? 394  ARG A NH1   1 
ATOM   3102  N  NH2   . ARG A 1 394 ? -15.673 11.860  44.428  1.00 25.70 ? 394  ARG A NH2   1 
ATOM   3103  N  N     . GLU A 1 395 ? -11.241 11.111  39.295  1.00 22.96 ? 395  GLU A N     1 
ATOM   3104  C  CA    . GLU A 1 395 ? -11.103 9.685   39.522  1.00 23.31 ? 395  GLU A CA    1 
ATOM   3105  C  C     . GLU A 1 395 ? -9.709  9.213   39.149  1.00 23.32 ? 395  GLU A C     1 
ATOM   3106  O  O     . GLU A 1 395 ? -9.180  8.287   39.752  1.00 23.19 ? 395  GLU A O     1 
ATOM   3107  C  CB    . GLU A 1 395 ? -12.131 8.961   38.665  1.00 23.48 ? 395  GLU A CB    1 
ATOM   3108  C  CG    . GLU A 1 395 ? -12.064 7.452   38.742  1.00 24.30 ? 395  GLU A CG    1 
ATOM   3109  C  CD    . GLU A 1 395 ? -12.562 6.923   40.063  1.00 26.10 ? 395  GLU A CD    1 
ATOM   3110  O  OE1   . GLU A 1 395 ? -13.566 7.467   40.589  1.00 26.16 ? 395  GLU A OE1   1 
ATOM   3111  O  OE2   . GLU A 1 395 ? -11.949 5.958   40.571  1.00 27.22 ? 395  GLU A OE2   1 
ATOM   3112  N  N     . LYS A 1 396 ? -9.123  9.859   38.148  1.00 23.31 ? 396  LYS A N     1 
ATOM   3113  C  CA    . LYS A 1 396 ? -7.796  9.504   37.654  1.00 23.49 ? 396  LYS A CA    1 
ATOM   3114  C  C     . LYS A 1 396 ? -6.745  9.996   38.643  1.00 23.68 ? 396  LYS A C     1 
ATOM   3115  O  O     . LYS A 1 396 ? -5.748  9.317   38.870  1.00 23.48 ? 396  LYS A O     1 
ATOM   3116  C  CB    . LYS A 1 396 ? -7.592  10.127  36.264  1.00 23.65 ? 396  LYS A CB    1 
ATOM   3117  C  CG    . LYS A 1 396 ? -6.422  9.614   35.398  1.00 23.46 ? 396  LYS A CG    1 
ATOM   3118  C  CD    . LYS A 1 396 ? -6.603  10.081  33.917  1.00 23.52 ? 396  LYS A CD    1 
ATOM   3119  C  CE    . LYS A 1 396 ? -5.286  10.329  33.156  1.00 24.41 ? 396  LYS A CE    1 
ATOM   3120  N  NZ    . LYS A 1 396 ? -5.307  11.571  32.273  1.00 24.92 ? 396  LYS A NZ    1 
ATOM   3121  N  N     . MET A 1 397 ? -6.998  11.180  39.214  1.00 24.27 ? 397  MET A N     1 
ATOM   3122  C  CA    . MET A 1 397 ? -6.226  11.785  40.316  1.00 25.05 ? 397  MET A CA    1 
ATOM   3123  C  C     . MET A 1 397 ? -5.855  10.802  41.436  1.00 25.21 ? 397  MET A C     1 
ATOM   3124  O  O     . MET A 1 397 ? -4.765  10.888  41.996  1.00 25.43 ? 397  MET A O     1 
ATOM   3125  C  CB    . MET A 1 397 ? -7.031  12.939  40.933  1.00 25.58 ? 397  MET A CB    1 
ATOM   3126  C  CG    . MET A 1 397 ? -6.217  14.074  41.544  1.00 27.59 ? 397  MET A CG    1 
ATOM   3127  S  SD    . MET A 1 397 ? -7.288  15.263  42.504  1.00 32.58 ? 397  MET A SD    1 
ATOM   3128  C  CE    . MET A 1 397 ? -8.263  15.859  41.269  1.00 32.11 ? 397  MET A CE    1 
ATOM   3129  N  N     . GLY A 1 398 ? -6.750  9.874   41.765  1.00 25.34 ? 398  GLY A N     1 
ATOM   3130  C  CA    . GLY A 1 398 ? -6.469  8.876   42.782  1.00 25.69 ? 398  GLY A CA    1 
ATOM   3131  C  C     . GLY A 1 398 ? -6.432  9.493   44.166  1.00 26.06 ? 398  GLY A C     1 
ATOM   3132  O  O     . GLY A 1 398 ? -6.956  10.582  44.371  1.00 26.30 ? 398  GLY A O     1 
ATOM   3133  N  N     . GLU A 1 399 ? -5.811  8.802   45.121  1.00 26.54 ? 399  GLU A N     1 
ATOM   3134  C  CA    . GLU A 1 399 ? -5.751  9.290   46.506  1.00 26.74 ? 399  GLU A CA    1 
ATOM   3135  C  C     . GLU A 1 399 ? -4.500  8.841   47.289  1.00 26.98 ? 399  GLU A C     1 
ATOM   3136  O  O     . GLU A 1 399 ? -3.836  9.658   47.951  1.00 27.26 ? 399  GLU A O     1 
ATOM   3137  C  CB    . GLU A 1 399 ? -7.009  8.863   47.259  1.00 26.76 ? 399  GLU A CB    1 
ATOM   3138  C  CG    . GLU A 1 399 ? -7.452  9.868   48.304  1.00 26.62 ? 399  GLU A CG    1 
ATOM   3139  C  CD    . GLU A 1 399 ? -8.334  9.254   49.372  1.00 25.97 ? 399  GLU A CD    1 
ATOM   3140  O  OE1   . GLU A 1 399 ? -9.519  8.987   49.073  1.00 24.98 ? 399  GLU A OE1   1 
ATOM   3141  O  OE2   . GLU A 1 399 ? -7.839  9.050   50.507  1.00 25.91 ? 399  GLU A OE2   1 
ATOM   3142  N  N     . PHE A 1 400 ? -4.204  7.543   47.243  1.00 26.97 ? 400  PHE A N     1 
ATOM   3143  C  CA    . PHE A 1 400 ? -2.980  7.016   47.825  1.00 26.72 ? 400  PHE A CA    1 
ATOM   3144  C  C     . PHE A 1 400 ? -2.907  7.355   49.308  1.00 26.87 ? 400  PHE A C     1 
ATOM   3145  O  O     . PHE A 1 400 ? -1.991  8.041   49.756  1.00 27.29 ? 400  PHE A O     1 
ATOM   3146  C  CB    . PHE A 1 400 ? -1.782  7.592   47.065  1.00 26.63 ? 400  PHE A CB    1 
ATOM   3147  C  CG    . PHE A 1 400 ? -1.922  7.486   45.576  1.00 25.62 ? 400  PHE A CG    1 
ATOM   3148  C  CD1   . PHE A 1 400 ? -1.852  6.234   44.950  1.00 24.93 ? 400  PHE A CD1   1 
ATOM   3149  C  CD2   . PHE A 1 400 ? -2.153  8.605   44.804  1.00 23.52 ? 400  PHE A CD2   1 
ATOM   3150  C  CE1   . PHE A 1 400 ? -2.000  6.119   43.585  1.00 23.60 ? 400  PHE A CE1   1 
ATOM   3151  C  CE2   . PHE A 1 400 ? -2.292  8.488   43.430  1.00 23.27 ? 400  PHE A CE2   1 
ATOM   3152  C  CZ    . PHE A 1 400 ? -2.221  7.250   42.823  1.00 22.86 ? 400  PHE A CZ    1 
ATOM   3153  N  N     . ALA A 1 401 ? -3.899  6.903   50.063  1.00 26.77 ? 401  ALA A N     1 
ATOM   3154  C  CA    . ALA A 1 401 ? -3.907  7.117   51.507  1.00 26.69 ? 401  ALA A CA    1 
ATOM   3155  C  C     . ALA A 1 401 ? -2.711  6.383   52.123  1.00 26.84 ? 401  ALA A C     1 
ATOM   3156  O  O     . ALA A 1 401 ? -1.953  6.965   52.887  1.00 26.94 ? 401  ALA A O     1 
ATOM   3157  C  CB    . ALA A 1 401 ? -5.207  6.633   52.110  1.00 26.57 ? 401  ALA A CB    1 
ATOM   3158  N  N     . GLU A 1 402 ? -2.541  5.113   51.748  1.00 26.76 ? 402  GLU A N     1 
ATOM   3159  C  CA    . GLU A 1 402 ? -1.440  4.276   52.218  1.00 26.46 ? 402  GLU A CA    1 
ATOM   3160  C  C     . GLU A 1 402 ? -0.090  4.971   52.035  1.00 26.02 ? 402  GLU A C     1 
ATOM   3161  O  O     . GLU A 1 402 ? 0.637   5.195   53.000  1.00 25.90 ? 402  GLU A O     1 
ATOM   3162  C  CB    . GLU A 1 402 ? -1.429  2.928   51.472  1.00 26.66 ? 402  GLU A CB    1 
ATOM   3163  C  CG    . GLU A 1 402 ? -2.377  1.871   52.023  1.00 27.67 ? 402  GLU A CG    1 
ATOM   3164  C  CD    . GLU A 1 402 ? -3.738  1.823   51.319  1.00 30.69 ? 402  GLU A CD    1 
ATOM   3165  O  OE1   . GLU A 1 402 ? -4.149  2.828   50.678  1.00 32.23 ? 402  GLU A OE1   1 
ATOM   3166  O  OE2   . GLU A 1 402 ? -4.425  0.770   51.413  1.00 31.63 ? 402  GLU A OE2   1 
ATOM   3167  N  N     . LEU A 1 403 ? 0.219   5.328   50.794  1.00 25.53 ? 403  LEU A N     1 
ATOM   3168  C  CA    . LEU A 1 403 ? 1.544   5.820   50.426  1.00 25.11 ? 403  LEU A CA    1 
ATOM   3169  C  C     . LEU A 1 403 ? 1.834   7.153   51.075  1.00 24.96 ? 403  LEU A C     1 
ATOM   3170  O  O     . LEU A 1 403 ? 2.976   7.462   51.394  1.00 25.00 ? 403  LEU A O     1 
ATOM   3171  C  CB    . LEU A 1 403 ? 1.669   5.960   48.903  1.00 25.19 ? 403  LEU A CB    1 
ATOM   3172  C  CG    . LEU A 1 403 ? 1.237   4.767   48.035  1.00 25.15 ? 403  LEU A CG    1 
ATOM   3173  C  CD1   . LEU A 1 403 ? 1.526   5.055   46.588  1.00 24.76 ? 403  LEU A CD1   1 
ATOM   3174  C  CD2   . LEU A 1 403 ? 1.927   3.480   48.461  1.00 25.41 ? 403  LEU A CD2   1 
ATOM   3175  N  N     . ARG A 1 404 ? 0.794   7.953   51.243  1.00 24.88 ? 404  ARG A N     1 
ATOM   3176  C  CA    . ARG A 1 404 ? 0.884   9.195   51.998  1.00 24.74 ? 404  ARG A CA    1 
ATOM   3177  C  C     . ARG A 1 404 ? 1.279   8.884   53.449  1.00 24.14 ? 404  ARG A C     1 
ATOM   3178  O  O     . ARG A 1 404 ? 2.249   9.439   53.969  1.00 24.32 ? 404  ARG A O     1 
ATOM   3179  C  CB    . ARG A 1 404 ? -0.459  9.943   51.931  1.00 24.90 ? 404  ARG A CB    1 
ATOM   3180  C  CG    . ARG A 1 404 ? -0.425  11.396  52.413  1.00 25.57 ? 404  ARG A CG    1 
ATOM   3181  C  CD    . ARG A 1 404 ? -1.667  11.817  53.179  1.00 25.22 ? 404  ARG A CD    1 
ATOM   3182  N  NE    . ARG A 1 404 ? -1.716  11.071  54.423  1.00 26.35 ? 404  ARG A NE    1 
ATOM   3183  C  CZ    . ARG A 1 404 ? -2.776  10.439  54.907  1.00 26.01 ? 404  ARG A CZ    1 
ATOM   3184  N  NH1   . ARG A 1 404 ? -3.946  10.458  54.273  1.00 25.56 ? 404  ARG A NH1   1 
ATOM   3185  N  NH2   . ARG A 1 404 ? -2.651  9.776   56.054  1.00 26.03 ? 404  ARG A NH2   1 
ATOM   3186  N  N     . ASP A 1 405 ? 0.544   7.972   54.080  1.00 23.44 ? 405  ASP A N     1 
ATOM   3187  C  CA    . ASP A 1 405 ? 0.814   7.549   55.462  1.00 22.97 ? 405  ASP A CA    1 
ATOM   3188  C  C     . ASP A 1 405 ? 2.205   6.920   55.647  1.00 22.27 ? 405  ASP A C     1 
ATOM   3189  O  O     . ASP A 1 405 ? 2.777   6.975   56.722  1.00 22.47 ? 405  ASP A O     1 
ATOM   3190  C  CB    . ASP A 1 405 ? -0.273  6.569   55.926  1.00 23.00 ? 405  ASP A CB    1 
ATOM   3191  C  CG    . ASP A 1 405 ? -0.085  6.116   57.353  1.00 23.36 ? 405  ASP A CG    1 
ATOM   3192  O  OD1   . ASP A 1 405 ? 0.445   6.899   58.171  1.00 23.57 ? 405  ASP A OD1   1 
ATOM   3193  O  OD2   . ASP A 1 405 ? -0.438  4.989   57.751  1.00 24.69 ? 405  ASP A OD2   1 
ATOM   3194  N  N     . LEU A 1 406 ? 2.736   6.323   54.592  1.00 21.50 ? 406  LEU A N     1 
ATOM   3195  C  CA    . LEU A 1 406 ? 4.077   5.763   54.604  1.00 20.88 ? 406  LEU A CA    1 
ATOM   3196  C  C     . LEU A 1 406 ? 5.147   6.869   54.602  1.00 20.79 ? 406  LEU A C     1 
ATOM   3197  O  O     . LEU A 1 406 ? 6.114   6.821   55.359  1.00 20.59 ? 406  LEU A O     1 
ATOM   3198  C  CB    . LEU A 1 406 ? 4.257   4.834   53.399  1.00 20.45 ? 406  LEU A CB    1 
ATOM   3199  C  CG    . LEU A 1 406 ? 5.683   4.575   52.932  1.00 19.53 ? 406  LEU A CG    1 
ATOM   3200  C  CD1   . LEU A 1 406 ? 6.435   3.801   54.003  1.00 19.47 ? 406  LEU A CD1   1 
ATOM   3201  C  CD2   . LEU A 1 406 ? 5.685   3.846   51.609  1.00 18.27 ? 406  LEU A CD2   1 
ATOM   3202  N  N     . LEU A 1 407 ? 4.989   7.859   53.741  1.00 20.79 ? 407  LEU A N     1 
ATOM   3203  C  CA    . LEU A 1 407 ? 5.962   8.937   53.679  1.00 20.97 ? 407  LEU A CA    1 
ATOM   3204  C  C     . LEU A 1 407 ? 5.905   9.848   54.904  1.00 21.29 ? 407  LEU A C     1 
ATOM   3205  O  O     . LEU A 1 407 ? 6.866   10.559  55.179  1.00 21.90 ? 407  LEU A O     1 
ATOM   3206  C  CB    . LEU A 1 407 ? 5.781   9.764   52.410  1.00 20.87 ? 407  LEU A CB    1 
ATOM   3207  C  CG    . LEU A 1 407 ? 6.086   9.078   51.079  1.00 19.99 ? 407  LEU A CG    1 
ATOM   3208  C  CD1   . LEU A 1 407 ? 6.147   10.116  49.990  1.00 18.82 ? 407  LEU A CD1   1 
ATOM   3209  C  CD2   . LEU A 1 407 ? 7.375   8.294   51.137  1.00 20.58 ? 407  LEU A CD2   1 
ATOM   3210  N  N     . GLU A 1 408 ? 4.799   9.832   55.642  1.00 21.21 ? 408  GLU A N     1 
ATOM   3211  C  CA    . GLU A 1 408 ? 4.705   10.616  56.874  1.00 21.23 ? 408  GLU A CA    1 
ATOM   3212  C  C     . GLU A 1 408 ? 5.397   9.901   58.031  1.00 20.89 ? 408  GLU A C     1 
ATOM   3213  O  O     . GLU A 1 408 ? 5.950   10.543  58.915  1.00 21.19 ? 408  GLU A O     1 
ATOM   3214  C  CB    . GLU A 1 408 ? 3.249   10.877  57.237  1.00 21.27 ? 408  GLU A CB    1 
ATOM   3215  C  CG    . GLU A 1 408 ? 2.514   11.699  56.203  1.00 21.05 ? 408  GLU A CG    1 
ATOM   3216  C  CD    . GLU A 1 408 ? 1.032   11.817  56.482  1.00 20.71 ? 408  GLU A CD    1 
ATOM   3217  O  OE1   . GLU A 1 408 ? 0.458   10.945  57.173  1.00 18.83 ? 408  GLU A OE1   1 
ATOM   3218  O  OE2   . GLU A 1 408 ? 0.440   12.799  55.992  1.00 20.86 ? 408  GLU A OE2   1 
ATOM   3219  N  N     . ARG A 1 409 ? 5.353   8.571   58.006  1.00 20.63 ? 409  ARG A N     1 
ATOM   3220  C  CA    . ARG A 1 409 ? 6.016   7.713   58.989  1.00 20.11 ? 409  ARG A CA    1 
ATOM   3221  C  C     . ARG A 1 409 ? 7.473   7.375   58.618  1.00 20.20 ? 409  ARG A C     1 
ATOM   3222  O  O     . ARG A 1 409 ? 8.135   6.634   59.344  1.00 20.37 ? 409  ARG A O     1 
ATOM   3223  C  CB    . ARG A 1 409 ? 5.240   6.398   59.114  1.00 19.80 ? 409  ARG A CB    1 
ATOM   3224  C  CG    . ARG A 1 409 ? 3.886   6.505   59.774  1.00 19.34 ? 409  ARG A CG    1 
ATOM   3225  C  CD    . ARG A 1 409 ? 3.195   5.150   59.994  1.00 18.84 ? 409  ARG A CD    1 
ATOM   3226  N  NE    . ARG A 1 409 ? 3.045   4.391   58.750  1.00 18.23 ? 409  ARG A NE    1 
ATOM   3227  C  CZ    . ARG A 1 409 ? 3.857   3.417   58.325  1.00 17.65 ? 409  ARG A CZ    1 
ATOM   3228  N  NH1   . ARG A 1 409 ? 4.912   3.028   59.036  1.00 17.51 ? 409  ARG A NH1   1 
ATOM   3229  N  NH2   . ARG A 1 409 ? 3.605   2.820   57.167  1.00 17.12 ? 409  ARG A NH2   1 
ATOM   3230  N  N     . ALA A 1 410 ? 7.971   7.881   57.488  1.00 20.00 ? 410  ALA A N     1 
ATOM   3231  C  CA    . ALA A 1 410 ? 9.279   7.470   56.990  1.00 19.65 ? 410  ALA A CA    1 
ATOM   3232  C  C     . ALA A 1 410 ? 10.211  8.651   56.972  1.00 19.30 ? 410  ALA A C     1 
ATOM   3233  O  O     . ALA A 1 410 ? 11.244  8.619   57.601  1.00 19.40 ? 410  ALA A O     1 
ATOM   3234  C  CB    . ALA A 1 410 ? 9.159   6.863   55.611  1.00 19.62 ? 410  ALA A CB    1 
ATOM   3235  N  N     . ILE A 1 411 ? 9.840   9.700   56.255  1.00 19.09 ? 411  ILE A N     1 
ATOM   3236  C  CA    . ILE A 1 411 ? 10.658  10.909  56.177  1.00 18.75 ? 411  ILE A CA    1 
ATOM   3237  C  C     . ILE A 1 411 ? 10.218  11.925  57.232  1.00 18.39 ? 411  ILE A C     1 
ATOM   3238  O  O     . ILE A 1 411 ? 9.037   12.041  57.536  1.00 18.09 ? 411  ILE A O     1 
ATOM   3239  C  CB    . ILE A 1 411 ? 10.570  11.545  54.766  1.00 18.64 ? 411  ILE A CB    1 
ATOM   3240  C  CG1   . ILE A 1 411 ? 10.586  10.486  53.652  1.00 18.77 ? 411  ILE A CG1   1 
ATOM   3241  C  CG2   . ILE A 1 411 ? 11.710  12.535  54.558  1.00 19.12 ? 411  ILE A CG2   1 
ATOM   3242  C  CD1   . ILE A 1 411 ? 11.645  9.401   53.790  1.00 18.64 ? 411  ILE A CD1   1 
ATOM   3243  N  N     . ILE A 1 412 ? 11.175  12.667  57.778  1.00 18.47 ? 412  ILE A N     1 
ATOM   3244  C  CA    . ILE A 1 412 ? 10.872  13.766  58.706  1.00 18.59 ? 412  ILE A CA    1 
ATOM   3245  C  C     . ILE A 1 412 ? 10.237  14.957  57.965  1.00 18.97 ? 412  ILE A C     1 
ATOM   3246  O  O     . ILE A 1 412 ? 10.129  14.948  56.738  1.00 18.95 ? 412  ILE A O     1 
ATOM   3247  C  CB    . ILE A 1 412 ? 12.136  14.206  59.482  1.00 18.30 ? 412  ILE A CB    1 
ATOM   3248  C  CG1   . ILE A 1 412 ? 13.178  14.858  58.559  1.00 18.69 ? 412  ILE A CG1   1 
ATOM   3249  C  CG2   . ILE A 1 412 ? 12.741  13.023  60.211  1.00 17.73 ? 412  ILE A CG2   1 
ATOM   3250  C  CD1   . ILE A 1 412 ? 14.219  15.711  59.322  1.00 18.62 ? 412  ILE A CD1   1 
ATOM   3251  N  N     . ASP A 1 413 ? 9.834   15.985  58.698  1.00 19.38 ? 413  ASP A N     1 
ATOM   3252  C  CA    . ASP A 1 413 ? 9.035   17.052  58.097  1.00 20.09 ? 413  ASP A CA    1 
ATOM   3253  C  C     . ASP A 1 413 ? 9.809   17.856  57.054  1.00 20.49 ? 413  ASP A C     1 
ATOM   3254  O  O     . ASP A 1 413 ? 9.264   18.155  55.985  1.00 21.12 ? 413  ASP A O     1 
ATOM   3255  C  CB    . ASP A 1 413 ? 8.400   17.938  59.171  1.00 20.07 ? 413  ASP A CB    1 
ATOM   3256  C  CG    . ASP A 1 413 ? 7.526   17.132  60.124  1.00 20.60 ? 413  ASP A CG    1 
ATOM   3257  O  OD1   . ASP A 1 413 ? 7.232   15.962  59.775  1.00 20.62 ? 413  ASP A OD1   1 
ATOM   3258  O  OD2   . ASP A 1 413 ? 7.100   17.552  61.227  1.00 19.71 ? 413  ASP A OD2   1 
ATOM   3259  N  N     . THR A 1 414 ? 11.071  18.176  57.324  1.00 20.43 ? 414  THR A N     1 
ATOM   3260  C  CA    . THR A 1 414 ? 11.911  18.794  56.293  1.00 20.42 ? 414  THR A CA    1 
ATOM   3261  C  C     . THR A 1 414 ? 13.295  18.164  56.269  1.00 20.33 ? 414  THR A C     1 
ATOM   3262  O  O     . THR A 1 414 ? 14.196  18.573  57.006  1.00 20.38 ? 414  THR A O     1 
ATOM   3263  C  CB    . THR A 1 414 ? 12.035  20.303  56.498  1.00 20.40 ? 414  THR A CB    1 
ATOM   3264  O  OG1   . THR A 1 414 ? 12.431  20.570  57.844  1.00 20.85 ? 414  THR A OG1   1 
ATOM   3265  C  CG2   . THR A 1 414 ? 10.679  20.985  56.366  1.00 20.56 ? 414  THR A CG2   1 
ATOM   3266  N  N     . PRO A 1 415 ? 13.475  17.192  55.389  1.00 20.07 ? 415  PRO A N     1 
ATOM   3267  C  CA    . PRO A 1 415 ? 14.748  16.484  55.284  1.00 20.03 ? 415  PRO A CA    1 
ATOM   3268  C  C     . PRO A 1 415 ? 15.818  17.328  54.593  1.00 19.99 ? 415  PRO A C     1 
ATOM   3269  O  O     . PRO A 1 415 ? 15.482  18.360  53.986  1.00 20.23 ? 415  PRO A O     1 
ATOM   3270  C  CB    . PRO A 1 415 ? 14.389  15.272  54.425  1.00 20.03 ? 415  PRO A CB    1 
ATOM   3271  C  CG    . PRO A 1 415 ? 13.268  15.734  53.593  1.00 20.00 ? 415  PRO A CG    1 
ATOM   3272  C  CD    . PRO A 1 415 ? 12.496  16.713  54.401  1.00 19.88 ? 415  PRO A CD    1 
ATOM   3273  N  N     . PRO A 1 416 ? 17.080  16.903  54.688  1.00 19.64 ? 416  PRO A N     1 
ATOM   3274  C  CA    . PRO A 1 416 ? 18.171  17.552  53.959  1.00 19.61 ? 416  PRO A CA    1 
ATOM   3275  C  C     . PRO A 1 416 ? 18.114  17.253  52.465  1.00 19.87 ? 416  PRO A C     1 
ATOM   3276  O  O     . PRO A 1 416 ? 17.342  16.401  52.018  1.00 19.99 ? 416  PRO A O     1 
ATOM   3277  C  CB    . PRO A 1 416 ? 19.424  16.941  54.589  1.00 19.39 ? 416  PRO A CB    1 
ATOM   3278  C  CG    . PRO A 1 416 ? 18.988  15.631  55.072  1.00 19.44 ? 416  PRO A CG    1 
ATOM   3279  C  CD    . PRO A 1 416 ? 17.570  15.790  55.516  1.00 19.42 ? 416  PRO A CD    1 
ATOM   3280  N  N     . VAL A 1 417 ? 18.942  17.957  51.703  1.00 20.33 ? 417  VAL A N     1 
ATOM   3281  C  CA    . VAL A 1 417 ? 18.982  17.822  50.243  1.00 20.49 ? 417  VAL A CA    1 
ATOM   3282  C  C     . VAL A 1 417 ? 19.378  16.403  49.790  1.00 20.66 ? 417  VAL A C     1 
ATOM   3283  O  O     . VAL A 1 417 ? 18.890  15.928  48.767  1.00 20.30 ? 417  VAL A O     1 
ATOM   3284  C  CB    . VAL A 1 417 ? 19.933  18.890  49.627  1.00 20.48 ? 417  VAL A CB    1 
ATOM   3285  C  CG1   . VAL A 1 417 ? 20.066  18.719  48.121  1.00 20.92 ? 417  VAL A CG1   1 
ATOM   3286  C  CG2   . VAL A 1 417 ? 19.435  20.298  49.956  1.00 20.35 ? 417  VAL A CG2   1 
ATOM   3287  N  N     . LEU A 1 418 ? 20.233  15.729  50.559  1.00 21.08 ? 418  LEU A N     1 
ATOM   3288  C  CA    . LEU A 1 418 ? 20.754  14.410  50.184  1.00 22.01 ? 418  LEU A CA    1 
ATOM   3289  C  C     . LEU A 1 418 ? 20.460  13.358  51.258  1.00 22.54 ? 418  LEU A C     1 
ATOM   3290  O  O     . LEU A 1 418 ? 20.030  13.710  52.340  1.00 23.19 ? 418  LEU A O     1 
ATOM   3291  C  CB    . LEU A 1 418 ? 22.271  14.500  49.951  1.00 22.14 ? 418  LEU A CB    1 
ATOM   3292  C  CG    . LEU A 1 418 ? 22.821  15.594  48.997  1.00 22.52 ? 418  LEU A CG    1 
ATOM   3293  C  CD1   . LEU A 1 418 ? 24.207  16.111  49.418  1.00 21.80 ? 418  LEU A CD1   1 
ATOM   3294  C  CD2   . LEU A 1 418 ? 22.877  15.101  47.565  1.00 22.00 ? 418  LEU A CD2   1 
ATOM   3295  N  N     . VAL A 1 419 ? 20.674  12.073  50.953  1.00 23.09 ? 419  VAL A N     1 
ATOM   3296  C  CA    . VAL A 1 419 ? 20.663  10.994  51.975  1.00 23.32 ? 419  VAL A CA    1 
ATOM   3297  C  C     . VAL A 1 419 ? 22.054  10.633  52.498  1.00 23.81 ? 419  VAL A C     1 
ATOM   3298  O  O     . VAL A 1 419 ? 22.166  10.003  53.540  1.00 24.04 ? 419  VAL A O     1 
ATOM   3299  C  CB    . VAL A 1 419 ? 20.033  9.640   51.484  1.00 23.14 ? 419  VAL A CB    1 
ATOM   3300  C  CG1   . VAL A 1 419 ? 18.545  9.679   51.593  1.00 23.33 ? 419  VAL A CG1   1 
ATOM   3301  C  CG2   . VAL A 1 419 ? 20.465  9.269   50.064  1.00 22.62 ? 419  VAL A CG2   1 
ATOM   3302  N  N     . ARG A 1 420 ? 23.099  10.992  51.755  1.00 24.29 ? 420  ARG A N     1 
ATOM   3303  C  CA    . ARG A 1 420 ? 24.494  10.693  52.118  1.00 24.74 ? 420  ARG A CA    1 
ATOM   3304  C  C     . ARG A 1 420 ? 24.813  10.990  53.591  1.00 24.82 ? 420  ARG A C     1 
ATOM   3305  O  O     . ARG A 1 420 ? 25.482  10.197  54.251  1.00 24.89 ? 420  ARG A O     1 
ATOM   3306  C  CB    . ARG A 1 420 ? 25.446  11.469  51.179  1.00 24.90 ? 420  ARG A CB    1 
ATOM   3307  C  CG    . ARG A 1 420 ? 26.902  11.661  51.641  1.00 25.87 ? 420  ARG A CG    1 
ATOM   3308  C  CD    . ARG A 1 420 ? 27.589  12.919  51.052  1.00 27.09 ? 420  ARG A CD    1 
ATOM   3309  N  NE    . ARG A 1 420 ? 27.286  13.094  49.624  1.00 27.77 ? 420  ARG A NE    1 
ATOM   3310  C  CZ    . ARG A 1 420 ? 27.593  14.173  48.891  1.00 27.58 ? 420  ARG A CZ    1 
ATOM   3311  N  NH1   . ARG A 1 420 ? 28.223  15.211  49.427  1.00 27.51 ? 420  ARG A NH1   1 
ATOM   3312  N  NH2   . ARG A 1 420 ? 27.262  14.209  47.604  1.00 27.22 ? 420  ARG A NH2   1 
ATOM   3313  N  N     . ASP A 1 421 ? 24.315  12.118  54.097  1.00 24.97 ? 421  ASP A N     1 
ATOM   3314  C  CA    . ASP A 1 421 ? 24.626  12.578  55.454  1.00 25.00 ? 421  ASP A CA    1 
ATOM   3315  C  C     . ASP A 1 421 ? 23.611  12.130  56.518  1.00 24.86 ? 421  ASP A C     1 
ATOM   3316  O  O     . ASP A 1 421 ? 23.622  12.637  57.644  1.00 24.66 ? 421  ASP A O     1 
ATOM   3317  C  CB    . ASP A 1 421 ? 24.748  14.108  55.457  1.00 25.07 ? 421  ASP A CB    1 
ATOM   3318  C  CG    . ASP A 1 421 ? 25.898  14.604  54.598  1.00 25.36 ? 421  ASP A CG    1 
ATOM   3319  O  OD1   . ASP A 1 421 ? 26.985  13.978  54.627  1.00 25.11 ? 421  ASP A OD1   1 
ATOM   3320  O  OD2   . ASP A 1 421 ? 25.806  15.609  53.860  1.00 26.05 ? 421  ASP A OD2   1 
ATOM   3321  N  N     . GLY A 1 422 ? 22.754  11.173  56.165  1.00 24.77 ? 422  GLY A N     1 
ATOM   3322  C  CA    . GLY A 1 422 ? 21.715  10.680  57.057  1.00 24.75 ? 422  GLY A CA    1 
ATOM   3323  C  C     . GLY A 1 422 ? 20.747  11.751  57.535  1.00 24.73 ? 422  GLY A C     1 
ATOM   3324  O  O     . GLY A 1 422 ? 20.600  12.802  56.897  1.00 24.66 ? 422  GLY A O     1 
ATOM   3325  N  N     . GLY A 1 423 ? 20.091  11.481  58.664  1.00 24.49 ? 423  GLY A N     1 
ATOM   3326  C  CA    . GLY A 1 423 ? 19.158  12.421  59.257  1.00 24.44 ? 423  GLY A CA    1 
ATOM   3327  C  C     . GLY A 1 423 ? 17.971  12.712  58.364  1.00 24.31 ? 423  GLY A C     1 
ATOM   3328  O  O     . GLY A 1 423 ? 17.583  13.870  58.219  1.00 24.34 ? 423  GLY A O     1 
ATOM   3329  N  N     . VAL A 1 424 ? 17.398  11.646  57.803  1.00 23.87 ? 424  VAL A N     1 
ATOM   3330  C  CA    . VAL A 1 424 ? 16.333  11.710  56.801  1.00 23.76 ? 424  VAL A CA    1 
ATOM   3331  C  C     . VAL A 1 424 ? 15.154  10.857  57.264  1.00 23.44 ? 424  VAL A C     1 
ATOM   3332  O  O     . VAL A 1 424 ? 14.029  11.334  57.332  1.00 23.78 ? 424  VAL A O     1 
ATOM   3333  C  CB    . VAL A 1 424 ? 16.833  11.185  55.402  1.00 23.99 ? 424  VAL A CB    1 
ATOM   3334  C  CG1   . VAL A 1 424 ? 15.696  10.594  54.547  1.00 23.53 ? 424  VAL A CG1   1 
ATOM   3335  C  CG2   . VAL A 1 424 ? 17.547  12.294  54.621  1.00 24.36 ? 424  VAL A CG2   1 
ATOM   3336  N  N     . ILE A 1 425 ? 15.422  9.585   57.552  1.00 22.92 ? 425  ILE A N     1 
ATOM   3337  C  CA    . ILE A 1 425 ? 14.422  8.673   58.108  1.00 22.23 ? 425  ILE A CA    1 
ATOM   3338  C  C     . ILE A 1 425 ? 14.042  9.091   59.539  1.00 22.26 ? 425  ILE A C     1 
ATOM   3339  O  O     . ILE A 1 425 ? 14.883  9.585   60.298  1.00 22.08 ? 425  ILE A O     1 
ATOM   3340  C  CB    . ILE A 1 425 ? 14.952  7.217   58.078  1.00 21.81 ? 425  ILE A CB    1 
ATOM   3341  C  CG1   . ILE A 1 425 ? 15.246  6.780   56.640  1.00 21.18 ? 425  ILE A CG1   1 
ATOM   3342  C  CG2   . ILE A 1 425 ? 13.971  6.259   58.726  1.00 21.09 ? 425  ILE A CG2   1 
ATOM   3343  C  CD1   . ILE A 1 425 ? 14.108  6.967   55.664  1.00 20.73 ? 425  ILE A CD1   1 
ATOM   3344  N  N     . ALA A 1 426 ? 12.780  8.863   59.901  1.00 22.19 ? 426  ALA A N     1 
ATOM   3345  C  CA    . ALA A 1 426 ? 12.189  9.445   61.102  1.00 22.28 ? 426  ALA A CA    1 
ATOM   3346  C  C     . ALA A 1 426 ? 12.175  8.466   62.266  1.00 22.38 ? 426  ALA A C     1 
ATOM   3347  O  O     . ALA A 1 426 ? 12.529  7.292   62.117  1.00 22.77 ? 426  ALA A O     1 
ATOM   3348  C  CB    . ALA A 1 426 ? 10.780  9.919   60.801  1.00 22.31 ? 426  ALA A CB    1 
ATOM   3349  N  N     . SER A 1 427 ? 11.763  8.960   63.430  1.00 22.22 ? 427  SER A N     1 
ATOM   3350  C  CA    . SER A 1 427 ? 11.672  8.135   64.623  1.00 21.98 ? 427  SER A CA    1 
ATOM   3351  C  C     . SER A 1 427 ? 10.451  7.231   64.597  1.00 21.79 ? 427  SER A C     1 
ATOM   3352  O  O     . SER A 1 427 ? 9.372   7.634   64.183  1.00 21.63 ? 427  SER A O     1 
ATOM   3353  C  CB    . SER A 1 427 ? 11.630  9.019   65.856  1.00 21.99 ? 427  SER A CB    1 
ATOM   3354  O  OG    . SER A 1 427 ? 12.851  9.708   65.966  1.00 22.41 ? 427  SER A OG    1 
ATOM   3355  N  N     . GLY A 1 428 ? 10.640  5.994   65.034  1.00 21.68 ? 428  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1 428 ? 9.563   5.023   65.101  1.00 21.56 ? 428  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1 428 ? 9.446   4.151   63.862  1.00 21.34 ? 428  GLY A C     1 
ATOM   3358  O  O     . GLY A 1 428 ? 8.872   3.058   63.934  1.00 21.43 ? 428  GLY A O     1 
ATOM   3359  N  N     . TYR A 1 429 ? 9.989   4.613   62.735  1.00 20.91 ? 429  TYR A N     1 
ATOM   3360  C  CA    . TYR A 1 429 ? 9.842   3.889   61.476  1.00 20.67 ? 429  TYR A CA    1 
ATOM   3361  C  C     . TYR A 1 429 ? 10.543  2.533   61.513  1.00 20.62 ? 429  TYR A C     1 
ATOM   3362  O  O     . TYR A 1 429 ? 10.011  1.528   61.043  1.00 20.75 ? 429  TYR A O     1 
ATOM   3363  C  CB    . TYR A 1 429 ? 10.371  4.701   60.285  1.00 20.35 ? 429  TYR A CB    1 
ATOM   3364  C  CG    . TYR A 1 429 ? 10.129  3.974   58.970  1.00 19.94 ? 429  TYR A CG    1 
ATOM   3365  C  CD1   . TYR A 1 429 ? 8.840   3.584   58.596  1.00 19.09 ? 429  TYR A CD1   1 
ATOM   3366  C  CD2   . TYR A 1 429 ? 11.182  3.624   58.133  1.00 18.48 ? 429  TYR A CD2   1 
ATOM   3367  C  CE1   . TYR A 1 429 ? 8.608   2.888   57.426  1.00 18.01 ? 429  TYR A CE1   1 
ATOM   3368  C  CE2   . TYR A 1 429 ? 10.950  2.934   56.955  1.00 18.34 ? 429  TYR A CE2   1 
ATOM   3369  C  CZ    . TYR A 1 429 ? 9.659   2.566   56.613  1.00 17.88 ? 429  TYR A CZ    1 
ATOM   3370  O  OH    . TYR A 1 429 ? 9.416   1.890   55.448  1.00 17.50 ? 429  TYR A OH    1 
ATOM   3371  N  N     . ASN A 1 430 ? 11.752  2.536   62.051  1.00 20.67 ? 430  ASN A N     1 
ATOM   3372  C  CA    . ASN A 1 430 ? 12.547  1.334   62.210  1.00 20.48 ? 430  ASN A CA    1 
ATOM   3373  C  C     . ASN A 1 430 ? 13.160  1.357   63.598  1.00 20.57 ? 430  ASN A C     1 
ATOM   3374  O  O     . ASN A 1 430 ? 13.874  2.301   63.950  1.00 20.07 ? 430  ASN A O     1 
ATOM   3375  C  CB    . ASN A 1 430 ? 13.627  1.301   61.139  1.00 20.44 ? 430  ASN A CB    1 
ATOM   3376  C  CG    . ASN A 1 430 ? 14.332  -0.030  61.061  1.00 19.97 ? 430  ASN A CG    1 
ATOM   3377  O  OD1   . ASN A 1 430 ? 15.099  -0.382  61.944  1.00 19.86 ? 430  ASN A OD1   1 
ATOM   3378  N  ND2   . ASN A 1 430 ? 14.087  -0.769  59.993  1.00 19.30 ? 430  ASN A ND2   1 
ATOM   3379  N  N     . GLU A 1 431 ? 12.865  0.328   64.394  1.00 21.05 ? 431  GLU A N     1 
ATOM   3380  C  CA    . GLU A 1 431 ? 13.276  0.321   65.806  1.00 21.36 ? 431  GLU A CA    1 
ATOM   3381  C  C     . GLU A 1 431 ? 14.740  -0.065  66.035  1.00 21.00 ? 431  GLU A C     1 
ATOM   3382  O  O     . GLU A 1 431 ? 15.290  0.202   67.098  1.00 20.97 ? 431  GLU A O     1 
ATOM   3383  C  CB    . GLU A 1 431 ? 12.325  -0.520  66.666  1.00 21.50 ? 431  GLU A CB    1 
ATOM   3384  C  CG    . GLU A 1 431 ? 12.323  -2.016  66.427  1.00 22.40 ? 431  GLU A CG    1 
ATOM   3385  C  CD    . GLU A 1 431 ? 11.778  -2.755  67.637  1.00 23.89 ? 431  GLU A CD    1 
ATOM   3386  O  OE1   . GLU A 1 431 ? 12.530  -2.877  68.637  1.00 24.56 ? 431  GLU A OE1   1 
ATOM   3387  O  OE2   . GLU A 1 431 ? 10.596  -3.176  67.606  1.00 23.47 ? 431  GLU A OE2   1 
ATOM   3388  N  N     . GLU A 1 432 ? 15.359  -0.676  65.033  1.00 20.71 ? 432  GLU A N     1 
ATOM   3389  C  CA    . GLU A 1 432 ? 16.804  -0.874  65.014  1.00 20.71 ? 432  GLU A CA    1 
ATOM   3390  C  C     . GLU A 1 432 ? 17.588  0.427   64.732  1.00 20.84 ? 432  GLU A C     1 
ATOM   3391  O  O     . GLU A 1 432 ? 18.748  0.556   65.103  1.00 20.59 ? 432  GLU A O     1 
ATOM   3392  C  CB    . GLU A 1 432 ? 17.149  -1.930  63.968  1.00 20.54 ? 432  GLU A CB    1 
ATOM   3393  C  CG    . GLU A 1 432 ? 18.499  -2.585  64.169  1.00 20.53 ? 432  GLU A CG    1 
ATOM   3394  C  CD    . GLU A 1 432 ? 19.013  -3.196  62.894  1.00 20.85 ? 432  GLU A CD    1 
ATOM   3395  O  OE1   . GLU A 1 432 ? 18.185  -3.767  62.149  1.00 20.76 ? 432  GLU A OE1   1 
ATOM   3396  O  OE2   . GLU A 1 432 ? 20.236  -3.104  62.644  1.00 20.41 ? 432  GLU A OE2   1 
ATOM   3397  N  N     . LEU A 1 433 ? 16.954  1.380   64.063  1.00 21.19 ? 433  LEU A N     1 
ATOM   3398  C  CA    . LEU A 1 433 ? 17.606  2.643   63.732  1.00 21.59 ? 433  LEU A CA    1 
ATOM   3399  C  C     . LEU A 1 433 ? 17.546  3.649   64.890  1.00 22.04 ? 433  LEU A C     1 
ATOM   3400  O  O     . LEU A 1 433 ? 18.500  4.399   65.111  1.00 21.58 ? 433  LEU A O     1 
ATOM   3401  C  CB    . LEU A 1 433 ? 16.978  3.259   62.471  1.00 21.54 ? 433  LEU A CB    1 
ATOM   3402  C  CG    . LEU A 1 433 ? 17.667  4.522   61.936  1.00 21.07 ? 433  LEU A CG    1 
ATOM   3403  C  CD1   . LEU A 1 433 ? 19.086  4.207   61.456  1.00 21.07 ? 433  LEU A CD1   1 
ATOM   3404  C  CD2   . LEU A 1 433 ? 16.855  5.165   60.828  1.00 20.49 ? 433  LEU A CD2   1 
ATOM   3405  N  N     . ASP A 1 434 ? 16.420  3.681   65.605  1.00 22.56 ? 434  ASP A N     1 
ATOM   3406  C  CA    . ASP A 1 434 ? 16.285  4.548   66.775  1.00 22.94 ? 434  ASP A CA    1 
ATOM   3407  C  C     . ASP A 1 434 ? 17.262  4.071   67.829  1.00 23.18 ? 434  ASP A C     1 
ATOM   3408  O  O     . ASP A 1 434 ? 17.824  4.876   68.573  1.00 23.12 ? 434  ASP A O     1 
ATOM   3409  C  CB    . ASP A 1 434 ? 14.871  4.493   67.358  1.00 23.03 ? 434  ASP A CB    1 
ATOM   3410  C  CG    . ASP A 1 434 ? 13.817  4.938   66.377  1.00 23.21 ? 434  ASP A CG    1 
ATOM   3411  O  OD1   . ASP A 1 434 ? 14.029  5.976   65.706  1.00 22.10 ? 434  ASP A OD1   1 
ATOM   3412  O  OD2   . ASP A 1 434 ? 12.749  4.298   66.218  1.00 23.85 ? 434  ASP A OD2   1 
ATOM   3413  N  N     . GLU A 1 435 ? 17.427  2.747   67.871  1.00 23.30 ? 435  GLU A N     1 
ATOM   3414  C  CA    . GLU A 1 435 ? 18.380  2.047   68.733  1.00 23.37 ? 435  GLU A CA    1 
ATOM   3415  C  C     . GLU A 1 435 ? 19.846  2.335   68.369  1.00 23.37 ? 435  GLU A C     1 
ATOM   3416  O  O     . GLU A 1 435 ? 20.701  2.332   69.241  1.00 23.43 ? 435  GLU A O     1 
ATOM   3417  C  CB    . GLU A 1 435 ? 18.081  0.535   68.662  1.00 23.47 ? 435  GLU A CB    1 
ATOM   3418  C  CG    . GLU A 1 435 ? 19.202  -0.422  69.044  1.00 23.90 ? 435  GLU A CG    1 
ATOM   3419  C  CD    . GLU A 1 435 ? 18.733  -1.871  69.123  1.00 24.75 ? 435  GLU A CD    1 
ATOM   3420  O  OE1   . GLU A 1 435 ? 19.255  -2.611  69.991  1.00 25.26 ? 435  GLU A OE1   1 
ATOM   3421  O  OE2   . GLU A 1 435 ? 17.851  -2.276  68.321  1.00 23.95 ? 435  GLU A OE2   1 
ATOM   3422  N  N     . TRP A 1 436 ? 20.130  2.567   67.088  1.00 23.66 ? 436  TRP A N     1 
ATOM   3423  C  CA    . TRP A 1 436 ? 21.492  2.879   66.620  1.00 23.80 ? 436  TRP A CA    1 
ATOM   3424  C  C     . TRP A 1 436 ? 21.852  4.373   66.811  1.00 24.51 ? 436  TRP A C     1 
ATOM   3425  O  O     . TRP A 1 436 ? 23.014  4.718   67.052  1.00 24.26 ? 436  TRP A O     1 
ATOM   3426  C  CB    . TRP A 1 436 ? 21.666  2.489   65.142  1.00 23.65 ? 436  TRP A CB    1 
ATOM   3427  C  CG    . TRP A 1 436 ? 22.124  1.063   64.861  1.00 22.18 ? 436  TRP A CG    1 
ATOM   3428  C  CD1   . TRP A 1 436 ? 21.544  0.183   64.009  1.00 20.93 ? 436  TRP A CD1   1 
ATOM   3429  C  CD2   . TRP A 1 436 ? 23.269  0.392   65.403  1.00 21.37 ? 436  TRP A CD2   1 
ATOM   3430  N  NE1   . TRP A 1 436 ? 22.240  -1.000  63.992  1.00 21.14 ? 436  TRP A NE1   1 
ATOM   3431  C  CE2   . TRP A 1 436 ? 23.305  -0.899  64.840  1.00 21.19 ? 436  TRP A CE2   1 
ATOM   3432  C  CE3   . TRP A 1 436 ? 24.262  0.746   66.321  1.00 20.69 ? 436  TRP A CE3   1 
ATOM   3433  C  CZ2   . TRP A 1 436 ? 24.289  -1.830  65.157  1.00 20.77 ? 436  TRP A CZ2   1 
ATOM   3434  C  CZ3   . TRP A 1 436 ? 25.243  -0.176  66.632  1.00 20.76 ? 436  TRP A CZ3   1 
ATOM   3435  C  CH2   . TRP A 1 436 ? 25.249  -1.450  66.051  1.00 20.92 ? 436  TRP A CH2   1 
ATOM   3436  N  N     . ARG A 1 437 ? 20.859  5.253   66.685  1.00 25.42 ? 437  ARG A N     1 
ATOM   3437  C  CA    . ARG A 1 437 ? 21.016  6.658   67.068  1.00 26.15 ? 437  ARG A CA    1 
ATOM   3438  C  C     . ARG A 1 437 ? 21.098  6.776   68.578  1.00 26.66 ? 437  ARG A C     1 
ATOM   3439  O  O     . ARG A 1 437 ? 21.821  7.623   69.103  1.00 27.05 ? 437  ARG A O     1 
ATOM   3440  C  CB    . ARG A 1 437 ? 19.839  7.504   66.584  1.00 26.36 ? 437  ARG A CB    1 
ATOM   3441  C  CG    . ARG A 1 437 ? 19.892  7.875   65.115  1.00 26.57 ? 437  ARG A CG    1 
ATOM   3442  C  CD    . ARG A 1 437 ? 18.527  7.944   64.466  1.00 26.97 ? 437  ARG A CD    1 
ATOM   3443  N  NE    . ARG A 1 437 ? 18.609  8.321   63.063  1.00 27.38 ? 437  ARG A NE    1 
ATOM   3444  C  CZ    . ARG A 1 437 ? 17.583  8.326   62.227  1.00 28.43 ? 437  ARG A CZ    1 
ATOM   3445  N  NH1   . ARG A 1 437 ? 16.372  7.969   62.634  1.00 27.75 ? 437  ARG A NH1   1 
ATOM   3446  N  NH2   . ARG A 1 437 ? 17.771  8.694   60.969  1.00 30.11 ? 437  ARG A NH2   1 
ATOM   3447  N  N     . ALA A 1 438 ? 20.345  5.927   69.270  1.00 27.17 ? 438  ALA A N     1 
ATOM   3448  C  CA    . ALA A 1 438 ? 20.326  5.917   70.730  1.00 27.61 ? 438  ALA A CA    1 
ATOM   3449  C  C     . ALA A 1 438 ? 21.750  5.872   71.282  1.00 27.84 ? 438  ALA A C     1 
ATOM   3450  O  O     . ALA A 1 438 ? 22.114  6.689   72.120  1.00 27.66 ? 438  ALA A O     1 
ATOM   3451  C  CB    . ALA A 1 438 ? 19.503  4.724   71.262  1.00 27.55 ? 438  ALA A CB    1 
ATOM   3452  N  N     . LEU A 1 439 ? 22.545  4.929   70.781  1.00 28.28 ? 439  LEU A N     1 
ATOM   3453  C  CA    . LEU A 1 439 ? 23.923  4.752   71.228  1.00 28.84 ? 439  LEU A CA    1 
ATOM   3454  C  C     . LEU A 1 439 ? 24.819  5.904   70.768  1.00 29.13 ? 439  LEU A C     1 
ATOM   3455  O  O     . LEU A 1 439 ? 25.740  6.281   71.482  1.00 29.43 ? 439  LEU A O     1 
ATOM   3456  C  CB    . LEU A 1 439 ? 24.492  3.413   70.736  1.00 29.00 ? 439  LEU A CB    1 
ATOM   3457  C  CG    . LEU A 1 439 ? 23.846  2.078   71.172  1.00 29.60 ? 439  LEU A CG    1 
ATOM   3458  C  CD1   . LEU A 1 439 ? 22.594  2.228   72.088  1.00 30.13 ? 439  LEU A CD1   1 
ATOM   3459  C  CD2   . LEU A 1 439 ? 23.525  1.218   69.939  1.00 29.62 ? 439  LEU A CD2   1 
ATOM   3460  N  N     . ALA A 1 440 ? 24.550  6.457   69.586  1.00 29.47 ? 440  ALA A N     1 
ATOM   3461  C  CA    . ALA A 1 440 ? 25.218  7.677   69.121  1.00 29.73 ? 440  ALA A CA    1 
ATOM   3462  C  C     . ALA A 1 440 ? 24.453  8.939   69.580  1.00 30.13 ? 440  ALA A C     1 
ATOM   3463  O  O     . ALA A 1 440 ? 24.240  9.882   68.801  1.00 30.09 ? 440  ALA A O     1 
ATOM   3464  C  CB    . ALA A 1 440 ? 25.373  7.654   67.601  1.00 29.64 ? 440  ALA A CB    1 
ATOM   3465  N  N     . ASP A 1 441 ? 24.008  8.915   70.838  1.00 30.43 ? 441  ASP A N     1 
ATOM   3466  C  CA    . ASP A 1 441 ? 23.541  10.098  71.558  1.00 30.69 ? 441  ASP A CA    1 
ATOM   3467  C  C     . ASP A 1 441 ? 24.230  10.131  72.942  1.00 30.69 ? 441  ASP A C     1 
ATOM   3468  O  O     . ASP A 1 441 ? 23.641  10.511  73.955  1.00 30.48 ? 441  ASP A O     1 
ATOM   3469  C  CB    . ASP A 1 441 ? 22.001  10.121  71.651  1.00 30.81 ? 441  ASP A CB    1 
ATOM   3470  C  CG    . ASP A 1 441 ? 21.350  10.897  70.490  1.00 31.71 ? 441  ASP A CG    1 
ATOM   3471  O  OD1   . ASP A 1 441 ? 20.518  10.317  69.745  1.00 31.81 ? 441  ASP A OD1   1 
ATOM   3472  O  OD2   . ASP A 1 441 ? 21.613  12.098  70.249  1.00 32.43 ? 441  ASP A OD2   1 
ATOM   3473  N  N     . GLY A 1 442 ? 25.491  9.701   72.957  1.00 30.83 ? 442  GLY A N     1 
ATOM   3474  C  CA    . GLY A 1 442 ? 26.421  10.023  74.024  1.00 30.90 ? 442  GLY A CA    1 
ATOM   3475  C  C     . GLY A 1 442 ? 27.093  11.364  73.736  1.00 31.09 ? 442  GLY A C     1 
ATOM   3476  O  O     . GLY A 1 442 ? 27.798  11.896  74.589  1.00 30.95 ? 442  GLY A O     1 
ATOM   3477  N  N     . ALA A 1 443 ? 26.886  11.901  72.524  1.00 31.43 ? 443  ALA A N     1 
ATOM   3478  C  CA    . ALA A 1 443 ? 27.443  13.201  72.101  1.00 31.61 ? 443  ALA A CA    1 
ATOM   3479  C  C     . ALA A 1 443 ? 27.014  14.355  73.025  1.00 31.79 ? 443  ALA A C     1 
ATOM   3480  O  O     . ALA A 1 443 ? 27.861  15.140  73.490  1.00 31.88 ? 443  ALA A O     1 
ATOM   3481  C  CB    . ALA A 1 443 ? 27.061  13.505  70.643  1.00 31.57 ? 443  ALA A CB    1 
ATOM   3482  N  N     . THR A 1 444 ? 25.706  14.447  73.286  1.00 31.75 ? 444  THR A N     1 
ATOM   3483  C  CA    . THR A 1 444 ? 25.168  15.340  74.330  1.00 31.67 ? 444  THR A CA    1 
ATOM   3484  C  C     . THR A 1 444 ? 25.838  15.044  75.702  1.00 31.42 ? 444  THR A C     1 
ATOM   3485  O  O     . THR A 1 444 ? 26.900  15.615  76.028  1.00 31.20 ? 444  THR A O     1 
ATOM   3486  C  CB    . THR A 1 444 ? 23.588  15.223  74.440  1.00 31.70 ? 444  THR A CB    1 
ATOM   3487  O  OG1   . THR A 1 444 ? 22.984  15.182  73.139  1.00 32.10 ? 444  THR A OG1   1 
ATOM   3488  C  CG2   . THR A 1 444 ? 22.972  16.467  75.099  1.00 31.60 ? 444  THR A CG2   1 
ATOM   3489  N  N     . ASP A 1 445 ? 25.229  14.127  76.464  1.00 30.93 ? 445  ASP A N     1 
ATOM   3490  C  CA    . ASP A 1 445 ? 25.623  13.818  77.851  1.00 30.48 ? 445  ASP A CA    1 
ATOM   3491  C  C     . ASP A 1 445 ? 27.103  13.421  78.041  1.00 29.86 ? 445  ASP A C     1 
ATOM   3492  O  O     . ASP A 1 445 ? 27.873  14.211  78.585  1.00 29.78 ? 445  ASP A O     1 
ATOM   3493  C  CB    . ASP A 1 445 ? 24.704  12.739  78.473  1.00 30.51 ? 445  ASP A CB    1 
ATOM   3494  C  CG    . ASP A 1 445 ? 24.084  11.793  77.431  1.00 30.79 ? 445  ASP A CG    1 
ATOM   3495  O  OD1   . ASP A 1 445 ? 24.811  11.312  76.524  1.00 30.47 ? 445  ASP A OD1   1 
ATOM   3496  O  OD2   . ASP A 1 445 ? 22.868  11.479  77.455  1.00 30.64 ? 445  ASP A OD2   1 
ATOM   3497  N  N     . TYR A 1 446 ? 27.488  12.227  77.577  1.00 28.99 ? 446  TYR A N     1 
ATOM   3498  C  CA    . TYR A 1 446 ? 28.763  11.595  77.953  1.00 28.30 ? 446  TYR A CA    1 
ATOM   3499  C  C     . TYR A 1 446 ? 30.010  12.486  77.912  1.00 27.55 ? 446  TYR A C     1 
ATOM   3500  O  O     . TYR A 1 446 ? 30.836  12.426  78.814  1.00 27.35 ? 446  TYR A O     1 
ATOM   3501  C  CB    . TYR A 1 446 ? 29.034  10.354  77.099  1.00 28.31 ? 446  TYR A CB    1 
ATOM   3502  C  CG    . TYR A 1 446 ? 30.422  9.839   77.321  1.00 29.20 ? 446  TYR A CG    1 
ATOM   3503  C  CD1   . TYR A 1 446 ? 31.503  10.391  76.634  1.00 30.53 ? 446  TYR A CD1   1 
ATOM   3504  C  CD2   . TYR A 1 446 ? 30.672  8.844   78.266  1.00 30.37 ? 446  TYR A CD2   1 
ATOM   3505  C  CE1   . TYR A 1 446 ? 32.797  9.952   76.856  1.00 31.86 ? 446  TYR A CE1   1 
ATOM   3506  C  CE2   . TYR A 1 446 ? 31.967  8.381   78.500  1.00 31.27 ? 446  TYR A CE2   1 
ATOM   3507  C  CZ    . TYR A 1 446 ? 33.028  8.939   77.789  1.00 32.69 ? 446  TYR A CZ    1 
ATOM   3508  O  OH    . TYR A 1 446 ? 34.323  8.507   78.003  1.00 34.32 ? 446  TYR A OH    1 
ATOM   3509  N  N     . LEU A 1 447 ? 30.143  13.284  76.859  1.00 26.85 ? 447  LEU A N     1 
ATOM   3510  C  CA    . LEU A 1 447 ? 31.368  14.030  76.596  1.00 26.33 ? 447  LEU A CA    1 
ATOM   3511  C  C     . LEU A 1 447 ? 31.497  15.221  77.504  1.00 26.04 ? 447  LEU A C     1 
ATOM   3512  O  O     . LEU A 1 447 ? 32.591  15.525  77.964  1.00 26.17 ? 447  LEU A O     1 
ATOM   3513  C  CB    . LEU A 1 447 ? 31.409  14.535  75.149  1.00 26.44 ? 447  LEU A CB    1 
ATOM   3514  C  CG    . LEU A 1 447 ? 31.742  13.552  74.026  1.00 26.42 ? 447  LEU A CG    1 
ATOM   3515  C  CD1   . LEU A 1 447 ? 31.447  14.185  72.651  1.00 26.36 ? 447  LEU A CD1   1 
ATOM   3516  C  CD2   . LEU A 1 447 ? 33.190  13.102  74.119  1.00 26.60 ? 447  LEU A CD2   1 
ATOM   3517  N  N     . GLU A 1 448 ? 30.398  15.932  77.731  1.00 25.82 ? 448  GLU A N     1 
ATOM   3518  C  CA    . GLU A 1 448 ? 30.427  17.041  78.688  1.00 25.65 ? 448  GLU A CA    1 
ATOM   3519  C  C     . GLU A 1 448 ? 30.735  16.501  80.084  1.00 25.16 ? 448  GLU A C     1 
ATOM   3520  O  O     . GLU A 1 448 ? 31.423  17.151  80.849  1.00 25.47 ? 448  GLU A O     1 
ATOM   3521  C  CB    . GLU A 1 448 ? 29.113  17.851  78.697  1.00 25.78 ? 448  GLU A CB    1 
ATOM   3522  C  CG    . GLU A 1 448 ? 29.290  19.312  79.125  1.00 25.62 ? 448  GLU A CG    1 
ATOM   3523  C  CD    . GLU A 1 448 ? 28.071  19.895  79.837  1.00 25.45 ? 448  GLU A CD    1 
ATOM   3524  O  OE1   . GLU A 1 448 ? 27.089  20.285  79.158  1.00 24.27 ? 448  GLU A OE1   1 
ATOM   3525  O  OE2   . GLU A 1 448 ? 28.098  19.973  81.087  1.00 26.31 ? 448  GLU A OE2   1 
ATOM   3526  N  N     . ARG A 1 449 ? 30.243  15.303  80.398  1.00 24.58 ? 449  ARG A N     1 
ATOM   3527  C  CA    . ARG A 1 449 ? 30.433  14.706  81.719  1.00 24.08 ? 449  ARG A CA    1 
ATOM   3528  C  C     . ARG A 1 449 ? 31.889  14.273  81.893  1.00 23.47 ? 449  ARG A C     1 
ATOM   3529  O  O     . ARG A 1 449 ? 32.508  14.595  82.893  1.00 23.16 ? 449  ARG A O     1 
ATOM   3530  C  CB    . ARG A 1 449 ? 29.472  13.520  81.944  1.00 24.16 ? 449  ARG A CB    1 
ATOM   3531  C  CG    . ARG A 1 449 ? 27.988  13.895  81.952  1.00 24.22 ? 449  ARG A CG    1 
ATOM   3532  C  CD    . ARG A 1 449 ? 27.265  13.705  83.294  1.00 25.54 ? 449  ARG A CD    1 
ATOM   3533  N  NE    . ARG A 1 449 ? 26.444  12.488  83.323  1.00 26.47 ? 449  ARG A NE    1 
ATOM   3534  C  CZ    . ARG A 1 449 ? 25.652  12.118  84.332  1.00 26.33 ? 449  ARG A CZ    1 
ATOM   3535  N  NH1   . ARG A 1 449 ? 25.548  12.864  85.425  1.00 26.56 ? 449  ARG A NH1   1 
ATOM   3536  N  NH2   . ARG A 1 449 ? 24.958  10.988  84.245  1.00 26.12 ? 449  ARG A NH2   1 
ATOM   3537  N  N     . LEU A 1 450 ? 32.435  13.561  80.911  1.00 22.89 ? 450  LEU A N     1 
ATOM   3538  C  CA    . LEU A 1 450 ? 33.839  13.167  80.949  1.00 22.42 ? 450  LEU A CA    1 
ATOM   3539  C  C     . LEU A 1 450 ? 34.719  14.387  81.015  1.00 22.32 ? 450  LEU A C     1 
ATOM   3540  O  O     . LEU A 1 450 ? 35.792  14.329  81.601  1.00 22.41 ? 450  LEU A O     1 
ATOM   3541  C  CB    . LEU A 1 450 ? 34.234  12.362  79.717  1.00 22.32 ? 450  LEU A CB    1 
ATOM   3542  C  CG    . LEU A 1 450 ? 35.727  12.445  79.364  1.00 22.18 ? 450  LEU A CG    1 
ATOM   3543  C  CD1   . LEU A 1 450 ? 36.567  11.641  80.360  1.00 21.98 ? 450  LEU A CD1   1 
ATOM   3544  C  CD2   . LEU A 1 450 ? 35.992  11.999  77.937  1.00 22.21 ? 450  LEU A CD2   1 
ATOM   3545  N  N     . GLU A 1 451 ? 34.279  15.478  80.390  1.00 22.11 ? 451  GLU A N     1 
ATOM   3546  C  CA    . GLU A 1 451 ? 35.056  16.709  80.360  1.00 21.94 ? 451  GLU A CA    1 
ATOM   3547  C  C     . GLU A 1 451 ? 35.146  17.319  81.751  1.00 21.87 ? 451  GLU A C     1 
ATOM   3548  O  O     . GLU A 1 451 ? 36.236  17.583  82.251  1.00 21.82 ? 451  GLU A O     1 
ATOM   3549  C  CB    . GLU A 1 451 ? 34.426  17.741  79.417  1.00 21.96 ? 451  GLU A CB    1 
ATOM   3550  C  CG    . GLU A 1 451 ? 35.240  19.033  79.339  1.00 22.14 ? 451  GLU A CG    1 
ATOM   3551  C  CD    . GLU A 1 451 ? 34.639  20.094  78.443  1.00 21.41 ? 451  GLU A CD    1 
ATOM   3552  O  OE1   . GLU A 1 451 ? 34.479  19.851  77.223  1.00 19.65 ? 451  GLU A OE1   1 
ATOM   3553  O  OE2   . GLU A 1 451 ? 34.358  21.189  78.976  1.00 22.39 ? 451  GLU A OE2   1 
ATOM   3554  N  N     . VAL A 1 452 ? 33.983  17.550  82.354  1.00 21.79 ? 452  VAL A N     1 
ATOM   3555  C  CA    . VAL A 1 452 ? 33.874  18.244  83.632  1.00 21.85 ? 452  VAL A CA    1 
ATOM   3556  C  C     . VAL A 1 452 ? 34.497  17.396  84.716  1.00 21.85 ? 452  VAL A C     1 
ATOM   3557  O  O     . VAL A 1 452 ? 35.041  17.907  85.671  1.00 22.11 ? 452  VAL A O     1 
ATOM   3558  C  CB    . VAL A 1 452 ? 32.399  18.513  84.011  1.00 21.94 ? 452  VAL A CB    1 
ATOM   3559  C  CG1   . VAL A 1 452 ? 32.283  19.007  85.473  1.00 22.01 ? 452  VAL A CG1   1 
ATOM   3560  C  CG2   . VAL A 1 452 ? 31.765  19.516  83.041  1.00 21.67 ? 452  VAL A CG2   1 
ATOM   3561  N  N     . ARG A 1 453 ? 34.382  16.089  84.550  1.00 22.05 ? 453  ARG A N     1 
ATOM   3562  C  CA    . ARG A 1 453 ? 34.952  15.109  85.456  1.00 22.17 ? 453  ARG A CA    1 
ATOM   3563  C  C     . ARG A 1 453 ? 36.470  15.227  85.451  1.00 22.04 ? 453  ARG A C     1 
ATOM   3564  O  O     . ARG A 1 453 ? 37.085  15.331  86.506  1.00 21.58 ? 453  ARG A O     1 
ATOM   3565  C  CB    . ARG A 1 453 ? 34.497  13.716  85.007  1.00 22.34 ? 453  ARG A CB    1 
ATOM   3566  C  CG    . ARG A 1 453 ? 35.148  12.552  85.683  1.00 23.64 ? 453  ARG A CG    1 
ATOM   3567  C  CD    . ARG A 1 453 ? 34.208  11.345  85.874  1.00 26.17 ? 453  ARG A CD    1 
ATOM   3568  N  NE    . ARG A 1 453 ? 33.660  10.804  84.624  1.00 27.55 ? 453  ARG A NE    1 
ATOM   3569  C  CZ    . ARG A 1 453 ? 34.366  10.144  83.699  1.00 28.97 ? 453  ARG A CZ    1 
ATOM   3570  N  NH1   . ARG A 1 453 ? 35.677  9.921   83.848  1.00 28.46 ? 453  ARG A NH1   1 
ATOM   3571  N  NH2   . ARG A 1 453 ? 33.749  9.705   82.608  1.00 29.85 ? 453  ARG A NH2   1 
ATOM   3572  N  N     . GLU A 1 454 ? 37.061  15.234  84.260  1.00 22.13 ? 454  GLU A N     1 
ATOM   3573  C  CA    . GLU A 1 454 ? 38.506  15.302  84.119  1.00 22.63 ? 454  GLU A CA    1 
ATOM   3574  C  C     . GLU A 1 454 ? 39.045  16.706  84.374  1.00 23.13 ? 454  GLU A C     1 
ATOM   3575  O  O     . GLU A 1 454 ? 40.196  16.865  84.761  1.00 23.00 ? 454  GLU A O     1 
ATOM   3576  C  CB    . GLU A 1 454 ? 38.921  14.832  82.739  1.00 22.94 ? 454  GLU A CB    1 
ATOM   3577  C  CG    . GLU A 1 454 ? 38.688  13.349  82.508  1.00 23.27 ? 454  GLU A CG    1 
ATOM   3578  C  CD    . GLU A 1 454 ? 39.650  12.500  83.296  1.00 24.59 ? 454  GLU A CD    1 
ATOM   3579  O  OE1   . GLU A 1 454 ? 40.869  12.663  83.078  1.00 25.93 ? 454  GLU A OE1   1 
ATOM   3580  O  OE2   . GLU A 1 454 ? 39.194  11.695  84.142  1.00 23.38 ? 454  GLU A OE2   1 
ATOM   3581  N  N     . ARG A 1 455 ? 38.208  17.724  84.199  1.00 23.66 ? 455  ARG A N     1 
ATOM   3582  C  CA    . ARG A 1 455 ? 38.601  19.095  84.534  1.00 23.85 ? 455  ARG A CA    1 
ATOM   3583  C  C     . ARG A 1 455 ? 38.689  19.295  86.050  1.00 23.88 ? 455  ARG A C     1 
ATOM   3584  O  O     . ARG A 1 455 ? 39.632  19.916  86.535  1.00 24.09 ? 455  ARG A O     1 
ATOM   3585  C  CB    . ARG A 1 455 ? 37.625  20.105  83.927  1.00 23.82 ? 455  ARG A CB    1 
ATOM   3586  C  CG    . ARG A 1 455 ? 38.165  21.518  83.895  1.00 24.28 ? 455  ARG A CG    1 
ATOM   3587  C  CD    . ARG A 1 455 ? 37.408  22.441  82.974  1.00 25.79 ? 455  ARG A CD    1 
ATOM   3588  N  NE    . ARG A 1 455 ? 36.108  22.819  83.541  1.00 28.23 ? 455  ARG A NE    1 
ATOM   3589  C  CZ    . ARG A 1 455 ? 34.909  22.623  82.968  1.00 29.15 ? 455  ARG A CZ    1 
ATOM   3590  N  NH1   . ARG A 1 455 ? 34.788  22.036  81.773  1.00 29.89 ? 455  ARG A NH1   1 
ATOM   3591  N  NH2   . ARG A 1 455 ? 33.811  23.020  83.607  1.00 28.80 ? 455  ARG A NH2   1 
ATOM   3592  N  N     . GLU A 1 456 ? 37.700  18.771  86.781  1.00 24.04 ? 456  GLU A N     1 
ATOM   3593  C  CA    . GLU A 1 456 ? 37.647  18.844  88.253  1.00 24.19 ? 456  GLU A CA    1 
ATOM   3594  C  C     . GLU A 1 456 ? 38.796  18.009  88.841  1.00 23.65 ? 456  GLU A C     1 
ATOM   3595  O  O     . GLU A 1 456 ? 39.520  18.484  89.715  1.00 23.82 ? 456  GLU A O     1 
ATOM   3596  C  CB    . GLU A 1 456 ? 36.278  18.351  88.799  1.00 24.42 ? 456  GLU A CB    1 
ATOM   3597  C  CG    . GLU A 1 456 ? 35.694  19.148  89.983  1.00 26.89 ? 456  GLU A CG    1 
ATOM   3598  C  CD    . GLU A 1 456 ? 35.593  18.359  91.315  1.00 28.98 ? 456  GLU A CD    1 
ATOM   3599  O  OE1   . GLU A 1 456 ? 34.561  17.685  91.563  1.00 28.70 ? 456  GLU A OE1   1 
ATOM   3600  O  OE2   . GLU A 1 456 ? 36.536  18.427  92.145  1.00 30.64 ? 456  GLU A OE2   1 
ATOM   3601  N  N     . ARG A 1 457 ? 38.962  16.788  88.317  1.00 22.78 ? 457  ARG A N     1 
ATOM   3602  C  CA    . ARG A 1 457 ? 39.921  15.801  88.810  1.00 21.92 ? 457  ARG A CA    1 
ATOM   3603  C  C     . ARG A 1 457 ? 41.357  16.266  88.687  1.00 21.20 ? 457  ARG A C     1 
ATOM   3604  O  O     . ARG A 1 457 ? 42.121  16.088  89.611  1.00 20.87 ? 457  ARG A O     1 
ATOM   3605  C  CB    . ARG A 1 457 ? 39.755  14.476  88.050  1.00 22.24 ? 457  ARG A CB    1 
ATOM   3606  C  CG    . ARG A 1 457 ? 40.668  13.324  88.531  1.00 22.91 ? 457  ARG A CG    1 
ATOM   3607  C  CD    . ARG A 1 457 ? 40.372  11.936  87.909  1.00 22.88 ? 457  ARG A CD    1 
ATOM   3608  N  NE    . ARG A 1 457 ? 40.943  11.774  86.570  1.00 22.95 ? 457  ARG A NE    1 
ATOM   3609  C  CZ    . ARG A 1 457 ? 42.230  11.500  86.299  1.00 23.39 ? 457  ARG A CZ    1 
ATOM   3610  N  NH1   . ARG A 1 457 ? 43.135  11.357  87.264  1.00 23.74 ? 457  ARG A NH1   1 
ATOM   3611  N  NH2   . ARG A 1 457 ? 42.625  11.382  85.036  1.00 23.75 ? 457  ARG A NH2   1 
ATOM   3612  N  N     . THR A 1 458 ? 41.727  16.840  87.543  1.00 20.69 ? 458  THR A N     1 
ATOM   3613  C  CA    . THR A 1 458 ? 43.099  17.314  87.314  1.00 20.00 ? 458  THR A CA    1 
ATOM   3614  C  C     . THR A 1 458 ? 43.311  18.745  87.832  1.00 19.81 ? 458  THR A C     1 
ATOM   3615  O  O     . THR A 1 458 ? 44.444  19.180  88.065  1.00 19.62 ? 458  THR A O     1 
ATOM   3616  C  CB    . THR A 1 458 ? 43.457  17.245  85.823  1.00 20.00 ? 458  THR A CB    1 
ATOM   3617  O  OG1   . THR A 1 458 ? 42.508  17.998  85.072  1.00 19.56 ? 458  THR A OG1   1 
ATOM   3618  C  CG2   . THR A 1 458 ? 43.333  15.808  85.262  1.00 19.54 ? 458  THR A CG2   1 
ATOM   3619  N  N     . GLY A 1 459 ? 42.216  19.468  88.042  1.00 19.49 ? 459  GLY A N     1 
ATOM   3620  C  CA    . GLY A 1 459 ? 42.290  20.876  88.390  1.00 19.40 ? 459  GLY A CA    1 
ATOM   3621  C  C     . GLY A 1 459 ? 42.946  21.703  87.303  1.00 19.15 ? 459  GLY A C     1 
ATOM   3622  O  O     . GLY A 1 459 ? 43.593  22.706  87.589  1.00 19.30 ? 459  GLY A O     1 
ATOM   3623  N  N     . LEU A 1 460 ? 42.789  21.274  86.054  1.00 18.83 ? 460  LEU A N     1 
ATOM   3624  C  CA    . LEU A 1 460 ? 43.396  21.964  84.919  1.00 18.77 ? 460  LEU A CA    1 
ATOM   3625  C  C     . LEU A 1 460 ? 42.293  22.646  84.127  1.00 18.74 ? 460  LEU A C     1 
ATOM   3626  O  O     . LEU A 1 460 ? 41.613  22.005  83.331  1.00 18.16 ? 460  LEU A O     1 
ATOM   3627  C  CB    . LEU A 1 460 ? 44.212  20.997  84.055  1.00 18.15 ? 460  LEU A CB    1 
ATOM   3628  C  CG    . LEU A 1 460 ? 45.470  20.452  84.748  1.00 18.23 ? 460  LEU A CG    1 
ATOM   3629  C  CD1   . LEU A 1 460 ? 46.363  19.770  83.751  1.00 17.67 ? 460  LEU A CD1   1 
ATOM   3630  C  CD2   . LEU A 1 460 ? 46.282  21.502  85.550  1.00 17.61 ? 460  LEU A CD2   1 
ATOM   3631  N  N     . ASP A 1 461 ? 42.145  23.952  84.368  1.00 19.05 ? 461  ASP A N     1 
ATOM   3632  C  CA    . ASP A 1 461 ? 40.945  24.706  83.975  1.00 19.46 ? 461  ASP A CA    1 
ATOM   3633  C  C     . ASP A 1 461 ? 40.789  24.934  82.473  1.00 19.73 ? 461  ASP A C     1 
ATOM   3634  O  O     . ASP A 1 461 ? 39.682  25.136  82.000  1.00 20.01 ? 461  ASP A O     1 
ATOM   3635  C  CB    . ASP A 1 461 ? 40.829  26.026  84.777  1.00 19.55 ? 461  ASP A CB    1 
ATOM   3636  C  CG    . ASP A 1 461 ? 41.800  27.120  84.311  1.00 19.18 ? 461  ASP A CG    1 
ATOM   3637  O  OD1   . ASP A 1 461 ? 42.827  26.812  83.662  1.00 19.32 ? 461  ASP A OD1   1 
ATOM   3638  O  OD2   . ASP A 1 461 ? 41.606  28.327  84.566  1.00 17.20 ? 461  ASP A OD2   1 
ATOM   3639  N  N     . THR A 1 462 ? 41.882  24.861  81.724  1.00 20.48 ? 462  THR A N     1 
ATOM   3640  C  CA    . THR A 1 462 ? 41.822  24.952  80.259  1.00 20.96 ? 462  THR A CA    1 
ATOM   3641  C  C     . THR A 1 462 ? 41.433  23.624  79.625  1.00 21.51 ? 462  THR A C     1 
ATOM   3642  O  O     . THR A 1 462 ? 41.464  23.503  78.406  1.00 22.13 ? 462  THR A O     1 
ATOM   3643  C  CB    . THR A 1 462 ? 43.185  25.320  79.670  1.00 20.71 ? 462  THR A CB    1 
ATOM   3644  O  OG1   . THR A 1 462 ? 44.132  24.317  80.063  1.00 21.88 ? 462  THR A OG1   1 
ATOM   3645  C  CG2   . THR A 1 462 ? 43.730  26.629  80.227  1.00 20.35 ? 462  THR A CG2   1 
ATOM   3646  N  N     . LEU A 1 463 ? 41.091  22.619  80.419  1.00 22.01 ? 463  LEU A N     1 
ATOM   3647  C  CA    . LEU A 1 463 ? 40.814  21.305  79.848  1.00 22.58 ? 463  LEU A CA    1 
ATOM   3648  C  C     . LEU A 1 463 ? 39.453  21.302  79.136  1.00 22.90 ? 463  LEU A C     1 
ATOM   3649  O  O     . LEU A 1 463 ? 38.439  21.681  79.731  1.00 23.05 ? 463  LEU A O     1 
ATOM   3650  C  CB    . LEU A 1 463 ? 40.865  20.218  80.928  1.00 22.71 ? 463  LEU A CB    1 
ATOM   3651  C  CG    . LEU A 1 463 ? 40.837  18.770  80.428  1.00 22.62 ? 463  LEU A CG    1 
ATOM   3652  C  CD1   . LEU A 1 463 ? 41.583  17.844  81.400  1.00 22.39 ? 463  LEU A CD1   1 
ATOM   3653  C  CD2   . LEU A 1 463 ? 39.408  18.286  80.206  1.00 22.50 ? 463  LEU A CD2   1 
ATOM   3654  N  N     . LYS A 1 464 ? 39.454  20.878  77.869  1.00 22.90 ? 464  LYS A N     1 
ATOM   3655  C  CA    . LYS A 1 464 ? 38.242  20.698  77.068  1.00 23.01 ? 464  LYS A CA    1 
ATOM   3656  C  C     . LYS A 1 464 ? 38.247  19.313  76.411  1.00 22.46 ? 464  LYS A C     1 
ATOM   3657  O  O     . LYS A 1 464 ? 39.284  18.656  76.371  1.00 22.58 ? 464  LYS A O     1 
ATOM   3658  C  CB    . LYS A 1 464 ? 38.168  21.796  75.994  1.00 23.41 ? 464  LYS A CB    1 
ATOM   3659  C  CG    . LYS A 1 464 ? 38.385  23.220  76.520  1.00 25.06 ? 464  LYS A CG    1 
ATOM   3660  C  CD    . LYS A 1 464 ? 38.419  24.248  75.366  1.00 28.32 ? 464  LYS A CD    1 
ATOM   3661  C  CE    . LYS A 1 464 ? 38.450  25.753  75.850  1.00 29.01 ? 464  LYS A CE    1 
ATOM   3662  N  NZ    . LYS A 1 464 ? 39.308  26.030  77.076  1.00 29.14 ? 464  LYS A NZ    1 
ATOM   3663  N  N     . VAL A 1 465 ? 37.096  18.865  75.911  1.00 21.76 ? 465  VAL A N     1 
ATOM   3664  C  CA    . VAL A 1 465 ? 37.021  17.644  75.096  1.00 21.25 ? 465  VAL A CA    1 
ATOM   3665  C  C     . VAL A 1 465 ? 36.463  17.977  73.717  1.00 20.88 ? 465  VAL A C     1 
ATOM   3666  O  O     . VAL A 1 465 ? 35.422  18.603  73.592  1.00 20.51 ? 465  VAL A O     1 
ATOM   3667  C  CB    . VAL A 1 465 ? 36.117  16.549  75.718  1.00 21.30 ? 465  VAL A CB    1 
ATOM   3668  C  CG1   . VAL A 1 465 ? 36.163  15.273  74.889  1.00 21.37 ? 465  VAL A CG1   1 
ATOM   3669  C  CG2   . VAL A 1 465 ? 36.530  16.227  77.129  1.00 21.32 ? 465  VAL A CG2   1 
ATOM   3670  N  N     . GLY A 1 466 ? 37.157  17.529  72.682  1.00 21.00 ? 466  GLY A N     1 
ATOM   3671  C  CA    . GLY A 1 466 ? 36.737  17.751  71.316  1.00 20.90 ? 466  GLY A CA    1 
ATOM   3672  C  C     . GLY A 1 466 ? 36.831  16.538  70.405  1.00 21.07 ? 466  GLY A C     1 
ATOM   3673  O  O     . GLY A 1 466 ? 37.193  15.434  70.810  1.00 20.78 ? 466  GLY A O     1 
ATOM   3674  N  N     . PHE A 1 467 ? 36.451  16.777  69.151  1.00 21.55 ? 467  PHE A N     1 
ATOM   3675  C  CA    . PHE A 1 467 ? 36.596  15.824  68.057  1.00 21.08 ? 467  PHE A CA    1 
ATOM   3676  C  C     . PHE A 1 467 ? 37.170  16.530  66.825  1.00 21.52 ? 467  PHE A C     1 
ATOM   3677  O  O     . PHE A 1 467 ? 36.938  17.721  66.570  1.00 21.49 ? 467  PHE A O     1 
ATOM   3678  C  CB    . PHE A 1 467 ? 35.259  15.200  67.699  1.00 20.90 ? 467  PHE A CB    1 
ATOM   3679  C  CG    . PHE A 1 467 ? 35.316  14.321  66.493  1.00 19.76 ? 467  PHE A CG    1 
ATOM   3680  C  CD1   . PHE A 1 467 ? 35.686  12.991  66.609  1.00 18.98 ? 467  PHE A CD1   1 
ATOM   3681  C  CD2   . PHE A 1 467 ? 35.031  14.832  65.237  1.00 18.12 ? 467  PHE A CD2   1 
ATOM   3682  C  CE1   . PHE A 1 467 ? 35.748  12.175  65.488  1.00 19.12 ? 467  PHE A CE1   1 
ATOM   3683  C  CE2   . PHE A 1 467 ? 35.100  14.033  64.120  1.00 18.34 ? 467  PHE A CE2   1 
ATOM   3684  C  CZ    . PHE A 1 467 ? 35.451  12.697  64.241  1.00 18.66 ? 467  PHE A CZ    1 
ATOM   3685  N  N     . ASN A 1 468 ? 37.910  15.754  66.052  1.00 21.77 ? 468  ASN A N     1 
ATOM   3686  C  CA    . ASN A 1 468 ? 38.631  16.246  64.903  1.00 21.42 ? 468  ASN A CA    1 
ATOM   3687  C  C     . ASN A 1 468 ? 38.690  15.087  63.927  1.00 21.08 ? 468  ASN A C     1 
ATOM   3688  O  O     . ASN A 1 468 ? 39.181  14.029  64.293  1.00 21.08 ? 468  ASN A O     1 
ATOM   3689  C  CB    . ASN A 1 468 ? 40.018  16.632  65.386  1.00 21.74 ? 468  ASN A CB    1 
ATOM   3690  C  CG    . ASN A 1 468 ? 40.924  17.013  64.289  1.00 21.37 ? 468  ASN A CG    1 
ATOM   3691  O  OD1   . ASN A 1 468 ? 41.573  16.164  63.716  1.00 21.62 ? 468  ASN A OD1   1 
ATOM   3692  N  ND2   . ASN A 1 468 ? 40.999  18.304  63.993  1.00 23.06 ? 468  ASN A ND2   1 
ATOM   3693  N  N     . ALA A 1 469 ? 38.193  15.278  62.706  1.00 20.70 ? 469  ALA A N     1 
ATOM   3694  C  CA    . ALA A 1 469 ? 38.026  14.177  61.746  1.00 20.41 ? 469  ALA A CA    1 
ATOM   3695  C  C     . ALA A 1 469 ? 39.320  13.389  61.476  1.00 20.26 ? 469  ALA A C     1 
ATOM   3696  O  O     . ALA A 1 469 ? 39.308  12.170  61.304  1.00 20.24 ? 469  ALA A O     1 
ATOM   3697  C  CB    . ALA A 1 469 ? 37.433  14.698  60.451  1.00 20.10 ? 469  ALA A CB    1 
ATOM   3698  N  N     . VAL A 1 470 ? 40.444  14.089  61.478  1.00 20.20 ? 470  VAL A N     1 
ATOM   3699  C  CA    . VAL A 1 470 ? 41.734  13.462  61.187  1.00 20.01 ? 470  VAL A CA    1 
ATOM   3700  C  C     . VAL A 1 470 ? 42.331  12.608  62.349  1.00 20.04 ? 470  VAL A C     1 
ATOM   3701  O  O     . VAL A 1 470 ? 43.039  11.645  62.083  1.00 20.26 ? 470  VAL A O     1 
ATOM   3702  C  CB    . VAL A 1 470 ? 42.743  14.535  60.655  1.00 19.57 ? 470  VAL A CB    1 
ATOM   3703  C  CG1   . VAL A 1 470 ? 44.122  13.939  60.415  1.00 19.55 ? 470  VAL A CG1   1 
ATOM   3704  C  CG2   . VAL A 1 470 ? 42.221  15.159  59.368  1.00 18.83 ? 470  VAL A CG2   1 
ATOM   3705  N  N     . HIS A 1 471 ? 42.064  12.961  63.608  1.00 20.09 ? 471  HIS A N     1 
ATOM   3706  C  CA    . HIS A 1 471 ? 42.659  12.268  64.764  1.00 20.37 ? 471  HIS A CA    1 
ATOM   3707  C  C     . HIS A 1 471 ? 41.646  11.689  65.756  1.00 20.16 ? 471  HIS A C     1 
ATOM   3708  O  O     . HIS A 1 471 ? 42.037  11.086  66.761  1.00 20.29 ? 471  HIS A O     1 
ATOM   3709  C  CB    . HIS A 1 471 ? 43.574  13.215  65.560  1.00 20.58 ? 471  HIS A CB    1 
ATOM   3710  C  CG    . HIS A 1 471 ? 44.495  14.025  64.716  1.00 21.08 ? 471  HIS A CG    1 
ATOM   3711  N  ND1   . HIS A 1 471 ? 45.816  14.215  65.039  1.00 23.22 ? 471  HIS A ND1   1 
ATOM   3712  C  CD2   . HIS A 1 471 ? 44.291  14.700  63.563  1.00 21.81 ? 471  HIS A CD2   1 
ATOM   3713  C  CE1   . HIS A 1 471 ? 46.389  14.966  64.111  1.00 23.78 ? 471  HIS A CE1   1 
ATOM   3714  N  NE2   . HIS A 1 471 ? 45.484  15.272  63.204  1.00 21.69 ? 471  HIS A NE2   1 
ATOM   3715  N  N     . GLY A 1 472 ? 40.359  11.883  65.497  1.00 20.10 ? 472  GLY A N     1 
ATOM   3716  C  CA    . GLY A 1 472 ? 39.316  11.450  66.411  1.00 20.25 ? 472  GLY A CA    1 
ATOM   3717  C  C     . GLY A 1 472 ? 39.196  12.315  67.657  1.00 20.15 ? 472  GLY A C     1 
ATOM   3718  O  O     . GLY A 1 472 ? 39.560  13.486  67.653  1.00 20.41 ? 472  GLY A O     1 
ATOM   3719  N  N     . TYR A 1 473 ? 38.669  11.719  68.719  1.00 19.94 ? 473  TYR A N     1 
ATOM   3720  C  CA    . TYR A 1 473 ? 38.429  12.406  69.985  1.00 19.56 ? 473  TYR A CA    1 
ATOM   3721  C  C     . TYR A 1 473 ? 39.717  12.702  70.756  1.00 19.66 ? 473  TYR A C     1 
ATOM   3722  O  O     . TYR A 1 473 ? 40.734  12.034  70.583  1.00 19.72 ? 473  TYR A O     1 
ATOM   3723  C  CB    . TYR A 1 473 ? 37.466  11.576  70.845  1.00 19.23 ? 473  TYR A CB    1 
ATOM   3724  C  CG    . TYR A 1 473 ? 36.060  11.620  70.328  1.00 18.42 ? 473  TYR A CG    1 
ATOM   3725  C  CD1   . TYR A 1 473 ? 35.587  10.654  69.467  1.00 19.22 ? 473  TYR A CD1   1 
ATOM   3726  C  CD2   . TYR A 1 473 ? 35.211  12.656  70.674  1.00 18.54 ? 473  TYR A CD2   1 
ATOM   3727  C  CE1   . TYR A 1 473 ? 34.283  10.711  68.963  1.00 19.61 ? 473  TYR A CE1   1 
ATOM   3728  C  CE2   . TYR A 1 473 ? 33.916  12.726  70.187  1.00 18.79 ? 473  TYR A CE2   1 
ATOM   3729  C  CZ    . TYR A 1 473 ? 33.451  11.757  69.333  1.00 19.09 ? 473  TYR A CZ    1 
ATOM   3730  O  OH    . TYR A 1 473 ? 32.158  11.844  68.856  1.00 18.00 ? 473  TYR A OH    1 
ATOM   3731  N  N     . TYR A 1 474 ? 39.666  13.714  71.614  1.00 19.72 ? 474  TYR A N     1 
ATOM   3732  C  CA    . TYR A 1 474 ? 40.831  14.087  72.397  1.00 19.59 ? 474  TYR A CA    1 
ATOM   3733  C  C     . TYR A 1 474 ? 40.480  14.852  73.650  1.00 19.38 ? 474  TYR A C     1 
ATOM   3734  O  O     . TYR A 1 474 ? 39.338  15.252  73.831  1.00 19.50 ? 474  TYR A O     1 
ATOM   3735  C  CB    . TYR A 1 474 ? 41.766  14.929  71.549  1.00 19.76 ? 474  TYR A CB    1 
ATOM   3736  C  CG    . TYR A 1 474 ? 41.139  16.175  70.975  1.00 20.56 ? 474  TYR A CG    1 
ATOM   3737  C  CD1   . TYR A 1 474 ? 40.947  17.292  71.765  1.00 22.43 ? 474  TYR A CD1   1 
ATOM   3738  C  CD2   . TYR A 1 474 ? 40.758  16.240  69.648  1.00 21.23 ? 474  TYR A CD2   1 
ATOM   3739  C  CE1   . TYR A 1 474 ? 40.386  18.435  71.265  1.00 23.22 ? 474  TYR A CE1   1 
ATOM   3740  C  CE2   . TYR A 1 474 ? 40.192  17.383  69.133  1.00 22.95 ? 474  TYR A CE2   1 
ATOM   3741  C  CZ    . TYR A 1 474 ? 40.009  18.493  69.957  1.00 22.67 ? 474  TYR A CZ    1 
ATOM   3742  O  OH    . TYR A 1 474 ? 39.468  19.669  69.497  1.00 19.78 ? 474  TYR A OH    1 
ATOM   3743  N  N     . ILE A 1 475 ? 41.476  15.041  74.510  1.00 19.15 ? 475  ILE A N     1 
ATOM   3744  C  CA    . ILE A 1 475 ? 41.365  15.935  75.644  1.00 19.53 ? 475  ILE A CA    1 
ATOM   3745  C  C     . ILE A 1 475 ? 42.409  17.054  75.459  1.00 20.20 ? 475  ILE A C     1 
ATOM   3746  O  O     . ILE A 1 475 ? 43.611  16.818  75.531  1.00 20.86 ? 475  ILE A O     1 
ATOM   3747  C  CB    . ILE A 1 475 ? 41.566  15.184  76.973  1.00 19.21 ? 475  ILE A CB    1 
ATOM   3748  C  CG1   . ILE A 1 475 ? 40.783  13.864  76.966  1.00 18.78 ? 475  ILE A CG1   1 
ATOM   3749  C  CG2   . ILE A 1 475 ? 41.088  16.046  78.114  1.00 19.43 ? 475  ILE A CG2   1 
ATOM   3750  C  CD1   . ILE A 1 475 ? 40.960  12.991  78.193  1.00 17.00 ? 475  ILE A CD1   1 
ATOM   3751  N  N     . GLN A 1 476 ? 41.950  18.265  75.188  1.00 20.28 ? 476  GLN A N     1 
ATOM   3752  C  CA    . GLN A 1 476 ? 42.856  19.392  75.057  1.00 20.63 ? 476  GLN A CA    1 
ATOM   3753  C  C     . GLN A 1 476 ? 43.293  19.965  76.396  1.00 20.72 ? 476  GLN A C     1 
ATOM   3754  O  O     . GLN A 1 476 ? 42.519  19.987  77.350  1.00 21.18 ? 476  GLN A O     1 
ATOM   3755  C  CB    . GLN A 1 476 ? 42.192  20.499  74.253  1.00 20.77 ? 476  GLN A CB    1 
ATOM   3756  C  CG    . GLN A 1 476 ? 43.164  21.422  73.606  1.00 20.24 ? 476  GLN A CG    1 
ATOM   3757  C  CD    . GLN A 1 476 ? 42.485  22.376  72.686  1.00 19.36 ? 476  GLN A CD    1 
ATOM   3758  O  OE1   . GLN A 1 476 ? 42.288  22.063  71.533  1.00 19.96 ? 476  GLN A OE1   1 
ATOM   3759  N  NE2   . GLN A 1 476 ? 42.116  23.545  73.190  1.00 19.21 ? 476  GLN A NE2   1 
ATOM   3760  N  N     . ILE A 1 477 ? 44.539  20.422  76.448  1.00 20.45 ? 477  ILE A N     1 
ATOM   3761  C  CA    . ILE A 1 477 ? 45.065  21.167  77.582  1.00 20.76 ? 477  ILE A CA    1 
ATOM   3762  C  C     . ILE A 1 477 ? 45.977  22.214  77.005  1.00 21.12 ? 477  ILE A C     1 
ATOM   3763  O  O     . ILE A 1 477 ? 46.709  21.917  76.073  1.00 21.38 ? 477  ILE A O     1 
ATOM   3764  C  CB    . ILE A 1 477 ? 45.871  20.260  78.531  1.00 20.79 ? 477  ILE A CB    1 
ATOM   3765  C  CG1   . ILE A 1 477 ? 45.000  19.120  79.046  1.00 20.44 ? 477  ILE A CG1   1 
ATOM   3766  C  CG2   . ILE A 1 477 ? 46.438  21.062  79.716  1.00 20.78 ? 477  ILE A CG2   1 
ATOM   3767  C  CD1   . ILE A 1 477 ? 45.620  18.335  80.165  1.00 20.76 ? 477  ILE A CD1   1 
ATOM   3768  N  N     . SER A 1 478 ? 45.930  23.436  77.538  1.00 21.82 ? 478  SER A N     1 
ATOM   3769  C  CA    . SER A 1 478 ? 46.799  24.534  77.077  1.00 22.00 ? 478  SER A CA    1 
ATOM   3770  C  C     . SER A 1 478 ? 48.281  24.141  77.156  1.00 22.64 ? 478  SER A C     1 
ATOM   3771  O  O     . SER A 1 478 ? 48.644  23.200  77.876  1.00 23.02 ? 478  SER A O     1 
ATOM   3772  C  CB    . SER A 1 478 ? 46.578  25.762  77.930  1.00 21.99 ? 478  SER A CB    1 
ATOM   3773  O  OG    . SER A 1 478 ? 47.116  25.560  79.225  1.00 21.00 ? 478  SER A OG    1 
ATOM   3774  N  N     . ARG A 1 479 ? 49.136  24.841  76.417  1.00 22.81 ? 479  ARG A N     1 
ATOM   3775  C  CA    . ARG A 1 479 ? 50.557  24.504  76.414  1.00 23.16 ? 479  ARG A CA    1 
ATOM   3776  C  C     . ARG A 1 479 ? 51.141  24.706  77.811  1.00 22.68 ? 479  ARG A C     1 
ATOM   3777  O  O     . ARG A 1 479 ? 51.872  23.847  78.304  1.00 22.89 ? 479  ARG A O     1 
ATOM   3778  C  CB    . ARG A 1 479 ? 51.321  25.318  75.366  1.00 23.57 ? 479  ARG A CB    1 
ATOM   3779  C  CG    . ARG A 1 479 ? 52.831  25.056  75.343  1.00 25.71 ? 479  ARG A CG    1 
ATOM   3780  C  CD    . ARG A 1 479 ? 53.527  25.405  74.029  1.00 28.25 ? 479  ARG A CD    1 
ATOM   3781  N  NE    . ARG A 1 479 ? 54.052  24.196  73.397  1.00 31.27 ? 479  ARG A NE    1 
ATOM   3782  C  CZ    . ARG A 1 479 ? 53.353  23.376  72.606  1.00 33.78 ? 479  ARG A CZ    1 
ATOM   3783  N  NH1   . ARG A 1 479 ? 52.091  23.629  72.310  1.00 35.40 ? 479  ARG A NH1   1 
ATOM   3784  N  NH2   . ARG A 1 479 ? 53.922  22.290  72.093  1.00 34.59 ? 479  ARG A NH2   1 
ATOM   3785  N  N     . GLY A 1 480 ? 50.769  25.814  78.460  1.00 22.31 ? 480  GLY A N     1 
ATOM   3786  C  CA    . GLY A 1 480 ? 51.197  26.129  79.818  1.00 21.62 ? 480  GLY A CA    1 
ATOM   3787  C  C     . GLY A 1 480 ? 50.642  25.267  80.951  1.00 21.42 ? 480  GLY A C     1 
ATOM   3788  O  O     . GLY A 1 480 ? 51.149  25.337  82.063  1.00 21.84 ? 480  GLY A O     1 
ATOM   3789  N  N     . GLN A 1 481 ? 49.604  24.467  80.703  1.00 21.13 ? 481  GLN A N     1 
ATOM   3790  C  CA    . GLN A 1 481 ? 49.128  23.492  81.700  1.00 20.52 ? 481  GLN A CA    1 
ATOM   3791  C  C     . GLN A 1 481 ? 49.457  22.038  81.351  1.00 20.31 ? 481  GLN A C     1 
ATOM   3792  O  O     . GLN A 1 481 ? 49.243  21.161  82.180  1.00 19.77 ? 481  GLN A O     1 
ATOM   3793  C  CB    . GLN A 1 481 ? 47.619  23.622  81.933  1.00 20.41 ? 481  GLN A CB    1 
ATOM   3794  C  CG    . GLN A 1 481 ? 47.219  24.778  82.832  1.00 19.95 ? 481  GLN A CG    1 
ATOM   3795  C  CD    . GLN A 1 481 ? 45.720  24.832  83.092  1.00 20.35 ? 481  GLN A CD    1 
ATOM   3796  O  OE1   . GLN A 1 481 ? 44.985  23.927  82.688  1.00 19.78 ? 481  GLN A OE1   1 
ATOM   3797  N  NE2   . GLN A 1 481 ? 45.262  25.899  83.758  1.00 18.84 ? 481  GLN A NE2   1 
ATOM   3798  N  N     . SER A 1 482 ? 50.004  21.786  80.160  1.00 20.40 ? 482  SER A N     1 
ATOM   3799  C  CA    . SER A 1 482 ? 50.158  20.411  79.653  1.00 20.47 ? 482  SER A CA    1 
ATOM   3800  C  C     . SER A 1 482 ? 51.290  19.613  80.305  1.00 20.70 ? 482  SER A C     1 
ATOM   3801  O  O     . SER A 1 482 ? 51.221  18.382  80.378  1.00 20.94 ? 482  SER A O     1 
ATOM   3802  C  CB    . SER A 1 482 ? 50.377  20.411  78.150  1.00 20.20 ? 482  SER A CB    1 
ATOM   3803  O  OG    . SER A 1 482 ? 51.641  20.955  77.860  1.00 20.23 ? 482  SER A OG    1 
ATOM   3804  N  N     . HIS A 1 483 ? 52.335  20.298  80.758  1.00 20.56 ? 483  HIS A N     1 
ATOM   3805  C  CA    . HIS A 1 483 ? 53.407  19.638  81.505  1.00 20.69 ? 483  HIS A CA    1 
ATOM   3806  C  C     . HIS A 1 483 ? 52.884  19.058  82.833  1.00 20.87 ? 483  HIS A C     1 
ATOM   3807  O  O     . HIS A 1 483 ? 53.630  18.439  83.597  1.00 21.06 ? 483  HIS A O     1 
ATOM   3808  C  CB    . HIS A 1 483 ? 54.567  20.619  81.763  1.00 20.69 ? 483  HIS A CB    1 
ATOM   3809  C  CG    . HIS A 1 483 ? 54.264  21.659  82.799  1.00 20.97 ? 483  HIS A CG    1 
ATOM   3810  N  ND1   . HIS A 1 483 ? 53.451  22.745  82.551  1.00 21.46 ? 483  HIS A ND1   1 
ATOM   3811  C  CD2   . HIS A 1 483 ? 54.647  21.763  84.095  1.00 21.60 ? 483  HIS A CD2   1 
ATOM   3812  C  CE1   . HIS A 1 483 ? 53.340  23.467  83.653  1.00 22.42 ? 483  HIS A CE1   1 
ATOM   3813  N  NE2   . HIS A 1 483 ? 54.062  22.897  84.602  1.00 22.30 ? 483  HIS A NE2   1 
ATOM   3814  N  N     . LEU A 1 484 ? 51.598  19.261  83.094  1.00 21.00 ? 484  LEU A N     1 
ATOM   3815  C  CA    . LEU A 1 484 ? 50.985  18.930  84.372  1.00 21.48 ? 484  LEU A CA    1 
ATOM   3816  C  C     . LEU A 1 484 ? 49.941  17.837  84.268  1.00 20.96 ? 484  LEU A C     1 
ATOM   3817  O  O     . LEU A 1 484 ? 49.345  17.463  85.270  1.00 20.73 ? 484  LEU A O     1 
ATOM   3818  C  CB    . LEU A 1 484 ? 50.317  20.190  84.926  1.00 21.92 ? 484  LEU A CB    1 
ATOM   3819  C  CG    . LEU A 1 484 ? 50.825  20.650  86.282  1.00 23.98 ? 484  LEU A CG    1 
ATOM   3820  C  CD1   . LEU A 1 484 ? 50.898  22.166  86.301  1.00 25.54 ? 484  LEU A CD1   1 
ATOM   3821  C  CD2   . LEU A 1 484 ? 49.916  20.105  87.400  1.00 26.54 ? 484  LEU A CD2   1 
ATOM   3822  N  N     . ALA A 1 485 ? 49.725  17.349  83.049  1.00 20.92 ? 485  ALA A N     1 
ATOM   3823  C  CA    . ALA A 1 485 ? 48.687  16.372  82.736  1.00 20.66 ? 485  ALA A CA    1 
ATOM   3824  C  C     . ALA A 1 485 ? 49.084  15.016  83.233  1.00 20.43 ? 485  ALA A C     1 
ATOM   3825  O  O     . ALA A 1 485 ? 50.261  14.762  83.393  1.00 19.89 ? 485  ALA A O     1 
ATOM   3826  C  CB    . ALA A 1 485 ? 48.490  16.291  81.250  1.00 20.85 ? 485  ALA A CB    1 
ATOM   3827  N  N     . PRO A 1 486 ? 48.121  14.125  83.454  1.00 20.50 ? 486  PRO A N     1 
ATOM   3828  C  CA    . PRO A 1 486 ? 48.470  12.772  83.886  1.00 20.69 ? 486  PRO A CA    1 
ATOM   3829  C  C     . PRO A 1 486 ? 49.477  12.074  82.974  1.00 21.06 ? 486  PRO A C     1 
ATOM   3830  O  O     . PRO A 1 486 ? 49.682  12.375  81.808  1.00 20.86 ? 486  PRO A O     1 
ATOM   3831  C  CB    . PRO A 1 486 ? 47.123  12.051  83.920  1.00 20.66 ? 486  PRO A CB    1 
ATOM   3832  C  CG    . PRO A 1 486 ? 46.136  13.149  84.150  1.00 20.65 ? 486  PRO A CG    1 
ATOM   3833  C  CD    . PRO A 1 486 ? 46.661  14.308  83.365  1.00 20.15 ? 486  PRO A CD    1 
ATOM   3834  N  N     . ILE A 1 487 ? 50.153  11.128  83.583  1.00 22.11 ? 487  ILE A N     1 
ATOM   3835  C  CA    . ILE A 1 487 ? 51.167  10.345  82.928  1.00 22.88 ? 487  ILE A CA    1 
ATOM   3836  C  C     . ILE A 1 487 ? 50.431  9.295   82.062  1.00 23.24 ? 487  ILE A C     1 
ATOM   3837  O  O     . ILE A 1 487 ? 50.887  8.935   80.977  1.00 23.43 ? 487  ILE A O     1 
ATOM   3838  C  CB    . ILE A 1 487 ? 52.107  9.784   84.045  1.00 23.11 ? 487  ILE A CB    1 
ATOM   3839  C  CG1   . ILE A 1 487 ? 53.355  10.668  84.169  1.00 24.28 ? 487  ILE A CG1   1 
ATOM   3840  C  CG2   . ILE A 1 487 ? 52.464  8.335   83.836  1.00 23.65 ? 487  ILE A CG2   1 
ATOM   3841  C  CD1   . ILE A 1 487 ? 54.242  10.732  82.885  1.00 26.41 ? 487  ILE A CD1   1 
ATOM   3842  N  N     . ASN A 1 488 ? 49.279  8.853   82.577  1.00 23.55 ? 488  ASN A N     1 
ATOM   3843  C  CA    . ASN A 1 488 ? 48.217  8.095   81.882  1.00 23.33 ? 488  ASN A CA    1 
ATOM   3844  C  C     . ASN A 1 488 ? 47.729  8.608   80.524  1.00 23.06 ? 488  ASN A C     1 
ATOM   3845  O  O     . ASN A 1 488 ? 47.239  7.837   79.698  1.00 22.84 ? 488  ASN A O     1 
ATOM   3846  C  CB    . ASN A 1 488 ? 46.972  8.138   82.790  1.00 23.62 ? 488  ASN A CB    1 
ATOM   3847  C  CG    . ASN A 1 488 ? 46.467  6.783   83.160  1.00 23.93 ? 488  ASN A CG    1 
ATOM   3848  O  OD1   . ASN A 1 488 ? 46.004  6.588   84.277  1.00 24.94 ? 488  ASN A OD1   1 
ATOM   3849  N  ND2   . ASN A 1 488 ? 46.532  5.834   82.229  1.00 24.43 ? 488  ASN A ND2   1 
ATOM   3850  N  N     . TYR A 1 489 ? 47.766  9.923   80.346  1.00 22.90 ? 489  TYR A N     1 
ATOM   3851  C  CA    . TYR A 1 489 ? 47.262  10.559  79.135  1.00 22.97 ? 489  TYR A CA    1 
ATOM   3852  C  C     . TYR A 1 489 ? 48.276  10.366  78.017  1.00 23.63 ? 489  TYR A C     1 
ATOM   3853  O  O     . TYR A 1 489 ? 49.456  10.629  78.218  1.00 24.53 ? 489  TYR A O     1 
ATOM   3854  C  CB    . TYR A 1 489 ? 47.084  12.071  79.338  1.00 22.68 ? 489  TYR A CB    1 
ATOM   3855  C  CG    . TYR A 1 489 ? 45.796  12.574  79.970  1.00 21.54 ? 489  TYR A CG    1 
ATOM   3856  C  CD1   . TYR A 1 489 ? 44.951  11.749  80.711  1.00 20.75 ? 489  TYR A CD1   1 
ATOM   3857  C  CD2   . TYR A 1 489 ? 45.453  13.914  79.853  1.00 20.73 ? 489  TYR A CD2   1 
ATOM   3858  C  CE1   . TYR A 1 489 ? 43.787  12.254  81.302  1.00 19.52 ? 489  TYR A CE1   1 
ATOM   3859  C  CE2   . TYR A 1 489 ? 44.309  14.422  80.432  1.00 19.91 ? 489  TYR A CE2   1 
ATOM   3860  C  CZ    . TYR A 1 489 ? 43.476  13.599  81.147  1.00 18.38 ? 489  TYR A CZ    1 
ATOM   3861  O  OH    . TYR A 1 489 ? 42.339  14.147  81.680  1.00 13.80 ? 489  TYR A OH    1 
ATOM   3862  N  N     . MET A 1 490 ? 47.817  9.964   76.836  1.00 23.96 ? 490  MET A N     1 
ATOM   3863  C  CA    . MET A 1 490 ? 48.690  9.678   75.705  1.00 24.43 ? 490  MET A CA    1 
ATOM   3864  C  C     . MET A 1 490 ? 48.622  10.833  74.687  1.00 24.41 ? 490  MET A C     1 
ATOM   3865  O  O     . MET A 1 490 ? 47.540  11.332  74.353  1.00 24.61 ? 490  MET A O     1 
ATOM   3866  C  CB    . MET A 1 490 ? 48.304  8.320   75.100  1.00 24.68 ? 490  MET A CB    1 
ATOM   3867  C  CG    . MET A 1 490 ? 48.239  7.214   76.190  1.00 26.26 ? 490  MET A CG    1 
ATOM   3868  S  SD    . MET A 1 490 ? 47.434  5.642   75.709  1.00 30.62 ? 490  MET A SD    1 
ATOM   3869  C  CE    . MET A 1 490 ? 46.655  5.067   77.340  1.00 29.69 ? 490  MET A CE    1 
ATOM   3870  N  N     . ARG A 1 491 ? 49.790  11.300  74.247  1.00 24.00 ? 491  ARG A N     1 
ATOM   3871  C  CA    . ARG A 1 491 ? 49.881  12.343  73.229  1.00 23.48 ? 491  ARG A CA    1 
ATOM   3872  C  C     . ARG A 1 491 ? 49.213  11.827  71.969  1.00 22.70 ? 491  ARG A C     1 
ATOM   3873  O  O     . ARG A 1 491 ? 49.576  10.760  71.477  1.00 23.11 ? 491  ARG A O     1 
ATOM   3874  C  CB    . ARG A 1 491 ? 51.345  12.634  72.908  1.00 23.88 ? 491  ARG A CB    1 
ATOM   3875  C  CG    . ARG A 1 491 ? 51.753  14.095  72.869  1.00 25.38 ? 491  ARG A CG    1 
ATOM   3876  C  CD    . ARG A 1 491 ? 53.292  14.293  72.909  1.00 26.93 ? 491  ARG A CD    1 
ATOM   3877  N  NE    . ARG A 1 491 ? 54.016  13.226  72.189  1.00 28.49 ? 491  ARG A NE    1 
ATOM   3878  C  CZ    . ARG A 1 491 ? 54.791  12.283  72.745  1.00 29.37 ? 491  ARG A CZ    1 
ATOM   3879  N  NH1   . ARG A 1 491 ? 54.982  12.216  74.059  1.00 29.69 ? 491  ARG A NH1   1 
ATOM   3880  N  NH2   . ARG A 1 491 ? 55.381  11.379  71.966  1.00 29.86 ? 491  ARG A NH2   1 
ATOM   3881  N  N     . ARG A 1 492 ? 48.245  12.580  71.457  1.00 21.44 ? 492  ARG A N     1 
ATOM   3882  C  CA    . ARG A 1 492 ? 47.514  12.239  70.240  1.00 20.40 ? 492  ARG A CA    1 
ATOM   3883  C  C     . ARG A 1 492 ? 47.807  13.248  69.137  1.00 20.12 ? 492  ARG A C     1 
ATOM   3884  O  O     . ARG A 1 492 ? 48.208  12.856  68.037  1.00 19.72 ? 492  ARG A O     1 
ATOM   3885  C  CB    . ARG A 1 492 ? 46.018  12.216  70.539  1.00 20.28 ? 492  ARG A CB    1 
ATOM   3886  C  CG    . ARG A 1 492 ? 45.104  11.991  69.343  1.00 19.59 ? 492  ARG A CG    1 
ATOM   3887  C  CD    . ARG A 1 492 ? 43.862  11.123  69.649  1.00 19.62 ? 492  ARG A CD    1 
ATOM   3888  N  NE    . ARG A 1 492 ? 44.066  9.713   69.310  1.00 19.02 ? 492  ARG A NE    1 
ATOM   3889  C  CZ    . ARG A 1 492 ? 43.090  8.806   69.126  1.00 19.12 ? 492  ARG A CZ    1 
ATOM   3890  N  NH1   . ARG A 1 492 ? 41.808  9.135   69.255  1.00 17.94 ? 492  ARG A NH1   1 
ATOM   3891  N  NH2   . ARG A 1 492 ? 43.406  7.546   68.805  1.00 18.74 ? 492  ARG A NH2   1 
ATOM   3892  N  N     . GLN A 1 493 ? 47.616  14.535  69.445  1.00 19.73 ? 493  GLN A N     1 
ATOM   3893  C  CA    . GLN A 1 493 ? 47.846  15.621  68.504  1.00 19.91 ? 493  GLN A CA    1 
ATOM   3894  C  C     . GLN A 1 493 ? 48.385  16.884  69.204  1.00 20.27 ? 493  GLN A C     1 
ATOM   3895  O  O     . GLN A 1 493 ? 47.807  17.363  70.179  1.00 20.33 ? 493  GLN A O     1 
ATOM   3896  C  CB    . GLN A 1 493 ? 46.530  15.934  67.792  1.00 20.18 ? 493  GLN A CB    1 
ATOM   3897  C  CG    . GLN A 1 493 ? 46.553  17.050  66.725  1.00 20.53 ? 493  GLN A CG    1 
ATOM   3898  C  CD    . GLN A 1 493 ? 45.141  17.528  66.322  1.00 22.09 ? 493  GLN A CD    1 
ATOM   3899  O  OE1   . GLN A 1 493 ? 44.122  16.992  66.792  1.00 22.04 ? 493  GLN A OE1   1 
ATOM   3900  N  NE2   . GLN A 1 493 ? 45.086  18.551  65.465  1.00 22.63 ? 493  GLN A NE2   1 
ATOM   3901  N  N     . THR A 1 494 ? 49.494  17.415  68.694  1.00 20.28 ? 494  THR A N     1 
ATOM   3902  C  CA    . THR A 1 494 ? 50.077  18.647  69.197  1.00 20.32 ? 494  THR A CA    1 
ATOM   3903  C  C     . THR A 1 494 ? 49.711  19.837  68.312  1.00 20.69 ? 494  THR A C     1 
ATOM   3904  O  O     . THR A 1 494 ? 49.560  19.695  67.093  1.00 20.85 ? 494  THR A O     1 
ATOM   3905  C  CB    . THR A 1 494 ? 51.602  18.533  69.256  1.00 20.19 ? 494  THR A CB    1 
ATOM   3906  O  OG1   . THR A 1 494 ? 51.969  17.365  69.973  1.00 19.93 ? 494  THR A OG1   1 
ATOM   3907  C  CG2   . THR A 1 494 ? 52.207  19.658  70.088  1.00 20.60 ? 494  THR A CG2   1 
ATOM   3908  N  N     . LEU A 1 495 ? 49.597  21.000  68.954  1.00 20.61 ? 495  LEU A N     1 
ATOM   3909  C  CA    . LEU A 1 495 ? 49.318  22.270  68.306  1.00 20.93 ? 495  LEU A CA    1 
ATOM   3910  C  C     . LEU A 1 495 ? 50.178  23.373  68.910  1.00 21.05 ? 495  LEU A C     1 
ATOM   3911  O  O     . LEU A 1 495 ? 50.791  23.183  69.949  1.00 20.77 ? 495  LEU A O     1 
ATOM   3912  C  CB    . LEU A 1 495 ? 47.862  22.637  68.502  1.00 21.08 ? 495  LEU A CB    1 
ATOM   3913  C  CG    . LEU A 1 495 ? 46.869  21.698  67.851  1.00 21.33 ? 495  LEU A CG    1 
ATOM   3914  C  CD1   . LEU A 1 495 ? 46.364  20.707  68.834  1.00 22.28 ? 495  LEU A CD1   1 
ATOM   3915  C  CD2   . LEU A 1 495 ? 45.729  22.508  67.312  1.00 22.91 ? 495  LEU A CD2   1 
ATOM   3916  N  N     . LYS A 1 496 ? 50.211  24.524  68.249  1.00 21.38 ? 496  LYS A N     1 
ATOM   3917  C  CA    . LYS A 1 496 ? 51.072  25.633  68.652  1.00 21.85 ? 496  LYS A CA    1 
ATOM   3918  C  C     . LYS A 1 496 ? 50.909  25.940  70.136  1.00 22.11 ? 496  LYS A C     1 
ATOM   3919  O  O     . LYS A 1 496 ? 51.907  26.104  70.852  1.00 22.22 ? 496  LYS A O     1 
ATOM   3920  C  CB    . LYS A 1 496 ? 50.766  26.885  67.809  1.00 22.11 ? 496  LYS A CB    1 
ATOM   3921  C  CG    . LYS A 1 496 ? 51.930  27.873  67.675  1.00 22.49 ? 496  LYS A CG    1 
ATOM   3922  C  CD    . LYS A 1 496 ? 51.436  29.229  67.175  1.00 23.66 ? 496  LYS A CD    1 
ATOM   3923  C  CE    . LYS A 1 496 ? 52.578  30.201  66.844  1.00 24.39 ? 496  LYS A CE    1 
ATOM   3924  N  NZ    . LYS A 1 496 ? 52.556  30.622  65.403  1.00 24.76 ? 496  LYS A NZ    1 
ATOM   3925  N  N     . ASN A 1 497 ? 49.655  25.982  70.597  1.00 22.27 ? 497  ASN A N     1 
ATOM   3926  C  CA    . ASN A 1 497 ? 49.352  26.326  71.982  1.00 22.19 ? 497  ASN A CA    1 
ATOM   3927  C  C     . ASN A 1 497 ? 48.416  25.372  72.700  1.00 22.55 ? 497  ASN A C     1 
ATOM   3928  O  O     . ASN A 1 497 ? 47.753  25.748  73.669  1.00 22.96 ? 497  ASN A O     1 
ATOM   3929  C  CB    . ASN A 1 497 ? 48.794  27.743  72.031  1.00 22.13 ? 497  ASN A CB    1 
ATOM   3930  C  CG    . ASN A 1 497 ? 49.880  28.775  71.977  1.00 21.65 ? 497  ASN A CG    1 
ATOM   3931  O  OD1   . ASN A 1 497 ? 50.670  28.900  72.922  1.00 21.39 ? 497  ASN A OD1   1 
ATOM   3932  N  ND2   . ASN A 1 497 ? 49.959  29.497  70.869  1.00 19.46 ? 497  ASN A ND2   1 
ATOM   3933  N  N     . ALA A 1 498 ? 48.362  24.129  72.245  1.00 22.60 ? 498  ALA A N     1 
ATOM   3934  C  CA    . ALA A 1 498 ? 47.626  23.109  72.976  1.00 22.83 ? 498  ALA A CA    1 
ATOM   3935  C  C     . ALA A 1 498 ? 48.248  21.748  72.768  1.00 23.13 ? 498  ALA A C     1 
ATOM   3936  O  O     . ALA A 1 498 ? 49.146  21.578  71.965  1.00 23.57 ? 498  ALA A O     1 
ATOM   3937  C  CB    . ALA A 1 498 ? 46.194  23.094  72.555  1.00 23.09 ? 498  ALA A CB    1 
ATOM   3938  N  N     . GLU A 1 499 ? 47.767  20.778  73.524  1.00 23.16 ? 499  GLU A N     1 
ATOM   3939  C  CA    . GLU A 1 499 ? 48.282  19.427  73.480  1.00 22.84 ? 499  GLU A CA    1 
ATOM   3940  C  C     . GLU A 1 499 ? 47.051  18.616  73.744  1.00 22.28 ? 499  GLU A C     1 
ATOM   3941  O  O     . GLU A 1 499 ? 46.406  18.809  74.747  1.00 22.68 ? 499  GLU A O     1 
ATOM   3942  C  CB    . GLU A 1 499 ? 49.349  19.239  74.569  1.00 23.15 ? 499  GLU A CB    1 
ATOM   3943  C  CG    . GLU A 1 499 ? 50.308  18.065  74.372  1.00 24.40 ? 499  GLU A CG    1 
ATOM   3944  C  CD    . GLU A 1 499 ? 51.378  18.275  73.310  1.00 24.85 ? 499  GLU A CD    1 
ATOM   3945  O  OE1   . GLU A 1 499 ? 52.029  19.336  73.313  1.00 27.01 ? 499  GLU A OE1   1 
ATOM   3946  O  OE2   . GLU A 1 499 ? 51.596  17.359  72.487  1.00 23.77 ? 499  GLU A OE2   1 
ATOM   3947  N  N     . ARG A 1 500 ? 46.691  17.752  72.814  1.00 22.03 ? 500  ARG A N     1 
ATOM   3948  C  CA    . ARG A 1 500 ? 45.501  16.916  72.939  1.00 21.95 ? 500  ARG A CA    1 
ATOM   3949  C  C     . ARG A 1 500 ? 45.851  15.480  73.271  1.00 21.38 ? 500  ARG A C     1 
ATOM   3950  O  O     . ARG A 1 500 ? 46.831  14.964  72.754  1.00 21.24 ? 500  ARG A O     1 
ATOM   3951  C  CB    . ARG A 1 500 ? 44.736  16.948  71.631  1.00 22.18 ? 500  ARG A CB    1 
ATOM   3952  C  CG    . ARG A 1 500 ? 44.157  18.315  71.380  1.00 23.02 ? 500  ARG A CG    1 
ATOM   3953  C  CD    . ARG A 1 500 ? 43.793  18.551  69.963  1.00 23.85 ? 500  ARG A CD    1 
ATOM   3954  N  NE    . ARG A 1 500 ? 42.929  19.708  69.844  1.00 23.54 ? 500  ARG A NE    1 
ATOM   3955  C  CZ    . ARG A 1 500 ? 42.618  20.288  68.710  1.00 22.15 ? 500  ARG A CZ    1 
ATOM   3956  N  NH1   . ARG A 1 500 ? 43.100  19.820  67.575  1.00 21.11 ? 500  ARG A NH1   1 
ATOM   3957  N  NH2   . ARG A 1 500 ? 41.815  21.343  68.714  1.00 23.55 ? 500  ARG A NH2   1 
ATOM   3958  N  N     . TYR A 1 501 ? 45.036  14.828  74.099  1.00 20.77 ? 501  TYR A N     1 
ATOM   3959  C  CA    . TYR A 1 501 ? 45.381  13.498  74.593  1.00 20.52 ? 501  TYR A CA    1 
ATOM   3960  C  C     . TYR A 1 501 ? 44.323  12.435  74.390  1.00 20.01 ? 501  TYR A C     1 
ATOM   3961  O  O     . TYR A 1 501 ? 43.193  12.725  74.050  1.00 19.61 ? 501  TYR A O     1 
ATOM   3962  C  CB    . TYR A 1 501 ? 45.726  13.571  76.075  1.00 20.61 ? 501  TYR A CB    1 
ATOM   3963  C  CG    . TYR A 1 501 ? 46.916  14.437  76.363  1.00 20.44 ? 501  TYR A CG    1 
ATOM   3964  C  CD1   . TYR A 1 501 ? 48.202  13.894  76.386  1.00 20.37 ? 501  TYR A CD1   1 
ATOM   3965  C  CD2   . TYR A 1 501 ? 46.768  15.800  76.601  1.00 20.15 ? 501  TYR A CD2   1 
ATOM   3966  C  CE1   . TYR A 1 501 ? 49.313  14.687  76.638  1.00 20.70 ? 501  TYR A CE1   1 
ATOM   3967  C  CE2   . TYR A 1 501 ? 47.885  16.603  76.868  1.00 21.21 ? 501  TYR A CE2   1 
ATOM   3968  C  CZ    . TYR A 1 501 ? 49.151  16.035  76.880  1.00 19.84 ? 501  TYR A CZ    1 
ATOM   3969  O  OH    . TYR A 1 501 ? 50.254  16.792  77.151  1.00 20.19 ? 501  TYR A OH    1 
ATOM   3970  N  N     . ILE A 1 502 ? 44.715  11.187  74.615  1.00 19.69 ? 502  ILE A N     1 
ATOM   3971  C  CA    . ILE A 1 502 ? 43.785  10.072  74.543  1.00 19.47 ? 502  ILE A CA    1 
ATOM   3972  C  C     . ILE A 1 502 ? 44.028  9.083   75.690  1.00 19.34 ? 502  ILE A C     1 
ATOM   3973  O  O     . ILE A 1 502 ? 45.157  8.661   75.952  1.00 18.93 ? 502  ILE A O     1 
ATOM   3974  C  CB    . ILE A 1 502 ? 43.838  9.403   73.140  1.00 19.31 ? 502  ILE A CB    1 
ATOM   3975  C  CG1   . ILE A 1 502 ? 42.685  8.417   72.942  1.00 19.78 ? 502  ILE A CG1   1 
ATOM   3976  C  CG2   . ILE A 1 502 ? 45.158  8.702   72.889  1.00 19.61 ? 502  ILE A CG2   1 
ATOM   3977  C  CD1   . ILE A 1 502 ? 41.326  9.079   72.721  1.00 19.42 ? 502  ILE A CD1   1 
ATOM   3978  N  N     . ILE A 1 503 ? 42.941  8.770   76.393  1.00 19.35 ? 503  ILE A N     1 
ATOM   3979  C  CA    . ILE A 1 503 ? 42.894  7.695   77.389  1.00 18.94 ? 503  ILE A CA    1 
ATOM   3980  C  C     . ILE A 1 503 ? 41.961  6.592   76.885  1.00 18.64 ? 503  ILE A C     1 
ATOM   3981  O  O     . ILE A 1 503 ? 41.201  6.833   75.955  1.00 18.57 ? 503  ILE A O     1 
ATOM   3982  C  CB    . ILE A 1 503 ? 42.423  8.226   78.755  1.00 19.01 ? 503  ILE A CB    1 
ATOM   3983  C  CG1   . ILE A 1 503 ? 41.197  9.135   78.630  1.00 18.34 ? 503  ILE A CG1   1 
ATOM   3984  C  CG2   . ILE A 1 503 ? 43.564  8.941   79.451  1.00 19.74 ? 503  ILE A CG2   1 
ATOM   3985  C  CD1   . ILE A 1 503 ? 40.296  9.076   79.841  1.00 18.02 ? 503  ILE A CD1   1 
ATOM   3986  N  N     . PRO A 1 504 ? 42.026  5.383   77.456  1.00 18.37 ? 504  PRO A N     1 
ATOM   3987  C  CA    . PRO A 1 504 ? 41.238  4.245   76.942  1.00 18.03 ? 504  PRO A CA    1 
ATOM   3988  C  C     . PRO A 1 504 ? 39.711  4.380   77.009  1.00 17.92 ? 504  PRO A C     1 
ATOM   3989  O  O     . PRO A 1 504 ? 39.032  3.771   76.196  1.00 18.06 ? 504  PRO A O     1 
ATOM   3990  C  CB    . PRO A 1 504 ? 41.700  3.081   77.816  1.00 18.09 ? 504  PRO A CB    1 
ATOM   3991  C  CG    . PRO A 1 504 ? 43.014  3.506   78.357  1.00 18.18 ? 504  PRO A CG    1 
ATOM   3992  C  CD    . PRO A 1 504 ? 42.878  4.976   78.589  1.00 18.41 ? 504  PRO A CD    1 
ATOM   3993  N  N     . GLU A 1 505 ? 39.187  5.146   77.956  1.00 17.88 ? 505  GLU A N     1 
ATOM   3994  C  CA    . GLU A 1 505 ? 37.754  5.380   78.055  1.00 17.91 ? 505  GLU A CA    1 
ATOM   3995  C  C     . GLU A 1 505 ? 37.224  6.245   76.900  1.00 17.94 ? 505  GLU A C     1 
ATOM   3996  O  O     . GLU A 1 505 ? 36.076  6.120   76.510  1.00 17.56 ? 505  GLU A O     1 
ATOM   3997  C  CB    . GLU A 1 505 ? 37.444  6.047   79.390  1.00 17.88 ? 505  GLU A CB    1 
ATOM   3998  C  CG    . GLU A 1 505 ? 35.962  6.153   79.724  1.00 19.50 ? 505  GLU A CG    1 
ATOM   3999  C  CD    . GLU A 1 505 ? 35.685  7.092   80.889  1.00 22.21 ? 505  GLU A CD    1 
ATOM   4000  O  OE1   . GLU A 1 505 ? 34.733  6.824   81.661  1.00 25.05 ? 505  GLU A OE1   1 
ATOM   4001  O  OE2   . GLU A 1 505 ? 36.416  8.093   81.051  1.00 23.44 ? 505  GLU A OE2   1 
ATOM   4002  N  N     . LEU A 1 506 ? 38.050  7.139   76.371  1.00 18.51 ? 506  LEU A N     1 
ATOM   4003  C  CA    . LEU A 1 506 ? 37.630  7.992   75.262  1.00 19.00 ? 506  LEU A CA    1 
ATOM   4004  C  C     . LEU A 1 506 ? 37.732  7.248   73.951  1.00 19.69 ? 506  LEU A C     1 
ATOM   4005  O  O     . LEU A 1 506 ? 36.854  7.378   73.111  1.00 19.64 ? 506  LEU A O     1 
ATOM   4006  C  CB    . LEU A 1 506 ? 38.462  9.283   75.181  1.00 18.90 ? 506  LEU A CB    1 
ATOM   4007  C  CG    . LEU A 1 506 ? 37.710  10.606  74.954  1.00 18.24 ? 506  LEU A CG    1 
ATOM   4008  C  CD1   . LEU A 1 506 ? 38.661  11.644  74.394  1.00 18.34 ? 506  LEU A CD1   1 
ATOM   4009  C  CD2   . LEU A 1 506 ? 36.486  10.484  74.049  1.00 17.38 ? 506  LEU A CD2   1 
ATOM   4010  N  N     . LYS A 1 507 ? 38.804  6.475   73.781  1.00 20.71 ? 507  LYS A N     1 
ATOM   4011  C  CA    . LYS A 1 507 ? 39.016  5.731   72.542  1.00 21.77 ? 507  LYS A CA    1 
ATOM   4012  C  C     . LYS A 1 507 ? 38.011  4.593   72.437  1.00 22.26 ? 507  LYS A C     1 
ATOM   4013  O  O     . LYS A 1 507 ? 37.667  4.194   71.336  1.00 22.37 ? 507  LYS A O     1 
ATOM   4014  C  CB    . LYS A 1 507 ? 40.476  5.240   72.397  1.00 22.02 ? 507  LYS A CB    1 
ATOM   4015  C  CG    . LYS A 1 507 ? 40.772  3.777   72.831  1.00 23.42 ? 507  LYS A CG    1 
ATOM   4016  C  CD    . LYS A 1 507 ? 41.911  3.137   72.004  1.00 24.86 ? 507  LYS A CD    1 
ATOM   4017  C  CE    . LYS A 1 507 ? 41.380  2.211   70.885  1.00 25.32 ? 507  LYS A CE    1 
ATOM   4018  N  NZ    . LYS A 1 507 ? 40.793  2.963   69.729  1.00 25.87 ? 507  LYS A NZ    1 
ATOM   4019  N  N     . GLU A 1 508 ? 37.545  4.077   73.575  1.00 22.94 ? 508  GLU A N     1 
ATOM   4020  C  CA    . GLU A 1 508 ? 36.451  3.111   73.589  1.00 23.48 ? 508  GLU A CA    1 
ATOM   4021  C  C     . GLU A 1 508 ? 35.186  3.809   73.115  1.00 23.76 ? 508  GLU A C     1 
ATOM   4022  O  O     . GLU A 1 508 ? 34.482  3.283   72.265  1.00 23.96 ? 508  GLU A O     1 
ATOM   4023  C  CB    . GLU A 1 508 ? 36.227  2.507   74.980  1.00 23.68 ? 508  GLU A CB    1 
ATOM   4024  C  CG    . GLU A 1 508 ? 35.329  1.266   74.959  1.00 24.91 ? 508  GLU A CG    1 
ATOM   4025  C  CD    . GLU A 1 508 ? 35.067  0.667   76.340  1.00 25.69 ? 508  GLU A CD    1 
ATOM   4026  O  OE1   . GLU A 1 508 ? 36.036  0.304   77.049  1.00 25.93 ? 508  GLU A OE1   1 
ATOM   4027  O  OE2   . GLU A 1 508 ? 33.880  0.550   76.714  1.00 25.71 ? 508  GLU A OE2   1 
ATOM   4028  N  N     . TYR A 1 509 ? 34.925  5.004   73.647  1.00 24.07 ? 509  TYR A N     1 
ATOM   4029  C  CA    . TYR A 1 509 ? 33.763  5.797   73.257  1.00 24.49 ? 509  TYR A CA    1 
ATOM   4030  C  C     . TYR A 1 509 ? 33.866  6.331   71.838  1.00 24.37 ? 509  TYR A C     1 
ATOM   4031  O  O     . TYR A 1 509 ? 32.885  6.794   71.269  1.00 24.89 ? 509  TYR A O     1 
ATOM   4032  C  CB    . TYR A 1 509 ? 33.567  6.975   74.210  1.00 24.90 ? 509  TYR A CB    1 
ATOM   4033  C  CG    . TYR A 1 509 ? 32.514  7.993   73.757  1.00 26.79 ? 509  TYR A CG    1 
ATOM   4034  C  CD1   . TYR A 1 509 ? 31.143  7.738   73.930  1.00 29.26 ? 509  TYR A CD1   1 
ATOM   4035  C  CD2   . TYR A 1 509 ? 32.891  9.212   73.159  1.00 28.84 ? 509  TYR A CD2   1 
ATOM   4036  C  CE1   . TYR A 1 509 ? 30.164  8.671   73.523  1.00 30.49 ? 509  TYR A CE1   1 
ATOM   4037  C  CE2   . TYR A 1 509 ? 31.931  10.158  72.743  1.00 29.89 ? 509  TYR A CE2   1 
ATOM   4038  C  CZ    . TYR A 1 509 ? 30.572  9.882   72.934  1.00 31.38 ? 509  TYR A CZ    1 
ATOM   4039  O  OH    . TYR A 1 509 ? 29.627  10.800  72.540  1.00 31.79 ? 509  TYR A OH    1 
ATOM   4040  N  N     . GLU A 1 510 ? 35.052  6.291   71.263  1.00 24.11 ? 510  GLU A N     1 
ATOM   4041  C  CA    . GLU A 1 510 ? 35.215  6.678   69.877  1.00 23.89 ? 510  GLU A CA    1 
ATOM   4042  C  C     . GLU A 1 510 ? 34.900  5.494   68.963  1.00 24.13 ? 510  GLU A C     1 
ATOM   4043  O  O     . GLU A 1 510 ? 34.305  5.671   67.920  1.00 24.06 ? 510  GLU A O     1 
ATOM   4044  C  CB    . GLU A 1 510 ? 36.638  7.161   69.661  1.00 23.68 ? 510  GLU A CB    1 
ATOM   4045  C  CG    . GLU A 1 510 ? 36.987  7.465   68.228  1.00 22.66 ? 510  GLU A CG    1 
ATOM   4046  C  CD    . GLU A 1 510 ? 38.457  7.667   68.076  1.00 21.05 ? 510  GLU A CD    1 
ATOM   4047  O  OE1   . GLU A 1 510 ? 38.938  8.684   68.573  1.00 19.79 ? 510  GLU A OE1   1 
ATOM   4048  O  OE2   . GLU A 1 510 ? 39.119  6.794   67.488  1.00 21.88 ? 510  GLU A OE2   1 
ATOM   4049  N  N     . ASP A 1 511 ? 35.303  4.291   69.366  1.00 24.63 ? 511  ASP A N     1 
ATOM   4050  C  CA    . ASP A 1 511 ? 35.091  3.082   68.571  1.00 24.99 ? 511  ASP A CA    1 
ATOM   4051  C  C     . ASP A 1 511 ? 33.606  2.765   68.437  1.00 25.29 ? 511  ASP A C     1 
ATOM   4052  O  O     . ASP A 1 511 ? 33.193  2.189   67.430  1.00 24.97 ? 511  ASP A O     1 
ATOM   4053  C  CB    . ASP A 1 511 ? 35.800  1.867   69.194  1.00 25.06 ? 511  ASP A CB    1 
ATOM   4054  C  CG    . ASP A 1 511 ? 37.332  1.939   69.104  1.00 25.60 ? 511  ASP A CG    1 
ATOM   4055  O  OD1   . ASP A 1 511 ? 37.887  2.974   68.643  1.00 25.76 ? 511  ASP A OD1   1 
ATOM   4056  O  OD2   . ASP A 1 511 ? 38.063  0.992   69.498  1.00 25.24 ? 511  ASP A OD2   1 
ATOM   4057  N  N     . LYS A 1 512 ? 32.810  3.134   69.445  1.00 25.58 ? 512  LYS A N     1 
ATOM   4058  C  CA    . LYS A 1 512 ? 31.374  2.850   69.403  1.00 25.98 ? 512  LYS A CA    1 
ATOM   4059  C  C     . LYS A 1 512 ? 30.553  3.977   68.811  1.00 25.87 ? 512  LYS A C     1 
ATOM   4060  O  O     . LYS A 1 512 ? 29.493  3.706   68.280  1.00 25.94 ? 512  LYS A O     1 
ATOM   4061  C  CB    . LYS A 1 512 ? 30.763  2.391   70.754  1.00 26.21 ? 512  LYS A CB    1 
ATOM   4062  C  CG    . LYS A 1 512 ? 31.357  2.907   72.077  1.00 27.46 ? 512  LYS A CG    1 
ATOM   4063  C  CD    . LYS A 1 512 ? 31.677  1.728   73.072  1.00 29.20 ? 512  LYS A CD    1 
ATOM   4064  C  CE    . LYS A 1 512 ? 31.297  2.034   74.545  1.00 29.72 ? 512  LYS A CE    1 
ATOM   4065  N  NZ    . LYS A 1 512 ? 30.680  0.860   75.254  1.00 29.29 ? 512  LYS A NZ    1 
ATOM   4066  N  N     . VAL A 1 513 ? 31.009  5.225   68.898  1.00 26.01 ? 513  VAL A N     1 
ATOM   4067  C  CA    . VAL A 1 513 ? 30.278  6.324   68.254  1.00 26.24 ? 513  VAL A CA    1 
ATOM   4068  C  C     . VAL A 1 513 ? 30.423  6.214   66.743  1.00 26.41 ? 513  VAL A C     1 
ATOM   4069  O  O     . VAL A 1 513 ? 29.429  6.119   66.032  1.00 26.47 ? 513  VAL A O     1 
ATOM   4070  C  CB    . VAL A 1 513 ? 30.748  7.727   68.701  1.00 26.30 ? 513  VAL A CB    1 
ATOM   4071  C  CG1   . VAL A 1 513 ? 30.195  8.821   67.762  1.00 26.36 ? 513  VAL A CG1   1 
ATOM   4072  C  CG2   . VAL A 1 513 ? 30.299  8.005   70.109  1.00 26.41 ? 513  VAL A CG2   1 
ATOM   4073  N  N     . LEU A 1 514 ? 31.664  6.232   66.268  1.00 26.47 ? 514  LEU A N     1 
ATOM   4074  C  CA    . LEU A 1 514 ? 31.957  6.056   64.853  1.00 26.71 ? 514  LEU A CA    1 
ATOM   4075  C  C     . LEU A 1 514 ? 31.290  4.816   64.244  1.00 26.87 ? 514  LEU A C     1 
ATOM   4076  O  O     . LEU A 1 514 ? 30.632  4.942   63.216  1.00 27.10 ? 514  LEU A O     1 
ATOM   4077  C  CB    . LEU A 1 514 ? 33.468  5.995   64.607  1.00 26.80 ? 514  LEU A CB    1 
ATOM   4078  C  CG    . LEU A 1 514 ? 34.312  7.226   64.978  1.00 27.67 ? 514  LEU A CG    1 
ATOM   4079  C  CD1   . LEU A 1 514 ? 35.744  7.089   64.407  1.00 27.80 ? 514  LEU A CD1   1 
ATOM   4080  C  CD2   . LEU A 1 514 ? 33.665  8.556   64.541  1.00 27.74 ? 514  LEU A CD2   1 
ATOM   4081  N  N     . THR A 1 515 ? 31.446  3.634   64.844  1.00 26.96 ? 515  THR A N     1 
ATOM   4082  C  CA    . THR A 1 515 ? 30.918  2.418   64.201  1.00 27.43 ? 515  THR A CA    1 
ATOM   4083  C  C     . THR A 1 515 ? 29.393  2.327   64.270  1.00 27.81 ? 515  THR A C     1 
ATOM   4084  O  O     . THR A 1 515 ? 28.756  1.929   63.295  1.00 27.58 ? 515  THR A O     1 
ATOM   4085  C  CB    . THR A 1 515 ? 31.573  1.103   64.706  1.00 27.38 ? 515  THR A CB    1 
ATOM   4086  O  OG1   . THR A 1 515 ? 31.671  1.098   66.129  1.00 27.63 ? 515  THR A OG1   1 
ATOM   4087  C  CG2   . THR A 1 515 ? 33.022  0.982   64.205  1.00 27.27 ? 515  THR A CG2   1 
ATOM   4088  N  N     . SER A 1 516 ? 28.809  2.720   65.397  1.00 28.27 ? 516  SER A N     1 
ATOM   4089  C  CA    . SER A 1 516 ? 27.350  2.794   65.497  1.00 28.60 ? 516  SER A CA    1 
ATOM   4090  C  C     . SER A 1 516 ? 26.778  3.829   64.514  1.00 28.95 ? 516  SER A C     1 
ATOM   4091  O  O     . SER A 1 516 ? 25.642  3.679   64.059  1.00 29.12 ? 516  SER A O     1 
ATOM   4092  C  CB    . SER A 1 516 ? 26.892  3.078   66.939  1.00 28.60 ? 516  SER A CB    1 
ATOM   4093  O  OG    . SER A 1 516 ? 26.716  4.464   67.180  1.00 29.10 ? 516  SER A OG    1 
ATOM   4094  N  N     . LYS A 1 517 ? 27.574  4.852   64.176  1.00 29.29 ? 517  LYS A N     1 
ATOM   4095  C  CA    . LYS A 1 517 ? 27.159  5.911   63.243  1.00 29.36 ? 517  LYS A CA    1 
ATOM   4096  C  C     . LYS A 1 517 ? 27.209  5.444   61.795  1.00 29.22 ? 517  LYS A C     1 
ATOM   4097  O  O     . LYS A 1 517 ? 26.388  5.857   60.992  1.00 29.58 ? 517  LYS A O     1 
ATOM   4098  C  CB    . LYS A 1 517 ? 28.014  7.176   63.404  1.00 29.43 ? 517  LYS A CB    1 
ATOM   4099  C  CG    . LYS A 1 517 ? 27.332  8.443   62.879  1.00 30.27 ? 517  LYS A CG    1 
ATOM   4100  C  CD    . LYS A 1 517 ? 28.077  9.731   63.246  1.00 30.92 ? 517  LYS A CD    1 
ATOM   4101  C  CE    . LYS A 1 517 ? 27.451  10.435  64.441  1.00 31.41 ? 517  LYS A CE    1 
ATOM   4102  N  NZ    . LYS A 1 517 ? 27.473  9.557   65.653  1.00 31.86 ? 517  LYS A NZ    1 
ATOM   4103  N  N     . GLY A 1 518 ? 28.170  4.588   61.465  1.00 29.15 ? 518  GLY A N     1 
ATOM   4104  C  CA    . GLY A 1 518 ? 28.257  3.996   60.141  1.00 28.90 ? 518  GLY A CA    1 
ATOM   4105  C  C     . GLY A 1 518 ? 27.183  2.939   59.937  1.00 28.67 ? 518  GLY A C     1 
ATOM   4106  O  O     . GLY A 1 518 ? 26.620  2.829   58.844  1.00 28.63 ? 518  GLY A O     1 
ATOM   4107  N  N     . LYS A 1 519 ? 26.912  2.159   60.989  1.00 28.27 ? 519  LYS A N     1 
ATOM   4108  C  CA    . LYS A 1 519 ? 25.825  1.173   60.980  1.00 27.94 ? 519  LYS A CA    1 
ATOM   4109  C  C     . LYS A 1 519 ? 24.462  1.887   60.795  1.00 27.53 ? 519  LYS A C     1 
ATOM   4110  O  O     . LYS A 1 519 ? 23.616  1.435   60.014  1.00 27.24 ? 519  LYS A O     1 
ATOM   4111  C  CB    . LYS A 1 519 ? 25.820  0.312   62.270  1.00 27.93 ? 519  LYS A CB    1 
ATOM   4112  C  CG    . LYS A 1 519 ? 26.996  -0.695  62.447  1.00 27.97 ? 519  LYS A CG    1 
ATOM   4113  C  CD    . LYS A 1 519 ? 26.932  -1.947  61.544  1.00 28.99 ? 519  LYS A CD    1 
ATOM   4114  C  CE    . LYS A 1 519 ? 25.607  -2.732  61.665  1.00 30.00 ? 519  LYS A CE    1 
ATOM   4115  N  NZ    . LYS A 1 519 ? 25.763  -4.224  61.601  1.00 29.56 ? 519  LYS A NZ    1 
ATOM   4116  N  N     . ALA A 1 520 ? 24.273  3.008   61.488  1.00 26.82 ? 520  ALA A N     1 
ATOM   4117  C  CA    . ALA A 1 520 ? 23.029  3.774   61.404  1.00 26.56 ? 520  ALA A CA    1 
ATOM   4118  C  C     . ALA A 1 520 ? 22.818  4.453   60.055  1.00 26.28 ? 520  ALA A C     1 
ATOM   4119  O  O     . ALA A 1 520 ? 21.683  4.786   59.694  1.00 25.77 ? 520  ALA A O     1 
ATOM   4120  C  CB    . ALA A 1 520 ? 22.994  4.824   62.487  1.00 26.78 ? 520  ALA A CB    1 
ATOM   4121  N  N     . LEU A 1 521 ? 23.906  4.690   59.329  1.00 25.84 ? 521  LEU A N     1 
ATOM   4122  C  CA    . LEU A 1 521 ? 23.822  5.413   58.064  1.00 25.78 ? 521  LEU A CA    1 
ATOM   4123  C  C     . LEU A 1 521 ? 23.459  4.445   56.965  1.00 24.98 ? 521  LEU A C     1 
ATOM   4124  O  O     . LEU A 1 521 ? 22.549  4.689   56.200  1.00 24.90 ? 521  LEU A O     1 
ATOM   4125  C  CB    . LEU A 1 521 ? 25.149  6.101   57.745  1.00 26.07 ? 521  LEU A CB    1 
ATOM   4126  C  CG    . LEU A 1 521 ? 25.064  7.331   56.840  1.00 27.00 ? 521  LEU A CG    1 
ATOM   4127  C  CD1   . LEU A 1 521 ? 24.472  8.531   57.579  1.00 27.24 ? 521  LEU A CD1   1 
ATOM   4128  C  CD2   . LEU A 1 521 ? 26.456  7.666   56.291  1.00 27.47 ? 521  LEU A CD2   1 
ATOM   4129  N  N     . ALA A 1 522 ? 24.196  3.346   56.907  1.00 24.20 ? 522  ALA A N     1 
ATOM   4130  C  CA    . ALA A 1 522 ? 23.911  2.251   56.001  1.00 23.72 ? 522  ALA A CA    1 
ATOM   4131  C  C     . ALA A 1 522 ? 22.469  1.838   56.119  1.00 23.14 ? 522  ALA A C     1 
ATOM   4132  O  O     . ALA A 1 522 ? 21.788  1.702   55.116  1.00 23.27 ? 522  ALA A O     1 
ATOM   4133  C  CB    . ALA A 1 522 ? 24.805  1.060   56.317  1.00 23.83 ? 522  ALA A CB    1 
ATOM   4134  N  N     . LEU A 1 523 ? 22.009  1.628   57.347  1.00 22.51 ? 523  LEU A N     1 
ATOM   4135  C  CA    . LEU A 1 523 ? 20.636  1.196   57.577  1.00 22.06 ? 523  LEU A CA    1 
ATOM   4136  C  C     . LEU A 1 523 ? 19.670  2.203   56.976  1.00 21.70 ? 523  LEU A C     1 
ATOM   4137  O  O     . LEU A 1 523 ? 18.824  1.842   56.185  1.00 21.92 ? 523  LEU A O     1 
ATOM   4138  C  CB    . LEU A 1 523 ? 20.347  1.015   59.066  1.00 21.84 ? 523  LEU A CB    1 
ATOM   4139  C  CG    . LEU A 1 523 ? 18.970  0.435   59.381  1.00 21.58 ? 523  LEU A CG    1 
ATOM   4140  C  CD1   . LEU A 1 523 ? 18.718  -0.858  58.617  1.00 21.05 ? 523  LEU A CD1   1 
ATOM   4141  C  CD2   . LEU A 1 523 ? 18.844  0.202   60.874  1.00 22.25 ? 523  LEU A CD2   1 
ATOM   4142  N  N     . GLU A 1 524 ? 19.818  3.467   57.346  1.00 21.31 ? 524  GLU A N     1 
ATOM   4143  C  CA    . GLU A 1 524 ? 19.042  4.550   56.753  1.00 20.94 ? 524  GLU A CA    1 
ATOM   4144  C  C     . GLU A 1 524 ? 18.959  4.522   55.211  1.00 20.76 ? 524  GLU A C     1 
ATOM   4145  O  O     . GLU A 1 524 ? 17.914  4.827   54.642  1.00 20.64 ? 524  GLU A O     1 
ATOM   4146  C  CB    . GLU A 1 524 ? 19.634  5.880   57.189  1.00 20.92 ? 524  GLU A CB    1 
ATOM   4147  C  CG    . GLU A 1 524 ? 18.611  6.974   57.313  1.00 21.02 ? 524  GLU A CG    1 
ATOM   4148  C  CD    . GLU A 1 524 ? 19.152  8.164   58.034  1.00 22.31 ? 524  GLU A CD    1 
ATOM   4149  O  OE1   . GLU A 1 524 ? 19.909  7.966   58.997  1.00 22.01 ? 524  GLU A OE1   1 
ATOM   4150  O  OE2   . GLU A 1 524 ? 18.822  9.295   57.631  1.00 25.37 ? 524  GLU A OE2   1 
ATOM   4151  N  N     . LYS A 1 525 ? 20.068  4.178   54.557  1.00 20.47 ? 525  LYS A N     1 
ATOM   4152  C  CA    . LYS A 1 525 ? 20.138  4.051   53.104  1.00 20.22 ? 525  LYS A CA    1 
ATOM   4153  C  C     . LYS A 1 525 ? 19.486  2.773   52.581  1.00 20.31 ? 525  LYS A C     1 
ATOM   4154  O  O     . LYS A 1 525 ? 18.988  2.757   51.461  1.00 20.88 ? 525  LYS A O     1 
ATOM   4155  C  CB    . LYS A 1 525 ? 21.585  4.076   52.647  1.00 20.19 ? 525  LYS A CB    1 
ATOM   4156  C  CG    . LYS A 1 525 ? 22.306  5.378   52.943  1.00 20.36 ? 525  LYS A CG    1 
ATOM   4157  C  CD    . LYS A 1 525 ? 23.778  5.330   52.514  1.00 19.73 ? 525  LYS A CD    1 
ATOM   4158  C  CE    . LYS A 1 525 ? 24.445  6.706   52.626  1.00 19.73 ? 525  LYS A CE    1 
ATOM   4159  N  NZ    . LYS A 1 525 ? 25.647  6.827   51.759  1.00 19.42 ? 525  LYS A NZ    1 
ATOM   4160  N  N     . GLN A 1 526 ? 19.516  1.702   53.368  1.00 20.08 ? 526  GLN A N     1 
ATOM   4161  C  CA    . GLN A 1 526 ? 18.739  0.494   53.074  1.00 20.15 ? 526  GLN A CA    1 
ATOM   4162  C  C     . GLN A 1 526 ? 17.243  0.798   53.164  1.00 19.73 ? 526  GLN A C     1 
ATOM   4163  O  O     . GLN A 1 526 ? 16.456  0.414   52.302  1.00 19.67 ? 526  GLN A O     1 
ATOM   4164  C  CB    . GLN A 1 526 ? 19.094  -0.652  54.044  1.00 20.36 ? 526  GLN A CB    1 
ATOM   4165  C  CG    . GLN A 1 526 ? 19.433  -1.980  53.354  1.00 21.72 ? 526  GLN A CG    1 
ATOM   4166  C  CD    . GLN A 1 526 ? 20.048  -3.004  54.308  1.00 24.35 ? 526  GLN A CD    1 
ATOM   4167  O  OE1   . GLN A 1 526 ? 21.024  -3.682  53.963  1.00 25.33 ? 526  GLN A OE1   1 
ATOM   4168  N  NE2   . GLN A 1 526 ? 19.474  -3.122  55.507  1.00 26.03 ? 526  GLN A NE2   1 
ATOM   4169  N  N     . LEU A 1 527 ? 16.861  1.498   54.220  1.00 19.34 ? 527  LEU A N     1 
ATOM   4170  C  CA    . LEU A 1 527 ? 15.478  1.890   54.422  1.00 19.20 ? 527  LEU A CA    1 
ATOM   4171  C  C     . LEU A 1 527 ? 14.974  2.931   53.415  1.00 19.29 ? 527  LEU A C     1 
ATOM   4172  O  O     . LEU A 1 527 ? 13.794  2.931   53.070  1.00 19.62 ? 527  LEU A O     1 
ATOM   4173  C  CB    . LEU A 1 527 ? 15.303  2.432   55.838  1.00 18.94 ? 527  LEU A CB    1 
ATOM   4174  C  CG    . LEU A 1 527 ? 15.438  1.373   56.927  1.00 17.52 ? 527  LEU A CG    1 
ATOM   4175  C  CD1   . LEU A 1 527 ? 15.656  2.065   58.263  1.00 17.60 ? 527  LEU A CD1   1 
ATOM   4176  C  CD2   . LEU A 1 527 ? 14.221  0.438   56.986  1.00 16.36 ? 527  LEU A CD2   1 
ATOM   4177  N  N     . TYR A 1 528 ? 15.856  3.803   52.940  1.00 19.08 ? 528  TYR A N     1 
ATOM   4178  C  CA    . TYR A 1 528 ? 15.439  4.874   52.055  1.00 19.00 ? 528  TYR A CA    1 
ATOM   4179  C  C     . TYR A 1 528 ? 15.303  4.347   50.645  1.00 19.68 ? 528  TYR A C     1 
ATOM   4180  O  O     . TYR A 1 528 ? 14.447  4.809   49.891  1.00 19.91 ? 528  TYR A O     1 
ATOM   4181  C  CB    . TYR A 1 528 ? 16.427  6.048   52.090  1.00 18.91 ? 528  TYR A CB    1 
ATOM   4182  C  CG    . TYR A 1 528 ? 16.143  7.115   51.051  1.00 16.32 ? 528  TYR A CG    1 
ATOM   4183  C  CD1   . TYR A 1 528 ? 15.331  8.217   51.344  1.00 13.71 ? 528  TYR A CD1   1 
ATOM   4184  C  CD2   . TYR A 1 528 ? 16.685  7.016   49.774  1.00 15.44 ? 528  TYR A CD2   1 
ATOM   4185  C  CE1   . TYR A 1 528 ? 15.071  9.193   50.390  1.00 12.62 ? 528  TYR A CE1   1 
ATOM   4186  C  CE2   . TYR A 1 528 ? 16.432  7.982   48.814  1.00 15.73 ? 528  TYR A CE2   1 
ATOM   4187  C  CZ    . TYR A 1 528 ? 15.626  9.069   49.134  1.00 13.92 ? 528  TYR A CZ    1 
ATOM   4188  O  OH    . TYR A 1 528 ? 15.394  9.991   48.168  1.00 11.79 ? 528  TYR A OH    1 
ATOM   4189  N  N     . GLU A 1 529 ? 16.159  3.403   50.271  1.00 20.16 ? 529  GLU A N     1 
ATOM   4190  C  CA    . GLU A 1 529 ? 16.008  2.734   48.984  1.00 20.80 ? 529  GLU A CA    1 
ATOM   4191  C  C     . GLU A 1 529 ? 14.871  1.697   49.050  1.00 20.60 ? 529  GLU A C     1 
ATOM   4192  O  O     . GLU A 1 529 ? 14.364  1.254   48.037  1.00 20.77 ? 529  GLU A O     1 
ATOM   4193  C  CB    . GLU A 1 529 ? 17.339  2.131   48.518  1.00 21.15 ? 529  GLU A CB    1 
ATOM   4194  C  CG    . GLU A 1 529 ? 18.382  3.185   48.081  1.00 23.78 ? 529  GLU A CG    1 
ATOM   4195  C  CD    . GLU A 1 529 ? 18.208  3.722   46.635  1.00 26.76 ? 529  GLU A CD    1 
ATOM   4196  O  OE1   . GLU A 1 529 ? 17.844  2.915   45.723  1.00 27.55 ? 529  GLU A OE1   1 
ATOM   4197  O  OE2   . GLU A 1 529 ? 18.457  4.952   46.401  1.00 26.34 ? 529  GLU A OE2   1 
ATOM   4198  N  N     . GLU A 1 530 ? 14.457  1.334   50.252  1.00 20.85 ? 530  GLU A N     1 
ATOM   4199  C  CA    . GLU A 1 530 ? 13.297  0.485   50.436  1.00 21.20 ? 530  GLU A CA    1 
ATOM   4200  C  C     . GLU A 1 530 ? 12.006  1.272   50.194  1.00 21.04 ? 530  GLU A C     1 
ATOM   4201  O  O     . GLU A 1 530 ? 10.992  0.689   49.834  1.00 20.94 ? 530  GLU A O     1 
ATOM   4202  C  CB    . GLU A 1 530 ? 13.301  -0.117  51.838  1.00 21.52 ? 530  GLU A CB    1 
ATOM   4203  C  CG    . GLU A 1 530 ? 12.082  -0.965  52.165  1.00 22.71 ? 530  GLU A CG    1 
ATOM   4204  C  CD    . GLU A 1 530 ? 12.185  -1.586  53.542  1.00 24.19 ? 530  GLU A CD    1 
ATOM   4205  O  OE1   . GLU A 1 530 ? 12.798  -2.679  53.645  1.00 24.22 ? 530  GLU A OE1   1 
ATOM   4206  O  OE2   . GLU A 1 530 ? 11.680  -0.959  54.510  1.00 23.73 ? 530  GLU A OE2   1 
ATOM   4207  N  N     . LEU A 1 531 ? 12.032  2.589   50.391  1.00 20.80 ? 531  LEU A N     1 
ATOM   4208  C  CA    . LEU A 1 531 ? 10.879  3.419   50.036  1.00 20.42 ? 531  LEU A CA    1 
ATOM   4209  C  C     . LEU A 1 531 ? 10.580  3.312   48.529  1.00 20.20 ? 531  LEU A C     1 
ATOM   4210  O  O     . LEU A 1 531 ? 9.425   3.360   48.116  1.00 20.04 ? 531  LEU A O     1 
ATOM   4211  C  CB    . LEU A 1 531 ? 11.094  4.881   50.456  1.00 20.29 ? 531  LEU A CB    1 
ATOM   4212  C  CG    . LEU A 1 531 ? 10.527  5.435   51.785  1.00 20.55 ? 531  LEU A CG    1 
ATOM   4213  C  CD1   . LEU A 1 531 ? 9.948   4.378   52.727  1.00 21.09 ? 531  LEU A CD1   1 
ATOM   4214  C  CD2   . LEU A 1 531 ? 11.587  6.247   52.515  1.00 19.88 ? 531  LEU A CD2   1 
ATOM   4215  N  N     . PHE A 1 532 ? 11.615  3.139   47.715  1.00 20.12 ? 532  PHE A N     1 
ATOM   4216  C  CA    . PHE A 1 532 ? 11.427  2.992   46.275  1.00 20.25 ? 532  PHE A CA    1 
ATOM   4217  C  C     . PHE A 1 532 ? 10.743  1.659   45.943  1.00 20.42 ? 532  PHE A C     1 
ATOM   4218  O  O     . PHE A 1 532 ? 9.854   1.618   45.086  1.00 20.54 ? 532  PHE A O     1 
ATOM   4219  C  CB    . PHE A 1 532 ? 12.765  3.090   45.520  1.00 20.33 ? 532  PHE A CB    1 
ATOM   4220  C  CG    . PHE A 1 532 ? 13.429  4.455   45.566  1.00 20.87 ? 532  PHE A CG    1 
ATOM   4221  C  CD1   . PHE A 1 532 ? 12.708  5.632   45.777  1.00 22.38 ? 532  PHE A CD1   1 
ATOM   4222  C  CD2   . PHE A 1 532 ? 14.797  4.562   45.371  1.00 22.04 ? 532  PHE A CD2   1 
ATOM   4223  C  CE1   . PHE A 1 532 ? 13.346  6.877   45.804  1.00 21.21 ? 532  PHE A CE1   1 
ATOM   4224  C  CE2   . PHE A 1 532 ? 15.439  5.811   45.392  1.00 21.54 ? 532  PHE A CE2   1 
ATOM   4225  C  CZ    . PHE A 1 532 ? 14.702  6.960   45.608  1.00 21.48 ? 532  PHE A CZ    1 
ATOM   4226  N  N     . ASP A 1 533 ? 11.150  0.573   46.604  1.00 20.11 ? 533  ASP A N     1 
ATOM   4227  C  CA    . ASP A 1 533 ? 10.528  -0.727  46.352  1.00 19.92 ? 533  ASP A CA    1 
ATOM   4228  C  C     . ASP A 1 533 ? 9.032   -0.695  46.676  1.00 20.20 ? 533  ASP A C     1 
ATOM   4229  O  O     . ASP A 1 533 ? 8.235   -1.355  46.005  1.00 20.02 ? 533  ASP A O     1 
ATOM   4230  C  CB    . ASP A 1 533 ? 11.182  -1.846  47.174  1.00 19.99 ? 533  ASP A CB    1 
ATOM   4231  C  CG    . ASP A 1 533 ? 12.617  -2.162  46.749  1.00 19.41 ? 533  ASP A CG    1 
ATOM   4232  O  OD1   . ASP A 1 533 ? 12.841  -2.556  45.580  1.00 17.60 ? 533  ASP A OD1   1 
ATOM   4233  O  OD2   . ASP A 1 533 ? 13.578  -2.080  47.554  1.00 17.48 ? 533  ASP A OD2   1 
ATOM   4234  N  N     . LEU A 1 534 ? 8.657   0.066   47.707  1.00 20.56 ? 534  LEU A N     1 
ATOM   4235  C  CA    . LEU A 1 534 ? 7.254   0.158   48.157  1.00 20.65 ? 534  LEU A CA    1 
ATOM   4236  C  C     . LEU A 1 534 ? 6.445   1.176   47.372  1.00 20.47 ? 534  LEU A C     1 
ATOM   4237  O  O     . LEU A 1 534 ? 5.234   1.056   47.273  1.00 21.16 ? 534  LEU A O     1 
ATOM   4238  C  CB    . LEU A 1 534 ? 7.164   0.552   49.638  1.00 20.68 ? 534  LEU A CB    1 
ATOM   4239  C  CG    . LEU A 1 534 ? 7.689   -0.400  50.714  1.00 21.10 ? 534  LEU A CG    1 
ATOM   4240  C  CD1   . LEU A 1 534 ? 7.576   0.258   52.104  1.00 21.53 ? 534  LEU A CD1   1 
ATOM   4241  C  CD2   . LEU A 1 534 ? 6.965   -1.730  50.678  1.00 20.22 ? 534  LEU A CD2   1 
ATOM   4242  N  N     . LEU A 1 535 ? 7.100   2.199   46.841  1.00 20.30 ? 535  LEU A N     1 
ATOM   4243  C  CA    . LEU A 1 535 ? 6.403   3.219   46.073  1.00 19.86 ? 535  LEU A CA    1 
ATOM   4244  C  C     . LEU A 1 535 ? 6.209   2.791   44.620  1.00 19.75 ? 535  LEU A C     1 
ATOM   4245  O  O     . LEU A 1 535 ? 5.190   3.110   44.004  1.00 19.63 ? 535  LEU A O     1 
ATOM   4246  C  CB    . LEU A 1 535 ? 7.196   4.513   46.103  1.00 19.78 ? 535  LEU A CB    1 
ATOM   4247  C  CG    . LEU A 1 535 ? 7.059   5.396   47.333  1.00 19.96 ? 535  LEU A CG    1 
ATOM   4248  C  CD1   . LEU A 1 535 ? 7.882   6.662   47.079  1.00 19.96 ? 535  LEU A CD1   1 
ATOM   4249  C  CD2   . LEU A 1 535 ? 5.610   5.751   47.634  1.00 19.98 ? 535  LEU A CD2   1 
ATOM   4250  N  N     . LEU A 1 536 ? 7.193   2.068   44.093  1.00 19.60 ? 536  LEU A N     1 
ATOM   4251  C  CA    . LEU A 1 536 ? 7.284   1.751   42.667  1.00 19.92 ? 536  LEU A CA    1 
ATOM   4252  C  C     . LEU A 1 536 ? 6.181   0.867   42.062  1.00 19.82 ? 536  LEU A C     1 
ATOM   4253  O  O     . LEU A 1 536 ? 5.829   1.061   40.897  1.00 20.00 ? 536  LEU A O     1 
ATOM   4254  C  CB    . LEU A 1 536 ? 8.662   1.139   42.332  1.00 20.10 ? 536  LEU A CB    1 
ATOM   4255  C  CG    . LEU A 1 536 ? 9.664   1.996   41.524  1.00 21.21 ? 536  LEU A CG    1 
ATOM   4256  C  CD1   . LEU A 1 536 ? 9.325   3.492   41.464  1.00 20.65 ? 536  LEU A CD1   1 
ATOM   4257  C  CD2   . LEU A 1 536 ? 11.095  1.801   42.028  1.00 21.07 ? 536  LEU A CD2   1 
ATOM   4258  N  N     . PRO A 1 537 ? 5.632   -0.096  42.801  1.00 19.57 ? 537  PRO A N     1 
ATOM   4259  C  CA    . PRO A 1 537 ? 4.591   -0.961  42.226  1.00 19.48 ? 537  PRO A CA    1 
ATOM   4260  C  C     . PRO A 1 537 ? 3.324   -0.181  41.843  1.00 18.86 ? 537  PRO A C     1 
ATOM   4261  O  O     . PRO A 1 537 ? 2.595   -0.612  40.974  1.00 18.74 ? 537  PRO A O     1 
ATOM   4262  C  CB    . PRO A 1 537 ? 4.301   -1.968  43.354  1.00 19.52 ? 537  PRO A CB    1 
ATOM   4263  C  CG    . PRO A 1 537 ? 5.521   -1.894  44.238  1.00 19.62 ? 537  PRO A CG    1 
ATOM   4264  C  CD    . PRO A 1 537 ? 5.903   -0.443  44.206  1.00 19.61 ? 537  PRO A CD    1 
ATOM   4265  N  N     . HIS A 1 538 ? 3.086   0.959   42.479  1.00 18.56 ? 538  HIS A N     1 
ATOM   4266  C  CA    . HIS A 1 538 ? 1.939   1.815   42.166  1.00 18.42 ? 538  HIS A CA    1 
ATOM   4267  C  C     . HIS A 1 538 ? 2.273   2.912   41.141  1.00 18.30 ? 538  HIS A C     1 
ATOM   4268  O  O     . HIS A 1 538 ? 1.510   3.852   40.952  1.00 18.46 ? 538  HIS A O     1 
ATOM   4269  C  CB    . HIS A 1 538 ? 1.412   2.425   43.465  1.00 18.38 ? 538  HIS A CB    1 
ATOM   4270  C  CG    . HIS A 1 538 ? 1.125   1.405   44.526  1.00 18.62 ? 538  HIS A CG    1 
ATOM   4271  N  ND1   . HIS A 1 538 ? 1.451   1.591   45.849  1.00 18.52 ? 538  HIS A ND1   1 
ATOM   4272  C  CD2   . HIS A 1 538 ? 0.574   0.168   44.445  1.00 19.53 ? 538  HIS A CD2   1 
ATOM   4273  C  CE1   . HIS A 1 538 ? 1.104   0.519   46.541  1.00 19.16 ? 538  HIS A CE1   1 
ATOM   4274  N  NE2   . HIS A 1 538 ? 0.566   -0.357  45.712  1.00 19.20 ? 538  HIS A NE2   1 
ATOM   4275  N  N     . LEU A 1 539 ? 3.390   2.762   40.442  1.00 18.03 ? 539  LEU A N     1 
ATOM   4276  C  CA    . LEU A 1 539 ? 3.859   3.803   39.550  1.00 18.07 ? 539  LEU A CA    1 
ATOM   4277  C  C     . LEU A 1 539 ? 2.875   4.095   38.427  1.00 18.19 ? 539  LEU A C     1 
ATOM   4278  O  O     . LEU A 1 539 ? 2.657   5.266   38.077  1.00 17.85 ? 539  LEU A O     1 
ATOM   4279  C  CB    . LEU A 1 539 ? 5.219   3.434   38.965  1.00 18.05 ? 539  LEU A CB    1 
ATOM   4280  C  CG    . LEU A 1 539 ? 5.869   4.489   38.067  1.00 18.09 ? 539  LEU A CG    1 
ATOM   4281  C  CD1   . LEU A 1 539 ? 6.007   5.843   38.757  1.00 16.82 ? 539  LEU A CD1   1 
ATOM   4282  C  CD2   . LEU A 1 539 ? 7.221   3.958   37.606  1.00 18.73 ? 539  LEU A CD2   1 
ATOM   4283  N  N     . GLU A 1 540 ? 2.284   3.047   37.855  1.00 18.06 ? 540  GLU A N     1 
ATOM   4284  C  CA    . GLU A 1 540 ? 1.310   3.251   36.783  1.00 18.35 ? 540  GLU A CA    1 
ATOM   4285  C  C     . GLU A 1 540 ? 0.282   4.326   37.204  1.00 18.47 ? 540  GLU A C     1 
ATOM   4286  O  O     . GLU A 1 540 ? 0.183   5.367   36.578  1.00 18.02 ? 540  GLU A O     1 
ATOM   4287  C  CB    . GLU A 1 540 ? 0.638   1.930   36.380  1.00 18.10 ? 540  GLU A CB    1 
ATOM   4288  C  CG    . GLU A 1 540 ? -0.331  2.050   35.216  1.00 18.78 ? 540  GLU A CG    1 
ATOM   4289  C  CD    . GLU A 1 540 ? -0.346  0.833   34.298  1.00 20.21 ? 540  GLU A CD    1 
ATOM   4290  O  OE1   . GLU A 1 540 ? -0.302  1.047   33.072  1.00 21.14 ? 540  GLU A OE1   1 
ATOM   4291  O  OE2   . GLU A 1 540 ? -0.422  -0.329  34.782  1.00 19.98 ? 540  GLU A OE2   1 
ATOM   4292  N  N     . ALA A 1 541 ? -0.414  4.086   38.311  1.00 19.07 ? 541  ALA A N     1 
ATOM   4293  C  CA    . ALA A 1 541 ? -1.459  4.984   38.806  1.00 19.28 ? 541  ALA A CA    1 
ATOM   4294  C  C     . ALA A 1 541 ? -0.917  6.316   39.252  1.00 19.57 ? 541  ALA A C     1 
ATOM   4295  O  O     . ALA A 1 541 ? -1.664  7.282   39.315  1.00 19.87 ? 541  ALA A O     1 
ATOM   4296  C  CB    . ALA A 1 541 ? -2.197  4.339   39.975  1.00 19.23 ? 541  ALA A CB    1 
ATOM   4297  N  N     . LEU A 1 542 ? 0.360   6.362   39.620  1.00 19.58 ? 542  LEU A N     1 
ATOM   4298  C  CA    . LEU A 1 542 ? 0.947   7.605   40.078  1.00 19.52 ? 542  LEU A CA    1 
ATOM   4299  C  C     . LEU A 1 542 ? 1.130   8.540   38.890  1.00 19.82 ? 542  LEU A C     1 
ATOM   4300  O  O     . LEU A 1 542 ? 0.745   9.698   38.962  1.00 19.73 ? 542  LEU A O     1 
ATOM   4301  C  CB    . LEU A 1 542 ? 2.262   7.357   40.825  1.00 19.55 ? 542  LEU A CB    1 
ATOM   4302  C  CG    . LEU A 1 542 ? 2.169   6.794   42.254  1.00 19.02 ? 542  LEU A CG    1 
ATOM   4303  C  CD1   . LEU A 1 542 ? 3.541   6.437   42.765  1.00 18.31 ? 542  LEU A CD1   1 
ATOM   4304  C  CD2   . LEU A 1 542 ? 1.509   7.768   43.218  1.00 19.43 ? 542  LEU A CD2   1 
ATOM   4305  N  N     . GLN A 1 543 ? 1.695   8.030   37.797  1.00 20.39 ? 543  GLN A N     1 
ATOM   4306  C  CA    . GLN A 1 543 ? 1.776   8.775   36.535  1.00 20.75 ? 543  GLN A CA    1 
ATOM   4307  C  C     . GLN A 1 543 ? 0.410   9.234   36.025  1.00 21.50 ? 543  GLN A C     1 
ATOM   4308  O  O     . GLN A 1 543 ? 0.292   10.352  35.541  1.00 22.31 ? 543  GLN A O     1 
ATOM   4309  C  CB    . GLN A 1 543 ? 2.482   7.963   35.454  1.00 20.56 ? 543  GLN A CB    1 
ATOM   4310  C  CG    . GLN A 1 543 ? 3.980   7.715   35.733  1.00 20.29 ? 543  GLN A CG    1 
ATOM   4311  C  CD    . GLN A 1 543 ? 4.645   6.910   34.632  1.00 19.34 ? 543  GLN A CD    1 
ATOM   4312  O  OE1   . GLN A 1 543 ? 5.465   7.442   33.884  1.00 17.74 ? 543  GLN A OE1   1 
ATOM   4313  N  NE2   . GLN A 1 543 ? 4.267   5.634   34.508  1.00 18.81 ? 543  GLN A NE2   1 
ATOM   4314  N  N     . GLN A 1 544 ? -0.619  8.402   36.166  1.00 22.16 ? 544  GLN A N     1 
ATOM   4315  C  CA    . GLN A 1 544 ? -1.984  8.790   35.786  1.00 22.89 ? 544  GLN A CA    1 
ATOM   4316  C  C     . GLN A 1 544 ? -2.529  9.862   36.721  1.00 22.77 ? 544  GLN A C     1 
ATOM   4317  O  O     . GLN A 1 544 ? -3.329  10.689  36.310  1.00 23.92 ? 544  GLN A O     1 
ATOM   4318  C  CB    . GLN A 1 544 ? -2.958  7.611   35.756  1.00 22.83 ? 544  GLN A CB    1 
ATOM   4319  C  CG    . GLN A 1 544 ? -2.351  6.319   35.244  1.00 25.28 ? 544  GLN A CG    1 
ATOM   4320  C  CD    . GLN A 1 544 ? -2.911  5.844   33.919  1.00 28.87 ? 544  GLN A CD    1 
ATOM   4321  O  OE1   . GLN A 1 544 ? -3.591  4.800   33.868  1.00 30.63 ? 544  GLN A OE1   1 
ATOM   4322  N  NE2   . GLN A 1 544 ? -2.586  6.570   32.829  1.00 29.56 ? 544  GLN A NE2   1 
ATOM   4323  N  N     . SER A 1 545 ? -2.099  9.858   37.970  1.00 22.35 ? 545  SER A N     1 
ATOM   4324  C  CA    . SER A 1 545 ? -2.482  10.909  38.903  1.00 21.97 ? 545  SER A CA    1 
ATOM   4325  C  C     . SER A 1 545 ? -1.824  12.250  38.493  1.00 22.06 ? 545  SER A C     1 
ATOM   4326  O  O     . SER A 1 545 ? -2.467  13.303  38.468  1.00 21.60 ? 545  SER A O     1 
ATOM   4327  C  CB    . SER A 1 545 ? -2.091  10.504  40.319  1.00 21.71 ? 545  SER A CB    1 
ATOM   4328  O  OG    . SER A 1 545 ? -2.306  11.549  41.240  1.00 21.64 ? 545  SER A OG    1 
ATOM   4329  N  N     . ALA A 1 546 ? -0.545  12.176  38.138  1.00 21.93 ? 546  ALA A N     1 
ATOM   4330  C  CA    . ALA A 1 546 ? 0.243   13.334  37.752  1.00 21.66 ? 546  ALA A CA    1 
ATOM   4331  C  C     . ALA A 1 546 ? -0.340  13.982  36.512  1.00 21.62 ? 546  ALA A C     1 
ATOM   4332  O  O     . ALA A 1 546 ? -0.435  15.200  36.407  1.00 21.17 ? 546  ALA A O     1 
ATOM   4333  C  CB    . ALA A 1 546 ? 1.692   12.900  37.479  1.00 21.54 ? 546  ALA A CB    1 
ATOM   4334  N  N     . SER A 1 547 ? -0.717  13.151  35.550  1.00 21.57 ? 547  SER A N     1 
ATOM   4335  C  CA    . SER A 1 547 ? -1.221  13.673  34.295  1.00 21.28 ? 547  SER A CA    1 
ATOM   4336  C  C     . SER A 1 547 ? -2.631  14.239  34.521  1.00 20.80 ? 547  SER A C     1 
ATOM   4337  O  O     . SER A 1 547 ? -2.967  15.295  33.996  1.00 19.79 ? 547  SER A O     1 
ATOM   4338  C  CB    . SER A 1 547 ? -1.209  12.596  33.224  1.00 20.98 ? 547  SER A CB    1 
ATOM   4339  O  OG    . SER A 1 547 ? -2.487  12.500  32.662  1.00 22.72 ? 547  SER A OG    1 
ATOM   4340  N  N     . ALA A 1 548 ? -3.428  13.540  35.334  1.00 20.44 ? 548  ALA A N     1 
ATOM   4341  C  CA    . ALA A 1 548 ? -4.746  14.037  35.738  1.00 20.32 ? 548  ALA A CA    1 
ATOM   4342  C  C     . ALA A 1 548 ? -4.655  15.457  36.272  1.00 20.22 ? 548  ALA A C     1 
ATOM   4343  O  O     . ALA A 1 548 ? -5.443  16.312  35.900  1.00 20.13 ? 548  ALA A O     1 
ATOM   4344  C  CB    . ALA A 1 548 ? -5.360  13.151  36.769  1.00 19.74 ? 548  ALA A CB    1 
ATOM   4345  N  N     . LEU A 1 549 ? -3.663  15.699  37.120  1.00 20.40 ? 549  LEU A N     1 
ATOM   4346  C  CA    . LEU A 1 549 ? -3.520  16.969  37.816  1.00 20.26 ? 549  LEU A CA    1 
ATOM   4347  C  C     . LEU A 1 549 ? -3.039  18.081  36.898  1.00 20.73 ? 549  LEU A C     1 
ATOM   4348  O  O     . LEU A 1 549 ? -3.410  19.239  37.087  1.00 21.43 ? 549  LEU A O     1 
ATOM   4349  C  CB    . LEU A 1 549 ? -2.574  16.815  39.004  1.00 19.72 ? 549  LEU A CB    1 
ATOM   4350  C  CG    . LEU A 1 549 ? -3.286  16.088  40.141  1.00 19.36 ? 549  LEU A CG    1 
ATOM   4351  C  CD1   . LEU A 1 549 ? -2.323  15.429  41.095  1.00 19.30 ? 549  LEU A CD1   1 
ATOM   4352  C  CD2   . LEU A 1 549 ? -4.204  17.036  40.897  1.00 19.11 ? 549  LEU A CD2   1 
ATOM   4353  N  N     . ALA A 1 550 ? -2.208  17.734  35.923  1.00 20.81 ? 550  ALA A N     1 
ATOM   4354  C  CA    . ALA A 1 550 ? -1.713  18.694  34.947  1.00 21.01 ? 550  ALA A CA    1 
ATOM   4355  C  C     . ALA A 1 550 ? -2.835  19.136  34.010  1.00 21.26 ? 550  ALA A C     1 
ATOM   4356  O  O     . ALA A 1 550 ? -2.956  20.306  33.704  1.00 21.38 ? 550  ALA A O     1 
ATOM   4357  C  CB    . ALA A 1 550 ? -0.560  18.084  34.147  1.00 21.03 ? 550  ALA A CB    1 
ATOM   4358  N  N     . GLU A 1 551 ? -3.643  18.177  33.566  1.00 22.04 ? 551  GLU A N     1 
ATOM   4359  C  CA    . GLU A 1 551 ? -4.829  18.403  32.733  1.00 22.18 ? 551  GLU A CA    1 
ATOM   4360  C  C     . GLU A 1 551 ? -5.788  19.294  33.485  1.00 22.28 ? 551  GLU A C     1 
ATOM   4361  O  O     . GLU A 1 551 ? -6.354  20.191  32.887  1.00 22.61 ? 551  GLU A O     1 
ATOM   4362  C  CB    . GLU A 1 551 ? -5.520  17.057  32.400  1.00 22.54 ? 551  GLU A CB    1 
ATOM   4363  C  CG    . GLU A 1 551 ? -6.281  16.945  31.064  1.00 23.56 ? 551  GLU A CG    1 
ATOM   4364  C  CD    . GLU A 1 551 ? -6.533  15.474  30.657  1.00 26.06 ? 551  GLU A CD    1 
ATOM   4365  O  OE1   . GLU A 1 551 ? -5.697  14.571  30.945  1.00 27.44 ? 551  GLU A OE1   1 
ATOM   4366  O  OE2   . GLU A 1 551 ? -7.576  15.184  30.056  1.00 26.25 ? 551  GLU A OE2   1 
ATOM   4367  N  N     . LEU A 1 552 ? -5.967  19.044  34.789  1.00 22.10 ? 552  LEU A N     1 
ATOM   4368  C  CA    . LEU A 1 552 ? -6.868  19.844  35.615  1.00 22.51 ? 552  LEU A CA    1 
ATOM   4369  C  C     . LEU A 1 552 ? -6.329  21.262  35.662  1.00 22.25 ? 552  LEU A C     1 
ATOM   4370  O  O     . LEU A 1 552 ? -7.039  22.221  35.416  1.00 22.03 ? 552  LEU A O     1 
ATOM   4371  C  CB    . LEU A 1 552 ? -6.975  19.295  37.044  1.00 22.76 ? 552  LEU A CB    1 
ATOM   4372  C  CG    . LEU A 1 552 ? -8.215  18.426  37.294  1.00 24.64 ? 552  LEU A CG    1 
ATOM   4373  C  CD1   . LEU A 1 552 ? -7.928  17.309  38.293  1.00 24.80 ? 552  LEU A CD1   1 
ATOM   4374  C  CD2   . LEU A 1 552 ? -9.392  19.260  37.757  1.00 25.09 ? 552  LEU A CD2   1 
ATOM   4375  N  N     . ASP A 1 553 ? -5.041  21.361  35.957  1.00 21.86 ? 553  ASP A N     1 
ATOM   4376  C  CA    . ASP A 1 553 ? -4.371  22.623  36.004  1.00 21.48 ? 553  ASP A CA    1 
ATOM   4377  C  C     . ASP A 1 553 ? -4.575  23.384  34.697  1.00 21.77 ? 553  ASP A C     1 
ATOM   4378  O  O     . ASP A 1 553 ? -4.703  24.622  34.691  1.00 21.37 ? 553  ASP A O     1 
ATOM   4379  C  CB    . ASP A 1 553 ? -2.882  22.429  36.275  1.00 20.95 ? 553  ASP A CB    1 
ATOM   4380  C  CG    . ASP A 1 553 ? -2.181  23.751  36.547  1.00 20.92 ? 553  ASP A CG    1 
ATOM   4381  O  OD1   . ASP A 1 553 ? -2.878  24.658  37.054  1.00 21.30 ? 553  ASP A OD1   1 
ATOM   4382  O  OD2   . ASP A 1 553 ? -0.973  23.984  36.308  1.00 16.91 ? 553  ASP A OD2   1 
ATOM   4383  N  N     . VAL A 1 554 ? -4.601  22.656  33.587  1.00 21.79 ? 554  VAL A N     1 
ATOM   4384  C  CA    . VAL A 1 554 ? -4.739  23.320  32.307  1.00 22.10 ? 554  VAL A CA    1 
ATOM   4385  C  C     . VAL A 1 554 ? -6.165  23.822  32.132  1.00 22.38 ? 554  VAL A C     1 
ATOM   4386  O  O     . VAL A 1 554 ? -6.370  24.960  31.736  1.00 22.78 ? 554  VAL A O     1 
ATOM   4387  C  CB    . VAL A 1 554 ? -4.344  22.428  31.137  1.00 21.91 ? 554  VAL A CB    1 
ATOM   4388  C  CG1   . VAL A 1 554 ? -4.767  23.065  29.824  1.00 21.92 ? 554  VAL A CG1   1 
ATOM   4389  C  CG2   . VAL A 1 554 ? -2.844  22.204  31.122  1.00 21.88 ? 554  VAL A CG2   1 
ATOM   4390  N  N     . LEU A 1 555 ? -7.141  22.980  32.442  1.00 22.25 ? 555  LEU A N     1 
ATOM   4391  C  CA    . LEU A 1 555 ? -8.518  23.298  32.131  1.00 22.42 ? 555  LEU A CA    1 
ATOM   4392  C  C     . LEU A 1 555 ? -9.028  24.377  33.076  1.00 22.76 ? 555  LEU A C     1 
ATOM   4393  O  O     . LEU A 1 555 ? -9.691  25.335  32.642  1.00 22.98 ? 555  LEU A O     1 
ATOM   4394  C  CB    . LEU A 1 555 ? -9.375  22.045  32.196  1.00 22.25 ? 555  LEU A CB    1 
ATOM   4395  C  CG    . LEU A 1 555 ? -8.938  20.980  31.180  1.00 23.02 ? 555  LEU A CG    1 
ATOM   4396  C  CD1   . LEU A 1 555 ? -9.603  19.607  31.457  1.00 22.64 ? 555  LEU A CD1   1 
ATOM   4397  C  CD2   . LEU A 1 555 ? -9.208  21.437  29.737  1.00 23.11 ? 555  LEU A CD2   1 
ATOM   4398  N  N     . VAL A 1 556 ? -8.705  24.226  34.358  1.00 22.49 ? 556  VAL A N     1 
ATOM   4399  C  CA    . VAL A 1 556 ? -8.950  25.261  35.358  1.00 22.63 ? 556  VAL A CA    1 
ATOM   4400  C  C     . VAL A 1 556 ? -8.366  26.625  34.920  1.00 22.78 ? 556  VAL A C     1 
ATOM   4401  O  O     . VAL A 1 556 ? -8.956  27.687  35.146  1.00 22.63 ? 556  VAL A O     1 
ATOM   4402  C  CB    . VAL A 1 556 ? -8.360  24.850  36.729  1.00 22.57 ? 556  VAL A CB    1 
ATOM   4403  C  CG1   . VAL A 1 556 ? -8.405  26.003  37.719  1.00 23.42 ? 556  VAL A CG1   1 
ATOM   4404  C  CG2   . VAL A 1 556 ? -9.122  23.671  37.315  1.00 22.64 ? 556  VAL A CG2   1 
ATOM   4405  N  N     . ASN A 1 557 ? -7.202  26.585  34.295  1.00 23.00 ? 557  ASN A N     1 
ATOM   4406  C  CA    . ASN A 1 557 ? -6.541  27.792  33.841  1.00 23.17 ? 557  ASN A CA    1 
ATOM   4407  C  C     . ASN A 1 557 ? -7.283  28.450  32.686  1.00 23.40 ? 557  ASN A C     1 
ATOM   4408  O  O     . ASN A 1 557 ? -7.439  29.681  32.651  1.00 23.94 ? 557  ASN A O     1 
ATOM   4409  C  CB    . ASN A 1 557 ? -5.126  27.473  33.372  1.00 23.14 ? 557  ASN A CB    1 
ATOM   4410  C  CG    . ASN A 1 557 ? -4.506  28.621  32.610  1.00 23.16 ? 557  ASN A CG    1 
ATOM   4411  O  OD1   . ASN A 1 557 ? -4.136  29.643  33.195  1.00 24.38 ? 557  ASN A OD1   1 
ATOM   4412  N  ND2   . ASN A 1 557 ? -4.407  28.470  31.304  1.00 21.23 ? 557  ASN A ND2   1 
ATOM   4413  N  N     . LEU A 1 558 ? -7.710  27.624  31.729  1.00 22.99 ? 558  LEU A N     1 
ATOM   4414  C  CA    . LEU A 1 558 ? -8.381  28.104  30.520  1.00 22.51 ? 558  LEU A CA    1 
ATOM   4415  C  C     . LEU A 1 558 ? -9.795  28.517  30.866  1.00 21.96 ? 558  LEU A C     1 
ATOM   4416  O  O     . LEU A 1 558 ? -10.416 29.294  30.154  1.00 21.56 ? 558  LEU A O     1 
ATOM   4417  C  CB    . LEU A 1 558 ? -8.377  27.018  29.430  1.00 22.27 ? 558  LEU A CB    1 
ATOM   4418  C  CG    . LEU A 1 558 ? -6.999  26.761  28.815  1.00 22.52 ? 558  LEU A CG    1 
ATOM   4419  C  CD1   . LEU A 1 558 ? -7.019  25.585  27.802  1.00 22.14 ? 558  LEU A CD1   1 
ATOM   4420  C  CD2   . LEU A 1 558 ? -6.471  28.032  28.163  1.00 21.79 ? 558  LEU A CD2   1 
ATOM   4421  N  N     . ALA A 1 559 ? -10.289 27.971  31.972  1.00 21.97 ? 559  ALA A N     1 
ATOM   4422  C  CA    . ALA A 1 559 ? -11.564 28.384  32.558  1.00 21.70 ? 559  ALA A CA    1 
ATOM   4423  C  C     . ALA A 1 559 ? -11.472 29.778  33.168  1.00 21.10 ? 559  ALA A C     1 
ATOM   4424  O  O     . ALA A 1 559 ? -12.395 30.563  33.032  1.00 21.23 ? 559  ALA A O     1 
ATOM   4425  C  CB    . ALA A 1 559 ? -12.026 27.371  33.609  1.00 21.39 ? 559  ALA A CB    1 
ATOM   4426  N  N     . GLU A 1 560 ? -10.363 30.069  33.842  1.00 20.72 ? 560  GLU A N     1 
ATOM   4427  C  CA    . GLU A 1 560 ? -10.141 31.376  34.466  1.00 20.53 ? 560  GLU A CA    1 
ATOM   4428  C  C     . GLU A 1 560 ? -9.932  32.438  33.379  1.00 20.19 ? 560  GLU A C     1 
ATOM   4429  O  O     . GLU A 1 560 ? -10.419 33.564  33.485  1.00 19.42 ? 560  GLU A O     1 
ATOM   4430  C  CB    . GLU A 1 560 ? -8.935  31.297  35.416  1.00 20.51 ? 560  GLU A CB    1 
ATOM   4431  C  CG    . GLU A 1 560 ? -8.607  32.583  36.150  1.00 20.92 ? 560  GLU A CG    1 
ATOM   4432  C  CD    . GLU A 1 560 ? -7.808  33.561  35.300  1.00 23.10 ? 560  GLU A CD    1 
ATOM   4433  O  OE1   . GLU A 1 560 ? -6.861  33.149  34.594  1.00 23.69 ? 560  GLU A OE1   1 
ATOM   4434  O  OE2   . GLU A 1 560 ? -8.127  34.763  35.332  1.00 26.16 ? 560  GLU A OE2   1 
ATOM   4435  N  N     . ARG A 1 561 ? -9.237  32.031  32.317  1.00 20.07 ? 561  ARG A N     1 
ATOM   4436  C  CA    . ARG A 1 561 ? -8.845  32.927  31.237  1.00 19.92 ? 561  ARG A CA    1 
ATOM   4437  C  C     . ARG A 1 561 ? -10.045 33.326  30.375  1.00 19.64 ? 561  ARG A C     1 
ATOM   4438  O  O     . ARG A 1 561 ? -10.190 34.498  30.015  1.00 19.41 ? 561  ARG A O     1 
ATOM   4439  C  CB    . ARG A 1 561 ? -7.714  32.308  30.410  1.00 19.93 ? 561  ARG A CB    1 
ATOM   4440  C  CG    . ARG A 1 561 ? -6.363  32.323  31.158  1.00 20.70 ? 561  ARG A CG    1 
ATOM   4441  C  CD    . ARG A 1 561 ? -5.566  33.649  31.073  1.00 19.35 ? 561  ARG A CD    1 
ATOM   4442  N  NE    . ARG A 1 561 ? -5.686  34.462  32.279  1.00 20.46 ? 561  ARG A NE    1 
ATOM   4443  C  CZ    . ARG A 1 561 ? -5.183  35.706  32.415  1.00 22.09 ? 561  ARG A CZ    1 
ATOM   4444  N  NH1   . ARG A 1 561 ? -4.524  36.312  31.426  1.00 22.00 ? 561  ARG A NH1   1 
ATOM   4445  N  NH2   . ARG A 1 561 ? -5.351  36.367  33.552  1.00 22.14 ? 561  ARG A NH2   1 
ATOM   4446  N  N     . ALA A 1 562 ? -10.919 32.369  30.076  1.00 19.47 ? 562  ALA A N     1 
ATOM   4447  C  CA    . ALA A 1 562 ? -12.189 32.683  29.424  1.00 19.67 ? 562  ALA A CA    1 
ATOM   4448  C  C     . ALA A 1 562 ? -12.944 33.748  30.222  1.00 20.03 ? 562  ALA A C     1 
ATOM   4449  O  O     . ALA A 1 562 ? -13.398 34.752  29.653  1.00 19.66 ? 562  ALA A O     1 
ATOM   4450  C  CB    . ALA A 1 562 ? -13.048 31.450  29.272  1.00 19.26 ? 562  ALA A CB    1 
ATOM   4451  N  N     . TYR A 1 563 ? -13.054 33.533  31.533  1.00 20.34 ? 563  TYR A N     1 
ATOM   4452  C  CA    . TYR A 1 563 ? -13.819 34.433  32.367  1.00 21.32 ? 563  TYR A CA    1 
ATOM   4453  C  C     . TYR A 1 563 ? -13.161 35.820  32.329  1.00 21.29 ? 563  TYR A C     1 
ATOM   4454  O  O     . TYR A 1 563 ? -13.782 36.796  31.922  1.00 21.20 ? 563  TYR A O     1 
ATOM   4455  C  CB    . TYR A 1 563 ? -13.970 33.897  33.813  1.00 21.67 ? 563  TYR A CB    1 
ATOM   4456  C  CG    . TYR A 1 563 ? -14.654 34.883  34.767  1.00 22.97 ? 563  TYR A CG    1 
ATOM   4457  C  CD1   . TYR A 1 563 ? -15.800 35.568  34.382  1.00 23.68 ? 563  TYR A CD1   1 
ATOM   4458  C  CD2   . TYR A 1 563 ? -14.142 35.133  36.045  1.00 23.87 ? 563  TYR A CD2   1 
ATOM   4459  C  CE1   . TYR A 1 563 ? -16.426 36.462  35.236  1.00 24.58 ? 563  TYR A CE1   1 
ATOM   4460  C  CE2   . TYR A 1 563 ? -14.760 36.037  36.908  1.00 24.36 ? 563  TYR A CE2   1 
ATOM   4461  C  CZ    . TYR A 1 563 ? -15.905 36.706  36.492  1.00 25.01 ? 563  TYR A CZ    1 
ATOM   4462  O  OH    . TYR A 1 563 ? -16.550 37.621  37.310  1.00 25.62 ? 563  TYR A OH    1 
ATOM   4463  N  N     . THR A 1 564 ? -11.890 35.882  32.694  1.00 21.30 ? 564  THR A N     1 
ATOM   4464  C  CA    . THR A 1 564 ? -11.224 37.158  32.886  1.00 21.24 ? 564  THR A CA    1 
ATOM   4465  C  C     . THR A 1 564 ? -11.172 38.021  31.632  1.00 21.45 ? 564  THR A C     1 
ATOM   4466  O  O     . THR A 1 564 ? -11.408 39.205  31.708  1.00 21.57 ? 564  THR A O     1 
ATOM   4467  C  CB    . THR A 1 564 ? -9.823  36.922  33.427  1.00 21.30 ? 564  THR A CB    1 
ATOM   4468  O  OG1   . THR A 1 564 ? -9.914  36.171  34.646  1.00 20.61 ? 564  THR A OG1   1 
ATOM   4469  C  CG2   . THR A 1 564 ? -9.145  38.255  33.820  1.00 20.46 ? 564  THR A CG2   1 
ATOM   4470  N  N     . LEU A 1 565 ? -10.885 37.416  30.485  1.00 21.98 ? 565  LEU A N     1 
ATOM   4471  C  CA    . LEU A 1 565 ? -10.652 38.153  29.241  1.00 21.95 ? 565  LEU A CA    1 
ATOM   4472  C  C     . LEU A 1 565 ? -11.829 38.079  28.286  1.00 21.62 ? 565  LEU A C     1 
ATOM   4473  O  O     . LEU A 1 565 ? -11.676 38.370  27.105  1.00 21.00 ? 565  LEU A O     1 
ATOM   4474  C  CB    . LEU A 1 565 ? -9.404  37.625  28.523  1.00 22.39 ? 565  LEU A CB    1 
ATOM   4475  C  CG    . LEU A 1 565 ? -8.186  37.175  29.351  1.00 23.40 ? 565  LEU A CG    1 
ATOM   4476  C  CD1   . LEU A 1 565 ? -7.638  35.867  28.792  1.00 24.66 ? 565  LEU A CD1   1 
ATOM   4477  C  CD2   . LEU A 1 565 ? -7.079  38.224  29.361  1.00 22.98 ? 565  LEU A CD2   1 
ATOM   4478  N  N     . ASN A 1 566 ? -12.993 37.683  28.801  1.00 21.85 ? 566  ASN A N     1 
ATOM   4479  C  CA    . ASN A 1 566 ? -14.246 37.644  28.035  1.00 21.75 ? 566  ASN A CA    1 
ATOM   4480  C  C     . ASN A 1 566 ? -14.133 36.840  26.735  1.00 21.41 ? 566  ASN A C     1 
ATOM   4481  O  O     . ASN A 1 566 ? -14.215 37.433  25.653  1.00 21.33 ? 566  ASN A O     1 
ATOM   4482  C  CB    . ASN A 1 566 ? -14.747 39.082  27.769  1.00 21.80 ? 566  ASN A CB    1 
ATOM   4483  C  CG    . ASN A 1 566 ? -16.209 39.144  27.246  1.00 22.77 ? 566  ASN A CG    1 
ATOM   4484  O  OD1   . ASN A 1 566 ? -16.454 39.642  26.148  1.00 24.28 ? 566  ASN A OD1   1 
ATOM   4485  N  ND2   . ASN A 1 566 ? -17.173 38.678  28.050  1.00 22.95 ? 566  ASN A ND2   1 
ATOM   4486  N  N     . TYR A 1 567 ? -13.931 35.515  26.854  1.00 20.69 ? 567  TYR A N     1 
ATOM   4487  C  CA    . TYR A 1 567 ? -13.997 34.573  25.716  1.00 20.73 ? 567  TYR A CA    1 
ATOM   4488  C  C     . TYR A 1 567 ? -15.277 33.705  25.709  1.00 20.69 ? 567  TYR A C     1 
ATOM   4489  O  O     . TYR A 1 567 ? -15.747 33.299  26.755  1.00 20.22 ? 567  TYR A O     1 
ATOM   4490  C  CB    . TYR A 1 567 ? -12.839 33.577  25.766  1.00 20.93 ? 567  TYR A CB    1 
ATOM   4491  C  CG    . TYR A 1 567 ? -11.426 34.094  25.690  1.00 20.46 ? 567  TYR A CG    1 
ATOM   4492  C  CD1   . TYR A 1 567 ? -11.138 35.406  25.352  1.00 17.78 ? 567  TYR A CD1   1 
ATOM   4493  C  CD2   . TYR A 1 567 ? -10.357 33.222  25.938  1.00 21.44 ? 567  TYR A CD2   1 
ATOM   4494  C  CE1   . TYR A 1 567 ? -9.856  35.843  25.272  1.00 17.42 ? 567  TYR A CE1   1 
ATOM   4495  C  CE2   . TYR A 1 567 ? -9.062  33.657  25.866  1.00 20.27 ? 567  TYR A CE2   1 
ATOM   4496  C  CZ    . TYR A 1 567 ? -8.821  34.974  25.537  1.00 19.94 ? 567  TYR A CZ    1 
ATOM   4497  O  OH    . TYR A 1 567 ? -7.523  35.424  25.461  1.00 22.77 ? 567  TYR A OH    1 
ATOM   4498  N  N     . THR A 1 568 ? -15.803 33.381  24.526  1.00 21.10 ? 568  THR A N     1 
ATOM   4499  C  CA    . THR A 1 568 ? -17.019 32.545  24.389  1.00 21.23 ? 568  THR A CA    1 
ATOM   4500  C  C     . THR A 1 568 ? -16.736 31.202  23.760  1.00 21.60 ? 568  THR A C     1 
ATOM   4501  O  O     . THR A 1 568 ? -15.675 30.980  23.173  1.00 22.20 ? 568  THR A O     1 
ATOM   4502  C  CB    . THR A 1 568 ? -18.108 33.220  23.509  1.00 20.95 ? 568  THR A CB    1 
ATOM   4503  O  OG1   . THR A 1 568 ? -17.708 33.187  22.133  1.00 21.16 ? 568  THR A OG1   1 
ATOM   4504  C  CG2   . THR A 1 568 ? -18.271 34.695  23.840  1.00 20.77 ? 568  THR A CG2   1 
ATOM   4505  N  N     . CYS A 1 569 ? -17.725 30.321  23.838  1.00 21.59 ? 569  CYS A N     1 
ATOM   4506  C  CA    . CYS A 1 569 ? -17.561 28.980  23.324  1.00 21.61 ? 569  CYS A CA    1 
ATOM   4507  C  C     . CYS A 1 569 ? -17.678 28.957  21.802  1.00 21.09 ? 569  CYS A C     1 
ATOM   4508  O  O     . CYS A 1 569 ? -18.610 29.536  21.226  1.00 20.66 ? 569  CYS A O     1 
ATOM   4509  C  CB    . CYS A 1 569 ? -18.571 28.016  23.938  1.00 21.84 ? 569  CYS A CB    1 
ATOM   4510  S  SG    . CYS A 1 569 ? -17.890 26.347  24.065  1.00 23.66 ? 569  CYS A SG    1 
ATOM   4511  N  N     . PRO A 1 570 ? -16.724 28.302  21.146  1.00 20.49 ? 570  PRO A N     1 
ATOM   4512  C  CA    . PRO A 1 570 ? -16.856 28.043  19.717  1.00 20.49 ? 570  PRO A CA    1 
ATOM   4513  C  C     . PRO A 1 570 ? -17.855 26.895  19.490  1.00 20.82 ? 570  PRO A C     1 
ATOM   4514  O  O     . PRO A 1 570 ? -18.005 26.072  20.389  1.00 21.05 ? 570  PRO A O     1 
ATOM   4515  C  CB    . PRO A 1 570 ? -15.429 27.663  19.308  1.00 20.67 ? 570  PRO A CB    1 
ATOM   4516  C  CG    . PRO A 1 570 ? -14.583 27.972  20.500  1.00 20.44 ? 570  PRO A CG    1 
ATOM   4517  C  CD    . PRO A 1 570 ? -15.446 27.798  21.681  1.00 20.34 ? 570  PRO A CD    1 
ATOM   4518  N  N     . THR A 1 571 ? -18.563 26.873  18.361  1.00 21.00 ? 571  THR A N     1 
ATOM   4519  C  CA    . THR A 1 571 ? -19.304 25.677  17.959  1.00 21.57 ? 571  THR A CA    1 
ATOM   4520  C  C     . THR A 1 571 ? -18.664 25.120  16.714  1.00 21.45 ? 571  THR A C     1 
ATOM   4521  O  O     . THR A 1 571 ? -17.994 25.842  15.994  1.00 21.93 ? 571  THR A O     1 
ATOM   4522  C  CB    . THR A 1 571 ? -20.817 25.933  17.738  1.00 21.62 ? 571  THR A CB    1 
ATOM   4523  O  OG1   . THR A 1 571 ? -21.040 26.833  16.641  1.00 22.58 ? 571  THR A OG1   1 
ATOM   4524  C  CG2   . THR A 1 571 ? -21.438 26.621  18.944  1.00 21.72 ? 571  THR A CG2   1 
ATOM   4525  N  N     . PHE A 1 572 ? -18.832 23.822  16.484  1.00 21.28 ? 572  PHE A N     1 
ATOM   4526  C  CA    . PHE A 1 572 ? -18.215 23.170  15.330  1.00 20.67 ? 572  PHE A CA    1 
ATOM   4527  C  C     . PHE A 1 572 ? -19.268 22.800  14.304  1.00 20.98 ? 572  PHE A C     1 
ATOM   4528  O  O     . PHE A 1 572 ? -20.387 22.472  14.666  1.00 21.72 ? 572  PHE A O     1 
ATOM   4529  C  CB    . PHE A 1 572 ? -17.463 21.919  15.766  1.00 20.58 ? 572  PHE A CB    1 
ATOM   4530  C  CG    . PHE A 1 572 ? -16.395 22.175  16.800  1.00 18.07 ? 572  PHE A CG    1 
ATOM   4531  C  CD1   . PHE A 1 572 ? -15.170 22.668  16.437  1.00 16.33 ? 572  PHE A CD1   1 
ATOM   4532  C  CD2   . PHE A 1 572 ? -16.611 21.885  18.118  1.00 17.05 ? 572  PHE A CD2   1 
ATOM   4533  C  CE1   . PHE A 1 572 ? -14.200 22.894  17.370  1.00 15.34 ? 572  PHE A CE1   1 
ATOM   4534  C  CE2   . PHE A 1 572 ? -15.642 22.107  19.042  1.00 16.30 ? 572  PHE A CE2   1 
ATOM   4535  C  CZ    . PHE A 1 572 ? -14.439 22.630  18.664  1.00 15.41 ? 572  PHE A CZ    1 
ATOM   4536  N  N     . ILE A 1 573 ? -18.904 22.854  13.030  1.00 21.26 ? 573  ILE A N     1 
ATOM   4537  C  CA    . ILE A 1 573 ? -19.815 22.571  11.920  1.00 21.68 ? 573  ILE A CA    1 
ATOM   4538  C  C     . ILE A 1 573 ? -19.187 21.512  10.990  1.00 22.22 ? 573  ILE A C     1 
ATOM   4539  O  O     . ILE A 1 573 ? -17.993 21.212  11.135  1.00 22.36 ? 573  ILE A O     1 
ATOM   4540  C  CB    . ILE A 1 573 ? -20.161 23.887  11.165  1.00 21.61 ? 573  ILE A CB    1 
ATOM   4541  C  CG1   . ILE A 1 573 ? -18.901 24.597  10.659  1.00 22.16 ? 573  ILE A CG1   1 
ATOM   4542  C  CG2   . ILE A 1 573 ? -20.913 24.838  12.077  1.00 21.26 ? 573  ILE A CG2   1 
ATOM   4543  C  CD1   . ILE A 1 573 ? -19.157 25.618  9.559   1.00 21.96 ? 573  ILE A CD1   1 
ATOM   4544  N  N     . ASP A 1 574 ? -19.973 20.945  10.065  1.00 22.65 ? 574  ASP A N     1 
ATOM   4545  C  CA    . ASP A 1 574 ? -19.513 19.805  9.243   1.00 23.03 ? 574  ASP A CA    1 
ATOM   4546  C  C     . ASP A 1 574 ? -18.572 20.196  8.117   1.00 23.45 ? 574  ASP A C     1 
ATOM   4547  O  O     . ASP A 1 574 ? -17.658 19.444  7.789   1.00 23.54 ? 574  ASP A O     1 
ATOM   4548  C  CB    . ASP A 1 574 ? -20.664 19.059  8.556   1.00 23.02 ? 574  ASP A CB    1 
ATOM   4549  C  CG    . ASP A 1 574 ? -21.794 18.716  9.481   1.00 23.39 ? 574  ASP A CG    1 
ATOM   4550  O  OD1   . ASP A 1 574 ? -21.588 18.004  10.493  1.00 26.24 ? 574  ASP A OD1   1 
ATOM   4551  O  OD2   . ASP A 1 574 ? -22.952 19.081  9.237   1.00 23.55 ? 574  ASP A OD2   1 
ATOM   4552  N  N     . LYS A 1 575 ? -18.838 21.337  7.487   1.00 23.83 ? 575  LYS A N     1 
ATOM   4553  C  CA    . LYS A 1 575 ? -18.108 21.745  6.283   1.00 24.23 ? 575  LYS A CA    1 
ATOM   4554  C  C     . LYS A 1 575 ? -17.024 22.764  6.607   1.00 23.70 ? 575  LYS A C     1 
ATOM   4555  O  O     . LYS A 1 575 ? -17.020 23.319  7.691   1.00 24.12 ? 575  LYS A O     1 
ATOM   4556  C  CB    . LYS A 1 575 ? -19.073 22.378  5.281   1.00 24.82 ? 575  LYS A CB    1 
ATOM   4557  C  CG    . LYS A 1 575 ? -20.292 21.526  4.954   1.00 25.26 ? 575  LYS A CG    1 
ATOM   4558  C  CD    . LYS A 1 575 ? -19.991 20.501  3.899   1.00 24.22 ? 575  LYS A CD    1 
ATOM   4559  C  CE    . LYS A 1 575 ? -21.252 19.752  3.568   1.00 24.34 ? 575  LYS A CE    1 
ATOM   4560  N  NZ    . LYS A 1 575 ? -21.119 19.119  2.253   1.00 25.12 ? 575  LYS A NZ    1 
ATOM   4561  N  N     . PRO A 1 576 ? -16.113 23.040  5.685   1.00 22.99 ? 576  PRO A N     1 
ATOM   4562  C  CA    . PRO A 1 576 ? -15.126 24.090  5.935   1.00 22.78 ? 576  PRO A CA    1 
ATOM   4563  C  C     . PRO A 1 576 ? -15.786 25.469  6.061   1.00 23.01 ? 576  PRO A C     1 
ATOM   4564  O  O     . PRO A 1 576 ? -16.745 25.805  5.379   1.00 22.79 ? 576  PRO A O     1 
ATOM   4565  C  CB    . PRO A 1 576 ? -14.208 24.017  4.721   1.00 22.55 ? 576  PRO A CB    1 
ATOM   4566  C  CG    . PRO A 1 576 ? -14.444 22.645  4.150   1.00 22.98 ? 576  PRO A CG    1 
ATOM   4567  C  CD    . PRO A 1 576 ? -15.914 22.404  4.372   1.00 23.14 ? 576  PRO A CD    1 
ATOM   4568  N  N     . GLY A 1 577 ? -15.276 26.260  6.989   1.00 23.21 ? 577  GLY A N     1 
ATOM   4569  C  CA    . GLY A 1 577 ? -15.751 27.607  7.154   1.00 23.16 ? 577  GLY A CA    1 
ATOM   4570  C  C     . GLY A 1 577 ? -15.420 28.142  8.509   1.00 23.01 ? 577  GLY A C     1 
ATOM   4571  O  O     . GLY A 1 577 ? -15.184 27.382  9.437   1.00 23.61 ? 577  GLY A O     1 
ATOM   4572  N  N     . ILE A 1 578 ? -15.363 29.459  8.592   1.00 22.72 ? 578  ILE A N     1 
ATOM   4573  C  CA    . ILE A 1 578 ? -15.195 30.165  9.848   1.00 22.66 ? 578  ILE A CA    1 
ATOM   4574  C  C     . ILE A 1 578 ? -16.137 31.350  9.816   1.00 22.56 ? 578  ILE A C     1 
ATOM   4575  O  O     . ILE A 1 578 ? -16.236 32.051  8.797   1.00 22.36 ? 578  ILE A O     1 
ATOM   4576  C  CB    . ILE A 1 578 ? -13.757 30.660  10.006  1.00 22.61 ? 578  ILE A CB    1 
ATOM   4577  C  CG1   . ILE A 1 578 ? -12.776 29.641  9.413   1.00 23.38 ? 578  ILE A CG1   1 
ATOM   4578  C  CG2   . ILE A 1 578 ? -13.456 30.928  11.464  1.00 22.64 ? 578  ILE A CG2   1 
ATOM   4579  C  CD1   . ILE A 1 578 ? -11.327 30.029  9.568   1.00 24.58 ? 578  ILE A CD1   1 
ATOM   4580  N  N     . ARG A 1 579 ? -16.854 31.554  10.913  1.00 22.28 ? 579  ARG A N     1 
ATOM   4581  C  CA    . ARG A 1 579 ? -17.691 32.742  11.078  1.00 22.01 ? 579  ARG A CA    1 
ATOM   4582  C  C     . ARG A 1 579 ? -17.393 33.317  12.443  1.00 21.09 ? 579  ARG A C     1 
ATOM   4583  O  O     . ARG A 1 579 ? -17.733 32.746  13.456  1.00 20.31 ? 579  ARG A O     1 
ATOM   4584  C  CB    . ARG A 1 579 ? -19.171 32.398  10.898  1.00 22.10 ? 579  ARG A CB    1 
ATOM   4585  C  CG    . ARG A 1 579 ? -19.419 31.709  9.561   1.00 24.28 ? 579  ARG A CG    1 
ATOM   4586  C  CD    . ARG A 1 579 ? -20.871 31.423  9.201   1.00 26.91 ? 579  ARG A CD    1 
ATOM   4587  N  NE    . ARG A 1 579 ? -21.436 30.312  9.982   1.00 27.94 ? 579  ARG A NE    1 
ATOM   4588  C  CZ    . ARG A 1 579 ? -22.062 29.228  9.493   1.00 28.84 ? 579  ARG A CZ    1 
ATOM   4589  N  NH1   . ARG A 1 579 ? -22.221 29.014  8.192   1.00 28.92 ? 579  ARG A NH1   1 
ATOM   4590  N  NH2   . ARG A 1 579 ? -22.542 28.336  10.338  1.00 29.83 ? 579  ARG A NH2   1 
ATOM   4591  N  N     . ILE A 1 580 ? -16.691 34.435  12.458  1.00 20.95 ? 580  ILE A N     1 
ATOM   4592  C  CA    . ILE A 1 580 ? -16.407 35.144  13.702  1.00 20.42 ? 580  ILE A CA    1 
ATOM   4593  C  C     . ILE A 1 580 ? -17.332 36.349  13.768  1.00 20.57 ? 580  ILE A C     1 
ATOM   4594  O  O     . ILE A 1 580 ? -17.426 37.112  12.805  1.00 20.21 ? 580  ILE A O     1 
ATOM   4595  C  CB    . ILE A 1 580 ? -14.921 35.595  13.763  1.00 19.96 ? 580  ILE A CB    1 
ATOM   4596  C  CG1   . ILE A 1 580 ? -13.988 34.448  13.353  1.00 19.38 ? 580  ILE A CG1   1 
ATOM   4597  C  CG2   . ILE A 1 580 ? -14.562 36.043  15.155  1.00 20.00 ? 580  ILE A CG2   1 
ATOM   4598  C  CD1   . ILE A 1 580 ? -12.576 34.851  13.162  1.00 17.83 ? 580  ILE A CD1   1 
ATOM   4599  N  N     . THR A 1 581 ? -18.048 36.484  14.883  1.00 20.83 ? 581  THR A N     1 
ATOM   4600  C  CA    . THR A 1 581 ? -18.636 37.764  15.265  1.00 21.08 ? 581  THR A CA    1 
ATOM   4601  C  C     . THR A 1 581 ? -17.746 38.411  16.324  1.00 21.50 ? 581  THR A C     1 
ATOM   4602  O  O     . THR A 1 581 ? -17.587 37.877  17.410  1.00 21.64 ? 581  THR A O     1 
ATOM   4603  C  CB    . THR A 1 581 ? -20.069 37.604  15.801  1.00 20.84 ? 581  THR A CB    1 
ATOM   4604  O  OG1   . THR A 1 581 ? -20.893 37.023  14.797  1.00 19.75 ? 581  THR A OG1   1 
ATOM   4605  C  CG2   . THR A 1 581 ? -20.735 38.983  16.040  1.00 20.62 ? 581  THR A CG2   1 
ATOM   4606  N  N     . GLU A 1 582 ? -17.183 39.569  15.988  1.00 22.25 ? 582  GLU A N     1 
ATOM   4607  C  CA    . GLU A 1 582 ? -16.402 40.401  16.912  1.00 22.69 ? 582  GLU A CA    1 
ATOM   4608  C  C     . GLU A 1 582 ? -15.180 39.702  17.497  1.00 22.71 ? 582  GLU A C     1 
ATOM   4609  O  O     . GLU A 1 582 ? -14.988 39.675  18.710  1.00 23.07 ? 582  GLU A O     1 
ATOM   4610  C  CB    . GLU A 1 582 ? -17.295 40.969  18.004  1.00 22.73 ? 582  GLU A CB    1 
ATOM   4611  C  CG    . GLU A 1 582 ? -18.420 41.819  17.437  1.00 24.89 ? 582  GLU A CG    1 
ATOM   4612  C  CD    . GLU A 1 582 ? -18.048 43.289  17.336  1.00 27.75 ? 582  GLU A CD    1 
ATOM   4613  O  OE1   . GLU A 1 582 ? -17.651 43.752  16.223  1.00 27.99 ? 582  GLU A OE1   1 
ATOM   4614  O  OE2   . GLU A 1 582 ? -18.145 43.971  18.389  1.00 29.52 ? 582  GLU A OE2   1 
ATOM   4615  N  N     . GLY A 1 583 ? -14.350 39.155  16.612  1.00 22.67 ? 583  GLY A N     1 
ATOM   4616  C  CA    . GLY A 1 583 ? -13.094 38.557  16.997  1.00 22.64 ? 583  GLY A CA    1 
ATOM   4617  C  C     . GLY A 1 583 ? -12.012 39.586  17.248  1.00 22.65 ? 583  GLY A C     1 
ATOM   4618  O  O     . GLY A 1 583 ? -11.989 40.653  16.626  1.00 22.25 ? 583  GLY A O     1 
ATOM   4619  N  N     . ARG A 1 584 ? -11.106 39.225  18.154  1.00 22.59 ? 584  ARG A N     1 
ATOM   4620  C  CA    . ARG A 1 584 ? -9.977  40.046  18.572  1.00 22.66 ? 584  ARG A CA    1 
ATOM   4621  C  C     . ARG A 1 584 ? -8.702  39.202  18.568  1.00 23.28 ? 584  ARG A C     1 
ATOM   4622  O  O     . ARG A 1 584 ? -8.750  37.973  18.786  1.00 23.80 ? 584  ARG A O     1 
ATOM   4623  C  CB    . ARG A 1 584 ? -10.211 40.530  20.001  1.00 22.61 ? 584  ARG A CB    1 
ATOM   4624  C  CG    . ARG A 1 584 ? -11.423 41.448  20.215  1.00 21.58 ? 584  ARG A CG    1 
ATOM   4625  C  CD    . ARG A 1 584 ? -12.439 40.995  21.277  1.00 19.96 ? 584  ARG A CD    1 
ATOM   4626  N  NE    . ARG A 1 584 ? -11.854 40.265  22.408  1.00 18.46 ? 584  ARG A NE    1 
ATOM   4627  C  CZ    . ARG A 1 584 ? -12.497 39.369  23.158  1.00 18.35 ? 584  ARG A CZ    1 
ATOM   4628  N  NH1   . ARG A 1 584 ? -13.771 39.075  22.910  1.00 19.45 ? 584  ARG A NH1   1 
ATOM   4629  N  NH2   . ARG A 1 584 ? -11.864 38.749  24.158  1.00 16.59 ? 584  ARG A NH2   1 
ATOM   4630  N  N     . HIS A 1 585 ? -7.556  39.832  18.330  1.00 23.24 ? 585  HIS A N     1 
ATOM   4631  C  CA    . HIS A 1 585 ? -6.291  39.100  18.400  1.00 23.19 ? 585  HIS A CA    1 
ATOM   4632  C  C     . HIS A 1 585 ? -5.965  38.952  19.880  1.00 23.89 ? 585  HIS A C     1 
ATOM   4633  O  O     . HIS A 1 585 ? -5.749  39.957  20.566  1.00 23.45 ? 585  HIS A O     1 
ATOM   4634  C  CB    . HIS A 1 585 ? -5.201  39.872  17.666  1.00 23.13 ? 585  HIS A CB    1 
ATOM   4635  C  CG    . HIS A 1 585 ? -3.901  39.131  17.485  1.00 20.77 ? 585  HIS A CG    1 
ATOM   4636  N  ND1   . HIS A 1 585 ? -3.097  38.753  18.536  1.00 18.58 ? 585  HIS A ND1   1 
ATOM   4637  C  CD2   . HIS A 1 585 ? -3.224  38.793  16.362  1.00 18.30 ? 585  HIS A CD2   1 
ATOM   4638  C  CE1   . HIS A 1 585 ? -2.001  38.181  18.073  1.00 17.15 ? 585  HIS A CE1   1 
ATOM   4639  N  NE2   . HIS A 1 585 ? -2.050  38.199  16.757  1.00 17.10 ? 585  HIS A NE2   1 
ATOM   4640  N  N     . PRO A 1 586 ? -5.911  37.711  20.370  1.00 24.25 ? 586  PRO A N     1 
ATOM   4641  C  CA    . PRO A 1 586 ? -5.742  37.457  21.808  1.00 24.39 ? 586  PRO A CA    1 
ATOM   4642  C  C     . PRO A 1 586 ? -4.578  38.242  22.393  1.00 24.39 ? 586  PRO A C     1 
ATOM   4643  O  O     . PRO A 1 586 ? -4.729  38.885  23.426  1.00 24.89 ? 586  PRO A O     1 
ATOM   4644  C  CB    . PRO A 1 586 ? -5.436  35.957  21.887  1.00 24.49 ? 586  PRO A CB    1 
ATOM   4645  C  CG    . PRO A 1 586 ? -5.802  35.378  20.574  1.00 24.64 ? 586  PRO A CG    1 
ATOM   4646  C  CD    . PRO A 1 586 ? -5.906  36.472  19.574  1.00 24.18 ? 586  PRO A CD    1 
ATOM   4647  N  N     . VAL A 1 587 ? -3.432  38.200  21.729  1.00 24.11 ? 587  VAL A N     1 
ATOM   4648  C  CA    . VAL A 1 587 ? -2.229  38.801  22.277  1.00 23.90 ? 587  VAL A CA    1 
ATOM   4649  C  C     . VAL A 1 587 ? -2.258  40.318  22.106  1.00 23.83 ? 587  VAL A C     1 
ATOM   4650  O  O     . VAL A 1 587 ? -2.071  41.057  23.066  1.00 23.63 ? 587  VAL A O     1 
ATOM   4651  C  CB    . VAL A 1 587 ? -0.963  38.218  21.627  1.00 23.92 ? 587  VAL A CB    1 
ATOM   4652  C  CG1   . VAL A 1 587 ? 0.297   38.826  22.247  1.00 23.99 ? 587  VAL A CG1   1 
ATOM   4653  C  CG2   . VAL A 1 587 ? -0.942  36.681  21.771  1.00 24.46 ? 587  VAL A CG2   1 
ATOM   4654  N  N     . VAL A 1 588 ? -2.515  40.784  20.892  1.00 23.93 ? 588  VAL A N     1 
ATOM   4655  C  CA    . VAL A 1 588 ? -2.399  42.211  20.583  1.00 23.93 ? 588  VAL A CA    1 
ATOM   4656  C  C     . VAL A 1 588 ? -3.381  43.041  21.411  1.00 24.11 ? 588  VAL A C     1 
ATOM   4657  O  O     . VAL A 1 588 ? -3.130  44.199  21.669  1.00 24.57 ? 588  VAL A O     1 
ATOM   4658  C  CB    . VAL A 1 588 ? -2.564  42.482  19.064  1.00 23.79 ? 588  VAL A CB    1 
ATOM   4659  C  CG1   . VAL A 1 588 ? -2.565  43.980  18.757  1.00 23.96 ? 588  VAL A CG1   1 
ATOM   4660  C  CG2   . VAL A 1 588 ? -1.451  41.800  18.275  1.00 23.11 ? 588  VAL A CG2   1 
ATOM   4661  N  N     . GLU A 1 589 ? -4.460  42.423  21.876  1.00 24.69 ? 589  GLU A N     1 
ATOM   4662  C  CA    . GLU A 1 589 ? -5.497  43.114  22.637  1.00 25.10 ? 589  GLU A CA    1 
ATOM   4663  C  C     . GLU A 1 589 ? -5.147  43.293  24.111  1.00 25.52 ? 589  GLU A C     1 
ATOM   4664  O  O     . GLU A 1 589 ? -5.890  43.949  24.825  1.00 26.08 ? 589  GLU A O     1 
ATOM   4665  C  CB    . GLU A 1 589 ? -6.856  42.399  22.499  1.00 24.92 ? 589  GLU A CB    1 
ATOM   4666  C  CG    . GLU A 1 589 ? -7.217  41.460  23.643  1.00 25.04 ? 589  GLU A CG    1 
ATOM   4667  C  CD    . GLU A 1 589 ? -8.561  40.801  23.454  1.00 24.34 ? 589  GLU A CD    1 
ATOM   4668  O  OE1   . GLU A 1 589 ? -9.429  41.453  22.853  1.00 23.23 ? 589  GLU A OE1   1 
ATOM   4669  O  OE2   . GLU A 1 589 ? -8.757  39.650  23.916  1.00 24.27 ? 589  GLU A OE2   1 
ATOM   4670  N  N     . GLN A 1 590 ? -4.048  42.691  24.562  1.00 26.00 ? 590  GLN A N     1 
ATOM   4671  C  CA    . GLN A 1 590 ? -3.482  42.933  25.899  1.00 26.06 ? 590  GLN A CA    1 
ATOM   4672  C  C     . GLN A 1 590 ? -2.277  43.888  25.924  1.00 26.28 ? 590  GLN A C     1 
ATOM   4673  O  O     . GLN A 1 590 ? -1.959  44.422  26.972  1.00 26.01 ? 590  GLN A O     1 
ATOM   4674  C  CB    . GLN A 1 590 ? -3.029  41.611  26.535  1.00 25.93 ? 590  GLN A CB    1 
ATOM   4675  C  CG    . GLN A 1 590 ? -4.086  40.506  26.579  1.00 25.63 ? 590  GLN A CG    1 
ATOM   4676  C  CD    . GLN A 1 590 ? -5.157  40.757  27.604  1.00 24.18 ? 590  GLN A CD    1 
ATOM   4677  O  OE1   . GLN A 1 590 ? -6.328  40.887  27.253  1.00 25.05 ? 590  GLN A OE1   1 
ATOM   4678  N  NE2   . GLN A 1 590 ? -4.771  40.819  28.872  1.00 22.04 ? 590  GLN A NE2   1 
ATOM   4679  N  N     . VAL A 1 591 ? -1.575  44.065  24.805  1.00 26.93 ? 591  VAL A N     1 
ATOM   4680  C  CA    . VAL A 1 591 ? -0.335  44.857  24.826  1.00 27.66 ? 591  VAL A CA    1 
ATOM   4681  C  C     . VAL A 1 591 ? -0.642  46.300  24.455  1.00 27.86 ? 591  VAL A C     1 
ATOM   4682  O  O     . VAL A 1 591 ? -0.166  47.216  25.109  1.00 27.77 ? 591  VAL A O     1 
ATOM   4683  C  CB    . VAL A 1 591 ? 0.851   44.254  23.965  1.00 27.79 ? 591  VAL A CB    1 
ATOM   4684  C  CG1   . VAL A 1 591 ? 0.686   42.752  23.742  1.00 28.51 ? 591  VAL A CG1   1 
ATOM   4685  C  CG2   . VAL A 1 591 ? 1.056   44.977  22.632  1.00 28.14 ? 591  VAL A CG2   1 
ATOM   4686  N  N     . LEU A 1 592 ? -1.444  46.476  23.410  1.00 28.27 ? 592  LEU A N     1 
ATOM   4687  C  CA    . LEU A 1 592 ? -2.017  47.771  23.045  1.00 28.57 ? 592  LEU A CA    1 
ATOM   4688  C  C     . LEU A 1 592 ? -2.600  48.455  24.262  1.00 28.51 ? 592  LEU A C     1 
ATOM   4689  O  O     . LEU A 1 592 ? -3.298  47.818  25.045  1.00 28.30 ? 592  LEU A O     1 
ATOM   4690  C  CB    . LEU A 1 592 ? -3.159  47.574  22.039  1.00 28.77 ? 592  LEU A CB    1 
ATOM   4691  C  CG    . LEU A 1 592 ? -3.123  48.199  20.648  1.00 29.45 ? 592  LEU A CG    1 
ATOM   4692  C  CD1   . LEU A 1 592 ? -1.709  48.321  20.073  1.00 30.24 ? 592  LEU A CD1   1 
ATOM   4693  C  CD2   . LEU A 1 592 ? -4.011  47.367  19.728  1.00 29.75 ? 592  LEU A CD2   1 
ATOM   4694  N  N     . ASN A 1 593 ? -2.319  49.748  24.421  1.00 28.94 ? 593  ASN A N     1 
ATOM   4695  C  CA    . ASN A 1 593 ? -2.951  50.524  25.494  1.00 29.19 ? 593  ASN A CA    1 
ATOM   4696  C  C     . ASN A 1 593 ? -4.337  51.017  25.045  1.00 29.11 ? 593  ASN A C     1 
ATOM   4697  O  O     . ASN A 1 593 ? -5.309  50.910  25.798  1.00 29.36 ? 593  ASN A O     1 
ATOM   4698  C  CB    . ASN A 1 593 ? -2.048  51.670  25.975  1.00 29.17 ? 593  ASN A CB    1 
ATOM   4699  C  CG    . ASN A 1 593 ? -1.624  51.501  27.426  1.00 29.75 ? 593  ASN A CG    1 
ATOM   4700  O  OD1   . ASN A 1 593 ? -1.661  52.453  28.211  1.00 30.80 ? 593  ASN A OD1   1 
ATOM   4701  N  ND2   . ASN A 1 593 ? -1.214  50.287  27.791  1.00 29.76 ? 593  ASN A ND2   1 
ATOM   4702  N  N     . GLU A 1 594 ? -4.417  51.527  23.812  1.00 28.72 ? 594  GLU A N     1 
ATOM   4703  C  CA    . GLU A 1 594 ? -5.700  51.840  23.160  1.00 28.21 ? 594  GLU A CA    1 
ATOM   4704  C  C     . GLU A 1 594 ? -6.573  50.571  22.925  1.00 27.89 ? 594  GLU A C     1 
ATOM   4705  O  O     . GLU A 1 594 ? -6.068  49.432  22.951  1.00 28.16 ? 594  GLU A O     1 
ATOM   4706  C  CB    . GLU A 1 594 ? -5.471  52.623  21.851  1.00 28.25 ? 594  GLU A CB    1 
ATOM   4707  C  CG    . GLU A 1 594 ? -4.440  52.058  20.879  1.00 28.24 ? 594  GLU A CG    1 
ATOM   4708  C  CD    . GLU A 1 594 ? -4.218  52.978  19.688  1.00 28.38 ? 594  GLU A CD    1 
ATOM   4709  O  OE1   . GLU A 1 594 ? -4.792  52.712  18.604  1.00 27.54 ? 594  GLU A OE1   1 
ATOM   4710  O  OE2   . GLU A 1 594 ? -3.475  53.979  19.841  1.00 28.75 ? 594  GLU A OE2   1 
ATOM   4711  N  N     . PRO A 1 595 ? -7.879  50.750  22.701  1.00 26.81 ? 595  PRO A N     1 
ATOM   4712  C  CA    . PRO A 1 595 ? -8.792  49.598  22.698  1.00 25.47 ? 595  PRO A CA    1 
ATOM   4713  C  C     . PRO A 1 595 ? -8.717  48.835  21.381  1.00 23.56 ? 595  PRO A C     1 
ATOM   4714  O  O     . PRO A 1 595 ? -8.415  49.414  20.340  1.00 22.93 ? 595  PRO A O     1 
ATOM   4715  C  CB    . PRO A 1 595 ? -10.173 50.246  22.923  1.00 25.77 ? 595  PRO A CB    1 
ATOM   4716  C  CG    . PRO A 1 595 ? -10.056 51.625  22.312  1.00 26.50 ? 595  PRO A CG    1 
ATOM   4717  C  CD    . PRO A 1 595 ? -8.588  52.014  22.400  1.00 26.84 ? 595  PRO A CD    1 
ATOM   4718  N  N     . PHE A 1 596 ? -8.988  47.540  21.433  1.00 21.85 ? 596  PHE A N     1 
ATOM   4719  C  CA    . PHE A 1 596 ? -8.853  46.691  20.248  1.00 20.51 ? 596  PHE A CA    1 
ATOM   4720  C  C     . PHE A 1 596 ? -10.116 46.687  19.392  1.00 19.70 ? 596  PHE A C     1 
ATOM   4721  O  O     . PHE A 1 596 ? -11.196 46.430  19.905  1.00 20.21 ? 596  PHE A O     1 
ATOM   4722  C  CB    . PHE A 1 596 ? -8.504  45.239  20.618  1.00 20.04 ? 596  PHE A CB    1 
ATOM   4723  C  CG    . PHE A 1 596 ? -8.114  44.432  19.417  1.00 19.69 ? 596  PHE A CG    1 
ATOM   4724  C  CD1   . PHE A 1 596 ? -9.077  43.961  18.548  1.00 17.19 ? 596  PHE A CD1   1 
ATOM   4725  C  CD2   . PHE A 1 596 ? -6.785  44.252  19.088  1.00 18.21 ? 596  PHE A CD2   1 
ATOM   4726  C  CE1   . PHE A 1 596 ? -8.725  43.324  17.440  1.00 16.09 ? 596  PHE A CE1   1 
ATOM   4727  C  CE2   . PHE A 1 596 ? -6.445  43.584  17.961  1.00 16.61 ? 596  PHE A CE2   1 
ATOM   4728  C  CZ    . PHE A 1 596 ? -7.405  43.131  17.140  1.00 16.51 ? 596  PHE A CZ    1 
ATOM   4729  N  N     . ILE A 1 597 ? -9.992  46.926  18.089  1.00 18.69 ? 597  ILE A N     1 
ATOM   4730  C  CA    . ILE A 1 597 ? -11.175 46.989  17.234  1.00 18.29 ? 597  ILE A CA    1 
ATOM   4731  C  C     . ILE A 1 597 ? -11.538 45.609  16.749  1.00 18.25 ? 597  ILE A C     1 
ATOM   4732  O  O     . ILE A 1 597 ? -10.845 45.053  15.912  1.00 18.71 ? 597  ILE A O     1 
ATOM   4733  C  CB    . ILE A 1 597 ? -10.969 47.943  16.009  1.00 18.22 ? 597  ILE A CB    1 
ATOM   4734  C  CG1   . ILE A 1 597 ? -10.609 49.366  16.459  1.00 15.59 ? 597  ILE A CG1   1 
ATOM   4735  C  CG2   . ILE A 1 597 ? -12.222 47.949  15.124  1.00 17.83 ? 597  ILE A CG2   1 
ATOM   4736  C  CD1   . ILE A 1 597 ? -11.227 49.782  17.727  1.00 13.35 ? 597  ILE A CD1   1 
ATOM   4737  N  N     . ALA A 1 598 ? -12.639 45.077  17.257  1.00 17.83 ? 598  ALA A N     1 
ATOM   4738  C  CA    . ALA A 1 598 ? -13.101 43.764  16.861  1.00 18.08 ? 598  ALA A CA    1 
ATOM   4739  C  C     . ALA A 1 598 ? -13.664 43.776  15.447  1.00 18.27 ? 598  ALA A C     1 
ATOM   4740  O  O     . ALA A 1 598 ? -14.428 44.663  15.108  1.00 18.73 ? 598  ALA A O     1 
ATOM   4741  C  CB    . ALA A 1 598 ? -14.153 43.292  17.831  1.00 18.15 ? 598  ALA A CB    1 
ATOM   4742  N  N     . ASN A 1 599 ? -13.286 42.791  14.629  1.00 18.74 ? 599  ASN A N     1 
ATOM   4743  C  CA    . ASN A 1 599 ? -13.836 42.607  13.278  1.00 18.61 ? 599  ASN A CA    1 
ATOM   4744  C  C     . ASN A 1 599 ? -14.436 41.228  13.070  1.00 19.10 ? 599  ASN A C     1 
ATOM   4745  O  O     . ASN A 1 599 ? -14.109 40.309  13.803  1.00 19.81 ? 599  ASN A O     1 
ATOM   4746  C  CB    . ASN A 1 599 ? -12.728 42.770  12.268  1.00 18.68 ? 599  ASN A CB    1 
ATOM   4747  C  CG    . ASN A 1 599 ? -12.042 44.071  12.400  1.00 18.07 ? 599  ASN A CG    1 
ATOM   4748  O  OD1   . ASN A 1 599 ? -12.648 45.094  12.178  1.00 20.07 ? 599  ASN A OD1   1 
ATOM   4749  N  ND2   . ASN A 1 599 ? -10.775 44.053  12.788  1.00 18.07 ? 599  ASN A ND2   1 
ATOM   4750  N  N     . PRO A 1 600 ? -15.298 41.059  12.069  1.00 19.56 ? 600  PRO A N     1 
ATOM   4751  C  CA    . PRO A 1 600 ? -15.849 39.741  11.754  1.00 19.92 ? 600  PRO A CA    1 
ATOM   4752  C  C     . PRO A 1 600 ? -15.066 38.944  10.693  1.00 20.19 ? 600  PRO A C     1 
ATOM   4753  O  O     . PRO A 1 600 ? -14.094 39.408  10.101  1.00 20.88 ? 600  PRO A O     1 
ATOM   4754  C  CB    . PRO A 1 600 ? -17.218 40.106  11.199  1.00 19.86 ? 600  PRO A CB    1 
ATOM   4755  C  CG    . PRO A 1 600 ? -16.950 41.333  10.424  1.00 19.73 ? 600  PRO A CG    1 
ATOM   4756  C  CD    . PRO A 1 600 ? -15.876 42.084  11.188  1.00 19.65 ? 600  PRO A CD    1 
ATOM   4757  N  N     . LEU A 1 601 ? -15.520 37.732  10.433  1.00 20.02 ? 601  LEU A N     1 
ATOM   4758  C  CA    . LEU A 1 601 ? -15.038 36.995  9.275   1.00 19.76 ? 601  LEU A CA    1 
ATOM   4759  C  C     . LEU A 1 601 ? -16.081 35.986  8.881   1.00 20.01 ? 601  LEU A C     1 
ATOM   4760  O  O     . LEU A 1 601 ? -16.816 35.468  9.723   1.00 19.75 ? 601  LEU A O     1 
ATOM   4761  C  CB    . LEU A 1 601 ? -13.733 36.290  9.605   1.00 19.67 ? 601  LEU A CB    1 
ATOM   4762  C  CG    . LEU A 1 601 ? -13.197 35.271  8.602   1.00 18.42 ? 601  LEU A CG    1 
ATOM   4763  C  CD1   . LEU A 1 601 ? -12.626 35.983  7.413   1.00 19.13 ? 601  LEU A CD1   1 
ATOM   4764  C  CD2   . LEU A 1 601 ? -12.142 34.428  9.259   1.00 17.19 ? 601  LEU A CD2   1 
ATOM   4765  N  N     . ASN A 1 602 ? -16.135 35.701  7.597   1.00 20.33 ? 602  ASN A N     1 
ATOM   4766  C  CA    . ASN A 1 602 ? -17.097 34.746  7.093   1.00 20.95 ? 602  ASN A CA    1 
ATOM   4767  C  C     . ASN A 1 602 ? -16.447 33.964  5.963   1.00 21.19 ? 602  ASN A C     1 
ATOM   4768  O  O     . ASN A 1 602 ? -16.383 34.461  4.847   1.00 22.10 ? 602  ASN A O     1 
ATOM   4769  C  CB    . ASN A 1 602 ? -18.329 35.512  6.631   1.00 21.09 ? 602  ASN A CB    1 
ATOM   4770  C  CG    . ASN A 1 602 ? -19.458 34.621  6.204   1.00 21.42 ? 602  ASN A CG    1 
ATOM   4771  O  OD1   . ASN A 1 602 ? -19.868 34.641  5.048   1.00 23.91 ? 602  ASN A OD1   1 
ATOM   4772  N  ND2   . ASN A 1 602 ? -20.015 33.880  7.144   1.00 23.15 ? 602  ASN A ND2   1 
ATOM   4773  N  N     . LEU A 1 603 ? -15.880 32.792  6.272   1.00 20.82 ? 603  LEU A N     1 
ATOM   4774  C  CA    . LEU A 1 603 ? -15.417 31.862  5.249   1.00 20.32 ? 603  LEU A CA    1 
ATOM   4775  C  C     . LEU A 1 603 ? -16.375 30.672  5.128   1.00 20.41 ? 603  LEU A C     1 
ATOM   4776  O  O     . LEU A 1 603 ? -16.791 30.091  6.122   1.00 19.81 ? 603  LEU A O     1 
ATOM   4777  C  CB    . LEU A 1 603 ? -14.031 31.356  5.582   1.00 20.31 ? 603  LEU A CB    1 
ATOM   4778  C  CG    . LEU A 1 603 ? -12.944 32.388  5.865   1.00 20.61 ? 603  LEU A CG    1 
ATOM   4779  C  CD1   . LEU A 1 603 ? -11.610 31.667  6.027   1.00 18.30 ? 603  LEU A CD1   1 
ATOM   4780  C  CD2   . LEU A 1 603 ? -12.893 33.441  4.748   1.00 20.56 ? 603  LEU A CD2   1 
ATOM   4781  N  N     . SER A 1 604 ? -16.760 30.353  3.901   1.00 20.68 ? 604  SER A N     1 
ATOM   4782  C  CA    . SER A 1 604 ? -17.453 29.109  3.587   1.00 20.79 ? 604  SER A CA    1 
ATOM   4783  C  C     . SER A 1 604 ? -16.886 28.560  2.277   1.00 21.26 ? 604  SER A C     1 
ATOM   4784  O  O     . SER A 1 604 ? -15.920 29.109  1.758   1.00 21.55 ? 604  SER A O     1 
ATOM   4785  C  CB    . SER A 1 604 ? -18.957 29.349  3.491   1.00 20.77 ? 604  SER A CB    1 
ATOM   4786  O  OG    . SER A 1 604 ? -19.331 29.693  2.180   1.00 21.57 ? 604  SER A OG    1 
ATOM   4787  N  N     . PRO A 1 605 ? -17.410 27.439  1.775   1.00 21.67 ? 605  PRO A N     1 
ATOM   4788  C  CA    . PRO A 1 605 ? -17.042 26.942  0.437   1.00 21.51 ? 605  PRO A CA    1 
ATOM   4789  C  C     . PRO A 1 605 ? -17.456 27.831  -0.736  1.00 21.50 ? 605  PRO A C     1 
ATOM   4790  O  O     . PRO A 1 605 ? -16.893 27.739  -1.823  1.00 20.88 ? 605  PRO A O     1 
ATOM   4791  C  CB    . PRO A 1 605 ? -17.762 25.613  0.376   1.00 21.53 ? 605  PRO A CB    1 
ATOM   4792  C  CG    . PRO A 1 605 ? -17.879 25.237  1.827   1.00 21.77 ? 605  PRO A CG    1 
ATOM   4793  C  CD    . PRO A 1 605 ? -18.308 26.500  2.465   1.00 21.24 ? 605  PRO A CD    1 
ATOM   4794  N  N     . GLN A 1 606 ? -18.455 28.668  -0.524  1.00 22.15 ? 606  GLN A N     1 
ATOM   4795  C  CA    . GLN A 1 606 ? -18.861 29.637  -1.535  1.00 22.68 ? 606  GLN A CA    1 
ATOM   4796  C  C     . GLN A 1 606 ? -18.093 30.960  -1.350  1.00 22.14 ? 606  GLN A C     1 
ATOM   4797  O  O     . GLN A 1 606 ? -17.927 31.730  -2.278  1.00 22.50 ? 606  GLN A O     1 
ATOM   4798  C  CB    . GLN A 1 606 ? -20.373 29.809  -1.489  1.00 22.82 ? 606  GLN A CB    1 
ATOM   4799  C  CG    . GLN A 1 606 ? -21.093 28.508  -1.852  1.00 24.69 ? 606  GLN A CG    1 
ATOM   4800  C  CD    . GLN A 1 606 ? -21.374 27.594  -0.654  1.00 27.53 ? 606  GLN A CD    1 
ATOM   4801  O  OE1   . GLN A 1 606 ? -21.500 28.062  0.486   1.00 30.75 ? 606  GLN A OE1   1 
ATOM   4802  N  NE2   . GLN A 1 606 ? -21.494 26.292  -0.913  1.00 28.08 ? 606  GLN A NE2   1 
ATOM   4803  N  N     . ARG A 1 607 ? -17.577 31.171  -0.155  1.00 21.52 ? 607  ARG A N     1 
ATOM   4804  C  CA    . ARG A 1 607 ? -16.776 32.328  0.148   1.00 21.35 ? 607  ARG A CA    1 
ATOM   4805  C  C     . ARG A 1 607 ? -15.482 31.834  0.778   1.00 21.02 ? 607  ARG A C     1 
ATOM   4806  O  O     . ARG A 1 607 ? -15.272 31.962  1.978   1.00 20.74 ? 607  ARG A O     1 
ATOM   4807  C  CB    . ARG A 1 607 ? -17.567 33.181  1.115   1.00 21.52 ? 607  ARG A CB    1 
ATOM   4808  C  CG    . ARG A 1 607 ? -17.031 34.529  1.397   1.00 21.07 ? 607  ARG A CG    1 
ATOM   4809  C  CD    . ARG A 1 607 ? -17.946 35.248  2.315   1.00 22.24 ? 607  ARG A CD    1 
ATOM   4810  N  NE    . ARG A 1 607 ? -17.315 36.396  2.938   1.00 23.51 ? 607  ARG A NE    1 
ATOM   4811  C  CZ    . ARG A 1 607 ? -17.152 37.553  2.342   1.00 24.45 ? 607  ARG A CZ    1 
ATOM   4812  N  NH1   . ARG A 1 607 ? -17.550 37.727  1.089   1.00 25.48 ? 607  ARG A NH1   1 
ATOM   4813  N  NH2   . ARG A 1 607 ? -16.572 38.541  2.994   1.00 25.53 ? 607  ARG A NH2   1 
ATOM   4814  N  N     . ARG A 1 608 ? -14.620 31.239  -0.040  1.00 20.97 ? 608  ARG A N     1 
ATOM   4815  C  CA    . ARG A 1 608 ? -13.449 30.544  0.474   1.00 20.72 ? 608  ARG A CA    1 
ATOM   4816  C  C     . ARG A 1 608 ? -12.111 31.284  0.297   1.00 20.50 ? 608  ARG A C     1 
ATOM   4817  O  O     . ARG A 1 608 ? -11.087 30.858  0.843   1.00 20.25 ? 608  ARG A O     1 
ATOM   4818  C  CB    . ARG A 1 608 ? -13.422 29.122  -0.103  1.00 21.02 ? 608  ARG A CB    1 
ATOM   4819  C  CG    . ARG A 1 608 ? -12.727 28.975  -1.431  1.00 21.09 ? 608  ARG A CG    1 
ATOM   4820  C  CD    . ARG A 1 608 ? -13.103 27.742  -2.179  1.00 17.11 ? 608  ARG A CD    1 
ATOM   4821  N  NE    . ARG A 1 608 ? -14.316 27.955  -2.943  1.00 15.91 ? 608  ARG A NE    1 
ATOM   4822  C  CZ    . ARG A 1 608 ? -14.390 27.978  -4.270  1.00 17.10 ? 608  ARG A CZ    1 
ATOM   4823  N  NH1   . ARG A 1 608 ? -13.321 27.856  -5.034  1.00 17.45 ? 608  ARG A NH1   1 
ATOM   4824  N  NH2   . ARG A 1 608 ? -15.557 28.153  -4.853  1.00 18.82 ? 608  ARG A NH2   1 
ATOM   4825  N  N     . MET A 1 609 ? -12.104 32.410  -0.417  1.00 20.33 ? 609  MET A N     1 
ATOM   4826  C  CA    . MET A 1 609 ? -10.892 33.246  -0.467  1.00 20.25 ? 609  MET A CA    1 
ATOM   4827  C  C     . MET A 1 609 ? -11.215 34.715  -0.349  1.00 19.18 ? 609  MET A C     1 
ATOM   4828  O  O     . MET A 1 609 ? -11.988 35.242  -1.128  1.00 20.13 ? 609  MET A O     1 
ATOM   4829  C  CB    . MET A 1 609 ? -10.082 32.978  -1.740  1.00 20.75 ? 609  MET A CB    1 
ATOM   4830  C  CG    . MET A 1 609 ? -8.914  33.941  -1.947  1.00 23.36 ? 609  MET A CG    1 
ATOM   4831  S  SD    . MET A 1 609 ? -7.965  33.616  -3.451  1.00 28.11 ? 609  MET A SD    1 
ATOM   4832  C  CE    . MET A 1 609 ? -7.446  31.989  -3.198  1.00 27.76 ? 609  MET A CE    1 
ATOM   4833  N  N     . LEU A 1 610 ? -10.644 35.377  0.646   1.00 17.80 ? 610  LEU A N     1 
ATOM   4834  C  CA    . LEU A 1 610 ? -10.735 36.835  0.753   1.00 16.36 ? 610  LEU A CA    1 
ATOM   4835  C  C     . LEU A 1 610 ? -9.442  37.485  0.281   1.00 14.83 ? 610  LEU A C     1 
ATOM   4836  O  O     . LEU A 1 610 ? -8.421  37.354  0.916   1.00 13.88 ? 610  LEU A O     1 
ATOM   4837  C  CB    . LEU A 1 610 ? -11.005 37.254  2.212   1.00 16.87 ? 610  LEU A CB    1 
ATOM   4838  C  CG    . LEU A 1 610 ? -12.153 36.558  2.971   1.00 16.11 ? 610  LEU A CG    1 
ATOM   4839  C  CD1   . LEU A 1 610 ? -12.439 37.275  4.258   1.00 16.35 ? 610  LEU A CD1   1 
ATOM   4840  C  CD2   . LEU A 1 610 ? -13.407 36.470  2.144   1.00 15.91 ? 610  LEU A CD2   1 
ATOM   4841  N  N     . ILE A 1 611 ? -9.475  38.163  -0.850  1.00 13.87 ? 611  ILE A N     1 
ATOM   4842  C  CA    . ILE A 1 611 ? -8.420  39.143  -1.170  1.00 13.36 ? 611  ILE A CA    1 
ATOM   4843  C  C     . ILE A 1 611 ? -8.541  40.352  -0.236  1.00 12.50 ? 611  ILE A C     1 
ATOM   4844  O  O     . ILE A 1 611 ? -9.585  40.968  -0.206  1.00 11.23 ? 611  ILE A O     1 
ATOM   4845  C  CB    . ILE A 1 611 ? -8.570  39.627  -2.599  1.00 13.38 ? 611  ILE A CB    1 
ATOM   4846  C  CG1   . ILE A 1 611 ? -8.631  38.421  -3.569  1.00 13.07 ? 611  ILE A CG1   1 
ATOM   4847  C  CG2   . ILE A 1 611 ? -7.440  40.595  -2.947  1.00 12.48 ? 611  ILE A CG2   1 
ATOM   4848  C  CD1   . ILE A 1 611 ? -7.534  37.420  -3.437  1.00 11.73 ? 611  ILE A CD1   1 
ATOM   4849  N  N     . ILE A 1 612 ? -7.500  40.659  0.535   1.00 12.17 ? 612  ILE A N     1 
ATOM   4850  C  CA    . ILE A 1 612 ? -7.570  41.744  1.532   1.00 12.38 ? 612  ILE A CA    1 
ATOM   4851  C  C     . ILE A 1 612 ? -6.679  42.946  1.181   1.00 12.71 ? 612  ILE A C     1 
ATOM   4852  O  O     . ILE A 1 612 ? -5.476  42.846  1.260   1.00 12.04 ? 612  ILE A O     1 
ATOM   4853  C  CB    . ILE A 1 612 ? -7.139  41.237  2.922   1.00 12.57 ? 612  ILE A CB    1 
ATOM   4854  C  CG1   . ILE A 1 612 ? -7.756  39.849  3.257   1.00 11.04 ? 612  ILE A CG1   1 
ATOM   4855  C  CG2   . ILE A 1 612 ? -7.454  42.309  3.991   1.00 12.69 ? 612  ILE A CG2   1 
ATOM   4856  C  CD1   . ILE A 1 612 ? -7.229  39.245  4.570   1.00 9.58  ? 612  ILE A CD1   1 
ATOM   4857  N  N     . THR A 1 613 ? -7.262  44.085  0.808   1.00 13.67 ? 613  THR A N     1 
ATOM   4858  C  CA    . THR A 1 613 ? -6.463  45.323  0.670   1.00 13.38 ? 613  THR A CA    1 
ATOM   4859  C  C     . THR A 1 613 ? -6.480  46.186  1.917   1.00 14.09 ? 613  THR A C     1 
ATOM   4860  O  O     . THR A 1 613 ? -7.072  45.818  2.921   1.00 14.10 ? 613  THR A O     1 
ATOM   4861  C  CB    . THR A 1 613 ? -6.873  46.162  -0.555  1.00 12.90 ? 613  THR A CB    1 
ATOM   4862  O  OG1   . THR A 1 613 ? -8.298  46.228  -0.705  1.00 11.42 ? 613  THR A OG1   1 
ATOM   4863  C  CG2   . THR A 1 613 ? -6.398  45.527  -1.801  1.00 13.07 ? 613  THR A CG2   1 
ATOM   4864  N  N     . GLY A 1 614 ? -5.787  47.325  1.838   1.00 15.55 ? 614  GLY A N     1 
ATOM   4865  C  CA    . GLY A 1 614 ? -5.811  48.358  2.861   1.00 16.17 ? 614  GLY A CA    1 
ATOM   4866  C  C     . GLY A 1 614 ? -4.400  48.835  3.096   1.00 17.25 ? 614  GLY A C     1 
ATOM   4867  O  O     . GLY A 1 614 ? -3.449  48.155  2.767   1.00 18.13 ? 614  GLY A O     1 
ATOM   4868  N  N     . PRO A 1 615 ? -4.234  49.985  3.711   1.00 18.28 ? 615  PRO A N     1 
ATOM   4869  C  CA    . PRO A 1 615 ? -2.910  50.603  3.755   1.00 18.84 ? 615  PRO A CA    1 
ATOM   4870  C  C     . PRO A 1 615 ? -1.913  49.830  4.636   1.00 19.31 ? 615  PRO A C     1 
ATOM   4871  O  O     . PRO A 1 615 ? -2.309  49.113  5.530   1.00 18.87 ? 615  PRO A O     1 
ATOM   4872  C  CB    . PRO A 1 615 ? -3.202  51.980  4.373   1.00 18.87 ? 615  PRO A CB    1 
ATOM   4873  C  CG    . PRO A 1 615 ? -4.370  51.720  5.266   1.00 18.42 ? 615  PRO A CG    1 
ATOM   4874  C  CD    . PRO A 1 615 ? -5.233  50.745  4.487   1.00 18.20 ? 615  PRO A CD    1 
ATOM   4875  N  N     . ASN A 1 616 ? -0.625  50.026  4.389   1.00 20.24 ? 616  ASN A N     1 
ATOM   4876  C  CA    . ASN A 1 616 ? 0.414   49.576  5.310   1.00 20.70 ? 616  ASN A CA    1 
ATOM   4877  C  C     . ASN A 1 616 ? 0.127   50.144  6.682   1.00 20.52 ? 616  ASN A C     1 
ATOM   4878  O  O     . ASN A 1 616 ? -0.057  51.361  6.808   1.00 21.33 ? 616  ASN A O     1 
ATOM   4879  C  CB    . ASN A 1 616 ? 1.833   50.021  4.839   1.00 21.03 ? 616  ASN A CB    1 
ATOM   4880  C  CG    . ASN A 1 616 ? 2.884   48.891  4.987   1.00 21.47 ? 616  ASN A CG    1 
ATOM   4881  O  OD1   . ASN A 1 616 ? 3.619   48.817  5.983   1.00 21.92 ? 616  ASN A OD1   1 
ATOM   4882  N  ND2   . ASN A 1 616 ? 2.942   48.010  3.996   1.00 21.48 ? 616  ASN A ND2   1 
ATOM   4883  N  N     . MET A 1 617 ? 0.118   49.270  7.693   1.00 19.93 ? 617  MET A N     1 
ATOM   4884  C  CA    . MET A 1 617 ? -0.261  49.595  9.086   1.00 19.36 ? 617  MET A CA    1 
ATOM   4885  C  C     . MET A 1 617 ? -1.794  49.580  9.314   1.00 18.47 ? 617  MET A C     1 
ATOM   4886  O  O     . MET A 1 617 ? -2.281  49.876  10.416  1.00 18.19 ? 617  MET A O     1 
ATOM   4887  C  CB    . MET A 1 617 ? 0.372   50.927  9.558   1.00 19.53 ? 617  MET A CB    1 
ATOM   4888  C  CG    . MET A 1 617 ? 1.903   50.898  9.648   1.00 20.80 ? 617  MET A CG    1 
ATOM   4889  S  SD    . MET A 1 617 ? 2.746   52.530  9.497   1.00 24.83 ? 617  MET A SD    1 
ATOM   4890  C  CE    . MET A 1 617 ? 2.054   53.509  10.970  1.00 25.19 ? 617  MET A CE    1 
ATOM   4891  N  N     . GLY A 1 618 ? -2.546  49.202  8.282   1.00 17.72 ? 618  GLY A N     1 
ATOM   4892  C  CA    . GLY A 1 618 ? -4.001  49.176  8.344   1.00 17.86 ? 618  GLY A CA    1 
ATOM   4893  C  C     . GLY A 1 618 ? -4.603  48.010  9.124   1.00 17.85 ? 618  GLY A C     1 
ATOM   4894  O  O     . GLY A 1 618 ? -5.799  48.013  9.440   1.00 18.30 ? 618  GLY A O     1 
ATOM   4895  N  N     . GLY A 1 619 ? -3.783  47.009  9.416   1.00 16.98 ? 619  GLY A N     1 
ATOM   4896  C  CA    . GLY A 1 619 ? -4.186  45.911  10.273  1.00 16.81 ? 619  GLY A CA    1 
ATOM   4897  C  C     . GLY A 1 619 ? -4.479  44.597  9.550   1.00 16.03 ? 619  GLY A C     1 
ATOM   4898  O  O     . GLY A 1 619 ? -5.275  43.818  10.039  1.00 15.97 ? 619  GLY A O     1 
ATOM   4899  N  N     . LYS A 1 620 ? -3.802  44.363  8.431   1.00 15.24 ? 620  LYS A N     1 
ATOM   4900  C  CA    . LYS A 1 620 ? -4.080  43.263  7.518   1.00 15.20 ? 620  LYS A CA    1 
ATOM   4901  C  C     . LYS A 1 620 ? -3.506  41.967  8.073   1.00 15.65 ? 620  LYS A C     1 
ATOM   4902  O  O     . LYS A 1 620 ? -4.219  41.020  8.324   1.00 15.72 ? 620  LYS A O     1 
ATOM   4903  C  CB    . LYS A 1 620 ? -3.435  43.523  6.151   1.00 14.57 ? 620  LYS A CB    1 
ATOM   4904  C  CG    . LYS A 1 620 ? -4.218  44.404  5.232   1.00 14.27 ? 620  LYS A CG    1 
ATOM   4905  C  CD    . LYS A 1 620 ? -3.643  44.420  3.799   1.00 15.09 ? 620  LYS A CD    1 
ATOM   4906  C  CE    . LYS A 1 620 ? -2.214  44.900  3.760   1.00 15.89 ? 620  LYS A CE    1 
ATOM   4907  N  NZ    . LYS A 1 620 ? -1.992  46.112  4.637   1.00 15.66 ? 620  LYS A NZ    1 
ATOM   4908  N  N     . SER A 1 621 ? -2.193  41.953  8.243   1.00 15.92 ? 621  SER A N     1 
ATOM   4909  C  CA    . SER A 1 621 ? -1.489  40.878  8.914   1.00 15.96 ? 621  SER A CA    1 
ATOM   4910  C  C     . SER A 1 621 ? -2.184  40.425  10.193  1.00 16.29 ? 621  SER A C     1 
ATOM   4911  O  O     . SER A 1 621 ? -2.265  39.226  10.483  1.00 17.26 ? 621  SER A O     1 
ATOM   4912  C  CB    . SER A 1 621 ? -0.054  41.332  9.232   1.00 15.64 ? 621  SER A CB    1 
ATOM   4913  O  OG    . SER A 1 621 ? 0.717   41.342  8.046   1.00 14.91 ? 621  SER A OG    1 
ATOM   4914  N  N     . THR A 1 622 ? -2.686  41.378  10.957  1.00 16.34 ? 622  THR A N     1 
ATOM   4915  C  CA    . THR A 1 622 ? -3.171  41.106  12.300  1.00 16.28 ? 622  THR A CA    1 
ATOM   4916  C  C     . THR A 1 622 ? -4.499  40.394  12.198  1.00 16.72 ? 622  THR A C     1 
ATOM   4917  O  O     . THR A 1 622 ? -4.736  39.411  12.877  1.00 16.93 ? 622  THR A O     1 
ATOM   4918  C  CB    . THR A 1 622 ? -3.308  42.411  13.043  1.00 16.02 ? 622  THR A CB    1 
ATOM   4919  O  OG1   . THR A 1 622 ? -2.013  43.002  13.169  1.00 15.11 ? 622  THR A OG1   1 
ATOM   4920  C  CG2   . THR A 1 622 ? -3.765  42.199  14.457  1.00 16.07 ? 622  THR A CG2   1 
ATOM   4921  N  N     . TYR A 1 623 ? -5.343  40.867  11.295  1.00 16.87 ? 623  TYR A N     1 
ATOM   4922  C  CA    . TYR A 1 623 ? -6.626  40.218  11.033  1.00 17.31 ? 623  TYR A CA    1 
ATOM   4923  C  C     . TYR A 1 623 ? -6.470  38.750  10.558  1.00 18.22 ? 623  TYR A C     1 
ATOM   4924  O  O     . TYR A 1 623 ? -7.362  37.925  10.776  1.00 17.61 ? 623  TYR A O     1 
ATOM   4925  C  CB    . TYR A 1 623 ? -7.377  41.039  9.988   1.00 16.71 ? 623  TYR A CB    1 
ATOM   4926  C  CG    . TYR A 1 623 ? -8.726  40.497  9.572   1.00 14.13 ? 623  TYR A CG    1 
ATOM   4927  C  CD1   . TYR A 1 623 ? -9.843  40.644  10.389  1.00 10.15 ? 623  TYR A CD1   1 
ATOM   4928  C  CD2   . TYR A 1 623 ? -8.886  39.880  8.332   1.00 11.09 ? 623  TYR A CD2   1 
ATOM   4929  C  CE1   . TYR A 1 623 ? -11.065 40.185  9.980   1.00 10.85 ? 623  TYR A CE1   1 
ATOM   4930  C  CE2   . TYR A 1 623 ? -10.102 39.420  7.913   1.00 9.57  ? 623  TYR A CE2   1 
ATOM   4931  C  CZ    . TYR A 1 623 ? -11.188 39.553  8.728   1.00 10.27 ? 623  TYR A CZ    1 
ATOM   4932  O  OH    . TYR A 1 623 ? -12.399 39.072  8.275   1.00 10.28 ? 623  TYR A OH    1 
ATOM   4933  N  N     . MET A 1 624 ? -5.347  38.475  9.896   1.00 19.15 ? 624  MET A N     1 
ATOM   4934  C  CA    . MET A 1 624 ? -5.026  37.157  9.372   1.00 20.74 ? 624  MET A CA    1 
ATOM   4935  C  C     . MET A 1 624 ? -4.557  36.267  10.494  1.00 20.85 ? 624  MET A C     1 
ATOM   4936  O  O     . MET A 1 624 ? -5.014  35.146  10.608  1.00 21.13 ? 624  MET A O     1 
ATOM   4937  C  CB    . MET A 1 624 ? -3.911  37.226  8.319   1.00 21.48 ? 624  MET A CB    1 
ATOM   4938  C  CG    . MET A 1 624 ? -4.187  38.157  7.138   1.00 22.27 ? 624  MET A CG    1 
ATOM   4939  S  SD    . MET A 1 624 ? -3.618  37.473  5.562   1.00 23.40 ? 624  MET A SD    1 
ATOM   4940  C  CE    . MET A 1 624 ? -1.982  37.490  5.827   1.00 22.47 ? 624  MET A CE    1 
ATOM   4941  N  N     . ARG A 1 625 ? -3.643  36.775  11.315  1.00 20.93 ? 625  ARG A N     1 
ATOM   4942  C  CA    . ARG A 1 625 ? -3.180  36.050  12.489  1.00 21.11 ? 625  ARG A CA    1 
ATOM   4943  C  C     . ARG A 1 625 ? -4.295  35.735  13.478  1.00 20.56 ? 625  ARG A C     1 
ATOM   4944  O  O     . ARG A 1 625 ? -4.279  34.676  14.094  1.00 21.56 ? 625  ARG A O     1 
ATOM   4945  C  CB    . ARG A 1 625 ? -2.094  36.832  13.230  1.00 21.76 ? 625  ARG A CB    1 
ATOM   4946  C  CG    . ARG A 1 625 ? -0.709  36.798  12.585  1.00 23.05 ? 625  ARG A CG    1 
ATOM   4947  C  CD    . ARG A 1 625 ? 0.115   37.997  12.951  1.00 25.70 ? 625  ARG A CD    1 
ATOM   4948  N  NE    . ARG A 1 625 ? 1.354   38.098  12.185  1.00 27.72 ? 625  ARG A NE    1 
ATOM   4949  C  CZ    . ARG A 1 625 ? 2.112   39.186  12.155  1.00 27.39 ? 625  ARG A CZ    1 
ATOM   4950  N  NH1   . ARG A 1 625 ? 1.754   40.271  12.835  1.00 26.93 ? 625  ARG A NH1   1 
ATOM   4951  N  NH2   . ARG A 1 625 ? 3.224   39.196  11.435  1.00 27.38 ? 625  ARG A NH2   1 
ATOM   4952  N  N     . GLN A 1 626 ? -5.257  36.635  13.641  1.00 19.54 ? 626  GLN A N     1 
ATOM   4953  C  CA    . GLN A 1 626 ? -6.268  36.445  14.678  1.00 18.66 ? 626  GLN A CA    1 
ATOM   4954  C  C     . GLN A 1 626 ? -7.222  35.319  14.290  1.00 18.55 ? 626  GLN A C     1 
ATOM   4955  O  O     . GLN A 1 626 ? -7.687  34.569  15.148  1.00 18.27 ? 626  GLN A O     1 
ATOM   4956  C  CB    . GLN A 1 626 ? -6.985  37.764  15.050  1.00 17.93 ? 626  GLN A CB    1 
ATOM   4957  C  CG    . GLN A 1 626 ? -8.198  38.193  14.245  1.00 17.35 ? 626  GLN A CG    1 
ATOM   4958  C  CD    . GLN A 1 626 ? -8.657  39.639  14.603  1.00 19.36 ? 626  GLN A CD    1 
ATOM   4959  O  OE1   . GLN A 1 626 ? -7.825  40.544  14.775  1.00 19.00 ? 626  GLN A OE1   1 
ATOM   4960  N  NE2   . GLN A 1 626 ? -9.975  39.839  14.737  1.00 18.87 ? 626  GLN A NE2   1 
ATOM   4961  N  N     . THR A 1 627 ? -7.476  35.193  12.996  1.00 18.42 ? 627  THR A N     1 
ATOM   4962  C  CA    . THR A 1 627 ? -8.193  34.045  12.452  1.00 18.65 ? 627  THR A CA    1 
ATOM   4963  C  C     . THR A 1 627 ? -7.507  32.716  12.799  1.00 18.53 ? 627  THR A C     1 
ATOM   4964  O  O     . THR A 1 627 ? -8.151  31.799  13.276  1.00 17.49 ? 627  THR A O     1 
ATOM   4965  C  CB    . THR A 1 627 ? -8.293  34.159  10.931  1.00 18.30 ? 627  THR A CB    1 
ATOM   4966  O  OG1   . THR A 1 627 ? -8.705  35.473  10.578  1.00 19.94 ? 627  THR A OG1   1 
ATOM   4967  C  CG2   . THR A 1 627 ? -9.394  33.276  10.381  1.00 18.58 ? 627  THR A CG2   1 
ATOM   4968  N  N     . ALA A 1 628 ? -6.202  32.627  12.558  1.00 18.86 ? 628  ALA A N     1 
ATOM   4969  C  CA    . ALA A 1 628 ? -5.474  31.372  12.805  1.00 19.42 ? 628  ALA A CA    1 
ATOM   4970  C  C     . ALA A 1 628 ? -5.405  30.987  14.277  1.00 18.91 ? 628  ALA A C     1 
ATOM   4971  O  O     . ALA A 1 628 ? -5.416  29.808  14.600  1.00 19.53 ? 628  ALA A O     1 
ATOM   4972  C  CB    . ALA A 1 628 ? -4.058  31.457  12.246  1.00 19.47 ? 628  ALA A CB    1 
ATOM   4973  N  N     . LEU A 1 629 ? -5.281  31.987  15.143  1.00 18.05 ? 629  LEU A N     1 
ATOM   4974  C  CA    . LEU A 1 629 ? -5.212  31.789  16.593  1.00 17.48 ? 629  LEU A CA    1 
ATOM   4975  C  C     . LEU A 1 629 ? -6.585  31.427  17.138  1.00 16.38 ? 629  LEU A C     1 
ATOM   4976  O  O     . LEU A 1 629 ? -6.680  30.818  18.172  1.00 16.15 ? 629  LEU A O     1 
ATOM   4977  C  CB    . LEU A 1 629 ? -4.729  33.084  17.323  1.00 17.54 ? 629  LEU A CB    1 
ATOM   4978  C  CG    . LEU A 1 629 ? -3.289  33.593  17.114  1.00 17.80 ? 629  LEU A CG    1 
ATOM   4979  C  CD1   . LEU A 1 629 ? -3.064  34.983  17.691  1.00 16.74 ? 629  LEU A CD1   1 
ATOM   4980  C  CD2   . LEU A 1 629 ? -2.279  32.624  17.696  1.00 18.71 ? 629  LEU A CD2   1 
ATOM   4981  N  N     . ILE A 1 630 ? -7.646  31.861  16.485  1.00 15.51 ? 630  ILE A N     1 
ATOM   4982  C  CA    . ILE A 1 630 ? -8.965  31.619  17.017  1.00 16.06 ? 630  ILE A CA    1 
ATOM   4983  C  C     . ILE A 1 630 ? -9.308  30.181  16.674  1.00 16.96 ? 630  ILE A C     1 
ATOM   4984  O  O     . ILE A 1 630 ? -9.760  29.407  17.508  1.00 16.99 ? 630  ILE A O     1 
ATOM   4985  C  CB    . ILE A 1 630 ? -9.985  32.577  16.419  1.00 15.75 ? 630  ILE A CB    1 
ATOM   4986  C  CG1   . ILE A 1 630 ? -10.066 33.851  17.272  1.00 15.62 ? 630  ILE A CG1   1 
ATOM   4987  C  CG2   . ILE A 1 630 ? -11.326 31.926  16.344  1.00 14.65 ? 630  ILE A CG2   1 
ATOM   4988  C  CD1   . ILE A 1 630 ? -10.697 35.097  16.534  1.00 16.36 ? 630  ILE A CD1   1 
ATOM   4989  N  N     . ALA A 1 631 ? -9.080  29.851  15.414  1.00 17.41 ? 631  ALA A N     1 
ATOM   4990  C  CA    . ALA A 1 631 ? -9.088  28.496  14.952  1.00 17.48 ? 631  ALA A CA    1 
ATOM   4991  C  C     . ALA A 1 631 ? -8.217  27.611  15.835  1.00 17.80 ? 631  ALA A C     1 
ATOM   4992  O  O     . ALA A 1 631 ? -8.580  26.466  16.098  1.00 18.97 ? 631  ALA A O     1 
ATOM   4993  C  CB    . ALA A 1 631 ? -8.605  28.453  13.530  1.00 17.48 ? 631  ALA A CB    1 
ATOM   4994  N  N     . LEU A 1 632 ? -7.090  28.129  16.305  1.00 17.41 ? 632  LEU A N     1 
ATOM   4995  C  CA    . LEU A 1 632 ? -6.135  27.327  17.068  1.00 17.42 ? 632  LEU A CA    1 
ATOM   4996  C  C     . LEU A 1 632 ? -6.642  27.079  18.479  1.00 17.47 ? 632  LEU A C     1 
ATOM   4997  O  O     . LEU A 1 632 ? -6.676  25.948  18.942  1.00 17.81 ? 632  LEU A O     1 
ATOM   4998  C  CB    . LEU A 1 632 ? -4.777  28.023  17.115  1.00 17.28 ? 632  LEU A CB    1 
ATOM   4999  C  CG    . LEU A 1 632 ? -3.629  27.343  17.851  1.00 16.41 ? 632  LEU A CG    1 
ATOM   5000  C  CD1   . LEU A 1 632 ? -2.343  28.097  17.549  1.00 15.84 ? 632  LEU A CD1   1 
ATOM   5001  C  CD2   . LEU A 1 632 ? -3.846  27.257  19.370  1.00 15.72 ? 632  LEU A CD2   1 
ATOM   5002  N  N     . MET A 1 633 ? -7.050  28.140  19.157  1.00 17.27 ? 633  MET A N     1 
ATOM   5003  C  CA    . MET A 1 633 ? -7.577  28.016  20.508  1.00 16.70 ? 633  MET A CA    1 
ATOM   5004  C  C     . MET A 1 633 ? -8.840  27.131  20.522  1.00 16.09 ? 633  MET A C     1 
ATOM   5005  O  O     . MET A 1 633 ? -9.015  26.304  21.401  1.00 16.16 ? 633  MET A O     1 
ATOM   5006  C  CB    . MET A 1 633 ? -7.872  29.392  21.091  1.00 16.47 ? 633  MET A CB    1 
ATOM   5007  C  CG    . MET A 1 633 ? -6.631  30.265  21.312  1.00 16.39 ? 633  MET A CG    1 
ATOM   5008  S  SD    . MET A 1 633 ? -7.128  32.027  21.501  1.00 15.26 ? 633  MET A SD    1 
ATOM   5009  C  CE    . MET A 1 633 ? -7.679  31.935  23.178  1.00 16.19 ? 633  MET A CE    1 
ATOM   5010  N  N     . ALA A 1 634 ? -9.708  27.301  19.543  1.00 15.31 ? 634  ALA A N     1 
ATOM   5011  C  CA    . ALA A 1 634 ? -10.900 26.471  19.421  1.00 15.02 ? 634  ALA A CA    1 
ATOM   5012  C  C     . ALA A 1 634 ? -10.584 24.976  19.301  1.00 15.15 ? 634  ALA A C     1 
ATOM   5013  O  O     . ALA A 1 634 ? -11.326 24.159  19.826  1.00 15.15 ? 634  ALA A O     1 
ATOM   5014  C  CB    . ALA A 1 634 ? -11.694 26.899  18.259  1.00 14.89 ? 634  ALA A CB    1 
ATOM   5015  N  N     . TYR A 1 635 ? -9.484  24.630  18.631  1.00 15.01 ? 635  TYR A N     1 
ATOM   5016  C  CA    . TYR A 1 635 ? -9.124  23.228  18.382  1.00 14.75 ? 635  TYR A CA    1 
ATOM   5017  C  C     . TYR A 1 635 ? -8.106  22.698  19.402  1.00 15.30 ? 635  TYR A C     1 
ATOM   5018  O  O     . TYR A 1 635 ? -7.502  21.621  19.201  1.00 14.40 ? 635  TYR A O     1 
ATOM   5019  C  CB    . TYR A 1 635 ? -8.637  23.030  16.935  1.00 14.52 ? 635  TYR A CB    1 
ATOM   5020  C  CG    . TYR A 1 635 ? -9.759  22.761  15.954  1.00 14.75 ? 635  TYR A CG    1 
ATOM   5021  C  CD1   . TYR A 1 635 ? -10.490 21.567  16.007  1.00 18.30 ? 635  TYR A CD1   1 
ATOM   5022  C  CD2   . TYR A 1 635 ? -10.100 23.685  14.988  1.00 15.36 ? 635  TYR A CD2   1 
ATOM   5023  C  CE1   . TYR A 1 635 ? -11.538 21.309  15.121  1.00 19.04 ? 635  TYR A CE1   1 
ATOM   5024  C  CE2   . TYR A 1 635 ? -11.140 23.448  14.100  1.00 18.06 ? 635  TYR A CE2   1 
ATOM   5025  C  CZ    . TYR A 1 635 ? -11.854 22.257  14.164  1.00 20.45 ? 635  TYR A CZ    1 
ATOM   5026  O  OH    . TYR A 1 635 ? -12.881 22.028  13.278  1.00 21.90 ? 635  TYR A OH    1 
ATOM   5027  N  N     . ILE A 1 636 ? -7.925  23.456  20.496  1.00 15.51 ? 636  ILE A N     1 
ATOM   5028  C  CA    . ILE A 1 636 ? -7.430  22.894  21.753  1.00 15.14 ? 636  ILE A CA    1 
ATOM   5029  C  C     . ILE A 1 636 ? -8.552  22.753  22.798  1.00 15.80 ? 636  ILE A C     1 
ATOM   5030  O  O     . ILE A 1 636 ? -8.317  22.253  23.891  1.00 16.17 ? 636  ILE A O     1 
ATOM   5031  C  CB    . ILE A 1 636 ? -6.229  23.685  22.315  1.00 14.89 ? 636  ILE A CB    1 
ATOM   5032  C  CG1   . ILE A 1 636 ? -6.653  25.033  22.905  1.00 14.73 ? 636  ILE A CG1   1 
ATOM   5033  C  CG2   . ILE A 1 636 ? -5.135  23.844  21.244  1.00 13.78 ? 636  ILE A CG2   1 
ATOM   5034  C  CD1   . ILE A 1 636 ? -5.790  25.486  24.063  1.00 13.59 ? 636  ILE A CD1   1 
ATOM   5035  N  N     . GLY A 1 637 ? -9.771  23.175  22.461  1.00 16.61 ? 637  GLY A N     1 
ATOM   5036  C  CA    . GLY A 1 637 ? -10.907 23.061  23.367  1.00 16.86 ? 637  GLY A CA    1 
ATOM   5037  C  C     . GLY A 1 637 ? -11.152 24.301  24.213  1.00 17.41 ? 637  GLY A C     1 
ATOM   5038  O  O     . GLY A 1 637 ? -12.129 24.371  24.936  1.00 18.33 ? 637  GLY A O     1 
ATOM   5039  N  N     . SER A 1 638 ? -10.248 25.266  24.155  1.00 17.87 ? 638  SER A N     1 
ATOM   5040  C  CA    . SER A 1 638 ? -10.384 26.522  24.873  1.00 18.03 ? 638  SER A CA    1 
ATOM   5041  C  C     . SER A 1 638 ? -11.560 27.346  24.356  1.00 18.34 ? 638  SER A C     1 
ATOM   5042  O  O     . SER A 1 638 ? -11.976 27.219  23.204  1.00 17.97 ? 638  SER A O     1 
ATOM   5043  C  CB    . SER A 1 638 ? -9.100  27.331  24.690  1.00 18.43 ? 638  SER A CB    1 
ATOM   5044  O  OG    . SER A 1 638 ? -9.264  28.694  25.044  1.00 18.79 ? 638  SER A OG    1 
ATOM   5045  N  N     . TYR A 1 639 ? -12.102 28.192  25.224  1.00 18.80 ? 639  TYR A N     1 
ATOM   5046  C  CA    . TYR A 1 639 ? -12.940 29.292  24.772  1.00 19.41 ? 639  TYR A CA    1 
ATOM   5047  C  C     . TYR A 1 639 ? -12.056 30.241  23.952  1.00 19.50 ? 639  TYR A C     1 
ATOM   5048  O  O     . TYR A 1 639 ? -10.835 30.144  23.963  1.00 20.18 ? 639  TYR A O     1 
ATOM   5049  C  CB    . TYR A 1 639 ? -13.621 29.998  25.946  1.00 19.65 ? 639  TYR A CB    1 
ATOM   5050  C  CG    . TYR A 1 639 ? -14.782 29.215  26.573  1.00 20.36 ? 639  TYR A CG    1 
ATOM   5051  C  CD1   . TYR A 1 639 ? -14.856 27.820  26.465  1.00 22.10 ? 639  TYR A CD1   1 
ATOM   5052  C  CD2   . TYR A 1 639 ? -15.803 29.873  27.266  1.00 19.69 ? 639  TYR A CD2   1 
ATOM   5053  C  CE1   . TYR A 1 639 ? -15.915 27.113  27.021  1.00 22.48 ? 639  TYR A CE1   1 
ATOM   5054  C  CE2   . TYR A 1 639 ? -16.849 29.180  27.823  1.00 20.47 ? 639  TYR A CE2   1 
ATOM   5055  C  CZ    . TYR A 1 639 ? -16.895 27.793  27.703  1.00 21.92 ? 639  TYR A CZ    1 
ATOM   5056  O  OH    . TYR A 1 639 ? -17.916 27.064  28.257  1.00 22.14 ? 639  TYR A OH    1 
ATOM   5057  N  N     . VAL A 1 640 ? -12.677 31.137  23.220  1.00 19.47 ? 640  VAL A N     1 
ATOM   5058  C  CA    . VAL A 1 640 ? -12.014 31.811  22.119  1.00 19.53 ? 640  VAL A CA    1 
ATOM   5059  C  C     . VAL A 1 640 ? -12.285 33.316  22.209  1.00 19.87 ? 640  VAL A C     1 
ATOM   5060  O  O     . VAL A 1 640 ? -13.350 33.717  22.668  1.00 20.44 ? 640  VAL A O     1 
ATOM   5061  C  CB    . VAL A 1 640 ? -12.556 31.186  20.834  1.00 19.46 ? 640  VAL A CB    1 
ATOM   5062  C  CG1   . VAL A 1 640 ? -13.289 32.192  19.967  1.00 20.96 ? 640  VAL A CG1   1 
ATOM   5063  C  CG2   . VAL A 1 640 ? -11.474 30.453  20.068  1.00 18.25 ? 640  VAL A CG2   1 
ATOM   5064  N  N     . PRO A 1 641 ? -11.352 34.170  21.790  1.00 20.31 ? 641  PRO A N     1 
ATOM   5065  C  CA    . PRO A 1 641 ? -11.500 35.633  21.994  1.00 20.14 ? 641  PRO A CA    1 
ATOM   5066  C  C     . PRO A 1 641 ? -12.433 36.288  20.996  1.00 20.11 ? 641  PRO A C     1 
ATOM   5067  O  O     . PRO A 1 641 ? -11.981 36.949  20.079  1.00 19.99 ? 641  PRO A O     1 
ATOM   5068  C  CB    . PRO A 1 641 ? -10.076 36.152  21.815  1.00 19.97 ? 641  PRO A CB    1 
ATOM   5069  C  CG    . PRO A 1 641 ? -9.486  35.228  20.841  1.00 20.12 ? 641  PRO A CG    1 
ATOM   5070  C  CD    . PRO A 1 641 ? -10.100 33.848  21.097  1.00 20.28 ? 641  PRO A CD    1 
ATOM   5071  N  N     . ALA A 1 642 ? -13.731 36.076  21.176  1.00 20.44 ? 642  ALA A N     1 
ATOM   5072  C  CA    . ALA A 1 642 ? -14.760 36.617  20.275  1.00 20.69 ? 642  ALA A CA    1 
ATOM   5073  C  C     . ALA A 1 642 ? -16.126 36.524  20.917  1.00 21.05 ? 642  ALA A C     1 
ATOM   5074  O  O     . ALA A 1 642 ? -16.319 35.791  21.888  1.00 21.21 ? 642  ALA A O     1 
ATOM   5075  C  CB    . ALA A 1 642 ? -14.779 35.892  18.948  1.00 20.48 ? 642  ALA A CB    1 
ATOM   5076  N  N     . GLN A 1 643 ? -17.066 37.284  20.362  1.00 21.34 ? 643  GLN A N     1 
ATOM   5077  C  CA    . GLN A 1 643 ? -18.484 37.239  20.766  1.00 21.17 ? 643  GLN A CA    1 
ATOM   5078  C  C     . GLN A 1 643 ? -19.211 35.953  20.298  1.00 19.92 ? 643  GLN A C     1 
ATOM   5079  O  O     . GLN A 1 643 ? -20.118 35.491  20.960  1.00 18.98 ? 643  GLN A O     1 
ATOM   5080  C  CB    . GLN A 1 643 ? -19.209 38.483  20.220  1.00 21.66 ? 643  GLN A CB    1 
ATOM   5081  C  CG    . GLN A 1 643 ? -20.560 38.770  20.860  1.00 23.17 ? 643  GLN A CG    1 
ATOM   5082  C  CD    . GLN A 1 643 ? -21.197 40.004  20.269  1.00 25.10 ? 643  GLN A CD    1 
ATOM   5083  O  OE1   . GLN A 1 643 ? -21.842 39.928  19.226  1.00 26.82 ? 643  GLN A OE1   1 
ATOM   5084  N  NE2   . GLN A 1 643 ? -20.999 41.152  20.917  1.00 25.70 ? 643  GLN A NE2   1 
ATOM   5085  N  N     . LYS A 1 644 ? -18.810 35.418  19.149  1.00 19.47 ? 644  LYS A N     1 
ATOM   5086  C  CA    . LYS A 1 644 ? -19.353 34.169  18.591  1.00 19.52 ? 644  LYS A CA    1 
ATOM   5087  C  C     . LYS A 1 644 ? -18.422 33.569  17.534  1.00 19.81 ? 644  LYS A C     1 
ATOM   5088  O  O     . LYS A 1 644 ? -17.824 34.308  16.755  1.00 19.56 ? 644  LYS A O     1 
ATOM   5089  C  CB    . LYS A 1 644 ? -20.731 34.392  17.955  1.00 19.32 ? 644  LYS A CB    1 
ATOM   5090  C  CG    . LYS A 1 644 ? -21.607 33.165  17.959  1.00 17.54 ? 644  LYS A CG    1 
ATOM   5091  C  CD    . LYS A 1 644 ? -22.499 33.100  16.743  1.00 16.56 ? 644  LYS A CD    1 
ATOM   5092  C  CE    . LYS A 1 644 ? -23.597 32.075  16.908  1.00 16.35 ? 644  LYS A CE    1 
ATOM   5093  N  NZ    . LYS A 1 644 ? -24.829 32.467  16.195  1.00 16.30 ? 644  LYS A NZ    1 
ATOM   5094  N  N     . VAL A 1 645 ? -18.318 32.237  17.517  1.00 20.35 ? 645  VAL A N     1 
ATOM   5095  C  CA    . VAL A 1 645 ? -17.470 31.515  16.575  1.00 20.69 ? 645  VAL A CA    1 
ATOM   5096  C  C     . VAL A 1 645 ? -18.040 30.140  16.173  1.00 21.52 ? 645  VAL A C     1 
ATOM   5097  O  O     . VAL A 1 645 ? -18.187 29.248  17.000  1.00 21.65 ? 645  VAL A O     1 
ATOM   5098  C  CB    . VAL A 1 645 ? -16.066 31.310  17.140  1.00 20.76 ? 645  VAL A CB    1 
ATOM   5099  C  CG1   . VAL A 1 645 ? -15.272 30.265  16.301  1.00 20.46 ? 645  VAL A CG1   1 
ATOM   5100  C  CG2   . VAL A 1 645 ? -15.313 32.649  17.207  1.00 20.21 ? 645  VAL A CG2   1 
ATOM   5101  N  N     . GLU A 1 646 ? -18.360 30.001  14.891  1.00 22.04 ? 646  GLU A N     1 
ATOM   5102  C  CA    . GLU A 1 646 ? -18.606 28.719  14.261  1.00 22.61 ? 646  GLU A CA    1 
ATOM   5103  C  C     . GLU A 1 646 ? -17.452 28.413  13.323  1.00 22.46 ? 646  GLU A C     1 
ATOM   5104  O  O     . GLU A 1 646 ? -17.086 29.263  12.501  1.00 22.92 ? 646  GLU A O     1 
ATOM   5105  C  CB    . GLU A 1 646 ? -19.882 28.771  13.431  1.00 23.13 ? 646  GLU A CB    1 
ATOM   5106  C  CG    . GLU A 1 646 ? -21.061 29.429  14.108  1.00 25.08 ? 646  GLU A CG    1 
ATOM   5107  C  CD    . GLU A 1 646 ? -22.377 28.855  13.626  1.00 29.23 ? 646  GLU A CD    1 
ATOM   5108  O  OE1   . GLU A 1 646 ? -22.581 27.616  13.761  1.00 32.86 ? 646  GLU A OE1   1 
ATOM   5109  O  OE2   . GLU A 1 646 ? -23.209 29.635  13.116  1.00 30.70 ? 646  GLU A OE2   1 
ATOM   5110  N  N     . ILE A 1 647 ? -16.921 27.192  13.405  1.00 22.05 ? 647  ILE A N     1 
ATOM   5111  C  CA    . ILE A 1 647 ? -15.741 26.786  12.634  1.00 21.81 ? 647  ILE A CA    1 
ATOM   5112  C  C     . ILE A 1 647 ? -15.810 25.317  12.274  1.00 21.27 ? 647  ILE A C     1 
ATOM   5113  O  O     . ILE A 1 647 ? -16.122 24.514  13.117  1.00 20.82 ? 647  ILE A O     1 
ATOM   5114  C  CB    . ILE A 1 647 ? -14.438 27.047  13.442  1.00 21.90 ? 647  ILE A CB    1 
ATOM   5115  C  CG1   . ILE A 1 647 ? -13.205 26.843  12.558  1.00 21.81 ? 647  ILE A CG1   1 
ATOM   5116  C  CG2   . ILE A 1 647 ? -14.348 26.135  14.691  1.00 22.61 ? 647  ILE A CG2   1 
ATOM   5117  C  CD1   . ILE A 1 647 ? -11.934 27.107  13.287  1.00 21.87 ? 647  ILE A CD1   1 
ATOM   5118  N  N     . GLY A 1 648 ? -15.470 24.984  11.034  1.00 21.03 ? 648  GLY A N     1 
ATOM   5119  C  CA    . GLY A 1 648 ? -15.514 23.618  10.546  1.00 21.02 ? 648  GLY A CA    1 
ATOM   5120  C  C     . GLY A 1 648 ? -14.166 22.927  10.678  1.00 20.90 ? 648  GLY A C     1 
ATOM   5121  O  O     . GLY A 1 648 ? -13.308 23.432  11.396  1.00 21.46 ? 648  GLY A O     1 
ATOM   5122  N  N     . PRO A 1 649 ? -13.958 21.792  9.997   1.00 20.42 ? 649  PRO A N     1 
ATOM   5123  C  CA    . PRO A 1 649 ? -12.734 21.018  10.191  1.00 20.11 ? 649  PRO A CA    1 
ATOM   5124  C  C     . PRO A 1 649 ? -11.573 21.636  9.449   1.00 19.45 ? 649  PRO A C     1 
ATOM   5125  O  O     . PRO A 1 649 ? -11.695 21.998  8.296   1.00 19.78 ? 649  PRO A O     1 
ATOM   5126  C  CB    . PRO A 1 649 ? -13.087 19.636  9.609   1.00 20.12 ? 649  PRO A CB    1 
ATOM   5127  C  CG    . PRO A 1 649 ? -14.523 19.696  9.305   1.00 19.88 ? 649  PRO A CG    1 
ATOM   5128  C  CD    . PRO A 1 649 ? -14.831 21.125  9.009   1.00 20.27 ? 649  PRO A CD    1 
ATOM   5129  N  N     . ILE A 1 650 ? -10.459 21.759  10.141  1.00 18.97 ? 650  ILE A N     1 
ATOM   5130  C  CA    . ILE A 1 650 ? -9.248  22.304  9.584   1.00 18.92 ? 650  ILE A CA    1 
ATOM   5131  C  C     . ILE A 1 650 ? -8.199  21.224  9.766   1.00 18.75 ? 650  ILE A C     1 
ATOM   5132  O  O     . ILE A 1 650 ? -8.003  20.728  10.868  1.00 17.96 ? 650  ILE A O     1 
ATOM   5133  C  CB    . ILE A 1 650 ? -8.876  23.622  10.314  1.00 19.06 ? 650  ILE A CB    1 
ATOM   5134  C  CG1   . ILE A 1 650 ? -10.021 24.634  10.157  1.00 19.38 ? 650  ILE A CG1   1 
ATOM   5135  C  CG2   . ILE A 1 650 ? -7.580  24.230  9.761   1.00 19.02 ? 650  ILE A CG2   1 
ATOM   5136  C  CD1   . ILE A 1 650 ? -9.731  25.980  10.777  1.00 19.73 ? 650  ILE A CD1   1 
ATOM   5137  N  N     . ASP A 1 651 ? -7.579  20.828  8.663   1.00 19.07 ? 651  ASP A N     1 
ATOM   5138  C  CA    . ASP A 1 651 ? -6.550  19.799  8.676   1.00 19.44 ? 651  ASP A CA    1 
ATOM   5139  C  C     . ASP A 1 651 ? -5.168  20.419  8.870   1.00 20.14 ? 651  ASP A C     1 
ATOM   5140  O  O     . ASP A 1 651 ? -4.374  19.912  9.628   1.00 21.34 ? 651  ASP A O     1 
ATOM   5141  C  CB    . ASP A 1 651 ? -6.630  18.847  7.438   1.00 18.99 ? 651  ASP A CB    1 
ATOM   5142  C  CG    . ASP A 1 651 ? -6.214  19.496  6.101   1.00 18.86 ? 651  ASP A CG    1 
ATOM   5143  O  OD1   . ASP A 1 651 ? -6.262  20.729  5.939   1.00 17.64 ? 651  ASP A OD1   1 
ATOM   5144  O  OD2   . ASP A 1 651 ? -5.839  18.819  5.111   1.00 20.40 ? 651  ASP A OD2   1 
ATOM   5145  N  N     . ARG A 1 652 ? -4.896  21.541  8.237   1.00 20.70 ? 652  ARG A N     1 
ATOM   5146  C  CA    . ARG A 1 652 ? -3.534  22.047  8.188   1.00 21.06 ? 652  ARG A CA    1 
ATOM   5147  C  C     . ARG A 1 652 ? -3.616  23.552  8.062   1.00 19.91 ? 652  ARG A C     1 
ATOM   5148  O  O     . ARG A 1 652 ? -4.500  24.054  7.379   1.00 19.32 ? 652  ARG A O     1 
ATOM   5149  C  CB    . ARG A 1 652 ? -2.801  21.409  6.986   1.00 21.80 ? 652  ARG A CB    1 
ATOM   5150  C  CG    . ARG A 1 652 ? -1.322  21.003  7.207   1.00 25.52 ? 652  ARG A CG    1 
ATOM   5151  C  CD    . ARG A 1 652 ? -0.266  22.100  6.761   1.00 29.79 ? 652  ARG A CD    1 
ATOM   5152  N  NE    . ARG A 1 652 ? 1.121   21.666  6.423   1.00 32.17 ? 652  ARG A NE    1 
ATOM   5153  C  CZ    . ARG A 1 652 ? 1.477   20.654  5.594   1.00 33.62 ? 652  ARG A CZ    1 
ATOM   5154  N  NH1   . ARG A 1 652 ? 0.562   19.869  5.006   1.00 34.81 ? 652  ARG A NH1   1 
ATOM   5155  N  NH2   . ARG A 1 652 ? 2.771   20.410  5.364   1.00 32.87 ? 652  ARG A NH2   1 
ATOM   5156  N  N     . ILE A 1 653 ? -2.744  24.280  8.755   1.00 19.53 ? 653  ILE A N     1 
ATOM   5157  C  CA    . ILE A 1 653 ? -2.611  25.728  8.499   1.00 19.05 ? 653  ILE A CA    1 
ATOM   5158  C  C     . ILE A 1 653 ? -1.265  25.998  7.846   1.00 18.87 ? 653  ILE A C     1 
ATOM   5159  O  O     . ILE A 1 653 ? -0.248  25.420  8.240   1.00 18.56 ? 653  ILE A O     1 
ATOM   5160  C  CB    . ILE A 1 653 ? -2.802  26.581  9.768   1.00 18.59 ? 653  ILE A CB    1 
ATOM   5161  C  CG1   . ILE A 1 653 ? -4.185  26.351  10.375  1.00 16.85 ? 653  ILE A CG1   1 
ATOM   5162  C  CG2   . ILE A 1 653 ? -2.651  28.045  9.437   1.00 19.25 ? 653  ILE A CG2   1 
ATOM   5163  C  CD1   . ILE A 1 653 ? -4.309  26.788  11.819  1.00 15.22 ? 653  ILE A CD1   1 
ATOM   5164  N  N     . PHE A 1 654 ? -1.307  26.842  6.812   1.00 18.96 ? 654  PHE A N     1 
ATOM   5165  C  CA    . PHE A 1 654 ? -0.155  27.279  6.024   1.00 18.70 ? 654  PHE A CA    1 
ATOM   5166  C  C     . PHE A 1 654 ? -0.001  28.796  6.088   1.00 19.13 ? 654  PHE A C     1 
ATOM   5167  O  O     . PHE A 1 654 ? -0.954  29.521  5.846   1.00 18.93 ? 654  PHE A O     1 
ATOM   5168  C  CB    . PHE A 1 654 ? -0.374  26.955  4.544   1.00 18.67 ? 654  PHE A CB    1 
ATOM   5169  C  CG    . PHE A 1 654 ? -0.443  25.516  4.249   1.00 17.12 ? 654  PHE A CG    1 
ATOM   5170  C  CD1   . PHE A 1 654 ? -1.664  24.888  4.127   1.00 15.62 ? 654  PHE A CD1   1 
ATOM   5171  C  CD2   . PHE A 1 654 ? 0.720   24.772  4.089   1.00 15.76 ? 654  PHE A CD2   1 
ATOM   5172  C  CE1   . PHE A 1 654 ? -1.729  23.513  3.870   1.00 13.38 ? 654  PHE A CE1   1 
ATOM   5173  C  CE2   . PHE A 1 654 ? 0.660   23.427  3.834   1.00 14.61 ? 654  PHE A CE2   1 
ATOM   5174  C  CZ    . PHE A 1 654 ? -0.581  22.799  3.721   1.00 14.14 ? 654  PHE A CZ    1 
ATOM   5175  N  N     . THR A 1 655 ? 1.207   29.270  6.354   1.00 19.98 ? 655  THR A N     1 
ATOM   5176  C  CA    . THR A 1 655 ? 1.530   30.683  6.235   1.00 20.39 ? 655  THR A CA    1 
ATOM   5177  C  C     . THR A 1 655 ? 2.668   30.846  5.220   1.00 21.15 ? 655  THR A C     1 
ATOM   5178  O  O     . THR A 1 655 ? 3.529   29.960  5.110   1.00 21.05 ? 655  THR A O     1 
ATOM   5179  C  CB    . THR A 1 655 ? 1.907   31.281  7.624   1.00 20.14 ? 655  THR A CB    1 
ATOM   5180  O  OG1   . THR A 1 655 ? 0.776   31.264  8.497   1.00 19.29 ? 655  THR A OG1   1 
ATOM   5181  C  CG2   . THR A 1 655 ? 2.204   32.748  7.525   1.00 20.34 ? 655  THR A CG2   1 
ATOM   5182  N  N     . ARG A 1 656 ? 2.617   31.954  4.464   1.00 22.11 ? 656  ARG A N     1 
ATOM   5183  C  CA    . ARG A 1 656 ? 3.713   32.469  3.629   1.00 22.93 ? 656  ARG A CA    1 
ATOM   5184  C  C     . ARG A 1 656 ? 3.738   33.966  3.824   1.00 23.40 ? 656  ARG A C     1 
ATOM   5185  O  O     . ARG A 1 656 ? 2.793   34.642  3.492   1.00 23.26 ? 656  ARG A O     1 
ATOM   5186  C  CB    . ARG A 1 656 ? 3.484   32.185  2.135   1.00 23.34 ? 656  ARG A CB    1 
ATOM   5187  C  CG    . ARG A 1 656 ? 4.719   31.713  1.315   1.00 24.89 ? 656  ARG A CG    1 
ATOM   5188  C  CD    . ARG A 1 656 ? 5.814   32.768  1.083   1.00 25.92 ? 656  ARG A CD    1 
ATOM   5189  N  NE    . ARG A 1 656 ? 6.811   32.714  2.147   1.00 27.69 ? 656  ARG A NE    1 
ATOM   5190  C  CZ    . ARG A 1 656 ? 7.918   33.440  2.202   1.00 28.87 ? 656  ARG A CZ    1 
ATOM   5191  N  NH1   . ARG A 1 656 ? 8.200   34.304  1.245   1.00 30.97 ? 656  ARG A NH1   1 
ATOM   5192  N  NH2   . ARG A 1 656 ? 8.756   33.300  3.225   1.00 28.15 ? 656  ARG A NH2   1 
ATOM   5193  N  N     . VAL A 1 657 ? 4.818   34.490  4.372   1.00 24.80 ? 657  VAL A N     1 
ATOM   5194  C  CA    . VAL A 1 657 ? 4.929   35.920  4.643   1.00 25.34 ? 657  VAL A CA    1 
ATOM   5195  C  C     . VAL A 1 657 ? 6.191   36.444  3.987   1.00 25.92 ? 657  VAL A C     1 
ATOM   5196  O  O     . VAL A 1 657 ? 7.309   36.203  4.480   1.00 25.32 ? 657  VAL A O     1 
ATOM   5197  C  CB    . VAL A 1 657 ? 4.999   36.229  6.155   1.00 25.33 ? 657  VAL A CB    1 
ATOM   5198  C  CG1   . VAL A 1 657 ? 5.259   37.695  6.387   1.00 26.60 ? 657  VAL A CG1   1 
ATOM   5199  C  CG2   . VAL A 1 657 ? 3.720   35.873  6.831   1.00 25.81 ? 657  VAL A CG2   1 
ATOM   5200  N  N     . GLY A 1 658 ? 5.994   37.147  2.863   1.00 26.87 ? 658  GLY A N     1 
ATOM   5201  C  CA    . GLY A 1 658 ? 7.002   38.042  2.296   1.00 27.17 ? 658  GLY A CA    1 
ATOM   5202  C  C     . GLY A 1 658 ? 6.787   39.500  2.738   1.00 27.52 ? 658  GLY A C     1 
ATOM   5203  O  O     . GLY A 1 658 ? 6.713   39.829  3.935   1.00 27.07 ? 658  GLY A O     1 
ATOM   5204  N  N     . PHE A 1 670 ? 13.360  35.335  -2.617  1.00 40.36 ? 670  PHE A N     1 
ATOM   5205  C  CA    . PHE A 1 670 ? 14.027  34.783  -3.774  1.00 40.13 ? 670  PHE A CA    1 
ATOM   5206  C  C     . PHE A 1 670 ? 13.466  33.379  -3.968  1.00 39.29 ? 670  PHE A C     1 
ATOM   5207  O  O     . PHE A 1 670 ? 12.251  33.233  -4.055  1.00 39.05 ? 670  PHE A O     1 
ATOM   5208  C  CB    . PHE A 1 670 ? 15.556  34.821  -3.587  1.00 40.67 ? 670  PHE A CB    1 
ATOM   5209  C  CG    . PHE A 1 670 ? 16.022  34.453  -2.201  1.00 42.35 ? 670  PHE A CG    1 
ATOM   5210  C  CD1   . PHE A 1 670 ? 16.927  33.406  -2.017  1.00 43.69 ? 670  PHE A CD1   1 
ATOM   5211  C  CD2   . PHE A 1 670 ? 15.581  35.168  -1.086  1.00 44.22 ? 670  PHE A CD2   1 
ATOM   5212  C  CE1   . PHE A 1 670 ? 17.371  33.068  -0.750  1.00 44.43 ? 670  PHE A CE1   1 
ATOM   5213  C  CE2   . PHE A 1 670 ? 16.019  34.836  0.190   1.00 45.17 ? 670  PHE A CE2   1 
ATOM   5214  C  CZ    . PHE A 1 670 ? 16.922  33.784  0.359   1.00 45.08 ? 670  PHE A CZ    1 
ATOM   5215  N  N     . MET A 1 671 ? 14.326  32.357  -4.018  1.00 38.21 ? 671  MET A N     1 
ATOM   5216  C  CA    . MET A 1 671 ? 13.891  30.977  -4.238  1.00 37.19 ? 671  MET A CA    1 
ATOM   5217  C  C     . MET A 1 671 ? 13.001  30.434  -3.115  1.00 36.15 ? 671  MET A C     1 
ATOM   5218  O  O     . MET A 1 671 ? 12.065  29.679  -3.368  1.00 35.93 ? 671  MET A O     1 
ATOM   5219  C  CB    . MET A 1 671 ? 15.109  30.068  -4.400  1.00 37.14 ? 671  MET A CB    1 
ATOM   5220  C  CG    . MET A 1 671 ? 14.778  28.602  -4.666  1.00 37.79 ? 671  MET A CG    1 
ATOM   5221  S  SD    . MET A 1 671 ? 14.851  28.153  -6.409  1.00 39.76 ? 671  MET A SD    1 
ATOM   5222  C  CE    . MET A 1 671 ? 15.039  26.336  -6.289  1.00 40.54 ? 671  MET A CE    1 
ATOM   5223  N  N     . VAL A 1 672 ? 13.298  30.810  -1.879  1.00 35.05 ? 672  VAL A N     1 
ATOM   5224  C  CA    . VAL A 1 672 ? 12.616  30.231  -0.727  1.00 34.11 ? 672  VAL A CA    1 
ATOM   5225  C  C     . VAL A 1 672 ? 11.127  30.553  -0.718  1.00 33.61 ? 672  VAL A C     1 
ATOM   5226  O  O     . VAL A 1 672 ? 10.317  29.679  -0.441  1.00 33.73 ? 672  VAL A O     1 
ATOM   5227  C  CB    . VAL A 1 672 ? 13.297  30.656  0.594   1.00 34.14 ? 672  VAL A CB    1 
ATOM   5228  C  CG1   . VAL A 1 672 ? 12.380  30.427  1.817   1.00 33.99 ? 672  VAL A CG1   1 
ATOM   5229  C  CG2   . VAL A 1 672 ? 14.622  29.909  0.758   1.00 33.58 ? 672  VAL A CG2   1 
ATOM   5230  N  N     . GLU A 1 673 ? 10.774  31.791  -1.044  1.00 32.95 ? 673  GLU A N     1 
ATOM   5231  C  CA    . GLU A 1 673 ? 9.371   32.208  -1.160  1.00 32.48 ? 673  GLU A CA    1 
ATOM   5232  C  C     . GLU A 1 673 ? 8.592   31.346  -2.158  1.00 31.18 ? 673  GLU A C     1 
ATOM   5233  O  O     . GLU A 1 673 ? 7.485   30.925  -1.896  1.00 30.82 ? 673  GLU A O     1 
ATOM   5234  C  CB    . GLU A 1 673 ? 9.289   33.672  -1.612  1.00 33.20 ? 673  GLU A CB    1 
ATOM   5235  C  CG    . GLU A 1 673 ? 10.388  34.585  -1.048  1.00 35.58 ? 673  GLU A CG    1 
ATOM   5236  C  CD    . GLU A 1 673 ? 10.050  36.079  -1.131  1.00 38.16 ? 673  GLU A CD    1 
ATOM   5237  O  OE1   . GLU A 1 673 ? 10.952  36.878  -1.512  1.00 37.80 ? 673  GLU A OE1   1 
ATOM   5238  O  OE2   . GLU A 1 673 ? 8.887   36.456  -0.813  1.00 39.86 ? 673  GLU A OE2   1 
ATOM   5239  N  N     . MET A 1 674 ? 9.193   31.103  -3.312  1.00 29.98 ? 674  MET A N     1 
ATOM   5240  C  CA    . MET A 1 674 ? 8.597   30.283  -4.361  1.00 29.18 ? 674  MET A CA    1 
ATOM   5241  C  C     . MET A 1 674 ? 8.416   28.831  -3.966  1.00 27.59 ? 674  MET A C     1 
ATOM   5242  O  O     . MET A 1 674 ? 7.459   28.199  -4.393  1.00 26.75 ? 674  MET A O     1 
ATOM   5243  C  CB    . MET A 1 674 ? 9.504   30.259  -5.592  1.00 29.84 ? 674  MET A CB    1 
ATOM   5244  C  CG    . MET A 1 674 ? 9.773   31.581  -6.243  1.00 31.30 ? 674  MET A CG    1 
ATOM   5245  S  SD    . MET A 1 674 ? 8.288   32.236  -6.938  1.00 35.70 ? 674  MET A SD    1 
ATOM   5246  C  CE    . MET A 1 674 ? 8.809   34.098  -6.919  1.00 35.76 ? 674  MET A CE    1 
ATOM   5247  N  N     . THR A 1 675 ? 9.387   28.301  -3.223  1.00 26.14 ? 675  THR A N     1 
ATOM   5248  C  CA    . THR A 1 675 ? 9.426   26.893  -2.850  1.00 25.07 ? 675  THR A CA    1 
ATOM   5249  C  C     . THR A 1 675 ? 8.397   26.668  -1.780  1.00 24.23 ? 675  THR A C     1 
ATOM   5250  O  O     . THR A 1 675 ? 7.608   25.742  -1.870  1.00 25.00 ? 675  THR A O     1 
ATOM   5251  C  CB    . THR A 1 675 ? 10.822  26.496  -2.341  1.00 25.04 ? 675  THR A CB    1 
ATOM   5252  O  OG1   . THR A 1 675 ? 11.711  26.384  -3.448  1.00 25.03 ? 675  THR A OG1   1 
ATOM   5253  C  CG2   . THR A 1 675 ? 10.843  25.087  -1.740  1.00 25.15 ? 675  THR A CG2   1 
ATOM   5254  N  N     . GLU A 1 676 ? 8.418   27.523  -0.768  1.00 23.05 ? 676  GLU A N     1 
ATOM   5255  C  CA    . GLU A 1 676 ? 7.390   27.559  0.253   1.00 22.25 ? 676  GLU A CA    1 
ATOM   5256  C  C     . GLU A 1 676 ? 6.003   27.555  -0.373  1.00 21.29 ? 676  GLU A C     1 
ATOM   5257  O  O     . GLU A 1 676 ? 5.113   26.882  0.126   1.00 21.93 ? 676  GLU A O     1 
ATOM   5258  C  CB    . GLU A 1 676 ? 7.551   28.799  1.149   1.00 22.49 ? 676  GLU A CB    1 
ATOM   5259  C  CG    . GLU A 1 676 ? 8.538   28.627  2.304   1.00 23.45 ? 676  GLU A CG    1 
ATOM   5260  C  CD    . GLU A 1 676 ? 8.519   29.788  3.324   1.00 24.79 ? 676  GLU A CD    1 
ATOM   5261  O  OE1   . GLU A 1 676 ? 7.444   30.130  3.903   1.00 23.49 ? 676  GLU A OE1   1 
ATOM   5262  O  OE2   . GLU A 1 676 ? 9.607   30.349  3.573   1.00 26.20 ? 676  GLU A OE2   1 
ATOM   5263  N  N     . THR A 1 677 ? 5.830   28.294  -1.467  1.00 20.21 ? 677  THR A N     1 
ATOM   5264  C  CA    . THR A 1 677 ? 4.524   28.498  -2.115  1.00 19.21 ? 677  THR A CA    1 
ATOM   5265  C  C     . THR A 1 677 ? 4.100   27.269  -2.916  1.00 18.84 ? 677  THR A C     1 
ATOM   5266  O  O     . THR A 1 677 ? 2.921   26.946  -3.002  1.00 17.96 ? 677  THR A O     1 
ATOM   5267  C  CB    . THR A 1 677 ? 4.593   29.736  -3.044  1.00 19.12 ? 677  THR A CB    1 
ATOM   5268  O  OG1   . THR A 1 677 ? 5.014   30.879  -2.296  1.00 17.75 ? 677  THR A OG1   1 
ATOM   5269  C  CG2   . THR A 1 677 ? 3.219   30.141  -3.559  1.00 19.03 ? 677  THR A CG2   1 
ATOM   5270  N  N     . ALA A 1 678 ? 5.090   26.600  -3.500  1.00 18.74 ? 678  ALA A N     1 
ATOM   5271  C  CA    . ALA A 1 678 ? 4.910   25.329  -4.179  1.00 18.41 ? 678  ALA A CA    1 
ATOM   5272  C  C     . ALA A 1 678 ? 4.307   24.330  -3.228  1.00 18.58 ? 678  ALA A C     1 
ATOM   5273  O  O     . ALA A 1 678 ? 3.417   23.586  -3.599  1.00 18.74 ? 678  ALA A O     1 
ATOM   5274  C  CB    . ALA A 1 678 ? 6.233   24.820  -4.679  1.00 18.39 ? 678  ALA A CB    1 
ATOM   5275  N  N     . ASN A 1 679 ? 4.792   24.333  -1.997  1.00 18.82 ? 679  ASN A N     1 
ATOM   5276  C  CA    . ASN A 1 679 ? 4.391   23.359  -1.000  1.00 19.42 ? 679  ASN A CA    1 
ATOM   5277  C  C     . ASN A 1 679 ? 2.969   23.616  -0.546  1.00 19.06 ? 679  ASN A C     1 
ATOM   5278  O  O     . ASN A 1 679 ? 2.227   22.694  -0.235  1.00 18.18 ? 679  ASN A O     1 
ATOM   5279  C  CB    . ASN A 1 679 ? 5.352   23.407  0.202   1.00 19.98 ? 679  ASN A CB    1 
ATOM   5280  C  CG    . ASN A 1 679 ? 4.780   22.715  1.451   1.00 21.64 ? 679  ASN A CG    1 
ATOM   5281  O  OD1   . ASN A 1 679 ? 4.472   21.511  1.433   1.00 24.62 ? 679  ASN A OD1   1 
ATOM   5282  N  ND2   . ASN A 1 679 ? 4.661   23.469  2.544   1.00 22.23 ? 679  ASN A ND2   1 
ATOM   5283  N  N     . ILE A 1 680 ? 2.597   24.890  -0.498  1.00 19.25 ? 680  ILE A N     1 
ATOM   5284  C  CA    . ILE A 1 680 ? 1.225   25.265  -0.183  1.00 18.81 ? 680  ILE A CA    1 
ATOM   5285  C  C     . ILE A 1 680 ? 0.321   24.734  -1.291  1.00 18.40 ? 680  ILE A C     1 
ATOM   5286  O  O     . ILE A 1 680 ? -0.723  24.175  -1.024  1.00 18.78 ? 680  ILE A O     1 
ATOM   5287  C  CB    . ILE A 1 680 ? 1.139   26.794  0.011   1.00 18.74 ? 680  ILE A CB    1 
ATOM   5288  C  CG1   . ILE A 1 680 ? 1.807   27.135  1.339   1.00 19.15 ? 680  ILE A CG1   1 
ATOM   5289  C  CG2   . ILE A 1 680 ? -0.307  27.314  -0.014  1.00 19.08 ? 680  ILE A CG2   1 
ATOM   5290  C  CD1   . ILE A 1 680 ? 1.620   28.528  1.762   1.00 20.10 ? 680  ILE A CD1   1 
ATOM   5291  N  N     . LEU A 1 681 ? 0.755   24.857  -2.533  1.00 17.95 ? 681  LEU A N     1 
ATOM   5292  C  CA    . LEU A 1 681 ? -0.069  24.467  -3.667  1.00 17.61 ? 681  LEU A CA    1 
ATOM   5293  C  C     . LEU A 1 681 ? -0.149  22.944  -3.874  1.00 17.58 ? 681  LEU A C     1 
ATOM   5294  O  O     . LEU A 1 681 ? -1.080  22.462  -4.520  1.00 17.77 ? 681  LEU A O     1 
ATOM   5295  C  CB    . LEU A 1 681 ? 0.456   25.141  -4.935  1.00 17.58 ? 681  LEU A CB    1 
ATOM   5296  C  CG    . LEU A 1 681 ? 0.300   26.657  -5.020  1.00 16.47 ? 681  LEU A CG    1 
ATOM   5297  C  CD1   . LEU A 1 681 ? 0.992   27.183  -6.237  1.00 14.68 ? 681  LEU A CD1   1 
ATOM   5298  C  CD2   . LEU A 1 681 ? -1.160  27.008  -5.067  1.00 17.17 ? 681  LEU A CD2   1 
ATOM   5299  N  N     . HIS A 1 682 ? 0.807   22.205  -3.314  1.00 17.17 ? 682  HIS A N     1 
ATOM   5300  C  CA    . HIS A 1 682 ? 0.901   20.748  -3.489  1.00 16.92 ? 682  HIS A CA    1 
ATOM   5301  C  C     . HIS A 1 682 ? 0.185   19.989  -2.364  1.00 17.06 ? 682  HIS A C     1 
ATOM   5302  O  O     . HIS A 1 682 ? -0.294  18.873  -2.578  1.00 18.27 ? 682  HIS A O     1 
ATOM   5303  C  CB    . HIS A 1 682 ? 2.371   20.283  -3.536  1.00 16.34 ? 682  HIS A CB    1 
ATOM   5304  C  CG    . HIS A 1 682 ? 3.098   20.646  -4.795  1.00 16.64 ? 682  HIS A CG    1 
ATOM   5305  N  ND1   . HIS A 1 682 ? 4.447   20.937  -4.815  1.00 17.31 ? 682  HIS A ND1   1 
ATOM   5306  C  CD2   . HIS A 1 682 ? 2.670   20.770  -6.078  1.00 18.06 ? 682  HIS A CD2   1 
ATOM   5307  C  CE1   . HIS A 1 682 ? 4.817   21.221  -6.053  1.00 17.58 ? 682  HIS A CE1   1 
ATOM   5308  N  NE2   . HIS A 1 682 ? 3.758   21.130  -6.840  1.00 17.09 ? 682  HIS A NE2   1 
ATOM   5309  N  N     . ASN A 1 683 ? 0.115   20.587  -1.177  1.00 16.69 ? 683  ASN A N     1 
ATOM   5310  C  CA    . ASN A 1 683 ? -0.377  19.900  0.022   1.00 16.28 ? 683  ASN A CA    1 
ATOM   5311  C  C     . ASN A 1 683 ? -1.627  20.513  0.680   1.00 15.95 ? 683  ASN A C     1 
ATOM   5312  O  O     . ASN A 1 683 ? -2.259  19.877  1.532   1.00 15.00 ? 683  ASN A O     1 
ATOM   5313  C  CB    . ASN A 1 683 ? 0.734   19.825  1.071   1.00 16.57 ? 683  ASN A CB    1 
ATOM   5314  C  CG    . ASN A 1 683 ? 1.936   19.092  0.581   1.00 16.31 ? 683  ASN A CG    1 
ATOM   5315  O  OD1   . ASN A 1 683 ? 1.934   17.865  0.502   1.00 20.92 ? 683  ASN A OD1   1 
ATOM   5316  N  ND2   . ASN A 1 683 ? 2.976   19.828  0.246   1.00 15.11 ? 683  ASN A ND2   1 
ATOM   5317  N  N     . ALA A 1 684 ? -1.985  21.738  0.305   1.00 15.88 ? 684  ALA A N     1 
ATOM   5318  C  CA    . ALA A 1 684 ? -3.243  22.304  0.765   1.00 15.80 ? 684  ALA A CA    1 
ATOM   5319  C  C     . ALA A 1 684 ? -4.406  21.528  0.134   1.00 15.79 ? 684  ALA A C     1 
ATOM   5320  O  O     . ALA A 1 684 ? -4.302  21.091  -1.009  1.00 15.09 ? 684  ALA A O     1 
ATOM   5321  C  CB    . ALA A 1 684 ? -3.332  23.742  0.433   1.00 15.80 ? 684  ALA A CB    1 
ATOM   5322  N  N     . THR A 1 685 ? -5.476  21.353  0.930   1.00 16.01 ? 685  THR A N     1 
ATOM   5323  C  CA    . THR A 1 685 ? -6.771  20.769  0.531   1.00 15.98 ? 685  THR A CA    1 
ATOM   5324  C  C     . THR A 1 685 ? -7.923  21.723  0.904   1.00 16.92 ? 685  THR A C     1 
ATOM   5325  O  O     . THR A 1 685 ? -7.694  22.734  1.549   1.00 16.89 ? 685  THR A O     1 
ATOM   5326  C  CB    . THR A 1 685 ? -6.998  19.385  1.231   1.00 15.49 ? 685  THR A CB    1 
ATOM   5327  O  OG1   . THR A 1 685 ? -7.356  19.571  2.597   1.00 13.16 ? 685  THR A OG1   1 
ATOM   5328  C  CG2   . THR A 1 685 ? -5.708  18.594  1.345   1.00 14.65 ? 685  THR A CG2   1 
ATOM   5329  N  N     . GLU A 1 686 ? -9.155  21.361  0.526   1.00 18.56 ? 686  GLU A N     1 
ATOM   5330  C  CA    . GLU A 1 686 ? -10.392 22.079  0.909   1.00 19.62 ? 686  GLU A CA    1 
ATOM   5331  C  C     . GLU A 1 686 ? -10.581 22.228  2.421   1.00 19.61 ? 686  GLU A C     1 
ATOM   5332  O  O     . GLU A 1 686 ? -11.500 22.920  2.847   1.00 20.06 ? 686  GLU A O     1 
ATOM   5333  C  CB    . GLU A 1 686 ? -11.662 21.375  0.354   1.00 20.40 ? 686  GLU A CB    1 
ATOM   5334  C  CG    . GLU A 1 686 ? -12.459 22.134  -0.734  1.00 24.03 ? 686  GLU A CG    1 
ATOM   5335  C  CD    . GLU A 1 686 ? -13.887 22.683  -0.328  1.00 28.69 ? 686  GLU A CD    1 
ATOM   5336  O  OE1   . GLU A 1 686 ? -13.999 23.726  0.413   1.00 31.29 ? 686  GLU A OE1   1 
ATOM   5337  O  OE2   . GLU A 1 686 ? -14.915 22.113  -0.801  1.00 26.03 ? 686  GLU A OE2   1 
ATOM   5338  N  N     . TYR A 1 687 ? -9.763  21.558  3.232   1.00 19.79 ? 687  TYR A N     1 
ATOM   5339  C  CA    . TYR A 1 687 ? -9.919  21.601  4.690   1.00 20.09 ? 687  TYR A CA    1 
ATOM   5340  C  C     . TYR A 1 687 ? -8.824  22.446  5.345   1.00 19.05 ? 687  TYR A C     1 
ATOM   5341  O  O     . TYR A 1 687 ? -8.735  22.495  6.570   1.00 18.52 ? 687  TYR A O     1 
ATOM   5342  C  CB    . TYR A 1 687 ? -9.936  20.167  5.275   1.00 20.57 ? 687  TYR A CB    1 
ATOM   5343  C  CG    . TYR A 1 687 ? -11.220 19.401  4.991   1.00 23.79 ? 687  TYR A CG    1 
ATOM   5344  C  CD1   . TYR A 1 687 ? -11.568 19.043  3.694   1.00 26.77 ? 687  TYR A CD1   1 
ATOM   5345  C  CD2   . TYR A 1 687 ? -12.090 19.038  6.018   1.00 27.68 ? 687  TYR A CD2   1 
ATOM   5346  C  CE1   . TYR A 1 687 ? -12.750 18.360  3.429   1.00 28.71 ? 687  TYR A CE1   1 
ATOM   5347  C  CE2   . TYR A 1 687 ? -13.278 18.346  5.759   1.00 27.63 ? 687  TYR A CE2   1 
ATOM   5348  C  CZ    . TYR A 1 687 ? -13.594 18.019  4.466   1.00 29.35 ? 687  TYR A CZ    1 
ATOM   5349  O  OH    . TYR A 1 687 ? -14.755 17.345  4.165   1.00 33.54 ? 687  TYR A OH    1 
ATOM   5350  N  N     . SER A 1 688 ? -7.995  23.102  4.536   1.00 18.17 ? 688  SER A N     1 
ATOM   5351  C  CA    . SER A 1 688 ? -6.879  23.877  5.060   1.00 17.75 ? 688  SER A CA    1 
ATOM   5352  C  C     . SER A 1 688 ? -7.208  25.331  5.077   1.00 16.84 ? 688  SER A C     1 
ATOM   5353  O  O     . SER A 1 688 ? -7.896  25.825  4.197   1.00 16.77 ? 688  SER A O     1 
ATOM   5354  C  CB    . SER A 1 688 ? -5.629  23.704  4.215   1.00 17.76 ? 688  SER A CB    1 
ATOM   5355  O  OG    . SER A 1 688 ? -5.490  22.377  3.771   1.00 19.42 ? 688  SER A OG    1 
ATOM   5356  N  N     . LEU A 1 689 ? -6.679  26.010  6.083   1.00 16.07 ? 689  LEU A N     1 
ATOM   5357  C  CA    . LEU A 1 689 ? -6.674  27.445  6.132   1.00 15.33 ? 689  LEU A CA    1 
ATOM   5358  C  C     . LEU A 1 689 ? -5.307  27.883  5.634   1.00 14.78 ? 689  LEU A C     1 
ATOM   5359  O  O     . LEU A 1 689 ? -4.325  27.499  6.213   1.00 15.05 ? 689  LEU A O     1 
ATOM   5360  C  CB    . LEU A 1 689 ? -6.915  27.888  7.552   1.00 15.11 ? 689  LEU A CB    1 
ATOM   5361  C  CG    . LEU A 1 689 ? -6.773  29.366  7.883   1.00 16.66 ? 689  LEU A CG    1 
ATOM   5362  C  CD1   . LEU A 1 689 ? -7.813  30.237  7.161   1.00 17.51 ? 689  LEU A CD1   1 
ATOM   5363  C  CD2   . LEU A 1 689 ? -6.914  29.511  9.393   1.00 17.80 ? 689  LEU A CD2   1 
ATOM   5364  N  N     . VAL A 1 690 ? -5.267  28.646  4.540   1.00 14.24 ? 690  VAL A N     1 
ATOM   5365  C  CA    . VAL A 1 690 ? -4.056  29.196  3.953   1.00 14.06 ? 690  VAL A CA    1 
ATOM   5366  C  C     . VAL A 1 690 ? -3.969  30.726  4.168   1.00 14.68 ? 690  VAL A C     1 
ATOM   5367  O  O     . VAL A 1 690 ? -4.826  31.496  3.720   1.00 14.95 ? 690  VAL A O     1 
ATOM   5368  C  CB    . VAL A 1 690 ? -4.043  28.933  2.452   1.00 13.78 ? 690  VAL A CB    1 
ATOM   5369  C  CG1   . VAL A 1 690 ? -2.924  29.710  1.760   1.00 14.06 ? 690  VAL A CG1   1 
ATOM   5370  C  CG2   . VAL A 1 690 ? -3.901  27.453  2.173   1.00 14.62 ? 690  VAL A CG2   1 
ATOM   5371  N  N     . LEU A 1 691 ? -2.911  31.165  4.833   1.00 14.96 ? 691  LEU A N     1 
ATOM   5372  C  CA    . LEU A 1 691 ? -2.643  32.581  5.036   1.00 15.13 ? 691  LEU A CA    1 
ATOM   5373  C  C     . LEU A 1 691 ? -1.488  33.086  4.146   1.00 15.49 ? 691  LEU A C     1 
ATOM   5374  O  O     . LEU A 1 691 ? -0.339  32.893  4.495   1.00 16.19 ? 691  LEU A O     1 
ATOM   5375  C  CB    . LEU A 1 691 ? -2.297  32.827  6.520   1.00 14.86 ? 691  LEU A CB    1 
ATOM   5376  C  CG    . LEU A 1 691 ? -3.214  32.222  7.578   1.00 12.86 ? 691  LEU A CG    1 
ATOM   5377  C  CD1   . LEU A 1 691 ? -2.859  32.740  8.937   1.00 12.83 ? 691  LEU A CD1   1 
ATOM   5378  C  CD2   . LEU A 1 691 ? -4.646  32.508  7.313   1.00 13.96 ? 691  LEU A CD2   1 
ATOM   5379  N  N     . MET A 1 692 ? -1.776  33.710  3.008   1.00 16.16 ? 692  MET A N     1 
ATOM   5380  C  CA    . MET A 1 692 ? -0.720  34.291  2.163   1.00 17.08 ? 692  MET A CA    1 
ATOM   5381  C  C     . MET A 1 692 ? -0.606  35.781  2.428   1.00 17.12 ? 692  MET A C     1 
ATOM   5382  O  O     . MET A 1 692 ? -1.505  36.528  2.085   1.00 17.00 ? 692  MET A O     1 
ATOM   5383  C  CB    . MET A 1 692 ? -1.004  34.084  0.672   1.00 17.24 ? 692  MET A CB    1 
ATOM   5384  C  CG    . MET A 1 692 ? -1.296  32.658  0.224   1.00 19.12 ? 692  MET A CG    1 
ATOM   5385  S  SD    . MET A 1 692 ? 0.028   31.471  0.576   1.00 24.68 ? 692  MET A SD    1 
ATOM   5386  C  CE    . MET A 1 692 ? 0.454   30.998  -1.031  1.00 25.02 ? 692  MET A CE    1 
ATOM   5387  N  N     . ASP A 1 693 ? 0.498   36.215  3.022   1.00 17.85 ? 693  ASP A N     1 
ATOM   5388  C  CA    . ASP A 1 693 ? 0.708   37.651  3.322   1.00 18.91 ? 693  ASP A CA    1 
ATOM   5389  C  C     . ASP A 1 693 ? 1.660   38.479  2.386   1.00 18.98 ? 693  ASP A C     1 
ATOM   5390  O  O     . ASP A 1 693 ? 2.858   38.531  2.602   1.00 19.40 ? 693  ASP A O     1 
ATOM   5391  C  CB    . ASP A 1 693 ? 1.148   37.829  4.791   1.00 18.82 ? 693  ASP A CB    1 
ATOM   5392  C  CG    . ASP A 1 693 ? 0.793   39.203  5.313   1.00 18.74 ? 693  ASP A CG    1 
ATOM   5393  O  OD1   . ASP A 1 693 ? 0.274   39.951  4.477   1.00 19.55 ? 693  ASP A OD1   1 
ATOM   5394  O  OD2   . ASP A 1 693 ? 0.969   39.632  6.480   1.00 17.02 ? 693  ASP A OD2   1 
ATOM   5395  N  N     . GLU A 1 694 ? 1.100   39.131  1.372   1.00 19.58 ? 694  GLU A N     1 
ATOM   5396  C  CA    . GLU A 1 694 ? 1.837   40.035  0.476   1.00 20.11 ? 694  GLU A CA    1 
ATOM   5397  C  C     . GLU A 1 694 ? 2.915   39.245  -0.267  1.00 20.44 ? 694  GLU A C     1 
ATOM   5398  O  O     . GLU A 1 694 ? 4.108   39.507  -0.128  1.00 20.24 ? 694  GLU A O     1 
ATOM   5399  C  CB    . GLU A 1 694 ? 2.436   41.290  1.212   1.00 20.02 ? 694  GLU A CB    1 
ATOM   5400  C  CG    . GLU A 1 694 ? 1.434   42.224  1.906   1.00 21.12 ? 694  GLU A CG    1 
ATOM   5401  C  CD    . GLU A 1 694 ? 1.974   43.626  2.262   1.00 25.51 ? 694  GLU A CD    1 
ATOM   5402  O  OE1   . GLU A 1 694 ? 3.032   44.039  1.725   1.00 30.01 ? 694  GLU A OE1   1 
ATOM   5403  O  OE2   . GLU A 1 694 ? 1.337   44.362  3.074   1.00 25.32 ? 694  GLU A OE2   1 
ATOM   5404  N  N     . ILE A 1 695 ? 2.500   38.276  -1.072  1.00 21.35 ? 695  ILE A N     1 
ATOM   5405  C  CA    . ILE A 1 695 ? 3.483   37.438  -1.775  1.00 21.91 ? 695  ILE A CA    1 
ATOM   5406  C  C     . ILE A 1 695 ? 3.638   37.837  -3.239  1.00 22.42 ? 695  ILE A C     1 
ATOM   5407  O  O     . ILE A 1 695 ? 3.057   38.838  -3.703  1.00 22.26 ? 695  ILE A O     1 
ATOM   5408  C  CB    . ILE A 1 695 ? 3.129   35.948  -1.659  1.00 21.63 ? 695  ILE A CB    1 
ATOM   5409  C  CG1   . ILE A 1 695 ? 1.873   35.612  -2.485  1.00 23.22 ? 695  ILE A CG1   1 
ATOM   5410  C  CG2   . ILE A 1 695 ? 2.945   35.579  -0.223  1.00 21.54 ? 695  ILE A CG2   1 
ATOM   5411  C  CD1   . ILE A 1 695 ? 1.777   34.110  -2.870  1.00 24.17 ? 695  ILE A CD1   1 
ATOM   5412  N  N     . GLY A 1 696 ? 4.396   37.021  -3.979  1.00 22.67 ? 696  GLY A N     1 
ATOM   5413  C  CA    . GLY A 1 696 ? 4.627   37.281  -5.383  1.00 22.31 ? 696  GLY A CA    1 
ATOM   5414  C  C     . GLY A 1 696 ? 5.639   38.411  -5.510  1.00 22.07 ? 696  GLY A C     1 
ATOM   5415  O  O     . GLY A 1 696 ? 5.309   39.617  -5.487  1.00 20.96 ? 696  GLY A O     1 
ATOM   5416  N  N     . ARG A 1 697 ? 6.889   37.975  -5.626  1.00 21.48 ? 697  ARG A N     1 
ATOM   5417  C  CA    . ARG A 1 697 ? 8.018   38.846  -5.836  1.00 21.07 ? 697  ARG A CA    1 
ATOM   5418  C  C     . ARG A 1 697 ? 8.619   38.465  -7.190  1.00 19.13 ? 697  ARG A C     1 
ATOM   5419  O  O     . ARG A 1 697 ? 8.879   37.285  -7.467  1.00 19.30 ? 697  ARG A O     1 
ATOM   5420  C  CB    . ARG A 1 697 ? 9.022   38.627  -4.701  1.00 21.93 ? 697  ARG A CB    1 
ATOM   5421  C  CG    . ARG A 1 697 ? 9.754   39.882  -4.228  1.00 26.09 ? 697  ARG A CG    1 
ATOM   5422  C  CD    . ARG A 1 697 ? 9.777   40.068  -2.709  1.00 30.92 ? 697  ARG A CD    1 
ATOM   5423  N  NE    . ARG A 1 697 ? 10.772  41.069  -2.286  1.00 35.81 ? 697  ARG A NE    1 
ATOM   5424  C  CZ    . ARG A 1 697 ? 10.822  41.641  -1.062  1.00 39.63 ? 697  ARG A CZ    1 
ATOM   5425  N  NH1   . ARG A 1 697 ? 9.933   41.309  -0.109  1.00 39.72 ? 697  ARG A NH1   1 
ATOM   5426  N  NH2   . ARG A 1 697 ? 11.774  42.547  -0.788  1.00 40.41 ? 697  ARG A NH2   1 
ATOM   5427  N  N     . GLY A 1 698 ? 8.822   39.463  -8.038  1.00 16.76 ? 698  GLY A N     1 
ATOM   5428  C  CA    . GLY A 1 698 ? 9.350   39.251  -9.370  1.00 15.15 ? 698  GLY A CA    1 
ATOM   5429  C  C     . GLY A 1 698 ? 10.609  40.045  -9.492  1.00 13.73 ? 698  GLY A C     1 
ATOM   5430  O  O     . GLY A 1 698 ? 11.084  40.473  -8.467  1.00 13.69 ? 698  GLY A O     1 
ATOM   5431  N  N     . THR A 1 699 ? 11.148  40.212  -10.705 1.00 12.48 ? 699  THR A N     1 
ATOM   5432  C  CA    . THR A 1 699 ? 12.285  41.113  -10.989 1.00 11.75 ? 699  THR A CA    1 
ATOM   5433  C  C     . THR A 1 699 ? 11.934  42.348  -11.835 1.00 11.44 ? 699  THR A C     1 
ATOM   5434  O  O     . THR A 1 699 ? 12.733  43.292  -11.948 1.00 11.53 ? 699  THR A O     1 
ATOM   5435  C  CB    . THR A 1 699 ? 13.411  40.356  -11.714 1.00 11.64 ? 699  THR A CB    1 
ATOM   5436  O  OG1   . THR A 1 699 ? 13.081  40.210  -13.103 1.00 11.56 ? 699  THR A OG1   1 
ATOM   5437  C  CG2   . THR A 1 699 ? 13.574  38.931  -11.170 1.00 10.17 ? 699  THR A CG2   1 
ATOM   5438  N  N     . SER A 1 700 ? 10.781  42.296  -12.492 1.00 10.90 ? 700  SER A N     1 
ATOM   5439  C  CA    . SER A 1 700 ? 10.257  43.418  -13.222 1.00 10.60 ? 700  SER A CA    1 
ATOM   5440  C  C     . SER A 1 700 ? 8.929   43.701  -12.552 1.00 10.63 ? 700  SER A C     1 
ATOM   5441  O  O     . SER A 1 700 ? 8.563   42.990  -11.594 1.00 10.66 ? 700  SER A O     1 
ATOM   5442  C  CB    . SER A 1 700 ? 10.080  43.094  -14.704 1.00 10.66 ? 700  SER A CB    1 
ATOM   5443  O  OG    . SER A 1 700 ? 9.782   44.289  -15.439 1.00 10.57 ? 700  SER A OG    1 
ATOM   5444  N  N     . THR A 1 701 ? 8.225   44.721  -13.060 1.00 9.58  ? 701  THR A N     1 
ATOM   5445  C  CA    . THR A 1 701 ? 6.979   45.218  -12.482 1.00 8.80  ? 701  THR A CA    1 
ATOM   5446  C  C     . THR A 1 701 ? 5.888   44.218  -12.158 1.00 9.04  ? 701  THR A C     1 
ATOM   5447  O  O     . THR A 1 701 ? 5.262   44.296  -11.080 1.00 8.79  ? 701  THR A O     1 
ATOM   5448  C  CB    . THR A 1 701 ? 6.335   46.238  -13.444 1.00 8.42  ? 701  THR A CB    1 
ATOM   5449  O  OG1   . THR A 1 701 ? 7.198   47.368  -13.627 1.00 8.12  ? 701  THR A OG1   1 
ATOM   5450  C  CG2   . THR A 1 701 ? 5.087   46.824  -12.824 1.00 7.16  ? 701  THR A CG2   1 
ATOM   5451  N  N     . TYR A 1 702 ? 5.587   43.368  -13.139 1.00 8.95  ? 702  TYR A N     1 
ATOM   5452  C  CA    . TYR A 1 702 ? 4.331   42.604  -13.181 1.00 9.24  ? 702  TYR A CA    1 
ATOM   5453  C  C     . TYR A 1 702 ? 4.529   41.088  -13.082 1.00 10.18 ? 702  TYR A C     1 
ATOM   5454  O  O     . TYR A 1 702 ? 3.599   40.275  -13.091 1.00 10.31 ? 702  TYR A O     1 
ATOM   5455  C  CB    . TYR A 1 702 ? 3.651   42.900  -14.511 1.00 9.16  ? 702  TYR A CB    1 
ATOM   5456  C  CG    . TYR A 1 702 ? 2.919   44.197  -14.537 1.00 8.26  ? 702  TYR A CG    1 
ATOM   5457  C  CD1   . TYR A 1 702 ? 1.955   44.474  -13.586 1.00 7.64  ? 702  TYR A CD1   1 
ATOM   5458  C  CD2   . TYR A 1 702 ? 3.196   45.171  -15.504 1.00 7.16  ? 702  TYR A CD2   1 
ATOM   5459  C  CE1   . TYR A 1 702 ? 1.299   45.662  -13.595 1.00 7.42  ? 702  TYR A CE1   1 
ATOM   5460  C  CE2   . TYR A 1 702 ? 2.517   46.362  -15.517 1.00 5.75  ? 702  TYR A CE2   1 
ATOM   5461  C  CZ    . TYR A 1 702 ? 1.572   46.585  -14.565 1.00 6.75  ? 702  TYR A CZ    1 
ATOM   5462  O  OH    . TYR A 1 702 ? 0.873   47.746  -14.546 1.00 12.76 ? 702  TYR A OH    1 
ATOM   5463  N  N     . ASP A 1 703 ? 5.789   40.761  -13.111 1.00 11.13 ? 703  ASP A N     1 
ATOM   5464  C  CA    . ASP A 1 703 ? 6.353   39.481  -12.889 1.00 12.05 ? 703  ASP A CA    1 
ATOM   5465  C  C     . ASP A 1 703 ? 5.718   38.774  -11.671 1.00 12.53 ? 703  ASP A C     1 
ATOM   5466  O  O     . ASP A 1 703 ? 4.995   37.765  -11.801 1.00 12.99 ? 703  ASP A O     1 
ATOM   5467  C  CB    . ASP A 1 703 ? 7.831   39.806  -12.631 1.00 12.23 ? 703  ASP A CB    1 
ATOM   5468  C  CG    . ASP A 1 703 ? 8.705   38.697  -12.891 1.00 15.75 ? 703  ASP A CG    1 
ATOM   5469  O  OD1   . ASP A 1 703 ? 8.215   37.638  -13.368 1.00 25.05 ? 703  ASP A OD1   1 
ATOM   5470  O  OD2   . ASP A 1 703 ? 9.920   38.791  -12.663 1.00 17.78 ? 703  ASP A OD2   1 
ATOM   5471  N  N     . GLY A 1 704 ? 5.985   39.329  -10.492 1.00 12.32 ? 704  GLY A N     1 
ATOM   5472  C  CA    . GLY A 1 704 ? 5.615   38.726  -9.236  1.00 12.27 ? 704  GLY A CA    1 
ATOM   5473  C  C     . GLY A 1 704 ? 4.136   38.736  -8.994  1.00 12.29 ? 704  GLY A C     1 
ATOM   5474  O  O     . GLY A 1 704 ? 3.641   37.901  -8.326  1.00 13.84 ? 704  GLY A O     1 
ATOM   5475  N  N     . LEU A 1 705 ? 3.428   39.684  -9.552  1.00 13.06 ? 705  LEU A N     1 
ATOM   5476  C  CA    . LEU A 1 705 ? 2.007   39.825  -9.344  1.00 13.27 ? 705  LEU A CA    1 
ATOM   5477  C  C     . LEU A 1 705 ? 1.274   38.755  -10.178 1.00 13.36 ? 705  LEU A C     1 
ATOM   5478  O  O     . LEU A 1 705 ? 0.330   38.121  -9.707  1.00 13.14 ? 705  LEU A O     1 
ATOM   5479  C  CB    . LEU A 1 705 ? 1.593   41.257  -9.758  1.00 13.56 ? 705  LEU A CB    1 
ATOM   5480  C  CG    . LEU A 1 705 ? 0.194   41.385  -10.340 1.00 15.35 ? 705  LEU A CG    1 
ATOM   5481  C  CD1   . LEU A 1 705 ? -0.807  40.982  -9.272  1.00 16.65 ? 705  LEU A CD1   1 
ATOM   5482  C  CD2   . LEU A 1 705 ? -0.099  42.793  -10.839 1.00 17.30 ? 705  LEU A CD2   1 
ATOM   5483  N  N     . SER A 1 706 ? 1.700   38.602  -11.426 1.00 13.28 ? 706  SER A N     1 
ATOM   5484  C  CA    . SER A 1 706 ? 1.280   37.510  -12.285 1.00 14.39 ? 706  SER A CA    1 
ATOM   5485  C  C     . SER A 1 706 ? 1.318   36.146  -11.593 1.00 14.79 ? 706  SER A C     1 
ATOM   5486  O  O     . SER A 1 706 ? 0.473   35.291  -11.781 1.00 14.20 ? 706  SER A O     1 
ATOM   5487  C  CB    . SER A 1 706 ? 2.212   37.453  -13.482 1.00 14.71 ? 706  SER A CB    1 
ATOM   5488  O  OG    . SER A 1 706 ? 1.865   38.458  -14.416 1.00 16.28 ? 706  SER A OG    1 
ATOM   5489  N  N     . LEU A 1 707 ? 2.332   35.984  -10.778 1.00 15.65 ? 707  LEU A N     1 
ATOM   5490  C  CA    . LEU A 1 707 ? 2.540   34.805  -10.016 1.00 16.42 ? 707  LEU A CA    1 
ATOM   5491  C  C     . LEU A 1 707 ? 1.558   34.686  -8.870  1.00 16.34 ? 707  LEU A C     1 
ATOM   5492  O  O     . LEU A 1 707 ? 1.047   33.576  -8.588  1.00 16.85 ? 707  LEU A O     1 
ATOM   5493  C  CB    . LEU A 1 707 ? 3.959   34.829  -9.482  1.00 17.01 ? 707  LEU A CB    1 
ATOM   5494  C  CG    . LEU A 1 707 ? 4.630   33.478  -9.662  1.00 20.77 ? 707  LEU A CG    1 
ATOM   5495  C  CD1   . LEU A 1 707 ? 6.062   33.628  -9.154  1.00 24.08 ? 707  LEU A CD1   1 
ATOM   5496  C  CD2   . LEU A 1 707 ? 3.870   32.370  -8.909  1.00 21.04 ? 707  LEU A CD2   1 
ATOM   5497  N  N     . ALA A 1 708 ? 1.316   35.788  -8.166  1.00 15.41 ? 708  ALA A N     1 
ATOM   5498  C  CA    . ALA A 1 708 ? 0.334   35.731  -7.084  1.00 15.21 ? 708  ALA A CA    1 
ATOM   5499  C  C     . ALA A 1 708 ? -1.057  35.477  -7.625  1.00 14.40 ? 708  ALA A C     1 
ATOM   5500  O  O     . ALA A 1 708 ? -1.884  34.892  -6.964  1.00 14.22 ? 708  ALA A O     1 
ATOM   5501  C  CB    . ALA A 1 708 ? 0.343   36.993  -6.285  1.00 15.48 ? 708  ALA A CB    1 
ATOM   5502  N  N     . TRP A 1 709 ? -1.304  35.939  -8.837  1.00 14.31 ? 709  TRP A N     1 
ATOM   5503  C  CA    . TRP A 1 709 ? -2.624  35.892  -9.429  1.00 13.92 ? 709  TRP A CA    1 
ATOM   5504  C  C     . TRP A 1 709 ? -2.899  34.437  -9.830  1.00 13.59 ? 709  TRP A C     1 
ATOM   5505  O  O     . TRP A 1 709 ? -3.942  33.884  -9.517  1.00 13.20 ? 709  TRP A O     1 
ATOM   5506  C  CB    . TRP A 1 709 ? -2.696  36.829  -10.642 1.00 13.65 ? 709  TRP A CB    1 
ATOM   5507  C  CG    . TRP A 1 709 ? -4.010  36.756  -11.344 1.00 14.89 ? 709  TRP A CG    1 
ATOM   5508  C  CD1   . TRP A 1 709 ? -4.576  35.659  -11.924 1.00 15.59 ? 709  TRP A CD1   1 
ATOM   5509  C  CD2   . TRP A 1 709 ? -4.926  37.814  -11.529 1.00 17.79 ? 709  TRP A CD2   1 
ATOM   5510  N  NE1   . TRP A 1 709 ? -5.798  35.971  -12.456 1.00 16.04 ? 709  TRP A NE1   1 
ATOM   5511  C  CE2   . TRP A 1 709 ? -6.042  37.293  -12.217 1.00 18.60 ? 709  TRP A CE2   1 
ATOM   5512  C  CE3   . TRP A 1 709 ? -4.919  39.172  -11.200 1.00 20.04 ? 709  TRP A CE3   1 
ATOM   5513  C  CZ2   . TRP A 1 709 ? -7.134  38.078  -12.574 1.00 20.06 ? 709  TRP A CZ2   1 
ATOM   5514  C  CZ3   . TRP A 1 709 ? -6.012  39.945  -11.538 1.00 20.85 ? 709  TRP A CZ3   1 
ATOM   5515  C  CH2   . TRP A 1 709 ? -7.098  39.397  -12.223 1.00 20.55 ? 709  TRP A CH2   1 
ATOM   5516  N  N     . ALA A 1 710 ? -1.963  33.851  -10.568 1.00 13.42 ? 710  ALA A N     1 
ATOM   5517  C  CA    . ALA A 1 710 ? -2.012  32.451  -10.919 1.00 13.22 ? 710  ALA A CA    1 
ATOM   5518  C  C     . ALA A 1 710 ? -2.149  31.564  -9.662  1.00 13.26 ? 710  ALA A C     1 
ATOM   5519  O  O     . ALA A 1 710 ? -2.928  30.619  -9.643  1.00 13.39 ? 710  ALA A O     1 
ATOM   5520  C  CB    . ALA A 1 710 ? -0.779  32.092  -11.705 1.00 13.02 ? 710  ALA A CB    1 
ATOM   5521  N  N     . CYS A 1 711 ? -1.436  31.921  -8.602  1.00 13.42 ? 711  CYS A N     1 
ATOM   5522  C  CA    . CYS A 1 711 ? -1.400  31.132  -7.385  1.00 13.77 ? 711  CYS A CA    1 
ATOM   5523  C  C     . CYS A 1 711 ? -2.718  31.186  -6.692  1.00 14.00 ? 711  CYS A C     1 
ATOM   5524  O  O     . CYS A 1 711 ? -3.188  30.170  -6.161  1.00 15.36 ? 711  CYS A O     1 
ATOM   5525  C  CB    . CYS A 1 711 ? -0.303  31.605  -6.445  1.00 13.44 ? 711  CYS A CB    1 
ATOM   5526  S  SG    . CYS A 1 711 ? 1.313   30.916  -6.888  1.00 17.90 ? 711  CYS A SG    1 
ATOM   5527  N  N     . ALA A 1 712 ? -3.331  32.361  -6.717  1.00 14.01 ? 712  ALA A N     1 
ATOM   5528  C  CA    . ALA A 1 712 ? -4.591  32.608  -6.028  1.00 13.69 ? 712  ALA A CA    1 
ATOM   5529  C  C     . ALA A 1 712 ? -5.673  31.814  -6.701  1.00 13.55 ? 712  ALA A C     1 
ATOM   5530  O  O     . ALA A 1 712 ? -6.542  31.281  -6.072  1.00 13.59 ? 712  ALA A O     1 
ATOM   5531  C  CB    . ALA A 1 712 ? -4.934  34.113  -6.101  1.00 13.34 ? 712  ALA A CB    1 
ATOM   5532  N  N     . GLU A 1 713 ? -5.624  31.831  -8.017  1.00 14.00 ? 713  GLU A N     1 
ATOM   5533  C  CA    . GLU A 1 713 ? -6.558  31.165  -8.879  1.00 15.06 ? 713  GLU A CA    1 
ATOM   5534  C  C     . GLU A 1 713 ? -6.439  29.651  -8.661  1.00 15.55 ? 713  GLU A C     1 
ATOM   5535  O  O     . GLU A 1 713 ? -7.416  28.932  -8.588  1.00 15.47 ? 713  GLU A O     1 
ATOM   5536  C  CB    . GLU A 1 713 ? -6.195  31.572  -10.304 1.00 15.31 ? 713  GLU A CB    1 
ATOM   5537  C  CG    . GLU A 1 713 ? -6.942  30.885  -11.413 1.00 17.74 ? 713  GLU A CG    1 
ATOM   5538  C  CD    . GLU A 1 713 ? -6.456  31.322  -12.786 1.00 20.70 ? 713  GLU A CD    1 
ATOM   5539  O  OE1   . GLU A 1 713 ? -6.415  30.459  -13.691 1.00 22.09 ? 713  GLU A OE1   1 
ATOM   5540  O  OE2   . GLU A 1 713 ? -6.135  32.526  -12.972 1.00 23.27 ? 713  GLU A OE2   1 
ATOM   5541  N  N     . ASN A 1 714 ? -5.232  29.161  -8.497  1.00 15.96 ? 714  ASN A N     1 
ATOM   5542  C  CA    . ASN A 1 714 ? -5.112  27.781  -8.159  1.00 16.30 ? 714  ASN A CA    1 
ATOM   5543  C  C     . ASN A 1 714 ? -5.761  27.439  -6.826  1.00 16.59 ? 714  ASN A C     1 
ATOM   5544  O  O     . ASN A 1 714 ? -6.317  26.344  -6.661  1.00 15.85 ? 714  ASN A O     1 
ATOM   5545  C  CB    . ASN A 1 714 ? -3.658  27.355  -8.148  1.00 16.74 ? 714  ASN A CB    1 
ATOM   5546  C  CG    . ASN A 1 714 ? -3.532  25.883  -8.307  1.00 16.75 ? 714  ASN A CG    1 
ATOM   5547  O  OD1   . ASN A 1 714 ? -3.228  25.140  -7.355  1.00 18.30 ? 714  ASN A OD1   1 
ATOM   5548  N  ND2   . ASN A 1 714 ? -3.851  25.426  -9.495  1.00 17.25 ? 714  ASN A ND2   1 
ATOM   5549  N  N     . LEU A 1 715 ? -5.656  28.349  -5.857  1.00 16.66 ? 715  LEU A N     1 
ATOM   5550  C  CA    . LEU A 1 715 ? -6.147  28.060  -4.506  1.00 16.62 ? 715  LEU A CA    1 
ATOM   5551  C  C     . LEU A 1 715 ? -7.670  28.063  -4.502  1.00 17.37 ? 715  LEU A C     1 
ATOM   5552  O  O     . LEU A 1 715 ? -8.290  27.199  -3.871  1.00 17.25 ? 715  LEU A O     1 
ATOM   5553  C  CB    . LEU A 1 715 ? -5.585  29.042  -3.474  1.00 16.17 ? 715  LEU A CB    1 
ATOM   5554  C  CG    . LEU A 1 715 ? -4.184  28.710  -2.933  1.00 16.14 ? 715  LEU A CG    1 
ATOM   5555  C  CD1   . LEU A 1 715 ? -3.437  29.925  -2.444  1.00 15.05 ? 715  LEU A CD1   1 
ATOM   5556  C  CD2   . LEU A 1 715 ? -4.257  27.681  -1.837  1.00 17.47 ? 715  LEU A CD2   1 
ATOM   5557  N  N     . ALA A 1 716 ? -8.250  29.036  -5.215  1.00 18.00 ? 716  ALA A N     1 
ATOM   5558  C  CA    . ALA A 1 716 ? -9.695  29.188  -5.354  1.00 18.23 ? 716  ALA A CA    1 
ATOM   5559  C  C     . ALA A 1 716 ? -10.250 28.089  -6.230  1.00 18.39 ? 716  ALA A C     1 
ATOM   5560  O  O     . ALA A 1 716 ? -11.011 27.258  -5.785  1.00 17.54 ? 716  ALA A O     1 
ATOM   5561  C  CB    . ALA A 1 716 ? -10.021 30.512  -5.959  1.00 18.29 ? 716  ALA A CB    1 
ATOM   5562  N  N     . ASN A 1 717 ? -9.842  28.069  -7.479  1.00 18.90 ? 717  ASN A N     1 
ATOM   5563  C  CA    . ASN A 1 717 ? -10.470 27.183  -8.436  1.00 20.12 ? 717  ASN A CA    1 
ATOM   5564  C  C     . ASN A 1 717 ? -10.076 25.666  -8.341  1.00 20.11 ? 717  ASN A C     1 
ATOM   5565  O  O     . ASN A 1 717 ? -10.951 24.824  -8.456  1.00 21.08 ? 717  ASN A O     1 
ATOM   5566  C  CB    . ASN A 1 717 ? -10.408 27.837  -9.831  1.00 20.65 ? 717  ASN A CB    1 
ATOM   5567  C  CG    . ASN A 1 717 ? -10.063 26.876  -10.948 1.00 24.10 ? 717  ASN A CG    1 
ATOM   5568  O  OD1   . ASN A 1 717 ? -10.932 26.119  -11.426 1.00 25.53 ? 717  ASN A OD1   1 
ATOM   5569  N  ND2   . ASN A 1 717 ? -8.796  26.945  -11.429 1.00 27.07 ? 717  ASN A ND2   1 
ATOM   5570  N  N     . LYS A 1 718 ? -8.832  25.297  -8.047  1.00 20.05 ? 718  LYS A N     1 
ATOM   5571  C  CA    . LYS A 1 718 ? -8.441  23.854  -8.027  1.00 20.06 ? 718  LYS A CA    1 
ATOM   5572  C  C     . LYS A 1 718 ? -8.346  23.200  -6.638  1.00 19.31 ? 718  LYS A C     1 
ATOM   5573  O  O     . LYS A 1 718 ? -8.719  22.040  -6.474  1.00 20.07 ? 718  LYS A O     1 
ATOM   5574  C  CB    . LYS A 1 718 ? -7.108  23.630  -8.787  1.00 20.38 ? 718  LYS A CB    1 
ATOM   5575  C  CG    . LYS A 1 718 ? -7.196  22.714  -10.021 1.00 21.90 ? 718  LYS A CG    1 
ATOM   5576  C  CD    . LYS A 1 718 ? -7.638  23.412  -11.330 1.00 23.35 ? 718  LYS A CD    1 
ATOM   5577  C  CE    . LYS A 1 718 ? -7.442  22.513  -12.573 1.00 24.68 ? 718  LYS A CE    1 
ATOM   5578  N  NZ    . LYS A 1 718 ? -7.689  21.029  -12.284 1.00 25.68 ? 718  LYS A NZ    1 
ATOM   5579  N  N     . ILE A 1 719 ? -7.832  23.922  -5.648  1.00 18.20 ? 719  ILE A N     1 
ATOM   5580  C  CA    . ILE A 1 719 ? -7.637  23.378  -4.308  1.00 17.19 ? 719  ILE A CA    1 
ATOM   5581  C  C     . ILE A 1 719 ? -8.816  23.647  -3.396  1.00 16.24 ? 719  ILE A C     1 
ATOM   5582  O  O     . ILE A 1 719 ? -9.056  22.894  -2.467  1.00 16.68 ? 719  ILE A O     1 
ATOM   5583  C  CB    . ILE A 1 719 ? -6.345  23.924  -3.698  1.00 17.63 ? 719  ILE A CB    1 
ATOM   5584  C  CG1   . ILE A 1 719 ? -5.126  23.417  -4.487  1.00 18.46 ? 719  ILE A CG1   1 
ATOM   5585  C  CG2   . ILE A 1 719 ? -6.217  23.543  -2.221  1.00 17.93 ? 719  ILE A CG2   1 
ATOM   5586  C  CD1   . ILE A 1 719 ? -3.870  24.248  -4.248  1.00 19.98 ? 719  ILE A CD1   1 
ATOM   5587  N  N     . LYS A 1 720 ? -9.568  24.696  -3.697  1.00 15.81 ? 720  LYS A N     1 
ATOM   5588  C  CA    . LYS A 1 720 ? -10.743 25.160  -2.940  1.00 15.29 ? 720  LYS A CA    1 
ATOM   5589  C  C     . LYS A 1 720 ? -10.560 25.251  -1.397  1.00 14.93 ? 720  LYS A C     1 
ATOM   5590  O  O     . LYS A 1 720 ? -11.496 25.103  -0.638  1.00 14.52 ? 720  LYS A O     1 
ATOM   5591  C  CB    . LYS A 1 720 ? -11.998 24.388  -3.382  1.00 14.97 ? 720  LYS A CB    1 
ATOM   5592  C  CG    . LYS A 1 720 ? -12.115 24.208  -4.916  1.00 17.33 ? 720  LYS A CG    1 
ATOM   5593  C  CD    . LYS A 1 720 ? -13.362 23.434  -5.416  1.00 20.94 ? 720  LYS A CD    1 
ATOM   5594  C  CE    . LYS A 1 720 ? -13.371 21.945  -4.894  1.00 24.58 ? 720  LYS A CE    1 
ATOM   5595  N  NZ    . LYS A 1 720 ? -14.159 20.924  -5.729  1.00 26.06 ? 720  LYS A NZ    1 
ATOM   5596  N  N     . ALA A 1 721 ? -9.350  25.547  -0.945  1.00 15.29 ? 721  ALA A N     1 
ATOM   5597  C  CA    . ALA A 1 721 ? -9.100  25.764  0.471   1.00 16.01 ? 721  ALA A CA    1 
ATOM   5598  C  C     . ALA A 1 721 ? -9.587  27.162  0.924   1.00 16.90 ? 721  ALA A C     1 
ATOM   5599  O  O     . ALA A 1 721 ? -9.980  27.987  0.094   1.00 17.30 ? 721  ALA A O     1 
ATOM   5600  C  CB    . ALA A 1 721 ? -7.628  25.625  0.745   1.00 16.17 ? 721  ALA A CB    1 
ATOM   5601  N  N     . LEU A 1 722 ? -9.568  27.392  2.242   1.00 17.19 ? 722  LEU A N     1 
ATOM   5602  C  CA    . LEU A 1 722 ? -9.992  28.636  2.845   1.00 17.50 ? 722  LEU A CA    1 
ATOM   5603  C  C     . LEU A 1 722 ? -8.765  29.525  2.903   1.00 18.18 ? 722  LEU A C     1 
ATOM   5604  O  O     . LEU A 1 722 ? -7.801  29.160  3.552   1.00 17.90 ? 722  LEU A O     1 
ATOM   5605  C  CB    . LEU A 1 722 ? -10.536 28.393  4.259   1.00 17.88 ? 722  LEU A CB    1 
ATOM   5606  C  CG    . LEU A 1 722 ? -11.798 27.527  4.502   1.00 18.48 ? 722  LEU A CG    1 
ATOM   5607  C  CD1   . LEU A 1 722 ? -12.303 27.665  5.937   1.00 18.50 ? 722  LEU A CD1   1 
ATOM   5608  C  CD2   . LEU A 1 722 ? -12.925 27.858  3.556   1.00 19.05 ? 722  LEU A CD2   1 
ATOM   5609  N  N     . THR A 1 723 ? -8.797  30.695  2.263   1.00 18.60 ? 723  THR A N     1 
ATOM   5610  C  CA    . THR A 1 723 ? -7.568  31.462  2.024   1.00 19.55 ? 723  THR A CA    1 
ATOM   5611  C  C     . THR A 1 723 ? -7.740  32.907  2.439   1.00 20.25 ? 723  THR A C     1 
ATOM   5612  O  O     . THR A 1 723 ? -8.529  33.632  1.836   1.00 21.35 ? 723  THR A O     1 
ATOM   5613  C  CB    . THR A 1 723 ? -7.237  31.417  0.504   1.00 19.46 ? 723  THR A CB    1 
ATOM   5614  O  OG1   . THR A 1 723 ? -7.254  30.060  0.036   1.00 20.83 ? 723  THR A OG1   1 
ATOM   5615  C  CG2   . THR A 1 723 ? -5.854  31.891  0.207   1.00 18.97 ? 723  THR A CG2   1 
ATOM   5616  N  N     . LEU A 1 724 ? -7.054  33.356  3.476   1.00 20.94 ? 724  LEU A N     1 
ATOM   5617  C  CA    . LEU A 1 724 ? -6.930  34.809  3.689   1.00 20.99 ? 724  LEU A CA    1 
ATOM   5618  C  C     . LEU A 1 724 ? -5.691  35.258  2.913   1.00 20.73 ? 724  LEU A C     1 
ATOM   5619  O  O     . LEU A 1 724 ? -4.610  34.704  3.103   1.00 19.77 ? 724  LEU A O     1 
ATOM   5620  C  CB    . LEU A 1 724 ? -6.833  35.156  5.178   1.00 21.22 ? 724  LEU A CB    1 
ATOM   5621  C  CG    . LEU A 1 724 ? -8.056  34.790  6.026   1.00 21.64 ? 724  LEU A CG    1 
ATOM   5622  C  CD1   . LEU A 1 724 ? -7.987  35.432  7.438   1.00 20.11 ? 724  LEU A CD1   1 
ATOM   5623  C  CD2   . LEU A 1 724 ? -9.356  35.172  5.312   1.00 21.47 ? 724  LEU A CD2   1 
ATOM   5624  N  N     . PHE A 1 725 ? -5.865  36.246  2.036   1.00 20.96 ? 725  PHE A N     1 
ATOM   5625  C  CA    . PHE A 1 725 ? -4.852  36.638  1.043   1.00 21.37 ? 725  PHE A CA    1 
ATOM   5626  C  C     . PHE A 1 725 ? -4.535  38.161  1.044   1.00 21.57 ? 725  PHE A C     1 
ATOM   5627  O  O     . PHE A 1 725 ? -4.971  38.901  0.176   1.00 21.81 ? 725  PHE A O     1 
ATOM   5628  C  CB    . PHE A 1 725 ? -5.361  36.201  -0.335  1.00 21.16 ? 725  PHE A CB    1 
ATOM   5629  C  CG    . PHE A 1 725 ? -4.294  36.162  -1.400  1.00 21.91 ? 725  PHE A CG    1 
ATOM   5630  C  CD1   . PHE A 1 725 ? -3.778  37.361  -1.966  1.00 21.90 ? 725  PHE A CD1   1 
ATOM   5631  C  CD2   . PHE A 1 725 ? -3.803  34.931  -1.860  1.00 18.92 ? 725  PHE A CD2   1 
ATOM   5632  C  CE1   . PHE A 1 725 ? -2.779  37.315  -2.959  1.00 19.84 ? 725  PHE A CE1   1 
ATOM   5633  C  CE2   . PHE A 1 725 ? -2.820  34.888  -2.845  1.00 18.58 ? 725  PHE A CE2   1 
ATOM   5634  C  CZ    . PHE A 1 725 ? -2.298  36.075  -3.384  1.00 18.71 ? 725  PHE A CZ    1 
ATOM   5635  N  N     . ALA A 1 726 ? -3.781  38.648  2.014   1.00 21.93 ? 726  ALA A N     1 
ATOM   5636  C  CA    . ALA A 1 726 ? -3.485  40.089  2.050   1.00 21.97 ? 726  ALA A CA    1 
ATOM   5637  C  C     . ALA A 1 726 ? -2.545  40.491  0.917   1.00 22.32 ? 726  ALA A C     1 
ATOM   5638  O  O     . ALA A 1 726 ? -1.619  39.747  0.593   1.00 22.88 ? 726  ALA A O     1 
ATOM   5639  C  CB    . ALA A 1 726 ? -2.904  40.474  3.390   1.00 21.59 ? 726  ALA A CB    1 
ATOM   5640  N  N     . THR A 1 727 ? -2.791  41.657  0.310   1.00 22.71 ? 727  THR A N     1 
ATOM   5641  C  CA    . THR A 1 727 ? -1.953  42.195  -0.777  1.00 22.97 ? 727  THR A CA    1 
ATOM   5642  C  C     . THR A 1 727 ? -1.880  43.725  -0.817  1.00 23.19 ? 727  THR A C     1 
ATOM   5643  O  O     . THR A 1 727 ? -2.810  44.405  -0.396  1.00 22.93 ? 727  THR A O     1 
ATOM   5644  C  CB    . THR A 1 727 ? -2.524  41.776  -2.107  1.00 22.82 ? 727  THR A CB    1 
ATOM   5645  O  OG1   . THR A 1 727 ? -2.846  40.398  -2.077  1.00 27.13 ? 727  THR A OG1   1 
ATOM   5646  C  CG2   . THR A 1 727 ? -1.500  41.813  -3.168  1.00 23.28 ? 727  THR A CG2   1 
ATOM   5647  N  N     . HIS A 1 728 ? -0.793  44.268  -1.366  1.00 23.48 ? 728  HIS A N     1 
ATOM   5648  C  CA    . HIS A 1 728 ? -0.804  45.665  -1.762  1.00 24.28 ? 728  HIS A CA    1 
ATOM   5649  C  C     . HIS A 1 728 ? -1.087  45.840  -3.258  1.00 23.33 ? 728  HIS A C     1 
ATOM   5650  O  O     . HIS A 1 728 ? -1.386  46.949  -3.700  1.00 23.93 ? 728  HIS A O     1 
ATOM   5651  C  CB    . HIS A 1 728 ? 0.480   46.406  -1.331  1.00 25.29 ? 728  HIS A CB    1 
ATOM   5652  C  CG    . HIS A 1 728 ? 0.439   46.948  0.085   1.00 28.44 ? 728  HIS A CG    1 
ATOM   5653  N  ND1   . HIS A 1 728 ? -0.681  46.888  0.891   1.00 31.38 ? 728  HIS A ND1   1 
ATOM   5654  C  CD2   . HIS A 1 728 ? 1.401   47.535  0.840   1.00 30.48 ? 728  HIS A CD2   1 
ATOM   5655  C  CE1   . HIS A 1 728 ? -0.400  47.392  2.081   1.00 31.34 ? 728  HIS A CE1   1 
ATOM   5656  N  NE2   . HIS A 1 728 ? 0.854   47.800  2.072   1.00 31.09 ? 728  HIS A NE2   1 
ATOM   5657  N  N     . TYR A 1 729 ? -0.961  44.773  -4.034  1.00 22.10 ? 729  TYR A N     1 
ATOM   5658  C  CA    . TYR A 1 729 ? -1.415  44.755  -5.429  1.00 21.46 ? 729  TYR A CA    1 
ATOM   5659  C  C     . TYR A 1 729 ? -2.916  44.950  -5.641  1.00 20.68 ? 729  TYR A C     1 
ATOM   5660  O  O     . TYR A 1 729 ? -3.691  43.998  -5.625  1.00 21.11 ? 729  TYR A O     1 
ATOM   5661  C  CB    . TYR A 1 729 ? -1.007  43.456  -6.113  1.00 21.59 ? 729  TYR A CB    1 
ATOM   5662  C  CG    . TYR A 1 729 ? 0.478   43.214  -6.078  1.00 22.26 ? 729  TYR A CG    1 
ATOM   5663  C  CD1   . TYR A 1 729 ? 1.363   44.208  -6.482  1.00 23.33 ? 729  TYR A CD1   1 
ATOM   5664  C  CD2   . TYR A 1 729 ? 1.002   42.004  -5.628  1.00 20.49 ? 729  TYR A CD2   1 
ATOM   5665  C  CE1   . TYR A 1 729 ? 2.712   43.994  -6.454  1.00 24.87 ? 729  TYR A CE1   1 
ATOM   5666  C  CE2   . TYR A 1 729 ? 2.354   41.784  -5.592  1.00 21.02 ? 729  TYR A CE2   1 
ATOM   5667  C  CZ    . TYR A 1 729 ? 3.208   42.773  -6.014  1.00 23.65 ? 729  TYR A CZ    1 
ATOM   5668  O  OH    . TYR A 1 729 ? 4.569   42.591  -5.989  1.00 24.93 ? 729  TYR A OH    1 
ATOM   5669  N  N     . PHE A 1 730 ? -3.306  46.187  -5.898  1.00 19.67 ? 730  PHE A N     1 
ATOM   5670  C  CA    . PHE A 1 730 ? -4.676  46.541  -6.228  1.00 18.96 ? 730  PHE A CA    1 
ATOM   5671  C  C     . PHE A 1 730 ? -5.246  45.780  -7.429  1.00 18.24 ? 730  PHE A C     1 
ATOM   5672  O  O     . PHE A 1 730 ? -6.458  45.592  -7.549  1.00 17.88 ? 730  PHE A O     1 
ATOM   5673  C  CB    . PHE A 1 730 ? -4.751  48.047  -6.527  1.00 19.22 ? 730  PHE A CB    1 
ATOM   5674  C  CG    . PHE A 1 730 ? -6.096  48.632  -6.254  1.00 19.91 ? 730  PHE A CG    1 
ATOM   5675  C  CD1   . PHE A 1 730 ? -6.463  48.976  -4.946  1.00 20.45 ? 730  PHE A CD1   1 
ATOM   5676  C  CD2   . PHE A 1 730 ? -7.017  48.791  -7.288  1.00 20.83 ? 730  PHE A CD2   1 
ATOM   5677  C  CE1   . PHE A 1 730 ? -7.703  49.503  -4.685  1.00 20.55 ? 730  PHE A CE1   1 
ATOM   5678  C  CE2   . PHE A 1 730 ? -8.285  49.311  -7.037  1.00 21.40 ? 730  PHE A CE2   1 
ATOM   5679  C  CZ    . PHE A 1 730 ? -8.628  49.676  -5.737  1.00 21.88 ? 730  PHE A CZ    1 
ATOM   5680  N  N     . GLU A 1 731 ? -4.370  45.365  -8.333  1.00 17.18 ? 731  GLU A N     1 
ATOM   5681  C  CA    . GLU A 1 731 ? -4.790  44.625  -9.495  1.00 16.51 ? 731  GLU A CA    1 
ATOM   5682  C  C     . GLU A 1 731 ? -5.492  43.310  -9.138  1.00 16.61 ? 731  GLU A C     1 
ATOM   5683  O  O     . GLU A 1 731 ? -6.316  42.833  -9.917  1.00 16.50 ? 731  GLU A O     1 
ATOM   5684  C  CB    . GLU A 1 731 ? -3.587  44.353  -10.397 1.00 16.42 ? 731  GLU A CB    1 
ATOM   5685  C  CG    . GLU A 1 731 ? -2.917  45.622  -10.909 1.00 14.02 ? 731  GLU A CG    1 
ATOM   5686  C  CD    . GLU A 1 731 ? -1.575  45.913  -10.239 1.00 9.15  ? 731  GLU A CD    1 
ATOM   5687  O  OE1   . GLU A 1 731 ? -1.468  45.900  -8.997  1.00 6.47  ? 731  GLU A OE1   1 
ATOM   5688  O  OE2   . GLU A 1 731 ? -0.621  46.167  -10.958 1.00 4.62  ? 731  GLU A OE2   1 
ATOM   5689  N  N     . LEU A 1 732 ? -5.171  42.723  -7.986  1.00 16.84 ? 732  LEU A N     1 
ATOM   5690  C  CA    . LEU A 1 732 ? -5.820  41.462  -7.556  1.00 17.16 ? 732  LEU A CA    1 
ATOM   5691  C  C     . LEU A 1 732 ? -7.222  41.646  -6.990  1.00 17.06 ? 732  LEU A C     1 
ATOM   5692  O  O     . LEU A 1 732 ? -7.904  40.632  -6.742  1.00 15.45 ? 732  LEU A O     1 
ATOM   5693  C  CB    . LEU A 1 732 ? -4.998  40.726  -6.512  1.00 17.05 ? 732  LEU A CB    1 
ATOM   5694  C  CG    . LEU A 1 732 ? -3.548  40.524  -6.907  1.00 19.07 ? 732  LEU A CG    1 
ATOM   5695  C  CD1   . LEU A 1 732 ? -2.810  39.763  -5.852  1.00 21.72 ? 732  LEU A CD1   1 
ATOM   5696  C  CD2   . LEU A 1 732 ? -3.503  39.796  -8.193  1.00 20.43 ? 732  LEU A CD2   1 
ATOM   5697  N  N     . THR A 1 733 ? -7.639  42.908  -6.769  1.00 16.66 ? 733  THR A N     1 
ATOM   5698  C  CA    . THR A 1 733 ? -9.025  43.174  -6.379  1.00 17.14 ? 733  THR A CA    1 
ATOM   5699  C  C     . THR A 1 733 ? -10.011 42.879  -7.509  1.00 17.62 ? 733  THR A C     1 
ATOM   5700  O  O     . THR A 1 733 ? -11.194 42.732  -7.262  1.00 16.79 ? 733  THR A O     1 
ATOM   5701  C  CB    . THR A 1 733 ? -9.259  44.610  -5.856  1.00 17.39 ? 733  THR A CB    1 
ATOM   5702  O  OG1   . THR A 1 733 ? -9.049  45.591  -6.885  1.00 15.51 ? 733  THR A OG1   1 
ATOM   5703  C  CG2   . THR A 1 733 ? -8.302  44.937  -4.746  1.00 17.95 ? 733  THR A CG2   1 
ATOM   5704  N  N     . GLN A 1 734 ? -9.501  42.808  -8.735  1.00 18.56 ? 734  GLN A N     1 
ATOM   5705  C  CA    . GLN A 1 734 ? -10.250 42.385  -9.917  1.00 19.56 ? 734  GLN A CA    1 
ATOM   5706  C  C     . GLN A 1 734 ? -10.422 40.852  -9.960  1.00 19.96 ? 734  GLN A C     1 
ATOM   5707  O  O     . GLN A 1 734 ? -10.981 40.334  -10.926 1.00 20.10 ? 734  GLN A O     1 
ATOM   5708  C  CB    . GLN A 1 734 ? -9.519  42.875  -11.191 1.00 19.75 ? 734  GLN A CB    1 
ATOM   5709  C  CG    . GLN A 1 734 ? -10.413 43.299  -12.376 1.00 23.30 ? 734  GLN A CG    1 
ATOM   5710  C  CD    . GLN A 1 734 ? -10.527 44.849  -12.560 1.00 28.68 ? 734  GLN A CD    1 
ATOM   5711  O  OE1   . GLN A 1 734 ? -11.628 45.446  -12.399 1.00 28.96 ? 734  GLN A OE1   1 
ATOM   5712  N  NE2   . GLN A 1 734 ? -9.395  45.492  -12.905 1.00 29.50 ? 734  GLN A NE2   1 
ATOM   5713  N  N     . LEU A 1 735 ? -9.950  40.131  -8.936  1.00 20.04 ? 735  LEU A N     1 
ATOM   5714  C  CA    . LEU A 1 735 ? -10.085 38.666  -8.899  1.00 20.68 ? 735  LEU A CA    1 
ATOM   5715  C  C     . LEU A 1 735 ? -11.501 38.127  -8.727  1.00 20.09 ? 735  LEU A C     1 
ATOM   5716  O  O     . LEU A 1 735 ? -11.857 37.215  -9.434  1.00 20.67 ? 735  LEU A O     1 
ATOM   5717  C  CB    . LEU A 1 735 ? -9.222  38.030  -7.793  1.00 21.49 ? 735  LEU A CB    1 
ATOM   5718  C  CG    . LEU A 1 735 ? -7.921  37.388  -8.252  1.00 22.17 ? 735  LEU A CG    1 
ATOM   5719  C  CD1   . LEU A 1 735 ? -6.983  37.240  -7.081  1.00 22.80 ? 735  LEU A CD1   1 
ATOM   5720  C  CD2   . LEU A 1 735 ? -8.258  36.061  -8.877  1.00 25.00 ? 735  LEU A CD2   1 
ATOM   5721  N  N     . PRO A 1 736 ? -12.263 38.591  -7.740  1.00 19.03 ? 736  PRO A N     1 
ATOM   5722  C  CA    . PRO A 1 736 ? -13.654 38.165  -7.582  1.00 18.94 ? 736  PRO A CA    1 
ATOM   5723  C  C     . PRO A 1 736 ? -14.484 38.238  -8.870  1.00 19.35 ? 736  PRO A C     1 
ATOM   5724  O  O     . PRO A 1 736 ? -15.121 37.292  -9.230  1.00 19.49 ? 736  PRO A O     1 
ATOM   5725  C  CB    . PRO A 1 736 ? -14.184 39.146  -6.543  1.00 18.80 ? 736  PRO A CB    1 
ATOM   5726  C  CG    . PRO A 1 736 ? -13.034 39.491  -5.736  1.00 18.03 ? 736  PRO A CG    1 
ATOM   5727  C  CD    . PRO A 1 736 ? -11.868 39.519  -6.668  1.00 18.50 ? 736  PRO A CD    1 
ATOM   5728  N  N     . GLU A 1 737 ? -14.525 39.387  -9.523  1.00 20.35 ? 737  GLU A N     1 
ATOM   5729  C  CA    . GLU A 1 737 ? -15.106 39.536  -10.856 1.00 20.38 ? 737  GLU A CA    1 
ATOM   5730  C  C     . GLU A 1 737 ? -14.937 38.257  -11.669 1.00 20.77 ? 737  GLU A C     1 
ATOM   5731  O  O     . GLU A 1 737 ? -15.855 37.759  -12.303 1.00 20.40 ? 737  GLU A O     1 
ATOM   5732  C  CB    . GLU A 1 737 ? -14.332 40.663  -11.533 1.00 20.36 ? 737  GLU A CB    1 
ATOM   5733  C  CG    . GLU A 1 737 ? -14.819 41.154  -12.875 1.00 21.44 ? 737  GLU A CG    1 
ATOM   5734  C  CD    . GLU A 1 737 ? -14.616 42.662  -13.024 1.00 24.89 ? 737  GLU A CD    1 
ATOM   5735  O  OE1   . GLU A 1 737 ? -15.248 43.270  -13.911 1.00 28.48 ? 737  GLU A OE1   1 
ATOM   5736  O  OE2   . GLU A 1 737 ? -13.841 43.260  -12.238 1.00 25.65 ? 737  GLU A OE2   1 
ATOM   5737  N  N     . LYS A 1 738 ? -13.726 37.734  -11.625 1.00 21.57 ? 738  LYS A N     1 
ATOM   5738  C  CA    . LYS A 1 738 ? -13.297 36.682  -12.517 1.00 22.63 ? 738  LYS A CA    1 
ATOM   5739  C  C     . LYS A 1 738 ? -13.280 35.233  -11.955 1.00 23.25 ? 738  LYS A C     1 
ATOM   5740  O  O     . LYS A 1 738 ? -13.075 34.315  -12.718 1.00 23.15 ? 738  LYS A O     1 
ATOM   5741  C  CB    . LYS A 1 738 ? -11.902 37.060  -13.029 1.00 22.43 ? 738  LYS A CB    1 
ATOM   5742  C  CG    . LYS A 1 738 ? -11.902 38.257  -13.969 1.00 22.98 ? 738  LYS A CG    1 
ATOM   5743  C  CD    . LYS A 1 738 ? -11.412 37.867  -15.357 1.00 23.48 ? 738  LYS A CD    1 
ATOM   5744  C  CE    . LYS A 1 738 ? -11.575 38.972  -16.409 1.00 22.81 ? 738  LYS A CE    1 
ATOM   5745  N  NZ    . LYS A 1 738 ? -12.096 38.386  -17.677 1.00 21.30 ? 738  LYS A NZ    1 
ATOM   5746  N  N     . MET A 1 739 ? -13.493 35.037  -10.657 1.00 24.26 ? 739  MET A N     1 
ATOM   5747  C  CA    . MET A 1 739 ? -13.225 33.753  -10.006 1.00 25.72 ? 739  MET A CA    1 
ATOM   5748  C  C     . MET A 1 739 ? -14.269 33.362  -8.985  1.00 24.98 ? 739  MET A C     1 
ATOM   5749  O  O     . MET A 1 739 ? -14.478 34.098  -8.022  1.00 24.74 ? 739  MET A O     1 
ATOM   5750  C  CB    . MET A 1 739 ? -11.933 33.838  -9.210  1.00 27.06 ? 739  MET A CB    1 
ATOM   5751  C  CG    . MET A 1 739 ? -10.714 34.176  -9.983  1.00 32.35 ? 739  MET A CG    1 
ATOM   5752  S  SD    . MET A 1 739 ? -10.167 32.823  -11.011 1.00 44.01 ? 739  MET A SD    1 
ATOM   5753  C  CE    . MET A 1 739 ? -8.765  33.766  -11.994 1.00 42.41 ? 739  MET A CE    1 
ATOM   5754  N  N     . GLU A 1 740 ? -14.868 32.180  -9.141  1.00 24.45 ? 740  GLU A N     1 
ATOM   5755  C  CA    . GLU A 1 740 ? -15.808 31.660  -8.134  1.00 23.76 ? 740  GLU A CA    1 
ATOM   5756  C  C     . GLU A 1 740 ? -15.109 31.462  -6.781  1.00 22.37 ? 740  GLU A C     1 
ATOM   5757  O  O     . GLU A 1 740 ? -13.970 31.008  -6.737  1.00 22.37 ? 740  GLU A O     1 
ATOM   5758  C  CB    . GLU A 1 740 ? -16.414 30.348  -8.603  1.00 23.70 ? 740  GLU A CB    1 
ATOM   5759  C  CG    . GLU A 1 740 ? -17.775 30.072  -7.981  1.00 25.88 ? 740  GLU A CG    1 
ATOM   5760  C  CD    . GLU A 1 740 ? -17.724 29.131  -6.781  1.00 27.89 ? 740  GLU A CD    1 
ATOM   5761  O  OE1   . GLU A 1 740 ? -17.300 27.967  -7.003  1.00 30.14 ? 740  GLU A OE1   1 
ATOM   5762  O  OE2   . GLU A 1 740 ? -18.101 29.538  -5.632  1.00 27.03 ? 740  GLU A OE2   1 
ATOM   5763  N  N     . GLY A 1 741 ? -15.776 31.823  -5.690  1.00 20.92 ? 741  GLY A N     1 
ATOM   5764  C  CA    . GLY A 1 741 ? -15.182 31.739  -4.359  1.00 20.32 ? 741  GLY A CA    1 
ATOM   5765  C  C     . GLY A 1 741 ? -14.440 33.007  -3.895  1.00 19.48 ? 741  GLY A C     1 
ATOM   5766  O  O     . GLY A 1 741 ? -14.215 33.252  -2.712  1.00 19.78 ? 741  GLY A O     1 
ATOM   5767  N  N     . VAL A 1 742 ? -14.035 33.841  -4.812  1.00 17.66 ? 742  VAL A N     1 
ATOM   5768  C  CA    . VAL A 1 742 ? -13.190 34.944  -4.400  1.00 17.48 ? 742  VAL A CA    1 
ATOM   5769  C  C     . VAL A 1 742 ? -13.971 36.220  -4.088  1.00 16.41 ? 742  VAL A C     1 
ATOM   5770  O  O     . VAL A 1 742 ? -14.864 36.610  -4.836  1.00 16.75 ? 742  VAL A O     1 
ATOM   5771  C  CB    . VAL A 1 742 ? -12.105 35.198  -5.415  1.00 17.60 ? 742  VAL A CB    1 
ATOM   5772  C  CG1   . VAL A 1 742 ? -11.167 36.288  -4.898  1.00 15.13 ? 742  VAL A CG1   1 
ATOM   5773  C  CG2   . VAL A 1 742 ? -11.356 33.780  -5.695  1.00 16.77 ? 742  VAL A CG2   1 
ATOM   5774  N  N     . ALA A 1 743 ? -13.668 36.801  -2.932  1.00 14.95 ? 743  ALA A N     1 
ATOM   5775  C  CA    . ALA A 1 743 ? -14.300 38.045  -2.500  1.00 14.68 ? 743  ALA A CA    1 
ATOM   5776  C  C     . ALA A 1 743 ? -13.230 39.117  -2.055  1.00 13.22 ? 743  ALA A C     1 
ATOM   5777  O  O     . ALA A 1 743 ? -12.142 38.783  -1.578  1.00 12.17 ? 743  ALA A O     1 
ATOM   5778  C  CB    . ALA A 1 743 ? -15.314 37.741  -1.405  1.00 14.21 ? 743  ALA A CB    1 
ATOM   5779  N  N     . ASN A 1 744 ? -13.547 40.388  -2.240  1.00 12.31 ? 744  ASN A N     1 
ATOM   5780  C  CA    . ASN A 1 744 ? -12.703 41.478  -1.722  1.00 11.48 ? 744  ASN A CA    1 
ATOM   5781  C  C     . ASN A 1 744 ? -13.173 41.924  -0.332  1.00 12.53 ? 744  ASN A C     1 
ATOM   5782  O  O     . ASN A 1 744 ? -14.333 42.152  -0.135  1.00 12.03 ? 744  ASN A O     1 
ATOM   5783  C  CB    . ASN A 1 744 ? -12.742 42.669  -2.643  1.00 10.55 ? 744  ASN A CB    1 
ATOM   5784  C  CG    . ASN A 1 744 ? -11.943 42.487  -3.915  1.00 7.72  ? 744  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A 1 744 ? -10.746 42.215  -3.903  1.00 8.68  ? 744  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A 1 744 ? -12.590 42.713  -5.022  1.00 4.39  ? 744  ASN A ND2   1 
ATOM   5787  N  N     . VAL A 1 745 ? -12.269 41.953  0.639   1.00 14.55 ? 745  VAL A N     1 
ATOM   5788  C  CA    . VAL A 1 745 ? -12.444 42.701  1.878   1.00 16.36 ? 745  VAL A CA    1 
ATOM   5789  C  C     . VAL A 1 745 ? -11.282 43.700  2.016   1.00 17.11 ? 745  VAL A C     1 
ATOM   5790  O  O     . VAL A 1 745 ? -10.350 43.738  1.182   1.00 17.48 ? 745  VAL A O     1 
ATOM   5791  C  CB    . VAL A 1 745 ? -12.518 41.796  3.137   1.00 17.08 ? 745  VAL A CB    1 
ATOM   5792  C  CG1   . VAL A 1 745 ? -13.613 40.765  3.007   1.00 17.62 ? 745  VAL A CG1   1 
ATOM   5793  C  CG2   . VAL A 1 745 ? -11.191 41.149  3.432   1.00 17.14 ? 745  VAL A CG2   1 
ATOM   5794  N  N     . HIS A 1 746 ? -11.335 44.533  3.044   1.00 18.11 ? 746  HIS A N     1 
ATOM   5795  C  CA    . HIS A 1 746 ? -10.441 45.690  3.072   1.00 19.01 ? 746  HIS A CA    1 
ATOM   5796  C  C     . HIS A 1 746 ? -10.398 46.390  4.407   1.00 19.32 ? 746  HIS A C     1 
ATOM   5797  O  O     . HIS A 1 746 ? -11.385 46.408  5.117   1.00 20.02 ? 746  HIS A O     1 
ATOM   5798  C  CB    . HIS A 1 746 ? -10.828 46.646  1.934   1.00 19.16 ? 746  HIS A CB    1 
ATOM   5799  C  CG    . HIS A 1 746 ? -11.681 47.818  2.334   1.00 20.64 ? 746  HIS A CG    1 
ATOM   5800  N  ND1   . HIS A 1 746 ? -13.004 47.931  1.960   1.00 21.02 ? 746  HIS A ND1   1 
ATOM   5801  C  CD2   . HIS A 1 746 ? -11.366 48.982  2.966   1.00 19.75 ? 746  HIS A CD2   1 
ATOM   5802  C  CE1   . HIS A 1 746 ? -13.480 49.086  2.399   1.00 21.47 ? 746  HIS A CE1   1 
ATOM   5803  N  NE2   . HIS A 1 746 ? -12.510 49.737  3.019   1.00 19.20 ? 746  HIS A NE2   1 
ATOM   5804  N  N     . LEU A 1 747 ? -9.257  46.987  4.743   1.00 19.94 ? 747  LEU A N     1 
ATOM   5805  C  CA    . LEU A 1 747 ? -9.126  47.687  6.023   1.00 19.89 ? 747  LEU A CA    1 
ATOM   5806  C  C     . LEU A 1 747 ? -9.231  49.182  5.891   1.00 20.25 ? 747  LEU A C     1 
ATOM   5807  O  O     . LEU A 1 747 ? -8.415  49.862  5.243   1.00 19.99 ? 747  LEU A O     1 
ATOM   5808  C  CB    . LEU A 1 747 ? -7.867  47.259  6.755   1.00 19.85 ? 747  LEU A CB    1 
ATOM   5809  C  CG    . LEU A 1 747 ? -8.200  45.851  7.293   1.00 19.44 ? 747  LEU A CG    1 
ATOM   5810  C  CD1   . LEU A 1 747 ? -7.411  44.841  6.508   1.00 20.98 ? 747  LEU A CD1   1 
ATOM   5811  C  CD2   . LEU A 1 747 ? -7.979  45.715  8.779   1.00 17.42 ? 747  LEU A CD2   1 
ATOM   5812  N  N     . ASP A 1 748 ? -10.272 49.684  6.538   1.00 20.57 ? 748  ASP A N     1 
ATOM   5813  C  CA    . ASP A 1 748 ? -10.698 51.052  6.358   1.00 20.66 ? 748  ASP A CA    1 
ATOM   5814  C  C     . ASP A 1 748 ? -9.579  51.958  6.779   1.00 20.46 ? 748  ASP A C     1 
ATOM   5815  O  O     . ASP A 1 748 ? -8.920  51.735  7.799   1.00 19.67 ? 748  ASP A O     1 
ATOM   5816  C  CB    . ASP A 1 748 ? -11.992 51.360  7.137   1.00 20.94 ? 748  ASP A CB    1 
ATOM   5817  C  CG    . ASP A 1 748 ? -13.003 52.112  6.303   1.00 21.17 ? 748  ASP A CG    1 
ATOM   5818  O  OD1   . ASP A 1 748 ? -12.667 53.197  5.805   1.00 23.33 ? 748  ASP A OD1   1 
ATOM   5819  O  OD2   . ASP A 1 748 ? -14.150 51.699  6.081   1.00 22.67 ? 748  ASP A OD2   1 
ATOM   5820  N  N     . ALA A 1 749 ? -9.347  52.952  5.932   1.00 20.74 ? 749  ALA A N     1 
ATOM   5821  C  CA    . ALA A 1 749 ? -8.449  54.033  6.234   1.00 20.80 ? 749  ALA A CA    1 
ATOM   5822  C  C     . ALA A 1 749 ? -9.260  55.304  6.065   1.00 21.51 ? 749  ALA A C     1 
ATOM   5823  O  O     . ALA A 1 749 ? -10.359 55.274  5.515   1.00 21.39 ? 749  ALA A O     1 
ATOM   5824  C  CB    . ALA A 1 749 ? -7.287  53.993  5.296   1.00 20.22 ? 749  ALA A CB    1 
ATOM   5825  N  N     . LEU A 1 750 ? -8.723  56.424  6.518   1.00 22.35 ? 750  LEU A N     1 
ATOM   5826  C  CA    . LEU A 1 750 ? -9.461  57.659  6.438   1.00 23.47 ? 750  LEU A CA    1 
ATOM   5827  C  C     . LEU A 1 750 ? -8.551  58.861  6.234   1.00 23.96 ? 750  LEU A C     1 
ATOM   5828  O  O     . LEU A 1 750 ? -7.769  59.248  7.119   1.00 24.03 ? 750  LEU A O     1 
ATOM   5829  C  CB    . LEU A 1 750 ? -10.347 57.823  7.672   1.00 23.97 ? 750  LEU A CB    1 
ATOM   5830  C  CG    . LEU A 1 750 ? -11.756 57.216  7.545   1.00 25.32 ? 750  LEU A CG    1 
ATOM   5831  C  CD1   . LEU A 1 750 ? -12.562 57.547  8.799   1.00 26.27 ? 750  LEU A CD1   1 
ATOM   5832  C  CD2   . LEU A 1 750 ? -12.504 57.695  6.274   1.00 25.51 ? 750  LEU A CD2   1 
ATOM   5833  N  N     . GLU A 1 751 ? -8.693  59.444  5.045   1.00 24.32 ? 751  GLU A N     1 
ATOM   5834  C  CA    . GLU A 1 751 ? -7.829  60.493  4.552   1.00 24.50 ? 751  GLU A CA    1 
ATOM   5835  C  C     . GLU A 1 751 ? -8.573  61.822  4.705   1.00 25.17 ? 751  GLU A C     1 
ATOM   5836  O  O     . GLU A 1 751 ? -8.864  62.534  3.734   1.00 25.21 ? 751  GLU A O     1 
ATOM   5837  C  CB    . GLU A 1 751 ? -7.443  60.209  3.090   1.00 24.36 ? 751  GLU A CB    1 
ATOM   5838  C  CG    . GLU A 1 751 ? -5.992  59.786  2.874   1.00 24.07 ? 751  GLU A CG    1 
ATOM   5839  C  CD    . GLU A 1 751 ? -5.646  59.612  1.400   1.00 23.63 ? 751  GLU A CD    1 
ATOM   5840  O  OE1   . GLU A 1 751 ? -6.505  59.095  0.676   1.00 24.18 ? 751  GLU A OE1   1 
ATOM   5841  O  OE2   . GLU A 1 751 ? -4.535  59.993  0.953   1.00 23.08 ? 751  GLU A OE2   1 
ATOM   5842  N  N     . HIS A 1 752 ? -8.917  62.135  5.947   1.00 25.61 ? 752  HIS A N     1 
ATOM   5843  C  CA    . HIS A 1 752 ? -9.255  63.498  6.302   1.00 26.08 ? 752  HIS A CA    1 
ATOM   5844  C  C     . HIS A 1 752 ? -8.019  64.325  5.910   1.00 25.72 ? 752  HIS A C     1 
ATOM   5845  O  O     . HIS A 1 752 ? -7.083  63.783  5.312   1.00 25.84 ? 752  HIS A O     1 
ATOM   5846  C  CB    . HIS A 1 752 ? -9.608  63.612  7.801   1.00 26.58 ? 752  HIS A CB    1 
ATOM   5847  C  CG    . HIS A 1 752 ? -8.588  63.011  8.728   1.00 28.48 ? 752  HIS A CG    1 
ATOM   5848  N  ND1   . HIS A 1 752 ? -7.309  62.677  8.326   1.00 30.06 ? 752  HIS A ND1   1 
ATOM   5849  C  CD2   . HIS A 1 752 ? -8.664  62.678  10.040  1.00 29.84 ? 752  HIS A CD2   1 
ATOM   5850  C  CE1   . HIS A 1 752 ? -6.642  62.174  9.350   1.00 29.70 ? 752  HIS A CE1   1 
ATOM   5851  N  NE2   . HIS A 1 752 ? -7.442  62.161  10.401  1.00 29.91 ? 752  HIS A NE2   1 
ATOM   5852  N  N     . GLY A 1 753 ? -7.999  65.609  6.241   1.00 24.94 ? 753  GLY A N     1 
ATOM   5853  C  CA    . GLY A 1 753 ? -6.987  66.515  5.720   1.00 24.58 ? 753  GLY A CA    1 
ATOM   5854  C  C     . GLY A 1 753 ? -5.808  65.925  4.940   1.00 23.96 ? 753  GLY A C     1 
ATOM   5855  O  O     . GLY A 1 753 ? -5.954  65.409  3.820   1.00 23.14 ? 753  GLY A O     1 
ATOM   5856  N  N     . ASP A 1 754 ? -4.628  66.050  5.546   1.00 23.57 ? 754  ASP A N     1 
ATOM   5857  C  CA    . ASP A 1 754 ? -3.336  65.759  4.919   1.00 22.97 ? 754  ASP A CA    1 
ATOM   5858  C  C     . ASP A 1 754 ? -2.727  64.489  5.518   1.00 22.15 ? 754  ASP A C     1 
ATOM   5859  O  O     . ASP A 1 754 ? -1.810  63.895  4.936   1.00 21.58 ? 754  ASP A O     1 
ATOM   5860  C  CB    . ASP A 1 754 ? -2.373  66.962  5.137   1.00 22.81 ? 754  ASP A CB    1 
ATOM   5861  C  CG    . ASP A 1 754 ? -1.373  67.145  3.990   1.00 22.98 ? 754  ASP A CG    1 
ATOM   5862  O  OD1   . ASP A 1 754 ? -0.781  66.151  3.520   1.00 24.99 ? 754  ASP A OD1   1 
ATOM   5863  O  OD2   . ASP A 1 754 ? -1.108  68.247  3.478   1.00 23.17 ? 754  ASP A OD2   1 
ATOM   5864  N  N     . THR A 1 755 ? -3.222  64.101  6.694   1.00 21.63 ? 755  THR A N     1 
ATOM   5865  C  CA    . THR A 1 755 ? -2.716  62.927  7.398   1.00 21.75 ? 755  THR A CA    1 
ATOM   5866  C  C     . THR A 1 755 ? -3.643  61.707  7.174   1.00 20.86 ? 755  THR A C     1 
ATOM   5867  O  O     . THR A 1 755 ? -4.633  61.787  6.447   1.00 20.39 ? 755  THR A O     1 
ATOM   5868  C  CB    . THR A 1 755 ? -2.432  63.273  8.912   1.00 21.89 ? 755  THR A CB    1 
ATOM   5869  O  OG1   . THR A 1 755 ? -1.805  62.163  9.569   1.00 23.20 ? 755  THR A OG1   1 
ATOM   5870  C  CG2   . THR A 1 755 ? -3.696  63.533  9.731   1.00 21.93 ? 755  THR A CG2   1 
ATOM   5871  N  N     . ILE A 1 756 ? -3.286  60.562  7.731   1.00 20.37 ? 756  ILE A N     1 
ATOM   5872  C  CA    . ILE A 1 756 ? -4.105  59.352  7.541   1.00 20.14 ? 756  ILE A CA    1 
ATOM   5873  C  C     . ILE A 1 756 ? -4.477  58.702  8.867   1.00 19.65 ? 756  ILE A C     1 
ATOM   5874  O  O     . ILE A 1 756 ? -3.724  58.771  9.852   1.00 19.63 ? 756  ILE A O     1 
ATOM   5875  C  CB    . ILE A 1 756 ? -3.402  58.329  6.588   1.00 19.91 ? 756  ILE A CB    1 
ATOM   5876  C  CG1   . ILE A 1 756 ? -4.439  57.372  5.979   1.00 20.68 ? 756  ILE A CG1   1 
ATOM   5877  C  CG2   . ILE A 1 756 ? -2.271  57.586  7.313   1.00 19.65 ? 756  ILE A CG2   1 
ATOM   5878  C  CD1   . ILE A 1 756 ? -3.918  56.409  4.908   1.00 20.81 ? 756  ILE A CD1   1 
ATOM   5879  N  N     . ALA A 1 757 ? -5.646  58.073  8.867   1.00 19.13 ? 757  ALA A N     1 
ATOM   5880  C  CA    . ALA A 1 757 ? -6.230  57.488  10.066  1.00 18.91 ? 757  ALA A CA    1 
ATOM   5881  C  C     . ALA A 1 757 ? -6.486  56.004  9.845   1.00 18.68 ? 757  ALA A C     1 
ATOM   5882  O  O     . ALA A 1 757 ? -7.217  55.610  8.928   1.00 18.20 ? 757  ALA A O     1 
ATOM   5883  C  CB    . ALA A 1 757 ? -7.524  58.204  10.400  1.00 18.86 ? 757  ALA A CB    1 
ATOM   5884  N  N     . PHE A 1 758 ? -5.887  55.184  10.699  1.00 18.91 ? 758  PHE A N     1 
ATOM   5885  C  CA    . PHE A 1 758 ? -5.943  53.717  10.567  1.00 18.52 ? 758  PHE A CA    1 
ATOM   5886  C  C     . PHE A 1 758 ? -7.063  53.148  11.420  1.00 18.75 ? 758  PHE A C     1 
ATOM   5887  O  O     . PHE A 1 758 ? -6.905  52.992  12.620  1.00 19.23 ? 758  PHE A O     1 
ATOM   5888  C  CB    . PHE A 1 758 ? -4.591  53.131  10.963  1.00 18.19 ? 758  PHE A CB    1 
ATOM   5889  C  CG    . PHE A 1 758 ? -3.483  53.472  9.988   1.00 17.68 ? 758  PHE A CG    1 
ATOM   5890  C  CD1   . PHE A 1 758 ? -3.399  52.826  8.781   1.00 16.67 ? 758  PHE A CD1   1 
ATOM   5891  C  CD2   . PHE A 1 758 ? -2.570  54.477  10.260  1.00 18.11 ? 758  PHE A CD2   1 
ATOM   5892  C  CE1   . PHE A 1 758 ? -2.406  53.131  7.873   1.00 17.67 ? 758  PHE A CE1   1 
ATOM   5893  C  CE2   . PHE A 1 758 ? -1.578  54.798  9.355   1.00 18.20 ? 758  PHE A CE2   1 
ATOM   5894  C  CZ    . PHE A 1 758 ? -1.493  54.121  8.155   1.00 18.71 ? 758  PHE A CZ    1 
ATOM   5895  N  N     . MET A 1 759 ? -8.197  52.846  10.798  1.00 19.06 ? 759  MET A N     1 
ATOM   5896  C  CA    . MET A 1 759 ? -9.417  52.464  11.535  1.00 19.51 ? 759  MET A CA    1 
ATOM   5897  C  C     . MET A 1 759 ? -9.455  51.025  12.052  1.00 19.50 ? 759  MET A C     1 
ATOM   5898  O  O     . MET A 1 759 ? -10.275 50.713  12.919  1.00 19.27 ? 759  MET A O     1 
ATOM   5899  C  CB    . MET A 1 759 ? -10.659 52.688  10.657  1.00 19.68 ? 759  MET A CB    1 
ATOM   5900  C  CG    . MET A 1 759 ? -10.818 54.111  10.128  1.00 20.28 ? 759  MET A CG    1 
ATOM   5901  S  SD    . MET A 1 759 ? -10.609 55.412  11.398  1.00 22.15 ? 759  MET A SD    1 
ATOM   5902  C  CE    . MET A 1 759 ? -12.108 55.176  12.425  1.00 20.44 ? 759  MET A CE    1 
ATOM   5903  N  N     . HIS A 1 760 ? -8.601  50.159  11.488  1.00 19.73 ? 760  HIS A N     1 
ATOM   5904  C  CA    . HIS A 1 760 ? -8.491  48.738  11.860  1.00 19.53 ? 760  HIS A CA    1 
ATOM   5905  C  C     . HIS A 1 760 ? -9.842  48.003  11.726  1.00 19.47 ? 760  HIS A C     1 
ATOM   5906  O  O     . HIS A 1 760 ? -10.104 46.994  12.393  1.00 18.98 ? 760  HIS A O     1 
ATOM   5907  C  CB    . HIS A 1 760 ? -7.869  48.598  13.271  1.00 19.72 ? 760  HIS A CB    1 
ATOM   5908  C  CG    . HIS A 1 760 ? -6.542  49.289  13.417  1.00 19.28 ? 760  HIS A CG    1 
ATOM   5909  N  ND1   . HIS A 1 760 ? -6.354  50.379  14.234  1.00 19.43 ? 760  HIS A ND1   1 
ATOM   5910  C  CD2   . HIS A 1 760 ? -5.339  49.048  12.838  1.00 19.92 ? 760  HIS A CD2   1 
ATOM   5911  C  CE1   . HIS A 1 760 ? -5.094  50.776  14.158  1.00 19.14 ? 760  HIS A CE1   1 
ATOM   5912  N  NE2   . HIS A 1 760 ? -4.456  49.986  13.315  1.00 17.71 ? 760  HIS A NE2   1 
ATOM   5913  N  N     . SER A 1 761 ? -10.663 48.519  10.808  1.00 19.49 ? 761  SER A N     1 
ATOM   5914  C  CA    . SER A 1 761 ? -12.054 48.110  10.601  1.00 19.28 ? 761  SER A CA    1 
ATOM   5915  C  C     . SER A 1 761 ? -12.150 47.286  9.323   1.00 19.14 ? 761  SER A C     1 
ATOM   5916  O  O     . SER A 1 761 ? -11.774 47.763  8.271   1.00 19.68 ? 761  SER A O     1 
ATOM   5917  C  CB    . SER A 1 761 ? -12.912 49.370  10.453  1.00 19.21 ? 761  SER A CB    1 
ATOM   5918  O  OG    . SER A 1 761 ? -14.164 49.227  11.082  1.00 20.10 ? 761  SER A OG    1 
ATOM   5919  N  N     . VAL A 1 762 ? -12.644 46.057  9.388   1.00 18.83 ? 762  VAL A N     1 
ATOM   5920  C  CA    . VAL A 1 762 ? -12.727 45.226  8.186   1.00 18.78 ? 762  VAL A CA    1 
ATOM   5921  C  C     . VAL A 1 762 ? -14.078 45.507  7.538   1.00 18.66 ? 762  VAL A C     1 
ATOM   5922  O  O     . VAL A 1 762 ? -15.099 45.386  8.170   1.00 18.81 ? 762  VAL A O     1 
ATOM   5923  C  CB    . VAL A 1 762 ? -12.467 43.696  8.518   1.00 18.86 ? 762  VAL A CB    1 
ATOM   5924  C  CG1   . VAL A 1 762 ? -12.617 42.788  7.316   1.00 18.56 ? 762  VAL A CG1   1 
ATOM   5925  C  CG2   . VAL A 1 762 ? -11.065 43.525  9.037   1.00 18.87 ? 762  VAL A CG2   1 
ATOM   5926  N  N     . GLN A 1 763 ? -14.077 45.971  6.296   1.00 19.10 ? 763  GLN A N     1 
ATOM   5927  C  CA    . GLN A 1 763 ? -15.315 46.143  5.530   1.00 19.08 ? 763  GLN A CA    1 
ATOM   5928  C  C     . GLN A 1 763 ? -15.310 45.188  4.342   1.00 19.20 ? 763  GLN A C     1 
ATOM   5929  O  O     . GLN A 1 763 ? -14.270 44.638  3.953   1.00 19.12 ? 763  GLN A O     1 
ATOM   5930  C  CB    . GLN A 1 763 ? -15.478 47.563  4.965   1.00 19.37 ? 763  GLN A CB    1 
ATOM   5931  C  CG    . GLN A 1 763 ? -15.158 48.751  5.890   1.00 18.51 ? 763  GLN A CG    1 
ATOM   5932  C  CD    . GLN A 1 763 ? -16.217 49.002  6.932   1.00 16.24 ? 763  GLN A CD    1 
ATOM   5933  O  OE1   . GLN A 1 763 ? -17.375 49.258  6.603   1.00 16.08 ? 763  GLN A OE1   1 
ATOM   5934  N  NE2   . GLN A 1 763 ? -15.827 48.931  8.194   1.00 13.76 ? 763  GLN A NE2   1 
ATOM   5935  N  N     . ASP A 1 764 ? -16.494 45.027  3.759   1.00 19.09 ? 764  ASP A N     1 
ATOM   5936  C  CA    . ASP A 1 764 ? -16.696 44.168  2.612   1.00 18.76 ? 764  ASP A CA    1 
ATOM   5937  C  C     . ASP A 1 764 ? -16.401 45.035  1.404   1.00 18.14 ? 764  ASP A C     1 
ATOM   5938  O  O     . ASP A 1 764 ? -16.741 46.214  1.387   1.00 19.20 ? 764  ASP A O     1 
ATOM   5939  C  CB    . ASP A 1 764 ? -18.137 43.620  2.583   1.00 18.80 ? 764  ASP A CB    1 
ATOM   5940  C  CG    . ASP A 1 764 ? -18.250 42.183  3.145   1.00 20.92 ? 764  ASP A CG    1 
ATOM   5941  O  OD1   . ASP A 1 764 ? -17.219 41.519  3.404   1.00 22.69 ? 764  ASP A OD1   1 
ATOM   5942  O  OD2   . ASP A 1 764 ? -19.347 41.617  3.357   1.00 23.13 ? 764  ASP A OD2   1 
ATOM   5943  N  N     . GLY A 1 765 ? -15.734 44.459  0.415   1.00 16.92 ? 765  GLY A N     1 
ATOM   5944  C  CA    . GLY A 1 765 ? -15.483 45.108  -0.855  1.00 15.85 ? 765  GLY A CA    1 
ATOM   5945  C  C     . GLY A 1 765 ? -14.015 45.357  -1.046  1.00 14.82 ? 765  GLY A C     1 
ATOM   5946  O  O     . GLY A 1 765 ? -13.222 45.204  -0.114  1.00 14.60 ? 765  GLY A O     1 
ATOM   5947  N  N     . ALA A 1 766 ? -13.638 45.763  -2.248  1.00 14.52 ? 766  ALA A N     1 
ATOM   5948  C  CA    . ALA A 1 766 ? -12.289 46.267  -2.460  1.00 14.53 ? 766  ALA A CA    1 
ATOM   5949  C  C     . ALA A 1 766 ? -12.207 47.679  -1.879  1.00 14.34 ? 766  ALA A C     1 
ATOM   5950  O  O     . ALA A 1 766 ? -13.214 48.348  -1.754  1.00 13.92 ? 766  ALA A O     1 
ATOM   5951  C  CB    . ALA A 1 766 ? -11.945 46.258  -3.930  1.00 14.58 ? 766  ALA A CB    1 
ATOM   5952  N  N     . ALA A 1 767 ? -11.013 48.113  -1.501  1.00 14.80 ? 767  ALA A N     1 
ATOM   5953  C  CA    . ALA A 1 767 ? -10.804 49.489  -1.020  1.00 15.38 ? 767  ALA A CA    1 
ATOM   5954  C  C     . ALA A 1 767 ? -11.126 50.525  -2.114  1.00 15.91 ? 767  ALA A C     1 
ATOM   5955  O  O     . ALA A 1 767 ? -11.047 50.224  -3.310  1.00 15.89 ? 767  ALA A O     1 
ATOM   5956  C  CB    . ALA A 1 767 ? -9.371  49.663  -0.530  1.00 15.06 ? 767  ALA A CB    1 
ATOM   5957  N  N     . SER A 1 768 ? -11.493 51.741  -1.715  1.00 16.83 ? 768  SER A N     1 
ATOM   5958  C  CA    . SER A 1 768 ? -11.782 52.800  -2.702  1.00 17.76 ? 768  SER A CA    1 
ATOM   5959  C  C     . SER A 1 768 ? -10.531 53.152  -3.486  1.00 17.66 ? 768  SER A C     1 
ATOM   5960  O  O     . SER A 1 768 ? -10.613 53.522  -4.661  1.00 18.12 ? 768  SER A O     1 
ATOM   5961  C  CB    . SER A 1 768 ? -12.389 54.061  -2.063  1.00 18.10 ? 768  SER A CB    1 
ATOM   5962  O  OG    . SER A 1 768 ? -13.814 54.082  -2.249  1.00 19.87 ? 768  SER A OG    1 
ATOM   5963  N  N     . LYS A 1 769 ? -9.383  53.001  -2.824  1.00 17.40 ? 769  LYS A N     1 
ATOM   5964  C  CA    . LYS A 1 769 ? -8.081  53.277  -3.401  1.00 16.94 ? 769  LYS A CA    1 
ATOM   5965  C  C     . LYS A 1 769 ? -6.936  52.660  -2.561  1.00 16.87 ? 769  LYS A C     1 
ATOM   5966  O  O     . LYS A 1 769 ? -7.109  52.406  -1.360  1.00 16.57 ? 769  LYS A O     1 
ATOM   5967  C  CB    . LYS A 1 769 ? -7.896  54.794  -3.456  1.00 16.73 ? 769  LYS A CB    1 
ATOM   5968  C  CG    . LYS A 1 769 ? -7.839  55.461  -2.079  1.00 16.97 ? 769  LYS A CG    1 
ATOM   5969  C  CD    . LYS A 1 769 ? -8.086  57.002  -2.149  1.00 19.96 ? 769  LYS A CD    1 
ATOM   5970  C  CE    . LYS A 1 769 ? -6.843  57.858  -1.788  1.00 19.61 ? 769  LYS A CE    1 
ATOM   5971  N  NZ    . LYS A 1 769 ? -5.779  57.904  -2.832  1.00 20.05 ? 769  LYS A NZ    1 
ATOM   5972  N  N     . SER A 1 770 ? -5.768  52.452  -3.179  1.00 16.84 ? 770  SER A N     1 
ATOM   5973  C  CA    . SER A 1 770 ? -4.508  52.310  -2.420  1.00 17.29 ? 770  SER A CA    1 
ATOM   5974  C  C     . SER A 1 770 ? -4.035  53.661  -1.803  1.00 17.03 ? 770  SER A C     1 
ATOM   5975  O  O     . SER A 1 770 ? -4.518  54.733  -2.179  1.00 16.56 ? 770  SER A O     1 
ATOM   5976  C  CB    . SER A 1 770 ? -3.384  51.688  -3.280  1.00 17.63 ? 770  SER A CB    1 
ATOM   5977  O  OG    . SER A 1 770 ? -3.091  52.453  -4.445  1.00 18.70 ? 770  SER A OG    1 
ATOM   5978  N  N     . TYR A 1 771 ? -3.082  53.578  -0.868  1.00 16.90 ? 771  TYR A N     1 
ATOM   5979  C  CA    . TYR A 1 771 ? -2.750  54.679  0.056   1.00 17.01 ? 771  TYR A CA    1 
ATOM   5980  C  C     . TYR A 1 771 ? -1.238  54.912  0.240   1.00 16.22 ? 771  TYR A C     1 
ATOM   5981  O  O     . TYR A 1 771 ? -0.773  55.378  1.289   1.00 14.79 ? 771  TYR A O     1 
ATOM   5982  C  CB    . TYR A 1 771 ? -3.333  54.342  1.419   1.00 17.22 ? 771  TYR A CB    1 
ATOM   5983  C  CG    . TYR A 1 771 ? -4.817  54.522  1.530   1.00 20.15 ? 771  TYR A CG    1 
ATOM   5984  C  CD1   . TYR A 1 771 ? -5.409  55.740  1.224   1.00 22.92 ? 771  TYR A CD1   1 
ATOM   5985  C  CD2   . TYR A 1 771 ? -5.633  53.488  1.976   1.00 22.24 ? 771  TYR A CD2   1 
ATOM   5986  C  CE1   . TYR A 1 771 ? -6.775  55.917  1.347   1.00 24.05 ? 771  TYR A CE1   1 
ATOM   5987  C  CE2   . TYR A 1 771 ? -7.004  53.661  2.100   1.00 23.88 ? 771  TYR A CE2   1 
ATOM   5988  C  CZ    . TYR A 1 771 ? -7.565  54.883  1.785   1.00 23.49 ? 771  TYR A CZ    1 
ATOM   5989  O  OH    . TYR A 1 771 ? -8.918  55.089  1.903   1.00 24.07 ? 771  TYR A OH    1 
ATOM   5990  N  N     . GLY A 1 772 ? -0.482  54.548  -0.786  1.00 16.07 ? 772  GLY A N     1 
ATOM   5991  C  CA    . GLY A 1 772 ? 0.961   54.409  -0.693  1.00 16.04 ? 772  GLY A CA    1 
ATOM   5992  C  C     . GLY A 1 772 ? 1.621   55.758  -0.637  1.00 15.46 ? 772  GLY A C     1 
ATOM   5993  O  O     . GLY A 1 772 ? 2.570   55.975  0.113   1.00 15.39 ? 772  GLY A O     1 
ATOM   5994  N  N     . LEU A 1 773 ? 1.096   56.652  -1.463  1.00 15.25 ? 773  LEU A N     1 
ATOM   5995  C  CA    . LEU A 1 773 ? 1.493   58.024  -1.467  1.00 15.13 ? 773  LEU A CA    1 
ATOM   5996  C  C     . LEU A 1 773 ? 1.275   58.600  -0.084  1.00 15.71 ? 773  LEU A C     1 
ATOM   5997  O  O     . LEU A 1 773 ? 2.173   59.226  0.444   1.00 16.66 ? 773  LEU A O     1 
ATOM   5998  C  CB    . LEU A 1 773 ? 0.704   58.796  -2.518  1.00 15.05 ? 773  LEU A CB    1 
ATOM   5999  C  CG    . LEU A 1 773 ? 0.967   58.447  -3.991  1.00 13.64 ? 773  LEU A CG    1 
ATOM   6000  C  CD1   . LEU A 1 773 ? 0.701   59.675  -4.896  1.00 14.06 ? 773  LEU A CD1   1 
ATOM   6001  C  CD2   . LEU A 1 773 ? 2.359   57.906  -4.238  1.00 11.21 ? 773  LEU A CD2   1 
ATOM   6002  N  N     . ALA A 1 774 ? 0.109   58.354  0.516   1.00 16.15 ? 774  ALA A N     1 
ATOM   6003  C  CA    . ALA A 1 774 ? -0.232  58.860  1.870   1.00 16.17 ? 774  ALA A CA    1 
ATOM   6004  C  C     . ALA A 1 774 ? 0.720   58.430  3.011   1.00 16.61 ? 774  ALA A C     1 
ATOM   6005  O  O     . ALA A 1 774 ? 1.057   59.252  3.887   1.00 16.35 ? 774  ALA A O     1 
ATOM   6006  C  CB    . ALA A 1 774 ? -1.668  58.463  2.227   1.00 15.77 ? 774  ALA A CB    1 
ATOM   6007  N  N     . VAL A 1 775 ? 1.098   57.144  3.003   1.00 17.22 ? 775  VAL A N     1 
ATOM   6008  C  CA    . VAL A 1 775 ? 2.025   56.546  3.970   1.00 17.79 ? 775  VAL A CA    1 
ATOM   6009  C  C     . VAL A 1 775 ? 3.403   57.171  3.802   1.00 18.60 ? 775  VAL A C     1 
ATOM   6010  O  O     . VAL A 1 775 ? 4.109   57.399  4.789   1.00 18.74 ? 775  VAL A O     1 
ATOM   6011  C  CB    . VAL A 1 775 ? 2.206   54.993  3.746   1.00 17.94 ? 775  VAL A CB    1 
ATOM   6012  C  CG1   . VAL A 1 775 ? 3.414   54.465  4.535   1.00 17.85 ? 775  VAL A CG1   1 
ATOM   6013  C  CG2   . VAL A 1 775 ? 0.954   54.197  4.115   1.00 17.06 ? 775  VAL A CG2   1 
ATOM   6014  N  N     . ALA A 1 776 ? 3.800   57.377  2.542   1.00 19.23 ? 776  ALA A N     1 
ATOM   6015  C  CA    . ALA A 1 776 ? 5.065   58.018  2.215   1.00 19.59 ? 776  ALA A CA    1 
ATOM   6016  C  C     . ALA A 1 776 ? 5.105   59.430  2.780   1.00 19.85 ? 776  ALA A C     1 
ATOM   6017  O  O     . ALA A 1 776 ? 6.117   59.825  3.339   1.00 20.26 ? 776  ALA A O     1 
ATOM   6018  C  CB    . ALA A 1 776 ? 5.273   58.067  0.710   1.00 19.85 ? 776  ALA A CB    1 
ATOM   6019  N  N     . ALA A 1 777 ? 4.009   60.179  2.623   1.00 19.67 ? 777  ALA A N     1 
ATOM   6020  C  CA    . ALA A 1 777 ? 3.908   61.548  3.115   1.00 19.53 ? 777  ALA A CA    1 
ATOM   6021  C  C     . ALA A 1 777 ? 4.070   61.546  4.619   1.00 19.51 ? 777  ALA A C     1 
ATOM   6022  O  O     . ALA A 1 777 ? 4.662   62.479  5.188   1.00 19.32 ? 777  ALA A O     1 
ATOM   6023  C  CB    . ALA A 1 777 ? 2.560   62.175  2.728   1.00 19.37 ? 777  ALA A CB    1 
ATOM   6024  N  N     . LEU A 1 778 ? 3.537   60.491  5.245   1.00 19.40 ? 778  LEU A N     1 
ATOM   6025  C  CA    . LEU A 1 778 ? 3.572   60.320  6.696   1.00 19.37 ? 778  LEU A CA    1 
ATOM   6026  C  C     . LEU A 1 778 ? 5.011   60.174  7.180   1.00 19.48 ? 778  LEU A C     1 
ATOM   6027  O  O     . LEU A 1 778 ? 5.367   60.688  8.236   1.00 20.17 ? 778  LEU A O     1 
ATOM   6028  C  CB    . LEU A 1 778 ? 2.737   59.096  7.135   1.00 19.03 ? 778  LEU A CB    1 
ATOM   6029  C  CG    . LEU A 1 778 ? 2.551   58.865  8.649   1.00 19.41 ? 778  LEU A CG    1 
ATOM   6030  C  CD1   . LEU A 1 778 ? 2.158   60.166  9.379   1.00 20.32 ? 778  LEU A CD1   1 
ATOM   6031  C  CD2   . LEU A 1 778 ? 1.522   57.778  8.938   1.00 18.80 ? 778  LEU A CD2   1 
ATOM   6032  N  N     . ALA A 1 779 ? 5.827   59.480  6.392   1.00 19.32 ? 779  ALA A N     1 
ATOM   6033  C  CA    . ALA A 1 779 ? 7.228   59.215  6.712   1.00 18.93 ? 779  ALA A CA    1 
ATOM   6034  C  C     . ALA A 1 779 ? 8.150   60.373  6.318   1.00 18.49 ? 779  ALA A C     1 
ATOM   6035  O  O     . ALA A 1 779 ? 9.352   60.227  6.379   1.00 18.38 ? 779  ALA A O     1 
ATOM   6036  C  CB    . ALA A 1 779 ? 7.691   57.891  6.034   1.00 18.84 ? 779  ALA A CB    1 
ATOM   6037  N  N     . GLY A 1 780 ? 7.585   61.512  5.908   1.00 18.34 ? 780  GLY A N     1 
ATOM   6038  C  CA    . GLY A 1 780 ? 8.334   62.749  5.738   1.00 18.00 ? 780  GLY A CA    1 
ATOM   6039  C  C     . GLY A 1 780 ? 9.050   62.867  4.405   1.00 18.10 ? 780  GLY A C     1 
ATOM   6040  O  O     . GLY A 1 780 ? 10.011  63.631  4.277   1.00 18.71 ? 780  GLY A O     1 
ATOM   6041  N  N     . VAL A 1 781 ? 8.598   62.095  3.419   1.00 17.76 ? 781  VAL A N     1 
ATOM   6042  C  CA    . VAL A 1 781 ? 9.042   62.232  2.039   1.00 17.26 ? 781  VAL A CA    1 
ATOM   6043  C  C     . VAL A 1 781 ? 8.610   63.606  1.583   1.00 17.19 ? 781  VAL A C     1 
ATOM   6044  O  O     . VAL A 1 781 ? 7.425   63.898  1.625   1.00 17.16 ? 781  VAL A O     1 
ATOM   6045  C  CB    . VAL A 1 781 ? 8.354   61.203  1.145   1.00 17.16 ? 781  VAL A CB    1 
ATOM   6046  C  CG1   . VAL A 1 781 ? 8.589   61.521  -0.333  1.00 17.37 ? 781  VAL A CG1   1 
ATOM   6047  C  CG2   . VAL A 1 781 ? 8.830   59.790  1.474   1.00 17.04 ? 781  VAL A CG2   1 
ATOM   6048  N  N     . PRO A 1 782 ? 9.539   64.431  1.103   1.00 17.11 ? 782  PRO A N     1 
ATOM   6049  C  CA    . PRO A 1 782 ? 9.273   65.860  0.909   1.00 16.71 ? 782  PRO A CA    1 
ATOM   6050  C  C     . PRO A 1 782 ? 7.988   66.134  0.153   1.00 16.72 ? 782  PRO A C     1 
ATOM   6051  O  O     . PRO A 1 782 ? 7.712   65.434  -0.812  1.00 14.82 ? 782  PRO A O     1 
ATOM   6052  C  CB    . PRO A 1 782 ? 10.506  66.378  0.130   1.00 16.68 ? 782  PRO A CB    1 
ATOM   6053  C  CG    . PRO A 1 782 ? 11.236  65.193  -0.342  1.00 17.75 ? 782  PRO A CG    1 
ATOM   6054  C  CD    . PRO A 1 782 ? 10.878  64.046  0.611   1.00 17.45 ? 782  PRO A CD    1 
ATOM   6055  N  N     . LYS A 1 783 ? 7.223   67.138  0.615   1.00 17.67 ? 783  LYS A N     1 
ATOM   6056  C  CA    . LYS A 1 783 ? 6.002   67.599  -0.058  1.00 18.54 ? 783  LYS A CA    1 
ATOM   6057  C  C     . LYS A 1 783 ? 6.178   67.671  -1.587  1.00 18.44 ? 783  LYS A C     1 
ATOM   6058  O  O     . LYS A 1 783 ? 5.387   67.095  -2.346  1.00 18.11 ? 783  LYS A O     1 
ATOM   6059  C  CB    . LYS A 1 783 ? 5.570   68.984  0.462   1.00 19.15 ? 783  LYS A CB    1 
ATOM   6060  C  CG    . LYS A 1 783 ? 5.174   69.050  1.983   1.00 21.89 ? 783  LYS A CG    1 
ATOM   6061  C  CD    . LYS A 1 783 ? 3.652   68.848  2.260   1.00 23.45 ? 783  LYS A CD    1 
ATOM   6062  C  CE    . LYS A 1 783 ? 3.344   68.134  3.615   1.00 23.72 ? 783  LYS A CE    1 
ATOM   6063  N  NZ    . LYS A 1 783 ? 3.740   68.912  4.838   1.00 23.22 ? 783  LYS A NZ    1 
ATOM   6064  N  N     . GLU A 1 784 ? 7.216   68.358  -2.038  1.00 18.17 ? 784  GLU A N     1 
ATOM   6065  C  CA    . GLU A 1 784 ? 7.429   68.526  -3.472  1.00 18.99 ? 784  GLU A CA    1 
ATOM   6066  C  C     . GLU A 1 784 ? 7.470   67.227  -4.306  1.00 18.75 ? 784  GLU A C     1 
ATOM   6067  O  O     . GLU A 1 784 ? 7.221   67.253  -5.531  1.00 18.73 ? 784  GLU A O     1 
ATOM   6068  C  CB    . GLU A 1 784 ? 8.727   69.298  -3.699  1.00 19.48 ? 784  GLU A CB    1 
ATOM   6069  C  CG    . GLU A 1 784 ? 9.149   69.460  -5.165  1.00 22.54 ? 784  GLU A CG    1 
ATOM   6070  C  CD    . GLU A 1 784 ? 8.106   70.153  -6.065  1.00 25.60 ? 784  GLU A CD    1 
ATOM   6071  O  OE1   . GLU A 1 784 ? 8.426   70.420  -7.258  1.00 27.94 ? 784  GLU A OE1   1 
ATOM   6072  O  OE2   . GLU A 1 784 ? 6.972   70.438  -5.608  1.00 25.66 ? 784  GLU A OE2   1 
ATOM   6073  N  N     . VAL A 1 785 ? 7.837   66.112  -3.664  1.00 18.13 ? 785  VAL A N     1 
ATOM   6074  C  CA    . VAL A 1 785 ? 7.972   64.826  -4.354  1.00 17.36 ? 785  VAL A CA    1 
ATOM   6075  C  C     . VAL A 1 785 ? 6.619   64.114  -4.373  1.00 16.77 ? 785  VAL A C     1 
ATOM   6076  O  O     . VAL A 1 785 ? 6.182   63.645  -5.401  1.00 16.65 ? 785  VAL A O     1 
ATOM   6077  C  CB    . VAL A 1 785 ? 9.091   63.972  -3.722  1.00 17.21 ? 785  VAL A CB    1 
ATOM   6078  C  CG1   . VAL A 1 785 ? 8.808   62.491  -3.865  1.00 18.34 ? 785  VAL A CG1   1 
ATOM   6079  C  CG2   . VAL A 1 785 ? 10.412  64.297  -4.369  1.00 17.26 ? 785  VAL A CG2   1 
ATOM   6080  N  N     . ILE A 1 786 ? 5.955   64.056  -3.231  1.00 16.36 ? 786  ILE A N     1 
ATOM   6081  C  CA    . ILE A 1 786 ? 4.573   63.636  -3.166  1.00 16.58 ? 786  ILE A CA    1 
ATOM   6082  C  C     . ILE A 1 786 ? 3.684   64.373  -4.213  1.00 17.50 ? 786  ILE A C     1 
ATOM   6083  O  O     . ILE A 1 786 ? 2.780   63.807  -4.787  1.00 17.37 ? 786  ILE A O     1 
ATOM   6084  C  CB    . ILE A 1 786 ? 4.066   63.873  -1.733  1.00 16.55 ? 786  ILE A CB    1 
ATOM   6085  C  CG1   . ILE A 1 786 ? 4.890   63.083  -0.707  1.00 17.86 ? 786  ILE A CG1   1 
ATOM   6086  C  CG2   . ILE A 1 786 ? 2.585   63.520  -1.582  1.00 16.12 ? 786  ILE A CG2   1 
ATOM   6087  C  CD1   . ILE A 1 786 ? 4.933   61.540  -0.945  1.00 19.78 ? 786  ILE A CD1   1 
ATOM   6088  N  N     . LYS A 1 787 ? 3.945   65.648  -4.466  1.00 18.88 ? 787  LYS A N     1 
ATOM   6089  C  CA    . LYS A 1 787 ? 3.190   66.398  -5.456  1.00 19.21 ? 787  LYS A CA    1 
ATOM   6090  C  C     . LYS A 1 787 ? 3.308   65.785  -6.851  1.00 19.55 ? 787  LYS A C     1 
ATOM   6091  O  O     . LYS A 1 787 ? 2.308   65.648  -7.560  1.00 19.20 ? 787  LYS A O     1 
ATOM   6092  C  CB    . LYS A 1 787 ? 3.710   67.817  -5.477  1.00 19.37 ? 787  LYS A CB    1 
ATOM   6093  C  CG    . LYS A 1 787 ? 2.907   68.773  -6.282  1.00 19.72 ? 787  LYS A CG    1 
ATOM   6094  C  CD    . LYS A 1 787 ? 3.484   70.180  -6.107  1.00 22.51 ? 787  LYS A CD    1 
ATOM   6095  C  CE    . LYS A 1 787 ? 4.157   70.738  -7.400  1.00 23.58 ? 787  LYS A CE    1 
ATOM   6096  N  NZ    . LYS A 1 787 ? 3.778   72.175  -7.659  1.00 22.79 ? 787  LYS A NZ    1 
ATOM   6097  N  N     . ARG A 1 788 ? 4.541   65.443  -7.241  1.00 20.37 ? 788  ARG A N     1 
ATOM   6098  C  CA    . ARG A 1 788 ? 4.821   64.877  -8.569  1.00 20.67 ? 788  ARG A CA    1 
ATOM   6099  C  C     . ARG A 1 788 ? 4.373   63.426  -8.670  1.00 20.18 ? 788  ARG A C     1 
ATOM   6100  O  O     . ARG A 1 788 ? 3.864   63.031  -9.698  1.00 20.36 ? 788  ARG A O     1 
ATOM   6101  C  CB    . ARG A 1 788 ? 6.301   65.022  -8.953  1.00 20.70 ? 788  ARG A CB    1 
ATOM   6102  C  CG    . ARG A 1 788 ? 6.652   64.489  -10.379 1.00 23.43 ? 788  ARG A CG    1 
ATOM   6103  C  CD    . ARG A 1 788 ? 6.414   65.449  -11.583 1.00 26.03 ? 788  ARG A CD    1 
ATOM   6104  N  NE    . ARG A 1 788 ? 5.441   64.936  -12.574 1.00 27.70 ? 788  ARG A NE    1 
ATOM   6105  C  CZ    . ARG A 1 788 ? 5.722   64.215  -13.672 1.00 28.07 ? 788  ARG A CZ    1 
ATOM   6106  N  NH1   . ARG A 1 788 ? 6.959   63.856  -13.959 1.00 28.84 ? 788  ARG A NH1   1 
ATOM   6107  N  NH2   . ARG A 1 788 ? 4.742   63.831  -14.489 1.00 27.44 ? 788  ARG A NH2   1 
ATOM   6108  N  N     . ALA A 1 789 ? 4.586   62.638  -7.623  1.00 20.04 ? 789  ALA A N     1 
ATOM   6109  C  CA    . ALA A 1 789 ? 4.036   61.283  -7.530  1.00 19.96 ? 789  ALA A CA    1 
ATOM   6110  C  C     . ALA A 1 789 ? 2.535   61.269  -7.841  1.00 19.77 ? 789  ALA A C     1 
ATOM   6111  O  O     . ALA A 1 789 ? 2.073   60.474  -8.652  1.00 18.50 ? 789  ALA A O     1 
ATOM   6112  C  CB    . ALA A 1 789 ? 4.277   60.725  -6.145  1.00 20.12 ? 789  ALA A CB    1 
ATOM   6113  N  N     . ARG A 1 790 ? 1.797   62.176  -7.196  1.00 19.89 ? 790  ARG A N     1 
ATOM   6114  C  CA    . ARG A 1 790 ? 0.353   62.375  -7.431  1.00 20.40 ? 790  ARG A CA    1 
ATOM   6115  C  C     . ARG A 1 790 ? 0.045   62.726  -8.881  1.00 19.66 ? 790  ARG A C     1 
ATOM   6116  O  O     . ARG A 1 790 ? -0.986  62.344  -9.393  1.00 19.63 ? 790  ARG A O     1 
ATOM   6117  C  CB    . ARG A 1 790 ? -0.199  63.491  -6.547  1.00 20.73 ? 790  ARG A CB    1 
ATOM   6118  C  CG    . ARG A 1 790 ? -1.328  63.123  -5.627  1.00 24.41 ? 790  ARG A CG    1 
ATOM   6119  C  CD    . ARG A 1 790 ? -1.120  63.720  -4.225  1.00 30.09 ? 790  ARG A CD    1 
ATOM   6120  N  NE    . ARG A 1 790 ? -2.291  63.658  -3.321  1.00 34.36 ? 790  ARG A NE    1 
ATOM   6121  C  CZ    . ARG A 1 790 ? -2.435  62.802  -2.284  1.00 37.17 ? 790  ARG A CZ    1 
ATOM   6122  N  NH1   . ARG A 1 790 ? -1.511  61.875  -1.996  1.00 39.06 ? 790  ARG A NH1   1 
ATOM   6123  N  NH2   . ARG A 1 790 ? -3.522  62.869  -1.529  1.00 37.10 ? 790  ARG A NH2   1 
ATOM   6124  N  N     . GLN A 1 791 ? 0.933   63.470  -9.528  1.00 19.55 ? 791  GLN A N     1 
ATOM   6125  C  CA    . GLN A 1 791 ? 0.813   63.726  -10.957 1.00 19.49 ? 791  GLN A CA    1 
ATOM   6126  C  C     . GLN A 1 791 ? 0.930   62.468  -11.779 1.00 18.89 ? 791  GLN A C     1 
ATOM   6127  O  O     . GLN A 1 791 ? 0.083   62.238  -12.616 1.00 19.29 ? 791  GLN A O     1 
ATOM   6128  C  CB    . GLN A 1 791 ? 1.839   64.736  -11.432 1.00 19.86 ? 791  GLN A CB    1 
ATOM   6129  C  CG    . GLN A 1 791 ? 1.287   66.165  -11.534 1.00 22.67 ? 791  GLN A CG    1 
ATOM   6130  C  CD    . GLN A 1 791 ? 2.373   67.244  -11.389 1.00 25.77 ? 791  GLN A CD    1 
ATOM   6131  O  OE1   . GLN A 1 791 ? 2.235   68.165  -10.567 1.00 27.34 ? 791  GLN A OE1   1 
ATOM   6132  N  NE2   . GLN A 1 791 ? 3.448   67.130  -12.188 1.00 25.08 ? 791  GLN A NE2   1 
ATOM   6133  N  N     . LYS A 1 792 ? 1.961   61.656  -11.553 1.00 18.18 ? 792  LYS A N     1 
ATOM   6134  C  CA    . LYS A 1 792 ? 2.131   60.417  -12.312 1.00 17.93 ? 792  LYS A CA    1 
ATOM   6135  C  C     . LYS A 1 792 ? 1.014   59.405  -12.029 1.00 17.39 ? 792  LYS A C     1 
ATOM   6136  O  O     . LYS A 1 792 ? 0.591   58.680  -12.915 1.00 16.55 ? 792  LYS A O     1 
ATOM   6137  C  CB    . LYS A 1 792 ? 3.496   59.770  -12.032 1.00 18.15 ? 792  LYS A CB    1 
ATOM   6138  C  CG    . LYS A 1 792 ? 3.880   58.634  -13.008 1.00 18.16 ? 792  LYS A CG    1 
ATOM   6139  C  CD    . LYS A 1 792 ? 4.562   59.172  -14.268 1.00 20.22 ? 792  LYS A CD    1 
ATOM   6140  C  CE    . LYS A 1 792 ? 4.636   58.144  -15.411 1.00 21.63 ? 792  LYS A CE    1 
ATOM   6141  N  NZ    . LYS A 1 792 ? 3.471   58.237  -16.378 1.00 24.24 ? 792  LYS A NZ    1 
ATOM   6142  N  N     . LEU A 1 793 ? 0.541   59.366  -10.793 1.00 17.33 ? 793  LEU A N     1 
ATOM   6143  C  CA    . LEU A 1 793 ? -0.495  58.433  -10.421 1.00 17.05 ? 793  LEU A CA    1 
ATOM   6144  C  C     . LEU A 1 793 ? -1.663  58.716  -11.331 1.00 17.47 ? 793  LEU A C     1 
ATOM   6145  O  O     . LEU A 1 793 ? -2.117  57.812  -12.027 1.00 17.61 ? 793  LEU A O     1 
ATOM   6146  C  CB    . LEU A 1 793 ? -0.883  58.592  -8.951  1.00 17.01 ? 793  LEU A CB    1 
ATOM   6147  C  CG    . LEU A 1 793 ? -1.867  57.573  -8.364  1.00 15.98 ? 793  LEU A CG    1 
ATOM   6148  C  CD1   . LEU A 1 793 ? -1.360  56.200  -8.517  1.00 15.14 ? 793  LEU A CD1   1 
ATOM   6149  C  CD2   . LEU A 1 793 ? -2.111  57.864  -6.892  1.00 15.94 ? 793  LEU A CD2   1 
ATOM   6150  N  N     . ARG A 1 794 ? -2.089  59.988  -11.374 1.00 17.36 ? 794  ARG A N     1 
ATOM   6151  C  CA    . ARG A 1 794 ? -3.184  60.455  -12.237 1.00 17.23 ? 794  ARG A CA    1 
ATOM   6152  C  C     . ARG A 1 794 ? -3.029  60.067  -13.692 1.00 16.63 ? 794  ARG A C     1 
ATOM   6153  O  O     . ARG A 1 794 ? -4.005  59.754  -14.361 1.00 17.04 ? 794  ARG A O     1 
ATOM   6154  C  CB    . ARG A 1 794 ? -3.313  61.981  -12.175 1.00 17.94 ? 794  ARG A CB    1 
ATOM   6155  C  CG    . ARG A 1 794 ? -4.630  62.473  -11.624 1.00 19.52 ? 794  ARG A CG    1 
ATOM   6156  C  CD    . ARG A 1 794 ? -4.587  62.775  -10.148 1.00 23.48 ? 794  ARG A CD    1 
ATOM   6157  N  NE    . ARG A 1 794 ? -5.082  64.140  -9.920  1.00 29.08 ? 794  ARG A NE    1 
ATOM   6158  C  CZ    . ARG A 1 794 ? -5.982  64.497  -8.998  1.00 31.88 ? 794  ARG A CZ    1 
ATOM   6159  N  NH1   . ARG A 1 794 ? -6.527  63.625  -8.143  1.00 34.39 ? 794  ARG A NH1   1 
ATOM   6160  N  NH2   . ARG A 1 794 ? -6.337  65.752  -8.923  1.00 32.51 ? 794  ARG A NH2   1 
ATOM   6161  N  N     . GLU A 1 795 ? -1.800  60.135  -14.184 1.00 16.22 ? 795  GLU A N     1 
ATOM   6162  C  CA    . GLU A 1 795 ? -1.433  59.576  -15.482 1.00 15.89 ? 795  GLU A CA    1 
ATOM   6163  C  C     . GLU A 1 795 ? -1.708  58.072  -15.568 1.00 15.48 ? 795  GLU A C     1 
ATOM   6164  O  O     . GLU A 1 795 ? -2.291  57.615  -16.533 1.00 15.68 ? 795  GLU A O     1 
ATOM   6165  C  CB    . GLU A 1 795 ? 0.038   59.875  -15.780 1.00 15.83 ? 795  GLU A CB    1 
ATOM   6166  C  CG    . GLU A 1 795 ? 0.237   61.300  -16.280 1.00 16.46 ? 795  GLU A CG    1 
ATOM   6167  C  CD    . GLU A 1 795 ? 1.651   61.819  -16.122 1.00 17.37 ? 795  GLU A CD    1 
ATOM   6168  O  OE1   . GLU A 1 795 ? 2.623   61.038  -16.329 1.00 14.64 ? 795  GLU A OE1   1 
ATOM   6169  O  OE2   . GLU A 1 795 ? 1.765   63.034  -15.803 1.00 18.61 ? 795  GLU A OE2   1 
ATOM   6170  N  N     . LEU A 1 796 ? -1.318  57.314  -14.552 1.00 15.05 ? 796  LEU A N     1 
ATOM   6171  C  CA    . LEU A 1 796 ? -1.487  55.855  -14.570 1.00 14.92 ? 796  LEU A CA    1 
ATOM   6172  C  C     . LEU A 1 796 ? -2.935  55.434  -14.410 1.00 15.47 ? 796  LEU A C     1 
ATOM   6173  O  O     . LEU A 1 796 ? -3.340  54.412  -14.957 1.00 15.88 ? 796  LEU A O     1 
ATOM   6174  C  CB    . LEU A 1 796 ? -0.643  55.185  -13.484 1.00 14.16 ? 796  LEU A CB    1 
ATOM   6175  C  CG    . LEU A 1 796 ? 0.851   55.445  -13.615 1.00 11.49 ? 796  LEU A CG    1 
ATOM   6176  C  CD1   . LEU A 1 796 ? 1.554   55.138  -12.317 1.00 9.26  ? 796  LEU A CD1   1 
ATOM   6177  C  CD2   . LEU A 1 796 ? 1.428   54.655  -14.764 1.00 10.62 ? 796  LEU A CD2   1 
ATOM   6178  N  N     . GLU A 1 797 ? -3.716  56.240  -13.693 1.00 15.92 ? 797  GLU A N     1 
ATOM   6179  C  CA    . GLU A 1 797 ? -5.123  55.930  -13.428 1.00 16.15 ? 797  GLU A CA    1 
ATOM   6180  C  C     . GLU A 1 797 ? -5.959  56.246  -14.646 1.00 15.86 ? 797  GLU A C     1 
ATOM   6181  O  O     . GLU A 1 797 ? -7.159  56.018  -14.628 1.00 15.57 ? 797  GLU A O     1 
ATOM   6182  C  CB    . GLU A 1 797 ? -5.700  56.717  -12.229 1.00 16.15 ? 797  GLU A CB    1 
ATOM   6183  C  CG    . GLU A 1 797 ? -4.762  56.880  -11.039 1.00 17.73 ? 797  GLU A CG    1 
ATOM   6184  C  CD    . GLU A 1 797 ? -5.362  56.528  -9.689  1.00 18.12 ? 797  GLU A CD    1 
ATOM   6185  O  OE1   . GLU A 1 797 ? -5.773  57.466  -8.978  1.00 16.93 ? 797  GLU A OE1   1 
ATOM   6186  O  OE2   . GLU A 1 797 ? -5.365  55.315  -9.318  1.00 21.15 ? 797  GLU A OE2   1 
ATOM   6187  N  N     . SER A 1 798 ? -5.350  56.793  -15.693 1.00 16.20 ? 798  SER A N     1 
ATOM   6188  C  CA    . SER A 1 798 ? -6.121  57.127  -16.890 1.00 16.99 ? 798  SER A CA    1 
ATOM   6189  C  C     . SER A 1 798 ? -5.957  56.063  -17.979 1.00 17.89 ? 798  SER A C     1 
ATOM   6190  O  O     . SER A 1 798 ? -6.805  55.963  -18.867 1.00 17.93 ? 798  SER A O     1 
ATOM   6191  C  CB    . SER A 1 798 ? -5.870  58.585  -17.371 1.00 16.38 ? 798  SER A CB    1 
ATOM   6192  O  OG    . SER A 1 798 ? -4.593  58.768  -17.938 1.00 14.98 ? 798  SER A OG    1 
ATOM   6193  N  N     . ILE A 1 799 ? -4.907  55.243  -17.879 1.00 19.78 ? 799  ILE A N     1 
ATOM   6194  C  CA    . ILE A 1 799 ? -4.784  54.021  -18.710 1.00 21.23 ? 799  ILE A CA    1 
ATOM   6195  C  C     . ILE A 1 799 ? -6.085  53.234  -18.651 1.00 22.04 ? 799  ILE A C     1 
ATOM   6196  O  O     . ILE A 1 799 ? -6.723  52.996  -19.677 1.00 22.18 ? 799  ILE A O     1 
ATOM   6197  C  CB    . ILE A 1 799 ? -3.610  53.101  -18.284 1.00 21.37 ? 799  ILE A CB    1 
ATOM   6198  C  CG1   . ILE A 1 799 ? -2.245  53.794  -18.491 1.00 22.62 ? 799  ILE A CG1   1 
ATOM   6199  C  CG2   . ILE A 1 799 ? -3.628  51.827  -19.117 1.00 21.34 ? 799  ILE A CG2   1 
ATOM   6200  C  CD1   . ILE A 1 799 ? -1.119  53.319  -17.545 1.00 22.74 ? 799  ILE A CD1   1 
ATOM   6201  N  N     . SER A 1 800 ? -6.490  52.860  -17.440 1.00 23.21 ? 800  SER A N     1 
ATOM   6202  C  CA    . SER A 1 800 ? -7.832  52.295  -17.236 1.00 24.03 ? 800  SER A CA    1 
ATOM   6203  C  C     . SER A 1 800 ? -8.747  53.360  -16.612 1.00 24.26 ? 800  SER A C     1 
ATOM   6204  O  O     . SER A 1 800 ? -8.769  53.528  -15.385 1.00 24.31 ? 800  SER A O     1 
ATOM   6205  C  CB    . SER A 1 800 ? -7.781  50.997  -16.390 1.00 24.26 ? 800  SER A CB    1 
ATOM   6206  O  OG    . SER A 1 800 ? -8.653  50.020  -16.924 1.00 23.83 ? 800  SER A OG    1 
ATOM   6207  O  OXT   . SER A 1 800 ? -9.443  54.065  -17.362 1.00 24.39 ? 800  SER A OXT   1 
ATOM   6208  N  N     . MET B 1 14  ? 24.178  41.812  58.332  1.00 24.90 ? 14   MET B N     1 
ATOM   6209  C  CA    . MET B 1 14  ? 24.251  42.591  57.065  1.00 25.07 ? 14   MET B CA    1 
ATOM   6210  C  C     . MET B 1 14  ? 23.236  43.738  57.054  1.00 25.06 ? 14   MET B C     1 
ATOM   6211  O  O     . MET B 1 14  ? 22.551  43.973  56.056  1.00 24.88 ? 14   MET B O     1 
ATOM   6212  C  CB    . MET B 1 14  ? 24.051  41.675  55.849  1.00 25.18 ? 14   MET B CB    1 
ATOM   6213  C  CG    . MET B 1 14  ? 22.660  41.064  55.722  1.00 25.30 ? 14   MET B CG    1 
ATOM   6214  S  SD    . MET B 1 14  ? 22.694  39.448  54.917  1.00 25.98 ? 14   MET B SD    1 
ATOM   6215  C  CE    . MET B 1 14  ? 22.313  38.320  56.351  1.00 25.31 ? 14   MET B CE    1 
ATOM   6216  N  N     . GLN B 1 15  ? 23.150  44.451  58.175  1.00 25.11 ? 15   GLN B N     1 
ATOM   6217  C  CA    . GLN B 1 15  ? 22.424  45.723  58.224  1.00 25.08 ? 15   GLN B CA    1 
ATOM   6218  C  C     . GLN B 1 15  ? 23.354  46.898  57.777  1.00 25.47 ? 15   GLN B C     1 
ATOM   6219  O  O     . GLN B 1 15  ? 22.862  47.986  57.449  1.00 25.59 ? 15   GLN B O     1 
ATOM   6220  C  CB    . GLN B 1 15  ? 21.794  45.957  59.615  1.00 24.82 ? 15   GLN B CB    1 
ATOM   6221  C  CG    . GLN B 1 15  ? 21.234  44.677  60.305  1.00 24.01 ? 15   GLN B CG    1 
ATOM   6222  C  CD    . GLN B 1 15  ? 19.774  44.786  60.746  1.00 22.52 ? 15   GLN B CD    1 
ATOM   6223  O  OE1   . GLN B 1 15  ? 19.372  45.769  61.363  1.00 21.31 ? 15   GLN B OE1   1 
ATOM   6224  N  NE2   . GLN B 1 15  ? 18.991  43.763  60.439  1.00 21.34 ? 15   GLN B NE2   1 
ATOM   6225  N  N     . GLN B 1 16  ? 24.679  46.664  57.731  1.00 25.60 ? 16   GLN B N     1 
ATOM   6226  C  CA    . GLN B 1 16  ? 25.653  47.634  57.186  1.00 25.67 ? 16   GLN B CA    1 
ATOM   6227  C  C     . GLN B 1 16  ? 25.893  47.375  55.688  1.00 25.62 ? 16   GLN B C     1 
ATOM   6228  O  O     . GLN B 1 16  ? 27.012  47.526  55.188  1.00 25.64 ? 16   GLN B O     1 
ATOM   6229  C  CB    . GLN B 1 16  ? 27.000  47.617  57.968  1.00 25.80 ? 16   GLN B CB    1 
ATOM   6230  C  CG    . GLN B 1 16  ? 27.819  48.963  57.903  1.00 26.16 ? 16   GLN B CG    1 
ATOM   6231  C  CD    . GLN B 1 16  ? 29.289  48.858  58.382  1.00 26.55 ? 16   GLN B CD    1 
ATOM   6232  O  OE1   . GLN B 1 16  ? 29.555  48.358  59.479  1.00 26.48 ? 16   GLN B OE1   1 
ATOM   6233  N  NE2   . GLN B 1 16  ? 30.230  49.354  57.565  1.00 26.24 ? 16   GLN B NE2   1 
ATOM   6234  N  N     . TYR B 1 17  ? 24.834  46.980  54.981  1.00 25.57 ? 17   TYR B N     1 
ATOM   6235  C  CA    . TYR B 1 17  ? 24.868  46.829  53.528  1.00 25.36 ? 17   TYR B CA    1 
ATOM   6236  C  C     . TYR B 1 17  ? 24.001  47.898  52.875  1.00 25.44 ? 17   TYR B C     1 
ATOM   6237  O  O     . TYR B 1 17  ? 24.463  48.594  51.977  1.00 25.52 ? 17   TYR B O     1 
ATOM   6238  C  CB    . TYR B 1 17  ? 24.372  45.444  53.095  1.00 25.18 ? 17   TYR B CB    1 
ATOM   6239  C  CG    . TYR B 1 17  ? 24.091  45.384  51.613  1.00 24.77 ? 17   TYR B CG    1 
ATOM   6240  C  CD1   . TYR B 1 17  ? 22.820  45.666  51.110  1.00 24.22 ? 17   TYR B CD1   1 
ATOM   6241  C  CD2   . TYR B 1 17  ? 25.109  45.095  50.705  1.00 24.39 ? 17   TYR B CD2   1 
ATOM   6242  C  CE1   . TYR B 1 17  ? 22.566  45.640  49.742  1.00 23.93 ? 17   TYR B CE1   1 
ATOM   6243  C  CE2   . TYR B 1 17  ? 24.864  45.062  49.338  1.00 23.87 ? 17   TYR B CE2   1 
ATOM   6244  C  CZ    . TYR B 1 17  ? 23.593  45.335  48.861  1.00 23.57 ? 17   TYR B CZ    1 
ATOM   6245  O  OH    . TYR B 1 17  ? 23.356  45.304  47.504  1.00 23.53 ? 17   TYR B OH    1 
ATOM   6246  N  N     . LEU B 1 18  ? 22.740  47.987  53.311  1.00 25.52 ? 18   LEU B N     1 
ATOM   6247  C  CA    . LEU B 1 18  ? 21.771  48.970  52.799  1.00 25.68 ? 18   LEU B CA    1 
ATOM   6248  C  C     . LEU B 1 18  ? 22.234  50.403  53.057  1.00 25.76 ? 18   LEU B C     1 
ATOM   6249  O  O     . LEU B 1 18  ? 21.941  51.313  52.267  1.00 25.69 ? 18   LEU B O     1 
ATOM   6250  C  CB    . LEU B 1 18  ? 20.388  48.759  53.443  1.00 25.75 ? 18   LEU B CB    1 
ATOM   6251  C  CG    . LEU B 1 18  ? 19.145  49.173  52.634  1.00 25.92 ? 18   LEU B CG    1 
ATOM   6252  C  CD1   . LEU B 1 18  ? 17.925  48.371  53.090  1.00 25.52 ? 18   LEU B CD1   1 
ATOM   6253  C  CD2   . LEU B 1 18  ? 18.844  50.681  52.712  1.00 25.92 ? 18   LEU B CD2   1 
ATOM   6254  N  N     . ARG B 1 19  ? 22.938  50.588  54.175  1.00 25.88 ? 19   ARG B N     1 
ATOM   6255  C  CA    . ARG B 1 19  ? 23.575  51.863  54.518  1.00 26.15 ? 19   ARG B CA    1 
ATOM   6256  C  C     . ARG B 1 19  ? 24.576  52.312  53.432  1.00 26.51 ? 19   ARG B C     1 
ATOM   6257  O  O     . ARG B 1 19  ? 24.616  53.499  53.073  1.00 26.54 ? 19   ARG B O     1 
ATOM   6258  C  CB    . ARG B 1 19  ? 24.283  51.764  55.888  1.00 26.13 ? 19   ARG B CB    1 
ATOM   6259  C  CG    . ARG B 1 19  ? 23.482  52.317  57.085  1.00 25.90 ? 19   ARG B CG    1 
ATOM   6260  C  CD    . ARG B 1 19  ? 24.219  53.395  57.900  1.00 25.71 ? 19   ARG B CD    1 
ATOM   6261  N  NE    . ARG B 1 19  ? 23.355  54.499  58.321  1.00 25.55 ? 19   ARG B NE    1 
ATOM   6262  C  CZ    . ARG B 1 19  ? 22.807  55.398  57.503  1.00 25.53 ? 19   ARG B CZ    1 
ATOM   6263  N  NH1   . ARG B 1 19  ? 23.003  55.345  56.184  1.00 25.32 ? 19   ARG B NH1   1 
ATOM   6264  N  NH2   . ARG B 1 19  ? 22.045  56.360  58.009  1.00 25.49 ? 19   ARG B NH2   1 
ATOM   6265  N  N     . LEU B 1 20  ? 25.375  51.361  52.929  1.00 26.79 ? 20   LEU B N     1 
ATOM   6266  C  CA    . LEU B 1 20  ? 26.336  51.601  51.836  1.00 26.86 ? 20   LEU B CA    1 
ATOM   6267  C  C     . LEU B 1 20  ? 25.697  51.746  50.451  1.00 27.10 ? 20   LEU B C     1 
ATOM   6268  O  O     . LEU B 1 20  ? 26.266  52.412  49.583  1.00 27.25 ? 20   LEU B O     1 
ATOM   6269  C  CB    . LEU B 1 20  ? 27.404  50.498  51.781  1.00 26.78 ? 20   LEU B CB    1 
ATOM   6270  C  CG    . LEU B 1 20  ? 28.531  50.626  52.812  1.00 26.93 ? 20   LEU B CG    1 
ATOM   6271  C  CD1   . LEU B 1 20  ? 29.235  49.294  52.996  1.00 26.99 ? 20   LEU B CD1   1 
ATOM   6272  C  CD2   . LEU B 1 20  ? 29.533  51.715  52.420  1.00 26.92 ? 20   LEU B CD2   1 
ATOM   6273  N  N     . LYS B 1 21  ? 24.537  51.123  50.232  1.00 27.34 ? 21   LYS B N     1 
ATOM   6274  C  CA    . LYS B 1 21  ? 23.812  51.300  48.973  1.00 27.58 ? 21   LYS B CA    1 
ATOM   6275  C  C     . LYS B 1 21  ? 23.029  52.619  48.945  1.00 27.89 ? 21   LYS B C     1 
ATOM   6276  O  O     . LYS B 1 21  ? 22.445  52.967  47.928  1.00 27.98 ? 21   LYS B O     1 
ATOM   6277  C  CB    . LYS B 1 21  ? 22.884  50.118  48.680  1.00 27.53 ? 21   LYS B CB    1 
ATOM   6278  C  CG    . LYS B 1 21  ? 22.513  49.992  47.197  1.00 27.59 ? 21   LYS B CG    1 
ATOM   6279  C  CD    . LYS B 1 21  ? 22.168  48.563  46.794  1.00 27.84 ? 21   LYS B CD    1 
ATOM   6280  C  CE    . LYS B 1 21  ? 20.821  48.109  47.378  1.00 28.22 ? 21   LYS B CE    1 
ATOM   6281  N  NZ    . LYS B 1 21  ? 20.131  47.099  46.514  1.00 27.83 ? 21   LYS B NZ    1 
ATOM   6282  N  N     . ALA B 1 22  ? 23.005  53.340  50.062  1.00 28.26 ? 22   ALA B N     1 
ATOM   6283  C  CA    . ALA B 1 22  ? 22.579  54.731  50.060  1.00 28.45 ? 22   ALA B CA    1 
ATOM   6284  C  C     . ALA B 1 22  ? 23.696  55.589  49.446  1.00 28.82 ? 22   ALA B C     1 
ATOM   6285  O  O     . ALA B 1 22  ? 23.423  56.458  48.614  1.00 29.04 ? 22   ALA B O     1 
ATOM   6286  C  CB    . ALA B 1 22  ? 22.252  55.191  51.471  1.00 28.38 ? 22   ALA B CB    1 
ATOM   6287  N  N     . GLN B 1 23  ? 24.945  55.320  49.852  1.00 29.10 ? 23   GLN B N     1 
ATOM   6288  C  CA    . GLN B 1 23  ? 26.154  56.042  49.386  1.00 29.26 ? 23   GLN B CA    1 
ATOM   6289  C  C     . GLN B 1 23  ? 26.216  56.185  47.857  1.00 29.56 ? 23   GLN B C     1 
ATOM   6290  O  O     . GLN B 1 23  ? 26.446  57.289  47.341  1.00 29.60 ? 23   GLN B O     1 
ATOM   6291  C  CB    . GLN B 1 23  ? 27.438  55.328  49.882  1.00 29.33 ? 23   GLN B CB    1 
ATOM   6292  C  CG    . GLN B 1 23  ? 28.563  56.241  50.412  1.00 28.78 ? 23   GLN B CG    1 
ATOM   6293  C  CD    . GLN B 1 23  ? 29.666  55.464  51.144  1.00 27.84 ? 23   GLN B CD    1 
ATOM   6294  O  OE1   . GLN B 1 23  ? 30.577  54.914  50.519  1.00 27.19 ? 23   GLN B OE1   1 
ATOM   6295  N  NE2   . GLN B 1 23  ? 29.580  55.425  52.466  1.00 26.91 ? 23   GLN B NE2   1 
ATOM   6296  N  N     . HIS B 1 24  ? 26.034  55.053  47.161  1.00 29.72 ? 24   HIS B N     1 
ATOM   6297  C  CA    . HIS B 1 24  ? 25.931  54.984  45.693  1.00 29.69 ? 24   HIS B CA    1 
ATOM   6298  C  C     . HIS B 1 24  ? 24.778  54.007  45.312  1.00 29.35 ? 24   HIS B C     1 
ATOM   6299  O  O     . HIS B 1 24  ? 24.986  52.781  45.285  1.00 29.10 ? 24   HIS B O     1 
ATOM   6300  C  CB    . HIS B 1 24  ? 27.249  54.484  45.072  1.00 29.95 ? 24   HIS B CB    1 
ATOM   6301  C  CG    . HIS B 1 24  ? 28.398  55.447  45.179  1.00 30.87 ? 24   HIS B CG    1 
ATOM   6302  N  ND1   . HIS B 1 24  ? 28.756  56.301  44.154  1.00 31.65 ? 24   HIS B ND1   1 
ATOM   6303  C  CD2   . HIS B 1 24  ? 29.299  55.656  46.171  1.00 31.56 ? 24   HIS B CD2   1 
ATOM   6304  C  CE1   . HIS B 1 24  ? 29.811  57.010  44.520  1.00 31.91 ? 24   HIS B CE1   1 
ATOM   6305  N  NE2   . HIS B 1 24  ? 30.159  56.641  45.741  1.00 31.42 ? 24   HIS B NE2   1 
ATOM   6306  N  N     . PRO B 1 25  ? 23.576  54.544  45.041  1.00 28.80 ? 25   PRO B N     1 
ATOM   6307  C  CA    . PRO B 1 25  ? 22.376  53.724  44.763  1.00 28.34 ? 25   PRO B CA    1 
ATOM   6308  C  C     . PRO B 1 25  ? 22.204  53.226  43.317  1.00 27.75 ? 25   PRO B C     1 
ATOM   6309  O  O     . PRO B 1 25  ? 21.815  52.072  43.093  1.00 27.80 ? 25   PRO B O     1 
ATOM   6310  C  CB    . PRO B 1 25  ? 21.222  54.676  45.121  1.00 28.37 ? 25   PRO B CB    1 
ATOM   6311  C  CG    . PRO B 1 25  ? 21.755  56.047  44.845  1.00 28.52 ? 25   PRO B CG    1 
ATOM   6312  C  CD    . PRO B 1 25  ? 23.254  55.984  45.038  1.00 28.71 ? 25   PRO B CD    1 
ATOM   6313  N  N     . GLU B 1 26  ? 22.483  54.107  42.361  1.00 26.95 ? 26   GLU B N     1 
ATOM   6314  C  CA    . GLU B 1 26  ? 22.367  53.816  40.934  1.00 26.16 ? 26   GLU B CA    1 
ATOM   6315  C  C     . GLU B 1 26  ? 23.473  52.864  40.385  1.00 25.29 ? 26   GLU B C     1 
ATOM   6316  O  O     . GLU B 1 26  ? 23.556  52.644  39.175  1.00 24.87 ? 26   GLU B O     1 
ATOM   6317  C  CB    . GLU B 1 26  ? 22.317  55.157  40.155  1.00 26.28 ? 26   GLU B CB    1 
ATOM   6318  C  CG    . GLU B 1 26  ? 23.660  55.757  39.673  1.00 26.61 ? 26   GLU B CG    1 
ATOM   6319  C  CD    . GLU B 1 26  ? 24.537  56.411  40.754  1.00 27.13 ? 26   GLU B CD    1 
ATOM   6320  O  OE1   . GLU B 1 26  ? 24.185  56.413  41.960  1.00 26.77 ? 26   GLU B OE1   1 
ATOM   6321  O  OE2   . GLU B 1 26  ? 25.614  56.936  40.382  1.00 26.99 ? 26   GLU B OE2   1 
ATOM   6322  N  N     . ILE B 1 27  ? 24.314  52.306  41.260  1.00 24.41 ? 27   ILE B N     1 
ATOM   6323  C  CA    . ILE B 1 27  ? 25.397  51.408  40.836  1.00 23.88 ? 27   ILE B CA    1 
ATOM   6324  C  C     . ILE B 1 27  ? 25.316  50.041  41.525  1.00 23.45 ? 27   ILE B C     1 
ATOM   6325  O  O     . ILE B 1 27  ? 25.087  49.950  42.727  1.00 23.41 ? 27   ILE B O     1 
ATOM   6326  C  CB    . ILE B 1 27  ? 26.775  52.065  41.109  1.00 23.74 ? 27   ILE B CB    1 
ATOM   6327  C  CG1   . ILE B 1 27  ? 26.979  53.271  40.181  1.00 23.61 ? 27   ILE B CG1   1 
ATOM   6328  C  CG2   . ILE B 1 27  ? 27.908  51.059  40.934  1.00 23.52 ? 27   ILE B CG2   1 
ATOM   6329  C  CD1   . ILE B 1 27  ? 28.017  54.272  40.654  1.00 23.05 ? 27   ILE B CD1   1 
ATOM   6330  N  N     . LEU B 1 28  ? 25.526  48.980  40.756  1.00 22.91 ? 28   LEU B N     1 
ATOM   6331  C  CA    . LEU B 1 28  ? 25.577  47.639  41.320  1.00 22.76 ? 28   LEU B CA    1 
ATOM   6332  C  C     . LEU B 1 28  ? 26.622  47.564  42.427  1.00 22.70 ? 28   LEU B C     1 
ATOM   6333  O  O     . LEU B 1 28  ? 27.683  48.143  42.306  1.00 22.70 ? 28   LEU B O     1 
ATOM   6334  C  CB    . LEU B 1 28  ? 25.902  46.612  40.238  1.00 22.68 ? 28   LEU B CB    1 
ATOM   6335  C  CG    . LEU B 1 28  ? 24.923  46.533  39.061  1.00 22.56 ? 28   LEU B CG    1 
ATOM   6336  C  CD1   . LEU B 1 28  ? 25.399  45.453  38.115  1.00 22.83 ? 28   LEU B CD1   1 
ATOM   6337  C  CD2   . LEU B 1 28  ? 23.461  46.294  39.486  1.00 21.95 ? 28   LEU B CD2   1 
ATOM   6338  N  N     . LEU B 1 29  ? 26.331  46.830  43.496  1.00 22.81 ? 29   LEU B N     1 
ATOM   6339  C  CA    . LEU B 1 29  ? 27.196  46.827  44.668  1.00 22.69 ? 29   LEU B CA    1 
ATOM   6340  C  C     . LEU B 1 29  ? 27.677  45.432  45.060  1.00 22.36 ? 29   LEU B C     1 
ATOM   6341  O  O     . LEU B 1 29  ? 27.021  44.718  45.809  1.00 22.28 ? 29   LEU B O     1 
ATOM   6342  C  CB    . LEU B 1 29  ? 26.488  47.519  45.834  1.00 22.96 ? 29   LEU B CB    1 
ATOM   6343  C  CG    . LEU B 1 29  ? 27.324  48.622  46.486  1.00 23.28 ? 29   LEU B CG    1 
ATOM   6344  C  CD1   . LEU B 1 29  ? 26.451  49.438  47.423  1.00 23.57 ? 29   LEU B CD1   1 
ATOM   6345  C  CD2   . LEU B 1 29  ? 28.546  48.030  47.225  1.00 23.16 ? 29   LEU B CD2   1 
ATOM   6346  N  N     . PHE B 1 30  ? 28.834  45.069  44.515  1.00 22.23 ? 30   PHE B N     1 
ATOM   6347  C  CA    . PHE B 1 30  ? 29.571  43.857  44.868  1.00 22.25 ? 30   PHE B CA    1 
ATOM   6348  C  C     . PHE B 1 30  ? 30.027  43.890  46.329  1.00 22.82 ? 30   PHE B C     1 
ATOM   6349  O  O     . PHE B 1 30  ? 30.864  44.711  46.690  1.00 22.98 ? 30   PHE B O     1 
ATOM   6350  C  CB    . PHE B 1 30  ? 30.807  43.746  43.975  1.00 21.91 ? 30   PHE B CB    1 
ATOM   6351  C  CG    . PHE B 1 30  ? 30.539  43.145  42.625  1.00 21.35 ? 30   PHE B CG    1 
ATOM   6352  C  CD1   . PHE B 1 30  ? 29.378  43.440  41.920  1.00 20.50 ? 30   PHE B CD1   1 
ATOM   6353  C  CD2   . PHE B 1 30  ? 31.463  42.272  42.054  1.00 20.34 ? 30   PHE B CD2   1 
ATOM   6354  C  CE1   . PHE B 1 30  ? 29.149  42.872  40.685  1.00 20.19 ? 30   PHE B CE1   1 
ATOM   6355  C  CE2   . PHE B 1 30  ? 31.235  41.701  40.822  1.00 19.84 ? 30   PHE B CE2   1 
ATOM   6356  C  CZ    . PHE B 1 30  ? 30.080  41.999  40.135  1.00 20.25 ? 30   PHE B CZ    1 
ATOM   6357  N  N     . TYR B 1 31  ? 29.506  42.983  47.157  1.00 23.43 ? 31   TYR B N     1 
ATOM   6358  C  CA    . TYR B 1 31  ? 29.708  43.040  48.610  1.00 23.73 ? 31   TYR B CA    1 
ATOM   6359  C  C     . TYR B 1 31  ? 30.471  41.847  49.169  1.00 24.01 ? 31   TYR B C     1 
ATOM   6360  O  O     . TYR B 1 31  ? 29.972  40.725  49.127  1.00 24.04 ? 31   TYR B O     1 
ATOM   6361  C  CB    . TYR B 1 31  ? 28.360  43.117  49.320  1.00 23.74 ? 31   TYR B CB    1 
ATOM   6362  C  CG    . TYR B 1 31  ? 28.490  43.502  50.761  1.00 24.15 ? 31   TYR B CG    1 
ATOM   6363  C  CD1   . TYR B 1 31  ? 28.912  44.776  51.105  1.00 24.22 ? 31   TYR B CD1   1 
ATOM   6364  C  CD2   . TYR B 1 31  ? 28.211  42.594  51.786  1.00 24.51 ? 31   TYR B CD2   1 
ATOM   6365  C  CE1   . TYR B 1 31  ? 29.047  45.154  52.424  1.00 24.32 ? 31   TYR B CE1   1 
ATOM   6366  C  CE2   . TYR B 1 31  ? 28.342  42.969  53.116  1.00 24.68 ? 31   TYR B CE2   1 
ATOM   6367  C  CZ    . TYR B 1 31  ? 28.767  44.260  53.418  1.00 24.61 ? 31   TYR B CZ    1 
ATOM   6368  O  OH    . TYR B 1 31  ? 28.916  44.693  54.707  1.00 25.32 ? 31   TYR B OH    1 
ATOM   6369  N  N     . ARG B 1 32  ? 31.650  42.100  49.736  1.00 24.36 ? 32   ARG B N     1 
ATOM   6370  C  CA    . ARG B 1 32  ? 32.503  41.023  50.236  1.00 24.59 ? 32   ARG B CA    1 
ATOM   6371  C  C     . ARG B 1 32  ? 31.796  40.230  51.327  1.00 24.60 ? 32   ARG B C     1 
ATOM   6372  O  O     . ARG B 1 32  ? 31.245  40.812  52.265  1.00 24.75 ? 32   ARG B O     1 
ATOM   6373  C  CB    . ARG B 1 32  ? 33.835  41.550  50.763  1.00 24.69 ? 32   ARG B CB    1 
ATOM   6374  C  CG    . ARG B 1 32  ? 34.925  40.479  50.795  1.00 25.45 ? 32   ARG B CG    1 
ATOM   6375  C  CD    . ARG B 1 32  ? 35.707  40.372  49.492  1.00 26.09 ? 32   ARG B CD    1 
ATOM   6376  N  NE    . ARG B 1 32  ? 36.358  39.069  49.314  1.00 26.21 ? 32   ARG B NE    1 
ATOM   6377  C  CZ    . ARG B 1 32  ? 37.676  38.857  49.272  1.00 26.55 ? 32   ARG B CZ    1 
ATOM   6378  N  NH1   . ARG B 1 32  ? 38.548  39.855  49.409  1.00 26.37 ? 32   ARG B NH1   1 
ATOM   6379  N  NH2   . ARG B 1 32  ? 38.131  37.620  49.092  1.00 27.18 ? 32   ARG B NH2   1 
ATOM   6380  N  N     . MET B 1 33  ? 31.815  38.904  51.173  1.00 24.57 ? 33   MET B N     1 
ATOM   6381  C  CA    . MET B 1 33  ? 31.101  37.974  52.051  1.00 24.47 ? 33   MET B CA    1 
ATOM   6382  C  C     . MET B 1 33  ? 31.936  36.746  52.456  1.00 24.37 ? 33   MET B C     1 
ATOM   6383  O  O     . MET B 1 33  ? 31.585  36.049  53.403  1.00 24.40 ? 33   MET B O     1 
ATOM   6384  C  CB    . MET B 1 33  ? 29.798  37.520  51.385  1.00 24.42 ? 33   MET B CB    1 
ATOM   6385  C  CG    . MET B 1 33  ? 28.634  38.498  51.542  1.00 24.68 ? 33   MET B CG    1 
ATOM   6386  S  SD    . MET B 1 33  ? 28.158  38.827  53.260  1.00 25.66 ? 33   MET B SD    1 
ATOM   6387  C  CE    . MET B 1 33  ? 26.497  38.199  53.381  1.00 25.43 ? 33   MET B CE    1 
ATOM   6388  N  N     . GLY B 1 34  ? 33.013  36.465  51.728  1.00 24.27 ? 34   GLY B N     1 
ATOM   6389  C  CA    . GLY B 1 34  ? 33.983  35.461  52.134  1.00 24.23 ? 34   GLY B CA    1 
ATOM   6390  C  C     . GLY B 1 34  ? 35.088  35.443  51.098  1.00 24.27 ? 34   GLY B C     1 
ATOM   6391  O  O     . GLY B 1 34  ? 35.880  36.393  51.013  1.00 24.29 ? 34   GLY B O     1 
ATOM   6392  N  N     . ASP B 1 35  ? 35.115  34.380  50.291  1.00 24.18 ? 35   ASP B N     1 
ATOM   6393  C  CA    . ASP B 1 35  ? 35.908  34.345  49.054  1.00 24.09 ? 35   ASP B CA    1 
ATOM   6394  C  C     . ASP B 1 35  ? 35.057  34.777  47.831  1.00 23.74 ? 35   ASP B C     1 
ATOM   6395  O  O     . ASP B 1 35  ? 35.346  34.403  46.692  1.00 23.81 ? 35   ASP B O     1 
ATOM   6396  C  CB    . ASP B 1 35  ? 36.502  32.934  48.844  1.00 24.07 ? 35   ASP B CB    1 
ATOM   6397  C  CG    . ASP B 1 35  ? 37.861  32.767  49.508  1.00 24.28 ? 35   ASP B CG    1 
ATOM   6398  O  OD1   . ASP B 1 35  ? 38.080  31.714  50.153  1.00 23.81 ? 35   ASP B OD1   1 
ATOM   6399  O  OD2   . ASP B 1 35  ? 38.769  33.636  49.432  1.00 24.38 ? 35   ASP B OD2   1 
ATOM   6400  N  N     . PHE B 1 36  ? 34.028  35.587  48.081  1.00 23.24 ? 36   PHE B N     1 
ATOM   6401  C  CA    . PHE B 1 36  ? 32.977  35.879  47.102  1.00 22.94 ? 36   PHE B CA    1 
ATOM   6402  C  C     . PHE B 1 36  ? 32.610  37.364  47.135  1.00 22.76 ? 36   PHE B C     1 
ATOM   6403  O  O     . PHE B 1 36  ? 32.818  38.034  48.143  1.00 22.66 ? 36   PHE B O     1 
ATOM   6404  C  CB    . PHE B 1 36  ? 31.709  35.082  47.454  1.00 22.85 ? 36   PHE B CB    1 
ATOM   6405  C  CG    . PHE B 1 36  ? 31.754  33.630  47.067  1.00 22.45 ? 36   PHE B CG    1 
ATOM   6406  C  CD1   . PHE B 1 36  ? 31.088  33.185  45.930  1.00 22.15 ? 36   PHE B CD1   1 
ATOM   6407  C  CD2   . PHE B 1 36  ? 32.425  32.698  47.862  1.00 22.19 ? 36   PHE B CD2   1 
ATOM   6408  C  CE1   . PHE B 1 36  ? 31.111  31.838  45.577  1.00 21.95 ? 36   PHE B CE1   1 
ATOM   6409  C  CE2   . PHE B 1 36  ? 32.453  31.352  47.515  1.00 21.46 ? 36   PHE B CE2   1 
ATOM   6410  C  CZ    . PHE B 1 36  ? 31.794  30.921  46.372  1.00 21.55 ? 36   PHE B CZ    1 
ATOM   6411  N  N     . TYR B 1 37  ? 32.050  37.876  46.041  1.00 22.76 ? 37   TYR B N     1 
ATOM   6412  C  CA    . TYR B 1 37  ? 31.365  39.179  46.059  1.00 22.63 ? 37   TYR B CA    1 
ATOM   6413  C  C     . TYR B 1 37  ? 29.891  38.890  45.869  1.00 22.53 ? 37   TYR B C     1 
ATOM   6414  O  O     . TYR B 1 37  ? 29.515  38.132  44.980  1.00 22.43 ? 37   TYR B O     1 
ATOM   6415  C  CB    . TYR B 1 37  ? 31.883  40.111  44.966  1.00 22.44 ? 37   TYR B CB    1 
ATOM   6416  C  CG    . TYR B 1 37  ? 33.298  40.575  45.206  1.00 22.67 ? 37   TYR B CG    1 
ATOM   6417  C  CD1   . TYR B 1 37  ? 33.569  41.661  46.034  1.00 22.87 ? 37   TYR B CD1   1 
ATOM   6418  C  CD2   . TYR B 1 37  ? 34.373  39.916  44.614  1.00 23.14 ? 37   TYR B CD2   1 
ATOM   6419  C  CE1   . TYR B 1 37  ? 34.884  42.088  46.260  1.00 23.05 ? 37   TYR B CE1   1 
ATOM   6420  C  CE2   . TYR B 1 37  ? 35.688  40.327  44.835  1.00 23.42 ? 37   TYR B CE2   1 
ATOM   6421  C  CZ    . TYR B 1 37  ? 35.945  41.416  45.657  1.00 23.38 ? 37   TYR B CZ    1 
ATOM   6422  O  OH    . TYR B 1 37  ? 37.257  41.818  45.873  1.00 22.14 ? 37   TYR B OH    1 
ATOM   6423  N  N     . GLU B 1 38  ? 29.059  39.475  46.716  1.00 22.54 ? 38   GLU B N     1 
ATOM   6424  C  CA    . GLU B 1 38  ? 27.665  39.090  46.779  1.00 22.79 ? 38   GLU B CA    1 
ATOM   6425  C  C     . GLU B 1 38  ? 26.775  40.306  46.600  1.00 23.18 ? 38   GLU B C     1 
ATOM   6426  O  O     . GLU B 1 38  ? 26.900  41.293  47.320  1.00 23.15 ? 38   GLU B O     1 
ATOM   6427  C  CB    . GLU B 1 38  ? 27.375  38.366  48.099  1.00 22.73 ? 38   GLU B CB    1 
ATOM   6428  C  CG    . GLU B 1 38  ? 28.001  36.967  48.176  1.00 22.56 ? 38   GLU B CG    1 
ATOM   6429  C  CD    . GLU B 1 38  ? 27.421  36.068  49.274  1.00 22.27 ? 38   GLU B CD    1 
ATOM   6430  O  OE1   . GLU B 1 38  ? 28.172  35.210  49.791  1.00 21.78 ? 38   GLU B OE1   1 
ATOM   6431  O  OE2   . GLU B 1 38  ? 26.223  36.192  49.623  1.00 21.75 ? 38   GLU B OE2   1 
ATOM   6432  N  N     . LEU B 1 39  ? 25.898  40.240  45.604  1.00 23.60 ? 39   LEU B N     1 
ATOM   6433  C  CA    . LEU B 1 39  ? 24.934  41.303  45.355  1.00 23.95 ? 39   LEU B CA    1 
ATOM   6434  C  C     . LEU B 1 39  ? 23.604  40.896  45.978  1.00 24.26 ? 39   LEU B C     1 
ATOM   6435  O  O     . LEU B 1 39  ? 23.213  39.729  45.905  1.00 24.17 ? 39   LEU B O     1 
ATOM   6436  C  CB    . LEU B 1 39  ? 24.765  41.543  43.847  1.00 24.07 ? 39   LEU B CB    1 
ATOM   6437  C  CG    . LEU B 1 39  ? 25.985  42.066  43.066  1.00 23.86 ? 39   LEU B CG    1 
ATOM   6438  C  CD1   . LEU B 1 39  ? 26.741  40.905  42.437  1.00 23.47 ? 39   LEU B CD1   1 
ATOM   6439  C  CD2   . LEU B 1 39  ? 25.586  43.087  41.998  1.00 23.47 ? 39   LEU B CD2   1 
ATOM   6440  N  N     . PHE B 1 40  ? 22.913  41.853  46.597  1.00 24.63 ? 40   PHE B N     1 
ATOM   6441  C  CA    . PHE B 1 40  ? 21.604  41.593  47.201  1.00 24.99 ? 40   PHE B CA    1 
ATOM   6442  C  C     . PHE B 1 40  ? 20.514  42.413  46.495  1.00 25.09 ? 40   PHE B C     1 
ATOM   6443  O  O     . PHE B 1 40  ? 20.643  42.709  45.316  1.00 24.96 ? 40   PHE B O     1 
ATOM   6444  C  CB    . PHE B 1 40  ? 21.639  41.842  48.720  1.00 25.07 ? 40   PHE B CB    1 
ATOM   6445  C  CG    . PHE B 1 40  ? 22.610  40.960  49.449  1.00 25.59 ? 40   PHE B CG    1 
ATOM   6446  C  CD1   . PHE B 1 40  ? 22.227  39.689  49.882  1.00 25.99 ? 40   PHE B CD1   1 
ATOM   6447  C  CD2   . PHE B 1 40  ? 23.913  41.392  49.694  1.00 25.68 ? 40   PHE B CD2   1 
ATOM   6448  C  CE1   . PHE B 1 40  ? 23.125  38.869  50.553  1.00 25.96 ? 40   PHE B CE1   1 
ATOM   6449  C  CE2   . PHE B 1 40  ? 24.816  40.582  50.362  1.00 25.71 ? 40   PHE B CE2   1 
ATOM   6450  C  CZ    . PHE B 1 40  ? 24.422  39.317  50.793  1.00 25.97 ? 40   PHE B CZ    1 
ATOM   6451  N  N     . TYR B 1 41  ? 19.491  42.845  47.218  1.00 25.31 ? 41   TYR B N     1 
ATOM   6452  C  CA    . TYR B 1 41  ? 18.179  43.212  46.664  1.00 25.39 ? 41   TYR B CA    1 
ATOM   6453  C  C     . TYR B 1 41  ? 18.269  44.098  45.412  1.00 25.39 ? 41   TYR B C     1 
ATOM   6454  O  O     . TYR B 1 41  ? 18.763  45.228  45.476  1.00 25.50 ? 41   TYR B O     1 
ATOM   6455  C  CB    . TYR B 1 41  ? 17.330  43.915  47.740  1.00 25.39 ? 41   TYR B CB    1 
ATOM   6456  C  CG    . TYR B 1 41  ? 16.911  43.039  48.925  1.00 25.82 ? 41   TYR B CG    1 
ATOM   6457  C  CD1   . TYR B 1 41  ? 17.833  42.660  49.907  1.00 25.94 ? 41   TYR B CD1   1 
ATOM   6458  C  CD2   . TYR B 1 41  ? 15.590  42.601  49.072  1.00 25.95 ? 41   TYR B CD2   1 
ATOM   6459  C  CE1   . TYR B 1 41  ? 17.456  41.861  50.988  1.00 25.76 ? 41   TYR B CE1   1 
ATOM   6460  C  CE2   . TYR B 1 41  ? 15.204  41.798  50.154  1.00 25.79 ? 41   TYR B CE2   1 
ATOM   6461  C  CZ    . TYR B 1 41  ? 16.143  41.434  51.105  1.00 25.76 ? 41   TYR B CZ    1 
ATOM   6462  O  OH    . TYR B 1 41  ? 15.777  40.646  52.171  1.00 24.97 ? 41   TYR B OH    1 
ATOM   6463  N  N     . ASP B 1 42  ? 17.808  43.564  44.278  1.00 25.25 ? 42   ASP B N     1 
ATOM   6464  C  CA    . ASP B 1 42  ? 17.647  44.328  43.028  1.00 25.02 ? 42   ASP B CA    1 
ATOM   6465  C  C     . ASP B 1 42  ? 18.909  44.803  42.317  1.00 24.86 ? 42   ASP B C     1 
ATOM   6466  O  O     . ASP B 1 42  ? 18.809  45.481  41.278  1.00 25.29 ? 42   ASP B O     1 
ATOM   6467  C  CB    . ASP B 1 42  ? 16.712  45.525  43.233  1.00 24.91 ? 42   ASP B CB    1 
ATOM   6468  C  CG    . ASP B 1 42  ? 15.432  45.391  42.500  1.00 24.87 ? 42   ASP B CG    1 
ATOM   6469  O  OD1   . ASP B 1 42  ? 14.402  45.825  43.047  1.00 24.93 ? 42   ASP B OD1   1 
ATOM   6470  O  OD2   . ASP B 1 42  ? 15.346  44.866  41.370  1.00 25.27 ? 42   ASP B OD2   1 
ATOM   6471  N  N     . ASP B 1 43  ? 20.089  44.552  42.875  1.00 24.64 ? 43   ASP B N     1 
ATOM   6472  C  CA    . ASP B 1 43  ? 21.307  44.465  42.079  1.00 24.36 ? 43   ASP B CA    1 
ATOM   6473  C  C     . ASP B 1 43  ? 21.423  43.015  41.627  1.00 24.11 ? 43   ASP B C     1 
ATOM   6474  O  O     . ASP B 1 43  ? 21.888  42.739  40.527  1.00 23.93 ? 43   ASP B O     1 
ATOM   6475  C  CB    . ASP B 1 43  ? 22.553  44.883  42.882  1.00 24.34 ? 43   ASP B CB    1 
ATOM   6476  C  CG    . ASP B 1 43  ? 22.555  46.369  43.256  1.00 23.89 ? 43   ASP B CG    1 
ATOM   6477  O  OD1   . ASP B 1 43  ? 21.736  47.132  42.695  1.00 23.66 ? 43   ASP B OD1   1 
ATOM   6478  O  OD2   . ASP B 1 43  ? 23.352  46.856  44.097  1.00 22.81 ? 43   ASP B OD2   1 
ATOM   6479  N  N     . ALA B 1 44  ? 20.966  42.106  42.488  1.00 24.00 ? 44   ALA B N     1 
ATOM   6480  C  CA    . ALA B 1 44  ? 21.037  40.665  42.265  1.00 23.98 ? 44   ALA B CA    1 
ATOM   6481  C  C     . ALA B 1 44  ? 20.071  40.192  41.190  1.00 24.07 ? 44   ALA B C     1 
ATOM   6482  O  O     . ALA B 1 44  ? 20.356  39.216  40.495  1.00 24.13 ? 44   ALA B O     1 
ATOM   6483  C  CB    . ALA B 1 44  ? 20.758  39.924  43.561  1.00 23.93 ? 44   ALA B CB    1 
ATOM   6484  N  N     . LYS B 1 45  ? 18.926  40.863  41.063  1.00 24.07 ? 45   LYS B N     1 
ATOM   6485  C  CA    . LYS B 1 45  ? 17.989  40.560  39.983  1.00 24.08 ? 45   LYS B CA    1 
ATOM   6486  C  C     . LYS B 1 45  ? 18.709  40.820  38.671  1.00 24.05 ? 45   LYS B C     1 
ATOM   6487  O  O     . LYS B 1 45  ? 18.979  39.896  37.906  1.00 24.23 ? 45   LYS B O     1 
ATOM   6488  C  CB    . LYS B 1 45  ? 16.731  41.433  40.075  1.00 24.10 ? 45   LYS B CB    1 
ATOM   6489  C  CG    . LYS B 1 45  ? 15.869  41.174  41.287  1.00 24.12 ? 45   LYS B CG    1 
ATOM   6490  C  CD    . LYS B 1 45  ? 15.032  39.927  41.118  1.00 24.28 ? 45   LYS B CD    1 
ATOM   6491  C  CE    . LYS B 1 45  ? 14.445  39.483  42.443  1.00 24.33 ? 45   LYS B CE    1 
ATOM   6492  N  NZ    . LYS B 1 45  ? 13.042  39.029  42.279  1.00 24.59 ? 45   LYS B NZ    1 
ATOM   6493  N  N     . ARG B 1 46  ? 19.029  42.090  38.450  1.00 24.04 ? 46   ARG B N     1 
ATOM   6494  C  CA    . ARG B 1 46  ? 19.871  42.554  37.354  1.00 24.06 ? 46   ARG B CA    1 
ATOM   6495  C  C     . ARG B 1 46  ? 21.130  41.722  37.057  1.00 23.71 ? 46   ARG B C     1 
ATOM   6496  O  O     . ARG B 1 46  ? 21.510  41.572  35.903  1.00 23.57 ? 46   ARG B O     1 
ATOM   6497  C  CB    . ARG B 1 46  ? 20.313  43.984  37.668  1.00 24.27 ? 46   ARG B CB    1 
ATOM   6498  C  CG    . ARG B 1 46  ? 19.460  45.068  37.053  1.00 25.42 ? 46   ARG B CG    1 
ATOM   6499  C  CD    . ARG B 1 46  ? 20.264  46.003  36.174  1.00 27.16 ? 46   ARG B CD    1 
ATOM   6500  N  NE    . ARG B 1 46  ? 19.414  46.960  35.474  1.00 28.92 ? 46   ARG B NE    1 
ATOM   6501  C  CZ    . ARG B 1 46  ? 19.067  46.894  34.190  1.00 30.54 ? 46   ARG B CZ    1 
ATOM   6502  N  NH1   . ARG B 1 46  ? 19.481  45.900  33.409  1.00 31.21 ? 46   ARG B NH1   1 
ATOM   6503  N  NH2   . ARG B 1 46  ? 18.287  47.841  33.677  1.00 31.56 ? 46   ARG B NH2   1 
ATOM   6504  N  N     . ALA B 1 47  ? 21.786  41.203  38.086  1.00 23.51 ? 47   ALA B N     1 
ATOM   6505  C  CA    . ALA B 1 47  ? 23.078  40.540  37.912  1.00 23.46 ? 47   ALA B CA    1 
ATOM   6506  C  C     . ALA B 1 47  ? 22.966  39.106  37.383  1.00 23.59 ? 47   ALA B C     1 
ATOM   6507  O  O     . ALA B 1 47  ? 23.819  38.678  36.607  1.00 23.37 ? 47   ALA B O     1 
ATOM   6508  C  CB    . ALA B 1 47  ? 23.856  40.561  39.213  1.00 23.46 ? 47   ALA B CB    1 
ATOM   6509  N  N     . SER B 1 48  ? 21.927  38.372  37.803  1.00 23.84 ? 48   SER B N     1 
ATOM   6510  C  CA    . SER B 1 48  ? 21.718  36.981  37.359  1.00 24.04 ? 48   SER B CA    1 
ATOM   6511  C  C     . SER B 1 48  ? 21.128  36.921  35.949  1.00 23.85 ? 48   SER B C     1 
ATOM   6512  O  O     . SER B 1 48  ? 21.207  35.885  35.285  1.00 23.65 ? 48   SER B O     1 
ATOM   6513  C  CB    . SER B 1 48  ? 20.849  36.155  38.341  1.00 24.15 ? 48   SER B CB    1 
ATOM   6514  O  OG    . SER B 1 48  ? 20.045  36.947  39.195  1.00 24.85 ? 48   SER B OG    1 
ATOM   6515  N  N     . GLN B 1 49  ? 20.546  38.034  35.509  1.00 23.81 ? 49   GLN B N     1 
ATOM   6516  C  CA    . GLN B 1 49  ? 20.012  38.168  34.155  1.00 23.88 ? 49   GLN B CA    1 
ATOM   6517  C  C     . GLN B 1 49  ? 21.103  38.604  33.155  1.00 23.71 ? 49   GLN B C     1 
ATOM   6518  O  O     . GLN B 1 49  ? 21.095  38.172  32.000  1.00 23.67 ? 49   GLN B O     1 
ATOM   6519  C  CB    . GLN B 1 49  ? 18.807  39.134  34.140  1.00 23.95 ? 49   GLN B CB    1 
ATOM   6520  C  CG    . GLN B 1 49  ? 19.094  40.555  33.607  1.00 24.56 ? 49   GLN B CG    1 
ATOM   6521  C  CD    . GLN B 1 49  ? 17.875  41.483  33.645  1.00 25.49 ? 49   GLN B CD    1 
ATOM   6522  O  OE1   . GLN B 1 49  ? 16.738  41.016  33.762  1.00 26.17 ? 49   GLN B OE1   1 
ATOM   6523  N  NE2   . GLN B 1 49  ? 18.113  42.798  33.543  1.00 25.35 ? 49   GLN B NE2   1 
ATOM   6524  N  N     . LEU B 1 50  ? 22.038  39.445  33.596  1.00 23.48 ? 50   LEU B N     1 
ATOM   6525  C  CA    . LEU B 1 50  ? 23.098  39.948  32.719  1.00 23.37 ? 50   LEU B CA    1 
ATOM   6526  C  C     . LEU B 1 50  ? 24.293  38.993  32.610  1.00 23.37 ? 50   LEU B C     1 
ATOM   6527  O  O     . LEU B 1 50  ? 25.120  39.148  31.711  1.00 23.20 ? 50   LEU B O     1 
ATOM   6528  C  CB    . LEU B 1 50  ? 23.601  41.310  33.204  1.00 23.35 ? 50   LEU B CB    1 
ATOM   6529  C  CG    . LEU B 1 50  ? 22.634  42.495  33.175  1.00 23.44 ? 50   LEU B CG    1 
ATOM   6530  C  CD1   . LEU B 1 50  ? 23.185  43.645  34.024  1.00 23.34 ? 50   LEU B CD1   1 
ATOM   6531  C  CD2   . LEU B 1 50  ? 22.384  42.960  31.762  1.00 23.60 ? 50   LEU B CD2   1 
ATOM   6532  N  N     . LEU B 1 51  ? 24.390  38.015  33.513  1.00 23.41 ? 51   LEU B N     1 
ATOM   6533  C  CA    . LEU B 1 51  ? 25.570  37.141  33.578  1.00 23.54 ? 51   LEU B CA    1 
ATOM   6534  C  C     . LEU B 1 51  ? 25.294  35.632  33.559  1.00 23.66 ? 51   LEU B C     1 
ATOM   6535  O  O     . LEU B 1 51  ? 26.230  34.838  33.659  1.00 23.80 ? 51   LEU B O     1 
ATOM   6536  C  CB    . LEU B 1 51  ? 26.376  37.472  34.831  1.00 23.52 ? 51   LEU B CB    1 
ATOM   6537  C  CG    . LEU B 1 51  ? 26.892  38.905  34.900  1.00 23.48 ? 51   LEU B CG    1 
ATOM   6538  C  CD1   . LEU B 1 51  ? 27.224  39.287  36.338  1.00 23.45 ? 51   LEU B CD1   1 
ATOM   6539  C  CD2   . LEU B 1 51  ? 28.106  39.052  33.988  1.00 23.86 ? 51   LEU B CD2   1 
ATOM   6540  N  N     . ASP B 1 52  ? 24.029  35.232  33.446  1.00 23.78 ? 52   ASP B N     1 
ATOM   6541  C  CA    . ASP B 1 52  ? 23.645  33.809  33.367  1.00 23.87 ? 52   ASP B CA    1 
ATOM   6542  C  C     . ASP B 1 52  ? 23.844  32.989  34.667  1.00 23.92 ? 52   ASP B C     1 
ATOM   6543  O  O     . ASP B 1 52  ? 23.551  31.781  34.688  1.00 23.67 ? 52   ASP B O     1 
ATOM   6544  C  CB    . ASP B 1 52  ? 24.339  33.109  32.173  1.00 23.81 ? 52   ASP B CB    1 
ATOM   6545  C  CG    . ASP B 1 52  ? 23.410  32.911  30.988  1.00 23.09 ? 52   ASP B CG    1 
ATOM   6546  O  OD1   . ASP B 1 52  ? 23.571  33.630  29.980  1.00 22.44 ? 52   ASP B OD1   1 
ATOM   6547  O  OD2   . ASP B 1 52  ? 22.496  32.064  30.973  1.00 22.01 ? 52   ASP B OD2   1 
ATOM   6548  N  N     . ILE B 1 53  ? 24.313  33.644  35.734  1.00 23.89 ? 53   ILE B N     1 
ATOM   6549  C  CA    . ILE B 1 53  ? 24.423  33.014  37.056  1.00 23.98 ? 53   ILE B CA    1 
ATOM   6550  C  C     . ILE B 1 53  ? 23.087  33.083  37.821  1.00 24.11 ? 53   ILE B C     1 
ATOM   6551  O  O     . ILE B 1 53  ? 22.199  33.859  37.465  1.00 24.05 ? 53   ILE B O     1 
ATOM   6552  C  CB    . ILE B 1 53  ? 25.583  33.639  37.889  1.00 23.99 ? 53   ILE B CB    1 
ATOM   6553  C  CG1   . ILE B 1 53  ? 25.243  35.085  38.312  1.00 23.88 ? 53   ILE B CG1   1 
ATOM   6554  C  CG2   . ILE B 1 53  ? 26.907  33.514  37.115  1.00 23.82 ? 53   ILE B CG2   1 
ATOM   6555  C  CD1   . ILE B 1 53  ? 26.429  35.936  38.721  1.00 23.50 ? 53   ILE B CD1   1 
ATOM   6556  N  N     . SER B 1 54  ? 22.973  32.269  38.874  1.00 24.29 ? 54   SER B N     1 
ATOM   6557  C  CA    . SER B 1 54  ? 21.701  32.018  39.575  1.00 24.29 ? 54   SER B CA    1 
ATOM   6558  C  C     . SER B 1 54  ? 21.486  32.954  40.766  1.00 24.57 ? 54   SER B C     1 
ATOM   6559  O  O     . SER B 1 54  ? 22.402  33.674  41.173  1.00 24.42 ? 54   SER B O     1 
ATOM   6560  C  CB    . SER B 1 54  ? 21.626  30.557  40.059  1.00 24.06 ? 54   SER B CB    1 
ATOM   6561  O  OG    . SER B 1 54  ? 22.086  29.656  39.071  1.00 22.99 ? 54   SER B OG    1 
ATOM   6562  N  N     . LEU B 1 55  ? 20.268  32.925  41.315  1.00 24.86 ? 55   LEU B N     1 
ATOM   6563  C  CA    . LEU B 1 55  ? 19.893  33.756  42.466  1.00 25.11 ? 55   LEU B CA    1 
ATOM   6564  C  C     . LEU B 1 55  ? 19.215  32.934  43.559  1.00 25.30 ? 55   LEU B C     1 
ATOM   6565  O  O     . LEU B 1 55  ? 18.642  31.886  43.278  1.00 25.55 ? 55   LEU B O     1 
ATOM   6566  C  CB    . LEU B 1 55  ? 18.974  34.908  42.019  1.00 25.18 ? 55   LEU B CB    1 
ATOM   6567  C  CG    . LEU B 1 55  ? 17.457  34.689  41.872  1.00 25.07 ? 55   LEU B CG    1 
ATOM   6568  C  CD1   . LEU B 1 55  ? 16.688  35.025  43.155  1.00 24.93 ? 55   LEU B CD1   1 
ATOM   6569  C  CD2   . LEU B 1 55  ? 16.925  35.528  40.719  1.00 25.06 ? 55   LEU B CD2   1 
ATOM   6570  N  N     . THR B 1 56  ? 19.284  33.411  44.802  1.00 25.40 ? 56   THR B N     1 
ATOM   6571  C  CA    . THR B 1 56  ? 18.517  32.820  45.902  1.00 25.54 ? 56   THR B CA    1 
ATOM   6572  C  C     . THR B 1 56  ? 18.024  33.897  46.856  1.00 25.47 ? 56   THR B C     1 
ATOM   6573  O  O     . THR B 1 56  ? 17.383  33.592  47.861  1.00 25.53 ? 56   THR B O     1 
ATOM   6574  C  CB    . THR B 1 56  ? 19.360  31.778  46.678  1.00 25.68 ? 56   THR B CB    1 
ATOM   6575  O  OG1   . THR B 1 56  ? 20.290  31.142  45.794  1.00 25.97 ? 56   THR B OG1   1 
ATOM   6576  C  CG2   . THR B 1 56  ? 18.483  30.621  47.192  1.00 25.68 ? 56   THR B CG2   1 
ATOM   6577  N  N     . PRO B 1 67  ? 17.291  38.000  48.345  1.00 24.76 ? 67   PRO B N     1 
ATOM   6578  C  CA    . PRO B 1 67  ? 17.627  38.040  46.916  1.00 24.60 ? 67   PRO B CA    1 
ATOM   6579  C  C     . PRO B 1 67  ? 19.136  38.139  46.668  1.00 24.40 ? 67   PRO B C     1 
ATOM   6580  O  O     . PRO B 1 67  ? 19.631  39.179  46.240  1.00 24.47 ? 67   PRO B O     1 
ATOM   6581  C  CB    . PRO B 1 67  ? 16.879  39.288  46.419  1.00 24.54 ? 67   PRO B CB    1 
ATOM   6582  C  CG    . PRO B 1 67  ? 15.680  39.396  47.320  1.00 24.68 ? 67   PRO B CG    1 
ATOM   6583  C  CD    . PRO B 1 67  ? 15.988  38.633  48.611  1.00 24.84 ? 67   PRO B CD    1 
ATOM   6584  N  N     . MET B 1 68  ? 19.843  37.044  46.930  1.00 24.17 ? 68   MET B N     1 
ATOM   6585  C  CA    . MET B 1 68  ? 21.299  36.972  46.778  1.00 24.02 ? 68   MET B CA    1 
ATOM   6586  C  C     . MET B 1 68  ? 21.737  36.814  45.311  1.00 23.80 ? 68   MET B C     1 
ATOM   6587  O  O     . MET B 1 68  ? 20.917  36.580  44.423  1.00 23.78 ? 68   MET B O     1 
ATOM   6588  C  CB    . MET B 1 68  ? 21.830  35.782  47.598  1.00 24.05 ? 68   MET B CB    1 
ATOM   6589  C  CG    . MET B 1 68  ? 23.316  35.837  47.970  1.00 24.26 ? 68   MET B CG    1 
ATOM   6590  S  SD    . MET B 1 68  ? 24.324  34.509  47.208  1.00 24.83 ? 68   MET B SD    1 
ATOM   6591  C  CE    . MET B 1 68  ? 23.762  33.017  48.160  1.00 24.87 ? 68   MET B CE    1 
ATOM   6592  N  N     . ALA B 1 69  ? 23.039  36.982  45.080  1.00 23.49 ? 69   ALA B N     1 
ATOM   6593  C  CA    . ALA B 1 69  ? 23.742  36.470  43.888  1.00 23.25 ? 69   ALA B CA    1 
ATOM   6594  C  C     . ALA B 1 69  ? 25.249  36.444  44.195  1.00 23.12 ? 69   ALA B C     1 
ATOM   6595  O  O     . ALA B 1 69  ? 25.685  37.071  45.158  1.00 23.16 ? 69   ALA B O     1 
ATOM   6596  C  CB    . ALA B 1 69  ? 23.446  37.314  42.672  1.00 23.16 ? 69   ALA B CB    1 
ATOM   6597  N  N     . GLY B 1 70  ? 26.054  35.725  43.415  1.00 23.06 ? 70   GLY B N     1 
ATOM   6598  C  CA    . GLY B 1 70  ? 27.461  35.585  43.775  1.00 23.18 ? 70   GLY B CA    1 
ATOM   6599  C  C     . GLY B 1 70  ? 28.455  35.241  42.682  1.00 23.33 ? 70   GLY B C     1 
ATOM   6600  O  O     . GLY B 1 70  ? 28.100  34.624  41.673  1.00 23.45 ? 70   GLY B O     1 
ATOM   6601  N  N     . ILE B 1 71  ? 29.711  35.645  42.899  1.00 23.43 ? 71   ILE B N     1 
ATOM   6602  C  CA    . ILE B 1 71  ? 30.826  35.302  42.010  1.00 23.58 ? 71   ILE B CA    1 
ATOM   6603  C  C     . ILE B 1 71  ? 32.112  35.040  42.810  1.00 23.64 ? 71   ILE B C     1 
ATOM   6604  O  O     . ILE B 1 71  ? 32.396  35.753  43.770  1.00 23.50 ? 71   ILE B O     1 
ATOM   6605  C  CB    . ILE B 1 71  ? 31.082  36.413  40.921  1.00 23.74 ? 71   ILE B CB    1 
ATOM   6606  C  CG1   . ILE B 1 71  ? 31.283  37.808  41.540  1.00 23.63 ? 71   ILE B CG1   1 
ATOM   6607  C  CG2   . ILE B 1 71  ? 29.948  36.445  39.880  1.00 23.86 ? 71   ILE B CG2   1 
ATOM   6608  C  CD1   . ILE B 1 71  ? 32.625  38.431  41.223  1.00 23.63 ? 71   ILE B CD1   1 
ATOM   6609  N  N     . PRO B 1 72  ? 32.890  34.024  42.423  1.00 23.87 ? 72   PRO B N     1 
ATOM   6610  C  CA    . PRO B 1 72  ? 34.166  33.750  43.100  1.00 24.05 ? 72   PRO B CA    1 
ATOM   6611  C  C     . PRO B 1 72  ? 35.141  34.920  42.991  1.00 24.19 ? 72   PRO B C     1 
ATOM   6612  O  O     . PRO B 1 72  ? 35.024  35.733  42.074  1.00 24.18 ? 72   PRO B O     1 
ATOM   6613  C  CB    . PRO B 1 72  ? 34.704  32.500  42.373  1.00 24.15 ? 72   PRO B CB    1 
ATOM   6614  C  CG    . PRO B 1 72  ? 33.950  32.419  41.092  1.00 23.90 ? 72   PRO B CG    1 
ATOM   6615  C  CD    . PRO B 1 72  ? 32.626  33.059  41.339  1.00 23.79 ? 72   PRO B CD    1 
ATOM   6616  N  N     . TYR B 1 73  ? 36.086  34.997  43.924  1.00 24.48 ? 73   TYR B N     1 
ATOM   6617  C  CA    . TYR B 1 73  ? 37.030  36.119  43.990  1.00 24.65 ? 73   TYR B CA    1 
ATOM   6618  C  C     . TYR B 1 73  ? 38.045  36.041  42.845  1.00 25.02 ? 73   TYR B C     1 
ATOM   6619  O  O     . TYR B 1 73  ? 38.447  37.069  42.288  1.00 25.13 ? 73   TYR B O     1 
ATOM   6620  C  CB    . TYR B 1 73  ? 37.749  36.145  45.349  1.00 24.58 ? 73   TYR B CB    1 
ATOM   6621  C  CG    . TYR B 1 73  ? 38.936  37.092  45.429  1.00 24.20 ? 73   TYR B CG    1 
ATOM   6622  C  CD1   . TYR B 1 73  ? 38.749  38.467  45.624  1.00 24.50 ? 73   TYR B CD1   1 
ATOM   6623  C  CD2   . TYR B 1 73  ? 40.243  36.616  45.313  1.00 23.42 ? 73   TYR B CD2   1 
ATOM   6624  C  CE1   . TYR B 1 73  ? 39.833  39.345  45.695  1.00 23.59 ? 73   TYR B CE1   1 
ATOM   6625  C  CE2   . TYR B 1 73  ? 41.329  37.479  45.385  1.00 23.65 ? 73   TYR B CE2   1 
ATOM   6626  C  CZ    . TYR B 1 73  ? 41.117  38.843  45.576  1.00 23.62 ? 73   TYR B CZ    1 
ATOM   6627  O  OH    . TYR B 1 73  ? 42.189  39.699  45.644  1.00 23.34 ? 73   TYR B OH    1 
ATOM   6628  N  N     . HIS B 1 74  ? 38.450  34.820  42.494  1.00 25.32 ? 74   HIS B N     1 
ATOM   6629  C  CA    . HIS B 1 74  ? 39.368  34.596  41.372  1.00 25.59 ? 74   HIS B CA    1 
ATOM   6630  C  C     . HIS B 1 74  ? 38.815  35.156  40.038  1.00 25.45 ? 74   HIS B C     1 
ATOM   6631  O  O     . HIS B 1 74  ? 39.584  35.497  39.138  1.00 25.49 ? 74   HIS B O     1 
ATOM   6632  C  CB    . HIS B 1 74  ? 39.725  33.099  41.271  1.00 25.72 ? 74   HIS B CB    1 
ATOM   6633  C  CG    . HIS B 1 74  ? 40.150  32.656  39.903  1.00 26.70 ? 74   HIS B CG    1 
ATOM   6634  N  ND1   . HIS B 1 74  ? 39.604  31.556  39.278  1.00 27.53 ? 74   HIS B ND1   1 
ATOM   6635  C  CD2   . HIS B 1 74  ? 41.071  33.159  39.044  1.00 27.61 ? 74   HIS B CD2   1 
ATOM   6636  C  CE1   . HIS B 1 74  ? 40.168  31.400  38.093  1.00 28.02 ? 74   HIS B CE1   1 
ATOM   6637  N  NE2   . HIS B 1 74  ? 41.056  32.363  37.924  1.00 27.90 ? 74   HIS B NE2   1 
ATOM   6638  N  N     . ALA B 1 75  ? 37.491  35.254  39.923  1.00 25.31 ? 75   ALA B N     1 
ATOM   6639  C  CA    . ALA B 1 75  ? 36.854  35.844  38.748  1.00 25.25 ? 75   ALA B CA    1 
ATOM   6640  C  C     . ALA B 1 75  ? 36.004  37.067  39.139  1.00 25.15 ? 75   ALA B C     1 
ATOM   6641  O  O     . ALA B 1 75  ? 34.787  36.967  39.309  1.00 25.17 ? 75   ALA B O     1 
ATOM   6642  C  CB    . ALA B 1 75  ? 36.013  34.785  38.006  1.00 24.99 ? 75   ALA B CB    1 
ATOM   6643  N  N     . VAL B 1 76  ? 36.658  38.212  39.307  1.00 24.99 ? 76   VAL B N     1 
ATOM   6644  C  CA    . VAL B 1 76  ? 35.940  39.481  39.472  1.00 24.99 ? 76   VAL B CA    1 
ATOM   6645  C  C     . VAL B 1 76  ? 36.168  40.341  38.265  1.00 25.16 ? 76   VAL B C     1 
ATOM   6646  O  O     . VAL B 1 76  ? 35.233  40.964  37.771  1.00 25.08 ? 76   VAL B O     1 
ATOM   6647  C  CB    . VAL B 1 76  ? 36.367  40.334  40.683  1.00 24.82 ? 76   VAL B CB    1 
ATOM   6648  C  CG1   . VAL B 1 76  ? 35.143  40.784  41.425  1.00 24.82 ? 76   VAL B CG1   1 
ATOM   6649  C  CG2   . VAL B 1 76  ? 37.309  39.605  41.609  1.00 25.07 ? 76   VAL B CG2   1 
ATOM   6650  N  N     . GLU B 1 77  ? 37.425  40.402  37.824  1.00 25.37 ? 77   GLU B N     1 
ATOM   6651  C  CA    . GLU B 1 77  ? 37.786  41.083  36.584  1.00 25.51 ? 77   GLU B CA    1 
ATOM   6652  C  C     . GLU B 1 77  ? 37.103  40.394  35.383  1.00 25.76 ? 77   GLU B C     1 
ATOM   6653  O  O     . GLU B 1 77  ? 36.729  41.050  34.410  1.00 25.55 ? 77   GLU B O     1 
ATOM   6654  C  CB    . GLU B 1 77  ? 39.315  41.124  36.388  1.00 25.34 ? 77   GLU B CB    1 
ATOM   6655  C  CG    . GLU B 1 77  ? 40.126  41.761  37.520  1.00 25.43 ? 77   GLU B CG    1 
ATOM   6656  C  CD    . GLU B 1 77  ? 40.062  43.290  37.553  1.00 25.46 ? 77   GLU B CD    1 
ATOM   6657  O  OE1   . GLU B 1 77  ? 40.495  43.964  36.574  1.00 24.03 ? 77   GLU B OE1   1 
ATOM   6658  O  OE2   . GLU B 1 77  ? 39.598  43.819  38.587  1.00 23.94 ? 77   GLU B OE2   1 
ATOM   6659  N  N     . ASN B 1 78  ? 36.922  39.076  35.463  1.00 26.28 ? 78   ASN B N     1 
ATOM   6660  C  CA    . ASN B 1 78  ? 36.219  38.343  34.406  1.00 26.57 ? 78   ASN B CA    1 
ATOM   6661  C  C     . ASN B 1 78  ? 34.705  38.605  34.403  1.00 26.59 ? 78   ASN B C     1 
ATOM   6662  O  O     . ASN B 1 78  ? 34.088  38.588  33.335  1.00 26.85 ? 78   ASN B O     1 
ATOM   6663  C  CB    . ASN B 1 78  ? 36.508  36.840  34.479  1.00 26.57 ? 78   ASN B CB    1 
ATOM   6664  C  CG    . ASN B 1 78  ? 36.190  36.129  33.180  1.00 27.20 ? 78   ASN B CG    1 
ATOM   6665  O  OD1   . ASN B 1 78  ? 36.610  36.571  32.107  1.00 27.93 ? 78   ASN B OD1   1 
ATOM   6666  N  ND2   . ASN B 1 78  ? 35.436  35.025  33.264  1.00 27.39 ? 78   ASN B ND2   1 
ATOM   6667  N  N     . TYR B 1 79  ? 34.121  38.843  35.583  1.00 26.48 ? 79   TYR B N     1 
ATOM   6668  C  CA    . TYR B 1 79  ? 32.711  39.246  35.706  1.00 26.50 ? 79   TYR B CA    1 
ATOM   6669  C  C     . TYR B 1 79  ? 32.490  40.782  35.720  1.00 26.51 ? 79   TYR B C     1 
ATOM   6670  O  O     . TYR B 1 79  ? 31.369  41.249  35.536  1.00 26.64 ? 79   TYR B O     1 
ATOM   6671  C  CB    . TYR B 1 79  ? 32.083  38.602  36.946  1.00 26.28 ? 79   TYR B CB    1 
ATOM   6672  C  CG    . TYR B 1 79  ? 31.752  37.130  36.751  1.00 27.35 ? 79   TYR B CG    1 
ATOM   6673  C  CD1   . TYR B 1 79  ? 30.467  36.721  36.381  1.00 27.56 ? 79   TYR B CD1   1 
ATOM   6674  C  CD2   . TYR B 1 79  ? 32.726  36.135  36.927  1.00 27.73 ? 79   TYR B CD2   1 
ATOM   6675  C  CE1   . TYR B 1 79  ? 30.164  35.365  36.198  1.00 27.03 ? 79   TYR B CE1   1 
ATOM   6676  C  CE2   . TYR B 1 79  ? 32.426  34.778  36.745  1.00 26.49 ? 79   TYR B CE2   1 
ATOM   6677  C  CZ    . TYR B 1 79  ? 31.146  34.406  36.385  1.00 26.61 ? 79   TYR B CZ    1 
ATOM   6678  O  OH    . TYR B 1 79  ? 30.838  33.077  36.210  1.00 26.24 ? 79   TYR B OH    1 
ATOM   6679  N  N     . LEU B 1 80  ? 33.551  41.559  35.919  1.00 26.33 ? 80   LEU B N     1 
ATOM   6680  C  CA    . LEU B 1 80  ? 33.445  43.017  35.874  1.00 26.46 ? 80   LEU B CA    1 
ATOM   6681  C  C     . LEU B 1 80  ? 33.520  43.494  34.429  1.00 26.70 ? 80   LEU B C     1 
ATOM   6682  O  O     . LEU B 1 80  ? 33.024  44.576  34.101  1.00 26.62 ? 80   LEU B O     1 
ATOM   6683  C  CB    . LEU B 1 80  ? 34.574  43.702  36.663  1.00 26.37 ? 80   LEU B CB    1 
ATOM   6684  C  CG    . LEU B 1 80  ? 34.380  43.948  38.159  1.00 25.75 ? 80   LEU B CG    1 
ATOM   6685  C  CD1   . LEU B 1 80  ? 35.645  44.515  38.791  1.00 25.07 ? 80   LEU B CD1   1 
ATOM   6686  C  CD2   . LEU B 1 80  ? 33.213  44.859  38.382  1.00 25.22 ? 80   LEU B CD2   1 
ATOM   6687  N  N     . ALA B 1 81  ? 34.178  42.695  33.586  1.00 26.63 ? 81   ALA B N     1 
ATOM   6688  C  CA    . ALA B 1 81  ? 34.410  43.051  32.191  1.00 26.37 ? 81   ALA B CA    1 
ATOM   6689  C  C     . ALA B 1 81  ? 33.134  42.853  31.396  1.00 26.05 ? 81   ALA B C     1 
ATOM   6690  O  O     . ALA B 1 81  ? 32.897  43.568  30.416  1.00 26.18 ? 81   ALA B O     1 
ATOM   6691  C  CB    . ALA B 1 81  ? 35.541  42.209  31.595  1.00 26.39 ? 81   ALA B CB    1 
ATOM   6692  N  N     . LYS B 1 82  ? 32.318  41.887  31.822  1.00 25.39 ? 82   LYS B N     1 
ATOM   6693  C  CA    . LYS B 1 82  ? 31.032  41.641  31.185  1.00 24.91 ? 82   LYS B CA    1 
ATOM   6694  C  C     . LYS B 1 82  ? 30.094  42.763  31.580  1.00 24.35 ? 82   LYS B C     1 
ATOM   6695  O  O     . LYS B 1 82  ? 29.594  43.470  30.719  1.00 24.37 ? 82   LYS B O     1 
ATOM   6696  C  CB    . LYS B 1 82  ? 30.464  40.267  31.559  1.00 24.76 ? 82   LYS B CB    1 
ATOM   6697  C  CG    . LYS B 1 82  ? 31.241  39.106  30.932  1.00 24.68 ? 82   LYS B CG    1 
ATOM   6698  C  CD    . LYS B 1 82  ? 31.131  37.811  31.749  1.00 24.55 ? 82   LYS B CD    1 
ATOM   6699  C  CE    . LYS B 1 82  ? 31.863  36.628  31.096  1.00 23.59 ? 82   LYS B CE    1 
ATOM   6700  N  NZ    . LYS B 1 82  ? 32.112  35.543  32.088  1.00 22.72 ? 82   LYS B NZ    1 
ATOM   6701  N  N     . LEU B 1 83  ? 29.900  42.957  32.879  1.00 23.78 ? 83   LEU B N     1 
ATOM   6702  C  CA    . LEU B 1 83  ? 29.015  44.018  33.368  1.00 23.50 ? 83   LEU B CA    1 
ATOM   6703  C  C     . LEU B 1 83  ? 29.391  45.397  32.822  1.00 23.17 ? 83   LEU B C     1 
ATOM   6704  O  O     . LEU B 1 83  ? 28.523  46.208  32.502  1.00 23.04 ? 83   LEU B O     1 
ATOM   6705  C  CB    . LEU B 1 83  ? 29.035  44.065  34.892  1.00 23.50 ? 83   LEU B CB    1 
ATOM   6706  C  CG    . LEU B 1 83  ? 28.454  42.829  35.579  1.00 23.81 ? 83   LEU B CG    1 
ATOM   6707  C  CD1   . LEU B 1 83  ? 28.775  42.863  37.065  1.00 23.94 ? 83   LEU B CD1   1 
ATOM   6708  C  CD2   . LEU B 1 83  ? 26.954  42.728  35.352  1.00 23.80 ? 83   LEU B CD2   1 
ATOM   6709  N  N     . VAL B 1 84  ? 30.683  45.654  32.694  1.00 22.69 ? 84   VAL B N     1 
ATOM   6710  C  CA    . VAL B 1 84  ? 31.130  46.955  32.234  1.00 22.49 ? 84   VAL B CA    1 
ATOM   6711  C  C     . VAL B 1 84  ? 30.954  47.141  30.726  1.00 22.28 ? 84   VAL B C     1 
ATOM   6712  O  O     . VAL B 1 84  ? 30.774  48.268  30.276  1.00 22.79 ? 84   VAL B O     1 
ATOM   6713  C  CB    . VAL B 1 84  ? 32.572  47.279  32.723  1.00 22.61 ? 84   VAL B CB    1 
ATOM   6714  C  CG1   . VAL B 1 84  ? 33.538  47.583  31.578  1.00 22.79 ? 84   VAL B CG1   1 
ATOM   6715  C  CG2   . VAL B 1 84  ? 32.527  48.414  33.724  1.00 21.81 ? 84   VAL B CG2   1 
ATOM   6716  N  N     . ASN B 1 85  ? 30.990  46.064  29.940  1.00 21.63 ? 85   ASN B N     1 
ATOM   6717  C  CA    . ASN B 1 85  ? 30.665  46.180  28.513  1.00 20.95 ? 85   ASN B CA    1 
ATOM   6718  C  C     . ASN B 1 85  ? 29.161  45.920  28.234  1.00 20.22 ? 85   ASN B C     1 
ATOM   6719  O  O     . ASN B 1 85  ? 28.759  45.639  27.107  1.00 20.48 ? 85   ASN B O     1 
ATOM   6720  C  CB    . ASN B 1 85  ? 31.633  45.344  27.639  1.00 20.97 ? 85   ASN B CB    1 
ATOM   6721  C  CG    . ASN B 1 85  ? 31.092  43.975  27.285  1.00 21.38 ? 85   ASN B CG    1 
ATOM   6722  O  OD1   . ASN B 1 85  ? 30.842  43.151  28.161  1.00 23.12 ? 85   ASN B OD1   1 
ATOM   6723  N  ND2   . ASN B 1 85  ? 30.903  43.725  25.996  1.00 20.86 ? 85   ASN B ND2   1 
ATOM   6724  N  N     . GLN B 1 86  ? 28.331  46.022  29.269  1.00 19.09 ? 86   GLN B N     1 
ATOM   6725  C  CA    . GLN B 1 86  ? 26.884  46.154  29.091  1.00 18.11 ? 86   GLN B CA    1 
ATOM   6726  C  C     . GLN B 1 86  ? 26.399  47.453  29.735  1.00 17.34 ? 86   GLN B C     1 
ATOM   6727  O  O     . GLN B 1 86  ? 25.222  47.599  30.032  1.00 17.35 ? 86   GLN B O     1 
ATOM   6728  C  CB    . GLN B 1 86  ? 26.157  44.942  29.662  1.00 17.80 ? 86   GLN B CB    1 
ATOM   6729  C  CG    . GLN B 1 86  ? 26.907  43.672  29.382  1.00 17.74 ? 86   GLN B CG    1 
ATOM   6730  C  CD    . GLN B 1 86  ? 26.067  42.431  29.484  1.00 17.20 ? 86   GLN B CD    1 
ATOM   6731  O  OE1   . GLN B 1 86  ? 26.304  41.594  30.361  1.00 16.58 ? 86   GLN B OE1   1 
ATOM   6732  N  NE2   . GLN B 1 86  ? 25.093  42.292  28.586  1.00 16.04 ? 86   GLN B NE2   1 
ATOM   6733  N  N     . GLY B 1 87  ? 27.316  48.398  29.928  1.00 16.43 ? 87   GLY B N     1 
ATOM   6734  C  CA    . GLY B 1 87  ? 26.974  49.739  30.362  1.00 15.95 ? 87   GLY B CA    1 
ATOM   6735  C  C     . GLY B 1 87  ? 26.663  49.892  31.837  1.00 15.55 ? 87   GLY B C     1 
ATOM   6736  O  O     . GLY B 1 87  ? 25.893  50.771  32.207  1.00 15.49 ? 87   GLY B O     1 
ATOM   6737  N  N     . GLU B 1 88  ? 27.258  49.043  32.673  1.00 15.18 ? 88   GLU B N     1 
ATOM   6738  C  CA    . GLU B 1 88  ? 26.986  49.037  34.102  1.00 14.72 ? 88   GLU B CA    1 
ATOM   6739  C  C     . GLU B 1 88  ? 28.250  49.398  34.846  1.00 14.41 ? 88   GLU B C     1 
ATOM   6740  O  O     . GLU B 1 88  ? 29.309  48.826  34.598  1.00 14.06 ? 88   GLU B O     1 
ATOM   6741  C  CB    . GLU B 1 88  ? 26.538  47.653  34.581  1.00 14.92 ? 88   GLU B CB    1 
ATOM   6742  C  CG    . GLU B 1 88  ? 25.263  47.097  33.951  1.00 15.46 ? 88   GLU B CG    1 
ATOM   6743  C  CD    . GLU B 1 88  ? 23.984  47.733  34.477  1.00 15.67 ? 88   GLU B CD    1 
ATOM   6744  O  OE1   . GLU B 1 88  ? 24.006  48.321  35.584  1.00 15.61 ? 88   GLU B OE1   1 
ATOM   6745  O  OE2   . GLU B 1 88  ? 22.949  47.636  33.774  1.00 15.29 ? 88   GLU B OE2   1 
ATOM   6746  N  N     . SER B 1 89  ? 28.137  50.336  35.773  1.00 14.18 ? 89   SER B N     1 
ATOM   6747  C  CA    . SER B 1 89  ? 29.208  50.568  36.716  1.00 14.38 ? 89   SER B CA    1 
ATOM   6748  C  C     . SER B 1 89  ? 29.051  49.559  37.837  1.00 14.63 ? 89   SER B C     1 
ATOM   6749  O  O     . SER B 1 89  ? 27.957  49.048  38.104  1.00 14.23 ? 89   SER B O     1 
ATOM   6750  C  CB    . SER B 1 89  ? 29.173  51.991  37.275  1.00 14.47 ? 89   SER B CB    1 
ATOM   6751  O  OG    . SER B 1 89  ? 28.798  52.930  36.282  1.00 14.33 ? 89   SER B OG    1 
ATOM   6752  N  N     . VAL B 1 90  ? 30.165  49.267  38.486  1.00 14.96 ? 90   VAL B N     1 
ATOM   6753  C  CA    . VAL B 1 90  ? 30.193  48.349  39.602  1.00 14.88 ? 90   VAL B CA    1 
ATOM   6754  C  C     . VAL B 1 90  ? 30.988  48.997  40.728  1.00 14.96 ? 90   VAL B C     1 
ATOM   6755  O  O     . VAL B 1 90  ? 32.014  49.622  40.500  1.00 14.69 ? 90   VAL B O     1 
ATOM   6756  C  CB    . VAL B 1 90  ? 30.820  47.000  39.188  1.00 14.72 ? 90   VAL B CB    1 
ATOM   6757  C  CG1   . VAL B 1 90  ? 30.595  45.938  40.257  1.00 15.20 ? 90   VAL B CG1   1 
ATOM   6758  C  CG2   . VAL B 1 90  ? 30.234  46.526  37.888  1.00 14.57 ? 90   VAL B CG2   1 
ATOM   6759  N  N     . ALA B 1 91  ? 30.497  48.852  41.947  1.00 15.20 ? 91   ALA B N     1 
ATOM   6760  C  CA    . ALA B 1 91  ? 31.194  49.345  43.115  1.00 15.35 ? 91   ALA B CA    1 
ATOM   6761  C  C     . ALA B 1 91  ? 31.534  48.128  43.943  1.00 15.59 ? 91   ALA B C     1 
ATOM   6762  O  O     . ALA B 1 91  ? 30.667  47.314  44.197  1.00 15.63 ? 91   ALA B O     1 
ATOM   6763  C  CB    . ALA B 1 91  ? 30.309  50.306  43.891  1.00 15.14 ? 91   ALA B CB    1 
ATOM   6764  N  N     . ILE B 1 92  ? 32.799  48.013  44.340  1.00 16.26 ? 92   ILE B N     1 
ATOM   6765  C  CA    . ILE B 1 92  ? 33.297  46.934  45.185  1.00 16.80 ? 92   ILE B CA    1 
ATOM   6766  C  C     . ILE B 1 92  ? 33.326  47.385  46.644  1.00 17.05 ? 92   ILE B C     1 
ATOM   6767  O  O     . ILE B 1 92  ? 33.492  48.559  46.935  1.00 16.93 ? 92   ILE B O     1 
ATOM   6768  C  CB    . ILE B 1 92  ? 34.724  46.531  44.731  1.00 17.17 ? 92   ILE B CB    1 
ATOM   6769  C  CG1   . ILE B 1 92  ? 34.790  46.341  43.210  1.00 17.52 ? 92   ILE B CG1   1 
ATOM   6770  C  CG2   . ILE B 1 92  ? 35.189  45.254  45.425  1.00 17.68 ? 92   ILE B CG2   1 
ATOM   6771  C  CD1   . ILE B 1 92  ? 33.702  45.476  42.647  1.00 18.35 ? 92   ILE B CD1   1 
ATOM   6772  N  N     . CYS B 1 93  ? 33.199  46.433  47.560  1.00 17.60 ? 93   CYS B N     1 
ATOM   6773  C  CA    . CYS B 1 93  ? 33.091  46.726  48.987  1.00 17.85 ? 93   CYS B CA    1 
ATOM   6774  C  C     . CYS B 1 93  ? 33.894  45.736  49.875  1.00 18.05 ? 93   CYS B C     1 
ATOM   6775  O  O     . CYS B 1 93  ? 33.715  44.515  49.783  1.00 18.19 ? 93   CYS B O     1 
ATOM   6776  C  CB    . CYS B 1 93  ? 31.615  46.703  49.362  1.00 17.68 ? 93   CYS B CB    1 
ATOM   6777  S  SG    . CYS B 1 93  ? 31.327  47.228  51.037  1.00 18.12 ? 93   CYS B SG    1 
ATOM   6778  N  N     . GLU B 1 94  ? 34.780  46.268  50.725  1.00 18.16 ? 94   GLU B N     1 
ATOM   6779  C  CA    . GLU B 1 94  ? 35.655  45.444  51.586  1.00 17.92 ? 94   GLU B CA    1 
ATOM   6780  C  C     . GLU B 1 94  ? 35.783  46.041  52.989  1.00 17.99 ? 94   GLU B C     1 
ATOM   6781  O  O     . GLU B 1 94  ? 36.581  45.571  53.820  1.00 18.32 ? 94   GLU B O     1 
ATOM   6782  C  CB    . GLU B 1 94  ? 37.065  45.262  50.978  1.00 17.80 ? 94   GLU B CB    1 
ATOM   6783  C  CG    . GLU B 1 94  ? 37.211  45.490  49.463  1.00 17.42 ? 94   GLU B CG    1 
ATOM   6784  C  CD    . GLU B 1 94  ? 37.861  44.327  48.718  1.00 16.71 ? 94   GLU B CD    1 
ATOM   6785  O  OE1   . GLU B 1 94  ? 37.681  44.241  47.487  1.00 15.13 ? 94   GLU B OE1   1 
ATOM   6786  O  OE2   . GLU B 1 94  ? 38.551  43.496  49.349  1.00 17.16 ? 94   GLU B OE2   1 
ATOM   6787  N  N     . ARG B 1 108 ? 33.665  47.963  56.951  1.00 19.26 ? 108  ARG B N     1 
ATOM   6788  C  CA    . ARG B 1 108 ? 33.774  47.857  55.492  1.00 19.66 ? 108  ARG B CA    1 
ATOM   6789  C  C     . ARG B 1 108 ? 33.227  49.109  54.794  1.00 18.93 ? 108  ARG B C     1 
ATOM   6790  O  O     . ARG B 1 108 ? 32.266  49.704  55.265  1.00 19.04 ? 108  ARG B O     1 
ATOM   6791  C  CB    . ARG B 1 108 ? 33.036  46.600  54.982  1.00 20.02 ? 108  ARG B CB    1 
ATOM   6792  C  CG    . ARG B 1 108 ? 33.496  45.281  55.656  1.00 21.59 ? 108  ARG B CG    1 
ATOM   6793  C  CD    . ARG B 1 108 ? 33.528  44.024  54.739  1.00 23.50 ? 108  ARG B CD    1 
ATOM   6794  N  NE    . ARG B 1 108 ? 34.744  43.205  54.937  1.00 25.05 ? 108  ARG B NE    1 
ATOM   6795  C  CZ    . ARG B 1 108 ? 34.940  42.306  55.925  1.00 24.70 ? 108  ARG B CZ    1 
ATOM   6796  N  NH1   . ARG B 1 108 ? 34.008  42.069  56.842  1.00 23.78 ? 108  ARG B NH1   1 
ATOM   6797  N  NH2   . ARG B 1 108 ? 36.088  41.636  55.993  1.00 24.20 ? 108  ARG B NH2   1 
ATOM   6798  N  N     . LYS B 1 109 ? 33.839  49.486  53.668  1.00 18.35 ? 109  LYS B N     1 
ATOM   6799  C  CA    . LYS B 1 109 ? 33.474  50.705  52.902  1.00 17.65 ? 109  LYS B CA    1 
ATOM   6800  C  C     . LYS B 1 109 ? 33.826  50.555  51.407  1.00 17.11 ? 109  LYS B C     1 
ATOM   6801  O  O     . LYS B 1 109 ? 34.711  49.772  51.055  1.00 17.16 ? 109  LYS B O     1 
ATOM   6802  C  CB    . LYS B 1 109 ? 34.129  51.957  53.552  1.00 17.70 ? 109  LYS B CB    1 
ATOM   6803  C  CG    . LYS B 1 109 ? 34.830  53.002  52.638  1.00 16.67 ? 109  LYS B CG    1 
ATOM   6804  C  CD    . LYS B 1 109 ? 36.323  52.685  52.419  1.00 15.65 ? 109  LYS B CD    1 
ATOM   6805  C  CE    . LYS B 1 109 ? 37.213  53.949  52.382  1.00 15.09 ? 109  LYS B CE    1 
ATOM   6806  N  NZ    . LYS B 1 109 ? 36.641  55.072  51.605  1.00 11.60 ? 109  LYS B NZ    1 
ATOM   6807  N  N     . VAL B 1 110 ? 33.128  51.290  50.533  1.00 16.50 ? 110  VAL B N     1 
ATOM   6808  C  CA    . VAL B 1 110 ? 33.293  51.142  49.071  1.00 15.98 ? 110  VAL B CA    1 
ATOM   6809  C  C     . VAL B 1 110 ? 34.669  51.605  48.579  1.00 15.36 ? 110  VAL B C     1 
ATOM   6810  O  O     . VAL B 1 110 ? 34.924  52.803  48.507  1.00 15.26 ? 110  VAL B O     1 
ATOM   6811  C  CB    . VAL B 1 110 ? 32.196  51.896  48.285  1.00 16.05 ? 110  VAL B CB    1 
ATOM   6812  C  CG1   . VAL B 1 110 ? 32.510  51.929  46.805  1.00 16.08 ? 110  VAL B CG1   1 
ATOM   6813  C  CG2   . VAL B 1 110 ? 30.850  51.234  48.485  1.00 16.58 ? 110  VAL B CG2   1 
ATOM   6814  N  N     . VAL B 1 111 ? 35.513  50.639  48.197  1.00 14.68 ? 111  VAL B N     1 
ATOM   6815  C  CA    . VAL B 1 111 ? 36.951  50.838  47.958  1.00 14.05 ? 111  VAL B CA    1 
ATOM   6816  C  C     . VAL B 1 111 ? 37.326  50.981  46.470  1.00 13.31 ? 111  VAL B C     1 
ATOM   6817  O  O     . VAL B 1 111 ? 38.438  51.401  46.136  1.00 13.18 ? 111  VAL B O     1 
ATOM   6818  C  CB    . VAL B 1 111 ? 37.778  49.674  48.635  1.00 14.12 ? 111  VAL B CB    1 
ATOM   6819  C  CG1   . VAL B 1 111 ? 38.418  48.721  47.615  1.00 14.16 ? 111  VAL B CG1   1 
ATOM   6820  C  CG2   . VAL B 1 111 ? 38.832  50.233  49.593  1.00 14.75 ? 111  VAL B CG2   1 
ATOM   6821  N  N     . ARG B 1 112 ? 36.399  50.648  45.582  1.00 12.39 ? 112  ARG B N     1 
ATOM   6822  C  CA    . ARG B 1 112 ? 36.672  50.686  44.157  1.00 11.77 ? 112  ARG B CA    1 
ATOM   6823  C  C     . ARG B 1 112 ? 35.390  50.829  43.341  1.00 11.60 ? 112  ARG B C     1 
ATOM   6824  O  O     . ARG B 1 112 ? 34.386  50.187  43.643  1.00 10.91 ? 112  ARG B O     1 
ATOM   6825  C  CB    . ARG B 1 112 ? 37.397  49.416  43.764  1.00 11.83 ? 112  ARG B CB    1 
ATOM   6826  C  CG    . ARG B 1 112 ? 37.833  49.338  42.334  1.00 11.83 ? 112  ARG B CG    1 
ATOM   6827  C  CD    . ARG B 1 112 ? 38.483  48.031  42.023  1.00 12.32 ? 112  ARG B CD    1 
ATOM   6828  N  NE    . ARG B 1 112 ? 38.621  47.825  40.592  1.00 13.01 ? 112  ARG B NE    1 
ATOM   6829  C  CZ    . ARG B 1 112 ? 38.946  46.672  40.037  1.00 13.02 ? 112  ARG B CZ    1 
ATOM   6830  N  NH1   . ARG B 1 112 ? 39.180  45.614  40.794  1.00 12.57 ? 112  ARG B NH1   1 
ATOM   6831  N  NH2   . ARG B 1 112 ? 39.042  46.583  38.714  1.00 14.26 ? 112  ARG B NH2   1 
ATOM   6832  N  N     . ILE B 1 113 ? 35.435  51.698  42.322  1.00 11.32 ? 113  ILE B N     1 
ATOM   6833  C  CA    . ILE B 1 113 ? 34.330  51.856  41.383  1.00 10.88 ? 113  ILE B CA    1 
ATOM   6834  C  C     . ILE B 1 113 ? 34.848  51.862  39.970  1.00 11.00 ? 113  ILE B C     1 
ATOM   6835  O  O     . ILE B 1 113 ? 35.688  52.684  39.592  1.00 11.51 ? 113  ILE B O     1 
ATOM   6836  C  CB    . ILE B 1 113 ? 33.551  53.141  41.621  1.00 10.68 ? 113  ILE B CB    1 
ATOM   6837  C  CG1   . ILE B 1 113 ? 33.087  53.201  43.075  1.00 11.46 ? 113  ILE B CG1   1 
ATOM   6838  C  CG2   . ILE B 1 113 ? 32.360  53.222  40.649  1.00 10.44 ? 113  ILE B CG2   1 
ATOM   6839  C  CD1   . ILE B 1 113 ? 31.996  54.206  43.334  1.00 11.99 ? 113  ILE B CD1   1 
ATOM   6840  N  N     . VAL B 1 114 ? 34.319  50.950  39.175  1.00 10.80 ? 114  VAL B N     1 
ATOM   6841  C  CA    . VAL B 1 114 ? 34.666  50.882  37.783  1.00 10.52 ? 114  VAL B CA    1 
ATOM   6842  C  C     . VAL B 1 114 ? 33.454  51.318  37.024  1.00 10.36 ? 114  VAL B C     1 
ATOM   6843  O  O     . VAL B 1 114 ? 32.338  50.960  37.367  1.00 11.00 ? 114  VAL B O     1 
ATOM   6844  C  CB    . VAL B 1 114 ? 35.139  49.470  37.404  1.00 10.71 ? 114  VAL B CB    1 
ATOM   6845  C  CG1   . VAL B 1 114 ? 36.202  48.995  38.430  1.00 10.78 ? 114  VAL B CG1   1 
ATOM   6846  C  CG2   . VAL B 1 114 ? 33.996  48.492  37.329  1.00 10.44 ? 114  VAL B CG2   1 
ATOM   6847  N  N     . THR B 1 115 ? 33.665  52.137  36.012  1.00 10.14 ? 115  THR B N     1 
ATOM   6848  C  CA    . THR B 1 115 ? 32.580  52.556  35.142  1.00 9.93  ? 115  THR B CA    1 
ATOM   6849  C  C     . THR B 1 115 ? 33.003  52.158  33.739  1.00 10.39 ? 115  THR B C     1 
ATOM   6850  O  O     . THR B 1 115 ? 34.196  52.064  33.492  1.00 10.43 ? 115  THR B O     1 
ATOM   6851  C  CB    . THR B 1 115 ? 32.285  54.106  35.295  1.00 9.87  ? 115  THR B CB    1 
ATOM   6852  O  OG1   . THR B 1 115 ? 32.903  54.864  34.238  1.00 8.77  ? 115  THR B OG1   1 
ATOM   6853  C  CG2   . THR B 1 115 ? 32.885  54.670  36.584  1.00 8.08  ? 115  THR B CG2   1 
ATOM   6854  N  N     . PRO B 1 116 ? 32.047  51.895  32.845  1.00 11.45 ? 116  PRO B N     1 
ATOM   6855  C  CA    . PRO B 1 116 ? 32.312  51.405  31.466  1.00 12.46 ? 116  PRO B CA    1 
ATOM   6856  C  C     . PRO B 1 116 ? 33.221  52.232  30.551  1.00 14.16 ? 116  PRO B C     1 
ATOM   6857  O  O     . PRO B 1 116 ? 34.011  51.673  29.777  1.00 14.87 ? 116  PRO B O     1 
ATOM   6858  C  CB    . PRO B 1 116 ? 30.921  51.389  30.831  1.00 12.43 ? 116  PRO B CB    1 
ATOM   6859  C  CG    . PRO B 1 116 ? 29.984  51.221  31.975  1.00 12.31 ? 116  PRO B CG    1 
ATOM   6860  C  CD    . PRO B 1 116 ? 30.603  52.021  33.107  1.00 11.36 ? 116  PRO B CD    1 
ATOM   6861  N  N     . GLY B 1 117 ? 33.086  53.553  30.611  1.00 15.34 ? 117  GLY B N     1 
ATOM   6862  C  CA    . GLY B 1 117 ? 33.843  54.444  29.756  1.00 15.96 ? 117  GLY B CA    1 
ATOM   6863  C  C     . GLY B 1 117 ? 35.143  54.909  30.355  1.00 16.91 ? 117  GLY B C     1 
ATOM   6864  O  O     . GLY B 1 117 ? 35.894  55.640  29.684  1.00 17.97 ? 117  GLY B O     1 
ATOM   6865  N  N     . THR B 1 118 ? 35.430  54.492  31.593  1.00 17.18 ? 118  THR B N     1 
ATOM   6866  C  CA    . THR B 1 118 ? 36.627  54.970  32.296  1.00 17.48 ? 118  THR B CA    1 
ATOM   6867  C  C     . THR B 1 118 ? 37.664  53.893  32.678  1.00 17.30 ? 118  THR B C     1 
ATOM   6868  O  O     . THR B 1 118 ? 38.665  54.190  33.314  1.00 16.89 ? 118  THR B O     1 
ATOM   6869  C  CB    . THR B 1 118 ? 36.204  55.762  33.552  1.00 18.12 ? 118  THR B CB    1 
ATOM   6870  O  OG1   . THR B 1 118 ? 35.377  54.949  34.428  1.00 17.48 ? 118  THR B OG1   1 
ATOM   6871  C  CG2   . THR B 1 118 ? 35.365  57.012  33.141  1.00 17.65 ? 118  THR B CG2   1 
ATOM   6872  N  N     . ILE B 1 119 ? 37.449  52.652  32.272  1.00 17.45 ? 119  ILE B N     1 
ATOM   6873  C  CA    . ILE B 1 119 ? 38.399  51.596  32.612  1.00 17.43 ? 119  ILE B CA    1 
ATOM   6874  C  C     . ILE B 1 119 ? 39.627  51.676  31.758  1.00 17.27 ? 119  ILE B C     1 
ATOM   6875  O  O     . ILE B 1 119 ? 39.546  52.137  30.637  1.00 18.15 ? 119  ILE B O     1 
ATOM   6876  C  CB    . ILE B 1 119 ? 37.772  50.229  32.499  1.00 17.09 ? 119  ILE B CB    1 
ATOM   6877  C  CG1   . ILE B 1 119 ? 36.877  50.124  31.270  1.00 17.89 ? 119  ILE B CG1   1 
ATOM   6878  C  CG2   . ILE B 1 119 ? 36.977  49.982  33.736  1.00 18.08 ? 119  ILE B CG2   1 
ATOM   6879  C  CD1   . ILE B 1 119 ? 36.926  48.754  30.596  1.00 18.28 ? 119  ILE B CD1   1 
ATOM   6880  N  N     . SER B 1 120 ? 40.771  51.286  32.313  1.00 17.22 ? 120  SER B N     1 
ATOM   6881  C  CA    . SER B 1 120 ? 41.980  51.133  31.519  1.00 17.23 ? 120  SER B CA    1 
ATOM   6882  C  C     . SER B 1 120 ? 42.799  49.874  31.832  1.00 17.68 ? 120  SER B C     1 
ATOM   6883  O  O     . SER B 1 120 ? 43.898  49.727  31.340  1.00 17.16 ? 120  SER B O     1 
ATOM   6884  C  CB    . SER B 1 120 ? 42.848  52.400  31.620  1.00 17.06 ? 120  SER B CB    1 
ATOM   6885  O  OG    . SER B 1 120 ? 43.337  52.591  32.912  1.00 15.63 ? 120  SER B OG    1 
ATOM   6886  N  N     . ASP B 1 121 ? 42.273  48.949  32.623  1.00 19.01 ? 121  ASP B N     1 
ATOM   6887  C  CA    . ASP B 1 121 ? 43.003  47.701  32.887  1.00 19.85 ? 121  ASP B CA    1 
ATOM   6888  C  C     . ASP B 1 121 ? 42.803  46.757  31.704  1.00 19.58 ? 121  ASP B C     1 
ATOM   6889  O  O     . ASP B 1 121 ? 41.728  46.703  31.130  1.00 19.78 ? 121  ASP B O     1 
ATOM   6890  C  CB    . ASP B 1 121 ? 42.623  47.104  34.253  1.00 20.16 ? 121  ASP B CB    1 
ATOM   6891  C  CG    . ASP B 1 121 ? 43.115  47.983  35.425  1.00 23.37 ? 121  ASP B CG    1 
ATOM   6892  O  OD1   . ASP B 1 121 ? 44.354  48.247  35.533  1.00 27.87 ? 121  ASP B OD1   1 
ATOM   6893  O  OD2   . ASP B 1 121 ? 42.340  48.502  36.263  1.00 26.81 ? 121  ASP B OD2   1 
ATOM   6894  N  N     . GLU B 1 122 ? 43.872  46.084  31.294  1.00 19.70 ? 122  GLU B N     1 
ATOM   6895  C  CA    . GLU B 1 122 ? 43.873  45.304  30.045  1.00 19.78 ? 122  GLU B CA    1 
ATOM   6896  C  C     . GLU B 1 122 ? 42.925  44.074  30.096  1.00 19.50 ? 122  GLU B C     1 
ATOM   6897  O  O     . GLU B 1 122 ? 42.445  43.613  29.058  1.00 19.72 ? 122  GLU B O     1 
ATOM   6898  C  CB    . GLU B 1 122 ? 45.310  44.892  29.645  1.00 19.53 ? 122  GLU B CB    1 
ATOM   6899  C  CG    . GLU B 1 122 ? 45.555  43.388  29.639  1.00 20.68 ? 122  GLU B CG    1 
ATOM   6900  C  CD    . GLU B 1 122 ? 46.939  43.015  29.145  1.00 21.84 ? 122  GLU B CD    1 
ATOM   6901  O  OE1   . GLU B 1 122 ? 47.123  42.902  27.906  1.00 23.26 ? 122  GLU B OE1   1 
ATOM   6902  O  OE2   . GLU B 1 122 ? 47.836  42.825  29.993  1.00 21.33 ? 122  GLU B OE2   1 
ATOM   6903  N  N     . ALA B 1 123 ? 42.666  43.562  31.295  1.00 19.11 ? 123  ALA B N     1 
ATOM   6904  C  CA    . ALA B 1 123 ? 41.750  42.449  31.489  1.00 19.00 ? 123  ALA B CA    1 
ATOM   6905  C  C     . ALA B 1 123 ? 40.293  42.875  31.289  1.00 18.95 ? 123  ALA B C     1 
ATOM   6906  O  O     . ALA B 1 123 ? 39.411  42.024  31.080  1.00 18.35 ? 123  ALA B O     1 
ATOM   6907  C  CB    . ALA B 1 123 ? 41.936  41.881  32.884  1.00 19.02 ? 123  ALA B CB    1 
ATOM   6908  N  N     . LEU B 1 124 ? 40.057  44.193  31.376  1.00 18.83 ? 124  LEU B N     1 
ATOM   6909  C  CA    . LEU B 1 124 ? 38.718  44.780  31.314  1.00 18.64 ? 124  LEU B CA    1 
ATOM   6910  C  C     . LEU B 1 124 ? 38.352  45.390  29.963  1.00 18.77 ? 124  LEU B C     1 
ATOM   6911  O  O     . LEU B 1 124 ? 37.187  45.754  29.737  1.00 18.55 ? 124  LEU B O     1 
ATOM   6912  C  CB    . LEU B 1 124 ? 38.573  45.858  32.378  1.00 18.87 ? 124  LEU B CB    1 
ATOM   6913  C  CG    . LEU B 1 124 ? 38.574  45.430  33.840  1.00 18.75 ? 124  LEU B CG    1 
ATOM   6914  C  CD1   . LEU B 1 124 ? 38.067  46.600  34.693  1.00 18.78 ? 124  LEU B CD1   1 
ATOM   6915  C  CD2   . LEU B 1 124 ? 37.722  44.183  34.060  1.00 19.09 ? 124  LEU B CD2   1 
ATOM   6916  N  N     . LEU B 1 125 ? 39.336  45.496  29.073  1.00 18.84 ? 125  LEU B N     1 
ATOM   6917  C  CA    . LEU B 1 125 ? 39.109  45.977  27.710  1.00 18.62 ? 125  LEU B CA    1 
ATOM   6918  C  C     . LEU B 1 125 ? 39.210  44.845  26.675  1.00 18.51 ? 125  LEU B C     1 
ATOM   6919  O  O     . LEU B 1 125 ? 39.801  43.799  26.934  1.00 18.04 ? 125  LEU B O     1 
ATOM   6920  C  CB    . LEU B 1 125 ? 40.133  47.063  27.366  1.00 18.40 ? 125  LEU B CB    1 
ATOM   6921  C  CG    . LEU B 1 125 ? 40.011  48.369  28.155  1.00 18.21 ? 125  LEU B CG    1 
ATOM   6922  C  CD1   . LEU B 1 125 ? 41.370  48.915  28.369  1.00 19.83 ? 125  LEU B CD1   1 
ATOM   6923  C  CD2   . LEU B 1 125 ? 39.164  49.415  27.446  1.00 17.73 ? 125  LEU B CD2   1 
ATOM   6924  N  N     . GLN B 1 126 ? 38.632  45.095  25.504  1.00 18.32 ? 126  GLN B N     1 
ATOM   6925  C  CA    . GLN B 1 126 ? 38.765  44.235  24.345  1.00 18.23 ? 126  GLN B CA    1 
ATOM   6926  C  C     . GLN B 1 126 ? 39.925  44.824  23.568  1.00 18.17 ? 126  GLN B C     1 
ATOM   6927  O  O     . GLN B 1 126 ? 39.945  46.035  23.282  1.00 18.47 ? 126  GLN B O     1 
ATOM   6928  C  CB    . GLN B 1 126 ? 37.494  44.266  23.500  1.00 18.30 ? 126  GLN B CB    1 
ATOM   6929  C  CG    . GLN B 1 126 ? 36.213  44.026  24.291  1.00 20.58 ? 126  GLN B CG    1 
ATOM   6930  C  CD    . GLN B 1 126 ? 34.964  44.042  23.423  1.00 24.94 ? 126  GLN B CD    1 
ATOM   6931  O  OE1   . GLN B 1 126 ? 34.086  43.175  23.571  1.00 27.57 ? 126  GLN B OE1   1 
ATOM   6932  N  NE2   . GLN B 1 126 ? 34.877  45.017  22.506  1.00 27.20 ? 126  GLN B NE2   1 
ATOM   6933  N  N     . GLU B 1 127 ? 40.886  43.968  23.232  1.00 17.68 ? 127  GLU B N     1 
ATOM   6934  C  CA    . GLU B 1 127 ? 42.193  44.384  22.747  1.00 17.79 ? 127  GLU B CA    1 
ATOM   6935  C  C     . GLU B 1 127 ? 42.137  45.237  21.473  1.00 17.76 ? 127  GLU B C     1 
ATOM   6936  O  O     . GLU B 1 127 ? 42.912  46.190  21.362  1.00 17.77 ? 127  GLU B O     1 
ATOM   6937  C  CB    . GLU B 1 127 ? 43.053  43.141  22.535  1.00 18.32 ? 127  GLU B CB    1 
ATOM   6938  C  CG    . GLU B 1 127 ? 44.533  43.363  22.299  1.00 19.55 ? 127  GLU B CG    1 
ATOM   6939  C  CD    . GLU B 1 127 ? 45.176  42.139  21.671  1.00 22.07 ? 127  GLU B CD    1 
ATOM   6940  O  OE1   . GLU B 1 127 ? 45.777  41.328  22.419  1.00 23.86 ? 127  GLU B OE1   1 
ATOM   6941  O  OE2   . GLU B 1 127 ? 45.059  41.969  20.427  1.00 24.30 ? 127  GLU B OE2   1 
ATOM   6942  N  N     . ARG B 1 128 ? 41.205  44.932  20.552  1.00 17.22 ? 128  ARG B N     1 
ATOM   6943  C  CA    . ARG B 1 128 ? 41.115  45.615  19.246  1.00 17.18 ? 128  ARG B CA    1 
ATOM   6944  C  C     . ARG B 1 128 ? 39.880  46.531  19.031  1.00 17.16 ? 128  ARG B C     1 
ATOM   6945  O  O     . ARG B 1 128 ? 39.381  46.650  17.913  1.00 16.65 ? 128  ARG B O     1 
ATOM   6946  C  CB    . ARG B 1 128 ? 41.130  44.573  18.128  1.00 17.27 ? 128  ARG B CB    1 
ATOM   6947  C  CG    . ARG B 1 128 ? 42.419  43.810  17.990  1.00 17.45 ? 128  ARG B CG    1 
ATOM   6948  C  CD    . ARG B 1 128 ? 42.564  43.075  16.662  1.00 17.17 ? 128  ARG B CD    1 
ATOM   6949  N  NE    . ARG B 1 128 ? 43.935  43.200  16.171  1.00 17.20 ? 128  ARG B NE    1 
ATOM   6950  C  CZ    . ARG B 1 128 ? 44.333  43.063  14.901  1.00 15.52 ? 128  ARG B CZ    1 
ATOM   6951  N  NH1   . ARG B 1 128 ? 43.476  42.769  13.916  1.00 13.25 ? 128  ARG B NH1   1 
ATOM   6952  N  NH2   . ARG B 1 128 ? 45.626  43.221  14.623  1.00 15.20 ? 128  ARG B NH2   1 
ATOM   6953  N  N     . GLN B 1 129 ? 39.412  47.202  20.080  1.00 17.41 ? 129  GLN B N     1 
ATOM   6954  C  CA    . GLN B 1 129 ? 38.165  47.963  20.014  1.00 17.61 ? 129  GLN B CA    1 
ATOM   6955  C  C     . GLN B 1 129 ? 38.219  49.194  20.883  1.00 17.19 ? 129  GLN B C     1 
ATOM   6956  O  O     . GLN B 1 129 ? 38.540  49.080  22.053  1.00 17.42 ? 129  GLN B O     1 
ATOM   6957  C  CB    . GLN B 1 129 ? 37.046  47.065  20.516  1.00 18.15 ? 129  GLN B CB    1 
ATOM   6958  C  CG    . GLN B 1 129 ? 35.633  47.548  20.235  1.00 19.98 ? 129  GLN B CG    1 
ATOM   6959  C  CD    . GLN B 1 129 ? 34.786  46.523  19.486  1.00 22.20 ? 129  GLN B CD    1 
ATOM   6960  O  OE1   . GLN B 1 129 ? 33.775  46.893  18.881  1.00 25.89 ? 129  GLN B OE1   1 
ATOM   6961  N  NE2   . GLN B 1 129 ? 35.185  45.252  19.521  1.00 19.19 ? 129  GLN B NE2   1 
ATOM   6962  N  N     . ASP B 1 130 ? 37.897  50.369  20.339  1.00 17.21 ? 130  ASP B N     1 
ATOM   6963  C  CA    . ASP B 1 130 ? 37.883  51.609  21.157  1.00 17.26 ? 130  ASP B CA    1 
ATOM   6964  C  C     . ASP B 1 130 ? 36.791  51.537  22.208  1.00 16.90 ? 130  ASP B C     1 
ATOM   6965  O  O     . ASP B 1 130 ? 35.792  50.849  22.016  1.00 16.70 ? 130  ASP B O     1 
ATOM   6966  C  CB    . ASP B 1 130 ? 37.665  52.875  20.320  1.00 17.16 ? 130  ASP B CB    1 
ATOM   6967  C  CG    . ASP B 1 130 ? 38.926  53.351  19.623  1.00 18.28 ? 130  ASP B CG    1 
ATOM   6968  O  OD1   . ASP B 1 130 ? 40.017  53.389  20.251  1.00 22.25 ? 130  ASP B OD1   1 
ATOM   6969  O  OD2   . ASP B 1 130 ? 38.917  53.705  18.433  1.00 15.96 ? 130  ASP B OD2   1 
ATOM   6970  N  N     . ASN B 1 131 ? 37.013  52.240  23.316  1.00 16.63 ? 131  ASN B N     1 
ATOM   6971  C  CA    . ASN B 1 131 ? 36.063  52.339  24.414  1.00 16.60 ? 131  ASN B CA    1 
ATOM   6972  C  C     . ASN B 1 131 ? 35.976  53.796  24.882  1.00 16.19 ? 131  ASN B C     1 
ATOM   6973  O  O     . ASN B 1 131 ? 36.882  54.280  25.493  1.00 16.73 ? 131  ASN B O     1 
ATOM   6974  C  CB    . ASN B 1 131 ? 36.505  51.449  25.565  1.00 16.51 ? 131  ASN B CB    1 
ATOM   6975  C  CG    . ASN B 1 131 ? 35.445  51.310  26.631  1.00 16.86 ? 131  ASN B CG    1 
ATOM   6976  O  OD1   . ASN B 1 131 ? 34.367  50.790  26.360  1.00 18.66 ? 131  ASN B OD1   1 
ATOM   6977  N  ND2   . ASN B 1 131 ? 35.744  51.768  27.854  1.00 15.78 ? 131  ASN B ND2   1 
ATOM   6978  N  N     . LEU B 1 132 ? 34.887  54.489  24.582  1.00 15.92 ? 132  LEU B N     1 
ATOM   6979  C  CA    . LEU B 1 132 ? 34.809  55.927  24.800  1.00 15.54 ? 132  LEU B CA    1 
ATOM   6980  C  C     . LEU B 1 132 ? 33.870  56.340  25.924  1.00 15.07 ? 132  LEU B C     1 
ATOM   6981  O  O     . LEU B 1 132 ? 32.797  55.781  26.087  1.00 15.62 ? 132  LEU B O     1 
ATOM   6982  C  CB    . LEU B 1 132 ? 34.351  56.613  23.508  1.00 15.58 ? 132  LEU B CB    1 
ATOM   6983  C  CG    . LEU B 1 132 ? 35.072  56.167  22.228  1.00 15.94 ? 132  LEU B CG    1 
ATOM   6984  C  CD1   . LEU B 1 132 ? 34.552  56.972  21.074  1.00 15.23 ? 132  LEU B CD1   1 
ATOM   6985  C  CD2   . LEU B 1 132 ? 36.584  56.323  22.342  1.00 16.76 ? 132  LEU B CD2   1 
ATOM   6986  N  N     . LEU B 1 133 ? 34.295  57.313  26.713  1.00 14.37 ? 133  LEU B N     1 
ATOM   6987  C  CA    . LEU B 1 133 ? 33.369  58.163  27.456  1.00 14.20 ? 133  LEU B CA    1 
ATOM   6988  C  C     . LEU B 1 133 ? 32.836  59.199  26.479  1.00 13.61 ? 133  LEU B C     1 
ATOM   6989  O  O     . LEU B 1 133 ? 33.557  59.631  25.603  1.00 12.25 ? 133  LEU B O     1 
ATOM   6990  C  CB    . LEU B 1 133 ? 34.101  58.873  28.601  1.00 14.63 ? 133  LEU B CB    1 
ATOM   6991  C  CG    . LEU B 1 133 ? 33.286  59.711  29.569  1.00 13.81 ? 133  LEU B CG    1 
ATOM   6992  C  CD1   . LEU B 1 133 ? 32.016  58.990  30.017  1.00 14.96 ? 133  LEU B CD1   1 
ATOM   6993  C  CD2   . LEU B 1 133 ? 34.166  60.031  30.740  1.00 12.94 ? 133  LEU B CD2   1 
ATOM   6994  N  N     . ALA B 1 134 ? 31.561  59.533  26.598  1.00 14.14 ? 134  ALA B N     1 
ATOM   6995  C  CA    . ALA B 1 134 ? 30.945  60.580  25.802  1.00 14.67 ? 134  ALA B CA    1 
ATOM   6996  C  C     . ALA B 1 134 ? 30.020  61.441  26.655  1.00 15.49 ? 134  ALA B C     1 
ATOM   6997  O  O     . ALA B 1 134 ? 29.413  60.981  27.606  1.00 14.84 ? 134  ALA B O     1 
ATOM   6998  C  CB    . ALA B 1 134 ? 30.196  59.996  24.651  1.00 14.62 ? 134  ALA B CB    1 
ATOM   6999  N  N     . ALA B 1 135 ? 29.945  62.719  26.334  1.00 17.07 ? 135  ALA B N     1 
ATOM   7000  C  CA    . ALA B 1 135 ? 28.929  63.584  26.936  1.00 17.81 ? 135  ALA B CA    1 
ATOM   7001  C  C     . ALA B 1 135 ? 28.112  64.219  25.825  1.00 18.42 ? 135  ALA B C     1 
ATOM   7002  O  O     . ALA B 1 135 ? 28.648  64.549  24.782  1.00 18.39 ? 135  ALA B O     1 
ATOM   7003  C  CB    . ALA B 1 135 ? 29.562  64.637  27.800  1.00 17.69 ? 135  ALA B CB    1 
ATOM   7004  N  N     . ILE B 1 136 ? 26.811  64.363  26.048  1.00 19.40 ? 136  ILE B N     1 
ATOM   7005  C  CA    . ILE B 1 136 ? 25.905  64.982  25.077  1.00 20.18 ? 136  ILE B CA    1 
ATOM   7006  C  C     . ILE B 1 136 ? 25.125  66.130  25.717  1.00 20.72 ? 136  ILE B C     1 
ATOM   7007  O  O     . ILE B 1 136 ? 24.944  66.155  26.930  1.00 21.02 ? 136  ILE B O     1 
ATOM   7008  C  CB    . ILE B 1 136 ? 24.941  63.930  24.504  1.00 19.90 ? 136  ILE B CB    1 
ATOM   7009  C  CG1   . ILE B 1 136 ? 24.168  64.519  23.329  1.00 19.91 ? 136  ILE B CG1   1 
ATOM   7010  C  CG2   . ILE B 1 136 ? 24.016  63.401  25.594  1.00 19.39 ? 136  ILE B CG2   1 
ATOM   7011  C  CD1   . ILE B 1 136 ? 23.572  63.497  22.433  1.00 21.09 ? 136  ILE B CD1   1 
ATOM   7012  N  N     . TRP B 1 137 ? 24.650  67.070  24.908  1.00 21.42 ? 137  TRP B N     1 
ATOM   7013  C  CA    . TRP B 1 137 ? 24.032  68.276  25.463  1.00 22.00 ? 137  TRP B CA    1 
ATOM   7014  C  C     . TRP B 1 137 ? 23.266  69.031  24.379  1.00 22.13 ? 137  TRP B C     1 
ATOM   7015  O  O     . TRP B 1 137 ? 23.633  68.960  23.207  1.00 22.04 ? 137  TRP B O     1 
ATOM   7016  C  CB    . TRP B 1 137 ? 25.120  69.106  26.161  1.00 21.72 ? 137  TRP B CB    1 
ATOM   7017  C  CG    . TRP B 1 137 ? 24.979  70.582  26.196  1.00 23.52 ? 137  TRP B CG    1 
ATOM   7018  C  CD1   . TRP B 1 137 ? 25.618  71.468  25.399  1.00 23.62 ? 137  TRP B CD1   1 
ATOM   7019  C  CD2   . TRP B 1 137 ? 24.231  71.370  27.146  1.00 25.23 ? 137  TRP B CD2   1 
ATOM   7020  N  NE1   . TRP B 1 137 ? 25.285  72.752  25.755  1.00 23.49 ? 137  TRP B NE1   1 
ATOM   7021  C  CE2   . TRP B 1 137 ? 24.437  72.717  26.824  1.00 24.29 ? 137  TRP B CE2   1 
ATOM   7022  C  CE3   . TRP B 1 137 ? 23.391  71.064  28.228  1.00 26.42 ? 137  TRP B CE3   1 
ATOM   7023  C  CZ2   . TRP B 1 137 ? 23.835  73.760  27.528  1.00 26.28 ? 137  TRP B CZ2   1 
ATOM   7024  C  CZ3   . TRP B 1 137 ? 22.790  72.099  28.927  1.00 25.95 ? 137  TRP B CZ3   1 
ATOM   7025  C  CH2   . TRP B 1 137 ? 23.017  73.430  28.575  1.00 26.33 ? 137  TRP B CH2   1 
ATOM   7026  N  N     . GLN B 1 138 ? 22.180  69.697  24.784  1.00 22.25 ? 138  GLN B N     1 
ATOM   7027  C  CA    . GLN B 1 138 ? 21.301  70.426  23.873  1.00 22.74 ? 138  GLN B CA    1 
ATOM   7028  C  C     . GLN B 1 138 ? 21.073  71.908  24.251  1.00 22.65 ? 138  GLN B C     1 
ATOM   7029  O  O     . GLN B 1 138 ? 21.255  72.339  25.382  1.00 22.37 ? 138  GLN B O     1 
ATOM   7030  C  CB    . GLN B 1 138 ? 19.947  69.709  23.738  1.00 23.05 ? 138  GLN B CB    1 
ATOM   7031  C  CG    . GLN B 1 138 ? 19.195  70.012  22.424  1.00 24.10 ? 138  GLN B CG    1 
ATOM   7032  C  CD    . GLN B 1 138 ? 18.007  69.085  22.169  1.00 25.95 ? 138  GLN B CD    1 
ATOM   7033  O  OE1   . GLN B 1 138 ? 17.455  68.507  23.104  1.00 27.79 ? 138  GLN B OE1   1 
ATOM   7034  N  NE2   . GLN B 1 138 ? 17.604  68.961  20.905  1.00 26.53 ? 138  GLN B NE2   1 
ATOM   7035  N  N     . ASP B 1 139 ? 20.653  72.657  23.245  1.00 22.84 ? 139  ASP B N     1 
ATOM   7036  C  CA    . ASP B 1 139 ? 20.506  74.096  23.269  1.00 22.90 ? 139  ASP B CA    1 
ATOM   7037  C  C     . ASP B 1 139 ? 19.245  74.424  22.462  1.00 22.88 ? 139  ASP B C     1 
ATOM   7038  O  O     . ASP B 1 139 ? 18.770  73.608  21.651  1.00 22.85 ? 139  ASP B O     1 
ATOM   7039  C  CB    . ASP B 1 139 ? 21.717  74.710  22.543  1.00 23.15 ? 139  ASP B CB    1 
ATOM   7040  C  CG    . ASP B 1 139 ? 22.390  75.841  23.306  1.00 23.84 ? 139  ASP B CG    1 
ATOM   7041  O  OD1   . ASP B 1 139 ? 22.658  75.687  24.513  1.00 25.08 ? 139  ASP B OD1   1 
ATOM   7042  O  OD2   . ASP B 1 139 ? 22.742  76.908  22.746  1.00 25.12 ? 139  ASP B OD2   1 
ATOM   7043  N  N     . SER B 1 140 ? 18.707  75.622  22.675  1.00 22.69 ? 140  SER B N     1 
ATOM   7044  C  CA    . SER B 1 140 ? 17.842  76.255  21.677  1.00 22.31 ? 140  SER B CA    1 
ATOM   7045  C  C     . SER B 1 140 ? 18.468  76.077  20.276  1.00 22.20 ? 140  SER B C     1 
ATOM   7046  O  O     . SER B 1 140 ? 17.781  75.680  19.332  1.00 22.48 ? 140  SER B O     1 
ATOM   7047  C  CB    . SER B 1 140 ? 17.628  77.758  21.978  1.00 22.33 ? 140  SER B CB    1 
ATOM   7048  O  OG    . SER B 1 140 ? 18.219  78.177  23.202  1.00 21.28 ? 140  SER B OG    1 
ATOM   7049  N  N     . LYS B 1 141 ? 19.777  76.349  20.169  1.00 21.83 ? 141  LYS B N     1 
ATOM   7050  C  CA    . LYS B 1 141 ? 20.542  76.254  18.909  1.00 21.27 ? 141  LYS B CA    1 
ATOM   7051  C  C     . LYS B 1 141 ? 20.771  74.817  18.427  1.00 20.68 ? 141  LYS B C     1 
ATOM   7052  O  O     . LYS B 1 141 ? 20.304  74.445  17.358  1.00 20.93 ? 141  LYS B O     1 
ATOM   7053  C  CB    . LYS B 1 141 ? 21.902  76.974  19.032  1.00 21.40 ? 141  LYS B CB    1 
ATOM   7054  C  CG    . LYS B 1 141 ? 21.847  78.453  19.529  1.00 22.01 ? 141  LYS B CG    1 
ATOM   7055  C  CD    . LYS B 1 141 ? 20.785  79.313  18.800  1.00 22.36 ? 141  LYS B CD    1 
ATOM   7056  C  CE    . LYS B 1 141 ? 20.887  80.787  19.197  1.00 22.84 ? 141  LYS B CE    1 
ATOM   7057  N  NZ    . LYS B 1 141 ? 19.697  81.594  18.784  1.00 21.79 ? 141  LYS B NZ    1 
ATOM   7058  N  N     . GLY B 1 142 ? 21.500  74.013  19.197  1.00 19.84 ? 142  GLY B N     1 
ATOM   7059  C  CA    . GLY B 1 142 ? 21.827  72.660  18.770  1.00 19.16 ? 142  GLY B CA    1 
ATOM   7060  C  C     . GLY B 1 142 ? 22.471  71.725  19.798  1.00 18.51 ? 142  GLY B C     1 
ATOM   7061  O  O     . GLY B 1 142 ? 22.301  71.866  21.013  1.00 18.63 ? 142  GLY B O     1 
ATOM   7062  N  N     . PHE B 1 143 ? 23.222  70.751  19.293  1.00 17.33 ? 143  PHE B N     1 
ATOM   7063  C  CA    . PHE B 1 143 ? 23.826  69.728  20.127  1.00 16.01 ? 143  PHE B CA    1 
ATOM   7064  C  C     . PHE B 1 143 ? 25.304  70.003  20.360  1.00 16.10 ? 143  PHE B C     1 
ATOM   7065  O  O     . PHE B 1 143 ? 25.996  70.438  19.440  1.00 15.76 ? 143  PHE B O     1 
ATOM   7066  C  CB    . PHE B 1 143 ? 23.664  68.365  19.458  1.00 15.45 ? 143  PHE B CB    1 
ATOM   7067  C  CG    . PHE B 1 143 ? 22.238  67.939  19.291  1.00 12.62 ? 143  PHE B CG    1 
ATOM   7068  C  CD1   . PHE B 1 143 ? 21.538  67.430  20.354  1.00 10.01 ? 143  PHE B CD1   1 
ATOM   7069  C  CD2   . PHE B 1 143 ? 21.603  68.058  18.070  1.00 11.30 ? 143  PHE B CD2   1 
ATOM   7070  C  CE1   . PHE B 1 143 ? 20.226  67.047  20.214  1.00 10.03 ? 143  PHE B CE1   1 
ATOM   7071  C  CE2   . PHE B 1 143 ? 20.282  67.673  17.911  1.00 11.65 ? 143  PHE B CE2   1 
ATOM   7072  C  CZ    . PHE B 1 143 ? 19.593  67.156  18.988  1.00 10.89 ? 143  PHE B CZ    1 
ATOM   7073  N  N     . GLY B 1 144 ? 25.773  69.767  21.592  1.00 16.04 ? 144  GLY B N     1 
ATOM   7074  C  CA    . GLY B 1 144 ? 27.192  69.566  21.882  1.00 16.16 ? 144  GLY B CA    1 
ATOM   7075  C  C     . GLY B 1 144 ? 27.506  68.082  22.141  1.00 16.37 ? 144  GLY B C     1 
ATOM   7076  O  O     . GLY B 1 144 ? 26.685  67.335  22.693  1.00 16.38 ? 144  GLY B O     1 
ATOM   7077  N  N     . TYR B 1 145 ? 28.699  67.666  21.735  1.00 16.27 ? 145  TYR B N     1 
ATOM   7078  C  CA    . TYR B 1 145 ? 29.164  66.295  21.900  1.00 16.16 ? 145  TYR B CA    1 
ATOM   7079  C  C     . TYR B 1 145 ? 30.663  66.249  22.167  1.00 16.01 ? 145  TYR B C     1 
ATOM   7080  O  O     . TYR B 1 145 ? 31.431  66.922  21.502  1.00 16.01 ? 145  TYR B O     1 
ATOM   7081  C  CB    . TYR B 1 145 ? 28.874  65.484  20.638  1.00 16.40 ? 145  TYR B CB    1 
ATOM   7082  C  CG    . TYR B 1 145 ? 28.879  63.989  20.854  1.00 16.72 ? 145  TYR B CG    1 
ATOM   7083  C  CD1   . TYR B 1 145 ? 28.126  63.420  21.860  1.00 17.52 ? 145  TYR B CD1   1 
ATOM   7084  C  CD2   . TYR B 1 145 ? 29.631  63.150  20.046  1.00 16.91 ? 145  TYR B CD2   1 
ATOM   7085  C  CE1   . TYR B 1 145 ? 28.126  62.035  22.069  1.00 19.79 ? 145  TYR B CE1   1 
ATOM   7086  C  CE2   . TYR B 1 145 ? 29.643  61.779  20.240  1.00 18.51 ? 145  TYR B CE2   1 
ATOM   7087  C  CZ    . TYR B 1 145 ? 28.882  61.205  21.258  1.00 19.63 ? 145  TYR B CZ    1 
ATOM   7088  O  OH    . TYR B 1 145 ? 28.882  59.819  21.493  1.00 16.95 ? 145  TYR B OH    1 
ATOM   7089  N  N     . ALA B 1 146 ? 31.067  65.454  23.152  1.00 16.37 ? 146  ALA B N     1 
ATOM   7090  C  CA    . ALA B 1 146 ? 32.476  65.164  23.427  1.00 16.72 ? 146  ALA B CA    1 
ATOM   7091  C  C     . ALA B 1 146 ? 32.711  63.661  23.630  1.00 17.35 ? 146  ALA B C     1 
ATOM   7092  O  O     . ALA B 1 146 ? 31.843  62.956  24.124  1.00 17.55 ? 146  ALA B O     1 
ATOM   7093  C  CB    . ALA B 1 146 ? 32.911  65.918  24.658  1.00 16.72 ? 146  ALA B CB    1 
ATOM   7094  N  N     . THR B 1 147 ? 33.895  63.181  23.273  1.00 18.07 ? 147  THR B N     1 
ATOM   7095  C  CA    . THR B 1 147 ? 34.279  61.786  23.492  1.00 18.14 ? 147  THR B CA    1 
ATOM   7096  C  C     . THR B 1 147 ? 35.705  61.729  24.015  1.00 19.20 ? 147  THR B C     1 
ATOM   7097  O  O     . THR B 1 147 ? 36.581  62.374  23.467  1.00 19.15 ? 147  THR B O     1 
ATOM   7098  C  CB    . THR B 1 147 ? 34.250  60.996  22.181  1.00 17.88 ? 147  THR B CB    1 
ATOM   7099  O  OG1   . THR B 1 147 ? 35.258  61.517  21.310  1.00 15.97 ? 147  THR B OG1   1 
ATOM   7100  C  CG2   . THR B 1 147 ? 32.942  61.182  21.421  1.00 17.64 ? 147  THR B CG2   1 
ATOM   7101  N  N     . LEU B 1 148 ? 35.943  60.956  25.067  1.00 20.61 ? 148  LEU B N     1 
ATOM   7102  C  CA    . LEU B 1 148 ? 37.300  60.658  25.518  1.00 21.37 ? 148  LEU B CA    1 
ATOM   7103  C  C     . LEU B 1 148 ? 37.551  59.164  25.346  1.00 21.63 ? 148  LEU B C     1 
ATOM   7104  O  O     . LEU B 1 148 ? 36.663  58.361  25.595  1.00 21.66 ? 148  LEU B O     1 
ATOM   7105  C  CB    . LEU B 1 148 ? 37.459  61.029  26.986  1.00 21.61 ? 148  LEU B CB    1 
ATOM   7106  C  CG    . LEU B 1 148 ? 38.830  60.811  27.626  1.00 22.45 ? 148  LEU B CG    1 
ATOM   7107  C  CD1   . LEU B 1 148 ? 39.872  61.691  26.951  1.00 23.47 ? 148  LEU B CD1   1 
ATOM   7108  C  CD2   . LEU B 1 148 ? 38.765  61.099  29.131  1.00 22.23 ? 148  LEU B CD2   1 
ATOM   7109  N  N     . ASP B 1 149 ? 38.741  58.806  24.881  1.00 21.92 ? 149  ASP B N     1 
ATOM   7110  C  CA    . ASP B 1 149 ? 39.275  57.474  25.112  1.00 22.38 ? 149  ASP B CA    1 
ATOM   7111  C  C     . ASP B 1 149 ? 40.185  57.597  26.307  1.00 22.24 ? 149  ASP B C     1 
ATOM   7112  O  O     . ASP B 1 149 ? 41.289  58.115  26.180  1.00 22.40 ? 149  ASP B O     1 
ATOM   7113  C  CB    . ASP B 1 149 ? 40.091  56.960  23.919  1.00 22.41 ? 149  ASP B CB    1 
ATOM   7114  C  CG    . ASP B 1 149 ? 40.794  55.617  24.217  1.00 23.07 ? 149  ASP B CG    1 
ATOM   7115  O  OD1   . ASP B 1 149 ? 40.696  55.094  25.367  1.00 22.19 ? 149  ASP B OD1   1 
ATOM   7116  O  OD2   . ASP B 1 149 ? 41.478  55.009  23.362  1.00 22.93 ? 149  ASP B OD2   1 
ATOM   7117  N  N     . ILE B 1 150 ? 39.764  57.102  27.461  1.00 22.06 ? 150  ILE B N     1 
ATOM   7118  C  CA    . ILE B 1 150 ? 40.592  57.301  28.629  1.00 22.21 ? 150  ILE B CA    1 
ATOM   7119  C  C     . ILE B 1 150 ? 42.038  56.725  28.530  1.00 22.69 ? 150  ILE B C     1 
ATOM   7120  O  O     . ILE B 1 150 ? 42.946  57.265  29.187  1.00 23.23 ? 150  ILE B O     1 
ATOM   7121  C  CB    . ILE B 1 150 ? 39.874  56.868  29.908  1.00 22.11 ? 150  ILE B CB    1 
ATOM   7122  C  CG1   . ILE B 1 150 ? 40.343  57.774  31.071  1.00 22.25 ? 150  ILE B CG1   1 
ATOM   7123  C  CG2   . ILE B 1 150 ? 40.075  55.351  30.182  1.00 22.49 ? 150  ILE B CG2   1 
ATOM   7124  C  CD1   . ILE B 1 150 ? 39.579  57.568  32.376  1.00 22.24 ? 150  ILE B CD1   1 
ATOM   7125  N  N     . SER B 1 151 ? 42.265  55.683  27.718  1.00 22.58 ? 151  SER B N     1 
ATOM   7126  C  CA    . SER B 1 151 ? 43.616  55.095  27.566  1.00 22.55 ? 151  SER B CA    1 
ATOM   7127  C  C     . SER B 1 151 ? 44.582  55.854  26.614  1.00 22.57 ? 151  SER B C     1 
ATOM   7128  O  O     . SER B 1 151 ? 45.783  55.926  26.862  1.00 23.85 ? 151  SER B O     1 
ATOM   7129  C  CB    . SER B 1 151 ? 43.530  53.640  27.128  1.00 22.58 ? 151  SER B CB    1 
ATOM   7130  O  OG    . SER B 1 151 ? 42.981  52.805  28.143  1.00 23.37 ? 151  SER B OG    1 
ATOM   7131  N  N     . SER B 1 152 ? 44.092  56.425  25.529  1.00 21.78 ? 152  SER B N     1 
ATOM   7132  C  CA    . SER B 1 152 ? 44.976  57.126  24.609  1.00 20.84 ? 152  SER B CA    1 
ATOM   7133  C  C     . SER B 1 152 ? 45.048  58.646  24.889  1.00 20.65 ? 152  SER B C     1 
ATOM   7134  O  O     . SER B 1 152 ? 45.989  59.328  24.469  1.00 20.21 ? 152  SER B O     1 
ATOM   7135  C  CB    . SER B 1 152 ? 44.536  56.845  23.176  1.00 20.68 ? 152  SER B CB    1 
ATOM   7136  O  OG    . SER B 1 152 ? 43.214  57.276  22.976  1.00 19.08 ? 152  SER B OG    1 
ATOM   7137  N  N     . GLY B 1 153 ? 44.063  59.168  25.608  1.00 20.45 ? 153  GLY B N     1 
ATOM   7138  C  CA    . GLY B 1 153 ? 43.883  60.605  25.741  1.00 20.32 ? 153  GLY B CA    1 
ATOM   7139  C  C     . GLY B 1 153 ? 43.205  61.291  24.563  1.00 20.28 ? 153  GLY B C     1 
ATOM   7140  O  O     . GLY B 1 153 ? 42.978  62.480  24.629  1.00 20.58 ? 153  GLY B O     1 
ATOM   7141  N  N     . ARG B 1 154 ? 42.917  60.567  23.477  1.00 20.01 ? 154  ARG B N     1 
ATOM   7142  C  CA    . ARG B 1 154 ? 42.139  61.106  22.372  1.00 19.76 ? 154  ARG B CA    1 
ATOM   7143  C  C     . ARG B 1 154 ? 40.846  61.727  22.887  1.00 18.88 ? 154  ARG B C     1 
ATOM   7144  O  O     . ARG B 1 154 ? 39.890  61.012  23.173  1.00 18.45 ? 154  ARG B O     1 
ATOM   7145  C  CB    . ARG B 1 154 ? 41.820  60.026  21.323  1.00 20.22 ? 154  ARG B CB    1 
ATOM   7146  C  CG    . ARG B 1 154 ? 42.365  60.355  19.927  1.00 23.14 ? 154  ARG B CG    1 
ATOM   7147  C  CD    . ARG B 1 154 ? 41.794  59.533  18.747  1.00 26.23 ? 154  ARG B CD    1 
ATOM   7148  N  NE    . ARG B 1 154 ? 40.336  59.702  18.583  1.00 30.03 ? 154  ARG B NE    1 
ATOM   7149  C  CZ    . ARG B 1 154 ? 39.681  59.829  17.414  1.00 30.10 ? 154  ARG B CZ    1 
ATOM   7150  N  NH1   . ARG B 1 154 ? 40.322  59.804  16.249  1.00 29.41 ? 154  ARG B NH1   1 
ATOM   7151  N  NH2   . ARG B 1 154 ? 38.357  59.968  17.421  1.00 31.12 ? 154  ARG B NH2   1 
ATOM   7152  N  N     . PHE B 1 155 ? 40.849  63.062  22.999  1.00 18.22 ? 155  PHE B N     1 
ATOM   7153  C  CA    . PHE B 1 155 ? 39.706  63.882  23.435  1.00 17.35 ? 155  PHE B CA    1 
ATOM   7154  C  C     . PHE B 1 155 ? 39.203  64.548  22.166  1.00 17.41 ? 155  PHE B C     1 
ATOM   7155  O  O     . PHE B 1 155 ? 39.993  64.916  21.346  1.00 17.64 ? 155  PHE B O     1 
ATOM   7156  C  CB    . PHE B 1 155 ? 40.231  64.915  24.443  1.00 17.24 ? 155  PHE B CB    1 
ATOM   7157  C  CG    . PHE B 1 155 ? 39.211  65.463  25.419  1.00 15.57 ? 155  PHE B CG    1 
ATOM   7158  C  CD1   . PHE B 1 155 ? 37.846  65.261  25.276  1.00 15.38 ? 155  PHE B CD1   1 
ATOM   7159  C  CD2   . PHE B 1 155 ? 39.651  66.221  26.480  1.00 13.53 ? 155  PHE B CD2   1 
ATOM   7160  C  CE1   . PHE B 1 155 ? 36.964  65.793  26.190  1.00 14.62 ? 155  PHE B CE1   1 
ATOM   7161  C  CE2   . PHE B 1 155 ? 38.782  66.747  27.379  1.00 14.21 ? 155  PHE B CE2   1 
ATOM   7162  C  CZ    . PHE B 1 155 ? 37.428  66.540  27.235  1.00 13.81 ? 155  PHE B CZ    1 
ATOM   7163  N  N     . ARG B 1 156 ? 37.893  64.649  21.969  1.00 18.42 ? 156  ARG B N     1 
ATOM   7164  C  CA    . ARG B 1 156 ? 37.288  65.234  20.753  1.00 18.73 ? 156  ARG B CA    1 
ATOM   7165  C  C     . ARG B 1 156 ? 35.967  65.874  21.120  1.00 18.62 ? 156  ARG B C     1 
ATOM   7166  O  O     . ARG B 1 156 ? 35.190  65.292  21.901  1.00 19.08 ? 156  ARG B O     1 
ATOM   7167  C  CB    . ARG B 1 156 ? 36.914  64.180  19.706  1.00 19.03 ? 156  ARG B CB    1 
ATOM   7168  C  CG    . ARG B 1 156 ? 38.011  63.263  19.193  1.00 21.68 ? 156  ARG B CG    1 
ATOM   7169  C  CD    . ARG B 1 156 ? 38.839  63.811  18.035  1.00 24.84 ? 156  ARG B CD    1 
ATOM   7170  N  NE    . ARG B 1 156 ? 40.218  63.989  18.484  1.00 28.07 ? 156  ARG B NE    1 
ATOM   7171  C  CZ    . ARG B 1 156 ? 41.286  63.393  17.966  1.00 28.79 ? 156  ARG B CZ    1 
ATOM   7172  N  NH1   . ARG B 1 156 ? 41.187  62.583  16.917  1.00 29.49 ? 156  ARG B NH1   1 
ATOM   7173  N  NH2   . ARG B 1 156 ? 42.476  63.626  18.508  1.00 28.69 ? 156  ARG B NH2   1 
ATOM   7174  N  N     . LEU B 1 157 ? 35.668  67.028  20.526  1.00 17.84 ? 157  LEU B N     1 
ATOM   7175  C  CA    . LEU B 1 157 ? 34.324  67.561  20.610  1.00 17.37 ? 157  LEU B CA    1 
ATOM   7176  C  C     . LEU B 1 157 ? 33.746  67.814  19.239  1.00 17.92 ? 157  LEU B C     1 
ATOM   7177  O  O     . LEU B 1 157 ? 34.432  67.626  18.224  1.00 18.55 ? 157  LEU B O     1 
ATOM   7178  C  CB    . LEU B 1 157 ? 34.264  68.780  21.533  1.00 17.37 ? 157  LEU B CB    1 
ATOM   7179  C  CG    . LEU B 1 157 ? 34.496  70.279  21.207  1.00 15.76 ? 157  LEU B CG    1 
ATOM   7180  C  CD1   . LEU B 1 157 ? 35.739  70.734  21.895  1.00 15.90 ? 157  LEU B CD1   1 
ATOM   7181  C  CD2   . LEU B 1 157 ? 34.528  70.666  19.758  1.00 14.66 ? 157  LEU B CD2   1 
ATOM   7182  N  N     . SER B 1 158 ? 32.474  68.218  19.212  1.00 18.01 ? 158  SER B N     1 
ATOM   7183  C  CA    . SER B 1 158 ? 31.737  68.494  17.968  1.00 17.80 ? 158  SER B CA    1 
ATOM   7184  C  C     . SER B 1 158 ? 30.401  69.195  18.281  1.00 18.40 ? 158  SER B C     1 
ATOM   7185  O  O     . SER B 1 158 ? 29.931  69.206  19.428  1.00 18.32 ? 158  SER B O     1 
ATOM   7186  C  CB    . SER B 1 158 ? 31.531  67.203  17.142  1.00 17.79 ? 158  SER B CB    1 
ATOM   7187  O  OG    . SER B 1 158 ? 30.475  66.393  17.621  1.00 16.43 ? 158  SER B OG    1 
ATOM   7188  N  N     . GLU B 1 159 ? 29.792  69.802  17.275  1.00 19.01 ? 159  GLU B N     1 
ATOM   7189  C  CA    . GLU B 1 159 ? 28.566  70.555  17.510  1.00 19.75 ? 159  GLU B CA    1 
ATOM   7190  C  C     . GLU B 1 159 ? 27.546  70.287  16.396  1.00 20.28 ? 159  GLU B C     1 
ATOM   7191  O  O     . GLU B 1 159 ? 27.232  71.192  15.636  1.00 20.98 ? 159  GLU B O     1 
ATOM   7192  C  CB    . GLU B 1 159 ? 28.860  72.068  17.601  1.00 19.76 ? 159  GLU B CB    1 
ATOM   7193  C  CG    . GLU B 1 159 ? 29.749  72.544  18.753  1.00 20.37 ? 159  GLU B CG    1 
ATOM   7194  C  CD    . GLU B 1 159 ? 29.595  74.063  19.046  1.00 23.18 ? 159  GLU B CD    1 
ATOM   7195  O  OE1   . GLU B 1 159 ? 29.029  74.812  18.211  1.00 23.74 ? 159  GLU B OE1   1 
ATOM   7196  O  OE2   . GLU B 1 159 ? 30.035  74.540  20.123  1.00 23.01 ? 159  GLU B OE2   1 
ATOM   7197  N  N     . PRO B 1 160 ? 27.002  69.072  16.311  1.00 20.81 ? 160  PRO B N     1 
ATOM   7198  C  CA    . PRO B 1 160 ? 26.044  68.723  15.246  1.00 21.28 ? 160  PRO B CA    1 
ATOM   7199  C  C     . PRO B 1 160 ? 24.806  69.620  15.229  1.00 21.80 ? 160  PRO B C     1 
ATOM   7200  O  O     . PRO B 1 160 ? 24.259  69.865  16.300  1.00 22.29 ? 160  PRO B O     1 
ATOM   7201  C  CB    . PRO B 1 160 ? 25.639  67.284  15.597  1.00 21.22 ? 160  PRO B CB    1 
ATOM   7202  C  CG    . PRO B 1 160 ? 26.750  66.770  16.460  1.00 20.87 ? 160  PRO B CG    1 
ATOM   7203  C  CD    . PRO B 1 160 ? 27.234  67.942  17.230  1.00 20.66 ? 160  PRO B CD    1 
ATOM   7204  N  N     . ALA B 1 161 ? 24.355  70.082  14.060  1.00 22.42 ? 161  ALA B N     1 
ATOM   7205  C  CA    . ALA B 1 161 ? 23.259  71.074  14.016  1.00 22.82 ? 161  ALA B CA    1 
ATOM   7206  C  C     . ALA B 1 161 ? 21.881  70.422  14.073  1.00 23.00 ? 161  ALA B C     1 
ATOM   7207  O  O     . ALA B 1 161 ? 21.121  70.667  15.011  1.00 23.23 ? 161  ALA B O     1 
ATOM   7208  C  CB    . ALA B 1 161 ? 23.383  71.988  12.806  1.00 22.69 ? 161  ALA B CB    1 
ATOM   7209  N  N     . ASP B 1 162 ? 21.558  69.595  13.081  1.00 23.27 ? 162  ASP B N     1 
ATOM   7210  C  CA    . ASP B 1 162 ? 20.304  68.832  13.110  1.00 23.53 ? 162  ASP B CA    1 
ATOM   7211  C  C     . ASP B 1 162 ? 20.463  67.564  13.953  1.00 23.67 ? 162  ASP B C     1 
ATOM   7212  O  O     . ASP B 1 162 ? 21.577  67.173  14.313  1.00 23.14 ? 162  ASP B O     1 
ATOM   7213  C  CB    . ASP B 1 162 ? 19.790  68.496  11.699  1.00 23.61 ? 162  ASP B CB    1 
ATOM   7214  C  CG    . ASP B 1 162 ? 20.850  67.871  10.806  1.00 24.23 ? 162  ASP B CG    1 
ATOM   7215  O  OD1   . ASP B 1 162 ? 21.599  66.982  11.281  1.00 25.03 ? 162  ASP B OD1   1 
ATOM   7216  O  OD2   . ASP B 1 162 ? 20.996  68.208  9.606   1.00 23.92 ? 162  ASP B OD2   1 
ATOM   7217  N  N     . ARG B 1 163 ? 19.341  66.929  14.267  1.00 24.06 ? 163  ARG B N     1 
ATOM   7218  C  CA    . ARG B 1 163 ? 19.376  65.716  15.063  1.00 24.58 ? 163  ARG B CA    1 
ATOM   7219  C  C     . ARG B 1 163 ? 19.882  64.482  14.307  1.00 24.38 ? 163  ARG B C     1 
ATOM   7220  O  O     . ARG B 1 163 ? 20.450  63.597  14.934  1.00 24.46 ? 163  ARG B O     1 
ATOM   7221  C  CB    . ARG B 1 163 ? 18.019  65.449  15.731  1.00 24.96 ? 163  ARG B CB    1 
ATOM   7222  C  CG    . ARG B 1 163 ? 16.912  64.894  14.857  1.00 26.26 ? 163  ARG B CG    1 
ATOM   7223  C  CD    . ARG B 1 163 ? 15.814  64.172  15.667  1.00 28.48 ? 163  ARG B CD    1 
ATOM   7224  N  NE    . ARG B 1 163 ? 15.994  62.711  15.694  1.00 29.81 ? 163  ARG B NE    1 
ATOM   7225  C  CZ    . ARG B 1 163 ? 15.705  61.909  16.726  1.00 30.60 ? 163  ARG B CZ    1 
ATOM   7226  N  NH1   . ARG B 1 163 ? 15.208  62.390  17.870  1.00 31.05 ? 163  ARG B NH1   1 
ATOM   7227  N  NH2   . ARG B 1 163 ? 15.925  60.603  16.608  1.00 30.29 ? 163  ARG B NH2   1 
ATOM   7228  N  N     . GLU B 1 164 ? 19.696  64.412  12.986  1.00 24.05 ? 164  GLU B N     1 
ATOM   7229  C  CA    . GLU B 1 164 ? 20.118  63.217  12.235  1.00 23.77 ? 164  GLU B CA    1 
ATOM   7230  C  C     . GLU B 1 164 ? 21.647  63.046  12.207  1.00 23.09 ? 164  GLU B C     1 
ATOM   7231  O  O     . GLU B 1 164 ? 22.128  61.911  12.174  1.00 22.54 ? 164  GLU B O     1 
ATOM   7232  C  CB    . GLU B 1 164 ? 19.536  63.181  10.806  1.00 24.14 ? 164  GLU B CB    1 
ATOM   7233  C  CG    . GLU B 1 164 ? 18.180  62.472  10.689  1.00 24.91 ? 164  GLU B CG    1 
ATOM   7234  C  CD    . GLU B 1 164 ? 17.007  63.442  10.553  1.00 26.46 ? 164  GLU B CD    1 
ATOM   7235  O  OE1   . GLU B 1 164 ? 17.093  64.567  11.109  1.00 27.53 ? 164  GLU B OE1   1 
ATOM   7236  O  OE2   . GLU B 1 164 ? 15.996  63.086  9.898   1.00 26.27 ? 164  GLU B OE2   1 
ATOM   7237  N  N     . THR B 1 165 ? 22.398  64.159  12.232  1.00 22.31 ? 165  THR B N     1 
ATOM   7238  C  CA    . THR B 1 165 ? 23.879  64.106  12.325  1.00 21.39 ? 165  THR B CA    1 
ATOM   7239  C  C     . THR B 1 165 ? 24.328  63.860  13.754  1.00 20.45 ? 165  THR B C     1 
ATOM   7240  O  O     . THR B 1 165 ? 25.451  63.443  13.984  1.00 19.88 ? 165  THR B O     1 
ATOM   7241  C  CB    . THR B 1 165 ? 24.586  65.389  11.779  1.00 21.26 ? 165  THR B CB    1 
ATOM   7242  O  OG1   . THR B 1 165 ? 23.910  66.559  12.231  1.00 21.84 ? 165  THR B OG1   1 
ATOM   7243  C  CG2   . THR B 1 165 ? 24.500  65.485  10.260  1.00 21.18 ? 165  THR B CG2   1 
ATOM   7244  N  N     . MET B 1 166 ? 23.461  64.155  14.710  1.00 19.78 ? 166  MET B N     1 
ATOM   7245  C  CA    . MET B 1 166 ? 23.694  63.748  16.083  1.00 19.70 ? 166  MET B CA    1 
ATOM   7246  C  C     . MET B 1 166 ? 23.526  62.222  16.216  1.00 19.52 ? 166  MET B C     1 
ATOM   7247  O  O     . MET B 1 166 ? 24.379  61.565  16.765  1.00 19.54 ? 166  MET B O     1 
ATOM   7248  C  CB    . MET B 1 166 ? 22.774  64.518  17.042  1.00 19.53 ? 166  MET B CB    1 
ATOM   7249  C  CG    . MET B 1 166 ? 23.061  64.303  18.531  1.00 19.12 ? 166  MET B CG    1 
ATOM   7250  S  SD    . MET B 1 166 ? 24.613  65.043  19.095  1.00 20.17 ? 166  MET B SD    1 
ATOM   7251  C  CE    . MET B 1 166 ? 25.685  63.570  19.171  1.00 18.81 ? 166  MET B CE    1 
ATOM   7252  N  N     . ALA B 1 167 ? 22.443  61.667  15.695  1.00 19.84 ? 167  ALA B N     1 
ATOM   7253  C  CA    . ALA B 1 167 ? 22.269  60.219  15.616  1.00 20.45 ? 167  ALA B CA    1 
ATOM   7254  C  C     . ALA B 1 167 ? 23.445  59.553  14.907  1.00 20.70 ? 167  ALA B C     1 
ATOM   7255  O  O     . ALA B 1 167 ? 23.943  58.531  15.348  1.00 20.23 ? 167  ALA B O     1 
ATOM   7256  C  CB    . ALA B 1 167 ? 20.973  59.892  14.889  1.00 20.51 ? 167  ALA B CB    1 
ATOM   7257  N  N     . ALA B 1 168 ? 23.886  60.173  13.817  1.00 21.66 ? 168  ALA B N     1 
ATOM   7258  C  CA    . ALA B 1 168 ? 24.992  59.685  13.002  1.00 22.41 ? 168  ALA B CA    1 
ATOM   7259  C  C     . ALA B 1 168 ? 26.287  59.578  13.803  1.00 23.39 ? 168  ALA B C     1 
ATOM   7260  O  O     . ALA B 1 168 ? 27.047  58.622  13.628  1.00 24.19 ? 168  ALA B O     1 
ATOM   7261  C  CB    . ALA B 1 168 ? 25.200  60.609  11.807  1.00 22.27 ? 168  ALA B CB    1 
ATOM   7262  N  N     . GLU B 1 169 ? 26.526  60.558  14.679  1.00 23.81 ? 169  GLU B N     1 
ATOM   7263  C  CA    . GLU B 1 169 ? 27.737  60.617  15.489  1.00 24.14 ? 169  GLU B CA    1 
ATOM   7264  C  C     . GLU B 1 169 ? 27.725  59.608  16.631  1.00 24.10 ? 169  GLU B C     1 
ATOM   7265  O  O     . GLU B 1 169 ? 28.790  59.165  17.072  1.00 24.13 ? 169  GLU B O     1 
ATOM   7266  C  CB    . GLU B 1 169 ? 27.936  62.022  16.058  1.00 24.40 ? 169  GLU B CB    1 
ATOM   7267  C  CG    . GLU B 1 169 ? 28.467  63.035  15.051  1.00 25.71 ? 169  GLU B CG    1 
ATOM   7268  C  CD    . GLU B 1 169 ? 29.988  63.052  14.963  1.00 27.95 ? 169  GLU B CD    1 
ATOM   7269  O  OE1   . GLU B 1 169 ? 30.685  63.290  16.006  1.00 27.99 ? 169  GLU B OE1   1 
ATOM   7270  O  OE2   . GLU B 1 169 ? 30.481  62.838  13.833  1.00 29.17 ? 169  GLU B OE2   1 
ATOM   7271  N  N     . LEU B 1 170 ? 26.534  59.268  17.115  1.00 23.93 ? 170  LEU B N     1 
ATOM   7272  C  CA    . LEU B 1 170 ? 26.377  58.248  18.148  1.00 24.10 ? 170  LEU B CA    1 
ATOM   7273  C  C     . LEU B 1 170 ? 26.602  56.808  17.653  1.00 24.33 ? 170  LEU B C     1 
ATOM   7274  O  O     . LEU B 1 170 ? 27.082  55.981  18.422  1.00 24.58 ? 170  LEU B O     1 
ATOM   7275  C  CB    . LEU B 1 170 ? 24.976  58.307  18.750  1.00 24.01 ? 170  LEU B CB    1 
ATOM   7276  C  CG    . LEU B 1 170 ? 24.672  59.404  19.744  1.00 24.49 ? 170  LEU B CG    1 
ATOM   7277  C  CD1   . LEU B 1 170 ? 23.207  59.300  20.124  1.00 25.55 ? 170  LEU B CD1   1 
ATOM   7278  C  CD2   . LEU B 1 170 ? 25.554  59.303  20.960  1.00 24.53 ? 170  LEU B CD2   1 
ATOM   7279  N  N     . GLN B 1 171 ? 26.216  56.483  16.417  1.00 24.23 ? 171  GLN B N     1 
ATOM   7280  C  CA    . GLN B 1 171 ? 26.437  55.125  15.911  1.00 24.73 ? 171  GLN B CA    1 
ATOM   7281  C  C     . GLN B 1 171 ? 27.936  54.940  15.612  1.00 24.69 ? 171  GLN B C     1 
ATOM   7282  O  O     . GLN B 1 171 ? 28.522  53.896  15.907  1.00 25.29 ? 171  GLN B O     1 
ATOM   7283  C  CB    . GLN B 1 171 ? 25.572  54.828  14.667  1.00 24.93 ? 171  GLN B CB    1 
ATOM   7284  C  CG    . GLN B 1 171 ? 25.578  53.352  14.181  1.00 25.40 ? 171  GLN B CG    1 
ATOM   7285  C  CD    . GLN B 1 171 ? 24.347  52.537  14.642  1.00 27.49 ? 171  GLN B CD    1 
ATOM   7286  O  OE1   . GLN B 1 171 ? 24.110  52.372  15.845  1.00 27.29 ? 171  GLN B OE1   1 
ATOM   7287  N  NE2   . GLN B 1 171 ? 23.568  52.033  13.681  1.00 28.12 ? 171  GLN B NE2   1 
ATOM   7288  N  N     . ARG B 1 172 ? 28.546  55.974  15.045  1.00 24.09 ? 172  ARG B N     1 
ATOM   7289  C  CA    . ARG B 1 172 ? 29.961  55.969  14.675  1.00 23.44 ? 172  ARG B CA    1 
ATOM   7290  C  C     . ARG B 1 172 ? 30.892  55.757  15.859  1.00 22.62 ? 172  ARG B C     1 
ATOM   7291  O  O     . ARG B 1 172 ? 31.826  54.963  15.797  1.00 22.37 ? 172  ARG B O     1 
ATOM   7292  C  CB    . ARG B 1 172 ? 30.296  57.319  14.034  1.00 23.57 ? 172  ARG B CB    1 
ATOM   7293  C  CG    . ARG B 1 172 ? 31.727  57.488  13.586  1.00 23.73 ? 172  ARG B CG    1 
ATOM   7294  C  CD    . ARG B 1 172 ? 31.961  58.778  12.819  1.00 24.95 ? 172  ARG B CD    1 
ATOM   7295  N  NE    . ARG B 1 172 ? 32.134  59.892  13.733  1.00 25.79 ? 172  ARG B NE    1 
ATOM   7296  C  CZ    . ARG B 1 172 ? 33.220  60.071  14.464  1.00 28.56 ? 172  ARG B CZ    1 
ATOM   7297  N  NH1   . ARG B 1 172 ? 34.240  59.208  14.374  1.00 30.68 ? 172  ARG B NH1   1 
ATOM   7298  N  NH2   . ARG B 1 172 ? 33.302  61.111  15.292  1.00 29.03 ? 172  ARG B NH2   1 
ATOM   7299  N  N     . THR B 1 173 ? 30.628  56.499  16.928  1.00 22.00 ? 173  THR B N     1 
ATOM   7300  C  CA    . THR B 1 173 ? 31.544  56.607  18.064  1.00 21.42 ? 173  THR B CA    1 
ATOM   7301  C  C     . THR B 1 173 ? 31.202  55.570  19.117  1.00 20.44 ? 173  THR B C     1 
ATOM   7302  O  O     . THR B 1 173 ? 32.087  55.002  19.779  1.00 20.52 ? 173  THR B O     1 
ATOM   7303  C  CB    . THR B 1 173 ? 31.508  58.035  18.670  1.00 21.52 ? 173  THR B CB    1 
ATOM   7304  O  OG1   . THR B 1 173 ? 30.177  58.370  19.102  1.00 22.39 ? 173  THR B OG1   1 
ATOM   7305  C  CG2   . THR B 1 173 ? 31.838  59.080  17.618  1.00 22.06 ? 173  THR B CG2   1 
ATOM   7306  N  N     . ASN B 1 174 ? 29.905  55.346  19.269  1.00 19.45 ? 174  ASN B N     1 
ATOM   7307  C  CA    . ASN B 1 174 ? 29.396  54.164  19.941  1.00 18.39 ? 174  ASN B CA    1 
ATOM   7308  C  C     . ASN B 1 174 ? 29.934  54.093  21.355  1.00 17.51 ? 174  ASN B C     1 
ATOM   7309  O  O     . ASN B 1 174 ? 30.522  53.095  21.744  1.00 17.81 ? 174  ASN B O     1 
ATOM   7310  C  CB    . ASN B 1 174 ? 29.777  52.919  19.149  1.00 18.15 ? 174  ASN B CB    1 
ATOM   7311  C  CG    . ASN B 1 174 ? 29.245  51.656  19.769  1.00 18.36 ? 174  ASN B CG    1 
ATOM   7312  O  OD1   . ASN B 1 174 ? 28.309  51.706  20.560  1.00 17.76 ? 174  ASN B OD1   1 
ATOM   7313  N  ND2   . ASN B 1 174 ? 29.846  50.512  19.424  1.00 14.97 ? 174  ASN B ND2   1 
ATOM   7314  N  N     . PRO B 1 175 ? 29.721  55.151  22.138  1.00 16.30 ? 175  PRO B N     1 
ATOM   7315  C  CA    . PRO B 1 175 ? 30.274  55.203  23.483  1.00 15.44 ? 175  PRO B CA    1 
ATOM   7316  C  C     . PRO B 1 175 ? 29.806  54.020  24.327  1.00 15.27 ? 175  PRO B C     1 
ATOM   7317  O  O     . PRO B 1 175 ? 28.741  53.426  24.145  1.00 14.72 ? 175  PRO B O     1 
ATOM   7318  C  CB    . PRO B 1 175 ? 29.724  56.506  24.030  1.00 15.13 ? 175  PRO B CB    1 
ATOM   7319  C  CG    . PRO B 1 175 ? 28.500  56.738  23.238  1.00 15.48 ? 175  PRO B CG    1 
ATOM   7320  C  CD    . PRO B 1 175 ? 28.887  56.329  21.855  1.00 16.18 ? 175  PRO B CD    1 
ATOM   7321  N  N     . ALA B 1 176 ? 30.671  53.664  25.254  1.00 15.42 ? 176  ALA B N     1 
ATOM   7322  C  CA    . ALA B 1 176 ? 30.387  52.642  26.226  1.00 15.13 ? 176  ALA B CA    1 
ATOM   7323  C  C     . ALA B 1 176 ? 29.618  53.264  27.383  1.00 14.73 ? 176  ALA B C     1 
ATOM   7324  O  O     . ALA B 1 176 ? 28.969  52.510  28.155  1.00 14.07 ? 176  ALA B O     1 
ATOM   7325  C  CB    . ALA B 1 176 ? 31.693  52.028  26.698  1.00 15.28 ? 176  ALA B CB    1 
ATOM   7326  N  N     . GLU B 1 177 ? 29.696  54.611  27.479  1.00 13.90 ? 177  GLU B N     1 
ATOM   7327  C  CA    . GLU B 1 177 ? 29.093  55.413  28.562  1.00 13.98 ? 177  GLU B CA    1 
ATOM   7328  C  C     . GLU B 1 177 ? 28.722  56.860  28.134  1.00 14.18 ? 177  GLU B C     1 
ATOM   7329  O  O     . GLU B 1 177 ? 29.536  57.617  27.561  1.00 13.38 ? 177  GLU B O     1 
ATOM   7330  C  CB    . GLU B 1 177 ? 30.069  55.448  29.734  1.00 14.32 ? 177  GLU B CB    1 
ATOM   7331  C  CG    . GLU B 1 177 ? 29.506  55.859  31.082  1.00 15.48 ? 177  GLU B CG    1 
ATOM   7332  C  CD    . GLU B 1 177 ? 30.470  55.540  32.220  1.00 18.37 ? 177  GLU B CD    1 
ATOM   7333  O  OE1   . GLU B 1 177 ? 31.649  55.233  31.936  1.00 17.60 ? 177  GLU B OE1   1 
ATOM   7334  O  OE2   . GLU B 1 177 ? 30.056  55.584  33.405  1.00 20.56 ? 177  GLU B OE2   1 
ATOM   7335  N  N     . LEU B 1 178 ? 27.492  57.254  28.424  1.00 14.71 ? 178  LEU B N     1 
ATOM   7336  C  CA    . LEU B 1 178 ? 26.931  58.484  27.860  1.00 15.31 ? 178  LEU B CA    1 
ATOM   7337  C  C     . LEU B 1 178 ? 26.409  59.437  28.943  1.00 15.74 ? 178  LEU B C     1 
ATOM   7338  O  O     . LEU B 1 178 ? 25.428  59.159  29.610  1.00 15.03 ? 178  LEU B O     1 
ATOM   7339  C  CB    . LEU B 1 178 ? 25.815  58.124  26.866  1.00 15.29 ? 178  LEU B CB    1 
ATOM   7340  C  CG    . LEU B 1 178 ? 25.518  58.999  25.635  1.00 15.28 ? 178  LEU B CG    1 
ATOM   7341  C  CD1   . LEU B 1 178 ? 24.032  59.014  25.368  1.00 14.96 ? 178  LEU B CD1   1 
ATOM   7342  C  CD2   . LEU B 1 178 ? 26.029  60.438  25.767  1.00 16.04 ? 178  LEU B CD2   1 
ATOM   7343  N  N     . LEU B 1 179 ? 27.085  60.563  29.120  1.00 16.99 ? 179  LEU B N     1 
ATOM   7344  C  CA    . LEU B 1 179 ? 26.636  61.569  30.071  1.00 18.12 ? 179  LEU B CA    1 
ATOM   7345  C  C     . LEU B 1 179 ? 25.704  62.506  29.347  1.00 18.58 ? 179  LEU B C     1 
ATOM   7346  O  O     . LEU B 1 179 ? 26.083  63.073  28.353  1.00 18.87 ? 179  LEU B O     1 
ATOM   7347  C  CB    . LEU B 1 179 ? 27.804  62.374  30.629  1.00 18.46 ? 179  LEU B CB    1 
ATOM   7348  C  CG    . LEU B 1 179 ? 29.022  61.640  31.181  1.00 20.02 ? 179  LEU B CG    1 
ATOM   7349  C  CD1   . LEU B 1 179 ? 30.035  62.657  31.734  1.00 21.34 ? 179  LEU B CD1   1 
ATOM   7350  C  CD2   . LEU B 1 179 ? 28.628  60.632  32.231  1.00 20.86 ? 179  LEU B CD2   1 
ATOM   7351  N  N     . TYR B 1 180 ? 24.489  62.663  29.843  1.00 19.70 ? 180  TYR B N     1 
ATOM   7352  C  CA    . TYR B 1 180 ? 23.525  63.552  29.231  1.00 20.68 ? 180  TYR B CA    1 
ATOM   7353  C  C     . TYR B 1 180 ? 22.902  64.489  30.248  1.00 22.06 ? 180  TYR B C     1 
ATOM   7354  O  O     . TYR B 1 180 ? 22.758  64.141  31.418  1.00 22.24 ? 180  TYR B O     1 
ATOM   7355  C  CB    . TYR B 1 180 ? 22.450  62.741  28.521  1.00 20.85 ? 180  TYR B CB    1 
ATOM   7356  C  CG    . TYR B 1 180 ? 21.547  61.895  29.391  1.00 19.89 ? 180  TYR B CG    1 
ATOM   7357  C  CD1   . TYR B 1 180 ? 21.991  60.705  29.941  1.00 20.70 ? 180  TYR B CD1   1 
ATOM   7358  C  CD2   . TYR B 1 180 ? 20.230  62.255  29.606  1.00 19.45 ? 180  TYR B CD2   1 
ATOM   7359  C  CE1   . TYR B 1 180 ? 21.145  59.904  30.718  1.00 20.21 ? 180  TYR B CE1   1 
ATOM   7360  C  CE2   . TYR B 1 180 ? 19.382  61.459  30.363  1.00 20.00 ? 180  TYR B CE2   1 
ATOM   7361  C  CZ    . TYR B 1 180 ? 19.841  60.286  30.920  1.00 19.19 ? 180  TYR B CZ    1 
ATOM   7362  O  OH    . TYR B 1 180 ? 18.987  59.504  31.670  1.00 17.30 ? 180  TYR B OH    1 
ATOM   7363  N  N     . ALA B 1 181 ? 22.532  65.685  29.801  1.00 23.67 ? 181  ALA B N     1 
ATOM   7364  C  CA    . ALA B 1 181 ? 21.946  66.672  30.701  1.00 24.98 ? 181  ALA B CA    1 
ATOM   7365  C  C     . ALA B 1 181 ? 20.538  66.251  31.135  1.00 26.16 ? 181  ALA B C     1 
ATOM   7366  O  O     . ALA B 1 181 ? 19.764  65.719  30.347  1.00 26.83 ? 181  ALA B O     1 
ATOM   7367  C  CB    . ALA B 1 181 ? 21.919  68.054  30.046  1.00 25.04 ? 181  ALA B CB    1 
ATOM   7368  N  N     . GLU B 1 182 ? 20.244  66.473  32.409  1.00 27.42 ? 182  GLU B N     1 
ATOM   7369  C  CA    . GLU B 1 182 ? 18.938  66.223  33.011  1.00 28.34 ? 182  GLU B CA    1 
ATOM   7370  C  C     . GLU B 1 182 ? 17.779  66.696  32.137  1.00 28.83 ? 182  GLU B C     1 
ATOM   7371  O  O     . GLU B 1 182 ? 16.876  65.922  31.800  1.00 29.09 ? 182  GLU B O     1 
ATOM   7372  C  CB    . GLU B 1 182 ? 18.847  67.014  34.315  1.00 28.72 ? 182  GLU B CB    1 
ATOM   7373  C  CG    . GLU B 1 182 ? 19.157  66.256  35.582  1.00 30.18 ? 182  GLU B CG    1 
ATOM   7374  C  CD    . GLU B 1 182 ? 18.732  67.057  36.794  1.00 32.66 ? 182  GLU B CD    1 
ATOM   7375  O  OE1   . GLU B 1 182 ? 18.673  68.312  36.687  1.00 33.43 ? 182  GLU B OE1   1 
ATOM   7376  O  OE2   . GLU B 1 182 ? 18.441  66.435  37.839  1.00 34.83 ? 182  GLU B OE2   1 
ATOM   7377  N  N     . ASP B 1 183 ? 17.815  67.988  31.804  1.00 29.19 ? 183  ASP B N     1 
ATOM   7378  C  CA    . ASP B 1 183 ? 16.737  68.650  31.085  1.00 29.40 ? 183  ASP B CA    1 
ATOM   7379  C  C     . ASP B 1 183 ? 17.110  68.679  29.602  1.00 29.18 ? 183  ASP B C     1 
ATOM   7380  O  O     . ASP B 1 183 ? 17.131  69.723  28.954  1.00 28.97 ? 183  ASP B O     1 
ATOM   7381  C  CB    . ASP B 1 183 ? 16.459  70.050  31.683  1.00 29.69 ? 183  ASP B CB    1 
ATOM   7382  C  CG    . ASP B 1 183 ? 15.467  70.011  32.907  1.00 30.64 ? 183  ASP B CG    1 
ATOM   7383  O  OD1   . ASP B 1 183 ? 15.927  70.220  34.065  1.00 30.40 ? 183  ASP B OD1   1 
ATOM   7384  O  OD2   . ASP B 1 183 ? 14.221  69.793  32.801  1.00 29.58 ? 183  ASP B OD2   1 
ATOM   7385  N  N     . PHE B 1 184 ? 17.398  67.478  29.102  1.00 29.01 ? 184  PHE B N     1 
ATOM   7386  C  CA    . PHE B 1 184 ? 17.729  67.189  27.716  1.00 28.84 ? 184  PHE B CA    1 
ATOM   7387  C  C     . PHE B 1 184 ? 16.435  66.784  27.036  1.00 28.61 ? 184  PHE B C     1 
ATOM   7388  O  O     . PHE B 1 184 ? 15.752  65.868  27.498  1.00 28.52 ? 184  PHE B O     1 
ATOM   7389  C  CB    . PHE B 1 184 ? 18.702  66.007  27.703  1.00 28.99 ? 184  PHE B CB    1 
ATOM   7390  C  CG    . PHE B 1 184 ? 19.182  65.577  26.335  1.00 29.37 ? 184  PHE B CG    1 
ATOM   7391  C  CD1   . PHE B 1 184 ? 20.060  66.374  25.605  1.00 29.43 ? 184  PHE B CD1   1 
ATOM   7392  C  CD2   . PHE B 1 184 ? 18.812  64.336  25.814  1.00 28.61 ? 184  PHE B CD2   1 
ATOM   7393  C  CE1   . PHE B 1 184 ? 20.526  65.956  24.367  1.00 29.59 ? 184  PHE B CE1   1 
ATOM   7394  C  CE2   . PHE B 1 184 ? 19.268  63.920  24.581  1.00 28.00 ? 184  PHE B CE2   1 
ATOM   7395  C  CZ    . PHE B 1 184 ? 20.129  64.727  23.856  1.00 28.61 ? 184  PHE B CZ    1 
ATOM   7396  N  N     . ALA B 1 185 ? 16.105  67.460  25.938  1.00 28.28 ? 185  ALA B N     1 
ATOM   7397  C  CA    . ALA B 1 185 ? 14.798  67.306  25.283  1.00 27.92 ? 185  ALA B CA    1 
ATOM   7398  C  C     . ALA B 1 185 ? 14.626  66.030  24.427  1.00 27.65 ? 185  ALA B C     1 
ATOM   7399  O  O     . ALA B 1 185 ? 13.631  65.311  24.593  1.00 27.32 ? 185  ALA B O     1 
ATOM   7400  C  CB    . ALA B 1 185 ? 14.487  68.556  24.446  1.00 27.84 ? 185  ALA B CB    1 
ATOM   7401  N  N     . GLU B 1 186 ? 15.587  65.758  23.532  1.00 27.44 ? 186  GLU B N     1 
ATOM   7402  C  CA    . GLU B 1 186 ? 15.470  64.693  22.505  1.00 27.18 ? 186  GLU B CA    1 
ATOM   7403  C  C     . GLU B 1 186 ? 15.907  63.311  22.997  1.00 26.38 ? 186  GLU B C     1 
ATOM   7404  O  O     . GLU B 1 186 ? 16.860  62.745  22.474  1.00 26.43 ? 186  GLU B O     1 
ATOM   7405  C  CB    . GLU B 1 186 ? 16.288  65.049  21.238  1.00 27.26 ? 186  GLU B CB    1 
ATOM   7406  C  CG    . GLU B 1 186 ? 15.833  66.318  20.506  1.00 28.12 ? 186  GLU B CG    1 
ATOM   7407  C  CD    . GLU B 1 186 ? 14.765  66.078  19.437  1.00 28.51 ? 186  GLU B CD    1 
ATOM   7408  O  OE1   . GLU B 1 186 ? 13.903  65.188  19.614  1.00 27.74 ? 186  GLU B OE1   1 
ATOM   7409  O  OE2   . GLU B 1 186 ? 14.780  66.802  18.417  1.00 29.30 ? 186  GLU B OE2   1 
ATOM   7410  N  N     . MET B 1 187 ? 15.194  62.763  23.978  1.00 25.61 ? 187  MET B N     1 
ATOM   7411  C  CA    . MET B 1 187 ? 15.576  61.483  24.585  1.00 25.16 ? 187  MET B CA    1 
ATOM   7412  C  C     . MET B 1 187 ? 15.539  60.339  23.584  1.00 24.62 ? 187  MET B C     1 
ATOM   7413  O  O     . MET B 1 187 ? 16.265  59.364  23.719  1.00 24.09 ? 187  MET B O     1 
ATOM   7414  C  CB    . MET B 1 187 ? 14.676  61.149  25.784  1.00 25.03 ? 187  MET B CB    1 
ATOM   7415  C  CG    . MET B 1 187 ? 14.967  61.994  27.014  1.00 24.66 ? 187  MET B CG    1 
ATOM   7416  S  SD    . MET B 1 187 ? 16.574  61.685  27.857  1.00 23.56 ? 187  MET B SD    1 
ATOM   7417  C  CE    . MET B 1 187 ? 16.260  62.850  29.291  1.00 24.73 ? 187  MET B CE    1 
ATOM   7418  N  N     . SER B 1 188 ? 14.666  60.479  22.595  1.00 24.33 ? 188  SER B N     1 
ATOM   7419  C  CA    . SER B 1 188 ? 14.573  59.567  21.472  1.00 24.01 ? 188  SER B CA    1 
ATOM   7420  C  C     . SER B 1 188 ? 15.945  59.100  20.924  1.00 23.45 ? 188  SER B C     1 
ATOM   7421  O  O     . SER B 1 188 ? 16.110  57.942  20.556  1.00 23.17 ? 188  SER B O     1 
ATOM   7422  C  CB    . SER B 1 188 ? 13.732  60.251  20.391  1.00 24.04 ? 188  SER B CB    1 
ATOM   7423  O  OG    . SER B 1 188 ? 13.912  59.632  19.138  1.00 25.05 ? 188  SER B OG    1 
ATOM   7424  N  N     . LEU B 1 189 ? 16.921  60.001  20.891  1.00 23.14 ? 189  LEU B N     1 
ATOM   7425  C  CA    . LEU B 1 189 ? 18.280  59.693  20.410  1.00 22.94 ? 189  LEU B CA    1 
ATOM   7426  C  C     . LEU B 1 189 ? 19.068  58.683  21.261  1.00 23.20 ? 189  LEU B C     1 
ATOM   7427  O  O     . LEU B 1 189 ? 19.756  57.793  20.742  1.00 22.79 ? 189  LEU B O     1 
ATOM   7428  C  CB    . LEU B 1 189 ? 19.107  60.983  20.373  1.00 22.59 ? 189  LEU B CB    1 
ATOM   7429  C  CG    . LEU B 1 189 ? 18.808  62.006  19.292  1.00 21.81 ? 189  LEU B CG    1 
ATOM   7430  C  CD1   . LEU B 1 189 ? 19.582  63.293  19.581  1.00 20.87 ? 189  LEU B CD1   1 
ATOM   7431  C  CD2   . LEU B 1 189 ? 19.158  61.458  17.910  1.00 21.51 ? 189  LEU B CD2   1 
ATOM   7432  N  N     . ILE B 1 190 ? 18.988  58.882  22.573  1.00 23.51 ? 190  ILE B N     1 
ATOM   7433  C  CA    . ILE B 1 190 ? 19.823  58.195  23.537  1.00 23.84 ? 190  ILE B CA    1 
ATOM   7434  C  C     . ILE B 1 190 ? 19.030  57.222  24.409  1.00 23.98 ? 190  ILE B C     1 
ATOM   7435  O  O     . ILE B 1 190 ? 19.557  56.723  25.376  1.00 24.39 ? 190  ILE B O     1 
ATOM   7436  C  CB    . ILE B 1 190 ? 20.548  59.255  24.428  1.00 24.12 ? 190  ILE B CB    1 
ATOM   7437  C  CG1   . ILE B 1 190 ? 19.559  59.988  25.345  1.00 24.74 ? 190  ILE B CG1   1 
ATOM   7438  C  CG2   . ILE B 1 190 ? 21.273  60.308  23.564  1.00 24.51 ? 190  ILE B CG2   1 
ATOM   7439  C  CD1   . ILE B 1 190 ? 20.206  60.866  26.384  1.00 25.02 ? 190  ILE B CD1   1 
ATOM   7440  N  N     . GLU B 1 191 ? 17.783  56.923  24.066  1.00 24.19 ? 191  GLU B N     1 
ATOM   7441  C  CA    . GLU B 1 191 ? 16.902  56.194  24.980  1.00 24.25 ? 191  GLU B CA    1 
ATOM   7442  C  C     . GLU B 1 191 ? 17.365  54.747  25.180  1.00 24.21 ? 191  GLU B C     1 
ATOM   7443  O  O     . GLU B 1 191 ? 17.503  54.286  26.314  1.00 24.27 ? 191  GLU B O     1 
ATOM   7444  C  CB    . GLU B 1 191 ? 15.442  56.241  24.483  1.00 24.50 ? 191  GLU B CB    1 
ATOM   7445  C  CG    . GLU B 1 191 ? 14.415  56.728  25.509  1.00 25.36 ? 191  GLU B CG    1 
ATOM   7446  C  CD    . GLU B 1 191 ? 12.968  56.660  24.999  1.00 27.14 ? 191  GLU B CD    1 
ATOM   7447  O  OE1   . GLU B 1 191 ? 12.748  56.833  23.778  1.00 27.80 ? 191  GLU B OE1   1 
ATOM   7448  O  OE2   . GLU B 1 191 ? 12.035  56.430  25.817  1.00 28.76 ? 191  GLU B OE2   1 
ATOM   7449  N  N     . GLY B 1 192 ? 17.623  54.042  24.080  1.00 24.24 ? 192  GLY B N     1 
ATOM   7450  C  CA    . GLY B 1 192 ? 17.927  52.614  24.130  1.00 24.25 ? 192  GLY B CA    1 
ATOM   7451  C  C     . GLY B 1 192 ? 19.395  52.280  24.352  1.00 24.21 ? 192  GLY B C     1 
ATOM   7452  O  O     . GLY B 1 192 ? 19.763  51.098  24.428  1.00 24.13 ? 192  GLY B O     1 
ATOM   7453  N  N     . ARG B 1 193 ? 20.225  53.318  24.460  1.00 23.79 ? 193  ARG B N     1 
ATOM   7454  C  CA    . ARG B 1 193 ? 21.670  53.165  24.583  1.00 23.64 ? 193  ARG B CA    1 
ATOM   7455  C  C     . ARG B 1 193 ? 22.072  52.653  25.951  1.00 23.70 ? 193  ARG B C     1 
ATOM   7456  O  O     . ARG B 1 193 ? 21.447  52.992  26.951  1.00 24.17 ? 193  ARG B O     1 
ATOM   7457  C  CB    . ARG B 1 193 ? 22.356  54.513  24.370  1.00 23.59 ? 193  ARG B CB    1 
ATOM   7458  C  CG    . ARG B 1 193 ? 22.400  54.958  22.940  1.00 22.72 ? 193  ARG B CG    1 
ATOM   7459  C  CD    . ARG B 1 193 ? 23.592  55.780  22.663  1.00 21.93 ? 193  ARG B CD    1 
ATOM   7460  N  NE    . ARG B 1 193 ? 24.802  54.978  22.719  1.00 21.45 ? 193  ARG B NE    1 
ATOM   7461  C  CZ    . ARG B 1 193 ? 25.270  54.243  21.724  1.00 20.81 ? 193  ARG B CZ    1 
ATOM   7462  N  NH1   . ARG B 1 193 ? 24.642  54.191  20.563  1.00 22.16 ? 193  ARG B NH1   1 
ATOM   7463  N  NH2   . ARG B 1 193 ? 26.385  53.546  21.888  1.00 21.32 ? 193  ARG B NH2   1 
ATOM   7464  N  N     . ARG B 1 194 ? 23.139  51.868  26.000  1.00 23.50 ? 194  ARG B N     1 
ATOM   7465  C  CA    . ARG B 1 194 ? 23.647  51.374  27.268  1.00 23.41 ? 194  ARG B CA    1 
ATOM   7466  C  C     . ARG B 1 194 ? 24.663  52.359  27.844  1.00 23.10 ? 194  ARG B C     1 
ATOM   7467  O  O     . ARG B 1 194 ? 25.337  53.065  27.091  1.00 23.13 ? 194  ARG B O     1 
ATOM   7468  C  CB    . ARG B 1 194 ? 24.256  49.981  27.087  1.00 23.76 ? 194  ARG B CB    1 
ATOM   7469  C  CG    . ARG B 1 194 ? 25.775  49.941  26.855  1.00 24.06 ? 194  ARG B CG    1 
ATOM   7470  C  CD    . ARG B 1 194 ? 26.193  50.094  25.414  1.00 23.58 ? 194  ARG B CD    1 
ATOM   7471  N  NE    . ARG B 1 194 ? 27.641  50.039  25.295  1.00 23.90 ? 194  ARG B NE    1 
ATOM   7472  C  CZ    . ARG B 1 194 ? 28.296  50.066  24.150  1.00 24.52 ? 194  ARG B CZ    1 
ATOM   7473  N  NH1   . ARG B 1 194 ? 27.627  50.142  23.008  1.00 24.38 ? 194  ARG B NH1   1 
ATOM   7474  N  NH2   . ARG B 1 194 ? 29.628  50.019  24.145  1.00 25.22 ? 194  ARG B NH2   1 
ATOM   7475  N  N     . GLY B 1 195 ? 24.755  52.413  29.174  1.00 22.78 ? 195  GLY B N     1 
ATOM   7476  C  CA    . GLY B 1 195 ? 25.717  53.269  29.850  1.00 22.50 ? 195  GLY B CA    1 
ATOM   7477  C  C     . GLY B 1 195 ? 25.275  54.710  29.999  1.00 22.50 ? 195  GLY B C     1 
ATOM   7478  O  O     . GLY B 1 195 ? 26.107  55.596  30.162  1.00 22.98 ? 195  GLY B O     1 
ATOM   7479  N  N     . LEU B 1 196 ? 23.974  54.960  29.957  1.00 22.41 ? 196  LEU B N     1 
ATOM   7480  C  CA    . LEU B 1 196 ? 23.450  56.308  30.172  1.00 22.22 ? 196  LEU B CA    1 
ATOM   7481  C  C     . LEU B 1 196 ? 23.677  56.782  31.603  1.00 21.78 ? 196  LEU B C     1 
ATOM   7482  O  O     . LEU B 1 196 ? 23.625  55.995  32.534  1.00 21.45 ? 196  LEU B O     1 
ATOM   7483  C  CB    . LEU B 1 196 ? 21.958  56.346  29.888  1.00 22.62 ? 196  LEU B CB    1 
ATOM   7484  C  CG    . LEU B 1 196 ? 21.475  56.331  28.442  1.00 23.45 ? 196  LEU B CG    1 
ATOM   7485  C  CD1   . LEU B 1 196 ? 19.953  56.080  28.450  1.00 22.88 ? 196  LEU B CD1   1 
ATOM   7486  C  CD2   . LEU B 1 196 ? 21.827  57.658  27.773  1.00 24.37 ? 196  LEU B CD2   1 
ATOM   7487  N  N     . ARG B 1 197 ? 23.900  58.081  31.765  1.00 21.71 ? 197  ARG B N     1 
ATOM   7488  C  CA    . ARG B 1 197 ? 24.207  58.679  33.060  1.00 21.69 ? 197  ARG B CA    1 
ATOM   7489  C  C     . ARG B 1 197 ? 23.592  60.087  33.136  1.00 21.85 ? 197  ARG B C     1 
ATOM   7490  O  O     . ARG B 1 197 ? 24.140  61.033  32.580  1.00 20.87 ? 197  ARG B O     1 
ATOM   7491  C  CB    . ARG B 1 197 ? 25.720  58.766  33.262  1.00 21.49 ? 197  ARG B CB    1 
ATOM   7492  C  CG    . ARG B 1 197 ? 26.468  57.441  33.173  1.00 21.59 ? 197  ARG B CG    1 
ATOM   7493  C  CD    . ARG B 1 197 ? 26.231  56.512  34.348  1.00 21.75 ? 197  ARG B CD    1 
ATOM   7494  N  NE    . ARG B 1 197 ? 27.044  55.296  34.284  1.00 21.52 ? 197  ARG B NE    1 
ATOM   7495  C  CZ    . ARG B 1 197 ? 26.618  54.093  33.857  1.00 21.63 ? 197  ARG B CZ    1 
ATOM   7496  N  NH1   . ARG B 1 197 ? 25.381  53.886  33.415  1.00 20.11 ? 197  ARG B NH1   1 
ATOM   7497  N  NH2   . ARG B 1 197 ? 27.460  53.077  33.866  1.00 22.13 ? 197  ARG B NH2   1 
ATOM   7498  N  N     . ARG B 1 198 ? 22.447  60.213  33.815  1.00 22.40 ? 198  ARG B N     1 
ATOM   7499  C  CA    . ARG B 1 198 ? 21.773  61.514  33.987  1.00 22.78 ? 198  ARG B CA    1 
ATOM   7500  C  C     . ARG B 1 198 ? 22.628  62.450  34.825  1.00 22.50 ? 198  ARG B C     1 
ATOM   7501  O  O     . ARG B 1 198 ? 23.114  62.044  35.861  1.00 22.71 ? 198  ARG B O     1 
ATOM   7502  C  CB    . ARG B 1 198 ? 20.431  61.314  34.671  1.00 23.01 ? 198  ARG B CB    1 
ATOM   7503  C  CG    . ARG B 1 198 ? 19.475  62.483  34.573  1.00 24.48 ? 198  ARG B CG    1 
ATOM   7504  C  CD    . ARG B 1 198 ? 17.979  62.116  34.839  1.00 26.29 ? 198  ARG B CD    1 
ATOM   7505  N  NE    . ARG B 1 198 ? 17.150  62.545  33.710  1.00 28.29 ? 198  ARG B NE    1 
ATOM   7506  C  CZ    . ARG B 1 198 ? 15.827  62.688  33.710  1.00 29.53 ? 198  ARG B CZ    1 
ATOM   7507  N  NH1   . ARG B 1 198 ? 15.092  62.408  34.785  1.00 29.99 ? 198  ARG B NH1   1 
ATOM   7508  N  NH2   . ARG B 1 198 ? 15.231  63.103  32.596  1.00 29.81 ? 198  ARG B NH2   1 
ATOM   7509  N  N     . ARG B 1 199 ? 22.819  63.692  34.384  1.00 22.48 ? 199  ARG B N     1 
ATOM   7510  C  CA    . ARG B 1 199 ? 23.714  64.629  35.081  1.00 22.42 ? 199  ARG B CA    1 
ATOM   7511  C  C     . ARG B 1 199 ? 23.077  65.996  35.355  1.00 22.52 ? 199  ARG B C     1 
ATOM   7512  O  O     . ARG B 1 199 ? 22.354  66.528  34.524  1.00 22.09 ? 199  ARG B O     1 
ATOM   7513  C  CB    . ARG B 1 199 ? 24.984  64.881  34.270  1.00 22.27 ? 199  ARG B CB    1 
ATOM   7514  C  CG    . ARG B 1 199 ? 25.785  63.658  33.853  1.00 21.88 ? 199  ARG B CG    1 
ATOM   7515  C  CD    . ARG B 1 199 ? 26.227  62.720  34.967  1.00 20.89 ? 199  ARG B CD    1 
ATOM   7516  N  NE    . ARG B 1 199 ? 26.906  63.411  36.055  1.00 20.37 ? 199  ARG B NE    1 
ATOM   7517  C  CZ    . ARG B 1 199 ? 27.480  62.815  37.086  1.00 19.68 ? 199  ARG B CZ    1 
ATOM   7518  N  NH1   . ARG B 1 199 ? 27.477  61.500  37.196  1.00 20.26 ? 199  ARG B NH1   1 
ATOM   7519  N  NH2   . ARG B 1 199 ? 28.065  63.536  38.025  1.00 20.14 ? 199  ARG B NH2   1 
ATOM   7520  N  N     . PRO B 1 200 ? 23.390  66.588  36.497  1.00 22.87 ? 200  PRO B N     1 
ATOM   7521  C  CA    . PRO B 1 200 ? 22.932  67.942  36.788  1.00 23.31 ? 200  PRO B CA    1 
ATOM   7522  C  C     . PRO B 1 200 ? 23.270  68.950  35.682  1.00 23.50 ? 200  PRO B C     1 
ATOM   7523  O  O     . PRO B 1 200 ? 24.298  68.853  35.034  1.00 23.31 ? 200  PRO B O     1 
ATOM   7524  C  CB    . PRO B 1 200 ? 23.665  68.298  38.089  1.00 23.45 ? 200  PRO B CB    1 
ATOM   7525  C  CG    . PRO B 1 200 ? 24.685  67.247  38.318  1.00 23.08 ? 200  PRO B CG    1 
ATOM   7526  C  CD    . PRO B 1 200 ? 24.232  66.047  37.580  1.00 23.16 ? 200  PRO B CD    1 
ATOM   7527  N  N     . LEU B 1 201 ? 22.380  69.914  35.500  1.00 24.08 ? 201  LEU B N     1 
ATOM   7528  C  CA    . LEU B 1 201 ? 22.511  70.947  34.476  1.00 24.62 ? 201  LEU B CA    1 
ATOM   7529  C  C     . LEU B 1 201 ? 23.730  71.869  34.685  1.00 24.60 ? 201  LEU B C     1 
ATOM   7530  O  O     . LEU B 1 201 ? 24.276  72.386  33.724  1.00 24.25 ? 201  LEU B O     1 
ATOM   7531  C  CB    . LEU B 1 201 ? 21.230  71.804  34.458  1.00 25.05 ? 201  LEU B CB    1 
ATOM   7532  C  CG    . LEU B 1 201 ? 20.461  71.971  33.144  1.00 25.90 ? 201  LEU B CG    1 
ATOM   7533  C  CD1   . LEU B 1 201 ? 19.157  72.747  33.415  1.00 25.33 ? 201  LEU B CD1   1 
ATOM   7534  C  CD2   . LEU B 1 201 ? 21.316  72.665  32.072  1.00 26.42 ? 201  LEU B CD2   1 
ATOM   7535  N  N     . TRP B 1 202 ? 24.119  72.101  35.937  1.00 25.06 ? 202  TRP B N     1 
ATOM   7536  C  CA    . TRP B 1 202 ? 25.289  72.936  36.258  1.00 25.67 ? 202  TRP B CA    1 
ATOM   7537  C  C     . TRP B 1 202 ? 26.643  72.316  35.836  1.00 25.33 ? 202  TRP B C     1 
ATOM   7538  O  O     . TRP B 1 202 ? 27.664  73.013  35.738  1.00 25.03 ? 202  TRP B O     1 
ATOM   7539  C  CB    . TRP B 1 202 ? 25.314  73.302  37.751  1.00 25.88 ? 202  TRP B CB    1 
ATOM   7540  C  CG    . TRP B 1 202 ? 25.375  72.128  38.709  1.00 28.89 ? 202  TRP B CG    1 
ATOM   7541  C  CD1   . TRP B 1 202 ? 24.308  71.451  39.257  1.00 31.03 ? 202  TRP B CD1   1 
ATOM   7542  C  CD2   . TRP B 1 202 ? 26.558  71.503  39.257  1.00 32.24 ? 202  TRP B CD2   1 
ATOM   7543  N  NE1   . TRP B 1 202 ? 24.755  70.449  40.091  1.00 31.75 ? 202  TRP B NE1   1 
ATOM   7544  C  CE2   . TRP B 1 202 ? 26.128  70.458  40.111  1.00 32.34 ? 202  TRP B CE2   1 
ATOM   7545  C  CE3   . TRP B 1 202 ? 27.943  71.722  39.112  1.00 33.53 ? 202  TRP B CE3   1 
ATOM   7546  C  CZ2   . TRP B 1 202 ? 27.025  69.642  40.811  1.00 33.46 ? 202  TRP B CZ2   1 
ATOM   7547  C  CZ3   . TRP B 1 202 ? 28.836  70.903  39.808  1.00 33.77 ? 202  TRP B CZ3   1 
ATOM   7548  C  CH2   . TRP B 1 202 ? 28.371  69.880  40.647  1.00 33.89 ? 202  TRP B CH2   1 
ATOM   7549  N  N     . GLU B 1 203 ? 26.653  71.009  35.587  1.00 25.11 ? 203  GLU B N     1 
ATOM   7550  C  CA    . GLU B 1 203 ? 27.850  70.348  35.081  1.00 24.69 ? 203  GLU B CA    1 
ATOM   7551  C  C     . GLU B 1 203 ? 28.175  70.733  33.646  1.00 24.64 ? 203  GLU B C     1 
ATOM   7552  O  O     . GLU B 1 203 ? 29.244  70.394  33.143  1.00 25.00 ? 203  GLU B O     1 
ATOM   7553  C  CB    . GLU B 1 203 ? 27.678  68.851  35.151  1.00 24.47 ? 203  GLU B CB    1 
ATOM   7554  C  CG    . GLU B 1 203 ? 27.972  68.305  36.516  1.00 24.11 ? 203  GLU B CG    1 
ATOM   7555  C  CD    . GLU B 1 203 ? 28.129  66.809  36.504  1.00 23.16 ? 203  GLU B CD    1 
ATOM   7556  O  OE1   . GLU B 1 203 ? 28.608  66.256  35.488  1.00 22.51 ? 203  GLU B OE1   1 
ATOM   7557  O  OE2   . GLU B 1 203 ? 27.779  66.201  37.520  1.00 22.44 ? 203  GLU B OE2   1 
ATOM   7558  N  N     . PHE B 1 204 ? 27.241  71.411  32.986  1.00 24.23 ? 204  PHE B N     1 
ATOM   7559  C  CA    . PHE B 1 204 ? 27.433  71.890  31.628  1.00 24.03 ? 204  PHE B CA    1 
ATOM   7560  C  C     . PHE B 1 204 ? 27.587  73.423  31.537  1.00 23.74 ? 204  PHE B C     1 
ATOM   7561  O  O     . PHE B 1 204 ? 27.364  74.000  30.479  1.00 23.80 ? 204  PHE B O     1 
ATOM   7562  C  CB    . PHE B 1 204 ? 26.253  71.403  30.779  1.00 24.19 ? 204  PHE B CB    1 
ATOM   7563  C  CG    . PHE B 1 204 ? 26.185  69.900  30.652  1.00 24.27 ? 204  PHE B CG    1 
ATOM   7564  C  CD1   . PHE B 1 204 ? 26.642  69.265  29.498  1.00 23.47 ? 204  PHE B CD1   1 
ATOM   7565  C  CD2   . PHE B 1 204 ? 25.687  69.126  31.688  1.00 24.06 ? 204  PHE B CD2   1 
ATOM   7566  C  CE1   . PHE B 1 204 ? 26.592  67.906  29.381  1.00 24.35 ? 204  PHE B CE1   1 
ATOM   7567  C  CE2   . PHE B 1 204 ? 25.634  67.748  31.580  1.00 24.02 ? 204  PHE B CE2   1 
ATOM   7568  C  CZ    . PHE B 1 204 ? 26.087  67.132  30.431  1.00 24.65 ? 204  PHE B CZ    1 
ATOM   7569  N  N     . GLU B 1 205 ? 27.981  74.083  32.626  1.00 23.33 ? 205  GLU B N     1 
ATOM   7570  C  CA    . GLU B 1 205 ? 28.178  75.541  32.590  1.00 23.26 ? 205  GLU B CA    1 
ATOM   7571  C  C     . GLU B 1 205 ? 29.447  75.871  31.814  1.00 22.51 ? 205  GLU B C     1 
ATOM   7572  O  O     . GLU B 1 205 ? 30.516  75.319  32.090  1.00 22.01 ? 205  GLU B O     1 
ATOM   7573  C  CB    . GLU B 1 205 ? 28.266  76.158  33.994  1.00 23.49 ? 205  GLU B CB    1 
ATOM   7574  C  CG    . GLU B 1 205 ? 27.588  77.518  34.131  1.00 25.23 ? 205  GLU B CG    1 
ATOM   7575  C  CD    . GLU B 1 205 ? 28.335  78.660  33.436  1.00 28.56 ? 205  GLU B CD    1 
ATOM   7576  O  OE1   . GLU B 1 205 ? 29.472  78.991  33.851  1.00 29.54 ? 205  GLU B OE1   1 
ATOM   7577  O  OE2   . GLU B 1 205 ? 27.778  79.255  32.477  1.00 30.48 ? 205  GLU B OE2   1 
ATOM   7578  N  N     . ILE B 1 206 ? 29.321  76.791  30.863  1.00 21.73 ? 206  ILE B N     1 
ATOM   7579  C  CA    . ILE B 1 206 ? 30.434  77.159  30.001  1.00 21.27 ? 206  ILE B CA    1 
ATOM   7580  C  C     . ILE B 1 206 ? 31.666  77.697  30.742  1.00 21.07 ? 206  ILE B C     1 
ATOM   7581  O  O     . ILE B 1 206 ? 32.776  77.387  30.354  1.00 21.61 ? 206  ILE B O     1 
ATOM   7582  C  CB    . ILE B 1 206 ? 29.973  78.146  28.902  1.00 21.13 ? 206  ILE B CB    1 
ATOM   7583  C  CG1   . ILE B 1 206 ? 31.041  78.273  27.809  1.00 21.51 ? 206  ILE B CG1   1 
ATOM   7584  C  CG2   . ILE B 1 206 ? 29.678  79.524  29.491  1.00 20.84 ? 206  ILE B CG2   1 
ATOM   7585  C  CD1   . ILE B 1 206 ? 31.112  77.139  26.828  1.00 21.20 ? 206  ILE B CD1   1 
ATOM   7586  N  N     . ASP B 1 207 ? 31.500  78.499  31.788  1.00 20.67 ? 207  ASP B N     1 
ATOM   7587  C  CA    . ASP B 1 207 ? 32.672  79.058  32.472  1.00 20.21 ? 207  ASP B CA    1 
ATOM   7588  C  C     . ASP B 1 207 ? 33.420  78.067  33.330  1.00 19.97 ? 207  ASP B C     1 
ATOM   7589  O  O     . ASP B 1 207 ? 34.645  78.126  33.405  1.00 19.38 ? 207  ASP B O     1 
ATOM   7590  C  CB    . ASP B 1 207 ? 32.305  80.293  33.286  1.00 20.10 ? 207  ASP B CB    1 
ATOM   7591  C  CG    . ASP B 1 207 ? 31.843  81.421  32.415  1.00 20.05 ? 207  ASP B CG    1 
ATOM   7592  O  OD1   . ASP B 1 207 ? 32.385  81.555  31.295  1.00 18.48 ? 207  ASP B OD1   1 
ATOM   7593  O  OD2   . ASP B 1 207 ? 30.932  82.209  32.751  1.00 21.78 ? 207  ASP B OD2   1 
ATOM   7594  N  N     . THR B 1 208 ? 32.693  77.166  33.985  1.00 20.31 ? 208  THR B N     1 
ATOM   7595  C  CA    . THR B 1 208 ? 33.324  76.022  34.657  1.00 20.31 ? 208  THR B CA    1 
ATOM   7596  C  C     . THR B 1 208 ? 34.059  75.195  33.628  1.00 20.04 ? 208  THR B C     1 
ATOM   7597  O  O     . THR B 1 208 ? 35.179  74.756  33.877  1.00 20.11 ? 208  THR B O     1 
ATOM   7598  C  CB    . THR B 1 208 ? 32.301  75.131  35.407  1.00 20.31 ? 208  THR B CB    1 
ATOM   7599  O  OG1   . THR B 1 208 ? 31.571  75.907  36.373  1.00 21.34 ? 208  THR B OG1   1 
ATOM   7600  C  CG2   . THR B 1 208 ? 33.010  74.128  36.269  1.00 20.23 ? 208  THR B CG2   1 
ATOM   7601  N  N     . ALA B 1 209 ? 33.446  75.021  32.459  1.00 19.92 ? 209  ALA B N     1 
ATOM   7602  C  CA    . ALA B 1 209 ? 34.006  74.162  31.412  1.00 19.95 ? 209  ALA B CA    1 
ATOM   7603  C  C     . ALA B 1 209 ? 35.361  74.671  30.909  1.00 20.19 ? 209  ALA B C     1 
ATOM   7604  O  O     . ALA B 1 209 ? 36.355  73.931  30.898  1.00 20.17 ? 209  ALA B O     1 
ATOM   7605  C  CB    . ALA B 1 209 ? 33.033  74.042  30.249  1.00 19.75 ? 209  ALA B CB    1 
ATOM   7606  N  N     . ARG B 1 210 ? 35.384  75.932  30.478  1.00 20.16 ? 210  ARG B N     1 
ATOM   7607  C  CA    . ARG B 1 210 ? 36.577  76.541  29.934  1.00 20.10 ? 210  ARG B CA    1 
ATOM   7608  C  C     . ARG B 1 210 ? 37.692  76.498  30.959  1.00 20.53 ? 210  ARG B C     1 
ATOM   7609  O  O     . ARG B 1 210 ? 38.854  76.294  30.625  1.00 20.59 ? 210  ARG B O     1 
ATOM   7610  C  CB    . ARG B 1 210 ? 36.313  77.992  29.588  1.00 20.24 ? 210  ARG B CB    1 
ATOM   7611  C  CG    . ARG B 1 210 ? 35.498  78.253  28.347  1.00 19.87 ? 210  ARG B CG    1 
ATOM   7612  C  CD    . ARG B 1 210 ? 35.367  79.757  28.094  1.00 18.45 ? 210  ARG B CD    1 
ATOM   7613  N  NE    . ARG B 1 210 ? 34.247  80.085  27.224  1.00 17.71 ? 210  ARG B NE    1 
ATOM   7614  C  CZ    . ARG B 1 210 ? 34.266  80.039  25.894  1.00 17.60 ? 210  ARG B CZ    1 
ATOM   7615  N  NH1   . ARG B 1 210 ? 35.360  79.675  25.234  1.00 16.92 ? 210  ARG B NH1   1 
ATOM   7616  N  NH2   . ARG B 1 210 ? 33.167  80.366  25.219  1.00 18.63 ? 210  ARG B NH2   1 
ATOM   7617  N  N     . GLN B 1 211 ? 37.336  76.702  32.216  1.00 21.18 ? 211  GLN B N     1 
ATOM   7618  C  CA    . GLN B 1 211 ? 38.334  76.871  33.259  1.00 21.81 ? 211  GLN B CA    1 
ATOM   7619  C  C     . GLN B 1 211 ? 38.898  75.515  33.661  1.00 21.98 ? 211  GLN B C     1 
ATOM   7620  O  O     . GLN B 1 211 ? 40.067  75.416  34.030  1.00 22.65 ? 211  GLN B O     1 
ATOM   7621  C  CB    . GLN B 1 211 ? 37.737  77.613  34.457  1.00 21.88 ? 211  GLN B CB    1 
ATOM   7622  C  CG    . GLN B 1 211 ? 38.662  77.722  35.670  1.00 22.67 ? 211  GLN B CG    1 
ATOM   7623  C  CD    . GLN B 1 211 ? 38.034  77.148  36.933  1.00 23.25 ? 211  GLN B CD    1 
ATOM   7624  O  OE1   . GLN B 1 211 ? 38.235  75.959  37.277  1.00 21.80 ? 211  GLN B OE1   1 
ATOM   7625  N  NE2   . GLN B 1 211 ? 37.258  77.986  37.624  1.00 22.90 ? 211  GLN B NE2   1 
ATOM   7626  N  N     . GLN B 1 212 ? 38.089  74.471  33.574  1.00 21.91 ? 212  GLN B N     1 
ATOM   7627  C  CA    . GLN B 1 212 ? 38.593  73.136  33.858  1.00 22.24 ? 212  GLN B CA    1 
ATOM   7628  C  C     . GLN B 1 212 ? 39.528  72.733  32.758  1.00 21.44 ? 212  GLN B C     1 
ATOM   7629  O  O     . GLN B 1 212 ? 40.643  72.322  33.029  1.00 21.78 ? 212  GLN B O     1 
ATOM   7630  C  CB    . GLN B 1 212 ? 37.471  72.089  33.955  1.00 22.82 ? 212  GLN B CB    1 
ATOM   7631  C  CG    . GLN B 1 212 ? 37.593  71.198  35.189  1.00 24.78 ? 212  GLN B CG    1 
ATOM   7632  C  CD    . GLN B 1 212 ? 37.179  71.938  36.434  1.00 26.41 ? 212  GLN B CD    1 
ATOM   7633  O  OE1   . GLN B 1 212 ? 36.123  72.573  36.441  1.00 28.55 ? 212  GLN B OE1   1 
ATOM   7634  N  NE2   . GLN B 1 212 ? 38.011  71.889  37.482  1.00 26.28 ? 212  GLN B NE2   1 
ATOM   7635  N  N     . LEU B 1 213 ? 39.051  72.843  31.522  1.00 20.39 ? 213  LEU B N     1 
ATOM   7636  C  CA    . LEU B 1 213 ? 39.785  72.382  30.360  1.00 19.81 ? 213  LEU B CA    1 
ATOM   7637  C  C     . LEU B 1 213 ? 41.149  73.054  30.233  1.00 19.51 ? 213  LEU B C     1 
ATOM   7638  O  O     . LEU B 1 213 ? 42.147  72.366  29.967  1.00 19.55 ? 213  LEU B O     1 
ATOM   7639  C  CB    . LEU B 1 213 ? 38.967  72.613  29.099  1.00 19.76 ? 213  LEU B CB    1 
ATOM   7640  C  CG    . LEU B 1 213 ? 37.743  71.719  28.905  1.00 20.90 ? 213  LEU B CG    1 
ATOM   7641  C  CD1   . LEU B 1 213 ? 36.882  72.288  27.806  1.00 23.51 ? 213  LEU B CD1   1 
ATOM   7642  C  CD2   . LEU B 1 213 ? 38.117  70.293  28.544  1.00 20.08 ? 213  LEU B CD2   1 
ATOM   7643  N  N     . ASN B 1 214 ? 41.185  74.380  30.434  1.00 18.55 ? 214  ASN B N     1 
ATOM   7644  C  CA    . ASN B 1 214 ? 42.430  75.157  30.431  1.00 17.88 ? 214  ASN B CA    1 
ATOM   7645  C  C     . ASN B 1 214 ? 43.359  74.728  31.550  1.00 18.14 ? 214  ASN B C     1 
ATOM   7646  O  O     . ASN B 1 214 ? 44.559  74.585  31.346  1.00 17.59 ? 214  ASN B O     1 
ATOM   7647  C  CB    . ASN B 1 214 ? 42.157  76.666  30.572  1.00 17.48 ? 214  ASN B CB    1 
ATOM   7648  C  CG    . ASN B 1 214 ? 41.706  77.302  29.285  1.00 16.04 ? 214  ASN B CG    1 
ATOM   7649  O  OD1   . ASN B 1 214 ? 42.405  77.257  28.263  1.00 14.10 ? 214  ASN B OD1   1 
ATOM   7650  N  ND2   . ASN B 1 214 ? 40.513  77.885  29.312  1.00 14.45 ? 214  ASN B ND2   1 
ATOM   7651  N  N     . LEU B 1 215 ? 42.803  74.545  32.742  1.00 18.77 ? 215  LEU B N     1 
ATOM   7652  C  CA    . LEU B 1 215 ? 43.556  73.940  33.848  1.00 19.17 ? 215  LEU B CA    1 
ATOM   7653  C  C     . LEU B 1 215 ? 44.104  72.563  33.476  1.00 18.72 ? 215  LEU B C     1 
ATOM   7654  O  O     . LEU B 1 215 ? 45.255  72.273  33.759  1.00 19.36 ? 215  LEU B O     1 
ATOM   7655  C  CB    . LEU B 1 215 ? 42.714  73.815  35.127  1.00 19.40 ? 215  LEU B CB    1 
ATOM   7656  C  CG    . LEU B 1 215 ? 43.518  73.541  36.409  1.00 20.23 ? 215  LEU B CG    1 
ATOM   7657  C  CD1   . LEU B 1 215 ? 44.362  74.764  36.804  1.00 20.89 ? 215  LEU B CD1   1 
ATOM   7658  C  CD2   . LEU B 1 215 ? 42.601  73.125  37.549  1.00 19.96 ? 215  LEU B CD2   1 
ATOM   7659  N  N     . GLN B 1 216 ? 43.314  71.724  32.822  1.00 18.36 ? 216  GLN B N     1 
ATOM   7660  C  CA    . GLN B 1 216 ? 43.786  70.368  32.491  1.00 18.17 ? 216  GLN B CA    1 
ATOM   7661  C  C     . GLN B 1 216 ? 44.994  70.417  31.551  1.00 17.49 ? 216  GLN B C     1 
ATOM   7662  O  O     . GLN B 1 216 ? 45.944  69.670  31.760  1.00 17.71 ? 216  GLN B O     1 
ATOM   7663  C  CB    . GLN B 1 216 ? 42.670  69.507  31.890  1.00 18.00 ? 216  GLN B CB    1 
ATOM   7664  C  CG    . GLN B 1 216 ? 43.160  68.241  31.232  1.00 18.61 ? 216  GLN B CG    1 
ATOM   7665  C  CD    . GLN B 1 216 ? 43.617  67.201  32.231  1.00 19.40 ? 216  GLN B CD    1 
ATOM   7666  O  OE1   . GLN B 1 216 ? 43.152  67.188  33.354  1.00 23.76 ? 216  GLN B OE1   1 
ATOM   7667  N  NE2   . GLN B 1 216 ? 44.493  66.308  31.813  1.00 17.62 ? 216  GLN B NE2   1 
ATOM   7668  N  N     . PHE B 1 217 ? 44.947  71.308  30.554  1.00 16.61 ? 217  PHE B N     1 
ATOM   7669  C  CA    . PHE B 1 217 ? 45.949  71.400  29.487  1.00 15.98 ? 217  PHE B CA    1 
ATOM   7670  C  C     . PHE B 1 217 ? 47.023  72.477  29.709  1.00 15.38 ? 217  PHE B C     1 
ATOM   7671  O  O     . PHE B 1 217 ? 47.842  72.728  28.830  1.00 15.82 ? 217  PHE B O     1 
ATOM   7672  C  CB    . PHE B 1 217 ? 45.285  71.737  28.126  1.00 16.21 ? 217  PHE B CB    1 
ATOM   7673  C  CG    . PHE B 1 217 ? 44.097  70.881  27.753  1.00 16.20 ? 217  PHE B CG    1 
ATOM   7674  C  CD1   . PHE B 1 217 ? 44.129  69.492  27.884  1.00 18.98 ? 217  PHE B CD1   1 
ATOM   7675  C  CD2   . PHE B 1 217 ? 42.958  71.468  27.212  1.00 16.60 ? 217  PHE B CD2   1 
ATOM   7676  C  CE1   . PHE B 1 217 ? 43.013  68.697  27.521  1.00 17.71 ? 217  PHE B CE1   1 
ATOM   7677  C  CE2   . PHE B 1 217 ? 41.867  70.699  26.842  1.00 16.99 ? 217  PHE B CE2   1 
ATOM   7678  C  CZ    . PHE B 1 217 ? 41.887  69.307  27.003  1.00 17.03 ? 217  PHE B CZ    1 
ATOM   7679  N  N     . GLY B 1 218 ? 47.015  73.157  30.838  1.00 14.92 ? 218  GLY B N     1 
ATOM   7680  C  CA    . GLY B 1 218 ? 48.037  74.158  31.100  1.00 14.88 ? 218  GLY B CA    1 
ATOM   7681  C  C     . GLY B 1 218 ? 47.989  75.458  30.287  1.00 15.06 ? 218  GLY B C     1 
ATOM   7682  O  O     . GLY B 1 218 ? 48.965  76.219  30.299  1.00 15.82 ? 218  GLY B O     1 
ATOM   7683  N  N     . THR B 1 219 ? 46.880  75.735  29.603  1.00 14.60 ? 219  THR B N     1 
ATOM   7684  C  CA    . THR B 1 219 ? 46.766  76.920  28.757  1.00 14.29 ? 219  THR B CA    1 
ATOM   7685  C  C     . THR B 1 219 ? 45.897  77.961  29.434  1.00 14.45 ? 219  THR B C     1 
ATOM   7686  O  O     . THR B 1 219 ? 45.090  77.602  30.295  1.00 14.72 ? 219  THR B O     1 
ATOM   7687  C  CB    . THR B 1 219 ? 46.113  76.575  27.403  1.00 14.09 ? 219  THR B CB    1 
ATOM   7688  O  OG1   . THR B 1 219 ? 44.764  76.153  27.625  1.00 14.04 ? 219  THR B OG1   1 
ATOM   7689  C  CG2   . THR B 1 219 ? 46.790  75.406  26.727  1.00 13.44 ? 219  THR B CG2   1 
ATOM   7690  N  N     . ARG B 1 220 ? 46.047  79.237  29.042  1.00 14.01 ? 220  ARG B N     1 
ATOM   7691  C  CA    . ARG B 1 220 ? 45.119  80.280  29.494  1.00 13.90 ? 220  ARG B CA    1 
ATOM   7692  C  C     . ARG B 1 220 ? 43.810  80.251  28.663  1.00 13.36 ? 220  ARG B C     1 
ATOM   7693  O  O     . ARG B 1 220 ? 42.705  80.442  29.203  1.00 12.06 ? 220  ARG B O     1 
ATOM   7694  C  CB    . ARG B 1 220 ? 45.780  81.666  29.472  1.00 14.27 ? 220  ARG B CB    1 
ATOM   7695  C  CG    . ARG B 1 220 ? 46.453  82.079  28.148  1.00 16.09 ? 220  ARG B CG    1 
ATOM   7696  C  CD    . ARG B 1 220 ? 46.717  83.596  27.997  1.00 17.80 ? 220  ARG B CD    1 
ATOM   7697  N  NE    . ARG B 1 220 ? 46.589  84.057  26.597  1.00 18.81 ? 220  ARG B NE    1 
ATOM   7698  C  CZ    . ARG B 1 220 ? 47.598  84.451  25.805  1.00 19.22 ? 220  ARG B CZ    1 
ATOM   7699  N  NH1   . ARG B 1 220 ? 48.866  84.475  26.229  1.00 19.40 ? 220  ARG B NH1   1 
ATOM   7700  N  NH2   . ARG B 1 220 ? 47.334  84.839  24.564  1.00 19.54 ? 220  ARG B NH2   1 
ATOM   7701  N  N     . ASP B 1 221 ? 43.945  79.985  27.363  1.00 13.19 ? 221  ASP B N     1 
ATOM   7702  C  CA    . ASP B 1 221 ? 42.793  79.892  26.454  1.00 13.85 ? 221  ASP B CA    1 
ATOM   7703  C  C     . ASP B 1 221 ? 42.940  78.714  25.472  1.00 13.97 ? 221  ASP B C     1 
ATOM   7704  O  O     . ASP B 1 221 ? 44.024  78.162  25.320  1.00 14.69 ? 221  ASP B O     1 
ATOM   7705  C  CB    . ASP B 1 221 ? 42.598  81.219  25.696  1.00 13.91 ? 221  ASP B CB    1 
ATOM   7706  C  CG    . ASP B 1 221 ? 43.787  81.578  24.839  1.00 14.34 ? 221  ASP B CG    1 
ATOM   7707  O  OD1   . ASP B 1 221 ? 43.833  81.114  23.687  1.00 15.77 ? 221  ASP B OD1   1 
ATOM   7708  O  OD2   . ASP B 1 221 ? 44.742  82.284  25.228  1.00 15.64 ? 221  ASP B OD2   1 
ATOM   7709  N  N     . LEU B 1 222 ? 41.859  78.340  24.792  1.00 13.87 ? 222  LEU B N     1 
ATOM   7710  C  CA    . LEU B 1 222 ? 41.820  77.078  24.044  1.00 13.55 ? 222  LEU B CA    1 
ATOM   7711  C  C     . LEU B 1 222 ? 41.972  77.299  22.553  1.00 14.38 ? 222  LEU B C     1 
ATOM   7712  O  O     . LEU B 1 222 ? 41.459  76.525  21.731  1.00 14.77 ? 222  LEU B O     1 
ATOM   7713  C  CB    . LEU B 1 222 ? 40.512  76.357  24.302  1.00 13.03 ? 222  LEU B CB    1 
ATOM   7714  C  CG    . LEU B 1 222 ? 40.193  76.043  25.754  1.00 11.43 ? 222  LEU B CG    1 
ATOM   7715  C  CD1   . LEU B 1 222 ? 38.746  75.619  25.871  1.00 10.08 ? 222  LEU B CD1   1 
ATOM   7716  C  CD2   . LEU B 1 222 ? 41.119  74.992  26.280  1.00 11.56 ? 222  LEU B CD2   1 
ATOM   7717  N  N     . VAL B 1 223 ? 42.717  78.331  22.198  1.00 14.75 ? 223  VAL B N     1 
ATOM   7718  C  CA    . VAL B 1 223 ? 42.795  78.760  20.813  1.00 15.02 ? 223  VAL B CA    1 
ATOM   7719  C  C     . VAL B 1 223 ? 43.729  77.842  20.004  1.00 15.12 ? 223  VAL B C     1 
ATOM   7720  O  O     . VAL B 1 223 ? 43.484  77.605  18.826  1.00 14.83 ? 223  VAL B O     1 
ATOM   7721  C  CB    . VAL B 1 223 ? 43.237  80.242  20.746  1.00 14.91 ? 223  VAL B CB    1 
ATOM   7722  C  CG1   . VAL B 1 223 ? 43.663  80.617  19.356  1.00 15.29 ? 223  VAL B CG1   1 
ATOM   7723  C  CG2   . VAL B 1 223 ? 42.104  81.153  21.229  1.00 13.78 ? 223  VAL B CG2   1 
ATOM   7724  N  N     . GLY B 1 224 ? 44.791  77.349  20.643  1.00 15.27 ? 224  GLY B N     1 
ATOM   7725  C  CA    . GLY B 1 224 ? 45.707  76.385  20.044  1.00 15.62 ? 224  GLY B CA    1 
ATOM   7726  C  C     . GLY B 1 224 ? 45.082  75.014  19.783  1.00 15.93 ? 224  GLY B C     1 
ATOM   7727  O  O     . GLY B 1 224 ? 45.640  74.189  19.055  1.00 16.13 ? 224  GLY B O     1 
ATOM   7728  N  N     . PHE B 1 225 ? 43.924  74.775  20.387  1.00 15.88 ? 225  PHE B N     1 
ATOM   7729  C  CA    . PHE B 1 225 ? 43.160  73.551  20.173  1.00 15.78 ? 225  PHE B CA    1 
ATOM   7730  C  C     . PHE B 1 225 ? 41.996  73.739  19.195  1.00 14.94 ? 225  PHE B C     1 
ATOM   7731  O  O     . PHE B 1 225 ? 41.354  72.750  18.792  1.00 14.46 ? 225  PHE B O     1 
ATOM   7732  C  CB    . PHE B 1 225 ? 42.656  73.070  21.514  1.00 15.91 ? 225  PHE B CB    1 
ATOM   7733  C  CG    . PHE B 1 225 ? 43.753  72.773  22.464  1.00 17.83 ? 225  PHE B CG    1 
ATOM   7734  C  CD1   . PHE B 1 225 ? 44.626  71.703  22.211  1.00 19.00 ? 225  PHE B CD1   1 
ATOM   7735  C  CD2   . PHE B 1 225 ? 43.960  73.565  23.582  1.00 18.54 ? 225  PHE B CD2   1 
ATOM   7736  C  CE1   . PHE B 1 225 ? 45.670  71.401  23.083  1.00 18.04 ? 225  PHE B CE1   1 
ATOM   7737  C  CE2   . PHE B 1 225 ? 45.002  73.275  24.456  1.00 19.32 ? 225  PHE B CE2   1 
ATOM   7738  C  CZ    . PHE B 1 225 ? 45.861  72.174  24.202  1.00 19.04 ? 225  PHE B CZ    1 
ATOM   7739  N  N     . GLY B 1 226 ? 41.734  75.001  18.837  1.00 13.55 ? 226  GLY B N     1 
ATOM   7740  C  CA    . GLY B 1 226 ? 40.795  75.349  17.789  1.00 12.81 ? 226  GLY B CA    1 
ATOM   7741  C  C     . GLY B 1 226 ? 39.333  75.311  18.210  1.00 12.23 ? 226  GLY B C     1 
ATOM   7742  O  O     . GLY B 1 226 ? 38.459  75.156  17.358  1.00 11.36 ? 226  GLY B O     1 
ATOM   7743  N  N     . VAL B 1 227 ? 39.071  75.470  19.508  1.00 12.36 ? 227  VAL B N     1 
ATOM   7744  C  CA    . VAL B 1 227 ? 37.725  75.261  20.077  1.00 12.65 ? 227  VAL B CA    1 
ATOM   7745  C  C     . VAL B 1 227 ? 37.254  76.400  20.958  1.00 13.23 ? 227  VAL B C     1 
ATOM   7746  O  O     . VAL B 1 227 ? 36.227  76.276  21.605  1.00 13.60 ? 227  VAL B O     1 
ATOM   7747  C  CB    . VAL B 1 227 ? 37.589  73.878  20.878  1.00 11.92 ? 227  VAL B CB    1 
ATOM   7748  C  CG1   . VAL B 1 227 ? 38.233  72.748  20.126  1.00 11.85 ? 227  VAL B CG1   1 
ATOM   7749  C  CG2   . VAL B 1 227 ? 38.220  73.939  22.227  1.00 11.98 ? 227  VAL B CG2   1 
ATOM   7750  N  N     . GLU B 1 228 ? 37.964  77.521  20.976  1.00 14.45 ? 228  GLU B N     1 
ATOM   7751  C  CA    . GLU B 1 228 ? 37.560  78.628  21.848  1.00 15.34 ? 228  GLU B CA    1 
ATOM   7752  C  C     . GLU B 1 228 ? 36.138  79.152  21.515  1.00 15.57 ? 228  GLU B C     1 
ATOM   7753  O  O     . GLU B 1 228 ? 35.362  79.443  22.417  1.00 15.68 ? 228  GLU B O     1 
ATOM   7754  C  CB    . GLU B 1 228 ? 38.608  79.748  21.845  1.00 15.24 ? 228  GLU B CB    1 
ATOM   7755  C  CG    . GLU B 1 228 ? 38.349  80.820  22.893  1.00 16.17 ? 228  GLU B CG    1 
ATOM   7756  C  CD    . GLU B 1 228 ? 39.030  80.568  24.234  1.00 17.67 ? 228  GLU B CD    1 
ATOM   7757  O  OE1   . GLU B 1 228 ? 38.980  79.424  24.769  1.00 16.75 ? 228  GLU B OE1   1 
ATOM   7758  O  OE2   . GLU B 1 228 ? 39.595  81.555  24.772  1.00 18.19 ? 228  GLU B OE2   1 
ATOM   7759  N  N     . ASN B 1 229 ? 35.777  79.224  20.239  1.00 16.13 ? 229  ASN B N     1 
ATOM   7760  C  CA    . ASN B 1 229 ? 34.402  79.591  19.867  1.00 16.82 ? 229  ASN B CA    1 
ATOM   7761  C  C     . ASN B 1 229 ? 33.504  78.393  19.583  1.00 16.66 ? 229  ASN B C     1 
ATOM   7762  O  O     . ASN B 1 229 ? 32.793  78.359  18.595  1.00 16.89 ? 229  ASN B O     1 
ATOM   7763  C  CB    . ASN B 1 229 ? 34.379  80.573  18.677  1.00 17.32 ? 229  ASN B CB    1 
ATOM   7764  C  CG    . ASN B 1 229 ? 34.980  79.992  17.400  1.00 18.35 ? 229  ASN B CG    1 
ATOM   7765  O  OD1   . ASN B 1 229 ? 35.481  78.843  17.377  1.00 19.18 ? 229  ASN B OD1   1 
ATOM   7766  N  ND2   . ASN B 1 229 ? 34.946  80.796  16.320  1.00 17.72 ? 229  ASN B ND2   1 
ATOM   7767  N  N     . ALA B 1 230 ? 33.513  77.421  20.476  1.00 16.94 ? 230  ALA B N     1 
ATOM   7768  C  CA    . ALA B 1 230 ? 32.717  76.221  20.286  1.00 17.11 ? 230  ALA B CA    1 
ATOM   7769  C  C     . ALA B 1 230 ? 31.984  75.860  21.571  1.00 17.16 ? 230  ALA B C     1 
ATOM   7770  O  O     . ALA B 1 230 ? 32.052  74.721  22.021  1.00 16.83 ? 230  ALA B O     1 
ATOM   7771  C  CB    . ALA B 1 230 ? 33.607  75.085  19.837  1.00 17.13 ? 230  ALA B CB    1 
ATOM   7772  N  N     . PRO B 1 231 ? 31.241  76.821  22.122  1.00 17.24 ? 231  PRO B N     1 
ATOM   7773  C  CA    . PRO B 1 231 ? 30.687  76.719  23.483  1.00 17.52 ? 231  PRO B CA    1 
ATOM   7774  C  C     . PRO B 1 231 ? 29.761  75.522  23.739  1.00 17.67 ? 231  PRO B C     1 
ATOM   7775  O  O     . PRO B 1 231 ? 29.856  74.906  24.779  1.00 16.76 ? 231  PRO B O     1 
ATOM   7776  C  CB    . PRO B 1 231 ? 29.907  78.034  23.632  1.00 17.19 ? 231  PRO B CB    1 
ATOM   7777  C  CG    . PRO B 1 231 ? 29.618  78.457  22.246  1.00 16.92 ? 231  PRO B CG    1 
ATOM   7778  C  CD    . PRO B 1 231 ? 30.828  78.071  21.470  1.00 17.07 ? 231  PRO B CD    1 
ATOM   7779  N  N     . ARG B 1 232 ? 28.858  75.241  22.816  1.00 18.64 ? 232  ARG B N     1 
ATOM   7780  C  CA    . ARG B 1 232 ? 27.998  74.056  22.886  1.00 19.92 ? 232  ARG B CA    1 
ATOM   7781  C  C     . ARG B 1 232 ? 28.843  72.786  23.155  1.00 19.99 ? 232  ARG B C     1 
ATOM   7782  O  O     . ARG B 1 232 ? 28.571  72.015  24.084  1.00 20.57 ? 232  ARG B O     1 
ATOM   7783  C  CB    . ARG B 1 232 ? 27.229  73.913  21.551  1.00 20.60 ? 232  ARG B CB    1 
ATOM   7784  C  CG    . ARG B 1 232 ? 25.788  73.417  21.625  1.00 22.91 ? 232  ARG B CG    1 
ATOM   7785  C  CD    . ARG B 1 232 ? 24.725  74.245  20.843  1.00 25.48 ? 232  ARG B CD    1 
ATOM   7786  N  NE    . ARG B 1 232 ? 25.191  74.920  19.622  1.00 28.60 ? 232  ARG B NE    1 
ATOM   7787  C  CZ    . ARG B 1 232 ? 25.323  74.358  18.415  1.00 29.75 ? 232  ARG B CZ    1 
ATOM   7788  N  NH1   . ARG B 1 232 ? 25.050  73.078  18.224  1.00 30.55 ? 232  ARG B NH1   1 
ATOM   7789  N  NH2   . ARG B 1 232 ? 25.751  75.085  17.388  1.00 30.02 ? 232  ARG B NH2   1 
ATOM   7790  N  N     . GLY B 1 233 ? 29.873  72.581  22.335  1.00 19.74 ? 233  GLY B N     1 
ATOM   7791  C  CA    . GLY B 1 233 ? 30.786  71.463  22.489  1.00 19.30 ? 233  GLY B CA    1 
ATOM   7792  C  C     . GLY B 1 233 ? 31.597  71.549  23.762  1.00 18.79 ? 233  GLY B C     1 
ATOM   7793  O  O     . GLY B 1 233 ? 31.806  70.551  24.421  1.00 19.50 ? 233  GLY B O     1 
ATOM   7794  N  N     . LEU B 1 234 ? 32.040  72.742  24.127  1.00 18.39 ? 234  LEU B N     1 
ATOM   7795  C  CA    . LEU B 1 234 ? 32.890  72.911  25.304  1.00 18.00 ? 234  LEU B CA    1 
ATOM   7796  C  C     . LEU B 1 234 ? 32.189  72.439  26.581  1.00 17.77 ? 234  LEU B C     1 
ATOM   7797  O  O     . LEU B 1 234 ? 32.806  71.788  27.439  1.00 17.09 ? 234  LEU B O     1 
ATOM   7798  C  CB    . LEU B 1 234 ? 33.352  74.365  25.438  1.00 17.71 ? 234  LEU B CB    1 
ATOM   7799  C  CG    . LEU B 1 234 ? 34.578  74.712  24.602  1.00 17.45 ? 234  LEU B CG    1 
ATOM   7800  C  CD1   . LEU B 1 234 ? 34.737  76.213  24.501  1.00 17.76 ? 234  LEU B CD1   1 
ATOM   7801  C  CD2   . LEU B 1 234 ? 35.816  74.097  25.214  1.00 17.25 ? 234  LEU B CD2   1 
ATOM   7802  N  N     . CYS B 1 235 ? 30.895  72.742  26.670  1.00 17.54 ? 235  CYS B N     1 
ATOM   7803  C  CA    . CYS B 1 235 ? 30.079  72.375  27.822  1.00 17.29 ? 235  CYS B CA    1 
ATOM   7804  C  C     . CYS B 1 235 ? 30.022  70.896  27.971  1.00 17.03 ? 235  CYS B C     1 
ATOM   7805  O  O     . CYS B 1 235 ? 30.129  70.380  29.069  1.00 17.08 ? 235  CYS B O     1 
ATOM   7806  C  CB    . CYS B 1 235 ? 28.664  72.911  27.689  1.00 17.42 ? 235  CYS B CB    1 
ATOM   7807  S  SG    . CYS B 1 235 ? 28.612  74.683  27.966  1.00 15.45 ? 235  CYS B SG    1 
ATOM   7808  N  N     . ALA B 1 236 ? 29.848  70.214  26.856  1.00 17.42 ? 236  ALA B N     1 
ATOM   7809  C  CA    . ALA B 1 236 ? 29.892  68.757  26.853  1.00 17.45 ? 236  ALA B CA    1 
ATOM   7810  C  C     . ALA B 1 236 ? 31.250  68.259  27.332  1.00 17.52 ? 236  ALA B C     1 
ATOM   7811  O  O     . ALA B 1 236 ? 31.316  67.409  28.213  1.00 17.34 ? 236  ALA B O     1 
ATOM   7812  C  CB    . ALA B 1 236 ? 29.583  68.235  25.480  1.00 17.77 ? 236  ALA B CB    1 
ATOM   7813  N  N     . ALA B 1 237 ? 32.334  68.817  26.798  1.00 17.73 ? 237  ALA B N     1 
ATOM   7814  C  CA    . ALA B 1 237 ? 33.679  68.361  27.179  1.00 18.06 ? 237  ALA B CA    1 
ATOM   7815  C  C     . ALA B 1 237 ? 34.064  68.708  28.623  1.00 18.29 ? 237  ALA B C     1 
ATOM   7816  O  O     . ALA B 1 237 ? 34.969  68.119  29.196  1.00 18.11 ? 237  ALA B O     1 
ATOM   7817  C  CB    . ALA B 1 237 ? 34.712  68.907  26.203  1.00 17.96 ? 237  ALA B CB    1 
ATOM   7818  N  N     . GLY B 1 238 ? 33.378  69.682  29.203  1.00 19.36 ? 238  GLY B N     1 
ATOM   7819  C  CA    . GLY B 1 238 ? 33.660  70.128  30.550  1.00 19.75 ? 238  GLY B CA    1 
ATOM   7820  C  C     . GLY B 1 238 ? 33.019  69.181  31.537  1.00 20.29 ? 238  GLY B C     1 
ATOM   7821  O  O     . GLY B 1 238 ? 33.532  68.984  32.644  1.00 20.44 ? 238  GLY B O     1 
ATOM   7822  N  N     . CYS B 1 239 ? 31.875  68.628  31.140  1.00 20.96 ? 239  CYS B N     1 
ATOM   7823  C  CA    . CYS B 1 239 ? 31.194  67.604  31.908  1.00 21.69 ? 239  CYS B CA    1 
ATOM   7824  C  C     . CYS B 1 239 ? 32.048  66.362  31.822  1.00 21.79 ? 239  CYS B C     1 
ATOM   7825  O  O     . CYS B 1 239 ? 32.509  65.858  32.823  1.00 22.20 ? 239  CYS B O     1 
ATOM   7826  C  CB    . CYS B 1 239 ? 29.802  67.341  31.335  1.00 22.06 ? 239  CYS B CB    1 
ATOM   7827  S  SG    . CYS B 1 239 ? 28.862  66.006  32.127  1.00 24.28 ? 239  CYS B SG    1 
ATOM   7828  N  N     . LEU B 1 240 ? 32.315  65.911  30.607  1.00 21.96 ? 240  LEU B N     1 
ATOM   7829  C  CA    . LEU B 1 240 ? 33.063  64.674  30.394  1.00 22.06 ? 240  LEU B CA    1 
ATOM   7830  C  C     . LEU B 1 240 ? 34.304  64.590  31.285  1.00 22.20 ? 240  LEU B C     1 
ATOM   7831  O  O     . LEU B 1 240 ? 34.551  63.557  31.924  1.00 21.72 ? 240  LEU B O     1 
ATOM   7832  C  CB    . LEU B 1 240 ? 33.480  64.545  28.926  1.00 21.76 ? 240  LEU B CB    1 
ATOM   7833  C  CG    . LEU B 1 240 ? 33.936  63.148  28.539  1.00 21.43 ? 240  LEU B CG    1 
ATOM   7834  C  CD1   . LEU B 1 240 ? 33.717  62.874  27.040  1.00 21.05 ? 240  LEU B CD1   1 
ATOM   7835  C  CD2   . LEU B 1 240 ? 35.398  62.943  28.876  1.00 22.08 ? 240  LEU B CD2   1 
ATOM   7836  N  N     . LEU B 1 241 ? 35.078  65.677  31.298  1.00 22.09 ? 241  LEU B N     1 
ATOM   7837  C  CA    . LEU B 1 241 ? 36.375  65.723  31.973  1.00 21.95 ? 241  LEU B CA    1 
ATOM   7838  C  C     . LEU B 1 241 ? 36.138  65.678  33.473  1.00 22.33 ? 241  LEU B C     1 
ATOM   7839  O  O     . LEU B 1 241 ? 36.802  64.945  34.213  1.00 22.34 ? 241  LEU B O     1 
ATOM   7840  C  CB    . LEU B 1 241 ? 37.126  66.992  31.565  1.00 21.83 ? 241  LEU B CB    1 
ATOM   7841  C  CG    . LEU B 1 241 ? 38.479  67.315  32.184  1.00 20.97 ? 241  LEU B CG    1 
ATOM   7842  C  CD1   . LEU B 1 241 ? 39.408  66.173  31.910  1.00 21.63 ? 241  LEU B CD1   1 
ATOM   7843  C  CD2   . LEU B 1 241 ? 39.059  68.631  31.628  1.00 20.17 ? 241  LEU B CD2   1 
ATOM   7844  N  N     . GLN B 1 242 ? 35.172  66.458  33.927  1.00 22.82 ? 242  GLN B N     1 
ATOM   7845  C  CA    . GLN B 1 242 ? 34.738  66.369  35.312  1.00 23.63 ? 242  GLN B CA    1 
ATOM   7846  C  C     . GLN B 1 242 ? 34.482  64.916  35.746  1.00 22.90 ? 242  GLN B C     1 
ATOM   7847  O  O     . GLN B 1 242 ? 34.965  64.496  36.777  1.00 22.87 ? 242  GLN B O     1 
ATOM   7848  C  CB    . GLN B 1 242 ? 33.468  67.176  35.512  1.00 24.28 ? 242  GLN B CB    1 
ATOM   7849  C  CG    . GLN B 1 242 ? 33.616  68.356  36.458  1.00 27.81 ? 242  GLN B CG    1 
ATOM   7850  C  CD    . GLN B 1 242 ? 32.282  68.696  37.110  1.00 31.48 ? 242  GLN B CD    1 
ATOM   7851  O  OE1   . GLN B 1 242 ? 32.110  68.503  38.331  1.00 33.26 ? 242  GLN B OE1   1 
ATOM   7852  N  NE2   . GLN B 1 242 ? 31.316  69.168  36.291  1.00 31.97 ? 242  GLN B NE2   1 
ATOM   7853  N  N     . TYR B 1 243 ? 33.730  64.163  34.952  1.00 22.12 ? 243  TYR B N     1 
ATOM   7854  C  CA    . TYR B 1 243 ? 33.354  62.807  35.313  1.00 21.90 ? 243  TYR B CA    1 
ATOM   7855  C  C     . TYR B 1 243 ? 34.594  61.905  35.314  1.00 21.46 ? 243  TYR B C     1 
ATOM   7856  O  O     . TYR B 1 243 ? 34.867  61.191  36.271  1.00 20.41 ? 243  TYR B O     1 
ATOM   7857  C  CB    . TYR B 1 243 ? 32.295  62.287  34.337  1.00 22.10 ? 243  TYR B CB    1 
ATOM   7858  C  CG    . TYR B 1 243 ? 31.716  60.934  34.673  1.00 20.81 ? 243  TYR B CG    1 
ATOM   7859  C  CD1   . TYR B 1 243 ? 30.719  60.793  35.627  1.00 20.61 ? 243  TYR B CD1   1 
ATOM   7860  C  CD2   . TYR B 1 243 ? 32.148  59.802  34.013  1.00 22.19 ? 243  TYR B CD2   1 
ATOM   7861  C  CE1   . TYR B 1 243 ? 30.181  59.550  35.918  1.00 20.74 ? 243  TYR B CE1   1 
ATOM   7862  C  CE2   . TYR B 1 243 ? 31.623  58.546  34.298  1.00 21.79 ? 243  TYR B CE2   1 
ATOM   7863  C  CZ    . TYR B 1 243 ? 30.646  58.429  35.242  1.00 21.23 ? 243  TYR B CZ    1 
ATOM   7864  O  OH    . TYR B 1 243 ? 30.149  57.185  35.502  1.00 21.79 ? 243  TYR B OH    1 
ATOM   7865  N  N     . ALA B 1 244 ? 35.353  61.967  34.235  1.00 21.21 ? 244  ALA B N     1 
ATOM   7866  C  CA    . ALA B 1 244 ? 36.591  61.208  34.121  1.00 21.33 ? 244  ALA B CA    1 
ATOM   7867  C  C     . ALA B 1 244 ? 37.406  61.340  35.403  1.00 20.99 ? 244  ALA B C     1 
ATOM   7868  O  O     . ALA B 1 244 ? 37.837  60.360  35.991  1.00 21.03 ? 244  ALA B O     1 
ATOM   7869  C  CB    . ALA B 1 244 ? 37.404  61.696  32.894  1.00 20.88 ? 244  ALA B CB    1 
ATOM   7870  N  N     . LYS B 1 245 ? 37.575  62.580  35.838  1.00 21.26 ? 245  LYS B N     1 
ATOM   7871  C  CA    . LYS B 1 245 ? 38.495  62.921  36.914  1.00 20.98 ? 245  LYS B CA    1 
ATOM   7872  C  C     . LYS B 1 245 ? 37.975  62.363  38.213  1.00 20.50 ? 245  LYS B C     1 
ATOM   7873  O  O     . LYS B 1 245 ? 38.752  61.941  39.043  1.00 20.32 ? 245  LYS B O     1 
ATOM   7874  C  CB    . LYS B 1 245 ? 38.627  64.439  37.024  1.00 21.12 ? 245  LYS B CB    1 
ATOM   7875  C  CG    . LYS B 1 245 ? 39.353  65.077  35.877  1.00 22.02 ? 245  LYS B CG    1 
ATOM   7876  C  CD    . LYS B 1 245 ? 40.546  65.892  36.348  1.00 24.52 ? 245  LYS B CD    1 
ATOM   7877  C  CE    . LYS B 1 245 ? 40.147  67.280  36.878  1.00 24.87 ? 245  LYS B CE    1 
ATOM   7878  N  NZ    . LYS B 1 245 ? 40.888  68.324  36.108  1.00 26.48 ? 245  LYS B NZ    1 
ATOM   7879  N  N     . ASP B 1 246 ? 36.651  62.392  38.360  1.00 20.02 ? 246  ASP B N     1 
ATOM   7880  C  CA    . ASP B 1 246 ? 35.933  61.923  39.542  1.00 19.66 ? 246  ASP B CA    1 
ATOM   7881  C  C     . ASP B 1 246 ? 35.989  60.405  39.648  1.00 18.80 ? 246  ASP B C     1 
ATOM   7882  O  O     . ASP B 1 246 ? 36.096  59.875  40.734  1.00 18.51 ? 246  ASP B O     1 
ATOM   7883  C  CB    . ASP B 1 246 ? 34.473  62.431  39.491  1.00 19.66 ? 246  ASP B CB    1 
ATOM   7884  C  CG    . ASP B 1 246 ? 33.621  61.961  40.671  1.00 20.68 ? 246  ASP B CG    1 
ATOM   7885  O  OD1   . ASP B 1 246 ? 34.033  62.117  41.841  1.00 21.43 ? 246  ASP B OD1   1 
ATOM   7886  O  OD2   . ASP B 1 246 ? 32.492  61.437  40.518  1.00 23.07 ? 246  ASP B OD2   1 
ATOM   7887  N  N     . THR B 1 247 ? 35.943  59.708  38.519  1.00 18.34 ? 247  THR B N     1 
ATOM   7888  C  CA    . THR B 1 247 ? 35.997  58.247  38.527  1.00 17.84 ? 247  THR B CA    1 
ATOM   7889  C  C     . THR B 1 247 ? 37.409  57.740  38.853  1.00 18.23 ? 247  THR B C     1 
ATOM   7890  O  O     . THR B 1 247 ? 37.563  56.631  39.369  1.00 18.50 ? 247  THR B O     1 
ATOM   7891  C  CB    . THR B 1 247 ? 35.516  57.637  37.192  1.00 17.30 ? 247  THR B CB    1 
ATOM   7892  O  OG1   . THR B 1 247 ? 36.307  58.116  36.094  1.00 17.91 ? 247  THR B OG1   1 
ATOM   7893  C  CG2   . THR B 1 247 ? 34.083  58.049  36.836  1.00 17.03 ? 247  THR B CG2   1 
ATOM   7894  N  N     . GLN B 1 248 ? 38.427  58.547  38.552  1.00 18.49 ? 248  GLN B N     1 
ATOM   7895  C  CA    . GLN B 1 248 ? 39.827  58.120  38.642  1.00 18.86 ? 248  GLN B CA    1 
ATOM   7896  C  C     . GLN B 1 248 ? 40.438  58.461  39.999  1.00 19.17 ? 248  GLN B C     1 
ATOM   7897  O  O     . GLN B 1 248 ? 41.184  57.643  40.611  1.00 18.94 ? 248  GLN B O     1 
ATOM   7898  C  CB    . GLN B 1 248 ? 40.656  58.781  37.529  1.00 18.79 ? 248  GLN B CB    1 
ATOM   7899  C  CG    . GLN B 1 248 ? 40.411  58.232  36.113  1.00 20.01 ? 248  GLN B CG    1 
ATOM   7900  C  CD    . GLN B 1 248 ? 40.086  56.726  36.061  1.00 21.46 ? 248  GLN B CD    1 
ATOM   7901  O  OE1   . GLN B 1 248 ? 38.912  56.334  35.959  1.00 21.38 ? 248  GLN B OE1   1 
ATOM   7902  N  NE2   . GLN B 1 248 ? 41.116  55.898  36.123  1.00 21.36 ? 248  GLN B NE2   1 
ATOM   7903  N  N     . ARG B 1 249 ? 40.078  59.668  40.454  1.00 19.18 ? 249  ARG B N     1 
ATOM   7904  C  CA    . ARG B 1 249 ? 40.672  60.351  41.582  1.00 18.66 ? 249  ARG B CA    1 
ATOM   7905  C  C     . ARG B 1 249 ? 42.181  60.409  41.396  1.00 18.83 ? 249  ARG B C     1 
ATOM   7906  O  O     . ARG B 1 249 ? 42.956  60.124  42.320  1.00 19.02 ? 249  ARG B O     1 
ATOM   7907  C  CB    . ARG B 1 249 ? 40.256  59.695  42.897  1.00 18.87 ? 249  ARG B CB    1 
ATOM   7908  C  CG    . ARG B 1 249 ? 38.732  59.663  43.168  1.00 18.54 ? 249  ARG B CG    1 
ATOM   7909  C  CD    . ARG B 1 249 ? 38.057  61.022  43.031  1.00 18.22 ? 249  ARG B CD    1 
ATOM   7910  N  NE    . ARG B 1 249 ? 36.615  61.019  43.302  1.00 17.86 ? 249  ARG B NE    1 
ATOM   7911  C  CZ    . ARG B 1 249 ? 36.052  60.914  44.506  1.00 17.61 ? 249  ARG B CZ    1 
ATOM   7912  N  NH1   . ARG B 1 249 ? 36.782  60.768  45.599  1.00 17.52 ? 249  ARG B NH1   1 
ATOM   7913  N  NH2   . ARG B 1 249 ? 34.735  60.952  44.616  1.00 17.70 ? 249  ARG B NH2   1 
ATOM   7914  N  N     . THR B 1 250 ? 42.581  60.761  40.173  1.00 19.01 ? 250  THR B N     1 
ATOM   7915  C  CA    . THR B 1 250 ? 43.964  61.175  39.856  1.00 19.44 ? 250  THR B CA    1 
ATOM   7916  C  C     . THR B 1 250 ? 44.064  62.281  38.776  1.00 19.27 ? 250  THR B C     1 
ATOM   7917  O  O     . THR B 1 250 ? 43.089  62.727  38.164  1.00 18.13 ? 250  THR B O     1 
ATOM   7918  C  CB    . THR B 1 250 ? 44.843  59.976  39.368  1.00 19.24 ? 250  THR B CB    1 
ATOM   7919  O  OG1   . THR B 1 250 ? 44.311  59.435  38.156  1.00 19.58 ? 250  THR B OG1   1 
ATOM   7920  C  CG2   . THR B 1 250 ? 44.800  58.819  40.308  1.00 20.51 ? 250  THR B CG2   1 
ATOM   7921  N  N     . THR B 1 251 ? 45.297  62.708  38.586  1.00 19.97 ? 251  THR B N     1 
ATOM   7922  C  CA    . THR B 1 251 ? 45.699  63.482  37.453  1.00 20.83 ? 251  THR B CA    1 
ATOM   7923  C  C     . THR B 1 251 ? 45.547  62.554  36.266  1.00 21.97 ? 251  THR B C     1 
ATOM   7924  O  O     . THR B 1 251 ? 45.662  61.313  36.395  1.00 23.29 ? 251  THR B O     1 
ATOM   7925  C  CB    . THR B 1 251 ? 47.170  63.911  37.623  1.00 20.68 ? 251  THR B CB    1 
ATOM   7926  O  OG1   . THR B 1 251 ? 47.285  64.817  38.723  1.00 20.47 ? 251  THR B OG1   1 
ATOM   7927  C  CG2   . THR B 1 251 ? 47.645  64.745  36.458  1.00 21.92 ? 251  THR B CG2   1 
ATOM   7928  N  N     . LEU B 1 252 ? 45.289  63.148  35.107  1.00 22.17 ? 252  LEU B N     1 
ATOM   7929  C  CA    . LEU B 1 252 ? 45.245  62.406  33.868  1.00 21.99 ? 252  LEU B CA    1 
ATOM   7930  C  C     . LEU B 1 252 ? 46.205  63.116  32.929  1.00 21.73 ? 252  LEU B C     1 
ATOM   7931  O  O     . LEU B 1 252 ? 45.809  63.708  31.949  1.00 21.72 ? 252  LEU B O     1 
ATOM   7932  C  CB    . LEU B 1 252 ? 43.821  62.370  33.320  1.00 22.17 ? 252  LEU B CB    1 
ATOM   7933  C  CG    . LEU B 1 252 ? 42.747  62.006  34.334  1.00 22.26 ? 252  LEU B CG    1 
ATOM   7934  C  CD1   . LEU B 1 252 ? 41.407  62.398  33.792  1.00 24.50 ? 252  LEU B CD1   1 
ATOM   7935  C  CD2   . LEU B 1 252 ? 42.774  60.568  34.600  1.00 23.16 ? 252  LEU B CD2   1 
ATOM   7936  N  N     . PRO B 1 253 ? 47.495  63.023  33.210  1.00 21.79 ? 253  PRO B N     1 
ATOM   7937  C  CA    . PRO B 1 253 ? 48.462  63.909  32.548  1.00 21.76 ? 253  PRO B CA    1 
ATOM   7938  C  C     . PRO B 1 253 ? 48.536  63.654  31.040  1.00 21.68 ? 253  PRO B C     1 
ATOM   7939  O  O     . PRO B 1 253 ? 49.095  64.497  30.319  1.00 21.99 ? 253  PRO B O     1 
ATOM   7940  C  CB    . PRO B 1 253 ? 49.784  63.560  33.251  1.00 21.94 ? 253  PRO B CB    1 
ATOM   7941  C  CG    . PRO B 1 253 ? 49.592  62.124  33.754  1.00 21.73 ? 253  PRO B CG    1 
ATOM   7942  C  CD    . PRO B 1 253 ? 48.143  62.014  34.077  1.00 21.29 ? 253  PRO B CD    1 
ATOM   7943  N  N     . HIS B 1 254 ? 47.983  62.506  30.606  1.00 21.48 ? 254  HIS B N     1 
ATOM   7944  C  CA    . HIS B 1 254 ? 47.975  62.026  29.211  1.00 21.14 ? 254  HIS B CA    1 
ATOM   7945  C  C     . HIS B 1 254 ? 46.859  62.596  28.336  1.00 20.66 ? 254  HIS B C     1 
ATOM   7946  O  O     . HIS B 1 254 ? 46.864  62.412  27.128  1.00 20.93 ? 254  HIS B O     1 
ATOM   7947  C  CB    . HIS B 1 254 ? 47.940  60.486  29.160  1.00 21.21 ? 254  HIS B CB    1 
ATOM   7948  C  CG    . HIS B 1 254 ? 46.665  59.868  29.646  1.00 22.62 ? 254  HIS B CG    1 
ATOM   7949  N  ND1   . HIS B 1 254 ? 46.128  60.133  30.887  1.00 25.01 ? 254  HIS B ND1   1 
ATOM   7950  C  CD2   . HIS B 1 254 ? 45.845  58.955  29.074  1.00 24.56 ? 254  HIS B CD2   1 
ATOM   7951  C  CE1   . HIS B 1 254 ? 45.020  59.429  31.049  1.00 25.56 ? 254  HIS B CE1   1 
ATOM   7952  N  NE2   . HIS B 1 254 ? 44.828  58.702  29.963  1.00 25.03 ? 254  HIS B NE2   1 
ATOM   7953  N  N     . ILE B 1 255 ? 45.902  63.275  28.950  1.00 20.07 ? 255  ILE B N     1 
ATOM   7954  C  CA    . ILE B 1 255 ? 44.886  64.032  28.235  1.00 19.16 ? 255  ILE B CA    1 
ATOM   7955  C  C     . ILE B 1 255 ? 45.345  65.495  28.160  1.00 18.42 ? 255  ILE B C     1 
ATOM   7956  O  O     . ILE B 1 255 ? 45.042  66.298  29.035  1.00 18.28 ? 255  ILE B O     1 
ATOM   7957  C  CB    . ILE B 1 255 ? 43.537  63.912  28.998  1.00 19.04 ? 255  ILE B CB    1 
ATOM   7958  C  CG1   . ILE B 1 255 ? 43.157  62.444  29.167  1.00 17.85 ? 255  ILE B CG1   1 
ATOM   7959  C  CG2   . ILE B 1 255 ? 42.414  64.700  28.273  1.00 18.20 ? 255  ILE B CG2   1 
ATOM   7960  C  CD1   . ILE B 1 255 ? 42.094  62.212  30.195  1.00 17.94 ? 255  ILE B CD1   1 
ATOM   7961  N  N     . ARG B 1 256 ? 46.085  65.832  27.120  1.00 18.07 ? 256  ARG B N     1 
ATOM   7962  C  CA    . ARG B 1 256 ? 46.715  67.168  27.017  1.00 18.05 ? 256  ARG B CA    1 
ATOM   7963  C  C     . ARG B 1 256 ? 46.261  67.971  25.824  1.00 17.63 ? 256  ARG B C     1 
ATOM   7964  O  O     . ARG B 1 256 ? 46.925  68.897  25.456  1.00 17.83 ? 256  ARG B O     1 
ATOM   7965  C  CB    . ARG B 1 256 ? 48.228  67.034  26.890  1.00 17.98 ? 256  ARG B CB    1 
ATOM   7966  C  CG    . ARG B 1 256 ? 48.658  66.419  25.574  1.00 18.30 ? 256  ARG B CG    1 
ATOM   7967  C  CD    . ARG B 1 256 ? 50.067  65.864  25.550  1.00 19.50 ? 256  ARG B CD    1 
ATOM   7968  N  NE    . ARG B 1 256 ? 50.275  64.839  26.555  1.00 21.27 ? 256  ARG B NE    1 
ATOM   7969  C  CZ    . ARG B 1 256 ? 51.115  64.959  27.575  1.00 24.01 ? 256  ARG B CZ    1 
ATOM   7970  N  NH1   . ARG B 1 256 ? 51.840  66.063  27.761  1.00 23.12 ? 256  ARG B NH1   1 
ATOM   7971  N  NH2   . ARG B 1 256 ? 51.229  63.963  28.430  1.00 25.77 ? 256  ARG B NH2   1 
ATOM   7972  N  N     . SER B 1 257 ? 45.142  67.608  25.217  1.00 17.88 ? 257  SER B N     1 
ATOM   7973  C  CA    . SER B 1 257 ? 44.710  68.213  23.968  1.00 17.61 ? 257  SER B CA    1 
ATOM   7974  C  C     . SER B 1 257 ? 43.241  67.894  23.687  1.00 18.57 ? 257  SER B C     1 
ATOM   7975  O  O     . SER B 1 257 ? 42.672  66.933  24.230  1.00 17.67 ? 257  SER B O     1 
ATOM   7976  C  CB    . SER B 1 257 ? 45.620  67.731  22.842  1.00 17.04 ? 257  SER B CB    1 
ATOM   7977  O  OG    . SER B 1 257 ? 45.121  68.066  21.580  1.00 16.86 ? 257  SER B OG    1 
ATOM   7978  N  N     . ILE B 1 258 ? 42.606  68.752  22.889  1.00 19.97 ? 258  ILE B N     1 
ATOM   7979  C  CA    . ILE B 1 258 ? 41.251  68.469  22.376  1.00 20.85 ? 258  ILE B CA    1 
ATOM   7980  C  C     . ILE B 1 258 ? 41.123  68.998  20.954  1.00 21.39 ? 258  ILE B C     1 
ATOM   7981  O  O     . ILE B 1 258 ? 41.771  69.953  20.591  1.00 21.18 ? 258  ILE B O     1 
ATOM   7982  C  CB    . ILE B 1 258 ? 40.150  69.070  23.295  1.00 21.06 ? 258  ILE B CB    1 
ATOM   7983  C  CG1   . ILE B 1 258 ? 38.791  68.420  22.987  1.00 21.20 ? 258  ILE B CG1   1 
ATOM   7984  C  CG2   . ILE B 1 258 ? 40.071  70.588  23.143  1.00 20.21 ? 258  ILE B CG2   1 
ATOM   7985  C  CD1   . ILE B 1 258 ? 37.693  68.850  23.928  1.00 20.90 ? 258  ILE B CD1   1 
ATOM   7986  N  N     . THR B 1 259 ? 40.306  68.342  20.147  1.00 22.74 ? 259  THR B N     1 
ATOM   7987  C  CA    . THR B 1 259 ? 40.132  68.735  18.761  1.00 23.74 ? 259  THR B CA    1 
ATOM   7988  C  C     . THR B 1 259 ? 38.689  68.732  18.395  1.00 24.62 ? 259  THR B C     1 
ATOM   7989  O  O     . THR B 1 259 ? 37.924  67.841  18.759  1.00 24.51 ? 259  THR B O     1 
ATOM   7990  C  CB    . THR B 1 259 ? 40.810  67.768  17.801  1.00 23.72 ? 259  THR B CB    1 
ATOM   7991  O  OG1   . THR B 1 259 ? 42.153  67.534  18.211  1.00 25.02 ? 259  THR B OG1   1 
ATOM   7992  C  CG2   . THR B 1 259 ? 40.966  68.408  16.429  1.00 24.27 ? 259  THR B CG2   1 
ATOM   7993  N  N     . MET B 1 260 ? 38.359  69.720  17.601  1.00 25.61 ? 260  MET B N     1 
ATOM   7994  C  CA    . MET B 1 260 ? 37.055  69.862  17.042  1.00 26.68 ? 260  MET B CA    1 
ATOM   7995  C  C     . MET B 1 260 ? 37.014  68.988  15.808  1.00 26.95 ? 260  MET B C     1 
ATOM   7996  O  O     . MET B 1 260 ? 37.955  68.994  15.011  1.00 26.92 ? 260  MET B O     1 
ATOM   7997  C  CB    . MET B 1 260 ? 36.872  71.336  16.666  1.00 27.20 ? 260  MET B CB    1 
ATOM   7998  C  CG    . MET B 1 260 ? 35.584  71.659  15.974  1.00 28.25 ? 260  MET B CG    1 
ATOM   7999  S  SD    . MET B 1 260 ? 34.723  72.882  16.869  1.00 30.56 ? 260  MET B SD    1 
ATOM   8000  C  CE    . MET B 1 260 ? 33.056  72.552  16.356  1.00 30.46 ? 260  MET B CE    1 
ATOM   8001  N  N     . GLU B 1 261 ? 35.934  68.225  15.667  1.00 27.51 ? 261  GLU B N     1 
ATOM   8002  C  CA    . GLU B 1 261 ? 35.626  67.489  14.437  1.00 27.69 ? 261  GLU B CA    1 
ATOM   8003  C  C     . GLU B 1 261 ? 34.574  68.324  13.694  1.00 27.73 ? 261  GLU B C     1 
ATOM   8004  O  O     . GLU B 1 261 ? 33.540  68.662  14.259  1.00 27.89 ? 261  GLU B O     1 
ATOM   8005  C  CB    . GLU B 1 261 ? 35.090  66.080  14.764  1.00 27.70 ? 261  GLU B CB    1 
ATOM   8006  C  CG    . GLU B 1 261 ? 36.022  65.224  15.616  1.00 28.56 ? 261  GLU B CG    1 
ATOM   8007  C  CD    . GLU B 1 261 ? 35.497  63.805  15.906  1.00 30.47 ? 261  GLU B CD    1 
ATOM   8008  O  OE1   . GLU B 1 261 ? 34.814  63.588  16.936  1.00 31.57 ? 261  GLU B OE1   1 
ATOM   8009  O  OE2   . GLU B 1 261 ? 35.801  62.878  15.127  1.00 30.25 ? 261  GLU B OE2   1 
ATOM   8010  N  N     . ARG B 1 262 ? 34.843  68.703  12.451  1.00 28.02 ? 262  ARG B N     1 
ATOM   8011  C  CA    . ARG B 1 262 ? 33.905  69.537  11.706  1.00 28.04 ? 262  ARG B CA    1 
ATOM   8012  C  C     . ARG B 1 262 ? 33.169  68.748  10.642  1.00 27.94 ? 262  ARG B C     1 
ATOM   8013  O  O     . ARG B 1 262 ? 33.700  67.803  10.064  1.00 28.13 ? 262  ARG B O     1 
ATOM   8014  C  CB    . ARG B 1 262 ? 34.615  70.722  11.066  1.00 28.34 ? 262  ARG B CB    1 
ATOM   8015  C  CG    . ARG B 1 262 ? 34.979  71.824  12.048  1.00 29.60 ? 262  ARG B CG    1 
ATOM   8016  C  CD    . ARG B 1 262 ? 36.118  72.701  11.577  1.00 32.17 ? 262  ARG B CD    1 
ATOM   8017  N  NE    . ARG B 1 262 ? 36.928  73.263  12.669  1.00 34.64 ? 262  ARG B NE    1 
ATOM   8018  C  CZ    . ARG B 1 262 ? 36.683  74.425  13.296  1.00 35.77 ? 262  ARG B CZ    1 
ATOM   8019  N  NH1   . ARG B 1 262 ? 35.609  75.164  12.985  1.00 35.60 ? 262  ARG B NH1   1 
ATOM   8020  N  NH2   . ARG B 1 262 ? 37.515  74.843  14.255  1.00 35.84 ? 262  ARG B NH2   1 
ATOM   8021  N  N     . GLU B 1 263 ? 31.937  69.170  10.389  1.00 27.85 ? 263  GLU B N     1 
ATOM   8022  C  CA    . GLU B 1 263 ? 31.038  68.523  9.444   1.00 27.62 ? 263  GLU B CA    1 
ATOM   8023  C  C     . GLU B 1 263 ? 31.649  68.429  8.049   1.00 27.03 ? 263  GLU B C     1 
ATOM   8024  O  O     . GLU B 1 263 ? 31.615  67.368  7.437   1.00 27.03 ? 263  GLU B O     1 
ATOM   8025  C  CB    . GLU B 1 263 ? 29.715  69.306  9.389   1.00 27.91 ? 263  GLU B CB    1 
ATOM   8026  C  CG    . GLU B 1 263 ? 28.515  68.513  8.889   1.00 29.03 ? 263  GLU B CG    1 
ATOM   8027  C  CD    . GLU B 1 263 ? 27.240  69.346  8.842   1.00 29.82 ? 263  GLU B CD    1 
ATOM   8028  O  OE1   . GLU B 1 263 ? 27.120  70.214  7.942   1.00 28.85 ? 263  GLU B OE1   1 
ATOM   8029  O  OE2   . GLU B 1 263 ? 26.361  69.125  9.709   1.00 30.27 ? 263  GLU B OE2   1 
ATOM   8030  N  N     . GLN B 1 264 ? 32.210  69.533  7.559   1.00 26.31 ? 264  GLN B N     1 
ATOM   8031  C  CA    . GLN B 1 264 ? 32.794  69.564  6.220   1.00 25.94 ? 264  GLN B CA    1 
ATOM   8032  C  C     . GLN B 1 264 ? 34.139  68.834  6.083   1.00 25.33 ? 264  GLN B C     1 
ATOM   8033  O  O     . GLN B 1 264 ? 34.618  68.651  4.982   1.00 25.56 ? 264  GLN B O     1 
ATOM   8034  C  CB    . GLN B 1 264 ? 32.941  71.003  5.720   1.00 26.25 ? 264  GLN B CB    1 
ATOM   8035  C  CG    . GLN B 1 264 ? 34.298  71.655  6.015   1.00 26.74 ? 264  GLN B CG    1 
ATOM   8036  C  CD    . GLN B 1 264 ? 34.191  72.821  6.969   1.00 27.17 ? 264  GLN B CD    1 
ATOM   8037  O  OE1   . GLN B 1 264 ? 34.633  73.923  6.645   1.00 28.87 ? 264  GLN B OE1   1 
ATOM   8038  N  NE2   . GLN B 1 264 ? 33.604  72.589  8.144   1.00 25.12 ? 264  GLN B NE2   1 
ATOM   8039  N  N     . ASP B 1 265 ? 34.759  68.436  7.184   1.00 24.82 ? 265  ASP B N     1 
ATOM   8040  C  CA    . ASP B 1 265 ? 35.984  67.626  7.121   1.00 24.30 ? 265  ASP B CA    1 
ATOM   8041  C  C     . ASP B 1 265 ? 35.740  66.179  6.788   1.00 24.42 ? 265  ASP B C     1 
ATOM   8042  O  O     . ASP B 1 265 ? 36.695  65.416  6.625   1.00 24.45 ? 265  ASP B O     1 
ATOM   8043  C  CB    . ASP B 1 265 ? 36.710  67.623  8.469   1.00 23.86 ? 265  ASP B CB    1 
ATOM   8044  C  CG    . ASP B 1 265 ? 37.333  68.941  8.789   1.00 22.01 ? 265  ASP B CG    1 
ATOM   8045  O  OD1   . ASP B 1 265 ? 37.505  69.734  7.839   1.00 15.95 ? 265  ASP B OD1   1 
ATOM   8046  O  OD2   . ASP B 1 265 ? 37.675  69.252  9.959   1.00 20.54 ? 265  ASP B OD2   1 
ATOM   8047  N  N     . SER B 1 266 ? 34.475  65.786  6.737   1.00 24.45 ? 266  SER B N     1 
ATOM   8048  C  CA    . SER B 1 266 ? 34.149  64.376  6.718   1.00 24.57 ? 266  SER B CA    1 
ATOM   8049  C  C     . SER B 1 266 ? 33.103  64.086  5.688   1.00 24.16 ? 266  SER B C     1 
ATOM   8050  O  O     . SER B 1 266 ? 32.314  64.975  5.344   1.00 24.17 ? 266  SER B O     1 
ATOM   8051  C  CB    . SER B 1 266 ? 33.656  63.930  8.091   1.00 24.70 ? 266  SER B CB    1 
ATOM   8052  O  OG    . SER B 1 266 ? 34.658  63.149  8.715   1.00 26.16 ? 266  SER B OG    1 
ATOM   8053  N  N     . ILE B 1 267 ? 33.116  62.844  5.191   1.00 23.19 ? 267  ILE B N     1 
ATOM   8054  C  CA    . ILE B 1 267 ? 32.004  62.335  4.415   1.00 22.70 ? 267  ILE B CA    1 
ATOM   8055  C  C     . ILE B 1 267 ? 31.028  61.833  5.457   1.00 21.85 ? 267  ILE B C     1 
ATOM   8056  O  O     . ILE B 1 267 ? 31.382  60.985  6.275   1.00 21.66 ? 267  ILE B O     1 
ATOM   8057  C  CB    . ILE B 1 267 ? 32.418  61.214  3.451   1.00 22.87 ? 267  ILE B CB    1 
ATOM   8058  C  CG1   . ILE B 1 267 ? 33.513  61.716  2.512   1.00 23.42 ? 267  ILE B CG1   1 
ATOM   8059  C  CG2   . ILE B 1 267 ? 31.201  60.715  2.651   1.00 22.63 ? 267  ILE B CG2   1 
ATOM   8060  C  CD1   . ILE B 1 267 ? 34.008  60.655  1.535   1.00 23.72 ? 267  ILE B CD1   1 
ATOM   8061  N  N     . ILE B 1 268 ? 29.822  62.386  5.433   1.00 20.92 ? 268  ILE B N     1 
ATOM   8062  C  CA    . ILE B 1 268 ? 28.817  62.067  6.411   1.00 20.96 ? 268  ILE B CA    1 
ATOM   8063  C  C     . ILE B 1 268 ? 28.107  60.807  5.952   1.00 20.90 ? 268  ILE B C     1 
ATOM   8064  O  O     . ILE B 1 268 ? 27.806  60.637  4.765   1.00 20.90 ? 268  ILE B O     1 
ATOM   8065  C  CB    . ILE B 1 268 ? 27.831  63.244  6.580   1.00 21.16 ? 268  ILE B CB    1 
ATOM   8066  C  CG1   . ILE B 1 268 ? 28.540  64.442  7.232   1.00 21.58 ? 268  ILE B CG1   1 
ATOM   8067  C  CG2   . ILE B 1 268 ? 26.637  62.849  7.436   1.00 21.61 ? 268  ILE B CG2   1 
ATOM   8068  C  CD1   . ILE B 1 268 ? 28.506  65.694  6.370   1.00 22.41 ? 268  ILE B CD1   1 
ATOM   8069  N  N     . MET B 1 269 ? 27.868  59.910  6.897   1.00 20.55 ? 269  MET B N     1 
ATOM   8070  C  CA    . MET B 1 269 ? 27.213  58.658  6.610   1.00 20.56 ? 269  MET B CA    1 
ATOM   8071  C  C     . MET B 1 269 ? 26.245  58.423  7.733   1.00 20.79 ? 269  MET B C     1 
ATOM   8072  O  O     . MET B 1 269 ? 26.650  58.320  8.880   1.00 21.14 ? 269  MET B O     1 
ATOM   8073  C  CB    . MET B 1 269 ? 28.234  57.522  6.538   1.00 20.62 ? 269  MET B CB    1 
ATOM   8074  C  CG    . MET B 1 269 ? 29.311  57.695  5.480   1.00 20.03 ? 269  MET B CG    1 
ATOM   8075  S  SD    . MET B 1 269 ? 30.246  56.179  5.208   1.00 22.14 ? 269  MET B SD    1 
ATOM   8076  C  CE    . MET B 1 269 ? 31.555  56.295  6.428   1.00 21.40 ? 269  MET B CE    1 
ATOM   8077  N  N     . ASP B 1 270 ? 24.957  58.378  7.405   1.00 21.16 ? 270  ASP B N     1 
ATOM   8078  C  CA    . ASP B 1 270 ? 23.916  58.105  8.399   1.00 21.24 ? 270  ASP B CA    1 
ATOM   8079  C  C     . ASP B 1 270 ? 24.127  56.710  8.989   1.00 21.00 ? 270  ASP B C     1 
ATOM   8080  O  O     . ASP B 1 270 ? 24.845  55.899  8.427   1.00 21.32 ? 270  ASP B O     1 
ATOM   8081  C  CB    . ASP B 1 270 ? 22.500  58.268  7.799   1.00 21.20 ? 270  ASP B CB    1 
ATOM   8082  C  CG    . ASP B 1 270 ? 22.384  57.751  6.359   1.00 23.15 ? 270  ASP B CG    1 
ATOM   8083  O  OD1   . ASP B 1 270 ? 22.017  56.570  6.178   1.00 26.92 ? 270  ASP B OD1   1 
ATOM   8084  O  OD2   . ASP B 1 270 ? 22.612  58.441  5.336   1.00 24.64 ? 270  ASP B OD2   1 
ATOM   8085  N  N     . ALA B 1 271 ? 23.523  56.433  10.136  1.00 21.16 ? 271  ALA B N     1 
ATOM   8086  C  CA    . ALA B 1 271 ? 23.591  55.092  10.735  1.00 20.92 ? 271  ALA B CA    1 
ATOM   8087  C  C     . ALA B 1 271 ? 23.209  54.007  9.751   1.00 20.70 ? 271  ALA B C     1 
ATOM   8088  O  O     . ALA B 1 271 ? 23.935  53.031  9.609   1.00 20.93 ? 271  ALA B O     1 
ATOM   8089  C  CB    . ALA B 1 271 ? 22.699  55.002  11.940  1.00 21.20 ? 271  ALA B CB    1 
ATOM   8090  N  N     . ALA B 1 272 ? 22.071  54.179  9.080   1.00 20.39 ? 272  ALA B N     1 
ATOM   8091  C  CA    . ALA B 1 272 ? 21.582  53.195  8.111   1.00 20.11 ? 272  ALA B CA    1 
ATOM   8092  C  C     . ALA B 1 272 ? 22.610  52.874  7.031   1.00 20.14 ? 272  ALA B C     1 
ATOM   8093  O  O     . ALA B 1 272 ? 22.699  51.741  6.587   1.00 19.89 ? 272  ALA B O     1 
ATOM   8094  C  CB    . ALA B 1 272 ? 20.303  53.670  7.479   1.00 19.83 ? 272  ALA B CB    1 
ATOM   8095  N  N     . THR B 1 273 ? 23.380  53.875  6.616   1.00 20.27 ? 273  THR B N     1 
ATOM   8096  C  CA    . THR B 1 273 ? 24.386  53.700  5.572   1.00 20.31 ? 273  THR B CA    1 
ATOM   8097  C  C     . THR B 1 273 ? 25.580  52.952  6.122   1.00 20.67 ? 273  THR B C     1 
ATOM   8098  O  O     . THR B 1 273 ? 26.065  51.960  5.548   1.00 20.08 ? 273  THR B O     1 
ATOM   8099  C  CB    . THR B 1 273 ? 24.830  55.074  5.059   1.00 20.10 ? 273  THR B CB    1 
ATOM   8100  O  OG1   . THR B 1 273 ? 23.886  55.546  4.094   1.00 19.92 ? 273  THR B OG1   1 
ATOM   8101  C  CG2   . THR B 1 273 ? 26.135  54.993  4.296   1.00 19.48 ? 273  THR B CG2   1 
ATOM   8102  N  N     . ARG B 1 274 ? 26.070  53.489  7.227   1.00 21.09 ? 274  ARG B N     1 
ATOM   8103  C  CA    . ARG B 1 274 ? 27.138  52.884  7.996   1.00 21.81 ? 274  ARG B CA    1 
ATOM   8104  C  C     . ARG B 1 274 ? 26.920  51.378  8.179   1.00 21.89 ? 274  ARG B C     1 
ATOM   8105  O  O     . ARG B 1 274 ? 27.835  50.593  8.018   1.00 21.78 ? 274  ARG B O     1 
ATOM   8106  C  CB    . ARG B 1 274 ? 27.206  53.571  9.356   1.00 21.90 ? 274  ARG B CB    1 
ATOM   8107  C  CG    . ARG B 1 274 ? 28.585  53.688  9.960   1.00 22.56 ? 274  ARG B CG    1 
ATOM   8108  C  CD    . ARG B 1 274 ? 28.620  54.695  11.076  1.00 22.04 ? 274  ARG B CD    1 
ATOM   8109  N  NE    . ARG B 1 274 ? 28.693  56.072  10.582  1.00 21.20 ? 274  ARG B NE    1 
ATOM   8110  C  CZ    . ARG B 1 274 ? 29.810  56.668  10.170  1.00 21.91 ? 274  ARG B CZ    1 
ATOM   8111  N  NH1   . ARG B 1 274 ? 30.958  56.005  10.157  1.00 22.88 ? 274  ARG B NH1   1 
ATOM   8112  N  NH2   . ARG B 1 274 ? 29.791  57.928  9.754   1.00 21.74 ? 274  ARG B NH2   1 
ATOM   8113  N  N     . ARG B 1 275 ? 25.688  51.004  8.493   1.00 22.60 ? 275  ARG B N     1 
ATOM   8114  C  CA    . ARG B 1 275 ? 25.309  49.621  8.800   1.00 23.14 ? 275  ARG B CA    1 
ATOM   8115  C  C     . ARG B 1 275 ? 25.286  48.751  7.534   1.00 22.55 ? 275  ARG B C     1 
ATOM   8116  O  O     . ARG B 1 275 ? 25.842  47.652  7.547   1.00 23.14 ? 275  ARG B O     1 
ATOM   8117  C  CB    . ARG B 1 275 ? 23.929  49.606  9.484   1.00 23.69 ? 275  ARG B CB    1 
ATOM   8118  C  CG    . ARG B 1 275 ? 23.583  48.345  10.291  1.00 26.88 ? 275  ARG B CG    1 
ATOM   8119  C  CD    . ARG B 1 275 ? 22.107  48.279  10.761  1.00 30.06 ? 275  ARG B CD    1 
ATOM   8120  N  NE    . ARG B 1 275 ? 21.734  49.487  11.537  1.00 33.56 ? 275  ARG B NE    1 
ATOM   8121  C  CZ    . ARG B 1 275 ? 20.752  50.358  11.230  1.00 34.72 ? 275  ARG B CZ    1 
ATOM   8122  N  NH1   . ARG B 1 275 ? 19.969  50.196  10.162  1.00 36.03 ? 275  ARG B NH1   1 
ATOM   8123  N  NH2   . ARG B 1 275 ? 20.550  51.407  12.008  1.00 35.12 ? 275  ARG B NH2   1 
ATOM   8124  N  N     . ASN B 1 276 ? 24.659  49.248  6.457   1.00 21.50 ? 276  ASN B N     1 
ATOM   8125  C  CA    . ASN B 1 276 ? 24.589  48.564  5.152   1.00 20.77 ? 276  ASN B CA    1 
ATOM   8126  C  C     . ASN B 1 276 ? 25.905  48.417  4.382   1.00 20.35 ? 276  ASN B C     1 
ATOM   8127  O  O     . ASN B 1 276 ? 25.951  47.777  3.334   1.00 20.76 ? 276  ASN B O     1 
ATOM   8128  C  CB    . ASN B 1 276 ? 23.639  49.301  4.192   1.00 20.82 ? 276  ASN B CB    1 
ATOM   8129  C  CG    . ASN B 1 276 ? 22.220  49.376  4.695   1.00 20.92 ? 276  ASN B CG    1 
ATOM   8130  O  OD1   . ASN B 1 276 ? 21.868  48.783  5.723   1.00 22.66 ? 276  ASN B OD1   1 
ATOM   8131  N  ND2   . ASN B 1 276 ? 21.390  50.127  3.978   1.00 18.48 ? 276  ASN B ND2   1 
ATOM   8132  N  N     . LEU B 1 277 ? 26.954  49.067  4.834   1.00 20.13 ? 277  LEU B N     1 
ATOM   8133  C  CA    . LEU B 1 277 ? 28.239  48.982  4.160   1.00 19.59 ? 277  LEU B CA    1 
ATOM   8134  C  C     . LEU B 1 277 ? 29.122  48.020  4.912   1.00 19.53 ? 277  LEU B C     1 
ATOM   8135  O  O     . LEU B 1 277 ? 30.206  47.693  4.437   1.00 19.85 ? 277  LEU B O     1 
ATOM   8136  C  CB    . LEU B 1 277 ? 28.898  50.371  4.073   1.00 19.49 ? 277  LEU B CB    1 
ATOM   8137  C  CG    . LEU B 1 277 ? 28.295  51.353  3.065   1.00 18.38 ? 277  LEU B CG    1 
ATOM   8138  C  CD1   . LEU B 1 277 ? 29.190  52.574  2.883   1.00 16.26 ? 277  LEU B CD1   1 
ATOM   8139  C  CD2   . LEU B 1 277 ? 28.014  50.666  1.707   1.00 18.70 ? 277  LEU B CD2   1 
ATOM   8140  N  N     . GLU B 1 278 ? 28.654  47.564  6.076   1.00 19.37 ? 278  GLU B N     1 
ATOM   8141  C  CA    . GLU B 1 278 ? 29.315  46.517  6.838   1.00 19.52 ? 278  GLU B CA    1 
ATOM   8142  C  C     . GLU B 1 278 ? 30.797  46.869  6.992   1.00 19.48 ? 278  GLU B C     1 
ATOM   8143  O  O     . GLU B 1 278 ? 31.671  46.076  6.629   1.00 19.14 ? 278  GLU B O     1 
ATOM   8144  C  CB    . GLU B 1 278 ? 29.157  45.160  6.150   1.00 19.47 ? 278  GLU B CB    1 
ATOM   8145  C  CG    . GLU B 1 278 ? 27.714  44.718  5.934   1.00 20.53 ? 278  GLU B CG    1 
ATOM   8146  C  CD    . GLU B 1 278 ? 27.611  43.233  5.570   1.00 21.16 ? 278  GLU B CD    1 
ATOM   8147  O  OE1   . GLU B 1 278 ? 28.122  42.825  4.501   1.00 21.69 ? 278  GLU B OE1   1 
ATOM   8148  O  OE2   . GLU B 1 278 ? 27.028  42.464  6.358   1.00 19.83 ? 278  GLU B OE2   1 
ATOM   8149  N  N     . ILE B 1 279 ? 31.052  48.062  7.537   1.00 19.08 ? 279  ILE B N     1 
ATOM   8150  C  CA    . ILE B 1 279 ? 32.400  48.592  7.671   1.00 19.09 ? 279  ILE B CA    1 
ATOM   8151  C  C     . ILE B 1 279 ? 33.215  47.829  8.727   1.00 19.61 ? 279  ILE B C     1 
ATOM   8152  O  O     . ILE B 1 279 ? 34.281  47.310  8.409   1.00 18.84 ? 279  ILE B O     1 
ATOM   8153  C  CB    . ILE B 1 279 ? 32.386  50.124  7.974   1.00 18.53 ? 279  ILE B CB    1 
ATOM   8154  C  CG1   . ILE B 1 279 ? 31.452  50.842  7.003   1.00 19.13 ? 279  ILE B CG1   1 
ATOM   8155  C  CG2   . ILE B 1 279 ? 33.795  50.701  7.831   1.00 17.37 ? 279  ILE B CG2   1 
ATOM   8156  C  CD1   . ILE B 1 279 ? 31.367  52.361  7.209   1.00 20.61 ? 279  ILE B CD1   1 
ATOM   8157  N  N     . THR B 1 280 ? 32.711  47.809  9.970   1.00 20.61 ? 280  THR B N     1 
ATOM   8158  C  CA    . THR B 1 280 ? 33.306  47.083  11.121  1.00 21.15 ? 280  THR B CA    1 
ATOM   8159  C  C     . THR B 1 280 ? 32.412  45.952  11.611  1.00 21.62 ? 280  THR B C     1 
ATOM   8160  O  O     . THR B 1 280 ? 32.899  44.966  12.184  1.00 21.41 ? 280  THR B O     1 
ATOM   8161  C  CB    . THR B 1 280 ? 33.479  48.025  12.323  1.00 21.25 ? 280  THR B CB    1 
ATOM   8162  O  OG1   . THR B 1 280 ? 32.399  48.972  12.350  1.00 21.38 ? 280  THR B OG1   1 
ATOM   8163  C  CG2   . THR B 1 280 ? 34.750  48.870  12.192  1.00 22.52 ? 280  THR B CG2   1 
ATOM   8164  N  N     . GLN B 1 281 ? 31.108  46.125  11.384  1.00 21.96 ? 281  GLN B N     1 
ATOM   8165  C  CA    . GLN B 1 281 ? 30.062  45.313  11.970  1.00 22.87 ? 281  GLN B CA    1 
ATOM   8166  C  C     . GLN B 1 281 ? 29.203  44.788  10.831  1.00 22.69 ? 281  GLN B C     1 
ATOM   8167  O  O     . GLN B 1 281 ? 28.914  45.526  9.909   1.00 22.21 ? 281  GLN B O     1 
ATOM   8168  C  CB    . GLN B 1 281 ? 29.247  46.211  12.905  1.00 23.43 ? 281  GLN B CB    1 
ATOM   8169  C  CG    . GLN B 1 281 ? 28.248  45.524  13.821  1.00 26.04 ? 281  GLN B CG    1 
ATOM   8170  C  CD    . GLN B 1 281 ? 26.980  46.389  14.052  1.00 28.99 ? 281  GLN B CD    1 
ATOM   8171  O  OE1   . GLN B 1 281 ? 26.032  46.381  13.219  1.00 31.10 ? 281  GLN B OE1   1 
ATOM   8172  N  NE2   . GLN B 1 281 ? 26.959  47.125  15.174  1.00 27.18 ? 281  GLN B NE2   1 
ATOM   8173  N  N     . ASN B 1 282 ? 28.797  43.521  10.867  1.00 23.01 ? 282  ASN B N     1 
ATOM   8174  C  CA    . ASN B 1 282 ? 27.960  43.003  9.781   1.00 23.23 ? 282  ASN B CA    1 
ATOM   8175  C  C     . ASN B 1 282 ? 26.469  43.137  10.086  1.00 23.88 ? 282  ASN B C     1 
ATOM   8176  O  O     . ASN B 1 282 ? 26.065  43.283  11.243  1.00 23.48 ? 282  ASN B O     1 
ATOM   8177  C  CB    . ASN B 1 282 ? 28.362  41.582  9.327   1.00 23.11 ? 282  ASN B CB    1 
ATOM   8178  C  CG    . ASN B 1 282 ? 28.363  40.556  10.450  1.00 22.70 ? 282  ASN B CG    1 
ATOM   8179  O  OD1   . ASN B 1 282 ? 29.411  40.055  10.844  1.00 21.80 ? 282  ASN B OD1   1 
ATOM   8180  N  ND2   . ASN B 1 282 ? 27.188  40.209  10.935  1.00 20.92 ? 282  ASN B ND2   1 
ATOM   8181  N  N     . LEU B 1 283 ? 25.657  43.124  9.027   1.00 24.83 ? 283  LEU B N     1 
ATOM   8182  C  CA    . LEU B 1 283 ? 24.204  43.262  9.167   1.00 25.71 ? 283  LEU B CA    1 
ATOM   8183  C  C     . LEU B 1 283 ? 23.645  42.314  10.222  1.00 26.17 ? 283  LEU B C     1 
ATOM   8184  O  O     . LEU B 1 283 ? 22.563  42.550  10.733  1.00 26.40 ? 283  LEU B O     1 
ATOM   8185  C  CB    . LEU B 1 283 ? 23.475  43.069  7.815   1.00 25.81 ? 283  LEU B CB    1 
ATOM   8186  C  CG    . LEU B 1 283 ? 23.275  44.306  6.900   1.00 26.64 ? 283  LEU B CG    1 
ATOM   8187  C  CD1   . LEU B 1 283 ? 22.001  44.182  6.057   1.00 27.37 ? 283  LEU B CD1   1 
ATOM   8188  C  CD2   . LEU B 1 283 ? 23.247  45.650  7.673   1.00 26.30 ? 283  LEU B CD2   1 
ATOM   8189  N  N     . ALA B 1 284 ? 24.389  41.253  10.540  1.00 26.76 ? 284  ALA B N     1 
ATOM   8190  C  CA    . ALA B 1 284 ? 23.997  40.267  11.547  1.00 26.94 ? 284  ALA B CA    1 
ATOM   8191  C  C     . ALA B 1 284 ? 24.847  40.340  12.831  1.00 27.09 ? 284  ALA B C     1 
ATOM   8192  O  O     . ALA B 1 284 ? 25.288  39.309  13.347  1.00 28.08 ? 284  ALA B O     1 
ATOM   8193  C  CB    . ALA B 1 284 ? 24.079  38.864  10.932  1.00 26.91 ? 284  ALA B CB    1 
ATOM   8194  N  N     . GLY B 1 285 ? 25.091  41.551  13.333  1.00 26.77 ? 285  GLY B N     1 
ATOM   8195  C  CA    . GLY B 1 285 ? 25.841  41.769  14.563  1.00 26.04 ? 285  GLY B CA    1 
ATOM   8196  C  C     . GLY B 1 285 ? 27.234  41.190  14.784  1.00 25.74 ? 285  GLY B C     1 
ATOM   8197  O  O     . GLY B 1 285 ? 27.721  41.283  15.897  1.00 26.10 ? 285  GLY B O     1 
ATOM   8198  N  N     . GLY B 1 286 ? 27.890  40.618  13.776  1.00 25.38 ? 286  GLY B N     1 
ATOM   8199  C  CA    . GLY B 1 286 ? 29.241  40.054  13.941  1.00 25.24 ? 286  GLY B CA    1 
ATOM   8200  C  C     . GLY B 1 286 ? 30.416  40.899  13.433  1.00 24.93 ? 286  GLY B C     1 
ATOM   8201  O  O     . GLY B 1 286 ? 30.233  42.049  13.027  1.00 25.38 ? 286  GLY B O     1 
ATOM   8202  N  N     . ALA B 1 287 ? 31.625  40.336  13.432  1.00 24.55 ? 287  ALA B N     1 
ATOM   8203  C  CA    . ALA B 1 287 ? 32.820  41.077  13.006  1.00 24.47 ? 287  ALA B CA    1 
ATOM   8204  C  C     . ALA B 1 287 ? 33.445  40.566  11.713  1.00 24.79 ? 287  ALA B C     1 
ATOM   8205  O  O     . ALA B 1 287 ? 34.501  41.079  11.312  1.00 25.27 ? 287  ALA B O     1 
ATOM   8206  C  CB    . ALA B 1 287 ? 33.872  41.088  14.110  1.00 24.31 ? 287  ALA B CB    1 
ATOM   8207  N  N     . GLU B 1 288 ? 32.812  39.584  11.061  1.00 24.41 ? 288  GLU B N     1 
ATOM   8208  C  CA    . GLU B 1 288 ? 33.313  39.052  9.797   1.00 24.67 ? 288  GLU B CA    1 
ATOM   8209  C  C     . GLU B 1 288 ? 32.514  39.549  8.570   1.00 24.78 ? 288  GLU B C     1 
ATOM   8210  O  O     . GLU B 1 288 ? 31.501  40.220  8.718   1.00 24.58 ? 288  GLU B O     1 
ATOM   8211  C  CB    . GLU B 1 288 ? 33.333  37.516  9.852   1.00 24.81 ? 288  GLU B CB    1 
ATOM   8212  C  CG    . GLU B 1 288 ? 34.667  36.946  10.350  1.00 26.02 ? 288  GLU B CG    1 
ATOM   8213  C  CD    . GLU B 1 288 ? 35.707  36.742  9.237   1.00 26.45 ? 288  GLU B CD    1 
ATOM   8214  O  OE1   . GLU B 1 288 ? 35.370  36.949  8.023   1.00 24.94 ? 288  GLU B OE1   1 
ATOM   8215  O  OE2   . GLU B 1 288 ? 36.862  36.367  9.587   1.00 24.22 ? 288  GLU B OE2   1 
ATOM   8216  N  N     . ASN B 1 289 ? 32.994  39.208  7.366   1.00 25.09 ? 289  ASN B N     1 
ATOM   8217  C  CA    . ASN B 1 289 ? 32.333  39.531  6.096   1.00 25.13 ? 289  ASN B CA    1 
ATOM   8218  C  C     . ASN B 1 289 ? 32.025  41.002  6.139   1.00 24.68 ? 289  ASN B C     1 
ATOM   8219  O  O     . ASN B 1 289 ? 30.935  41.485  5.805   1.00 24.45 ? 289  ASN B O     1 
ATOM   8220  C  CB    . ASN B 1 289 ? 31.104  38.655  5.848   1.00 25.44 ? 289  ASN B CB    1 
ATOM   8221  C  CG    . ASN B 1 289 ? 31.473  37.173  5.651   1.00 27.35 ? 289  ASN B CG    1 
ATOM   8222  O  OD1   . ASN B 1 289 ? 31.000  36.517  4.718   1.00 30.04 ? 289  ASN B OD1   1 
ATOM   8223  N  ND2   . ASN B 1 289 ? 32.322  36.645  6.534   1.00 28.28 ? 289  ASN B ND2   1 
ATOM   8224  N  N     . THR B 1 290 ? 33.057  41.690  6.591   1.00 23.98 ? 290  THR B N     1 
ATOM   8225  C  CA    . THR B 1 290 ? 33.042  43.099  6.790   1.00 23.54 ? 290  THR B CA    1 
ATOM   8226  C  C     . THR B 1 290 ? 34.295  43.667  6.135   1.00 23.05 ? 290  THR B C     1 
ATOM   8227  O  O     . THR B 1 290 ? 35.246  42.943  5.811   1.00 22.97 ? 290  THR B O     1 
ATOM   8228  C  CB    . THR B 1 290 ? 32.988  43.384  8.288   1.00 23.63 ? 290  THR B CB    1 
ATOM   8229  O  OG1   . THR B 1 290 ? 33.228  44.761  8.517   1.00 25.92 ? 290  THR B OG1   1 
ATOM   8230  C  CG2   . THR B 1 290 ? 34.122  42.755  9.033   1.00 23.54 ? 290  THR B CG2   1 
ATOM   8231  N  N     . LEU B 1 291 ? 34.277  44.966  5.907   1.00 22.61 ? 291  LEU B N     1 
ATOM   8232  C  CA    . LEU B 1 291 ? 35.352  45.645  5.217   1.00 22.34 ? 291  LEU B CA    1 
ATOM   8233  C  C     . LEU B 1 291 ? 36.614  45.586  6.053   1.00 22.21 ? 291  LEU B C     1 
ATOM   8234  O  O     . LEU B 1 291 ? 37.716  45.411  5.518   1.00 22.41 ? 291  LEU B O     1 
ATOM   8235  C  CB    . LEU B 1 291 ? 34.966  47.110  4.970   1.00 22.47 ? 291  LEU B CB    1 
ATOM   8236  C  CG    . LEU B 1 291 ? 36.045  47.962  4.309   1.00 22.54 ? 291  LEU B CG    1 
ATOM   8237  C  CD1   . LEU B 1 291 ? 36.249  47.494  2.897   1.00 22.99 ? 291  LEU B CD1   1 
ATOM   8238  C  CD2   . LEU B 1 291 ? 35.674  49.418  4.341   1.00 22.60 ? 291  LEU B CD2   1 
ATOM   8239  N  N     . ALA B 1 292 ? 36.448  45.712  7.369   1.00 21.75 ? 292  ALA B N     1 
ATOM   8240  C  CA    . ALA B 1 292 ? 37.579  45.841  8.278   1.00 21.50 ? 292  ALA B CA    1 
ATOM   8241  C  C     . ALA B 1 292 ? 38.295  44.531  8.406   1.00 20.95 ? 292  ALA B C     1 
ATOM   8242  O  O     . ALA B 1 292 ? 39.484  44.528  8.608   1.00 20.78 ? 292  ALA B O     1 
ATOM   8243  C  CB    . ALA B 1 292 ? 37.130  46.325  9.647   1.00 21.74 ? 292  ALA B CB    1 
ATOM   8244  N  N     . SER B 1 293 ? 37.549  43.433  8.277   1.00 20.94 ? 293  SER B N     1 
ATOM   8245  C  CA    . SER B 1 293 ? 38.071  42.062  8.264   1.00 20.66 ? 293  SER B CA    1 
ATOM   8246  C  C     . SER B 1 293 ? 38.978  41.780  7.087   1.00 20.61 ? 293  SER B C     1 
ATOM   8247  O  O     . SER B 1 293 ? 39.968  41.096  7.227   1.00 20.46 ? 293  SER B O     1 
ATOM   8248  C  CB    . SER B 1 293 ? 36.923  41.068  8.193   1.00 20.82 ? 293  SER B CB    1 
ATOM   8249  O  OG    . SER B 1 293 ? 36.228  41.212  6.957   1.00 21.87 ? 293  SER B OG    1 
ATOM   8250  N  N     . VAL B 1 294 ? 38.631  42.279  5.909   1.00 21.11 ? 294  VAL B N     1 
ATOM   8251  C  CA    . VAL B 1 294 ? 39.507  42.100  4.745   1.00 21.32 ? 294  VAL B CA    1 
ATOM   8252  C  C     . VAL B 1 294 ? 40.735  42.991  4.822   1.00 21.34 ? 294  VAL B C     1 
ATOM   8253  O  O     . VAL B 1 294 ? 41.850  42.515  4.609   1.00 21.64 ? 294  VAL B O     1 
ATOM   8254  C  CB    . VAL B 1 294 ? 38.804  42.428  3.433   1.00 21.29 ? 294  VAL B CB    1 
ATOM   8255  C  CG1   . VAL B 1 294 ? 39.775  42.295  2.279   1.00 21.87 ? 294  VAL B CG1   1 
ATOM   8256  C  CG2   . VAL B 1 294 ? 37.653  41.514  3.230   1.00 21.71 ? 294  VAL B CG2   1 
ATOM   8257  N  N     . LEU B 1 295 ? 40.527  44.274  5.120   1.00 21.03 ? 295  LEU B N     1 
ATOM   8258  C  CA    . LEU B 1 295 ? 41.604  45.236  5.112   1.00 21.07 ? 295  LEU B CA    1 
ATOM   8259  C  C     . LEU B 1 295 ? 42.388  45.322  6.406   1.00 21.12 ? 295  LEU B C     1 
ATOM   8260  O  O     . LEU B 1 295 ? 43.353  46.094  6.444   1.00 22.65 ? 295  LEU B O     1 
ATOM   8261  C  CB    . LEU B 1 295 ? 41.070  46.642  4.880   1.00 21.45 ? 295  LEU B CB    1 
ATOM   8262  C  CG    . LEU B 1 295 ? 40.454  47.104  3.576   1.00 22.83 ? 295  LEU B CG    1 
ATOM   8263  C  CD1   . LEU B 1 295 ? 39.904  48.506  3.811   1.00 24.13 ? 295  LEU B CD1   1 
ATOM   8264  C  CD2   . LEU B 1 295 ? 41.460  47.127  2.461   1.00 23.55 ? 295  LEU B CD2   1 
ATOM   8265  N  N     . ASP B 1 296 ? 42.002  44.639  7.482   1.00 20.23 ? 296  ASP B N     1 
ATOM   8266  C  CA    . ASP B 1 296 ? 42.682  44.899  8.756   1.00 20.19 ? 296  ASP B CA    1 
ATOM   8267  C  C     . ASP B 1 296 ? 43.745  43.897  9.095   1.00 20.51 ? 296  ASP B C     1 
ATOM   8268  O  O     . ASP B 1 296 ? 43.546  43.034  9.940   1.00 21.00 ? 296  ASP B O     1 
ATOM   8269  C  CB    . ASP B 1 296 ? 41.730  45.012  9.934   1.00 19.96 ? 296  ASP B CB    1 
ATOM   8270  C  CG    . ASP B 1 296 ? 42.449  45.417  11.221  1.00 21.72 ? 296  ASP B CG    1 
ATOM   8271  O  OD1   . ASP B 1 296 ? 43.577  45.964  11.160  1.00 24.31 ? 296  ASP B OD1   1 
ATOM   8272  O  OD2   . ASP B 1 296 ? 41.971  45.234  12.351  1.00 22.95 ? 296  ASP B OD2   1 
ATOM   8273  N  N     . CYS B 1 297 ? 44.896  44.017  8.455   1.00 21.10 ? 297  CYS B N     1 
ATOM   8274  C  CA    . CYS B 1 297 ? 46.023  43.131  8.767   1.00 21.75 ? 297  CYS B CA    1 
ATOM   8275  C  C     . CYS B 1 297 ? 47.150  43.850  9.485   1.00 21.36 ? 297  CYS B C     1 
ATOM   8276  O  O     . CYS B 1 297 ? 48.324  43.490  9.326   1.00 22.20 ? 297  CYS B O     1 
ATOM   8277  C  CB    . CYS B 1 297 ? 46.508  42.447  7.508   1.00 21.63 ? 297  CYS B CB    1 
ATOM   8278  S  SG    . CYS B 1 297 ? 45.124  41.498  6.867   1.00 25.08 ? 297  CYS B SG    1 
ATOM   8279  N  N     . THR B 1 298 ? 46.770  44.835  10.304  1.00 20.42 ? 298  THR B N     1 
ATOM   8280  C  CA    . THR B 1 298 ? 47.690  45.498  11.213  1.00 19.53 ? 298  THR B CA    1 
ATOM   8281  C  C     . THR B 1 298 ? 48.263  44.486  12.190  1.00 19.59 ? 298  THR B C     1 
ATOM   8282  O  O     . THR B 1 298 ? 47.662  43.425  12.446  1.00 18.81 ? 298  THR B O     1 
ATOM   8283  C  CB    . THR B 1 298 ? 46.993  46.622  11.985  1.00 19.40 ? 298  THR B CB    1 
ATOM   8284  O  OG1   . THR B 1 298 ? 45.781  46.150  12.574  1.00 18.48 ? 298  THR B OG1   1 
ATOM   8285  C  CG2   . THR B 1 298 ? 46.533  47.748  11.054  1.00 19.96 ? 298  THR B CG2   1 
ATOM   8286  N  N     . VAL B 1 299 ? 49.426  44.825  12.739  1.00 19.40 ? 299  VAL B N     1 
ATOM   8287  C  CA    . VAL B 1 299 ? 50.175  43.903  13.587  1.00 19.69 ? 299  VAL B CA    1 
ATOM   8288  C  C     . VAL B 1 299 ? 50.108  44.189  15.092  1.00 19.68 ? 299  VAL B C     1 
ATOM   8289  O  O     . VAL B 1 299 ? 50.427  43.319  15.910  1.00 19.72 ? 299  VAL B O     1 
ATOM   8290  C  CB    . VAL B 1 299 ? 51.637  43.864  13.163  1.00 19.97 ? 299  VAL B CB    1 
ATOM   8291  C  CG1   . VAL B 1 299 ? 51.799  42.981  11.931  1.00 20.10 ? 299  VAL B CG1   1 
ATOM   8292  C  CG2   . VAL B 1 299 ? 52.179  45.273  12.922  1.00 19.91 ? 299  VAL B CG2   1 
ATOM   8293  N  N     . THR B 1 300 ? 49.692  45.402  15.444  1.00 19.44 ? 300  THR B N     1 
ATOM   8294  C  CA    . THR B 1 300 ? 49.604  45.836  16.831  1.00 18.85 ? 300  THR B CA    1 
ATOM   8295  C  C     . THR B 1 300 ? 48.178  46.199  17.086  1.00 19.02 ? 300  THR B C     1 
ATOM   8296  O  O     . THR B 1 300 ? 47.507  46.685  16.180  1.00 19.62 ? 300  THR B O     1 
ATOM   8297  C  CB    . THR B 1 300 ? 50.481  47.091  17.091  1.00 18.71 ? 300  THR B CB    1 
ATOM   8298  O  OG1   . THR B 1 300 ? 49.941  48.216  16.397  1.00 16.88 ? 300  THR B OG1   1 
ATOM   8299  C  CG2   . THR B 1 300 ? 51.896  46.912  16.527  1.00 17.31 ? 300  THR B CG2   1 
ATOM   8300  N  N     . PRO B 1 301 ? 47.690  45.996  18.306  1.00 18.81 ? 301  PRO B N     1 
ATOM   8301  C  CA    . PRO B 1 301 ? 46.284  46.312  18.588  1.00 18.36 ? 301  PRO B CA    1 
ATOM   8302  C  C     . PRO B 1 301 ? 45.954  47.793  18.464  1.00 17.66 ? 301  PRO B C     1 
ATOM   8303  O  O     . PRO B 1 301 ? 44.821  48.119  18.174  1.00 18.10 ? 301  PRO B O     1 
ATOM   8304  C  CB    . PRO B 1 301 ? 46.091  45.824  20.024  1.00 18.27 ? 301  PRO B CB    1 
ATOM   8305  C  CG    . PRO B 1 301 ? 47.194  44.849  20.248  1.00 18.62 ? 301  PRO B CG    1 
ATOM   8306  C  CD    . PRO B 1 301 ? 48.370  45.438  19.490  1.00 18.63 ? 301  PRO B CD    1 
ATOM   8307  N  N     . MET B 1 302 ? 46.920  48.670  18.673  1.00 17.00 ? 302  MET B N     1 
ATOM   8308  C  CA    . MET B 1 302 ? 46.654  50.100  18.646  1.00 16.27 ? 302  MET B CA    1 
ATOM   8309  C  C     . MET B 1 302 ? 46.565  50.562  17.210  1.00 16.20 ? 302  MET B C     1 
ATOM   8310  O  O     . MET B 1 302 ? 45.843  51.486  16.898  1.00 15.97 ? 302  MET B O     1 
ATOM   8311  C  CB    . MET B 1 302 ? 47.749  50.848  19.404  1.00 16.41 ? 302  MET B CB    1 
ATOM   8312  C  CG    . MET B 1 302 ? 48.966  51.211  18.579  1.00 15.57 ? 302  MET B CG    1 
ATOM   8313  S  SD    . MET B 1 302 ? 50.366  51.635  19.586  1.00 14.32 ? 302  MET B SD    1 
ATOM   8314  C  CE    . MET B 1 302 ? 51.681  50.943  18.610  1.00 13.60 ? 302  MET B CE    1 
ATOM   8315  N  N     . GLY B 1 303 ? 47.298  49.890  16.328  1.00 16.59 ? 303  GLY B N     1 
ATOM   8316  C  CA    . GLY B 1 303 ? 47.183  50.115  14.893  1.00 16.32 ? 303  GLY B CA    1 
ATOM   8317  C  C     . GLY B 1 303 ? 45.920  49.536  14.266  1.00 15.75 ? 303  GLY B C     1 
ATOM   8318  O  O     . GLY B 1 303 ? 45.562  49.894  13.162  1.00 16.51 ? 303  GLY B O     1 
ATOM   8319  N  N     . SER B 1 304 ? 45.243  48.630  14.945  1.00 15.08 ? 304  SER B N     1 
ATOM   8320  C  CA    . SER B 1 304 ? 44.029  48.045  14.393  1.00 14.81 ? 304  SER B CA    1 
ATOM   8321  C  C     . SER B 1 304 ? 42.881  49.001  14.706  1.00 14.82 ? 304  SER B C     1 
ATOM   8322  O  O     . SER B 1 304 ? 42.015  49.232  13.878  1.00 14.01 ? 304  SER B O     1 
ATOM   8323  C  CB    . SER B 1 304 ? 43.785  46.627  14.971  1.00 14.65 ? 304  SER B CB    1 
ATOM   8324  O  OG    . SER B 1 304 ? 42.526  46.093  14.607  1.00 12.34 ? 304  SER B OG    1 
ATOM   8325  N  N     . ARG B 1 305 ? 42.906  49.557  15.910  1.00 15.53 ? 305  ARG B N     1 
ATOM   8326  C  CA    . ARG B 1 305 ? 41.915  50.535  16.350  1.00 16.24 ? 305  ARG B CA    1 
ATOM   8327  C  C     . ARG B 1 305 ? 41.987  51.822  15.546  1.00 16.54 ? 305  ARG B C     1 
ATOM   8328  O  O     . ARG B 1 305 ? 40.969  52.415  15.243  1.00 17.09 ? 305  ARG B O     1 
ATOM   8329  C  CB    . ARG B 1 305 ? 42.136  50.876  17.802  1.00 16.23 ? 305  ARG B CB    1 
ATOM   8330  C  CG    . ARG B 1 305 ? 41.793  49.784  18.781  1.00 16.83 ? 305  ARG B CG    1 
ATOM   8331  C  CD    . ARG B 1 305 ? 41.733  50.315  20.215  1.00 17.73 ? 305  ARG B CD    1 
ATOM   8332  N  NE    . ARG B 1 305 ? 43.030  50.850  20.683  1.00 18.93 ? 305  ARG B NE    1 
ATOM   8333  C  CZ    . ARG B 1 305 ? 43.996  50.125  21.264  1.00 18.53 ? 305  ARG B CZ    1 
ATOM   8334  N  NH1   . ARG B 1 305 ? 43.822  48.815  21.429  1.00 19.99 ? 305  ARG B NH1   1 
ATOM   8335  N  NH2   . ARG B 1 305 ? 45.132  50.701  21.671  1.00 15.35 ? 305  ARG B NH2   1 
ATOM   8336  N  N     . MET B 1 306 ? 43.185  52.244  15.186  1.00 16.89 ? 306  MET B N     1 
ATOM   8337  C  CA    . MET B 1 306 ? 43.335  53.449  14.382  1.00 17.35 ? 306  MET B CA    1 
ATOM   8338  C  C     . MET B 1 306 ? 42.767  53.278  12.986  1.00 17.71 ? 306  MET B C     1 
ATOM   8339  O  O     . MET B 1 306 ? 42.209  54.218  12.416  1.00 18.04 ? 306  MET B O     1 
ATOM   8340  C  CB    . MET B 1 306 ? 44.799  53.877  14.279  1.00 17.05 ? 306  MET B CB    1 
ATOM   8341  C  CG    . MET B 1 306 ? 44.995  55.163  13.493  1.00 15.81 ? 306  MET B CG    1 
ATOM   8342  S  SD    . MET B 1 306 ? 46.713  55.667  13.405  1.00 15.79 ? 306  MET B SD    1 
ATOM   8343  C  CE    . MET B 1 306 ? 46.797  56.660  14.920  1.00 17.25 ? 306  MET B CE    1 
ATOM   8344  N  N     . LEU B 1 307 ? 42.937  52.094  12.422  1.00 18.14 ? 307  LEU B N     1 
ATOM   8345  C  CA    . LEU B 1 307 ? 42.463  51.848  11.065  1.00 18.46 ? 307  LEU B CA    1 
ATOM   8346  C  C     . LEU B 1 307 ? 40.948  51.924  11.063  1.00 18.18 ? 307  LEU B C     1 
ATOM   8347  O  O     . LEU B 1 307 ? 40.368  52.534  10.187  1.00 18.70 ? 307  LEU B O     1 
ATOM   8348  C  CB    . LEU B 1 307 ? 42.930  50.479  10.532  1.00 18.69 ? 307  LEU B CB    1 
ATOM   8349  C  CG    . LEU B 1 307 ? 42.191  49.904  9.306   1.00 19.19 ? 307  LEU B CG    1 
ATOM   8350  C  CD1   . LEU B 1 307 ? 42.558  50.698  8.057   1.00 19.28 ? 307  LEU B CD1   1 
ATOM   8351  C  CD2   . LEU B 1 307 ? 42.490  48.393  9.122   1.00 19.78 ? 307  LEU B CD2   1 
ATOM   8352  N  N     . LYS B 1 308 ? 40.322  51.309  12.054  1.00 17.77 ? 308  LYS B N     1 
ATOM   8353  C  CA    . LYS B 1 308 ? 38.880  51.255  12.119  1.00 17.57 ? 308  LYS B CA    1 
ATOM   8354  C  C     . LYS B 1 308 ? 38.310  52.651  12.239  1.00 16.98 ? 308  LYS B C     1 
ATOM   8355  O  O     . LYS B 1 308 ? 37.246  52.907  11.741  1.00 16.40 ? 308  LYS B O     1 
ATOM   8356  C  CB    . LYS B 1 308 ? 38.436  50.412  13.295  1.00 17.79 ? 308  LYS B CB    1 
ATOM   8357  C  CG    . LYS B 1 308 ? 38.534  48.919  13.044  1.00 18.87 ? 308  LYS B CG    1 
ATOM   8358  C  CD    . LYS B 1 308 ? 38.020  48.164  14.274  1.00 21.26 ? 308  LYS B CD    1 
ATOM   8359  C  CE    . LYS B 1 308 ? 39.070  47.254  14.888  1.00 22.66 ? 308  LYS B CE    1 
ATOM   8360  N  NZ    . LYS B 1 308 ? 38.466  45.926  15.224  1.00 24.09 ? 308  LYS B NZ    1 
ATOM   8361  N  N     . ARG B 1 309 ? 39.050  53.552  12.872  1.00 17.22 ? 309  ARG B N     1 
ATOM   8362  C  CA    . ARG B 1 309 ? 38.647  54.958  12.981  1.00 17.67 ? 309  ARG B CA    1 
ATOM   8363  C  C     . ARG B 1 309 ? 38.705  55.693  11.628  1.00 17.43 ? 309  ARG B C     1 
ATOM   8364  O  O     . ARG B 1 309 ? 37.764  56.408  11.273  1.00 17.10 ? 309  ARG B O     1 
ATOM   8365  C  CB    . ARG B 1 309 ? 39.486  55.694  14.035  1.00 17.70 ? 309  ARG B CB    1 
ATOM   8366  C  CG    . ARG B 1 309 ? 39.183  55.247  15.479  1.00 17.68 ? 309  ARG B CG    1 
ATOM   8367  C  CD    . ARG B 1 309 ? 39.552  56.284  16.552  1.00 17.24 ? 309  ARG B CD    1 
ATOM   8368  N  NE    . ARG B 1 309 ? 40.954  56.637  16.472  1.00 17.74 ? 309  ARG B NE    1 
ATOM   8369  C  CZ    . ARG B 1 309 ? 41.978  55.907  16.932  1.00 20.35 ? 309  ARG B CZ    1 
ATOM   8370  N  NH1   . ARG B 1 309 ? 41.797  54.740  17.553  1.00 20.65 ? 309  ARG B NH1   1 
ATOM   8371  N  NH2   . ARG B 1 309 ? 43.218  56.368  16.763  1.00 20.76 ? 309  ARG B NH2   1 
ATOM   8372  N  N     . TRP B 1 310 ? 39.776  55.480  10.868  1.00 16.77 ? 310  TRP B N     1 
ATOM   8373  C  CA    . TRP B 1 310 ? 39.856  56.025  9.528   1.00 16.50 ? 310  TRP B CA    1 
ATOM   8374  C  C     . TRP B 1 310 ? 38.711  55.444  8.665   1.00 17.21 ? 310  TRP B C     1 
ATOM   8375  O  O     . TRP B 1 310 ? 38.098  56.150  7.843   1.00 17.53 ? 310  TRP B O     1 
ATOM   8376  C  CB    . TRP B 1 310 ? 41.207  55.694  8.874   1.00 16.15 ? 310  TRP B CB    1 
ATOM   8377  C  CG    . TRP B 1 310 ? 42.454  56.253  9.518   1.00 14.22 ? 310  TRP B CG    1 
ATOM   8378  C  CD1   . TRP B 1 310 ? 42.591  56.768  10.781  1.00 14.03 ? 310  TRP B CD1   1 
ATOM   8379  C  CD2   . TRP B 1 310 ? 43.749  56.334  8.923   1.00 12.02 ? 310  TRP B CD2   1 
ATOM   8380  N  NE1   . TRP B 1 310 ? 43.888  57.178  10.992  1.00 11.89 ? 310  TRP B NE1   1 
ATOM   8381  C  CE2   . TRP B 1 310 ? 44.620  56.910  9.871   1.00 12.78 ? 310  TRP B CE2   1 
ATOM   8382  C  CE3   . TRP B 1 310 ? 44.265  55.988  7.677   1.00 12.54 ? 310  TRP B CE3   1 
ATOM   8383  C  CZ2   . TRP B 1 310 ? 45.973  57.140  9.606   1.00 14.62 ? 310  TRP B CZ2   1 
ATOM   8384  C  CZ3   . TRP B 1 310 ? 45.618  56.215  7.415   1.00 12.47 ? 310  TRP B CZ3   1 
ATOM   8385  C  CH2   . TRP B 1 310 ? 46.450  56.773  8.371   1.00 13.03 ? 310  TRP B CH2   1 
ATOM   8386  N  N     . LEU B 1 311 ? 38.408  54.159  8.845   1.00 17.42 ? 311  LEU B N     1 
ATOM   8387  C  CA    . LEU B 1 311 ? 37.395  53.525  8.006   1.00 17.69 ? 311  LEU B CA    1 
ATOM   8388  C  C     . LEU B 1 311 ? 35.988  54.066  8.246   1.00 18.17 ? 311  LEU B C     1 
ATOM   8389  O  O     . LEU B 1 311 ? 35.154  53.967  7.363   1.00 18.06 ? 311  LEU B O     1 
ATOM   8390  C  CB    . LEU B 1 311 ? 37.399  52.011  8.157   1.00 17.42 ? 311  LEU B CB    1 
ATOM   8391  C  CG    . LEU B 1 311 ? 38.582  51.325  7.502   1.00 17.15 ? 311  LEU B CG    1 
ATOM   8392  C  CD1   . LEU B 1 311 ? 38.586  49.870  7.922   1.00 18.36 ? 311  LEU B CD1   1 
ATOM   8393  C  CD2   . LEU B 1 311 ? 38.555  51.446  5.999   1.00 16.28 ? 311  LEU B CD2   1 
ATOM   8394  N  N     . HIS B 1 312 ? 35.731  54.603  9.436   1.00 19.06 ? 312  HIS B N     1 
ATOM   8395  C  CA    . HIS B 1 312 ? 34.440  55.209  9.777   1.00 19.68 ? 312  HIS B CA    1 
ATOM   8396  C  C     . HIS B 1 312 ? 34.448  56.728  9.583   1.00 20.85 ? 312  HIS B C     1 
ATOM   8397  O  O     . HIS B 1 312 ? 33.415  57.357  9.727   1.00 21.11 ? 312  HIS B O     1 
ATOM   8398  C  CB    . HIS B 1 312 ? 34.043  54.898  11.222  1.00 18.86 ? 312  HIS B CB    1 
ATOM   8399  C  CG    . HIS B 1 312 ? 33.472  53.523  11.428  1.00 18.35 ? 312  HIS B CG    1 
ATOM   8400  N  ND1   . HIS B 1 312 ? 32.145  53.216  11.184  1.00 16.48 ? 312  HIS B ND1   1 
ATOM   8401  C  CD2   . HIS B 1 312 ? 34.036  52.388  11.913  1.00 15.37 ? 312  HIS B CD2   1 
ATOM   8402  C  CE1   . HIS B 1 312 ? 31.925  51.956  11.507  1.00 15.44 ? 312  HIS B CE1   1 
ATOM   8403  N  NE2   . HIS B 1 312 ? 33.057  51.429  11.942  1.00 14.26 ? 312  HIS B NE2   1 
ATOM   8404  N  N     . MET B 1 313 ? 35.599  57.327  9.281   1.00 22.25 ? 313  MET B N     1 
ATOM   8405  C  CA    . MET B 1 313 ? 35.649  58.780  9.074   1.00 23.03 ? 313  MET B CA    1 
ATOM   8406  C  C     . MET B 1 313 ? 36.504  59.182  7.870   1.00 22.28 ? 313  MET B C     1 
ATOM   8407  O  O     . MET B 1 313 ? 37.633  59.638  7.978   1.00 21.66 ? 313  MET B O     1 
ATOM   8408  C  CB    . MET B 1 313 ? 36.055  59.510  10.345  1.00 23.88 ? 313  MET B CB    1 
ATOM   8409  C  CG    . MET B 1 313 ? 34.979  60.571  10.728  1.00 27.51 ? 313  MET B CG    1 
ATOM   8410  S  SD    . MET B 1 313 ? 35.371  61.582  12.186  1.00 34.24 ? 313  MET B SD    1 
ATOM   8411  C  CE    . MET B 1 313 ? 37.225  61.983  11.895  1.00 33.20 ? 313  MET B CE    1 
ATOM   8412  N  N     . PRO B 1 314 ? 35.955  58.928  6.698   1.00 21.91 ? 314  PRO B N     1 
ATOM   8413  C  CA    . PRO B 1 314 ? 36.574  59.398  5.474   1.00 21.98 ? 314  PRO B CA    1 
ATOM   8414  C  C     . PRO B 1 314 ? 36.625  60.926  5.438   1.00 22.26 ? 314  PRO B C     1 
ATOM   8415  O  O     . PRO B 1 314 ? 35.640  61.569  5.765   1.00 22.09 ? 314  PRO B O     1 
ATOM   8416  C  CB    . PRO B 1 314 ? 35.651  58.818  4.388   1.00 21.95 ? 314  PRO B CB    1 
ATOM   8417  C  CG    . PRO B 1 314 ? 34.378  58.508  5.080   1.00 21.14 ? 314  PRO B CG    1 
ATOM   8418  C  CD    . PRO B 1 314 ? 34.760  58.099  6.436   1.00 21.35 ? 314  PRO B CD    1 
ATOM   8419  N  N     . VAL B 1 315 ? 37.755  61.492  5.031   1.00 23.10 ? 315  VAL B N     1 
ATOM   8420  C  CA    . VAL B 1 315 ? 37.947  62.950  5.044   1.00 23.74 ? 315  VAL B CA    1 
ATOM   8421  C  C     . VAL B 1 315 ? 37.826  63.571  3.652   1.00 23.87 ? 315  VAL B C     1 
ATOM   8422  O  O     . VAL B 1 315 ? 38.254  62.977  2.676   1.00 24.76 ? 315  VAL B O     1 
ATOM   8423  C  CB    . VAL B 1 315 ? 39.317  63.345  5.688   1.00 23.98 ? 315  VAL B CB    1 
ATOM   8424  C  CG1   . VAL B 1 315 ? 39.865  62.226  6.585   1.00 23.05 ? 315  VAL B CG1   1 
ATOM   8425  C  CG2   . VAL B 1 315 ? 40.349  63.732  4.634   1.00 24.35 ? 315  VAL B CG2   1 
ATOM   8426  N  N     . ARG B 1 316 ? 37.264  64.768  3.568   1.00 23.93 ? 316  ARG B N     1 
ATOM   8427  C  CA    . ARG B 1 316 ? 37.131  65.484  2.297   1.00 24.13 ? 316  ARG B CA    1 
ATOM   8428  C  C     . ARG B 1 316 ? 38.450  66.107  1.778   1.00 23.98 ? 316  ARG B C     1 
ATOM   8429  O  O     . ARG B 1 316 ? 38.623  66.249  0.569   1.00 23.46 ? 316  ARG B O     1 
ATOM   8430  C  CB    . ARG B 1 316 ? 36.034  66.570  2.406   1.00 24.45 ? 316  ARG B CB    1 
ATOM   8431  C  CG    . ARG B 1 316 ? 34.795  66.315  1.482   1.00 26.22 ? 316  ARG B CG    1 
ATOM   8432  C  CD    . ARG B 1 316 ? 33.648  67.370  1.537   1.00 26.02 ? 316  ARG B CD    1 
ATOM   8433  N  NE    . ARG B 1 316 ? 32.645  67.023  2.549   1.00 26.99 ? 316  ARG B NE    1 
ATOM   8434  C  CZ    . ARG B 1 316 ? 31.641  67.815  2.956   1.00 29.03 ? 316  ARG B CZ    1 
ATOM   8435  N  NH1   . ARG B 1 316 ? 31.470  69.035  2.434   1.00 30.72 ? 316  ARG B NH1   1 
ATOM   8436  N  NH2   . ARG B 1 316 ? 30.787  67.380  3.892   1.00 28.04 ? 316  ARG B NH2   1 
ATOM   8437  N  N     . ASP B 1 317 ? 39.363  66.471  2.685   1.00 24.36 ? 317  ASP B N     1 
ATOM   8438  C  CA    . ASP B 1 317 ? 40.627  67.161  2.343   1.00 24.87 ? 317  ASP B CA    1 
ATOM   8439  C  C     . ASP B 1 317 ? 41.642  66.309  1.588   1.00 25.05 ? 317  ASP B C     1 
ATOM   8440  O  O     . ASP B 1 317 ? 42.364  65.518  2.207   1.00 25.44 ? 317  ASP B O     1 
ATOM   8441  C  CB    . ASP B 1 317 ? 41.306  67.662  3.633   1.00 25.13 ? 317  ASP B CB    1 
ATOM   8442  C  CG    . ASP B 1 317 ? 42.598  68.457  3.368   1.00 26.15 ? 317  ASP B CG    1 
ATOM   8443  O  OD1   . ASP B 1 317 ? 42.750  69.064  2.280   1.00 27.40 ? 317  ASP B OD1   1 
ATOM   8444  O  OD2   . ASP B 1 317 ? 43.512  68.549  4.214   1.00 27.52 ? 317  ASP B OD2   1 
ATOM   8445  N  N     . THR B 1 318 ? 41.755  66.489  0.273   1.00 25.09 ? 318  THR B N     1 
ATOM   8446  C  CA    . THR B 1 318 ? 42.640  65.618  -0.497  1.00 25.46 ? 318  THR B CA    1 
ATOM   8447  C  C     . THR B 1 318 ? 44.121  65.706  -0.110  1.00 25.94 ? 318  THR B C     1 
ATOM   8448  O  O     . THR B 1 318 ? 44.856  64.747  -0.295  1.00 26.59 ? 318  THR B O     1 
ATOM   8449  C  CB    . THR B 1 318 ? 42.480  65.822  -1.980  1.00 25.29 ? 318  THR B CB    1 
ATOM   8450  O  OG1   . THR B 1 318 ? 42.513  67.205  -2.284  1.00 25.52 ? 318  THR B OG1   1 
ATOM   8451  C  CG2   . THR B 1 318 ? 41.103  65.387  -2.434  1.00 26.23 ? 318  THR B CG2   1 
ATOM   8452  N  N     . ARG B 1 319 ? 44.566  66.821  0.454   1.00 25.88 ? 319  ARG B N     1 
ATOM   8453  C  CA    . ARG B 1 319 ? 45.937  66.903  0.931   1.00 25.62 ? 319  ARG B CA    1 
ATOM   8454  C  C     . ARG B 1 319 ? 46.294  65.697  1.791   1.00 25.14 ? 319  ARG B C     1 
ATOM   8455  O  O     . ARG B 1 319 ? 47.290  65.040  1.540   1.00 25.86 ? 319  ARG B O     1 
ATOM   8456  C  CB    . ARG B 1 319 ? 46.175  68.198  1.706   1.00 25.75 ? 319  ARG B CB    1 
ATOM   8457  C  CG    . ARG B 1 319 ? 46.547  69.381  0.813   1.00 27.13 ? 319  ARG B CG    1 
ATOM   8458  C  CD    . ARG B 1 319 ? 46.435  70.723  1.484   1.00 28.17 ? 319  ARG B CD    1 
ATOM   8459  N  NE    . ARG B 1 319 ? 45.035  71.110  1.629   1.00 30.08 ? 319  ARG B NE    1 
ATOM   8460  C  CZ    . ARG B 1 319 ? 44.363  71.922  0.803   1.00 31.50 ? 319  ARG B CZ    1 
ATOM   8461  N  NH1   . ARG B 1 319 ? 44.936  72.494  -0.260  1.00 30.74 ? 319  ARG B NH1   1 
ATOM   8462  N  NH2   . ARG B 1 319 ? 43.087  72.173  1.061   1.00 33.32 ? 319  ARG B NH2   1 
ATOM   8463  N  N     . VAL B 1 320 ? 45.491  65.402  2.801   1.00 24.53 ? 320  VAL B N     1 
ATOM   8464  C  CA    . VAL B 1 320 ? 45.809  64.327  3.744   1.00 24.21 ? 320  VAL B CA    1 
ATOM   8465  C  C     . VAL B 1 320 ? 45.763  62.976  3.027   1.00 24.14 ? 320  VAL B C     1 
ATOM   8466  O  O     . VAL B 1 320 ? 46.447  62.013  3.402   1.00 23.97 ? 320  VAL B O     1 
ATOM   8467  C  CB    . VAL B 1 320 ? 44.813  64.313  4.948   1.00 24.16 ? 320  VAL B CB    1 
ATOM   8468  C  CG1   . VAL B 1 320 ? 45.080  63.116  5.897   1.00 24.01 ? 320  VAL B CG1   1 
ATOM   8469  C  CG2   . VAL B 1 320 ? 44.877  65.630  5.733   1.00 23.94 ? 320  VAL B CG2   1 
ATOM   8470  N  N     . LEU B 1 321 ? 44.930  62.933  1.995   1.00 23.83 ? 321  LEU B N     1 
ATOM   8471  C  CA    . LEU B 1 321 ? 44.710  61.735  1.217   1.00 23.89 ? 321  LEU B CA    1 
ATOM   8472  C  C     . LEU B 1 321 ? 45.872  61.457  0.268   1.00 23.56 ? 321  LEU B C     1 
ATOM   8473  O  O     . LEU B 1 321 ? 46.372  60.342  0.216   1.00 23.33 ? 321  LEU B O     1 
ATOM   8474  C  CB    . LEU B 1 321 ? 43.381  61.848  0.442   1.00 23.84 ? 321  LEU B CB    1 
ATOM   8475  C  CG    . LEU B 1 321 ? 42.145  62.012  1.331   1.00 22.85 ? 321  LEU B CG    1 
ATOM   8476  C  CD1   . LEU B 1 321 ? 40.924  62.160  0.474   1.00 23.37 ? 321  LEU B CD1   1 
ATOM   8477  C  CD2   . LEU B 1 321 ? 41.986  60.827  2.267   1.00 20.83 ? 321  LEU B CD2   1 
ATOM   8478  N  N     . LEU B 1 322 ? 46.286  62.471  -0.481  1.00 23.19 ? 322  LEU B N     1 
ATOM   8479  C  CA    . LEU B 1 322 ? 47.440  62.364  -1.363  1.00 22.98 ? 322  LEU B CA    1 
ATOM   8480  C  C     . LEU B 1 322 ? 48.650  61.886  -0.592  1.00 22.82 ? 322  LEU B C     1 
ATOM   8481  O  O     . LEU B 1 322 ? 49.532  61.250  -1.146  1.00 23.16 ? 322  LEU B O     1 
ATOM   8482  C  CB    . LEU B 1 322 ? 47.765  63.709  -1.983  1.00 22.58 ? 322  LEU B CB    1 
ATOM   8483  C  CG    . LEU B 1 322 ? 46.883  64.075  -3.159  1.00 22.76 ? 322  LEU B CG    1 
ATOM   8484  C  CD1   . LEU B 1 322 ? 47.007  65.587  -3.433  1.00 23.21 ? 322  LEU B CD1   1 
ATOM   8485  C  CD2   . LEU B 1 322 ? 47.233  63.254  -4.392  1.00 21.80 ? 322  LEU B CD2   1 
ATOM   8486  N  N     . GLU B 1 323 ? 48.668  62.194  0.690   1.00 22.47 ? 323  GLU B N     1 
ATOM   8487  C  CA    . GLU B 1 323 ? 49.808  61.953  1.535   1.00 22.59 ? 323  GLU B CA    1 
ATOM   8488  C  C     . GLU B 1 323 ? 49.840  60.506  1.982   1.00 22.54 ? 323  GLU B C     1 
ATOM   8489  O  O     . GLU B 1 323 ? 50.894  59.900  1.965   1.00 23.19 ? 323  GLU B O     1 
ATOM   8490  C  CB    . GLU B 1 323 ? 49.708  62.865  2.750   1.00 22.69 ? 323  GLU B CB    1 
ATOM   8491  C  CG    . GLU B 1 323 ? 51.014  63.375  3.285   1.00 23.66 ? 323  GLU B CG    1 
ATOM   8492  C  CD    . GLU B 1 323 ? 50.808  64.659  4.054   1.00 24.97 ? 323  GLU B CD    1 
ATOM   8493  O  OE1   . GLU B 1 323 ? 50.413  64.576  5.235   1.00 24.88 ? 323  GLU B OE1   1 
ATOM   8494  O  OE2   . GLU B 1 323 ? 51.008  65.747  3.460   1.00 27.62 ? 323  GLU B OE2   1 
ATOM   8495  N  N     . ARG B 1 324 ? 48.697  59.982  2.433   1.00 22.25 ? 324  ARG B N     1 
ATOM   8496  C  CA    . ARG B 1 324 ? 48.552  58.571  2.791   1.00 21.73 ? 324  ARG B CA    1 
ATOM   8497  C  C     . ARG B 1 324 ? 48.806  57.699  1.554   1.00 21.65 ? 324  ARG B C     1 
ATOM   8498  O  O     . ARG B 1 324 ? 49.510  56.693  1.608   1.00 21.43 ? 324  ARG B O     1 
ATOM   8499  C  CB    . ARG B 1 324 ? 47.132  58.303  3.339   1.00 21.64 ? 324  ARG B CB    1 
ATOM   8500  C  CG    . ARG B 1 324 ? 46.870  58.874  4.726   1.00 20.64 ? 324  ARG B CG    1 
ATOM   8501  C  CD    . ARG B 1 324 ? 45.402  58.984  5.093   1.00 18.55 ? 324  ARG B CD    1 
ATOM   8502  N  NE    . ARG B 1 324 ? 45.179  59.282  6.511   1.00 15.43 ? 324  ARG B NE    1 
ATOM   8503  C  CZ    . ARG B 1 324 ? 43.981  59.364  7.076   1.00 14.70 ? 324  ARG B CZ    1 
ATOM   8504  N  NH1   . ARG B 1 324 ? 42.883  59.179  6.356   1.00 13.88 ? 324  ARG B NH1   1 
ATOM   8505  N  NH2   . ARG B 1 324 ? 43.862  59.623  8.373   1.00 14.92 ? 324  ARG B NH2   1 
ATOM   8506  N  N     . GLN B 1 325 ? 48.205  58.102  0.443   1.00 21.66 ? 325  GLN B N     1 
ATOM   8507  C  CA    . GLN B 1 325 ? 48.483  57.516  -0.861  1.00 21.65 ? 325  GLN B CA    1 
ATOM   8508  C  C     . GLN B 1 325 ? 49.985  57.407  -1.069  1.00 22.18 ? 325  GLN B C     1 
ATOM   8509  O  O     . GLN B 1 325 ? 50.507  56.301  -1.186  1.00 22.73 ? 325  GLN B O     1 
ATOM   8510  C  CB    . GLN B 1 325 ? 47.835  58.334  -1.994  1.00 21.02 ? 325  GLN B CB    1 
ATOM   8511  C  CG    . GLN B 1 325 ? 46.381  57.980  -2.207  1.00 19.70 ? 325  GLN B CG    1 
ATOM   8512  C  CD    . GLN B 1 325 ? 45.750  58.695  -3.373  1.00 18.98 ? 325  GLN B CD    1 
ATOM   8513  O  OE1   . GLN B 1 325 ? 46.453  59.236  -4.233  1.00 18.68 ? 325  GLN B OE1   1 
ATOM   8514  N  NE2   . GLN B 1 325 ? 44.411  58.684  -3.423  1.00 15.53 ? 325  GLN B NE2   1 
ATOM   8515  N  N     . GLN B 1 326 ? 50.664  58.553  -1.072  1.00 22.38 ? 326  GLN B N     1 
ATOM   8516  C  CA    . GLN B 1 326 ? 52.112  58.638  -1.322  1.00 22.68 ? 326  GLN B CA    1 
ATOM   8517  C  C     . GLN B 1 326 ? 52.923  57.725  -0.382  1.00 22.69 ? 326  GLN B C     1 
ATOM   8518  O  O     . GLN B 1 326 ? 53.927  57.172  -0.784  1.00 22.85 ? 326  GLN B O     1 
ATOM   8519  C  CB    . GLN B 1 326 ? 52.599  60.116  -1.255  1.00 22.69 ? 326  GLN B CB    1 
ATOM   8520  C  CG    . GLN B 1 326 ? 52.265  60.937  -2.558  1.00 24.01 ? 326  GLN B CG    1 
ATOM   8521  C  CD    . GLN B 1 326 ? 52.420  62.501  -2.473  1.00 26.26 ? 326  GLN B CD    1 
ATOM   8522  O  OE1   . GLN B 1 326 ? 53.025  63.057  -1.537  1.00 27.31 ? 326  GLN B OE1   1 
ATOM   8523  N  NE2   . GLN B 1 326 ? 51.873  63.192  -3.482  1.00 26.55 ? 326  GLN B NE2   1 
ATOM   8524  N  N     . THR B 1 327 ? 52.448  57.543  0.843   1.00 22.81 ? 327  THR B N     1 
ATOM   8525  C  CA    . THR B 1 327 ? 53.094  56.701  1.846   1.00 23.39 ? 327  THR B CA    1 
ATOM   8526  C  C     . THR B 1 327 ? 52.927  55.200  1.605   1.00 23.87 ? 327  THR B C     1 
ATOM   8527  O  O     . THR B 1 327 ? 53.836  54.415  1.870   1.00 23.92 ? 327  THR B O     1 
ATOM   8528  C  CB    . THR B 1 327 ? 52.501  57.023  3.232   1.00 23.18 ? 327  THR B CB    1 
ATOM   8529  O  OG1   . THR B 1 327 ? 52.776  58.388  3.578   1.00 25.00 ? 327  THR B OG1   1 
ATOM   8530  C  CG2   . THR B 1 327 ? 53.178  56.243  4.317   1.00 23.28 ? 327  THR B CG2   1 
ATOM   8531  N  N     . ILE B 1 328 ? 51.741  54.800  1.163   1.00 24.33 ? 328  ILE B N     1 
ATOM   8532  C  CA    . ILE B 1 328 ? 51.459  53.402  0.881   1.00 24.47 ? 328  ILE B CA    1 
ATOM   8533  C  C     . ILE B 1 328 ? 52.309  52.933  -0.283  1.00 24.44 ? 328  ILE B C     1 
ATOM   8534  O  O     . ILE B 1 328 ? 52.823  51.816  -0.258  1.00 25.33 ? 328  ILE B O     1 
ATOM   8535  C  CB    . ILE B 1 328 ? 49.950  53.194  0.577   1.00 24.58 ? 328  ILE B CB    1 
ATOM   8536  C  CG1   . ILE B 1 328 ? 49.173  52.920  1.869   1.00 25.19 ? 328  ILE B CG1   1 
ATOM   8537  C  CG2   . ILE B 1 328 ? 49.735  52.045  -0.411  1.00 24.70 ? 328  ILE B CG2   1 
ATOM   8538  C  CD1   . ILE B 1 328 ? 47.799  53.562  1.894   1.00 25.59 ? 328  ILE B CD1   1 
ATOM   8539  N  N     . GLY B 1 329 ? 52.446  53.774  -1.306  1.00 24.21 ? 329  GLY B N     1 
ATOM   8540  C  CA    . GLY B 1 329 ? 53.268  53.460  -2.459  1.00 23.89 ? 329  GLY B CA    1 
ATOM   8541  C  C     . GLY B 1 329 ? 54.737  53.424  -2.091  1.00 23.98 ? 329  GLY B C     1 
ATOM   8542  O  O     . GLY B 1 329 ? 55.489  52.602  -2.595  1.00 23.89 ? 329  GLY B O     1 
ATOM   8543  N  N     . ALA B 1 330 ? 55.137  54.316  -1.191  1.00 24.13 ? 330  ALA B N     1 
ATOM   8544  C  CA    . ALA B 1 330 ? 56.517  54.394  -0.738  1.00 24.32 ? 330  ALA B CA    1 
ATOM   8545  C  C     . ALA B 1 330 ? 56.951  53.153  0.042   1.00 24.69 ? 330  ALA B C     1 
ATOM   8546  O  O     . ALA B 1 330 ? 58.131  52.803  0.026   1.00 24.93 ? 330  ALA B O     1 
ATOM   8547  C  CB    . ALA B 1 330 ? 56.713  55.633  0.114   1.00 24.36 ? 330  ALA B CB    1 
ATOM   8548  N  N     . LEU B 1 331 ? 56.004  52.490  0.709   1.00 24.78 ? 331  LEU B N     1 
ATOM   8549  C  CA    . LEU B 1 331 ? 56.313  51.400  1.611   1.00 24.99 ? 331  LEU B CA    1 
ATOM   8550  C  C     . LEU B 1 331 ? 55.980  50.039  1.030   1.00 25.54 ? 331  LEU B C     1 
ATOM   8551  O  O     . LEU B 1 331 ? 56.300  49.022  1.652   1.00 25.45 ? 331  LEU B O     1 
ATOM   8552  C  CB    . LEU B 1 331 ? 55.552  51.564  2.914   1.00 24.80 ? 331  LEU B CB    1 
ATOM   8553  C  CG    . LEU B 1 331 ? 55.815  52.806  3.753   1.00 25.72 ? 331  LEU B CG    1 
ATOM   8554  C  CD1   . LEU B 1 331 ? 54.575  53.183  4.577   1.00 26.15 ? 331  LEU B CD1   1 
ATOM   8555  C  CD2   . LEU B 1 331 ? 56.999  52.578  4.679   1.00 26.54 ? 331  LEU B CD2   1 
ATOM   8556  N  N     . GLN B 1 332 ? 55.336  49.986  -0.140  1.00 26.11 ? 332  GLN B N     1 
ATOM   8557  C  CA    . GLN B 1 332 ? 54.980  48.678  -0.713  1.00 26.55 ? 332  GLN B CA    1 
ATOM   8558  C  C     . GLN B 1 332 ? 56.211  47.772  -0.607  1.00 26.17 ? 332  GLN B C     1 
ATOM   8559  O  O     . GLN B 1 332 ? 56.116  46.630  -0.162  1.00 26.17 ? 332  GLN B O     1 
ATOM   8560  C  CB    . GLN B 1 332 ? 54.429  48.778  -2.165  1.00 26.93 ? 332  GLN B CB    1 
ATOM   8561  C  CG    . GLN B 1 332 ? 52.850  48.840  -2.275  1.00 28.07 ? 332  GLN B CG    1 
ATOM   8562  C  CD    . GLN B 1 332 ? 52.337  49.291  -3.664  1.00 29.87 ? 332  GLN B CD    1 
ATOM   8563  O  OE1   . GLN B 1 332 ? 51.914  50.430  -3.832  1.00 31.45 ? 332  GLN B OE1   1 
ATOM   8564  N  NE2   . GLN B 1 332 ? 52.379  48.404  -4.650  1.00 29.68 ? 332  GLN B NE2   1 
ATOM   8565  N  N     . ASP B 1 333 ? 57.373  48.321  -0.947  1.00 26.14 ? 333  ASP B N     1 
ATOM   8566  C  CA    . ASP B 1 333 ? 58.628  47.562  -0.947  1.00 26.18 ? 333  ASP B CA    1 
ATOM   8567  C  C     . ASP B 1 333 ? 59.154  47.105  0.454   1.00 25.99 ? 333  ASP B C     1 
ATOM   8568  O  O     . ASP B 1 333 ? 59.740  46.038  0.563   1.00 26.29 ? 333  ASP B O     1 
ATOM   8569  C  CB    . ASP B 1 333 ? 59.714  48.379  -1.679  1.00 26.24 ? 333  ASP B CB    1 
ATOM   8570  C  CG    . ASP B 1 333 ? 59.599  48.319  -3.205  1.00 26.34 ? 333  ASP B CG    1 
ATOM   8571  O  OD1   . ASP B 1 333 ? 58.650  47.705  -3.754  1.00 26.65 ? 333  ASP B OD1   1 
ATOM   8572  O  OD2   . ASP B 1 333 ? 60.441  48.871  -3.943  1.00 26.21 ? 333  ASP B OD2   1 
ATOM   8573  N  N     . PHE B 1 334 ? 58.935  47.896  1.508   1.00 25.41 ? 334  PHE B N     1 
ATOM   8574  C  CA    . PHE B 1 334 ? 59.547  47.669  2.834   1.00 24.66 ? 334  PHE B CA    1 
ATOM   8575  C  C     . PHE B 1 334 ? 58.651  46.943  3.842   1.00 23.81 ? 334  PHE B C     1 
ATOM   8576  O  O     . PHE B 1 334 ? 59.000  46.800  5.008   1.00 23.24 ? 334  PHE B O     1 
ATOM   8577  C  CB    . PHE B 1 334 ? 59.929  49.014  3.451   1.00 24.88 ? 334  PHE B CB    1 
ATOM   8578  C  CG    . PHE B 1 334 ? 60.830  49.844  2.591   1.00 25.26 ? 334  PHE B CG    1 
ATOM   8579  C  CD1   . PHE B 1 334 ? 60.319  50.574  1.515   1.00 25.11 ? 334  PHE B CD1   1 
ATOM   8580  C  CD2   . PHE B 1 334 ? 62.187  49.908  2.857   1.00 25.48 ? 334  PHE B CD2   1 
ATOM   8581  C  CE1   . PHE B 1 334 ? 61.148  51.346  0.714   1.00 24.61 ? 334  PHE B CE1   1 
ATOM   8582  C  CE2   . PHE B 1 334 ? 63.020  50.680  2.059   1.00 26.06 ? 334  PHE B CE2   1 
ATOM   8583  C  CZ    . PHE B 1 334 ? 62.495  51.406  0.983   1.00 25.44 ? 334  PHE B CZ    1 
ATOM   8584  N  N     . THR B 1 335 ? 57.502  46.484  3.379   1.00 23.23 ? 335  THR B N     1 
ATOM   8585  C  CA    . THR B 1 335 ? 56.460  45.893  4.224   1.00 22.40 ? 335  THR B CA    1 
ATOM   8586  C  C     . THR B 1 335 ? 56.878  44.621  4.966   1.00 21.95 ? 335  THR B C     1 
ATOM   8587  O  O     . THR B 1 335 ? 56.660  44.516  6.169   1.00 21.97 ? 335  THR B O     1 
ATOM   8588  C  CB    . THR B 1 335 ? 55.221  45.613  3.335   1.00 22.50 ? 335  THR B CB    1 
ATOM   8589  O  OG1   . THR B 1 335 ? 54.314  46.727  3.400   1.00 21.80 ? 335  THR B OG1   1 
ATOM   8590  C  CG2   . THR B 1 335 ? 54.423  44.382  3.794   1.00 22.72 ? 335  THR B CG2   1 
ATOM   8591  N  N     . ALA B 1 336 ? 57.445  43.648  4.253   1.00 21.34 ? 336  ALA B N     1 
ATOM   8592  C  CA    . ALA B 1 336 ? 57.814  42.358  4.862   1.00 20.71 ? 336  ALA B CA    1 
ATOM   8593  C  C     . ALA B 1 336 ? 58.846  42.518  5.973   1.00 20.13 ? 336  ALA B C     1 
ATOM   8594  O  O     . ALA B 1 336 ? 58.839  41.754  6.933   1.00 20.01 ? 336  ALA B O     1 
ATOM   8595  C  CB    . ALA B 1 336 ? 58.344  41.404  3.809   1.00 20.46 ? 336  ALA B CB    1 
ATOM   8596  N  N     . GLY B 1 337 ? 59.729  43.508  5.827   1.00 19.56 ? 337  GLY B N     1 
ATOM   8597  C  CA    . GLY B 1 337 ? 60.762  43.782  6.806   1.00 19.28 ? 337  GLY B CA    1 
ATOM   8598  C  C     . GLY B 1 337 ? 60.236  44.421  8.074   1.00 19.38 ? 337  GLY B C     1 
ATOM   8599  O  O     . GLY B 1 337 ? 60.748  44.156  9.166   1.00 19.24 ? 337  GLY B O     1 
ATOM   8600  N  N     . LEU B 1 338 ? 59.191  45.239  7.907   1.00 19.28 ? 338  LEU B N     1 
ATOM   8601  C  CA    . LEU B 1 338 ? 58.665  46.149  8.916   1.00 18.57 ? 338  LEU B CA    1 
ATOM   8602  C  C     . LEU B 1 338 ? 57.673  45.493  9.876   1.00 18.70 ? 338  LEU B C     1 
ATOM   8603  O  O     . LEU B 1 338 ? 57.749  45.707  11.080  1.00 18.85 ? 338  LEU B O     1 
ATOM   8604  C  CB    . LEU B 1 338 ? 57.965  47.308  8.208   1.00 18.49 ? 338  LEU B CB    1 
ATOM   8605  C  CG    . LEU B 1 338 ? 58.500  48.748  8.187   1.00 18.60 ? 338  LEU B CG    1 
ATOM   8606  C  CD1   . LEU B 1 338 ? 59.924  48.904  8.587   1.00 19.02 ? 338  LEU B CD1   1 
ATOM   8607  C  CD2   . LEU B 1 338 ? 58.317  49.374  6.821   1.00 18.53 ? 338  LEU B CD2   1 
ATOM   8608  N  N     . GLN B 1 339 ? 56.748  44.695  9.355   1.00 19.05 ? 339  GLN B N     1 
ATOM   8609  C  CA    . GLN B 1 339 ? 55.622  44.172  10.155  1.00 19.26 ? 339  GLN B CA    1 
ATOM   8610  C  C     . GLN B 1 339 ? 55.972  43.210  11.307  1.00 19.75 ? 339  GLN B C     1 
ATOM   8611  O  O     . GLN B 1 339 ? 55.282  43.245  12.331  1.00 20.78 ? 339  GLN B O     1 
ATOM   8612  C  CB    . GLN B 1 339 ? 54.546  43.516  9.262   1.00 19.03 ? 339  GLN B CB    1 
ATOM   8613  C  CG    . GLN B 1 339 ? 53.918  44.453  8.259   1.00 18.37 ? 339  GLN B CG    1 
ATOM   8614  C  CD    . GLN B 1 339 ? 52.661  43.910  7.636   1.00 17.33 ? 339  GLN B CD    1 
ATOM   8615  O  OE1   . GLN B 1 339 ? 52.706  42.923  6.929   1.00 17.34 ? 339  GLN B OE1   1 
ATOM   8616  N  NE2   . GLN B 1 339 ? 51.538  44.578  7.871   1.00 18.19 ? 339  GLN B NE2   1 
ATOM   8617  N  N     . PRO B 1 340 ? 56.967  42.328  11.166  1.00 19.83 ? 340  PRO B N     1 
ATOM   8618  C  CA    . PRO B 1 340 ? 57.386  41.472  12.304  1.00 19.84 ? 340  PRO B CA    1 
ATOM   8619  C  C     . PRO B 1 340 ? 58.064  42.247  13.455  1.00 19.90 ? 340  PRO B C     1 
ATOM   8620  O  O     . PRO B 1 340 ? 57.894  41.935  14.646  1.00 19.50 ? 340  PRO B O     1 
ATOM   8621  C  CB    . PRO B 1 340 ? 58.347  40.462  11.663  1.00 19.70 ? 340  PRO B CB    1 
ATOM   8622  C  CG    . PRO B 1 340 ? 58.112  40.591  10.183  1.00 19.75 ? 340  PRO B CG    1 
ATOM   8623  C  CD    . PRO B 1 340 ? 57.720  42.017  9.944   1.00 19.59 ? 340  PRO B CD    1 
ATOM   8624  N  N     . VAL B 1 341 ? 58.831  43.263  13.081  1.00 19.94 ? 341  VAL B N     1 
ATOM   8625  C  CA    . VAL B 1 341 ? 59.368  44.205  14.038  1.00 20.31 ? 341  VAL B CA    1 
ATOM   8626  C  C     . VAL B 1 341 ? 58.231  45.007  14.743  1.00 20.96 ? 341  VAL B C     1 
ATOM   8627  O  O     . VAL B 1 341 ? 58.203  45.105  15.979  1.00 21.10 ? 341  VAL B O     1 
ATOM   8628  C  CB    . VAL B 1 341 ? 60.348  45.144  13.334  1.00 20.59 ? 341  VAL B CB    1 
ATOM   8629  C  CG1   . VAL B 1 341 ? 60.767  46.293  14.246  1.00 21.25 ? 341  VAL B CG1   1 
ATOM   8630  C  CG2   . VAL B 1 341 ? 61.576  44.361  12.857  1.00 19.81 ? 341  VAL B CG2   1 
ATOM   8631  N  N     . LEU B 1 342 ? 57.288  45.550  13.970  1.00 20.99 ? 342  LEU B N     1 
ATOM   8632  C  CA    . LEU B 1 342 ? 56.172  46.293  14.551  1.00 21.25 ? 342  LEU B CA    1 
ATOM   8633  C  C     . LEU B 1 342 ? 55.284  45.402  15.404  1.00 21.52 ? 342  LEU B C     1 
ATOM   8634  O  O     . LEU B 1 342 ? 54.760  45.861  16.406  1.00 21.30 ? 342  LEU B O     1 
ATOM   8635  C  CB    . LEU B 1 342 ? 55.312  46.962  13.478  1.00 21.40 ? 342  LEU B CB    1 
ATOM   8636  C  CG    . LEU B 1 342 ? 55.814  48.248  12.807  1.00 21.79 ? 342  LEU B CG    1 
ATOM   8637  C  CD1   . LEU B 1 342 ? 55.430  48.283  11.329  1.00 20.94 ? 342  LEU B CD1   1 
ATOM   8638  C  CD2   . LEU B 1 342 ? 55.279  49.463  13.517  1.00 22.23 ? 342  LEU B CD2   1 
ATOM   8639  N  N     . ARG B 1 343 ? 55.109  44.135  15.022  1.00 21.81 ? 343  ARG B N     1 
ATOM   8640  C  CA    . ARG B 1 343 ? 54.218  43.240  15.766  1.00 22.06 ? 343  ARG B CA    1 
ATOM   8641  C  C     . ARG B 1 343 ? 54.700  43.124  17.190  1.00 22.11 ? 343  ARG B C     1 
ATOM   8642  O  O     . ARG B 1 343 ? 53.904  43.041  18.130  1.00 22.16 ? 343  ARG B O     1 
ATOM   8643  C  CB    . ARG B 1 343 ? 54.183  41.854  15.145  1.00 22.71 ? 343  ARG B CB    1 
ATOM   8644  C  CG    . ARG B 1 343 ? 53.472  40.790  16.005  1.00 23.75 ? 343  ARG B CG    1 
ATOM   8645  C  CD    . ARG B 1 343 ? 53.291  39.466  15.299  1.00 25.43 ? 343  ARG B CD    1 
ATOM   8646  N  NE    . ARG B 1 343 ? 52.148  39.458  14.379  1.00 27.93 ? 343  ARG B NE    1 
ATOM   8647  C  CZ    . ARG B 1 343 ? 52.224  39.582  13.046  1.00 30.62 ? 343  ARG B CZ    1 
ATOM   8648  N  NH1   . ARG B 1 343 ? 53.394  39.762  12.425  1.00 31.82 ? 343  ARG B NH1   1 
ATOM   8649  N  NH2   . ARG B 1 343 ? 51.113  39.544  12.319  1.00 31.24 ? 343  ARG B NH2   1 
ATOM   8650  N  N     . GLN B 1 344 ? 56.026  43.123  17.325  1.00 22.15 ? 344  GLN B N     1 
ATOM   8651  C  CA    . GLN B 1 344 ? 56.709  43.080  18.611  1.00 21.47 ? 344  GLN B CA    1 
ATOM   8652  C  C     . GLN B 1 344 ? 56.423  44.277  19.498  1.00 20.83 ? 344  GLN B C     1 
ATOM   8653  O  O     . GLN B 1 344 ? 56.450  44.137  20.712  1.00 20.53 ? 344  GLN B O     1 
ATOM   8654  C  CB    . GLN B 1 344 ? 58.238  42.950  18.394  1.00 21.94 ? 344  GLN B CB    1 
ATOM   8655  C  CG    . GLN B 1 344 ? 58.711  41.544  17.928  1.00 20.78 ? 344  GLN B CG    1 
ATOM   8656  C  CD    . GLN B 1 344 ? 57.920  40.448  18.600  1.00 18.80 ? 344  GLN B CD    1 
ATOM   8657  O  OE1   . GLN B 1 344 ? 57.806  40.441  19.816  1.00 15.35 ? 344  GLN B OE1   1 
ATOM   8658  N  NE2   . GLN B 1 344 ? 57.330  39.551  17.811  1.00 19.95 ? 344  GLN B NE2   1 
ATOM   8659  N  N     . VAL B 1 345 ? 56.156  45.438  18.893  1.00 20.26 ? 345  VAL B N     1 
ATOM   8660  C  CA    . VAL B 1 345 ? 55.879  46.690  19.632  1.00 19.60 ? 345  VAL B CA    1 
ATOM   8661  C  C     . VAL B 1 345 ? 54.576  46.664  20.449  1.00 19.14 ? 345  VAL B C     1 
ATOM   8662  O  O     . VAL B 1 345 ? 54.460  47.330  21.462  1.00 19.01 ? 345  VAL B O     1 
ATOM   8663  C  CB    . VAL B 1 345 ? 55.922  47.905  18.662  1.00 19.53 ? 345  VAL B CB    1 
ATOM   8664  C  CG1   . VAL B 1 345 ? 55.361  49.171  19.280  1.00 20.22 ? 345  VAL B CG1   1 
ATOM   8665  C  CG2   . VAL B 1 345 ? 57.341  48.143  18.220  1.00 19.59 ? 345  VAL B CG2   1 
ATOM   8666  N  N     . GLY B 1 346 ? 53.597  45.886  20.016  1.00 19.10 ? 346  GLY B N     1 
ATOM   8667  C  CA    . GLY B 1 346 ? 52.398  45.654  20.807  1.00 18.66 ? 346  GLY B CA    1 
ATOM   8668  C  C     . GLY B 1 346 ? 51.638  46.927  21.094  1.00 18.49 ? 346  GLY B C     1 
ATOM   8669  O  O     . GLY B 1 346 ? 51.740  47.907  20.340  1.00 18.48 ? 346  GLY B O     1 
ATOM   8670  N  N     . ASP B 1 347 ? 50.889  46.924  22.196  1.00 18.05 ? 347  ASP B N     1 
ATOM   8671  C  CA    . ASP B 1 347 ? 49.973  48.018  22.502  1.00 17.91 ? 347  ASP B CA    1 
ATOM   8672  C  C     . ASP B 1 347 ? 50.569  49.212  23.308  1.00 18.10 ? 347  ASP B C     1 
ATOM   8673  O  O     . ASP B 1 347 ? 50.083  49.562  24.396  1.00 17.94 ? 347  ASP B O     1 
ATOM   8674  C  CB    . ASP B 1 347 ? 48.745  47.439  23.210  1.00 17.63 ? 347  ASP B CB    1 
ATOM   8675  C  CG    . ASP B 1 347 ? 47.500  48.288  23.007  1.00 16.64 ? 347  ASP B CG    1 
ATOM   8676  O  OD1   . ASP B 1 347 ? 47.635  49.520  22.748  1.00 14.99 ? 347  ASP B OD1   1 
ATOM   8677  O  OD2   . ASP B 1 347 ? 46.359  47.791  23.086  1.00 12.03 ? 347  ASP B OD2   1 
ATOM   8678  N  N     . LEU B 1 348 ? 51.583  49.869  22.758  1.00 18.03 ? 348  LEU B N     1 
ATOM   8679  C  CA    . LEU B 1 348 ? 52.278  50.910  23.508  1.00 18.40 ? 348  LEU B CA    1 
ATOM   8680  C  C     . LEU B 1 348 ? 51.354  52.041  23.916  1.00 18.57 ? 348  LEU B C     1 
ATOM   8681  O  O     . LEU B 1 348 ? 51.685  52.776  24.829  1.00 19.54 ? 348  LEU B O     1 
ATOM   8682  C  CB    . LEU B 1 348 ? 53.466  51.472  22.714  1.00 18.55 ? 348  LEU B CB    1 
ATOM   8683  C  CG    . LEU B 1 348 ? 54.368  52.513  23.401  1.00 19.35 ? 348  LEU B CG    1 
ATOM   8684  C  CD1   . LEU B 1 348 ? 55.161  51.903  24.554  1.00 19.26 ? 348  LEU B CD1   1 
ATOM   8685  C  CD2   . LEU B 1 348 ? 55.314  53.160  22.404  1.00 20.30 ? 348  LEU B CD2   1 
ATOM   8686  N  N     . GLU B 1 349 ? 50.203  52.188  23.266  1.00 18.80 ? 349  GLU B N     1 
ATOM   8687  C  CA    . GLU B 1 349 ? 49.233  53.232  23.631  1.00 19.22 ? 349  GLU B CA    1 
ATOM   8688  C  C     . GLU B 1 349 ? 48.642  52.999  25.016  1.00 18.82 ? 349  GLU B C     1 
ATOM   8689  O  O     . GLU B 1 349 ? 48.745  53.851  25.891  1.00 19.21 ? 349  GLU B O     1 
ATOM   8690  C  CB    . GLU B 1 349 ? 48.105  53.299  22.584  1.00 19.84 ? 349  GLU B CB    1 
ATOM   8691  C  CG    . GLU B 1 349 ? 47.259  54.557  22.601  1.00 20.77 ? 349  GLU B CG    1 
ATOM   8692  C  CD    . GLU B 1 349 ? 46.313  54.600  21.423  1.00 23.33 ? 349  GLU B CD    1 
ATOM   8693  O  OE1   . GLU B 1 349 ? 46.327  55.604  20.665  1.00 26.75 ? 349  GLU B OE1   1 
ATOM   8694  O  OE2   . GLU B 1 349 ? 45.546  53.631  21.259  1.00 24.14 ? 349  GLU B OE2   1 
ATOM   8695  N  N     . ARG B 1 350 ? 48.043  51.826  25.214  1.00 18.78 ? 350  ARG B N     1 
ATOM   8696  C  CA    . ARG B 1 350 ? 47.400  51.464  26.491  1.00 18.03 ? 350  ARG B CA    1 
ATOM   8697  C  C     . ARG B 1 350 ? 48.365  51.209  27.652  1.00 18.03 ? 350  ARG B C     1 
ATOM   8698  O  O     . ARG B 1 350 ? 47.943  51.261  28.805  1.00 18.02 ? 350  ARG B O     1 
ATOM   8699  C  CB    . ARG B 1 350 ? 46.509  50.245  26.292  1.00 17.55 ? 350  ARG B CB    1 
ATOM   8700  C  CG    . ARG B 1 350 ? 45.354  50.551  25.405  1.00 17.00 ? 350  ARG B CG    1 
ATOM   8701  C  CD    . ARG B 1 350 ? 44.301  49.477  25.289  1.00 16.78 ? 350  ARG B CD    1 
ATOM   8702  N  NE    . ARG B 1 350 ? 43.093  50.027  24.674  1.00 18.01 ? 350  ARG B NE    1 
ATOM   8703  C  CZ    . ARG B 1 350 ? 42.043  49.317  24.302  1.00 18.50 ? 350  ARG B CZ    1 
ATOM   8704  N  NH1   . ARG B 1 350 ? 42.028  47.998  24.470  1.00 20.56 ? 350  ARG B NH1   1 
ATOM   8705  N  NH2   . ARG B 1 350 ? 41.000  49.922  23.755  1.00 17.22 ? 350  ARG B NH2   1 
ATOM   8706  N  N     . ILE B 1 351 ? 49.637  50.916  27.363  1.00 17.83 ? 351  ILE B N     1 
ATOM   8707  C  CA    . ILE B 1 351 ? 50.638  50.775  28.410  1.00 17.83 ? 351  ILE B CA    1 
ATOM   8708  C  C     . ILE B 1 351 ? 50.972  52.149  28.918  1.00 17.82 ? 351  ILE B C     1 
ATOM   8709  O  O     . ILE B 1 351 ? 51.160  52.348  30.105  1.00 17.91 ? 351  ILE B O     1 
ATOM   8710  C  CB    . ILE B 1 351 ? 51.910  50.093  27.884  1.00 18.27 ? 351  ILE B CB    1 
ATOM   8711  C  CG1   . ILE B 1 351 ? 51.689  48.584  27.775  1.00 18.53 ? 351  ILE B CG1   1 
ATOM   8712  C  CG2   . ILE B 1 351 ? 53.120  50.379  28.795  1.00 18.03 ? 351  ILE B CG2   1 
ATOM   8713  C  CD1   . ILE B 1 351 ? 52.602  47.921  26.814  1.00 18.79 ? 351  ILE B CD1   1 
ATOM   8714  N  N     . LEU B 1 352 ? 51.044  53.106  28.007  1.00 18.02 ? 352  LEU B N     1 
ATOM   8715  C  CA    . LEU B 1 352 ? 51.326  54.500  28.376  1.00 18.07 ? 352  LEU B CA    1 
ATOM   8716  C  C     . LEU B 1 352 ? 50.212  55.116  29.214  1.00 17.95 ? 352  LEU B C     1 
ATOM   8717  O  O     . LEU B 1 352 ? 50.459  56.026  29.998  1.00 17.61 ? 352  LEU B O     1 
ATOM   8718  C  CB    . LEU B 1 352 ? 51.573  55.347  27.114  1.00 18.21 ? 352  LEU B CB    1 
ATOM   8719  C  CG    . LEU B 1 352 ? 53.013  55.670  26.678  1.00 18.36 ? 352  LEU B CG    1 
ATOM   8720  C  CD1   . LEU B 1 352 ? 54.051  54.692  27.194  1.00 18.76 ? 352  LEU B CD1   1 
ATOM   8721  C  CD2   . LEU B 1 352 ? 53.077  55.757  25.158  1.00 18.77 ? 352  LEU B CD2   1 
ATOM   8722  N  N     . ALA B 1 353 ? 48.988  54.620  29.043  1.00 18.39 ? 353  ALA B N     1 
ATOM   8723  C  CA    . ALA B 1 353 ? 47.838  55.094  29.828  1.00 18.42 ? 353  ALA B CA    1 
ATOM   8724  C  C     . ALA B 1 353 ? 48.046  54.695  31.249  1.00 18.21 ? 353  ALA B C     1 
ATOM   8725  O  O     . ALA B 1 353 ? 47.820  55.467  32.170  1.00 18.84 ? 353  ALA B O     1 
ATOM   8726  C  CB    . ALA B 1 353 ? 46.554  54.469  29.333  1.00 18.29 ? 353  ALA B CB    1 
ATOM   8727  N  N     . ARG B 1 354 ? 48.473  53.454  31.405  1.00 18.13 ? 354  ARG B N     1 
ATOM   8728  C  CA    . ARG B 1 354 ? 48.706  52.860  32.704  1.00 17.64 ? 354  ARG B CA    1 
ATOM   8729  C  C     . ARG B 1 354 ? 49.947  53.437  33.331  1.00 17.37 ? 354  ARG B C     1 
ATOM   8730  O  O     . ARG B 1 354 ? 50.005  53.547  34.523  1.00 17.30 ? 354  ARG B O     1 
ATOM   8731  C  CB    . ARG B 1 354 ? 48.812  51.344  32.558  1.00 17.71 ? 354  ARG B CB    1 
ATOM   8732  C  CG    . ARG B 1 354 ? 47.467  50.674  32.482  1.00 17.36 ? 354  ARG B CG    1 
ATOM   8733  C  CD    . ARG B 1 354 ? 47.519  49.212  32.780  1.00 18.67 ? 354  ARG B CD    1 
ATOM   8734  N  NE    . ARG B 1 354 ? 48.184  48.494  31.688  1.00 19.56 ? 354  ARG B NE    1 
ATOM   8735  C  CZ    . ARG B 1 354 ? 47.572  48.088  30.580  1.00 16.76 ? 354  ARG B CZ    1 
ATOM   8736  N  NH1   . ARG B 1 354 ? 46.285  48.332  30.412  1.00 16.79 ? 354  ARG B NH1   1 
ATOM   8737  N  NH2   . ARG B 1 354 ? 48.250  47.459  29.631  1.00 15.19 ? 354  ARG B NH2   1 
ATOM   8738  N  N     . LEU B 1 355 ? 50.933  53.824  32.530  1.00 17.71 ? 355  LEU B N     1 
ATOM   8739  C  CA    . LEU B 1 355 ? 52.049  54.650  33.027  1.00 18.23 ? 355  LEU B CA    1 
ATOM   8740  C  C     . LEU B 1 355 ? 51.634  56.040  33.563  1.00 18.39 ? 355  LEU B C     1 
ATOM   8741  O  O     . LEU B 1 355 ? 52.237  56.525  34.508  1.00 18.96 ? 355  LEU B O     1 
ATOM   8742  C  CB    . LEU B 1 355 ? 53.112  54.848  31.945  1.00 18.07 ? 355  LEU B CB    1 
ATOM   8743  C  CG    . LEU B 1 355 ? 54.410  55.521  32.393  1.00 18.56 ? 355  LEU B CG    1 
ATOM   8744  C  CD1   . LEU B 1 355 ? 55.192  54.595  33.294  1.00 19.66 ? 355  LEU B CD1   1 
ATOM   8745  C  CD2   . LEU B 1 355 ? 55.266  55.919  31.218  1.00 17.91 ? 355  LEU B CD2   1 
ATOM   8746  N  N     . ALA B 1 356 ? 50.632  56.677  32.958  1.00 18.48 ? 356  ALA B N     1 
ATOM   8747  C  CA    . ALA B 1 356 ? 50.179  58.016  33.379  1.00 18.64 ? 356  ALA B CA    1 
ATOM   8748  C  C     . ALA B 1 356 ? 49.260  57.985  34.607  1.00 18.68 ? 356  ALA B C     1 
ATOM   8749  O  O     . ALA B 1 356 ? 49.275  58.898  35.460  1.00 18.63 ? 356  ALA B O     1 
ATOM   8750  C  CB    . ALA B 1 356 ? 49.472  58.709  32.227  1.00 18.83 ? 356  ALA B CB    1 
ATOM   8751  N  N     . LEU B 1 357 ? 48.438  56.939  34.677  1.00 18.49 ? 357  LEU B N     1 
ATOM   8752  C  CA    . LEU B 1 357 ? 47.584  56.692  35.839  1.00 17.96 ? 357  LEU B CA    1 
ATOM   8753  C  C     . LEU B 1 357 ? 48.410  56.145  37.008  1.00 17.86 ? 357  LEU B C     1 
ATOM   8754  O  O     . LEU B 1 357 ? 47.956  56.170  38.131  1.00 17.96 ? 357  LEU B O     1 
ATOM   8755  C  CB    . LEU B 1 357 ? 46.459  55.707  35.491  1.00 17.71 ? 357  LEU B CB    1 
ATOM   8756  C  CG    . LEU B 1 357 ? 45.113  56.147  34.906  1.00 16.39 ? 357  LEU B CG    1 
ATOM   8757  C  CD1   . LEU B 1 357 ? 44.903  57.673  34.898  1.00 17.80 ? 357  LEU B CD1   1 
ATOM   8758  C  CD2   . LEU B 1 357 ? 44.939  55.576  33.542  1.00 14.98 ? 357  LEU B CD2   1 
ATOM   8759  N  N     . ARG B 1 358 ? 49.625  55.678  36.735  1.00 18.05 ? 358  ARG B N     1 
ATOM   8760  C  CA    . ARG B 1 358 ? 50.526  55.092  37.740  1.00 18.31 ? 358  ARG B CA    1 
ATOM   8761  C  C     . ARG B 1 358 ? 50.100  53.693  38.219  1.00 17.88 ? 358  ARG B C     1 
ATOM   8762  O  O     . ARG B 1 358 ? 50.383  53.280  39.348  1.00 17.78 ? 358  ARG B O     1 
ATOM   8763  C  CB    . ARG B 1 358 ? 50.789  56.064  38.904  1.00 18.46 ? 358  ARG B CB    1 
ATOM   8764  C  CG    . ARG B 1 358 ? 51.742  57.185  38.518  1.00 20.52 ? 358  ARG B CG    1 
ATOM   8765  C  CD    . ARG B 1 358 ? 52.367  57.937  39.682  1.00 23.88 ? 358  ARG B CD    1 
ATOM   8766  N  NE    . ARG B 1 358 ? 53.451  57.166  40.304  1.00 27.28 ? 358  ARG B NE    1 
ATOM   8767  C  CZ    . ARG B 1 358 ? 54.622  57.660  40.731  1.00 28.70 ? 358  ARG B CZ    1 
ATOM   8768  N  NH1   . ARG B 1 358 ? 55.514  56.838  41.282  1.00 28.38 ? 358  ARG B NH1   1 
ATOM   8769  N  NH2   . ARG B 1 358 ? 54.916  58.957  40.614  1.00 30.13 ? 358  ARG B NH2   1 
ATOM   8770  N  N     . THR B 1 359 ? 49.473  52.955  37.314  1.00 17.68 ? 359  THR B N     1 
ATOM   8771  C  CA    . THR B 1 359 ? 48.963  51.624  37.592  1.00 17.74 ? 359  THR B CA    1 
ATOM   8772  C  C     . THR B 1 359 ? 49.705  50.543  36.802  1.00 18.11 ? 359  THR B C     1 
ATOM   8773  O  O     . THR B 1 359 ? 49.405  49.344  36.939  1.00 18.54 ? 359  THR B O     1 
ATOM   8774  C  CB    . THR B 1 359 ? 47.456  51.568  37.248  1.00 17.47 ? 359  THR B CB    1 
ATOM   8775  O  OG1   . THR B 1 359 ? 47.273  51.820  35.849  1.00 17.39 ? 359  THR B OG1   1 
ATOM   8776  C  CG2   . THR B 1 359 ? 46.684  52.683  37.921  1.00 16.16 ? 359  THR B CG2   1 
ATOM   8777  N  N     . ALA B 1 360 ? 50.678  50.947  35.996  1.00 18.30 ? 360  ALA B N     1 
ATOM   8778  C  CA    . ALA B 1 360 ? 51.376  50.001  35.129  1.00 18.83 ? 360  ALA B CA    1 
ATOM   8779  C  C     . ALA B 1 360 ? 52.151  48.957  35.922  1.00 19.05 ? 360  ALA B C     1 
ATOM   8780  O  O     . ALA B 1 360 ? 53.101  49.283  36.623  1.00 18.91 ? 360  ALA B O     1 
ATOM   8781  C  CB    . ALA B 1 360 ? 52.309  50.727  34.184  1.00 19.28 ? 360  ALA B CB    1 
ATOM   8782  N  N     . ARG B 1 361 ? 51.727  47.700  35.760  1.00 19.68 ? 361  ARG B N     1 
ATOM   8783  C  CA    . ARG B 1 361 ? 52.283  46.520  36.439  1.00 19.54 ? 361  ARG B CA    1 
ATOM   8784  C  C     . ARG B 1 361 ? 53.589  46.075  35.743  1.00 19.18 ? 361  ARG B C     1 
ATOM   8785  O  O     . ARG B 1 361 ? 53.824  46.468  34.626  1.00 19.48 ? 361  ARG B O     1 
ATOM   8786  C  CB    . ARG B 1 361 ? 51.222  45.412  36.422  1.00 20.05 ? 361  ARG B CB    1 
ATOM   8787  C  CG    . ARG B 1 361 ? 49.726  45.911  36.390  1.00 20.79 ? 361  ARG B CG    1 
ATOM   8788  C  CD    . ARG B 1 361 ? 48.652  44.839  36.731  1.00 21.61 ? 361  ARG B CD    1 
ATOM   8789  N  NE    . ARG B 1 361 ? 48.395  43.899  35.620  1.00 22.79 ? 361  ARG B NE    1 
ATOM   8790  C  CZ    . ARG B 1 361 ? 47.709  42.751  35.737  1.00 23.39 ? 361  ARG B CZ    1 
ATOM   8791  N  NH1   . ARG B 1 361 ? 47.178  42.393  36.911  1.00 24.18 ? 361  ARG B NH1   1 
ATOM   8792  N  NH2   . ARG B 1 361 ? 47.542  41.954  34.685  1.00 22.29 ? 361  ARG B NH2   1 
ATOM   8793  N  N     . PRO B 1 362 ? 54.472  45.322  36.398  1.00 19.12 ? 362  PRO B N     1 
ATOM   8794  C  CA    . PRO B 1 362 ? 55.798  45.000  35.841  1.00 18.88 ? 362  PRO B CA    1 
ATOM   8795  C  C     . PRO B 1 362 ? 55.892  44.511  34.381  1.00 18.73 ? 362  PRO B C     1 
ATOM   8796  O  O     . PRO B 1 362 ? 56.898  44.844  33.734  1.00 18.64 ? 362  PRO B O     1 
ATOM   8797  C  CB    . PRO B 1 362 ? 56.300  43.906  36.774  1.00 18.81 ? 362  PRO B CB    1 
ATOM   8798  C  CG    . PRO B 1 362 ? 55.703  44.246  38.055  1.00 19.20 ? 362  PRO B CG    1 
ATOM   8799  C  CD    . PRO B 1 362 ? 54.307  44.709  37.730  1.00 19.67 ? 362  PRO B CD    1 
ATOM   8800  N  N     . ARG B 1 363 ? 54.918  43.737  33.893  1.00 18.49 ? 363  ARG B N     1 
ATOM   8801  C  CA    . ARG B 1 363 ? 54.919  43.266  32.496  1.00 18.12 ? 363  ARG B CA    1 
ATOM   8802  C  C     . ARG B 1 363 ? 54.575  44.377  31.512  1.00 17.86 ? 363  ARG B C     1 
ATOM   8803  O  O     . ARG B 1 363 ? 55.055  44.369  30.388  1.00 17.42 ? 363  ARG B O     1 
ATOM   8804  C  CB    . ARG B 1 363 ? 53.941  42.106  32.276  1.00 18.15 ? 363  ARG B CB    1 
ATOM   8805  C  CG    . ARG B 1 363 ? 54.178  40.903  33.163  1.00 18.76 ? 363  ARG B CG    1 
ATOM   8806  C  CD    . ARG B 1 363 ? 54.418  39.607  32.404  1.00 19.47 ? 363  ARG B CD    1 
ATOM   8807  N  NE    . ARG B 1 363 ? 54.542  38.472  33.321  1.00 19.98 ? 363  ARG B NE    1 
ATOM   8808  C  CZ    . ARG B 1 363 ? 53.749  37.394  33.348  1.00 20.16 ? 363  ARG B CZ    1 
ATOM   8809  N  NH1   . ARG B 1 363 ? 52.717  37.259  32.521  1.00 20.34 ? 363  ARG B NH1   1 
ATOM   8810  N  NH2   . ARG B 1 363 ? 53.995  36.437  34.238  1.00 19.86 ? 363  ARG B NH2   1 
ATOM   8811  N  N     . ASP B 1 364 ? 53.711  45.304  31.913  1.00 17.90 ? 364  ASP B N     1 
ATOM   8812  C  CA    . ASP B 1 364 ? 53.517  46.548  31.168  1.00 18.15 ? 364  ASP B CA    1 
ATOM   8813  C  C     . ASP B 1 364 ? 54.845  47.284  30.941  1.00 18.58 ? 364  ASP B C     1 
ATOM   8814  O  O     . ASP B 1 364 ? 55.084  47.833  29.862  1.00 18.48 ? 364  ASP B O     1 
ATOM   8815  C  CB    . ASP B 1 364 ? 52.554  47.471  31.913  1.00 18.50 ? 364  ASP B CB    1 
ATOM   8816  C  CG    . ASP B 1 364 ? 51.126  46.993  31.859  1.00 18.93 ? 364  ASP B CG    1 
ATOM   8817  O  OD1   . ASP B 1 364 ? 50.651  46.741  30.735  1.00 22.37 ? 364  ASP B OD1   1 
ATOM   8818  O  OD2   . ASP B 1 364 ? 50.400  46.850  32.862  1.00 17.51 ? 364  ASP B OD2   1 
ATOM   8819  N  N     . LEU B 1 365 ? 55.705  47.290  31.956  1.00 19.30 ? 365  LEU B N     1 
ATOM   8820  C  CA    . LEU B 1 365 ? 57.042  47.873  31.817  1.00 20.29 ? 365  LEU B CA    1 
ATOM   8821  C  C     . LEU B 1 365 ? 57.991  47.005  31.005  1.00 20.47 ? 365  LEU B C     1 
ATOM   8822  O  O     . LEU B 1 365 ? 58.809  47.526  30.250  1.00 20.30 ? 365  LEU B O     1 
ATOM   8823  C  CB    . LEU B 1 365 ? 57.664  48.173  33.191  1.00 20.61 ? 365  LEU B CB    1 
ATOM   8824  C  CG    . LEU B 1 365 ? 57.301  49.506  33.873  1.00 21.18 ? 365  LEU B CG    1 
ATOM   8825  C  CD1   . LEU B 1 365 ? 58.499  50.012  34.630  1.00 22.72 ? 365  LEU B CD1   1 
ATOM   8826  C  CD2   . LEU B 1 365 ? 56.784  50.589  32.918  1.00 20.30 ? 365  LEU B CD2   1 
ATOM   8827  N  N     . ALA B 1 366 ? 57.873  45.691  31.157  1.00 21.16 ? 366  ALA B N     1 
ATOM   8828  C  CA    . ALA B 1 366 ? 58.697  44.745  30.408  1.00 21.71 ? 366  ALA B CA    1 
ATOM   8829  C  C     . ALA B 1 366 ? 58.388  44.824  28.928  1.00 22.41 ? 366  ALA B C     1 
ATOM   8830  O  O     . ALA B 1 366 ? 59.283  44.713  28.112  1.00 23.23 ? 366  ALA B O     1 
ATOM   8831  C  CB    . ALA B 1 366 ? 58.484  43.321  30.914  1.00 21.77 ? 366  ALA B CB    1 
ATOM   8832  N  N     . ARG B 1 367 ? 57.126  45.047  28.578  1.00 23.31 ? 367  ARG B N     1 
ATOM   8833  C  CA    . ARG B 1 367 ? 56.714  45.141  27.179  1.00 23.85 ? 367  ARG B CA    1 
ATOM   8834  C  C     . ARG B 1 367 ? 56.891  46.543  26.578  1.00 23.56 ? 367  ARG B C     1 
ATOM   8835  O  O     . ARG B 1 367 ? 56.941  46.692  25.364  1.00 23.55 ? 367  ARG B O     1 
ATOM   8836  C  CB    . ARG B 1 367 ? 55.286  44.622  27.032  1.00 24.36 ? 367  ARG B CB    1 
ATOM   8837  C  CG    . ARG B 1 367 ? 55.220  43.086  27.290  1.00 27.46 ? 367  ARG B CG    1 
ATOM   8838  C  CD    . ARG B 1 367 ? 53.883  42.426  26.948  1.00 31.03 ? 367  ARG B CD    1 
ATOM   8839  N  NE    . ARG B 1 367 ? 52.763  43.275  27.382  1.00 34.32 ? 367  ARG B NE    1 
ATOM   8840  C  CZ    . ARG B 1 367 ? 51.797  42.913  28.229  1.00 37.22 ? 367  ARG B CZ    1 
ATOM   8841  N  NH1   . ARG B 1 367 ? 51.753  41.688  28.757  1.00 38.47 ? 367  ARG B NH1   1 
ATOM   8842  N  NH2   . ARG B 1 367 ? 50.853  43.793  28.546  1.00 38.69 ? 367  ARG B NH2   1 
ATOM   8843  N  N     . MET B 1 368 ? 57.016  47.567  27.415  1.00 23.23 ? 368  MET B N     1 
ATOM   8844  C  CA    . MET B 1 368 ? 57.436  48.876  26.924  1.00 23.01 ? 368  MET B CA    1 
ATOM   8845  C  C     . MET B 1 368 ? 58.940  48.835  26.584  1.00 22.56 ? 368  MET B C     1 
ATOM   8846  O  O     . MET B 1 368 ? 59.384  49.395  25.586  1.00 21.88 ? 368  MET B O     1 
ATOM   8847  C  CB    . MET B 1 368 ? 57.107  49.954  27.955  1.00 22.95 ? 368  MET B CB    1 
ATOM   8848  C  CG    . MET B 1 368 ? 57.544  51.344  27.574  1.00 23.18 ? 368  MET B CG    1 
ATOM   8849  S  SD    . MET B 1 368 ? 57.565  52.415  29.044  1.00 25.57 ? 368  MET B SD    1 
ATOM   8850  C  CE    . MET B 1 368 ? 55.859  52.448  29.459  1.00 25.10 ? 368  MET B CE    1 
ATOM   8851  N  N     . ARG B 1 369 ? 59.716  48.158  27.417  1.00 22.43 ? 369  ARG B N     1 
ATOM   8852  C  CA    . ARG B 1 369 ? 61.118  47.870  27.104  1.00 22.65 ? 369  ARG B CA    1 
ATOM   8853  C  C     . ARG B 1 369 ? 61.287  47.137  25.754  1.00 22.75 ? 369  ARG B C     1 
ATOM   8854  O  O     . ARG B 1 369 ? 62.108  47.509  24.934  1.00 22.62 ? 369  ARG B O     1 
ATOM   8855  C  CB    . ARG B 1 369 ? 61.726  47.038  28.233  1.00 22.62 ? 369  ARG B CB    1 
ATOM   8856  C  CG    . ARG B 1 369 ? 63.163  46.589  28.036  1.00 22.53 ? 369  ARG B CG    1 
ATOM   8857  C  CD    . ARG B 1 369 ? 63.682  45.702  29.188  1.00 22.91 ? 369  ARG B CD    1 
ATOM   8858  N  NE    . ARG B 1 369 ? 63.088  44.359  29.189  1.00 20.58 ? 369  ARG B NE    1 
ATOM   8859  C  CZ    . ARG B 1 369 ? 63.030  43.548  30.242  1.00 19.04 ? 369  ARG B CZ    1 
ATOM   8860  N  NH1   . ARG B 1 369 ? 63.522  43.916  31.411  1.00 17.45 ? 369  ARG B NH1   1 
ATOM   8861  N  NH2   . ARG B 1 369 ? 62.457  42.352  30.121  1.00 20.34 ? 369  ARG B NH2   1 
ATOM   8862  N  N     . HIS B 1 370 ? 60.495  46.110  25.520  1.00 22.73 ? 370  HIS B N     1 
ATOM   8863  C  CA    . HIS B 1 370 ? 60.552  45.408  24.259  1.00 23.33 ? 370  HIS B CA    1 
ATOM   8864  C  C     . HIS B 1 370 ? 60.266  46.341  23.062  1.00 23.40 ? 370  HIS B C     1 
ATOM   8865  O  O     . HIS B 1 370 ? 61.001  46.348  22.082  1.00 24.06 ? 370  HIS B O     1 
ATOM   8866  C  CB    . HIS B 1 370 ? 59.573  44.230  24.301  1.00 23.82 ? 370  HIS B CB    1 
ATOM   8867  C  CG    . HIS B 1 370 ? 59.976  43.084  23.445  1.00 25.38 ? 370  HIS B CG    1 
ATOM   8868  N  ND1   . HIS B 1 370 ? 59.743  43.058  22.089  1.00 29.19 ? 370  HIS B ND1   1 
ATOM   8869  C  CD2   . HIS B 1 370 ? 60.604  41.923  23.744  1.00 29.17 ? 370  HIS B CD2   1 
ATOM   8870  C  CE1   . HIS B 1 370 ? 60.209  41.925  21.586  1.00 31.39 ? 370  HIS B CE1   1 
ATOM   8871  N  NE2   . HIS B 1 370 ? 60.735  41.216  22.571  1.00 30.60 ? 370  HIS B NE2   1 
ATOM   8872  N  N     . ALA B 1 371 ? 59.191  47.113  23.134  1.00 23.41 ? 371  ALA B N     1 
ATOM   8873  C  CA    . ALA B 1 371 ? 58.887  48.145  22.127  1.00 23.44 ? 371  ALA B CA    1 
ATOM   8874  C  C     . ALA B 1 371 ? 60.073  49.048  21.780  1.00 23.12 ? 371  ALA B C     1 
ATOM   8875  O  O     . ALA B 1 371 ? 60.317  49.327  20.602  1.00 23.04 ? 371  ALA B O     1 
ATOM   8876  C  CB    . ALA B 1 371 ? 57.707  49.017  22.600  1.00 23.49 ? 371  ALA B CB    1 
ATOM   8877  N  N     . PHE B 1 372 ? 60.782  49.505  22.816  1.00 23.15 ? 372  PHE B N     1 
ATOM   8878  C  CA    . PHE B 1 372 ? 61.969  50.372  22.681  1.00 22.85 ? 372  PHE B CA    1 
ATOM   8879  C  C     . PHE B 1 372 ? 63.117  49.724  21.922  1.00 22.54 ? 372  PHE B C     1 
ATOM   8880  O  O     . PHE B 1 372 ? 63.870  50.402  21.216  1.00 22.57 ? 372  PHE B O     1 
ATOM   8881  C  CB    . PHE B 1 372 ? 62.500  50.772  24.063  1.00 22.57 ? 372  PHE B CB    1 
ATOM   8882  C  CG    . PHE B 1 372 ? 61.607  51.725  24.832  1.00 22.30 ? 372  PHE B CG    1 
ATOM   8883  C  CD1   . PHE B 1 372 ? 60.563  52.413  24.228  1.00 23.24 ? 372  PHE B CD1   1 
ATOM   8884  C  CD2   . PHE B 1 372 ? 61.828  51.933  26.177  1.00 20.84 ? 372  PHE B CD2   1 
ATOM   8885  C  CE1   . PHE B 1 372 ? 59.770  53.302  24.974  1.00 23.09 ? 372  PHE B CE1   1 
ATOM   8886  C  CE2   . PHE B 1 372 ? 61.041  52.789  26.913  1.00 20.68 ? 372  PHE B CE2   1 
ATOM   8887  C  CZ    . PHE B 1 372 ? 60.018  53.478  26.315  1.00 21.84 ? 372  PHE B CZ    1 
ATOM   8888  N  N     . GLN B 1 373 ? 63.258  48.414  22.107  1.00 22.22 ? 373  GLN B N     1 
ATOM   8889  C  CA    . GLN B 1 373 ? 64.334  47.628  21.511  1.00 21.56 ? 373  GLN B CA    1 
ATOM   8890  C  C     . GLN B 1 373 ? 64.111  47.455  20.008  1.00 21.48 ? 373  GLN B C     1 
ATOM   8891  O  O     . GLN B 1 373 ? 65.052  47.117  19.282  1.00 21.30 ? 373  GLN B O     1 
ATOM   8892  C  CB    . GLN B 1 373 ? 64.432  46.256  22.197  1.00 21.44 ? 373  GLN B CB    1 
ATOM   8893  C  CG    . GLN B 1 373 ? 65.113  46.295  23.559  1.00 21.13 ? 373  GLN B CG    1 
ATOM   8894  C  CD    . GLN B 1 373 ? 64.783  45.108  24.455  1.00 20.13 ? 373  GLN B CD    1 
ATOM   8895  O  OE1   . GLN B 1 373 ? 63.953  44.275  24.122  1.00 20.94 ? 373  GLN B OE1   1 
ATOM   8896  N  NE2   . GLN B 1 373 ? 65.440  45.040  25.602  1.00 20.58 ? 373  GLN B NE2   1 
ATOM   8897  N  N     . GLN B 1 374 ? 62.870  47.671  19.556  1.00 20.83 ? 374  GLN B N     1 
ATOM   8898  C  CA    . GLN B 1 374 ? 62.543  47.653  18.131  1.00 20.31 ? 374  GLN B CA    1 
ATOM   8899  C  C     . GLN B 1 374 ? 62.755  48.989  17.405  1.00 19.88 ? 374  GLN B C     1 
ATOM   8900  O  O     . GLN B 1 374 ? 62.830  48.995  16.182  1.00 19.57 ? 374  GLN B O     1 
ATOM   8901  C  CB    . GLN B 1 374 ? 61.091  47.244  17.894  1.00 20.29 ? 374  GLN B CB    1 
ATOM   8902  C  CG    . GLN B 1 374 ? 60.581  46.077  18.687  1.00 20.74 ? 374  GLN B CG    1 
ATOM   8903  C  CD    . GLN B 1 374 ? 61.460  44.853  18.621  1.00 20.78 ? 374  GLN B CD    1 
ATOM   8904  O  OE1   . GLN B 1 374 ? 62.020  44.511  17.578  1.00 19.13 ? 374  GLN B OE1   1 
ATOM   8905  N  NE2   . GLN B 1 374 ? 61.561  44.168  19.743  1.00 22.78 ? 374  GLN B NE2   1 
ATOM   8906  N  N     . LEU B 1 375 ? 62.830  50.109  18.128  1.00 19.64 ? 375  LEU B N     1 
ATOM   8907  C  CA    . LEU B 1 375 ? 62.908  51.446  17.489  1.00 19.32 ? 375  LEU B CA    1 
ATOM   8908  C  C     . LEU B 1 375 ? 64.144  51.707  16.619  1.00 18.75 ? 375  LEU B C     1 
ATOM   8909  O  O     . LEU B 1 375 ? 63.992  52.208  15.522  1.00 17.90 ? 375  LEU B O     1 
ATOM   8910  C  CB    . LEU B 1 375 ? 62.751  52.570  18.516  1.00 19.70 ? 375  LEU B CB    1 
ATOM   8911  C  CG    . LEU B 1 375 ? 61.444  52.572  19.309  1.00 20.40 ? 375  LEU B CG    1 
ATOM   8912  C  CD1   . LEU B 1 375 ? 61.312  53.867  20.056  1.00 21.17 ? 375  LEU B CD1   1 
ATOM   8913  C  CD2   . LEU B 1 375 ? 60.263  52.380  18.402  1.00 22.01 ? 375  LEU B CD2   1 
ATOM   8914  N  N     . PRO B 1 376 ? 65.355  51.375  17.084  1.00 18.96 ? 376  PRO B N     1 
ATOM   8915  C  CA    . PRO B 1 376 ? 66.548  51.428  16.216  1.00 18.94 ? 376  PRO B CA    1 
ATOM   8916  C  C     . PRO B 1 376 ? 66.459  50.600  14.913  1.00 19.12 ? 376  PRO B C     1 
ATOM   8917  O  O     . PRO B 1 376 ? 66.951  51.070  13.891  1.00 19.05 ? 376  PRO B O     1 
ATOM   8918  C  CB    . PRO B 1 376 ? 67.681  50.895  17.118  1.00 18.77 ? 376  PRO B CB    1 
ATOM   8919  C  CG    . PRO B 1 376 ? 67.196  50.994  18.504  1.00 18.40 ? 376  PRO B CG    1 
ATOM   8920  C  CD    . PRO B 1 376 ? 65.699  50.961  18.459  1.00 18.99 ? 376  PRO B CD    1 
ATOM   8921  N  N     . GLU B 1 377 ? 65.849  49.414  14.950  1.00 19.50 ? 377  GLU B N     1 
ATOM   8922  C  CA    . GLU B 1 377 ? 65.712  48.571  13.765  1.00 19.95 ? 377  GLU B CA    1 
ATOM   8923  C  C     . GLU B 1 377 ? 64.692  49.205  12.840  1.00 20.29 ? 377  GLU B C     1 
ATOM   8924  O  O     . GLU B 1 377 ? 64.967  49.424  11.667  1.00 20.67 ? 377  GLU B O     1 
ATOM   8925  C  CB    . GLU B 1 377 ? 65.259  47.162  14.155  1.00 20.35 ? 377  GLU B CB    1 
ATOM   8926  C  CG    . GLU B 1 377 ? 64.756  46.297  12.998  1.00 21.34 ? 377  GLU B CG    1 
ATOM   8927  C  CD    . GLU B 1 377 ? 65.854  45.525  12.306  1.00 24.01 ? 377  GLU B CD    1 
ATOM   8928  O  OE1   . GLU B 1 377 ? 66.936  45.350  12.915  1.00 26.96 ? 377  GLU B OE1   1 
ATOM   8929  O  OE2   . GLU B 1 377 ? 65.640  45.079  11.154  1.00 25.14 ? 377  GLU B OE2   1 
ATOM   8930  N  N     . LEU B 1 378 ? 63.499  49.474  13.372  1.00 20.35 ? 378  LEU B N     1 
ATOM   8931  C  CA    . LEU B 1 378 ? 62.505  50.325  12.702  1.00 20.34 ? 378  LEU B CA    1 
ATOM   8932  C  C     . LEU B 1 378 ? 63.095  51.590  12.055  1.00 20.37 ? 378  LEU B C     1 
ATOM   8933  O  O     . LEU B 1 378 ? 62.668  51.967  10.978  1.00 20.29 ? 378  LEU B O     1 
ATOM   8934  C  CB    . LEU B 1 378 ? 61.391  50.728  13.681  1.00 20.00 ? 378  LEU B CB    1 
ATOM   8935  C  CG    . LEU B 1 378 ? 60.406  49.615  13.991  1.00 19.39 ? 378  LEU B CG    1 
ATOM   8936  C  CD1   . LEU B 1 378 ? 59.325  50.063  14.928  1.00 19.85 ? 378  LEU B CD1   1 
ATOM   8937  C  CD2   . LEU B 1 378 ? 59.796  49.069  12.720  1.00 20.20 ? 378  LEU B CD2   1 
ATOM   8938  N  N     . ARG B 1 379 ? 64.076  52.217  12.702  1.00 20.27 ? 379  ARG B N     1 
ATOM   8939  C  CA    . ARG B 1 379 ? 64.667  53.462  12.207  1.00 20.52 ? 379  ARG B CA    1 
ATOM   8940  C  C     . ARG B 1 379 ? 65.584  53.207  11.021  1.00 20.25 ? 379  ARG B C     1 
ATOM   8941  O  O     . ARG B 1 379 ? 65.640  54.012  10.091  1.00 19.99 ? 379  ARG B O     1 
ATOM   8942  C  CB    . ARG B 1 379 ? 65.425  54.189  13.330  1.00 20.69 ? 379  ARG B CB    1 
ATOM   8943  C  CG    . ARG B 1 379 ? 64.501  54.944  14.282  1.00 22.40 ? 379  ARG B CG    1 
ATOM   8944  C  CD    . ARG B 1 379 ? 65.204  55.861  15.278  1.00 24.40 ? 379  ARG B CD    1 
ATOM   8945  N  NE    . ARG B 1 379 ? 65.288  57.222  14.740  1.00 25.13 ? 379  ARG B NE    1 
ATOM   8946  C  CZ    . ARG B 1 379 ? 66.399  57.816  14.334  1.00 25.72 ? 379  ARG B CZ    1 
ATOM   8947  N  NH1   . ARG B 1 379 ? 67.574  57.206  14.415  1.00 25.30 ? 379  ARG B NH1   1 
ATOM   8948  N  NH2   . ARG B 1 379 ? 66.336  59.051  13.844  1.00 27.74 ? 379  ARG B NH2   1 
ATOM   8949  N  N     . ALA B 1 380 ? 66.301  52.081  11.063  1.00 20.15 ? 380  ALA B N     1 
ATOM   8950  C  CA    . ALA B 1 380 ? 67.182  51.638  9.966   1.00 19.80 ? 380  ALA B CA    1 
ATOM   8951  C  C     . ALA B 1 380 ? 66.417  51.266  8.686   1.00 19.55 ? 380  ALA B C     1 
ATOM   8952  O  O     . ALA B 1 380 ? 66.733  51.742  7.613   1.00 19.54 ? 380  ALA B O     1 
ATOM   8953  C  CB    . ALA B 1 380 ? 68.022  50.460  10.424  1.00 19.78 ? 380  ALA B CB    1 
ATOM   8954  N  N     . GLN B 1 381 ? 65.413  50.410  8.813   1.00 19.72 ? 381  GLN B N     1 
ATOM   8955  C  CA    . GLN B 1 381 ? 64.525  50.066  7.708   1.00 19.81 ? 381  GLN B CA    1 
ATOM   8956  C  C     . GLN B 1 381 ? 63.845  51.273  7.051   1.00 20.01 ? 381  GLN B C     1 
ATOM   8957  O  O     . GLN B 1 381 ? 63.752  51.303  5.826   1.00 20.49 ? 381  GLN B O     1 
ATOM   8958  C  CB    . GLN B 1 381 ? 63.468  49.078  8.176   1.00 19.71 ? 381  GLN B CB    1 
ATOM   8959  C  CG    . GLN B 1 381 ? 64.045  47.740  8.560   1.00 20.47 ? 381  GLN B CG    1 
ATOM   8960  C  CD    . GLN B 1 381 ? 62.991  46.685  8.780   1.00 21.94 ? 381  GLN B CD    1 
ATOM   8961  O  OE1   . GLN B 1 381 ? 61.952  46.691  8.131   1.00 23.60 ? 381  GLN B OE1   1 
ATOM   8962  N  NE2   . GLN B 1 381 ? 63.261  45.764  9.690   1.00 23.24 ? 381  GLN B NE2   1 
ATOM   8963  N  N     . LEU B 1 382 ? 63.394  52.262  7.832   1.00 20.03 ? 382  LEU B N     1 
ATOM   8964  C  CA    . LEU B 1 382 ? 62.750  53.462  7.268   1.00 20.26 ? 382  LEU B CA    1 
ATOM   8965  C  C     . LEU B 1 382 ? 63.719  54.529  6.740   1.00 21.03 ? 382  LEU B C     1 
ATOM   8966  O  O     . LEU B 1 382 ? 63.311  55.451  6.046   1.00 20.95 ? 382  LEU B O     1 
ATOM   8967  C  CB    . LEU B 1 382 ? 61.842  54.123  8.292   1.00 20.15 ? 382  LEU B CB    1 
ATOM   8968  C  CG    . LEU B 1 382 ? 60.690  53.315  8.872   1.00 20.16 ? 382  LEU B CG    1 
ATOM   8969  C  CD1   . LEU B 1 382 ? 60.100  54.032  10.076  1.00 19.16 ? 382  LEU B CD1   1 
ATOM   8970  C  CD2   . LEU B 1 382 ? 59.631  53.038  7.822   1.00 21.11 ? 382  LEU B CD2   1 
ATOM   8971  N  N     . GLU B 1 383 ? 64.998  54.411  7.070   1.00 22.06 ? 383  GLU B N     1 
ATOM   8972  C  CA    . GLU B 1 383 ? 66.012  55.390  6.649   1.00 22.76 ? 383  GLU B CA    1 
ATOM   8973  C  C     . GLU B 1 383 ? 65.943  55.807  5.171   1.00 23.43 ? 383  GLU B C     1 
ATOM   8974  O  O     . GLU B 1 383 ? 66.143  56.978  4.847   1.00 23.66 ? 383  GLU B O     1 
ATOM   8975  C  CB    . GLU B 1 383 ? 67.424  54.846  6.948   1.00 22.89 ? 383  GLU B CB    1 
ATOM   8976  C  CG    . GLU B 1 383 ? 68.504  55.908  7.073   1.00 22.88 ? 383  GLU B CG    1 
ATOM   8977  C  CD    . GLU B 1 383 ? 69.892  55.359  6.826   1.00 22.95 ? 383  GLU B CD    1 
ATOM   8978  O  OE1   . GLU B 1 383 ? 70.600  55.075  7.808   1.00 23.18 ? 383  GLU B OE1   1 
ATOM   8979  O  OE2   . GLU B 1 383 ? 70.280  55.219  5.646   1.00 24.02 ? 383  GLU B OE2   1 
ATOM   8980  N  N     . THR B 1 384 ? 65.687  54.853  4.276   1.00 24.23 ? 384  THR B N     1 
ATOM   8981  C  CA    . THR B 1 384 ? 65.797  55.108  2.834   1.00 24.62 ? 384  THR B CA    1 
ATOM   8982  C  C     . THR B 1 384 ? 64.470  55.454  2.123   1.00 25.23 ? 384  THR B C     1 
ATOM   8983  O  O     . THR B 1 384 ? 64.487  55.897  0.967   1.00 25.65 ? 384  THR B O     1 
ATOM   8984  C  CB    . THR B 1 384 ? 66.486  53.919  2.128   1.00 24.71 ? 384  THR B CB    1 
ATOM   8985  O  OG1   . THR B 1 384 ? 65.702  52.731  2.279   1.00 24.49 ? 384  THR B OG1   1 
ATOM   8986  C  CG2   . THR B 1 384 ? 67.829  53.579  2.799   1.00 24.44 ? 384  THR B CG2   1 
ATOM   8987  N  N     . VAL B 1 385 ? 63.333  55.267  2.795   1.00 25.41 ? 385  VAL B N     1 
ATOM   8988  C  CA    . VAL B 1 385 ? 62.042  55.574  2.186   1.00 25.72 ? 385  VAL B CA    1 
ATOM   8989  C  C     . VAL B 1 385 ? 61.976  57.068  1.827   1.00 26.21 ? 385  VAL B C     1 
ATOM   8990  O  O     . VAL B 1 385 ? 62.035  57.922  2.715   1.00 26.45 ? 385  VAL B O     1 
ATOM   8991  C  CB    . VAL B 1 385 ? 60.879  55.201  3.111   1.00 25.71 ? 385  VAL B CB    1 
ATOM   8992  C  CG1   . VAL B 1 385 ? 59.559  55.473  2.433   1.00 25.96 ? 385  VAL B CG1   1 
ATOM   8993  C  CG2   . VAL B 1 385 ? 60.957  53.734  3.518   1.00 26.06 ? 385  VAL B CG2   1 
ATOM   8994  N  N     . ASP B 1 386 ? 61.868  57.367  0.528   1.00 26.65 ? 386  ASP B N     1 
ATOM   8995  C  CA    . ASP B 1 386 ? 61.882  58.750  0.023   1.00 27.16 ? 386  ASP B CA    1 
ATOM   8996  C  C     . ASP B 1 386 ? 60.476  59.300  -0.049  1.00 26.88 ? 386  ASP B C     1 
ATOM   8997  O  O     . ASP B 1 386 ? 59.975  59.604  -1.116  1.00 27.05 ? 386  ASP B O     1 
ATOM   8998  C  CB    . ASP B 1 386 ? 62.536  58.859  -1.375  1.00 27.41 ? 386  ASP B CB    1 
ATOM   8999  C  CG    . ASP B 1 386 ? 64.072  59.000  -1.317  1.00 28.72 ? 386  ASP B CG    1 
ATOM   9000  O  OD1   . ASP B 1 386 ? 64.674  58.948  -0.212  1.00 28.63 ? 386  ASP B OD1   1 
ATOM   9001  O  OD2   . ASP B 1 386 ? 64.764  59.149  -2.358  1.00 30.78 ? 386  ASP B OD2   1 
ATOM   9002  N  N     . SER B 1 387 ? 59.838  59.387  1.104   1.00 26.74 ? 387  SER B N     1 
ATOM   9003  C  CA    . SER B 1 387 ? 58.629  60.164  1.273   1.00 26.53 ? 387  SER B CA    1 
ATOM   9004  C  C     . SER B 1 387 ? 58.804  60.951  2.556   1.00 26.07 ? 387  SER B C     1 
ATOM   9005  O  O     . SER B 1 387 ? 59.250  60.404  3.559   1.00 26.36 ? 387  SER B O     1 
ATOM   9006  C  CB    . SER B 1 387 ? 57.413  59.248  1.374   1.00 26.73 ? 387  SER B CB    1 
ATOM   9007  O  OG    . SER B 1 387 ? 57.341  58.659  2.655   1.00 27.22 ? 387  SER B OG    1 
ATOM   9008  N  N     . ALA B 1 388 ? 58.455  62.229  2.525   1.00 25.52 ? 388  ALA B N     1 
ATOM   9009  C  CA    . ALA B 1 388 ? 58.597  63.093  3.690   1.00 24.99 ? 388  ALA B CA    1 
ATOM   9010  C  C     . ALA B 1 388 ? 57.723  62.674  4.899   1.00 24.58 ? 388  ALA B C     1 
ATOM   9011  O  O     . ALA B 1 388 ? 58.141  62.868  6.040   1.00 24.17 ? 388  ALA B O     1 
ATOM   9012  C  CB    . ALA B 1 388 ? 58.316  64.536  3.299   1.00 24.88 ? 388  ALA B CB    1 
ATOM   9013  N  N     . PRO B 1 389 ? 56.516  62.146  4.664   1.00 24.12 ? 389  PRO B N     1 
ATOM   9014  C  CA    . PRO B 1 389 ? 55.677  61.625  5.754   1.00 23.71 ? 389  PRO B CA    1 
ATOM   9015  C  C     . PRO B 1 389 ? 56.235  60.399  6.478   1.00 23.19 ? 389  PRO B C     1 
ATOM   9016  O  O     . PRO B 1 389 ? 56.126  60.356  7.695   1.00 23.30 ? 389  PRO B O     1 
ATOM   9017  C  CB    . PRO B 1 389 ? 54.368  61.264  5.048   1.00 23.82 ? 389  PRO B CB    1 
ATOM   9018  C  CG    . PRO B 1 389 ? 54.377  62.086  3.832   1.00 24.30 ? 389  PRO B CG    1 
ATOM   9019  C  CD    . PRO B 1 389 ? 55.811  62.071  3.370   1.00 24.09 ? 389  PRO B CD    1 
ATOM   9020  N  N     . VAL B 1 390 ? 56.800  59.427  5.768   1.00 22.70 ? 390  VAL B N     1 
ATOM   9021  C  CA    . VAL B 1 390 ? 57.427  58.271  6.428   1.00 22.32 ? 390  VAL B CA    1 
ATOM   9022  C  C     . VAL B 1 390 ? 58.601  58.720  7.278   1.00 21.79 ? 390  VAL B C     1 
ATOM   9023  O  O     . VAL B 1 390 ? 58.860  58.136  8.322   1.00 22.11 ? 390  VAL B O     1 
ATOM   9024  C  CB    . VAL B 1 390 ? 57.936  57.207  5.429   1.00 22.18 ? 390  VAL B CB    1 
ATOM   9025  C  CG1   . VAL B 1 390 ? 58.888  56.227  6.108   1.00 22.64 ? 390  VAL B CG1   1 
ATOM   9026  C  CG2   . VAL B 1 390 ? 56.778  56.450  4.847   1.00 22.31 ? 390  VAL B CG2   1 
ATOM   9027  N  N     . GLN B 1 391 ? 59.319  59.736  6.812   1.00 21.17 ? 391  GLN B N     1 
ATOM   9028  C  CA    . GLN B 1 391 ? 60.441  60.295  7.557   1.00 20.97 ? 391  GLN B CA    1 
ATOM   9029  C  C     . GLN B 1 391 ? 59.958  61.108  8.766   1.00 20.59 ? 391  GLN B C     1 
ATOM   9030  O  O     . GLN B 1 391 ? 60.685  61.269  9.727   1.00 21.01 ? 391  GLN B O     1 
ATOM   9031  C  CB    . GLN B 1 391 ? 61.335  61.171  6.657   1.00 20.99 ? 391  GLN B CB    1 
ATOM   9032  C  CG    . GLN B 1 391 ? 62.000  60.459  5.471   1.00 20.65 ? 391  GLN B CG    1 
ATOM   9033  C  CD    . GLN B 1 391 ? 62.878  59.303  5.891   1.00 19.90 ? 391  GLN B CD    1 
ATOM   9034  O  OE1   . GLN B 1 391 ? 63.851  59.491  6.610   1.00 20.02 ? 391  GLN B OE1   1 
ATOM   9035  N  NE2   . GLN B 1 391 ? 62.544  58.108  5.437   1.00 20.04 ? 391  GLN B NE2   1 
ATOM   9036  N  N     . ALA B 1 392 ? 58.734  61.611  8.721   1.00 20.29 ? 392  ALA B N     1 
ATOM   9037  C  CA    . ALA B 1 392 ? 58.174  62.348  9.848   1.00 19.81 ? 392  ALA B CA    1 
ATOM   9038  C  C     . ALA B 1 392 ? 57.712  61.361  10.907  1.00 19.30 ? 392  ALA B C     1 
ATOM   9039  O  O     . ALA B 1 392 ? 57.977  61.549  12.087  1.00 18.89 ? 392  ALA B O     1 
ATOM   9040  C  CB    . ALA B 1 392 ? 57.038  63.256  9.392   1.00 19.75 ? 392  ALA B CB    1 
ATOM   9041  N  N     . LEU B 1 393 ? 57.050  60.291  10.473  1.00 19.26 ? 393  LEU B N     1 
ATOM   9042  C  CA    . LEU B 1 393 ? 56.705  59.154  11.358  1.00 19.19 ? 393  LEU B CA    1 
ATOM   9043  C  C     . LEU B 1 393 ? 57.925  58.515  11.984  1.00 19.22 ? 393  LEU B C     1 
ATOM   9044  O  O     . LEU B 1 393 ? 57.836  57.922  13.038  1.00 18.89 ? 393  LEU B O     1 
ATOM   9045  C  CB    . LEU B 1 393 ? 55.951  58.058  10.589  1.00 18.83 ? 393  LEU B CB    1 
ATOM   9046  C  CG    . LEU B 1 393 ? 54.534  58.432  10.152  1.00 18.06 ? 393  LEU B CG    1 
ATOM   9047  C  CD1   . LEU B 1 393 ? 53.985  57.335  9.257   1.00 16.84 ? 393  LEU B CD1   1 
ATOM   9048  C  CD2   . LEU B 1 393 ? 53.610  58.724  11.353  1.00 15.77 ? 393  LEU B CD2   1 
ATOM   9049  N  N     . ARG B 1 394 ? 59.057  58.636  11.308  1.00 19.84 ? 394  ARG B N     1 
ATOM   9050  C  CA    . ARG B 1 394 ? 60.312  58.078  11.777  1.00 20.31 ? 394  ARG B CA    1 
ATOM   9051  C  C     . ARG B 1 394 ? 60.930  58.969  12.869  1.00 20.82 ? 394  ARG B C     1 
ATOM   9052  O  O     . ARG B 1 394 ? 61.434  58.460  13.865  1.00 21.38 ? 394  ARG B O     1 
ATOM   9053  C  CB    . ARG B 1 394 ? 61.239  57.838  10.578  1.00 19.99 ? 394  ARG B CB    1 
ATOM   9054  C  CG    . ARG B 1 394 ? 62.711  57.722  10.875  1.00 19.65 ? 394  ARG B CG    1 
ATOM   9055  C  CD    . ARG B 1 394 ? 63.569  57.466  9.637   1.00 18.07 ? 394  ARG B CD    1 
ATOM   9056  N  NE    . ARG B 1 394 ? 64.883  56.943  9.990   1.00 17.96 ? 394  ARG B NE    1 
ATOM   9057  C  CZ    . ARG B 1 394 ? 65.906  57.668  10.440  1.00 17.95 ? 394  ARG B CZ    1 
ATOM   9058  N  NH1   . ARG B 1 394 ? 65.812  58.982  10.596  1.00 18.33 ? 394  ARG B NH1   1 
ATOM   9059  N  NH2   . ARG B 1 394 ? 67.049  57.070  10.734  1.00 18.16 ? 394  ARG B NH2   1 
ATOM   9060  N  N     . GLU B 1 395 ? 60.864  60.288  12.715  1.00 21.41 ? 395  GLU B N     1 
ATOM   9061  C  CA    . GLU B 1 395 ? 61.343  61.188  13.768  1.00 21.94 ? 395  GLU B CA    1 
ATOM   9062  C  C     . GLU B 1 395 ? 60.400  61.112  14.988  1.00 21.87 ? 395  GLU B C     1 
ATOM   9063  O  O     . GLU B 1 395 ? 60.819  60.786  16.107  1.00 21.34 ? 395  GLU B O     1 
ATOM   9064  C  CB    . GLU B 1 395 ? 61.459  62.627  13.237  1.00 22.39 ? 395  GLU B CB    1 
ATOM   9065  C  CG    . GLU B 1 395 ? 62.280  63.574  14.124  1.00 24.93 ? 395  GLU B CG    1 
ATOM   9066  C  CD    . GLU B 1 395 ? 63.739  63.144  14.295  1.00 27.33 ? 395  GLU B CD    1 
ATOM   9067  O  OE1   . GLU B 1 395 ? 64.498  63.203  13.292  1.00 27.44 ? 395  GLU B OE1   1 
ATOM   9068  O  OE2   . GLU B 1 395 ? 64.125  62.750  15.433  1.00 28.62 ? 395  GLU B OE2   1 
ATOM   9069  N  N     . LYS B 1 396 ? 59.125  61.415  14.747  1.00 21.82 ? 396  LYS B N     1 
ATOM   9070  C  CA    . LYS B 1 396 ? 58.065  61.277  15.739  1.00 22.07 ? 396  LYS B CA    1 
ATOM   9071  C  C     . LYS B 1 396 ? 58.178  59.982  16.575  1.00 22.03 ? 396  LYS B C     1 
ATOM   9072  O  O     . LYS B 1 396 ? 58.029  60.025  17.800  1.00 22.51 ? 396  LYS B O     1 
ATOM   9073  C  CB    . LYS B 1 396 ? 56.712  61.323  15.027  1.00 22.22 ? 396  LYS B CB    1 
ATOM   9074  C  CG    . LYS B 1 396 ? 55.561  61.747  15.909  1.00 22.95 ? 396  LYS B CG    1 
ATOM   9075  C  CD    . LYS B 1 396 ? 54.205  61.636  15.196  1.00 22.99 ? 396  LYS B CD    1 
ATOM   9076  C  CE    . LYS B 1 396 ? 53.071  61.646  16.209  1.00 23.23 ? 396  LYS B CE    1 
ATOM   9077  N  NZ    . LYS B 1 396 ? 51.892  62.339  15.657  1.00 24.90 ? 396  LYS B NZ    1 
ATOM   9078  N  N     . MET B 1 397 ? 58.449  58.860  15.896  1.00 21.68 ? 397  MET B N     1 
ATOM   9079  C  CA    . MET B 1 397 ? 58.645  57.527  16.492  1.00 21.37 ? 397  MET B CA    1 
ATOM   9080  C  C     . MET B 1 397 ? 59.562  57.543  17.716  1.00 21.13 ? 397  MET B C     1 
ATOM   9081  O  O     . MET B 1 397 ? 59.219  57.042  18.773  1.00 20.67 ? 397  MET B O     1 
ATOM   9082  C  CB    . MET B 1 397 ? 59.244  56.566  15.440  1.00 21.55 ? 397  MET B CB    1 
ATOM   9083  C  CG    . MET B 1 397 ? 58.643  55.143  15.419  1.00 22.00 ? 397  MET B CG    1 
ATOM   9084  S  SD    . MET B 1 397 ? 59.731  53.847  14.699  1.00 21.12 ? 397  MET B SD    1 
ATOM   9085  C  CE    . MET B 1 397 ? 60.637  54.774  13.566  1.00 21.27 ? 397  MET B CE    1 
ATOM   9086  N  N     . GLY B 1 398 ? 60.747  58.102  17.546  1.00 21.58 ? 398  GLY B N     1 
ATOM   9087  C  CA    . GLY B 1 398 ? 61.671  58.289  18.639  1.00 22.00 ? 398  GLY B CA    1 
ATOM   9088  C  C     . GLY B 1 398 ? 62.535  57.070  18.789  1.00 22.54 ? 398  GLY B C     1 
ATOM   9089  O  O     . GLY B 1 398 ? 62.444  56.124  18.000  1.00 23.04 ? 398  GLY B O     1 
ATOM   9090  N  N     . GLU B 1 399 ? 63.384  57.105  19.809  1.00 22.89 ? 399  GLU B N     1 
ATOM   9091  C  CA    . GLU B 1 399 ? 64.331  56.034  20.082  1.00 23.04 ? 399  GLU B CA    1 
ATOM   9092  C  C     . GLU B 1 399 ? 64.371  55.738  21.580  1.00 23.08 ? 399  GLU B C     1 
ATOM   9093  O  O     . GLU B 1 399 ? 64.295  54.574  21.975  1.00 23.43 ? 399  GLU B O     1 
ATOM   9094  C  CB    . GLU B 1 399 ? 65.720  56.426  19.565  1.00 23.26 ? 399  GLU B CB    1 
ATOM   9095  C  CG    . GLU B 1 399 ? 66.497  55.299  18.886  1.00 24.34 ? 399  GLU B CG    1 
ATOM   9096  C  CD    . GLU B 1 399 ? 67.949  55.668  18.604  1.00 25.00 ? 399  GLU B CD    1 
ATOM   9097  O  OE1   . GLU B 1 399 ? 68.203  56.630  17.836  1.00 26.47 ? 399  GLU B OE1   1 
ATOM   9098  O  OE2   . GLU B 1 399 ? 68.838  54.998  19.157  1.00 24.34 ? 399  GLU B OE2   1 
ATOM   9099  N  N     . PHE B 1 400 ? 64.489  56.795  22.397  1.00 23.07 ? 400  PHE B N     1 
ATOM   9100  C  CA    . PHE B 1 400 ? 64.492  56.702  23.863  1.00 22.71 ? 400  PHE B CA    1 
ATOM   9101  C  C     . PHE B 1 400 ? 65.495  55.662  24.372  1.00 22.67 ? 400  PHE B C     1 
ATOM   9102  O  O     . PHE B 1 400 ? 65.138  54.777  25.163  1.00 22.64 ? 400  PHE B O     1 
ATOM   9103  C  CB    . PHE B 1 400 ? 63.094  56.350  24.394  1.00 22.72 ? 400  PHE B CB    1 
ATOM   9104  C  CG    . PHE B 1 400 ? 62.000  57.220  23.865  1.00 21.85 ? 400  PHE B CG    1 
ATOM   9105  C  CD1   . PHE B 1 400 ? 61.251  56.825  22.767  1.00 21.43 ? 400  PHE B CD1   1 
ATOM   9106  C  CD2   . PHE B 1 400 ? 61.701  58.430  24.482  1.00 21.28 ? 400  PHE B CD2   1 
ATOM   9107  C  CE1   . PHE B 1 400 ? 60.230  57.641  22.274  1.00 21.20 ? 400  PHE B CE1   1 
ATOM   9108  C  CE2   . PHE B 1 400 ? 60.683  59.242  24.002  1.00 20.30 ? 400  PHE B CE2   1 
ATOM   9109  C  CZ    . PHE B 1 400 ? 59.942  58.849  22.905  1.00 19.47 ? 400  PHE B CZ    1 
ATOM   9110  N  N     . ALA B 1 401 ? 66.743  55.779  23.925  1.00 22.36 ? 401  ALA B N     1 
ATOM   9111  C  CA    . ALA B 1 401 ? 67.770  54.780  24.230  1.00 22.30 ? 401  ALA B CA    1 
ATOM   9112  C  C     . ALA B 1 401 ? 68.054  54.645  25.715  1.00 22.31 ? 401  ALA B C     1 
ATOM   9113  O  O     . ALA B 1 401 ? 68.352  53.553  26.204  1.00 22.24 ? 401  ALA B O     1 
ATOM   9114  C  CB    . ALA B 1 401 ? 69.073  55.096  23.475  1.00 22.25 ? 401  ALA B CB    1 
ATOM   9115  N  N     . GLU B 1 402 ? 67.983  55.755  26.434  1.00 22.60 ? 402  GLU B N     1 
ATOM   9116  C  CA    . GLU B 1 402 ? 68.455  55.772  27.811  1.00 22.72 ? 402  GLU B CA    1 
ATOM   9117  C  C     . GLU B 1 402 ? 67.343  55.336  28.741  1.00 22.52 ? 402  GLU B C     1 
ATOM   9118  O  O     . GLU B 1 402 ? 67.604  54.925  29.867  1.00 22.55 ? 402  GLU B O     1 
ATOM   9119  C  CB    . GLU B 1 402 ? 69.081  57.141  28.177  1.00 22.77 ? 402  GLU B CB    1 
ATOM   9120  C  CG    . GLU B 1 402 ? 70.437  57.439  27.480  1.00 23.30 ? 402  GLU B CG    1 
ATOM   9121  C  CD    . GLU B 1 402 ? 71.498  56.295  27.543  1.00 24.59 ? 402  GLU B CD    1 
ATOM   9122  O  OE1   . GLU B 1 402 ? 71.878  55.873  28.680  1.00 25.01 ? 402  GLU B OE1   1 
ATOM   9123  O  OE2   . GLU B 1 402 ? 71.972  55.813  26.459  1.00 21.95 ? 402  GLU B OE2   1 
ATOM   9124  N  N     . LEU B 1 403 ? 66.111  55.387  28.247  1.00 22.58 ? 403  LEU B N     1 
ATOM   9125  C  CA    . LEU B 1 403 ? 64.991  54.710  28.900  1.00 22.96 ? 403  LEU B CA    1 
ATOM   9126  C  C     . LEU B 1 403 ? 64.976  53.191  28.617  1.00 22.89 ? 403  LEU B C     1 
ATOM   9127  O  O     . LEU B 1 403 ? 64.627  52.403  29.474  1.00 22.74 ? 403  LEU B O     1 
ATOM   9128  C  CB    . LEU B 1 403 ? 63.677  55.309  28.419  1.00 23.12 ? 403  LEU B CB    1 
ATOM   9129  C  CG    . LEU B 1 403 ? 63.393  56.775  28.743  1.00 24.06 ? 403  LEU B CG    1 
ATOM   9130  C  CD1   . LEU B 1 403 ? 61.886  56.994  28.547  1.00 24.68 ? 403  LEU B CD1   1 
ATOM   9131  C  CD2   . LEU B 1 403 ? 63.843  57.120  30.153  1.00 24.29 ? 403  LEU B CD2   1 
ATOM   9132  N  N     . ARG B 1 404 ? 65.318  52.804  27.392  1.00 22.88 ? 404  ARG B N     1 
ATOM   9133  C  CA    . ARG B 1 404 ? 65.523  51.409  27.035  1.00 22.92 ? 404  ARG B CA    1 
ATOM   9134  C  C     . ARG B 1 404 ? 66.544  50.811  27.982  1.00 22.79 ? 404  ARG B C     1 
ATOM   9135  O  O     . ARG B 1 404 ? 66.346  49.738  28.518  1.00 22.79 ? 404  ARG B O     1 
ATOM   9136  C  CB    . ARG B 1 404 ? 66.012  51.293  25.577  1.00 22.94 ? 404  ARG B CB    1 
ATOM   9137  C  CG    . ARG B 1 404 ? 66.727  49.984  25.223  1.00 23.95 ? 404  ARG B CG    1 
ATOM   9138  C  CD    . ARG B 1 404 ? 67.221  49.909  23.772  1.00 25.55 ? 404  ARG B CD    1 
ATOM   9139  N  NE    . ARG B 1 404 ? 68.643  50.273  23.650  1.00 27.05 ? 404  ARG B NE    1 
ATOM   9140  C  CZ    . ARG B 1 404 ? 69.179  51.095  22.726  1.00 28.12 ? 404  ARG B CZ    1 
ATOM   9141  N  NH1   . ARG B 1 404 ? 68.438  51.697  21.783  1.00 27.04 ? 404  ARG B NH1   1 
ATOM   9142  N  NH2   . ARG B 1 404 ? 70.495  51.315  22.751  1.00 29.10 ? 404  ARG B NH2   1 
ATOM   9143  N  N     . ASP B 1 405 ? 67.636  51.530  28.192  1.00 22.84 ? 405  ASP B N     1 
ATOM   9144  C  CA    . ASP B 1 405 ? 68.750  51.026  28.982  1.00 22.79 ? 405  ASP B CA    1 
ATOM   9145  C  C     . ASP B 1 405 ? 68.392  51.001  30.453  1.00 22.30 ? 405  ASP B C     1 
ATOM   9146  O  O     . ASP B 1 405 ? 68.796  50.097  31.167  1.00 22.22 ? 405  ASP B O     1 
ATOM   9147  C  CB    . ASP B 1 405 ? 69.989  51.887  28.764  1.00 22.91 ? 405  ASP B CB    1 
ATOM   9148  C  CG    . ASP B 1 405 ? 71.151  51.412  29.566  1.00 23.82 ? 405  ASP B CG    1 
ATOM   9149  O  OD1   . ASP B 1 405 ? 71.683  50.325  29.245  1.00 24.79 ? 405  ASP B OD1   1 
ATOM   9150  O  OD2   . ASP B 1 405 ? 71.583  52.048  30.552  1.00 25.31 ? 405  ASP B OD2   1 
ATOM   9151  N  N     . LEU B 1 406 ? 67.610  51.984  30.888  1.00 21.72 ? 406  LEU B N     1 
ATOM   9152  C  CA    . LEU B 1 406 ? 67.164  52.053  32.269  1.00 21.50 ? 406  LEU B CA    1 
ATOM   9153  C  C     . LEU B 1 406 ? 66.358  50.828  32.685  1.00 21.18 ? 406  LEU B C     1 
ATOM   9154  O  O     . LEU B 1 406 ? 66.573  50.314  33.777  1.00 21.63 ? 406  LEU B O     1 
ATOM   9155  C  CB    . LEU B 1 406 ? 66.340  53.320  32.509  1.00 21.69 ? 406  LEU B CB    1 
ATOM   9156  C  CG    . LEU B 1 406 ? 65.551  53.394  33.828  1.00 22.12 ? 406  LEU B CG    1 
ATOM   9157  C  CD1   . LEU B 1 406 ? 66.471  53.797  34.991  1.00 21.93 ? 406  LEU B CD1   1 
ATOM   9158  C  CD2   . LEU B 1 406 ? 64.352  54.345  33.687  1.00 21.97 ? 406  LEU B CD2   1 
ATOM   9159  N  N     . LEU B 1 407 ? 65.438  50.377  31.834  1.00 20.49 ? 407  LEU B N     1 
ATOM   9160  C  CA    . LEU B 1 407 ? 64.613  49.188  32.108  1.00 20.34 ? 407  LEU B CA    1 
ATOM   9161  C  C     . LEU B 1 407 ? 65.285  47.846  31.774  1.00 20.12 ? 407  LEU B C     1 
ATOM   9162  O  O     . LEU B 1 407 ? 64.824  46.795  32.224  1.00 19.07 ? 407  LEU B O     1 
ATOM   9163  C  CB    . LEU B 1 407 ? 63.294  49.261  31.340  1.00 20.36 ? 407  LEU B CB    1 
ATOM   9164  C  CG    . LEU B 1 407 ? 62.473  50.545  31.429  1.00 20.45 ? 407  LEU B CG    1 
ATOM   9165  C  CD1   . LEU B 1 407 ? 61.272  50.436  30.498  1.00 20.88 ? 407  LEU B CD1   1 
ATOM   9166  C  CD2   . LEU B 1 407 ? 62.046  50.793  32.848  1.00 20.85 ? 407  LEU B CD2   1 
ATOM   9167  N  N     . GLU B 1 408 ? 66.348  47.891  30.968  1.00 20.30 ? 408  GLU B N     1 
ATOM   9168  C  CA    . GLU B 1 408 ? 67.174  46.708  30.676  1.00 20.58 ? 408  GLU B CA    1 
ATOM   9169  C  C     . GLU B 1 408 ? 67.895  46.295  31.964  1.00 20.20 ? 408  GLU B C     1 
ATOM   9170  O  O     . GLU B 1 408 ? 67.983  45.108  32.293  1.00 19.74 ? 408  GLU B O     1 
ATOM   9171  C  CB    . GLU B 1 408 ? 68.192  46.993  29.545  1.00 20.82 ? 408  GLU B CB    1 
ATOM   9172  C  CG    . GLU B 1 408 ? 67.606  46.855  28.130  1.00 21.79 ? 408  GLU B CG    1 
ATOM   9173  C  CD    . GLU B 1 408 ? 68.553  47.244  26.984  1.00 22.20 ? 408  GLU B CD    1 
ATOM   9174  O  OE1   . GLU B 1 408 ? 69.647  47.812  27.213  1.00 20.68 ? 408  GLU B OE1   1 
ATOM   9175  O  OE2   . GLU B 1 408 ? 68.184  46.975  25.820  1.00 23.15 ? 408  GLU B OE2   1 
ATOM   9176  N  N     . ARG B 1 409 ? 68.350  47.315  32.696  1.00 19.95 ? 409  ARG B N     1 
ATOM   9177  C  CA    . ARG B 1 409 ? 69.054  47.175  33.968  1.00 19.57 ? 409  ARG B CA    1 
ATOM   9178  C  C     . ARG B 1 409 ? 68.147  47.159  35.186  1.00 18.93 ? 409  ARG B C     1 
ATOM   9179  O  O     . ARG B 1 409 ? 68.584  46.753  36.246  1.00 18.86 ? 409  ARG B O     1 
ATOM   9180  C  CB    . ARG B 1 409 ? 70.008  48.345  34.165  1.00 19.66 ? 409  ARG B CB    1 
ATOM   9181  C  CG    . ARG B 1 409 ? 71.038  48.527  33.088  1.00 20.62 ? 409  ARG B CG    1 
ATOM   9182  C  CD    . ARG B 1 409 ? 71.930  49.713  33.351  1.00 21.87 ? 409  ARG B CD    1 
ATOM   9183  N  NE    . ARG B 1 409 ? 71.176  50.974  33.380  1.00 23.63 ? 409  ARG B NE    1 
ATOM   9184  C  CZ    . ARG B 1 409 ? 71.189  51.877  34.370  1.00 24.71 ? 409  ARG B CZ    1 
ATOM   9185  N  NH1   . ARG B 1 409 ? 71.907  51.683  35.475  1.00 25.49 ? 409  ARG B NH1   1 
ATOM   9186  N  NH2   . ARG B 1 409 ? 70.466  52.995  34.249  1.00 24.16 ? 409  ARG B NH2   1 
ATOM   9187  N  N     . ALA B 1 410 ? 66.909  47.618  35.056  1.00 18.51 ? 410  ALA B N     1 
ATOM   9188  C  CA    . ALA B 1 410 ? 66.021  47.728  36.214  1.00 18.48 ? 410  ALA B CA    1 
ATOM   9189  C  C     . ALA B 1 410 ? 65.219  46.472  36.501  1.00 18.51 ? 410  ALA B C     1 
ATOM   9190  O  O     . ALA B 1 410 ? 65.017  46.123  37.658  1.00 18.38 ? 410  ALA B O     1 
ATOM   9191  C  CB    . ALA B 1 410 ? 65.064  48.904  36.047  1.00 18.51 ? 410  ALA B CB    1 
ATOM   9192  N  N     . ILE B 1 411 ? 64.748  45.828  35.436  1.00 18.69 ? 411  ILE B N     1 
ATOM   9193  C  CA    . ILE B 1 411 ? 63.746  44.776  35.489  1.00 18.72 ? 411  ILE B CA    1 
ATOM   9194  C  C     . ILE B 1 411 ? 64.325  43.491  34.867  1.00 18.94 ? 411  ILE B C     1 
ATOM   9195  O  O     . ILE B 1 411 ? 65.187  43.565  33.995  1.00 18.91 ? 411  ILE B O     1 
ATOM   9196  C  CB    . ILE B 1 411 ? 62.506  45.312  34.731  1.00 18.54 ? 411  ILE B CB    1 
ATOM   9197  C  CG1   . ILE B 1 411 ? 62.185  46.713  35.265  1.00 19.78 ? 411  ILE B CG1   1 
ATOM   9198  C  CG2   . ILE B 1 411 ? 61.311  44.417  34.891  1.00 18.59 ? 411  ILE B CG2   1 
ATOM   9199  C  CD1   . ILE B 1 411 ? 60.774  47.224  35.040  1.00 20.38 ? 411  ILE B CD1   1 
ATOM   9200  N  N     . ILE B 1 412 ? 63.864  42.322  35.310  1.00 19.28 ? 412  ILE B N     1 
ATOM   9201  C  CA    . ILE B 1 412 ? 64.387  41.046  34.809  1.00 19.81 ? 412  ILE B CA    1 
ATOM   9202  C  C     . ILE B 1 412 ? 63.743  40.670  33.462  1.00 20.35 ? 412  ILE B C     1 
ATOM   9203  O  O     . ILE B 1 412 ? 62.790  41.329  33.025  1.00 20.63 ? 412  ILE B O     1 
ATOM   9204  C  CB    . ILE B 1 412 ? 64.184  39.907  35.843  1.00 19.98 ? 412  ILE B CB    1 
ATOM   9205  C  CG1   . ILE B 1 412 ? 62.692  39.592  36.052  1.00 20.74 ? 412  ILE B CG1   1 
ATOM   9206  C  CG2   . ILE B 1 412 ? 64.888  40.236  37.176  1.00 19.75 ? 412  ILE B CG2   1 
ATOM   9207  C  CD1   . ILE B 1 412 ? 62.387  38.103  36.192  1.00 21.11 ? 412  ILE B CD1   1 
ATOM   9208  N  N     . ASP B 1 413 ? 64.240  39.609  32.819  1.00 20.31 ? 413  ASP B N     1 
ATOM   9209  C  CA    . ASP B 1 413 ? 63.767  39.235  31.485  1.00 20.76 ? 413  ASP B CA    1 
ATOM   9210  C  C     . ASP B 1 413 ? 62.274  38.824  31.469  1.00 20.81 ? 413  ASP B C     1 
ATOM   9211  O  O     . ASP B 1 413 ? 61.562  39.142  30.530  1.00 21.24 ? 413  ASP B O     1 
ATOM   9212  C  CB    . ASP B 1 413 ? 64.617  38.101  30.859  1.00 21.09 ? 413  ASP B CB    1 
ATOM   9213  C  CG    . ASP B 1 413 ? 66.066  38.520  30.534  1.00 21.91 ? 413  ASP B CG    1 
ATOM   9214  O  OD1   . ASP B 1 413 ? 66.660  39.312  31.295  1.00 24.05 ? 413  ASP B OD1   1 
ATOM   9215  O  OD2   . ASP B 1 413 ? 66.707  38.073  29.550  1.00 22.23 ? 413  ASP B OD2   1 
ATOM   9216  N  N     . THR B 1 414 ? 61.790  38.101  32.475  1.00 20.87 ? 414  THR B N     1 
ATOM   9217  C  CA    . THR B 1 414 ? 60.371  37.690  32.485  1.00 20.56 ? 414  THR B CA    1 
ATOM   9218  C  C     . THR B 1 414 ? 59.741  37.887  33.868  1.00 20.34 ? 414  THR B C     1 
ATOM   9219  O  O     . THR B 1 414 ? 59.498  36.901  34.584  1.00 19.97 ? 414  THR B O     1 
ATOM   9220  C  CB    . THR B 1 414 ? 60.192  36.206  32.012  1.00 20.71 ? 414  THR B CB    1 
ATOM   9221  O  OG1   . THR B 1 414 ? 61.143  35.867  30.987  1.00 19.87 ? 414  THR B OG1   1 
ATOM   9222  C  CG2   . THR B 1 414 ? 58.826  36.015  31.328  1.00 20.75 ? 414  THR B CG2   1 
ATOM   9223  N  N     . PRO B 1 415 ? 59.434  39.150  34.215  1.00 19.98 ? 415  PRO B N     1 
ATOM   9224  C  CA    . PRO B 1 415 ? 58.992  39.513  35.576  1.00 19.75 ? 415  PRO B CA    1 
ATOM   9225  C  C     . PRO B 1 415 ? 57.575  39.039  35.835  1.00 19.49 ? 415  PRO B C     1 
ATOM   9226  O  O     . PRO B 1 415 ? 56.864  38.837  34.862  1.00 19.25 ? 415  PRO B O     1 
ATOM   9227  C  CB    . PRO B 1 415 ? 59.042  41.060  35.583  1.00 19.72 ? 415  PRO B CB    1 
ATOM   9228  C  CG    . PRO B 1 415 ? 58.814  41.456  34.155  1.00 19.83 ? 415  PRO B CG    1 
ATOM   9229  C  CD    . PRO B 1 415 ? 59.415  40.318  33.309  1.00 19.96 ? 415  PRO B CD    1 
ATOM   9230  N  N     . PRO B 1 416 ? 57.164  38.875  37.087  1.00 19.61 ? 416  PRO B N     1 
ATOM   9231  C  CA    . PRO B 1 416 ? 55.805  38.425  37.380  1.00 20.34 ? 416  PRO B CA    1 
ATOM   9232  C  C     . PRO B 1 416 ? 54.763  39.507  37.117  1.00 21.07 ? 416  PRO B C     1 
ATOM   9233  O  O     . PRO B 1 416 ? 55.105  40.699  37.005  1.00 21.76 ? 416  PRO B O     1 
ATOM   9234  C  CB    . PRO B 1 416 ? 55.856  38.081  38.872  1.00 20.17 ? 416  PRO B CB    1 
ATOM   9235  C  CG    . PRO B 1 416 ? 57.278  38.083  39.222  1.00 20.07 ? 416  PRO B CG    1 
ATOM   9236  C  CD    . PRO B 1 416 ? 57.934  39.086  38.323  1.00 19.68 ? 416  PRO B CD    1 
ATOM   9237  N  N     . VAL B 1 417 ? 53.506  39.080  37.036  1.00 21.68 ? 417  VAL B N     1 
ATOM   9238  C  CA    . VAL B 1 417 ? 52.385  39.968  36.754  1.00 22.43 ? 417  VAL B CA    1 
ATOM   9239  C  C     . VAL B 1 417 ? 52.373  41.183  37.716  1.00 23.39 ? 417  VAL B C     1 
ATOM   9240  O  O     . VAL B 1 417 ? 52.234  42.340  37.273  1.00 23.02 ? 417  VAL B O     1 
ATOM   9241  C  CB    . VAL B 1 417 ? 51.032  39.195  36.827  1.00 22.63 ? 417  VAL B CB    1 
ATOM   9242  C  CG1   . VAL B 1 417 ? 49.841  40.142  36.679  1.00 22.88 ? 417  VAL B CG1   1 
ATOM   9243  C  CG2   . VAL B 1 417 ? 50.963  38.084  35.757  1.00 22.34 ? 417  VAL B CG2   1 
ATOM   9244  N  N     . LEU B 1 418 ? 52.554  40.911  39.012  1.00 24.23 ? 418  LEU B N     1 
ATOM   9245  C  CA    . LEU B 1 418 ? 52.495  41.934  40.056  1.00 24.81 ? 418  LEU B CA    1 
ATOM   9246  C  C     . LEU B 1 418 ? 53.873  42.240  40.657  1.00 25.69 ? 418  LEU B C     1 
ATOM   9247  O  O     . LEU B 1 418 ? 54.738  41.363  40.701  1.00 25.77 ? 418  LEU B O     1 
ATOM   9248  C  CB    . LEU B 1 418 ? 51.541  41.470  41.165  1.00 24.81 ? 418  LEU B CB    1 
ATOM   9249  C  CG    . LEU B 1 418 ? 50.244  40.771  40.730  1.00 24.28 ? 418  LEU B CG    1 
ATOM   9250  C  CD1   . LEU B 1 418 ? 49.587  40.038  41.892  1.00 23.56 ? 418  LEU B CD1   1 
ATOM   9251  C  CD2   . LEU B 1 418 ? 49.282  41.772  40.125  1.00 24.40 ? 418  LEU B CD2   1 
ATOM   9252  N  N     . VAL B 1 419 ? 54.076  43.485  41.101  1.00 26.62 ? 419  VAL B N     1 
ATOM   9253  C  CA    . VAL B 1 419 ? 55.203  43.826  41.987  1.00 27.38 ? 419  VAL B CA    1 
ATOM   9254  C  C     . VAL B 1 419 ? 55.077  43.185  43.368  1.00 27.78 ? 419  VAL B C     1 
ATOM   9255  O  O     . VAL B 1 419 ? 56.075  43.005  44.050  1.00 28.15 ? 419  VAL B O     1 
ATOM   9256  C  CB    . VAL B 1 419 ? 55.322  45.361  42.290  1.00 27.87 ? 419  VAL B CB    1 
ATOM   9257  C  CG1   . VAL B 1 419 ? 56.165  46.078  41.252  1.00 28.25 ? 419  VAL B CG1   1 
ATOM   9258  C  CG2   . VAL B 1 419 ? 53.935  46.038  42.469  1.00 27.96 ? 419  VAL B CG2   1 
ATOM   9259  N  N     . ARG B 1 420 ? 53.846  42.877  43.777  1.00 28.16 ? 420  ARG B N     1 
ATOM   9260  C  CA    . ARG B 1 420 ? 53.492  42.518  45.158  1.00 28.33 ? 420  ARG B CA    1 
ATOM   9261  C  C     . ARG B 1 420 ? 54.488  41.670  45.929  1.00 28.18 ? 420  ARG B C     1 
ATOM   9262  O  O     . ARG B 1 420 ? 54.646  41.850  47.134  1.00 28.35 ? 420  ARG B O     1 
ATOM   9263  C  CB    . ARG B 1 420 ? 52.153  41.777  45.166  1.00 28.69 ? 420  ARG B CB    1 
ATOM   9264  C  CG    . ARG B 1 420 ? 51.403  41.848  46.479  1.00 29.87 ? 420  ARG B CG    1 
ATOM   9265  C  CD    . ARG B 1 420 ? 50.211  40.936  46.519  1.00 31.48 ? 420  ARG B CD    1 
ATOM   9266  N  NE    . ARG B 1 420 ? 50.595  39.591  46.946  1.00 33.48 ? 420  ARG B NE    1 
ATOM   9267  C  CZ    . ARG B 1 420 ? 49.966  38.470  46.597  1.00 34.38 ? 420  ARG B CZ    1 
ATOM   9268  N  NH1   . ARG B 1 420 ? 48.901  38.493  45.793  1.00 34.12 ? 420  ARG B NH1   1 
ATOM   9269  N  NH2   . ARG B 1 420 ? 50.413  37.310  47.054  1.00 34.47 ? 420  ARG B NH2   1 
ATOM   9270  N  N     . ASP B 1 421 ? 55.125  40.725  45.247  1.00 28.07 ? 421  ASP B N     1 
ATOM   9271  C  CA    . ASP B 1 421 ? 55.982  39.744  45.909  1.00 27.96 ? 421  ASP B CA    1 
ATOM   9272  C  C     . ASP B 1 421 ? 57.444  39.838  45.477  1.00 27.36 ? 421  ASP B C     1 
ATOM   9273  O  O     . ASP B 1 421 ? 58.280  39.080  45.976  1.00 27.47 ? 421  ASP B O     1 
ATOM   9274  C  CB    . ASP B 1 421 ? 55.456  38.320  45.668  1.00 28.14 ? 421  ASP B CB    1 
ATOM   9275  C  CG    . ASP B 1 421 ? 53.998  38.297  45.257  1.00 28.99 ? 421  ASP B CG    1 
ATOM   9276  O  OD1   . ASP B 1 421 ? 53.137  38.132  46.149  1.00 29.72 ? 421  ASP B OD1   1 
ATOM   9277  O  OD2   . ASP B 1 421 ? 53.624  38.449  44.066  1.00 30.38 ? 421  ASP B OD2   1 
ATOM   9278  N  N     . GLY B 1 422 ? 57.754  40.754  44.561  1.00 26.56 ? 422  GLY B N     1 
ATOM   9279  C  CA    . GLY B 1 422 ? 59.128  40.996  44.153  1.00 26.00 ? 422  GLY B CA    1 
ATOM   9280  C  C     . GLY B 1 422 ? 59.597  39.970  43.144  1.00 25.43 ? 422  GLY B C     1 
ATOM   9281  O  O     . GLY B 1 422 ? 58.777  39.337  42.474  1.00 25.15 ? 422  GLY B O     1 
ATOM   9282  N  N     . GLY B 1 423 ? 60.911  39.780  43.058  1.00 24.91 ? 423  GLY B N     1 
ATOM   9283  C  CA    . GLY B 1 423 ? 61.511  39.039  41.957  1.00 24.40 ? 423  GLY B CA    1 
ATOM   9284  C  C     . GLY B 1 423 ? 61.254  39.729  40.623  1.00 23.95 ? 423  GLY B C     1 
ATOM   9285  O  O     . GLY B 1 423 ? 61.014  39.060  39.612  1.00 23.37 ? 423  GLY B O     1 
ATOM   9286  N  N     . VAL B 1 424 ? 61.272  41.069  40.637  1.00 23.49 ? 424  VAL B N     1 
ATOM   9287  C  CA    . VAL B 1 424 ? 61.090  41.880  39.425  1.00 23.15 ? 424  VAL B CA    1 
ATOM   9288  C  C     . VAL B 1 424 ? 62.347  42.701  39.099  1.00 23.44 ? 424  VAL B C     1 
ATOM   9289  O  O     . VAL B 1 424 ? 62.735  42.795  37.931  1.00 23.34 ? 424  VAL B O     1 
ATOM   9290  C  CB    . VAL B 1 424 ? 59.797  42.781  39.463  1.00 22.86 ? 424  VAL B CB    1 
ATOM   9291  C  CG1   . VAL B 1 424 ? 58.897  42.440  40.626  1.00 21.72 ? 424  VAL B CG1   1 
ATOM   9292  C  CG2   . VAL B 1 424 ? 60.127  44.279  39.454  1.00 22.83 ? 424  VAL B CG2   1 
ATOM   9293  N  N     . ILE B 1 425 ? 62.979  43.287  40.119  1.00 23.52 ? 425  ILE B N     1 
ATOM   9294  C  CA    . ILE B 1 425 ? 64.146  44.147  39.910  1.00 23.45 ? 425  ILE B CA    1 
ATOM   9295  C  C     . ILE B 1 425 ? 65.390  43.310  39.668  1.00 23.42 ? 425  ILE B C     1 
ATOM   9296  O  O     . ILE B 1 425 ? 65.631  42.330  40.360  1.00 23.99 ? 425  ILE B O     1 
ATOM   9297  C  CB    . ILE B 1 425 ? 64.376  45.109  41.110  1.00 23.26 ? 425  ILE B CB    1 
ATOM   9298  C  CG1   . ILE B 1 425 ? 63.218  46.097  41.256  1.00 22.70 ? 425  ILE B CG1   1 
ATOM   9299  C  CG2   . ILE B 1 425 ? 65.706  45.858  40.957  1.00 23.32 ? 425  ILE B CG2   1 
ATOM   9300  C  CD1   . ILE B 1 425 ? 62.960  46.935  40.028  1.00 22.71 ? 425  ILE B CD1   1 
ATOM   9301  N  N     . ALA B 1 426 ? 66.206  43.746  38.722  1.00 23.16 ? 426  ALA B N     1 
ATOM   9302  C  CA    . ALA B 1 426 ? 67.274  42.930  38.186  1.00 23.10 ? 426  ALA B CA    1 
ATOM   9303  C  C     . ALA B 1 426 ? 68.475  42.782  39.124  1.00 22.99 ? 426  ALA B C     1 
ATOM   9304  O  O     . ALA B 1 426 ? 68.725  43.628  39.974  1.00 22.69 ? 426  ALA B O     1 
ATOM   9305  C  CB    . ALA B 1 426 ? 67.710  43.499  36.830  1.00 23.09 ? 426  ALA B CB    1 
ATOM   9306  N  N     . SER B 1 427 ? 69.196  41.676  38.948  1.00 23.13 ? 427  SER B N     1 
ATOM   9307  C  CA    . SER B 1 427 ? 70.481  41.432  39.606  1.00 23.20 ? 427  SER B CA    1 
ATOM   9308  C  C     . SER B 1 427 ? 71.436  42.558  39.233  1.00 22.93 ? 427  SER B C     1 
ATOM   9309  O  O     . SER B 1 427 ? 71.756  42.723  38.062  1.00 23.38 ? 427  SER B O     1 
ATOM   9310  C  CB    . SER B 1 427 ? 71.076  40.088  39.107  1.00 23.40 ? 427  SER B CB    1 
ATOM   9311  O  OG    . SER B 1 427 ? 71.245  39.131  40.143  1.00 23.98 ? 427  SER B OG    1 
ATOM   9312  N  N     . GLY B 1 428 ? 71.894  43.338  40.196  1.00 22.56 ? 428  GLY B N     1 
ATOM   9313  C  CA    . GLY B 1 428 ? 72.968  44.286  39.923  1.00 22.10 ? 428  GLY B CA    1 
ATOM   9314  C  C     . GLY B 1 428 ? 72.550  45.688  39.493  1.00 21.63 ? 428  GLY B C     1 
ATOM   9315  O  O     . GLY B 1 428 ? 73.375  46.452  38.981  1.00 21.80 ? 428  GLY B O     1 
ATOM   9316  N  N     . TYR B 1 429 ? 71.285  46.027  39.708  1.00 20.89 ? 429  TYR B N     1 
ATOM   9317  C  CA    . TYR B 1 429 ? 70.765  47.377  39.454  1.00 20.47 ? 429  TYR B CA    1 
ATOM   9318  C  C     . TYR B 1 429 ? 71.020  48.336  40.629  1.00 20.52 ? 429  TYR B C     1 
ATOM   9319  O  O     . TYR B 1 429 ? 71.294  49.519  40.424  1.00 20.35 ? 429  TYR B O     1 
ATOM   9320  C  CB    . TYR B 1 429 ? 69.258  47.297  39.149  1.00 20.14 ? 429  TYR B CB    1 
ATOM   9321  C  CG    . TYR B 1 429 ? 68.536  48.631  38.989  1.00 18.32 ? 429  TYR B CG    1 
ATOM   9322  C  CD1   . TYR B 1 429 ? 68.833  49.507  37.946  1.00 15.21 ? 429  TYR B CD1   1 
ATOM   9323  C  CD2   . TYR B 1 429 ? 67.517  48.993  39.875  1.00 17.62 ? 429  TYR B CD2   1 
ATOM   9324  C  CE1   . TYR B 1 429 ? 68.146  50.710  37.807  1.00 14.43 ? 429  TYR B CE1   1 
ATOM   9325  C  CE2   . TYR B 1 429 ? 66.842  50.194  39.747  1.00 16.54 ? 429  TYR B CE2   1 
ATOM   9326  C  CZ    . TYR B 1 429 ? 67.160  51.050  38.722  1.00 14.93 ? 429  TYR B CZ    1 
ATOM   9327  O  OH    . TYR B 1 429 ? 66.466  52.233  38.643  1.00 12.78 ? 429  TYR B OH    1 
ATOM   9328  N  N     . ASN B 1 430 ? 70.920  47.807  41.848  1.00 20.79 ? 430  ASN B N     1 
ATOM   9329  C  CA    . ASN B 1 430 ? 71.047  48.581  43.093  1.00 20.82 ? 430  ASN B CA    1 
ATOM   9330  C  C     . ASN B 1 430 ? 71.921  47.851  44.126  1.00 20.97 ? 430  ASN B C     1 
ATOM   9331  O  O     . ASN B 1 430 ? 71.732  46.652  44.382  1.00 20.75 ? 430  ASN B O     1 
ATOM   9332  C  CB    . ASN B 1 430 ? 69.650  48.821  43.666  1.00 20.76 ? 430  ASN B CB    1 
ATOM   9333  C  CG    . ASN B 1 430 ? 69.674  49.446  45.032  1.00 20.33 ? 430  ASN B CG    1 
ATOM   9334  O  OD1   . ASN B 1 430 ? 69.934  48.767  46.023  1.00 20.44 ? 430  ASN B OD1   1 
ATOM   9335  N  ND2   . ASN B 1 430 ? 69.379  50.743  45.101  1.00 19.10 ? 430  ASN B ND2   1 
ATOM   9336  N  N     . GLU B 1 431 ? 72.867  48.575  44.727  1.00 21.28 ? 431  GLU B N     1 
ATOM   9337  C  CA    . GLU B 1 431 ? 73.798  47.957  45.674  1.00 21.39 ? 431  GLU B CA    1 
ATOM   9338  C  C     . GLU B 1 431 ? 73.064  47.306  46.853  1.00 21.27 ? 431  GLU B C     1 
ATOM   9339  O  O     . GLU B 1 431 ? 73.208  46.107  47.069  1.00 21.04 ? 431  GLU B O     1 
ATOM   9340  C  CB    . GLU B 1 431 ? 74.842  48.962  46.172  1.00 21.55 ? 431  GLU B CB    1 
ATOM   9341  C  CG    . GLU B 1 431 ? 75.700  48.424  47.321  1.00 22.74 ? 431  GLU B CG    1 
ATOM   9342  C  CD    . GLU B 1 431 ? 77.044  49.121  47.505  1.00 24.05 ? 431  GLU B CD    1 
ATOM   9343  O  OE1   . GLU B 1 431 ? 77.656  48.917  48.581  1.00 24.94 ? 431  GLU B OE1   1 
ATOM   9344  O  OE2   . GLU B 1 431 ? 77.502  49.852  46.594  1.00 24.97 ? 431  GLU B OE2   1 
ATOM   9345  N  N     . GLU B 1 432 ? 72.282  48.088  47.598  1.00 21.37 ? 432  GLU B N     1 
ATOM   9346  C  CA    . GLU B 1 432 ? 71.568  47.589  48.791  1.00 21.68 ? 432  GLU B CA    1 
ATOM   9347  C  C     . GLU B 1 432 ? 70.802  46.268  48.562  1.00 21.63 ? 432  GLU B C     1 
ATOM   9348  O  O     . GLU B 1 432 ? 70.862  45.357  49.385  1.00 21.73 ? 432  GLU B O     1 
ATOM   9349  C  CB    . GLU B 1 432 ? 70.553  48.623  49.295  1.00 21.71 ? 432  GLU B CB    1 
ATOM   9350  C  CG    . GLU B 1 432 ? 71.085  49.717  50.201  1.00 22.95 ? 432  GLU B CG    1 
ATOM   9351  C  CD    . GLU B 1 432 ? 69.980  50.671  50.658  1.00 25.10 ? 432  GLU B CD    1 
ATOM   9352  O  OE1   . GLU B 1 432 ? 69.732  51.709  49.972  1.00 26.10 ? 432  GLU B OE1   1 
ATOM   9353  O  OE2   . GLU B 1 432 ? 69.343  50.374  51.698  1.00 25.35 ? 432  GLU B OE2   1 
ATOM   9354  N  N     . LEU B 1 433 ? 70.068  46.201  47.453  1.00 21.15 ? 433  LEU B N     1 
ATOM   9355  C  CA    . LEU B 1 433 ? 69.161  45.101  47.169  1.00 21.14 ? 433  LEU B CA    1 
ATOM   9356  C  C     . LEU B 1 433 ? 69.853  43.743  47.009  1.00 21.46 ? 433  LEU B C     1 
ATOM   9357  O  O     . LEU B 1 433 ? 69.317  42.713  47.423  1.00 21.32 ? 433  LEU B O     1 
ATOM   9358  C  CB    . LEU B 1 433 ? 68.362  45.408  45.898  1.00 20.94 ? 433  LEU B CB    1 
ATOM   9359  C  CG    . LEU B 1 433 ? 67.263  44.402  45.512  1.00 20.51 ? 433  LEU B CG    1 
ATOM   9360  C  CD1   . LEU B 1 433 ? 66.123  44.450  46.511  1.00 20.54 ? 433  LEU B CD1   1 
ATOM   9361  C  CD2   . LEU B 1 433 ? 66.737  44.651  44.104  1.00 18.90 ? 433  LEU B CD2   1 
ATOM   9362  N  N     . ASP B 1 434 ? 71.018  43.741  46.371  1.00 21.83 ? 434  ASP B N     1 
ATOM   9363  C  CA    . ASP B 1 434 ? 71.805  42.516  46.207  1.00 22.06 ? 434  ASP B CA    1 
ATOM   9364  C  C     . ASP B 1 434 ? 72.365  42.070  47.553  1.00 21.96 ? 434  ASP B C     1 
ATOM   9365  O  O     . ASP B 1 434 ? 72.478  40.872  47.813  1.00 21.52 ? 434  ASP B O     1 
ATOM   9366  C  CB    . ASP B 1 434 ? 72.963  42.733  45.227  1.00 22.22 ? 434  ASP B CB    1 
ATOM   9367  C  CG    . ASP B 1 434 ? 72.497  43.019  43.800  1.00 23.22 ? 434  ASP B CG    1 
ATOM   9368  O  OD1   . ASP B 1 434 ? 71.342  42.688  43.427  1.00 24.56 ? 434  ASP B OD1   1 
ATOM   9369  O  OD2   . ASP B 1 434 ? 73.249  43.579  42.978  1.00 24.29 ? 434  ASP B OD2   1 
ATOM   9370  N  N     . GLU B 1 435 ? 72.711  43.057  48.387  1.00 21.94 ? 435  GLU B N     1 
ATOM   9371  C  CA    . GLU B 1 435 ? 73.202  42.836  49.741  1.00 21.91 ? 435  GLU B CA    1 
ATOM   9372  C  C     . GLU B 1 435 ? 72.143  42.180  50.615  1.00 21.23 ? 435  GLU B C     1 
ATOM   9373  O  O     . GLU B 1 435 ? 72.433  41.220  51.327  1.00 21.52 ? 435  GLU B O     1 
ATOM   9374  C  CB    . GLU B 1 435 ? 73.663  44.159  50.380  1.00 22.39 ? 435  GLU B CB    1 
ATOM   9375  C  CG    . GLU B 1 435 ? 74.958  44.741  49.799  1.00 23.70 ? 435  GLU B CG    1 
ATOM   9376  C  CD    . GLU B 1 435 ? 75.468  45.978  50.548  1.00 25.21 ? 435  GLU B CD    1 
ATOM   9377  O  OE1   . GLU B 1 435 ? 76.646  46.347  50.347  1.00 26.46 ? 435  GLU B OE1   1 
ATOM   9378  O  OE2   . GLU B 1 435 ? 74.706  46.592  51.335  1.00 25.91 ? 435  GLU B OE2   1 
ATOM   9379  N  N     . TRP B 1 436 ? 70.919  42.684  50.557  1.00 20.38 ? 436  TRP B N     1 
ATOM   9380  C  CA    . TRP B 1 436 ? 69.834  42.106  51.336  1.00 20.00 ? 436  TRP B CA    1 
ATOM   9381  C  C     . TRP B 1 436 ? 69.447  40.715  50.811  1.00 19.52 ? 436  TRP B C     1 
ATOM   9382  O  O     . TRP B 1 436 ? 69.044  39.855  51.577  1.00 19.36 ? 436  TRP B O     1 
ATOM   9383  C  CB    . TRP B 1 436 ? 68.617  43.046  51.368  1.00 20.06 ? 436  TRP B CB    1 
ATOM   9384  C  CG    . TRP B 1 436 ? 68.829  44.336  52.160  1.00 19.88 ? 436  TRP B CG    1 
ATOM   9385  C  CD1   . TRP B 1 436 ? 68.747  45.614  51.680  1.00 19.39 ? 436  TRP B CD1   1 
ATOM   9386  C  CD2   . TRP B 1 436 ? 69.145  44.461  53.559  1.00 20.12 ? 436  TRP B CD2   1 
ATOM   9387  N  NE1   . TRP B 1 436 ? 68.999  46.522  52.683  1.00 19.21 ? 436  TRP B NE1   1 
ATOM   9388  C  CE2   . TRP B 1 436 ? 69.247  45.846  53.847  1.00 19.21 ? 436  TRP B CE2   1 
ATOM   9389  C  CE3   . TRP B 1 436 ? 69.362  43.544  54.601  1.00 20.36 ? 436  TRP B CE3   1 
ATOM   9390  C  CZ2   . TRP B 1 436 ? 69.544  46.333  55.122  1.00 19.27 ? 436  TRP B CZ2   1 
ATOM   9391  C  CZ3   . TRP B 1 436 ? 69.666  44.030  55.875  1.00 19.65 ? 436  TRP B CZ3   1 
ATOM   9392  C  CH2   . TRP B 1 436 ? 69.754  45.414  56.120  1.00 19.90 ? 436  TRP B CH2   1 
ATOM   9393  N  N     . ARG B 1 437 ? 69.594  40.492  49.514  1.00 19.36 ? 437  ARG B N     1 
ATOM   9394  C  CA    . ARG B 1 437 ? 69.237  39.206  48.903  1.00 19.36 ? 437  ARG B CA    1 
ATOM   9395  C  C     . ARG B 1 437 ? 70.301  38.139  49.167  1.00 19.51 ? 437  ARG B C     1 
ATOM   9396  O  O     . ARG B 1 437 ? 70.008  36.937  49.166  1.00 19.04 ? 437  ARG B O     1 
ATOM   9397  C  CB    . ARG B 1 437 ? 69.077  39.348  47.391  1.00 19.21 ? 437  ARG B CB    1 
ATOM   9398  C  CG    . ARG B 1 437 ? 67.771  39.924  46.931  1.00 18.86 ? 437  ARG B CG    1 
ATOM   9399  C  CD    . ARG B 1 437 ? 67.829  40.339  45.481  1.00 19.16 ? 437  ARG B CD    1 
ATOM   9400  N  NE    . ARG B 1 437 ? 66.552  40.825  44.958  1.00 18.00 ? 437  ARG B NE    1 
ATOM   9401  C  CZ    . ARG B 1 437 ? 66.316  41.051  43.667  1.00 15.62 ? 437  ARG B CZ    1 
ATOM   9402  N  NH1   . ARG B 1 437 ? 67.262  40.858  42.754  1.00 14.23 ? 437  ARG B NH1   1 
ATOM   9403  N  NH2   . ARG B 1 437 ? 65.125  41.480  43.291  1.00 16.03 ? 437  ARG B NH2   1 
ATOM   9404  N  N     . ALA B 1 438 ? 71.536  38.592  49.371  1.00 19.59 ? 438  ALA B N     1 
ATOM   9405  C  CA    . ALA B 1 438 ? 72.666  37.701  49.576  1.00 19.58 ? 438  ALA B CA    1 
ATOM   9406  C  C     . ALA B 1 438 ? 72.635  37.234  51.019  1.00 19.62 ? 438  ALA B C     1 
ATOM   9407  O  O     . ALA B 1 438 ? 72.967  36.097  51.324  1.00 19.66 ? 438  ALA B O     1 
ATOM   9408  C  CB    . ALA B 1 438 ? 73.964  38.420  49.275  1.00 19.45 ? 438  ALA B CB    1 
ATOM   9409  N  N     . LEU B 1 439 ? 72.223  38.130  51.901  1.00 19.70 ? 439  LEU B N     1 
ATOM   9410  C  CA    . LEU B 1 439 ? 72.031  37.790  53.295  1.00 19.82 ? 439  LEU B CA    1 
ATOM   9411  C  C     . LEU B 1 439 ? 70.864  36.805  53.454  1.00 19.94 ? 439  LEU B C     1 
ATOM   9412  O  O     . LEU B 1 439 ? 70.942  35.873  54.247  1.00 19.63 ? 439  LEU B O     1 
ATOM   9413  C  CB    . LEU B 1 439 ? 71.806  39.069  54.101  1.00 19.94 ? 439  LEU B CB    1 
ATOM   9414  C  CG    . LEU B 1 439 ? 73.050  39.973  54.206  1.00 19.74 ? 439  LEU B CG    1 
ATOM   9415  C  CD1   . LEU B 1 439 ? 72.648  41.393  54.592  1.00 19.38 ? 439  LEU B CD1   1 
ATOM   9416  C  CD2   . LEU B 1 439 ? 74.067  39.414  55.200  1.00 19.15 ? 439  LEU B CD2   1 
ATOM   9417  N  N     . ALA B 1 440 ? 69.801  37.002  52.676  1.00 20.32 ? 440  ALA B N     1 
ATOM   9418  C  CA    . ALA B 1 440 ? 68.647  36.112  52.692  1.00 20.50 ? 440  ALA B CA    1 
ATOM   9419  C  C     . ALA B 1 440 ? 69.039  34.732  52.202  1.00 21.26 ? 440  ALA B C     1 
ATOM   9420  O  O     . ALA B 1 440 ? 68.685  33.721  52.817  1.00 21.58 ? 440  ALA B O     1 
ATOM   9421  C  CB    . ALA B 1 440 ? 67.574  36.645  51.823  1.00 20.42 ? 440  ALA B CB    1 
ATOM   9422  N  N     . ASP B 1 441 ? 69.768  34.697  51.086  1.00 21.75 ? 441  ASP B N     1 
ATOM   9423  C  CA    . ASP B 1 441 ? 70.206  33.438  50.481  1.00 21.73 ? 441  ASP B CA    1 
ATOM   9424  C  C     . ASP B 1 441 ? 71.177  32.686  51.371  1.00 21.81 ? 441  ASP B C     1 
ATOM   9425  O  O     . ASP B 1 441 ? 71.113  31.469  51.423  1.00 22.20 ? 441  ASP B O     1 
ATOM   9426  C  CB    . ASP B 1 441 ? 70.856  33.666  49.114  1.00 21.73 ? 441  ASP B CB    1 
ATOM   9427  C  CG    . ASP B 1 441 ? 69.848  33.986  48.034  1.00 21.88 ? 441  ASP B CG    1 
ATOM   9428  O  OD1   . ASP B 1 441 ? 68.725  33.446  48.079  1.00 22.26 ? 441  ASP B OD1   1 
ATOM   9429  O  OD2   . ASP B 1 441 ? 70.094  34.769  47.095  1.00 22.49 ? 441  ASP B OD2   1 
ATOM   9430  N  N     . GLY B 1 442 ? 72.067  33.401  52.060  1.00 21.82 ? 442  GLY B N     1 
ATOM   9431  C  CA    . GLY B 1 442 ? 73.033  32.786  52.966  1.00 21.78 ? 442  GLY B CA    1 
ATOM   9432  C  C     . GLY B 1 442 ? 72.408  32.294  54.265  1.00 21.84 ? 442  GLY B C     1 
ATOM   9433  O  O     . GLY B 1 442 ? 72.963  31.445  54.957  1.00 21.58 ? 442  GLY B O     1 
ATOM   9434  N  N     . ALA B 1 443 ? 71.250  32.852  54.600  1.00 22.02 ? 443  ALA B N     1 
ATOM   9435  C  CA    . ALA B 1 443 ? 70.439  32.367  55.702  1.00 22.20 ? 443  ALA B CA    1 
ATOM   9436  C  C     . ALA B 1 443 ? 69.647  31.137  55.239  1.00 22.31 ? 443  ALA B C     1 
ATOM   9437  O  O     . ALA B 1 443 ? 69.479  30.168  55.982  1.00 22.29 ? 443  ALA B O     1 
ATOM   9438  C  CB    . ALA B 1 443 ? 69.500  33.470  56.183  1.00 22.15 ? 443  ALA B CB    1 
ATOM   9439  N  N     . THR B 1 444 ? 69.180  31.186  53.995  1.00 22.39 ? 444  THR B N     1 
ATOM   9440  C  CA    . THR B 1 444 ? 68.403  30.108  53.397  1.00 22.55 ? 444  THR B CA    1 
ATOM   9441  C  C     . THR B 1 444 ? 69.306  28.941  53.003  1.00 22.62 ? 444  THR B C     1 
ATOM   9442  O  O     . THR B 1 444 ? 68.836  27.816  52.861  1.00 22.65 ? 444  THR B O     1 
ATOM   9443  C  CB    . THR B 1 444 ? 67.639  30.643  52.161  1.00 22.70 ? 444  THR B CB    1 
ATOM   9444  O  OG1   . THR B 1 444 ? 66.722  31.672  52.570  1.00 22.85 ? 444  THR B OG1   1 
ATOM   9445  C  CG2   . THR B 1 444 ? 66.740  29.568  51.526  1.00 22.73 ? 444  THR B CG2   1 
ATOM   9446  N  N     . ASP B 1 445 ? 70.600  29.216  52.829  1.00 22.76 ? 445  ASP B N     1 
ATOM   9447  C  CA    . ASP B 1 445 ? 71.590  28.202  52.459  1.00 22.63 ? 445  ASP B CA    1 
ATOM   9448  C  C     . ASP B 1 445 ? 71.949  27.466  53.730  1.00 22.63 ? 445  ASP B C     1 
ATOM   9449  O  O     . ASP B 1 445 ? 71.999  26.237  53.746  1.00 22.96 ? 445  ASP B O     1 
ATOM   9450  C  CB    . ASP B 1 445 ? 72.858  28.823  51.836  1.00 22.64 ? 445  ASP B CB    1 
ATOM   9451  C  CG    . ASP B 1 445 ? 72.720  29.097  50.332  1.00 22.69 ? 445  ASP B CG    1 
ATOM   9452  O  OD1   . ASP B 1 445 ? 71.746  28.608  49.707  1.00 22.83 ? 445  ASP B OD1   1 
ATOM   9453  O  OD2   . ASP B 1 445 ? 73.542  29.799  49.693  1.00 21.20 ? 445  ASP B OD2   1 
ATOM   9454  N  N     . TYR B 1 446 ? 72.176  28.222  54.804  1.00 22.39 ? 446  TYR B N     1 
ATOM   9455  C  CA    . TYR B 1 446 ? 72.379  27.632  56.123  1.00 22.18 ? 446  TYR B CA    1 
ATOM   9456  C  C     . TYR B 1 446 ? 71.342  26.559  56.414  1.00 22.08 ? 446  TYR B C     1 
ATOM   9457  O  O     . TYR B 1 446 ? 71.678  25.488  56.894  1.00 21.98 ? 446  TYR B O     1 
ATOM   9458  C  CB    . TYR B 1 446 ? 72.310  28.688  57.230  1.00 22.04 ? 446  TYR B CB    1 
ATOM   9459  C  CG    . TYR B 1 446 ? 72.810  28.146  58.547  1.00 22.07 ? 446  TYR B CG    1 
ATOM   9460  C  CD1   . TYR B 1 446 ? 71.981  27.381  59.370  1.00 21.48 ? 446  TYR B CD1   1 
ATOM   9461  C  CD2   . TYR B 1 446 ? 74.127  28.354  58.954  1.00 21.43 ? 446  TYR B CD2   1 
ATOM   9462  C  CE1   . TYR B 1 446 ? 72.442  26.861  60.571  1.00 20.86 ? 446  TYR B CE1   1 
ATOM   9463  C  CE2   . TYR B 1 446 ? 74.595  27.833  60.154  1.00 21.07 ? 446  TYR B CE2   1 
ATOM   9464  C  CZ    . TYR B 1 446 ? 73.744  27.091  60.957  1.00 20.74 ? 446  TYR B CZ    1 
ATOM   9465  O  OH    . TYR B 1 446 ? 74.193  26.578  62.149  1.00 20.20 ? 446  TYR B OH    1 
ATOM   9466  N  N     . LEU B 1 447 ? 70.084  26.860  56.121  1.00 22.28 ? 447  LEU B N     1 
ATOM   9467  C  CA    . LEU B 1 447 ? 68.975  26.011  56.545  1.00 22.62 ? 447  LEU B CA    1 
ATOM   9468  C  C     . LEU B 1 447 ? 68.810  24.742  55.703  1.00 22.84 ? 447  LEU B C     1 
ATOM   9469  O  O     . LEU B 1 447 ? 68.370  23.710  56.216  1.00 22.80 ? 447  LEU B O     1 
ATOM   9470  C  CB    . LEU B 1 447 ? 67.680  26.824  56.583  1.00 22.56 ? 447  LEU B CB    1 
ATOM   9471  C  CG    . LEU B 1 447 ? 67.634  27.838  57.725  1.00 22.26 ? 447  LEU B CG    1 
ATOM   9472  C  CD1   . LEU B 1 447 ? 66.498  28.836  57.527  1.00 21.92 ? 447  LEU B CD1   1 
ATOM   9473  C  CD2   . LEU B 1 447 ? 67.503  27.118  59.056  1.00 22.46 ? 447  LEU B CD2   1 
ATOM   9474  N  N     . GLU B 1 448 ? 69.172  24.809  54.425  1.00 23.06 ? 448  GLU B N     1 
ATOM   9475  C  CA    . GLU B 1 448 ? 69.226  23.607  53.597  1.00 23.18 ? 448  GLU B CA    1 
ATOM   9476  C  C     . GLU B 1 448 ? 70.288  22.650  54.168  1.00 23.42 ? 448  GLU B C     1 
ATOM   9477  O  O     . GLU B 1 448 ? 70.113  21.439  54.125  1.00 23.62 ? 448  GLU B O     1 
ATOM   9478  C  CB    . GLU B 1 448 ? 69.506  23.957  52.128  1.00 23.10 ? 448  GLU B CB    1 
ATOM   9479  C  CG    . GLU B 1 448 ? 68.257  24.345  51.327  1.00 23.22 ? 448  GLU B CG    1 
ATOM   9480  C  CD    . GLU B 1 448 ? 68.495  25.464  50.304  1.00 22.70 ? 448  GLU B CD    1 
ATOM   9481  O  OE1   . GLU B 1 448 ? 69.552  25.458  49.629  1.00 21.09 ? 448  GLU B OE1   1 
ATOM   9482  O  OE2   . GLU B 1 448 ? 67.612  26.346  50.166  1.00 21.81 ? 448  GLU B OE2   1 
ATOM   9483  N  N     . ARG B 1 449 ? 71.363  23.209  54.730  1.00 23.60 ? 449  ARG B N     1 
ATOM   9484  C  CA    . ARG B 1 449 ? 72.455  22.441  55.340  1.00 23.59 ? 449  ARG B CA    1 
ATOM   9485  C  C     . ARG B 1 449 ? 72.184  22.042  56.793  1.00 23.47 ? 449  ARG B C     1 
ATOM   9486  O  O     . ARG B 1 449 ? 72.816  21.118  57.306  1.00 22.92 ? 449  ARG B O     1 
ATOM   9487  C  CB    . ARG B 1 449 ? 73.755  23.245  55.295  1.00 23.70 ? 449  ARG B CB    1 
ATOM   9488  C  CG    . ARG B 1 449 ? 74.548  23.114  53.995  1.00 24.62 ? 449  ARG B CG    1 
ATOM   9489  C  CD    . ARG B 1 449 ? 75.806  23.992  53.926  1.00 26.45 ? 449  ARG B CD    1 
ATOM   9490  N  NE    . ARG B 1 449 ? 75.631  25.257  54.640  1.00 27.41 ? 449  ARG B NE    1 
ATOM   9491  C  CZ    . ARG B 1 449 ? 76.580  26.165  54.816  1.00 28.66 ? 449  ARG B CZ    1 
ATOM   9492  N  NH1   . ARG B 1 449 ? 77.805  25.993  54.307  1.00 28.75 ? 449  ARG B NH1   1 
ATOM   9493  N  NH2   . ARG B 1 449 ? 76.288  27.269  55.501  1.00 29.18 ? 449  ARG B NH2   1 
ATOM   9494  N  N     . LEU B 1 450 ? 71.274  22.757  57.454  1.00 23.53 ? 450  LEU B N     1 
ATOM   9495  C  CA    . LEU B 1 450 ? 70.837  22.403  58.801  1.00 23.63 ? 450  LEU B CA    1 
ATOM   9496  C  C     . LEU B 1 450 ? 70.038  21.111  58.706  1.00 23.89 ? 450  LEU B C     1 
ATOM   9497  O  O     . LEU B 1 450 ? 70.067  20.278  59.604  1.00 23.97 ? 450  LEU B O     1 
ATOM   9498  C  CB    . LEU B 1 450 ? 69.962  23.506  59.392  1.00 23.58 ? 450  LEU B CB    1 
ATOM   9499  C  CG    . LEU B 1 450 ? 69.395  23.254  60.798  1.00 23.17 ? 450  LEU B CG    1 
ATOM   9500  C  CD1   . LEU B 1 450 ? 69.407  24.545  61.590  1.00 23.05 ? 450  LEU B CD1   1 
ATOM   9501  C  CD2   . LEU B 1 450 ? 67.989  22.676  60.774  1.00 22.34 ? 450  LEU B CD2   1 
ATOM   9502  N  N     . GLU B 1 451 ? 69.319  20.977  57.599  1.00 24.15 ? 451  GLU B N     1 
ATOM   9503  C  CA    . GLU B 1 451 ? 68.558  19.785  57.277  1.00 24.55 ? 451  GLU B CA    1 
ATOM   9504  C  C     . GLU B 1 451 ? 69.443  18.555  57.043  1.00 24.60 ? 451  GLU B C     1 
ATOM   9505  O  O     . GLU B 1 451 ? 69.119  17.471  57.515  1.00 24.89 ? 451  GLU B O     1 
ATOM   9506  C  CB    . GLU B 1 451 ? 67.714  20.050  56.025  1.00 24.93 ? 451  GLU B CB    1 
ATOM   9507  C  CG    . GLU B 1 451 ? 66.671  18.985  55.728  1.00 25.60 ? 451  GLU B CG    1 
ATOM   9508  C  CD    . GLU B 1 451 ? 66.179  19.043  54.301  1.00 26.20 ? 451  GLU B CD    1 
ATOM   9509  O  OE1   . GLU B 1 451 ? 65.818  20.152  53.856  1.00 27.31 ? 451  GLU B OE1   1 
ATOM   9510  O  OE2   . GLU B 1 451 ? 66.158  17.986  53.632  1.00 26.57 ? 451  GLU B OE2   1 
ATOM   9511  N  N     . VAL B 1 452 ? 70.542  18.722  56.307  1.00 24.55 ? 452  VAL B N     1 
ATOM   9512  C  CA    . VAL B 1 452 ? 71.471  17.620  56.024  1.00 24.41 ? 452  VAL B CA    1 
ATOM   9513  C  C     . VAL B 1 452 ? 72.339  17.296  57.249  1.00 24.34 ? 452  VAL B C     1 
ATOM   9514  O  O     . VAL B 1 452 ? 72.893  16.207  57.343  1.00 24.34 ? 452  VAL B O     1 
ATOM   9515  C  CB    . VAL B 1 452 ? 72.367  17.941  54.779  1.00 24.58 ? 452  VAL B CB    1 
ATOM   9516  C  CG1   . VAL B 1 452 ? 73.434  16.854  54.532  1.00 24.57 ? 452  VAL B CG1   1 
ATOM   9517  C  CG2   . VAL B 1 452 ? 71.505  18.111  53.532  1.00 24.53 ? 452  VAL B CG2   1 
ATOM   9518  N  N     . ARG B 1 453 ? 72.436  18.243  58.185  1.00 24.40 ? 453  ARG B N     1 
ATOM   9519  C  CA    . ARG B 1 453 ? 73.228  18.084  59.411  1.00 24.32 ? 453  ARG B CA    1 
ATOM   9520  C  C     . ARG B 1 453 ? 72.420  17.313  60.436  1.00 24.38 ? 453  ARG B C     1 
ATOM   9521  O  O     . ARG B 1 453 ? 72.912  16.348  61.019  1.00 24.15 ? 453  ARG B O     1 
ATOM   9522  C  CB    . ARG B 1 453 ? 73.658  19.457  59.973  1.00 24.30 ? 453  ARG B CB    1 
ATOM   9523  C  CG    . ARG B 1 453 ? 73.910  19.532  61.495  1.00 24.02 ? 453  ARG B CG    1 
ATOM   9524  C  CD    . ARG B 1 453 ? 74.789  20.711  61.951  1.00 24.03 ? 453  ARG B CD    1 
ATOM   9525  N  NE    . ARG B 1 453 ? 75.013  21.707  60.893  1.00 24.54 ? 453  ARG B NE    1 
ATOM   9526  C  CZ    . ARG B 1 453 ? 74.332  22.847  60.734  1.00 24.84 ? 453  ARG B CZ    1 
ATOM   9527  N  NH1   . ARG B 1 453 ? 73.356  23.198  61.568  1.00 24.82 ? 453  ARG B NH1   1 
ATOM   9528  N  NH2   . ARG B 1 453 ? 74.633  23.652  59.724  1.00 25.04 ? 453  ARG B NH2   1 
ATOM   9529  N  N     . GLU B 1 454 ? 71.181  17.747  60.646  1.00 24.52 ? 454  GLU B N     1 
ATOM   9530  C  CA    . GLU B 1 454 ? 70.269  17.071  61.566  1.00 24.70 ? 454  GLU B CA    1 
ATOM   9531  C  C     . GLU B 1 454 ? 69.997  15.640  61.096  1.00 24.92 ? 454  GLU B C     1 
ATOM   9532  O  O     . GLU B 1 454 ? 69.903  14.713  61.906  1.00 24.76 ? 454  GLU B O     1 
ATOM   9533  C  CB    . GLU B 1 454 ? 68.950  17.851  61.708  1.00 24.51 ? 454  GLU B CB    1 
ATOM   9534  C  CG    . GLU B 1 454 ? 69.046  19.160  62.488  1.00 24.45 ? 454  GLU B CG    1 
ATOM   9535  C  CD    . GLU B 1 454 ? 69.593  18.996  63.904  1.00 25.61 ? 454  GLU B CD    1 
ATOM   9536  O  OE1   . GLU B 1 454 ? 68.838  18.620  64.826  1.00 25.13 ? 454  GLU B OE1   1 
ATOM   9537  O  OE2   . GLU B 1 454 ? 70.796  19.258  64.108  1.00 27.68 ? 454  GLU B OE2   1 
ATOM   9538  N  N     . ARG B 1 455 ? 69.903  15.469  59.784  1.00 25.24 ? 455  ARG B N     1 
ATOM   9539  C  CA    . ARG B 1 455 ? 69.578  14.178  59.187  1.00 25.71 ? 455  ARG B CA    1 
ATOM   9540  C  C     . ARG B 1 455 ? 70.766  13.209  59.138  1.00 26.15 ? 455  ARG B C     1 
ATOM   9541  O  O     . ARG B 1 455 ? 70.581  11.993  59.061  1.00 26.50 ? 455  ARG B O     1 
ATOM   9542  C  CB    . ARG B 1 455 ? 69.040  14.397  57.780  1.00 25.64 ? 455  ARG B CB    1 
ATOM   9543  C  CG    . ARG B 1 455 ? 68.665  13.130  57.059  1.00 26.25 ? 455  ARG B CG    1 
ATOM   9544  C  CD    . ARG B 1 455 ? 67.746  13.360  55.903  1.00 26.56 ? 455  ARG B CD    1 
ATOM   9545  N  NE    . ARG B 1 455 ? 68.375  14.213  54.905  1.00 27.07 ? 455  ARG B NE    1 
ATOM   9546  C  CZ    . ARG B 1 455 ? 67.774  14.624  53.802  1.00 29.11 ? 455  ARG B CZ    1 
ATOM   9547  N  NH1   . ARG B 1 455 ? 66.516  14.262  53.552  1.00 30.00 ? 455  ARG B NH1   1 
ATOM   9548  N  NH2   . ARG B 1 455 ? 68.429  15.395  52.936  1.00 29.61 ? 455  ARG B NH2   1 
ATOM   9549  N  N     . GLU B 1 456 ? 71.980  13.740  59.152  1.00 26.45 ? 456  GLU B N     1 
ATOM   9550  C  CA    . GLU B 1 456 ? 73.162  12.894  59.195  1.00 26.83 ? 456  GLU B CA    1 
ATOM   9551  C  C     . GLU B 1 456 ? 73.553  12.618  60.653  1.00 26.81 ? 456  GLU B C     1 
ATOM   9552  O  O     . GLU B 1 456 ? 74.316  11.694  60.926  1.00 26.99 ? 456  GLU B O     1 
ATOM   9553  C  CB    . GLU B 1 456 ? 74.323  13.545  58.415  1.00 27.07 ? 456  GLU B CB    1 
ATOM   9554  C  CG    . GLU B 1 456 ? 75.164  12.574  57.583  1.00 27.42 ? 456  GLU B CG    1 
ATOM   9555  C  CD    . GLU B 1 456 ? 76.584  12.409  58.098  1.00 27.66 ? 456  GLU B CD    1 
ATOM   9556  O  OE1   . GLU B 1 456 ? 76.770  12.262  59.328  1.00 27.91 ? 456  GLU B OE1   1 
ATOM   9557  O  OE2   . GLU B 1 456 ? 77.516  12.414  57.269  1.00 27.81 ? 456  GLU B OE2   1 
ATOM   9558  N  N     . ARG B 1 457 ? 73.014  13.414  61.579  1.00 26.75 ? 457  ARG B N     1 
ATOM   9559  C  CA    . ARG B 1 457 ? 73.303  13.291  63.013  1.00 26.56 ? 457  ARG B CA    1 
ATOM   9560  C  C     . ARG B 1 457 ? 72.258  12.411  63.731  1.00 25.98 ? 457  ARG B C     1 
ATOM   9561  O  O     . ARG B 1 457 ? 72.519  11.928  64.829  1.00 26.05 ? 457  ARG B O     1 
ATOM   9562  C  CB    . ARG B 1 457 ? 73.374  14.691  63.663  1.00 26.67 ? 457  ARG B CB    1 
ATOM   9563  C  CG    . ARG B 1 457 ? 74.218  14.788  64.950  1.00 27.90 ? 457  ARG B CG    1 
ATOM   9564  C  CD    . ARG B 1 457 ? 73.407  14.957  66.251  1.00 29.59 ? 457  ARG B CD    1 
ATOM   9565  N  NE    . ARG B 1 457 ? 72.372  15.999  66.159  1.00 30.93 ? 457  ARG B NE    1 
ATOM   9566  C  CZ    . ARG B 1 457 ? 71.286  16.083  66.943  1.00 32.13 ? 457  ARG B CZ    1 
ATOM   9567  N  NH1   . ARG B 1 457 ? 71.061  15.185  67.906  1.00 32.29 ? 457  ARG B NH1   1 
ATOM   9568  N  NH2   . ARG B 1 457 ? 70.412  17.077  66.763  1.00 32.13 ? 457  ARG B NH2   1 
ATOM   9569  N  N     . THR B 1 458 ? 71.089  12.207  63.111  1.00 25.35 ? 458  THR B N     1 
ATOM   9570  C  CA    . THR B 1 458 ? 70.021  11.365  63.678  1.00 24.81 ? 458  THR B CA    1 
ATOM   9571  C  C     . THR B 1 458 ? 69.850  10.017  62.956  1.00 24.30 ? 458  THR B C     1 
ATOM   9572  O  O     . THR B 1 458 ? 69.392  9.049   63.568  1.00 24.05 ? 458  THR B O     1 
ATOM   9573  C  CB    . THR B 1 458 ? 68.654  12.113  63.689  1.00 24.82 ? 458  THR B CB    1 
ATOM   9574  O  OG1   . THR B 1 458 ? 68.307  12.557  62.367  1.00 24.85 ? 458  THR B OG1   1 
ATOM   9575  C  CG2   . THR B 1 458 ? 68.719  13.391  64.523  1.00 24.89 ? 458  THR B CG2   1 
ATOM   9576  N  N     . GLY B 1 459 ? 70.207  9.964   61.668  1.00 23.70 ? 459  GLY B N     1 
ATOM   9577  C  CA    . GLY B 1 459 ? 69.989  8.790   60.836  1.00 23.26 ? 459  GLY B CA    1 
ATOM   9578  C  C     . GLY B 1 459 ? 68.524  8.581   60.506  1.00 22.98 ? 459  GLY B C     1 
ATOM   9579  O  O     . GLY B 1 459 ? 68.049  7.449   60.448  1.00 22.61 ? 459  GLY B O     1 
ATOM   9580  N  N     . LEU B 1 460 ? 67.809  9.685   60.305  1.00 22.97 ? 460  LEU B N     1 
ATOM   9581  C  CA    . LEU B 1 460 ? 66.377  9.654   60.006  1.00 22.93 ? 460  LEU B CA    1 
ATOM   9582  C  C     . LEU B 1 460 ? 66.135  10.188  58.595  1.00 22.73 ? 460  LEU B C     1 
ATOM   9583  O  O     . LEU B 1 460 ? 66.175  11.396  58.355  1.00 22.43 ? 460  LEU B O     1 
ATOM   9584  C  CB    . LEU B 1 460 ? 65.599  10.490  61.025  1.00 23.06 ? 460  LEU B CB    1 
ATOM   9585  C  CG    . LEU B 1 460 ? 65.742  10.113  62.497  1.00 22.84 ? 460  LEU B CG    1 
ATOM   9586  C  CD1   . LEU B 1 460 ? 64.946  11.069  63.342  1.00 22.62 ? 460  LEU B CD1   1 
ATOM   9587  C  CD2   . LEU B 1 460 ? 65.285  8.689   62.761  1.00 23.65 ? 460  LEU B CD2   1 
ATOM   9588  N  N     . ASP B 1 461 ? 65.871  9.273   57.667  1.00 22.51 ? 461  ASP B N     1 
ATOM   9589  C  CA    . ASP B 1 461 ? 65.869  9.605   56.242  1.00 22.30 ? 461  ASP B CA    1 
ATOM   9590  C  C     . ASP B 1 461 ? 64.628  10.383  55.766  1.00 22.14 ? 461  ASP B C     1 
ATOM   9591  O  O     . ASP B 1 461 ? 64.545  10.765  54.607  1.00 22.16 ? 461  ASP B O     1 
ATOM   9592  C  CB    . ASP B 1 461 ? 66.148  8.339   55.394  1.00 22.09 ? 461  ASP B CB    1 
ATOM   9593  C  CG    . ASP B 1 461 ? 64.955  7.382   55.303  1.00 22.06 ? 461  ASP B CG    1 
ATOM   9594  O  OD1   . ASP B 1 461 ? 64.199  7.216   56.284  1.00 21.25 ? 461  ASP B OD1   1 
ATOM   9595  O  OD2   . ASP B 1 461 ? 64.706  6.733   54.266  1.00 21.78 ? 461  ASP B OD2   1 
ATOM   9596  N  N     . THR B 1 462 ? 63.682  10.635  56.663  1.00 22.20 ? 462  THR B N     1 
ATOM   9597  C  CA    . THR B 1 462 ? 62.464  11.373  56.322  1.00 22.12 ? 462  THR B CA    1 
ATOM   9598  C  C     . THR B 1 462 ? 62.453  12.784  56.913  1.00 22.14 ? 462  THR B C     1 
ATOM   9599  O  O     . THR B 1 462 ? 61.481  13.518  56.767  1.00 21.94 ? 462  THR B O     1 
ATOM   9600  C  CB    . THR B 1 462 ? 61.239  10.603  56.813  1.00 22.00 ? 462  THR B CB    1 
ATOM   9601  O  OG1   . THR B 1 462 ? 61.279  10.483  58.240  1.00 22.40 ? 462  THR B OG1   1 
ATOM   9602  C  CG2   . THR B 1 462 ? 61.268  9.183   56.333  1.00 21.70 ? 462  THR B CG2   1 
ATOM   9603  N  N     . LEU B 1 463 ? 63.543  13.157  57.571  1.00 22.46 ? 463  LEU B N     1 
ATOM   9604  C  CA    . LEU B 1 463 ? 63.699  14.490  58.131  1.00 22.66 ? 463  LEU B CA    1 
ATOM   9605  C  C     . LEU B 1 463 ? 63.891  15.493  57.017  1.00 22.61 ? 463  LEU B C     1 
ATOM   9606  O  O     . LEU B 1 463 ? 64.710  15.266  56.125  1.00 22.71 ? 463  LEU B O     1 
ATOM   9607  C  CB    . LEU B 1 463 ? 64.922  14.534  59.045  1.00 22.96 ? 463  LEU B CB    1 
ATOM   9608  C  CG    . LEU B 1 463 ? 65.020  15.731  60.002  1.00 23.65 ? 463  LEU B CG    1 
ATOM   9609  C  CD1   . LEU B 1 463 ? 65.780  15.307  61.261  1.00 23.81 ? 463  LEU B CD1   1 
ATOM   9610  C  CD2   . LEU B 1 463 ? 65.682  16.965  59.362  1.00 24.01 ? 463  LEU B CD2   1 
ATOM   9611  N  N     . LYS B 1 464 ? 63.126  16.583  57.056  1.00 22.61 ? 464  LYS B N     1 
ATOM   9612  C  CA    . LYS B 1 464 ? 63.384  17.737  56.195  1.00 22.92 ? 464  LYS B CA    1 
ATOM   9613  C  C     . LYS B 1 464 ? 63.015  19.051  56.886  1.00 22.30 ? 464  LYS B C     1 
ATOM   9614  O  O     . LYS B 1 464 ? 62.500  19.036  57.990  1.00 22.21 ? 464  LYS B O     1 
ATOM   9615  C  CB    . LYS B 1 464 ? 62.674  17.586  54.837  1.00 23.40 ? 464  LYS B CB    1 
ATOM   9616  C  CG    . LYS B 1 464 ? 61.138  17.506  54.900  1.00 25.15 ? 464  LYS B CG    1 
ATOM   9617  C  CD    . LYS B 1 464 ? 60.556  16.545  53.830  1.00 26.07 ? 464  LYS B CD    1 
ATOM   9618  C  CE    . LYS B 1 464 ? 60.197  15.165  54.414  1.00 26.66 ? 464  LYS B CE    1 
ATOM   9619  N  NZ    . LYS B 1 464 ? 59.157  14.449  53.611  1.00 25.99 ? 464  LYS B NZ    1 
ATOM   9620  N  N     . VAL B 1 465 ? 63.323  20.180  56.248  1.00 21.88 ? 465  VAL B N     1 
ATOM   9621  C  CA    . VAL B 1 465 ? 62.937  21.506  56.746  1.00 21.54 ? 465  VAL B CA    1 
ATOM   9622  C  C     . VAL B 1 465 ? 61.938  22.145  55.784  1.00 21.58 ? 465  VAL B C     1 
ATOM   9623  O  O     . VAL B 1 465 ? 62.188  22.211  54.578  1.00 21.83 ? 465  VAL B O     1 
ATOM   9624  C  CB    . VAL B 1 465 ? 64.154  22.469  56.870  1.00 21.35 ? 465  VAL B CB    1 
ATOM   9625  C  CG1   . VAL B 1 465 ? 63.711  23.871  57.280  1.00 20.72 ? 465  VAL B CG1   1 
ATOM   9626  C  CG2   . VAL B 1 465 ? 65.154  21.947  57.859  1.00 21.30 ? 465  VAL B CG2   1 
ATOM   9627  N  N     . GLY B 1 466 ? 60.819  22.623  56.316  1.00 21.45 ? 466  GLY B N     1 
ATOM   9628  C  CA    . GLY B 1 466 ? 59.848  23.379  55.537  1.00 21.43 ? 466  GLY B CA    1 
ATOM   9629  C  C     . GLY B 1 466 ? 59.546  24.749  56.146  1.00 21.13 ? 466  GLY B C     1 
ATOM   9630  O  O     . GLY B 1 466 ? 60.153  25.146  57.149  1.00 20.90 ? 466  GLY B O     1 
ATOM   9631  N  N     . PHE B 1 467 ? 58.602  25.455  55.521  1.00 20.66 ? 467  PHE B N     1 
ATOM   9632  C  CA    . PHE B 1 467 ? 58.135  26.765  55.974  1.00 20.38 ? 467  PHE B CA    1 
ATOM   9633  C  C     . PHE B 1 467 ? 56.612  26.935  55.730  1.00 20.58 ? 467  PHE B C     1 
ATOM   9634  O  O     . PHE B 1 467 ? 56.103  26.557  54.674  1.00 20.36 ? 467  PHE B O     1 
ATOM   9635  C  CB    . PHE B 1 467 ? 58.925  27.877  55.249  1.00 20.01 ? 467  PHE B CB    1 
ATOM   9636  C  CG    . PHE B 1 467 ? 58.549  29.278  55.673  1.00 19.23 ? 467  PHE B CG    1 
ATOM   9637  C  CD1   . PHE B 1 467 ? 57.511  29.962  55.044  1.00 18.39 ? 467  PHE B CD1   1 
ATOM   9638  C  CD2   . PHE B 1 467 ? 59.232  29.915  56.703  1.00 19.15 ? 467  PHE B CD2   1 
ATOM   9639  C  CE1   . PHE B 1 467 ? 57.150  31.249  55.440  1.00 17.68 ? 467  PHE B CE1   1 
ATOM   9640  C  CE2   . PHE B 1 467 ? 58.881  31.209  57.109  1.00 19.10 ? 467  PHE B CE2   1 
ATOM   9641  C  CZ    . PHE B 1 467 ? 57.833  31.875  56.469  1.00 19.03 ? 467  PHE B CZ    1 
ATOM   9642  N  N     . ASN B 1 468 ? 55.888  27.472  56.717  1.00 20.75 ? 468  ASN B N     1 
ATOM   9643  C  CA    . ASN B 1 468 ? 54.589  28.121  56.465  1.00 20.70 ? 468  ASN B CA    1 
ATOM   9644  C  C     . ASN B 1 468 ? 54.288  29.253  57.455  1.00 20.66 ? 468  ASN B C     1 
ATOM   9645  O  O     . ASN B 1 468 ? 55.023  29.447  58.408  1.00 20.83 ? 468  ASN B O     1 
ATOM   9646  C  CB    . ASN B 1 468 ? 53.437  27.105  56.398  1.00 20.88 ? 468  ASN B CB    1 
ATOM   9647  C  CG    . ASN B 1 468 ? 53.251  26.310  57.681  1.00 21.01 ? 468  ASN B CG    1 
ATOM   9648  O  OD1   . ASN B 1 468 ? 53.203  26.862  58.773  1.00 22.75 ? 468  ASN B OD1   1 
ATOM   9649  N  ND2   . ASN B 1 468 ? 53.116  25.005  57.541  1.00 21.33 ? 468  ASN B ND2   1 
ATOM   9650  N  N     . ALA B 1 469 ? 53.209  29.996  57.210  1.00 20.77 ? 469  ALA B N     1 
ATOM   9651  C  CA    . ALA B 1 469 ? 52.860  31.198  57.984  1.00 20.74 ? 469  ALA B CA    1 
ATOM   9652  C  C     . ALA B 1 469 ? 52.570  30.932  59.463  1.00 20.93 ? 469  ALA B C     1 
ATOM   9653  O  O     . ALA B 1 469 ? 52.937  31.724  60.339  1.00 21.14 ? 469  ALA B O     1 
ATOM   9654  C  CB    . ALA B 1 469 ? 51.674  31.893  57.346  1.00 20.42 ? 469  ALA B CB    1 
ATOM   9655  N  N     . VAL B 1 470 ? 51.908  29.815  59.731  1.00 21.10 ? 470  VAL B N     1 
ATOM   9656  C  CA    . VAL B 1 470 ? 51.567  29.409  61.097  1.00 21.15 ? 470  VAL B CA    1 
ATOM   9657  C  C     . VAL B 1 470 ? 52.814  29.186  61.976  1.00 20.97 ? 470  VAL B C     1 
ATOM   9658  O  O     . VAL B 1 470 ? 52.790  29.501  63.178  1.00 20.96 ? 470  VAL B O     1 
ATOM   9659  C  CB    . VAL B 1 470 ? 50.707  28.104  61.073  1.00 21.38 ? 470  VAL B CB    1 
ATOM   9660  C  CG1   . VAL B 1 470 ? 50.255  27.688  62.477  1.00 21.61 ? 470  VAL B CG1   1 
ATOM   9661  C  CG2   . VAL B 1 470 ? 49.497  28.266  60.147  1.00 21.63 ? 470  VAL B CG2   1 
ATOM   9662  N  N     . HIS B 1 471 ? 53.891  28.663  61.377  1.00 20.61 ? 471  HIS B N     1 
ATOM   9663  C  CA    . HIS B 1 471 ? 55.033  28.145  62.136  1.00 20.69 ? 471  HIS B CA    1 
ATOM   9664  C  C     . HIS B 1 471 ? 56.386  28.725  61.788  1.00 20.87 ? 471  HIS B C     1 
ATOM   9665  O  O     . HIS B 1 471 ? 57.362  28.429  62.478  1.00 21.54 ? 471  HIS B O     1 
ATOM   9666  C  CB    . HIS B 1 471 ? 55.139  26.622  61.932  1.00 21.06 ? 471  HIS B CB    1 
ATOM   9667  C  CG    . HIS B 1 471 ? 54.042  25.841  62.589  1.00 21.04 ? 471  HIS B CG    1 
ATOM   9668  N  ND1   . HIS B 1 471 ? 54.180  25.271  63.833  1.00 21.34 ? 471  HIS B ND1   1 
ATOM   9669  C  CD2   . HIS B 1 471 ? 52.784  25.554  62.183  1.00 21.40 ? 471  HIS B CD2   1 
ATOM   9670  C  CE1   . HIS B 1 471 ? 53.057  24.662  64.166  1.00 21.89 ? 471  HIS B CE1   1 
ATOM   9671  N  NE2   . HIS B 1 471 ? 52.192  24.821  63.183  1.00 22.50 ? 471  HIS B NE2   1 
ATOM   9672  N  N     . GLY B 1 472 ? 56.475  29.543  60.742  1.00 20.84 ? 472  GLY B N     1 
ATOM   9673  C  CA    . GLY B 1 472 ? 57.765  29.848  60.139  1.00 20.61 ? 472  GLY B CA    1 
ATOM   9674  C  C     . GLY B 1 472 ? 58.423  28.558  59.651  1.00 20.59 ? 472  GLY B C     1 
ATOM   9675  O  O     . GLY B 1 472 ? 57.743  27.687  59.095  1.00 20.68 ? 472  GLY B O     1 
ATOM   9676  N  N     . TYR B 1 473 ? 59.733  28.420  59.851  1.00 20.42 ? 473  TYR B N     1 
ATOM   9677  C  CA    . TYR B 1 473 ? 60.430  27.179  59.514  1.00 20.32 ? 473  TYR B CA    1 
ATOM   9678  C  C     . TYR B 1 473 ? 60.194  26.124  60.597  1.00 20.68 ? 473  TYR B C     1 
ATOM   9679  O  O     . TYR B 1 473 ? 59.788  26.433  61.708  1.00 20.86 ? 473  TYR B O     1 
ATOM   9680  C  CB    . TYR B 1 473 ? 61.937  27.415  59.333  1.00 20.28 ? 473  TYR B CB    1 
ATOM   9681  C  CG    . TYR B 1 473 ? 62.323  28.259  58.131  1.00 19.24 ? 473  TYR B CG    1 
ATOM   9682  C  CD1   . TYR B 1 473 ? 62.342  29.651  58.212  1.00 18.81 ? 473  TYR B CD1   1 
ATOM   9683  C  CD2   . TYR B 1 473 ? 62.685  27.668  56.924  1.00 18.70 ? 473  TYR B CD2   1 
ATOM   9684  C  CE1   . TYR B 1 473 ? 62.695  30.439  57.123  1.00 18.39 ? 473  TYR B CE1   1 
ATOM   9685  C  CE2   . TYR B 1 473 ? 63.033  28.444  55.821  1.00 18.78 ? 473  TYR B CE2   1 
ATOM   9686  C  CZ    . TYR B 1 473 ? 63.041  29.831  55.931  1.00 18.74 ? 473  TYR B CZ    1 
ATOM   9687  O  OH    . TYR B 1 473 ? 63.400  30.608  54.856  1.00 17.55 ? 473  TYR B OH    1 
ATOM   9688  N  N     . TYR B 1 474 ? 60.453  24.870  60.260  1.00 21.14 ? 474  TYR B N     1 
ATOM   9689  C  CA    . TYR B 1 474 ? 60.254  23.756  61.185  1.00 21.21 ? 474  TYR B CA    1 
ATOM   9690  C  C     . TYR B 1 474 ? 61.000  22.540  60.664  1.00 21.42 ? 474  TYR B C     1 
ATOM   9691  O  O     . TYR B 1 474 ? 61.084  22.336  59.464  1.00 21.67 ? 474  TYR B O     1 
ATOM   9692  C  CB    . TYR B 1 474 ? 58.765  23.436  61.325  1.00 21.16 ? 474  TYR B CB    1 
ATOM   9693  C  CG    . TYR B 1 474 ? 58.046  23.208  60.014  1.00 21.16 ? 474  TYR B CG    1 
ATOM   9694  C  CD1   . TYR B 1 474 ? 58.140  21.980  59.345  1.00 22.01 ? 474  TYR B CD1   1 
ATOM   9695  C  CD2   . TYR B 1 474 ? 57.269  24.215  59.431  1.00 21.00 ? 474  TYR B CD2   1 
ATOM   9696  C  CE1   . TYR B 1 474 ? 57.490  21.766  58.125  1.00 20.71 ? 474  TYR B CE1   1 
ATOM   9697  C  CE2   . TYR B 1 474 ? 56.612  24.006  58.216  1.00 20.32 ? 474  TYR B CE2   1 
ATOM   9698  C  CZ    . TYR B 1 474 ? 56.725  22.774  57.576  1.00 20.38 ? 474  TYR B CZ    1 
ATOM   9699  O  OH    . TYR B 1 474 ? 56.073  22.541  56.388  1.00 20.38 ? 474  TYR B OH    1 
ATOM   9700  N  N     . ILE B 1 475 ? 61.582  21.742  61.542  1.00 21.81 ? 475  ILE B N     1 
ATOM   9701  C  CA    . ILE B 1 475 ? 62.006  20.416  61.113  1.00 21.84 ? 475  ILE B CA    1 
ATOM   9702  C  C     . ILE B 1 475 ? 60.764  19.549  61.086  1.00 21.52 ? 475  ILE B C     1 
ATOM   9703  O  O     . ILE B 1 475 ? 59.894  19.712  61.913  1.00 21.26 ? 475  ILE B O     1 
ATOM   9704  C  CB    . ILE B 1 475 ? 63.053  19.851  62.046  1.00 21.89 ? 475  ILE B CB    1 
ATOM   9705  C  CG1   . ILE B 1 475 ? 64.362  20.632  61.871  1.00 22.32 ? 475  ILE B CG1   1 
ATOM   9706  C  CG2   . ILE B 1 475 ? 63.245  18.357  61.793  1.00 21.97 ? 475  ILE B CG2   1 
ATOM   9707  C  CD1   . ILE B 1 475 ? 64.700  21.522  63.051  1.00 22.77 ? 475  ILE B CD1   1 
ATOM   9708  N  N     . GLN B 1 476 ? 60.672  18.661  60.111  1.00 21.56 ? 476  GLN B N     1 
ATOM   9709  C  CA    . GLN B 1 476 ? 59.562  17.733  60.023  1.00 22.04 ? 476  GLN B CA    1 
ATOM   9710  C  C     . GLN B 1 476 ? 60.114  16.323  59.950  1.00 22.25 ? 476  GLN B C     1 
ATOM   9711  O  O     . GLN B 1 476 ? 60.884  16.017  59.059  1.00 22.10 ? 476  GLN B O     1 
ATOM   9712  C  CB    . GLN B 1 476 ? 58.693  18.019  58.787  1.00 22.11 ? 476  GLN B CB    1 
ATOM   9713  C  CG    . GLN B 1 476 ? 57.729  16.860  58.447  1.00 22.37 ? 476  GLN B CG    1 
ATOM   9714  C  CD    . GLN B 1 476 ? 56.586  17.230  57.495  1.00 22.39 ? 476  GLN B CD    1 
ATOM   9715  O  OE1   . GLN B 1 476 ? 56.347  18.406  57.201  1.00 22.26 ? 476  GLN B OE1   1 
ATOM   9716  N  NE2   . GLN B 1 476 ? 55.889  16.210  57.001  1.00 20.61 ? 476  GLN B NE2   1 
ATOM   9717  N  N     . ILE B 1 477 ? 59.738  15.486  60.911  1.00 22.61 ? 477  ILE B N     1 
ATOM   9718  C  CA    . ILE B 1 477 ? 59.986  14.049  60.866  1.00 22.94 ? 477  ILE B CA    1 
ATOM   9719  C  C     . ILE B 1 477 ? 58.674  13.390  60.488  1.00 23.03 ? 477  ILE B C     1 
ATOM   9720  O  O     . ILE B 1 477 ? 57.623  13.943  60.732  1.00 22.83 ? 477  ILE B O     1 
ATOM   9721  C  CB    . ILE B 1 477 ? 60.416  13.512  62.268  1.00 23.26 ? 477  ILE B CB    1 
ATOM   9722  C  CG1   . ILE B 1 477 ? 61.403  14.453  62.987  1.00 23.85 ? 477  ILE B CG1   1 
ATOM   9723  C  CG2   . ILE B 1 477 ? 61.000  12.110  62.154  1.00 23.54 ? 477  ILE B CG2   1 
ATOM   9724  C  CD1   . ILE B 1 477 ? 62.506  14.973  62.138  1.00 24.87 ? 477  ILE B CD1   1 
ATOM   9725  N  N     . SER B 1 478 ? 58.720  12.202  59.912  1.00 23.59 ? 478  SER B N     1 
ATOM   9726  C  CA    . SER B 1 478 ? 57.498  11.413  59.707  1.00 24.14 ? 478  SER B CA    1 
ATOM   9727  C  C     . SER B 1 478 ? 57.026  10.739  60.998  1.00 24.58 ? 478  SER B C     1 
ATOM   9728  O  O     . SER B 1 478 ? 57.815  10.525  61.922  1.00 24.94 ? 478  SER B O     1 
ATOM   9729  C  CB    . SER B 1 478 ? 57.739  10.340  58.663  1.00 24.18 ? 478  SER B CB    1 
ATOM   9730  O  OG    . SER B 1 478 ? 58.652  9.366   59.154  1.00 25.02 ? 478  SER B OG    1 
ATOM   9731  N  N     . ARG B 1 479 ? 55.752  10.364  61.042  1.00 24.88 ? 479  ARG B N     1 
ATOM   9732  C  CA    . ARG B 1 479 ? 55.171  9.704   62.225  1.00 25.29 ? 479  ARG B CA    1 
ATOM   9733  C  C     . ARG B 1 479 ? 55.936  8.449   62.676  1.00 24.88 ? 479  ARG B C     1 
ATOM   9734  O  O     . ARG B 1 479 ? 56.232  8.300   63.858  1.00 24.87 ? 479  ARG B O     1 
ATOM   9735  C  CB    . ARG B 1 479 ? 53.692  9.350   61.990  1.00 25.41 ? 479  ARG B CB    1 
ATOM   9736  C  CG    . ARG B 1 479 ? 53.140  8.249   62.924  1.00 26.37 ? 479  ARG B CG    1 
ATOM   9737  C  CD    . ARG B 1 479 ? 51.649  7.988   62.776  1.00 27.89 ? 479  ARG B CD    1 
ATOM   9738  N  NE    . ARG B 1 479 ? 50.883  9.240   62.831  1.00 30.18 ? 479  ARG B NE    1 
ATOM   9739  C  CZ    . ARG B 1 479 ? 50.186  9.702   63.883  1.00 30.35 ? 479  ARG B CZ    1 
ATOM   9740  N  NH1   . ARG B 1 479 ? 49.548  10.861  63.781  1.00 29.90 ? 479  ARG B NH1   1 
ATOM   9741  N  NH2   . ARG B 1 479 ? 50.110  9.026   65.027  1.00 30.82 ? 479  ARG B NH2   1 
ATOM   9742  N  N     . GLY B 1 480 ? 56.230  7.549   61.742  1.00 24.63 ? 480  GLY B N     1 
ATOM   9743  C  CA    . GLY B 1 480 ? 56.918  6.308   62.069  1.00 24.72 ? 480  GLY B CA    1 
ATOM   9744  C  C     . GLY B 1 480 ? 58.292  6.522   62.695  1.00 24.74 ? 480  GLY B C     1 
ATOM   9745  O  O     . GLY B 1 480 ? 58.689  5.783   63.584  1.00 24.74 ? 480  GLY B O     1 
ATOM   9746  N  N     . GLN B 1 481 ? 59.001  7.555   62.240  1.00 24.83 ? 481  GLN B N     1 
ATOM   9747  C  CA    . GLN B 1 481 ? 60.356  7.861   62.710  1.00 24.56 ? 481  GLN B CA    1 
ATOM   9748  C  C     . GLN B 1 481 ? 60.406  8.881   63.843  1.00 24.43 ? 481  GLN B C     1 
ATOM   9749  O  O     . GLN B 1 481 ? 61.458  9.060   64.446  1.00 24.23 ? 481  GLN B O     1 
ATOM   9750  C  CB    . GLN B 1 481 ? 61.220  8.394   61.551  1.00 24.61 ? 481  GLN B CB    1 
ATOM   9751  C  CG    . GLN B 1 481 ? 61.407  7.411   60.384  1.00 23.77 ? 481  GLN B CG    1 
ATOM   9752  C  CD    . GLN B 1 481 ? 62.654  7.686   59.568  1.00 22.38 ? 481  GLN B CD    1 
ATOM   9753  O  OE1   . GLN B 1 481 ? 63.077  8.833   59.433  1.00 20.79 ? 481  GLN B OE1   1 
ATOM   9754  N  NE2   . GLN B 1 481 ? 63.245  6.629   59.017  1.00 22.91 ? 481  GLN B NE2   1 
ATOM   9755  N  N     . SER B 1 482 ? 59.285  9.539   64.140  1.00 24.50 ? 482  SER B N     1 
ATOM   9756  C  CA    . SER B 1 482 ? 59.288  10.700  65.048  1.00 24.28 ? 482  SER B CA    1 
ATOM   9757  C  C     . SER B 1 482 ? 59.566  10.363  66.505  1.00 24.16 ? 482  SER B C     1 
ATOM   9758  O  O     . SER B 1 482 ? 59.950  11.240  67.275  1.00 24.60 ? 482  SER B O     1 
ATOM   9759  C  CB    . SER B 1 482 ? 57.979  11.487  64.961  1.00 24.08 ? 482  SER B CB    1 
ATOM   9760  O  OG    . SER B 1 482 ? 56.899  10.726  65.447  1.00 23.88 ? 482  SER B OG    1 
ATOM   9761  N  N     . HIS B 1 483 ? 59.387  9.107   66.891  1.00 23.98 ? 483  HIS B N     1 
ATOM   9762  C  CA    . HIS B 1 483 ? 59.650  8.712   68.276  1.00 23.97 ? 483  HIS B CA    1 
ATOM   9763  C  C     . HIS B 1 483 ? 61.152  8.707   68.630  1.00 23.40 ? 483  HIS B C     1 
ATOM   9764  O  O     . HIS B 1 483 ? 61.511  8.524   69.787  1.00 23.14 ? 483  HIS B O     1 
ATOM   9765  C  CB    . HIS B 1 483 ? 58.986  7.365   68.586  1.00 24.05 ? 483  HIS B CB    1 
ATOM   9766  C  CG    . HIS B 1 483 ? 59.732  6.184   68.059  1.00 25.38 ? 483  HIS B CG    1 
ATOM   9767  N  ND1   . HIS B 1 483 ? 60.456  6.221   66.889  1.00 26.98 ? 483  HIS B ND1   1 
ATOM   9768  C  CD2   . HIS B 1 483 ? 59.864  4.927   68.544  1.00 26.99 ? 483  HIS B CD2   1 
ATOM   9769  C  CE1   . HIS B 1 483 ? 61.007  5.039   66.676  1.00 27.32 ? 483  HIS B CE1   1 
ATOM   9770  N  NE2   . HIS B 1 483 ? 60.668  4.237   67.669  1.00 27.48 ? 483  HIS B NE2   1 
ATOM   9771  N  N     . LEU B 1 484 ? 62.011  8.923   67.630  1.00 23.13 ? 484  LEU B N     1 
ATOM   9772  C  CA    . LEU B 1 484 ? 63.455  9.121   67.837  1.00 22.78 ? 484  LEU B CA    1 
ATOM   9773  C  C     . LEU B 1 484 ? 63.846  10.573  67.550  1.00 22.45 ? 484  LEU B C     1 
ATOM   9774  O  O     . LEU B 1 484 ? 64.944  10.850  67.085  1.00 21.98 ? 484  LEU B O     1 
ATOM   9775  C  CB    . LEU B 1 484 ? 64.284  8.188   66.939  1.00 22.61 ? 484  LEU B CB    1 
ATOM   9776  C  CG    . LEU B 1 484 ? 63.672  6.853   66.522  1.00 22.46 ? 484  LEU B CG    1 
ATOM   9777  C  CD1   . LEU B 1 484 ? 64.308  6.366   65.220  1.00 22.76 ? 484  LEU B CD1   1 
ATOM   9778  C  CD2   . LEU B 1 484 ? 63.808  5.808   67.641  1.00 22.68 ? 484  LEU B CD2   1 
ATOM   9779  N  N     . ALA B 1 485 ? 62.938  11.500  67.810  1.00 22.42 ? 485  ALA B N     1 
ATOM   9780  C  CA    . ALA B 1 485 ? 63.262  12.901  67.655  1.00 22.46 ? 485  ALA B CA    1 
ATOM   9781  C  C     . ALA B 1 485 ? 64.124  13.228  68.857  1.00 22.66 ? 485  ALA B C     1 
ATOM   9782  O  O     . ALA B 1 485 ? 63.819  12.776  69.965  1.00 22.52 ? 485  ALA B O     1 
ATOM   9783  C  CB    . ALA B 1 485 ? 62.008  13.752  67.637  1.00 22.27 ? 485  ALA B CB    1 
ATOM   9784  N  N     . PRO B 1 486 ? 65.212  13.968  68.643  1.00 22.85 ? 486  PRO B N     1 
ATOM   9785  C  CA    . PRO B 1 486 ? 66.039  14.469  69.744  1.00 22.97 ? 486  PRO B CA    1 
ATOM   9786  C  C     . PRO B 1 486 ? 65.209  15.177  70.802  1.00 23.38 ? 486  PRO B C     1 
ATOM   9787  O  O     . PRO B 1 486 ? 64.174  15.765  70.473  1.00 23.27 ? 486  PRO B O     1 
ATOM   9788  C  CB    . PRO B 1 486 ? 66.952  15.466  69.057  1.00 22.86 ? 486  PRO B CB    1 
ATOM   9789  C  CG    . PRO B 1 486 ? 67.088  14.921  67.692  1.00 23.19 ? 486  PRO B CG    1 
ATOM   9790  C  CD    . PRO B 1 486 ? 65.750  14.369  67.334  1.00 22.83 ? 486  PRO B CD    1 
ATOM   9791  N  N     . ILE B 1 487 ? 65.659  15.114  72.054  1.00 23.61 ? 487  ILE B N     1 
ATOM   9792  C  CA    . ILE B 1 487 ? 64.870  15.650  73.157  1.00 23.84 ? 487  ILE B CA    1 
ATOM   9793  C  C     . ILE B 1 487 ? 64.920  17.177  73.236  1.00 23.66 ? 487  ILE B C     1 
ATOM   9794  O  O     . ILE B 1 487 ? 64.185  17.764  74.022  1.00 23.93 ? 487  ILE B O     1 
ATOM   9795  C  CB    . ILE B 1 487 ? 65.211  14.973  74.540  1.00 24.22 ? 487  ILE B CB    1 
ATOM   9796  C  CG1   . ILE B 1 487 ? 66.682  14.522  74.662  1.00 24.86 ? 487  ILE B CG1   1 
ATOM   9797  C  CG2   . ILE B 1 487 ? 64.292  13.753  74.767  1.00 24.65 ? 487  ILE B CG2   1 
ATOM   9798  C  CD1   . ILE B 1 487 ? 67.708  15.650  74.588  1.00 25.53 ? 487  ILE B CD1   1 
ATOM   9799  N  N     . ASN B 1 488 ? 65.759  17.813  72.410  1.00 23.46 ? 488  ASN B N     1 
ATOM   9800  C  CA    . ASN B 1 488 ? 65.839  19.283  72.330  1.00 23.10 ? 488  ASN B CA    1 
ATOM   9801  C  C     . ASN B 1 488 ? 64.831  19.876  71.350  1.00 22.85 ? 488  ASN B C     1 
ATOM   9802  O  O     . ASN B 1 488 ? 64.601  21.086  71.356  1.00 22.80 ? 488  ASN B O     1 
ATOM   9803  C  CB    . ASN B 1 488 ? 67.285  19.758  72.028  1.00 23.09 ? 488  ASN B CB    1 
ATOM   9804  C  CG    . ASN B 1 488 ? 67.706  19.586  70.553  1.00 23.67 ? 488  ASN B CG    1 
ATOM   9805  O  OD1   . ASN B 1 488 ? 67.791  18.471  70.024  1.00 24.33 ? 488  ASN B OD1   1 
ATOM   9806  N  ND2   . ASN B 1 488 ? 68.019  20.704  69.904  1.00 23.96 ? 488  ASN B ND2   1 
ATOM   9807  N  N     . TYR B 1 489 ? 64.243  19.010  70.519  1.00 22.57 ? 489  TYR B N     1 
ATOM   9808  C  CA    . TYR B 1 489 ? 63.194  19.365  69.561  1.00 22.21 ? 489  TYR B CA    1 
ATOM   9809  C  C     . TYR B 1 489 ? 61.862  19.615  70.255  1.00 22.57 ? 489  TYR B C     1 
ATOM   9810  O  O     . TYR B 1 489 ? 61.353  18.738  70.944  1.00 22.95 ? 489  TYR B O     1 
ATOM   9811  C  CB    . TYR B 1 489 ? 62.966  18.208  68.583  1.00 22.03 ? 489  TYR B CB    1 
ATOM   9812  C  CG    . TYR B 1 489 ? 63.986  18.031  67.475  1.00 21.69 ? 489  TYR B CG    1 
ATOM   9813  C  CD1   . TYR B 1 489 ? 65.314  18.424  67.633  1.00 21.33 ? 489  TYR B CD1   1 
ATOM   9814  C  CD2   . TYR B 1 489 ? 63.613  17.452  66.265  1.00 21.07 ? 489  TYR B CD2   1 
ATOM   9815  C  CE1   . TYR B 1 489 ? 66.231  18.254  66.620  1.00 20.93 ? 489  TYR B CE1   1 
ATOM   9816  C  CE2   . TYR B 1 489 ? 64.519  17.286  65.244  1.00 21.05 ? 489  TYR B CE2   1 
ATOM   9817  C  CZ    . TYR B 1 489 ? 65.833  17.681  65.428  1.00 21.16 ? 489  TYR B CZ    1 
ATOM   9818  O  OH    . TYR B 1 489 ? 66.752  17.511  64.419  1.00 19.71 ? 489  TYR B OH    1 
ATOM   9819  N  N     . MET B 1 490 ? 61.261  20.776  70.027  1.00 22.87 ? 490  MET B N     1 
ATOM   9820  C  CA    . MET B 1 490 ? 59.966  21.109  70.618  1.00 23.17 ? 490  MET B CA    1 
ATOM   9821  C  C     . MET B 1 490 ? 58.849  20.937  69.594  1.00 22.86 ? 490  MET B C     1 
ATOM   9822  O  O     . MET B 1 490 ? 58.887  21.573  68.552  1.00 22.72 ? 490  MET B O     1 
ATOM   9823  C  CB    . MET B 1 490 ? 59.985  22.549  71.111  1.00 23.60 ? 490  MET B CB    1 
ATOM   9824  C  CG    . MET B 1 490 ? 61.296  22.974  71.739  1.00 25.82 ? 490  MET B CG    1 
ATOM   9825  S  SD    . MET B 1 490 ? 61.066  24.231  73.028  1.00 31.87 ? 490  MET B SD    1 
ATOM   9826  C  CE    . MET B 1 490 ? 60.616  25.728  71.984  1.00 31.50 ? 490  MET B CE    1 
ATOM   9827  N  N     . ARG B 1 491 ? 57.855  20.098  69.888  1.00 22.71 ? 491  ARG B N     1 
ATOM   9828  C  CA    . ARG B 1 491 ? 56.760  19.843  68.951  1.00 23.07 ? 491  ARG B CA    1 
ATOM   9829  C  C     . ARG B 1 491 ? 55.811  21.017  68.891  1.00 22.74 ? 491  ARG B C     1 
ATOM   9830  O  O     . ARG B 1 491 ? 55.422  21.527  69.931  1.00 22.58 ? 491  ARG B O     1 
ATOM   9831  C  CB    . ARG B 1 491 ? 55.927  18.637  69.371  1.00 23.42 ? 491  ARG B CB    1 
ATOM   9832  C  CG    . ARG B 1 491 ? 56.666  17.340  69.431  1.00 25.25 ? 491  ARG B CG    1 
ATOM   9833  C  CD    . ARG B 1 491 ? 56.260  16.496  70.648  1.00 28.61 ? 491  ARG B CD    1 
ATOM   9834  N  NE    . ARG B 1 491 ? 54.876  16.052  70.535  1.00 31.24 ? 491  ARG B NE    1 
ATOM   9835  C  CZ    . ARG B 1 491 ? 54.452  15.107  69.683  1.00 33.09 ? 491  ARG B CZ    1 
ATOM   9836  N  NH1   . ARG B 1 491 ? 55.314  14.488  68.869  1.00 33.72 ? 491  ARG B NH1   1 
ATOM   9837  N  NH2   . ARG B 1 491 ? 53.159  14.765  69.653  1.00 32.83 ? 491  ARG B NH2   1 
ATOM   9838  N  N     . ARG B 1 492 ? 55.412  21.415  67.683  1.00 22.42 ? 492  ARG B N     1 
ATOM   9839  C  CA    . ARG B 1 492 ? 54.403  22.461  67.508  1.00 22.52 ? 492  ARG B CA    1 
ATOM   9840  C  C     . ARG B 1 492 ? 53.162  22.023  66.734  1.00 22.02 ? 492  ARG B C     1 
ATOM   9841  O  O     . ARG B 1 492 ? 52.153  22.694  66.805  1.00 22.20 ? 492  ARG B O     1 
ATOM   9842  C  CB    . ARG B 1 492 ? 54.988  23.699  66.808  1.00 22.84 ? 492  ARG B CB    1 
ATOM   9843  C  CG    . ARG B 1 492 ? 56.132  24.397  67.525  1.00 23.73 ? 492  ARG B CG    1 
ATOM   9844  C  CD    . ARG B 1 492 ? 55.735  25.104  68.817  1.00 25.24 ? 492  ARG B CD    1 
ATOM   9845  N  NE    . ARG B 1 492 ? 56.419  24.504  69.960  1.00 27.30 ? 492  ARG B NE    1 
ATOM   9846  C  CZ    . ARG B 1 492 ? 56.462  25.015  71.187  1.00 28.63 ? 492  ARG B CZ    1 
ATOM   9847  N  NH1   . ARG B 1 492 ? 55.857  26.167  71.480  1.00 30.16 ? 492  ARG B NH1   1 
ATOM   9848  N  NH2   . ARG B 1 492 ? 57.122  24.360  72.134  1.00 28.39 ? 492  ARG B NH2   1 
ATOM   9849  N  N     . GLN B 1 493 ? 53.222  20.939  65.974  1.00 21.78 ? 493  GLN B N     1 
ATOM   9850  C  CA    . GLN B 1 493 ? 52.075  20.538  65.152  1.00 21.61 ? 493  GLN B CA    1 
ATOM   9851  C  C     . GLN B 1 493 ? 52.166  19.097  64.740  1.00 21.21 ? 493  GLN B C     1 
ATOM   9852  O  O     . GLN B 1 493 ? 53.163  18.664  64.178  1.00 21.05 ? 493  GLN B O     1 
ATOM   9853  C  CB    . GLN B 1 493 ? 51.952  21.398  63.884  1.00 21.78 ? 493  GLN B CB    1 
ATOM   9854  C  CG    . GLN B 1 493 ? 50.664  21.155  63.058  1.00 21.95 ? 493  GLN B CG    1 
ATOM   9855  C  CD    . GLN B 1 493 ? 50.658  21.882  61.710  1.00 22.52 ? 493  GLN B CD    1 
ATOM   9856  O  OE1   . GLN B 1 493 ? 51.542  22.692  61.424  1.00 23.35 ? 493  GLN B OE1   1 
ATOM   9857  N  NE2   . GLN B 1 493 ? 49.668  21.582  60.879  1.00 21.60 ? 493  GLN B NE2   1 
ATOM   9858  N  N     . THR B 1 494 ? 51.092  18.368  64.988  1.00 21.07 ? 494  THR B N     1 
ATOM   9859  C  CA    . THR B 1 494 ? 51.001  16.987  64.577  1.00 20.71 ? 494  THR B CA    1 
ATOM   9860  C  C     . THR B 1 494 ? 50.127  16.948  63.349  1.00 20.62 ? 494  THR B C     1 
ATOM   9861  O  O     . THR B 1 494 ? 48.971  17.387  63.392  1.00 20.60 ? 494  THR B O     1 
ATOM   9862  C  CB    . THR B 1 494 ? 50.396  16.157  65.692  1.00 20.57 ? 494  THR B CB    1 
ATOM   9863  O  OG1   . THR B 1 494 ? 51.395  15.918  66.686  1.00 20.24 ? 494  THR B OG1   1 
ATOM   9864  C  CG2   . THR B 1 494 ? 50.029  14.767  65.217  1.00 20.89 ? 494  THR B CG2   1 
ATOM   9865  N  N     . LEU B 1 495 ? 50.708  16.465  62.249  1.00 20.42 ? 495  LEU B N     1 
ATOM   9866  C  CA    . LEU B 1 495 ? 49.958  16.112  61.047  1.00 19.97 ? 495  LEU B CA    1 
ATOM   9867  C  C     . LEU B 1 495 ? 49.580  14.635  61.161  1.00 19.65 ? 495  LEU B C     1 
ATOM   9868  O  O     . LEU B 1 495 ? 49.903  13.990  62.152  1.00 19.38 ? 495  LEU B O     1 
ATOM   9869  C  CB    . LEU B 1 495 ? 50.791  16.347  59.792  1.00 19.93 ? 495  LEU B CB    1 
ATOM   9870  C  CG    . LEU B 1 495 ? 51.622  17.626  59.638  1.00 19.87 ? 495  LEU B CG    1 
ATOM   9871  C  CD1   . LEU B 1 495 ? 51.879  17.895  58.163  1.00 20.12 ? 495  LEU B CD1   1 
ATOM   9872  C  CD2   . LEU B 1 495 ? 50.965  18.832  60.268  1.00 20.26 ? 495  LEU B CD2   1 
ATOM   9873  N  N     . LYS B 1 496 ? 48.907  14.106  60.143  1.00 19.46 ? 496  LYS B N     1 
ATOM   9874  C  CA    . LYS B 1 496 ? 48.395  12.736  60.171  1.00 19.31 ? 496  LYS B CA    1 
ATOM   9875  C  C     . LYS B 1 496 ? 49.509  11.700  60.035  1.00 19.45 ? 496  LYS B C     1 
ATOM   9876  O  O     . LYS B 1 496 ? 49.502  10.697  60.733  1.00 19.51 ? 496  LYS B O     1 
ATOM   9877  C  CB    . LYS B 1 496 ? 47.369  12.519  59.064  1.00 19.13 ? 496  LYS B CB    1 
ATOM   9878  C  CG    . LYS B 1 496 ? 46.468  11.337  59.311  1.00 18.94 ? 496  LYS B CG    1 
ATOM   9879  C  CD    . LYS B 1 496 ? 46.175  10.589  58.025  1.00 19.46 ? 496  LYS B CD    1 
ATOM   9880  C  CE    . LYS B 1 496 ? 44.939  9.717   58.157  1.00 19.94 ? 496  LYS B CE    1 
ATOM   9881  N  NZ    . LYS B 1 496 ? 44.518  9.188   56.842  1.00 20.83 ? 496  LYS B NZ    1 
ATOM   9882  N  N     . ASN B 1 497 ? 50.454  11.933  59.128  1.00 19.59 ? 497  ASN B N     1 
ATOM   9883  C  CA    . ASN B 1 497 ? 51.580  11.031  58.970  1.00 19.61 ? 497  ASN B CA    1 
ATOM   9884  C  C     . ASN B 1 497 ? 52.917  11.604  59.386  1.00 19.59 ? 497  ASN B C     1 
ATOM   9885  O  O     . ASN B 1 497 ? 53.911  10.914  59.266  1.00 19.78 ? 497  ASN B O     1 
ATOM   9886  C  CB    . ASN B 1 497 ? 51.677  10.513  57.537  1.00 19.77 ? 497  ASN B CB    1 
ATOM   9887  C  CG    . ASN B 1 497 ? 52.472  9.209   57.451  1.00 20.34 ? 497  ASN B CG    1 
ATOM   9888  O  OD1   . ASN B 1 497 ? 52.177  8.242   58.171  1.00 20.30 ? 497  ASN B OD1   1 
ATOM   9889  N  ND2   . ASN B 1 497 ? 53.509  9.191   56.607  1.00 19.79 ? 497  ASN B ND2   1 
ATOM   9890  N  N     . ALA B 1 498 ? 52.948  12.837  59.890  1.00 19.71 ? 498  ALA B N     1 
ATOM   9891  C  CA    . ALA B 1 498 ? 54.193  13.456  60.368  1.00 19.66 ? 498  ALA B CA    1 
ATOM   9892  C  C     . ALA B 1 498 ? 54.045  14.168  61.735  1.00 19.90 ? 498  ALA B C     1 
ATOM   9893  O  O     . ALA B 1 498 ? 52.948  14.229  62.300  1.00 19.95 ? 498  ALA B O     1 
ATOM   9894  C  CB    . ALA B 1 498 ? 54.687  14.419  59.328  1.00 19.63 ? 498  ALA B CB    1 
ATOM   9895  N  N     . GLU B 1 499 ? 55.170  14.636  62.285  1.00 20.11 ? 499  GLU B N     1 
ATOM   9896  C  CA    . GLU B 1 499 ? 55.195  15.639  63.364  1.00 20.25 ? 499  GLU B CA    1 
ATOM   9897  C  C     . GLU B 1 499 ? 56.182  16.758  62.975  1.00 20.12 ? 499  GLU B C     1 
ATOM   9898  O  O     . GLU B 1 499 ? 57.165  16.525  62.275  1.00 20.33 ? 499  GLU B O     1 
ATOM   9899  C  CB    . GLU B 1 499 ? 55.561  15.055  64.745  1.00 20.22 ? 499  GLU B CB    1 
ATOM   9900  C  CG    . GLU B 1 499 ? 55.186  13.593  65.000  1.00 22.09 ? 499  GLU B CG    1 
ATOM   9901  C  CD    . GLU B 1 499 ? 53.842  13.389  65.703  1.00 24.54 ? 499  GLU B CD    1 
ATOM   9902  O  OE1   . GLU B 1 499 ? 53.680  13.894  66.826  1.00 24.67 ? 499  GLU B OE1   1 
ATOM   9903  O  OE2   . GLU B 1 499 ? 52.946  12.696  65.145  1.00 26.86 ? 499  GLU B OE2   1 
ATOM   9904  N  N     . ARG B 1 500 ? 55.903  17.980  63.410  1.00 19.96 ? 500  ARG B N     1 
ATOM   9905  C  CA    . ARG B 1 500 ? 56.749  19.117  63.087  1.00 19.95 ? 500  ARG B CA    1 
ATOM   9906  C  C     . ARG B 1 500 ? 57.287  19.677  64.377  1.00 19.95 ? 500  ARG B C     1 
ATOM   9907  O  O     . ARG B 1 500 ? 56.631  19.556  65.422  1.00 20.26 ? 500  ARG B O     1 
ATOM   9908  C  CB    . ARG B 1 500 ? 55.946  20.181  62.339  1.00 20.28 ? 500  ARG B CB    1 
ATOM   9909  C  CG    . ARG B 1 500 ? 55.024  19.600  61.262  1.00 20.60 ? 500  ARG B CG    1 
ATOM   9910  C  CD    . ARG B 1 500 ? 55.200  20.159  59.876  1.00 20.55 ? 500  ARG B CD    1 
ATOM   9911  N  NE    . ARG B 1 500 ? 54.137  21.098  59.553  1.00 22.19 ? 500  ARG B NE    1 
ATOM   9912  C  CZ    . ARG B 1 500 ? 53.640  21.332  58.336  1.00 23.54 ? 500  ARG B CZ    1 
ATOM   9913  N  NH1   . ARG B 1 500 ? 54.100  20.697  57.268  1.00 24.07 ? 500  ARG B NH1   1 
ATOM   9914  N  NH2   . ARG B 1 500 ? 52.661  22.224  58.194  1.00 24.31 ? 500  ARG B NH2   1 
ATOM   9915  N  N     . TYR B 1 501 ? 58.472  20.286  64.307  1.00 19.67 ? 501  TYR B N     1 
ATOM   9916  C  CA    . TYR B 1 501 ? 59.194  20.758  65.490  1.00 19.45 ? 501  TYR B CA    1 
ATOM   9917  C  C     . TYR B 1 501 ? 59.885  22.086  65.244  1.00 19.83 ? 501  TYR B C     1 
ATOM   9918  O  O     . TYR B 1 501 ? 60.083  22.487  64.099  1.00 20.08 ? 501  TYR B O     1 
ATOM   9919  C  CB    . TYR B 1 501 ? 60.279  19.763  65.894  1.00 19.24 ? 501  TYR B CB    1 
ATOM   9920  C  CG    . TYR B 1 501 ? 59.842  18.332  66.099  1.00 18.47 ? 501  TYR B CG    1 
ATOM   9921  C  CD1   . TYR B 1 501 ? 59.568  17.499  65.020  1.00 18.25 ? 501  TYR B CD1   1 
ATOM   9922  C  CD2   . TYR B 1 501 ? 59.751  17.798  67.367  1.00 18.23 ? 501  TYR B CD2   1 
ATOM   9923  C  CE1   . TYR B 1 501 ? 59.185  16.190  65.206  1.00 17.98 ? 501  TYR B CE1   1 
ATOM   9924  C  CE2   . TYR B 1 501 ? 59.385  16.489  67.562  1.00 18.95 ? 501  TYR B CE2   1 
ATOM   9925  C  CZ    . TYR B 1 501 ? 59.106  15.687  66.481  1.00 18.84 ? 501  TYR B CZ    1 
ATOM   9926  O  OH    . TYR B 1 501 ? 58.753  14.374  66.695  1.00 20.05 ? 501  TYR B OH    1 
ATOM   9927  N  N     . ILE B 1 502 ? 60.265  22.762  66.325  1.00 20.28 ? 502  ILE B N     1 
ATOM   9928  C  CA    . ILE B 1 502 ? 61.186  23.891  66.241  1.00 20.61 ? 502  ILE B CA    1 
ATOM   9929  C  C     . ILE B 1 502 ? 62.333  23.730  67.236  1.00 21.20 ? 502  ILE B C     1 
ATOM   9930  O  O     . ILE B 1 502 ? 62.178  23.106  68.285  1.00 21.38 ? 502  ILE B O     1 
ATOM   9931  C  CB    . ILE B 1 502 ? 60.461  25.253  66.458  1.00 20.73 ? 502  ILE B CB    1 
ATOM   9932  C  CG1   . ILE B 1 502 ? 59.990  25.418  67.918  1.00 20.55 ? 502  ILE B CG1   1 
ATOM   9933  C  CG2   . ILE B 1 502 ? 59.309  25.401  65.472  1.00 20.19 ? 502  ILE B CG2   1 
ATOM   9934  C  CD1   . ILE B 1 502 ? 59.298  26.751  68.214  1.00 19.92 ? 502  ILE B CD1   1 
ATOM   9935  N  N     . ILE B 1 503 ? 63.488  24.279  66.869  1.00 21.73 ? 503  ILE B N     1 
ATOM   9936  C  CA    . ILE B 1 503 ? 64.635  24.434  67.761  1.00 22.17 ? 503  ILE B CA    1 
ATOM   9937  C  C     . ILE B 1 503 ? 65.081  25.914  67.694  1.00 22.48 ? 503  ILE B C     1 
ATOM   9938  O  O     . ILE B 1 503 ? 64.675  26.620  66.775  1.00 22.52 ? 503  ILE B O     1 
ATOM   9939  C  CB    . ILE B 1 503 ? 65.773  23.431  67.371  1.00 22.18 ? 503  ILE B CB    1 
ATOM   9940  C  CG1   . ILE B 1 503 ? 66.093  23.473  65.875  1.00 22.44 ? 503  ILE B CG1   1 
ATOM   9941  C  CG2   . ILE B 1 503 ? 65.373  22.023  67.728  1.00 21.73 ? 503  ILE B CG2   1 
ATOM   9942  C  CD1   . ILE B 1 503 ? 67.362  22.710  65.510  1.00 22.61 ? 503  ILE B CD1   1 
ATOM   9943  N  N     . PRO B 1 504 ? 65.878  26.396  68.652  1.00 22.94 ? 504  PRO B N     1 
ATOM   9944  C  CA    . PRO B 1 504 ? 66.272  27.819  68.687  1.00 23.10 ? 504  PRO B CA    1 
ATOM   9945  C  C     . PRO B 1 504 ? 67.043  28.264  67.449  1.00 23.29 ? 504  PRO B C     1 
ATOM   9946  O  O     . PRO B 1 504 ? 66.805  29.339  66.916  1.00 23.23 ? 504  PRO B O     1 
ATOM   9947  C  CB    . PRO B 1 504 ? 67.192  27.905  69.910  1.00 23.05 ? 504  PRO B CB    1 
ATOM   9948  C  CG    . PRO B 1 504 ? 66.888  26.697  70.721  1.00 23.09 ? 504  PRO B CG    1 
ATOM   9949  C  CD    . PRO B 1 504 ? 66.480  25.636  69.765  1.00 23.05 ? 504  PRO B CD    1 
ATOM   9950  N  N     . GLU B 1 505 ? 67.978  27.420  67.028  1.00 23.69 ? 505  GLU B N     1 
ATOM   9951  C  CA    . GLU B 1 505 ? 68.802  27.623  65.832  1.00 23.69 ? 505  GLU B CA    1 
ATOM   9952  C  C     . GLU B 1 505 ? 67.947  27.769  64.570  1.00 23.50 ? 505  GLU B C     1 
ATOM   9953  O  O     . GLU B 1 505 ? 68.292  28.514  63.663  1.00 23.72 ? 505  GLU B O     1 
ATOM   9954  C  CB    . GLU B 1 505 ? 69.775  26.431  65.715  1.00 23.85 ? 505  GLU B CB    1 
ATOM   9955  C  CG    . GLU B 1 505 ? 70.607  26.305  64.442  1.00 24.02 ? 505  GLU B CG    1 
ATOM   9956  C  CD    . GLU B 1 505 ? 71.506  25.071  64.466  1.00 23.73 ? 505  GLU B CD    1 
ATOM   9957  O  OE1   . GLU B 1 505 ? 71.257  24.167  65.286  1.00 23.34 ? 505  GLU B OE1   1 
ATOM   9958  O  OE2   . GLU B 1 505 ? 72.467  24.999  63.673  1.00 23.59 ? 505  GLU B OE2   1 
ATOM   9959  N  N     . LEU B 1 506 ? 66.826  27.062  64.519  1.00 23.33 ? 506  LEU B N     1 
ATOM   9960  C  CA    . LEU B 1 506 ? 65.917  27.157  63.381  1.00 23.00 ? 506  LEU B CA    1 
ATOM   9961  C  C     . LEU B 1 506 ? 65.194  28.497  63.345  1.00 22.75 ? 506  LEU B C     1 
ATOM   9962  O  O     . LEU B 1 506 ? 64.950  29.047  62.286  1.00 22.40 ? 506  LEU B O     1 
ATOM   9963  C  CB    . LEU B 1 506 ? 64.893  26.030  63.435  1.00 22.84 ? 506  LEU B CB    1 
ATOM   9964  C  CG    . LEU B 1 506 ? 64.280  25.724  62.079  1.00 22.98 ? 506  LEU B CG    1 
ATOM   9965  C  CD1   . LEU B 1 506 ? 65.249  24.933  61.219  1.00 23.70 ? 506  LEU B CD1   1 
ATOM   9966  C  CD2   . LEU B 1 506 ? 63.015  24.958  62.252  1.00 23.27 ? 506  LEU B CD2   1 
ATOM   9967  N  N     . LYS B 1 507 ? 64.850  29.001  64.521  1.00 22.75 ? 507  LYS B N     1 
ATOM   9968  C  CA    . LYS B 1 507 ? 64.108  30.236  64.657  1.00 22.74 ? 507  LYS B CA    1 
ATOM   9969  C  C     . LYS B 1 507 ? 65.037  31.427  64.500  1.00 22.95 ? 507  LYS B C     1 
ATOM   9970  O  O     . LYS B 1 507 ? 64.606  32.487  64.046  1.00 22.96 ? 507  LYS B O     1 
ATOM   9971  C  CB    . LYS B 1 507 ? 63.397  30.284  66.015  1.00 22.79 ? 507  LYS B CB    1 
ATOM   9972  C  CG    . LYS B 1 507 ? 61.865  30.329  65.926  1.00 23.21 ? 507  LYS B CG    1 
ATOM   9973  C  CD    . LYS B 1 507 ? 61.270  28.999  65.446  1.00 23.55 ? 507  LYS B CD    1 
ATOM   9974  C  CE    . LYS B 1 507 ? 60.047  29.185  64.527  1.00 23.53 ? 507  LYS B CE    1 
ATOM   9975  N  NZ    . LYS B 1 507 ? 60.241  28.576  63.175  1.00 22.38 ? 507  LYS B NZ    1 
ATOM   9976  N  N     . GLU B 1 508 ? 66.309  31.257  64.871  1.00 23.12 ? 508  GLU B N     1 
ATOM   9977  C  CA    . GLU B 1 508 ? 67.297  32.326  64.717  1.00 23.16 ? 508  GLU B CA    1 
ATOM   9978  C  C     . GLU B 1 508 ? 67.497  32.627  63.243  1.00 22.85 ? 508  GLU B C     1 
ATOM   9979  O  O     . GLU B 1 508 ? 67.489  33.789  62.843  1.00 23.01 ? 508  GLU B O     1 
ATOM   9980  C  CB    . GLU B 1 508 ? 68.650  31.968  65.351  1.00 23.37 ? 508  GLU B CB    1 
ATOM   9981  C  CG    . GLU B 1 508 ? 69.564  33.185  65.572  1.00 24.14 ? 508  GLU B CG    1 
ATOM   9982  C  CD    . GLU B 1 508 ? 71.063  32.859  65.610  1.00 24.85 ? 508  GLU B CD    1 
ATOM   9983  O  OE1   . GLU B 1 508 ? 71.669  32.939  66.707  1.00 24.69 ? 508  GLU B OE1   1 
ATOM   9984  O  OE2   . GLU B 1 508 ? 71.650  32.550  64.543  1.00 24.67 ? 508  GLU B OE2   1 
ATOM   9985  N  N     . TYR B 1 509 ? 67.669  31.582  62.437  1.00 22.38 ? 509  TYR B N     1 
ATOM   9986  C  CA    . TYR B 1 509 ? 67.896  31.769  61.006  1.00 22.00 ? 509  TYR B CA    1 
ATOM   9987  C  C     . TYR B 1 509 ? 66.618  32.117  60.242  1.00 21.88 ? 509  TYR B C     1 
ATOM   9988  O  O     . TYR B 1 509 ? 66.692  32.688  59.164  1.00 22.08 ? 509  TYR B O     1 
ATOM   9989  C  CB    . TYR B 1 509 ? 68.629  30.570  60.397  1.00 21.84 ? 509  TYR B CB    1 
ATOM   9990  C  CG    . TYR B 1 509 ? 70.111  30.600  60.728  1.00 21.13 ? 509  TYR B CG    1 
ATOM   9991  C  CD1   . TYR B 1 509 ? 70.565  30.108  61.938  1.00 19.85 ? 509  TYR B CD1   1 
ATOM   9992  C  CD2   . TYR B 1 509 ? 71.043  31.157  59.848  1.00 19.94 ? 509  TYR B CD2   1 
ATOM   9993  C  CE1   . TYR B 1 509 ? 71.892  30.140  62.269  1.00 20.55 ? 509  TYR B CE1   1 
ATOM   9994  C  CE2   . TYR B 1 509 ? 72.384  31.192  60.166  1.00 19.56 ? 509  TYR B CE2   1 
ATOM   9995  C  CZ    . TYR B 1 509 ? 72.803  30.681  61.390  1.00 20.29 ? 509  TYR B CZ    1 
ATOM   9996  O  OH    . TYR B 1 509 ? 74.119  30.692  61.777  1.00 18.90 ? 509  TYR B OH    1 
ATOM   9997  N  N     . GLU B 1 510 ? 65.455  31.792  60.800  1.00 21.78 ? 510  GLU B N     1 
ATOM   9998  C  CA    . GLU B 1 510 ? 64.187  32.267  60.246  1.00 21.64 ? 510  GLU B CA    1 
ATOM   9999  C  C     . GLU B 1 510 ? 64.163  33.781  60.300  1.00 21.98 ? 510  GLU B C     1 
ATOM   10000 O  O     . GLU B 1 510 ? 63.688  34.418  59.381  1.00 22.04 ? 510  GLU B O     1 
ATOM   10001 C  CB    . GLU B 1 510 ? 62.997  31.701  61.030  1.00 21.45 ? 510  GLU B CB    1 
ATOM   10002 C  CG    . GLU B 1 510 ? 61.643  32.327  60.716  1.00 20.23 ? 510  GLU B CG    1 
ATOM   10003 C  CD    . GLU B 1 510 ? 60.551  31.824  61.643  1.00 19.67 ? 510  GLU B CD    1 
ATOM   10004 O  OE1   . GLU B 1 510 ? 60.410  30.601  61.779  1.00 18.88 ? 510  GLU B OE1   1 
ATOM   10005 O  OE2   . GLU B 1 510 ? 59.830  32.642  62.247  1.00 19.67 ? 510  GLU B OE2   1 
ATOM   10006 N  N     . ASP B 1 511 ? 64.673  34.339  61.394  1.00 22.67 ? 511  ASP B N     1 
ATOM   10007 C  CA    . ASP B 1 511 ? 64.741  35.785  61.591  1.00 23.29 ? 511  ASP B CA    1 
ATOM   10008 C  C     . ASP B 1 511 ? 65.596  36.444  60.526  1.00 23.57 ? 511  ASP B C     1 
ATOM   10009 O  O     . ASP B 1 511 ? 65.219  37.483  59.993  1.00 23.77 ? 511  ASP B O     1 
ATOM   10010 C  CB    . ASP B 1 511 ? 65.333  36.130  62.972  1.00 23.47 ? 511  ASP B CB    1 
ATOM   10011 C  CG    . ASP B 1 511 ? 64.273  36.428  64.018  1.00 24.27 ? 511  ASP B CG    1 
ATOM   10012 O  OD1   . ASP B 1 511 ? 63.094  36.602  63.654  1.00 25.70 ? 511  ASP B OD1   1 
ATOM   10013 O  OD2   . ASP B 1 511 ? 64.533  36.508  65.240  1.00 25.47 ? 511  ASP B OD2   1 
ATOM   10014 N  N     . LYS B 1 512 ? 66.750  35.846  60.232  1.00 23.88 ? 512  LYS B N     1 
ATOM   10015 C  CA    . LYS B 1 512 ? 67.673  36.385  59.228  1.00 24.15 ? 512  LYS B CA    1 
ATOM   10016 C  C     . LYS B 1 512 ? 67.028  36.439  57.840  1.00 24.36 ? 512  LYS B C     1 
ATOM   10017 O  O     . LYS B 1 512 ? 67.217  37.398  57.092  1.00 24.25 ? 512  LYS B O     1 
ATOM   10018 C  CB    . LYS B 1 512 ? 68.959  35.542  59.158  1.00 24.32 ? 512  LYS B CB    1 
ATOM   10019 C  CG    . LYS B 1 512 ? 69.780  35.474  60.463  1.00 24.56 ? 512  LYS B CG    1 
ATOM   10020 C  CD    . LYS B 1 512 ? 71.290  35.470  60.191  1.00 25.18 ? 512  LYS B CD    1 
ATOM   10021 C  CE    . LYS B 1 512 ? 72.098  35.219  61.461  1.00 25.63 ? 512  LYS B CE    1 
ATOM   10022 N  NZ    . LYS B 1 512 ? 72.158  33.772  61.793  1.00 25.87 ? 512  LYS B NZ    1 
ATOM   10023 N  N     . VAL B 1 513 ? 66.259  35.403  57.511  1.00 24.67 ? 513  VAL B N     1 
ATOM   10024 C  CA    . VAL B 1 513 ? 65.640  35.280  56.193  1.00 24.67 ? 513  VAL B CA    1 
ATOM   10025 C  C     . VAL B 1 513 ? 64.534  36.297  56.052  1.00 24.71 ? 513  VAL B C     1 
ATOM   10026 O  O     . VAL B 1 513 ? 64.461  36.991  55.056  1.00 24.55 ? 513  VAL B O     1 
ATOM   10027 C  CB    . VAL B 1 513 ? 65.016  33.878  55.963  1.00 24.55 ? 513  VAL B CB    1 
ATOM   10028 C  CG1   . VAL B 1 513 ? 64.308  33.825  54.629  1.00 24.73 ? 513  VAL B CG1   1 
ATOM   10029 C  CG2   . VAL B 1 513 ? 66.066  32.791  56.036  1.00 24.83 ? 513  VAL B CG2   1 
ATOM   10030 N  N     . LEU B 1 514 ? 63.678  36.379  57.062  1.00 24.89 ? 514  LEU B N     1 
ATOM   10031 C  CA    . LEU B 1 514 ? 62.441  37.134  56.944  1.00 25.23 ? 514  LEU B CA    1 
ATOM   10032 C  C     . LEU B 1 514 ? 62.674  38.641  57.018  1.00 25.22 ? 514  LEU B C     1 
ATOM   10033 O  O     . LEU B 1 514 ? 61.928  39.421  56.419  1.00 25.00 ? 514  LEU B O     1 
ATOM   10034 C  CB    . LEU B 1 514 ? 61.433  36.684  58.006  1.00 25.29 ? 514  LEU B CB    1 
ATOM   10035 C  CG    . LEU B 1 514 ? 60.170  36.021  57.453  1.00 26.05 ? 514  LEU B CG    1 
ATOM   10036 C  CD1   . LEU B 1 514 ? 60.503  34.718  56.712  1.00 26.44 ? 514  LEU B CD1   1 
ATOM   10037 C  CD2   . LEU B 1 514 ? 59.171  35.768  58.585  1.00 26.25 ? 514  LEU B CD2   1 
ATOM   10038 N  N     . THR B 1 515 ? 63.708  39.046  57.746  1.00 25.37 ? 515  THR B N     1 
ATOM   10039 C  CA    . THR B 1 515 ? 64.042  40.463  57.841  1.00 25.61 ? 515  THR B CA    1 
ATOM   10040 C  C     . THR B 1 515 ? 64.726  40.897  56.549  1.00 25.72 ? 515  THR B C     1 
ATOM   10041 O  O     . THR B 1 515 ? 64.344  41.906  55.961  1.00 25.65 ? 515  THR B O     1 
ATOM   10042 C  CB    . THR B 1 515 ? 64.930  40.774  59.069  1.00 25.70 ? 515  THR B CB    1 
ATOM   10043 O  OG1   . THR B 1 515 ? 65.300  39.572  59.752  1.00 25.18 ? 515  THR B OG1   1 
ATOM   10044 C  CG2   . THR B 1 515 ? 64.149  41.591  60.114  1.00 25.65 ? 515  THR B CG2   1 
ATOM   10045 N  N     . SER B 1 516 ? 65.718  40.118  56.111  1.00 25.80 ? 516  SER B N     1 
ATOM   10046 C  CA    . SER B 1 516 ? 66.391  40.350  54.834  1.00 25.96 ? 516  SER B CA    1 
ATOM   10047 C  C     . SER B 1 516 ? 65.381  40.420  53.698  1.00 26.09 ? 516  SER B C     1 
ATOM   10048 O  O     . SER B 1 516 ? 65.254  41.459  53.072  1.00 26.48 ? 516  SER B O     1 
ATOM   10049 C  CB    . SER B 1 516 ? 67.440  39.271  54.531  1.00 26.04 ? 516  SER B CB    1 
ATOM   10050 O  OG    . SER B 1 516 ? 68.750  39.697  54.876  1.00 26.45 ? 516  SER B OG    1 
ATOM   10051 N  N     . LYS B 1 517 ? 64.660  39.325  53.444  1.00 26.20 ? 517  LYS B N     1 
ATOM   10052 C  CA    . LYS B 1 517 ? 63.611  39.275  52.406  1.00 26.19 ? 517  LYS B CA    1 
ATOM   10053 C  C     . LYS B 1 517 ? 62.683  40.482  52.445  1.00 25.79 ? 517  LYS B C     1 
ATOM   10054 O  O     . LYS B 1 517 ? 62.360  41.036  51.415  1.00 25.74 ? 517  LYS B O     1 
ATOM   10055 C  CB    . LYS B 1 517 ? 62.761  37.995  52.510  1.00 26.31 ? 517  LYS B CB    1 
ATOM   10056 C  CG    . LYS B 1 517 ? 63.369  36.752  51.835  1.00 27.69 ? 517  LYS B CG    1 
ATOM   10057 C  CD    . LYS B 1 517 ? 62.303  35.691  51.454  1.00 29.75 ? 517  LYS B CD    1 
ATOM   10058 C  CE    . LYS B 1 517 ? 62.958  34.437  50.846  1.00 30.85 ? 517  LYS B CE    1 
ATOM   10059 N  NZ    . LYS B 1 517 ? 62.025  33.635  50.012  1.00 31.61 ? 517  LYS B NZ    1 
ATOM   10060 N  N     . GLY B 1 518 ? 62.269  40.881  53.642  1.00 25.67 ? 518  GLY B N     1 
ATOM   10061 C  CA    . GLY B 1 518 ? 61.327  41.969  53.816  1.00 25.37 ? 518  GLY B CA    1 
ATOM   10062 C  C     . GLY B 1 518 ? 61.906  43.315  53.443  1.00 25.14 ? 518  GLY B C     1 
ATOM   10063 O  O     . GLY B 1 518 ? 61.209  44.156  52.885  1.00 25.13 ? 518  GLY B O     1 
ATOM   10064 N  N     . LYS B 1 519 ? 63.179  43.519  53.767  1.00 24.78 ? 519  LYS B N     1 
ATOM   10065 C  CA    . LYS B 1 519 ? 63.874  44.755  53.436  1.00 24.54 ? 519  LYS B CA    1 
ATOM   10066 C  C     . LYS B 1 519 ? 64.104  44.864  51.935  1.00 24.01 ? 519  LYS B C     1 
ATOM   10067 O  O     . LYS B 1 519 ? 63.952  45.931  51.353  1.00 24.14 ? 519  LYS B O     1 
ATOM   10068 C  CB    . LYS B 1 519 ? 65.216  44.812  54.152  1.00 24.77 ? 519  LYS B CB    1 
ATOM   10069 C  CG    . LYS B 1 519 ? 65.121  44.986  55.660  1.00 25.66 ? 519  LYS B CG    1 
ATOM   10070 C  CD    . LYS B 1 519 ? 66.341  44.371  56.361  1.00 26.40 ? 519  LYS B CD    1 
ATOM   10071 C  CE    . LYS B 1 519 ? 66.386  44.703  57.854  1.00 27.37 ? 519  LYS B CE    1 
ATOM   10072 N  NZ    . LYS B 1 519 ? 66.299  43.536  58.764  1.00 27.02 ? 519  LYS B NZ    1 
ATOM   10073 N  N     . ALA B 1 520 ? 64.478  43.747  51.320  1.00 23.44 ? 520  ALA B N     1 
ATOM   10074 C  CA    . ALA B 1 520 ? 64.664  43.647  49.869  1.00 22.91 ? 520  ALA B CA    1 
ATOM   10075 C  C     . ALA B 1 520 ? 63.356  43.755  49.071  1.00 22.41 ? 520  ALA B C     1 
ATOM   10076 O  O     . ALA B 1 520 ? 63.387  44.034  47.886  1.00 22.02 ? 520  ALA B O     1 
ATOM   10077 C  CB    . ALA B 1 520 ? 65.358  42.324  49.529  1.00 22.97 ? 520  ALA B CB    1 
ATOM   10078 N  N     . LEU B 1 521 ? 62.222  43.501  49.716  1.00 22.10 ? 521  LEU B N     1 
ATOM   10079 C  CA    . LEU B 1 521 ? 60.923  43.616  49.076  1.00 21.92 ? 521  LEU B CA    1 
ATOM   10080 C  C     . LEU B 1 521 ? 60.413  45.057  49.199  1.00 21.82 ? 521  LEU B C     1 
ATOM   10081 O  O     . LEU B 1 521 ? 59.932  45.616  48.233  1.00 21.83 ? 521  LEU B O     1 
ATOM   10082 C  CB    . LEU B 1 521 ? 59.936  42.610  49.666  1.00 21.75 ? 521  LEU B CB    1 
ATOM   10083 C  CG    . LEU B 1 521 ? 58.495  42.648  49.164  1.00 22.23 ? 521  LEU B CG    1 
ATOM   10084 C  CD1   . LEU B 1 521 ? 58.441  42.549  47.650  1.00 22.83 ? 521  LEU B CD1   1 
ATOM   10085 C  CD2   . LEU B 1 521 ? 57.667  41.534  49.800  1.00 22.39 ? 521  LEU B CD2   1 
ATOM   10086 N  N     . ALA B 1 522 ? 60.541  45.665  50.372  1.00 21.89 ? 522  ALA B N     1 
ATOM   10087 C  CA    . ALA B 1 522 ? 60.277  47.099  50.524  1.00 22.00 ? 522  ALA B CA    1 
ATOM   10088 C  C     . ALA B 1 522 ? 61.112  47.921  49.533  1.00 22.18 ? 522  ALA B C     1 
ATOM   10089 O  O     . ALA B 1 522 ? 60.621  48.886  48.941  1.00 22.19 ? 522  ALA B O     1 
ATOM   10090 C  CB    . ALA B 1 522 ? 60.565  47.549  51.959  1.00 22.02 ? 522  ALA B CB    1 
ATOM   10091 N  N     . LEU B 1 523 ? 62.366  47.523  49.344  1.00 22.18 ? 523  LEU B N     1 
ATOM   10092 C  CA    . LEU B 1 523 ? 63.262  48.244  48.460  1.00 22.48 ? 523  LEU B CA    1 
ATOM   10093 C  C     . LEU B 1 523 ? 62.898  48.033  46.995  1.00 22.56 ? 523  LEU B C     1 
ATOM   10094 O  O     . LEU B 1 523 ? 62.967  48.956  46.208  1.00 22.39 ? 523  LEU B O     1 
ATOM   10095 C  CB    . LEU B 1 523 ? 64.707  47.828  48.706  1.00 22.72 ? 523  LEU B CB    1 
ATOM   10096 C  CG    . LEU B 1 523 ? 65.788  48.806  48.218  1.00 23.54 ? 523  LEU B CG    1 
ATOM   10097 C  CD1   . LEU B 1 523 ? 65.721  50.147  48.960  1.00 24.07 ? 523  LEU B CD1   1 
ATOM   10098 C  CD2   . LEU B 1 523 ? 67.185  48.198  48.371  1.00 23.50 ? 523  LEU B CD2   1 
ATOM   10099 N  N     . GLU B 1 524 ? 62.510  46.816  46.630  1.00 22.88 ? 524  GLU B N     1 
ATOM   10100 C  CA    . GLU B 1 524 ? 62.085  46.522  45.260  1.00 23.04 ? 524  GLU B CA    1 
ATOM   10101 C  C     . GLU B 1 524 ? 60.953  47.466  44.865  1.00 23.50 ? 524  GLU B C     1 
ATOM   10102 O  O     . GLU B 1 524 ? 61.005  48.097  43.826  1.00 23.40 ? 524  GLU B O     1 
ATOM   10103 C  CB    . GLU B 1 524 ? 61.620  45.064  45.123  1.00 22.85 ? 524  GLU B CB    1 
ATOM   10104 C  CG    . GLU B 1 524 ? 62.724  44.085  44.749  1.00 22.38 ? 524  GLU B CG    1 
ATOM   10105 C  CD    . GLU B 1 524 ? 62.192  42.806  44.144  1.00 22.08 ? 524  GLU B CD    1 
ATOM   10106 O  OE1   . GLU B 1 524 ? 61.535  42.902  43.088  1.00 21.62 ? 524  GLU B OE1   1 
ATOM   10107 O  OE2   . GLU B 1 524 ? 62.432  41.713  44.716  1.00 20.71 ? 524  GLU B OE2   1 
ATOM   10108 N  N     . LYS B 1 525 ? 59.945  47.560  45.724  1.00 23.98 ? 525  LYS B N     1 
ATOM   10109 C  CA    . LYS B 1 525 ? 58.808  48.444  45.524  1.00 24.49 ? 525  LYS B CA    1 
ATOM   10110 C  C     . LYS B 1 525 ? 59.229  49.914  45.403  1.00 24.73 ? 525  LYS B C     1 
ATOM   10111 O  O     . LYS B 1 525 ? 58.791  50.614  44.502  1.00 25.14 ? 525  LYS B O     1 
ATOM   10112 C  CB    . LYS B 1 525 ? 57.793  48.261  46.664  1.00 24.83 ? 525  LYS B CB    1 
ATOM   10113 C  CG    . LYS B 1 525 ? 56.914  46.993  46.516  1.00 25.77 ? 525  LYS B CG    1 
ATOM   10114 C  CD    . LYS B 1 525 ? 56.651  46.251  47.845  1.00 26.24 ? 525  LYS B CD    1 
ATOM   10115 C  CE    . LYS B 1 525 ? 55.338  45.462  47.792  1.00 26.58 ? 525  LYS B CE    1 
ATOM   10116 N  NZ    . LYS B 1 525 ? 55.227  44.435  48.860  1.00 26.04 ? 525  LYS B NZ    1 
ATOM   10117 N  N     . GLN B 1 526 ? 60.085  50.384  46.295  1.00 24.80 ? 526  GLN B N     1 
ATOM   10118 C  CA    . GLN B 1 526 ? 60.541  51.771  46.226  1.00 24.71 ? 526  GLN B CA    1 
ATOM   10119 C  C     . GLN B 1 526 ? 61.296  51.999  44.913  1.00 24.24 ? 526  GLN B C     1 
ATOM   10120 O  O     . GLN B 1 526 ? 61.107  53.010  44.246  1.00 24.37 ? 526  GLN B O     1 
ATOM   10121 C  CB    . GLN B 1 526 ? 61.413  52.124  47.446  1.00 24.87 ? 526  GLN B CB    1 
ATOM   10122 C  CG    . GLN B 1 526 ? 60.638  52.154  48.795  1.00 25.75 ? 526  GLN B CG    1 
ATOM   10123 C  CD    . GLN B 1 526 ? 59.520  53.221  48.835  1.00 26.71 ? 526  GLN B CD    1 
ATOM   10124 O  OE1   . GLN B 1 526 ? 58.336  52.896  48.719  1.00 26.40 ? 526  GLN B OE1   1 
ATOM   10125 N  NE2   . GLN B 1 526 ? 59.905  54.486  49.000  1.00 26.61 ? 526  GLN B NE2   1 
ATOM   10126 N  N     . LEU B 1 527 ? 62.124  51.036  44.530  1.00 23.73 ? 527  LEU B N     1 
ATOM   10127 C  CA    . LEU B 1 527 ? 62.891  51.129  43.290  1.00 23.31 ? 527  LEU B CA    1 
ATOM   10128 C  C     . LEU B 1 527 ? 61.988  51.164  42.064  1.00 23.40 ? 527  LEU B C     1 
ATOM   10129 O  O     . LEU B 1 527 ? 62.262  51.899  41.112  1.00 23.57 ? 527  LEU B O     1 
ATOM   10130 C  CB    . LEU B 1 527 ? 63.849  49.951  43.164  1.00 22.84 ? 527  LEU B CB    1 
ATOM   10131 C  CG    . LEU B 1 527 ? 65.082  50.025  44.054  1.00 21.28 ? 527  LEU B CG    1 
ATOM   10132 C  CD1   . LEU B 1 527 ? 65.797  48.686  44.054  1.00 20.35 ? 527  LEU B CD1   1 
ATOM   10133 C  CD2   . LEU B 1 527 ? 66.008  51.136  43.606  1.00 20.45 ? 527  LEU B CD2   1 
ATOM   10134 N  N     . TYR B 1 528 ? 60.914  50.373  42.116  1.00 23.27 ? 528  TYR B N     1 
ATOM   10135 C  CA    . TYR B 1 528 ? 59.937  50.269  41.040  1.00 23.08 ? 528  TYR B CA    1 
ATOM   10136 C  C     . TYR B 1 528 ? 59.108  51.546  40.907  1.00 23.12 ? 528  TYR B C     1 
ATOM   10137 O  O     . TYR B 1 528 ? 58.871  52.005  39.799  1.00 23.17 ? 528  TYR B O     1 
ATOM   10138 C  CB    . TYR B 1 528 ? 59.031  49.059  41.268  1.00 22.82 ? 528  TYR B CB    1 
ATOM   10139 C  CG    . TYR B 1 528 ? 57.997  48.808  40.177  1.00 22.78 ? 528  TYR B CG    1 
ATOM   10140 C  CD1   . TYR B 1 528 ? 58.347  48.219  38.968  1.00 22.58 ? 528  TYR B CD1   1 
ATOM   10141 C  CD2   . TYR B 1 528 ? 56.661  49.139  40.374  1.00 23.21 ? 528  TYR B CD2   1 
ATOM   10142 C  CE1   . TYR B 1 528 ? 57.393  47.985  37.983  1.00 22.46 ? 528  TYR B CE1   1 
ATOM   10143 C  CE2   . TYR B 1 528 ? 55.714  48.905  39.411  1.00 22.87 ? 528  TYR B CE2   1 
ATOM   10144 C  CZ    . TYR B 1 528 ? 56.084  48.331  38.226  1.00 23.10 ? 528  TYR B CZ    1 
ATOM   10145 O  OH    . TYR B 1 528 ? 55.134  48.111  37.285  1.00 24.20 ? 528  TYR B OH    1 
ATOM   10146 N  N     . GLU B 1 529 ? 58.688  52.123  42.029  1.00 23.25 ? 529  GLU B N     1 
ATOM   10147 C  CA    . GLU B 1 529 ? 58.003  53.415  42.017  1.00 23.47 ? 529  GLU B CA    1 
ATOM   10148 C  C     . GLU B 1 529 ? 58.934  54.471  41.442  1.00 23.55 ? 529  GLU B C     1 
ATOM   10149 O  O     . GLU B 1 529 ? 58.465  55.445  40.892  1.00 23.72 ? 529  GLU B O     1 
ATOM   10150 C  CB    . GLU B 1 529 ? 57.537  53.858  43.427  1.00 23.45 ? 529  GLU B CB    1 
ATOM   10151 C  CG    . GLU B 1 529 ? 56.381  53.074  44.073  1.00 24.01 ? 529  GLU B CG    1 
ATOM   10152 C  CD    . GLU B 1 529 ? 55.044  53.158  43.326  1.00 25.36 ? 529  GLU B CD    1 
ATOM   10153 O  OE1   . GLU B 1 529 ? 54.703  54.238  42.804  1.00 26.52 ? 529  GLU B OE1   1 
ATOM   10154 O  OE2   . GLU B 1 529 ? 54.317  52.136  43.256  1.00 25.31 ? 529  GLU B OE2   1 
ATOM   10155 N  N     . GLU B 1 530 ? 60.247  54.290  41.579  1.00 23.85 ? 530  GLU B N     1 
ATOM   10156 C  CA    . GLU B 1 530 ? 61.213  55.246  41.021  1.00 24.32 ? 530  GLU B CA    1 
ATOM   10157 C  C     . GLU B 1 530 ? 61.380  55.117  39.509  1.00 24.08 ? 530  GLU B C     1 
ATOM   10158 O  O     . GLU B 1 530 ? 61.996  55.969  38.875  1.00 24.17 ? 530  GLU B O     1 
ATOM   10159 C  CB    . GLU B 1 530 ? 62.598  55.112  41.680  1.00 24.86 ? 530  GLU B CB    1 
ATOM   10160 C  CG    . GLU B 1 530 ? 63.370  56.440  41.710  1.00 25.91 ? 530  GLU B CG    1 
ATOM   10161 C  CD    . GLU B 1 530 ? 64.891  56.317  41.839  1.00 27.42 ? 530  GLU B CD    1 
ATOM   10162 O  OE1   . GLU B 1 530 ? 65.476  55.206  41.710  1.00 27.43 ? 530  GLU B OE1   1 
ATOM   10163 O  OE2   . GLU B 1 530 ? 65.509  57.379  42.069  1.00 28.81 ? 530  GLU B OE2   1 
ATOM   10164 N  N     . LEU B 1 531 ? 60.877  54.034  38.929  1.00 23.64 ? 531  LEU B N     1 
ATOM   10165 C  CA    . LEU B 1 531 ? 60.847  53.936  37.488  1.00 22.97 ? 531  LEU B CA    1 
ATOM   10166 C  C     . LEU B 1 531 ? 59.728  54.813  36.975  1.00 22.64 ? 531  LEU B C     1 
ATOM   10167 O  O     . LEU B 1 531 ? 59.893  55.456  35.956  1.00 22.74 ? 531  LEU B O     1 
ATOM   10168 C  CB    . LEU B 1 531 ? 60.712  52.493  37.023  1.00 22.92 ? 531  LEU B CB    1 
ATOM   10169 C  CG    . LEU B 1 531 ? 61.943  51.656  37.378  1.00 22.88 ? 531  LEU B CG    1 
ATOM   10170 C  CD1   . LEU B 1 531 ? 61.655  50.176  37.275  1.00 23.65 ? 531  LEU B CD1   1 
ATOM   10171 C  CD2   . LEU B 1 531 ? 63.120  52.007  36.508  1.00 22.59 ? 531  LEU B CD2   1 
ATOM   10172 N  N     . PHE B 1 532 ? 58.605  54.880  37.684  1.00 22.36 ? 532  PHE B N     1 
ATOM   10173 C  CA    . PHE B 1 532 ? 57.534  55.816  37.291  1.00 22.23 ? 532  PHE B CA    1 
ATOM   10174 C  C     . PHE B 1 532 ? 58.026  57.276  37.296  1.00 21.86 ? 532  PHE B C     1 
ATOM   10175 O  O     . PHE B 1 532 ? 57.688  58.055  36.406  1.00 21.62 ? 532  PHE B O     1 
ATOM   10176 C  CB    . PHE B 1 532 ? 56.329  55.710  38.221  1.00 22.32 ? 532  PHE B CB    1 
ATOM   10177 C  CG    . PHE B 1 532 ? 55.501  54.474  38.044  1.00 22.93 ? 532  PHE B CG    1 
ATOM   10178 C  CD1   . PHE B 1 532 ? 55.283  53.917  36.804  1.00 24.22 ? 532  PHE B CD1   1 
ATOM   10179 C  CD2   . PHE B 1 532 ? 54.881  53.898  39.140  1.00 24.96 ? 532  PHE B CD2   1 
ATOM   10180 C  CE1   . PHE B 1 532 ? 54.486  52.789  36.657  1.00 24.81 ? 532  PHE B CE1   1 
ATOM   10181 C  CE2   . PHE B 1 532 ? 54.074  52.775  38.995  1.00 25.45 ? 532  PHE B CE2   1 
ATOM   10182 C  CZ    . PHE B 1 532 ? 53.885  52.226  37.748  1.00 25.14 ? 532  PHE B CZ    1 
ATOM   10183 N  N     . ASP B 1 533 ? 58.819  57.627  38.306  1.00 21.37 ? 533  ASP B N     1 
ATOM   10184 C  CA    . ASP B 1 533 ? 59.449  58.940  38.403  1.00 21.30 ? 533  ASP B CA    1 
ATOM   10185 C  C     . ASP B 1 533 ? 60.295  59.271  37.174  1.00 20.81 ? 533  ASP B C     1 
ATOM   10186 O  O     . ASP B 1 533 ? 60.142  60.332  36.582  1.00 21.16 ? 533  ASP B O     1 
ATOM   10187 C  CB    . ASP B 1 533 ? 60.348  59.015  39.645  1.00 21.46 ? 533  ASP B CB    1 
ATOM   10188 C  CG    . ASP B 1 533 ? 59.572  58.908  40.955  1.00 21.88 ? 533  ASP B CG    1 
ATOM   10189 O  OD1   . ASP B 1 533 ? 58.333  58.689  40.924  1.00 22.70 ? 533  ASP B OD1   1 
ATOM   10190 O  OD2   . ASP B 1 533 ? 60.140  59.019  42.067  1.00 21.50 ? 533  ASP B OD2   1 
ATOM   10191 N  N     . LEU B 1 534 ? 61.172  58.352  36.782  1.00 20.38 ? 534  LEU B N     1 
ATOM   10192 C  CA    . LEU B 1 534 ? 62.086  58.578  35.651  1.00 19.74 ? 534  LEU B CA    1 
ATOM   10193 C  C     . LEU B 1 534 ? 61.460  58.421  34.269  1.00 18.94 ? 534  LEU B C     1 
ATOM   10194 O  O     . LEU B 1 534 ? 61.979  58.950  33.315  1.00 19.83 ? 534  LEU B O     1 
ATOM   10195 C  CB    . LEU B 1 534 ? 63.310  57.661  35.755  1.00 20.01 ? 534  LEU B CB    1 
ATOM   10196 C  CG    . LEU B 1 534 ? 64.341  57.933  36.880  1.00 20.08 ? 534  LEU B CG    1 
ATOM   10197 C  CD1   . LEU B 1 534 ? 65.362  56.787  36.954  1.00 20.18 ? 534  LEU B CD1   1 
ATOM   10198 C  CD2   . LEU B 1 534 ? 65.048  59.271  36.709  1.00 19.24 ? 534  LEU B CD2   1 
ATOM   10199 N  N     . LEU B 1 535 ? 60.351  57.712  34.153  1.00 18.13 ? 535  LEU B N     1 
ATOM   10200 C  CA    . LEU B 1 535 ? 59.706  57.478  32.856  1.00 17.31 ? 535  LEU B CA    1 
ATOM   10201 C  C     . LEU B 1 535 ? 58.777  58.626  32.501  1.00 16.55 ? 535  LEU B C     1 
ATOM   10202 O  O     . LEU B 1 535 ? 58.825  59.141  31.409  1.00 16.16 ? 535  LEU B O     1 
ATOM   10203 C  CB    . LEU B 1 535 ? 58.877  56.185  32.898  1.00 17.29 ? 535  LEU B CB    1 
ATOM   10204 C  CG    . LEU B 1 535 ? 59.425  54.885  32.315  1.00 17.00 ? 535  LEU B CG    1 
ATOM   10205 C  CD1   . LEU B 1 535 ? 60.907  54.879  32.188  1.00 17.50 ? 535  LEU B CD1   1 
ATOM   10206 C  CD2   . LEU B 1 535 ? 58.969  53.696  33.171  1.00 17.33 ? 535  LEU B CD2   1 
ATOM   10207 N  N     . LEU B 1 536 ? 57.941  59.007  33.460  1.00 16.36 ? 536  LEU B N     1 
ATOM   10208 C  CA    . LEU B 1 536 ? 56.860  59.978  33.288  1.00 16.04 ? 536  LEU B CA    1 
ATOM   10209 C  C     . LEU B 1 536 ? 57.219  61.359  32.711  1.00 16.52 ? 536  LEU B C     1 
ATOM   10210 O  O     . LEU B 1 536 ? 56.383  61.947  32.048  1.00 16.74 ? 536  LEU B O     1 
ATOM   10211 C  CB    . LEU B 1 536 ? 56.157  60.208  34.628  1.00 15.84 ? 536  LEU B CB    1 
ATOM   10212 C  CG    . LEU B 1 536 ? 54.931  59.356  34.956  1.00 14.69 ? 536  LEU B CG    1 
ATOM   10213 C  CD1   . LEU B 1 536 ? 54.624  59.449  36.423  1.00 12.53 ? 536  LEU B CD1   1 
ATOM   10214 C  CD2   . LEU B 1 536 ? 53.735  59.801  34.170  1.00 14.55 ? 536  LEU B CD2   1 
ATOM   10215 N  N     . PRO B 1 537 ? 58.400  61.920  32.974  1.00 17.08 ? 537  PRO B N     1 
ATOM   10216 C  CA    . PRO B 1 537 ? 58.733  63.223  32.380  1.00 17.24 ? 537  PRO B CA    1 
ATOM   10217 C  C     . PRO B 1 537 ? 58.761  63.178  30.843  1.00 17.81 ? 537  PRO B C     1 
ATOM   10218 O  O     . PRO B 1 537 ? 58.547  64.208  30.206  1.00 17.67 ? 537  PRO B O     1 
ATOM   10219 C  CB    . PRO B 1 537 ? 60.122  63.530  32.942  1.00 17.14 ? 537  PRO B CB    1 
ATOM   10220 C  CG    . PRO B 1 537 ? 60.300  62.616  34.108  1.00 17.22 ? 537  PRO B CG    1 
ATOM   10221 C  CD    . PRO B 1 537 ? 59.495  61.405  33.825  1.00 17.08 ? 537  PRO B CD    1 
ATOM   10222 N  N     . HIS B 1 538 ? 59.012  62.003  30.260  1.00 18.14 ? 538  HIS B N     1 
ATOM   10223 C  CA    . HIS B 1 538 ? 59.004  61.857  28.804  1.00 18.56 ? 538  HIS B CA    1 
ATOM   10224 C  C     . HIS B 1 538 ? 57.673  61.309  28.270  1.00 18.19 ? 538  HIS B C     1 
ATOM   10225 O  O     . HIS B 1 538 ? 57.581  60.903  27.131  1.00 17.99 ? 538  HIS B O     1 
ATOM   10226 C  CB    . HIS B 1 538 ? 60.160  60.965  28.359  1.00 19.00 ? 538  HIS B CB    1 
ATOM   10227 C  CG    . HIS B 1 538 ? 61.429  61.179  29.131  1.00 21.28 ? 538  HIS B CG    1 
ATOM   10228 N  ND1   . HIS B 1 538 ? 61.816  62.412  29.607  1.00 23.29 ? 538  HIS B ND1   1 
ATOM   10229 C  CD2   . HIS B 1 538 ? 62.402  60.315  29.505  1.00 22.59 ? 538  HIS B CD2   1 
ATOM   10230 C  CE1   . HIS B 1 538 ? 62.964  62.297  30.252  1.00 23.25 ? 538  HIS B CE1   1 
ATOM   10231 N  NE2   . HIS B 1 538 ? 63.342  61.033  30.205  1.00 23.00 ? 538  HIS B NE2   1 
ATOM   10232 N  N     . LEU B 1 539 ? 56.632  61.319  29.093  1.00 18.23 ? 539  LEU B N     1 
ATOM   10233 C  CA    . LEU B 1 539 ? 55.301  60.868  28.688  1.00 17.85 ? 539  LEU B CA    1 
ATOM   10234 C  C     . LEU B 1 539 ? 54.814  61.482  27.367  1.00 18.33 ? 539  LEU B C     1 
ATOM   10235 O  O     . LEU B 1 539 ? 54.326  60.754  26.505  1.00 18.82 ? 539  LEU B O     1 
ATOM   10236 C  CB    . LEU B 1 539 ? 54.281  61.160  29.798  1.00 17.41 ? 539  LEU B CB    1 
ATOM   10237 C  CG    . LEU B 1 539 ? 52.830  60.763  29.491  1.00 16.49 ? 539  LEU B CG    1 
ATOM   10238 C  CD1   . LEU B 1 539 ? 52.640  59.238  29.524  1.00 14.73 ? 539  LEU B CD1   1 
ATOM   10239 C  CD2   . LEU B 1 539 ? 51.864  61.458  30.437  1.00 15.61 ? 539  LEU B CD2   1 
ATOM   10240 N  N     . GLU B 1 540 ? 54.906  62.805  27.216  1.00 18.56 ? 540  GLU B N     1 
ATOM   10241 C  CA    . GLU B 1 540 ? 54.525  63.463  25.964  1.00 18.75 ? 540  GLU B CA    1 
ATOM   10242 C  C     . GLU B 1 540 ? 55.172  62.810  24.753  1.00 18.42 ? 540  GLU B C     1 
ATOM   10243 O  O     . GLU B 1 540 ? 54.478  62.390  23.834  1.00 18.95 ? 540  GLU B O     1 
ATOM   10244 C  CB    . GLU B 1 540 ? 54.869  64.956  25.974  1.00 19.00 ? 540  GLU B CB    1 
ATOM   10245 C  CG    . GLU B 1 540 ? 54.217  65.722  24.823  1.00 20.81 ? 540  GLU B CG    1 
ATOM   10246 C  CD    . GLU B 1 540 ? 54.219  67.238  25.011  1.00 24.17 ? 540  GLU B CD    1 
ATOM   10247 O  OE1   . GLU B 1 540 ? 54.895  67.757  25.933  1.00 23.51 ? 540  GLU B OE1   1 
ATOM   10248 O  OE2   . GLU B 1 540 ? 53.543  67.921  24.210  1.00 26.71 ? 540  GLU B OE2   1 
ATOM   10249 N  N     . ALA B 1 541 ? 56.493  62.721  24.745  1.00 18.16 ? 541  ALA B N     1 
ATOM   10250 C  CA    . ALA B 1 541 ? 57.206  62.144  23.609  1.00 18.16 ? 541  ALA B CA    1 
ATOM   10251 C  C     . ALA B 1 541 ? 56.848  60.692  23.427  1.00 18.54 ? 541  ALA B C     1 
ATOM   10252 O  O     . ALA B 1 541 ? 56.805  60.220  22.314  1.00 18.88 ? 541  ALA B O     1 
ATOM   10253 C  CB    . ALA B 1 541 ? 58.705  62.278  23.782  1.00 18.12 ? 541  ALA B CB    1 
ATOM   10254 N  N     . LEU B 1 542 ? 56.619  59.981  24.524  1.00 19.26 ? 542  LEU B N     1 
ATOM   10255 C  CA    . LEU B 1 542 ? 56.222  58.582  24.467  1.00 19.85 ? 542  LEU B CA    1 
ATOM   10256 C  C     . LEU B 1 542 ? 54.879  58.452  23.753  1.00 20.41 ? 542  LEU B C     1 
ATOM   10257 O  O     . LEU B 1 542 ? 54.714  57.551  22.942  1.00 21.48 ? 542  LEU B O     1 
ATOM   10258 C  CB    . LEU B 1 542 ? 56.158  57.939  25.868  1.00 19.52 ? 542  LEU B CB    1 
ATOM   10259 C  CG    . LEU B 1 542 ? 57.474  57.711  26.601  1.00 19.60 ? 542  LEU B CG    1 
ATOM   10260 C  CD1   . LEU B 1 542 ? 57.239  57.280  28.040  1.00 19.97 ? 542  LEU B CD1   1 
ATOM   10261 C  CD2   . LEU B 1 542 ? 58.283  56.677  25.895  1.00 20.84 ? 542  LEU B CD2   1 
ATOM   10262 N  N     . GLN B 1 543 ? 53.932  59.342  24.035  1.00 20.84 ? 543  GLN B N     1 
ATOM   10263 C  CA    . GLN B 1 543 ? 52.618  59.321  23.369  1.00 21.39 ? 543  GLN B CA    1 
ATOM   10264 C  C     . GLN B 1 543 ? 52.706  59.649  21.882  1.00 21.49 ? 543  GLN B C     1 
ATOM   10265 O  O     . GLN B 1 543 ? 52.014  59.048  21.074  1.00 21.72 ? 543  GLN B O     1 
ATOM   10266 C  CB    . GLN B 1 543 ? 51.645  60.296  24.028  1.00 21.48 ? 543  GLN B CB    1 
ATOM   10267 C  CG    . GLN B 1 543 ? 51.146  59.853  25.387  1.00 22.72 ? 543  GLN B CG    1 
ATOM   10268 C  CD    . GLN B 1 543 ? 50.215  60.875  25.989  1.00 24.17 ? 543  GLN B CD    1 
ATOM   10269 O  OE1   . GLN B 1 543 ? 50.581  62.043  26.166  1.00 26.52 ? 543  GLN B OE1   1 
ATOM   10270 N  NE2   . GLN B 1 543 ? 49.008  60.457  26.282  1.00 24.72 ? 543  GLN B NE2   1 
ATOM   10271 N  N     . GLN B 1 544 ? 53.532  60.626  21.534  1.00 21.85 ? 544  GLN B N     1 
ATOM   10272 C  CA    . GLN B 1 544 ? 53.871  60.878  20.139  1.00 22.17 ? 544  GLN B CA    1 
ATOM   10273 C  C     . GLN B 1 544 ? 54.482  59.625  19.461  1.00 21.63 ? 544  GLN B C     1 
ATOM   10274 O  O     . GLN B 1 544 ? 54.244  59.372  18.292  1.00 21.53 ? 544  GLN B O     1 
ATOM   10275 C  CB    . GLN B 1 544 ? 54.820  62.082  20.030  1.00 22.33 ? 544  GLN B CB    1 
ATOM   10276 C  CG    . GLN B 1 544 ? 54.120  63.463  20.141  1.00 24.67 ? 544  GLN B CG    1 
ATOM   10277 C  CD    . GLN B 1 544 ? 55.106  64.651  19.998  1.00 27.00 ? 544  GLN B CD    1 
ATOM   10278 O  OE1   . GLN B 1 544 ? 55.632  64.903  18.903  1.00 28.92 ? 544  GLN B OE1   1 
ATOM   10279 N  NE2   . GLN B 1 544 ? 55.380  65.343  21.105  1.00 26.08 ? 544  GLN B NE2   1 
ATOM   10280 N  N     . SER B 1 545 ? 55.261  58.843  20.197  1.00 21.35 ? 545  SER B N     1 
ATOM   10281 C  CA    . SER B 1 545 ? 55.825  57.593  19.676  1.00 21.06 ? 545  SER B CA    1 
ATOM   10282 C  C     . SER B 1 545 ? 54.736  56.556  19.404  1.00 20.66 ? 545  SER B C     1 
ATOM   10283 O  O     . SER B 1 545 ? 54.580  56.137  18.282  1.00 20.49 ? 545  SER B O     1 
ATOM   10284 C  CB    . SER B 1 545 ? 56.864  57.014  20.643  1.00 20.97 ? 545  SER B CB    1 
ATOM   10285 O  OG    . SER B 1 545 ? 57.410  55.808  20.149  1.00 21.54 ? 545  SER B OG    1 
ATOM   10286 N  N     . ALA B 1 546 ? 53.992  56.159  20.437  1.00 20.55 ? 546  ALA B N     1 
ATOM   10287 C  CA    . ALA B 1 546 ? 52.885  55.189  20.331  1.00 20.47 ? 546  ALA B CA    1 
ATOM   10288 C  C     . ALA B 1 546 ? 51.906  55.491  19.209  1.00 20.30 ? 546  ALA B C     1 
ATOM   10289 O  O     . ALA B 1 546 ? 51.348  54.573  18.578  1.00 19.57 ? 546  ALA B O     1 
ATOM   10290 C  CB    . ALA B 1 546 ? 52.110  55.158  21.643  1.00 20.77 ? 546  ALA B CB    1 
ATOM   10291 N  N     . SER B 1 547 ? 51.695  56.792  19.007  1.00 19.87 ? 547  SER B N     1 
ATOM   10292 C  CA    . SER B 1 547 ? 50.792  57.330  18.013  1.00 19.68 ? 547  SER B CA    1 
ATOM   10293 C  C     . SER B 1 547 ? 51.386  57.163  16.643  1.00 19.44 ? 547  SER B C     1 
ATOM   10294 O  O     . SER B 1 547 ? 50.716  56.771  15.712  1.00 18.68 ? 547  SER B O     1 
ATOM   10295 C  CB    . SER B 1 547 ? 50.590  58.821  18.292  1.00 19.89 ? 547  SER B CB    1 
ATOM   10296 O  OG    . SER B 1 547 ? 50.016  59.497  17.192  1.00 20.81 ? 547  SER B OG    1 
ATOM   10297 N  N     . ALA B 1 548 ? 52.663  57.491  16.527  1.00 20.09 ? 548  ALA B N     1 
ATOM   10298 C  CA    . ALA B 1 548 ? 53.358  57.459  15.242  1.00 20.51 ? 548  ALA B CA    1 
ATOM   10299 C  C     . ALA B 1 548 ? 53.510  56.040  14.838  1.00 20.91 ? 548  ALA B C     1 
ATOM   10300 O  O     . ALA B 1 548 ? 53.385  55.724  13.683  1.00 21.33 ? 548  ALA B O     1 
ATOM   10301 C  CB    . ALA B 1 548 ? 54.700  58.088  15.344  1.00 20.53 ? 548  ALA B CB    1 
ATOM   10302 N  N     . LEU B 1 549 ? 53.780  55.189  15.819  1.00 21.46 ? 549  LEU B N     1 
ATOM   10303 C  CA    . LEU B 1 549 ? 53.880  53.754  15.617  1.00 21.74 ? 549  LEU B CA    1 
ATOM   10304 C  C     . LEU B 1 549 ? 52.547  53.187  15.168  1.00 21.78 ? 549  LEU B C     1 
ATOM   10305 O  O     . LEU B 1 549 ? 52.513  52.240  14.379  1.00 21.42 ? 549  LEU B O     1 
ATOM   10306 C  CB    . LEU B 1 549 ? 54.343  53.061  16.909  1.00 21.77 ? 549  LEU B CB    1 
ATOM   10307 C  CG    . LEU B 1 549 ? 55.824  53.235  17.227  1.00 22.77 ? 549  LEU B CG    1 
ATOM   10308 C  CD1   . LEU B 1 549 ? 56.115  52.924  18.688  1.00 23.61 ? 549  LEU B CD1   1 
ATOM   10309 C  CD2   . LEU B 1 549 ? 56.686  52.367  16.306  1.00 23.87 ? 549  LEU B CD2   1 
ATOM   10310 N  N     . ALA B 1 550 ? 51.453  53.754  15.689  1.00 21.91 ? 550  ALA B N     1 
ATOM   10311 C  CA    . ALA B 1 550 ? 50.106  53.300  15.327  1.00 21.74 ? 550  ALA B CA    1 
ATOM   10312 C  C     . ALA B 1 550 ? 49.833  53.570  13.857  1.00 22.14 ? 550  ALA B C     1 
ATOM   10313 O  O     . ALA B 1 550 ? 49.414  52.658  13.128  1.00 22.26 ? 550  ALA B O     1 
ATOM   10314 C  CB    . ALA B 1 550 ? 49.042  53.970  16.189  1.00 21.55 ? 550  ALA B CB    1 
ATOM   10315 N  N     . GLU B 1 551 ? 50.074  54.815  13.434  1.00 22.19 ? 551  GLU B N     1 
ATOM   10316 C  CA    . GLU B 1 551 ? 49.838  55.239  12.052  1.00 22.35 ? 551  GLU B CA    1 
ATOM   10317 C  C     . GLU B 1 551 ? 50.679  54.411  11.111  1.00 22.19 ? 551  GLU B C     1 
ATOM   10318 O  O     . GLU B 1 551 ? 50.217  53.937  10.091  1.00 22.05 ? 551  GLU B O     1 
ATOM   10319 C  CB    . GLU B 1 551 ? 50.145  56.746  11.863  1.00 22.15 ? 551  GLU B CB    1 
ATOM   10320 C  CG    . GLU B 1 551 ? 49.764  57.247  10.480  1.00 23.27 ? 551  GLU B CG    1 
ATOM   10321 C  CD    . GLU B 1 551 ? 49.691  58.761  10.327  1.00 26.93 ? 551  GLU B CD    1 
ATOM   10322 O  OE1   . GLU B 1 551 ? 49.990  59.523  11.279  1.00 26.07 ? 551  GLU B OE1   1 
ATOM   10323 O  OE2   . GLU B 1 551 ? 49.330  59.196  9.202   1.00 31.32 ? 551  GLU B OE2   1 
ATOM   10324 N  N     . LEU B 1 552 ? 51.931  54.240  11.471  1.00 22.72 ? 552  LEU B N     1 
ATOM   10325 C  CA    . LEU B 1 552 ? 52.851  53.470  10.656  1.00 23.47 ? 552  LEU B CA    1 
ATOM   10326 C  C     . LEU B 1 552 ? 52.342  52.036  10.486  1.00 23.15 ? 552  LEU B C     1 
ATOM   10327 O  O     . LEU B 1 552 ? 52.457  51.436  9.442   1.00 22.91 ? 552  LEU B O     1 
ATOM   10328 C  CB    . LEU B 1 552 ? 54.231  53.474  11.309  1.00 23.76 ? 552  LEU B CB    1 
ATOM   10329 C  CG    . LEU B 1 552 ? 55.338  53.094  10.340  1.00 25.05 ? 552  LEU B CG    1 
ATOM   10330 C  CD1   . LEU B 1 552 ? 56.041  54.345  9.812   1.00 24.31 ? 552  LEU B CD1   1 
ATOM   10331 C  CD2   . LEU B 1 552 ? 56.308  52.123  11.023  1.00 25.78 ? 552  LEU B CD2   1 
ATOM   10332 N  N     . ASP B 1 553 ? 51.742  51.508  11.532  1.00 23.23 ? 553  ASP B N     1 
ATOM   10333 C  CA    . ASP B 1 553 ? 51.160  50.196  11.471  1.00 23.02 ? 553  ASP B CA    1 
ATOM   10334 C  C     . ASP B 1 553 ? 50.065  50.136  10.424  1.00 23.60 ? 553  ASP B C     1 
ATOM   10335 O  O     . ASP B 1 553 ? 49.928  49.131  9.694   1.00 23.71 ? 553  ASP B O     1 
ATOM   10336 C  CB    . ASP B 1 553 ? 50.586  49.823  12.828  1.00 22.64 ? 553  ASP B CB    1 
ATOM   10337 C  CG    . ASP B 1 553 ? 50.172  48.391  12.876  1.00 20.89 ? 553  ASP B CG    1 
ATOM   10338 O  OD1   . ASP B 1 553 ? 50.523  47.707  11.919  1.00 20.39 ? 553  ASP B OD1   1 
ATOM   10339 O  OD2   . ASP B 1 553 ? 49.506  47.864  13.788  1.00 17.23 ? 553  ASP B OD2   1 
ATOM   10340 N  N     . VAL B 1 554 ? 49.286  51.221  10.377  1.00 23.73 ? 554  VAL B N     1 
ATOM   10341 C  CA    . VAL B 1 554 ? 48.113  51.345  9.518   1.00 23.74 ? 554  VAL B CA    1 
ATOM   10342 C  C     . VAL B 1 554 ? 48.539  51.467  8.060   1.00 23.98 ? 554  VAL B C     1 
ATOM   10343 O  O     . VAL B 1 554 ? 47.978  50.811  7.184   1.00 24.27 ? 554  VAL B O     1 
ATOM   10344 C  CB    . VAL B 1 554 ? 47.248  52.545  9.977   1.00 23.88 ? 554  VAL B CB    1 
ATOM   10345 C  CG1   . VAL B 1 554 ? 46.232  52.992  8.909   1.00 25.05 ? 554  VAL B CG1   1 
ATOM   10346 C  CG2   . VAL B 1 554 ? 46.540  52.207  11.309  1.00 23.27 ? 554  VAL B CG2   1 
ATOM   10347 N  N     . LEU B 1 555 ? 49.569  52.262  7.812   1.00 23.86 ? 555  LEU B N     1 
ATOM   10348 C  CA    . LEU B 1 555 ? 49.962  52.579  6.457   1.00 23.73 ? 555  LEU B CA    1 
ATOM   10349 C  C     . LEU B 1 555 ? 50.745  51.467  5.862   1.00 23.51 ? 555  LEU B C     1 
ATOM   10350 O  O     . LEU B 1 555 ? 50.555  51.130  4.705   1.00 23.84 ? 555  LEU B O     1 
ATOM   10351 C  CB    . LEU B 1 555 ? 50.771  53.856  6.427   1.00 23.80 ? 555  LEU B CB    1 
ATOM   10352 C  CG    . LEU B 1 555 ? 49.946  55.054  6.850   1.00 24.25 ? 555  LEU B CG    1 
ATOM   10353 C  CD1   . LEU B 1 555 ? 50.812  56.281  7.037   1.00 26.65 ? 555  LEU B CD1   1 
ATOM   10354 C  CD2   . LEU B 1 555 ? 48.906  55.298  5.809   1.00 24.93 ? 555  LEU B CD2   1 
ATOM   10355 N  N     . VAL B 1 556 ? 51.640  50.906  6.652   1.00 23.75 ? 556  VAL B N     1 
ATOM   10356 C  CA    . VAL B 1 556 ? 52.331  49.667  6.274   1.00 23.79 ? 556  VAL B CA    1 
ATOM   10357 C  C     . VAL B 1 556 ? 51.321  48.564  5.949   1.00 23.92 ? 556  VAL B C     1 
ATOM   10358 O  O     . VAL B 1 556 ? 51.526  47.819  5.027   1.00 24.00 ? 556  VAL B O     1 
ATOM   10359 C  CB    . VAL B 1 556 ? 53.300  49.198  7.371   1.00 23.37 ? 556  VAL B CB    1 
ATOM   10360 C  CG1   . VAL B 1 556 ? 53.786  47.778  7.107   1.00 22.77 ? 556  VAL B CG1   1 
ATOM   10361 C  CG2   . VAL B 1 556 ? 54.478  50.181  7.460   1.00 22.87 ? 556  VAL B CG2   1 
ATOM   10362 N  N     . ASN B 1 557 ? 50.216  48.501  6.679   1.00 24.36 ? 557  ASN B N     1 
ATOM   10363 C  CA    . ASN B 1 557 ? 49.176  47.517  6.409   1.00 24.49 ? 557  ASN B CA    1 
ATOM   10364 C  C     . ASN B 1 557 ? 48.397  47.858  5.152   1.00 24.75 ? 557  ASN B C     1 
ATOM   10365 O  O     . ASN B 1 557 ? 48.167  46.999  4.310   1.00 25.20 ? 557  ASN B O     1 
ATOM   10366 C  CB    . ASN B 1 557 ? 48.213  47.415  7.592   1.00 24.77 ? 557  ASN B CB    1 
ATOM   10367 C  CG    . ASN B 1 557 ? 46.857  46.906  7.190   1.00 24.99 ? 557  ASN B CG    1 
ATOM   10368 O  OD1   . ASN B 1 557 ? 46.678  45.700  7.022   1.00 27.00 ? 557  ASN B OD1   1 
ATOM   10369 N  ND2   . ASN B 1 557 ? 45.889  47.821  7.016   1.00 23.69 ? 557  ASN B ND2   1 
ATOM   10370 N  N     . LEU B 1 558 ? 47.973  49.110  5.017   1.00 24.72 ? 558  LEU B N     1 
ATOM   10371 C  CA    . LEU B 1 558 ? 47.202  49.501  3.845   1.00 24.29 ? 558  LEU B CA    1 
ATOM   10372 C  C     . LEU B 1 558 ? 48.037  49.264  2.593   1.00 24.14 ? 558  LEU B C     1 
ATOM   10373 O  O     . LEU B 1 558 ? 47.498  49.125  1.499   1.00 24.19 ? 558  LEU B O     1 
ATOM   10374 C  CB    . LEU B 1 558 ? 46.824  50.978  3.920   1.00 23.93 ? 558  LEU B CB    1 
ATOM   10375 C  CG    . LEU B 1 558 ? 45.644  51.352  4.818   1.00 23.96 ? 558  LEU B CG    1 
ATOM   10376 C  CD1   . LEU B 1 558 ? 45.463  52.852  4.781   1.00 24.76 ? 558  LEU B CD1   1 
ATOM   10377 C  CD2   . LEU B 1 558 ? 44.351  50.680  4.423   1.00 23.60 ? 558  LEU B CD2   1 
ATOM   10378 N  N     . ALA B 1 559 ? 49.361  49.235  2.761   1.00 23.87 ? 559  ALA B N     1 
ATOM   10379 C  CA    . ALA B 1 559 ? 50.283  49.131  1.640   1.00 23.23 ? 559  ALA B CA    1 
ATOM   10380 C  C     . ALA B 1 559 ? 50.491  47.685  1.233   1.00 22.99 ? 559  ALA B C     1 
ATOM   10381 O  O     . ALA B 1 559 ? 50.599  47.394  0.049   1.00 23.52 ? 559  ALA B O     1 
ATOM   10382 C  CB    . ALA B 1 559 ? 51.585  49.764  1.987   1.00 23.12 ? 559  ALA B CB    1 
ATOM   10383 N  N     . GLU B 1 560 ? 50.562  46.789  2.213   1.00 22.63 ? 560  GLU B N     1 
ATOM   10384 C  CA    . GLU B 1 560 ? 50.624  45.344  1.970   1.00 22.00 ? 560  GLU B CA    1 
ATOM   10385 C  C     . GLU B 1 560 ? 49.333  44.918  1.291   1.00 21.91 ? 560  GLU B C     1 
ATOM   10386 O  O     . GLU B 1 560 ? 49.354  44.194  0.280   1.00 21.69 ? 560  GLU B O     1 
ATOM   10387 C  CB    . GLU B 1 560 ? 50.800  44.584  3.296   1.00 21.87 ? 560