data_1OL5
# 
_entry.id   1OL5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OL5         
PDBE  EBI-13206    
WWPDB D_1290013206 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1MUO unspecified 'CRYSTAL STRUCTURE OF AURORA-2, AN ONCOGENIC SERINE-THREONINE KINASE'  
PDB 1OL6 unspecified 'STRUCTURE OF UNPHOSPHORYLATED D274N MUTANT OF AURORA-A'               
PDB 1OL7 unspecified 'STRUCTURE OF HUMAN AURORA-A 122-403 PHOSPHORYLATED ON THR287, THR288' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OL5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bayliss, R.' 1 
'Conti, E.'   2 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis of Aurora-A Activation by Tpx2 at the Mitotic Spindle' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            12 
_citation.page_first                851 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14580337 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(03)00392-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bayliss, R.' 1 
primary 'Sardon, T.'  2 
primary 'Vernos, I.'  3 
primary 'Conti, E.'   4 
# 
_cell.entry_id           1OL5 
_cell.length_a           59.630 
_cell.length_b           81.720 
_cell.length_c           83.050 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OL5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE KINASE 6'                                  32849.418 1   2.7.1.37 ? 
'CATALYTIC DOMAIN, RESIDUES 122-403' 'PHOSPHORYLATED ON THR287, THR288' 
2 polymer     man 'RESTRICTED EXPRESSION PROLIFERATION ASSOCIATED PROTEIN 100' 4911.110  1   ?        ? 
'N-TERMINAL, RESIDUES 1-43'          ?                                  
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                   427.201   1   ?        ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                              24.305    3   ?        ? ? ? 
5 non-polymer syn 'SULFATE ION'                                                96.063    3   ?        ? ? ? 
6 water       nat water                                                        18.015    144 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'AURORA-A, SERINE/THREONINE KINASE 15, AURORA/IPL1-RELATED KINASE 1, AURORA-RELATED KINASE 1, HARK1, BREAST-TUMOR-AMPLIFIED KINASE' 
2 'TPX2, PROTEIN FLS353, DIL-2, P100, TARGETING PROTEIN FOR XKLP2, HEPATOCELLULAR CARCINOMA-ASSOCIATED ANTIGEN 519' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH
DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA
PSSRR(TPO)(TPO)LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVT
EGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
;
;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH
DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLIS
RLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
;
A ? 
2 'polypeptide(L)' no no  MAQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN MAQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   SER n 
1 3   LYS n 
1 4   LYS n 
1 5   ARG n 
1 6   GLN n 
1 7   TRP n 
1 8   ALA n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  PHE n 
1 13  GLU n 
1 14  ILE n 
1 15  GLY n 
1 16  ARG n 
1 17  PRO n 
1 18  LEU n 
1 19  GLY n 
1 20  LYS n 
1 21  GLY n 
1 22  LYS n 
1 23  PHE n 
1 24  GLY n 
1 25  ASN n 
1 26  VAL n 
1 27  TYR n 
1 28  LEU n 
1 29  ALA n 
1 30  ARG n 
1 31  GLU n 
1 32  LYS n 
1 33  GLN n 
1 34  SER n 
1 35  LYS n 
1 36  PHE n 
1 37  ILE n 
1 38  LEU n 
1 39  ALA n 
1 40  LEU n 
1 41  LYS n 
1 42  VAL n 
1 43  LEU n 
1 44  PHE n 
1 45  LYS n 
1 46  ALA n 
1 47  GLN n 
1 48  LEU n 
1 49  GLU n 
1 50  LYS n 
1 51  ALA n 
1 52  GLY n 
1 53  VAL n 
1 54  GLU n 
1 55  HIS n 
1 56  GLN n 
1 57  LEU n 
1 58  ARG n 
1 59  ARG n 
1 60  GLU n 
1 61  VAL n 
1 62  GLU n 
1 63  ILE n 
1 64  GLN n 
1 65  SER n 
1 66  HIS n 
1 67  LEU n 
1 68  ARG n 
1 69  HIS n 
1 70  PRO n 
1 71  ASN n 
1 72  ILE n 
1 73  LEU n 
1 74  ARG n 
1 75  LEU n 
1 76  TYR n 
1 77  GLY n 
1 78  TYR n 
1 79  PHE n 
1 80  HIS n 
1 81  ASP n 
1 82  ALA n 
1 83  THR n 
1 84  ARG n 
1 85  VAL n 
1 86  TYR n 
1 87  LEU n 
1 88  ILE n 
1 89  LEU n 
1 90  GLU n 
1 91  TYR n 
1 92  ALA n 
1 93  PRO n 
1 94  LEU n 
1 95  GLY n 
1 96  THR n 
1 97  VAL n 
1 98  TYR n 
1 99  ARG n 
1 100 GLU n 
1 101 LEU n 
1 102 GLN n 
1 103 LYS n 
1 104 LEU n 
1 105 SER n 
1 106 LYS n 
1 107 PHE n 
1 108 ASP n 
1 109 GLU n 
1 110 GLN n 
1 111 ARG n 
1 112 THR n 
1 113 ALA n 
1 114 THR n 
1 115 TYR n 
1 116 ILE n 
1 117 THR n 
1 118 GLU n 
1 119 LEU n 
1 120 ALA n 
1 121 ASN n 
1 122 ALA n 
1 123 LEU n 
1 124 SER n 
1 125 TYR n 
1 126 CYS n 
1 127 HIS n 
1 128 SER n 
1 129 LYS n 
1 130 ARG n 
1 131 VAL n 
1 132 ILE n 
1 133 HIS n 
1 134 ARG n 
1 135 ASP n 
1 136 ILE n 
1 137 LYS n 
1 138 PRO n 
1 139 GLU n 
1 140 ASN n 
1 141 LEU n 
1 142 LEU n 
1 143 LEU n 
1 144 GLY n 
1 145 SER n 
1 146 ALA n 
1 147 GLY n 
1 148 GLU n 
1 149 LEU n 
1 150 LYS n 
1 151 ILE n 
1 152 ALA n 
1 153 ASP n 
1 154 PHE n 
1 155 GLY n 
1 156 TRP n 
1 157 SER n 
1 158 VAL n 
1 159 HIS n 
1 160 ALA n 
1 161 PRO n 
1 162 SER n 
1 163 SER n 
1 164 ARG n 
1 165 ARG n 
1 166 TPO n 
1 167 TPO n 
1 168 LEU n 
1 169 CYS n 
1 170 GLY n 
1 171 THR n 
1 172 LEU n 
1 173 ASP n 
1 174 TYR n 
1 175 LEU n 
1 176 PRO n 
1 177 PRO n 
1 178 GLU n 
1 179 MET n 
1 180 ILE n 
1 181 GLU n 
1 182 GLY n 
1 183 ARG n 
1 184 MET n 
1 185 HIS n 
1 186 ASP n 
1 187 GLU n 
1 188 LYS n 
1 189 VAL n 
1 190 ASP n 
1 191 LEU n 
1 192 TRP n 
1 193 SER n 
1 194 LEU n 
1 195 GLY n 
1 196 VAL n 
1 197 LEU n 
1 198 CYS n 
1 199 TYR n 
1 200 GLU n 
1 201 PHE n 
1 202 LEU n 
1 203 VAL n 
1 204 GLY n 
1 205 LYS n 
1 206 PRO n 
1 207 PRO n 
1 208 PHE n 
1 209 GLU n 
1 210 ALA n 
1 211 ASN n 
1 212 THR n 
1 213 TYR n 
1 214 GLN n 
1 215 GLU n 
1 216 THR n 
1 217 TYR n 
1 218 LYS n 
1 219 ARG n 
1 220 ILE n 
1 221 SER n 
1 222 ARG n 
1 223 VAL n 
1 224 GLU n 
1 225 PHE n 
1 226 THR n 
1 227 PHE n 
1 228 PRO n 
1 229 ASP n 
1 230 PHE n 
1 231 VAL n 
1 232 THR n 
1 233 GLU n 
1 234 GLY n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 LEU n 
1 239 ILE n 
1 240 SER n 
1 241 ARG n 
1 242 LEU n 
1 243 LEU n 
1 244 LYS n 
1 245 HIS n 
1 246 ASN n 
1 247 PRO n 
1 248 SER n 
1 249 GLN n 
1 250 ARG n 
1 251 PRO n 
1 252 MET n 
1 253 LEU n 
1 254 ARG n 
1 255 GLU n 
1 256 VAL n 
1 257 LEU n 
1 258 GLU n 
1 259 HIS n 
1 260 PRO n 
1 261 TRP n 
1 262 ILE n 
1 263 THR n 
1 264 ALA n 
1 265 ASN n 
1 266 SER n 
1 267 SER n 
1 268 LYS n 
1 269 PRO n 
1 270 SER n 
1 271 ASN n 
1 272 CYS n 
1 273 GLN n 
1 274 ASN n 
1 275 LYS n 
1 276 GLU n 
1 277 SER n 
1 278 ALA n 
1 279 SER n 
1 280 LYS n 
1 281 GLN n 
1 282 SER n 
2 1   MET n 
2 2   ALA n 
2 3   GLN n 
2 4   VAL n 
2 5   LYS n 
2 6   SER n 
2 7   SER n 
2 8   TYR n 
2 9   SER n 
2 10  TYR n 
2 11  ASP n 
2 12  ALA n 
2 13  PRO n 
2 14  SER n 
2 15  ASP n 
2 16  PHE n 
2 17  ILE n 
2 18  ASN n 
2 19  PHE n 
2 20  SER n 
2 21  SER n 
2 22  LEU n 
2 23  ASP n 
2 24  ASP n 
2 25  GLU n 
2 26  GLY n 
2 27  ASP n 
2 28  THR n 
2 29  GLN n 
2 30  ASN n 
2 31  ILE n 
2 32  ASP n 
2 33  SER n 
2 34  TRP n 
2 35  PHE n 
2 36  GLU n 
2 37  GLU n 
2 38  LYS n 
2 39  ALA n 
2 40  ASN n 
2 41  LEU n 
2 42  GLU n 
2 43  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? 'CODONPLUS RIL' ? 
? ? ? ? ? ? ? PET-M11 ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)'     ? 
? ? ? ? ? ? ? PGEXCS  ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP STK6_HUMAN 1 ? ? O14965 ? 
2 UNP DIL2_HUMAN 2 ? ? Q9ULW0 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OL5 A 1 ? 282 ? O14965 122 ? 403 ? 122 403 
2 2 1OL5 B 1 ? 43  ? Q9ULW0 1   ? 43  ? 1   43  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ?                  'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ?                  'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ?                  'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                  'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                  'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                  'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ?                  'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                  'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ?                  'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                  'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ?                  'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                  'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                  'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ?                  'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ?                  'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ?                  'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ?                  'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ?                  'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ?                  'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'              ?                  'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                  ?                  'C4 H9 N O3'        119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE           PHOSPHONOTHREONINE 'C4 H10 N O6 P'     199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                  'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                  'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ?                  'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1OL5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   55.3 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '18% (W/V) PEG8000, 100 MM MES PH 6.5, 200 MM MGSO4' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2003-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OL5 
_reflns.observed_criterion_sigma_I   6.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   14609 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.09900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.1000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.24800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.100 
_reflns_shell.pdbx_redundancy        5.70 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OL5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14609 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.194 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'UNPHOSPHORYLATED AURORA/TPX2' 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2418 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             144 
_refine_hist.number_atoms_total               2607 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1OL5 
_struct.title                     'Structure of Aurora-A 122-403, phosphorylated on Thr287, Thr288 and bound to TPX2 1-43' 
_struct.pdbx_descriptor           
'SERINE/THREONINE KINASE 6 (E.C.2.7.1.37), RESTRICTED EXPRESSION PROLIFERATION ASSOCIATED PROTEIN 100' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OL5 
_struct_keywords.pdbx_keywords   'TRANSFERASE/CELL CYCLE' 
_struct_keywords.text            
'TRANSFERASE-CELL CYCLE COMPLEX, CELL CYCLE, TRANSFERASE, SERINE/THREONINE-PROTEIN KINASE, ATP-BINDING, PHOSPHORYLATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 4 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;FOR THE HETERO-ASSEMBLY DESCRIBED BY REMARK                  
  350
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 8   ? GLU A 10  ? ALA A 129 GLU A 131 5 ? 3  
HELX_P HELX_P2  2  LYS A 45  ? GLY A 52  ? LYS A 166 GLY A 173 1 ? 8  
HELX_P HELX_P3  3  VAL A 53  ? HIS A 66  ? VAL A 174 HIS A 187 1 ? 14 
HELX_P HELX_P4  4  THR A 96  ? SER A 105 ? THR A 217 SER A 226 1 ? 10 
HELX_P HELX_P5  5  ASP A 108 ? LYS A 129 ? ASP A 229 LYS A 250 1 ? 22 
HELX_P HELX_P6  6  LYS A 137 ? GLU A 139 ? LYS A 258 GLU A 260 5 ? 3  
HELX_P HELX_P7  7  THR A 171 ? LEU A 175 ? THR A 292 LEU A 296 5 ? 5  
HELX_P HELX_P8  8  PRO A 176 ? GLU A 181 ? PRO A 297 GLU A 302 1 ? 6  
HELX_P HELX_P9  9  GLU A 187 ? GLY A 204 ? GLU A 308 GLY A 325 1 ? 18 
HELX_P HELX_P10 10 THR A 212 ? VAL A 223 ? THR A 333 VAL A 344 1 ? 12 
HELX_P HELX_P11 11 THR A 232 ? LEU A 243 ? THR A 353 LEU A 364 1 ? 12 
HELX_P HELX_P12 12 ASN A 246 ? ARG A 250 ? ASN A 367 ARG A 371 5 ? 5  
HELX_P HELX_P13 13 MET A 252 ? GLU A 258 ? MET A 373 GLU A 379 1 ? 7  
HELX_P HELX_P14 14 HIS A 259 ? SER A 266 ? HIS A 380 SER A 387 1 ? 8  
HELX_P HELX_P15 15 ASN B 30  ? ASP B 32  ? ASN B 30  ASP B 32  5 ? 3  
HELX_P HELX_P16 16 SER B 33  ? LEU B 41  ? SER B 33  LEU B 41  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A ARG 165 C  ? ? ? 1_555 A TPO 166 N   ? ? A ARG 286  A TPO 287  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale2  covale ? ? A TPO 166 C  ? ? ? 1_555 A TPO 167 N   ? ? A TPO 287  A TPO 288  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale3  covale ? ? A TPO 167 C  ? ? ? 1_555 A LEU 168 N   ? ? A TPO 288  A LEU 289  1_555 ? ? ? ? ? ? ? 1.325 ? 
metalc1  metalc ? ? D MG  .   MG ? ? ? 1_555 A ASN 140 OD1 ? ? A MG  1389 A ASN 261  1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc2  metalc ? ? D MG  .   MG ? ? ? 1_555 C ADP .   O2A ? ? A MG  1389 A ADP 1388 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc3  metalc ? ? D MG  .   MG ? ? ? 1_555 A ASP 153 OD2 ? ? A MG  1389 A ASP 274  1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc4  metalc ? ? D MG  .   MG ? ? ? 1_555 C ADP .   O3A ? ? A MG  1389 A ADP 1388 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc5  metalc ? ? D MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1389 A HOH 2073 1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc6  metalc ? ? D MG  .   MG ? ? ? 1_555 C ADP .   O3B ? ? A MG  1389 A ADP 1388 1_555 ? ? ? ? ? ? ? 3.140 ? 
metalc7  metalc ? ? E MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1390 A HOH 2123 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc8  metalc ? ? E MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1390 A HOH 2028 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc9  metalc ? ? E MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1390 A HOH 2125 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc10 metalc ? ? E MG  .   MG ? ? ? 1_555 C ADP .   O2B ? ? A MG  1390 A ADP 1388 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc11 metalc ? ? E MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1390 A HOH 2124 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc12 metalc ? ? E MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1390 A HOH 2026 1_555 ? ? ? ? ? ? ? 1.793 ? 
metalc13 metalc ? ? I MG  .   MG ? ? ? 1_555 J HOH .   O   ? ? A MG  1394 A HOH 2104 1_555 ? ? ? ? ? ? ? 2.454 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 12  ? GLY A 21  ? PHE A 133 GLY A 142 
AA 2 GLY A 24  ? GLU A 31  ? GLY A 145 GLU A 152 
AA 3 ILE A 37  ? PHE A 44  ? ILE A 158 PHE A 165 
AA 4 ARG A 84  ? LEU A 89  ? ARG A 205 LEU A 210 
AA 5 LEU A 75  ? HIS A 80  ? LEU A 196 HIS A 201 
AB 1 VAL A 131 ? ILE A 132 ? VAL A 252 ILE A 253 
AB 2 VAL A 158 ? HIS A 159 ? VAL A 279 HIS A 280 
AC 1 LEU A 141 ? LEU A 143 ? LEU A 262 LEU A 264 
AC 2 LEU A 149 ? ILE A 151 ? LEU A 270 ILE A 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 21  ? N GLY A 142 O GLY A 24  ? O GLY A 145 
AA 2 3 N ALA A 29  ? N ALA A 150 O LEU A 38  ? O LEU A 159 
AA 3 4 N LEU A 43  ? N LEU A 164 O VAL A 85  ? O VAL A 206 
AA 4 5 O ILE A 88  ? O ILE A 209 N TYR A 76  ? N TYR A 197 
AB 1 2 N ILE A 132 ? N ILE A 253 O VAL A 158 ? O VAL A 279 
AC 1 2 N LEU A 142 ? N LEU A 263 O LYS A 150 ? O LYS A 271 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A1389'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A1390'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A1391' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1392' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A1393' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG A1394'  
AC7 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ADP A1388' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASN A 140 ? ASN A 261  . ? 1_555 ? 
2  AC1 4  ASP A 153 ? ASP A 274  . ? 1_555 ? 
3  AC1 4  ADP C .   ? ADP A 1388 . ? 1_555 ? 
4  AC1 4  HOH J .   ? HOH A 2073 . ? 1_555 ? 
5  AC2 6  ADP C .   ? ADP A 1388 . ? 1_555 ? 
6  AC2 6  HOH J .   ? HOH A 2026 . ? 1_555 ? 
7  AC2 6  HOH J .   ? HOH A 2028 . ? 1_555 ? 
8  AC2 6  HOH J .   ? HOH A 2123 . ? 1_555 ? 
9  AC2 6  HOH J .   ? HOH A 2124 . ? 1_555 ? 
10 AC2 6  HOH J .   ? HOH A 2125 . ? 1_555 ? 
11 AC3 6  SER A 124 ? SER A 245  . ? 1_555 ? 
12 AC3 6  MET A 252 ? MET A 373  . ? 1_555 ? 
13 AC3 6  LEU A 253 ? LEU A 374  . ? 1_555 ? 
14 AC3 6  ARG A 254 ? ARG A 375  . ? 1_555 ? 
15 AC3 6  HOH J .   ? HOH A 2130 . ? 1_555 ? 
16 AC3 6  HOH J .   ? HOH A 2131 . ? 1_555 ? 
17 AC4 4  ARG A 99  ? ARG A 220  . ? 1_555 ? 
18 AC4 4  LYS A 103 ? LYS A 224  . ? 1_555 ? 
19 AC4 4  HOH J .   ? HOH A 2053 . ? 1_555 ? 
20 AC4 4  HOH J .   ? HOH A 2132 . ? 1_555 ? 
21 AC5 5  HIS A 55  ? HIS A 176  . ? 1_555 ? 
22 AC5 5  ARG A 59  ? ARG A 180  . ? 1_555 ? 
23 AC5 5  ARG A 165 ? ARG A 286  . ? 1_555 ? 
24 AC5 5  HOH J .   ? HOH A 2081 . ? 1_555 ? 
25 AC5 5  HOH J .   ? HOH A 2089 . ? 1_555 ? 
26 AC6 1  HOH J .   ? HOH A 2104 . ? 1_555 ? 
27 AC7 22 GLY A 19  ? GLY A 140  . ? 1_555 ? 
28 AC7 22 GLY A 21  ? GLY A 142  . ? 1_555 ? 
29 AC7 22 VAL A 26  ? VAL A 147  . ? 1_555 ? 
30 AC7 22 ALA A 39  ? ALA A 160  . ? 1_555 ? 
31 AC7 22 LYS A 41  ? LYS A 162  . ? 1_555 ? 
32 AC7 22 LEU A 73  ? LEU A 194  . ? 1_555 ? 
33 AC7 22 GLU A 90  ? GLU A 211  . ? 1_555 ? 
34 AC7 22 ALA A 92  ? ALA A 213  . ? 1_555 ? 
35 AC7 22 THR A 96  ? THR A 217  . ? 1_555 ? 
36 AC7 22 GLU A 139 ? GLU A 260  . ? 1_555 ? 
37 AC7 22 ASN A 140 ? ASN A 261  . ? 1_555 ? 
38 AC7 22 LEU A 142 ? LEU A 263  . ? 1_555 ? 
39 AC7 22 ASP A 153 ? ASP A 274  . ? 1_555 ? 
40 AC7 22 MG  D .   ? MG  A 1389 . ? 1_555 ? 
41 AC7 22 MG  E .   ? MG  A 1390 . ? 1_555 ? 
42 AC7 22 HOH J .   ? HOH A 2122 . ? 1_555 ? 
43 AC7 22 HOH J .   ? HOH A 2123 . ? 1_555 ? 
44 AC7 22 HOH J .   ? HOH A 2124 . ? 1_555 ? 
45 AC7 22 HOH J .   ? HOH A 2126 . ? 1_555 ? 
46 AC7 22 HOH J .   ? HOH A 2127 . ? 1_555 ? 
47 AC7 22 HOH J .   ? HOH A 2128 . ? 1_555 ? 
48 AC7 22 HOH J .   ? HOH A 2129 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OL5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OL5 
_atom_sites.fract_transf_matrix[1][1]   0.016770 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012237 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012041 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? 174.192 196.109 19.556  1.00 32.09 ? 123  SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? 173.449 195.246 20.532  1.00 33.80 ? 123  SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? 173.331 195.751 21.954  1.00 32.28 ? 123  SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? 174.318 196.187 22.580  1.00 32.38 ? 123  SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? 174.078 193.853 20.627  1.00 33.78 ? 123  SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? 173.358 193.080 21.584  1.00 34.86 ? 123  SER A OG    1 
ATOM   7    N  N     . LYS A 1 3   ? 172.107 195.682 22.463  1.00 30.56 ? 124  LYS A N     1 
ATOM   8    C  CA    . LYS A 1 3   ? 171.860 196.059 23.849  1.00 31.07 ? 124  LYS A CA    1 
ATOM   9    C  C     . LYS A 1 3   ? 171.929 194.785 24.714  1.00 30.29 ? 124  LYS A C     1 
ATOM   10   O  O     . LYS A 1 3   ? 171.724 194.845 25.913  1.00 30.99 ? 124  LYS A O     1 
ATOM   11   C  CB    . LYS A 1 3   ? 170.483 196.727 24.005  1.00 31.64 ? 124  LYS A CB    1 
ATOM   12   C  CG    . LYS A 1 3   ? 170.231 197.847 23.021  1.00 33.77 ? 124  LYS A CG    1 
ATOM   13   C  CD    . LYS A 1 3   ? 168.734 198.157 22.847  1.00 35.14 ? 124  LYS A CD    1 
ATOM   14   C  CE    . LYS A 1 3   ? 168.571 198.989 21.582  1.00 38.52 ? 124  LYS A CE    1 
ATOM   15   N  NZ    . LYS A 1 3   ? 167.170 199.182 21.123  1.00 40.74 ? 124  LYS A NZ    1 
ATOM   16   N  N     . LYS A 1 4   ? 172.256 193.646 24.102  1.00 30.71 ? 125  LYS A N     1 
ATOM   17   C  CA    . LYS A 1 4   ? 172.352 192.375 24.835  1.00 29.50 ? 125  LYS A CA    1 
ATOM   18   C  C     . LYS A 1 4   ? 173.728 192.027 25.381  1.00 26.48 ? 125  LYS A C     1 
ATOM   19   O  O     . LYS A 1 4   ? 174.769 192.438 24.859  1.00 24.13 ? 125  LYS A O     1 
ATOM   20   C  CB    . LYS A 1 4   ? 171.942 191.210 23.951  1.00 32.42 ? 125  LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 4   ? 170.496 191.147 23.609  1.00 35.74 ? 125  LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 4   ? 170.221 189.915 22.777  1.00 38.96 ? 125  LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 4   ? 168.757 189.905 22.351  1.00 44.54 ? 125  LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 4   ? 168.305 188.576 21.807  1.00 44.21 ? 125  LYS A NZ    1 
ATOM   25   N  N     . ARG A 1 5   ? 173.713 191.215 26.421  1.00 24.15 ? 126  ARG A N     1 
ATOM   26   C  CA    . ARG A 1 5   ? 174.952 190.756 27.020  1.00 22.33 ? 126  ARG A CA    1 
ATOM   27   C  C     . ARG A 1 5   ? 175.752 189.995 25.943  1.00 22.44 ? 126  ARG A C     1 
ATOM   28   O  O     . ARG A 1 5   ? 175.252 189.077 25.296  1.00 20.29 ? 126  ARG A O     1 
ATOM   29   C  CB    . ARG A 1 5   ? 174.636 189.835 28.191  1.00 21.13 ? 126  ARG A CB    1 
ATOM   30   C  CG    . ARG A 1 5   ? 175.841 189.331 28.897  1.00 18.73 ? 126  ARG A CG    1 
ATOM   31   C  CD    . ARG A 1 5   ? 175.395 188.263 29.847  1.00 19.74 ? 126  ARG A CD    1 
ATOM   32   N  NE    . ARG A 1 5   ? 176.552 187.628 30.420  1.00 16.73 ? 126  ARG A NE    1 
ATOM   33   C  CZ    . ARG A 1 5   ? 176.503 186.741 31.394  1.00 17.59 ? 126  ARG A CZ    1 
ATOM   34   N  NH1   . ARG A 1 5   ? 175.331 186.391 31.902  1.00 16.71 ? 126  ARG A NH1   1 
ATOM   35   N  NH2   . ARG A 1 5   ? 177.633 186.214 31.854  1.00 18.45 ? 126  ARG A NH2   1 
ATOM   36   N  N     . GLN A 1 6   ? 176.997 190.406 25.763  1.00 21.10 ? 127  GLN A N     1 
ATOM   37   C  CA    . GLN A 1 6   ? 177.904 189.815 24.787  1.00 19.12 ? 127  GLN A CA    1 
ATOM   38   C  C     . GLN A 1 6   ? 178.861 188.861 25.496  1.00 17.70 ? 127  GLN A C     1 
ATOM   39   O  O     . GLN A 1 6   ? 179.049 188.941 26.715  1.00 13.46 ? 127  GLN A O     1 
ATOM   40   C  CB    . GLN A 1 6   ? 178.707 190.934 24.102  1.00 18.99 ? 127  GLN A CB    1 
ATOM   41   C  CG    . GLN A 1 6   ? 177.842 191.925 23.355  1.00 15.64 ? 127  GLN A CG    1 
ATOM   42   C  CD    . GLN A 1 6   ? 177.154 191.297 22.162  1.00 17.04 ? 127  GLN A CD    1 
ATOM   43   O  OE1   . GLN A 1 6   ? 177.748 191.151 21.093  1.00 21.45 ? 127  GLN A OE1   1 
ATOM   44   N  NE2   . GLN A 1 6   ? 175.902 190.912 22.339  1.00 20.66 ? 127  GLN A NE2   1 
ATOM   45   N  N     . TRP A 1 7   ? 179.460 187.956 24.735  1.00 16.62 ? 128  TRP A N     1 
ATOM   46   C  CA    . TRP A 1 7   ? 180.411 187.014 25.303  1.00 14.25 ? 128  TRP A CA    1 
ATOM   47   C  C     . TRP A 1 7   ? 181.611 187.777 25.855  1.00 16.17 ? 128  TRP A C     1 
ATOM   48   O  O     . TRP A 1 7   ? 181.885 188.903 25.457  1.00 17.48 ? 128  TRP A O     1 
ATOM   49   C  CB    . TRP A 1 7   ? 180.890 186.029 24.237  1.00 13.22 ? 128  TRP A CB    1 
ATOM   50   C  CG    . TRP A 1 7   ? 179.858 185.060 23.779  1.00 9.34  ? 128  TRP A CG    1 
ATOM   51   C  CD1   . TRP A 1 7   ? 179.338 184.945 22.529  1.00 11.79 ? 128  TRP A CD1   1 
ATOM   52   C  CD2   . TRP A 1 7   ? 179.264 184.022 24.557  1.00 13.44 ? 128  TRP A CD2   1 
ATOM   53   N  NE1   . TRP A 1 7   ? 178.460 183.893 22.469  1.00 12.24 ? 128  TRP A NE1   1 
ATOM   54   C  CE2   . TRP A 1 7   ? 178.396 183.304 23.704  1.00 11.84 ? 128  TRP A CE2   1 
ATOM   55   C  CE3   . TRP A 1 7   ? 179.389 183.618 25.899  1.00 15.05 ? 128  TRP A CE3   1 
ATOM   56   C  CZ2   . TRP A 1 7   ? 177.648 182.204 24.146  1.00 10.99 ? 128  TRP A CZ2   1 
ATOM   57   C  CZ3   . TRP A 1 7   ? 178.646 182.523 26.336  1.00 15.81 ? 128  TRP A CZ3   1 
ATOM   58   C  CH2   . TRP A 1 7   ? 177.789 181.828 25.457  1.00 13.35 ? 128  TRP A CH2   1 
ATOM   59   N  N     . ALA A 1 8   ? 182.306 187.146 26.790  1.00 17.52 ? 129  ALA A N     1 
ATOM   60   C  CA    . ALA A 1 8   ? 183.501 187.695 27.415  1.00 17.26 ? 129  ALA A CA    1 
ATOM   61   C  C     . ALA A 1 8   ? 184.303 186.478 27.906  1.00 17.06 ? 129  ALA A C     1 
ATOM   62   O  O     . ALA A 1 8   ? 183.733 185.426 28.198  1.00 17.77 ? 129  ALA A O     1 
ATOM   63   C  CB    . ALA A 1 8   ? 183.129 188.595 28.576  1.00 8.15  ? 129  ALA A CB    1 
ATOM   64   N  N     . LEU A 1 9   ? 185.618 186.620 27.979  1.00 16.79 ? 130  LEU A N     1 
ATOM   65   C  CA    . LEU A 1 9   ? 186.479 185.540 28.425  1.00 19.53 ? 130  LEU A CA    1 
ATOM   66   C  C     . LEU A 1 9   ? 186.090 185.081 29.834  1.00 21.19 ? 130  LEU A C     1 
ATOM   67   O  O     . LEU A 1 9   ? 186.080 183.885 30.121  1.00 24.25 ? 130  LEU A O     1 
ATOM   68   C  CB    . LEU A 1 9   ? 187.943 186.006 28.392  1.00 19.86 ? 130  LEU A CB    1 
ATOM   69   C  CG    . LEU A 1 9   ? 189.050 184.967 28.619  1.00 22.85 ? 130  LEU A CG    1 
ATOM   70   C  CD1   . LEU A 1 9   ? 188.897 183.839 27.604  1.00 17.77 ? 130  LEU A CD1   1 
ATOM   71   C  CD2   . LEU A 1 9   ? 190.429 185.631 28.492  1.00 16.04 ? 130  LEU A CD2   1 
ATOM   72   N  N     . GLU A 1 10  ? 185.756 186.032 30.705  1.00 23.78 ? 131  GLU A N     1 
ATOM   73   C  CA    . GLU A 1 10  ? 185.349 185.729 32.082  1.00 25.83 ? 131  GLU A CA    1 
ATOM   74   C  C     . GLU A 1 10  ? 184.146 184.751 32.145  1.00 25.30 ? 131  GLU A C     1 
ATOM   75   O  O     . GLU A 1 10  ? 183.790 184.281 33.227  1.00 21.67 ? 131  GLU A O     1 
ATOM   76   C  CB    . GLU A 1 10  ? 184.952 187.016 32.834  1.00 30.42 ? 131  GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 10  ? 186.005 188.110 32.945  1.00 42.06 ? 131  GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 10  ? 186.135 188.977 31.686  1.00 46.89 ? 131  GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 10  ? 185.319 188.822 30.747  1.00 51.89 ? 131  GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 10  ? 187.058 189.821 31.640  1.00 50.51 ? 131  GLU A OE2   1 
ATOM   81   N  N     . ASP A 1 11  ? 183.503 184.473 31.008  1.00 22.51 ? 132  ASP A N     1 
ATOM   82   C  CA    . ASP A 1 11  ? 182.364 183.565 30.989  1.00 22.54 ? 132  ASP A CA    1 
ATOM   83   C  C     . ASP A 1 11  ? 182.752 182.087 30.966  1.00 21.99 ? 132  ASP A C     1 
ATOM   84   O  O     . ASP A 1 11  ? 181.925 181.226 31.267  1.00 22.12 ? 132  ASP A O     1 
ATOM   85   C  CB    . ASP A 1 11  ? 181.458 183.825 29.782  1.00 24.79 ? 132  ASP A CB    1 
ATOM   86   C  CG    . ASP A 1 11  ? 180.631 185.120 29.908  1.00 28.99 ? 132  ASP A CG    1 
ATOM   87   O  OD1   . ASP A 1 11  ? 180.136 185.417 31.025  1.00 29.67 ? 132  ASP A OD1   1 
ATOM   88   O  OD2   . ASP A 1 11  ? 180.450 185.824 28.873  1.00 26.45 ? 132  ASP A OD2   1 
ATOM   89   N  N     . PHE A 1 12  ? 183.998 181.781 30.625  1.00 23.02 ? 133  PHE A N     1 
ATOM   90   C  CA    . PHE A 1 12  ? 184.411 180.378 30.554  1.00 22.89 ? 133  PHE A CA    1 
ATOM   91   C  C     . PHE A 1 12  ? 185.557 179.984 31.484  1.00 22.91 ? 133  PHE A C     1 
ATOM   92   O  O     . PHE A 1 12  ? 186.466 180.766 31.755  1.00 24.66 ? 133  PHE A O     1 
ATOM   93   C  CB    . PHE A 1 12  ? 184.812 179.998 29.111  1.00 18.64 ? 133  PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 12  ? 183.901 180.565 28.039  1.00 17.41 ? 133  PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 12  ? 184.042 181.884 27.616  1.00 15.80 ? 133  PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 12  ? 182.904 179.783 27.456  1.00 16.46 ? 133  PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 12  ? 183.215 182.414 26.637  1.00 14.66 ? 133  PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 12  ? 182.063 180.305 26.466  1.00 15.10 ? 133  PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 12  ? 182.224 181.626 26.060  1.00 18.42 ? 133  PHE A CZ    1 
ATOM   100  N  N     . GLU A 1 13  ? 185.484 178.767 32.005  1.00 22.49 ? 134  GLU A N     1 
ATOM   101  C  CA    . GLU A 1 13  ? 186.566 178.248 32.814  1.00 21.74 ? 134  GLU A CA    1 
ATOM   102  C  C     . GLU A 1 13  ? 187.313 177.528 31.695  1.00 21.49 ? 134  GLU A C     1 
ATOM   103  O  O     . GLU A 1 13  ? 186.702 176.784 30.922  1.00 23.43 ? 134  GLU A O     1 
ATOM   104  C  CB    . GLU A 1 13  ? 186.054 177.264 33.870  1.00 23.93 ? 134  GLU A CB    1 
ATOM   105  C  CG    . GLU A 1 13  ? 185.401 177.912 35.088  1.00 29.62 ? 134  GLU A CG    1 
ATOM   106  C  CD    . GLU A 1 13  ? 184.751 176.887 36.020  1.00 37.53 ? 134  GLU A CD    1 
ATOM   107  O  OE1   . GLU A 1 13  ? 185.460 175.983 36.533  1.00 38.84 ? 134  GLU A OE1   1 
ATOM   108  O  OE2   . GLU A 1 13  ? 183.517 176.974 36.236  1.00 43.58 ? 134  GLU A OE2   1 
ATOM   109  N  N     . ILE A 1 14  ? 188.608 177.794 31.564  1.00 19.74 ? 135  ILE A N     1 
ATOM   110  C  CA    . ILE A 1 14  ? 189.425 177.197 30.524  1.00 19.08 ? 135  ILE A CA    1 
ATOM   111  C  C     . ILE A 1 14  ? 190.099 175.941 31.044  1.00 20.74 ? 135  ILE A C     1 
ATOM   112  O  O     . ILE A 1 14  ? 190.667 175.944 32.140  1.00 19.34 ? 135  ILE A O     1 
ATOM   113  C  CB    . ILE A 1 14  ? 190.554 178.149 30.072  1.00 22.58 ? 135  ILE A CB    1 
ATOM   114  C  CG1   . ILE A 1 14  ? 189.990 179.541 29.762  1.00 20.52 ? 135  ILE A CG1   1 
ATOM   115  C  CG2   . ILE A 1 14  ? 191.285 177.543 28.866  1.00 19.44 ? 135  ILE A CG2   1 
ATOM   116  C  CD1   . ILE A 1 14  ? 188.876 179.535 28.771  1.00 21.85 ? 135  ILE A CD1   1 
ATOM   117  N  N     . GLY A 1 15  ? 190.058 174.876 30.245  1.00 19.98 ? 136  GLY A N     1 
ATOM   118  C  CA    . GLY A 1 15  ? 190.688 173.629 30.637  1.00 19.38 ? 136  GLY A CA    1 
ATOM   119  C  C     . GLY A 1 15  ? 191.995 173.397 29.906  1.00 18.61 ? 136  GLY A C     1 
ATOM   120  O  O     . GLY A 1 15  ? 192.742 174.324 29.668  1.00 20.61 ? 136  GLY A O     1 
ATOM   121  N  N     . ARG A 1 16  ? 192.267 172.156 29.533  1.00 22.50 ? 137  ARG A N     1 
ATOM   122  C  CA    . ARG A 1 16  ? 193.500 171.827 28.833  1.00 22.75 ? 137  ARG A CA    1 
ATOM   123  C  C     . ARG A 1 16  ? 193.396 172.183 27.357  1.00 23.53 ? 137  ARG A C     1 
ATOM   124  O  O     . ARG A 1 16  ? 192.316 172.425 26.840  1.00 24.10 ? 137  ARG A O     1 
ATOM   125  C  CB    . ARG A 1 16  ? 193.771 170.325 28.920  1.00 22.49 ? 137  ARG A CB    1 
ATOM   126  C  CG    . ARG A 1 16  ? 192.820 169.474 28.047  1.00 20.82 ? 137  ARG A CG    1 
ATOM   127  C  CD    . ARG A 1 16  ? 193.107 168.016 28.252  1.00 15.70 ? 137  ARG A CD    1 
ATOM   128  N  NE    . ARG A 1 16  ? 192.212 167.104 27.554  1.00 14.70 ? 137  ARG A NE    1 
ATOM   129  C  CZ    . ARG A 1 16  ? 192.299 166.784 26.266  1.00 14.90 ? 137  ARG A CZ    1 
ATOM   130  N  NH1   . ARG A 1 16  ? 193.237 167.305 25.493  1.00 13.75 ? 137  ARG A NH1   1 
ATOM   131  N  NH2   . ARG A 1 16  ? 191.462 165.900 25.758  1.00 13.41 ? 137  ARG A NH2   1 
ATOM   132  N  N     . PRO A 1 17  ? 194.542 172.250 26.671  1.00 22.98 ? 138  PRO A N     1 
ATOM   133  C  CA    . PRO A 1 17  ? 194.613 172.552 25.237  1.00 22.67 ? 138  PRO A CA    1 
ATOM   134  C  C     . PRO A 1 17  ? 194.135 171.275 24.497  1.00 23.48 ? 138  PRO A C     1 
ATOM   135  O  O     . PRO A 1 17  ? 194.528 170.147 24.876  1.00 21.67 ? 138  PRO A O     1 
ATOM   136  C  CB    . PRO A 1 17  ? 196.116 172.791 25.007  1.00 21.39 ? 138  PRO A CB    1 
ATOM   137  C  CG    . PRO A 1 17  ? 196.570 173.354 26.295  1.00 19.67 ? 138  PRO A CG    1 
ATOM   138  C  CD    . PRO A 1 17  ? 195.850 172.477 27.313  1.00 19.97 ? 138  PRO A CD    1 
ATOM   139  N  N     . LEU A 1 18  ? 193.297 171.435 23.471  1.00 19.70 ? 139  LEU A N     1 
ATOM   140  C  CA    . LEU A 1 18  ? 192.809 170.281 22.716  1.00 19.33 ? 139  LEU A CA    1 
ATOM   141  C  C     . LEU A 1 18  ? 193.636 170.125 21.454  1.00 18.97 ? 139  LEU A C     1 
ATOM   142  O  O     . LEU A 1 18  ? 193.714 169.045 20.883  1.00 20.68 ? 139  LEU A O     1 
ATOM   143  C  CB    . LEU A 1 18  ? 191.340 170.454 22.318  1.00 19.32 ? 139  LEU A CB    1 
ATOM   144  C  CG    . LEU A 1 18  ? 190.349 170.509 23.473  1.00 18.46 ? 139  LEU A CG    1 
ATOM   145  C  CD1   . LEU A 1 18  ? 188.966 170.866 22.964  1.00 16.26 ? 139  LEU A CD1   1 
ATOM   146  C  CD2   . LEU A 1 18  ? 190.342 169.178 24.163  1.00 15.61 ? 139  LEU A CD2   1 
ATOM   147  N  N     . GLY A 1 19  ? 194.256 171.215 21.026  1.00 19.57 ? 140  GLY A N     1 
ATOM   148  C  CA    . GLY A 1 19  ? 195.056 171.181 19.825  1.00 16.45 ? 140  GLY A CA    1 
ATOM   149  C  C     . GLY A 1 19  ? 195.821 172.461 19.630  1.00 18.41 ? 140  GLY A C     1 
ATOM   150  O  O     . GLY A 1 19  ? 195.560 173.469 20.280  1.00 17.66 ? 140  GLY A O     1 
ATOM   151  N  N     . LYS A 1 20  ? 196.778 172.413 18.713  1.00 23.54 ? 141  LYS A N     1 
ATOM   152  C  CA    . LYS A 1 20  ? 197.635 173.547 18.399  1.00 25.64 ? 141  LYS A CA    1 
ATOM   153  C  C     . LYS A 1 20  ? 197.313 174.071 16.995  1.00 26.94 ? 141  LYS A C     1 
ATOM   154  O  O     . LYS A 1 20  ? 197.578 173.409 15.986  1.00 26.47 ? 141  LYS A O     1 
ATOM   155  C  CB    . LYS A 1 20  ? 199.103 173.104 18.473  1.00 29.50 ? 141  LYS A CB    1 
ATOM   156  C  CG    . LYS A 1 20  ? 200.101 174.192 18.080  1.00 37.58 ? 141  LYS A CG    1 
ATOM   157  C  CD    . LYS A 1 20  ? 201.550 173.744 18.187  1.00 42.29 ? 141  LYS A CD    1 
ATOM   158  C  CE    . LYS A 1 20  ? 202.483 174.918 17.891  1.00 46.12 ? 141  LYS A CE    1 
ATOM   159  N  NZ    . LYS A 1 20  ? 203.914 174.481 17.890  1.00 49.84 ? 141  LYS A NZ    1 
ATOM   160  N  N     . GLY A 1 21  ? 196.724 175.256 16.938  1.00 26.51 ? 142  GLY A N     1 
ATOM   161  C  CA    . GLY A 1 21  ? 196.392 175.839 15.656  1.00 26.65 ? 142  GLY A CA    1 
ATOM   162  C  C     . GLY A 1 21  ? 197.515 176.753 15.234  1.00 26.71 ? 142  GLY A C     1 
ATOM   163  O  O     . GLY A 1 21  ? 198.384 177.086 16.052  1.00 26.93 ? 142  GLY A O     1 
ATOM   164  N  N     . LYS A 1 22  ? 197.501 177.158 13.969  1.00 24.67 ? 143  LYS A N     1 
ATOM   165  C  CA    . LYS A 1 22  ? 198.529 178.037 13.452  1.00 22.25 ? 143  LYS A CA    1 
ATOM   166  C  C     . LYS A 1 22  ? 198.554 179.404 14.160  1.00 22.22 ? 143  LYS A C     1 
ATOM   167  O  O     . LYS A 1 22  ? 199.641 179.921 14.425  1.00 22.44 ? 143  LYS A O     1 
ATOM   168  C  CB    . LYS A 1 22  ? 198.362 178.220 11.925  1.00 25.89 ? 143  LYS A CB    1 
ATOM   169  C  CG    . LYS A 1 22  ? 199.535 178.982 11.307  1.00 30.09 ? 143  LYS A CG    1 
ATOM   170  C  CD    . LYS A 1 22  ? 199.516 179.060 9.792   1.00 35.88 ? 143  LYS A CD    1 
ATOM   171  C  CE    . LYS A 1 22  ? 200.619 180.037 9.330   1.00 41.66 ? 143  LYS A CE    1 
ATOM   172  N  NZ    . LYS A 1 22  ? 200.871 180.206 7.857   1.00 42.97 ? 143  LYS A NZ    1 
ATOM   173  N  N     . PHE A 1 23  ? 197.394 179.986 14.477  1.00 20.35 ? 144  PHE A N     1 
ATOM   174  C  CA    . PHE A 1 23  ? 197.370 181.311 15.130  1.00 21.42 ? 144  PHE A CA    1 
ATOM   175  C  C     . PHE A 1 23  ? 197.001 181.263 16.626  1.00 20.47 ? 144  PHE A C     1 
ATOM   176  O  O     . PHE A 1 23  ? 196.668 182.283 17.246  1.00 20.98 ? 144  PHE A O     1 
ATOM   177  C  CB    . PHE A 1 23  ? 196.429 182.258 14.362  1.00 17.68 ? 144  PHE A CB    1 
ATOM   178  C  CG    . PHE A 1 23  ? 196.798 182.429 12.896  1.00 22.16 ? 144  PHE A CG    1 
ATOM   179  C  CD1   . PHE A 1 23  ? 196.541 181.421 11.959  1.00 20.33 ? 144  PHE A CD1   1 
ATOM   180  C  CD2   . PHE A 1 23  ? 197.460 183.574 12.464  1.00 23.47 ? 144  PHE A CD2   1 
ATOM   181  C  CE1   . PHE A 1 23  ? 196.944 181.564 10.624  1.00 20.91 ? 144  PHE A CE1   1 
ATOM   182  C  CE2   . PHE A 1 23  ? 197.864 183.716 11.128  1.00 21.10 ? 144  PHE A CE2   1 
ATOM   183  C  CZ    . PHE A 1 23  ? 197.606 182.708 10.213  1.00 18.55 ? 144  PHE A CZ    1 
ATOM   184  N  N     . GLY A 1 24  ? 197.094 180.072 17.208  1.00 18.58 ? 145  GLY A N     1 
ATOM   185  C  CA    . GLY A 1 24  ? 196.786 179.915 18.616  1.00 19.23 ? 145  GLY A CA    1 
ATOM   186  C  C     . GLY A 1 24  ? 196.229 178.538 18.922  1.00 20.99 ? 145  GLY A C     1 
ATOM   187  O  O     . GLY A 1 24  ? 195.911 177.756 18.016  1.00 21.28 ? 145  GLY A O     1 
ATOM   188  N  N     . ASN A 1 25  ? 196.100 178.233 20.204  1.00 20.66 ? 146  ASN A N     1 
ATOM   189  C  CA    . ASN A 1 25  ? 195.574 176.938 20.598  1.00 21.26 ? 146  ASN A CA    1 
ATOM   190  C  C     . ASN A 1 25  ? 194.056 176.878 20.683  1.00 20.53 ? 146  ASN A C     1 
ATOM   191  O  O     . ASN A 1 25  ? 193.370 177.902 20.676  1.00 20.90 ? 146  ASN A O     1 
ATOM   192  C  CB    . ASN A 1 25  ? 196.140 176.544 21.964  1.00 24.59 ? 146  ASN A CB    1 
ATOM   193  C  CG    . ASN A 1 25  ? 197.638 176.352 21.939  1.00 27.16 ? 146  ASN A CG    1 
ATOM   194  O  OD1   . ASN A 1 25  ? 198.205 175.853 20.956  1.00 32.36 ? 146  ASN A OD1   1 
ATOM   195  N  ND2   . ASN A 1 25  ? 198.292 176.737 23.015  1.00 27.51 ? 146  ASN A ND2   1 
ATOM   196  N  N     . VAL A 1 26  ? 193.540 175.658 20.740  1.00 18.03 ? 147  VAL A N     1 
ATOM   197  C  CA    . VAL A 1 26  ? 192.121 175.430 20.922  1.00 14.64 ? 147  VAL A CA    1 
ATOM   198  C  C     . VAL A 1 26  ? 192.142 174.746 22.301  1.00 16.21 ? 147  VAL A C     1 
ATOM   199  O  O     . VAL A 1 26  ? 192.897 173.783 22.523  1.00 14.13 ? 147  VAL A O     1 
ATOM   200  C  CB    . VAL A 1 26  ? 191.528 174.515 19.799  1.00 13.96 ? 147  VAL A CB    1 
ATOM   201  C  CG1   . VAL A 1 26  ? 190.053 174.217 20.092  1.00 10.05 ? 147  VAL A CG1   1 
ATOM   202  C  CG2   . VAL A 1 26  ? 191.669 175.213 18.439  1.00 8.41  ? 147  VAL A CG2   1 
ATOM   203  N  N     . TYR A 1 27  ? 191.375 175.299 23.242  1.00 14.89 ? 148  TYR A N     1 
ATOM   204  C  CA    . TYR A 1 27  ? 191.315 174.786 24.614  1.00 14.47 ? 148  TYR A CA    1 
ATOM   205  C  C     . TYR A 1 27  ? 189.943 174.234 24.936  1.00 13.13 ? 148  TYR A C     1 
ATOM   206  O  O     . TYR A 1 27  ? 188.942 174.674 24.386  1.00 14.07 ? 148  TYR A O     1 
ATOM   207  C  CB    . TYR A 1 27  ? 191.593 175.891 25.642  1.00 12.68 ? 148  TYR A CB    1 
ATOM   208  C  CG    . TYR A 1 27  ? 192.910 176.619 25.491  1.00 18.66 ? 148  TYR A CG    1 
ATOM   209  C  CD1   . TYR A 1 27  ? 193.031 177.690 24.605  1.00 16.46 ? 148  TYR A CD1   1 
ATOM   210  C  CD2   . TYR A 1 27  ? 194.047 176.222 26.217  1.00 15.67 ? 148  TYR A CD2   1 
ATOM   211  C  CE1   . TYR A 1 27  ? 194.243 178.347 24.434  1.00 18.77 ? 148  TYR A CE1   1 
ATOM   212  C  CE2   . TYR A 1 27  ? 195.269 176.880 26.050  1.00 20.14 ? 148  TYR A CE2   1 
ATOM   213  C  CZ    . TYR A 1 27  ? 195.355 177.938 25.153  1.00 18.86 ? 148  TYR A CZ    1 
ATOM   214  O  OH    . TYR A 1 27  ? 196.555 178.569 24.934  1.00 23.63 ? 148  TYR A OH    1 
ATOM   215  N  N     . LEU A 1 28  ? 189.887 173.265 25.831  1.00 11.62 ? 149  LEU A N     1 
ATOM   216  C  CA    . LEU A 1 28  ? 188.600 172.753 26.223  1.00 11.86 ? 149  LEU A CA    1 
ATOM   217  C  C     . LEU A 1 28  ? 188.071 173.911 27.101  1.00 13.55 ? 149  LEU A C     1 
ATOM   218  O  O     . LEU A 1 28  ? 188.857 174.728 27.565  1.00 12.48 ? 149  LEU A O     1 
ATOM   219  C  CB    . LEU A 1 28  ? 188.787 171.466 27.003  1.00 10.50 ? 149  LEU A CB    1 
ATOM   220  C  CG    . LEU A 1 28  ? 187.547 170.675 27.388  1.00 12.61 ? 149  LEU A CG    1 
ATOM   221  C  CD1   . LEU A 1 28  ? 186.695 170.364 26.182  1.00 11.20 ? 149  LEU A CD1   1 
ATOM   222  C  CD2   . LEU A 1 28  ? 188.001 169.410 28.051  1.00 11.24 ? 149  LEU A CD2   1 
ATOM   223  N  N     . ALA A 1 29  ? 186.763 174.008 27.316  1.00 14.24 ? 150  ALA A N     1 
ATOM   224  C  CA    . ALA A 1 29  ? 186.227 175.102 28.120  1.00 15.20 ? 150  ALA A CA    1 
ATOM   225  C  C     . ALA A 1 29  ? 184.817 174.800 28.612  1.00 17.25 ? 150  ALA A C     1 
ATOM   226  O  O     . ALA A 1 29  ? 184.122 173.929 28.083  1.00 18.30 ? 150  ALA A O     1 
ATOM   227  C  CB    . ALA A 1 29  ? 186.230 176.406 27.318  1.00 15.60 ? 150  ALA A CB    1 
ATOM   228  N  N     . ARG A 1 30  ? 184.398 175.532 29.629  1.00 17.29 ? 151  ARG A N     1 
ATOM   229  C  CA    . ARG A 1 30  ? 183.091 175.334 30.215  1.00 19.70 ? 151  ARG A CA    1 
ATOM   230  C  C     . ARG A 1 30  ? 182.516 176.707 30.518  1.00 20.61 ? 151  ARG A C     1 
ATOM   231  O  O     . ARG A 1 30  ? 183.158 177.560 31.163  1.00 19.62 ? 151  ARG A O     1 
ATOM   232  C  CB    . ARG A 1 30  ? 183.245 174.479 31.492  1.00 20.02 ? 151  ARG A CB    1 
ATOM   233  C  CG    . ARG A 1 30  ? 181.977 174.102 32.258  1.00 26.58 ? 151  ARG A CG    1 
ATOM   234  C  CD    . ARG A 1 30  ? 182.321 173.557 33.686  1.00 30.64 ? 151  ARG A CD    1 
ATOM   235  N  NE    . ARG A 1 30  ? 183.235 172.405 33.673  1.00 32.15 ? 151  ARG A NE    1 
ATOM   236  C  CZ    . ARG A 1 30  ? 182.900 171.151 33.348  1.00 33.18 ? 151  ARG A CZ    1 
ATOM   237  N  NH1   . ARG A 1 30  ? 181.644 170.851 33.004  1.00 33.09 ? 151  ARG A NH1   1 
ATOM   238  N  NH2   . ARG A 1 30  ? 183.831 170.190 33.362  1.00 31.48 ? 151  ARG A NH2   1 
ATOM   239  N  N     . GLU A 1 31  ? 181.315 176.939 30.006  1.00 21.84 ? 152  GLU A N     1 
ATOM   240  C  CA    . GLU A 1 31  ? 180.633 178.196 30.264  1.00 21.85 ? 152  GLU A CA    1 
ATOM   241  C  C     . GLU A 1 31  ? 180.252 178.091 31.742  1.00 21.10 ? 152  GLU A C     1 
ATOM   242  O  O     . GLU A 1 31  ? 179.661 177.102 32.172  1.00 19.62 ? 152  GLU A O     1 
ATOM   243  C  CB    . GLU A 1 31  ? 179.401 178.298 29.377  1.00 26.06 ? 152  GLU A CB    1 
ATOM   244  C  CG    . GLU A 1 31  ? 178.766 179.690 29.289  1.00 28.31 ? 152  GLU A CG    1 
ATOM   245  C  CD    . GLU A 1 31  ? 177.996 180.078 30.543  1.00 32.60 ? 152  GLU A CD    1 
ATOM   246  O  OE1   . GLU A 1 31  ? 178.576 180.804 31.391  1.00 33.50 ? 152  GLU A OE1   1 
ATOM   247  O  OE2   . GLU A 1 31  ? 176.821 179.650 30.679  1.00 29.24 ? 152  GLU A OE2   1 
ATOM   248  N  N     . LYS A 1 32  ? 180.613 179.114 32.504  1.00 21.06 ? 153  LYS A N     1 
ATOM   249  C  CA    . LYS A 1 32  ? 180.366 179.156 33.933  1.00 20.90 ? 153  LYS A CA    1 
ATOM   250  C  C     . LYS A 1 32  ? 178.927 179.048 34.421  1.00 21.26 ? 153  LYS A C     1 
ATOM   251  O  O     . LYS A 1 32  ? 178.649 178.362 35.390  1.00 25.58 ? 153  LYS A O     1 
ATOM   252  C  CB    . LYS A 1 32  ? 180.996 180.417 34.513  1.00 20.37 ? 153  LYS A CB    1 
ATOM   253  C  CG    . LYS A 1 32  ? 182.501 180.458 34.440  1.00 22.17 ? 153  LYS A CG    1 
ATOM   254  C  CD    . LYS A 1 32  ? 183.063 181.720 35.091  1.00 21.22 ? 153  LYS A CD    1 
ATOM   255  C  CE    . LYS A 1 32  ? 184.568 181.658 35.002  1.00 22.77 ? 153  LYS A CE    1 
ATOM   256  N  NZ    . LYS A 1 32  ? 185.178 182.877 35.572  1.00 24.11 ? 153  LYS A NZ    1 
ATOM   257  N  N     . GLN A 1 33  ? 177.982 179.704 33.786  1.00 23.03 ? 154  GLN A N     1 
ATOM   258  C  CA    . GLN A 1 33  ? 176.639 179.579 34.330  1.00 23.96 ? 154  GLN A CA    1 
ATOM   259  C  C     . GLN A 1 33  ? 175.951 178.229 34.086  1.00 24.10 ? 154  GLN A C     1 
ATOM   260  O  O     . GLN A 1 33  ? 175.345 177.675 34.996  1.00 25.34 ? 154  GLN A O     1 
ATOM   261  C  CB    . GLN A 1 33  ? 175.744 180.686 33.800  1.00 23.79 ? 154  GLN A CB    1 
ATOM   262  C  CG    . GLN A 1 33  ? 176.125 182.053 34.288  1.00 24.55 ? 154  GLN A CG    1 
ATOM   263  C  CD    . GLN A 1 33  ? 175.243 183.133 33.709  1.00 24.55 ? 154  GLN A CD    1 
ATOM   264  O  OE1   . GLN A 1 33  ? 175.674 184.283 33.617  1.00 23.87 ? 154  GLN A OE1   1 
ATOM   265  N  NE2   . GLN A 1 33  ? 173.998 182.779 33.309  1.00 22.50 ? 154  GLN A NE2   1 
ATOM   266  N  N     . SER A 1 34  ? 176.018 177.700 32.871  1.00 22.36 ? 155  SER A N     1 
ATOM   267  C  CA    . SER A 1 34  ? 175.351 176.441 32.585  1.00 21.24 ? 155  SER A CA    1 
ATOM   268  C  C     . SER A 1 34  ? 176.234 175.182 32.691  1.00 23.66 ? 155  SER A C     1 
ATOM   269  O  O     . SER A 1 34  ? 175.725 174.048 32.677  1.00 20.04 ? 155  SER A O     1 
ATOM   270  C  CB    . SER A 1 34  ? 174.790 176.517 31.180  1.00 20.38 ? 155  SER A CB    1 
ATOM   271  O  OG    . SER A 1 34  ? 175.875 176.607 30.282  1.00 22.24 ? 155  SER A OG    1 
ATOM   272  N  N     . LYS A 1 35  ? 177.549 175.406 32.789  1.00 23.61 ? 156  LYS A N     1 
ATOM   273  C  CA    . LYS A 1 35  ? 178.572 174.358 32.849  1.00 24.47 ? 156  LYS A CA    1 
ATOM   274  C  C     . LYS A 1 35  ? 178.634 173.543 31.548  1.00 22.03 ? 156  LYS A C     1 
ATOM   275  O  O     . LYS A 1 35  ? 179.131 172.417 31.509  1.00 22.31 ? 156  LYS A O     1 
ATOM   276  C  CB    . LYS A 1 35  ? 178.350 173.467 34.065  1.00 25.24 ? 156  LYS A CB    1 
ATOM   277  C  CG    . LYS A 1 35  ? 178.523 174.254 35.368  1.00 32.64 ? 156  LYS A CG    1 
ATOM   278  C  CD    . LYS A 1 35  ? 178.309 173.358 36.552  1.00 35.73 ? 156  LYS A CD    1 
ATOM   279  C  CE    . LYS A 1 35  ? 178.506 174.079 37.870  1.00 41.50 ? 156  LYS A CE    1 
ATOM   280  N  NZ    . LYS A 1 35  ? 178.457 173.059 38.978  1.00 42.75 ? 156  LYS A NZ    1 
ATOM   281  N  N     . PHE A 1 36  ? 178.152 174.152 30.472  1.00 20.94 ? 157  PHE A N     1 
ATOM   282  C  CA    . PHE A 1 36  ? 178.180 173.530 29.162  1.00 19.88 ? 157  PHE A CA    1 
ATOM   283  C  C     . PHE A 1 36  ? 179.645 173.447 28.708  1.00 20.86 ? 157  PHE A C     1 
ATOM   284  O  O     . PHE A 1 36  ? 180.394 174.451 28.739  1.00 16.68 ? 157  PHE A O     1 
ATOM   285  C  CB    . PHE A 1 36  ? 177.370 174.367 28.174  1.00 21.87 ? 157  PHE A CB    1 
ATOM   286  C  CG    . PHE A 1 36  ? 177.209 173.735 26.840  1.00 22.62 ? 157  PHE A CG    1 
ATOM   287  C  CD1   . PHE A 1 36  ? 176.501 172.546 26.704  1.00 26.84 ? 157  PHE A CD1   1 
ATOM   288  C  CD2   . PHE A 1 36  ? 177.745 174.336 25.707  1.00 24.18 ? 157  PHE A CD2   1 
ATOM   289  C  CE1   . PHE A 1 36  ? 176.326 171.957 25.448  1.00 27.13 ? 157  PHE A CE1   1 
ATOM   290  C  CE2   . PHE A 1 36  ? 177.576 173.763 24.446  1.00 24.84 ? 157  PHE A CE2   1 
ATOM   291  C  CZ    . PHE A 1 36  ? 176.868 172.574 24.316  1.00 26.19 ? 157  PHE A CZ    1 
ATOM   292  N  N     . ILE A 1 37  ? 180.056 172.243 28.316  1.00 18.62 ? 158  ILE A N     1 
ATOM   293  C  CA    . ILE A 1 37  ? 181.412 171.997 27.862  1.00 17.65 ? 158  ILE A CA    1 
ATOM   294  C  C     . ILE A 1 37  ? 181.502 172.306 26.363  1.00 19.32 ? 158  ILE A C     1 
ATOM   295  O  O     . ILE A 1 37  ? 180.622 171.940 25.588  1.00 21.25 ? 158  ILE A O     1 
ATOM   296  C  CB    . ILE A 1 37  ? 181.818 170.521 28.156  1.00 21.22 ? 158  ILE A CB    1 
ATOM   297  C  CG1   . ILE A 1 37  ? 181.998 170.339 29.675  1.00 25.44 ? 158  ILE A CG1   1 
ATOM   298  C  CG2   . ILE A 1 37  ? 183.120 170.183 27.472  1.00 20.54 ? 158  ILE A CG2   1 
ATOM   299  C  CD1   . ILE A 1 37  ? 181.751 168.898 30.193  1.00 32.22 ? 158  ILE A CD1   1 
ATOM   300  N  N     . LEU A 1 38  ? 182.544 173.021 25.958  1.00 19.68 ? 159  LEU A N     1 
ATOM   301  C  CA    . LEU A 1 38  ? 182.729 173.365 24.552  1.00 18.03 ? 159  LEU A CA    1 
ATOM   302  C  C     . LEU A 1 38  ? 184.218 173.553 24.263  1.00 16.64 ? 159  LEU A C     1 
ATOM   303  O  O     . LEU A 1 38  ? 185.054 173.211 25.099  1.00 10.64 ? 159  LEU A O     1 
ATOM   304  C  CB    . LEU A 1 38  ? 181.915 174.625 24.214  1.00 18.70 ? 159  LEU A CB    1 
ATOM   305  C  CG    . LEU A 1 38  ? 181.855 175.726 25.275  1.00 18.81 ? 159  LEU A CG    1 
ATOM   306  C  CD1   . LEU A 1 38  ? 183.137 176.522 25.197  1.00 25.89 ? 159  LEU A CD1   1 
ATOM   307  C  CD2   . LEU A 1 38  ? 180.667 176.644 25.065  1.00 15.33 ? 159  LEU A CD2   1 
ATOM   308  N  N     . ALA A 1 39  ? 184.562 174.069 23.084  1.00 14.09 ? 160  ALA A N     1 
ATOM   309  C  CA    . ALA A 1 39  ? 185.981 174.271 22.742  1.00 14.90 ? 160  ALA A CA    1 
ATOM   310  C  C     . ALA A 1 39  ? 186.230 175.736 22.420  1.00 15.35 ? 160  ALA A C     1 
ATOM   311  O  O     . ALA A 1 39  ? 185.419 176.377 21.777  1.00 16.22 ? 160  ALA A O     1 
ATOM   312  C  CB    . ALA A 1 39  ? 186.371 173.394 21.574  1.00 11.94 ? 160  ALA A CB    1 
ATOM   313  N  N     . LEU A 1 40  ? 187.348 176.277 22.876  1.00 17.51 ? 161  LEU A N     1 
ATOM   314  C  CA    . LEU A 1 40  ? 187.656 177.685 22.636  1.00 17.81 ? 161  LEU A CA    1 
ATOM   315  C  C     . LEU A 1 40  ? 188.857 177.829 21.697  1.00 18.94 ? 161  LEU A C     1 
ATOM   316  O  O     . LEU A 1 40  ? 189.984 177.506 22.070  1.00 15.15 ? 161  LEU A O     1 
ATOM   317  C  CB    . LEU A 1 40  ? 187.959 178.379 23.958  1.00 19.09 ? 161  LEU A CB    1 
ATOM   318  C  CG    . LEU A 1 40  ? 187.661 179.882 24.003  1.00 24.28 ? 161  LEU A CG    1 
ATOM   319  C  CD1   . LEU A 1 40  ? 186.190 180.085 23.715  1.00 19.74 ? 161  LEU A CD1   1 
ATOM   320  C  CD2   . LEU A 1 40  ? 188.020 180.482 25.396  1.00 26.64 ? 161  LEU A CD2   1 
ATOM   321  N  N     . LYS A 1 41  ? 188.605 178.302 20.477  1.00 15.44 ? 162  LYS A N     1 
ATOM   322  C  CA    . LYS A 1 41  ? 189.671 178.489 19.506  1.00 16.27 ? 162  LYS A CA    1 
ATOM   323  C  C     . LYS A 1 41  ? 190.220 179.909 19.626  1.00 16.04 ? 162  LYS A C     1 
ATOM   324  O  O     . LYS A 1 41  ? 189.486 180.863 19.427  1.00 17.16 ? 162  LYS A O     1 
ATOM   325  C  CB    . LYS A 1 41  ? 189.142 178.254 18.093  1.00 15.06 ? 162  LYS A CB    1 
ATOM   326  C  CG    . LYS A 1 41  ? 190.184 178.338 17.036  1.00 13.12 ? 162  LYS A CG    1 
ATOM   327  C  CD    . LYS A 1 41  ? 189.615 177.968 15.682  1.00 15.23 ? 162  LYS A CD    1 
ATOM   328  C  CE    . LYS A 1 41  ? 190.694 178.025 14.590  1.00 15.94 ? 162  LYS A CE    1 
ATOM   329  N  NZ    . LYS A 1 41  ? 190.118 177.625 13.262  1.00 21.75 ? 162  LYS A NZ    1 
ATOM   330  N  N     . VAL A 1 42  ? 191.501 180.044 19.955  1.00 15.21 ? 163  VAL A N     1 
ATOM   331  C  CA    . VAL A 1 42  ? 192.110 181.357 20.107  1.00 16.50 ? 163  VAL A CA    1 
ATOM   332  C  C     . VAL A 1 42  ? 192.938 181.758 18.888  1.00 17.82 ? 163  VAL A C     1 
ATOM   333  O  O     . VAL A 1 42  ? 193.616 180.933 18.287  1.00 20.09 ? 163  VAL A O     1 
ATOM   334  C  CB    . VAL A 1 42  ? 193.047 181.400 21.336  1.00 17.79 ? 163  VAL A CB    1 
ATOM   335  C  CG1   . VAL A 1 42  ? 193.563 182.816 21.546  1.00 15.20 ? 163  VAL A CG1   1 
ATOM   336  C  CG2   . VAL A 1 42  ? 192.316 180.897 22.578  1.00 14.92 ? 163  VAL A CG2   1 
ATOM   337  N  N     . LEU A 1 43  ? 192.888 183.028 18.522  1.00 18.13 ? 164  LEU A N     1 
ATOM   338  C  CA    . LEU A 1 43  ? 193.670 183.509 17.387  1.00 15.87 ? 164  LEU A CA    1 
ATOM   339  C  C     . LEU A 1 43  ? 194.352 184.789 17.835  1.00 16.04 ? 164  LEU A C     1 
ATOM   340  O  O     . LEU A 1 43  ? 193.687 185.709 18.295  1.00 13.41 ? 164  LEU A O     1 
ATOM   341  C  CB    . LEU A 1 43  ? 192.747 183.802 16.203  1.00 18.86 ? 164  LEU A CB    1 
ATOM   342  C  CG    . LEU A 1 43  ? 191.903 182.603 15.752  1.00 20.75 ? 164  LEU A CG    1 
ATOM   343  C  CD1   . LEU A 1 43  ? 190.429 182.980 15.575  1.00 23.26 ? 164  LEU A CD1   1 
ATOM   344  C  CD2   . LEU A 1 43  ? 192.481 182.084 14.477  1.00 19.09 ? 164  LEU A CD2   1 
ATOM   345  N  N     . PHE A 1 44  ? 195.670 184.858 17.738  1.00 15.52 ? 165  PHE A N     1 
ATOM   346  C  CA    . PHE A 1 44  ? 196.340 186.082 18.141  1.00 18.33 ? 165  PHE A CA    1 
ATOM   347  C  C     . PHE A 1 44  ? 196.228 187.062 16.989  1.00 19.49 ? 165  PHE A C     1 
ATOM   348  O  O     . PHE A 1 44  ? 196.610 186.742 15.857  1.00 21.60 ? 165  PHE A O     1 
ATOM   349  C  CB    . PHE A 1 44  ? 197.804 185.823 18.497  1.00 19.71 ? 165  PHE A CB    1 
ATOM   350  C  CG    . PHE A 1 44  ? 197.987 185.214 19.850  1.00 26.23 ? 165  PHE A CG    1 
ATOM   351  C  CD1   . PHE A 1 44  ? 197.826 183.840 20.033  1.00 27.06 ? 165  PHE A CD1   1 
ATOM   352  C  CD2   . PHE A 1 44  ? 198.222 186.025 20.961  1.00 28.47 ? 165  PHE A CD2   1 
ATOM   353  C  CE1   . PHE A 1 44  ? 197.899 183.281 21.298  1.00 32.07 ? 165  PHE A CE1   1 
ATOM   354  C  CE2   . PHE A 1 44  ? 198.299 185.479 22.239  1.00 31.56 ? 165  PHE A CE2   1 
ATOM   355  C  CZ    . PHE A 1 44  ? 198.133 184.104 22.411  1.00 35.02 ? 165  PHE A CZ    1 
ATOM   356  N  N     . LYS A 1 45  ? 195.674 188.242 17.277  1.00 18.17 ? 166  LYS A N     1 
ATOM   357  C  CA    . LYS A 1 45  ? 195.458 189.299 16.282  1.00 17.63 ? 166  LYS A CA    1 
ATOM   358  C  C     . LYS A 1 45  ? 196.696 189.792 15.536  1.00 19.44 ? 166  LYS A C     1 
ATOM   359  O  O     . LYS A 1 45  ? 196.615 190.103 14.343  1.00 19.53 ? 166  LYS A O     1 
ATOM   360  C  CB    . LYS A 1 45  ? 194.786 190.520 16.931  1.00 16.68 ? 166  LYS A CB    1 
ATOM   361  C  CG    . LYS A 1 45  ? 193.319 190.346 17.376  1.00 15.54 ? 166  LYS A CG    1 
ATOM   362  C  CD    . LYS A 1 45  ? 192.703 191.672 17.826  1.00 10.39 ? 166  LYS A CD    1 
ATOM   363  C  CE    . LYS A 1 45  ? 191.259 191.452 18.272  1.00 12.43 ? 166  LYS A CE    1 
ATOM   364  N  NZ    . LYS A 1 45  ? 190.505 192.644 18.792  1.00 7.46  ? 166  LYS A NZ    1 
ATOM   365  N  N     . ALA A 1 46  ? 197.828 189.885 16.237  1.00 19.10 ? 167  ALA A N     1 
ATOM   366  C  CA    . ALA A 1 46  ? 199.068 190.369 15.628  1.00 18.82 ? 167  ALA A CA    1 
ATOM   367  C  C     . ALA A 1 46  ? 199.551 189.377 14.571  1.00 18.71 ? 167  ALA A C     1 
ATOM   368  O  O     . ALA A 1 46  ? 200.085 189.762 13.534  1.00 19.61 ? 167  ALA A O     1 
ATOM   369  C  CB    . ALA A 1 46  ? 200.140 190.591 16.710  1.00 11.48 ? 167  ALA A CB    1 
ATOM   370  N  N     . GLN A 1 47  ? 199.351 188.092 14.840  1.00 18.71 ? 168  GLN A N     1 
ATOM   371  C  CA    . GLN A 1 47  ? 199.734 187.039 13.907  1.00 18.86 ? 168  GLN A CA    1 
ATOM   372  C  C     . GLN A 1 47  ? 198.824 187.137 12.688  1.00 17.82 ? 168  GLN A C     1 
ATOM   373  O  O     . GLN A 1 47  ? 199.273 187.079 11.560  1.00 20.56 ? 168  GLN A O     1 
ATOM   374  C  CB    . GLN A 1 47  ? 199.584 185.666 14.561  1.00 21.65 ? 168  GLN A CB    1 
ATOM   375  C  CG    . GLN A 1 47  ? 200.584 184.664 14.014  1.00 25.64 ? 168  GLN A CG    1 
ATOM   376  C  CD    . GLN A 1 47  ? 200.544 183.310 14.690  1.00 29.19 ? 168  GLN A CD    1 
ATOM   377  O  OE1   . GLN A 1 47  ? 200.269 183.208 15.900  1.00 27.17 ? 168  GLN A OE1   1 
ATOM   378  N  NE2   . GLN A 1 47  ? 200.846 182.249 13.920  1.00 28.74 ? 168  GLN A NE2   1 
ATOM   379  N  N     . LEU A 1 48  ? 197.530 187.289 12.931  1.00 19.46 ? 169  LEU A N     1 
ATOM   380  C  CA    . LEU A 1 48  ? 196.553 187.404 11.848  1.00 19.86 ? 169  LEU A CA    1 
ATOM   381  C  C     . LEU A 1 48  ? 196.802 188.604 10.961  1.00 21.12 ? 169  LEU A C     1 
ATOM   382  O  O     . LEU A 1 48  ? 196.533 188.564 9.761   1.00 17.39 ? 169  LEU A O     1 
ATOM   383  C  CB    . LEU A 1 48  ? 195.146 187.572 12.393  1.00 20.65 ? 169  LEU A CB    1 
ATOM   384  C  CG    . LEU A 1 48  ? 194.514 186.370 13.052  1.00 24.58 ? 169  LEU A CG    1 
ATOM   385  C  CD1   . LEU A 1 48  ? 193.168 186.837 13.566  1.00 23.53 ? 169  LEU A CD1   1 
ATOM   386  C  CD2   . LEU A 1 48  ? 194.396 185.189 12.069  1.00 20.67 ? 169  LEU A CD2   1 
ATOM   387  N  N     . GLU A 1 49  ? 197.261 189.697 11.564  1.00 22.51 ? 170  GLU A N     1 
ATOM   388  C  CA    . GLU A 1 49  ? 197.520 190.915 10.807  1.00 23.02 ? 170  GLU A CA    1 
ATOM   389  C  C     . GLU A 1 49  ? 198.762 190.753 9.949   1.00 21.03 ? 170  GLU A C     1 
ATOM   390  O  O     . GLU A 1 49  ? 198.739 191.068 8.757   1.00 23.09 ? 170  GLU A O     1 
ATOM   391  C  CB    . GLU A 1 49  ? 197.637 192.102 11.769  1.00 22.68 ? 170  GLU A CB    1 
ATOM   392  C  CG    . GLU A 1 49  ? 196.267 192.607 12.232  1.00 27.99 ? 170  GLU A CG    1 
ATOM   393  C  CD    . GLU A 1 49  ? 196.294 193.330 13.579  1.00 31.84 ? 170  GLU A CD    1 
ATOM   394  O  OE1   . GLU A 1 49  ? 197.334 193.955 13.920  1.00 33.33 ? 170  GLU A OE1   1 
ATOM   395  O  OE2   . GLU A 1 49  ? 195.256 193.278 14.285  1.00 31.22 ? 170  GLU A OE2   1 
ATOM   396  N  N     . LYS A 1 50  ? 199.826 190.220 10.535  1.00 17.25 ? 171  LYS A N     1 
ATOM   397  C  CA    . LYS A 1 50  ? 201.059 190.014 9.790   1.00 19.63 ? 171  LYS A CA    1 
ATOM   398  C  C     . LYS A 1 50  ? 200.838 189.074 8.609   1.00 19.42 ? 171  LYS A C     1 
ATOM   399  O  O     . LYS A 1 50  ? 201.451 189.235 7.551   1.00 21.92 ? 171  LYS A O     1 
ATOM   400  C  CB    . LYS A 1 50  ? 202.139 189.442 10.706  1.00 21.18 ? 171  LYS A CB    1 
ATOM   401  C  CG    . LYS A 1 50  ? 203.525 189.395 10.073  1.00 25.15 ? 171  LYS A CG    1 
ATOM   402  C  CD    . LYS A 1 50  ? 204.574 188.888 11.054  1.00 28.24 ? 171  LYS A CD    1 
ATOM   403  C  CE    . LYS A 1 50  ? 205.952 188.807 10.395  1.00 32.60 ? 171  LYS A CE    1 
ATOM   404  N  NZ    . LYS A 1 50  ? 207.003 188.297 11.331  1.00 33.23 ? 171  LYS A NZ    1 
ATOM   405  N  N     . ALA A 1 51  ? 199.957 188.095 8.782   1.00 17.92 ? 172  ALA A N     1 
ATOM   406  C  CA    . ALA A 1 51  ? 199.666 187.126 7.720   1.00 18.61 ? 172  ALA A CA    1 
ATOM   407  C  C     . ALA A 1 51  ? 198.666 187.627 6.679   1.00 16.48 ? 172  ALA A C     1 
ATOM   408  O  O     . ALA A 1 51  ? 198.600 187.082 5.577   1.00 18.45 ? 172  ALA A O     1 
ATOM   409  C  CB    . ALA A 1 51  ? 199.168 185.826 8.341   1.00 13.39 ? 172  ALA A CB    1 
ATOM   410  N  N     . GLY A 1 52  ? 197.890 188.651 7.053   1.00 16.48 ? 173  GLY A N     1 
ATOM   411  C  CA    . GLY A 1 52  ? 196.876 189.241 6.178   1.00 17.37 ? 173  GLY A CA    1 
ATOM   412  C  C     . GLY A 1 52  ? 195.719 188.297 5.904   1.00 18.48 ? 173  GLY A C     1 
ATOM   413  O  O     . GLY A 1 52  ? 195.158 188.264 4.789   1.00 17.50 ? 173  GLY A O     1 
ATOM   414  N  N     . VAL A 1 53  ? 195.344 187.536 6.921   1.00 16.39 ? 174  VAL A N     1 
ATOM   415  C  CA    . VAL A 1 53  ? 194.274 186.573 6.770   1.00 18.80 ? 174  VAL A CA    1 
ATOM   416  C  C     . VAL A 1 53  ? 193.015 186.982 7.535   1.00 19.69 ? 174  VAL A C     1 
ATOM   417  O  O     . VAL A 1 53  ? 192.152 186.152 7.828   1.00 22.14 ? 174  VAL A O     1 
ATOM   418  C  CB    . VAL A 1 53  ? 194.778 185.171 7.226   1.00 17.75 ? 174  VAL A CB    1 
ATOM   419  C  CG1   . VAL A 1 53  ? 195.976 184.770 6.371   1.00 17.03 ? 174  VAL A CG1   1 
ATOM   420  C  CG2   . VAL A 1 53  ? 195.166 185.207 8.684   1.00 12.69 ? 174  VAL A CG2   1 
ATOM   421  N  N     . GLU A 1 54  ? 192.900 188.282 7.801   1.00 24.29 ? 175  GLU A N     1 
ATOM   422  C  CA    . GLU A 1 54  ? 191.751 188.834 8.521   1.00 25.76 ? 175  GLU A CA    1 
ATOM   423  C  C     . GLU A 1 54  ? 190.452 188.611 7.752   1.00 25.95 ? 175  GLU A C     1 
ATOM   424  O  O     . GLU A 1 54  ? 189.423 188.313 8.337   1.00 25.42 ? 175  GLU A O     1 
ATOM   425  C  CB    . GLU A 1 54  ? 191.902 190.351 8.799   1.00 29.22 ? 175  GLU A CB    1 
ATOM   426  C  CG    . GLU A 1 54  ? 193.333 190.938 8.903   1.00 38.41 ? 175  GLU A CG    1 
ATOM   427  C  CD    . GLU A 1 54  ? 193.998 191.112 7.548   1.00 39.97 ? 175  GLU A CD    1 
ATOM   428  O  OE1   . GLU A 1 54  ? 193.310 190.986 6.511   1.00 47.49 ? 175  GLU A OE1   1 
ATOM   429  O  OE2   . GLU A 1 54  ? 195.206 191.382 7.507   1.00 46.22 ? 175  GLU A OE2   1 
ATOM   430  N  N     . HIS A 1 55  ? 190.483 188.768 6.438   1.00 26.45 ? 176  HIS A N     1 
ATOM   431  C  CA    . HIS A 1 55  ? 189.254 188.539 5.708   1.00 24.68 ? 176  HIS A CA    1 
ATOM   432  C  C     . HIS A 1 55  ? 188.848 187.062 5.703   1.00 23.32 ? 176  HIS A C     1 
ATOM   433  O  O     . HIS A 1 55  ? 187.661 186.755 5.693   1.00 22.64 ? 176  HIS A O     1 
ATOM   434  C  CB    . HIS A 1 55  ? 189.316 189.074 4.278   1.00 23.09 ? 176  HIS A CB    1 
ATOM   435  C  CG    . HIS A 1 55  ? 187.983 189.014 3.596   1.00 32.41 ? 176  HIS A CG    1 
ATOM   436  N  ND1   . HIS A 1 55  ? 186.845 189.576 4.148   1.00 32.75 ? 176  HIS A ND1   1 
ATOM   437  C  CD2   . HIS A 1 55  ? 187.570 188.363 2.477   1.00 34.18 ? 176  HIS A CD2   1 
ATOM   438  C  CE1   . HIS A 1 55  ? 185.796 189.266 3.406   1.00 33.74 ? 176  HIS A CE1   1 
ATOM   439  N  NE2   . HIS A 1 55  ? 186.207 188.529 2.386   1.00 34.72 ? 176  HIS A NE2   1 
ATOM   440  N  N     . GLN A 1 56  ? 189.803 186.137 5.744   1.00 21.78 ? 177  GLN A N     1 
ATOM   441  C  CA    . GLN A 1 56  ? 189.432 184.721 5.774   1.00 19.85 ? 177  GLN A CA    1 
ATOM   442  C  C     . GLN A 1 56  ? 188.859 184.317 7.129   1.00 18.66 ? 177  GLN A C     1 
ATOM   443  O  O     . GLN A 1 56  ? 188.057 183.390 7.195   1.00 18.16 ? 177  GLN A O     1 
ATOM   444  C  CB    . GLN A 1 56  ? 190.628 183.818 5.421   1.00 21.23 ? 177  GLN A CB    1 
ATOM   445  C  CG    . GLN A 1 56  ? 191.173 183.994 3.977   1.00 23.08 ? 177  GLN A CG    1 
ATOM   446  C  CD    . GLN A 1 56  ? 192.113 185.179 3.856   1.00 26.14 ? 177  GLN A CD    1 
ATOM   447  O  OE1   . GLN A 1 56  ? 191.901 186.204 4.512   1.00 27.02 ? 177  GLN A OE1   1 
ATOM   448  N  NE2   . GLN A 1 56  ? 193.161 185.056 3.012   1.00 25.09 ? 177  GLN A NE2   1 
ATOM   449  N  N     . LEU A 1 57  ? 189.267 185.001 8.202   1.00 17.80 ? 178  LEU A N     1 
ATOM   450  C  CA    . LEU A 1 57  ? 188.742 184.695 9.532   1.00 17.25 ? 178  LEU A CA    1 
ATOM   451  C  C     . LEU A 1 57  ? 187.257 185.050 9.569   1.00 18.82 ? 178  LEU A C     1 
ATOM   452  O  O     . LEU A 1 57  ? 186.436 184.346 10.148  1.00 18.56 ? 178  LEU A O     1 
ATOM   453  C  CB    . LEU A 1 57  ? 189.473 185.495 10.616  1.00 14.48 ? 178  LEU A CB    1 
ATOM   454  C  CG    . LEU A 1 57  ? 188.948 185.297 12.041  1.00 14.78 ? 178  LEU A CG    1 
ATOM   455  C  CD1   . LEU A 1 57  ? 188.822 183.792 12.391  1.00 13.65 ? 178  LEU A CD1   1 
ATOM   456  C  CD2   . LEU A 1 57  ? 189.904 185.964 13.002  1.00 15.52 ? 178  LEU A CD2   1 
ATOM   457  N  N     . ARG A 1 58  ? 186.929 186.171 8.950   1.00 17.14 ? 179  ARG A N     1 
ATOM   458  C  CA    . ARG A 1 58  ? 185.570 186.637 8.893   1.00 20.36 ? 179  ARG A CA    1 
ATOM   459  C  C     . ARG A 1 58  ? 184.677 185.663 8.112   1.00 20.68 ? 179  ARG A C     1 
ATOM   460  O  O     . ARG A 1 58  ? 183.516 185.428 8.490   1.00 20.49 ? 179  ARG A O     1 
ATOM   461  C  CB    . ARG A 1 58  ? 185.547 188.004 8.238   1.00 24.60 ? 179  ARG A CB    1 
ATOM   462  C  CG    . ARG A 1 58  ? 184.191 188.581 8.190   1.00 30.51 ? 179  ARG A CG    1 
ATOM   463  C  CD    . ARG A 1 58  ? 184.079 189.355 6.937   1.00 34.92 ? 179  ARG A CD    1 
ATOM   464  N  NE    . ARG A 1 58  ? 183.602 190.700 7.192   1.00 44.42 ? 179  ARG A NE    1 
ATOM   465  C  CZ    . ARG A 1 58  ? 184.338 191.679 7.721   1.00 50.64 ? 179  ARG A CZ    1 
ATOM   466  N  NH1   . ARG A 1 58  ? 185.609 191.475 8.060   1.00 53.62 ? 179  ARG A NH1   1 
ATOM   467  N  NH2   . ARG A 1 58  ? 183.800 192.881 7.910   1.00 54.27 ? 179  ARG A NH2   1 
ATOM   468  N  N     . ARG A 1 59  ? 185.211 185.102 7.027   1.00 16.87 ? 180  ARG A N     1 
ATOM   469  C  CA    . ARG A 1 59  ? 184.457 184.139 6.240   1.00 16.27 ? 180  ARG A CA    1 
ATOM   470  C  C     . ARG A 1 59  ? 184.277 182.837 7.037   1.00 16.14 ? 180  ARG A C     1 
ATOM   471  O  O     . ARG A 1 59  ? 183.225 182.207 6.950   1.00 17.78 ? 180  ARG A O     1 
ATOM   472  C  CB    . ARG A 1 59  ? 185.145 183.851 4.880   1.00 15.64 ? 180  ARG A CB    1 
ATOM   473  C  CG    . ARG A 1 59  ? 185.036 184.997 3.869   1.00 19.03 ? 180  ARG A CG    1 
ATOM   474  C  CD    . ARG A 1 59  ? 185.243 184.593 2.394   1.00 19.17 ? 180  ARG A CD    1 
ATOM   475  N  NE    . ARG A 1 59  ? 186.536 183.973 2.158   1.00 22.25 ? 180  ARG A NE    1 
ATOM   476  C  CZ    . ARG A 1 59  ? 187.223 184.003 1.011   1.00 22.42 ? 180  ARG A CZ    1 
ATOM   477  N  NH1   . ARG A 1 59  ? 186.778 184.633 -0.067  1.00 16.67 ? 180  ARG A NH1   1 
ATOM   478  N  NH2   . ARG A 1 59  ? 188.390 183.384 0.949   1.00 23.03 ? 180  ARG A NH2   1 
ATOM   479  N  N     . GLU A 1 60  ? 185.294 182.439 7.812   1.00 15.13 ? 181  GLU A N     1 
ATOM   480  C  CA    . GLU A 1 60  ? 185.211 181.222 8.627   1.00 15.82 ? 181  GLU A CA    1 
ATOM   481  C  C     . GLU A 1 60  ? 184.059 181.374 9.615   1.00 17.24 ? 181  GLU A C     1 
ATOM   482  O  O     . GLU A 1 60  ? 183.169 180.514 9.711   1.00 17.81 ? 181  GLU A O     1 
ATOM   483  C  CB    . GLU A 1 60  ? 186.512 180.969 9.431   1.00 17.60 ? 181  GLU A CB    1 
ATOM   484  C  CG    . GLU A 1 60  ? 186.517 179.610 10.164  1.00 22.11 ? 181  GLU A CG    1 
ATOM   485  C  CD    . GLU A 1 60  ? 187.779 179.293 11.023  1.00 29.50 ? 181  GLU A CD    1 
ATOM   486  O  OE1   . GLU A 1 60  ? 188.877 179.898 10.811  1.00 23.91 ? 181  GLU A OE1   1 
ATOM   487  O  OE2   . GLU A 1 60  ? 187.654 178.393 11.914  1.00 30.52 ? 181  GLU A OE2   1 
ATOM   488  N  N     . VAL A 1 61  ? 184.075 182.486 10.336  1.00 13.24 ? 182  VAL A N     1 
ATOM   489  C  CA    . VAL A 1 61  ? 183.056 182.746 11.323  1.00 16.10 ? 182  VAL A CA    1 
ATOM   490  C  C     . VAL A 1 61  ? 181.650 182.907 10.756  1.00 16.14 ? 182  VAL A C     1 
ATOM   491  O  O     . VAL A 1 61  ? 180.718 182.216 11.186  1.00 14.19 ? 182  VAL A O     1 
ATOM   492  C  CB    . VAL A 1 61  ? 183.417 183.989 12.155  1.00 17.20 ? 182  VAL A CB    1 
ATOM   493  C  CG1   . VAL A 1 61  ? 182.271 184.362 13.059  1.00 11.33 ? 182  VAL A CG1   1 
ATOM   494  C  CG2   . VAL A 1 61  ? 184.675 183.709 12.948  1.00 15.06 ? 182  VAL A CG2   1 
ATOM   495  N  N     . GLU A 1 62  ? 181.491 183.805 9.788   1.00 16.25 ? 183  GLU A N     1 
ATOM   496  C  CA    . GLU A 1 62  ? 180.162 184.021 9.212   1.00 17.30 ? 183  GLU A CA    1 
ATOM   497  C  C     . GLU A 1 62  ? 179.581 182.764 8.555   1.00 14.99 ? 183  GLU A C     1 
ATOM   498  O  O     . GLU A 1 62  ? 178.405 182.460 8.753   1.00 16.33 ? 183  GLU A O     1 
ATOM   499  C  CB    . GLU A 1 62  ? 180.190 185.187 8.214   1.00 16.51 ? 183  GLU A CB    1 
ATOM   500  C  CG    . GLU A 1 62  ? 180.630 186.499 8.842   1.00 21.63 ? 183  GLU A CG    1 
ATOM   501  C  CD    . GLU A 1 62  ? 180.566 187.674 7.874   1.00 24.47 ? 183  GLU A CD    1 
ATOM   502  O  OE1   . GLU A 1 62  ? 180.841 187.477 6.673   1.00 27.21 ? 183  GLU A OE1   1 
ATOM   503  O  OE2   . GLU A 1 62  ? 180.255 188.801 8.315   1.00 29.43 ? 183  GLU A OE2   1 
ATOM   504  N  N     . ILE A 1 63  ? 180.396 182.019 7.810   1.00 12.00 ? 184  ILE A N     1 
ATOM   505  C  CA    . ILE A 1 63  ? 179.908 180.808 7.159   1.00 10.45 ? 184  ILE A CA    1 
ATOM   506  C  C     . ILE A 1 63  ? 179.633 179.675 8.149   1.00 12.74 ? 184  ILE A C     1 
ATOM   507  O  O     . ILE A 1 63  ? 178.552 179.077 8.135   1.00 13.03 ? 184  ILE A O     1 
ATOM   508  C  CB    . ILE A 1 63  ? 180.904 180.302 6.094   1.00 9.02  ? 184  ILE A CB    1 
ATOM   509  C  CG1   . ILE A 1 63  ? 180.862 181.248 4.893   1.00 4.36  ? 184  ILE A CG1   1 
ATOM   510  C  CG2   . ILE A 1 63  ? 180.595 178.854 5.712   1.00 2.93  ? 184  ILE A CG2   1 
ATOM   511  C  CD1   . ILE A 1 63  ? 182.025 181.076 3.939   1.00 5.66  ? 184  ILE A CD1   1 
ATOM   512  N  N     . GLN A 1 64  ? 180.585 179.380 9.026   1.00 14.41 ? 185  GLN A N     1 
ATOM   513  C  CA    . GLN A 1 64  ? 180.365 178.279 9.960   1.00 15.94 ? 185  GLN A CA    1 
ATOM   514  C  C     . GLN A 1 64  ? 179.257 178.551 10.977  1.00 14.85 ? 185  GLN A C     1 
ATOM   515  O  O     . GLN A 1 64  ? 178.507 177.637 11.339  1.00 11.63 ? 185  GLN A O     1 
ATOM   516  C  CB    . GLN A 1 64  ? 181.663 177.933 10.682  1.00 15.68 ? 185  GLN A CB    1 
ATOM   517  C  CG    . GLN A 1 64  ? 181.684 176.556 11.281  1.00 15.22 ? 185  GLN A CG    1 
ATOM   518  C  CD    . GLN A 1 64  ? 182.955 176.333 12.074  1.00 16.62 ? 185  GLN A CD    1 
ATOM   519  O  OE1   . GLN A 1 64  ? 183.844 177.184 12.072  1.00 19.84 ? 185  GLN A OE1   1 
ATOM   520  N  NE2   . GLN A 1 64  ? 183.048 175.198 12.760  1.00 15.50 ? 185  GLN A NE2   1 
ATOM   521  N  N     . SER A 1 65  ? 179.134 179.798 11.424  1.00 14.21 ? 186  SER A N     1 
ATOM   522  C  CA    . SER A 1 65  ? 178.102 180.102 12.421  1.00 15.30 ? 186  SER A CA    1 
ATOM   523  C  C     . SER A 1 65  ? 176.686 179.916 11.898  1.00 15.48 ? 186  SER A C     1 
ATOM   524  O  O     . SER A 1 65  ? 175.787 179.612 12.672  1.00 20.12 ? 186  SER A O     1 
ATOM   525  C  CB    . SER A 1 65  ? 178.265 181.527 13.028  1.00 15.24 ? 186  SER A CB    1 
ATOM   526  O  OG    . SER A 1 65  ? 178.146 182.584 12.086  1.00 16.11 ? 186  SER A OG    1 
ATOM   527  N  N     . HIS A 1 66  ? 176.483 180.048 10.592  1.00 15.79 ? 187  HIS A N     1 
ATOM   528  C  CA    . HIS A 1 66  ? 175.153 179.908 10.018  1.00 15.76 ? 187  HIS A CA    1 
ATOM   529  C  C     . HIS A 1 66  ? 174.838 178.515 9.469   1.00 17.67 ? 187  HIS A C     1 
ATOM   530  O  O     . HIS A 1 66  ? 173.762 178.272 8.931   1.00 17.40 ? 187  HIS A O     1 
ATOM   531  C  CB    . HIS A 1 66  ? 174.964 180.942 8.914   1.00 14.22 ? 187  HIS A CB    1 
ATOM   532  C  CG    . HIS A 1 66  ? 174.857 182.348 9.414   1.00 14.55 ? 187  HIS A CG    1 
ATOM   533  N  ND1   . HIS A 1 66  ? 175.944 183.189 9.516   1.00 13.11 ? 187  HIS A ND1   1 
ATOM   534  C  CD2   . HIS A 1 66  ? 173.787 183.070 9.816   1.00 12.55 ? 187  HIS A CD2   1 
ATOM   535  C  CE1   . HIS A 1 66  ? 175.548 184.369 9.951   1.00 10.14 ? 187  HIS A CE1   1 
ATOM   536  N  NE2   . HIS A 1 66  ? 174.243 184.324 10.140  1.00 15.06 ? 187  HIS A NE2   1 
ATOM   537  N  N     . LEU A 1 67  ? 175.777 177.595 9.616   1.00 18.89 ? 188  LEU A N     1 
ATOM   538  C  CA    . LEU A 1 67  ? 175.608 176.243 9.118   1.00 16.21 ? 188  LEU A CA    1 
ATOM   539  C  C     . LEU A 1 67  ? 175.047 175.408 10.266  1.00 17.59 ? 188  LEU A C     1 
ATOM   540  O  O     . LEU A 1 67  ? 175.382 175.630 11.423  1.00 19.21 ? 188  LEU A O     1 
ATOM   541  C  CB    . LEU A 1 67  ? 176.972 175.721 8.652   1.00 15.40 ? 188  LEU A CB    1 
ATOM   542  C  CG    . LEU A 1 67  ? 177.339 175.433 7.185   1.00 14.79 ? 188  LEU A CG    1 
ATOM   543  C  CD1   . LEU A 1 67  ? 176.514 176.200 6.155   1.00 14.64 ? 188  LEU A CD1   1 
ATOM   544  C  CD2   . LEU A 1 67  ? 178.805 175.738 7.024   1.00 11.29 ? 188  LEU A CD2   1 
ATOM   545  N  N     . ARG A 1 68  ? 174.174 174.458 9.955   1.00 19.36 ? 189  ARG A N     1 
ATOM   546  C  CA    . ARG A 1 68  ? 173.579 173.603 10.988  1.00 21.36 ? 189  ARG A CA    1 
ATOM   547  C  C     . ARG A 1 68  ? 173.423 172.219 10.415  1.00 19.45 ? 189  ARG A C     1 
ATOM   548  O  O     . ARG A 1 68  ? 172.582 171.996 9.558   1.00 19.37 ? 189  ARG A O     1 
ATOM   549  C  CB    . ARG A 1 68  ? 172.190 174.086 11.398  1.00 22.58 ? 189  ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 68  ? 172.131 175.420 12.110  1.00 32.57 ? 189  ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 68  ? 172.277 175.274 13.621  1.00 34.83 ? 189  ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 68  ? 172.168 176.568 14.298  1.00 40.56 ? 189  ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 68  ? 172.993 177.598 14.091  1.00 43.35 ? 189  ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 68  ? 173.993 177.481 13.215  1.00 42.31 ? 189  ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 68  ? 172.827 178.740 14.770  1.00 42.32 ? 189  ARG A NH2   1 
ATOM   556  N  N     . HIS A 1 69  ? 174.218 171.283 10.900  1.00 16.48 ? 190  HIS A N     1 
ATOM   557  C  CA    . HIS A 1 69  ? 174.148 169.936 10.388  1.00 16.32 ? 190  HIS A CA    1 
ATOM   558  C  C     . HIS A 1 69  ? 174.857 169.069 11.409  1.00 18.77 ? 190  HIS A C     1 
ATOM   559  O  O     . HIS A 1 69  ? 175.747 169.538 12.110  1.00 19.58 ? 190  HIS A O     1 
ATOM   560  C  CB    . HIS A 1 69  ? 174.865 169.868 9.042   1.00 13.06 ? 190  HIS A CB    1 
ATOM   561  C  CG    . HIS A 1 69  ? 174.848 168.517 8.403   1.00 8.96  ? 190  HIS A CG    1 
ATOM   562  N  ND1   . HIS A 1 69  ? 173.942 168.169 7.422   1.00 9.60  ? 190  HIS A ND1   1 
ATOM   563  C  CD2   . HIS A 1 69  ? 175.640 167.430 8.584   1.00 9.19  ? 190  HIS A CD2   1 
ATOM   564  C  CE1   . HIS A 1 69  ? 174.177 166.929 7.026   1.00 8.25  ? 190  HIS A CE1   1 
ATOM   565  N  NE2   . HIS A 1 69  ? 175.202 166.456 7.717   1.00 10.48 ? 190  HIS A NE2   1 
ATOM   566  N  N     . PRO A 1 70  ? 174.437 167.797 11.526  1.00 19.81 ? 191  PRO A N     1 
ATOM   567  C  CA    . PRO A 1 70  ? 174.946 166.749 12.430  1.00 18.82 ? 191  PRO A CA    1 
ATOM   568  C  C     . PRO A 1 70  ? 176.422 166.383 12.239  1.00 15.63 ? 191  PRO A C     1 
ATOM   569  O  O     . PRO A 1 70  ? 177.074 165.908 13.167  1.00 16.18 ? 191  PRO A O     1 
ATOM   570  C  CB    . PRO A 1 70  ? 174.058 165.545 12.108  1.00 15.98 ? 191  PRO A CB    1 
ATOM   571  C  CG    . PRO A 1 70  ? 172.813 166.147 11.615  1.00 19.49 ? 191  PRO A CG    1 
ATOM   572  C  CD    . PRO A 1 70  ? 173.236 167.329 10.808  1.00 18.67 ? 191  PRO A CD    1 
ATOM   573  N  N     . ASN A 1 71  ? 176.930 166.564 11.029  1.00 13.38 ? 192  ASN A N     1 
ATOM   574  C  CA    . ASN A 1 71  ? 178.306 166.216 10.740  1.00 13.06 ? 192  ASN A CA    1 
ATOM   575  C  C     . ASN A 1 71  ? 179.189 167.407 10.467  1.00 13.65 ? 192  ASN A C     1 
ATOM   576  O  O     . ASN A 1 71  ? 180.258 167.276 9.869   1.00 15.58 ? 192  ASN A O     1 
ATOM   577  C  CB    . ASN A 1 71  ? 178.367 165.242 9.568   1.00 16.94 ? 192  ASN A CB    1 
ATOM   578  C  CG    . ASN A 1 71  ? 177.621 163.963 9.853   1.00 21.40 ? 192  ASN A CG    1 
ATOM   579  O  OD1   . ASN A 1 71  ? 176.478 163.790 9.431   1.00 24.81 ? 192  ASN A OD1   1 
ATOM   580  N  ND2   . ASN A 1 71  ? 178.255 163.062 10.596  1.00 19.25 ? 192  ASN A ND2   1 
ATOM   581  N  N     . ILE A 1 72  ? 178.725 168.584 10.865  1.00 13.34 ? 193  ILE A N     1 
ATOM   582  C  CA    . ILE A 1 72  ? 179.529 169.789 10.734  1.00 12.06 ? 193  ILE A CA    1 
ATOM   583  C  C     . ILE A 1 72  ? 179.651 170.377 12.134  1.00 12.85 ? 193  ILE A C     1 
ATOM   584  O  O     . ILE A 1 72  ? 178.663 170.540 12.840  1.00 14.90 ? 193  ILE A O     1 
ATOM   585  C  CB    . ILE A 1 72  ? 178.886 170.843 9.814   1.00 11.35 ? 193  ILE A CB    1 
ATOM   586  C  CG1   . ILE A 1 72  ? 178.807 170.317 8.381   1.00 6.17  ? 193  ILE A CG1   1 
ATOM   587  C  CG2   . ILE A 1 72  ? 179.688 172.131 9.882   1.00 5.81  ? 193  ILE A CG2   1 
ATOM   588  C  CD1   . ILE A 1 72  ? 178.045 171.205 7.453   1.00 8.69  ? 193  ILE A CD1   1 
ATOM   589  N  N     . LEU A 1 73  ? 180.874 170.678 12.530  1.00 13.66 ? 194  LEU A N     1 
ATOM   590  C  CA    . LEU A 1 73  ? 181.123 171.253 13.839  1.00 14.76 ? 194  LEU A CA    1 
ATOM   591  C  C     . LEU A 1 73  ? 180.381 172.578 13.964  1.00 16.81 ? 194  LEU A C     1 
ATOM   592  O  O     . LEU A 1 73  ? 180.450 173.433 13.070  1.00 18.34 ? 194  LEU A O     1 
ATOM   593  C  CB    . LEU A 1 73  ? 182.623 171.519 14.036  1.00 16.68 ? 194  LEU A CB    1 
ATOM   594  C  CG    . LEU A 1 73  ? 183.117 171.537 15.486  1.00 15.84 ? 194  LEU A CG    1 
ATOM   595  C  CD1   . LEU A 1 73  ? 183.039 170.099 16.000  1.00 14.02 ? 194  LEU A CD1   1 
ATOM   596  C  CD2   . LEU A 1 73  ? 184.545 172.073 15.588  1.00 14.49 ? 194  LEU A CD2   1 
ATOM   597  N  N     . ARG A 1 74  ? 179.683 172.727 15.085  1.00 15.08 ? 195  ARG A N     1 
ATOM   598  C  CA    . ARG A 1 74  ? 178.924 173.924 15.390  1.00 16.45 ? 195  ARG A CA    1 
ATOM   599  C  C     . ARG A 1 74  ? 179.787 175.113 15.870  1.00 16.17 ? 195  ARG A C     1 
ATOM   600  O  O     . ARG A 1 74  ? 180.714 174.950 16.656  1.00 13.03 ? 195  ARG A O     1 
ATOM   601  C  CB    . ARG A 1 74  ? 177.878 173.634 16.474  1.00 19.44 ? 195  ARG A CB    1 
ATOM   602  C  CG    . ARG A 1 74  ? 176.596 172.975 15.987  1.00 25.93 ? 195  ARG A CG    1 
ATOM   603  C  CD    . ARG A 1 74  ? 175.746 173.967 15.232  1.00 29.82 ? 195  ARG A CD    1 
ATOM   604  N  NE    . ARG A 1 74  ? 174.811 174.694 16.091  1.00 36.41 ? 195  ARG A NE    1 
ATOM   605  C  CZ    . ARG A 1 74  ? 174.859 176.008 16.302  1.00 39.91 ? 195  ARG A CZ    1 
ATOM   606  N  NH1   . ARG A 1 74  ? 175.804 176.729 15.718  1.00 44.61 ? 195  ARG A NH1   1 
ATOM   607  N  NH2   . ARG A 1 74  ? 173.958 176.608 17.075  1.00 40.14 ? 195  ARG A NH2   1 
ATOM   608  N  N     . LEU A 1 75  ? 179.471 176.293 15.341  1.00 17.85 ? 196  LEU A N     1 
ATOM   609  C  CA    . LEU A 1 75  ? 180.114 177.536 15.749  1.00 16.50 ? 196  LEU A CA    1 
ATOM   610  C  C     . LEU A 1 75  ? 178.975 178.281 16.466  1.00 15.90 ? 196  LEU A C     1 
ATOM   611  O  O     . LEU A 1 75  ? 178.037 178.767 15.839  1.00 15.06 ? 196  LEU A O     1 
ATOM   612  C  CB    . LEU A 1 75  ? 180.623 178.380 14.572  1.00 13.17 ? 196  LEU A CB    1 
ATOM   613  C  CG    . LEU A 1 75  ? 181.348 179.669 14.959  1.00 15.31 ? 196  LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1 75  ? 182.467 179.277 15.910  1.00 13.98 ? 196  LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1 75  ? 181.922 180.404 13.749  1.00 12.29 ? 196  LEU A CD2   1 
ATOM   616  N  N     . TYR A 1 76  ? 179.062 178.337 17.791  1.00 18.19 ? 197  TYR A N     1 
ATOM   617  C  CA    . TYR A 1 76  ? 178.049 178.974 18.610  1.00 18.38 ? 197  TYR A CA    1 
ATOM   618  C  C     . TYR A 1 76  ? 178.174 180.481 18.561  1.00 19.88 ? 197  TYR A C     1 
ATOM   619  O  O     . TYR A 1 76  ? 177.180 181.193 18.454  1.00 19.95 ? 197  TYR A O     1 
ATOM   620  C  CB    . TYR A 1 76  ? 178.154 178.464 20.033  1.00 15.79 ? 197  TYR A CB    1 
ATOM   621  C  CG    . TYR A 1 76  ? 177.908 176.980 20.126  1.00 17.64 ? 197  TYR A CG    1 
ATOM   622  C  CD1   . TYR A 1 76  ? 178.955 176.080 20.280  1.00 15.26 ? 197  TYR A CD1   1 
ATOM   623  C  CD2   . TYR A 1 76  ? 176.607 176.469 20.054  1.00 21.32 ? 197  TYR A CD2   1 
ATOM   624  C  CE1   . TYR A 1 76  ? 178.712 174.718 20.364  1.00 20.64 ? 197  TYR A CE1   1 
ATOM   625  C  CE2   . TYR A 1 76  ? 176.360 175.104 20.138  1.00 20.23 ? 197  TYR A CE2   1 
ATOM   626  C  CZ    . TYR A 1 76  ? 177.418 174.242 20.293  1.00 20.94 ? 197  TYR A CZ    1 
ATOM   627  O  OH    . TYR A 1 76  ? 177.185 172.900 20.387  1.00 26.42 ? 197  TYR A OH    1 
ATOM   628  N  N     . GLY A 1 77  ? 179.394 180.985 18.611  1.00 20.35 ? 198  GLY A N     1 
ATOM   629  C  CA    . GLY A 1 77  ? 179.542 182.425 18.562  1.00 20.00 ? 198  GLY A CA    1 
ATOM   630  C  C     . GLY A 1 77  ? 180.984 182.838 18.642  1.00 17.90 ? 198  GLY A C     1 
ATOM   631  O  O     . GLY A 1 77  ? 181.874 182.005 18.677  1.00 19.17 ? 198  GLY A O     1 
ATOM   632  N  N     . TYR A 1 78  ? 181.222 184.134 18.686  1.00 17.72 ? 199  TYR A N     1 
ATOM   633  C  CA    . TYR A 1 78  ? 182.589 184.593 18.748  1.00 19.93 ? 199  TYR A CA    1 
ATOM   634  C  C     . TYR A 1 78  ? 182.693 185.910 19.508  1.00 19.03 ? 199  TYR A C     1 
ATOM   635  O  O     . TYR A 1 78  ? 181.703 186.618 19.699  1.00 19.48 ? 199  TYR A O     1 
ATOM   636  C  CB    . TYR A 1 78  ? 183.128 184.776 17.325  1.00 19.83 ? 199  TYR A CB    1 
ATOM   637  C  CG    . TYR A 1 78  ? 182.894 186.166 16.788  1.00 21.41 ? 199  TYR A CG    1 
ATOM   638  C  CD1   . TYR A 1 78  ? 183.892 187.135 16.885  1.00 21.65 ? 199  TYR A CD1   1 
ATOM   639  C  CD2   . TYR A 1 78  ? 181.660 186.538 16.266  1.00 18.59 ? 199  TYR A CD2   1 
ATOM   640  C  CE1   . TYR A 1 78  ? 183.677 188.430 16.486  1.00 22.65 ? 199  TYR A CE1   1 
ATOM   641  C  CE2   . TYR A 1 78  ? 181.426 187.841 15.862  1.00 22.04 ? 199  TYR A CE2   1 
ATOM   642  C  CZ    . TYR A 1 78  ? 182.439 188.787 15.972  1.00 23.54 ? 199  TYR A CZ    1 
ATOM   643  O  OH    . TYR A 1 78  ? 182.223 190.089 15.557  1.00 24.04 ? 199  TYR A OH    1 
ATOM   644  N  N     . PHE A 1 79  ? 183.910 186.238 19.920  1.00 18.13 ? 200  PHE A N     1 
ATOM   645  C  CA    . PHE A 1 79  ? 184.177 187.478 20.627  1.00 17.58 ? 200  PHE A CA    1 
ATOM   646  C  C     . PHE A 1 79  ? 185.675 187.756 20.549  1.00 18.86 ? 200  PHE A C     1 
ATOM   647  O  O     . PHE A 1 79  ? 186.482 186.840 20.451  1.00 24.13 ? 200  PHE A O     1 
ATOM   648  C  CB    . PHE A 1 79  ? 183.677 187.397 22.091  1.00 12.35 ? 200  PHE A CB    1 
ATOM   649  C  CG    . PHE A 1 79  ? 184.369 186.344 22.955  1.00 13.81 ? 200  PHE A CG    1 
ATOM   650  C  CD1   . PHE A 1 79  ? 185.449 186.685 23.779  1.00 14.44 ? 200  PHE A CD1   1 
ATOM   651  C  CD2   . PHE A 1 79  ? 183.898 185.033 22.998  1.00 12.16 ? 200  PHE A CD2   1 
ATOM   652  C  CE1   . PHE A 1 79  ? 186.043 185.731 24.636  1.00 13.44 ? 200  PHE A CE1   1 
ATOM   653  C  CE2   . PHE A 1 79  ? 184.474 184.075 23.845  1.00 13.42 ? 200  PHE A CE2   1 
ATOM   654  C  CZ    . PHE A 1 79  ? 185.552 184.426 24.669  1.00 13.28 ? 200  PHE A CZ    1 
ATOM   655  N  N     . HIS A 1 80  ? 186.056 189.019 20.573  1.00 19.06 ? 201  HIS A N     1 
ATOM   656  C  CA    . HIS A 1 80  ? 187.467 189.335 20.512  1.00 22.05 ? 201  HIS A CA    1 
ATOM   657  C  C     . HIS A 1 80  ? 187.840 190.279 21.629  1.00 22.96 ? 201  HIS A C     1 
ATOM   658  O  O     . HIS A 1 80  ? 186.977 190.871 22.253  1.00 23.67 ? 201  HIS A O     1 
ATOM   659  C  CB    . HIS A 1 80  ? 187.820 189.966 19.159  1.00 20.51 ? 201  HIS A CB    1 
ATOM   660  C  CG    . HIS A 1 80  ? 187.161 191.286 18.903  1.00 18.99 ? 201  HIS A CG    1 
ATOM   661  N  ND1   . HIS A 1 80  ? 187.848 192.478 18.965  1.00 21.28 ? 201  HIS A ND1   1 
ATOM   662  C  CD2   . HIS A 1 80  ? 185.922 191.593 18.450  1.00 19.83 ? 201  HIS A CD2   1 
ATOM   663  C  CE1   . HIS A 1 80  ? 187.071 193.459 18.544  1.00 19.32 ? 201  HIS A CE1   1 
ATOM   664  N  NE2   . HIS A 1 80  ? 185.896 192.948 18.223  1.00 20.12 ? 201  HIS A NE2   1 
ATOM   665  N  N     . ASP A 1 81  ? 189.126 190.395 21.913  1.00 23.03 ? 202  ASP A N     1 
ATOM   666  C  CA    . ASP A 1 81  ? 189.535 191.331 22.936  1.00 24.25 ? 202  ASP A CA    1 
ATOM   667  C  C     . ASP A 1 81  ? 190.696 192.148 22.398  1.00 25.07 ? 202  ASP A C     1 
ATOM   668  O  O     . ASP A 1 81  ? 190.896 192.235 21.193  1.00 24.05 ? 202  ASP A O     1 
ATOM   669  C  CB    . ASP A 1 81  ? 189.928 190.621 24.235  1.00 25.39 ? 202  ASP A CB    1 
ATOM   670  C  CG    . ASP A 1 81  ? 191.175 189.780 24.097  1.00 28.38 ? 202  ASP A CG    1 
ATOM   671  O  OD1   . ASP A 1 81  ? 191.836 189.826 23.031  1.00 34.60 ? 202  ASP A OD1   1 
ATOM   672  O  OD2   . ASP A 1 81  ? 191.495 189.066 25.067  1.00 24.71 ? 202  ASP A OD2   1 
ATOM   673  N  N     . ALA A 1 82  ? 191.480 192.733 23.287  1.00 26.38 ? 203  ALA A N     1 
ATOM   674  C  CA    . ALA A 1 82  ? 192.595 193.564 22.856  1.00 25.39 ? 203  ALA A CA    1 
ATOM   675  C  C     . ALA A 1 82  ? 193.678 192.847 22.039  1.00 25.31 ? 203  ALA A C     1 
ATOM   676  O  O     . ALA A 1 82  ? 194.184 193.405 21.070  1.00 24.76 ? 203  ALA A O     1 
ATOM   677  C  CB    . ALA A 1 82  ? 193.217 194.257 24.082  1.00 23.30 ? 203  ALA A CB    1 
ATOM   678  N  N     . THR A 1 83  ? 194.038 191.623 22.409  1.00 24.17 ? 204  THR A N     1 
ATOM   679  C  CA    . THR A 1 83  ? 195.084 190.922 21.682  1.00 24.93 ? 204  THR A CA    1 
ATOM   680  C  C     . THR A 1 83  ? 194.638 189.711 20.869  1.00 26.55 ? 204  THR A C     1 
ATOM   681  O  O     . THR A 1 83  ? 195.360 189.270 19.968  1.00 25.70 ? 204  THR A O     1 
ATOM   682  C  CB    . THR A 1 83  ? 196.202 190.467 22.631  1.00 28.17 ? 204  THR A CB    1 
ATOM   683  O  OG1   . THR A 1 83  ? 195.667 189.534 23.582  1.00 29.58 ? 204  THR A OG1   1 
ATOM   684  C  CG2   . THR A 1 83  ? 196.805 191.672 23.364  1.00 26.38 ? 204  THR A CG2   1 
ATOM   685  N  N     . ARG A 1 84  ? 193.469 189.149 21.166  1.00 26.89 ? 205  ARG A N     1 
ATOM   686  C  CA    . ARG A 1 84  ? 193.039 188.002 20.382  1.00 26.09 ? 205  ARG A CA    1 
ATOM   687  C  C     . ARG A 1 84  ? 191.561 187.869 20.036  1.00 23.76 ? 205  ARG A C     1 
ATOM   688  O  O     . ARG A 1 84  ? 190.728 188.654 20.478  1.00 26.35 ? 205  ARG A O     1 
ATOM   689  C  CB    . ARG A 1 84  ? 193.558 186.710 21.026  1.00 29.89 ? 205  ARG A CB    1 
ATOM   690  C  CG    . ARG A 1 84  ? 193.403 186.595 22.508  1.00 35.65 ? 205  ARG A CG    1 
ATOM   691  C  CD    . ARG A 1 84  ? 194.768 186.465 23.174  1.00 41.67 ? 205  ARG A CD    1 
ATOM   692  N  NE    . ARG A 1 84  ? 194.650 186.517 24.630  1.00 50.08 ? 205  ARG A NE    1 
ATOM   693  C  CZ    . ARG A 1 84  ? 195.657 186.756 25.467  1.00 53.61 ? 205  ARG A CZ    1 
ATOM   694  N  NH1   . ARG A 1 84  ? 196.884 186.972 24.997  1.00 54.63 ? 205  ARG A NH1   1 
ATOM   695  N  NH2   . ARG A 1 84  ? 195.429 186.782 26.781  1.00 57.41 ? 205  ARG A NH2   1 
ATOM   696  N  N     . VAL A 1 85  ? 191.253 186.892 19.187  1.00 21.67 ? 206  VAL A N     1 
ATOM   697  C  CA    . VAL A 1 85  ? 189.883 186.606 18.776  1.00 17.07 ? 206  VAL A CA    1 
ATOM   698  C  C     . VAL A 1 85  ? 189.541 185.179 19.225  1.00 16.35 ? 206  VAL A C     1 
ATOM   699  O  O     . VAL A 1 85  ? 190.380 184.277 19.146  1.00 15.34 ? 206  VAL A O     1 
ATOM   700  C  CB    . VAL A 1 85  ? 189.704 186.683 17.247  1.00 16.64 ? 206  VAL A CB    1 
ATOM   701  C  CG1   . VAL A 1 85  ? 188.235 186.422 16.888  1.00 11.75 ? 206  VAL A CG1   1 
ATOM   702  C  CG2   . VAL A 1 85  ? 190.136 188.055 16.741  1.00 15.29 ? 206  VAL A CG2   1 
ATOM   703  N  N     . TYR A 1 86  ? 188.308 184.987 19.688  1.00 15.70 ? 207  TYR A N     1 
ATOM   704  C  CA    . TYR A 1 86  ? 187.866 183.692 20.185  1.00 14.78 ? 207  TYR A CA    1 
ATOM   705  C  C     . TYR A 1 86  ? 186.624 183.132 19.506  1.00 14.64 ? 207  TYR A C     1 
ATOM   706  O  O     . TYR A 1 86  ? 185.604 183.807 19.390  1.00 14.86 ? 207  TYR A O     1 
ATOM   707  C  CB    . TYR A 1 86  ? 187.555 183.754 21.686  1.00 14.30 ? 207  TYR A CB    1 
ATOM   708  C  CG    . TYR A 1 86  ? 188.599 184.415 22.538  1.00 15.34 ? 207  TYR A CG    1 
ATOM   709  C  CD1   . TYR A 1 86  ? 188.725 185.809 22.565  1.00 15.56 ? 207  TYR A CD1   1 
ATOM   710  C  CD2   . TYR A 1 86  ? 189.445 183.655 23.347  1.00 13.39 ? 207  TYR A CD2   1 
ATOM   711  C  CE1   . TYR A 1 86  ? 189.669 186.433 23.389  1.00 14.72 ? 207  TYR A CE1   1 
ATOM   712  C  CE2   . TYR A 1 86  ? 190.393 184.263 24.174  1.00 15.70 ? 207  TYR A CE2   1 
ATOM   713  C  CZ    . TYR A 1 86  ? 190.497 185.652 24.192  1.00 16.96 ? 207  TYR A CZ    1 
ATOM   714  O  OH    . TYR A 1 86  ? 191.413 186.252 25.028  1.00 17.44 ? 207  TYR A OH    1 
ATOM   715  N  N     . LEU A 1 87  ? 186.716 181.882 19.082  1.00 12.98 ? 208  LEU A N     1 
ATOM   716  C  CA    . LEU A 1 87  ? 185.597 181.206 18.475  1.00 11.35 ? 208  LEU A CA    1 
ATOM   717  C  C     . LEU A 1 87  ? 185.092 180.162 19.473  1.00 11.42 ? 208  LEU A C     1 
ATOM   718  O  O     . LEU A 1 87  ? 185.875 179.354 19.978  1.00 9.69  ? 208  LEU A O     1 
ATOM   719  C  CB    . LEU A 1 87  ? 186.025 180.515 17.181  1.00 12.38 ? 208  LEU A CB    1 
ATOM   720  C  CG    . LEU A 1 87  ? 186.790 181.296 16.101  1.00 18.53 ? 208  LEU A CG    1 
ATOM   721  C  CD1   . LEU A 1 87  ? 186.415 180.695 14.759  1.00 13.01 ? 208  LEU A CD1   1 
ATOM   722  C  CD2   . LEU A 1 87  ? 186.466 182.794 16.118  1.00 17.18 ? 208  LEU A CD2   1 
ATOM   723  N  N     . ILE A 1 88  ? 183.789 180.194 19.753  1.00 11.10 ? 209  ILE A N     1 
ATOM   724  C  CA    . ILE A 1 88  ? 183.146 179.268 20.670  1.00 10.69 ? 209  ILE A CA    1 
ATOM   725  C  C     . ILE A 1 88  ? 182.659 178.124 19.785  1.00 13.02 ? 209  ILE A C     1 
ATOM   726  O  O     . ILE A 1 88  ? 181.689 178.238 19.040  1.00 13.94 ? 209  ILE A O     1 
ATOM   727  C  CB    . ILE A 1 88  ? 181.968 179.962 21.389  1.00 13.97 ? 209  ILE A CB    1 
ATOM   728  C  CG1   . ILE A 1 88  ? 182.489 181.303 21.979  1.00 14.77 ? 209  ILE A CG1   1 
ATOM   729  C  CG2   . ILE A 1 88  ? 181.316 178.980 22.422  1.00 10.28 ? 209  ILE A CG2   1 
ATOM   730  C  CD1   . ILE A 1 88  ? 181.466 182.209 22.621  1.00 10.27 ? 209  ILE A CD1   1 
ATOM   731  N  N     . LEU A 1 89  ? 183.373 177.019 19.856  1.00 12.66 ? 210  LEU A N     1 
ATOM   732  C  CA    . LEU A 1 89  ? 183.065 175.867 19.044  1.00 13.21 ? 210  LEU A CA    1 
ATOM   733  C  C     . LEU A 1 89  ? 182.464 174.731 19.841  1.00 10.33 ? 210  LEU A C     1 
ATOM   734  O  O     . LEU A 1 89  ? 182.591 174.664 21.053  1.00 14.25 ? 210  LEU A O     1 
ATOM   735  C  CB    . LEU A 1 89  ? 184.348 175.383 18.375  1.00 13.93 ? 210  LEU A CB    1 
ATOM   736  C  CG    . LEU A 1 89  ? 185.046 176.317 17.381  1.00 16.57 ? 210  LEU A CG    1 
ATOM   737  C  CD1   . LEU A 1 89  ? 186.507 175.915 17.264  1.00 14.44 ? 210  LEU A CD1   1 
ATOM   738  C  CD2   . LEU A 1 89  ? 184.351 176.245 16.022  1.00 12.75 ? 210  LEU A CD2   1 
ATOM   739  N  N     . GLU A 1 90  ? 181.784 173.843 19.139  1.00 11.52 ? 211  GLU A N     1 
ATOM   740  C  CA    . GLU A 1 90  ? 181.218 172.646 19.739  1.00 12.06 ? 211  GLU A CA    1 
ATOM   741  C  C     . GLU A 1 90  ? 182.424 171.723 20.009  1.00 14.58 ? 211  GLU A C     1 
ATOM   742  O  O     . GLU A 1 90  ? 183.296 171.561 19.156  1.00 11.41 ? 211  GLU A O     1 
ATOM   743  C  CB    . GLU A 1 90  ? 180.272 171.970 18.751  1.00 15.25 ? 211  GLU A CB    1 
ATOM   744  C  CG    . GLU A 1 90  ? 180.147 170.462 18.927  1.00 16.63 ? 211  GLU A CG    1 
ATOM   745  C  CD    . GLU A 1 90  ? 179.379 169.783 17.784  1.00 23.31 ? 211  GLU A CD    1 
ATOM   746  O  OE1   . GLU A 1 90  ? 179.201 168.531 17.837  1.00 22.59 ? 211  GLU A OE1   1 
ATOM   747  O  OE2   . GLU A 1 90  ? 178.954 170.500 16.829  1.00 22.15 ? 211  GLU A OE2   1 
ATOM   748  N  N     . TYR A 1 91  ? 182.466 171.133 21.196  1.00 13.40 ? 212  TYR A N     1 
ATOM   749  C  CA    . TYR A 1 91  ? 183.555 170.247 21.589  1.00 15.01 ? 212  TYR A CA    1 
ATOM   750  C  C     . TYR A 1 91  ? 183.463 168.889 20.909  1.00 15.14 ? 212  TYR A C     1 
ATOM   751  O  O     . TYR A 1 91  ? 182.414 168.259 20.920  1.00 14.66 ? 212  TYR A O     1 
ATOM   752  C  CB    . TYR A 1 91  ? 183.541 170.072 23.108  1.00 16.32 ? 212  TYR A CB    1 
ATOM   753  C  CG    . TYR A 1 91  ? 184.387 168.938 23.679  1.00 18.16 ? 212  TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1 91  ? 185.744 168.820 23.391  1.00 15.83 ? 212  TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1 91  ? 183.829 168.042 24.601  1.00 18.49 ? 212  TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1 91  ? 186.528 167.845 24.013  1.00 16.35 ? 212  TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1 91  ? 184.590 167.074 25.223  1.00 16.40 ? 212  TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1 91  ? 185.934 166.973 24.934  1.00 19.22 ? 212  TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1 91  ? 186.655 165.995 25.594  1.00 15.81 ? 212  TYR A OH    1 
ATOM   760  N  N     . ALA A 1 92  ? 184.561 168.451 20.297  1.00 15.74 ? 213  ALA A N     1 
ATOM   761  C  CA    . ALA A 1 92  ? 184.623 167.142 19.636  1.00 14.66 ? 213  ALA A CA    1 
ATOM   762  C  C     . ALA A 1 92  ? 185.417 166.270 20.615  1.00 16.61 ? 213  ALA A C     1 
ATOM   763  O  O     . ALA A 1 92  ? 186.638 166.352 20.682  1.00 16.21 ? 213  ALA A O     1 
ATOM   764  C  CB    . ALA A 1 92  ? 185.341 167.270 18.302  1.00 16.59 ? 213  ALA A CB    1 
ATOM   765  N  N     . PRO A 1 93  ? 184.724 165.418 21.380  1.00 15.97 ? 214  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 93  ? 185.258 164.515 22.398  1.00 15.31 ? 214  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 93  ? 186.319 163.472 22.000  1.00 17.90 ? 214  PRO A C     1 
ATOM   768  O  O     . PRO A 1 93  ? 187.172 163.152 22.829  1.00 18.00 ? 214  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 93  ? 184.000 163.837 22.963  1.00 14.60 ? 214  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 93  ? 182.844 164.624 22.417  1.00 17.26 ? 214  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 93  ? 183.323 165.077 21.082  1.00 15.58 ? 214  PRO A CD    1 
ATOM   772  N  N     . LEU A 1 94  ? 186.274 162.922 20.777  1.00 14.95 ? 215  LEU A N     1 
ATOM   773  C  CA    . LEU A 1 94  ? 187.214 161.880 20.362  1.00 14.66 ? 215  LEU A CA    1 
ATOM   774  C  C     . LEU A 1 94  ? 188.415 162.306 19.505  1.00 14.59 ? 215  LEU A C     1 
ATOM   775  O  O     . LEU A 1 94  ? 189.093 161.477 18.905  1.00 14.29 ? 215  LEU A O     1 
ATOM   776  C  CB    . LEU A 1 94  ? 186.453 160.710 19.692  1.00 16.00 ? 215  LEU A CB    1 
ATOM   777  C  CG    . LEU A 1 94  ? 185.316 160.072 20.536  1.00 22.00 ? 215  LEU A CG    1 
ATOM   778  C  CD1   . LEU A 1 94  ? 184.664 158.818 19.898  1.00 17.85 ? 215  LEU A CD1   1 
ATOM   779  C  CD2   . LEU A 1 94  ? 185.906 159.717 21.877  1.00 20.55 ? 215  LEU A CD2   1 
ATOM   780  N  N     . GLY A 1 95  ? 188.691 163.603 19.455  1.00 16.74 ? 216  GLY A N     1 
ATOM   781  C  CA    . GLY A 1 95  ? 189.836 164.070 18.694  1.00 14.83 ? 216  GLY A CA    1 
ATOM   782  C  C     . GLY A 1 95  ? 189.701 164.060 17.184  1.00 13.54 ? 216  GLY A C     1 
ATOM   783  O  O     . GLY A 1 95  ? 188.597 164.008 16.656  1.00 12.48 ? 216  GLY A O     1 
ATOM   784  N  N     . THR A 1 96  ? 190.843 164.091 16.497  1.00 12.97 ? 217  THR A N     1 
ATOM   785  C  CA    . THR A 1 96  ? 190.867 164.136 15.044  1.00 14.08 ? 217  THR A CA    1 
ATOM   786  C  C     . THR A 1 96  ? 191.060 162.811 14.347  1.00 16.46 ? 217  THR A C     1 
ATOM   787  O  O     . THR A 1 96  ? 191.741 161.910 14.849  1.00 15.02 ? 217  THR A O     1 
ATOM   788  C  CB    . THR A 1 96  ? 192.005 164.998 14.503  1.00 14.49 ? 217  THR A CB    1 
ATOM   789  O  OG1   . THR A 1 96  ? 193.242 164.310 14.733  1.00 16.68 ? 217  THR A OG1   1 
ATOM   790  C  CG2   . THR A 1 96  ? 192.043 166.347 15.167  1.00 10.84 ? 217  THR A CG2   1 
ATOM   791  N  N     . VAL A 1 97  ? 190.481 162.721 13.153  1.00 16.27 ? 218  VAL A N     1 
ATOM   792  C  CA    . VAL A 1 97  ? 190.616 161.533 12.340  1.00 15.99 ? 218  VAL A CA    1 
ATOM   793  C  C     . VAL A 1 97  ? 192.117 161.366 12.051  1.00 16.41 ? 218  VAL A C     1 
ATOM   794  O  O     . VAL A 1 97  ? 192.611 160.255 11.896  1.00 15.84 ? 218  VAL A O     1 
ATOM   795  C  CB    . VAL A 1 97  ? 189.802 161.683 11.038  1.00 16.57 ? 218  VAL A CB    1 
ATOM   796  C  CG1   . VAL A 1 97  ? 190.263 160.649 9.999   1.00 18.56 ? 218  VAL A CG1   1 
ATOM   797  C  CG2   . VAL A 1 97  ? 188.339 161.504 11.349  1.00 11.27 ? 218  VAL A CG2   1 
ATOM   798  N  N     . TYR A 1 98  ? 192.826 162.487 12.008  1.00 15.85 ? 219  TYR A N     1 
ATOM   799  C  CA    . TYR A 1 98  ? 194.261 162.509 11.789  1.00 16.76 ? 219  TYR A CA    1 
ATOM   800  C  C     . TYR A 1 98  ? 194.999 161.661 12.826  1.00 18.49 ? 219  TYR A C     1 
ATOM   801  O  O     . TYR A 1 98  ? 195.910 160.888 12.494  1.00 18.32 ? 219  TYR A O     1 
ATOM   802  C  CB    . TYR A 1 98  ? 194.771 163.937 11.908  1.00 18.52 ? 219  TYR A CB    1 
ATOM   803  C  CG    . TYR A 1 98  ? 196.259 164.024 11.800  1.00 19.33 ? 219  TYR A CG    1 
ATOM   804  C  CD1   . TYR A 1 98  ? 196.870 163.870 10.570  1.00 17.55 ? 219  TYR A CD1   1 
ATOM   805  C  CD2   . TYR A 1 98  ? 197.065 164.236 12.936  1.00 21.27 ? 219  TYR A CD2   1 
ATOM   806  C  CE1   . TYR A 1 98  ? 198.249 163.929 10.450  1.00 23.59 ? 219  TYR A CE1   1 
ATOM   807  C  CE2   . TYR A 1 98  ? 198.454 164.289 12.834  1.00 20.92 ? 219  TYR A CE2   1 
ATOM   808  C  CZ    . TYR A 1 98  ? 199.032 164.136 11.584  1.00 24.53 ? 219  TYR A CZ    1 
ATOM   809  O  OH    . TYR A 1 98  ? 200.392 164.188 11.448  1.00 28.22 ? 219  TYR A OH    1 
ATOM   810  N  N     . ARG A 1 99  ? 194.617 161.836 14.086  1.00 16.66 ? 220  ARG A N     1 
ATOM   811  C  CA    . ARG A 1 99  ? 195.247 161.100 15.154  1.00 19.76 ? 220  ARG A CA    1 
ATOM   812  C  C     . ARG A 1 99  ? 194.908 159.608 15.088  1.00 19.85 ? 220  ARG A C     1 
ATOM   813  O  O     . ARG A 1 99  ? 195.768 158.748 15.322  1.00 19.84 ? 220  ARG A O     1 
ATOM   814  C  CB    . ARG A 1 99  ? 194.848 161.674 16.514  1.00 22.26 ? 220  ARG A CB    1 
ATOM   815  C  CG    . ARG A 1 99  ? 195.514 160.949 17.669  1.00 27.26 ? 220  ARG A CG    1 
ATOM   816  C  CD    . ARG A 1 99  ? 197.039 161.124 17.660  1.00 29.11 ? 220  ARG A CD    1 
ATOM   817  N  NE    . ARG A 1 99  ? 197.689 160.200 18.595  1.00 32.84 ? 220  ARG A NE    1 
ATOM   818  C  CZ    . ARG A 1 99  ? 199.003 160.005 18.702  1.00 35.53 ? 220  ARG A CZ    1 
ATOM   819  N  NH1   . ARG A 1 99  ? 199.867 160.669 17.931  1.00 39.53 ? 220  ARG A NH1   1 
ATOM   820  N  NH2   . ARG A 1 99  ? 199.449 159.129 19.594  1.00 36.11 ? 220  ARG A NH2   1 
ATOM   821  N  N     . GLU A 1 100 ? 193.661 159.309 14.746  1.00 19.44 ? 221  GLU A N     1 
ATOM   822  C  CA    . GLU A 1 100 ? 193.192 157.935 14.628  1.00 21.14 ? 221  GLU A CA    1 
ATOM   823  C  C     . GLU A 1 100 ? 193.930 157.268 13.465  1.00 22.03 ? 221  GLU A C     1 
ATOM   824  O  O     . GLU A 1 100 ? 194.201 156.061 13.493  1.00 21.79 ? 221  GLU A O     1 
ATOM   825  C  CB    . GLU A 1 100 ? 191.670 157.930 14.386  1.00 22.94 ? 221  GLU A CB    1 
ATOM   826  C  CG    . GLU A 1 100 ? 190.968 156.594 14.519  1.00 27.24 ? 221  GLU A CG    1 
ATOM   827  C  CD    . GLU A 1 100 ? 191.078 155.998 15.918  1.00 30.92 ? 221  GLU A CD    1 
ATOM   828  O  OE1   . GLU A 1 100 ? 190.736 154.798 16.073  1.00 35.57 ? 221  GLU A OE1   1 
ATOM   829  O  OE2   . GLU A 1 100 ? 191.502 156.716 16.857  1.00 31.40 ? 221  GLU A OE2   1 
ATOM   830  N  N     . LEU A 1 101 ? 194.257 158.060 12.442  1.00 20.91 ? 222  LEU A N     1 
ATOM   831  C  CA    . LEU A 1 101 ? 194.969 157.533 11.287  1.00 18.01 ? 222  LEU A CA    1 
ATOM   832  C  C     . LEU A 1 101 ? 196.439 157.261 11.639  1.00 16.91 ? 222  LEU A C     1 
ATOM   833  O  O     . LEU A 1 101 ? 197.012 156.317 11.119  1.00 16.89 ? 222  LEU A O     1 
ATOM   834  C  CB    . LEU A 1 101 ? 194.838 158.485 10.079  1.00 17.83 ? 222  LEU A CB    1 
ATOM   835  C  CG    . LEU A 1 101 ? 195.181 157.923 8.676   1.00 21.87 ? 222  LEU A CG    1 
ATOM   836  C  CD1   . LEU A 1 101 ? 194.366 156.652 8.358   1.00 17.44 ? 222  LEU A CD1   1 
ATOM   837  C  CD2   . LEU A 1 101 ? 194.892 159.007 7.634   1.00 19.79 ? 222  LEU A CD2   1 
ATOM   838  N  N     . GLN A 1 102 ? 197.062 158.066 12.503  1.00 16.66 ? 223  GLN A N     1 
ATOM   839  C  CA    . GLN A 1 102 ? 198.446 157.769 12.900  1.00 17.24 ? 223  GLN A CA    1 
ATOM   840  C  C     . GLN A 1 102 ? 198.456 156.448 13.688  1.00 21.01 ? 223  GLN A C     1 
ATOM   841  O  O     . GLN A 1 102 ? 199.360 155.630 13.523  1.00 18.77 ? 223  GLN A O     1 
ATOM   842  C  CB    . GLN A 1 102 ? 199.022 158.808 13.850  1.00 19.18 ? 223  GLN A CB    1 
ATOM   843  C  CG    . GLN A 1 102 ? 199.250 160.205 13.317  1.00 28.34 ? 223  GLN A CG    1 
ATOM   844  C  CD    . GLN A 1 102 ? 199.954 161.058 14.355  1.00 31.88 ? 223  GLN A CD    1 
ATOM   845  O  OE1   . GLN A 1 102 ? 199.437 161.241 15.474  1.00 31.86 ? 223  GLN A OE1   1 
ATOM   846  N  NE2   . GLN A 1 102 ? 201.149 161.584 14.005  1.00 34.43 ? 223  GLN A NE2   1 
ATOM   847  N  N     . LYS A 1 103 ? 197.464 156.277 14.570  1.00 21.30 ? 224  LYS A N     1 
ATOM   848  C  CA    . LYS A 1 103 ? 197.357 155.099 15.419  1.00 21.07 ? 224  LYS A CA    1 
ATOM   849  C  C     . LYS A 1 103 ? 197.088 153.812 14.647  1.00 20.29 ? 224  LYS A C     1 
ATOM   850  O  O     . LYS A 1 103 ? 197.799 152.829 14.821  1.00 19.90 ? 224  LYS A O     1 
ATOM   851  C  CB    . LYS A 1 103 ? 196.258 155.300 16.492  1.00 24.80 ? 224  LYS A CB    1 
ATOM   852  C  CG    . LYS A 1 103 ? 196.479 156.522 17.399  1.00 26.43 ? 224  LYS A CG    1 
ATOM   853  C  CD    . LYS A 1 103 ? 195.427 156.642 18.505  1.00 30.49 ? 224  LYS A CD    1 
ATOM   854  C  CE    . LYS A 1 103 ? 195.834 157.727 19.507  1.00 31.44 ? 224  LYS A CE    1 
ATOM   855  N  NZ    . LYS A 1 103 ? 194.917 157.868 20.668  1.00 33.32 ? 224  LYS A NZ    1 
ATOM   856  N  N     . LEU A 1 104 ? 196.059 153.800 13.806  1.00 20.45 ? 225  LEU A N     1 
ATOM   857  C  CA    . LEU A 1 104 ? 195.753 152.603 13.039  1.00 18.46 ? 225  LEU A CA    1 
ATOM   858  C  C     . LEU A 1 104 ? 196.631 152.464 11.780  1.00 19.83 ? 225  LEU A C     1 
ATOM   859  O  O     . LEU A 1 104 ? 196.694 151.381 11.186  1.00 20.09 ? 225  LEU A O     1 
ATOM   860  C  CB    . LEU A 1 104 ? 194.272 152.588 12.615  1.00 20.03 ? 225  LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 104 ? 193.224 152.691 13.740  1.00 24.89 ? 225  LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 104 ? 191.784 152.656 13.213  1.00 20.57 ? 225  LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 104 ? 193.462 151.543 14.674  1.00 26.58 ? 225  LEU A CD2   1 
ATOM   864  N  N     . SER A 1 105 ? 197.296 153.545 11.375  1.00 18.33 ? 226  SER A N     1 
ATOM   865  C  CA    . SER A 1 105 ? 198.137 153.578 10.158  1.00 21.51 ? 226  SER A CA    1 
ATOM   866  C  C     . SER A 1 105 ? 197.295 153.542 8.871   1.00 20.48 ? 226  SER A C     1 
ATOM   867  O  O     . SER A 1 105 ? 197.566 154.284 7.927   1.00 19.41 ? 226  SER A O     1 
ATOM   868  C  CB    . SER A 1 105 ? 199.160 152.426 10.124  1.00 21.48 ? 226  SER A CB    1 
ATOM   869  O  OG    . SER A 1 105 ? 200.116 152.533 11.177  1.00 27.63 ? 226  SER A OG    1 
ATOM   870  N  N     . LYS A 1 106 ? 196.290 152.664 8.838   1.00 20.02 ? 227  LYS A N     1 
ATOM   871  C  CA    . LYS A 1 106 ? 195.358 152.524 7.697   1.00 19.86 ? 227  LYS A CA    1 
ATOM   872  C  C     . LYS A 1 106 ? 193.970 152.303 8.274   1.00 16.62 ? 227  LYS A C     1 
ATOM   873  O  O     . LYS A 1 106 ? 193.852 151.881 9.411   1.00 18.80 ? 227  LYS A O     1 
ATOM   874  C  CB    . LYS A 1 106 ? 195.668 151.280 6.876   1.00 24.72 ? 227  LYS A CB    1 
ATOM   875  C  CG    . LYS A 1 106 ? 196.854 151.364 5.990   1.00 29.64 ? 227  LYS A CG    1 
ATOM   876  C  CD    . LYS A 1 106 ? 197.148 149.990 5.419   1.00 35.21 ? 227  LYS A CD    1 
ATOM   877  C  CE    . LYS A 1 106 ? 198.330 150.088 4.465   1.00 41.32 ? 227  LYS A CE    1 
ATOM   878  N  NZ    . LYS A 1 106 ? 198.843 148.758 4.016   1.00 43.82 ? 227  LYS A NZ    1 
ATOM   879  N  N     . PHE A 1 107 ? 192.930 152.584 7.499   1.00 14.54 ? 228  PHE A N     1 
ATOM   880  C  CA    . PHE A 1 107 ? 191.548 152.342 7.932   1.00 15.70 ? 228  PHE A CA    1 
ATOM   881  C  C     . PHE A 1 107 ? 191.051 151.227 7.016   1.00 15.70 ? 228  PHE A C     1 
ATOM   882  O  O     . PHE A 1 107 ? 191.399 151.212 5.833   1.00 16.89 ? 228  PHE A O     1 
ATOM   883  C  CB    . PHE A 1 107 ? 190.665 153.590 7.729   1.00 12.09 ? 228  PHE A CB    1 
ATOM   884  C  CG    . PHE A 1 107 ? 190.958 154.697 8.679   1.00 13.97 ? 228  PHE A CG    1 
ATOM   885  C  CD1   . PHE A 1 107 ? 190.564 156.005 8.400   1.00 14.03 ? 228  PHE A CD1   1 
ATOM   886  C  CD2   . PHE A 1 107 ? 191.629 154.439 9.860   1.00 13.49 ? 228  PHE A CD2   1 
ATOM   887  C  CE1   . PHE A 1 107 ? 190.844 157.046 9.299   1.00 12.37 ? 228  PHE A CE1   1 
ATOM   888  C  CE2   . PHE A 1 107 ? 191.912 155.466 10.767  1.00 14.79 ? 228  PHE A CE2   1 
ATOM   889  C  CZ    . PHE A 1 107 ? 191.520 156.772 10.487  1.00 11.50 ? 228  PHE A CZ    1 
ATOM   890  N  N     . ASP A 1 108 ? 190.261 150.290 7.536   1.00 16.61 ? 229  ASP A N     1 
ATOM   891  C  CA    . ASP A 1 108 ? 189.753 149.221 6.666   1.00 18.23 ? 229  ASP A CA    1 
ATOM   892  C  C     . ASP A 1 108 ? 188.624 149.817 5.810   1.00 16.57 ? 229  ASP A C     1 
ATOM   893  O  O     . ASP A 1 108 ? 188.322 151.006 5.939   1.00 17.37 ? 229  ASP A O     1 
ATOM   894  C  CB    . ASP A 1 108 ? 189.261 148.005 7.478   1.00 17.42 ? 229  ASP A CB    1 
ATOM   895  C  CG    . ASP A 1 108 ? 188.092 148.325 8.369   1.00 20.41 ? 229  ASP A CG    1 
ATOM   896  O  OD1   . ASP A 1 108 ? 187.161 149.024 7.930   1.00 28.20 ? 229  ASP A OD1   1 
ATOM   897  O  OD2   . ASP A 1 108 ? 188.072 147.859 9.511   1.00 26.24 ? 229  ASP A OD2   1 
ATOM   898  N  N     . GLU A 1 109 ? 187.998 149.020 4.952   1.00 15.33 ? 230  GLU A N     1 
ATOM   899  C  CA    . GLU A 1 109 ? 186.947 149.560 4.084   1.00 17.43 ? 230  GLU A CA    1 
ATOM   900  C  C     . GLU A 1 109 ? 185.680 150.062 4.783   1.00 16.70 ? 230  GLU A C     1 
ATOM   901  O  O     . GLU A 1 109 ? 185.141 151.099 4.419   1.00 13.33 ? 230  GLU A O     1 
ATOM   902  C  CB    . GLU A 1 109 ? 186.571 148.541 3.002   1.00 16.24 ? 230  GLU A CB    1 
ATOM   903  C  CG    . GLU A 1 109 ? 187.743 148.066 2.153   1.00 23.01 ? 230  GLU A CG    1 
ATOM   904  C  CD    . GLU A 1 109 ? 187.313 147.497 0.794   1.00 27.22 ? 230  GLU A CD    1 
ATOM   905  O  OE1   . GLU A 1 109 ? 186.584 146.478 0.753   1.00 28.49 ? 230  GLU A OE1   1 
ATOM   906  O  OE2   . GLU A 1 109 ? 187.711 148.085 -0.244  1.00 29.45 ? 230  GLU A OE2   1 
ATOM   907  N  N     . GLN A 1 110 ? 185.209 149.326 5.782   1.00 16.53 ? 231  GLN A N     1 
ATOM   908  C  CA    . GLN A 1 110 ? 184.003 149.711 6.512   1.00 17.02 ? 231  GLN A CA    1 
ATOM   909  C  C     . GLN A 1 110 ? 184.195 151.124 7.120   1.00 17.00 ? 231  GLN A C     1 
ATOM   910  O  O     . GLN A 1 110 ? 183.381 152.024 6.890   1.00 18.40 ? 231  GLN A O     1 
ATOM   911  C  CB    . GLN A 1 110 ? 183.728 148.656 7.596   1.00 15.32 ? 231  GLN A CB    1 
ATOM   912  C  CG    . GLN A 1 110 ? 182.370 148.737 8.289   1.00 17.56 ? 231  GLN A CG    1 
ATOM   913  C  CD    . GLN A 1 110 ? 182.297 149.841 9.359   1.00 22.59 ? 231  GLN A CD    1 
ATOM   914  O  OE1   . GLN A 1 110 ? 183.298 150.112 10.075  1.00 21.11 ? 231  GLN A OE1   1 
ATOM   915  N  NE2   . GLN A 1 110 ? 181.106 150.478 9.494   1.00 19.70 ? 231  GLN A NE2   1 
ATOM   916  N  N     . ARG A 1 111 ? 185.281 151.308 7.873   1.00 17.36 ? 232  ARG A N     1 
ATOM   917  C  CA    . ARG A 1 111 ? 185.607 152.593 8.509   1.00 17.63 ? 232  ARG A CA    1 
ATOM   918  C  C     . ARG A 1 111 ? 185.770 153.747 7.507   1.00 14.94 ? 232  ARG A C     1 
ATOM   919  O  O     . ARG A 1 111 ? 185.356 154.866 7.761   1.00 12.98 ? 232  ARG A O     1 
ATOM   920  C  CB    . ARG A 1 111 ? 186.905 152.465 9.307   1.00 19.87 ? 232  ARG A CB    1 
ATOM   921  C  CG    . ARG A 1 111 ? 187.205 153.647 10.172  1.00 20.99 ? 232  ARG A CG    1 
ATOM   922  C  CD    . ARG A 1 111 ? 186.795 153.359 11.597  1.00 28.38 ? 232  ARG A CD    1 
ATOM   923  N  NE    . ARG A 1 111 ? 187.588 154.189 12.487  1.00 32.23 ? 232  ARG A NE    1 
ATOM   924  C  CZ    . ARG A 1 111 ? 188.247 153.745 13.545  1.00 31.41 ? 232  ARG A CZ    1 
ATOM   925  N  NH1   . ARG A 1 111 ? 188.213 152.459 13.873  1.00 29.13 ? 232  ARG A NH1   1 
ATOM   926  N  NH2   . ARG A 1 111 ? 188.963 154.604 14.257  1.00 35.98 ? 232  ARG A NH2   1 
ATOM   927  N  N     . THR A 1 112 ? 186.403 153.457 6.384   1.00 13.16 ? 233  THR A N     1 
ATOM   928  C  CA    . THR A 1 112 ? 186.652 154.446 5.361   1.00 13.60 ? 233  THR A CA    1 
ATOM   929  C  C     . THR A 1 112 ? 185.339 154.863 4.686   1.00 13.47 ? 233  THR A C     1 
ATOM   930  O  O     . THR A 1 112 ? 185.090 156.056 4.508   1.00 12.81 ? 233  THR A O     1 
ATOM   931  C  CB    . THR A 1 112 ? 187.719 153.902 4.340   1.00 14.55 ? 233  THR A CB    1 
ATOM   932  O  OG1   . THR A 1 112 ? 188.937 153.623 5.048   1.00 14.87 ? 233  THR A OG1   1 
ATOM   933  C  CG2   . THR A 1 112 ? 188.016 154.908 3.231   1.00 13.20 ? 233  THR A CG2   1 
ATOM   934  N  N     . ALA A 1 113 ? 184.481 153.901 4.353   1.00 11.54 ? 234  ALA A N     1 
ATOM   935  C  CA    . ALA A 1 113 ? 183.199 154.225 3.713   1.00 12.90 ? 234  ALA A CA    1 
ATOM   936  C  C     . ALA A 1 113 ? 182.254 154.953 4.675   1.00 15.13 ? 234  ALA A C     1 
ATOM   937  O  O     . ALA A 1 113 ? 181.498 155.843 4.272   1.00 18.25 ? 234  ALA A O     1 
ATOM   938  C  CB    . ALA A 1 113 ? 182.531 152.967 3.184   1.00 6.31  ? 234  ALA A CB    1 
ATOM   939  N  N     . THR A 1 114 ? 182.297 154.579 5.945   1.00 13.08 ? 235  THR A N     1 
ATOM   940  C  CA    . THR A 1 114 ? 181.450 155.221 6.909   1.00 11.34 ? 235  THR A CA    1 
ATOM   941  C  C     . THR A 1 114 ? 181.813 156.701 6.976   1.00 12.76 ? 235  THR A C     1 
ATOM   942  O  O     . THR A 1 114 ? 180.930 157.553 6.894   1.00 14.21 ? 235  THR A O     1 
ATOM   943  C  CB    . THR A 1 114 ? 181.581 154.543 8.289   1.00 13.04 ? 235  THR A CB    1 
ATOM   944  O  OG1   . THR A 1 114 ? 181.181 153.167 8.177   1.00 13.03 ? 235  THR A OG1   1 
ATOM   945  C  CG2   . THR A 1 114 ? 180.679 155.235 9.304   1.00 9.30  ? 235  THR A CG2   1 
ATOM   946  N  N     . TYR A 1 115 ? 183.104 157.003 7.115   1.00 12.83 ? 236  TYR A N     1 
ATOM   947  C  CA    . TYR A 1 115 ? 183.586 158.392 7.157   1.00 14.72 ? 236  TYR A CA    1 
ATOM   948  C  C     . TYR A 1 115 ? 183.291 159.154 5.862   1.00 16.50 ? 236  TYR A C     1 
ATOM   949  O  O     . TYR A 1 115 ? 182.873 160.311 5.898   1.00 15.39 ? 236  TYR A O     1 
ATOM   950  C  CB    . TYR A 1 115 ? 185.096 158.451 7.371   1.00 16.17 ? 236  TYR A CB    1 
ATOM   951  C  CG    . TYR A 1 115 ? 185.572 158.175 8.772   1.00 16.12 ? 236  TYR A CG    1 
ATOM   952  C  CD1   . TYR A 1 115 ? 184.785 158.491 9.876   1.00 16.03 ? 236  TYR A CD1   1 
ATOM   953  C  CD2   . TYR A 1 115 ? 186.830 157.626 8.993   1.00 13.79 ? 236  TYR A CD2   1 
ATOM   954  C  CE1   . TYR A 1 115 ? 185.237 158.261 11.162  1.00 16.90 ? 236  TYR A CE1   1 
ATOM   955  C  CE2   . TYR A 1 115 ? 187.290 157.397 10.266  1.00 15.98 ? 236  TYR A CE2   1 
ATOM   956  C  CZ    . TYR A 1 115 ? 186.490 157.709 11.347  1.00 19.04 ? 236  TYR A CZ    1 
ATOM   957  O  OH    . TYR A 1 115 ? 186.935 157.420 12.609  1.00 22.33 ? 236  TYR A OH    1 
ATOM   958  N  N     . ILE A 1 116 ? 183.536 158.517 4.718   1.00 14.99 ? 237  ILE A N     1 
ATOM   959  C  CA    . ILE A 1 116 ? 183.274 159.176 3.456   1.00 15.34 ? 237  ILE A CA    1 
ATOM   960  C  C     . ILE A 1 116 ? 181.795 159.542 3.379   1.00 17.56 ? 237  ILE A C     1 
ATOM   961  O  O     . ILE A 1 116 ? 181.442 160.638 2.953   1.00 18.55 ? 237  ILE A O     1 
ATOM   962  C  CB    . ILE A 1 116 ? 183.656 158.295 2.242   1.00 15.72 ? 237  ILE A CB    1 
ATOM   963  C  CG1   . ILE A 1 116 ? 185.157 157.993 2.241   1.00 13.11 ? 237  ILE A CG1   1 
ATOM   964  C  CG2   . ILE A 1 116 ? 183.331 159.027 0.960   1.00 17.81 ? 237  ILE A CG2   1 
ATOM   965  C  CD1   . ILE A 1 116 ? 186.062 159.254 2.278   1.00 13.67 ? 237  ILE A CD1   1 
ATOM   966  N  N     . THR A 1 117 ? 180.935 158.626 3.804   1.00 17.36 ? 238  THR A N     1 
ATOM   967  C  CA    . THR A 1 117 ? 179.489 158.853 3.816   1.00 14.99 ? 238  THR A CA    1 
ATOM   968  C  C     . THR A 1 117 ? 179.069 160.037 4.696   1.00 14.23 ? 238  THR A C     1 
ATOM   969  O  O     . THR A 1 117 ? 178.214 160.829 4.307   1.00 14.27 ? 238  THR A O     1 
ATOM   970  C  CB    . THR A 1 117 ? 178.760 157.600 4.330   1.00 13.08 ? 238  THR A CB    1 
ATOM   971  O  OG1   . THR A 1 117 ? 179.059 156.502 3.464   1.00 16.26 ? 238  THR A OG1   1 
ATOM   972  C  CG2   . THR A 1 117 ? 177.257 157.817 4.354   1.00 13.58 ? 238  THR A CG2   1 
ATOM   973  N  N     . GLU A 1 118 ? 179.649 160.149 5.888   1.00 11.63 ? 239  GLU A N     1 
ATOM   974  C  CA    . GLU A 1 118 ? 179.285 161.242 6.781   1.00 13.23 ? 239  GLU A CA    1 
ATOM   975  C  C     . GLU A 1 118 ? 179.767 162.548 6.149   1.00 13.27 ? 239  GLU A C     1 
ATOM   976  O  O     . GLU A 1 118 ? 179.028 163.525 6.073   1.00 12.45 ? 239  GLU A O     1 
ATOM   977  C  CB    . GLU A 1 118 ? 179.913 161.025 8.170   1.00 14.00 ? 239  GLU A CB    1 
ATOM   978  C  CG    . GLU A 1 118 ? 179.443 159.721 8.804   1.00 18.38 ? 239  GLU A CG    1 
ATOM   979  C  CD    . GLU A 1 118 ? 180.121 159.365 10.124  1.00 24.00 ? 239  GLU A CD    1 
ATOM   980  O  OE1   . GLU A 1 118 ? 181.366 159.259 10.187  1.00 24.67 ? 239  GLU A OE1   1 
ATOM   981  O  OE2   . GLU A 1 118 ? 179.385 159.158 11.114  1.00 32.52 ? 239  GLU A OE2   1 
ATOM   982  N  N     . LEU A 1 119 ? 181.005 162.538 5.668   1.00 11.05 ? 240  LEU A N     1 
ATOM   983  C  CA    . LEU A 1 119 ? 181.566 163.707 5.049   1.00 13.29 ? 240  LEU A CA    1 
ATOM   984  C  C     . LEU A 1 119 ? 180.798 164.081 3.773   1.00 13.39 ? 240  LEU A C     1 
ATOM   985  O  O     . LEU A 1 119 ? 180.513 165.256 3.548   1.00 14.19 ? 240  LEU A O     1 
ATOM   986  C  CB    . LEU A 1 119 ? 183.043 163.465 4.738   1.00 15.79 ? 240  LEU A CB    1 
ATOM   987  C  CG    . LEU A 1 119 ? 183.894 164.638 4.235   1.00 16.19 ? 240  LEU A CG    1 
ATOM   988  C  CD1   . LEU A 1 119 ? 184.031 165.720 5.279   1.00 19.17 ? 240  LEU A CD1   1 
ATOM   989  C  CD2   . LEU A 1 119 ? 185.267 164.108 3.884   1.00 19.04 ? 240  LEU A CD2   1 
ATOM   990  N  N     . ALA A 1 120 ? 180.443 163.091 2.955   1.00 11.67 ? 241  ALA A N     1 
ATOM   991  C  CA    . ALA A 1 120 ? 179.726 163.372 1.711   1.00 12.50 ? 241  ALA A CA    1 
ATOM   992  C  C     . ALA A 1 120 ? 178.367 164.004 1.979   1.00 14.45 ? 241  ALA A C     1 
ATOM   993  O  O     . ALA A 1 120 ? 177.923 164.878 1.222   1.00 14.36 ? 241  ALA A O     1 
ATOM   994  C  CB    . ALA A 1 120 ? 179.577 162.108 0.873   1.00 9.22  ? 241  ALA A CB    1 
ATOM   995  N  N     . ASN A 1 121 ? 177.714 163.562 3.053   1.00 14.82 ? 242  ASN A N     1 
ATOM   996  C  CA    . ASN A 1 121 ? 176.420 164.109 3.447   1.00 16.37 ? 242  ASN A CA    1 
ATOM   997  C  C     . ASN A 1 121 ? 176.623 165.540 3.918   1.00 16.87 ? 242  ASN A C     1 
ATOM   998  O  O     . ASN A 1 121 ? 175.804 166.429 3.636   1.00 13.50 ? 242  ASN A O     1 
ATOM   999  C  CB    . ASN A 1 121 ? 175.822 163.329 4.619   1.00 20.05 ? 242  ASN A CB    1 
ATOM   1000 C  CG    . ASN A 1 121 ? 175.213 162.005 4.210   1.00 22.16 ? 242  ASN A CG    1 
ATOM   1001 O  OD1   . ASN A 1 121 ? 175.027 161.133 5.055   1.00 23.63 ? 242  ASN A OD1   1 
ATOM   1002 N  ND2   . ASN A 1 121 ? 174.883 161.850 2.922   1.00 24.84 ? 242  ASN A ND2   1 
ATOM   1003 N  N     . ALA A 1 122 ? 177.713 165.747 4.656   1.00 13.07 ? 243  ALA A N     1 
ATOM   1004 C  CA    . ALA A 1 122 ? 178.019 167.065 5.190   1.00 13.28 ? 243  ALA A CA    1 
ATOM   1005 C  C     . ALA A 1 122 ? 178.292 168.063 4.072   1.00 14.76 ? 243  ALA A C     1 
ATOM   1006 O  O     . ALA A 1 122 ? 177.751 169.173 4.080   1.00 11.54 ? 243  ALA A O     1 
ATOM   1007 C  CB    . ALA A 1 122 ? 179.204 166.982 6.137   1.00 13.95 ? 243  ALA A CB    1 
ATOM   1008 N  N     . LEU A 1 123 ? 179.126 167.651 3.113   1.00 15.34 ? 244  LEU A N     1 
ATOM   1009 C  CA    . LEU A 1 123 ? 179.487 168.477 1.955   1.00 14.00 ? 244  LEU A CA    1 
ATOM   1010 C  C     . LEU A 1 123 ? 178.245 168.764 1.078   1.00 13.84 ? 244  LEU A C     1 
ATOM   1011 O  O     . LEU A 1 123 ? 178.079 169.862 0.545   1.00 9.94  ? 244  LEU A O     1 
ATOM   1012 C  CB    . LEU A 1 123 ? 180.572 167.766 1.134   1.00 12.82 ? 244  LEU A CB    1 
ATOM   1013 C  CG    . LEU A 1 123 ? 181.958 167.607 1.791   1.00 13.66 ? 244  LEU A CG    1 
ATOM   1014 C  CD1   . LEU A 1 123 ? 182.862 166.784 0.883   1.00 10.60 ? 244  LEU A CD1   1 
ATOM   1015 C  CD2   . LEU A 1 123 ? 182.570 168.990 2.068   1.00 10.59 ? 244  LEU A CD2   1 
ATOM   1016 N  N     . SER A 1 124 ? 177.363 167.776 0.949   1.00 11.65 ? 245  SER A N     1 
ATOM   1017 C  CA    . SER A 1 124 ? 176.162 167.951 0.149   1.00 12.45 ? 245  SER A CA    1 
ATOM   1018 C  C     . SER A 1 124 ? 175.284 169.090 0.716   1.00 12.58 ? 245  SER A C     1 
ATOM   1019 O  O     . SER A 1 124 ? 174.753 169.925 -0.028  1.00 13.38 ? 245  SER A O     1 
ATOM   1020 C  CB    . SER A 1 124 ? 175.403 166.623 0.101   1.00 11.63 ? 245  SER A CB    1 
ATOM   1021 O  OG    . SER A 1 124 ? 174.265 166.724 -0.729  1.00 18.58 ? 245  SER A OG    1 
ATOM   1022 N  N     . TYR A 1 125 ? 175.156 169.126 2.038   1.00 10.82 ? 246  TYR A N     1 
ATOM   1023 C  CA    . TYR A 1 125 ? 174.388 170.146 2.719   1.00 12.87 ? 246  TYR A CA    1 
ATOM   1024 C  C     . TYR A 1 125 ? 175.068 171.506 2.474   1.00 14.69 ? 246  TYR A C     1 
ATOM   1025 O  O     . TYR A 1 125 ? 174.399 172.522 2.263   1.00 16.54 ? 246  TYR A O     1 
ATOM   1026 C  CB    . TYR A 1 125 ? 174.337 169.838 4.232   1.00 10.92 ? 246  TYR A CB    1 
ATOM   1027 C  CG    . TYR A 1 125 ? 173.941 171.010 5.076   1.00 13.12 ? 246  TYR A CG    1 
ATOM   1028 C  CD1   . TYR A 1 125 ? 172.615 171.398 5.169   1.00 11.79 ? 246  TYR A CD1   1 
ATOM   1029 C  CD2   . TYR A 1 125 ? 174.905 171.782 5.727   1.00 14.34 ? 246  TYR A CD2   1 
ATOM   1030 C  CE1   . TYR A 1 125 ? 172.249 172.526 5.886   1.00 15.75 ? 246  TYR A CE1   1 
ATOM   1031 C  CE2   . TYR A 1 125 ? 174.548 172.925 6.452   1.00 17.65 ? 246  TYR A CE2   1 
ATOM   1032 C  CZ    . TYR A 1 125 ? 173.209 173.288 6.526   1.00 18.09 ? 246  TYR A CZ    1 
ATOM   1033 O  OH    . TYR A 1 125 ? 172.806 174.411 7.231   1.00 20.69 ? 246  TYR A OH    1 
ATOM   1034 N  N     . CYS A 1 126 ? 176.398 171.506 2.526   1.00 12.79 ? 247  CYS A N     1 
ATOM   1035 C  CA    . CYS A 1 126 ? 177.217 172.695 2.312   1.00 15.14 ? 247  CYS A CA    1 
ATOM   1036 C  C     . CYS A 1 126 ? 177.033 173.298 0.930   1.00 14.64 ? 247  CYS A C     1 
ATOM   1037 O  O     . CYS A 1 126 ? 176.944 174.517 0.765   1.00 13.32 ? 247  CYS A O     1 
ATOM   1038 C  CB    . CYS A 1 126 ? 178.697 172.339 2.453   1.00 18.30 ? 247  CYS A CB    1 
ATOM   1039 S  SG    . CYS A 1 126 ? 179.389 172.397 4.097   1.00 20.02 ? 247  CYS A SG    1 
ATOM   1040 N  N     . HIS A 1 127 ? 177.018 172.424 -0.063  1.00 12.96 ? 248  HIS A N     1 
ATOM   1041 C  CA    . HIS A 1 127 ? 176.867 172.853 -1.435  1.00 14.92 ? 248  HIS A CA    1 
ATOM   1042 C  C     . HIS A 1 127 ? 175.474 173.338 -1.717  1.00 16.00 ? 248  HIS A C     1 
ATOM   1043 O  O     . HIS A 1 127 ? 175.285 174.228 -2.538  1.00 16.44 ? 248  HIS A O     1 
ATOM   1044 C  CB    . HIS A 1 127 ? 177.246 171.711 -2.361  1.00 14.58 ? 248  HIS A CB    1 
ATOM   1045 C  CG    . HIS A 1 127 ? 178.698 171.388 -2.305  1.00 15.75 ? 248  HIS A CG    1 
ATOM   1046 N  ND1   . HIS A 1 127 ? 179.331 170.596 -3.236  1.00 18.18 ? 248  HIS A ND1   1 
ATOM   1047 C  CD2   . HIS A 1 127 ? 179.651 171.777 -1.427  1.00 14.69 ? 248  HIS A CD2   1 
ATOM   1048 C  CE1   . HIS A 1 127 ? 180.614 170.512 -2.934  1.00 15.22 ? 248  HIS A CE1   1 
ATOM   1049 N  NE2   . HIS A 1 127 ? 180.832 171.220 -1.840  1.00 14.77 ? 248  HIS A NE2   1 
ATOM   1050 N  N     . SER A 1 128 ? 174.503 172.744 -1.028  1.00 14.49 ? 249  SER A N     1 
ATOM   1051 C  CA    . SER A 1 128 ? 173.125 173.148 -1.197  1.00 15.32 ? 249  SER A CA    1 
ATOM   1052 C  C     . SER A 1 128 ? 173.055 174.597 -0.696  1.00 16.09 ? 249  SER A C     1 
ATOM   1053 O  O     . SER A 1 128 ? 172.139 175.350 -1.034  1.00 18.04 ? 249  SER A O     1 
ATOM   1054 C  CB    . SER A 1 128 ? 172.201 172.233 -0.392  1.00 11.40 ? 249  SER A CB    1 
ATOM   1055 O  OG    . SER A 1 128 ? 172.281 172.527 0.985   1.00 16.48 ? 249  SER A OG    1 
ATOM   1056 N  N     . LYS A 1 129 ? 174.031 174.988 0.118   1.00 15.99 ? 250  LYS A N     1 
ATOM   1057 C  CA    . LYS A 1 129 ? 174.072 176.363 0.599   1.00 15.13 ? 250  LYS A CA    1 
ATOM   1058 C  C     . LYS A 1 129 ? 175.106 177.133 -0.210  1.00 11.97 ? 250  LYS A C     1 
ATOM   1059 O  O     . LYS A 1 129 ? 175.375 178.286 0.057   1.00 14.99 ? 250  LYS A O     1 
ATOM   1060 C  CB    . LYS A 1 129 ? 174.405 176.441 2.107   1.00 13.57 ? 250  LYS A CB    1 
ATOM   1061 C  CG    . LYS A 1 129 ? 173.350 175.850 3.040   1.00 15.19 ? 250  LYS A CG    1 
ATOM   1062 C  CD    . LYS A 1 129 ? 171.930 176.203 2.629   1.00 19.05 ? 250  LYS A CD    1 
ATOM   1063 C  CE    . LYS A 1 129 ? 170.943 175.150 3.131   1.00 24.43 ? 250  LYS A CE    1 
ATOM   1064 N  NZ    . LYS A 1 129 ? 169.492 175.372 2.776   1.00 28.76 ? 250  LYS A NZ    1 
ATOM   1065 N  N     . ARG A 1 130 ? 175.686 176.478 -1.208  1.00 14.14 ? 251  ARG A N     1 
ATOM   1066 C  CA    . ARG A 1 130 ? 176.690 177.099 -2.079  1.00 13.45 ? 251  ARG A CA    1 
ATOM   1067 C  C     . ARG A 1 130 ? 177.974 177.493 -1.362  1.00 12.30 ? 251  ARG A C     1 
ATOM   1068 O  O     . ARG A 1 130 ? 178.618 178.472 -1.703  1.00 12.69 ? 251  ARG A O     1 
ATOM   1069 C  CB    . ARG A 1 130 ? 176.080 178.305 -2.792  1.00 14.05 ? 251  ARG A CB    1 
ATOM   1070 C  CG    . ARG A 1 130 ? 174.976 177.936 -3.779  1.00 21.06 ? 251  ARG A CG    1 
ATOM   1071 C  CD    . ARG A 1 130 ? 175.441 178.112 -5.227  1.00 27.95 ? 251  ARG A CD    1 
ATOM   1072 N  NE    . ARG A 1 130 ? 175.547 176.844 -5.943  1.00 31.22 ? 251  ARG A NE    1 
ATOM   1073 C  CZ    . ARG A 1 130 ? 176.391 176.615 -6.949  1.00 31.35 ? 251  ARG A CZ    1 
ATOM   1074 N  NH1   . ARG A 1 130 ? 177.214 177.570 -7.368  1.00 28.63 ? 251  ARG A NH1   1 
ATOM   1075 N  NH2   . ARG A 1 130 ? 176.427 175.422 -7.526  1.00 31.96 ? 251  ARG A NH2   1 
ATOM   1076 N  N     . VAL A 1 131 ? 178.344 176.714 -0.363  1.00 11.12 ? 252  VAL A N     1 
ATOM   1077 C  CA    . VAL A 1 131 ? 179.569 176.971 0.368   1.00 12.45 ? 252  VAL A CA    1 
ATOM   1078 C  C     . VAL A 1 131 ? 180.604 175.940 -0.083  1.00 15.27 ? 252  VAL A C     1 
ATOM   1079 O  O     . VAL A 1 131 ? 180.267 174.774 -0.265  1.00 12.78 ? 252  VAL A O     1 
ATOM   1080 C  CB    . VAL A 1 131 ? 179.338 176.810 1.885   1.00 12.23 ? 252  VAL A CB    1 
ATOM   1081 C  CG1   . VAL A 1 131 ? 180.651 176.509 2.587   1.00 9.08  ? 252  VAL A CG1   1 
ATOM   1082 C  CG2   . VAL A 1 131 ? 178.681 178.059 2.446   1.00 10.54 ? 252  VAL A CG2   1 
ATOM   1083 N  N     . ILE A 1 132 ? 181.840 176.373 -0.326  1.00 13.72 ? 253  ILE A N     1 
ATOM   1084 C  CA    . ILE A 1 132 ? 182.872 175.419 -0.680  1.00 10.89 ? 253  ILE A CA    1 
ATOM   1085 C  C     . ILE A 1 132 ? 183.831 175.453 0.498   1.00 13.01 ? 253  ILE A C     1 
ATOM   1086 O  O     . ILE A 1 132 ? 184.347 176.524 0.849   1.00 13.11 ? 253  ILE A O     1 
ATOM   1087 C  CB    . ILE A 1 132 ? 183.670 175.788 -1.957  1.00 11.67 ? 253  ILE A CB    1 
ATOM   1088 C  CG1   . ILE A 1 132 ? 182.733 176.323 -3.059  1.00 10.28 ? 253  ILE A CG1   1 
ATOM   1089 C  CG2   . ILE A 1 132 ? 184.426 174.535 -2.441  1.00 5.83  ? 253  ILE A CG2   1 
ATOM   1090 C  CD1   . ILE A 1 132 ? 183.439 176.812 -4.329  1.00 3.57  ? 253  ILE A CD1   1 
ATOM   1091 N  N     . HIS A 1 133 ? 184.050 174.288 1.113   1.00 13.19 ? 254  HIS A N     1 
ATOM   1092 C  CA    . HIS A 1 133 ? 184.943 174.161 2.259   1.00 12.95 ? 254  HIS A CA    1 
ATOM   1093 C  C     . HIS A 1 133 ? 186.383 174.507 1.889   1.00 13.04 ? 254  HIS A C     1 
ATOM   1094 O  O     . HIS A 1 133 ? 186.971 175.438 2.447   1.00 14.41 ? 254  HIS A O     1 
ATOM   1095 C  CB    . HIS A 1 133 ? 184.868 172.745 2.843   1.00 12.70 ? 254  HIS A CB    1 
ATOM   1096 C  CG    . HIS A 1 133 ? 185.587 172.606 4.160   1.00 12.92 ? 254  HIS A CG    1 
ATOM   1097 N  ND1   . HIS A 1 133 ? 186.898 172.180 4.257   1.00 13.73 ? 254  HIS A ND1   1 
ATOM   1098 C  CD2   . HIS A 1 133 ? 185.206 172.914 5.423   1.00 9.91  ? 254  HIS A CD2   1 
ATOM   1099 C  CE1   . HIS A 1 133 ? 187.290 172.229 5.515   1.00 10.14 ? 254  HIS A CE1   1 
ATOM   1100 N  NE2   . HIS A 1 133 ? 186.282 172.671 6.243   1.00 11.29 ? 254  HIS A NE2   1 
ATOM   1101 N  N     . ARG A 1 134 ? 186.935 173.743 0.953   1.00 12.07 ? 255  ARG A N     1 
ATOM   1102 C  CA    . ARG A 1 134 ? 188.291 173.910 0.438   1.00 12.35 ? 255  ARG A CA    1 
ATOM   1103 C  C     . ARG A 1 134 ? 189.479 173.491 1.328   1.00 14.82 ? 255  ARG A C     1 
ATOM   1104 O  O     . ARG A 1 134 ? 190.628 173.656 0.914   1.00 16.45 ? 255  ARG A O     1 
ATOM   1105 C  CB    . ARG A 1 134 ? 188.494 175.341 -0.050  1.00 13.05 ? 255  ARG A CB    1 
ATOM   1106 C  CG    . ARG A 1 134 ? 187.553 175.664 -1.200  1.00 15.96 ? 255  ARG A CG    1 
ATOM   1107 C  CD    . ARG A 1 134 ? 187.942 176.885 -1.997  1.00 11.42 ? 255  ARG A CD    1 
ATOM   1108 N  NE    . ARG A 1 134 ? 188.045 178.075 -1.183  1.00 13.42 ? 255  ARG A NE    1 
ATOM   1109 C  CZ    . ARG A 1 134 ? 188.194 179.295 -1.690  1.00 17.97 ? 255  ARG A CZ    1 
ATOM   1110 N  NH1   . ARG A 1 134 ? 188.248 179.453 -3.012  1.00 12.59 ? 255  ARG A NH1   1 
ATOM   1111 N  NH2   . ARG A 1 134 ? 188.308 180.348 -0.880  1.00 11.08 ? 255  ARG A NH2   1 
ATOM   1112 N  N     . ASP A 1 135 ? 189.237 172.959 2.528   1.00 13.90 ? 256  ASP A N     1 
ATOM   1113 C  CA    . ASP A 1 135 ? 190.355 172.522 3.364   1.00 14.13 ? 256  ASP A CA    1 
ATOM   1114 C  C     . ASP A 1 135 ? 190.021 171.231 4.094   1.00 14.83 ? 256  ASP A C     1 
ATOM   1115 O  O     . ASP A 1 135 ? 190.209 171.088 5.300   1.00 17.90 ? 256  ASP A O     1 
ATOM   1116 C  CB    . ASP A 1 135 ? 190.779 173.631 4.341   1.00 15.61 ? 256  ASP A CB    1 
ATOM   1117 C  CG    . ASP A 1 135 ? 192.185 173.408 4.930   1.00 17.71 ? 256  ASP A CG    1 
ATOM   1118 O  OD1   . ASP A 1 135 ? 193.119 172.950 4.217   1.00 18.23 ? 256  ASP A OD1   1 
ATOM   1119 O  OD2   . ASP A 1 135 ? 192.364 173.712 6.130   1.00 20.01 ? 256  ASP A OD2   1 
ATOM   1120 N  N     . ILE A 1 136 ? 189.522 170.285 3.321   1.00 14.83 ? 257  ILE A N     1 
ATOM   1121 C  CA    . ILE A 1 136 ? 189.170 168.978 3.809   1.00 15.89 ? 257  ILE A CA    1 
ATOM   1122 C  C     . ILE A 1 136 ? 190.461 168.170 3.888   1.00 16.84 ? 257  ILE A C     1 
ATOM   1123 O  O     . ILE A 1 136 ? 191.180 168.019 2.890   1.00 19.23 ? 257  ILE A O     1 
ATOM   1124 C  CB    . ILE A 1 136 ? 188.209 168.318 2.821   1.00 16.68 ? 257  ILE A CB    1 
ATOM   1125 C  CG1   . ILE A 1 136 ? 186.851 169.010 2.909   1.00 19.11 ? 257  ILE A CG1   1 
ATOM   1126 C  CG2   . ILE A 1 136 ? 188.096 166.834 3.106   1.00 18.21 ? 257  ILE A CG2   1 
ATOM   1127 C  CD1   . ILE A 1 136 ? 185.939 168.636 1.771   1.00 26.98 ? 257  ILE A CD1   1 
ATOM   1128 N  N     . LYS A 1 137 ? 190.759 167.673 5.079   1.00 14.42 ? 258  LYS A N     1 
ATOM   1129 C  CA    . LYS A 1 137 ? 191.948 166.861 5.321   1.00 13.61 ? 258  LYS A CA    1 
ATOM   1130 C  C     . LYS A 1 137 ? 191.828 166.275 6.728   1.00 12.82 ? 258  LYS A C     1 
ATOM   1131 O  O     . LYS A 1 137 ? 191.093 166.807 7.565   1.00 12.94 ? 258  LYS A O     1 
ATOM   1132 C  CB    . LYS A 1 137 ? 193.218 167.696 5.165   1.00 11.12 ? 258  LYS A CB    1 
ATOM   1133 C  CG    . LYS A 1 137 ? 193.288 168.912 6.021   1.00 10.35 ? 258  LYS A CG    1 
ATOM   1134 C  CD    . LYS A 1 137 ? 194.685 169.397 5.941   1.00 11.98 ? 258  LYS A CD    1 
ATOM   1135 C  CE    . LYS A 1 137 ? 194.946 170.539 6.844   1.00 10.31 ? 258  LYS A CE    1 
ATOM   1136 N  NZ    . LYS A 1 137 ? 196.316 171.028 6.523   1.00 13.12 ? 258  LYS A NZ    1 
ATOM   1137 N  N     . PRO A 1 138 ? 192.547 165.180 7.011   1.00 13.48 ? 259  PRO A N     1 
ATOM   1138 C  CA    . PRO A 1 138 ? 192.487 164.525 8.329   1.00 14.07 ? 259  PRO A CA    1 
ATOM   1139 C  C     . PRO A 1 138 ? 192.527 165.413 9.583   1.00 15.36 ? 259  PRO A C     1 
ATOM   1140 O  O     . PRO A 1 138 ? 191.773 165.171 10.520  1.00 15.88 ? 259  PRO A O     1 
ATOM   1141 C  CB    . PRO A 1 138 ? 193.641 163.517 8.267   1.00 14.89 ? 259  PRO A CB    1 
ATOM   1142 C  CG    . PRO A 1 138 ? 193.714 163.197 6.778   1.00 14.98 ? 259  PRO A CG    1 
ATOM   1143 C  CD    . PRO A 1 138 ? 193.607 164.582 6.181   1.00 11.93 ? 259  PRO A CD    1 
ATOM   1144 N  N     . GLU A 1 139 ? 193.388 166.428 9.593   1.00 15.22 ? 260  GLU A N     1 
ATOM   1145 C  CA    . GLU A 1 139 ? 193.516 167.340 10.734  1.00 19.96 ? 260  GLU A CA    1 
ATOM   1146 C  C     . GLU A 1 139 ? 192.280 168.252 10.924  1.00 18.80 ? 260  GLU A C     1 
ATOM   1147 O  O     . GLU A 1 139 ? 192.140 168.905 11.957  1.00 18.71 ? 260  GLU A O     1 
ATOM   1148 C  CB    . GLU A 1 139 ? 194.770 168.225 10.563  1.00 22.41 ? 260  GLU A CB    1 
ATOM   1149 C  CG    . GLU A 1 139 ? 196.090 167.457 10.516  1.00 29.11 ? 260  GLU A CG    1 
ATOM   1150 C  CD    . GLU A 1 139 ? 196.610 167.140 9.092   1.00 32.88 ? 260  GLU A CD    1 
ATOM   1151 O  OE1   . GLU A 1 139 ? 195.826 166.656 8.235   1.00 33.12 ? 260  GLU A OE1   1 
ATOM   1152 O  OE2   . GLU A 1 139 ? 197.823 167.360 8.841   1.00 35.49 ? 260  GLU A OE2   1 
ATOM   1153 N  N     . ASN A 1 140 ? 191.401 168.309 9.922   1.00 16.14 ? 261  ASN A N     1 
ATOM   1154 C  CA    . ASN A 1 140 ? 190.206 169.139 10.014  1.00 14.12 ? 261  ASN A CA    1 
ATOM   1155 C  C     . ASN A 1 140 ? 188.944 168.329 10.159  1.00 14.87 ? 261  ASN A C     1 
ATOM   1156 O  O     . ASN A 1 140 ? 187.844 168.855 10.027  1.00 14.12 ? 261  ASN A O     1 
ATOM   1157 C  CB    . ASN A 1 140 ? 190.084 170.036 8.799   1.00 12.74 ? 261  ASN A CB    1 
ATOM   1158 C  CG    . ASN A 1 140 ? 191.068 171.176 8.824   1.00 12.37 ? 261  ASN A CG    1 
ATOM   1159 O  OD1   . ASN A 1 140 ? 191.719 171.446 9.840   1.00 11.65 ? 261  ASN A OD1   1 
ATOM   1160 N  ND2   . ASN A 1 140 ? 191.178 171.868 7.705   1.00 11.18 ? 261  ASN A ND2   1 
ATOM   1161 N  N     . LEU A 1 141 ? 189.117 167.037 10.428  1.00 16.20 ? 262  LEU A N     1 
ATOM   1162 C  CA    . LEU A 1 141 ? 187.996 166.127 10.596  1.00 13.58 ? 262  LEU A CA    1 
ATOM   1163 C  C     . LEU A 1 141 ? 188.027 165.633 12.031  1.00 15.43 ? 262  LEU A C     1 
ATOM   1164 O  O     . LEU A 1 141 ? 188.999 165.008 12.459  1.00 17.59 ? 262  LEU A O     1 
ATOM   1165 C  CB    . LEU A 1 141 ? 188.128 164.954 9.627   1.00 13.22 ? 262  LEU A CB    1 
ATOM   1166 C  CG    . LEU A 1 141 ? 188.164 165.406 8.162   1.00 15.01 ? 262  LEU A CG    1 
ATOM   1167 C  CD1   . LEU A 1 141 ? 188.502 164.230 7.232   1.00 8.10  ? 262  LEU A CD1   1 
ATOM   1168 C  CD2   . LEU A 1 141 ? 186.807 166.049 7.834   1.00 10.56 ? 262  LEU A CD2   1 
ATOM   1169 N  N     . LEU A 1 142 ? 186.968 165.915 12.777  1.00 11.89 ? 263  LEU A N     1 
ATOM   1170 C  CA    . LEU A 1 142 ? 186.926 165.505 14.154  1.00 10.46 ? 263  LEU A CA    1 
ATOM   1171 C  C     . LEU A 1 142 ? 185.905 164.407 14.409  1.00 12.75 ? 263  LEU A C     1 
ATOM   1172 O  O     . LEU A 1 142 ? 185.068 164.112 13.553  1.00 13.83 ? 263  LEU A O     1 
ATOM   1173 C  CB    . LEU A 1 142 ? 186.657 166.725 15.005  1.00 13.46 ? 263  LEU A CB    1 
ATOM   1174 C  CG    . LEU A 1 142 ? 187.584 167.921 14.699  1.00 14.28 ? 263  LEU A CG    1 
ATOM   1175 C  CD1   . LEU A 1 142 ? 187.208 169.055 15.634  1.00 15.02 ? 263  LEU A CD1   1 
ATOM   1176 C  CD2   . LEU A 1 142 ? 189.050 167.563 14.865  1.00 12.28 ? 263  LEU A CD2   1 
ATOM   1177 N  N     . LEU A 1 143 ? 185.989 163.780 15.576  1.00 13.44 ? 264  LEU A N     1 
ATOM   1178 C  CA    . LEU A 1 143 ? 185.076 162.693 15.919  1.00 15.08 ? 264  LEU A CA    1 
ATOM   1179 C  C     . LEU A 1 143 ? 184.190 163.103 17.078  1.00 14.83 ? 264  LEU A C     1 
ATOM   1180 O  O     . LEU A 1 143 ? 184.669 163.613 18.096  1.00 13.07 ? 264  LEU A O     1 
ATOM   1181 C  CB    . LEU A 1 143 ? 185.856 161.421 16.298  1.00 15.27 ? 264  LEU A CB    1 
ATOM   1182 C  CG    . LEU A 1 143 ? 186.808 160.821 15.263  1.00 16.94 ? 264  LEU A CG    1 
ATOM   1183 C  CD1   . LEU A 1 143 ? 187.393 159.499 15.783  1.00 20.04 ? 264  LEU A CD1   1 
ATOM   1184 C  CD2   . LEU A 1 143 ? 186.043 160.590 13.944  1.00 16.69 ? 264  LEU A CD2   1 
ATOM   1185 N  N     . GLY A 1 144 ? 182.890 162.881 16.907  1.00 14.85 ? 265  GLY A N     1 
ATOM   1186 C  CA    . GLY A 1 144 ? 181.943 163.218 17.947  1.00 15.69 ? 265  GLY A CA    1 
ATOM   1187 C  C     . GLY A 1 144 ? 181.844 162.127 18.999  1.00 17.48 ? 265  GLY A C     1 
ATOM   1188 O  O     . GLY A 1 144 ? 182.597 161.144 18.989  1.00 19.40 ? 265  GLY A O     1 
ATOM   1189 N  N     . SER A 1 145 ? 180.888 162.306 19.899  1.00 17.64 ? 266  SER A N     1 
ATOM   1190 C  CA    . SER A 1 145 ? 180.641 161.398 21.007  1.00 18.83 ? 266  SER A CA    1 
ATOM   1191 C  C     . SER A 1 145 ? 180.457 159.923 20.615  1.00 16.59 ? 266  SER A C     1 
ATOM   1192 O  O     . SER A 1 145 ? 180.771 159.025 21.389  1.00 16.64 ? 266  SER A O     1 
ATOM   1193 C  CB    . SER A 1 145 ? 179.417 161.895 21.766  1.00 17.49 ? 266  SER A CB    1 
ATOM   1194 O  OG    . SER A 1 145 ? 179.347 161.294 23.037  1.00 31.06 ? 266  SER A OG    1 
ATOM   1195 N  N     . ALA A 1 146 ? 179.960 159.675 19.412  1.00 15.97 ? 267  ALA A N     1 
ATOM   1196 C  CA    . ALA A 1 146 ? 179.731 158.314 18.939  1.00 17.67 ? 267  ALA A CA    1 
ATOM   1197 C  C     . ALA A 1 146 ? 180.670 157.930 17.815  1.00 18.92 ? 267  ALA A C     1 
ATOM   1198 O  O     . ALA A 1 146 ? 180.353 157.040 17.025  1.00 21.00 ? 267  ALA A O     1 
ATOM   1199 C  CB    . ALA A 1 146 ? 178.288 158.163 18.456  1.00 14.65 ? 267  ALA A CB    1 
ATOM   1200 N  N     . GLY A 1 147 ? 181.812 158.604 17.716  1.00 21.24 ? 268  GLY A N     1 
ATOM   1201 C  CA    . GLY A 1 147 ? 182.741 158.278 16.648  1.00 22.38 ? 268  GLY A CA    1 
ATOM   1202 C  C     . GLY A 1 147 ? 182.289 158.773 15.282  1.00 21.15 ? 268  GLY A C     1 
ATOM   1203 O  O     . GLY A 1 147 ? 182.809 158.323 14.266  1.00 20.78 ? 268  GLY A O     1 
ATOM   1204 N  N     . GLU A 1 148 ? 181.324 159.690 15.249  1.00 19.71 ? 269  GLU A N     1 
ATOM   1205 C  CA    . GLU A 1 148 ? 180.831 160.239 13.983  1.00 18.83 ? 269  GLU A CA    1 
ATOM   1206 C  C     . GLU A 1 148 ? 181.702 161.409 13.549  1.00 17.27 ? 269  GLU A C     1 
ATOM   1207 O  O     . GLU A 1 148 ? 182.088 162.249 14.368  1.00 15.38 ? 269  GLU A O     1 
ATOM   1208 C  CB    . GLU A 1 148 ? 179.386 160.746 14.107  1.00 20.11 ? 269  GLU A CB    1 
ATOM   1209 C  CG    . GLU A 1 148 ? 179.239 162.020 14.944  1.00 27.28 ? 269  GLU A CG    1 
ATOM   1210 C  CD    . GLU A 1 148 ? 178.874 161.722 16.385  1.00 29.04 ? 269  GLU A CD    1 
ATOM   1211 O  OE1   . GLU A 1 148 ? 179.762 161.324 17.177  1.00 30.97 ? 269  GLU A OE1   1 
ATOM   1212 O  OE2   . GLU A 1 148 ? 177.677 161.868 16.711  1.00 33.63 ? 269  GLU A OE2   1 
ATOM   1213 N  N     . LEU A 1 149 ? 181.994 161.461 12.253  1.00 14.97 ? 270  LEU A N     1 
ATOM   1214 C  CA    . LEU A 1 149 ? 182.822 162.515 11.689  1.00 15.39 ? 270  LEU A CA    1 
ATOM   1215 C  C     . LEU A 1 149 ? 182.129 163.876 11.722  1.00 13.13 ? 270  LEU A C     1 
ATOM   1216 O  O     . LEU A 1 149 ? 180.932 163.973 11.490  1.00 12.45 ? 270  LEU A O     1 
ATOM   1217 C  CB    . LEU A 1 149 ? 183.169 162.167 10.229  1.00 21.78 ? 270  LEU A CB    1 
ATOM   1218 C  CG    . LEU A 1 149 ? 184.100 163.071 9.408   1.00 22.18 ? 270  LEU A CG    1 
ATOM   1219 C  CD1   . LEU A 1 149 ? 185.484 162.839 9.938   1.00 26.73 ? 270  LEU A CD1   1 
ATOM   1220 C  CD2   . LEU A 1 149 ? 184.109 162.725 7.944   1.00 27.39 ? 270  LEU A CD2   1 
ATOM   1221 N  N     . LYS A 1 150 ? 182.895 164.918 12.027  1.00 13.69 ? 271  LYS A N     1 
ATOM   1222 C  CA    . LYS A 1 150 ? 182.395 166.296 12.025  1.00 13.80 ? 271  LYS A CA    1 
ATOM   1223 C  C     . LYS A 1 150 ? 183.392 167.151 11.270  1.00 15.22 ? 271  LYS A C     1 
ATOM   1224 O  O     . LYS A 1 150 ? 184.586 167.152 11.582  1.00 16.95 ? 271  LYS A O     1 
ATOM   1225 C  CB    . LYS A 1 150 ? 182.201 166.814 13.450  1.00 13.22 ? 271  LYS A CB    1 
ATOM   1226 C  CG    . LYS A 1 150 ? 180.846 166.378 14.025  1.00 16.86 ? 271  LYS A CG    1 
ATOM   1227 C  CD    . LYS A 1 150 ? 180.790 166.428 15.509  1.00 17.04 ? 271  LYS A CD    1 
ATOM   1228 C  CE    . LYS A 1 150 ? 179.494 165.823 15.967  1.00 15.79 ? 271  LYS A CE    1 
ATOM   1229 N  NZ    . LYS A 1 150 ? 178.379 166.692 15.545  1.00 20.81 ? 271  LYS A NZ    1 
ATOM   1230 N  N     . ILE A 1 151 ? 182.919 167.842 10.238  1.00 15.55 ? 272  ILE A N     1 
ATOM   1231 C  CA    . ILE A 1 151 ? 183.803 168.702 9.462   1.00 15.61 ? 272  ILE A CA    1 
ATOM   1232 C  C     . ILE A 1 151 ? 184.051 169.926 10.303  1.00 13.27 ? 272  ILE A C     1 
ATOM   1233 O  O     . ILE A 1 151 ? 183.136 170.422 10.945  1.00 12.04 ? 272  ILE A O     1 
ATOM   1234 C  CB    . ILE A 1 151 ? 183.143 169.220 8.163   1.00 19.61 ? 272  ILE A CB    1 
ATOM   1235 C  CG1   . ILE A 1 151 ? 182.850 168.069 7.203   1.00 22.81 ? 272  ILE A CG1   1 
ATOM   1236 C  CG2   . ILE A 1 151 ? 184.054 170.269 7.530   1.00 18.20 ? 272  ILE A CG2   1 
ATOM   1237 C  CD1   . ILE A 1 151 ? 182.068 168.504 5.967   1.00 25.62 ? 272  ILE A CD1   1 
ATOM   1238 N  N     . ALA A 1 152 ? 185.270 170.428 10.294  1.00 11.17 ? 273  ALA A N     1 
ATOM   1239 C  CA    . ALA A 1 152 ? 185.568 171.623 11.069  1.00 13.73 ? 273  ALA A CA    1 
ATOM   1240 C  C     . ALA A 1 152 ? 186.472 172.498 10.225  1.00 16.38 ? 273  ALA A C     1 
ATOM   1241 O  O     . ALA A 1 152 ? 186.688 172.208 9.047   1.00 16.96 ? 273  ALA A O     1 
ATOM   1242 C  CB    . ALA A 1 152 ? 186.266 171.248 12.376  1.00 10.14 ? 273  ALA A CB    1 
ATOM   1243 N  N     . ASP A 1 153 ? 186.986 173.568 10.834  1.00 17.04 ? 274  ASP A N     1 
ATOM   1244 C  CA    . ASP A 1 153 ? 187.913 174.500 10.200  1.00 15.18 ? 274  ASP A CA    1 
ATOM   1245 C  C     . ASP A 1 153 ? 187.434 175.064 8.838   1.00 16.14 ? 274  ASP A C     1 
ATOM   1246 O  O     . ASP A 1 153 ? 187.846 174.604 7.776   1.00 12.68 ? 274  ASP A O     1 
ATOM   1247 C  CB    . ASP A 1 153 ? 189.288 173.805 10.074  1.00 17.02 ? 274  ASP A CB    1 
ATOM   1248 C  CG    . ASP A 1 153 ? 190.447 174.786 9.800   1.00 19.27 ? 274  ASP A CG    1 
ATOM   1249 O  OD1   . ASP A 1 153 ? 190.190 175.999 9.635   1.00 22.45 ? 274  ASP A OD1   1 
ATOM   1250 O  OD2   . ASP A 1 153 ? 191.624 174.338 9.753   1.00 17.87 ? 274  ASP A OD2   1 
ATOM   1251 N  N     . PHE A 1 154 ? 186.559 176.065 8.881   1.00 15.86 ? 275  PHE A N     1 
ATOM   1252 C  CA    . PHE A 1 154 ? 186.074 176.688 7.666   1.00 14.12 ? 275  PHE A CA    1 
ATOM   1253 C  C     . PHE A 1 154 ? 186.966 177.868 7.289   1.00 15.87 ? 275  PHE A C     1 
ATOM   1254 O  O     . PHE A 1 154 ? 186.541 178.780 6.568   1.00 15.07 ? 275  PHE A O     1 
ATOM   1255 C  CB    . PHE A 1 154 ? 184.602 177.108 7.835   1.00 13.16 ? 275  PHE A CB    1 
ATOM   1256 C  CG    . PHE A 1 154 ? 183.640 175.948 7.721   1.00 12.72 ? 275  PHE A CG    1 
ATOM   1257 C  CD1   . PHE A 1 154 ? 183.540 174.994 8.746   1.00 11.42 ? 275  PHE A CD1   1 
ATOM   1258 C  CD2   . PHE A 1 154 ? 182.936 175.727 6.535   1.00 11.44 ? 275  PHE A CD2   1 
ATOM   1259 C  CE1   . PHE A 1 154 ? 182.768 173.843 8.581   1.00 10.04 ? 275  PHE A CE1   1 
ATOM   1260 C  CE2   . PHE A 1 154 ? 182.157 174.568 6.367   1.00 12.57 ? 275  PHE A CE2   1 
ATOM   1261 C  CZ    . PHE A 1 154 ? 182.079 173.631 7.396   1.00 11.15 ? 275  PHE A CZ    1 
ATOM   1262 N  N     . GLY A 1 155 ? 188.221 177.820 7.751   1.00 15.09 ? 276  GLY A N     1 
ATOM   1263 C  CA    . GLY A 1 155 ? 189.184 178.875 7.452   1.00 17.20 ? 276  GLY A CA    1 
ATOM   1264 C  C     . GLY A 1 155 ? 189.322 179.285 5.983   1.00 16.44 ? 276  GLY A C     1 
ATOM   1265 O  O     . GLY A 1 155 ? 189.368 180.482 5.665   1.00 17.13 ? 276  GLY A O     1 
ATOM   1266 N  N     . TRP A 1 156 ? 189.378 178.307 5.082   1.00 13.73 ? 277  TRP A N     1 
ATOM   1267 C  CA    . TRP A 1 156 ? 189.514 178.596 3.664   1.00 14.40 ? 277  TRP A CA    1 
ATOM   1268 C  C     . TRP A 1 156 ? 188.202 178.467 2.888   1.00 13.46 ? 277  TRP A C     1 
ATOM   1269 O  O     . TRP A 1 156 ? 188.190 178.362 1.664   1.00 14.44 ? 277  TRP A O     1 
ATOM   1270 C  CB    . TRP A 1 156 ? 190.568 177.667 3.071   1.00 20.13 ? 277  TRP A CB    1 
ATOM   1271 C  CG    . TRP A 1 156 ? 191.860 177.753 3.789   1.00 22.40 ? 277  TRP A CG    1 
ATOM   1272 C  CD1   . TRP A 1 156 ? 192.463 176.777 4.517   1.00 23.25 ? 277  TRP A CD1   1 
ATOM   1273 C  CD2   . TRP A 1 156 ? 192.691 178.904 3.893   1.00 23.73 ? 277  TRP A CD2   1 
ATOM   1274 N  NE1   . TRP A 1 156 ? 193.625 177.250 5.074   1.00 24.53 ? 277  TRP A NE1   1 
ATOM   1275 C  CE2   . TRP A 1 156 ? 193.788 178.558 4.701   1.00 26.05 ? 277  TRP A CE2   1 
ATOM   1276 C  CE3   . TRP A 1 156 ? 192.617 180.198 3.375   1.00 25.94 ? 277  TRP A CE3   1 
ATOM   1277 C  CZ2   . TRP A 1 156 ? 194.806 179.467 5.015   1.00 27.86 ? 277  TRP A CZ2   1 
ATOM   1278 C  CZ3   . TRP A 1 156 ? 193.631 181.106 3.686   1.00 28.74 ? 277  TRP A CZ3   1 
ATOM   1279 C  CH2   . TRP A 1 156 ? 194.711 180.733 4.496   1.00 26.68 ? 277  TRP A CH2   1 
ATOM   1280 N  N     . SER A 1 157 ? 187.097 178.481 3.605   1.00 14.67 ? 278  SER A N     1 
ATOM   1281 C  CA    . SER A 1 157 ? 185.809 178.360 2.973   1.00 16.81 ? 278  SER A CA    1 
ATOM   1282 C  C     . SER A 1 157 ? 185.338 179.620 2.269   1.00 15.59 ? 278  SER A C     1 
ATOM   1283 O  O     . SER A 1 157 ? 185.887 180.700 2.456   1.00 13.40 ? 278  SER A O     1 
ATOM   1284 C  CB    . SER A 1 157 ? 184.785 177.937 4.009   1.00 18.65 ? 278  SER A CB    1 
ATOM   1285 O  OG    . SER A 1 157 ? 185.042 176.588 4.334   1.00 31.56 ? 278  SER A OG    1 
ATOM   1286 N  N     . VAL A 1 158 ? 184.330 179.468 1.427   1.00 12.47 ? 279  VAL A N     1 
ATOM   1287 C  CA    . VAL A 1 158 ? 183.790 180.622 0.750   1.00 15.04 ? 279  VAL A CA    1 
ATOM   1288 C  C     . VAL A 1 158 ? 182.347 180.399 0.352   1.00 15.66 ? 279  VAL A C     1 
ATOM   1289 O  O     . VAL A 1 158 ? 181.902 179.259 0.162   1.00 16.74 ? 279  VAL A O     1 
ATOM   1290 C  CB    . VAL A 1 158 ? 184.631 181.010 -0.524  1.00 14.76 ? 279  VAL A CB    1 
ATOM   1291 C  CG1   . VAL A 1 158 ? 184.436 179.985 -1.646  1.00 10.49 ? 279  VAL A CG1   1 
ATOM   1292 C  CG2   . VAL A 1 158 ? 184.256 182.419 -0.971  1.00 9.51  ? 279  VAL A CG2   1 
ATOM   1293 N  N     . HIS A 1 159 ? 181.604 181.491 0.276   1.00 14.84 ? 280  HIS A N     1 
ATOM   1294 C  CA    . HIS A 1 159 ? 180.224 181.389 -0.133  1.00 17.48 ? 280  HIS A CA    1 
ATOM   1295 C  C     . HIS A 1 159 ? 180.236 181.772 -1.622  1.00 17.74 ? 280  HIS A C     1 
ATOM   1296 O  O     . HIS A 1 159 ? 180.439 182.942 -1.989  1.00 16.22 ? 280  HIS A O     1 
ATOM   1297 C  CB    . HIS A 1 159 ? 179.332 182.330 0.694   1.00 14.36 ? 280  HIS A CB    1 
ATOM   1298 C  CG    . HIS A 1 159 ? 177.885 182.230 0.336   1.00 16.95 ? 280  HIS A CG    1 
ATOM   1299 N  ND1   . HIS A 1 159 ? 177.045 183.323 0.300   1.00 15.76 ? 280  HIS A ND1   1 
ATOM   1300 C  CD2   . HIS A 1 159 ? 177.154 181.176 -0.102  1.00 16.10 ? 280  HIS A CD2   1 
ATOM   1301 C  CE1   . HIS A 1 159 ? 175.864 182.946 -0.154  1.00 17.22 ? 280  HIS A CE1   1 
ATOM   1302 N  NE2   . HIS A 1 159 ? 175.903 181.648 -0.407  1.00 18.56 ? 280  HIS A NE2   1 
ATOM   1303 N  N     . ALA A 1 160 ? 180.048 180.773 -2.480  1.00 15.79 ? 281  ALA A N     1 
ATOM   1304 C  CA    . ALA A 1 160 ? 180.066 180.984 -3.930  1.00 17.35 ? 281  ALA A CA    1 
ATOM   1305 C  C     . ALA A 1 160 ? 178.693 180.779 -4.610  1.00 18.31 ? 281  ALA A C     1 
ATOM   1306 O  O     . ALA A 1 160 ? 178.489 179.809 -5.311  1.00 18.09 ? 281  ALA A O     1 
ATOM   1307 C  CB    . ALA A 1 160 ? 181.103 180.047 -4.565  1.00 15.43 ? 281  ALA A CB    1 
ATOM   1308 N  N     . PRO A 1 161 ? 177.754 181.726 -4.412  1.00 20.27 ? 282  PRO A N     1 
ATOM   1309 C  CA    . PRO A 1 161 ? 176.381 181.701 -4.974  1.00 21.92 ? 282  PRO A CA    1 
ATOM   1310 C  C     . PRO A 1 161 ? 176.326 181.581 -6.480  1.00 22.24 ? 282  PRO A C     1 
ATOM   1311 O  O     . PRO A 1 161 ? 175.611 180.729 -6.987  1.00 24.89 ? 282  PRO A O     1 
ATOM   1312 C  CB    . PRO A 1 161 ? 175.770 183.032 -4.483  1.00 21.47 ? 282  PRO A CB    1 
ATOM   1313 C  CG    . PRO A 1 161 ? 176.575 183.413 -3.327  1.00 21.85 ? 282  PRO A CG    1 
ATOM   1314 C  CD    . PRO A 1 161 ? 177.983 182.946 -3.597  1.00 20.44 ? 282  PRO A CD    1 
ATOM   1315 N  N     . SER A 1 162 ? 177.088 182.439 -7.163  1.00 24.90 ? 283  SER A N     1 
ATOM   1316 C  CA    . SER A 1 162 ? 177.131 182.464 -8.629  1.00 28.30 ? 283  SER A CA    1 
ATOM   1317 C  C     . SER A 1 162 ? 178.454 182.133 -9.327  1.00 27.14 ? 283  SER A C     1 
ATOM   1318 O  O     . SER A 1 162 ? 178.563 181.133 -10.033 1.00 31.35 ? 283  SER A O     1 
ATOM   1319 C  CB    . SER A 1 162 ? 176.711 183.837 -9.202  1.00 26.31 ? 283  SER A CB    1 
ATOM   1320 O  OG    . SER A 1 162 ? 175.659 184.461 -8.492  1.00 30.72 ? 283  SER A OG    1 
ATOM   1321 N  N     . SER A 1 163 ? 179.434 183.011 -9.147  1.00 25.92 ? 284  SER A N     1 
ATOM   1322 C  CA    . SER A 1 163 ? 180.749 182.937 -9.789  1.00 26.41 ? 284  SER A CA    1 
ATOM   1323 C  C     . SER A 1 163 ? 181.720 181.869 -9.346  1.00 24.70 ? 284  SER A C     1 
ATOM   1324 O  O     . SER A 1 163 ? 181.617 181.347 -8.254  1.00 26.06 ? 284  SER A O     1 
ATOM   1325 C  CB    . SER A 1 163 ? 181.476 184.252 -9.583  1.00 26.11 ? 284  SER A CB    1 
ATOM   1326 O  OG    . SER A 1 163 ? 180.590 185.288 -9.231  1.00 32.06 ? 284  SER A OG    1 
ATOM   1327 N  N     . ARG A 1 164 ? 182.717 181.636 -10.192 1.00 23.60 ? 285  ARG A N     1 
ATOM   1328 C  CA    . ARG A 1 164 ? 183.782 180.701 -9.910  1.00 25.00 ? 285  ARG A CA    1 
ATOM   1329 C  C     . ARG A 1 164 ? 184.869 181.436 -9.074  1.00 23.19 ? 285  ARG A C     1 
ATOM   1330 O  O     . ARG A 1 164 ? 184.791 182.652 -8.873  1.00 23.63 ? 285  ARG A O     1 
ATOM   1331 C  CB    . ARG A 1 164 ? 184.337 180.169 -11.225 1.00 25.95 ? 285  ARG A CB    1 
ATOM   1332 C  CG    . ARG A 1 164 ? 183.367 179.201 -11.935 1.00 31.00 ? 285  ARG A CG    1 
ATOM   1333 C  CD    . ARG A 1 164 ? 184.154 178.152 -12.746 1.00 38.12 ? 285  ARG A CD    1 
ATOM   1334 N  NE    . ARG A 1 164 ? 184.419 178.543 -14.135 1.00 42.96 ? 285  ARG A NE    1 
ATOM   1335 C  CZ    . ARG A 1 164 ? 185.202 177.856 -14.971 1.00 45.91 ? 285  ARG A CZ    1 
ATOM   1336 N  NH1   . ARG A 1 164 ? 185.808 176.744 -14.560 1.00 46.53 ? 285  ARG A NH1   1 
ATOM   1337 N  NH2   . ARG A 1 164 ? 185.364 178.267 -16.225 1.00 46.52 ? 285  ARG A NH2   1 
ATOM   1338 N  N     . ARG A 1 165 ? 185.871 180.720 -8.578  1.00 22.25 ? 286  ARG A N     1 
ATOM   1339 C  CA    . ARG A 1 165 ? 186.898 181.369 -7.770  1.00 18.11 ? 286  ARG A CA    1 
ATOM   1340 C  C     . ARG A 1 165 ? 188.309 181.189 -8.339  1.00 19.47 ? 286  ARG A C     1 
ATOM   1341 O  O     . ARG A 1 165 ? 188.537 180.305 -9.174  1.00 17.62 ? 286  ARG A O     1 
ATOM   1342 C  CB    . ARG A 1 165 ? 186.781 180.826 -6.344  1.00 16.41 ? 286  ARG A CB    1 
ATOM   1343 C  CG    . ARG A 1 165 ? 185.467 181.252 -5.671  1.00 17.03 ? 286  ARG A CG    1 
ATOM   1344 C  CD    . ARG A 1 165 ? 185.642 182.655 -5.179  1.00 16.99 ? 286  ARG A CD    1 
ATOM   1345 N  NE    . ARG A 1 165 ? 184.443 183.221 -4.632  1.00 25.38 ? 286  ARG A NE    1 
ATOM   1346 C  CZ    . ARG A 1 165 ? 184.398 184.417 -4.072  1.00 26.94 ? 286  ARG A CZ    1 
ATOM   1347 N  NH1   . ARG A 1 165 ? 185.509 185.138 -3.995  1.00 28.48 ? 286  ARG A NH1   1 
ATOM   1348 N  NH2   . ARG A 1 165 ? 183.244 184.894 -3.605  1.00 30.62 ? 286  ARG A NH2   1 
HETATM 1349 N  N     . TPO A 1 166 ? 189.226 182.041 -7.916  1.00 21.77 ? 287  TPO A N     1 
HETATM 1350 C  CA    . TPO A 1 166 ? 190.558 181.974 -8.377  1.00 21.28 ? 287  TPO A CA    1 
HETATM 1351 C  CB    . TPO A 1 166 ? 190.775 183.306 -9.113  1.00 25.22 ? 287  TPO A CB    1 
HETATM 1352 C  CG2   . TPO A 1 166 ? 189.942 183.372 -10.421 1.00 22.17 ? 287  TPO A CG2   1 
HETATM 1353 O  OG1   . TPO A 1 166 ? 190.484 184.557 -8.448  1.00 33.29 ? 287  TPO A OG1   1 
HETATM 1354 P  P     . TPO A 1 166 ? 191.582 185.763 -8.444  1.00 33.70 ? 287  TPO A P     1 
HETATM 1355 O  O1P   . TPO A 1 166 ? 190.902 186.991 -9.195  1.00 41.17 ? 287  TPO A O1P   1 
HETATM 1356 O  O2P   . TPO A 1 166 ? 192.847 185.199 -9.239  1.00 37.62 ? 287  TPO A O2P   1 
HETATM 1357 O  O3P   . TPO A 1 166 ? 191.990 186.067 -6.912  1.00 41.70 ? 287  TPO A O3P   1 
HETATM 1358 C  C     . TPO A 1 166 ? 191.612 181.717 -7.265  1.00 16.99 ? 287  TPO A C     1 
HETATM 1359 O  O     . TPO A 1 166 ? 192.886 181.536 -7.600  1.00 25.86 ? 287  TPO A O     1 
HETATM 1360 N  N     . TPO A 1 167 ? 191.139 181.614 -6.033  1.00 16.91 ? 288  TPO A N     1 
HETATM 1361 C  CA    . TPO A 1 167 ? 192.066 181.441 -4.938  1.00 16.31 ? 288  TPO A CA    1 
HETATM 1362 C  CB    . TPO A 1 167 ? 191.262 181.750 -3.672  1.00 18.77 ? 288  TPO A CB    1 
HETATM 1363 C  CG2   . TPO A 1 167 ? 192.190 181.949 -2.512  1.00 16.50 ? 288  TPO A CG2   1 
HETATM 1364 O  OG1   . TPO A 1 167 ? 190.694 183.015 -3.936  1.00 23.64 ? 288  TPO A OG1   1 
HETATM 1365 P  P     . TPO A 1 167 ? 189.163 183.188 -3.329  1.00 18.56 ? 288  TPO A P     1 
HETATM 1366 O  O1P   . TPO A 1 167 ? 189.234 182.723 -1.818  1.00 19.25 ? 288  TPO A O1P   1 
HETATM 1367 O  O2P   . TPO A 1 167 ? 188.217 182.242 -4.154  1.00 24.67 ? 288  TPO A O2P   1 
HETATM 1368 O  O3P   . TPO A 1 167 ? 188.820 184.760 -3.320  1.00 24.29 ? 288  TPO A O3P   1 
HETATM 1369 C  C     . TPO A 1 167 ? 192.828 180.109 -4.873  1.00 17.62 ? 288  TPO A C     1 
HETATM 1370 O  O     . TPO A 1 167 ? 192.132 178.986 -5.036  1.00 16.48 ? 288  TPO A O     1 
ATOM   1371 N  N     . LEU A 1 168 ? 194.152 180.122 -4.825  1.00 19.62 ? 289  LEU A N     1 
ATOM   1372 C  CA    . LEU A 1 168 ? 194.793 178.875 -4.419  1.00 20.29 ? 289  LEU A CA    1 
ATOM   1373 C  C     . LEU A 1 168 ? 194.833 178.800 -2.900  1.00 17.60 ? 289  LEU A C     1 
ATOM   1374 O  O     . LEU A 1 168 ? 195.428 179.646 -2.272  1.00 20.61 ? 289  LEU A O     1 
ATOM   1375 C  CB    . LEU A 1 168 ? 196.229 178.759 -4.993  1.00 21.71 ? 289  LEU A CB    1 
ATOM   1376 C  CG    . LEU A 1 168 ? 196.977 177.458 -4.598  1.00 25.59 ? 289  LEU A CG    1 
ATOM   1377 C  CD1   . LEU A 1 168 ? 196.506 176.298 -5.488  1.00 30.17 ? 289  LEU A CD1   1 
ATOM   1378 C  CD2   . LEU A 1 168 ? 198.475 177.596 -4.769  1.00 26.69 ? 289  LEU A CD2   1 
ATOM   1379 N  N     . CYS A 1 169 ? 194.191 177.810 -2.307  1.00 16.97 ? 290  CYS A N     1 
ATOM   1380 C  CA    . CYS A 1 169 ? 194.204 177.679 -0.844  1.00 18.91 ? 290  CYS A CA    1 
ATOM   1381 C  C     . CYS A 1 169 ? 194.003 176.211 -0.453  1.00 17.81 ? 290  CYS A C     1 
ATOM   1382 O  O     . CYS A 1 169 ? 193.554 175.403 -1.266  1.00 15.28 ? 290  CYS A O     1 
ATOM   1383 C  CB    . CYS A 1 169 ? 193.102 178.535 -0.201  1.00 16.86 ? 290  CYS A CB    1 
ATOM   1384 S  SG    . CYS A 1 169 ? 191.434 178.234 -0.820  1.00 22.10 ? 290  CYS A SG    1 
ATOM   1385 N  N     . GLY A 1 170 ? 194.340 175.862 0.786   1.00 19.11 ? 291  GLY A N     1 
ATOM   1386 C  CA    . GLY A 1 170 ? 194.203 174.484 1.227   1.00 18.98 ? 291  GLY A CA    1 
ATOM   1387 C  C     . GLY A 1 170 ? 195.536 173.896 1.644   1.00 19.71 ? 291  GLY A C     1 
ATOM   1388 O  O     . GLY A 1 170 ? 196.458 174.606 2.047   1.00 21.01 ? 291  GLY A O     1 
ATOM   1389 N  N     . THR A 1 171 ? 195.626 172.584 1.523   1.00 18.60 ? 292  THR A N     1 
ATOM   1390 C  CA    . THR A 1 171 ? 196.800 171.837 1.903   1.00 16.87 ? 292  THR A CA    1 
ATOM   1391 C  C     . THR A 1 171 ? 197.453 171.308 0.652   1.00 17.38 ? 292  THR A C     1 
ATOM   1392 O  O     . THR A 1 171 ? 196.772 170.864 -0.269  1.00 16.20 ? 292  THR A O     1 
ATOM   1393 C  CB    . THR A 1 171 ? 196.378 170.657 2.760   1.00 19.75 ? 292  THR A CB    1 
ATOM   1394 O  OG1   . THR A 1 171 ? 195.457 171.126 3.752   1.00 25.57 ? 292  THR A OG1   1 
ATOM   1395 C  CG2   . THR A 1 171 ? 197.563 169.991 3.407   1.00 18.64 ? 292  THR A CG2   1 
ATOM   1396 N  N     . LEU A 1 172 ? 198.780 171.347 0.631   1.00 18.38 ? 293  LEU A N     1 
ATOM   1397 C  CA    . LEU A 1 172 ? 199.545 170.868 -0.511  1.00 18.67 ? 293  LEU A CA    1 
ATOM   1398 C  C     . LEU A 1 172 ? 199.063 169.533 -1.126  1.00 19.06 ? 293  LEU A C     1 
ATOM   1399 O  O     . LEU A 1 172 ? 198.654 169.496 -2.287  1.00 16.78 ? 293  LEU A O     1 
ATOM   1400 C  CB    . LEU A 1 172 ? 201.011 170.747 -0.102  1.00 18.33 ? 293  LEU A CB    1 
ATOM   1401 C  CG    . LEU A 1 172 ? 201.947 170.217 -1.188  1.00 19.70 ? 293  LEU A CG    1 
ATOM   1402 C  CD1   . LEU A 1 172 ? 201.997 171.229 -2.316  1.00 20.14 ? 293  LEU A CD1   1 
ATOM   1403 C  CD2   . LEU A 1 172 ? 203.332 169.962 -0.603  1.00 18.52 ? 293  LEU A CD2   1 
ATOM   1404 N  N     . ASP A 1 173 ? 199.106 168.447 -0.355  1.00 16.52 ? 294  ASP A N     1 
ATOM   1405 C  CA    . ASP A 1 173 ? 198.701 167.143 -0.868  1.00 15.08 ? 294  ASP A CA    1 
ATOM   1406 C  C     . ASP A 1 173 ? 197.239 167.026 -1.309  1.00 14.50 ? 294  ASP A C     1 
ATOM   1407 O  O     . ASP A 1 173 ? 196.875 166.084 -2.011  1.00 11.76 ? 294  ASP A O     1 
ATOM   1408 C  CB    . ASP A 1 173 ? 199.029 166.048 0.164   1.00 19.73 ? 294  ASP A CB    1 
ATOM   1409 C  CG    . ASP A 1 173 ? 200.527 165.669 0.175   1.00 23.92 ? 294  ASP A CG    1 
ATOM   1410 O  OD1   . ASP A 1 173 ? 201.065 165.254 -0.891  1.00 23.94 ? 294  ASP A OD1   1 
ATOM   1411 O  OD2   . ASP A 1 173 ? 201.161 165.783 1.245   1.00 24.71 ? 294  ASP A OD2   1 
ATOM   1412 N  N     . TYR A 1 174 ? 196.411 167.996 -0.923  1.00 13.78 ? 295  TYR A N     1 
ATOM   1413 C  CA    . TYR A 1 174 ? 194.993 167.963 -1.267  1.00 12.35 ? 295  TYR A CA    1 
ATOM   1414 C  C     . TYR A 1 174 ? 194.542 168.963 -2.336  1.00 10.66 ? 295  TYR A C     1 
ATOM   1415 O  O     . TYR A 1 174 ? 193.387 168.955 -2.741  1.00 11.85 ? 295  TYR A O     1 
ATOM   1416 C  CB    . TYR A 1 174 ? 194.156 168.157 -0.001  1.00 12.74 ? 295  TYR A CB    1 
ATOM   1417 C  CG    . TYR A 1 174 ? 194.061 166.933 0.868   1.00 16.79 ? 295  TYR A CG    1 
ATOM   1418 C  CD1   . TYR A 1 174 ? 195.179 166.449 1.561   1.00 19.00 ? 295  TYR A CD1   1 
ATOM   1419 C  CD2   . TYR A 1 174 ? 192.871 166.216 0.947   1.00 16.93 ? 295  TYR A CD2   1 
ATOM   1420 C  CE1   . TYR A 1 174 ? 195.119 165.265 2.307   1.00 18.70 ? 295  TYR A CE1   1 
ATOM   1421 C  CE2   . TYR A 1 174 ? 192.792 165.035 1.682   1.00 21.69 ? 295  TYR A CE2   1 
ATOM   1422 C  CZ    . TYR A 1 174 ? 193.916 164.559 2.357   1.00 22.19 ? 295  TYR A CZ    1 
ATOM   1423 O  OH    . TYR A 1 174 ? 193.805 163.362 3.046   1.00 26.24 ? 295  TYR A OH    1 
ATOM   1424 N  N     . LEU A 1 175 ? 195.460 169.797 -2.805  1.00 10.92 ? 296  LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 175 ? 195.119 170.800 -3.807  1.00 13.78 ? 296  LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 175 ? 194.591 170.206 -5.108  1.00 14.17 ? 296  LEU A C     1 
ATOM   1427 O  O     . LEU A 1 175 ? 195.144 169.255 -5.648  1.00 12.20 ? 296  LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 175 ? 196.328 171.679 -4.144  1.00 11.44 ? 296  LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 175 ? 196.931 172.488 -2.995  1.00 15.78 ? 296  LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 175 ? 198.287 173.081 -3.411  1.00 13.74 ? 296  LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 175 ? 195.954 173.585 -2.582  1.00 15.05 ? 296  LEU A CD2   1 
ATOM   1432 N  N     . PRO A 1 176 ? 193.504 170.783 -5.631  1.00 13.56 ? 297  PRO A N     1 
ATOM   1433 C  CA    . PRO A 1 176 ? 192.921 170.302 -6.893  1.00 12.38 ? 297  PRO A CA    1 
ATOM   1434 C  C     . PRO A 1 176 ? 193.772 170.826 -8.083  1.00 14.86 ? 297  PRO A C     1 
ATOM   1435 O  O     . PRO A 1 176 ? 194.361 171.906 -7.993  1.00 14.20 ? 297  PRO A O     1 
ATOM   1436 C  CB    . PRO A 1 176 ? 191.516 170.923 -6.872  1.00 14.10 ? 297  PRO A CB    1 
ATOM   1437 C  CG    . PRO A 1 176 ? 191.744 172.233 -6.155  1.00 13.16 ? 297  PRO A CG    1 
ATOM   1438 C  CD    . PRO A 1 176 ? 192.676 171.841 -5.015  1.00 13.83 ? 297  PRO A CD    1 
ATOM   1439 N  N     . PRO A 1 177 ? 193.830 170.080 -9.213  1.00 14.90 ? 298  PRO A N     1 
ATOM   1440 C  CA    . PRO A 1 177 ? 194.606 170.479 -10.403 1.00 12.06 ? 298  PRO A CA    1 
ATOM   1441 C  C     . PRO A 1 177 ? 194.250 171.874 -10.894 1.00 12.75 ? 298  PRO A C     1 
ATOM   1442 O  O     . PRO A 1 177 ? 195.124 172.677 -11.218 1.00 12.47 ? 298  PRO A O     1 
ATOM   1443 C  CB    . PRO A 1 177 ? 194.228 169.428 -11.450 1.00 12.23 ? 298  PRO A CB    1 
ATOM   1444 C  CG    . PRO A 1 177 ? 193.813 168.254 -10.653 1.00 11.96 ? 298  PRO A CG    1 
ATOM   1445 C  CD    . PRO A 1 177 ? 193.074 168.838 -9.478  1.00 13.08 ? 298  PRO A CD    1 
ATOM   1446 N  N     . GLU A 1 178 ? 192.954 172.154 -10.954 1.00 12.43 ? 299  GLU A N     1 
ATOM   1447 C  CA    . GLU A 1 178 ? 192.495 173.447 -11.427 1.00 15.93 ? 299  GLU A CA    1 
ATOM   1448 C  C     . GLU A 1 178 ? 193.068 174.609 -10.615 1.00 17.99 ? 299  GLU A C     1 
ATOM   1449 O  O     . GLU A 1 178 ? 193.217 175.706 -11.147 1.00 21.24 ? 299  GLU A O     1 
ATOM   1450 C  CB    . GLU A 1 178 ? 190.956 173.520 -11.439 1.00 15.99 ? 299  GLU A CB    1 
ATOM   1451 C  CG    . GLU A 1 178 ? 190.283 173.211 -10.098 1.00 20.28 ? 299  GLU A CG    1 
ATOM   1452 C  CD    . GLU A 1 178 ? 189.893 171.729 -9.951  1.00 22.71 ? 299  GLU A CD    1 
ATOM   1453 O  OE1   . GLU A 1 178 ? 190.741 170.854 -10.262 1.00 22.72 ? 299  GLU A OE1   1 
ATOM   1454 O  OE2   . GLU A 1 178 ? 188.743 171.450 -9.525  1.00 19.63 ? 299  GLU A OE2   1 
ATOM   1455 N  N     . MET A 1 179 ? 193.385 174.401 -9.340  1.00 17.80 ? 300  MET A N     1 
ATOM   1456 C  CA    . MET A 1 179 ? 193.949 175.497 -8.541  1.00 21.17 ? 300  MET A CA    1 
ATOM   1457 C  C     . MET A 1 179 ? 195.429 175.697 -8.845  1.00 22.52 ? 300  MET A C     1 
ATOM   1458 O  O     . MET A 1 179 ? 195.900 176.818 -9.034  1.00 17.97 ? 300  MET A O     1 
ATOM   1459 C  CB    . MET A 1 179 ? 193.781 175.248 -7.031  1.00 21.87 ? 300  MET A CB    1 
ATOM   1460 C  CG    . MET A 1 179 ? 192.562 175.935 -6.417  1.00 24.58 ? 300  MET A CG    1 
ATOM   1461 S  SD    . MET A 1 179 ? 192.223 175.516 -4.665  1.00 23.96 ? 300  MET A SD    1 
ATOM   1462 C  CE    . MET A 1 179 ? 193.835 175.427 -4.097  1.00 25.92 ? 300  MET A CE    1 
ATOM   1463 N  N     . ILE A 1 180 ? 196.153 174.592 -8.905  1.00 25.70 ? 301  ILE A N     1 
ATOM   1464 C  CA    . ILE A 1 180 ? 197.573 174.627 -9.160  1.00 28.05 ? 301  ILE A CA    1 
ATOM   1465 C  C     . ILE A 1 180 ? 197.857 175.289 -10.501 1.00 28.39 ? 301  ILE A C     1 
ATOM   1466 O  O     . ILE A 1 180 ? 198.736 176.140 -10.608 1.00 28.70 ? 301  ILE A O     1 
ATOM   1467 C  CB    . ILE A 1 180 ? 198.162 173.192 -9.173  1.00 31.23 ? 301  ILE A CB    1 
ATOM   1468 C  CG1   . ILE A 1 180 ? 197.977 172.525 -7.813  1.00 34.03 ? 301  ILE A CG1   1 
ATOM   1469 C  CG2   . ILE A 1 180 ? 199.640 173.228 -9.502  1.00 33.00 ? 301  ILE A CG2   1 
ATOM   1470 C  CD1   . ILE A 1 180 ? 198.227 171.019 -7.871  1.00 39.59 ? 301  ILE A CD1   1 
ATOM   1471 N  N     . GLU A 1 181 ? 197.091 174.902 -11.513 1.00 29.15 ? 302  GLU A N     1 
ATOM   1472 C  CA    . GLU A 1 181 ? 197.260 175.411 -12.864 1.00 27.63 ? 302  GLU A CA    1 
ATOM   1473 C  C     . GLU A 1 181 ? 196.759 176.817 -13.160 1.00 26.56 ? 302  GLU A C     1 
ATOM   1474 O  O     . GLU A 1 181 ? 196.730 177.216 -14.323 1.00 25.45 ? 302  GLU A O     1 
ATOM   1475 C  CB    . GLU A 1 181 ? 196.614 174.449 -13.847 1.00 28.51 ? 302  GLU A CB    1 
ATOM   1476 C  CG    . GLU A 1 181 ? 197.309 173.128 -13.932 1.00 31.90 ? 302  GLU A CG    1 
ATOM   1477 C  CD    . GLU A 1 181 ? 196.442 172.074 -14.604 1.00 34.88 ? 302  GLU A CD    1 
ATOM   1478 O  OE1   . GLU A 1 181 ? 195.546 172.441 -15.420 1.00 35.44 ? 302  GLU A OE1   1 
ATOM   1479 O  OE2   . GLU A 1 181 ? 196.663 170.878 -14.322 1.00 33.88 ? 302  GLU A OE2   1 
ATOM   1480 N  N     . GLY A 1 182 ? 196.351 177.553 -12.130 1.00 26.68 ? 303  GLY A N     1 
ATOM   1481 C  CA    . GLY A 1 182 ? 195.891 178.915 -12.333 1.00 24.63 ? 303  GLY A CA    1 
ATOM   1482 C  C     . GLY A 1 182 ? 194.576 179.072 -13.077 1.00 26.17 ? 303  GLY A C     1 
ATOM   1483 O  O     . GLY A 1 182 ? 194.333 180.080 -13.739 1.00 25.60 ? 303  GLY A O     1 
ATOM   1484 N  N     . ARG A 1 183 ? 193.718 178.068 -12.976 1.00 27.24 ? 304  ARG A N     1 
ATOM   1485 C  CA    . ARG A 1 183 ? 192.409 178.095 -13.617 1.00 26.83 ? 304  ARG A CA    1 
ATOM   1486 C  C     . ARG A 1 183 ? 191.386 178.429 -12.536 1.00 27.81 ? 304  ARG A C     1 
ATOM   1487 O  O     . ARG A 1 183 ? 191.684 178.391 -11.326 1.00 29.71 ? 304  ARG A O     1 
ATOM   1488 C  CB    . ARG A 1 183 ? 192.068 176.721 -14.229 1.00 26.35 ? 304  ARG A CB    1 
ATOM   1489 C  CG    . ARG A 1 183 ? 192.726 176.410 -15.584 1.00 35.40 ? 304  ARG A CG    1 
ATOM   1490 C  CD    . ARG A 1 183 ? 191.737 176.691 -16.749 1.00 43.36 ? 304  ARG A CD    1 
ATOM   1491 N  NE    . ARG A 1 183 ? 192.316 176.665 -18.095 1.00 47.14 ? 304  ARG A NE    1 
ATOM   1492 C  CZ    . ARG A 1 183 ? 191.602 176.827 -19.210 1.00 51.59 ? 304  ARG A CZ    1 
ATOM   1493 N  NH1   . ARG A 1 183 ? 190.290 177.025 -19.121 1.00 54.10 ? 304  ARG A NH1   1 
ATOM   1494 N  NH2   . ARG A 1 183 ? 192.189 176.794 -20.413 1.00 53.71 ? 304  ARG A NH2   1 
ATOM   1495 N  N     . MET A 1 184 ? 190.178 178.746 -12.969 1.00 25.68 ? 305  MET A N     1 
ATOM   1496 C  CA    . MET A 1 184 ? 189.112 179.048 -12.038 1.00 26.17 ? 305  MET A CA    1 
ATOM   1497 C  C     . MET A 1 184 ? 188.544 177.772 -11.466 1.00 23.39 ? 305  MET A C     1 
ATOM   1498 O  O     . MET A 1 184 ? 188.653 176.721 -12.082 1.00 23.54 ? 305  MET A O     1 
ATOM   1499 C  CB    . MET A 1 184 ? 188.027 179.807 -12.757 1.00 30.29 ? 305  MET A CB    1 
ATOM   1500 C  CG    . MET A 1 184 ? 188.517 181.155 -13.154 1.00 35.60 ? 305  MET A CG    1 
ATOM   1501 S  SD    . MET A 1 184 ? 187.192 182.156 -13.740 1.00 46.48 ? 305  MET A SD    1 
ATOM   1502 C  CE    . MET A 1 184 ? 187.949 182.896 -15.291 1.00 45.95 ? 305  MET A CE    1 
ATOM   1503 N  N     . HIS A 1 185 ? 187.934 177.852 -10.290 1.00 21.16 ? 306  HIS A N     1 
ATOM   1504 C  CA    . HIS A 1 185 ? 187.363 176.655 -9.703  1.00 17.32 ? 306  HIS A CA    1 
ATOM   1505 C  C     . HIS A 1 185 ? 186.000 176.913 -9.078  1.00 18.65 ? 306  HIS A C     1 
ATOM   1506 O  O     . HIS A 1 185 ? 185.528 178.063 -9.040  1.00 15.46 ? 306  HIS A O     1 
ATOM   1507 C  CB    . HIS A 1 185 ? 188.312 176.035 -8.671  1.00 15.79 ? 306  HIS A CB    1 
ATOM   1508 C  CG    . HIS A 1 185 ? 188.498 176.853 -7.431  1.00 14.36 ? 306  HIS A CG    1 
ATOM   1509 N  ND1   . HIS A 1 185 ? 189.411 177.880 -7.347  1.00 15.91 ? 306  HIS A ND1   1 
ATOM   1510 C  CD2   . HIS A 1 185 ? 187.895 176.788 -6.218  1.00 12.29 ? 306  HIS A CD2   1 
ATOM   1511 C  CE1   . HIS A 1 185 ? 189.366 178.411 -6.139  1.00 13.45 ? 306  HIS A CE1   1 
ATOM   1512 N  NE2   . HIS A 1 185 ? 188.453 177.767 -5.434  1.00 10.38 ? 306  HIS A NE2   1 
ATOM   1513 N  N     . ASP A 1 186 ? 185.376 175.822 -8.622  1.00 18.40 ? 307  ASP A N     1 
ATOM   1514 C  CA    . ASP A 1 186 ? 184.057 175.824 -7.986  1.00 20.30 ? 307  ASP A CA    1 
ATOM   1515 C  C     . ASP A 1 186 ? 183.948 174.721 -6.917  1.00 19.00 ? 307  ASP A C     1 
ATOM   1516 O  O     . ASP A 1 186 ? 184.973 174.176 -6.486  1.00 21.60 ? 307  ASP A O     1 
ATOM   1517 C  CB    . ASP A 1 186 ? 182.969 175.631 -9.035  1.00 24.34 ? 307  ASP A CB    1 
ATOM   1518 C  CG    . ASP A 1 186 ? 183.174 174.374 -9.865  1.00 30.83 ? 307  ASP A CG    1 
ATOM   1519 O  OD1   . ASP A 1 186 ? 183.553 173.321 -9.286  1.00 33.25 ? 307  ASP A OD1   1 
ATOM   1520 O  OD2   . ASP A 1 186 ? 182.949 174.430 -11.098 1.00 33.88 ? 307  ASP A OD2   1 
ATOM   1521 N  N     . GLU A 1 187 ? 182.720 174.368 -6.519  1.00 18.46 ? 308  GLU A N     1 
ATOM   1522 C  CA    . GLU A 1 187 ? 182.507 173.358 -5.479  1.00 17.19 ? 308  GLU A CA    1 
ATOM   1523 C  C     . GLU A 1 187 ? 183.048 171.977 -5.820  1.00 14.99 ? 308  GLU A C     1 
ATOM   1524 O  O     . GLU A 1 187 ? 183.135 171.106 -4.946  1.00 14.14 ? 308  GLU A O     1 
ATOM   1525 C  CB    . GLU A 1 187 ? 181.014 173.257 -5.075  1.00 19.78 ? 308  GLU A CB    1 
ATOM   1526 C  CG    . GLU A 1 187 ? 180.067 172.849 -6.190  1.00 29.00 ? 308  GLU A CG    1 
ATOM   1527 C  CD    . GLU A 1 187 ? 178.600 172.827 -5.777  1.00 33.58 ? 308  GLU A CD    1 
ATOM   1528 O  OE1   . GLU A 1 187 ? 178.121 173.800 -5.139  1.00 38.06 ? 308  GLU A OE1   1 
ATOM   1529 O  OE2   . GLU A 1 187 ? 177.910 171.836 -6.115  1.00 41.55 ? 308  GLU A OE2   1 
ATOM   1530 N  N     . LYS A 1 188 ? 183.452 171.780 -7.066  1.00 12.83 ? 309  LYS A N     1 
ATOM   1531 C  CA    . LYS A 1 188 ? 183.997 170.488 -7.449  1.00 16.26 ? 309  LYS A CA    1 
ATOM   1532 C  C     . LYS A 1 188 ? 185.370 170.202 -6.826  1.00 16.49 ? 309  LYS A C     1 
ATOM   1533 O  O     . LYS A 1 188 ? 185.816 169.051 -6.804  1.00 15.73 ? 309  LYS A O     1 
ATOM   1534 C  CB    . LYS A 1 188 ? 184.061 170.376 -8.972  1.00 18.82 ? 309  LYS A CB    1 
ATOM   1535 C  CG    . LYS A 1 188 ? 182.731 170.086 -9.593  1.00 21.29 ? 309  LYS A CG    1 
ATOM   1536 C  CD    . LYS A 1 188 ? 182.215 168.769 -9.041  1.00 29.52 ? 309  LYS A CD    1 
ATOM   1537 C  CE    . LYS A 1 188 ? 181.020 168.263 -9.842  1.00 30.17 ? 309  LYS A CE    1 
ATOM   1538 N  NZ    . LYS A 1 188 ? 180.649 166.912 -9.358  1.00 35.57 ? 309  LYS A NZ    1 
ATOM   1539 N  N     . VAL A 1 189 ? 186.025 171.233 -6.291  1.00 15.44 ? 310  VAL A N     1 
ATOM   1540 C  CA    . VAL A 1 189 ? 187.319 171.020 -5.662  1.00 13.90 ? 310  VAL A CA    1 
ATOM   1541 C  C     . VAL A 1 189 ? 187.132 170.159 -4.410  1.00 17.23 ? 310  VAL A C     1 
ATOM   1542 O  O     . VAL A 1 189 ? 188.008 169.357 -4.083  1.00 19.39 ? 310  VAL A O     1 
ATOM   1543 C  CB    . VAL A 1 189 ? 188.051 172.358 -5.281  1.00 15.52 ? 310  VAL A CB    1 
ATOM   1544 C  CG1   . VAL A 1 189 ? 188.197 173.247 -6.503  1.00 7.36  ? 310  VAL A CG1   1 
ATOM   1545 C  CG2   . VAL A 1 189 ? 187.332 173.065 -4.151  1.00 12.70 ? 310  VAL A CG2   1 
ATOM   1546 N  N     . ASP A 1 190 ? 186.013 170.306 -3.700  1.00 14.90 ? 311  ASP A N     1 
ATOM   1547 C  CA    . ASP A 1 190 ? 185.804 169.452 -2.541  1.00 14.20 ? 311  ASP A CA    1 
ATOM   1548 C  C     . ASP A 1 190 ? 185.640 167.983 -2.979  1.00 14.98 ? 311  ASP A C     1 
ATOM   1549 O  O     . ASP A 1 190 ? 185.953 167.090 -2.202  1.00 16.71 ? 311  ASP A O     1 
ATOM   1550 C  CB    . ASP A 1 190 ? 184.574 169.876 -1.727  1.00 16.81 ? 311  ASP A CB    1 
ATOM   1551 C  CG    . ASP A 1 190 ? 184.778 171.192 -0.974  1.00 16.28 ? 311  ASP A CG    1 
ATOM   1552 O  OD1   . ASP A 1 190 ? 185.950 171.565 -0.731  1.00 12.12 ? 311  ASP A OD1   1 
ATOM   1553 O  OD2   . ASP A 1 190 ? 183.756 171.832 -0.617  1.00 13.33 ? 311  ASP A OD2   1 
ATOM   1554 N  N     . LEU A 1 191 ? 185.162 167.723 -4.205  1.00 13.32 ? 312  LEU A N     1 
ATOM   1555 C  CA    . LEU A 1 191 ? 185.019 166.342 -4.703  1.00 13.83 ? 312  LEU A CA    1 
ATOM   1556 C  C     . LEU A 1 191 ? 186.399 165.749 -4.951  1.00 13.94 ? 312  LEU A C     1 
ATOM   1557 O  O     . LEU A 1 191 ? 186.616 164.546 -4.837  1.00 15.77 ? 312  LEU A O     1 
ATOM   1558 C  CB    . LEU A 1 191 ? 184.238 166.279 -6.028  1.00 12.75 ? 312  LEU A CB    1 
ATOM   1559 C  CG    . LEU A 1 191 ? 182.708 166.216 -6.008  1.00 16.02 ? 312  LEU A CG    1 
ATOM   1560 C  CD1   . LEU A 1 191 ? 182.269 164.959 -5.273  1.00 14.12 ? 312  LEU A CD1   1 
ATOM   1561 C  CD2   . LEU A 1 191 ? 182.118 167.482 -5.336  1.00 16.09 ? 312  LEU A CD2   1 
ATOM   1562 N  N     . TRP A 1 192 ? 187.338 166.594 -5.329  1.00 15.19 ? 313  TRP A N     1 
ATOM   1563 C  CA    . TRP A 1 192 ? 188.673 166.093 -5.553  1.00 13.67 ? 313  TRP A CA    1 
ATOM   1564 C  C     . TRP A 1 192 ? 189.258 165.776 -4.183  1.00 12.20 ? 313  TRP A C     1 
ATOM   1565 O  O     . TRP A 1 192 ? 189.803 164.704 -3.983  1.00 11.38 ? 313  TRP A O     1 
ATOM   1566 C  CB    . TRP A 1 192 ? 189.505 167.131 -6.287  1.00 10.13 ? 313  TRP A CB    1 
ATOM   1567 C  CG    . TRP A 1 192 ? 190.948 166.889 -6.208  1.00 9.91  ? 313  TRP A CG    1 
ATOM   1568 C  CD1   . TRP A 1 192 ? 191.784 167.266 -5.199  1.00 10.59 ? 313  TRP A CD1   1 
ATOM   1569 C  CD2   . TRP A 1 192 ? 191.775 166.296 -7.214  1.00 11.32 ? 313  TRP A CD2   1 
ATOM   1570 N  NE1   . TRP A 1 192 ? 193.083 166.960 -5.513  1.00 9.03  ? 313  TRP A NE1   1 
ATOM   1571 C  CE2   . TRP A 1 192 ? 193.109 166.370 -6.750  1.00 10.99 ? 313  TRP A CE2   1 
ATOM   1572 C  CE3   . TRP A 1 192 ? 191.523 165.729 -8.471  1.00 8.98  ? 313  TRP A CE3   1 
ATOM   1573 C  CZ2   . TRP A 1 192 ? 194.190 165.890 -7.494  1.00 10.17 ? 313  TRP A CZ2   1 
ATOM   1574 C  CZ3   . TRP A 1 192 ? 192.598 165.254 -9.214  1.00 13.43 ? 313  TRP A CZ3   1 
ATOM   1575 C  CH2   . TRP A 1 192 ? 193.923 165.344 -8.723  1.00 12.05 ? 313  TRP A CH2   1 
ATOM   1576 N  N     . SER A 1 193 ? 189.111 166.700 -3.236  1.00 13.68 ? 314  SER A N     1 
ATOM   1577 C  CA    . SER A 1 193 ? 189.636 166.492 -1.893  1.00 16.07 ? 314  SER A CA    1 
ATOM   1578 C  C     . SER A 1 193 ? 189.172 165.168 -1.283  1.00 16.32 ? 314  SER A C     1 
ATOM   1579 O  O     . SER A 1 193 ? 189.942 164.475 -0.628  1.00 15.29 ? 314  SER A O     1 
ATOM   1580 C  CB    . SER A 1 193 ? 189.229 167.643 -0.984  1.00 17.53 ? 314  SER A CB    1 
ATOM   1581 O  OG    . SER A 1 193 ? 190.261 168.612 -0.972  1.00 25.41 ? 314  SER A OG    1 
ATOM   1582 N  N     . LEU A 1 194 ? 187.907 164.838 -1.517  1.00 15.55 ? 315  LEU A N     1 
ATOM   1583 C  CA    . LEU A 1 194 ? 187.311 163.618 -1.029  1.00 15.03 ? 315  LEU A CA    1 
ATOM   1584 C  C     . LEU A 1 194 ? 188.031 162.402 -1.626  1.00 15.76 ? 315  LEU A C     1 
ATOM   1585 O  O     . LEU A 1 194 ? 188.237 161.399 -0.935  1.00 16.26 ? 315  LEU A O     1 
ATOM   1586 C  CB    . LEU A 1 194 ? 185.822 163.597 -1.392  1.00 15.51 ? 315  LEU A CB    1 
ATOM   1587 C  CG    . LEU A 1 194 ? 184.951 162.599 -0.624  1.00 17.84 ? 315  LEU A CG    1 
ATOM   1588 C  CD1   . LEU A 1 194 ? 184.877 163.015 0.840   1.00 17.24 ? 315  LEU A CD1   1 
ATOM   1589 C  CD2   . LEU A 1 194 ? 183.555 162.551 -1.222  1.00 15.53 ? 315  LEU A CD2   1 
ATOM   1590 N  N     . GLY A 1 195 ? 188.414 162.480 -2.899  1.00 13.03 ? 316  GLY A N     1 
ATOM   1591 C  CA    . GLY A 1 195 ? 189.109 161.357 -3.507  1.00 12.73 ? 316  GLY A CA    1 
ATOM   1592 C  C     . GLY A 1 195 ? 190.486 161.200 -2.878  1.00 13.41 ? 316  GLY A C     1 
ATOM   1593 O  O     . GLY A 1 195 ? 190.933 160.092 -2.576  1.00 11.78 ? 316  GLY A O     1 
ATOM   1594 N  N     . VAL A 1 196 ? 191.167 162.329 -2.702  1.00 12.49 ? 317  VAL A N     1 
ATOM   1595 C  CA    . VAL A 1 196 ? 192.481 162.351 -2.089  1.00 11.35 ? 317  VAL A CA    1 
ATOM   1596 C  C     . VAL A 1 196 ? 192.362 161.759 -0.680  1.00 12.97 ? 317  VAL A C     1 
ATOM   1597 O  O     . VAL A 1 196 ? 193.152 160.887 -0.280  1.00 11.80 ? 317  VAL A O     1 
ATOM   1598 C  CB    . VAL A 1 196 ? 193.034 163.812 -1.984  1.00 11.65 ? 317  VAL A CB    1 
ATOM   1599 C  CG1   . VAL A 1 196 ? 194.231 163.859 -1.079  1.00 10.54 ? 317  VAL A CG1   1 
ATOM   1600 C  CG2   . VAL A 1 196 ? 193.431 164.323 -3.360  1.00 8.84  ? 317  VAL A CG2   1 
ATOM   1601 N  N     . LEU A 1 197 ? 191.355 162.229 0.052   1.00 10.99 ? 318  LEU A N     1 
ATOM   1602 C  CA    . LEU A 1 197 ? 191.097 161.785 1.408   1.00 12.40 ? 318  LEU A CA    1 
ATOM   1603 C  C     . LEU A 1 197 ? 190.760 160.286 1.527   1.00 12.64 ? 318  LEU A C     1 
ATOM   1604 O  O     . LEU A 1 197 ? 191.232 159.610 2.437   1.00 10.92 ? 318  LEU A O     1 
ATOM   1605 C  CB    . LEU A 1 197 ? 189.958 162.618 2.007   1.00 15.26 ? 318  LEU A CB    1 
ATOM   1606 C  CG    . LEU A 1 197 ? 189.652 162.340 3.475   1.00 15.97 ? 318  LEU A CG    1 
ATOM   1607 C  CD1   . LEU A 1 197 ? 190.731 162.990 4.377   1.00 14.54 ? 318  LEU A CD1   1 
ATOM   1608 C  CD2   . LEU A 1 197 ? 188.310 162.873 3.783   1.00 13.89 ? 318  LEU A CD2   1 
ATOM   1609 N  N     . CYS A 1 198 ? 189.936 159.778 0.617   1.00 12.91 ? 319  CYS A N     1 
ATOM   1610 C  CA    . CYS A 1 198 ? 189.547 158.372 0.623   1.00 15.63 ? 319  CYS A CA    1 
ATOM   1611 C  C     . CYS A 1 198 ? 190.757 157.490 0.394   1.00 15.66 ? 319  CYS A C     1 
ATOM   1612 O  O     . CYS A 1 198 ? 190.906 156.439 1.025   1.00 15.68 ? 319  CYS A O     1 
ATOM   1613 C  CB    . CYS A 1 198 ? 188.512 158.092 -0.479  1.00 20.57 ? 319  CYS A CB    1 
ATOM   1614 S  SG    . CYS A 1 198 ? 187.933 156.363 -0.531  1.00 23.04 ? 319  CYS A SG    1 
ATOM   1615 N  N     . TYR A 1 199 ? 191.614 157.922 -0.527  1.00 13.11 ? 320  TYR A N     1 
ATOM   1616 C  CA    . TYR A 1 199 ? 192.833 157.194 -0.827  1.00 12.42 ? 320  TYR A CA    1 
ATOM   1617 C  C     . TYR A 1 199 ? 193.727 157.138 0.428   1.00 13.58 ? 320  TYR A C     1 
ATOM   1618 O  O     . TYR A 1 199 ? 194.217 156.062 0.797   1.00 12.75 ? 320  TYR A O     1 
ATOM   1619 C  CB    . TYR A 1 199 ? 193.560 157.870 -1.999  1.00 12.90 ? 320  TYR A CB    1 
ATOM   1620 C  CG    . TYR A 1 199 ? 194.879 157.235 -2.378  1.00 11.79 ? 320  TYR A CG    1 
ATOM   1621 C  CD1   . TYR A 1 199 ? 196.014 157.423 -1.594  1.00 11.63 ? 320  TYR A CD1   1 
ATOM   1622 C  CD2   . TYR A 1 199 ? 194.978 156.414 -3.495  1.00 13.02 ? 320  TYR A CD2   1 
ATOM   1623 C  CE1   . TYR A 1 199 ? 197.213 156.803 -1.906  1.00 13.39 ? 320  TYR A CE1   1 
ATOM   1624 C  CE2   . TYR A 1 199 ? 196.167 155.790 -3.822  1.00 14.81 ? 320  TYR A CE2   1 
ATOM   1625 C  CZ    . TYR A 1 199 ? 197.287 155.980 -3.023  1.00 16.61 ? 320  TYR A CZ    1 
ATOM   1626 O  OH    . TYR A 1 199 ? 198.459 155.299 -3.325  1.00 14.17 ? 320  TYR A OH    1 
ATOM   1627 N  N     . GLU A 1 200 ? 193.922 158.287 1.083   1.00 12.98 ? 321  GLU A N     1 
ATOM   1628 C  CA    . GLU A 1 200 ? 194.752 158.359 2.289   1.00 13.87 ? 321  GLU A CA    1 
ATOM   1629 C  C     . GLU A 1 200 ? 194.218 157.470 3.416   1.00 14.01 ? 321  GLU A C     1 
ATOM   1630 O  O     . GLU A 1 200 ? 194.986 156.877 4.166   1.00 14.13 ? 321  GLU A O     1 
ATOM   1631 C  CB    . GLU A 1 200 ? 194.858 159.798 2.815   1.00 15.03 ? 321  GLU A CB    1 
ATOM   1632 C  CG    . GLU A 1 200 ? 196.109 160.011 3.685   1.00 22.02 ? 321  GLU A CG    1 
ATOM   1633 C  CD    . GLU A 1 200 ? 196.204 161.394 4.326   1.00 27.52 ? 321  GLU A CD    1 
ATOM   1634 O  OE1   . GLU A 1 200 ? 195.889 162.413 3.676   1.00 30.94 ? 321  GLU A OE1   1 
ATOM   1635 O  OE2   . GLU A 1 200 ? 196.621 161.470 5.494   1.00 31.35 ? 321  GLU A OE2   1 
ATOM   1636 N  N     . PHE A 1 201 ? 192.899 157.384 3.536   1.00 13.55 ? 322  PHE A N     1 
ATOM   1637 C  CA    . PHE A 1 201 ? 192.291 156.568 4.576   1.00 12.09 ? 322  PHE A CA    1 
ATOM   1638 C  C     . PHE A 1 201 ? 192.629 155.107 4.398   1.00 12.56 ? 322  PHE A C     1 
ATOM   1639 O  O     . PHE A 1 201 ? 192.888 154.401 5.375   1.00 14.57 ? 322  PHE A O     1 
ATOM   1640 C  CB    . PHE A 1 201 ? 190.765 156.710 4.570   1.00 6.70  ? 322  PHE A CB    1 
ATOM   1641 C  CG    . PHE A 1 201 ? 190.272 157.975 5.176   1.00 6.79  ? 322  PHE A CG    1 
ATOM   1642 C  CD1   . PHE A 1 201 ? 191.144 158.836 5.838   1.00 7.89  ? 322  PHE A CD1   1 
ATOM   1643 C  CD2   . PHE A 1 201 ? 188.933 158.312 5.106   1.00 8.09  ? 322  PHE A CD2   1 
ATOM   1644 C  CE1   . PHE A 1 201 ? 190.688 160.011 6.416   1.00 6.90  ? 322  PHE A CE1   1 
ATOM   1645 C  CE2   . PHE A 1 201 ? 188.464 159.497 5.689   1.00 10.00 ? 322  PHE A CE2   1 
ATOM   1646 C  CZ    . PHE A 1 201 ? 189.346 160.340 6.345   1.00 8.24  ? 322  PHE A CZ    1 
ATOM   1647 N  N     . LEU A 1 202 ? 192.629 154.663 3.147   1.00 11.23 ? 323  LEU A N     1 
ATOM   1648 C  CA    . LEU A 1 202 ? 192.876 153.269 2.830   1.00 10.81 ? 323  LEU A CA    1 
ATOM   1649 C  C     . LEU A 1 202 ? 194.341 152.888 2.725   1.00 13.31 ? 323  LEU A C     1 
ATOM   1650 O  O     . LEU A 1 202 ? 194.734 151.769 3.072   1.00 13.08 ? 323  LEU A O     1 
ATOM   1651 C  CB    . LEU A 1 202 ? 192.181 152.923 1.510   1.00 11.58 ? 323  LEU A CB    1 
ATOM   1652 C  CG    . LEU A 1 202 ? 190.650 152.911 1.467   1.00 11.82 ? 323  LEU A CG    1 
ATOM   1653 C  CD1   . LEU A 1 202 ? 190.149 152.693 0.033   1.00 1.00  ? 323  LEU A CD1   1 
ATOM   1654 C  CD2   . LEU A 1 202 ? 190.158 151.799 2.429   1.00 8.83  ? 323  LEU A CD2   1 
ATOM   1655 N  N     . VAL A 1 203 ? 195.144 153.832 2.253   1.00 13.79 ? 324  VAL A N     1 
ATOM   1656 C  CA    . VAL A 1 203 ? 196.552 153.589 2.028   1.00 13.43 ? 324  VAL A CA    1 
ATOM   1657 C  C     . VAL A 1 203 ? 197.439 154.085 3.153   1.00 15.36 ? 324  VAL A C     1 
ATOM   1658 O  O     . VAL A 1 203 ? 198.496 153.525 3.419   1.00 15.10 ? 324  VAL A O     1 
ATOM   1659 C  CB    . VAL A 1 203 ? 196.958 154.241 0.703   1.00 13.53 ? 324  VAL A CB    1 
ATOM   1660 C  CG1   . VAL A 1 203 ? 198.387 153.909 0.365   1.00 10.33 ? 324  VAL A CG1   1 
ATOM   1661 C  CG2   . VAL A 1 203 ? 196.009 153.788 -0.384  1.00 10.31 ? 324  VAL A CG2   1 
ATOM   1662 N  N     . GLY A 1 204 ? 197.019 155.146 3.819   1.00 16.58 ? 325  GLY A N     1 
ATOM   1663 C  CA    . GLY A 1 204 ? 197.834 155.647 4.902   1.00 18.98 ? 325  GLY A CA    1 
ATOM   1664 C  C     . GLY A 1 204 ? 198.687 156.819 4.459   1.00 22.31 ? 325  GLY A C     1 
ATOM   1665 O  O     . GLY A 1 204 ? 199.484 157.330 5.245   1.00 22.91 ? 325  GLY A O     1 
ATOM   1666 N  N     . LYS A 1 205 ? 198.556 157.238 3.204   1.00 22.34 ? 326  LYS A N     1 
ATOM   1667 C  CA    . LYS A 1 205 ? 199.299 158.399 2.743   1.00 20.73 ? 326  LYS A CA    1 
ATOM   1668 C  C     . LYS A 1 205 ? 198.627 158.927 1.496   1.00 18.10 ? 326  LYS A C     1 
ATOM   1669 O  O     . LYS A 1 205 ? 198.050 158.173 0.745   1.00 18.75 ? 326  LYS A O     1 
ATOM   1670 C  CB    . LYS A 1 205 ? 200.775 158.057 2.468   1.00 22.54 ? 326  LYS A CB    1 
ATOM   1671 C  CG    . LYS A 1 205 ? 201.002 157.016 1.405   1.00 26.76 ? 326  LYS A CG    1 
ATOM   1672 C  CD    . LYS A 1 205 ? 202.478 156.728 1.181   1.00 29.37 ? 326  LYS A CD    1 
ATOM   1673 C  CE    . LYS A 1 205 ? 202.635 155.634 0.108   1.00 36.99 ? 326  LYS A CE    1 
ATOM   1674 N  NZ    . LYS A 1 205 ? 204.059 155.235 -0.146  1.00 40.73 ? 326  LYS A NZ    1 
ATOM   1675 N  N     . PRO A 1 206 ? 198.657 160.254 1.290   1.00 19.06 ? 327  PRO A N     1 
ATOM   1676 C  CA    . PRO A 1 206 ? 198.046 160.877 0.111   1.00 16.77 ? 327  PRO A CA    1 
ATOM   1677 C  C     . PRO A 1 206 ? 198.719 160.334 -1.156  1.00 15.47 ? 327  PRO A C     1 
ATOM   1678 O  O     . PRO A 1 206 ? 199.920 160.074 -1.165  1.00 17.98 ? 327  PRO A O     1 
ATOM   1679 C  CB    . PRO A 1 206 ? 198.349 162.358 0.331   1.00 18.27 ? 327  PRO A CB    1 
ATOM   1680 C  CG    . PRO A 1 206 ? 199.652 162.318 0.997   1.00 17.79 ? 327  PRO A CG    1 
ATOM   1681 C  CD    . PRO A 1 206 ? 199.416 161.265 2.050   1.00 18.18 ? 327  PRO A CD    1 
ATOM   1682 N  N     . PRO A 1 207 ? 197.967 160.221 -2.256  1.00 15.81 ? 328  PRO A N     1 
ATOM   1683 C  CA    . PRO A 1 207 ? 198.467 159.699 -3.540  1.00 13.75 ? 328  PRO A CA    1 
ATOM   1684 C  C     . PRO A 1 207 ? 199.517 160.502 -4.312  1.00 14.29 ? 328  PRO A C     1 
ATOM   1685 O  O     . PRO A 1 207 ? 200.226 159.947 -5.150  1.00 15.51 ? 328  PRO A O     1 
ATOM   1686 C  CB    . PRO A 1 207 ? 197.183 159.511 -4.345  1.00 15.58 ? 328  PRO A CB    1 
ATOM   1687 C  CG    . PRO A 1 207 ? 196.384 160.712 -3.922  1.00 15.99 ? 328  PRO A CG    1 
ATOM   1688 C  CD    . PRO A 1 207 ? 196.629 160.830 -2.419  1.00 13.52 ? 328  PRO A CD    1 
ATOM   1689 N  N     . PHE A 1 208 ? 199.627 161.798 -4.039  1.00 15.34 ? 329  PHE A N     1 
ATOM   1690 C  CA    . PHE A 1 208 ? 200.600 162.627 -4.758  1.00 16.02 ? 329  PHE A CA    1 
ATOM   1691 C  C     . PHE A 1 208 ? 201.774 163.073 -3.896  1.00 18.50 ? 329  PHE A C     1 
ATOM   1692 O  O     . PHE A 1 208 ? 202.501 163.999 -4.242  1.00 17.82 ? 329  PHE A O     1 
ATOM   1693 C  CB    . PHE A 1 208 ? 199.880 163.832 -5.357  1.00 11.57 ? 329  PHE A CB    1 
ATOM   1694 C  CG    . PHE A 1 208 ? 198.677 163.456 -6.171  1.00 10.41 ? 329  PHE A CG    1 
ATOM   1695 C  CD1   . PHE A 1 208 ? 198.831 162.822 -7.393  1.00 7.22  ? 329  PHE A CD1   1 
ATOM   1696 C  CD2   . PHE A 1 208 ? 197.389 163.646 -5.672  1.00 10.88 ? 329  PHE A CD2   1 
ATOM   1697 C  CE1   . PHE A 1 208 ? 197.722 162.365 -8.117  1.00 11.91 ? 329  PHE A CE1   1 
ATOM   1698 C  CE2   . PHE A 1 208 ? 196.267 163.194 -6.387  1.00 9.29  ? 329  PHE A CE2   1 
ATOM   1699 C  CZ    . PHE A 1 208 ? 196.435 162.548 -7.611  1.00 11.49 ? 329  PHE A CZ    1 
ATOM   1700 N  N     . GLU A 1 209 ? 201.968 162.411 -2.765  1.00 20.96 ? 330  GLU A N     1 
ATOM   1701 C  CA    . GLU A 1 209 ? 203.061 162.781 -1.872  1.00 25.68 ? 330  GLU A CA    1 
ATOM   1702 C  C     . GLU A 1 209 ? 204.404 162.666 -2.593  1.00 25.36 ? 330  GLU A C     1 
ATOM   1703 O  O     . GLU A 1 209 ? 204.712 161.627 -3.177  1.00 25.32 ? 330  GLU A O     1 
ATOM   1704 C  CB    . GLU A 1 209 ? 203.042 161.868 -0.653  1.00 28.63 ? 330  GLU A CB    1 
ATOM   1705 C  CG    . GLU A 1 209 ? 203.889 162.292 0.527   1.00 35.48 ? 330  GLU A CG    1 
ATOM   1706 C  CD    . GLU A 1 209 ? 203.618 161.381 1.725   1.00 40.14 ? 330  GLU A CD    1 
ATOM   1707 O  OE1   . GLU A 1 209 ? 203.825 161.798 2.890   1.00 43.93 ? 330  GLU A OE1   1 
ATOM   1708 O  OE2   . GLU A 1 209 ? 203.186 160.230 1.490   1.00 43.19 ? 330  GLU A OE2   1 
ATOM   1709 N  N     . ALA A 1 210 ? 205.195 163.733 -2.551  1.00 23.31 ? 331  ALA A N     1 
ATOM   1710 C  CA    . ALA A 1 210 ? 206.506 163.745 -3.184  1.00 23.23 ? 331  ALA A CA    1 
ATOM   1711 C  C     . ALA A 1 210 ? 207.503 164.429 -2.239  1.00 24.76 ? 331  ALA A C     1 
ATOM   1712 O  O     . ALA A 1 210 ? 207.109 165.040 -1.249  1.00 22.52 ? 331  ALA A O     1 
ATOM   1713 C  CB    . ALA A 1 210 ? 206.432 164.479 -4.500  1.00 19.73 ? 331  ALA A CB    1 
ATOM   1714 N  N     . ASN A 1 211 ? 208.794 164.320 -2.542  1.00 27.89 ? 332  ASN A N     1 
ATOM   1715 C  CA    . ASN A 1 211 ? 209.822 164.922 -1.692  1.00 30.47 ? 332  ASN A CA    1 
ATOM   1716 C  C     . ASN A 1 211 ? 209.942 166.462 -1.771  1.00 29.91 ? 332  ASN A C     1 
ATOM   1717 O  O     . ASN A 1 211 ? 210.601 167.073 -0.928  1.00 29.72 ? 332  ASN A O     1 
ATOM   1718 C  CB    . ASN A 1 211 ? 211.174 164.246 -1.975  1.00 32.87 ? 332  ASN A CB    1 
ATOM   1719 C  CG    . ASN A 1 211 ? 211.190 162.794 -1.504  1.00 37.45 ? 332  ASN A CG    1 
ATOM   1720 O  OD1   . ASN A 1 211 ? 210.716 162.504 -0.401  1.00 36.73 ? 332  ASN A OD1   1 
ATOM   1721 N  ND2   . ASN A 1 211 ? 211.729 161.883 -2.321  1.00 37.38 ? 332  ASN A ND2   1 
ATOM   1722 N  N     . THR A 1 212 ? 209.303 167.092 -2.754  1.00 27.34 ? 333  THR A N     1 
ATOM   1723 C  CA    . THR A 1 212 ? 209.369 168.544 -2.881  1.00 25.63 ? 333  THR A CA    1 
ATOM   1724 C  C     . THR A 1 212 ? 208.021 169.099 -3.341  1.00 24.25 ? 333  THR A C     1 
ATOM   1725 O  O     . THR A 1 212 ? 207.168 168.355 -3.832  1.00 24.65 ? 333  THR A O     1 
ATOM   1726 C  CB    . THR A 1 212 ? 210.411 168.968 -3.919  1.00 27.29 ? 333  THR A CB    1 
ATOM   1727 O  OG1   . THR A 1 212 ? 209.862 168.766 -5.232  1.00 25.31 ? 333  THR A OG1   1 
ATOM   1728 C  CG2   . THR A 1 212 ? 211.683 168.122 -3.769  1.00 28.40 ? 333  THR A CG2   1 
ATOM   1729 N  N     . TYR A 1 213 ? 207.839 170.406 -3.177  1.00 22.97 ? 334  TYR A N     1 
ATOM   1730 C  CA    . TYR A 1 213 ? 206.610 171.081 -3.584  1.00 24.27 ? 334  TYR A CA    1 
ATOM   1731 C  C     . TYR A 1 213 ? 206.379 170.979 -5.088  1.00 25.01 ? 334  TYR A C     1 
ATOM   1732 O  O     . TYR A 1 213 ? 205.267 170.712 -5.567  1.00 24.09 ? 334  TYR A O     1 
ATOM   1733 C  CB    . TYR A 1 213 ? 206.670 172.557 -3.243  1.00 26.40 ? 334  TYR A CB    1 
ATOM   1734 C  CG    . TYR A 1 213 ? 206.122 172.899 -1.885  1.00 28.73 ? 334  TYR A CG    1 
ATOM   1735 C  CD1   . TYR A 1 213 ? 206.846 172.639 -0.725  1.00 29.53 ? 334  TYR A CD1   1 
ATOM   1736 C  CD2   . TYR A 1 213 ? 204.863 173.476 -1.759  1.00 28.50 ? 334  TYR A CD2   1 
ATOM   1737 C  CE1   . TYR A 1 213 ? 206.322 172.945 0.537   1.00 32.11 ? 334  TYR A CE1   1 
ATOM   1738 C  CE2   . TYR A 1 213 ? 204.329 173.794 -0.497  1.00 29.43 ? 334  TYR A CE2   1 
ATOM   1739 C  CZ    . TYR A 1 213 ? 205.072 173.518 0.645   1.00 31.88 ? 334  TYR A CZ    1 
ATOM   1740 O  OH    . TYR A 1 213 ? 204.597 173.783 1.910   1.00 34.80 ? 334  TYR A OH    1 
ATOM   1741 N  N     . GLN A 1 214 ? 207.445 171.221 -5.831  1.00 24.15 ? 335  GLN A N     1 
ATOM   1742 C  CA    . GLN A 1 214 ? 207.401 171.183 -7.272  1.00 26.26 ? 335  GLN A CA    1 
ATOM   1743 C  C     . GLN A 1 214 ? 207.014 169.785 -7.766  1.00 24.06 ? 335  GLN A C     1 
ATOM   1744 O  O     . GLN A 1 214 ? 206.182 169.643 -8.661  1.00 20.60 ? 335  GLN A O     1 
ATOM   1745 C  CB    . GLN A 1 214 ? 208.763 171.616 -7.820  1.00 30.16 ? 335  GLN A CB    1 
ATOM   1746 C  CG    . GLN A 1 214 ? 208.690 172.407 -9.123  1.00 37.20 ? 335  GLN A CG    1 
ATOM   1747 C  CD    . GLN A 1 214 ? 209.938 173.249 -9.353  1.00 44.29 ? 335  GLN A CD    1 
ATOM   1748 O  OE1   . GLN A 1 214 ? 211.075 172.716 -9.361  1.00 45.86 ? 335  GLN A OE1   1 
ATOM   1749 N  NE2   . GLN A 1 214 ? 209.749 174.581 -9.540  1.00 45.65 ? 335  GLN A NE2   1 
ATOM   1750 N  N     . GLU A 1 215 ? 207.596 168.746 -7.179  1.00 23.21 ? 336  GLU A N     1 
ATOM   1751 C  CA    . GLU A 1 215 ? 207.243 167.407 -7.624  1.00 22.61 ? 336  GLU A CA    1 
ATOM   1752 C  C     . GLU A 1 215 ? 205.775 167.056 -7.327  1.00 23.14 ? 336  GLU A C     1 
ATOM   1753 O  O     . GLU A 1 215 ? 205.138 166.363 -8.124  1.00 23.03 ? 336  GLU A O     1 
ATOM   1754 C  CB    . GLU A 1 215 ? 208.183 166.360 -7.022  1.00 19.74 ? 336  GLU A CB    1 
ATOM   1755 C  CG    . GLU A 1 215 ? 207.807 164.932 -7.350  1.00 27.97 ? 336  GLU A CG    1 
ATOM   1756 C  CD    . GLU A 1 215 ? 207.852 164.603 -8.845  1.00 35.28 ? 336  GLU A CD    1 
ATOM   1757 O  OE1   . GLU A 1 215 ? 207.231 163.579 -9.236  1.00 38.15 ? 336  GLU A OE1   1 
ATOM   1758 O  OE2   . GLU A 1 215 ? 208.508 165.350 -9.628  1.00 39.74 ? 336  GLU A OE2   1 
ATOM   1759 N  N     . THR A 1 216 ? 205.241 167.517 -6.196  1.00 21.09 ? 337  THR A N     1 
ATOM   1760 C  CA    . THR A 1 216 ? 203.849 167.229 -5.868  1.00 21.21 ? 337  THR A CA    1 
ATOM   1761 C  C     . THR A 1 216 ? 202.918 167.944 -6.855  1.00 19.71 ? 337  THR A C     1 
ATOM   1762 O  O     . THR A 1 216 ? 201.978 167.329 -7.346  1.00 21.88 ? 337  THR A O     1 
ATOM   1763 C  CB    . THR A 1 216 ? 203.541 167.589 -4.380  1.00 22.66 ? 337  THR A CB    1 
ATOM   1764 O  OG1   . THR A 1 216 ? 204.334 166.744 -3.537  1.00 24.71 ? 337  THR A OG1   1 
ATOM   1765 C  CG2   . THR A 1 216 ? 202.072 167.366 -4.030  1.00 16.15 ? 337  THR A CG2   1 
ATOM   1766 N  N     . TYR A 1 217 ? 203.191 169.210 -7.171  1.00 17.76 ? 338  TYR A N     1 
ATOM   1767 C  CA    . TYR A 1 217 ? 202.404 169.982 -8.151  1.00 17.94 ? 338  TYR A CA    1 
ATOM   1768 C  C     . TYR A 1 217 ? 202.342 169.248 -9.480  1.00 17.24 ? 338  TYR A C     1 
ATOM   1769 O  O     . TYR A 1 217 ? 201.303 169.202 -10.143 1.00 17.93 ? 338  TYR A O     1 
ATOM   1770 C  CB    . TYR A 1 217 ? 203.051 171.348 -8.416  1.00 19.72 ? 338  TYR A CB    1 
ATOM   1771 C  CG    . TYR A 1 217 ? 202.924 172.309 -7.282  1.00 21.47 ? 338  TYR A CG    1 
ATOM   1772 C  CD1   . TYR A 1 217 ? 203.927 173.231 -7.014  1.00 26.12 ? 338  TYR A CD1   1 
ATOM   1773 C  CD2   . TYR A 1 217 ? 201.775 172.333 -6.506  1.00 23.72 ? 338  TYR A CD2   1 
ATOM   1774 C  CE1   . TYR A 1 217 ? 203.780 174.172 -6.003  1.00 31.99 ? 338  TYR A CE1   1 
ATOM   1775 C  CE2   . TYR A 1 217 ? 201.609 173.256 -5.498  1.00 28.25 ? 338  TYR A CE2   1 
ATOM   1776 C  CZ    . TYR A 1 217 ? 202.605 174.184 -5.255  1.00 32.26 ? 338  TYR A CZ    1 
ATOM   1777 O  OH    . TYR A 1 217 ? 202.398 175.197 -4.343  1.00 37.49 ? 338  TYR A OH    1 
ATOM   1778 N  N     . LYS A 1 218 ? 203.492 168.704 -9.869  1.00 18.06 ? 339  LYS A N     1 
ATOM   1779 C  CA    . LYS A 1 218 ? 203.635 167.967 -11.112 1.00 15.13 ? 339  LYS A CA    1 
ATOM   1780 C  C     . LYS A 1 218 ? 202.734 166.747 -11.110 1.00 15.66 ? 339  LYS A C     1 
ATOM   1781 O  O     . LYS A 1 218 ? 201.999 166.520 -12.062 1.00 16.79 ? 339  LYS A O     1 
ATOM   1782 C  CB    . LYS A 1 218 ? 205.087 167.521 -11.318 1.00 15.66 ? 339  LYS A CB    1 
ATOM   1783 C  CG    . LYS A 1 218 ? 205.282 166.761 -12.647 1.00 25.11 ? 339  LYS A CG    1 
ATOM   1784 C  CD    . LYS A 1 218 ? 206.675 166.164 -12.838 1.00 28.61 ? 339  LYS A CD    1 
ATOM   1785 C  CE    . LYS A 1 218 ? 207.736 167.232 -12.973 1.00 30.48 ? 339  LYS A CE    1 
ATOM   1786 N  NZ    . LYS A 1 218 ? 209.081 166.590 -13.128 1.00 37.06 ? 339  LYS A NZ    1 
ATOM   1787 N  N     . ARG A 1 219 ? 202.788 165.963 -10.038 1.00 14.01 ? 340  ARG A N     1 
ATOM   1788 C  CA    . ARG A 1 219 ? 201.980 164.754 -9.941  1.00 17.25 ? 340  ARG A CA    1 
ATOM   1789 C  C     . ARG A 1 219 ? 200.467 164.980 -9.876  1.00 16.32 ? 340  ARG A C     1 
ATOM   1790 O  O     . ARG A 1 219 ? 199.692 164.177 -10.393 1.00 13.54 ? 340  ARG A O     1 
ATOM   1791 C  CB    . ARG A 1 219 ? 202.444 163.917 -8.749  1.00 17.92 ? 340  ARG A CB    1 
ATOM   1792 C  CG    . ARG A 1 219 ? 203.675 163.112 -9.058  1.00 20.94 ? 340  ARG A CG    1 
ATOM   1793 C  CD    . ARG A 1 219 ? 204.273 162.632 -7.805  1.00 26.11 ? 340  ARG A CD    1 
ATOM   1794 N  NE    . ARG A 1 219 ? 205.579 162.024 -8.000  1.00 30.74 ? 340  ARG A NE    1 
ATOM   1795 C  CZ    . ARG A 1 219 ? 206.247 161.430 -7.014  1.00 34.14 ? 340  ARG A CZ    1 
ATOM   1796 N  NH1   . ARG A 1 219 ? 205.697 161.387 -5.805  1.00 36.45 ? 340  ARG A NH1   1 
ATOM   1797 N  NH2   . ARG A 1 219 ? 207.447 160.886 -7.219  1.00 32.82 ? 340  ARG A NH2   1 
ATOM   1798 N  N     . ILE A 1 220 ? 200.052 166.068 -9.242  1.00 16.44 ? 341  ILE A N     1 
ATOM   1799 C  CA    . ILE A 1 220 ? 198.637 166.396 -9.147  1.00 15.90 ? 341  ILE A CA    1 
ATOM   1800 C  C     . ILE A 1 220 ? 198.139 166.813 -10.524 1.00 16.94 ? 341  ILE A C     1 
ATOM   1801 O  O     . ILE A 1 220 ? 197.099 166.346 -11.003 1.00 15.49 ? 341  ILE A O     1 
ATOM   1802 C  CB    . ILE A 1 220 ? 198.425 167.544 -8.133  1.00 14.61 ? 341  ILE A CB    1 
ATOM   1803 C  CG1   . ILE A 1 220 ? 198.636 166.991 -6.722  1.00 9.86  ? 341  ILE A CG1   1 
ATOM   1804 C  CG2   . ILE A 1 220 ? 197.031 168.173 -8.284  1.00 10.21 ? 341  ILE A CG2   1 
ATOM   1805 C  CD1   . ILE A 1 220 ? 198.865 168.066 -5.710  1.00 10.30 ? 341  ILE A CD1   1 
ATOM   1806 N  N     . SER A 1 221 ? 198.911 167.677 -11.165 1.00 17.49 ? 342  SER A N     1 
ATOM   1807 C  CA    . SER A 1 221 ? 198.556 168.185 -12.479 1.00 19.50 ? 342  SER A CA    1 
ATOM   1808 C  C     . SER A 1 221 ? 198.385 167.065 -13.518 1.00 18.65 ? 342  SER A C     1 
ATOM   1809 O  O     . SER A 1 221 ? 197.544 167.157 -14.414 1.00 17.15 ? 342  SER A O     1 
ATOM   1810 C  CB    . SER A 1 221 ? 199.638 169.153 -12.927 1.00 19.12 ? 342  SER A CB    1 
ATOM   1811 O  OG    . SER A 1 221 ? 199.178 169.899 -14.023 1.00 28.84 ? 342  SER A OG    1 
ATOM   1812 N  N     . ARG A 1 222 ? 199.209 166.027 -13.391 1.00 16.76 ? 343  ARG A N     1 
ATOM   1813 C  CA    . ARG A 1 222 ? 199.187 164.881 -14.291 1.00 16.82 ? 343  ARG A CA    1 
ATOM   1814 C  C     . ARG A 1 222 ? 198.213 163.833 -13.749 1.00 17.95 ? 343  ARG A C     1 
ATOM   1815 O  O     . ARG A 1 222 ? 197.789 162.927 -14.470 1.00 18.61 ? 343  ARG A O     1 
ATOM   1816 C  CB    . ARG A 1 222 ? 200.563 164.214 -14.356 1.00 19.40 ? 343  ARG A CB    1 
ATOM   1817 C  CG    . ARG A 1 222 ? 201.744 165.034 -14.873 1.00 20.85 ? 343  ARG A CG    1 
ATOM   1818 C  CD    . ARG A 1 222 ? 202.986 164.139 -14.768 1.00 22.63 ? 343  ARG A CD    1 
ATOM   1819 N  NE    . ARG A 1 222 ? 204.181 164.667 -15.420 1.00 29.67 ? 343  ARG A NE    1 
ATOM   1820 C  CZ    . ARG A 1 222 ? 205.296 163.964 -15.619 1.00 29.30 ? 343  ARG A CZ    1 
ATOM   1821 N  NH1   . ARG A 1 222 ? 205.362 162.702 -15.211 1.00 27.60 ? 343  ARG A NH1   1 
ATOM   1822 N  NH2   . ARG A 1 222 ? 206.337 164.521 -16.239 1.00 30.90 ? 343  ARG A NH2   1 
ATOM   1823 N  N     . VAL A 1 223 ? 197.880 163.963 -12.465 1.00 16.47 ? 344  VAL A N     1 
ATOM   1824 C  CA    . VAL A 1 223 ? 197.014 163.027 -11.767 1.00 15.15 ? 344  VAL A CA    1 
ATOM   1825 C  C     . VAL A 1 223 ? 197.751 161.702 -11.847 1.00 19.48 ? 344  VAL A C     1 
ATOM   1826 O  O     . VAL A 1 223 ? 197.240 160.697 -12.362 1.00 17.59 ? 344  VAL A O     1 
ATOM   1827 C  CB    . VAL A 1 223 ? 195.644 162.882 -12.427 1.00 14.04 ? 344  VAL A CB    1 
ATOM   1828 C  CG1   . VAL A 1 223 ? 194.791 161.919 -11.603 1.00 14.73 ? 344  VAL A CG1   1 
ATOM   1829 C  CG2   . VAL A 1 223 ? 194.949 164.217 -12.503 1.00 14.41 ? 344  VAL A CG2   1 
ATOM   1830 N  N     . GLU A 1 224 ? 198.970 161.733 -11.320 1.00 20.63 ? 345  GLU A N     1 
ATOM   1831 C  CA    . GLU A 1 224 ? 199.883 160.600 -11.314 1.00 21.68 ? 345  GLU A CA    1 
ATOM   1832 C  C     . GLU A 1 224 ? 199.906 159.839 -9.990  1.00 21.02 ? 345  GLU A C     1 
ATOM   1833 O  O     . GLU A 1 224 ? 200.516 160.289 -9.009  1.00 22.86 ? 345  GLU A O     1 
ATOM   1834 C  CB    . GLU A 1 224 ? 201.297 161.116 -11.635 1.00 22.57 ? 345  GLU A CB    1 
ATOM   1835 C  CG    . GLU A 1 224 ? 202.291 160.066 -12.115 1.00 29.02 ? 345  GLU A CG    1 
ATOM   1836 C  CD    . GLU A 1 224 ? 203.609 160.693 -12.596 1.00 34.43 ? 345  GLU A CD    1 
ATOM   1837 O  OE1   . GLU A 1 224 ? 203.572 161.826 -13.143 1.00 41.54 ? 345  GLU A OE1   1 
ATOM   1838 O  OE2   . GLU A 1 224 ? 204.677 160.062 -12.448 1.00 34.88 ? 345  GLU A OE2   1 
ATOM   1839 N  N     . PHE A 1 225 ? 199.260 158.679 -9.953  1.00 20.71 ? 346  PHE A N     1 
ATOM   1840 C  CA    . PHE A 1 225 ? 199.268 157.868 -8.730  1.00 20.54 ? 346  PHE A CA    1 
ATOM   1841 C  C     . PHE A 1 225 ? 198.893 156.424 -9.065  1.00 19.41 ? 346  PHE A C     1 
ATOM   1842 O  O     . PHE A 1 225 ? 198.376 156.142 -10.153 1.00 21.26 ? 346  PHE A O     1 
ATOM   1843 C  CB    . PHE A 1 225 ? 198.272 158.454 -7.705  1.00 19.53 ? 346  PHE A CB    1 
ATOM   1844 C  CG    . PHE A 1 225 ? 196.835 158.138 -8.013  1.00 21.11 ? 346  PHE A CG    1 
ATOM   1845 C  CD1   . PHE A 1 225 ? 196.203 157.064 -7.403  1.00 22.02 ? 346  PHE A CD1   1 
ATOM   1846 C  CD2   . PHE A 1 225 ? 196.130 158.888 -8.936  1.00 18.36 ? 346  PHE A CD2   1 
ATOM   1847 C  CE1   . PHE A 1 225 ? 194.878 156.744 -7.713  1.00 24.10 ? 346  PHE A CE1   1 
ATOM   1848 C  CE2   . PHE A 1 225 ? 194.807 158.574 -9.253  1.00 23.07 ? 346  PHE A CE2   1 
ATOM   1849 C  CZ    . PHE A 1 225 ? 194.181 157.500 -8.640  1.00 22.64 ? 346  PHE A CZ    1 
ATOM   1850 N  N     . THR A 1 226 ? 199.158 155.512 -8.137  1.00 17.51 ? 347  THR A N     1 
ATOM   1851 C  CA    . THR A 1 226 ? 198.809 154.113 -8.335  1.00 15.60 ? 347  THR A CA    1 
ATOM   1852 C  C     . THR A 1 226 ? 198.245 153.623 -7.026  1.00 14.01 ? 347  THR A C     1 
ATOM   1853 O  O     . THR A 1 226 ? 198.322 154.324 -6.030  1.00 14.17 ? 347  THR A O     1 
ATOM   1854 C  CB    . THR A 1 226 ? 200.042 153.259 -8.736  1.00 17.00 ? 347  THR A CB    1 
ATOM   1855 O  OG1   . THR A 1 226 ? 201.113 153.494 -7.812  1.00 20.54 ? 347  THR A OG1   1 
ATOM   1856 C  CG2   . THR A 1 226 ? 200.506 153.617 -10.145 1.00 14.88 ? 347  THR A CG2   1 
ATOM   1857 N  N     . PHE A 1 227 ? 197.659 152.434 -7.029  1.00 14.30 ? 348  PHE A N     1 
ATOM   1858 C  CA    . PHE A 1 227 ? 197.097 151.875 -5.809  1.00 15.62 ? 348  PHE A CA    1 
ATOM   1859 C  C     . PHE A 1 227 ? 197.936 150.690 -5.379  1.00 17.39 ? 348  PHE A C     1 
ATOM   1860 O  O     . PHE A 1 227 ? 198.493 149.986 -6.222  1.00 17.79 ? 348  PHE A O     1 
ATOM   1861 C  CB    . PHE A 1 227 ? 195.673 151.335 -6.022  1.00 13.71 ? 348  PHE A CB    1 
ATOM   1862 C  CG    . PHE A 1 227 ? 194.678 152.345 -6.553  1.00 14.90 ? 348  PHE A CG    1 
ATOM   1863 C  CD1   . PHE A 1 227 ? 194.476 152.496 -7.926  1.00 14.48 ? 348  PHE A CD1   1 
ATOM   1864 C  CD2   . PHE A 1 227 ? 193.915 153.115 -5.678  1.00 14.25 ? 348  PHE A CD2   1 
ATOM   1865 C  CE1   . PHE A 1 227 ? 193.520 153.399 -8.421  1.00 13.33 ? 348  PHE A CE1   1 
ATOM   1866 C  CE2   . PHE A 1 227 ? 192.956 154.020 -6.160  1.00 12.61 ? 348  PHE A CE2   1 
ATOM   1867 C  CZ    . PHE A 1 227 ? 192.758 154.162 -7.530  1.00 13.12 ? 348  PHE A CZ    1 
ATOM   1868 N  N     . PRO A 1 228 ? 198.077 150.478 -4.060  1.00 19.22 ? 349  PRO A N     1 
ATOM   1869 C  CA    . PRO A 1 228 ? 198.843 149.326 -3.550  1.00 18.28 ? 349  PRO A CA    1 
ATOM   1870 C  C     . PRO A 1 228 ? 197.913 148.144 -3.906  1.00 18.89 ? 349  PRO A C     1 
ATOM   1871 O  O     . PRO A 1 228 ? 196.765 148.365 -4.282  1.00 18.06 ? 349  PRO A O     1 
ATOM   1872 C  CB    . PRO A 1 228 ? 198.881 149.550 -2.034  1.00 19.47 ? 349  PRO A CB    1 
ATOM   1873 C  CG    . PRO A 1 228 ? 198.663 151.042 -1.874  1.00 21.78 ? 349  PRO A CG    1 
ATOM   1874 C  CD    . PRO A 1 228 ? 197.716 151.428 -2.984  1.00 20.64 ? 349  PRO A CD    1 
ATOM   1875 N  N     . ASP A 1 229 ? 198.360 146.901 -3.778  1.00 22.60 ? 350  ASP A N     1 
ATOM   1876 C  CA    . ASP A 1 229 ? 197.488 145.780 -4.137  1.00 24.29 ? 350  ASP A CA    1 
ATOM   1877 C  C     . ASP A 1 229 ? 196.293 145.489 -3.238  1.00 23.99 ? 350  ASP A C     1 
ATOM   1878 O  O     . ASP A 1 229 ? 195.352 144.835 -3.671  1.00 23.48 ? 350  ASP A O     1 
ATOM   1879 C  CB    . ASP A 1 229 ? 198.312 144.494 -4.298  1.00 28.79 ? 350  ASP A CB    1 
ATOM   1880 C  CG    . ASP A 1 229 ? 199.378 144.608 -5.404  1.00 33.91 ? 350  ASP A CG    1 
ATOM   1881 O  OD1   . ASP A 1 229 ? 200.001 143.575 -5.741  1.00 33.53 ? 350  ASP A OD1   1 
ATOM   1882 O  OD2   . ASP A 1 229 ? 199.591 145.733 -5.928  1.00 35.29 ? 350  ASP A OD2   1 
ATOM   1883 N  N     . PHE A 1 230 ? 196.279 145.964 -2.003  1.00 22.20 ? 351  PHE A N     1 
ATOM   1884 C  CA    . PHE A 1 230 ? 195.125 145.636 -1.171  1.00 23.75 ? 351  PHE A CA    1 
ATOM   1885 C  C     . PHE A 1 230 ? 193.883 146.509 -1.382  1.00 24.86 ? 351  PHE A C     1 
ATOM   1886 O  O     . PHE A 1 230 ? 192.826 146.215 -0.820  1.00 26.36 ? 351  PHE A O     1 
ATOM   1887 C  CB    . PHE A 1 230 ? 195.510 145.662 0.300   1.00 22.72 ? 351  PHE A CB    1 
ATOM   1888 C  CG    . PHE A 1 230 ? 196.082 146.956 0.738   1.00 20.40 ? 351  PHE A CG    1 
ATOM   1889 C  CD1   . PHE A 1 230 ? 197.451 147.151 0.756   1.00 17.28 ? 351  PHE A CD1   1 
ATOM   1890 C  CD2   . PHE A 1 230 ? 195.245 147.994 1.111   1.00 19.08 ? 351  PHE A CD2   1 
ATOM   1891 C  CE1   . PHE A 1 230 ? 197.983 148.379 1.142   1.00 21.72 ? 351  PHE A CE1   1 
ATOM   1892 C  CE2   . PHE A 1 230 ? 195.761 149.217 1.497   1.00 19.31 ? 351  PHE A CE2   1 
ATOM   1893 C  CZ    . PHE A 1 230 ? 197.128 149.417 1.515   1.00 20.15 ? 351  PHE A CZ    1 
ATOM   1894 N  N     . VAL A 1 231 ? 193.999 147.575 -2.174  1.00 22.98 ? 352  VAL A N     1 
ATOM   1895 C  CA    . VAL A 1 231 ? 192.845 148.431 -2.428  1.00 22.53 ? 352  VAL A CA    1 
ATOM   1896 C  C     . VAL A 1 231 ? 191.941 147.702 -3.416  1.00 22.85 ? 352  VAL A C     1 
ATOM   1897 O  O     . VAL A 1 231 ? 192.351 147.406 -4.541  1.00 25.56 ? 352  VAL A O     1 
ATOM   1898 C  CB    . VAL A 1 231 ? 193.297 149.810 -2.976  1.00 19.91 ? 352  VAL A CB    1 
ATOM   1899 C  CG1   . VAL A 1 231 ? 192.105 150.680 -3.293  1.00 15.94 ? 352  VAL A CG1   1 
ATOM   1900 C  CG2   . VAL A 1 231 ? 194.164 150.489 -1.936  1.00 17.58 ? 352  VAL A CG2   1 
ATOM   1901 N  N     . THR A 1 232 ? 190.722 147.393 -2.985  1.00 20.20 ? 353  THR A N     1 
ATOM   1902 C  CA    . THR A 1 232 ? 189.786 146.668 -3.833  1.00 20.47 ? 353  THR A CA    1 
ATOM   1903 C  C     . THR A 1 232 ? 189.331 147.452 -5.049  1.00 23.02 ? 353  THR A C     1 
ATOM   1904 O  O     . THR A 1 232 ? 189.525 148.665 -5.144  1.00 21.93 ? 353  THR A O     1 
ATOM   1905 C  CB    . THR A 1 232 ? 188.530 146.264 -3.059  1.00 18.44 ? 353  THR A CB    1 
ATOM   1906 O  OG1   . THR A 1 232 ? 187.777 147.445 -2.740  1.00 19.14 ? 353  THR A OG1   1 
ATOM   1907 C  CG2   . THR A 1 232 ? 188.915 145.544 -1.786  1.00 15.00 ? 353  THR A CG2   1 
ATOM   1908 N  N     . GLU A 1 233 ? 188.685 146.733 -5.960  1.00 23.98 ? 354  GLU A N     1 
ATOM   1909 C  CA    . GLU A 1 233 ? 188.175 147.274 -7.208  1.00 25.43 ? 354  GLU A CA    1 
ATOM   1910 C  C     . GLU A 1 233 ? 187.175 148.424 -7.055  1.00 24.34 ? 354  GLU A C     1 
ATOM   1911 O  O     . GLU A 1 233 ? 187.182 149.386 -7.840  1.00 24.85 ? 354  GLU A O     1 
ATOM   1912 C  CB    . GLU A 1 233 ? 187.543 146.130 -8.001  1.00 30.21 ? 354  GLU A CB    1 
ATOM   1913 C  CG    . GLU A 1 233 ? 186.780 146.540 -9.261  1.00 37.82 ? 354  GLU A CG    1 
ATOM   1914 C  CD    . GLU A 1 233 ? 186.031 145.351 -9.890  1.00 41.79 ? 354  GLU A CD    1 
ATOM   1915 O  OE1   . GLU A 1 233 ? 185.501 145.472 -11.025 1.00 43.51 ? 354  GLU A OE1   1 
ATOM   1916 O  OE2   . GLU A 1 233 ? 185.974 144.281 -9.224  1.00 44.80 ? 354  GLU A OE2   1 
ATOM   1917 N  N     . GLY A 1 234 ? 186.298 148.303 -6.065  1.00 20.96 ? 355  GLY A N     1 
ATOM   1918 C  CA    . GLY A 1 234 ? 185.289 149.314 -5.842  1.00 13.82 ? 355  GLY A CA    1 
ATOM   1919 C  C     . GLY A 1 234 ? 185.908 150.595 -5.333  1.00 16.94 ? 355  GLY A C     1 
ATOM   1920 O  O     . GLY A 1 234 ? 185.529 151.694 -5.760  1.00 13.60 ? 355  GLY A O     1 
ATOM   1921 N  N     . ALA A 1 235 ? 186.868 150.473 -4.425  1.00 15.45 ? 356  ALA A N     1 
ATOM   1922 C  CA    . ALA A 1 235 ? 187.501 151.674 -3.909  1.00 19.10 ? 356  ALA A CA    1 
ATOM   1923 C  C     . ALA A 1 235 ? 188.235 152.381 -5.068  1.00 19.08 ? 356  ALA A C     1 
ATOM   1924 O  O     . ALA A 1 235 ? 188.203 153.604 -5.162  1.00 16.84 ? 356  ALA A O     1 
ATOM   1925 C  CB    . ALA A 1 235 ? 188.475 151.326 -2.761  1.00 18.64 ? 356  ALA A CB    1 
ATOM   1926 N  N     . ARG A 1 236 ? 188.874 151.611 -5.951  1.00 18.44 ? 357  ARG A N     1 
ATOM   1927 C  CA    . ARG A 1 236 ? 189.586 152.184 -7.100  1.00 18.13 ? 357  ARG A CA    1 
ATOM   1928 C  C     . ARG A 1 236 ? 188.627 152.856 -8.062  1.00 17.28 ? 357  ARG A C     1 
ATOM   1929 O  O     . ARG A 1 236 ? 188.949 153.878 -8.637  1.00 16.53 ? 357  ARG A O     1 
ATOM   1930 C  CB    . ARG A 1 236 ? 190.349 151.113 -7.881  1.00 16.00 ? 357  ARG A CB    1 
ATOM   1931 C  CG    . ARG A 1 236 ? 191.447 150.447 -7.112  1.00 15.75 ? 357  ARG A CG    1 
ATOM   1932 C  CD    . ARG A 1 236 ? 192.125 149.414 -7.941  1.00 14.24 ? 357  ARG A CD    1 
ATOM   1933 N  NE    . ARG A 1 236 ? 193.120 148.721 -7.139  1.00 18.00 ? 357  ARG A NE    1 
ATOM   1934 C  CZ    . ARG A 1 236 ? 194.249 148.203 -7.607  1.00 18.74 ? 357  ARG A CZ    1 
ATOM   1935 N  NH1   . ARG A 1 236 ? 194.553 148.285 -8.898  1.00 21.62 ? 357  ARG A NH1   1 
ATOM   1936 N  NH2   . ARG A 1 236 ? 195.097 147.622 -6.768  1.00 20.49 ? 357  ARG A NH2   1 
ATOM   1937 N  N     . ASP A 1 237 ? 187.454 152.272 -8.261  1.00 17.73 ? 358  ASP A N     1 
ATOM   1938 C  CA    . ASP A 1 237 ? 186.511 152.887 -9.176  1.00 17.93 ? 358  ASP A CA    1 
ATOM   1939 C  C     . ASP A 1 237 ? 186.081 154.234 -8.611  1.00 17.83 ? 358  ASP A C     1 
ATOM   1940 O  O     . ASP A 1 237 ? 185.996 155.206 -9.348  1.00 20.18 ? 358  ASP A O     1 
ATOM   1941 C  CB    . ASP A 1 237 ? 185.267 152.024 -9.389  1.00 21.16 ? 358  ASP A CB    1 
ATOM   1942 C  CG    . ASP A 1 237 ? 184.269 152.688 -10.327 1.00 23.93 ? 358  ASP A CG    1 
ATOM   1943 O  OD1   . ASP A 1 237 ? 184.508 152.671 -11.559 1.00 29.93 ? 358  ASP A OD1   1 
ATOM   1944 O  OD2   . ASP A 1 237 ? 183.266 153.257 -9.840  1.00 22.82 ? 358  ASP A OD2   1 
ATOM   1945 N  N     . LEU A 1 238 ? 185.823 154.299 -7.303  1.00 16.69 ? 359  LEU A N     1 
ATOM   1946 C  CA    . LEU A 1 238 ? 185.389 155.543 -6.680  1.00 15.23 ? 359  LEU A CA    1 
ATOM   1947 C  C     . LEU A 1 238 ? 186.478 156.623 -6.646  1.00 15.38 ? 359  LEU A C     1 
ATOM   1948 O  O     . LEU A 1 238 ? 186.234 157.740 -7.071  1.00 16.61 ? 359  LEU A O     1 
ATOM   1949 C  CB    . LEU A 1 238 ? 184.873 155.292 -5.250  1.00 13.90 ? 359  LEU A CB    1 
ATOM   1950 C  CG    . LEU A 1 238 ? 184.459 156.568 -4.482  1.00 15.76 ? 359  LEU A CG    1 
ATOM   1951 C  CD1   . LEU A 1 238 ? 183.222 157.164 -5.105  1.00 14.16 ? 359  LEU A CD1   1 
ATOM   1952 C  CD2   . LEU A 1 238 ? 184.210 156.266 -3.027  1.00 16.19 ? 359  LEU A CD2   1 
ATOM   1953 N  N     . ILE A 1 239 ? 187.661 156.300 -6.132  1.00 15.08 ? 360  ILE A N     1 
ATOM   1954 C  CA    . ILE A 1 239 ? 188.737 157.280 -6.054  1.00 16.09 ? 360  ILE A CA    1 
ATOM   1955 C  C     . ILE A 1 239 ? 189.126 157.752 -7.457  1.00 18.67 ? 360  ILE A C     1 
ATOM   1956 O  O     . ILE A 1 239 ? 189.433 158.935 -7.652  1.00 19.76 ? 360  ILE A O     1 
ATOM   1957 C  CB    . ILE A 1 239 ? 189.972 156.694 -5.305  1.00 13.18 ? 360  ILE A CB    1 
ATOM   1958 C  CG1   . ILE A 1 239 ? 189.613 156.445 -3.843  1.00 11.43 ? 360  ILE A CG1   1 
ATOM   1959 C  CG2   . ILE A 1 239 ? 191.132 157.645 -5.348  1.00 8.95  ? 360  ILE A CG2   1 
ATOM   1960 C  CD1   . ILE A 1 239 ? 190.486 155.406 -3.211  1.00 15.13 ? 360  ILE A CD1   1 
ATOM   1961 N  N     . SER A 1 240 ? 189.099 156.841 -8.427  1.00 17.86 ? 361  SER A N     1 
ATOM   1962 C  CA    . SER A 1 240 ? 189.437 157.193 -9.792  1.00 17.51 ? 361  SER A CA    1 
ATOM   1963 C  C     . SER A 1 240 ? 188.438 158.163 -10.382 1.00 18.63 ? 361  SER A C     1 
ATOM   1964 O  O     . SER A 1 240 ? 188.805 159.011 -11.209 1.00 19.26 ? 361  SER A O     1 
ATOM   1965 C  CB    . SER A 1 240 ? 189.511 155.952 -10.682 1.00 18.17 ? 361  SER A CB    1 
ATOM   1966 O  OG    . SER A 1 240 ? 190.686 155.223 -10.384 1.00 20.30 ? 361  SER A OG    1 
ATOM   1967 N  N     . ARG A 1 241 ? 187.175 158.051 -9.977  1.00 18.68 ? 362  ARG A N     1 
ATOM   1968 C  CA    . ARG A 1 241 ? 186.156 158.973 -10.492 1.00 17.96 ? 362  ARG A CA    1 
ATOM   1969 C  C     . ARG A 1 241 ? 186.287 160.332 -9.817  1.00 16.66 ? 362  ARG A C     1 
ATOM   1970 O  O     . ARG A 1 241 ? 186.086 161.367 -10.452 1.00 21.59 ? 362  ARG A O     1 
ATOM   1971 C  CB    . ARG A 1 241 ? 184.740 158.464 -10.227 1.00 18.15 ? 362  ARG A CB    1 
ATOM   1972 C  CG    . ARG A 1 241 ? 184.389 157.189 -10.948 1.00 21.87 ? 362  ARG A CG    1 
ATOM   1973 C  CD    . ARG A 1 241 ? 182.950 156.762 -10.710 1.00 24.92 ? 362  ARG A CD    1 
ATOM   1974 N  NE    . ARG A 1 241 ? 182.669 155.532 -11.449 1.00 31.73 ? 362  ARG A NE    1 
ATOM   1975 C  CZ    . ARG A 1 241 ? 182.150 155.461 -12.682 1.00 35.25 ? 362  ARG A CZ    1 
ATOM   1976 N  NH1   . ARG A 1 241 ? 181.805 156.557 -13.358 1.00 34.91 ? 362  ARG A NH1   1 
ATOM   1977 N  NH2   . ARG A 1 241 ? 182.052 154.276 -13.281 1.00 35.12 ? 362  ARG A NH2   1 
ATOM   1978 N  N     . LEU A 1 242 ? 186.602 160.348 -8.527  1.00 15.31 ? 363  LEU A N     1 
ATOM   1979 C  CA    . LEU A 1 242 ? 186.726 161.620 -7.814  1.00 15.39 ? 363  LEU A CA    1 
ATOM   1980 C  C     . LEU A 1 242 ? 187.989 162.357 -8.252  1.00 16.50 ? 363  LEU A C     1 
ATOM   1981 O  O     . LEU A 1 242 ? 188.033 163.593 -8.252  1.00 16.60 ? 363  LEU A O     1 
ATOM   1982 C  CB    . LEU A 1 242 ? 186.758 161.376 -6.295  1.00 13.54 ? 363  LEU A CB    1 
ATOM   1983 C  CG    . LEU A 1 242 ? 185.452 160.880 -5.638  1.00 14.63 ? 363  LEU A CG    1 
ATOM   1984 C  CD1   . LEU A 1 242 ? 185.723 160.358 -4.216  1.00 12.73 ? 363  LEU A CD1   1 
ATOM   1985 C  CD2   . LEU A 1 242 ? 184.423 162.005 -5.613  1.00 7.80  ? 363  LEU A CD2   1 
ATOM   1986 N  N     . LEU A 1 243 ? 189.008 161.597 -8.656  1.00 17.23 ? 364  LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 243 ? 190.285 162.182 -9.051  1.00 20.15 ? 364  LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 243 ? 190.474 162.393 -10.557 1.00 19.92 ? 364  LEU A C     1 
ATOM   1989 O  O     . LEU A 1 243 ? 191.511 162.052 -11.143 1.00 20.12 ? 364  LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 243 ? 191.419 161.335 -8.467  1.00 18.29 ? 364  LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 243 ? 191.504 161.377 -6.926  1.00 20.11 ? 364  LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 243 ? 192.737 160.607 -6.509  1.00 16.10 ? 364  LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 243 ? 191.576 162.820 -6.413  1.00 16.30 ? 364  LEU A CD2   1 
ATOM   1994 N  N     . LYS A 1 244 ? 189.450 162.967 -11.169 1.00 19.36 ? 365  LYS A N     1 
ATOM   1995 C  CA    . LYS A 1 244 ? 189.461 163.275 -12.581 1.00 19.00 ? 365  LYS A CA    1 
ATOM   1996 C  C     . LYS A 1 244 ? 190.039 164.670 -12.715 1.00 18.75 ? 365  LYS A C     1 
ATOM   1997 O  O     . LYS A 1 244 ? 189.654 165.568 -11.956 1.00 15.64 ? 365  LYS A O     1 
ATOM   1998 C  CB    . LYS A 1 244 ? 188.039 163.289 -13.117 1.00 22.47 ? 365  LYS A CB    1 
ATOM   1999 C  CG    . LYS A 1 244 ? 187.417 161.929 -13.243 1.00 23.42 ? 365  LYS A CG    1 
ATOM   2000 C  CD    . LYS A 1 244 ? 188.039 161.224 -14.400 1.00 23.31 ? 365  LYS A CD    1 
ATOM   2001 C  CE    . LYS A 1 244 ? 187.320 159.930 -14.693 1.00 24.89 ? 365  LYS A CE    1 
ATOM   2002 N  NZ    . LYS A 1 244 ? 187.970 159.249 -15.851 1.00 30.35 ? 365  LYS A NZ    1 
ATOM   2003 N  N     . HIS A 1 245 ? 190.949 164.850 -13.676 1.00 17.07 ? 366  HIS A N     1 
ATOM   2004 C  CA    . HIS A 1 245 ? 191.568 166.150 -13.920 1.00 17.25 ? 366  HIS A CA    1 
ATOM   2005 C  C     . HIS A 1 245 ? 190.493 167.186 -14.291 1.00 17.88 ? 366  HIS A C     1 
ATOM   2006 O  O     . HIS A 1 245 ? 190.553 168.334 -13.864 1.00 14.94 ? 366  HIS A O     1 
ATOM   2007 C  CB    . HIS A 1 245 ? 192.611 166.038 -15.043 1.00 15.66 ? 366  HIS A CB    1 
ATOM   2008 C  CG    . HIS A 1 245 ? 193.302 167.331 -15.352 1.00 18.71 ? 366  HIS A CG    1 
ATOM   2009 N  ND1   . HIS A 1 245 ? 192.763 168.283 -16.194 1.00 19.79 ? 366  HIS A ND1   1 
ATOM   2010 C  CD2   . HIS A 1 245 ? 194.437 167.877 -14.849 1.00 17.17 ? 366  HIS A CD2   1 
ATOM   2011 C  CE1   . HIS A 1 245 ? 193.530 169.361 -16.187 1.00 18.47 ? 366  HIS A CE1   1 
ATOM   2012 N  NE2   . HIS A 1 245 ? 194.552 169.141 -15.378 1.00 18.20 ? 366  HIS A NE2   1 
ATOM   2013 N  N     . ASN A 1 246 ? 189.500 166.769 -15.071 1.00 19.37 ? 367  ASN A N     1 
ATOM   2014 C  CA    . ASN A 1 246 ? 188.436 167.676 -15.490 1.00 22.11 ? 367  ASN A CA    1 
ATOM   2015 C  C     . ASN A 1 246 ? 187.348 167.721 -14.412 1.00 22.00 ? 367  ASN A C     1 
ATOM   2016 O  O     . ASN A 1 246 ? 186.644 166.739 -14.198 1.00 21.37 ? 367  ASN A O     1 
ATOM   2017 C  CB    . ASN A 1 246 ? 187.841 167.205 -16.823 1.00 24.11 ? 367  ASN A CB    1 
ATOM   2018 C  CG    . ASN A 1 246 ? 186.929 168.246 -17.452 1.00 29.29 ? 367  ASN A CG    1 
ATOM   2019 O  OD1   . ASN A 1 246 ? 185.990 168.718 -16.827 1.00 34.30 ? 367  ASN A OD1   1 
ATOM   2020 N  ND2   . ASN A 1 246 ? 187.209 168.611 -18.688 1.00 31.42 ? 367  ASN A ND2   1 
ATOM   2021 N  N     . PRO A 1 247 ? 187.174 168.881 -13.751 1.00 22.13 ? 368  PRO A N     1 
ATOM   2022 C  CA    . PRO A 1 247 ? 186.181 169.073 -12.682 1.00 21.45 ? 368  PRO A CA    1 
ATOM   2023 C  C     . PRO A 1 247 ? 184.755 168.638 -13.047 1.00 22.70 ? 368  PRO A C     1 
ATOM   2024 O  O     . PRO A 1 247 ? 184.016 168.091 -12.209 1.00 21.09 ? 368  PRO A O     1 
ATOM   2025 C  CB    . PRO A 1 247 ? 186.292 170.571 -12.377 1.00 23.08 ? 368  PRO A CB    1 
ATOM   2026 C  CG    . PRO A 1 247 ? 187.705 170.942 -12.864 1.00 19.70 ? 368  PRO A CG    1 
ATOM   2027 C  CD    . PRO A 1 247 ? 187.763 170.174 -14.151 1.00 21.11 ? 368  PRO A CD    1 
ATOM   2028 N  N     . SER A 1 248 ? 184.386 168.865 -14.303 1.00 21.10 ? 369  SER A N     1 
ATOM   2029 C  CA    . SER A 1 248 ? 183.068 168.492 -14.818 1.00 25.15 ? 369  SER A CA    1 
ATOM   2030 C  C     . SER A 1 248 ? 182.809 166.986 -14.785 1.00 23.28 ? 369  SER A C     1 
ATOM   2031 O  O     . SER A 1 248 ? 181.685 166.555 -14.591 1.00 26.91 ? 369  SER A O     1 
ATOM   2032 C  CB    . SER A 1 248 ? 182.919 168.982 -16.263 1.00 25.61 ? 369  SER A CB    1 
ATOM   2033 O  OG    . SER A 1 248 ? 183.115 170.391 -16.341 1.00 37.93 ? 369  SER A OG    1 
ATOM   2034 N  N     . GLN A 1 249 ? 183.848 166.196 -14.995 1.00 20.71 ? 370  GLN A N     1 
ATOM   2035 C  CA    . GLN A 1 249 ? 183.744 164.749 -15.009 1.00 21.53 ? 370  GLN A CA    1 
ATOM   2036 C  C     . GLN A 1 249 ? 183.688 164.073 -13.665 1.00 20.69 ? 370  GLN A C     1 
ATOM   2037 O  O     . GLN A 1 249 ? 183.444 162.864 -13.600 1.00 19.42 ? 370  GLN A O     1 
ATOM   2038 C  CB    . GLN A 1 249 ? 184.922 164.172 -15.785 1.00 24.23 ? 370  GLN A CB    1 
ATOM   2039 C  CG    . GLN A 1 249 ? 184.674 164.178 -17.279 1.00 31.18 ? 370  GLN A CG    1 
ATOM   2040 C  CD    . GLN A 1 249 ? 185.948 164.183 -18.045 1.00 38.83 ? 370  GLN A CD    1 
ATOM   2041 O  OE1   . GLN A 1 249 ? 186.879 163.380 -17.767 1.00 41.58 ? 370  GLN A OE1   1 
ATOM   2042 N  NE2   . GLN A 1 249 ? 186.033 165.098 -19.038 1.00 43.83 ? 370  GLN A NE2   1 
ATOM   2043 N  N     . ARG A 1 250 ? 183.940 164.804 -12.585 1.00 18.88 ? 371  ARG A N     1 
ATOM   2044 C  CA    . ARG A 1 250 ? 183.906 164.189 -11.252 1.00 21.24 ? 371  ARG A CA    1 
ATOM   2045 C  C     . ARG A 1 250 ? 182.440 164.038 -10.854 1.00 22.37 ? 371  ARG A C     1 
ATOM   2046 O  O     . ARG A 1 250 ? 181.601 164.841 -11.176 1.00 22.50 ? 371  ARG A O     1 
ATOM   2047 C  CB    . ARG A 1 250 ? 184.612 165.072 -10.231 1.00 17.55 ? 371  ARG A CB    1 
ATOM   2048 C  CG    . ARG A 1 250 ? 186.104 165.158 -10.394 1.00 15.36 ? 371  ARG A CG    1 
ATOM   2049 C  CD    . ARG A 1 250 ? 186.643 166.286 -9.564  1.00 11.86 ? 371  ARG A CD    1 
ATOM   2050 N  NE    . ARG A 1 250 ? 187.913 166.739 -10.108 1.00 12.57 ? 371  ARG A NE    1 
ATOM   2051 C  CZ    . ARG A 1 250 ? 188.440 167.951 -9.938  1.00 14.14 ? 371  ARG A CZ    1 
ATOM   2052 N  NH1   . ARG A 1 250 ? 187.817 168.878 -9.216  1.00 10.91 ? 371  ARG A NH1   1 
ATOM   2053 N  NH2   . ARG A 1 250 ? 189.583 168.257 -10.545 1.00 9.48  ? 371  ARG A NH2   1 
ATOM   2054 N  N     . PRO A 1 251 ? 182.141 162.957 -10.111 1.00 23.64 ? 372  PRO A N     1 
ATOM   2055 C  CA    . PRO A 1 251 ? 180.757 162.663 -9.653  1.00 21.80 ? 372  PRO A CA    1 
ATOM   2056 C  C     . PRO A 1 251 ? 180.160 163.726 -8.739  1.00 21.72 ? 372  PRO A C     1 
ATOM   2057 O  O     . PRO A 1 251 ? 180.875 164.579 -8.217  1.00 23.11 ? 372  PRO A O     1 
ATOM   2058 C  CB    . PRO A 1 251 ? 180.923 161.269 -9.007  1.00 22.29 ? 372  PRO A CB    1 
ATOM   2059 C  CG    . PRO A 1 251 ? 182.365 161.227 -8.548  1.00 22.92 ? 372  PRO A CG    1 
ATOM   2060 C  CD    . PRO A 1 251 ? 183.165 162.051 -9.512  1.00 23.75 ? 372  PRO A CD    1 
ATOM   2061 N  N     . MET A 1 252 ? 178.840 163.740 -8.654  1.00 20.67 ? 373  MET A N     1 
ATOM   2062 C  CA    . MET A 1 252 ? 178.153 164.668 -7.731  1.00 19.68 ? 373  MET A CA    1 
ATOM   2063 C  C     . MET A 1 252 ? 178.231 163.942 -6.368  1.00 18.77 ? 373  MET A C     1 
ATOM   2064 O  O     . MET A 1 252 ? 178.518 162.750 -6.337  1.00 14.31 ? 373  MET A O     1 
ATOM   2065 C  CB    . MET A 1 252 ? 176.674 164.841 -8.137  1.00 25.32 ? 373  MET A CB    1 
ATOM   2066 C  CG    . MET A 1 252 ? 176.470 165.598 -9.397  1.00 29.58 ? 373  MET A CG    1 
ATOM   2067 S  SD    . MET A 1 252 ? 177.274 167.224 -9.216  1.00 44.08 ? 373  MET A SD    1 
ATOM   2068 C  CE    . MET A 1 252 ? 175.850 168.314 -8.571  1.00 34.35 ? 373  MET A CE    1 
ATOM   2069 N  N     . LEU A 1 253 ? 177.985 164.639 -5.257  1.00 16.82 ? 374  LEU A N     1 
ATOM   2070 C  CA    . LEU A 1 253 ? 178.041 163.984 -3.959  1.00 17.05 ? 374  LEU A CA    1 
ATOM   2071 C  C     . LEU A 1 253 ? 176.934 162.915 -3.837  1.00 18.65 ? 374  LEU A C     1 
ATOM   2072 O  O     . LEU A 1 253 ? 177.122 161.885 -3.201  1.00 19.21 ? 374  LEU A O     1 
ATOM   2073 C  CB    . LEU A 1 253 ? 177.959 165.010 -2.820  1.00 15.61 ? 374  LEU A CB    1 
ATOM   2074 C  CG    . LEU A 1 253 ? 179.224 165.888 -2.751  1.00 17.98 ? 374  LEU A CG    1 
ATOM   2075 C  CD1   . LEU A 1 253 ? 178.940 167.269 -2.145  1.00 8.94  ? 374  LEU A CD1   1 
ATOM   2076 C  CD2   . LEU A 1 253 ? 180.290 165.125 -1.973  1.00 12.26 ? 374  LEU A CD2   1 
ATOM   2077 N  N     . ARG A 1 254 ? 175.804 163.167 -4.504  1.00 18.78 ? 375  ARG A N     1 
ATOM   2078 C  CA    . ARG A 1 254 ? 174.657 162.248 -4.510  1.00 20.13 ? 375  ARG A CA    1 
ATOM   2079 C  C     . ARG A 1 254 ? 175.033 160.942 -5.178  1.00 21.00 ? 375  ARG A C     1 
ATOM   2080 O  O     . ARG A 1 254 ? 174.457 159.916 -4.909  1.00 21.05 ? 375  ARG A O     1 
ATOM   2081 C  CB    . ARG A 1 254 ? 173.504 162.813 -5.210  1.00 21.87 ? 375  ARG A CB    1 
ATOM   2082 N  N     . GLU A 1 255 ? 175.970 161.009 -6.106  1.00 23.11 ? 376  GLU A N     1 
ATOM   2083 C  CA    . GLU A 1 255 ? 176.419 159.788 -6.763  1.00 23.55 ? 376  GLU A CA    1 
ATOM   2084 C  C     . GLU A 1 255 ? 177.380 158.962 -5.852  1.00 23.36 ? 376  GLU A C     1 
ATOM   2085 O  O     . GLU A 1 255 ? 177.448 157.712 -5.874  1.00 25.32 ? 376  GLU A O     1 
ATOM   2086 C  CB    . GLU A 1 255 ? 177.142 160.139 -8.053  1.00 24.82 ? 376  GLU A CB    1 
ATOM   2087 C  CG    . GLU A 1 255 ? 176.400 161.110 -8.977  1.00 32.25 ? 376  GLU A CG    1 
ATOM   2088 C  CD    . GLU A 1 255 ? 177.239 161.561 -10.206 1.00 34.95 ? 376  GLU A CD    1 
ATOM   2089 O  OE1   . GLU A 1 255 ? 177.030 162.670 -10.770 1.00 37.06 ? 376  GLU A OE1   1 
ATOM   2090 O  OE2   . GLU A 1 255 ? 178.110 160.783 -10.630 1.00 37.87 ? 376  GLU A OE2   1 
ATOM   2091 N  N     . VAL A 1 256 ? 178.204 159.683 -5.113  1.00 20.65 ? 377  VAL A N     1 
ATOM   2092 C  CA    . VAL A 1 256 ? 179.168 159.065 -4.241  1.00 19.06 ? 377  VAL A CA    1 
ATOM   2093 C  C     . VAL A 1 256 ? 178.386 158.284 -3.229  1.00 20.23 ? 377  VAL A C     1 
ATOM   2094 O  O     . VAL A 1 256 ? 178.647 157.099 -3.037  1.00 20.59 ? 377  VAL A O     1 
ATOM   2095 C  CB    . VAL A 1 256 ? 180.021 160.117 -3.550  1.00 20.25 ? 377  VAL A CB    1 
ATOM   2096 C  CG1   . VAL A 1 256 ? 180.772 159.513 -2.415  1.00 14.07 ? 377  VAL A CG1   1 
ATOM   2097 C  CG2   . VAL A 1 256 ? 180.949 160.762 -4.587  1.00 16.78 ? 377  VAL A CG2   1 
ATOM   2098 N  N     . LEU A 1 257 ? 177.392 158.937 -2.620  1.00 20.07 ? 378  LEU A N     1 
ATOM   2099 C  CA    . LEU A 1 257 ? 176.526 158.314 -1.619  1.00 20.48 ? 378  LEU A CA    1 
ATOM   2100 C  C     . LEU A 1 257 ? 175.812 157.030 -2.120  1.00 22.64 ? 378  LEU A C     1 
ATOM   2101 O  O     . LEU A 1 257 ? 175.497 156.130 -1.318  1.00 21.93 ? 378  LEU A O     1 
ATOM   2102 C  CB    . LEU A 1 257 ? 175.514 159.346 -1.107  1.00 19.33 ? 378  LEU A CB    1 
ATOM   2103 C  CG    . LEU A 1 257 ? 175.794 160.087 0.237   1.00 25.33 ? 378  LEU A CG    1 
ATOM   2104 C  CD1   . LEU A 1 257 ? 177.197 159.794 0.722   1.00 23.60 ? 378  LEU A CD1   1 
ATOM   2105 C  CD2   . LEU A 1 257 ? 175.575 161.610 0.073   1.00 20.05 ? 378  LEU A CD2   1 
ATOM   2106 N  N     . GLU A 1 258 ? 175.612 156.930 -3.435  1.00 19.85 ? 379  GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 258 ? 174.972 155.756 -4.020  1.00 24.21 ? 379  GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 258 ? 175.989 154.817 -4.623  1.00 22.35 ? 379  GLU A C     1 
ATOM   2109 O  O     . GLU A 1 258 ? 175.607 153.788 -5.180  1.00 22.07 ? 379  GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 258 ? 174.038 156.118 -5.171  1.00 29.18 ? 379  GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 258 ? 173.003 157.140 -4.872  1.00 37.87 ? 379  GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 258 ? 172.172 157.458 -6.104  1.00 44.63 ? 379  GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 258 ? 172.774 157.586 -7.214  1.00 47.26 ? 379  GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 258 ? 170.924 157.587 -5.961  1.00 46.30 ? 379  GLU A OE2   1 
ATOM   2115 N  N     . HIS A 1 259 ? 177.268 155.165 -4.555  1.00 20.53 ? 380  HIS A N     1 
ATOM   2116 C  CA    . HIS A 1 259 ? 178.278 154.301 -5.145  1.00 20.63 ? 380  HIS A CA    1 
ATOM   2117 C  C     . HIS A 1 259 ? 178.209 152.904 -4.509  1.00 20.19 ? 380  HIS A C     1 
ATOM   2118 O  O     . HIS A 1 259 ? 178.129 152.774 -3.293  1.00 21.40 ? 380  HIS A O     1 
ATOM   2119 C  CB    . HIS A 1 259 ? 179.683 154.909 -4.995  1.00 15.41 ? 380  HIS A CB    1 
ATOM   2120 C  CG    . HIS A 1 259 ? 180.717 154.184 -5.800  1.00 17.05 ? 380  HIS A CG    1 
ATOM   2121 N  ND1   . HIS A 1 259 ? 181.129 152.901 -5.498  1.00 16.78 ? 380  HIS A ND1   1 
ATOM   2122 C  CD2   . HIS A 1 259 ? 181.309 154.493 -6.982  1.00 16.91 ? 380  HIS A CD2   1 
ATOM   2123 C  CE1   . HIS A 1 259 ? 181.918 152.453 -6.459  1.00 16.66 ? 380  HIS A CE1   1 
ATOM   2124 N  NE2   . HIS A 1 259 ? 182.042 153.399 -7.372  1.00 15.37 ? 380  HIS A NE2   1 
ATOM   2125 N  N     . PRO A 1 260 ? 178.231 151.843 -5.333  1.00 21.11 ? 381  PRO A N     1 
ATOM   2126 C  CA    . PRO A 1 260 ? 178.165 150.440 -4.874  1.00 22.07 ? 381  PRO A CA    1 
ATOM   2127 C  C     . PRO A 1 260 ? 179.103 150.109 -3.708  1.00 20.71 ? 381  PRO A C     1 
ATOM   2128 O  O     . PRO A 1 260 ? 178.722 149.416 -2.762  1.00 22.12 ? 381  PRO A O     1 
ATOM   2129 C  CB    . PRO A 1 260 ? 178.512 149.635 -6.139  1.00 23.24 ? 381  PRO A CB    1 
ATOM   2130 C  CG    . PRO A 1 260 ? 177.998 150.510 -7.246  1.00 25.34 ? 381  PRO A CG    1 
ATOM   2131 C  CD    . PRO A 1 260 ? 178.446 151.912 -6.792  1.00 20.62 ? 381  PRO A CD    1 
ATOM   2132 N  N     . TRP A 1 261 ? 180.330 150.607 -3.783  1.00 19.08 ? 382  TRP A N     1 
ATOM   2133 C  CA    . TRP A 1 261 ? 181.307 150.367 -2.733  1.00 18.09 ? 382  TRP A CA    1 
ATOM   2134 C  C     . TRP A 1 261 ? 180.898 151.042 -1.431  1.00 18.11 ? 382  TRP A C     1 
ATOM   2135 O  O     . TRP A 1 261 ? 181.045 150.467 -0.352  1.00 19.08 ? 382  TRP A O     1 
ATOM   2136 C  CB    . TRP A 1 261 ? 182.667 150.885 -3.160  1.00 16.26 ? 382  TRP A CB    1 
ATOM   2137 C  CG    . TRP A 1 261 ? 183.757 150.595 -2.180  1.00 17.75 ? 382  TRP A CG    1 
ATOM   2138 C  CD1   . TRP A 1 261 ? 184.389 149.398 -1.986  1.00 14.76 ? 382  TRP A CD1   1 
ATOM   2139 C  CD2   . TRP A 1 261 ? 184.370 151.524 -1.271  1.00 17.24 ? 382  TRP A CD2   1 
ATOM   2140 N  NE1   . TRP A 1 261 ? 185.358 149.524 -1.022  1.00 16.65 ? 382  TRP A NE1   1 
ATOM   2141 C  CE2   . TRP A 1 261 ? 185.366 150.816 -0.559  1.00 16.47 ? 382  TRP A CE2   1 
ATOM   2142 C  CE3   . TRP A 1 261 ? 184.165 152.882 -0.983  1.00 17.55 ? 382  TRP A CE3   1 
ATOM   2143 C  CZ2   . TRP A 1 261 ? 186.168 151.422 0.421   1.00 15.85 ? 382  TRP A CZ2   1 
ATOM   2144 C  CZ3   . TRP A 1 261 ? 184.965 153.487 -0.002  1.00 19.06 ? 382  TRP A CZ3   1 
ATOM   2145 C  CH2   . TRP A 1 261 ? 185.951 152.754 0.687   1.00 17.35 ? 382  TRP A CH2   1 
ATOM   2146 N  N     . ILE A 1 262 ? 180.391 152.266 -1.533  1.00 18.03 ? 383  ILE A N     1 
ATOM   2147 C  CA    . ILE A 1 262 ? 179.963 153.003 -0.354  1.00 17.34 ? 383  ILE A CA    1 
ATOM   2148 C  C     . ILE A 1 262 ? 178.790 152.312 0.324   1.00 19.72 ? 383  ILE A C     1 
ATOM   2149 O  O     . ILE A 1 262 ? 178.851 152.044 1.523   1.00 21.11 ? 383  ILE A O     1 
ATOM   2150 C  CB    . ILE A 1 262 ? 179.585 154.460 -0.709  1.00 15.70 ? 383  ILE A CB    1 
ATOM   2151 C  CG1   . ILE A 1 262 ? 180.841 155.212 -1.132  1.00 8.79  ? 383  ILE A CG1   1 
ATOM   2152 C  CG2   . ILE A 1 262 ? 178.985 155.178 0.495   1.00 13.48 ? 383  ILE A CG2   1 
ATOM   2153 C  CD1   . ILE A 1 262 ? 181.809 155.455 0.019   1.00 11.19 ? 383  ILE A CD1   1 
ATOM   2154 N  N     . THR A 1 263 ? 177.739 151.994 -0.428  1.00 18.67 ? 384  THR A N     1 
ATOM   2155 C  CA    . THR A 1 263 ? 176.585 151.336 0.180   1.00 21.04 ? 384  THR A CA    1 
ATOM   2156 C  C     . THR A 1 263 ? 176.868 149.921 0.721   1.00 20.77 ? 384  THR A C     1 
ATOM   2157 O  O     . THR A 1 263 ? 176.220 149.496 1.683   1.00 24.40 ? 384  THR A O     1 
ATOM   2158 C  CB    . THR A 1 263 ? 175.352 151.287 -0.784  1.00 22.27 ? 384  THR A CB    1 
ATOM   2159 O  OG1   . THR A 1 263 ? 175.657 150.457 -1.912  1.00 23.10 ? 384  THR A OG1   1 
ATOM   2160 C  CG2   . THR A 1 263 ? 174.969 152.706 -1.271  1.00 15.14 ? 384  THR A CG2   1 
ATOM   2161 N  N     . ALA A 1 264 ? 177.835 149.206 0.138   1.00 18.85 ? 385  ALA A N     1 
ATOM   2162 C  CA    . ALA A 1 264 ? 178.195 147.848 0.598   1.00 16.58 ? 385  ALA A CA    1 
ATOM   2163 C  C     . ALA A 1 264 ? 179.021 147.877 1.890   1.00 19.30 ? 385  ALA A C     1 
ATOM   2164 O  O     . ALA A 1 264 ? 178.987 146.950 2.699   1.00 17.69 ? 385  ALA A O     1 
ATOM   2165 C  CB    . ALA A 1 264 ? 178.996 147.119 -0.481  1.00 8.89  ? 385  ALA A CB    1 
ATOM   2166 N  N     . ASN A 1 265 ? 179.748 148.966 2.104   1.00 23.78 ? 386  ASN A N     1 
ATOM   2167 C  CA    . ASN A 1 265 ? 180.614 149.059 3.274   1.00 24.44 ? 386  ASN A CA    1 
ATOM   2168 C  C     . ASN A 1 265 ? 180.305 150.133 4.291   1.00 25.32 ? 386  ASN A C     1 
ATOM   2169 O  O     . ASN A 1 265 ? 180.891 150.175 5.366   1.00 25.70 ? 386  ASN A O     1 
ATOM   2170 C  CB    . ASN A 1 265 ? 182.039 149.240 2.783   1.00 22.82 ? 386  ASN A CB    1 
ATOM   2171 C  CG    . ASN A 1 265 ? 182.509 148.051 1.997   1.00 22.92 ? 386  ASN A CG    1 
ATOM   2172 O  OD1   . ASN A 1 265 ? 182.581 146.947 2.539   1.00 23.56 ? 386  ASN A OD1   1 
ATOM   2173 N  ND2   . ASN A 1 265 ? 182.807 148.251 0.706   1.00 20.68 ? 386  ASN A ND2   1 
ATOM   2174 N  N     . SER A 1 266 ? 179.385 151.009 3.950   1.00 28.67 ? 387  SER A N     1 
ATOM   2175 C  CA    . SER A 1 266 ? 179.063 152.111 4.823   1.00 30.65 ? 387  SER A CA    1 
ATOM   2176 C  C     . SER A 1 266 ? 178.063 151.687 5.890   1.00 32.67 ? 387  SER A C     1 
ATOM   2177 O  O     . SER A 1 266 ? 177.162 150.889 5.535   1.00 35.02 ? 387  SER A O     1 
ATOM   2178 C  CB    . SER A 1 266 ? 178.507 153.232 3.955   1.00 29.51 ? 387  SER A CB    1 
ATOM   2179 O  OG    . SER A 1 266 ? 178.208 154.364 4.724   1.00 35.78 ? 387  SER A OG    1 
ATOM   2180 N  N     . SER A 1 267 ? 178.173 152.164 7.055   1.00 35.90 ? 388  SER A N     1 
ATOM   2181 N  N     . SER B 2 7   ? 189.583 195.368 11.576  1.00 34.34 ? 7    SER B N     1 
ATOM   2182 C  CA    . SER B 2 7   ? 188.150 195.268 12.001  1.00 32.37 ? 7    SER B CA    1 
ATOM   2183 C  C     . SER B 2 7   ? 187.728 193.792 12.227  1.00 32.69 ? 7    SER B C     1 
ATOM   2184 O  O     . SER B 2 7   ? 187.932 192.918 11.331  1.00 33.35 ? 7    SER B O     1 
ATOM   2185 C  CB    . SER B 2 7   ? 187.273 195.899 10.921  1.00 30.72 ? 7    SER B CB    1 
ATOM   2186 O  OG    . SER B 2 7   ? 185.919 195.490 11.062  1.00 28.92 ? 7    SER B OG    1 
ATOM   2187 N  N     . TYR B 2 8   ? 187.139 193.527 13.402  1.00 28.10 ? 8    TYR B N     1 
ATOM   2188 C  CA    . TYR B 2 8   ? 186.671 192.188 13.775  1.00 25.10 ? 8    TYR B CA    1 
ATOM   2189 C  C     . TYR B 2 8   ? 185.151 192.143 14.045  1.00 24.33 ? 8    TYR B C     1 
ATOM   2190 O  O     . TYR B 2 8   ? 184.677 191.422 14.936  1.00 23.49 ? 8    TYR B O     1 
ATOM   2191 C  CB    . TYR B 2 8   ? 187.465 191.681 14.999  1.00 22.64 ? 8    TYR B CB    1 
ATOM   2192 C  CG    . TYR B 2 8   ? 188.962 191.579 14.731  1.00 22.03 ? 8    TYR B CG    1 
ATOM   2193 C  CD1   . TYR B 2 8   ? 189.806 192.667 14.982  1.00 19.79 ? 8    TYR B CD1   1 
ATOM   2194 C  CD2   . TYR B 2 8   ? 189.524 190.435 14.128  1.00 18.09 ? 8    TYR B CD2   1 
ATOM   2195 C  CE1   . TYR B 2 8   ? 191.153 192.623 14.642  1.00 19.33 ? 8    TYR B CE1   1 
ATOM   2196 C  CE2   . TYR B 2 8   ? 190.881 190.391 13.775  1.00 18.91 ? 8    TYR B CE2   1 
ATOM   2197 C  CZ    . TYR B 2 8   ? 191.686 191.488 14.038  1.00 20.94 ? 8    TYR B CZ    1 
ATOM   2198 O  OH    . TYR B 2 8   ? 193.020 191.444 13.712  1.00 23.31 ? 8    TYR B OH    1 
ATOM   2199 N  N     . SER B 2 9   ? 184.410 192.931 13.263  1.00 24.49 ? 9    SER B N     1 
ATOM   2200 C  CA    . SER B 2 9   ? 182.945 193.017 13.314  1.00 24.46 ? 9    SER B CA    1 
ATOM   2201 C  C     . SER B 2 9   ? 182.426 192.085 12.229  1.00 22.36 ? 9    SER B C     1 
ATOM   2202 O  O     . SER B 2 9   ? 182.469 192.408 11.035  1.00 22.10 ? 9    SER B O     1 
ATOM   2203 C  CB    . SER B 2 9   ? 182.455 194.444 13.006  1.00 23.56 ? 9    SER B CB    1 
ATOM   2204 O  OG    . SER B 2 9   ? 182.756 195.336 14.059  1.00 29.98 ? 9    SER B OG    1 
ATOM   2205 N  N     . TYR B 2 10  ? 181.926 190.938 12.653  1.00 20.97 ? 10   TYR B N     1 
ATOM   2206 C  CA    . TYR B 2 10  ? 181.434 189.932 11.728  1.00 21.80 ? 10   TYR B CA    1 
ATOM   2207 C  C     . TYR B 2 10  ? 179.918 189.807 11.832  1.00 21.84 ? 10   TYR B C     1 
ATOM   2208 O  O     . TYR B 2 10  ? 179.334 190.098 12.872  1.00 22.91 ? 10   TYR B O     1 
ATOM   2209 C  CB    . TYR B 2 10  ? 182.099 188.582 12.063  1.00 21.23 ? 10   TYR B CB    1 
ATOM   2210 C  CG    . TYR B 2 10  ? 183.618 188.617 12.082  1.00 23.30 ? 10   TYR B CG    1 
ATOM   2211 C  CD1   . TYR B 2 10  ? 184.345 187.694 12.836  1.00 24.95 ? 10   TYR B CD1   1 
ATOM   2212 C  CD2   . TYR B 2 10  ? 184.331 189.542 11.311  1.00 23.55 ? 10   TYR B CD2   1 
ATOM   2213 C  CE1   . TYR B 2 10  ? 185.744 187.683 12.816  1.00 25.40 ? 10   TYR B CE1   1 
ATOM   2214 C  CE2   . TYR B 2 10  ? 185.725 189.541 11.285  1.00 24.34 ? 10   TYR B CE2   1 
ATOM   2215 C  CZ    . TYR B 2 10  ? 186.421 188.600 12.036  1.00 26.19 ? 10   TYR B CZ    1 
ATOM   2216 O  OH    . TYR B 2 10  ? 187.800 188.526 11.956  1.00 31.92 ? 10   TYR B OH    1 
ATOM   2217 N  N     . ASP B 2 11  ? 179.283 189.372 10.754  1.00 19.80 ? 11   ASP B N     1 
ATOM   2218 C  CA    . ASP B 2 11  ? 177.842 189.173 10.751  1.00 19.63 ? 11   ASP B CA    1 
ATOM   2219 C  C     . ASP B 2 11  ? 177.653 187.756 11.297  1.00 19.67 ? 11   ASP B C     1 
ATOM   2220 O  O     . ASP B 2 11  ? 177.383 186.820 10.565  1.00 20.37 ? 11   ASP B O     1 
ATOM   2221 C  CB    . ASP B 2 11  ? 177.308 189.274 9.310   1.00 21.09 ? 11   ASP B CB    1 
ATOM   2222 C  CG    . ASP B 2 11  ? 175.778 189.141 9.217   1.00 23.91 ? 11   ASP B CG    1 
ATOM   2223 O  OD1   . ASP B 2 11  ? 175.093 188.957 10.256  1.00 24.67 ? 11   ASP B OD1   1 
ATOM   2224 O  OD2   . ASP B 2 11  ? 175.264 189.221 8.077   1.00 22.90 ? 11   ASP B OD2   1 
ATOM   2225 N  N     . ALA B 2 12  ? 177.844 187.593 12.590  1.00 19.26 ? 12   ALA B N     1 
ATOM   2226 C  CA    . ALA B 2 12  ? 177.696 186.285 13.174  1.00 19.72 ? 12   ALA B CA    1 
ATOM   2227 C  C     . ALA B 2 12  ? 177.337 186.502 14.640  1.00 20.60 ? 12   ALA B C     1 
ATOM   2228 O  O     . ALA B 2 12  ? 177.450 187.632 15.149  1.00 20.41 ? 12   ALA B O     1 
ATOM   2229 C  CB    . ALA B 2 12  ? 178.993 185.498 13.013  1.00 20.60 ? 12   ALA B CB    1 
ATOM   2230 N  N     . PRO B 2 13  ? 176.918 185.448 15.350  1.00 20.13 ? 13   PRO B N     1 
ATOM   2231 C  CA    . PRO B 2 13  ? 176.545 185.608 16.761  1.00 16.88 ? 13   PRO B CA    1 
ATOM   2232 C  C     . PRO B 2 13  ? 177.663 186.014 17.728  1.00 17.09 ? 13   PRO B C     1 
ATOM   2233 O  O     . PRO B 2 13  ? 178.797 185.573 17.590  1.00 17.90 ? 13   PRO B O     1 
ATOM   2234 C  CB    . PRO B 2 13  ? 175.959 184.246 17.137  1.00 16.25 ? 13   PRO B CB    1 
ATOM   2235 C  CG    . PRO B 2 13  ? 175.670 183.563 15.811  1.00 18.64 ? 13   PRO B CG    1 
ATOM   2236 C  CD    . PRO B 2 13  ? 176.769 184.055 14.907  1.00 17.56 ? 13   PRO B CD    1 
ATOM   2237 N  N     . SER B 2 14  ? 177.334 186.839 18.720  1.00 17.14 ? 14   SER B N     1 
ATOM   2238 C  CA    . SER B 2 14  ? 178.294 187.258 19.739  1.00 20.00 ? 14   SER B CA    1 
ATOM   2239 C  C     . SER B 2 14  ? 177.587 187.518 21.069  1.00 18.32 ? 14   SER B C     1 
ATOM   2240 O  O     . SER B 2 14  ? 178.199 187.968 22.056  1.00 14.51 ? 14   SER B O     1 
ATOM   2241 C  CB    . SER B 2 14  ? 179.094 188.499 19.294  1.00 19.42 ? 14   SER B CB    1 
ATOM   2242 O  OG    . SER B 2 14  ? 178.288 189.384 18.544  1.00 30.47 ? 14   SER B OG    1 
ATOM   2243 N  N     . ASP B 2 15  ? 176.297 187.215 21.076  1.00 18.48 ? 15   ASP B N     1 
ATOM   2244 C  CA    . ASP B 2 15  ? 175.445 187.376 22.248  1.00 23.79 ? 15   ASP B CA    1 
ATOM   2245 C  C     . ASP B 2 15  ? 175.569 186.172 23.199  1.00 21.79 ? 15   ASP B C     1 
ATOM   2246 O  O     . ASP B 2 15  ? 175.594 185.035 22.754  1.00 22.39 ? 15   ASP B O     1 
ATOM   2247 C  CB    . ASP B 2 15  ? 173.991 187.526 21.783  1.00 30.49 ? 15   ASP B CB    1 
ATOM   2248 C  CG    . ASP B 2 15  ? 173.676 188.932 21.226  1.00 39.83 ? 15   ASP B CG    1 
ATOM   2249 O  OD1   . ASP B 2 15  ? 174.558 189.605 20.616  1.00 44.43 ? 15   ASP B OD1   1 
ATOM   2250 O  OD2   . ASP B 2 15  ? 172.510 189.378 21.401  1.00 45.45 ? 15   ASP B OD2   1 
ATOM   2251 N  N     . PHE B 2 16  ? 175.660 186.432 24.500  1.00 21.47 ? 16   PHE B N     1 
ATOM   2252 C  CA    . PHE B 2 16  ? 175.756 185.373 25.514  1.00 22.21 ? 16   PHE B CA    1 
ATOM   2253 C  C     . PHE B 2 16  ? 174.542 184.448 25.301  1.00 21.16 ? 16   PHE B C     1 
ATOM   2254 O  O     . PHE B 2 16  ? 173.442 184.938 25.058  1.00 21.78 ? 16   PHE B O     1 
ATOM   2255 C  CB    . PHE B 2 16  ? 175.700 185.993 26.930  1.00 19.46 ? 16   PHE B CB    1 
ATOM   2256 C  CG    . PHE B 2 16  ? 175.637 184.978 28.025  1.00 18.34 ? 16   PHE B CG    1 
ATOM   2257 C  CD1   . PHE B 2 16  ? 176.789 184.362 28.491  1.00 18.98 ? 16   PHE B CD1   1 
ATOM   2258 C  CD2   . PHE B 2 16  ? 174.417 184.569 28.528  1.00 15.51 ? 16   PHE B CD2   1 
ATOM   2259 C  CE1   . PHE B 2 16  ? 176.716 183.339 29.435  1.00 18.59 ? 16   PHE B CE1   1 
ATOM   2260 C  CE2   . PHE B 2 16  ? 174.340 183.552 29.469  1.00 15.01 ? 16   PHE B CE2   1 
ATOM   2261 C  CZ    . PHE B 2 16  ? 175.488 182.939 29.921  1.00 15.05 ? 16   PHE B CZ    1 
ATOM   2262 N  N     . ILE B 2 17  ? 174.739 183.135 25.370  1.00 19.97 ? 17   ILE B N     1 
ATOM   2263 C  CA    . ILE B 2 17  ? 173.652 182.163 25.182  1.00 20.86 ? 17   ILE B CA    1 
ATOM   2264 C  C     . ILE B 2 17  ? 173.478 181.318 26.439  1.00 21.56 ? 17   ILE B C     1 
ATOM   2265 O  O     . ILE B 2 17  ? 174.462 180.965 27.086  1.00 23.11 ? 17   ILE B O     1 
ATOM   2266 C  CB    . ILE B 2 17  ? 173.965 181.144 24.009  1.00 21.47 ? 17   ILE B CB    1 
ATOM   2267 C  CG1   . ILE B 2 17  ? 173.957 181.844 22.654  1.00 16.04 ? 17   ILE B CG1   1 
ATOM   2268 C  CG2   . ILE B 2 17  ? 172.988 179.964 24.011  1.00 11.76 ? 17   ILE B CG2   1 
ATOM   2269 C  CD1   . ILE B 2 17  ? 174.760 181.051 21.631  1.00 18.42 ? 17   ILE B CD1   1 
ATOM   2270 N  N     . ASN B 2 18  ? 172.227 181.002 26.778  1.00 24.87 ? 18   ASN B N     1 
ATOM   2271 C  CA    . ASN B 2 18  ? 171.893 180.143 27.928  1.00 26.79 ? 18   ASN B CA    1 
ATOM   2272 C  C     . ASN B 2 18  ? 171.911 178.718 27.373  1.00 28.06 ? 18   ASN B C     1 
ATOM   2273 O  O     . ASN B 2 18  ? 170.947 178.305 26.737  1.00 31.09 ? 18   ASN B O     1 
ATOM   2274 C  CB    . ASN B 2 18  ? 170.485 180.437 28.427  1.00 26.34 ? 18   ASN B CB    1 
ATOM   2275 C  CG    . ASN B 2 18  ? 170.052 179.482 29.543  1.00 30.28 ? 18   ASN B CG    1 
ATOM   2276 O  OD1   . ASN B 2 18  ? 170.753 178.519 29.870  1.00 30.01 ? 18   ASN B OD1   1 
ATOM   2277 N  ND2   . ASN B 2 18  ? 168.893 179.747 30.125  1.00 28.50 ? 18   ASN B ND2   1 
ATOM   2278 N  N     . PHE B 2 19  ? 172.969 177.950 27.616  1.00 30.32 ? 19   PHE B N     1 
ATOM   2279 C  CA    . PHE B 2 19  ? 173.027 176.599 27.050  1.00 32.46 ? 19   PHE B CA    1 
ATOM   2280 C  C     . PHE B 2 19  ? 172.086 175.529 27.618  1.00 36.90 ? 19   PHE B C     1 
ATOM   2281 O  O     . PHE B 2 19  ? 172.063 174.397 27.124  1.00 41.31 ? 19   PHE B O     1 
ATOM   2282 C  CB    . PHE B 2 19  ? 174.460 176.061 27.076  1.00 27.50 ? 19   PHE B CB    1 
ATOM   2283 C  CG    . PHE B 2 19  ? 175.430 176.837 26.214  1.00 22.59 ? 19   PHE B CG    1 
ATOM   2284 C  CD1   . PHE B 2 19  ? 176.332 177.737 26.785  1.00 20.42 ? 19   PHE B CD1   1 
ATOM   2285 C  CD2   . PHE B 2 19  ? 175.426 176.682 24.831  1.00 21.89 ? 19   PHE B CD2   1 
ATOM   2286 C  CE1   . PHE B 2 19  ? 177.223 178.454 25.989  1.00 19.77 ? 19   PHE B CE1   1 
ATOM   2287 C  CE2   . PHE B 2 19  ? 176.312 177.398 24.021  1.00 18.13 ? 19   PHE B CE2   1 
ATOM   2288 C  CZ    . PHE B 2 19  ? 177.206 178.291 24.605  1.00 19.50 ? 19   PHE B CZ    1 
ATOM   2289 N  N     . SER B 2 20  ? 171.317 175.844 28.646  1.00 41.32 ? 20   SER B N     1 
ATOM   2290 C  CA    . SER B 2 20  ? 170.402 174.824 29.142  1.00 46.46 ? 20   SER B CA    1 
ATOM   2291 C  C     . SER B 2 20  ? 169.029 175.021 28.496  1.00 48.43 ? 20   SER B C     1 
ATOM   2292 O  O     . SER B 2 20  ? 168.337 174.060 28.170  1.00 50.43 ? 20   SER B O     1 
ATOM   2293 C  CB    . SER B 2 20  ? 170.317 174.921 30.652  1.00 47.60 ? 20   SER B CB    1 
ATOM   2294 O  OG    . SER B 2 20  ? 170.456 176.275 31.032  1.00 49.62 ? 20   SER B OG    1 
ATOM   2295 N  N     . SER B 2 21  ? 168.645 176.275 28.286  1.00 50.08 ? 21   SER B N     1 
ATOM   2296 C  CA    . SER B 2 21  ? 167.349 176.574 27.676  1.00 50.65 ? 21   SER B CA    1 
ATOM   2297 C  C     . SER B 2 21  ? 167.581 176.880 26.204  1.00 51.89 ? 21   SER B C     1 
ATOM   2298 O  O     . SER B 2 21  ? 166.843 176.336 25.325  1.00 51.53 ? 21   SER B O     1 
ATOM   2299 C  CB    . SER B 2 21  ? 166.742 177.810 28.317  1.00 49.82 ? 21   SER B CB    1 
ATOM   2300 O  OG    . SER B 2 21  ? 167.467 178.945 27.866  1.00 50.01 ? 21   SER B OG    1 
ATOM   2301 N  N     . LEU B 2 22  ? 168.482 177.716 25.953  1.00 53.54 ? 22   LEU B N     1 
ATOM   2302 N  N     . ASN B 2 30  ? 165.267 179.744 11.676  1.00 37.72 ? 30   ASN B N     1 
ATOM   2303 C  CA    . ASN B 2 30  ? 166.154 178.688 11.078  1.00 38.33 ? 30   ASN B CA    1 
ATOM   2304 C  C     . ASN B 2 30  ? 167.301 179.381 10.314  1.00 36.00 ? 30   ASN B C     1 
ATOM   2305 O  O     . ASN B 2 30  ? 167.202 179.731 9.143   1.00 34.36 ? 30   ASN B O     1 
ATOM   2306 C  CB    . ASN B 2 30  ? 165.336 177.781 10.155  1.00 41.18 ? 30   ASN B CB    1 
ATOM   2307 C  CG    . ASN B 2 30  ? 164.486 178.568 9.178   1.00 46.58 ? 30   ASN B CG    1 
ATOM   2308 O  OD1   . ASN B 2 30  ? 164.828 179.693 8.808   1.00 49.62 ? 30   ASN B OD1   1 
ATOM   2309 N  ND2   . ASN B 2 30  ? 163.363 177.973 8.740   1.00 49.11 ? 30   ASN B ND2   1 
ATOM   2310 N  N     . ILE B 2 31  ? 168.406 179.537 11.026  1.00 32.89 ? 31   ILE B N     1 
ATOM   2311 C  CA    . ILE B 2 31  ? 169.605 180.229 10.589  1.00 28.57 ? 31   ILE B CA    1 
ATOM   2312 C  C     . ILE B 2 31  ? 170.254 180.041 9.214   1.00 25.67 ? 31   ILE B C     1 
ATOM   2313 O  O     . ILE B 2 31  ? 170.816 180.996 8.677   1.00 20.90 ? 31   ILE B O     1 
ATOM   2314 C  CB    . ILE B 2 31  ? 170.635 180.011 11.676  1.00 31.08 ? 31   ILE B CB    1 
ATOM   2315 C  CG1   . ILE B 2 31  ? 169.991 180.405 13.012  1.00 34.10 ? 31   ILE B CG1   1 
ATOM   2316 C  CG2   . ILE B 2 31  ? 171.873 180.840 11.426  1.00 30.71 ? 31   ILE B CG2   1 
ATOM   2317 C  CD1   . ILE B 2 31  ? 169.738 181.909 13.147  1.00 41.37 ? 31   ILE B CD1   1 
ATOM   2318 N  N     . ASP B 2 32  ? 170.188 178.856 8.623   1.00 23.52 ? 32   ASP B N     1 
ATOM   2319 C  CA    . ASP B 2 32  ? 170.872 178.678 7.351   1.00 24.02 ? 32   ASP B CA    1 
ATOM   2320 C  C     . ASP B 2 32  ? 170.289 179.324 6.104   1.00 23.19 ? 32   ASP B C     1 
ATOM   2321 O  O     . ASP B 2 32  ? 170.804 179.126 5.001   1.00 22.55 ? 32   ASP B O     1 
ATOM   2322 C  CB    . ASP B 2 32  ? 171.126 177.197 7.086   1.00 27.28 ? 32   ASP B CB    1 
ATOM   2323 C  CG    . ASP B 2 32  ? 169.858 176.423 6.805   1.00 32.74 ? 32   ASP B CG    1 
ATOM   2324 O  OD1   . ASP B 2 32  ? 168.852 177.009 6.338   1.00 36.15 ? 32   ASP B OD1   1 
ATOM   2325 O  OD2   . ASP B 2 32  ? 169.884 175.202 7.039   1.00 33.71 ? 32   ASP B OD2   1 
ATOM   2326 N  N     . SER B 2 33  ? 169.223 180.090 6.271   1.00 21.46 ? 33   SER B N     1 
ATOM   2327 C  CA    . SER B 2 33  ? 168.608 180.781 5.136   1.00 22.57 ? 33   SER B CA    1 
ATOM   2328 C  C     . SER B 2 33  ? 169.448 182.002 4.805   1.00 19.49 ? 33   SER B C     1 
ATOM   2329 O  O     . SER B 2 33  ? 169.273 182.639 3.770   1.00 20.33 ? 33   SER B O     1 
ATOM   2330 C  CB    . SER B 2 33  ? 167.205 181.244 5.499   1.00 23.28 ? 33   SER B CB    1 
ATOM   2331 O  OG    . SER B 2 33  ? 166.326 180.142 5.639   1.00 33.59 ? 33   SER B OG    1 
ATOM   2332 N  N     . TRP B 2 34  ? 170.344 182.330 5.728   1.00 18.04 ? 34   TRP B N     1 
ATOM   2333 C  CA    . TRP B 2 34  ? 171.254 183.466 5.621   1.00 16.02 ? 34   TRP B CA    1 
ATOM   2334 C  C     . TRP B 2 34  ? 172.022 183.499 4.299   1.00 15.62 ? 34   TRP B C     1 
ATOM   2335 O  O     . TRP B 2 34  ? 172.251 184.579 3.735   1.00 16.88 ? 34   TRP B O     1 
ATOM   2336 C  CB    . TRP B 2 34  ? 172.234 183.422 6.792   1.00 15.82 ? 34   TRP B CB    1 
ATOM   2337 C  CG    . TRP B 2 34  ? 173.240 184.531 6.836   1.00 15.40 ? 34   TRP B CG    1 
ATOM   2338 C  CD1   . TRP B 2 34  ? 173.052 185.801 7.302   1.00 13.49 ? 34   TRP B CD1   1 
ATOM   2339 C  CD2   . TRP B 2 34  ? 174.599 184.462 6.404   1.00 13.15 ? 34   TRP B CD2   1 
ATOM   2340 N  NE1   . TRP B 2 34  ? 174.212 186.530 7.189   1.00 11.42 ? 34   TRP B NE1   1 
ATOM   2341 C  CE2   . TRP B 2 34  ? 175.180 185.735 6.640   1.00 14.42 ? 34   TRP B CE2   1 
ATOM   2342 C  CE3   . TRP B 2 34  ? 175.387 183.451 5.843   1.00 10.87 ? 34   TRP B CE3   1 
ATOM   2343 C  CZ2   . TRP B 2 34  ? 176.523 186.024 6.330   1.00 14.91 ? 34   TRP B CZ2   1 
ATOM   2344 C  CZ3   . TRP B 2 34  ? 176.727 183.738 5.538   1.00 12.26 ? 34   TRP B CZ3   1 
ATOM   2345 C  CH2   . TRP B 2 34  ? 177.278 185.016 5.785   1.00 10.61 ? 34   TRP B CH2   1 
ATOM   2346 N  N     . PHE B 2 35  ? 172.435 182.324 3.819   1.00 13.45 ? 35   PHE B N     1 
ATOM   2347 C  CA    . PHE B 2 35  ? 173.191 182.222 2.567   1.00 12.33 ? 35   PHE B CA    1 
ATOM   2348 C  C     . PHE B 2 35  ? 172.367 182.623 1.351   1.00 13.51 ? 35   PHE B C     1 
ATOM   2349 O  O     . PHE B 2 35  ? 172.779 183.502 0.597   1.00 13.63 ? 35   PHE B O     1 
ATOM   2350 C  CB    . PHE B 2 35  ? 173.739 180.801 2.344   1.00 8.78  ? 35   PHE B CB    1 
ATOM   2351 C  CG    . PHE B 2 35  ? 174.597 180.304 3.456   1.00 9.30  ? 35   PHE B CG    1 
ATOM   2352 C  CD1   . PHE B 2 35  ? 174.042 179.566 4.495   1.00 9.43  ? 35   PHE B CD1   1 
ATOM   2353 C  CD2   . PHE B 2 35  ? 175.960 180.610 3.500   1.00 9.38  ? 35   PHE B CD2   1 
ATOM   2354 C  CE1   . PHE B 2 35  ? 174.822 179.141 5.565   1.00 6.69  ? 35   PHE B CE1   1 
ATOM   2355 C  CE2   . PHE B 2 35  ? 176.749 180.190 4.569   1.00 8.62  ? 35   PHE B CE2   1 
ATOM   2356 C  CZ    . PHE B 2 35  ? 176.174 179.455 5.602   1.00 10.55 ? 35   PHE B CZ    1 
ATOM   2357 N  N     . GLU B 2 36  ? 171.207 181.997 1.153   1.00 14.52 ? 36   GLU B N     1 
ATOM   2358 C  CA    . GLU B 2 36  ? 170.392 182.349 -0.008  1.00 18.05 ? 36   GLU B CA    1 
ATOM   2359 C  C     . GLU B 2 36  ? 169.844 183.775 0.103   1.00 18.08 ? 36   GLU B C     1 
ATOM   2360 O  O     . GLU B 2 36  ? 169.797 184.500 -0.899  1.00 20.25 ? 36   GLU B O     1 
ATOM   2361 C  CB    . GLU B 2 36  ? 169.246 181.349 -0.209  1.00 13.28 ? 36   GLU B CB    1 
ATOM   2362 N  N     . GLU B 2 37  ? 169.458 184.192 1.307   1.00 18.61 ? 37   GLU B N     1 
ATOM   2363 C  CA    . GLU B 2 37  ? 168.905 185.536 1.505   1.00 21.91 ? 37   GLU B CA    1 
ATOM   2364 C  C     . GLU B 2 37  ? 169.913 186.649 1.194   1.00 22.74 ? 37   GLU B C     1 
ATOM   2365 O  O     . GLU B 2 37  ? 169.561 187.754 0.791   1.00 22.40 ? 37   GLU B O     1 
ATOM   2366 C  CB    . GLU B 2 37  ? 168.391 185.686 2.933   1.00 22.41 ? 37   GLU B CB    1 
ATOM   2367 C  CG    . GLU B 2 37  ? 167.103 184.901 3.240   1.00 24.75 ? 37   GLU B CG    1 
ATOM   2368 C  CD    . GLU B 2 37  ? 166.619 185.133 4.681   1.00 30.55 ? 37   GLU B CD    1 
ATOM   2369 O  OE1   . GLU B 2 37  ? 167.473 185.511 5.529   1.00 31.00 ? 37   GLU B OE1   1 
ATOM   2370 O  OE2   . GLU B 2 37  ? 165.414 184.932 4.976   1.00 30.11 ? 37   GLU B OE2   1 
ATOM   2371 N  N     . LYS B 2 38  ? 171.181 186.332 1.375   1.00 25.80 ? 38   LYS B N     1 
ATOM   2372 C  CA    . LYS B 2 38  ? 172.269 187.252 1.114   1.00 24.79 ? 38   LYS B CA    1 
ATOM   2373 C  C     . LYS B 2 38  ? 172.625 187.194 -0.373  1.00 25.05 ? 38   LYS B C     1 
ATOM   2374 O  O     . LYS B 2 38  ? 173.062 188.177 -0.969  1.00 23.54 ? 38   LYS B O     1 
ATOM   2375 C  CB    . LYS B 2 38  ? 173.438 186.831 1.982   1.00 27.15 ? 38   LYS B CB    1 
ATOM   2376 C  CG    . LYS B 2 38  ? 174.708 187.488 1.649   1.00 30.16 ? 38   LYS B CG    1 
ATOM   2377 C  CD    . LYS B 2 38  ? 175.776 187.057 2.622   1.00 31.96 ? 38   LYS B CD    1 
ATOM   2378 C  CE    . LYS B 2 38  ? 177.007 187.927 2.391   1.00 35.28 ? 38   LYS B CE    1 
ATOM   2379 N  NZ    . LYS B 2 38  ? 178.028 187.735 3.456   1.00 40.31 ? 38   LYS B NZ    1 
ATOM   2380 N  N     . ALA B 2 39  ? 172.418 186.032 -0.975  1.00 23.76 ? 39   ALA B N     1 
ATOM   2381 C  CA    . ALA B 2 39  ? 172.687 185.849 -2.400  1.00 23.35 ? 39   ALA B CA    1 
ATOM   2382 C  C     . ALA B 2 39  ? 171.642 186.576 -3.245  1.00 24.77 ? 39   ALA B C     1 
ATOM   2383 O  O     . ALA B 2 39  ? 171.950 187.112 -4.318  1.00 24.28 ? 39   ALA B O     1 
ATOM   2384 C  CB    . ALA B 2 39  ? 172.656 184.343 -2.762  1.00 20.98 ? 39   ALA B CB    1 
ATOM   2385 N  N     . ASN B 2 40  ? 170.403 186.592 -2.754  1.00 23.38 ? 40   ASN B N     1 
ATOM   2386 C  CA    . ASN B 2 40  ? 169.306 187.210 -3.480  1.00 23.68 ? 40   ASN B CA    1 
ATOM   2387 C  C     . ASN B 2 40  ? 169.122 188.701 -3.279  1.00 25.17 ? 40   ASN B C     1 
ATOM   2388 O  O     . ASN B 2 40  ? 168.413 189.332 -4.052  1.00 27.11 ? 40   ASN B O     1 
ATOM   2389 C  CB    . ASN B 2 40  ? 167.993 186.526 -3.137  1.00 18.03 ? 40   ASN B CB    1 
ATOM   2390 C  CG    . ASN B 2 40  ? 168.024 185.035 -3.395  1.00 17.89 ? 40   ASN B CG    1 
ATOM   2391 O  OD1   . ASN B 2 40  ? 168.646 184.553 -4.351  1.00 18.06 ? 40   ASN B OD1   1 
ATOM   2392 N  ND2   . ASN B 2 40  ? 167.325 184.287 -2.545  1.00 16.76 ? 40   ASN B ND2   1 
ATOM   2393 N  N     . LEU B 2 41  ? 169.731 189.268 -2.246  1.00 26.95 ? 41   LEU B N     1 
ATOM   2394 C  CA    . LEU B 2 41  ? 169.600 190.709 -1.965  1.00 29.31 ? 41   LEU B CA    1 
ATOM   2395 C  C     . LEU B 2 41  ? 170.091 191.589 -3.120  1.00 29.84 ? 41   LEU B C     1 
ATOM   2396 O  O     . LEU B 2 41  ? 171.051 191.230 -3.787  1.00 30.13 ? 41   LEU B O     1 
ATOM   2397 C  CB    . LEU B 2 41  ? 170.380 191.047 -0.705  1.00 29.88 ? 41   LEU B CB    1 
ATOM   2398 C  CG    . LEU B 2 41  ? 169.816 192.308 -0.057  1.00 30.53 ? 41   LEU B CG    1 
ATOM   2399 C  CD1   . LEU B 2 41  ? 168.319 192.148 0.221   1.00 30.41 ? 41   LEU B CD1   1 
ATOM   2400 C  CD2   . LEU B 2 41  ? 170.580 192.558 1.209   1.00 29.64 ? 41   LEU B CD2   1 
ATOM   2401 N  N     . GLU B 2 42  ? 169.487 192.763 -3.312  1.00 32.17 ? 42   GLU B N     1 
ATOM   2402 C  CA    . GLU B 2 42  ? 169.851 193.627 -4.439  1.00 35.33 ? 42   GLU B CA    1 
ATOM   2403 C  C     . GLU B 2 42  ? 170.537 194.977 -4.190  1.00 37.36 ? 42   GLU B C     1 
ATOM   2404 O  O     . GLU B 2 42  ? 170.487 195.539 -3.109  1.00 38.22 ? 42   GLU B O     1 
ATOM   2405 C  CB    . GLU B 2 42  ? 168.583 193.847 -5.286  1.00 33.50 ? 42   GLU B CB    1 
ATOM   2406 C  CG    . GLU B 2 42  ? 167.819 192.560 -5.616  1.00 32.30 ? 42   GLU B CG    1 
ATOM   2407 C  CD    . GLU B 2 42  ? 166.473 192.784 -6.334  1.00 34.80 ? 42   GLU B CD    1 
ATOM   2408 O  OE1   . GLU B 2 42  ? 165.892 193.892 -6.241  1.00 34.22 ? 42   GLU B OE1   1 
ATOM   2409 O  OE2   . GLU B 2 42  ? 165.980 191.829 -6.987  1.00 33.99 ? 42   GLU B OE2   1 
ATOM   2410 N  N     . ASN B 2 43  ? 171.220 195.457 -5.221  1.00 43.15 ? 43   ASN B N     1 
ATOM   2411 C  CA    . ASN B 2 43  ? 171.863 196.790 -5.266  1.00 48.74 ? 43   ASN B CA    1 
ATOM   2412 C  C     . ASN B 2 43  ? 172.809 196.704 -6.455  1.00 52.67 ? 43   ASN B C     1 
ATOM   2413 O  O     . ASN B 2 43  ? 172.493 197.379 -7.493  1.00 54.34 ? 43   ASN B O     1 
ATOM   2414 C  CB    . ASN B 2 43  ? 172.611 197.184 -3.967  1.00 48.84 ? 43   ASN B CB    1 
ATOM   2415 C  CG    . ASN B 2 43  ? 173.769 196.255 -3.632  1.00 50.97 ? 43   ASN B CG    1 
ATOM   2416 O  OD1   . ASN B 2 43  ? 173.749 195.054 -3.970  1.00 50.34 ? 43   ASN B OD1   1 
ATOM   2417 N  ND2   . ASN B 2 43  ? 174.793 196.804 -2.939  1.00 51.10 ? 43   ASN B ND2   1 
ATOM   2418 O  OXT   . ASN B 2 43  ? 173.808 195.931 -6.344  1.00 55.98 ? 43   ASN B OXT   1 
HETATM 2419 P  PB    . ADP C 3 .   ? 193.788 175.824 12.432  1.00 20.87 ? 1388 ADP A PB    1 
HETATM 2420 O  O1B   . ADP C 3 .   ? 193.884 176.352 13.792  1.00 32.28 ? 1388 ADP A O1B   1 
HETATM 2421 O  O2B   . ADP C 3 .   ? 193.566 176.837 11.394  1.00 26.12 ? 1388 ADP A O2B   1 
HETATM 2422 O  O3B   . ADP C 3 .   ? 194.979 174.908 12.132  1.00 31.89 ? 1388 ADP A O3B   1 
HETATM 2423 P  PA    . ADP C 3 .   ? 191.748 174.063 13.545  1.00 18.35 ? 1388 ADP A PA    1 
HETATM 2424 O  O1A   . ADP C 3 .   ? 190.611 174.901 14.032  1.00 26.99 ? 1388 ADP A O1A   1 
HETATM 2425 O  O2A   . ADP C 3 .   ? 191.357 172.755 12.954  1.00 26.80 ? 1388 ADP A O2A   1 
HETATM 2426 O  O3A   . ADP C 3 .   ? 192.532 174.874 12.450  1.00 28.14 ? 1388 ADP A O3A   1 
HETATM 2427 O  "O5'" . ADP C 3 .   ? 192.642 173.906 14.839  1.00 22.21 ? 1388 ADP A "O5'" 1 
HETATM 2428 C  "C5'" . ADP C 3 .   ? 193.768 172.965 14.869  1.00 20.71 ? 1388 ADP A "C5'" 1 
HETATM 2429 C  "C4'" . ADP C 3 .   ? 193.594 171.623 15.640  1.00 17.30 ? 1388 ADP A "C4'" 1 
HETATM 2430 O  "O4'" . ADP C 3 .   ? 192.923 171.842 16.897  1.00 18.08 ? 1388 ADP A "O4'" 1 
HETATM 2431 C  "C3'" . ADP C 3 .   ? 192.751 170.494 14.997  1.00 17.80 ? 1388 ADP A "C3'" 1 
HETATM 2432 O  "O3'" . ADP C 3 .   ? 193.561 169.824 14.038  1.00 18.78 ? 1388 ADP A "O3'" 1 
HETATM 2433 C  "C2'" . ADP C 3 .   ? 192.369 169.659 16.218  1.00 19.78 ? 1388 ADP A "C2'" 1 
HETATM 2434 O  "O2'" . ADP C 3 .   ? 193.423 168.749 16.615  1.00 19.10 ? 1388 ADP A "O2'" 1 
HETATM 2435 C  "C1'" . ADP C 3 .   ? 192.152 170.704 17.312  1.00 18.01 ? 1388 ADP A "C1'" 1 
HETATM 2436 N  N9    . ADP C 3 .   ? 190.711 171.169 17.445  1.00 18.12 ? 1388 ADP A N9    1 
HETATM 2437 C  C8    . ADP C 3 .   ? 190.169 172.237 16.808  1.00 20.72 ? 1388 ADP A C8    1 
HETATM 2438 N  N7    . ADP C 3 .   ? 188.877 172.431 17.108  1.00 19.94 ? 1388 ADP A N7    1 
HETATM 2439 C  C5    . ADP C 3 .   ? 188.596 171.408 17.961  1.00 15.87 ? 1388 ADP A C5    1 
HETATM 2440 C  C6    . ADP C 3 .   ? 187.377 171.071 18.652  1.00 14.49 ? 1388 ADP A C6    1 
HETATM 2441 N  N6    . ADP C 3 .   ? 186.260 171.696 18.563  1.00 9.66  ? 1388 ADP A N6    1 
HETATM 2442 N  N1    . ADP C 3 .   ? 187.474 169.935 19.454  1.00 13.01 ? 1388 ADP A N1    1 
HETATM 2443 C  C2    . ADP C 3 .   ? 188.642 169.198 19.595  1.00 14.56 ? 1388 ADP A C2    1 
HETATM 2444 N  N3    . ADP C 3 .   ? 189.773 169.512 18.982  1.00 17.25 ? 1388 ADP A N3    1 
HETATM 2445 C  C4    . ADP C 3 .   ? 189.716 170.610 18.162  1.00 16.09 ? 1388 ADP A C4    1 
HETATM 2446 MG MG    . MG  D 4 .   ? 192.801 173.013 10.897  1.00 18.98 ? 1389 MG  A MG    1 
HETATM 2447 MG MG    . MG  E 4 .   ? 192.933 178.461 10.215  1.00 21.17 ? 1390 MG  A MG    1 
HETATM 2448 S  S     . SO4 F 5 .   ? 175.520 167.060 -4.810  1.00 40.27 ? 1391 SO4 A S     1 
HETATM 2449 O  O1    . SO4 F 5 .   ? 175.005 168.134 -3.755  1.00 40.61 ? 1391 SO4 A O1    1 
HETATM 2450 O  O2    . SO4 F 5 .   ? 176.918 167.395 -5.118  1.00 40.85 ? 1391 SO4 A O2    1 
HETATM 2451 O  O3    . SO4 F 5 .   ? 175.333 165.874 -4.319  1.00 45.29 ? 1391 SO4 A O3    1 
HETATM 2452 O  O4    . SO4 F 5 .   ? 174.705 167.387 -6.003  1.00 46.53 ? 1391 SO4 A O4    1 
HETATM 2453 S  S     . SO4 G 5 .   ? 196.317 160.442 22.149  1.00 52.91 ? 1392 SO4 A S     1 
HETATM 2454 O  O1    . SO4 G 5 .   ? 194.902 160.702 22.904  1.00 53.25 ? 1392 SO4 A O1    1 
HETATM 2455 O  O2    . SO4 G 5 .   ? 197.156 161.615 22.484  1.00 52.23 ? 1392 SO4 A O2    1 
HETATM 2456 O  O3    . SO4 G 5 .   ? 196.808 159.261 22.506  1.00 50.45 ? 1392 SO4 A O3    1 
HETATM 2457 O  O4    . SO4 G 5 .   ? 195.932 160.567 20.717  1.00 53.17 ? 1392 SO4 A O4    1 
HETATM 2458 S  S     . SO4 H 5 .   ? 184.237 187.281 -0.473  1.00 69.64 ? 1393 SO4 A S     1 
HETATM 2459 O  O1    . SO4 H 5 .   ? 182.905 188.209 -0.613  1.00 70.60 ? 1393 SO4 A O1    1 
HETATM 2460 O  O2    . SO4 H 5 .   ? 185.274 188.143 0.172   1.00 70.08 ? 1393 SO4 A O2    1 
HETATM 2461 O  O3    . SO4 H 5 .   ? 183.925 186.181 0.170   1.00 69.68 ? 1393 SO4 A O3    1 
HETATM 2462 O  O4    . SO4 H 5 .   ? 184.641 187.119 -1.915  1.00 70.92 ? 1393 SO4 A O4    1 
HETATM 2463 MG MG    . MG  I 4 .   ? 174.135 172.090 -6.081  1.00 37.43 ? 1394 MG  A MG    1 
HETATM 2464 O  O     . HOH J 6 .   ? 176.961 195.154 23.343  1.00 26.84 ? 2001 HOH A O     1 
HETATM 2465 O  O     . HOH J 6 .   ? 170.598 187.029 21.078  1.00 24.60 ? 2002 HOH A O     1 
HETATM 2466 O  O     . HOH J 6 .   ? 172.594 187.824 25.336  1.00 22.88 ? 2003 HOH A O     1 
HETATM 2467 O  O     . HOH J 6 .   ? 172.799 187.052 31.328  1.00 38.58 ? 2004 HOH A O     1 
HETATM 2468 O  O     . HOH J 6 .   ? 176.840 183.702 20.193  1.00 22.57 ? 2005 HOH A O     1 
HETATM 2469 O  O     . HOH J 6 .   ? 186.965 189.198 27.316  1.00 33.73 ? 2006 HOH A O     1 
HETATM 2470 O  O     . HOH J 6 .   ? 181.155 186.952 32.619  1.00 32.00 ? 2007 HOH A O     1 
HETATM 2471 O  O     . HOH J 6 .   ? 178.988 188.073 29.292  1.00 22.03 ? 2008 HOH A O     1 
HETATM 2472 O  O     . HOH J 6 .   ? 193.611 166.439 22.911  1.00 37.73 ? 2009 HOH A O     1 
HETATM 2473 O  O     . HOH J 6 .   ? 197.111 180.066 22.244  1.00 15.19 ? 2010 HOH A O     1 
HETATM 2474 O  O     . HOH J 6 .   ? 196.411 181.887 24.452  1.00 31.18 ? 2011 HOH A O     1 
HETATM 2475 O  O     . HOH J 6 .   ? 174.844 179.377 29.234  1.00 21.85 ? 2012 HOH A O     1 
HETATM 2476 O  O     . HOH J 6 .   ? 193.706 178.975 16.555  1.00 28.73 ? 2013 HOH A O     1 
HETATM 2477 O  O     . HOH J 6 .   ? 201.524 183.136 11.412  1.00 27.78 ? 2014 HOH A O     1 
HETATM 2478 O  O     . HOH J 6 .   ? 201.846 186.034 10.890  1.00 39.65 ? 2015 HOH A O     1 
HETATM 2479 O  O     . HOH J 6 .   ? 179.830 187.974 34.894  1.00 39.81 ? 2016 HOH A O     1 
HETATM 2480 O  O     . HOH J 6 .   ? 200.711 191.015 5.492   1.00 22.39 ? 2017 HOH A O     1 
HETATM 2481 O  O     . HOH J 6 .   ? 209.300 189.438 10.191  1.00 32.59 ? 2018 HOH A O     1 
HETATM 2482 O  O     . HOH J 6 .   ? 202.921 187.953 5.807   1.00 25.48 ? 2019 HOH A O     1 
HETATM 2483 O  O     . HOH J 6 .   ? 200.047 185.273 4.691   1.00 36.63 ? 2020 HOH A O     1 
HETATM 2484 O  O     . HOH J 6 .   ? 192.261 183.101 8.973   1.00 35.20 ? 2021 HOH A O     1 
HETATM 2485 O  O     . HOH J 6 .   ? 196.564 193.700 7.818   1.00 32.38 ? 2022 HOH A O     1 
HETATM 2486 O  O     . HOH J 6 .   ? 195.433 186.638 2.426   1.00 32.36 ? 2023 HOH A O     1 
HETATM 2487 O  O     . HOH J 6 .   ? 188.303 192.170 8.139   1.00 29.33 ? 2024 HOH A O     1 
HETATM 2488 O  O     . HOH J 6 .   ? 190.638 181.376 1.418   1.00 40.50 ? 2025 HOH A O     1 
HETATM 2489 O  O     . HOH J 6 .   ? 191.151 178.650 10.287  1.00 25.58 ? 2026 HOH A O     1 
HETATM 2490 O  O     . HOH J 6 .   ? 201.816 192.555 4.023   1.00 28.31 ? 2027 HOH A O     1 
HETATM 2491 O  O     . HOH J 6 .   ? 192.921 180.168 8.084   1.00 30.46 ? 2028 HOH A O     1 
HETATM 2492 O  O     . HOH J 6 .   ? 181.725 186.361 4.468   1.00 44.13 ? 2029 HOH A O     1 
HETATM 2493 O  O     . HOH J 6 .   ? 189.838 194.231 7.217   1.00 42.16 ? 2030 HOH A O     1 
HETATM 2494 O  O     . HOH J 6 .   ? 173.867 181.212 14.618  1.00 28.93 ? 2031 HOH A O     1 
HETATM 2495 O  O     . HOH J 6 .   ? 174.539 169.945 15.478  1.00 36.75 ? 2032 HOH A O     1 
HETATM 2496 O  O     . HOH J 6 .   ? 176.401 172.283 12.285  1.00 22.44 ? 2033 HOH A O     1 
HETATM 2497 O  O     . HOH J 6 .   ? 177.094 169.275 14.745  1.00 17.83 ? 2034 HOH A O     1 
HETATM 2498 O  O     . HOH J 6 .   ? 178.487 174.788 11.702  1.00 18.10 ? 2035 HOH A O     1 
HETATM 2499 O  O     . HOH J 6 .   ? 176.985 177.272 13.711  1.00 28.39 ? 2036 HOH A O     1 
HETATM 2500 O  O     . HOH J 6 .   ? 175.457 179.403 15.662  1.00 39.35 ? 2037 HOH A O     1 
HETATM 2501 O  O     . HOH J 6 .   ? 174.316 180.622 18.227  1.00 29.36 ? 2038 HOH A O     1 
HETATM 2502 O  O     . HOH J 6 .   ? 178.223 170.722 21.753  1.00 28.96 ? 2039 HOH A O     1 
HETATM 2503 O  O     . HOH J 6 .   ? 191.430 148.459 1.931   1.00 29.87 ? 2040 HOH A O     1 
HETATM 2504 O  O     . HOH J 6 .   ? 183.937 190.638 21.333  1.00 17.02 ? 2041 HOH A O     1 
HETATM 2505 O  O     . HOH J 6 .   ? 186.340 190.812 24.666  1.00 32.99 ? 2042 HOH A O     1 
HETATM 2506 O  O     . HOH J 6 .   ? 189.561 189.228 27.405  1.00 21.42 ? 2043 HOH A O     1 
HETATM 2507 O  O     . HOH J 6 .   ? 194.391 191.022 26.003  1.00 35.26 ? 2044 HOH A O     1 
HETATM 2508 O  O     . HOH J 6 .   ? 197.775 190.097 18.980  1.00 22.00 ? 2045 HOH A O     1 
HETATM 2509 O  O     . HOH J 6 .   ? 180.703 166.918 18.919  1.00 22.25 ? 2046 HOH A O     1 
HETATM 2510 O  O     . HOH J 6 .   ? 188.683 164.953 24.250  1.00 16.65 ? 2047 HOH A O     1 
HETATM 2511 O  O     . HOH J 6 .   ? 180.414 171.384 22.814  1.00 8.30  ? 2048 HOH A O     1 
HETATM 2512 O  O     . HOH J 6 .   ? 189.284 166.218 21.436  1.00 18.57 ? 2049 HOH A O     1 
HETATM 2513 O  O     . HOH J 6 .   ? 191.345 160.562 17.366  1.00 19.61 ? 2050 HOH A O     1 
HETATM 2514 O  O     . HOH J 6 .   ? 193.113 164.352 18.292  1.00 18.52 ? 2051 HOH A O     1 
HETATM 2515 O  O     . HOH J 6 .   ? 197.775 160.663 10.355  1.00 30.90 ? 2052 HOH A O     1 
HETATM 2516 O  O     . HOH J 6 .   ? 199.421 160.492 21.694  1.00 54.41 ? 2053 HOH A O     1 
HETATM 2517 O  O     . HOH J 6 .   ? 192.854 158.543 18.441  1.00 20.42 ? 2054 HOH A O     1 
HETATM 2518 O  O     . HOH J 6 .   ? 195.036 155.601 22.286  1.00 43.08 ? 2055 HOH A O     1 
HETATM 2519 O  O     . HOH J 6 .   ? 199.841 150.695 13.176  1.00 35.40 ? 2056 HOH A O     1 
HETATM 2520 O  O     . HOH J 6 .   ? 199.217 156.232 8.084   1.00 24.50 ? 2057 HOH A O     1 
HETATM 2521 O  O     . HOH J 6 .   ? 192.666 150.025 4.037   1.00 24.70 ? 2058 HOH A O     1 
HETATM 2522 O  O     . HOH J 6 .   ? 189.806 150.396 10.582  1.00 17.00 ? 2059 HOH A O     1 
HETATM 2523 O  O     . HOH J 6 .   ? 184.713 145.517 -1.099  1.00 25.66 ? 2060 HOH A O     1 
HETATM 2524 O  O     . HOH J 6 .   ? 190.279 149.132 -0.366  1.00 23.37 ? 2061 HOH A O     1 
HETATM 2525 O  O     . HOH J 6 .   ? 185.689 149.073 10.194  1.00 32.44 ? 2062 HOH A O     1 
HETATM 2526 O  O     . HOH J 6 .   ? 189.320 149.244 12.871  1.00 39.74 ? 2063 HOH A O     1 
HETATM 2527 O  O     . HOH J 6 .   ? 176.801 160.388 11.646  1.00 15.90 ? 2064 HOH A O     1 
HETATM 2528 O  O     . HOH J 6 .   ? 209.038 162.643 -13.951 1.00 29.71 ? 2065 HOH A O     1 
HETATM 2529 O  O     . HOH J 6 .   ? 173.359 158.848 5.717   1.00 26.69 ? 2066 HOH A O     1 
HETATM 2530 O  O     . HOH J 6 .   ? 173.141 166.101 3.246   1.00 37.73 ? 2067 HOH A O     1 
HETATM 2531 O  O     . HOH J 6 .   ? 172.186 178.856 -0.480  1.00 35.57 ? 2068 HOH A O     1 
HETATM 2532 O  O     . HOH J 6 .   ? 168.783 176.131 0.277   1.00 37.59 ? 2069 HOH A O     1 
HETATM 2533 O  O     . HOH J 6 .   ? 187.994 175.656 4.804   1.00 16.00 ? 2070 HOH A O     1 
HETATM 2534 O  O     . HOH J 6 .   ? 191.798 173.307 -1.526  1.00 20.55 ? 2071 HOH A O     1 
HETATM 2535 O  O     . HOH J 6 .   ? 197.603 165.048 7.104   1.00 39.85 ? 2072 HOH A O     1 
HETATM 2536 O  O     . HOH J 6 .   ? 194.144 171.703 11.618  1.00 13.61 ? 2073 HOH A O     1 
HETATM 2537 O  O     . HOH J 6 .   ? 179.913 164.861 20.417  1.00 23.03 ? 2074 HOH A O     1 
HETATM 2538 O  O     . HOH J 6 .   ? 178.237 157.118 15.427  1.00 37.51 ? 2075 HOH A O     1 
HETATM 2539 O  O     . HOH J 6 .   ? 185.065 157.114 14.496  1.00 16.39 ? 2076 HOH A O     1 
HETATM 2540 O  O     . HOH J 6 .   ? 186.096 174.714 13.402  1.00 14.25 ? 2077 HOH A O     1 
HETATM 2541 O  O     . HOH J 6 .   ? 190.362 181.451 8.363   1.00 23.84 ? 2078 HOH A O     1 
HETATM 2542 O  O     . HOH J 6 .   ? 188.183 181.649 3.509   1.00 23.15 ? 2079 HOH A O     1 
HETATM 2543 O  O     . HOH J 6 .   ? 173.656 180.838 -1.296  1.00 19.16 ? 2080 HOH A O     1 
HETATM 2544 O  O     . HOH J 6 .   ? 182.606 183.843 1.498   1.00 23.82 ? 2081 HOH A O     1 
HETATM 2545 O  O     . HOH J 6 .   ? 179.041 176.835 -4.879  1.00 28.93 ? 2082 HOH A O     1 
HETATM 2546 O  O     . HOH J 6 .   ? 173.232 181.808 -8.349  1.00 19.06 ? 2083 HOH A O     1 
HETATM 2547 O  O     . HOH J 6 .   ? 174.542 185.298 -11.131 1.00 31.96 ? 2084 HOH A O     1 
HETATM 2548 O  O     . HOH J 6 .   ? 179.030 185.642 -6.293  1.00 8.84  ? 2085 HOH A O     1 
HETATM 2549 O  O     . HOH J 6 .   ? 188.055 177.150 -16.174 1.00 39.31 ? 2086 HOH A O     1 
HETATM 2550 O  O     . HOH J 6 .   ? 185.742 175.020 -12.633 1.00 32.61 ? 2087 HOH A O     1 
HETATM 2551 O  O     . HOH J 6 .   ? 182.000 183.023 -13.348 1.00 15.88 ? 2088 HOH A O     1 
HETATM 2552 O  O     . HOH J 6 .   ? 182.827 187.517 -4.364  1.00 45.61 ? 2089 HOH A O     1 
HETATM 2553 O  O     . HOH J 6 .   ? 194.572 183.197 -8.077  1.00 36.64 ? 2090 HOH A O     1 
HETATM 2554 O  O     . HOH J 6 .   ? 194.313 179.202 -8.444  1.00 16.79 ? 2091 HOH A O     1 
HETATM 2555 O  O     . HOH J 6 .   ? 188.179 184.543 -6.390  1.00 10.24 ? 2092 HOH A O     1 
HETATM 2556 O  O     . HOH J 6 .   ? 191.207 184.866 -0.535  1.00 34.38 ? 2093 HOH A O     1 
HETATM 2557 O  O     . HOH J 6 .   ? 189.954 187.203 -3.104  1.00 30.21 ? 2094 HOH A O     1 
HETATM 2558 O  O     . HOH J 6 .   ? 196.789 179.956 0.077   1.00 34.96 ? 2095 HOH A O     1 
HETATM 2559 O  O     . HOH J 6 .   ? 195.541 178.234 1.979   1.00 25.17 ? 2096 HOH A O     1 
HETATM 2560 O  O     . HOH J 6 .   ? 203.221 164.983 2.765   1.00 30.78 ? 2097 HOH A O     1 
HETATM 2561 O  O     . HOH J 6 .   ? 203.827 165.930 -0.838  1.00 16.37 ? 2098 HOH A O     1 
HETATM 2562 O  O     . HOH J 6 .   ? 198.698 163.980 -2.087  1.00 16.88 ? 2099 HOH A O     1 
HETATM 2563 O  O     . HOH J 6 .   ? 200.365 168.406 2.165   1.00 9.98  ? 2100 HOH A O     1 
HETATM 2564 O  O     . HOH J 6 .   ? 195.798 166.787 -4.678  1.00 16.05 ? 2101 HOH A O     1 
HETATM 2565 O  O     . HOH J 6 .   ? 186.612 173.366 -9.877  1.00 19.22 ? 2102 HOH A O     1 
HETATM 2566 O  O     . HOH J 6 .   ? 191.486 178.801 -8.556  1.00 14.47 ? 2103 HOH A O     1 
HETATM 2567 O  O     . HOH J 6 .   ? 175.607 172.274 -8.036  1.00 36.47 ? 2104 HOH A O     1 
HETATM 2568 O  O     . HOH J 6 .   ? 178.742 175.122 -2.821  1.00 12.41 ? 2105 HOH A O     1 
HETATM 2569 O  O     . HOH J 6 .   ? 197.136 162.247 7.860   1.00 20.24 ? 2106 HOH A O     1 
HETATM 2570 O  O     . HOH J 6 .   ? 203.088 159.272 -4.093  1.00 20.75 ? 2107 HOH A O     1 
HETATM 2571 O  O     . HOH J 6 .   ? 209.167 161.801 -3.764  1.00 29.76 ? 2108 HOH A O     1 
HETATM 2572 O  O     . HOH J 6 .   ? 204.362 177.082 -3.998  1.00 42.74 ? 2109 HOH A O     1 
HETATM 2573 O  O     . HOH J 6 .   ? 209.304 163.564 -16.281 1.00 27.44 ? 2110 HOH A O     1 
HETATM 2574 O  O     . HOH J 6 .   ? 204.072 167.051 -16.474 1.00 30.81 ? 2111 HOH A O     1 
HETATM 2575 O  O     . HOH J 6 .   ? 202.504 159.814 -7.441  1.00 22.58 ? 2112 HOH A O     1 
HETATM 2576 O  O     . HOH J 6 .   ? 201.038 146.684 -3.627  1.00 28.72 ? 2113 HOH A O     1 
HETATM 2577 O  O     . HOH J 6 .   ? 198.254 147.344 -7.377  1.00 23.99 ? 2114 HOH A O     1 
HETATM 2578 O  O     . HOH J 6 .   ? 188.136 149.463 -10.689 1.00 31.69 ? 2115 HOH A O     1 
HETATM 2579 O  O     . HOH J 6 .   ? 185.505 146.137 -4.208  1.00 30.91 ? 2116 HOH A O     1 
HETATM 2580 O  O     . HOH J 6 .   ? 191.170 159.628 -12.340 1.00 35.35 ? 2117 HOH A O     1 
HETATM 2581 O  O     . HOH J 6 .   ? 180.418 156.423 -15.983 1.00 38.69 ? 2118 HOH A O     1 
HETATM 2582 O  O     . HOH J 6 .   ? 191.553 162.337 -15.173 1.00 30.34 ? 2119 HOH A O     1 
HETATM 2583 O  O     . HOH J 6 .   ? 175.195 156.308 1.515   1.00 25.31 ? 2120 HOH A O     1 
HETATM 2584 O  O     . HOH J 6 .   ? 174.343 151.575 -4.090  1.00 24.22 ? 2121 HOH A O     1 
HETATM 2585 O  O     . HOH J 6 .   ? 189.729 170.883 13.071  1.00 24.00 ? 2122 HOH A O     1 
HETATM 2586 O  O     . HOH J 6 .   ? 192.932 176.681 8.727   1.00 17.49 ? 2123 HOH A O     1 
HETATM 2587 O  O     . HOH J 6 .   ? 194.908 178.479 10.038  1.00 12.42 ? 2124 HOH A O     1 
HETATM 2588 O  O     . HOH J 6 .   ? 193.215 179.995 11.973  1.00 17.15 ? 2125 HOH A O     1 
HETATM 2589 O  O     . HOH J 6 .   ? 193.562 167.033 18.576  1.00 34.40 ? 2126 HOH A O     1 
HETATM 2590 O  O     . HOH J 6 .   ? 188.165 173.468 14.493  1.00 18.83 ? 2127 HOH A O     1 
HETATM 2591 O  O     . HOH J 6 .   ? 191.227 167.117 19.848  1.00 27.52 ? 2128 HOH A O     1 
HETATM 2592 O  O     . HOH J 6 .   ? 194.904 178.835 14.332  1.00 9.84  ? 2129 HOH A O     1 
HETATM 2593 O  O     . HOH J 6 .   ? 178.455 169.305 -5.499  1.00 13.87 ? 2130 HOH A O     1 
HETATM 2594 O  O     . HOH J 6 .   ? 174.141 170.073 -2.678  1.00 18.36 ? 2131 HOH A O     1 
HETATM 2595 O  O     . HOH J 6 .   ? 197.989 162.673 24.709  1.00 31.35 ? 2132 HOH A O     1 
HETATM 2596 O  O     . HOH K 6 .   ? 190.076 196.775 13.865  1.00 38.81 ? 2001 HOH B O     1 
HETATM 2597 O  O     . HOH K 6 .   ? 186.693 195.451 15.184  1.00 30.28 ? 2002 HOH B O     1 
HETATM 2598 O  O     . HOH K 6 .   ? 183.572 197.288 15.706  1.00 39.58 ? 2003 HOH B O     1 
HETATM 2599 O  O     . HOH K 6 .   ? 175.707 190.116 18.448  1.00 37.47 ? 2004 HOH B O     1 
HETATM 2600 O  O     . HOH K 6 .   ? 169.850 183.554 9.734   1.00 31.19 ? 2005 HOH B O     1 
HETATM 2601 O  O     . HOH K 6 .   ? 168.310 173.985 5.026   1.00 36.83 ? 2006 HOH B O     1 
HETATM 2602 O  O     . HOH K 6 .   ? 168.522 176.594 9.704   1.00 27.47 ? 2007 HOH B O     1 
HETATM 2603 O  O     . HOH K 6 .   ? 178.977 189.493 5.006   1.00 25.99 ? 2008 HOH B O     1 
HETATM 2604 O  O     . HOH K 6 .   ? 168.429 188.864 -6.367  1.00 22.94 ? 2009 HOH B O     1 
HETATM 2605 O  O     . HOH K 6 .   ? 166.875 190.046 -8.389  1.00 35.44 ? 2010 HOH B O     1 
HETATM 2606 O  O     . HOH K 6 .   ? 169.159 198.181 -6.371  1.00 34.05 ? 2011 HOH B O     1 
HETATM 2607 O  O     . HOH K 6 .   ? 166.356 175.210 9.226   1.00 35.64 ? 2012 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   122 ?   ?   ?   A . n 
A 1 2   SER 2   123 123 SER SER A . n 
A 1 3   LYS 3   124 124 LYS LYS A . n 
A 1 4   LYS 4   125 125 LYS LYS A . n 
A 1 5   ARG 5   126 126 ARG ARG A . n 
A 1 6   GLN 6   127 127 GLN GLN A . n 
A 1 7   TRP 7   128 128 TRP TRP A . n 
A 1 8   ALA 8   129 129 ALA ALA A . n 
A 1 9   LEU 9   130 130 LEU LEU A . n 
A 1 10  GLU 10  131 131 GLU GLU A . n 
A 1 11  ASP 11  132 132 ASP ASP A . n 
A 1 12  PHE 12  133 133 PHE PHE A . n 
A 1 13  GLU 13  134 134 GLU GLU A . n 
A 1 14  ILE 14  135 135 ILE ILE A . n 
A 1 15  GLY 15  136 136 GLY GLY A . n 
A 1 16  ARG 16  137 137 ARG ARG A . n 
A 1 17  PRO 17  138 138 PRO PRO A . n 
A 1 18  LEU 18  139 139 LEU LEU A . n 
A 1 19  GLY 19  140 140 GLY GLY A . n 
A 1 20  LYS 20  141 141 LYS LYS A . n 
A 1 21  GLY 21  142 142 GLY GLY A . n 
A 1 22  LYS 22  143 143 LYS LYS A . n 
A 1 23  PHE 23  144 144 PHE PHE A . n 
A 1 24  GLY 24  145 145 GLY GLY A . n 
A 1 25  ASN 25  146 146 ASN ASN A . n 
A 1 26  VAL 26  147 147 VAL VAL A . n 
A 1 27  TYR 27  148 148 TYR TYR A . n 
A 1 28  LEU 28  149 149 LEU LEU A . n 
A 1 29  ALA 29  150 150 ALA ALA A . n 
A 1 30  ARG 30  151 151 ARG ARG A . n 
A 1 31  GLU 31  152 152 GLU GLU A . n 
A 1 32  LYS 32  153 153 LYS LYS A . n 
A 1 33  GLN 33  154 154 GLN GLN A . n 
A 1 34  SER 34  155 155 SER SER A . n 
A 1 35  LYS 35  156 156 LYS LYS A . n 
A 1 36  PHE 36  157 157 PHE PHE A . n 
A 1 37  ILE 37  158 158 ILE ILE A . n 
A 1 38  LEU 38  159 159 LEU LEU A . n 
A 1 39  ALA 39  160 160 ALA ALA A . n 
A 1 40  LEU 40  161 161 LEU LEU A . n 
A 1 41  LYS 41  162 162 LYS LYS A . n 
A 1 42  VAL 42  163 163 VAL VAL A . n 
A 1 43  LEU 43  164 164 LEU LEU A . n 
A 1 44  PHE 44  165 165 PHE PHE A . n 
A 1 45  LYS 45  166 166 LYS LYS A . n 
A 1 46  ALA 46  167 167 ALA ALA A . n 
A 1 47  GLN 47  168 168 GLN GLN A . n 
A 1 48  LEU 48  169 169 LEU LEU A . n 
A 1 49  GLU 49  170 170 GLU GLU A . n 
A 1 50  LYS 50  171 171 LYS LYS A . n 
A 1 51  ALA 51  172 172 ALA ALA A . n 
A 1 52  GLY 52  173 173 GLY GLY A . n 
A 1 53  VAL 53  174 174 VAL VAL A . n 
A 1 54  GLU 54  175 175 GLU GLU A . n 
A 1 55  HIS 55  176 176 HIS HIS A . n 
A 1 56  GLN 56  177 177 GLN GLN A . n 
A 1 57  LEU 57  178 178 LEU LEU A . n 
A 1 58  ARG 58  179 179 ARG ARG A . n 
A 1 59  ARG 59  180 180 ARG ARG A . n 
A 1 60  GLU 60  181 181 GLU GLU A . n 
A 1 61  VAL 61  182 182 VAL VAL A . n 
A 1 62  GLU 62  183 183 GLU GLU A . n 
A 1 63  ILE 63  184 184 ILE ILE A . n 
A 1 64  GLN 64  185 185 GLN GLN A . n 
A 1 65  SER 65  186 186 SER SER A . n 
A 1 66  HIS 66  187 187 HIS HIS A . n 
A 1 67  LEU 67  188 188 LEU LEU A . n 
A 1 68  ARG 68  189 189 ARG ARG A . n 
A 1 69  HIS 69  190 190 HIS HIS A . n 
A 1 70  PRO 70  191 191 PRO PRO A . n 
A 1 71  ASN 71  192 192 ASN ASN A . n 
A 1 72  ILE 72  193 193 ILE ILE A . n 
A 1 73  LEU 73  194 194 LEU LEU A . n 
A 1 74  ARG 74  195 195 ARG ARG A . n 
A 1 75  LEU 75  196 196 LEU LEU A . n 
A 1 76  TYR 76  197 197 TYR TYR A . n 
A 1 77  GLY 77  198 198 GLY GLY A . n 
A 1 78  TYR 78  199 199 TYR TYR A . n 
A 1 79  PHE 79  200 200 PHE PHE A . n 
A 1 80  HIS 80  201 201 HIS HIS A . n 
A 1 81  ASP 81  202 202 ASP ASP A . n 
A 1 82  ALA 82  203 203 ALA ALA A . n 
A 1 83  THR 83  204 204 THR THR A . n 
A 1 84  ARG 84  205 205 ARG ARG A . n 
A 1 85  VAL 85  206 206 VAL VAL A . n 
A 1 86  TYR 86  207 207 TYR TYR A . n 
A 1 87  LEU 87  208 208 LEU LEU A . n 
A 1 88  ILE 88  209 209 ILE ILE A . n 
A 1 89  LEU 89  210 210 LEU LEU A . n 
A 1 90  GLU 90  211 211 GLU GLU A . n 
A 1 91  TYR 91  212 212 TYR TYR A . n 
A 1 92  ALA 92  213 213 ALA ALA A . n 
A 1 93  PRO 93  214 214 PRO PRO A . n 
A 1 94  LEU 94  215 215 LEU LEU A . n 
A 1 95  GLY 95  216 216 GLY GLY A . n 
A 1 96  THR 96  217 217 THR THR A . n 
A 1 97  VAL 97  218 218 VAL VAL A . n 
A 1 98  TYR 98  219 219 TYR TYR A . n 
A 1 99  ARG 99  220 220 ARG ARG A . n 
A 1 100 GLU 100 221 221 GLU GLU A . n 
A 1 101 LEU 101 222 222 LEU LEU A . n 
A 1 102 GLN 102 223 223 GLN GLN A . n 
A 1 103 LYS 103 224 224 LYS LYS A . n 
A 1 104 LEU 104 225 225 LEU LEU A . n 
A 1 105 SER 105 226 226 SER SER A . n 
A 1 106 LYS 106 227 227 LYS LYS A . n 
A 1 107 PHE 107 228 228 PHE PHE A . n 
A 1 108 ASP 108 229 229 ASP ASP A . n 
A 1 109 GLU 109 230 230 GLU GLU A . n 
A 1 110 GLN 110 231 231 GLN GLN A . n 
A 1 111 ARG 111 232 232 ARG ARG A . n 
A 1 112 THR 112 233 233 THR THR A . n 
A 1 113 ALA 113 234 234 ALA ALA A . n 
A 1 114 THR 114 235 235 THR THR A . n 
A 1 115 TYR 115 236 236 TYR TYR A . n 
A 1 116 ILE 116 237 237 ILE ILE A . n 
A 1 117 THR 117 238 238 THR THR A . n 
A 1 118 GLU 118 239 239 GLU GLU A . n 
A 1 119 LEU 119 240 240 LEU LEU A . n 
A 1 120 ALA 120 241 241 ALA ALA A . n 
A 1 121 ASN 121 242 242 ASN ASN A . n 
A 1 122 ALA 122 243 243 ALA ALA A . n 
A 1 123 LEU 123 244 244 LEU LEU A . n 
A 1 124 SER 124 245 245 SER SER A . n 
A 1 125 TYR 125 246 246 TYR TYR A . n 
A 1 126 CYS 126 247 247 CYS CYS A . n 
A 1 127 HIS 127 248 248 HIS HIS A . n 
A 1 128 SER 128 249 249 SER SER A . n 
A 1 129 LYS 129 250 250 LYS LYS A . n 
A 1 130 ARG 130 251 251 ARG ARG A . n 
A 1 131 VAL 131 252 252 VAL VAL A . n 
A 1 132 ILE 132 253 253 ILE ILE A . n 
A 1 133 HIS 133 254 254 HIS HIS A . n 
A 1 134 ARG 134 255 255 ARG ARG A . n 
A 1 135 ASP 135 256 256 ASP ASP A . n 
A 1 136 ILE 136 257 257 ILE ILE A . n 
A 1 137 LYS 137 258 258 LYS LYS A . n 
A 1 138 PRO 138 259 259 PRO PRO A . n 
A 1 139 GLU 139 260 260 GLU GLU A . n 
A 1 140 ASN 140 261 261 ASN ASN A . n 
A 1 141 LEU 141 262 262 LEU LEU A . n 
A 1 142 LEU 142 263 263 LEU LEU A . n 
A 1 143 LEU 143 264 264 LEU LEU A . n 
A 1 144 GLY 144 265 265 GLY GLY A . n 
A 1 145 SER 145 266 266 SER SER A . n 
A 1 146 ALA 146 267 267 ALA ALA A . n 
A 1 147 GLY 147 268 268 GLY GLY A . n 
A 1 148 GLU 148 269 269 GLU GLU A . n 
A 1 149 LEU 149 270 270 LEU LEU A . n 
A 1 150 LYS 150 271 271 LYS LYS A . n 
A 1 151 ILE 151 272 272 ILE ILE A . n 
A 1 152 ALA 152 273 273 ALA ALA A . n 
A 1 153 ASP 153 274 274 ASP ASP A . n 
A 1 154 PHE 154 275 275 PHE PHE A . n 
A 1 155 GLY 155 276 276 GLY GLY A . n 
A 1 156 TRP 156 277 277 TRP TRP A . n 
A 1 157 SER 157 278 278 SER SER A . n 
A 1 158 VAL 158 279 279 VAL VAL A . n 
A 1 159 HIS 159 280 280 HIS HIS A . n 
A 1 160 ALA 160 281 281 ALA ALA A . n 
A 1 161 PRO 161 282 282 PRO PRO A . n 
A 1 162 SER 162 283 283 SER SER A . n 
A 1 163 SER 163 284 284 SER SER A . n 
A 1 164 ARG 164 285 285 ARG ARG A . n 
A 1 165 ARG 165 286 286 ARG ARG A . n 
A 1 166 TPO 166 287 287 TPO TPO A . n 
A 1 167 TPO 167 288 288 TPO TPO A . n 
A 1 168 LEU 168 289 289 LEU LEU A . n 
A 1 169 CYS 169 290 290 CYS CYS A . n 
A 1 170 GLY 170 291 291 GLY GLY A . n 
A 1 171 THR 171 292 292 THR THR A . n 
A 1 172 LEU 172 293 293 LEU LEU A . n 
A 1 173 ASP 173 294 294 ASP ASP A . n 
A 1 174 TYR 174 295 295 TYR TYR A . n 
A 1 175 LEU 175 296 296 LEU LEU A . n 
A 1 176 PRO 176 297 297 PRO PRO A . n 
A 1 177 PRO 177 298 298 PRO PRO A . n 
A 1 178 GLU 178 299 299 GLU GLU A . n 
A 1 179 MET 179 300 300 MET MET A . n 
A 1 180 ILE 180 301 301 ILE ILE A . n 
A 1 181 GLU 181 302 302 GLU GLU A . n 
A 1 182 GLY 182 303 303 GLY GLY A . n 
A 1 183 ARG 183 304 304 ARG ARG A . n 
A 1 184 MET 184 305 305 MET MET A . n 
A 1 185 HIS 185 306 306 HIS HIS A . n 
A 1 186 ASP 186 307 307 ASP ASP A . n 
A 1 187 GLU 187 308 308 GLU GLU A . n 
A 1 188 LYS 188 309 309 LYS LYS A . n 
A 1 189 VAL 189 310 310 VAL VAL A . n 
A 1 190 ASP 190 311 311 ASP ASP A . n 
A 1 191 LEU 191 312 312 LEU LEU A . n 
A 1 192 TRP 192 313 313 TRP TRP A . n 
A 1 193 SER 193 314 314 SER SER A . n 
A 1 194 LEU 194 315 315 LEU LEU A . n 
A 1 195 GLY 195 316 316 GLY GLY A . n 
A 1 196 VAL 196 317 317 VAL VAL A . n 
A 1 197 LEU 197 318 318 LEU LEU A . n 
A 1 198 CYS 198 319 319 CYS CYS A . n 
A 1 199 TYR 199 320 320 TYR TYR A . n 
A 1 200 GLU 200 321 321 GLU GLU A . n 
A 1 201 PHE 201 322 322 PHE PHE A . n 
A 1 202 LEU 202 323 323 LEU LEU A . n 
A 1 203 VAL 203 324 324 VAL VAL A . n 
A 1 204 GLY 204 325 325 GLY GLY A . n 
A 1 205 LYS 205 326 326 LYS LYS A . n 
A 1 206 PRO 206 327 327 PRO PRO A . n 
A 1 207 PRO 207 328 328 PRO PRO A . n 
A 1 208 PHE 208 329 329 PHE PHE A . n 
A 1 209 GLU 209 330 330 GLU GLU A . n 
A 1 210 ALA 210 331 331 ALA ALA A . n 
A 1 211 ASN 211 332 332 ASN ASN A . n 
A 1 212 THR 212 333 333 THR THR A . n 
A 1 213 TYR 213 334 334 TYR TYR A . n 
A 1 214 GLN 214 335 335 GLN GLN A . n 
A 1 215 GLU 215 336 336 GLU GLU A . n 
A 1 216 THR 216 337 337 THR THR A . n 
A 1 217 TYR 217 338 338 TYR TYR A . n 
A 1 218 LYS 218 339 339 LYS LYS A . n 
A 1 219 ARG 219 340 340 ARG ARG A . n 
A 1 220 ILE 220 341 341 ILE ILE A . n 
A 1 221 SER 221 342 342 SER SER A . n 
A 1 222 ARG 222 343 343 ARG ARG A . n 
A 1 223 VAL 223 344 344 VAL VAL A . n 
A 1 224 GLU 224 345 345 GLU GLU A . n 
A 1 225 PHE 225 346 346 PHE PHE A . n 
A 1 226 THR 226 347 347 THR THR A . n 
A 1 227 PHE 227 348 348 PHE PHE A . n 
A 1 228 PRO 228 349 349 PRO PRO A . n 
A 1 229 ASP 229 350 350 ASP ASP A . n 
A 1 230 PHE 230 351 351 PHE PHE A . n 
A 1 231 VAL 231 352 352 VAL VAL A . n 
A 1 232 THR 232 353 353 THR THR A . n 
A 1 233 GLU 233 354 354 GLU GLU A . n 
A 1 234 GLY 234 355 355 GLY GLY A . n 
A 1 235 ALA 235 356 356 ALA ALA A . n 
A 1 236 ARG 236 357 357 ARG ARG A . n 
A 1 237 ASP 237 358 358 ASP ASP A . n 
A 1 238 LEU 238 359 359 LEU LEU A . n 
A 1 239 ILE 239 360 360 ILE ILE A . n 
A 1 240 SER 240 361 361 SER SER A . n 
A 1 241 ARG 241 362 362 ARG ARG A . n 
A 1 242 LEU 242 363 363 LEU LEU A . n 
A 1 243 LEU 243 364 364 LEU LEU A . n 
A 1 244 LYS 244 365 365 LYS LYS A . n 
A 1 245 HIS 245 366 366 HIS HIS A . n 
A 1 246 ASN 246 367 367 ASN ASN A . n 
A 1 247 PRO 247 368 368 PRO PRO A . n 
A 1 248 SER 248 369 369 SER SER A . n 
A 1 249 GLN 249 370 370 GLN GLN A . n 
A 1 250 ARG 250 371 371 ARG ARG A . n 
A 1 251 PRO 251 372 372 PRO PRO A . n 
A 1 252 MET 252 373 373 MET MET A . n 
A 1 253 LEU 253 374 374 LEU LEU A . n 
A 1 254 ARG 254 375 375 ARG ARG A . n 
A 1 255 GLU 255 376 376 GLU GLU A . n 
A 1 256 VAL 256 377 377 VAL VAL A . n 
A 1 257 LEU 257 378 378 LEU LEU A . n 
A 1 258 GLU 258 379 379 GLU GLU A . n 
A 1 259 HIS 259 380 380 HIS HIS A . n 
A 1 260 PRO 260 381 381 PRO PRO A . n 
A 1 261 TRP 261 382 382 TRP TRP A . n 
A 1 262 ILE 262 383 383 ILE ILE A . n 
A 1 263 THR 263 384 384 THR THR A . n 
A 1 264 ALA 264 385 385 ALA ALA A . n 
A 1 265 ASN 265 386 386 ASN ASN A . n 
A 1 266 SER 266 387 387 SER SER A . n 
A 1 267 SER 267 388 388 SER SER A . n 
A 1 268 LYS 268 389 ?   ?   ?   A . n 
A 1 269 PRO 269 390 ?   ?   ?   A . n 
A 1 270 SER 270 391 ?   ?   ?   A . n 
A 1 271 ASN 271 392 ?   ?   ?   A . n 
A 1 272 CYS 272 393 ?   ?   ?   A . n 
A 1 273 GLN 273 394 ?   ?   ?   A . n 
A 1 274 ASN 274 395 ?   ?   ?   A . n 
A 1 275 LYS 275 396 ?   ?   ?   A . n 
A 1 276 GLU 276 397 ?   ?   ?   A . n 
A 1 277 SER 277 398 ?   ?   ?   A . n 
A 1 278 ALA 278 399 ?   ?   ?   A . n 
A 1 279 SER 279 400 ?   ?   ?   A . n 
A 1 280 LYS 280 401 ?   ?   ?   A . n 
A 1 281 GLN 281 402 ?   ?   ?   A . n 
A 1 282 SER 282 403 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   ALA 2   2   ?   ?   ?   B . n 
B 2 3   GLN 3   3   ?   ?   ?   B . n 
B 2 4   VAL 4   4   ?   ?   ?   B . n 
B 2 5   LYS 5   5   ?   ?   ?   B . n 
B 2 6   SER 6   6   ?   ?   ?   B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   TYR 8   8   8   TYR TYR B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  ASP 11  11  11  ASP ASP B . n 
B 2 12  ALA 12  12  12  ALA ALA B . n 
B 2 13  PRO 13  13  13  PRO PRO B . n 
B 2 14  SER 14  14  14  SER SER B . n 
B 2 15  ASP 15  15  15  ASP ASP B . n 
B 2 16  PHE 16  16  16  PHE PHE B . n 
B 2 17  ILE 17  17  17  ILE ILE B . n 
B 2 18  ASN 18  18  18  ASN ASN B . n 
B 2 19  PHE 19  19  19  PHE PHE B . n 
B 2 20  SER 20  20  20  SER SER B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  ASP 23  23  ?   ?   ?   B . n 
B 2 24  ASP 24  24  ?   ?   ?   B . n 
B 2 25  GLU 25  25  ?   ?   ?   B . n 
B 2 26  GLY 26  26  ?   ?   ?   B . n 
B 2 27  ASP 27  27  ?   ?   ?   B . n 
B 2 28  THR 28  28  ?   ?   ?   B . n 
B 2 29  GLN 29  29  ?   ?   ?   B . n 
B 2 30  ASN 30  30  30  ASN ASN B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  SER 33  33  33  SER SER B . n 
B 2 34  TRP 34  34  34  TRP TRP B . n 
B 2 35  PHE 35  35  35  PHE PHE B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  GLU 37  37  37  GLU GLU B . n 
B 2 38  LYS 38  38  38  LYS LYS B . n 
B 2 39  ALA 39  39  39  ALA ALA B . n 
B 2 40  ASN 40  40  40  ASN ASN B . n 
B 2 41  LEU 41  41  41  LEU LEU B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  ASN 43  43  43  ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ADP 1   1388 1388 ADP ADP A . 
D 4 MG  1   1389 1389 MG  MG  A . 
E 4 MG  1   1390 1390 MG  MG  A . 
F 5 SO4 1   1391 1391 SO4 SO4 A . 
G 5 SO4 1   1392 1392 SO4 SO4 A . 
H 5 SO4 1   1393 1393 SO4 SO4 A . 
I 4 MG  1   1394 1394 MG  MG  A . 
J 6 HOH 1   2001 2001 HOH HOH A . 
J 6 HOH 2   2002 2002 HOH HOH A . 
J 6 HOH 3   2003 2003 HOH HOH A . 
J 6 HOH 4   2004 2004 HOH HOH A . 
J 6 HOH 5   2005 2005 HOH HOH A . 
J 6 HOH 6   2006 2006 HOH HOH A . 
J 6 HOH 7   2007 2007 HOH HOH A . 
J 6 HOH 8   2008 2008 HOH HOH A . 
J 6 HOH 9   2009 2009 HOH HOH A . 
J 6 HOH 10  2010 2010 HOH HOH A . 
J 6 HOH 11  2011 2011 HOH HOH A . 
J 6 HOH 12  2012 2012 HOH HOH A . 
J 6 HOH 13  2013 2013 HOH HOH A . 
J 6 HOH 14  2014 2014 HOH HOH A . 
J 6 HOH 15  2015 2015 HOH HOH A . 
J 6 HOH 16  2016 2016 HOH HOH A . 
J 6 HOH 17  2017 2017 HOH HOH A . 
J 6 HOH 18  2018 2018 HOH HOH A . 
J 6 HOH 19  2019 2019 HOH HOH A . 
J 6 HOH 20  2020 2020 HOH HOH A . 
J 6 HOH 21  2021 2021 HOH HOH A . 
J 6 HOH 22  2022 2022 HOH HOH A . 
J 6 HOH 23  2023 2023 HOH HOH A . 
J 6 HOH 24  2024 2024 HOH HOH A . 
J 6 HOH 25  2025 2025 HOH HOH A . 
J 6 HOH 26  2026 2026 HOH HOH A . 
J 6 HOH 27  2027 2027 HOH HOH A . 
J 6 HOH 28  2028 2028 HOH HOH A . 
J 6 HOH 29  2029 2029 HOH HOH A . 
J 6 HOH 30  2030 2030 HOH HOH A . 
J 6 HOH 31  2031 2031 HOH HOH A . 
J 6 HOH 32  2032 2032 HOH HOH A . 
J 6 HOH 33  2033 2033 HOH HOH A . 
J 6 HOH 34  2034 2034 HOH HOH A . 
J 6 HOH 35  2035 2035 HOH HOH A . 
J 6 HOH 36  2036 2036 HOH HOH A . 
J 6 HOH 37  2037 2037 HOH HOH A . 
J 6 HOH 38  2038 2038 HOH HOH A . 
J 6 HOH 39  2039 2039 HOH HOH A . 
J 6 HOH 40  2040 2040 HOH HOH A . 
J 6 HOH 41  2041 2041 HOH HOH A . 
J 6 HOH 42  2042 2042 HOH HOH A . 
J 6 HOH 43  2043 2043 HOH HOH A . 
J 6 HOH 44  2044 2044 HOH HOH A . 
J 6 HOH 45  2045 2045 HOH HOH A . 
J 6 HOH 46  2046 2046 HOH HOH A . 
J 6 HOH 47  2047 2047 HOH HOH A . 
J 6 HOH 48  2048 2048 HOH HOH A . 
J 6 HOH 49  2049 2049 HOH HOH A . 
J 6 HOH 50  2050 2050 HOH HOH A . 
J 6 HOH 51  2051 2051 HOH HOH A . 
J 6 HOH 52  2052 2052 HOH HOH A . 
J 6 HOH 53  2053 2053 HOH HOH A . 
J 6 HOH 54  2054 2054 HOH HOH A . 
J 6 HOH 55  2055 2055 HOH HOH A . 
J 6 HOH 56  2056 2056 HOH HOH A . 
J 6 HOH 57  2057 2057 HOH HOH A . 
J 6 HOH 58  2058 2058 HOH HOH A . 
J 6 HOH 59  2059 2059 HOH HOH A . 
J 6 HOH 60  2060 2060 HOH HOH A . 
J 6 HOH 61  2061 2061 HOH HOH A . 
J 6 HOH 62  2062 2062 HOH HOH A . 
J 6 HOH 63  2063 2063 HOH HOH A . 
J 6 HOH 64  2064 2064 HOH HOH A . 
J 6 HOH 65  2065 2065 HOH HOH A . 
J 6 HOH 66  2066 2066 HOH HOH A . 
J 6 HOH 67  2067 2067 HOH HOH A . 
J 6 HOH 68  2068 2068 HOH HOH A . 
J 6 HOH 69  2069 2069 HOH HOH A . 
J 6 HOH 70  2070 2070 HOH HOH A . 
J 6 HOH 71  2071 2071 HOH HOH A . 
J 6 HOH 72  2072 2072 HOH HOH A . 
J 6 HOH 73  2073 2073 HOH HOH A . 
J 6 HOH 74  2074 2074 HOH HOH A . 
J 6 HOH 75  2075 2075 HOH HOH A . 
J 6 HOH 76  2076 2076 HOH HOH A . 
J 6 HOH 77  2077 2077 HOH HOH A . 
J 6 HOH 78  2078 2078 HOH HOH A . 
J 6 HOH 79  2079 2079 HOH HOH A . 
J 6 HOH 80  2080 2080 HOH HOH A . 
J 6 HOH 81  2081 2081 HOH HOH A . 
J 6 HOH 82  2082 2082 HOH HOH A . 
J 6 HOH 83  2083 2083 HOH HOH A . 
J 6 HOH 84  2084 2084 HOH HOH A . 
J 6 HOH 85  2085 2085 HOH HOH A . 
J 6 HOH 86  2086 2086 HOH HOH A . 
J 6 HOH 87  2087 2087 HOH HOH A . 
J 6 HOH 88  2088 2088 HOH HOH A . 
J 6 HOH 89  2089 2089 HOH HOH A . 
J 6 HOH 90  2090 2090 HOH HOH A . 
J 6 HOH 91  2091 2091 HOH HOH A . 
J 6 HOH 92  2092 2092 HOH HOH A . 
J 6 HOH 93  2093 2093 HOH HOH A . 
J 6 HOH 94  2094 2094 HOH HOH A . 
J 6 HOH 95  2095 2095 HOH HOH A . 
J 6 HOH 96  2096 2096 HOH HOH A . 
J 6 HOH 97  2097 2097 HOH HOH A . 
J 6 HOH 98  2098 2098 HOH HOH A . 
J 6 HOH 99  2099 2099 HOH HOH A . 
J 6 HOH 100 2100 2100 HOH HOH A . 
J 6 HOH 101 2101 2101 HOH HOH A . 
J 6 HOH 102 2102 2102 HOH HOH A . 
J 6 HOH 103 2103 2103 HOH HOH A . 
J 6 HOH 104 2104 2104 HOH HOH A . 
J 6 HOH 105 2105 2105 HOH HOH A . 
J 6 HOH 106 2106 2106 HOH HOH A . 
J 6 HOH 107 2107 2107 HOH HOH A . 
J 6 HOH 108 2108 2108 HOH HOH A . 
J 6 HOH 109 2109 2109 HOH HOH A . 
J 6 HOH 110 2110 2110 HOH HOH A . 
J 6 HOH 111 2111 2111 HOH HOH A . 
J 6 HOH 112 2112 2112 HOH HOH A . 
J 6 HOH 113 2113 2113 HOH HOH A . 
J 6 HOH 114 2114 2114 HOH HOH A . 
J 6 HOH 115 2115 2115 HOH HOH A . 
J 6 HOH 116 2116 2116 HOH HOH A . 
J 6 HOH 117 2117 2117 HOH HOH A . 
J 6 HOH 118 2118 2118 HOH HOH A . 
J 6 HOH 119 2119 2119 HOH HOH A . 
J 6 HOH 120 2120 2120 HOH HOH A . 
J 6 HOH 121 2121 2121 HOH HOH A . 
J 6 HOH 122 2122 2122 HOH HOH A . 
J 6 HOH 123 2123 2123 HOH HOH A . 
J 6 HOH 124 2124 2124 HOH HOH A . 
J 6 HOH 125 2125 2125 HOH HOH A . 
J 6 HOH 126 2126 2126 HOH HOH A . 
J 6 HOH 127 2127 2127 HOH HOH A . 
J 6 HOH 128 2128 2128 HOH HOH A . 
J 6 HOH 129 2129 2129 HOH HOH A . 
J 6 HOH 130 2130 2130 HOH HOH A . 
J 6 HOH 131 2131 2131 HOH HOH A . 
J 6 HOH 132 2132 2132 HOH HOH A . 
K 6 HOH 1   2001 2001 HOH HOH B . 
K 6 HOH 2   2002 2002 HOH HOH B . 
K 6 HOH 3   2003 2003 HOH HOH B . 
K 6 HOH 4   2004 2004 HOH HOH B . 
K 6 HOH 5   2005 2005 HOH HOH B . 
K 6 HOH 6   2006 2006 HOH HOH B . 
K 6 HOH 7   2007 2007 HOH HOH B . 
K 6 HOH 8   2008 2008 HOH HOH B . 
K 6 HOH 9   2009 2009 HOH HOH B . 
K 6 HOH 10  2010 2010 HOH HOH B . 
K 6 HOH 11  2011 2011 HOH HOH B . 
K 6 HOH 12  2012 2012 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 166 A TPO 287 ? THR PHOSPHOTHREONINE 
2 A TPO 167 A TPO 288 ? THR PHOSPHOTHREONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 140 ? A ASN 261  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O2A ? C ADP .   ? A ADP 1388 ? 1_555 92.2  ? 
2  OD1 ? A ASN 140 ? A ASN 261  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 OD2 ? A ASP 153 ? A ASP 274  ? 1_555 84.9  ? 
3  O2A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 OD2 ? A ASP 153 ? A ASP 274  ? 1_555 100.8 ? 
4  OD1 ? A ASN 140 ? A ASN 261  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3A ? C ADP .   ? A ADP 1388 ? 1_555 143.4 ? 
5  O2A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3A ? C ADP .   ? A ADP 1388 ? 1_555 59.8  ? 
6  OD2 ? A ASP 153 ? A ASP 274  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3A ? C ADP .   ? A ADP 1388 ? 1_555 78.7  ? 
7  OD1 ? A ASN 140 ? A ASN 261  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O   ? J HOH .   ? A HOH 2073 ? 1_555 92.1  ? 
8  O2A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O   ? J HOH .   ? A HOH 2073 ? 1_555 91.3  ? 
9  OD2 ? A ASP 153 ? A ASP 274  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O   ? J HOH .   ? A HOH 2073 ? 1_555 167.6 ? 
10 O3A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O   ? J HOH .   ? A HOH 2073 ? 1_555 110.0 ? 
11 OD1 ? A ASN 140 ? A ASN 261  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3B ? C ADP .   ? A ADP 1388 ? 1_555 165.9 ? 
12 O2A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3B ? C ADP .   ? A ADP 1388 ? 1_555 97.9  ? 
13 OD2 ? A ASP 153 ? A ASP 274  ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3B ? C ADP .   ? A ADP 1388 ? 1_555 102.8 ? 
14 O3A ? C ADP .   ? A ADP 1388 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3B ? C ADP .   ? A ADP 1388 ? 1_555 50.6  ? 
15 O   ? J HOH .   ? A HOH 2073 ? 1_555 MG ? D MG . ? A MG 1389 ? 1_555 O3B ? C ADP .   ? A ADP 1388 ? 1_555 77.8  ? 
16 O   ? J HOH .   ? A HOH 2123 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2028 ? 1_555 88.8  ? 
17 O   ? J HOH .   ? A HOH 2123 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2125 ? 1_555 168.7 ? 
18 O   ? J HOH .   ? A HOH 2028 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2125 ? 1_555 100.2 ? 
19 O   ? J HOH .   ? A HOH 2123 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O2B ? C ADP .   ? A ADP 1388 ? 1_555 76.5  ? 
20 O   ? J HOH .   ? A HOH 2028 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O2B ? C ADP .   ? A ADP 1388 ? 1_555 157.1 ? 
21 O   ? J HOH .   ? A HOH 2125 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O2B ? C ADP .   ? A ADP 1388 ? 1_555 92.8  ? 
22 O   ? J HOH .   ? A HOH 2123 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2124 ? 1_555 87.1  ? 
23 O   ? J HOH .   ? A HOH 2028 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2124 ? 1_555 85.9  ? 
24 O   ? J HOH .   ? A HOH 2125 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2124 ? 1_555 86.6  ? 
25 O2B ? C ADP .   ? A ADP 1388 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2124 ? 1_555 76.0  ? 
26 O   ? J HOH .   ? A HOH 2123 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2026 ? 1_555 96.1  ? 
27 O   ? J HOH .   ? A HOH 2028 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2026 ? 1_555 87.8  ? 
28 O   ? J HOH .   ? A HOH 2125 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2026 ? 1_555 91.2  ? 
29 O2B ? C ADP .   ? A ADP 1388 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2026 ? 1_555 111.0 ? 
30 O   ? J HOH .   ? A HOH 2124 ? 1_555 MG ? E MG . ? A MG 1390 ? 1_555 O   ? J HOH .   ? A HOH 2026 ? 1_555 172.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-30 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS refinement 1.1 ? 1 
CNS phasing    .   ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 202 ? ? -132.66 -158.61 
2 1 SER A 226 ? ? 71.46   -44.48  
3 1 ASP A 256 ? ? -141.20 49.05   
4 1 ASP A 274 ? ? 52.22   80.16   
5 1 ALA A 281 ? ? -112.32 72.83   
6 1 LEU A 364 ? ? -96.66  47.17   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 375 ? CG  ? A ARG 254 CG  
2  1 Y 1 A ARG 375 ? CD  ? A ARG 254 CD  
3  1 Y 1 A ARG 375 ? NE  ? A ARG 254 NE  
4  1 Y 1 A ARG 375 ? CZ  ? A ARG 254 CZ  
5  1 Y 1 A ARG 375 ? NH1 ? A ARG 254 NH1 
6  1 Y 1 A ARG 375 ? NH2 ? A ARG 254 NH2 
7  1 Y 1 A SER 388 ? CA  ? A SER 267 CA  
8  1 Y 1 A SER 388 ? C   ? A SER 267 C   
9  1 Y 1 A SER 388 ? O   ? A SER 267 O   
10 1 Y 1 A SER 388 ? CB  ? A SER 267 CB  
11 1 Y 1 A SER 388 ? OG  ? A SER 267 OG  
12 1 Y 1 B LEU 22  ? CA  ? B LEU 22  CA  
13 1 Y 1 B LEU 22  ? C   ? B LEU 22  C   
14 1 Y 1 B LEU 22  ? O   ? B LEU 22  O   
15 1 Y 1 B LEU 22  ? CB  ? B LEU 22  CB  
16 1 Y 1 B LEU 22  ? CG  ? B LEU 22  CG  
17 1 Y 1 B LEU 22  ? CD1 ? B LEU 22  CD1 
18 1 Y 1 B LEU 22  ? CD2 ? B LEU 22  CD2 
19 1 Y 1 B GLU 36  ? CG  ? B GLU 36  CG  
20 1 Y 1 B GLU 36  ? CD  ? B GLU 36  CD  
21 1 Y 1 B GLU 36  ? OE1 ? B GLU 36  OE1 
22 1 Y 1 B GLU 36  ? OE2 ? B GLU 36  OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 122 ? A GLU 1   
2  1 Y 1 A LYS 389 ? A LYS 268 
3  1 Y 1 A PRO 390 ? A PRO 269 
4  1 Y 1 A SER 391 ? A SER 270 
5  1 Y 1 A ASN 392 ? A ASN 271 
6  1 Y 1 A CYS 393 ? A CYS 272 
7  1 Y 1 A GLN 394 ? A GLN 273 
8  1 Y 1 A ASN 395 ? A ASN 274 
9  1 Y 1 A LYS 396 ? A LYS 275 
10 1 Y 1 A GLU 397 ? A GLU 276 
11 1 Y 1 A SER 398 ? A SER 277 
12 1 Y 1 A ALA 399 ? A ALA 278 
13 1 Y 1 A SER 400 ? A SER 279 
14 1 Y 1 A LYS 401 ? A LYS 280 
15 1 Y 1 A GLN 402 ? A GLN 281 
16 1 Y 1 A SER 403 ? A SER 282 
17 1 Y 1 B MET 1   ? B MET 1   
18 1 Y 1 B ALA 2   ? B ALA 2   
19 1 Y 1 B GLN 3   ? B GLN 3   
20 1 Y 1 B VAL 4   ? B VAL 4   
21 1 Y 1 B LYS 5   ? B LYS 5   
22 1 Y 1 B SER 6   ? B SER 6   
23 1 Y 1 B ASP 23  ? B ASP 23  
24 1 Y 1 B ASP 24  ? B ASP 24  
25 1 Y 1 B GLU 25  ? B GLU 25  
26 1 Y 1 B GLY 26  ? B GLY 26  
27 1 Y 1 B ASP 27  ? B ASP 27  
28 1 Y 1 B THR 28  ? B THR 28  
29 1 Y 1 B GLN 29  ? B GLN 29  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 'MAGNESIUM ION'            MG  
5 'SULFATE ION'              SO4 
6 water                      HOH 
#