data_1OLL
# 
_entry.id   1OLL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OLL         
PDBE  EBI-13270    
WWPDB D_1290013270 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OLL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ponassi, M.'     1  
'Cantoni, C.'     2  
'Biassoni, R.'    3  
'Conte, R.'       4  
'Spallarossa, A.' 5  
'Pesce, A.'       6  
'Moretta, A.'     7  
'Moretta, L.'     8  
'Bolognesi, M.'   9  
'Bordo, D.'       10 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Human Nk Cell Triggering Receptor Nkp46 Ectodomain' 
_citation.journal_abbrev            Biochem.Biophys.Res.Commun. 
_citation.journal_volume            309 
_citation.page_first                317 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           BBRCA9 
_citation.country                   US 
_citation.journal_id_ISSN           0006-291X 
_citation.journal_id_CSD            0146 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12951052 
_citation.pdbx_database_id_DOI      10.1016/J.BBRC.2003.08.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ponassi, M.'     1  ? 
primary 'Cantoni, C.'     2  ? 
primary 'Biassoni, R.'    3  ? 
primary 'Conte, R.'       4  ? 
primary 'Spallarossa, A.' 5  ? 
primary 'Pesce, A.'       6  ? 
primary 'Moretta, A.'     7  ? 
primary 'Moretta, L.'     8  ? 
primary 'Bolognesi, M.'   9  ? 
primary 'Bordo, D.'       10 ? 
# 
_cell.entry_id           1OLL 
_cell.length_a           85.477 
_cell.length_b           85.477 
_cell.length_c           59.909 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OLL 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NK RECEPTOR'  21323.410 1   ? ? 'EXTRACELLULAR DOMAIN, RESIDUES 25-212' ? 
2 non-polymer syn 1,2-ETHANEDIOL 62.068    1   ? ? ?                                       ? 
3 water       nat water          18.015    136 ? ? ?                                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ISOFORM BNKP46 CELL RECEPTOR' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
LWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAH
RGTYRCFGSYNNHAWSFPSEPVKLLVTG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
LWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAH
RGTYRCFGSYNNHAWSFPSEPVKLLVTG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   LEU n 
1 3   PRO n 
1 4   LYS n 
1 5   PRO n 
1 6   PHE n 
1 7   ILE n 
1 8   TRP n 
1 9   ALA n 
1 10  GLU n 
1 11  PRO n 
1 12  HIS n 
1 13  PHE n 
1 14  MET n 
1 15  VAL n 
1 16  PRO n 
1 17  LYS n 
1 18  GLU n 
1 19  LYS n 
1 20  GLN n 
1 21  VAL n 
1 22  THR n 
1 23  ILE n 
1 24  CYS n 
1 25  CYS n 
1 26  GLN n 
1 27  GLY n 
1 28  ASN n 
1 29  TYR n 
1 30  GLY n 
1 31  ALA n 
1 32  VAL n 
1 33  GLU n 
1 34  TYR n 
1 35  GLN n 
1 36  LEU n 
1 37  HIS n 
1 38  PHE n 
1 39  GLU n 
1 40  GLY n 
1 41  SER n 
1 42  LEU n 
1 43  PHE n 
1 44  ALA n 
1 45  VAL n 
1 46  ASP n 
1 47  ARG n 
1 48  PRO n 
1 49  LYS n 
1 50  PRO n 
1 51  PRO n 
1 52  GLU n 
1 53  ARG n 
1 54  ILE n 
1 55  ASN n 
1 56  LYS n 
1 57  VAL n 
1 58  LYS n 
1 59  PHE n 
1 60  TYR n 
1 61  ILE n 
1 62  PRO n 
1 63  ASP n 
1 64  MET n 
1 65  ASN n 
1 66  SER n 
1 67  ARG n 
1 68  MET n 
1 69  ALA n 
1 70  GLY n 
1 71  GLN n 
1 72  TYR n 
1 73  SER n 
1 74  CYS n 
1 75  ILE n 
1 76  TYR n 
1 77  ARG n 
1 78  VAL n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  TRP n 
1 83  SER n 
1 84  GLU n 
1 85  PRO n 
1 86  SER n 
1 87  ASN n 
1 88  LEU n 
1 89  LEU n 
1 90  ASP n 
1 91  LEU n 
1 92  VAL n 
1 93  VAL n 
1 94  THR n 
1 95  GLU n 
1 96  MET n 
1 97  TYR n 
1 98  ASP n 
1 99  THR n 
1 100 PRO n 
1 101 THR n 
1 102 LEU n 
1 103 SER n 
1 104 VAL n 
1 105 HIS n 
1 106 PRO n 
1 107 GLY n 
1 108 PRO n 
1 109 GLU n 
1 110 VAL n 
1 111 ILE n 
1 112 SER n 
1 113 GLY n 
1 114 GLU n 
1 115 LYS n 
1 116 VAL n 
1 117 THR n 
1 118 PHE n 
1 119 TYR n 
1 120 CYS n 
1 121 ARG n 
1 122 LEU n 
1 123 ASP n 
1 124 THR n 
1 125 ALA n 
1 126 THR n 
1 127 SER n 
1 128 MET n 
1 129 PHE n 
1 130 LEU n 
1 131 LEU n 
1 132 LEU n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 ARG n 
1 137 SER n 
1 138 SER n 
1 139 HIS n 
1 140 VAL n 
1 141 GLN n 
1 142 ARG n 
1 143 GLY n 
1 144 TYR n 
1 145 GLY n 
1 146 LYS n 
1 147 VAL n 
1 148 GLN n 
1 149 ALA n 
1 150 GLU n 
1 151 PHE n 
1 152 PRO n 
1 153 LEU n 
1 154 GLY n 
1 155 PRO n 
1 156 VAL n 
1 157 THR n 
1 158 THR n 
1 159 ALA n 
1 160 HIS n 
1 161 ARG n 
1 162 GLY n 
1 163 THR n 
1 164 TYR n 
1 165 ARG n 
1 166 CYS n 
1 167 PHE n 
1 168 GLY n 
1 169 SER n 
1 170 TYR n 
1 171 ASN n 
1 172 ASN n 
1 173 HIS n 
1 174 ALA n 
1 175 TRP n 
1 176 SER n 
1 177 PHE n 
1 178 PRO n 
1 179 SER n 
1 180 GLU n 
1 181 PRO n 
1 182 VAL n 
1 183 LYS n 
1 184 LEU n 
1 185 LEU n 
1 186 VAL n 
1 187 THR n 
1 188 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PQE30 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       VR1012-NKP46 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O76016 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O76016 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OLL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 188 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O76016 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  212 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       188 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OLL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 8000, 100 MM HEPES PH 7.8, 20% ETHANEDIOL, AT 277 K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-06-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8431 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             0.8431 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1OLL 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            1.930 
_reflns.number_obs                   18944 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.07500 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.9000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.93 
_reflns_shell.d_res_low              1.96 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.76500 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        5.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1OLL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18944 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            1.93 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.198 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.195 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  968 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.7 
_refine.aniso_B[1][1]                            1.05 
_refine.aniso_B[2][2]                            1.05 
_refine.aniso_B[3][3]                            -1.58 
_refine.aniso_B[1][2]                            0.53 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'SOME ATOMS HAVE BEEN REFINED WITH AN OCCUPANCY OF 0.00 DUE TO POOR ELECTRON DENSITY.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1G0X' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.145 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.108 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.796 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1501 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               1641 
_refine_hist.d_res_high                       1.93 
_refine_hist.d_res_low                        40 
# 
_struct.entry_id                  1OLL 
_struct.title                     'Extracellular region of the human receptor NKp46' 
_struct.pdbx_descriptor           'NK RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OLL 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM/RECEPTOR' 
_struct_keywords.text            
;IMMUNE SYSTEM/RECEPTOR, NK CELL TRIGGERING RECEPTOR, IMMUNE SYSTEM, IG DOMAIN, CYTOTOXICITY, C2-TYPE IG-LIKE DOMAINS, IMMUNE SYSTEM-RECEPTOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 65  ? ALA A 69  ? ASN A 65  ALA A 69  5 ? 5 
HELX_P HELX_P2 2 THR A 157 ? ARG A 161 ? THR A 157 ARG A 161 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 74  SG ? ? A CYS 25  A CYS 74  1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf2 disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 166 SG ? ? A CYS 120 A CYS 166 1_555 ? ? ? ? ? ? ? 2.027 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 10  A . ? GLU 10  A PRO 11  A ? PRO 11  A 1 6.54  
2 LYS 49  A . ? LYS 49  A PRO 50  A ? PRO 50  A 1 -4.83 
3 HIS 105 A . ? HIS 105 A PRO 106 A ? PRO 106 A 1 2.26  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 5 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 5 ? 
AF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 6   ? GLU A 10  ? PHE A 6   GLU A 10  
AA 2 VAL A 21  ? GLN A 26  ? VAL A 21  GLN A 26  
AA 3 LYS A 56  ? ILE A 61  ? LYS A 56  ILE A 61  
AB 1 MET A 14  ? PRO A 16  ? MET A 14  PRO A 16  
AB 2 LEU A 89  ? THR A 94  ? LEU A 89  THR A 94  
AB 3 GLY A 70  ? VAL A 78  ? GLY A 70  VAL A 78  
AB 4 GLU A 33  ? PHE A 38  ? GLU A 33  PHE A 38  
AB 5 SER A 41  ? ASP A 46  ? SER A 41  ASP A 46  
AC 1 MET A 14  ? PRO A 16  ? MET A 14  PRO A 16  
AC 2 LEU A 89  ? THR A 94  ? LEU A 89  THR A 94  
AC 3 GLY A 70  ? VAL A 78  ? GLY A 70  VAL A 78  
AC 4 LEU A 81  ? TRP A 82  ? LEU A 81  TRP A 82  
AD 1 THR A 101 ? HIS A 105 ? THR A 101 HIS A 105 
AD 2 LYS A 115 ? ARG A 121 ? LYS A 115 ARG A 121 
AD 3 GLN A 148 ? PRO A 155 ? GLN A 148 PRO A 155 
AE 1 GLU A 109 ? ILE A 111 ? GLU A 109 ILE A 111 
AE 2 VAL A 182 ? THR A 187 ? VAL A 182 THR A 187 
AE 3 GLY A 162 ? PHE A 167 ? GLY A 162 PHE A 167 
AE 4 MET A 128 ? GLU A 134 ? MET A 128 GLU A 134 
AE 5 HIS A 139 ? TYR A 144 ? HIS A 139 TYR A 144 
AF 1 SER A 169 ? ASN A 171 ? SER A 169 ASN A 171 
AF 2 ALA A 174 ? TRP A 175 ? ALA A 174 TRP A 175 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 10  ? N GLU A 10  O THR A 22  ? O THR A 22  
AA 2 3 N CYS A 25  ? N CYS A 25  O VAL A 57  ? O VAL A 57  
AB 1 2 N VAL A 15  ? N VAL A 15  O VAL A 92  ? O VAL A 92  
AB 2 3 N LEU A 91  ? N LEU A 91  O GLY A 70  ? O GLY A 70  
AB 3 4 N ARG A 77  ? N ARG A 77  O GLU A 33  ? O GLU A 33  
AB 4 5 N PHE A 38  ? N PHE A 38  O SER A 41  ? O SER A 41  
AC 1 2 N VAL A 15  ? N VAL A 15  O VAL A 92  ? O VAL A 92  
AC 2 3 N LEU A 91  ? N LEU A 91  O GLY A 70  ? O GLY A 70  
AC 3 4 N VAL A 78  ? N VAL A 78  O LEU A 81  ? O LEU A 81  
AD 1 2 N HIS A 105 ? N HIS A 105 O THR A 117 ? O THR A 117 
AD 2 3 N CYS A 120 ? N CYS A 120 O ALA A 149 ? O ALA A 149 
AE 1 2 N VAL A 110 ? N VAL A 110 O LEU A 185 ? O LEU A 185 
AE 2 3 N LEU A 184 ? N LEU A 184 O GLY A 162 ? O GLY A 162 
AE 3 4 N PHE A 167 ? N PHE A 167 O LEU A 130 ? O LEU A 130 
AE 4 5 N LYS A 133 ? N LYS A 133 O HIS A 139 ? O HIS A 139 
AF 1 2 N TYR A 170 ? N TYR A 170 O ALA A 174 ? O ALA A 174 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO A1189' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 HIS A 37 ? HIS A 37   . ? 1_555 ? 
2 AC1 6 GLU A 39 ? GLU A 39   . ? 1_555 ? 
3 AC1 6 GLY A 40 ? GLY A 40   . ? 1_555 ? 
4 AC1 6 GLN A 71 ? GLN A 71   . ? 1_555 ? 
5 AC1 6 SER A 73 ? SER A 73   . ? 1_555 ? 
6 AC1 6 HOH C .  ? HOH A 2052 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OLL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OLL 
_atom_sites.fract_transf_matrix[1][1]   0.011699 
_atom_sites.fract_transf_matrix[1][2]   0.006754 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013509 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016692 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 1   ? -15.306 53.091 26.927  1.00   76.34 ? 1    THR A N   1 
ATOM   2    C CA  . THR A 1 1   ? -16.656 53.658 27.228  1.00   76.40 ? 1    THR A CA  1 
ATOM   3    C C   . THR A 1 1   ? -17.457 53.938 25.945  1.00   72.48 ? 1    THR A C   1 
ATOM   4    O O   . THR A 1 1   ? -18.017 53.018 25.332  1.00   74.89 ? 1    THR A O   1 
ATOM   5    C CB  . THR A 1 1   ? -16.533 54.944 28.091  1.00   76.74 ? 1    THR A CB  1 
ATOM   6    O OG1 . THR A 1 1   ? -15.426 55.734 27.634  1.00   80.82 ? 1    THR A OG1 1 
ATOM   7    C CG2 . THR A 1 1   ? -16.143 54.594 29.527  1.00   81.93 ? 1    THR A CG2 1 
ATOM   8    N N   . LEU A 1 2   ? -17.516 55.211 25.552  1.00   65.47 ? 2    LEU A N   1 
ATOM   9    C CA  . LEU A 1 2   ? -18.173 55.613 24.304  1.00   52.89 ? 2    LEU A CA  1 
ATOM   10   C C   . LEU A 1 2   ? -17.127 55.877 23.226  1.00   43.98 ? 2    LEU A C   1 
ATOM   11   O O   . LEU A 1 2   ? -16.267 56.740 23.390  1.00   42.66 ? 2    LEU A O   1 
ATOM   12   C CB  . LEU A 1 2   ? -19.004 56.879 24.528  1.00   52.17 ? 2    LEU A CB  1 
ATOM   13   C CG  . LEU A 1 2   ? -19.958 56.880 25.718  1.00   51.32 ? 2    LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 2   ? -20.386 58.298 26.052  1.00   56.41 ? 2    LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 2   ? -21.165 56.014 25.429  1.00   56.73 ? 2    LEU A CD2 1 
ATOM   16   N N   . PRO A 1 3   ? -17.194 55.129 22.130  1.00   40.03 ? 3    PRO A N   1 
ATOM   17   C CA  . PRO A 1 3   ? -16.236 55.287 21.029  1.00   36.74 ? 3    PRO A CA  1 
ATOM   18   C C   . PRO A 1 3   ? -16.213 56.728 20.530  1.00   36.86 ? 3    PRO A C   1 
ATOM   19   O O   . PRO A 1 3   ? -17.267 57.388 20.489  1.00   31.01 ? 3    PRO A O   1 
ATOM   20   C CB  . PRO A 1 3   ? -16.780 54.353 19.941  1.00   35.75 ? 3    PRO A CB  1 
ATOM   21   C CG  . PRO A 1 3   ? -18.175 53.992 20.383  1.00   45.88 ? 3    PRO A CG  1 
ATOM   22   C CD  . PRO A 1 3   ? -18.194 54.084 21.864  1.00   41.82 ? 3    PRO A CD  1 
ATOM   23   N N   . LYS A 1 4   ? -15.027 57.220 20.192  1.00   35.44 ? 4    LYS A N   1 
ATOM   24   C CA  . LYS A 1 4   ? -14.877 58.567 19.649  1.00   37.86 ? 4    LYS A CA  1 
ATOM   25   C C   . LYS A 1 4   ? -15.765 58.710 18.407  1.00   36.70 ? 4    LYS A C   1 
ATOM   26   O O   . LYS A 1 4   ? -15.729 57.859 17.506  1.00   33.33 ? 4    LYS A O   1 
ATOM   27   C CB  . LYS A 1 4   ? -13.417 58.814 19.271  1.00   38.77 ? 4    LYS A CB  1 
ATOM   28   C CG  . LYS A 1 4   ? -13.078 60.260 18.872  1.00   37.43 ? 4    LYS A CG  1 
ATOM   29   C CD  . LYS A 1 4   ? -11.578 60.404 18.624  1.00   41.26 ? 4    LYS A CD  1 
ATOM   30   C CE  . LYS A 1 4   ? -11.214 61.844 18.253  1.00   38.86 ? 4    LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 4   ? -9.820  61.961 17.723  1.00   43.22 ? 4    LYS A NZ  1 
ATOM   32   N N   . PRO A 1 5   ? -16.558 59.778 18.355  1.00   33.35 ? 5    PRO A N   1 
ATOM   33   C CA  . PRO A 1 5   ? -17.369 60.057 17.166  1.00   28.54 ? 5    PRO A CA  1 
ATOM   34   C C   . PRO A 1 5   ? -16.501 60.485 15.990  1.00   28.77 ? 5    PRO A C   1 
ATOM   35   O O   . PRO A 1 5   ? -15.349 60.882 16.171  1.00   27.99 ? 5    PRO A O   1 
ATOM   36   C CB  . PRO A 1 5   ? -18.314 61.199 17.613  1.00   26.33 ? 5    PRO A CB  1 
ATOM   37   C CG  . PRO A 1 5   ? -17.745 61.756 18.877  1.00   26.90 ? 5    PRO A CG  1 
ATOM   38   C CD  . PRO A 1 5   ? -16.751 60.776 19.429  1.00   36.35 ? 5    PRO A CD  1 
ATOM   39   N N   . PHE A 1 6   ? -17.054 60.364 14.788  1.00   28.72 ? 6    PHE A N   1 
ATOM   40   C CA  . PHE A 1 6   ? -16.352 60.687 13.561  1.00   25.73 ? 6    PHE A CA  1 
ATOM   41   C C   . PHE A 1 6   ? -17.276 61.539 12.721  1.00   29.57 ? 6    PHE A C   1 
ATOM   42   O O   . PHE A 1 6   ? -18.445 61.203 12.558  1.00   27.80 ? 6    PHE A O   1 
ATOM   43   C CB  . PHE A 1 6   ? -16.000 59.414 12.768  1.00   27.20 ? 6    PHE A CB  1 
ATOM   44   C CG  . PHE A 1 6   ? -15.228 59.698 11.507  1.00   38.22 ? 6    PHE A CG  1 
ATOM   45   C CD1 . PHE A 1 6   ? -13.931 60.201 11.572  1.00   38.01 ? 6    PHE A CD1 1 
ATOM   46   C CD2 . PHE A 1 6   ? -15.803 59.516 10.268  1.00   40.99 ? 6    PHE A CD2 1 
ATOM   47   C CE1 . PHE A 1 6   ? -13.225 60.499 10.414  1.00   45.01 ? 6    PHE A CE1 1 
ATOM   48   C CE2 . PHE A 1 6   ? -15.096 59.806 9.107   1.00   46.26 ? 6    PHE A CE2 1 
ATOM   49   C CZ  . PHE A 1 6   ? -13.813 60.303 9.183   1.00   42.43 ? 6    PHE A CZ  1 
ATOM   50   N N   . ILE A 1 7   ? -16.763 62.649 12.199  1.00   27.11 ? 7    ILE A N   1 
ATOM   51   C CA  . ILE A 1 7   ? -17.551 63.480 11.307  1.00   28.59 ? 7    ILE A CA  1 
ATOM   52   C C   . ILE A 1 7   ? -16.901 63.664 9.972   1.00   31.28 ? 7    ILE A C   1 
ATOM   53   O O   . ILE A 1 7   ? -15.668 63.619 9.841   1.00   32.62 ? 7    ILE A O   1 
ATOM   54   C CB  . ILE A 1 7   ? -17.846 64.859 11.926  1.00   31.77 ? 7    ILE A CB  1 
ATOM   55   C CG1 . ILE A 1 7   ? -16.539 65.595 12.261  1.00   25.17 ? 7    ILE A CG1 1 
ATOM   56   C CG2 . ILE A 1 7   ? -18.750 64.722 13.147  1.00   31.21 ? 7    ILE A CG2 1 
ATOM   57   C CD1 . ILE A 1 7   ? -16.773 67.044 12.664  1.00   35.89 ? 7    ILE A CD1 1 
ATOM   58   N N   . TRP A 1 8   ? -17.731 63.891 8.970   1.00   29.44 ? 8    TRP A N   1 
ATOM   59   C CA  . TRP A 1 8   ? -17.249 64.147 7.635   1.00   29.85 ? 8    TRP A CA  1 
ATOM   60   C C   . TRP A 1 8   ? -18.288 64.939 6.867   1.00   29.63 ? 8    TRP A C   1 
ATOM   61   O O   . TRP A 1 8   ? -19.443 65.009 7.271   1.00   29.76 ? 8    TRP A O   1 
ATOM   62   C CB  . TRP A 1 8   ? -16.902 62.830 6.913   1.00   28.30 ? 8    TRP A CB  1 
ATOM   63   C CG  . TRP A 1 8   ? -18.077 61.952 6.555   1.00   30.83 ? 8    TRP A CG  1 
ATOM   64   C CD1 . TRP A 1 8   ? -18.701 61.869 5.345   1.00   35.34 ? 8    TRP A CD1 1 
ATOM   65   C CD2 . TRP A 1 8   ? -18.706 60.981 7.393   1.00   28.57 ? 8    TRP A CD2 1 
ATOM   66   N NE1 . TRP A 1 8   ? -19.704 60.931 5.390   1.00   31.70 ? 8    TRP A NE1 1 
ATOM   67   C CE2 . TRP A 1 8   ? -19.727 60.368 6.637   1.00   35.77 ? 8    TRP A CE2 1 
ATOM   68   C CE3 . TRP A 1 8   ? -18.525 60.579 8.722   1.00   30.21 ? 8    TRP A CE3 1 
ATOM   69   C CZ2 . TRP A 1 8   ? -20.556 59.375 7.161   1.00   33.45 ? 8    TRP A CZ2 1 
ATOM   70   C CZ3 . TRP A 1 8   ? -19.352 59.595 9.244   1.00   37.04 ? 8    TRP A CZ3 1 
ATOM   71   C CH2 . TRP A 1 8   ? -20.351 59.007 8.471   1.00   31.33 ? 8    TRP A CH2 1 
ATOM   72   N N   . ALA A 1 9   ? -17.870 65.550 5.770   1.00   28.36 ? 9    ALA A N   1 
ATOM   73   C CA  . ALA A 1 9   ? -18.761 66.401 4.983   1.00   30.85 ? 9    ALA A CA  1 
ATOM   74   C C   . ALA A 1 9   ? -19.221 65.670 3.714   1.00   29.63 ? 9    ALA A C   1 
ATOM   75   O O   . ALA A 1 9   ? -18.463 64.881 3.133   1.00   29.49 ? 9    ALA A O   1 
ATOM   76   C CB  . ALA A 1 9   ? -18.047 67.734 4.619   1.00   29.27 ? 9    ALA A CB  1 
ATOM   77   N N   . GLU A 1 10  ? -20.459 65.924 3.290   1.00   27.40 ? 10   GLU A N   1 
ATOM   78   C CA  . GLU A 1 10  ? -20.934 65.430 1.984   1.00   30.26 ? 10   GLU A CA  1 
ATOM   79   C C   . GLU A 1 10  ? -21.582 66.566 1.213   1.00   31.34 ? 10   GLU A C   1 
ATOM   80   O O   . GLU A 1 10  ? -22.417 67.277 1.759   1.00   34.67 ? 10   GLU A O   1 
ATOM   81   C CB  . GLU A 1 10  ? -21.938 64.279 2.178   1.00   32.77 ? 10   GLU A CB  1 
ATOM   82   C CG  . GLU A 1 10  ? -21.337 63.069 2.875   1.00   29.00 ? 10   GLU A CG  1 
ATOM   83   C CD  . GLU A 1 10  ? -22.306 61.895 3.034   1.00   42.14 ? 10   GLU A CD  1 
ATOM   84   O OE1 . GLU A 1 10  ? -23.519 62.095 2.927   1.00   43.11 ? 10   GLU A OE1 1 
ATOM   85   O OE2 . GLU A 1 10  ? -21.833 60.766 3.281   1.00   44.45 ? 10   GLU A OE2 1 
ATOM   86   N N   . PRO A 1 11  ? -21.214 66.737 -0.062  1.00   32.22 ? 11   PRO A N   1 
ATOM   87   C CA  . PRO A 1 11  ? -20.327 65.805 -0.792  1.00   36.39 ? 11   PRO A CA  1 
ATOM   88   C C   . PRO A 1 11  ? -18.848 65.960 -0.435  1.00   36.06 ? 11   PRO A C   1 
ATOM   89   O O   . PRO A 1 11  ? -18.063 65.037 -0.654  1.00   36.47 ? 11   PRO A O   1 
ATOM   90   C CB  . PRO A 1 11  ? -20.539 66.210 -2.260  1.00   38.49 ? 11   PRO A CB  1 
ATOM   91   C CG  . PRO A 1 11  ? -20.859 67.673 -2.189  1.00   37.63 ? 11   PRO A CG  1 
ATOM   92   C CD  . PRO A 1 11  ? -21.691 67.840 -0.918  1.00   34.18 ? 11   PRO A CD  1 
ATOM   93   N N   . HIS A 1 12  ? -18.474 67.117 0.097   1.00   36.53 ? 12   HIS A N   1 
ATOM   94   C CA  . HIS A 1 12  ? -17.135 67.297 0.670   1.00   36.85 ? 12   HIS A CA  1 
ATOM   95   C C   . HIS A 1 12  ? -17.033 68.659 1.360   1.00   33.51 ? 12   HIS A C   1 
ATOM   96   O O   . HIS A 1 12  ? -18.034 69.390 1.478   1.00   32.29 ? 12   HIS A O   1 
ATOM   97   C CB  . HIS A 1 12  ? -16.082 67.199 -0.418  1.00   42.76 ? 12   HIS A CB  1 
ATOM   98   C CG  . HIS A 1 12  ? -16.360 68.080 -1.579  1.00   34.47 ? 12   HIS A CG  1 
ATOM   99   N ND1 . HIS A 1 12  ? -16.884 67.605 -2.763  1.00   56.40 ? 12   HIS A ND1 1 
ATOM   100  C CD2 . HIS A 1 12  ? -16.249 69.419 -1.727  1.00   44.05 ? 12   HIS A CD2 1 
ATOM   101  C CE1 . HIS A 1 12  ? -17.058 68.612 -3.599  1.00   40.32 ? 12   HIS A CE1 1 
ATOM   102  N NE2 . HIS A 1 12  ? -16.679 69.724 -2.996  1.00   53.74 ? 12   HIS A NE2 1 
ATOM   103  N N   . PHE A 1 13  ? -15.827 68.996 1.809   1.00   27.48 ? 13   PHE A N   1 
ATOM   104  C CA  . PHE A 1 13  ? -15.641 70.083 2.759   1.00   25.37 ? 13   PHE A CA  1 
ATOM   105  C C   . PHE A 1 13  ? -15.552 71.418 2.046   1.00   27.37 ? 13   PHE A C   1 
ATOM   106  O O   . PHE A 1 13  ? -15.590 72.462 2.677   1.00   28.52 ? 13   PHE A O   1 
ATOM   107  C CB  . PHE A 1 13  ? -14.380 69.856 3.605   1.00   28.89 ? 13   PHE A CB  1 
ATOM   108  C CG  . PHE A 1 13  ? -13.084 70.203 2.892   1.00   27.15 ? 13   PHE A CG  1 
ATOM   109  C CD1 . PHE A 1 13  ? -12.524 71.467 3.020   1.00   26.07 ? 13   PHE A CD1 1 
ATOM   110  C CD2 . PHE A 1 13  ? -12.415 69.249 2.133   1.00   34.47 ? 13   PHE A CD2 1 
ATOM   111  C CE1 . PHE A 1 13  ? -11.330 71.788 2.389   1.00   29.16 ? 13   PHE A CE1 1 
ATOM   112  C CE2 . PHE A 1 13  ? -11.224 69.554 1.496   1.00   34.65 ? 13   PHE A CE2 1 
ATOM   113  C CZ  . PHE A 1 13  ? -10.673 70.823 1.629   1.00   29.24 ? 13   PHE A CZ  1 
ATOM   114  N N   . MET A 1 14  ? -15.434 71.376 0.721   1.00   23.60 ? 14   MET A N   1 
ATOM   115  C CA  . MET A 1 14  ? -15.371 72.600 -0.077  1.00   26.60 ? 14   MET A CA  1 
ATOM   116  C C   . MET A 1 14  ? -16.781 73.022 -0.539  1.00   26.54 ? 14   MET A C   1 
ATOM   117  O O   . MET A 1 14  ? -17.361 72.393 -1.415  1.00   28.79 ? 14   MET A O   1 
ATOM   118  C CB  . MET A 1 14  ? -14.471 72.372 -1.293  1.00   25.79 ? 14   MET A CB  1 
ATOM   119  C CG  . MET A 1 14  ? -12.979 72.405 -0.974  1.00   30.30 ? 14   MET A CG  1 
ATOM   120  S SD  . MET A 1 14  ? -12.045 71.577 -2.292  1.00   33.52 ? 14   MET A SD  1 
ATOM   121  C CE  . MET A 1 14  ? -12.748 69.875 -2.162  1.00   46.15 ? 14   MET A CE  1 
ATOM   122  N N   . VAL A 1 15  ? -17.312 74.095 0.045   1.00   29.06 ? 15   VAL A N   1 
ATOM   123  C CA  . VAL A 1 15  ? -18.721 74.467 -0.167  1.00   30.51 ? 15   VAL A CA  1 
ATOM   124  C C   . VAL A 1 15  ? -18.870 75.832 -0.846  1.00   28.65 ? 15   VAL A C   1 
ATOM   125  O O   . VAL A 1 15  ? -18.571 76.879 -0.241  1.00   30.22 ? 15   VAL A O   1 
ATOM   126  C CB  . VAL A 1 15  ? -19.490 74.489 1.173   1.00   33.80 ? 15   VAL A CB  1 
ATOM   127  C CG1 . VAL A 1 15  ? -21.023 74.667 0.934   1.00   29.74 ? 15   VAL A CG1 1 
ATOM   128  C CG2 . VAL A 1 15  ? -19.179 73.214 2.002   1.00   23.10 ? 15   VAL A CG2 1 
ATOM   129  N N   . PRO A 1 16  ? -19.356 75.834 -2.087  1.00   31.72 ? 16   PRO A N   1 
ATOM   130  C CA  . PRO A 1 16  ? -19.623 77.097 -2.796  1.00   32.62 ? 16   PRO A CA  1 
ATOM   131  C C   . PRO A 1 16  ? -20.581 77.980 -2.001  1.00   35.99 ? 16   PRO A C   1 
ATOM   132  O O   . PRO A 1 16  ? -21.529 77.478 -1.388  1.00   32.47 ? 16   PRO A O   1 
ATOM   133  C CB  . PRO A 1 16  ? -20.258 76.634 -4.126  1.00   30.53 ? 16   PRO A CB  1 
ATOM   134  C CG  . PRO A 1 16  ? -19.714 75.225 -4.331  1.00   36.26 ? 16   PRO A CG  1 
ATOM   135  C CD  . PRO A 1 16  ? -19.666 74.639 -2.914  1.00   29.31 ? 16   PRO A CD  1 
ATOM   136  N N   . LYS A 1 17  ? -20.319 79.279 -1.982  1.00   33.56 ? 17   LYS A N   1 
ATOM   137  C CA  . LYS A 1 17  ? -21.191 80.188 -1.267  1.00   37.69 ? 17   LYS A CA  1 
ATOM   138  C C   . LYS A 1 17  ? -22.615 79.982 -1.770  1.00   37.69 ? 17   LYS A C   1 
ATOM   139  O O   . LYS A 1 17  ? -22.825 79.704 -2.950  1.00   32.48 ? 17   LYS A O   1 
ATOM   140  C CB  . LYS A 1 17  ? -20.749 81.643 -1.462  1.00   35.69 ? 17   LYS A CB  1 
ATOM   141  C CG  . LYS A 1 17  ? -20.888 82.176 -2.900  1.00   43.32 ? 17   LYS A CG  1 
ATOM   142  C CD  . LYS A 1 17  ? -20.876 83.721 -2.922  1.00   53.61 ? 17   LYS A CD  1 
ATOM   143  C CE  . LYS A 1 17  ? -20.422 84.277 -4.287  1.00   47.35 ? 17   LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 17  ? -20.610 83.291 -5.388  1.00   47.91 ? 17   LYS A NZ  1 
ATOM   145  N N   . GLU A 1 18  ? -23.582 80.061 -0.859  1.00   37.71 ? 18   GLU A N   1 
ATOM   146  C CA  . GLU A 1 18  ? -24.993 79.908 -1.213  1.00   39.08 ? 18   GLU A CA  1 
ATOM   147  C C   . GLU A 1 18  ? -25.427 78.464 -1.482  1.00   40.66 ? 18   GLU A C   1 
ATOM   148  O O   . GLU A 1 18  ? -26.618 78.182 -1.637  1.00   41.41 ? 18   GLU A O   1 
ATOM   149  C CB  . GLU A 1 18  ? -25.353 80.823 -2.400  1.00   40.30 ? 18   GLU A CB  1 
ATOM   150  C CG  . GLU A 1 18  ? -25.208 82.305 -2.076  1.00   51.26 ? 18   GLU A CG  1 
ATOM   151  C CD  . GLU A 1 18  ? -25.528 83.214 -3.259  1.00   61.03 ? 18   GLU A CD  1 
ATOM   152  O OE1 . GLU A 1 18  ? -26.042 82.720 -4.288  1.00   59.37 ? 18   GLU A OE1 1 
ATOM   153  O OE2 . GLU A 1 18  ? -25.263 84.428 -3.154  1.00   63.11 ? 18   GLU A OE2 1 
ATOM   154  N N   . LYS A 1 19  ? -24.478 77.539 -1.539  1.00   34.70 ? 19   LYS A N   1 
ATOM   155  C CA  . LYS A 1 19  ? -24.854 76.140 -1.754  1.00   31.90 ? 19   LYS A CA  1 
ATOM   156  C C   . LYS A 1 19  ? -25.038 75.400 -0.429  1.00   33.66 ? 19   LYS A C   1 
ATOM   157  O O   . LYS A 1 19  ? -24.940 75.990 0.643   1.00   36.02 ? 19   LYS A O   1 
ATOM   158  C CB  . LYS A 1 19  ? -23.833 75.427 -2.643  1.00   36.08 ? 19   LYS A CB  1 
ATOM   159  C CG  . LYS A 1 19  ? -23.718 76.023 -4.065  1.00   43.65 ? 19   LYS A CG  1 
ATOM   160  C CD  . LYS A 1 19  ? -25.027 75.869 -4.842  1.00   54.46 ? 19   LYS A CD  1 
ATOM   161  C CE  . LYS A 1 19  ? -24.809 76.062 -6.345  1.00   60.08 ? 19   LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 19  ? -24.649 77.501 -6.697  1.00   64.45 ? 19   LYS A NZ  1 
ATOM   163  N N   . GLN A 1 20  ? -25.293 74.110 -0.515  1.00   34.76 ? 20   GLN A N   1 
ATOM   164  C CA  . GLN A 1 20  ? -25.619 73.329 0.659   1.00   39.14 ? 20   GLN A CA  1 
ATOM   165  C C   . GLN A 1 20  ? -24.549 72.270 0.884   1.00   33.10 ? 20   GLN A C   1 
ATOM   166  O O   . GLN A 1 20  ? -23.929 71.789 -0.055  1.00   31.37 ? 20   GLN A O   1 
ATOM   167  C CB  . GLN A 1 20  ? -26.988 72.669 0.489   1.00   40.65 ? 20   GLN A CB  1 
ATOM   168  C CG  . GLN A 1 20  ? -27.008 71.569 -0.558  1.00   55.55 ? 20   GLN A CG  1 
ATOM   169  C CD  . GLN A 1 20  ? -27.250 72.696 -1.974  0.0000 72.22 ? 20   GLN A CD  1 
ATOM   170  O OE1 . GLN A 1 20  ? -28.136 73.551 -2.080  0.0000 74.29 ? 20   GLN A OE1 1 
ATOM   171  N NE2 . GLN A 1 20  ? -26.354 72.459 -2.933  0.0000 59.98 ? 20   GLN A NE2 1 
ATOM   172  N N   . VAL A 1 21  ? -24.306 71.940 2.139   1.00   32.19 ? 21   VAL A N   1 
ATOM   173  C CA  . VAL A 1 21  ? -23.458 70.809 2.463   1.00   32.45 ? 21   VAL A CA  1 
ATOM   174  C C   . VAL A 1 21  ? -24.103 70.119 3.651   1.00   33.41 ? 21   VAL A C   1 
ATOM   175  O O   . VAL A 1 21  ? -24.848 70.753 4.402   1.00   32.05 ? 21   VAL A O   1 
ATOM   176  C CB  . VAL A 1 21  ? -22.017 71.270 2.824   1.00   33.71 ? 21   VAL A CB  1 
ATOM   177  C CG1 . VAL A 1 21  ? -22.027 72.152 4.096   1.00   31.10 ? 21   VAL A CG1 1 
ATOM   178  C CG2 . VAL A 1 21  ? -21.071 70.048 3.008   1.00   30.45 ? 21   VAL A CG2 1 
ATOM   179  N N   . THR A 1 22  ? -23.849 68.822 3.812   1.00   31.41 ? 22   THR A N   1 
ATOM   180  C CA  . THR A 1 22  ? -24.213 68.163 5.052   1.00   31.63 ? 22   THR A CA  1 
ATOM   181  C C   . THR A 1 22  ? -23.020 67.599 5.798   1.00   31.90 ? 22   THR A C   1 
ATOM   182  O O   . THR A 1 22  ? -22.026 67.170 5.195   1.00   30.12 ? 22   THR A O   1 
ATOM   183  C CB  . THR A 1 22  ? -25.295 67.091 4.826   1.00   36.49 ? 22   THR A CB  1 
ATOM   184  O OG1 . THR A 1 22  ? -24.896 66.229 3.792   1.00   39.21 ? 22   THR A OG1 1 
ATOM   185  C CG2 . THR A 1 22  ? -26.546 67.712 4.262   1.00   40.97 ? 22   THR A CG2 1 
ATOM   186  N N   . ILE A 1 23  ? -23.105 67.630 7.115   1.00   27.90 ? 23   ILE A N   1 
ATOM   187  C CA  . ILE A 1 23  ? -22.095 67.020 7.949   1.00   29.30 ? 23   ILE A CA  1 
ATOM   188  C C   . ILE A 1 23  ? -22.715 65.810 8.610   1.00   30.63 ? 23   ILE A C   1 
ATOM   189  O O   . ILE A 1 23  ? -23.773 65.912 9.221   1.00   27.32 ? 23   ILE A O   1 
ATOM   190  C CB  . ILE A 1 23  ? -21.600 68.025 9.003   1.00   29.03 ? 23   ILE A CB  1 
ATOM   191  C CG1 . ILE A 1 23  ? -20.781 69.139 8.333   1.00   31.12 ? 23   ILE A CG1 1 
ATOM   192  C CG2 . ILE A 1 23  ? -20.801 67.316 10.096  1.00   26.98 ? 23   ILE A CG2 1 
ATOM   193  C CD1 . ILE A 1 23  ? -20.058 70.080 9.339   1.00   33.29 ? 23   ILE A CD1 1 
ATOM   194  N N   . CYS A 1 24  ? -22.086 64.650 8.425   1.00   27.34 ? 24   CYS A N   1 
ATOM   195  C CA  . CYS A 1 24  ? -22.495 63.441 9.124   1.00   24.47 ? 24   CYS A CA  1 
ATOM   196  C C   . CYS A 1 24  ? -21.686 63.310 10.381  1.00   26.30 ? 24   CYS A C   1 
ATOM   197  O O   . CYS A 1 24  ? -20.486 63.618 10.396  1.00   26.69 ? 24   CYS A O   1 
ATOM   198  C CB  . CYS A 1 24  ? -22.256 62.194 8.266   1.00   26.81 ? 24   CYS A CB  1 
ATOM   199  S SG  A CYS A 1 24  ? -22.725 62.375 6.543   0.50   37.59 ? 24   CYS A SG  1 
ATOM   200  S SG  B CYS A 1 24  ? -23.147 60.717 8.849   0.50   28.22 ? 24   CYS A SG  1 
ATOM   201  N N   . CYS A 1 25  ? -22.339 62.869 11.444  1.00   26.57 ? 25   CYS A N   1 
ATOM   202  C CA  . CYS A 1 25  ? -21.642 62.453 12.633  1.00   27.15 ? 25   CYS A CA  1 
ATOM   203  C C   . CYS A 1 25  ? -22.017 61.024 13.006  1.00   30.50 ? 25   CYS A C   1 
ATOM   204  O O   . CYS A 1 25  ? -23.194 60.701 13.203  1.00   31.92 ? 25   CYS A O   1 
ATOM   205  C CB  . CYS A 1 25  ? -21.947 63.392 13.784  1.00   27.97 ? 25   CYS A CB  1 
ATOM   206  S SG  . CYS A 1 25  ? -21.293 62.859 15.376  1.00   28.54 ? 25   CYS A SG  1 
ATOM   207  N N   . GLN A 1 26  ? -21.002 60.178 13.088  1.00   25.18 ? 26   GLN A N   1 
ATOM   208  C CA  . GLN A 1 26  ? -21.150 58.821 13.582  1.00   25.40 ? 26   GLN A CA  1 
ATOM   209  C C   . GLN A 1 26  ? -20.815 58.783 15.073  1.00   27.60 ? 26   GLN A C   1 
ATOM   210  O O   . GLN A 1 26  ? -19.724 59.193 15.487  1.00   27.27 ? 26   GLN A O   1 
ATOM   211  C CB  . GLN A 1 26  ? -20.217 57.890 12.795  1.00   28.73 ? 26   GLN A CB  1 
ATOM   212  C CG  . GLN A 1 26  ? -20.179 56.446 13.316  1.00   30.57 ? 26   GLN A CG  1 
ATOM   213  C CD  . GLN A 1 26  ? -19.541 55.497 12.318  1.00   43.56 ? 26   GLN A CD  1 
ATOM   214  O OE1 . GLN A 1 26  ? -19.563 55.748 11.120  1.00   42.69 ? 26   GLN A OE1 1 
ATOM   215  N NE2 . GLN A 1 26  ? -18.967 54.422 12.811  1.00   36.82 ? 26   GLN A NE2 1 
ATOM   216  N N   . GLY A 1 27  ? -21.768 58.314 15.874  1.00   29.72 ? 27   GLY A N   1 
ATOM   217  C CA  . GLY A 1 27  ? -21.576 58.162 17.297  1.00   30.31 ? 27   GLY A CA  1 
ATOM   218  C C   . GLY A 1 27  ? -21.571 56.689 17.699  1.00   34.46 ? 27   GLY A C   1 
ATOM   219  O O   . GLY A 1 27  ? -20.570 55.996 17.521  1.00   36.21 ? 27   GLY A O   1 
ATOM   220  N N   . ASN A 1 28  ? -22.692 56.223 18.250  1.00   31.45 ? 28   ASN A N   1 
ATOM   221  C CA  . ASN A 1 28  ? -22.872 54.817 18.566  1.00   31.89 ? 28   ASN A CA  1 
ATOM   222  C C   . ASN A 1 28  ? -24.344 54.427 18.580  1.00   29.10 ? 28   ASN A C   1 
ATOM   223  O O   . ASN A 1 28  ? -25.212 55.243 18.891  1.00   29.85 ? 28   ASN A O   1 
ATOM   224  C CB  . ASN A 1 28  ? -22.236 54.487 19.921  1.00   35.27 ? 28   ASN A CB  1 
ATOM   225  C CG  . ASN A 1 28  ? -22.001 52.996 20.108  1.00   39.75 ? 28   ASN A CG  1 
ATOM   226  O OD1 . ASN A 1 28  ? -21.914 52.231 19.131  1.00   46.40 ? 28   ASN A OD1 1 
ATOM   227  N ND2 . ASN A 1 28  ? -21.921 52.569 21.358  1.00   39.91 ? 28   ASN A ND2 1 
ATOM   228  N N   . TYR A 1 29  ? -24.626 53.177 18.235  1.00   30.68 ? 29   TYR A N   1 
ATOM   229  C CA  . TYR A 1 29  ? -26.003 52.698 18.237  1.00   30.38 ? 29   TYR A CA  1 
ATOM   230  C C   . TYR A 1 29  ? -26.617 52.958 19.602  1.00   31.76 ? 29   TYR A C   1 
ATOM   231  O O   . TYR A 1 29  ? -25.996 52.692 20.632  1.00   33.32 ? 29   TYR A O   1 
ATOM   232  C CB  . TYR A 1 29  ? -26.046 51.188 17.905  1.00   31.44 ? 29   TYR A CB  1 
ATOM   233  C CG  . TYR A 1 29  ? -25.632 50.889 16.496  1.00   32.57 ? 29   TYR A CG  1 
ATOM   234  C CD1 . TYR A 1 29  ? -26.477 51.183 15.429  1.00   28.44 ? 29   TYR A CD1 1 
ATOM   235  C CD2 . TYR A 1 29  ? -24.377 50.351 16.217  1.00   42.84 ? 29   TYR A CD2 1 
ATOM   236  C CE1 . TYR A 1 29  ? -26.093 50.947 14.124  1.00   32.49 ? 29   TYR A CE1 1 
ATOM   237  C CE2 . TYR A 1 29  ? -23.986 50.096 14.913  1.00   39.85 ? 29   TYR A CE2 1 
ATOM   238  C CZ  . TYR A 1 29  ? -24.854 50.397 13.868  1.00   41.12 ? 29   TYR A CZ  1 
ATOM   239  O OH  . TYR A 1 29  ? -24.485 50.145 12.574  1.00   40.55 ? 29   TYR A OH  1 
ATOM   240  N N   . GLY A 1 30  ? -27.820 53.513 19.616  1.00   33.52 ? 30   GLY A N   1 
ATOM   241  C CA  . GLY A 1 30  ? -28.509 53.774 20.868  1.00   32.99 ? 30   GLY A CA  1 
ATOM   242  C C   . GLY A 1 30  ? -28.232 55.142 21.460  1.00   33.20 ? 30   GLY A C   1 
ATOM   243  O O   . GLY A 1 30  ? -28.903 55.562 22.396  1.00   31.25 ? 30   GLY A O   1 
ATOM   244  N N   . ALA A 1 31  ? -27.252 55.853 20.916  1.00   34.44 ? 31   ALA A N   1 
ATOM   245  C CA  . ALA A 1 31  ? -27.027 57.240 21.339  1.00   31.01 ? 31   ALA A CA  1 
ATOM   246  C C   . ALA A 1 31  ? -28.286 58.081 21.181  1.00   31.73 ? 31   ALA A C   1 
ATOM   247  O O   . ALA A 1 31  ? -28.953 58.028 20.140  1.00   31.71 ? 31   ALA A O   1 
ATOM   248  C CB  . ALA A 1 31  ? -25.857 57.860 20.562  1.00   32.93 ? 31   ALA A CB  1 
ATOM   249  N N   . VAL A 1 32  ? -28.599 58.885 22.198  1.00   31.42 ? 32   VAL A N   1 
ATOM   250  C CA  . VAL A 1 32  ? -29.904 59.543 22.273  1.00   32.30 ? 32   VAL A CA  1 
ATOM   251  C C   . VAL A 1 32  ? -29.846 61.024 21.932  1.00   30.16 ? 32   VAL A C   1 
ATOM   252  O O   . VAL A 1 32  ? -30.876 61.649 21.688  1.00   30.19 ? 32   VAL A O   1 
ATOM   253  C CB  . VAL A 1 32  ? -30.588 59.350 23.678  1.00   38.17 ? 32   VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 32  ? -30.894 57.874 23.932  1.00   34.52 ? 32   VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 32  ? -29.710 59.925 24.805  1.00   36.13 ? 32   VAL A CG2 1 
ATOM   256  N N   . GLU A 1 33  ? -28.639 61.581 21.906  1.00   28.54 ? 33   GLU A N   1 
ATOM   257  C CA  . GLU A 1 33  ? -28.452 62.995 21.549  1.00   25.67 ? 33   GLU A CA  1 
ATOM   258  C C   . GLU A 1 33  ? -27.109 63.193 20.877  1.00   26.69 ? 33   GLU A C   1 
ATOM   259  O O   . GLU A 1 33  ? -26.106 62.653 21.327  1.00   31.09 ? 33   GLU A O   1 
ATOM   260  C CB  . GLU A 1 33  ? -28.531 63.900 22.790  1.00   26.55 ? 33   GLU A CB  1 
ATOM   261  C CG  . GLU A 1 33  ? -28.634 65.387 22.438  1.00   26.16 ? 33   GLU A CG  1 
ATOM   262  C CD  . GLU A 1 33  ? -28.654 66.298 23.655  1.00   34.12 ? 33   GLU A CD  1 
ATOM   263  O OE1 . GLU A 1 33  ? -28.875 65.808 24.789  1.00   34.01 ? 33   GLU A OE1 1 
ATOM   264  O OE2 . GLU A 1 33  ? -28.453 67.509 23.474  1.00   35.77 ? 33   GLU A OE2 1 
ATOM   265  N N   . TYR A 1 34  ? -27.108 63.948 19.781  1.00   25.67 ? 34   TYR A N   1 
ATOM   266  C CA  . TYR A 1 34  ? -25.881 64.335 19.084  1.00   26.30 ? 34   TYR A CA  1 
ATOM   267  C C   . TYR A 1 34  ? -25.885 65.860 19.025  1.00   28.61 ? 34   TYR A C   1 
ATOM   268  O O   . TYR A 1 34  ? -26.901 66.451 18.717  1.00   30.23 ? 34   TYR A O   1 
ATOM   269  C CB  . TYR A 1 34  ? -25.906 63.807 17.650  1.00   22.95 ? 34   TYR A CB  1 
ATOM   270  C CG  . TYR A 1 34  ? -25.731 62.312 17.539  1.00   30.83 ? 34   TYR A CG  1 
ATOM   271  C CD1 . TYR A 1 34  ? -26.715 61.447 17.972  1.00   26.00 ? 34   TYR A CD1 1 
ATOM   272  C CD2 . TYR A 1 34  ? -24.581 61.773 16.989  1.00   28.14 ? 34   TYR A CD2 1 
ATOM   273  C CE1 . TYR A 1 34  ? -26.552 60.046 17.871  1.00   29.20 ? 34   TYR A CE1 1 
ATOM   274  C CE2 . TYR A 1 34  ? -24.415 60.399 16.873  1.00   31.89 ? 34   TYR A CE2 1 
ATOM   275  C CZ  . TYR A 1 34  ? -25.409 59.545 17.313  1.00   32.53 ? 34   TYR A CZ  1 
ATOM   276  O OH  . TYR A 1 34  ? -25.246 58.181 17.185  1.00   31.62 ? 34   TYR A OH  1 
ATOM   277  N N   . GLN A 1 35  ? -24.745 66.484 19.299  1.00   28.64 ? 35   GLN A N   1 
ATOM   278  C CA  . GLN A 1 35  ? -24.602 67.923 19.062  1.00   30.02 ? 35   GLN A CA  1 
ATOM   279  C C   . GLN A 1 35  ? -23.537 68.211 18.034  1.00   30.97 ? 35   GLN A C   1 
ATOM   280  O O   . GLN A 1 35  ? -22.451 67.635 18.073  1.00   27.52 ? 35   GLN A O   1 
ATOM   281  C CB  . GLN A 1 35  ? -24.272 68.653 20.370  1.00   24.13 ? 35   GLN A CB  1 
ATOM   282  C CG  . GLN A 1 35  ? -25.367 68.475 21.460  1.00   27.23 ? 35   GLN A CG  1 
ATOM   283  C CD  . GLN A 1 35  ? -25.113 69.324 22.684  1.00   27.98 ? 35   GLN A CD  1 
ATOM   284  O OE1 . GLN A 1 35  ? -24.049 69.943 22.803  1.00   29.69 ? 35   GLN A OE1 1 
ATOM   285  N NE2 . GLN A 1 35  ? -26.094 69.384 23.586  1.00   30.40 ? 35   GLN A NE2 1 
ATOM   286  N N   . LEU A 1 36  ? -23.830 69.121 17.115  1.00   25.11 ? 36   LEU A N   1 
ATOM   287  C CA  . LEU A 1 36  ? -22.782 69.624 16.250  1.00   27.75 ? 36   LEU A CA  1 
ATOM   288  C C   . LEU A 1 36  ? -22.356 70.970 16.766  1.00   28.63 ? 36   LEU A C   1 
ATOM   289  O O   . LEU A 1 36  ? -23.193 71.876 16.943  1.00   24.93 ? 36   LEU A O   1 
ATOM   290  C CB  . LEU A 1 36  ? -23.259 69.747 14.807  1.00   25.22 ? 36   LEU A CB  1 
ATOM   291  C CG  . LEU A 1 36  ? -22.185 70.238 13.831  1.00   26.88 ? 36   LEU A CG  1 
ATOM   292  C CD1 . LEU A 1 36  ? -21.146 69.129 13.579  1.00   26.20 ? 36   LEU A CD1 1 
ATOM   293  C CD2 . LEU A 1 36  ? -22.828 70.688 12.502  1.00   30.49 ? 36   LEU A CD2 1 
ATOM   294  N N   . HIS A 1 37  ? -21.059 71.110 17.018  1.00   28.34 ? 37   HIS A N   1 
ATOM   295  C CA  . HIS A 1 37  ? -20.507 72.384 17.478  1.00   25.50 ? 37   HIS A CA  1 
ATOM   296  C C   . HIS A 1 37  ? -19.747 73.053 16.354  1.00   28.49 ? 37   HIS A C   1 
ATOM   297  O O   . HIS A 1 37  ? -19.077 72.392 15.579  1.00   28.53 ? 37   HIS A O   1 
ATOM   298  C CB  . HIS A 1 37  ? -19.558 72.169 18.665  1.00   25.88 ? 37   HIS A CB  1 
ATOM   299  C CG  . HIS A 1 37  ? -20.235 71.687 19.909  1.00   28.98 ? 37   HIS A CG  1 
ATOM   300  N ND1 . HIS A 1 37  ? -19.564 71.537 21.107  1.00   29.65 ? 37   HIS A ND1 1 
ATOM   301  C CD2 . HIS A 1 37  ? -21.512 71.289 20.139  1.00   28.52 ? 37   HIS A CD2 1 
ATOM   302  C CE1 . HIS A 1 37  ? -20.400 71.070 22.021  1.00   35.71 ? 37   HIS A CE1 1 
ATOM   303  N NE2 . HIS A 1 37  ? -21.586 70.910 21.460  1.00   28.97 ? 37   HIS A NE2 1 
ATOM   304  N N   . PHE A 1 38  ? -19.821 74.384 16.309  1.00   25.41 ? 38   PHE A N   1 
ATOM   305  C CA  . PHE A 1 38  ? -19.048 75.186 15.374  1.00   28.97 ? 38   PHE A CA  1 
ATOM   306  C C   . PHE A 1 38  ? -18.264 76.256 16.148  1.00   27.67 ? 38   PHE A C   1 
ATOM   307  O O   . PHE A 1 38  ? -18.844 77.154 16.757  1.00   26.23 ? 38   PHE A O   1 
ATOM   308  C CB  . PHE A 1 38  ? -19.993 75.862 14.355  1.00   26.13 ? 38   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 38  ? -19.305 76.825 13.431  1.00   30.70 ? 38   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 38  ? -18.325 76.386 12.547  1.00   25.36 ? 38   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 38  ? -19.641 78.168 13.439  1.00   35.14 ? 38   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 38  ? -17.693 77.273 11.688  1.00   30.75 ? 38   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 38  ? -19.010 79.061 12.582  1.00   41.94 ? 38   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 38  ? -18.042 78.610 11.706  1.00   37.11 ? 38   PHE A CZ  1 
ATOM   315  N N   . GLU A 1 39  ? -16.950 76.119 16.155  1.00   23.58 ? 39   GLU A N   1 
ATOM   316  C CA  . GLU A 1 39  ? -16.073 77.094 16.810  1.00   31.08 ? 39   GLU A CA  1 
ATOM   317  C C   . GLU A 1 39  ? -16.587 77.609 18.154  1.00   29.13 ? 39   GLU A C   1 
ATOM   318  O O   . GLU A 1 39  ? -16.725 78.814 18.359  1.00   32.98 ? 39   GLU A O   1 
ATOM   319  C CB  . GLU A 1 39  ? -15.754 78.243 15.859  1.00   30.62 ? 39   GLU A CB  1 
ATOM   320  C CG  . GLU A 1 39  ? -14.572 77.900 14.960  1.00   38.68 ? 39   GLU A CG  1 
ATOM   321  C CD  . GLU A 1 39  ? -14.389 78.873 13.842  1.00   48.46 ? 39   GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 39  ? -14.720 80.068 14.029  1.00   44.06 ? 39   GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 39  ? -13.920 78.444 12.772  1.00   35.58 ? 39   GLU A OE2 1 
ATOM   324  N N   . GLY A 1 40  ? -16.847 76.685 19.072  1.00   28.28 ? 40   GLY A N   1 
ATOM   325  C CA  . GLY A 1 40  ? -17.183 77.051 20.433  1.00   25.82 ? 40   GLY A CA  1 
ATOM   326  C C   . GLY A 1 40  ? -18.674 77.330 20.644  1.00   25.36 ? 40   GLY A C   1 
ATOM   327  O O   . GLY A 1 40  ? -19.076 77.772 21.723  1.00   28.69 ? 40   GLY A O   1 
ATOM   328  N N   . SER A 1 41  ? -19.491 77.057 19.628  1.00   26.38 ? 41   SER A N   1 
ATOM   329  C CA  . SER A 1 41  ? -20.936 77.330 19.711  1.00   27.69 ? 41   SER A CA  1 
ATOM   330  C C   . SER A 1 41  ? -21.728 76.087 19.333  1.00   29.78 ? 41   SER A C   1 
ATOM   331  O O   . SER A 1 41  ? -21.238 75.235 18.600  1.00   30.35 ? 41   SER A O   1 
ATOM   332  C CB  . SER A 1 41  ? -21.324 78.480 18.780  1.00   26.27 ? 41   SER A CB  1 
ATOM   333  O OG  . SER A 1 41  ? -21.300 78.056 17.417  1.00   33.21 ? 41   SER A OG  1 
ATOM   334  N N   . LEU A 1 42  ? -22.954 75.989 19.833  1.00   29.23 ? 42   LEU A N   1 
ATOM   335  C CA  . LEU A 1 42  ? -23.843 74.908 19.444  1.00   27.10 ? 42   LEU A CA  1 
ATOM   336  C C   . LEU A 1 42  ? -24.460 75.240 18.092  1.00   32.05 ? 42   LEU A C   1 
ATOM   337  O O   . LEU A 1 42  ? -25.167 76.242 17.956  1.00   29.71 ? 42   LEU A O   1 
ATOM   338  C CB  . LEU A 1 42  ? -24.949 74.716 20.496  1.00   27.27 ? 42   LEU A CB  1 
ATOM   339  C CG  . LEU A 1 42  ? -26.016 73.647 20.177  1.00   27.30 ? 42   LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 42  ? -25.328 72.263 19.967  1.00   27.31 ? 42   LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 42  ? -27.064 73.575 21.328  1.00   31.02 ? 42   LEU A CD2 1 
ATOM   342  N N   . PHE A 1 43  ? -24.167 74.418 17.086  1.00   26.24 ? 43   PHE A N   1 
ATOM   343  C CA  . PHE A 1 43  ? -24.729 74.616 15.768  1.00   24.65 ? 43   PHE A CA  1 
ATOM   344  C C   . PHE A 1 43  ? -26.086 73.931 15.605  1.00   29.89 ? 43   PHE A C   1 
ATOM   345  O O   . PHE A 1 43  ? -27.025 74.514 15.061  1.00   31.00 ? 43   PHE A O   1 
ATOM   346  C CB  . PHE A 1 43  ? -23.752 74.170 14.679  1.00   28.72 ? 43   PHE A CB  1 
ATOM   347  C CG  . PHE A 1 43  ? -24.209 74.509 13.288  1.00   36.14 ? 43   PHE A CG  1 
ATOM   348  C CD1 . PHE A 1 43  ? -23.725 75.638 12.636  1.00   52.11 ? 43   PHE A CD1 1 
ATOM   349  C CD2 . PHE A 1 43  ? -25.138 73.706 12.635  1.00   41.56 ? 43   PHE A CD2 1 
ATOM   350  C CE1 . PHE A 1 43  ? -24.156 75.957 11.341  1.00   47.24 ? 43   PHE A CE1 1 
ATOM   351  C CE2 . PHE A 1 43  ? -25.574 74.020 11.349  1.00   44.57 ? 43   PHE A CE2 1 
ATOM   352  C CZ  . PHE A 1 43  ? -25.081 75.146 10.706  1.00   46.37 ? 43   PHE A CZ  1 
ATOM   353  N N   . ALA A 1 44  ? -26.196 72.704 16.097  1.00   27.26 ? 44   ALA A N   1 
ATOM   354  C CA  . ALA A 1 44  ? -27.386 71.901 15.859  1.00   30.25 ? 44   ALA A CA  1 
ATOM   355  C C   . ALA A 1 44  ? -27.408 70.659 16.738  1.00   31.06 ? 44   ALA A C   1 
ATOM   356  O O   . ALA A 1 44  ? -26.377 70.239 17.272  1.00   27.29 ? 44   ALA A O   1 
ATOM   357  C CB  . ALA A 1 44  ? -27.499 71.518 14.352  1.00   28.49 ? 44   ALA A CB  1 
ATOM   358  N N   . VAL A 1 45  ? -28.594 70.089 16.890  1.00   28.29 ? 45   VAL A N   1 
ATOM   359  C CA  . VAL A 1 45  ? -28.819 68.971 17.793  1.00   29.29 ? 45   VAL A CA  1 
ATOM   360  C C   . VAL A 1 45  ? -29.686 67.952 17.080  1.00   30.40 ? 45   VAL A C   1 
ATOM   361  O O   . VAL A 1 45  ? -30.636 68.310 16.394  1.00   30.02 ? 45   VAL A O   1 
ATOM   362  C CB  . VAL A 1 45  ? -29.554 69.440 19.071  1.00   36.70 ? 45   VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 45  ? -29.884 68.271 19.980  1.00   33.46 ? 45   VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 45  ? -28.721 70.511 19.811  1.00   36.56 ? 45   VAL A CG2 1 
ATOM   365  N N   . ASP A 1 46  ? -29.365 66.677 17.248  1.00   27.13 ? 46   ASP A N   1 
ATOM   366  C CA  . ASP A 1 46  ? -30.226 65.612 16.724  1.00   30.95 ? 46   ASP A CA  1 
ATOM   367  C C   . ASP A 1 46  ? -30.524 64.631 17.840  1.00   31.73 ? 46   ASP A C   1 
ATOM   368  O O   . ASP A 1 46  ? -29.646 64.309 18.633  1.00   32.27 ? 46   ASP A O   1 
ATOM   369  C CB  . ASP A 1 46  ? -29.525 64.885 15.566  1.00   28.22 ? 46   ASP A CB  1 
ATOM   370  C CG  . ASP A 1 46  ? -30.442 63.893 14.857  1.00   38.47 ? 46   ASP A CG  1 
ATOM   371  O OD1 . ASP A 1 46  ? -30.950 64.208 13.768  1.00   38.04 ? 46   ASP A OD1 1 
ATOM   372  O OD2 . ASP A 1 46  ? -30.713 62.787 15.323  1.00   34.17 ? 46   ASP A OD2 1 
ATOM   373  N N   . ARG A 1 47  ? -31.765 64.165 17.917  1.00   27.95 ? 47   ARG A N   1 
ATOM   374  C CA  . ARG A 1 47  ? -32.135 63.177 18.936  1.00   30.91 ? 47   ARG A CA  1 
ATOM   375  C C   . ARG A 1 47  ? -32.780 61.957 18.274  1.00   30.72 ? 47   ARG A C   1 
ATOM   376  O O   . ARG A 1 47  ? -33.975 61.963 18.047  1.00   32.34 ? 47   ARG A O   1 
ATOM   377  C CB  . ARG A 1 47  ? -33.143 63.782 19.922  1.00   32.32 ? 47   ARG A CB  1 
ATOM   378  C CG  . ARG A 1 47  ? -32.614 64.949 20.775  1.00   39.17 ? 47   ARG A CG  1 
ATOM   379  C CD  . ARG A 1 47  ? -33.729 65.742 21.481  1.00   46.33 ? 47   ARG A CD  1 
ATOM   380  N NE  . ARG A 1 47  ? -33.353 67.133 21.712  1.00   48.16 ? 47   ARG A NE  1 
ATOM   381  C CZ  . ARG A 1 47  ? -32.722 67.553 22.794  1.00   55.74 ? 47   ARG A CZ  1 
ATOM   382  N NH1 . ARG A 1 47  ? -32.403 66.688 23.751  1.00   58.96 ? 47   ARG A NH1 1 
ATOM   383  N NH2 . ARG A 1 47  ? -32.406 68.837 22.928  1.00   59.20 ? 47   ARG A NH2 1 
ATOM   384  N N   . PRO A 1 48  ? -31.989 60.935 17.941  1.00   31.88 ? 48   PRO A N   1 
ATOM   385  C CA  . PRO A 1 48  ? -32.526 59.747 17.253  1.00   29.70 ? 48   PRO A CA  1 
ATOM   386  C C   . PRO A 1 48  ? -33.672 59.091 18.035  1.00   34.75 ? 48   PRO A C   1 
ATOM   387  O O   . PRO A 1 48  ? -33.541 58.833 19.229  1.00   30.74 ? 48   PRO A O   1 
ATOM   388  C CB  . PRO A 1 48  ? -31.318 58.815 17.176  1.00   31.66 ? 48   PRO A CB  1 
ATOM   389  C CG  . PRO A 1 48  ? -30.126 59.757 17.156  1.00   30.99 ? 48   PRO A CG  1 
ATOM   390  C CD  . PRO A 1 48  ? -30.525 60.842 18.150  1.00   26.83 ? 48   PRO A CD  1 
ATOM   391  N N   . LYS A 1 49  ? -34.785 58.829 17.356  1.00   33.93 ? 49   LYS A N   1 
ATOM   392  C CA  . LYS A 1 49  ? -35.947 58.213 18.004  1.00   34.95 ? 49   LYS A CA  1 
ATOM   393  C C   . LYS A 1 49  ? -36.708 57.388 16.976  1.00   31.37 ? 49   LYS A C   1 
ATOM   394  O O   . LYS A 1 49  ? -37.293 57.951 16.050  1.00   32.50 ? 49   LYS A O   1 
ATOM   395  C CB  . LYS A 1 49  ? -36.824 59.282 18.659  1.00   34.88 ? 49   LYS A CB  1 
ATOM   396  C CG  . LYS A 1 49  ? -38.017 58.725 19.419  1.00   35.43 ? 49   LYS A CG  1 
ATOM   397  C CD  . LYS A 1 49  ? -37.577 57.959 20.655  0.0000 20.00 ? 49   LYS A CD  1 
ATOM   398  C CE  . LYS A 1 49  ? -38.770 57.402 21.414  0.0000 20.00 ? 49   LYS A CE  1 
ATOM   399  N NZ  . LYS A 1 49  ? -38.353 56.648 22.629  0.0000 20.00 ? 49   LYS A NZ  1 
ATOM   400  N N   . PRO A 1 50  ? -36.698 56.066 17.121  1.00   32.54 ? 50   PRO A N   1 
ATOM   401  C CA  . PRO A 1 50  ? -35.915 55.357 18.150  1.00   32.39 ? 50   PRO A CA  1 
ATOM   402  C C   . PRO A 1 50  ? -34.431 55.241 17.801  1.00   36.98 ? 50   PRO A C   1 
ATOM   403  O O   . PRO A 1 50  ? -34.077 55.122 16.625  1.00   35.51 ? 50   PRO A O   1 
ATOM   404  C CB  . PRO A 1 50  ? -36.516 53.947 18.117  1.00   34.41 ? 50   PRO A CB  1 
ATOM   405  C CG  . PRO A 1 50  ? -36.938 53.784 16.702  1.00   28.36 ? 50   PRO A CG  1 
ATOM   406  C CD  . PRO A 1 50  ? -37.456 55.132 16.263  1.00   32.12 ? 50   PRO A CD  1 
ATOM   407  N N   . PRO A 1 51  ? -33.584 55.235 18.831  1.00   38.16 ? 51   PRO A N   1 
ATOM   408  C CA  . PRO A 1 51  ? -32.124 55.308 18.668  1.00   38.76 ? 51   PRO A CA  1 
ATOM   409  C C   . PRO A 1 51  ? -31.406 53.972 18.495  1.00   36.40 ? 51   PRO A C   1 
ATOM   410  O O   . PRO A 1 51  ? -30.226 53.981 18.159  1.00   33.72 ? 51   PRO A O   1 
ATOM   411  C CB  . PRO A 1 51  ? -31.669 55.963 19.986  1.00   41.87 ? 51   PRO A CB  1 
ATOM   412  C CG  . PRO A 1 51  ? -32.672 55.484 21.005  1.00   38.57 ? 51   PRO A CG  1 
ATOM   413  C CD  . PRO A 1 51  ? -33.988 55.251 20.249  1.00   40.78 ? 51   PRO A CD  1 
ATOM   414  N N   . GLU A 1 52  ? -32.085 52.847 18.744  1.00   37.94 ? 52   GLU A N   1 
ATOM   415  C CA  . GLU A 1 52  ? -31.395 51.546 18.893  1.00   36.29 ? 52   GLU A CA  1 
ATOM   416  C C   . GLU A 1 52  ? -30.562 51.147 17.675  1.00   34.74 ? 52   GLU A C   1 
ATOM   417  O O   . GLU A 1 52  ? -29.471 50.567 17.800  1.00   34.51 ? 52   GLU A O   1 
ATOM   418  C CB  . GLU A 1 52  ? -32.416 50.427 19.210  1.00   39.53 ? 52   GLU A CB  1 
ATOM   419  C CG  . GLU A 1 52  ? -32.898 50.410 20.655  1.00   51.77 ? 52   GLU A CG  1 
ATOM   420  C CD  . GLU A 1 52  ? -33.953 51.467 20.937  1.00   58.53 ? 52   GLU A CD  1 
ATOM   421  O OE1 . GLU A 1 52  ? -34.439 52.096 19.976  1.00   48.49 ? 52   GLU A OE1 1 
ATOM   422  O OE2 . GLU A 1 52  ? -34.292 51.675 22.124  1.00   59.14 ? 52   GLU A OE2 1 
ATOM   423  N N   . ARG A 1 53  ? -31.083 51.411 16.491  1.00   34.22 ? 53   ARG A N   1 
ATOM   424  C CA  . ARG A 1 53  ? -30.467 50.893 15.284  1.00   32.87 ? 53   ARG A CA  1 
ATOM   425  C C   . ARG A 1 53  ? -29.831 52.032 14.478  1.00   32.38 ? 53   ARG A C   1 
ATOM   426  O O   . ARG A 1 53  ? -29.519 51.877 13.288  1.00   29.53 ? 53   ARG A O   1 
ATOM   427  C CB  . ARG A 1 53  ? -31.512 50.144 14.434  1.00   36.96 ? 53   ARG A CB  1 
ATOM   428  C CG  . ARG A 1 53  ? -32.065 48.856 15.098  1.00   38.79 ? 53   ARG A CG  1 
ATOM   429  C CD  . ARG A 1 53  ? -32.025 47.591 14.178  1.00   59.50 ? 53   ARG A CD  1 
ATOM   430  N NE  . ARG A 1 53  ? -32.460 46.352 14.858  1.00   43.66 ? 53   ARG A NE  1 
ATOM   431  C CZ  . ARG A 1 53  ? -33.638 46.201 15.463  1.00   48.44 ? 53   ARG A CZ  1 
ATOM   432  N NH1 . ARG A 1 53  ? -34.512 47.202 15.488  1.00   51.25 ? 53   ARG A NH1 1 
ATOM   433  N NH2 . ARG A 1 53  ? -33.946 45.048 16.044  1.00   54.00 ? 53   ARG A NH2 1 
ATOM   434  N N   . ILE A 1 54  ? -29.654 53.172 15.147  1.00   32.22 ? 54   ILE A N   1 
ATOM   435  C CA  . ILE A 1 54  ? -29.076 54.378 14.546  1.00   31.81 ? 54   ILE A CA  1 
ATOM   436  C C   . ILE A 1 54  ? -27.715 54.658 15.189  1.00   33.29 ? 54   ILE A C   1 
ATOM   437  O O   . ILE A 1 54  ? -27.602 54.713 16.419  1.00   31.19 ? 54   ILE A O   1 
ATOM   438  C CB  . ILE A 1 54  ? -30.009 55.580 14.819  1.00   31.67 ? 54   ILE A CB  1 
ATOM   439  C CG1 . ILE A 1 54  ? -31.359 55.399 14.107  1.00   33.72 ? 54   ILE A CG1 1 
ATOM   440  C CG2 . ILE A 1 54  ? -29.339 56.895 14.427  1.00   27.34 ? 54   ILE A CG2 1 
ATOM   441  C CD1 . ILE A 1 54  ? -31.301 55.545 12.563  1.00   29.84 ? 54   ILE A CD1 1 
ATOM   442  N N   . ASN A 1 55  ? -26.691 54.867 14.367  1.00   30.65 ? 55   ASN A N   1 
ATOM   443  C CA  . ASN A 1 55  ? -25.396 55.298 14.882  1.00   33.88 ? 55   ASN A CA  1 
ATOM   444  C C   . ASN A 1 55  ? -24.812 56.511 14.155  1.00   31.02 ? 55   ASN A C   1 
ATOM   445  O O   . ASN A 1 55  ? -23.646 56.847 14.351  1.00   32.07 ? 55   ASN A O   1 
ATOM   446  C CB  . ASN A 1 55  ? -24.378 54.128 14.881  1.00   30.87 ? 55   ASN A CB  1 
ATOM   447  C CG  . ASN A 1 55  ? -23.845 53.822 13.504  1.00   36.65 ? 55   ASN A CG  1 
ATOM   448  O OD1 . ASN A 1 55  ? -24.491 54.120 12.498  1.00   32.74 ? 55   ASN A OD1 1 
ATOM   449  N ND2 . ASN A 1 55  ? -22.656 53.213 13.442  1.00   30.30 ? 55   ASN A ND2 1 
ATOM   450  N N   . LYS A 1 56  ? -25.625 57.163 13.318  1.00   30.36 ? 56   LYS A N   1 
ATOM   451  C CA  . LYS A 1 56  ? -25.153 58.279 12.483  1.00   32.40 ? 56   LYS A CA  1 
ATOM   452  C C   . LYS A 1 56  ? -26.271 59.310 12.373  1.00   32.21 ? 56   LYS A C   1 
ATOM   453  O O   . LYS A 1 56  ? -27.419 58.950 12.197  1.00   28.80 ? 56   LYS A O   1 
ATOM   454  C CB  . LYS A 1 56  ? -24.826 57.784 11.067  1.00   33.44 ? 56   LYS A CB  1 
ATOM   455  C CG  . LYS A 1 56  ? -23.637 56.853 10.956  1.00   44.78 ? 56   LYS A CG  1 
ATOM   456  C CD  . LYS A 1 56  ? -23.352 56.541 9.476   1.00   33.85 ? 56   LYS A CD  1 
ATOM   457  C CE  . LYS A 1 56  ? -22.914 55.107 9.275   1.00   41.38 ? 56   LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 56  ? -23.559 54.185 10.217  1.00   36.90 ? 56   LYS A NZ  1 
ATOM   459  N N   . VAL A 1 57  ? -25.935 60.592 12.461  1.00   25.51 ? 57   VAL A N   1 
ATOM   460  C CA  . VAL A 1 57  ? -26.935 61.630 12.225  1.00   26.74 ? 57   VAL A CA  1 
ATOM   461  C C   . VAL A 1 57  ? -26.438 62.612 11.167  1.00   30.85 ? 57   VAL A C   1 
ATOM   462  O O   . VAL A 1 57  ? -25.229 62.735 10.924  1.00   28.51 ? 57   VAL A O   1 
ATOM   463  C CB  . VAL A 1 57  ? -27.283 62.398 13.506  1.00   25.70 ? 57   VAL A CB  1 
ATOM   464  C CG1 . VAL A 1 57  ? -27.898 61.469 14.529  1.00   28.01 ? 57   VAL A CG1 1 
ATOM   465  C CG2 . VAL A 1 57  ? -26.033 63.062 14.074  1.00   32.66 ? 57   VAL A CG2 1 
ATOM   466  N N   . LYS A 1 58  ? -27.373 63.312 10.549  1.00   26.40 ? 58   LYS A N   1 
ATOM   467  C CA  . LYS A 1 58  ? -27.053 64.203 9.460   1.00   30.83 ? 58   LYS A CA  1 
ATOM   468  C C   . LYS A 1 58  ? -27.388 65.617 9.880   1.00   30.64 ? 58   LYS A C   1 
ATOM   469  O O   . LYS A 1 58  ? -28.482 65.883 10.380  1.00   29.73 ? 58   LYS A O   1 
ATOM   470  C CB  . LYS A 1 58  ? -27.848 63.806 8.209   1.00   32.59 ? 58   LYS A CB  1 
ATOM   471  C CG  . LYS A 1 58  ? -29.170 64.523 8.056   1.00   47.86 ? 58   LYS A CG  1 
ATOM   472  C CD  . LYS A 1 58  ? -29.752 63.252 6.884   0.0000 66.28 ? 58   LYS A CD  1 
ATOM   473  C CE  . LYS A 1 58  ? -29.470 61.776 6.657   0.0000 62.59 ? 58   LYS A CE  1 
ATOM   474  N NZ  . LYS A 1 58  ? -30.033 61.294 5.367   0.0000 61.57 ? 58   LYS A NZ  1 
ATOM   475  N N   . PHE A 1 59  ? -26.431 66.513 9.686   1.00   28.04 ? 59   PHE A N   1 
ATOM   476  C CA  . PHE A 1 59  ? -26.624 67.919 9.996   1.00   31.95 ? 59   PHE A CA  1 
ATOM   477  C C   . PHE A 1 59  ? -26.618 68.681 8.679   1.00   33.56 ? 59   PHE A C   1 
ATOM   478  O O   . PHE A 1 59  ? -25.655 68.600 7.910   1.00   33.19 ? 59   PHE A O   1 
ATOM   479  C CB  . PHE A 1 59  ? -25.542 68.419 10.947  1.00   29.37 ? 59   PHE A CB  1 
ATOM   480  C CG  . PHE A 1 59  ? -25.606 67.819 12.325  1.00   30.49 ? 59   PHE A CG  1 
ATOM   481  C CD1 . PHE A 1 59  ? -24.629 66.928 12.744  1.00   26.74 ? 59   PHE A CD1 1 
ATOM   482  C CD2 . PHE A 1 59  ? -26.625 68.129 13.225  1.00   33.54 ? 59   PHE A CD2 1 
ATOM   483  C CE1 . PHE A 1 59  ? -24.655 66.353 13.993  1.00   31.12 ? 59   PHE A CE1 1 
ATOM   484  C CE2 . PHE A 1 59  ? -26.654 67.561 14.477  1.00   24.49 ? 59   PHE A CE2 1 
ATOM   485  C CZ  . PHE A 1 59  ? -25.679 66.663 14.874  1.00   28.99 ? 59   PHE A CZ  1 
ATOM   486  N N   . TYR A 1 60  ? -27.705 69.419 8.409   1.00   38.79 ? 60   TYR A N   1 
ATOM   487  C CA  . TYR A 1 60  ? -27.846 70.085 7.115   1.00   45.35 ? 60   TYR A CA  1 
ATOM   488  C C   . TYR A 1 60  ? -27.434 71.526 7.114   1.00   44.98 ? 60   TYR A C   1 
ATOM   489  O O   . TYR A 1 60  ? -27.632 72.232 8.101   1.00   47.78 ? 60   TYR A O   1 
ATOM   490  C CB  . TYR A 1 60  ? -29.317 70.024 6.644   1.00   48.51 ? 60   TYR A CB  1 
ATOM   491  C CG  . TYR A 1 60  ? -29.513 70.244 5.172   0.50   49.11 ? 60   TYR A CG  1 
ATOM   492  C CD1 . TYR A 1 60  ? -30.464 71.136 4.680   0.50   48.19 ? 60   TYR A CD1 1 
ATOM   493  C CD2 . TYR A 1 60  ? -28.737 69.544 4.253   0.50   41.10 ? 60   TYR A CD2 1 
ATOM   494  C CE1 . TYR A 1 60  ? -30.641 71.320 3.314   0.50   48.67 ? 60   TYR A CE1 1 
ATOM   495  C CE2 . TYR A 1 60  ? -28.908 69.725 2.876   0.50   43.79 ? 60   TYR A CE2 1 
ATOM   496  C CZ  . TYR A 1 60  ? -29.861 70.617 2.421   0.50   46.45 ? 60   TYR A CZ  1 
ATOM   497  O OH  . TYR A 1 60  ? -30.045 70.805 1.070   0.50   44.88 ? 60   TYR A OH  1 
ATOM   498  N N   . ILE A 1 61  ? -26.848 71.955 5.999   1.00   46.79 ? 61   ILE A N   1 
ATOM   499  C CA  . ILE A 1 61  ? -26.532 73.374 5.801   1.00   56.83 ? 61   ILE A CA  1 
ATOM   500  C C   . ILE A 1 61  ? -27.154 73.804 4.475   1.00   62.49 ? 61   ILE A C   1 
ATOM   501  O O   . ILE A 1 61  ? -26.742 73.342 3.402   1.00   63.68 ? 61   ILE A O   1 
ATOM   502  C CB  . ILE A 1 61  ? -25.033 73.687 5.706   1.00   58.28 ? 61   ILE A CB  1 
ATOM   503  C CG1 . ILE A 1 61  ? -24.523 74.159 7.076   1.00   55.12 ? 61   ILE A CG1 1 
ATOM   504  C CG2 . ILE A 1 61  ? -24.754 74.749 4.652   1.00   48.90 ? 61   ILE A CG2 1 
ATOM   505  C CD1 . ILE A 1 61  ? -23.458 73.271 7.679   1.00   48.16 ? 61   ILE A CD1 1 
ATOM   506  N N   . PRO A 1 62  ? -28.142 74.665 4.540   1.00   66.28 ? 62   PRO A N   1 
ATOM   507  C CA  . PRO A 1 62  ? -28.879 75.077 3.337   1.00   63.86 ? 62   PRO A CA  1 
ATOM   508  C C   . PRO A 1 62  ? -28.147 76.133 2.479   1.00   61.91 ? 62   PRO A C   1 
ATOM   509  O O   . PRO A 1 62  ? -28.294 76.123 1.243   1.00   63.93 ? 62   PRO A O   1 
ATOM   510  C CB  . PRO A 1 62  ? -30.188 75.663 3.909   1.00   63.29 ? 62   PRO A CB  1 
ATOM   511  C CG  . PRO A 1 62  ? -30.037 75.602 5.444   1.00   64.22 ? 62   PRO A CG  1 
ATOM   512  C CD  . PRO A 1 62  ? -28.577 75.402 5.736   1.00   68.09 ? 62   PRO A CD  1 
ATOM   513  N N   . ASP A 1 63  ? -27.393 77.032 3.114   1.00   55.09 ? 63   ASP A N   1 
ATOM   514  C CA  . ASP A 1 63  ? -27.127 78.346 2.525   1.00   54.19 ? 63   ASP A CA  1 
ATOM   515  C C   . ASP A 1 63  ? -25.739 78.855 2.844   1.00   50.32 ? 63   ASP A C   1 
ATOM   516  O O   . ASP A 1 63  ? -25.580 79.883 3.513   1.00   49.22 ? 63   ASP A O   1 
ATOM   517  C CB  . ASP A 1 63  ? -28.161 79.370 3.006   1.00   59.31 ? 63   ASP A CB  1 
ATOM   518  C CG  . ASP A 1 63  ? -28.861 80.060 1.871   1.00   67.98 ? 63   ASP A CG  1 
ATOM   519  O OD1 . ASP A 1 63  ? -28.179 80.746 1.074   1.00   73.51 ? 63   ASP A OD1 1 
ATOM   520  O OD2 . ASP A 1 63  ? -30.091 79.971 1.688   1.00   75.73 ? 63   ASP A OD2 1 
ATOM   521  N N   . MET A 1 64  ? -24.726 78.155 2.353   1.00   45.40 ? 64   MET A N   1 
ATOM   522  C CA  . MET A 1 64  ? -23.377 78.388 2.826   1.00   38.92 ? 64   MET A CA  1 
ATOM   523  C C   . MET A 1 64  ? -23.004 79.844 2.722   1.00   42.45 ? 64   MET A C   1 
ATOM   524  O O   . MET A 1 64  ? -23.151 80.458 1.661   1.00   42.78 ? 64   MET A O   1 
ATOM   525  C CB  . MET A 1 64  ? -22.373 77.564 2.031   1.00   32.65 ? 64   MET A CB  1 
ATOM   526  C CG  . MET A 1 64  ? -20.994 77.643 2.595   1.00   31.20 ? 64   MET A CG  1 
ATOM   527  S SD  . MET A 1 64  ? -20.892 76.790 4.194   1.00   33.15 ? 64   MET A SD  1 
ATOM   528  C CE  . MET A 1 64  ? -19.208 77.104 4.654   1.00   29.61 ? 64   MET A CE  1 
ATOM   529  N N   . ASN A 1 65  ? -22.479 80.391 3.809   1.00   45.67 ? 65   ASN A N   1 
ATOM   530  C CA  . ASN A 1 65  ? -21.800 81.669 3.747   1.00   48.27 ? 65   ASN A CA  1 
ATOM   531  C C   . ASN A 1 65  ? -20.503 81.652 4.514   1.00   45.29 ? 65   ASN A C   1 
ATOM   532  O O   . ASN A 1 65  ? -20.188 80.682 5.209   1.00   44.47 ? 65   ASN A O   1 
ATOM   533  C CB  . ASN A 1 65  ? -22.702 82.799 4.257   1.00   48.44 ? 65   ASN A CB  1 
ATOM   534  C CG  . ASN A 1 65  ? -22.863 82.782 5.759   1.00   59.68 ? 65   ASN A CG  1 
ATOM   535  O OD1 . ASN A 1 65  ? -21.879 82.829 6.504   1.00   51.16 ? 65   ASN A OD1 1 
ATOM   536  N ND2 . ASN A 1 65  ? -24.111 82.725 6.218   1.00   61.35 ? 65   ASN A ND2 1 
ATOM   537  N N   . SER A 1 66  ? -19.754 82.736 4.378   1.00   39.13 ? 66   SER A N   1 
ATOM   538  C CA  . SER A 1 66  ? -18.440 82.875 4.976   1.00   40.19 ? 66   SER A CA  1 
ATOM   539  C C   . SER A 1 66  ? -18.440 82.622 6.482   1.00   40.43 ? 66   SER A C   1 
ATOM   540  O O   . SER A 1 66  ? -17.422 82.212 7.053   1.00   44.10 ? 66   SER A O   1 
ATOM   541  C CB  . SER A 1 66  ? -17.896 84.281 4.683   1.00   44.76 ? 66   SER A CB  1 
ATOM   542  O OG  . SER A 1 66  ? -16.713 84.529 5.411   1.00   54.81 ? 66   SER A OG  1 
ATOM   543  N N   . ARG A 1 67  ? -19.564 82.898 7.138   1.00   36.33 ? 67   ARG A N   1 
ATOM   544  C CA  . ARG A 1 67  ? -19.617 82.819 8.593   1.00   34.61 ? 67   ARG A CA  1 
ATOM   545  C C   . ARG A 1 67  ? -19.805 81.383 9.078   1.00   32.96 ? 67   ARG A C   1 
ATOM   546  O O   . ARG A 1 67  ? -19.671 81.094 10.272  1.00   38.23 ? 67   ARG A O   1 
ATOM   547  C CB  . ARG A 1 67  ? -20.721 83.729 9.144   1.00   36.73 ? 67   ARG A CB  1 
ATOM   548  C CG  . ARG A 1 67  ? -20.509 85.196 8.814   1.00   44.35 ? 67   ARG A CG  1 
ATOM   549  C CD  . ARG A 1 67  ? -21.746 86.065 8.984   1.00   54.20 ? 67   ARG A CD  1 
ATOM   550  N NE  . ARG A 1 67  ? -21.533 87.399 8.431   1.00   64.70 ? 67   ARG A NE  1 
ATOM   551  C CZ  . ARG A 1 67  ? -21.822 87.744 7.180   1.00   72.49 ? 67   ARG A CZ  1 
ATOM   552  N NH1 . ARG A 1 67  ? -22.356 86.852 6.347   1.00   54.38 ? 67   ARG A NH1 1 
ATOM   553  N NH2 . ARG A 1 67  ? -21.588 88.985 6.762   1.00   70.46 ? 67   ARG A NH2 1 
ATOM   554  N N   . MET A 1 68  ? -20.100 80.483 8.148   1.00   30.83 ? 68   MET A N   1 
ATOM   555  C CA  . MET A 1 68  ? -20.221 79.066 8.470   1.00   32.99 ? 68   MET A CA  1 
ATOM   556  C C   . MET A 1 68  ? -18.955 78.284 8.076   1.00   35.39 ? 68   MET A C   1 
ATOM   557  O O   . MET A 1 68  ? -18.867 77.077 8.297   1.00   30.46 ? 68   MET A O   1 
ATOM   558  C CB  . MET A 1 68  ? -21.446 78.471 7.790   1.00   33.32 ? 68   MET A CB  1 
ATOM   559  C CG  . MET A 1 68  ? -22.777 78.974 8.348   1.00   45.83 ? 68   MET A CG  1 
ATOM   560  S SD  . MET A 1 68  ? -24.172 78.309 7.408   1.00   56.54 ? 68   MET A SD  1 
ATOM   561  C CE  . MET A 1 68  ? -24.009 79.227 5.950   1.00   47.30 ? 68   MET A CE  1 
ATOM   562  N N   . ALA A 1 69  ? -17.982 78.986 7.493   1.00   32.93 ? 69   ALA A N   1 
ATOM   563  C CA  . ALA A 1 69  ? -16.664 78.394 7.222   1.00   32.07 ? 69   ALA A CA  1 
ATOM   564  C C   . ALA A 1 69  ? -15.811 78.440 8.472   1.00   31.40 ? 69   ALA A C   1 
ATOM   565  O O   . ALA A 1 69  ? -15.690 79.480 9.109   1.00   32.90 ? 69   ALA A O   1 
ATOM   566  C CB  . ALA A 1 69  ? -15.960 79.136 6.055   1.00   25.75 ? 69   ALA A CB  1 
ATOM   567  N N   . GLY A 1 70  ? -15.234 77.300 8.834   1.00   27.19 ? 70   GLY A N   1 
ATOM   568  C CA  . GLY A 1 70  ? -14.527 77.175 10.091  1.00   23.47 ? 70   GLY A CA  1 
ATOM   569  C C   . GLY A 1 70  ? -14.528 75.732 10.557  1.00   29.37 ? 70   GLY A C   1 
ATOM   570  O O   . GLY A 1 70  ? -14.744 74.816 9.760   1.00   29.81 ? 70   GLY A O   1 
ATOM   571  N N   . GLN A 1 71  ? -14.325 75.536 11.855  1.00   25.45 ? 71   GLN A N   1 
ATOM   572  C CA  . GLN A 1 71  ? -14.038 74.211 12.410  1.00   25.48 ? 71   GLN A CA  1 
ATOM   573  C C   . GLN A 1 71  ? -15.252 73.669 13.176  1.00   28.11 ? 71   GLN A C   1 
ATOM   574  O O   . GLN A 1 71  ? -15.858 74.382 13.986  1.00   30.33 ? 71   GLN A O   1 
ATOM   575  C CB  . GLN A 1 71  ? -12.854 74.311 13.357  1.00   27.37 ? 71   GLN A CB  1 
ATOM   576  C CG  . GLN A 1 71  ? -12.244 72.998 13.729  1.00   33.24 ? 71   GLN A CG  1 
ATOM   577  C CD  . GLN A 1 71  ? -11.129 73.166 14.717  1.00   40.62 ? 71   GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 71  ? -11.357 73.627 15.828  1.00   34.49 ? 71   GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 71  ? -9.915  72.806 14.317  1.00   30.87 ? 71   GLN A NE2 1 
ATOM   580  N N   . TYR A 1 72  ? -15.620 72.424 12.881  1.00   28.29 ? 72   TYR A N   1 
ATOM   581  C CA  . TYR A 1 72  ? -16.775 71.770 13.493  1.00   26.54 ? 72   TYR A CA  1 
ATOM   582  C C   . TYR A 1 72  ? -16.325 70.536 14.273  1.00   27.64 ? 72   TYR A C   1 
ATOM   583  O O   . TYR A 1 72  ? -15.288 69.948 13.987  1.00   28.17 ? 72   TYR A O   1 
ATOM   584  C CB  . TYR A 1 72  ? -17.775 71.313 12.415  1.00   25.12 ? 72   TYR A CB  1 
ATOM   585  C CG  . TYR A 1 72  ? -18.466 72.435 11.684  1.00   28.80 ? 72   TYR A CG  1 
ATOM   586  C CD1 . TYR A 1 72  ? -17.791 73.179 10.716  1.00   29.48 ? 72   TYR A CD1 1 
ATOM   587  C CD2 . TYR A 1 72  ? -19.806 72.744 11.947  1.00   25.16 ? 72   TYR A CD2 1 
ATOM   588  C CE1 . TYR A 1 72  ? -18.429 74.203 10.034  1.00   25.70 ? 72   TYR A CE1 1 
ATOM   589  C CE2 . TYR A 1 72  ? -20.446 73.750 11.278  1.00   30.12 ? 72   TYR A CE2 1 
ATOM   590  C CZ  . TYR A 1 72  ? -19.763 74.487 10.331  1.00   33.02 ? 72   TYR A CZ  1 
ATOM   591  O OH  . TYR A 1 72  ? -20.408 75.510 9.679   1.00   27.24 ? 72   TYR A OH  1 
ATOM   592  N N   . SER A 1 73  ? -17.128 70.133 15.240  1.00   29.33 ? 73   SER A N   1 
ATOM   593  C CA  . SER A 1 73  ? -16.914 68.859 15.897  1.00   25.73 ? 73   SER A CA  1 
ATOM   594  C C   . SER A 1 73  ? -18.250 68.351 16.382  1.00   29.64 ? 73   SER A C   1 
ATOM   595  O O   . SER A 1 73  ? -19.238 69.100 16.436  1.00   29.79 ? 73   SER A O   1 
ATOM   596  C CB  . SER A 1 73  ? -15.950 69.033 17.075  1.00   29.51 ? 73   SER A CB  1 
ATOM   597  O OG  . SER A 1 73  ? -16.591 69.689 18.153  1.00   28.93 ? 73   SER A OG  1 
ATOM   598  N N   . CYS A 1 74  ? -18.298 67.084 16.734  1.00   23.99 ? 74   CYS A N   1 
ATOM   599  C CA  . CYS A 1 74  ? -19.540 66.481 17.164  1.00   24.35 ? 74   CYS A CA  1 
ATOM   600  C C   . CYS A 1 74  ? -19.302 65.728 18.469  1.00   24.34 ? 74   CYS A C   1 
ATOM   601  O O   . CYS A 1 74  ? -18.223 65.153 18.675  1.00   30.81 ? 74   CYS A O   1 
ATOM   602  C CB  . CYS A 1 74  ? -20.034 65.530 16.069  1.00   26.18 ? 74   CYS A CB  1 
ATOM   603  S SG  . CYS A 1 74  ? -21.367 64.483 16.567  1.00   36.85 ? 74   CYS A SG  1 
ATOM   604  N N   . ILE A 1 75  ? -20.282 65.770 19.367  1.00   26.05 ? 75   ILE A N   1 
ATOM   605  C CA  . ILE A 1 75  ? -20.298 64.881 20.531  1.00   26.19 ? 75   ILE A CA  1 
ATOM   606  C C   . ILE A 1 75  ? -21.668 64.237 20.626  1.00   30.61 ? 75   ILE A C   1 
ATOM   607  O O   . ILE A 1 75  ? -22.655 64.766 20.083  1.00   27.62 ? 75   ILE A O   1 
ATOM   608  C CB  . ILE A 1 75  ? -20.008 65.672 21.853  1.00   26.63 ? 75   ILE A CB  1 
ATOM   609  C CG1 . ILE A 1 75  ? -20.979 66.867 21.997  1.00   29.21 ? 75   ILE A CG1 1 
ATOM   610  C CG2 . ILE A 1 75  ? -18.558 66.149 21.884  1.00   27.96 ? 75   ILE A CG2 1 
ATOM   611  C CD1 . ILE A 1 75  ? -20.937 67.531 23.412  1.00   27.81 ? 75   ILE A CD1 1 
ATOM   612  N N   . TYR A 1 76  ? -21.739 63.108 21.317  1.00   25.64 ? 76   TYR A N   1 
ATOM   613  C CA  . TYR A 1 76  ? -23.013 62.437 21.496  1.00   27.19 ? 76   TYR A CA  1 
ATOM   614  C C   . TYR A 1 76  ? -23.133 61.826 22.876  1.00   31.19 ? 76   TYR A C   1 
ATOM   615  O O   . TYR A 1 76  ? -22.140 61.667 23.594  1.00   29.66 ? 76   TYR A O   1 
ATOM   616  C CB  . TYR A 1 76  ? -23.193 61.356 20.445  1.00   28.50 ? 76   TYR A CB  1 
ATOM   617  C CG  . TYR A 1 76  ? -22.280 60.181 20.644  1.00   29.63 ? 76   TYR A CG  1 
ATOM   618  C CD1 . TYR A 1 76  ? -22.693 59.074 21.390  1.00   31.18 ? 76   TYR A CD1 1 
ATOM   619  C CD2 . TYR A 1 76  ? -21.006 60.167 20.099  1.00   26.61 ? 76   TYR A CD2 1 
ATOM   620  C CE1 . TYR A 1 76  ? -21.872 57.987 21.572  1.00   33.88 ? 76   TYR A CE1 1 
ATOM   621  C CE2 . TYR A 1 76  ? -20.164 59.071 20.287  1.00   34.99 ? 76   TYR A CE2 1 
ATOM   622  C CZ  . TYR A 1 76  ? -20.617 57.981 21.026  1.00   32.62 ? 76   TYR A CZ  1 
ATOM   623  O OH  . TYR A 1 76  ? -19.800 56.894 21.234  1.00   34.17 ? 76   TYR A OH  1 
ATOM   624  N N   . ARG A 1 77  ? -24.358 61.487 23.234  1.00   31.19 ? 77   ARG A N   1 
ATOM   625  C CA  . ARG A 1 77  ? -24.704 61.112 24.591  1.00   36.85 ? 77   ARG A CA  1 
ATOM   626  C C   . ARG A 1 77  ? -25.403 59.749 24.563  1.00   38.43 ? 77   ARG A C   1 
ATOM   627  O O   . ARG A 1 77  ? -26.316 59.528 23.761  1.00   34.00 ? 77   ARG A O   1 
ATOM   628  C CB  . ARG A 1 77  ? -25.656 62.159 25.173  1.00   35.39 ? 77   ARG A CB  1 
ATOM   629  C CG  . ARG A 1 77  ? -26.152 61.853 26.553  1.00   39.49 ? 77   ARG A CG  1 
ATOM   630  C CD  . ARG A 1 77  ? -26.682 63.048 27.279  1.00   30.72 ? 77   ARG A CD  1 
ATOM   631  N NE  . ARG A 1 77  ? -27.879 63.589 26.650  1.00   31.97 ? 77   ARG A NE  1 
ATOM   632  C CZ  . ARG A 1 77  ? -29.109 63.086 26.813  1.00   42.92 ? 77   ARG A CZ  1 
ATOM   633  N NH1 . ARG A 1 77  ? -29.297 62.014 27.576  1.00   34.07 ? 77   ARG A NH1 1 
ATOM   634  N NH2 . ARG A 1 77  ? -30.150 63.652 26.204  1.00   33.33 ? 77   ARG A NH2 1 
ATOM   635  N N   . VAL A 1 78  ? -25.038 58.908 25.532  1.00   39.64 ? 78   VAL A N   1 
ATOM   636  C CA  . VAL A 1 78  ? -25.785 57.673 25.794  1.00   44.25 ? 78   VAL A CA  1 
ATOM   637  C C   . VAL A 1 78  ? -26.042 57.685 27.294  1.00   48.29 ? 78   VAL A C   1 
ATOM   638  O O   . VAL A 1 78  ? -25.121 57.430 28.074  1.00   50.10 ? 78   VAL A O   1 
ATOM   639  C CB  . VAL A 1 78  ? -25.083 56.347 25.418  1.00   47.00 ? 78   VAL A CB  1 
ATOM   640  C CG1 . VAL A 1 78  ? -25.955 55.146 25.760  1.00   49.65 ? 78   VAL A CG1 1 
ATOM   641  C CG2 . VAL A 1 78  ? -24.729 56.328 23.931  1.00   47.98 ? 78   VAL A CG2 1 
ATOM   642  N N   . GLY A 1 79  ? -27.258 57.959 27.689  1.00   47.50 ? 79   GLY A N   1 
ATOM   643  C CA  . GLY A 1 79  ? -27.507 58.051 29.099  1.00   49.04 ? 79   GLY A CA  1 
ATOM   644  C C   . GLY A 1 79  ? -27.198 59.500 29.502  1.00   51.54 ? 79   GLY A C   1 
ATOM   645  O O   . GLY A 1 79  ? -27.677 60.439 28.861  1.00   49.79 ? 79   GLY A O   1 
ATOM   646  N N   . GLU A 1 80  ? -26.395 59.684 30.544  1.00   45.44 ? 80   GLU A N   1 
ATOM   647  C CA  . GLU A 1 80  ? -26.063 61.011 31.014  1.00   43.01 ? 80   GLU A CA  1 
ATOM   648  C C   . GLU A 1 80  ? -24.665 61.432 30.576  1.00   41.00 ? 80   GLU A C   1 
ATOM   649  O O   . GLU A 1 80  ? -24.285 62.585 30.741  1.00   44.27 ? 80   GLU A O   1 
ATOM   650  C CB  . GLU A 1 80  ? -26.190 61.087 32.544  1.00   49.13 ? 80   GLU A CB  1 
ATOM   651  C CG  . GLU A 1 80  ? -27.608 60.869 33.057  1.00   62.67 ? 80   GLU A CG  1 
ATOM   652  C CD  . GLU A 1 80  ? -28.504 62.077 32.833  1.00   74.63 ? 80   GLU A CD  1 
ATOM   653  O OE1 . GLU A 1 80  ? -28.143 63.180 33.296  1.00   84.48 ? 80   GLU A OE1 1 
ATOM   654  O OE2 . GLU A 1 80  ? -29.572 61.926 32.194  1.00   75.98 ? 80   GLU A OE2 1 
ATOM   655  N N   . LEU A 1 81  ? -23.898 60.491 30.025  1.00   37.69 ? 81   LEU A N   1 
ATOM   656  C CA  . LEU A 1 81  ? -22.486 60.732 29.731  1.00   41.17 ? 81   LEU A CA  1 
ATOM   657  C C   . LEU A 1 81  ? -22.280 61.208 28.293  1.00   39.20 ? 81   LEU A C   1 
ATOM   658  O O   . LEU A 1 81  ? -22.841 60.637 27.349  1.00   35.33 ? 81   LEU A O   1 
ATOM   659  C CB  . LEU A 1 81  ? -21.656 59.464 29.972  1.00   44.31 ? 81   LEU A CB  1 
ATOM   660  C CG  . LEU A 1 81  ? -21.516 58.941 31.416  1.00   56.83 ? 81   LEU A CG  1 
ATOM   661  C CD1 . LEU A 1 81  ? -22.639 59.471 32.305  1.00   69.61 ? 81   LEU A CD1 1 
ATOM   662  C CD2 . LEU A 1 81  ? -21.490 57.409 31.439  1.00   59.68 ? 81   LEU A CD2 1 
ATOM   663  N N   . TRP A 1 82  ? -21.458 62.238 28.123  1.00   36.13 ? 82   TRP A N   1 
ATOM   664  C CA  . TRP A 1 82  ? -21.089 62.697 26.779  1.00   33.61 ? 82   TRP A CA  1 
ATOM   665  C C   . TRP A 1 82  ? -19.788 62.065 26.325  1.00   33.43 ? 82   TRP A C   1 
ATOM   666  O O   . TRP A 1 82  ? -18.882 61.860 27.120  1.00   36.69 ? 82   TRP A O   1 
ATOM   667  C CB  . TRP A 1 82  ? -20.981 64.227 26.734  1.00   35.71 ? 82   TRP A CB  1 
ATOM   668  C CG  . TRP A 1 82  ? -22.318 64.889 26.804  1.00   25.89 ? 82   TRP A CG  1 
ATOM   669  C CD1 . TRP A 1 82  ? -22.948 65.355 27.927  1.00   31.81 ? 82   TRP A CD1 1 
ATOM   670  C CD2 . TRP A 1 82  ? -23.217 65.117 25.715  1.00   33.76 ? 82   TRP A CD2 1 
ATOM   671  N NE1 . TRP A 1 82  ? -24.179 65.865 27.600  1.00   28.75 ? 82   TRP A NE1 1 
ATOM   672  C CE2 . TRP A 1 82  ? -24.367 65.738 26.243  1.00   34.49 ? 82   TRP A CE2 1 
ATOM   673  C CE3 . TRP A 1 82  ? -23.163 64.868 24.335  1.00   31.37 ? 82   TRP A CE3 1 
ATOM   674  C CZ2 . TRP A 1 82  ? -25.452 66.106 25.446  1.00   30.47 ? 82   TRP A CZ2 1 
ATOM   675  C CZ3 . TRP A 1 82  ? -24.246 65.243 23.544  1.00   32.61 ? 82   TRP A CZ3 1 
ATOM   676  C CH2 . TRP A 1 82  ? -25.368 65.856 24.102  1.00   33.26 ? 82   TRP A CH2 1 
ATOM   677  N N   . SER A 1 83  ? -19.693 61.786 25.033  1.00   29.82 ? 83   SER A N   1 
ATOM   678  C CA  . SER A 1 83  ? -18.452 61.298 24.422  1.00   29.01 ? 83   SER A CA  1 
ATOM   679  C C   . SER A 1 83  ? -17.397 62.393 24.369  1.00   31.99 ? 83   SER A C   1 
ATOM   680  O O   . SER A 1 83  ? -17.704 63.586 24.524  1.00   30.46 ? 83   SER A O   1 
ATOM   681  C CB  . SER A 1 83  ? -18.721 60.849 22.991  1.00   28.21 ? 83   SER A CB  1 
ATOM   682  O OG  . SER A 1 83  ? -18.890 62.005 22.151  1.00   30.40 ? 83   SER A OG  1 
ATOM   683  N N   . GLU A 1 84  ? -16.159 61.991 24.102  1.00   30.13 ? 84   GLU A N   1 
ATOM   684  C CA  . GLU A 1 84  ? -15.154 62.927 23.639  1.00   33.53 ? 84   GLU A CA  1 
ATOM   685  C C   . GLU A 1 84  ? -15.614 63.539 22.307  1.00   33.98 ? 84   GLU A C   1 
ATOM   686  O O   . GLU A 1 84  ? -16.431 62.949 21.588  1.00   33.84 ? 84   GLU A O   1 
ATOM   687  C CB  . GLU A 1 84  ? -13.811 62.215 23.459  1.00   34.98 ? 84   GLU A CB  1 
ATOM   688  C CG  . GLU A 1 84  ? -13.258 61.592 24.732  1.00   55.53 ? 84   GLU A CG  1 
ATOM   689  C CD  . GLU A 1 84  ? -13.124 62.590 25.873  1.00   71.81 ? 84   GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 84  ? -12.513 63.665 25.661  1.00   70.00 ? 84   GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 84  ? -13.625 62.295 26.987  1.00   76.41 ? 84   GLU A OE2 1 
ATOM   692  N N   . PRO A 1 85  ? -15.099 64.714 21.986  1.00   31.70 ? 85   PRO A N   1 
ATOM   693  C CA  . PRO A 1 85  ? -15.328 65.328 20.668  1.00   31.48 ? 85   PRO A CA  1 
ATOM   694  C C   . PRO A 1 85  ? -14.806 64.445 19.537  1.00   32.73 ? 85   PRO A C   1 
ATOM   695  O O   . PRO A 1 85  ? -13.831 63.705 19.716  1.00   28.60 ? 85   PRO A O   1 
ATOM   696  C CB  . PRO A 1 85  ? -14.495 66.619 20.733  1.00   31.82 ? 85   PRO A CB  1 
ATOM   697  C CG  . PRO A 1 85  ? -14.313 66.884 22.194  1.00   32.44 ? 85   PRO A CG  1 
ATOM   698  C CD  . PRO A 1 85  ? -14.245 65.545 22.856  1.00   32.91 ? 85   PRO A CD  1 
ATOM   699  N N   . SER A 1 86  ? -15.445 64.555 18.381  1.00   29.80 ? 86   SER A N   1 
ATOM   700  C CA  . SER A 1 86  ? -15.000 63.915 17.163  1.00   29.80 ? 86   SER A CA  1 
ATOM   701  C C   . SER A 1 86  ? -13.689 64.531 16.680  1.00   29.76 ? 86   SER A C   1 
ATOM   702  O O   . SER A 1 86  ? -13.173 65.475 17.285  1.00   30.55 ? 86   SER A O   1 
ATOM   703  C CB  . SER A 1 86  ? -16.058 64.100 16.090  1.00   25.61 ? 86   SER A CB  1 
ATOM   704  O OG  . SER A 1 86  ? -16.197 65.490 15.765  1.00   28.77 ? 86   SER A OG  1 
ATOM   705  N N   . ASN A 1 87  ? -13.169 64.014 15.578  1.00   28.07 ? 87   ASN A N   1 
ATOM   706  C CA  . ASN A 1 87  ? -12.174 64.743 14.805  1.00   33.27 ? 87   ASN A CA  1 
ATOM   707  C C   . ASN A 1 87  ? -12.718 66.119 14.487  1.00   32.47 ? 87   ASN A C   1 
ATOM   708  O O   . ASN A 1 87  ? -13.937 66.322 14.471  1.00   29.00 ? 87   ASN A O   1 
ATOM   709  C CB  . ASN A 1 87  ? -11.857 64.005 13.500  1.00   34.64 ? 87   ASN A CB  1 
ATOM   710  C CG  . ASN A 1 87  ? -13.094 63.743 12.666  1.00   38.36 ? 87   ASN A CG  1 
ATOM   711  O OD1 . ASN A 1 87  ? -13.169 64.137 11.492  1.00   38.21 ? 87   ASN A OD1 1 
ATOM   712  N ND2 . ASN A 1 87  ? -14.071 63.074 13.259  1.00   27.23 ? 87   ASN A ND2 1 
ATOM   713  N N   . LEU A 1 88  ? -11.816 67.062 14.230  1.00   29.09 ? 88   LEU A N   1 
ATOM   714  C CA  . LEU A 1 88  ? -12.199 68.444 13.964  1.00   33.70 ? 88   LEU A CA  1 
ATOM   715  C C   . LEU A 1 88  ? -12.262 68.671 12.465  1.00   33.16 ? 88   LEU A C   1 
ATOM   716  O O   . LEU A 1 88  ? -11.267 68.528 11.764  1.00   35.28 ? 88   LEU A O   1 
ATOM   717  C CB  . LEU A 1 88  ? -11.197 69.415 14.604  1.00   30.33 ? 88   LEU A CB  1 
ATOM   718  C CG  . LEU A 1 88  ? -10.967 69.200 16.104  1.00   35.47 ? 88   LEU A CG  1 
ATOM   719  C CD1 . LEU A 1 88  ? -9.955  70.213 16.671  1.00   36.17 ? 88   LEU A CD1 1 
ATOM   720  C CD2 . LEU A 1 88  ? -12.291 69.250 16.877  1.00   32.97 ? 88   LEU A CD2 1 
ATOM   721  N N   . LEU A 1 89  ? -13.444 68.998 11.975  1.00   27.70 ? 89   LEU A N   1 
ATOM   722  C CA  . LEU A 1 89  ? -13.664 69.091 10.549  1.00   26.72 ? 89   LEU A CA  1 
ATOM   723  C C   . LEU A 1 89  ? -13.656 70.539 10.125  1.00   25.24 ? 89   LEU A C   1 
ATOM   724  O O   . LEU A 1 89  ? -14.363 71.345 10.700  1.00   28.50 ? 89   LEU A O   1 
ATOM   725  C CB  . LEU A 1 89  ? -15.009 68.470 10.188  1.00   25.91 ? 89   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 89  ? -15.368 68.590 8.694   1.00   35.17 ? 89   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 89  ? -14.497 67.651 7.874   1.00   31.54 ? 89   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 89  ? -16.847 68.275 8.472   1.00   37.58 ? 89   LEU A CD2 1 
ATOM   729  N N   . ASP A 1 90  ? -12.864 70.867 9.104   1.00   25.43 ? 90   ASP A N   1 
ATOM   730  C CA  . ASP A 1 90  ? -12.900 72.207 8.513   1.00   29.45 ? 90   ASP A CA  1 
ATOM   731  C C   . ASP A 1 90  ? -13.812 72.252 7.293   1.00   29.58 ? 90   ASP A C   1 
ATOM   732  O O   . ASP A 1 90  ? -13.595 71.540 6.318   1.00   30.09 ? 90   ASP A O   1 
ATOM   733  C CB  . ASP A 1 90  ? -11.501 72.667 8.099   1.00   33.15 ? 90   ASP A CB  1 
ATOM   734  C CG  . ASP A 1 90  ? -10.611 72.959 9.282   1.00   38.38 ? 90   ASP A CG  1 
ATOM   735  O OD1 . ASP A 1 90  ? -10.889 73.942 10.013  1.00   31.89 ? 90   ASP A OD1 1 
ATOM   736  O OD2 . ASP A 1 90  ? -9.608  72.258 9.562   1.00   34.75 ? 90   ASP A OD2 1 
ATOM   737  N N   . LEU A 1 91  ? -14.811 73.121 7.341   1.00   25.57 ? 91   LEU A N   1 
ATOM   738  C CA  . LEU A 1 91  ? -15.558 73.480 6.141   1.00   30.81 ? 91   LEU A CA  1 
ATOM   739  C C   . LEU A 1 91  ? -14.943 74.761 5.571   1.00   27.23 ? 91   LEU A C   1 
ATOM   740  O O   . LEU A 1 91  ? -14.679 75.697 6.308   1.00   28.10 ? 91   LEU A O   1 
ATOM   741  C CB  . LEU A 1 91  ? -17.023 73.757 6.520   1.00   30.25 ? 91   LEU A CB  1 
ATOM   742  C CG  . LEU A 1 91  ? -18.159 72.897 5.965   1.00   38.83 ? 91   LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 91  ? -17.792 71.399 5.873   1.00   31.80 ? 91   LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 91  ? -19.430 73.122 6.831   1.00   27.60 ? 91   LEU A CD2 1 
ATOM   745  N N   . VAL A 1 92  ? -14.765 74.818 4.257   1.00   26.21 ? 92   VAL A N   1 
ATOM   746  C CA  . VAL A 1 92  ? -14.430 76.085 3.620   1.00   28.65 ? 92   VAL A CA  1 
ATOM   747  C C   . VAL A 1 92  ? -15.528 76.545 2.677   1.00   28.80 ? 92   VAL A C   1 
ATOM   748  O O   . VAL A 1 92  ? -16.221 75.727 2.059   1.00   30.95 ? 92   VAL A O   1 
ATOM   749  C CB  . VAL A 1 92  ? -13.067 76.024 2.883   1.00   26.42 ? 92   VAL A CB  1 
ATOM   750  C CG1 . VAL A 1 92  ? -11.991 75.405 3.803   1.00   35.70 ? 92   VAL A CG1 1 
ATOM   751  C CG2 . VAL A 1 92  ? -13.182 75.252 1.613   1.00   28.34 ? 92   VAL A CG2 1 
ATOM   752  N N   . VAL A 1 93  ? -15.632 77.856 2.513   1.00   32.20 ? 93   VAL A N   1 
ATOM   753  C CA  . VAL A 1 93  ? -16.546 78.429 1.541   1.00   30.83 ? 93   VAL A CA  1 
ATOM   754  C C   . VAL A 1 93  ? -15.693 78.782 0.322   1.00   31.62 ? 93   VAL A C   1 
ATOM   755  O O   . VAL A 1 93  ? -14.620 79.365 0.455   1.00   29.86 ? 93   VAL A O   1 
ATOM   756  C CB  . VAL A 1 93  ? -17.285 79.685 2.053   1.00   30.79 ? 93   VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 93  ? -16.296 80.806 2.313   1.00   27.63 ? 93   VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 93  ? -18.357 80.123 1.068   1.00   24.61 ? 93   VAL A CG2 1 
ATOM   759  N N   . THR A 1 94  ? -16.171 78.441 -0.862  1.00   29.20 ? 94   THR A N   1 
ATOM   760  C CA  . THR A 1 94  ? -15.483 78.808 -2.118  1.00   32.25 ? 94   THR A CA  1 
ATOM   761  C C   . THR A 1 94  ? -16.382 79.805 -2.900  1.00   35.48 ? 94   THR A C   1 
ATOM   762  O O   . THR A 1 94  ? -17.279 80.403 -2.311  1.00   33.15 ? 94   THR A O   1 
ATOM   763  C CB  . THR A 1 94  ? -15.156 77.567 -2.955  1.00   31.03 ? 94   THR A CB  1 
ATOM   764  O OG1 . THR A 1 94  ? -16.364 77.071 -3.539  1.00   30.88 ? 94   THR A OG1 1 
ATOM   765  C CG2 . THR A 1 94  ? -14.519 76.497 -2.082  1.00   31.72 ? 94   THR A CG2 1 
ATOM   766  N N   . GLU A 1 95  ? -16.132 80.001 -4.205  1.00   34.69 ? 95   GLU A N   1 
ATOM   767  C CA  . GLU A 1 95  ? -16.889 80.965 -5.068  1.00   34.10 ? 95   GLU A CA  1 
ATOM   768  C C   . GLU A 1 95  ? -16.890 82.384 -4.437  1.00   36.27 ? 95   GLU A C   1 
ATOM   769  O O   . GLU A 1 95  ? -17.901 83.080 -4.411  1.00   36.86 ? 95   GLU A O   1 
ATOM   770  C CB  . GLU A 1 95  ? -18.269 80.361 -5.377  1.00   28.36 ? 95   GLU A CB  1 
ATOM   771  C CG  . GLU A 1 95  ? -18.143 78.962 -5.954  1.00   34.55 ? 95   GLU A CG  1 
ATOM   772  C CD  . GLU A 1 95  ? -19.125 78.656 -7.058  1.00   42.08 ? 95   GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 95  ? -20.138 79.374 -7.144  1.00   40.25 ? 95   GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 95  ? -18.894 77.709 -7.834  1.00   48.24 ? 95   GLU A OE2 1 
ATOM   775  N N   . MET A 1 96  ? -15.704 82.749 -3.933  1.00   34.12 ? 96   MET A N   1 
ATOM   776  C CA  . MET A 1 96  ? -15.461 83.985 -3.193  1.00   36.31 ? 96   MET A CA  1 
ATOM   777  C C   . MET A 1 96  ? -14.693 85.055 -3.948  1.00   37.43 ? 96   MET A C   1 
ATOM   778  O O   . MET A 1 96  ? -13.455 85.022 -4.074  1.00   38.57 ? 96   MET A O   1 
ATOM   779  C CB  . MET A 1 96  ? -14.717 83.658 -1.905  1.00   32.82 ? 96   MET A CB  1 
ATOM   780  C CG  . MET A 1 96  ? -15.583 83.539 -0.675  1.00   47.98 ? 96   MET A CG  1 
ATOM   781  S SD  . MET A 1 96  ? -17.007 84.654 -0.739  1.00   47.27 ? 96   MET A SD  1 
ATOM   782  C CE  . MET A 1 96  ? -17.004 85.313 0.932   1.00   55.62 ? 96   MET A CE  1 
ATOM   783  N N   . TYR A 1 97  ? -15.466 86.003 -4.449  1.00   33.38 ? 97   TYR A N   1 
ATOM   784  C CA  . TYR A 1 97  ? -14.819 87.101 -5.072  1.00   34.68 ? 97   TYR A CA  1 
ATOM   785  C C   . TYR A 1 97  ? -14.223 86.777 -6.457  1.00   37.25 ? 97   TYR A C   1 
ATOM   786  O O   . TYR A 1 97  ? -14.949 86.298 -7.328  1.00   34.22 ? 97   TYR A O   1 
ATOM   787  C CB  . TYR A 1 97  ? -13.677 87.619 -4.195  1.00   32.76 ? 97   TYR A CB  1 
ATOM   788  C CG  . TYR A 1 97  ? -14.120 88.095 -2.830  1.00   40.71 ? 97   TYR A CG  1 
ATOM   789  C CD1 . TYR A 1 97  ? -13.450 87.691 -1.683  1.00   44.00 ? 97   TYR A CD1 1 
ATOM   790  C CD2 . TYR A 1 97  ? -15.204 88.946 -2.685  1.00   37.41 ? 97   TYR A CD2 1 
ATOM   791  C CE1 . TYR A 1 97  ? -13.848 88.122 -0.432  1.00   42.27 ? 97   TYR A CE1 1 
ATOM   792  C CE2 . TYR A 1 97  ? -15.611 89.383 -1.438  1.00   38.53 ? 97   TYR A CE2 1 
ATOM   793  C CZ  . TYR A 1 97  ? -14.929 88.968 -0.315  1.00   37.22 ? 97   TYR A CZ  1 
ATOM   794  O OH  . TYR A 1 97  ? -15.331 89.400 0.928   1.00   36.68 ? 97   TYR A OH  1 
ATOM   795  N N   . ASP A 1 98  ? -12.941 86.992 -6.633  1.00   39.19 ? 98   ASP A N   1 
ATOM   796  C CA  . ASP A 1 98  ? -12.296 86.785 -7.909  1.00   43.15 ? 98   ASP A CA  1 
ATOM   797  C C   . ASP A 1 98  ? -11.928 85.347 -8.235  1.00   43.32 ? 98   ASP A C   1 
ATOM   798  O O   . ASP A 1 98  ? -11.955 84.449 -7.409  1.00   37.61 ? 98   ASP A O   1 
ATOM   799  C CB  . ASP A 1 98  ? -11.044 87.647 -7.987  1.00   44.92 ? 98   ASP A CB  1 
ATOM   800  C CG  . ASP A 1 98  ? -11.375 89.113 -7.708  1.00   50.92 ? 98   ASP A CG  1 
ATOM   801  O OD1 . ASP A 1 98  ? -12.315 89.638 -8.332  1.00   59.75 ? 98   ASP A OD1 1 
ATOM   802  O OD2 . ASP A 1 98  ? -10.683 89.718 -6.877  1.00   59.33 ? 98   ASP A OD2 1 
ATOM   803  N N   . THR A 1 99  ? -11.574 85.187 -9.519  1.00   41.49 ? 99   THR A N   1 
ATOM   804  C CA  . THR A 1 99  ? -11.174 83.945 -10.129 1.00   38.36 ? 99   THR A CA  1 
ATOM   805  C C   . THR A 1 99  ? -9.646  83.966 -10.393 1.00   40.51 ? 99   THR A C   1 
ATOM   806  O O   . THR A 1 99  ? -9.101  84.987 -10.832 1.00   37.76 ? 99   THR A O   1 
ATOM   807  C CB  . THR A 1 99  ? -11.983 83.723 -11.420 1.00   39.14 ? 99   THR A CB  1 
ATOM   808  O OG1 . THR A 1 99  ? -13.365 83.966 -11.147 1.00   39.51 ? 99   THR A OG1 1 
ATOM   809  C CG2 . THR A 1 99  ? -11.777 82.308 -11.927 1.00   42.22 ? 99   THR A CG2 1 
ATOM   810  N N   . PRO A 1 100 ? -8.965  82.838 -10.122 1.00   38.63 ? 100  PRO A N   1 
ATOM   811  C CA  . PRO A 1 100 ? -7.523  82.731 -10.356 1.00   36.78 ? 100  PRO A CA  1 
ATOM   812  C C   . PRO A 1 100 ? -7.255  82.112 -11.721 1.00   32.06 ? 100  PRO A C   1 
ATOM   813  O O   . PRO A 1 100 ? -8.155  81.526 -12.314 1.00   36.81 ? 100  PRO A O   1 
ATOM   814  C CB  . PRO A 1 100 ? -7.065  81.785 -9.243  1.00   35.83 ? 100  PRO A CB  1 
ATOM   815  C CG  . PRO A 1 100 ? -8.258  80.883 -9.006  1.00   33.74 ? 100  PRO A CG  1 
ATOM   816  C CD  . PRO A 1 100 ? -9.498  81.714 -9.328  1.00   34.27 ? 100  PRO A CD  1 
ATOM   817  N N   . THR A 1 101 ? -6.030  82.227 -12.214 1.00   38.09 ? 101  THR A N   1 
ATOM   818  C CA  . THR A 1 101 ? -5.655  81.510 -13.430 1.00   38.08 ? 101  THR A CA  1 
ATOM   819  C C   . THR A 1 101 ? -4.810  80.296 -13.118 1.00   34.96 ? 101  THR A C   1 
ATOM   820  O O   . THR A 1 101 ? -4.024  80.304 -12.180 1.00   33.86 ? 101  THR A O   1 
ATOM   821  C CB  . THR A 1 101 ? -4.938  82.442 -14.430 1.00   37.06 ? 101  THR A CB  1 
ATOM   822  O OG1 . THR A 1 101 ? -3.899  83.160 -13.760 1.00   48.14 ? 101  THR A OG1 1 
ATOM   823  C CG2 . THR A 1 101 ? -5.875  83.540 -14.885 1.00   41.11 ? 101  THR A CG2 1 
ATOM   824  N N   . LEU A 1 102 ? -4.995  79.237 -13.891 1.00   32.66 ? 102  LEU A N   1 
ATOM   825  C CA  . LEU A 1 102 ? -4.182  78.047 -13.733 1.00   31.64 ? 102  LEU A CA  1 
ATOM   826  C C   . LEU A 1 102 ? -3.442  77.759 -15.035 1.00   36.12 ? 102  LEU A C   1 
ATOM   827  O O   . LEU A 1 102 ? -4.035  77.809 -16.122 1.00   35.27 ? 102  LEU A O   1 
ATOM   828  C CB  . LEU A 1 102 ? -5.056  76.849 -13.348 1.00   33.27 ? 102  LEU A CB  1 
ATOM   829  C CG  . LEU A 1 102 ? -4.355  75.483 -13.228 1.00   34.33 ? 102  LEU A CG  1 
ATOM   830  C CD1 . LEU A 1 102 ? -3.421  75.459 -12.031 1.00   30.48 ? 102  LEU A CD1 1 
ATOM   831  C CD2 . LEU A 1 102 ? -5.384  74.362 -13.130 1.00   30.76 ? 102  LEU A CD2 1 
ATOM   832  N N   . SER A 1 103 ? -2.148  77.468 -14.924 1.00   34.72 ? 103  SER A N   1 
ATOM   833  C CA  . SER A 1 103 ? -1.335  77.096 -16.083 1.00   33.37 ? 103  SER A CA  1 
ATOM   834  C C   . SER A 1 103 ? -0.524  75.848 -15.748 1.00   28.06 ? 103  SER A C   1 
ATOM   835  O O   . SER A 1 103 ? -0.351  75.504 -14.581 1.00   29.31 ? 103  SER A O   1 
ATOM   836  C CB  . SER A 1 103 ? -0.398  78.246 -16.461 1.00   34.49 ? 103  SER A CB  1 
ATOM   837  O OG  . SER A 1 103 ? 0.681   78.314 -15.556 1.00   39.64 ? 103  SER A OG  1 
ATOM   838  N N   . VAL A 1 104 ? -0.048  75.150 -16.762 1.00   26.19 ? 104  VAL A N   1 
ATOM   839  C CA  . VAL A 1 104 ? 0.694   73.908 -16.520 1.00   27.87 ? 104  VAL A CA  1 
ATOM   840  C C   . VAL A 1 104 ? 1.968   73.857 -17.362 1.00   30.18 ? 104  VAL A C   1 
ATOM   841  O O   . VAL A 1 104 ? 1.962   74.237 -18.522 1.00   28.73 ? 104  VAL A O   1 
ATOM   842  C CB  . VAL A 1 104 ? -0.157  72.673 -16.841 1.00   24.99 ? 104  VAL A CB  1 
ATOM   843  C CG1 . VAL A 1 104 ? -0.510  72.635 -18.303 1.00   28.83 ? 104  VAL A CG1 1 
ATOM   844  C CG2 . VAL A 1 104 ? 0.588   71.389 -16.426 1.00   27.84 ? 104  VAL A CG2 1 
ATOM   845  N N   . HIS A 1 105 ? 3.051   73.400 -16.756 1.00   30.34 ? 105  HIS A N   1 
ATOM   846  C CA  . HIS A 1 105 ? 4.312   73.194 -17.471 1.00   31.07 ? 105  HIS A CA  1 
ATOM   847  C C   . HIS A 1 105 ? 4.613   71.708 -17.422 1.00   28.23 ? 105  HIS A C   1 
ATOM   848  O O   . HIS A 1 105 ? 4.392   71.061 -16.386 1.00   32.45 ? 105  HIS A O   1 
ATOM   849  C CB  . HIS A 1 105 ? 5.437   73.984 -16.771 1.00   30.66 ? 105  HIS A CB  1 
ATOM   850  C CG  . HIS A 1 105 ? 6.798   73.727 -17.331 1.00   34.13 ? 105  HIS A CG  1 
ATOM   851  N ND1 . HIS A 1 105 ? 7.590   72.676 -16.910 1.00   31.84 ? 105  HIS A ND1 1 
ATOM   852  C CD2 . HIS A 1 105 ? 7.505   74.375 -18.288 1.00   33.22 ? 105  HIS A CD2 1 
ATOM   853  C CE1 . HIS A 1 105 ? 8.727   72.692 -17.584 1.00   30.71 ? 105  HIS A CE1 1 
ATOM   854  N NE2 . HIS A 1 105 ? 8.705   73.717 -18.419 1.00   29.65 ? 105  HIS A NE2 1 
ATOM   855  N N   . PRO A 1 106 ? 5.112   71.148 -18.522 1.00   27.66 ? 106  PRO A N   1 
ATOM   856  C CA  . PRO A 1 106 ? 5.425   71.907 -19.749 1.00   28.76 ? 106  PRO A CA  1 
ATOM   857  C C   . PRO A 1 106 ? 4.206   72.115 -20.655 1.00   33.39 ? 106  PRO A C   1 
ATOM   858  O O   . PRO A 1 106 ? 4.268   72.890 -21.620 1.00   32.13 ? 106  PRO A O   1 
ATOM   859  C CB  . PRO A 1 106 ? 6.438   71.010 -20.460 1.00   25.97 ? 106  PRO A CB  1 
ATOM   860  C CG  . PRO A 1 106 ? 6.060   69.575 -20.014 1.00   34.11 ? 106  PRO A CG  1 
ATOM   861  C CD  . PRO A 1 106 ? 5.430   69.715 -18.637 1.00   30.53 ? 106  PRO A CD  1 
ATOM   862  N N   . GLY A 1 107 ? 3.114   71.419 -20.353 1.00   30.15 ? 107  GLY A N   1 
ATOM   863  C CA  . GLY A 1 107 ? 1.923   71.461 -21.182 1.00   27.65 ? 107  GLY A CA  1 
ATOM   864  C C   . GLY A 1 107 ? 0.924   70.424 -20.665 1.00   33.09 ? 107  GLY A C   1 
ATOM   865  O O   . GLY A 1 107 ? 1.256   69.631 -19.799 1.00   31.44 ? 107  GLY A O   1 
ATOM   866  N N   . PRO A 1 108 ? -0.299  70.455 -21.166 1.00   33.68 ? 108  PRO A N   1 
ATOM   867  C CA  . PRO A 1 108 ? -1.356  69.580 -20.641 1.00   32.30 ? 108  PRO A CA  1 
ATOM   868  C C   . PRO A 1 108 ? -1.348  68.163 -21.243 1.00   33.70 ? 108  PRO A C   1 
ATOM   869  O O   . PRO A 1 108 ? -2.127  67.307 -20.793 1.00   34.62 ? 108  PRO A O   1 
ATOM   870  C CB  . PRO A 1 108 ? -2.640  70.336 -21.000 1.00   31.08 ? 108  PRO A CB  1 
ATOM   871  C CG  . PRO A 1 108 ? -2.286  71.073 -22.290 1.00   41.19 ? 108  PRO A CG  1 
ATOM   872  C CD  . PRO A 1 108 ? -0.795  71.383 -22.212 1.00   31.90 ? 108  PRO A CD  1 
ATOM   873  N N   . GLU A 1 109 ? -0.458  67.899 -22.201 1.00   31.44 ? 109  GLU A N   1 
ATOM   874  C CA  . GLU A 1 109 ? -0.252  66.526 -22.668 1.00   34.25 ? 109  GLU A CA  1 
ATOM   875  C C   . GLU A 1 109 ? 1.189   66.070 -22.514 1.00   33.48 ? 109  GLU A C   1 
ATOM   876  O O   . GLU A 1 109 ? 2.115   66.693 -23.037 1.00   33.95 ? 109  GLU A O   1 
ATOM   877  C CB  . GLU A 1 109 ? -0.762  66.334 -24.112 1.00   35.60 ? 109  GLU A CB  1 
ATOM   878  C CG  . GLU A 1 109 ? -2.089  67.034 -24.369 1.00   38.91 ? 109  GLU A CG  1 
ATOM   879  C CD  . GLU A 1 109 ? -2.807  66.555 -25.631 1.00   36.60 ? 109  GLU A CD  1 
ATOM   880  O OE1 . GLU A 1 109 ? -2.464  65.484 -26.161 1.00   30.94 ? 109  GLU A OE1 1 
ATOM   881  O OE2 . GLU A 1 109 ? -3.725  67.261 -26.081 1.00   37.44 ? 109  GLU A OE2 1 
ATOM   882  N N   . VAL A 1 110 ? 1.377   64.993 -21.756 1.00   28.00 ? 110  VAL A N   1 
ATOM   883  C CA  . VAL A 1 110 ? 2.707   64.526 -21.420 1.00   29.83 ? 110  VAL A CA  1 
ATOM   884  C C   . VAL A 1 110 ? 2.773   63.016 -21.527 1.00   32.56 ? 110  VAL A C   1 
ATOM   885  O O   . VAL A 1 110 ? 1.736   62.345 -21.553 1.00   35.50 ? 110  VAL A O   1 
ATOM   886  C CB  . VAL A 1 110 ? 3.143   64.998 -20.008 1.00   31.21 ? 110  VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 110 ? 3.231   66.526 -19.969 1.00   35.98 ? 110  VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 110 ? 2.182   64.484 -18.945 1.00   34.30 ? 110  VAL A CG2 1 
ATOM   889  N N   . ILE A 1 111 ? 3.983   62.476 -21.619 1.00   30.99 ? 111  ILE A N   1 
ATOM   890  C CA  . ILE A 1 111 ? 4.150   61.039 -21.477 1.00   35.63 ? 111  ILE A CA  1 
ATOM   891  C C   . ILE A 1 111 ? 4.569   60.725 -20.062 1.00   36.89 ? 111  ILE A C   1 
ATOM   892  O O   . ILE A 1 111 ? 5.080   61.589 -19.356 1.00   37.88 ? 111  ILE A O   1 
ATOM   893  C CB  . ILE A 1 111 ? 5.158   60.468 -22.519 1.00   32.65 ? 111  ILE A CB  1 
ATOM   894  C CG1 . ILE A 1 111 ? 6.554   61.054 -22.327 1.00   39.90 ? 111  ILE A CG1 1 
ATOM   895  C CG2 . ILE A 1 111 ? 4.667   60.727 -23.942 1.00   35.96 ? 111  ILE A CG2 1 
ATOM   896  C CD1 . ILE A 1 111 ? 7.639   60.379 -23.221 1.00   38.62 ? 111  ILE A CD1 1 
ATOM   897  N N   . SER A 1 112 ? 4.308   59.506 -19.615 1.00   36.81 ? 112  SER A N   1 
ATOM   898  C CA  . SER A 1 112 ? 4.797   59.097 -18.311 1.00   39.25 ? 112  SER A CA  1 
ATOM   899  C C   . SER A 1 112 ? 6.291   59.387 -18.204 1.00   39.93 ? 112  SER A C   1 
ATOM   900  O O   . SER A 1 112 ? 7.041   59.151 -19.145 1.00   42.94 ? 112  SER A O   1 
ATOM   901  C CB  . SER A 1 112 ? 4.518   57.612 -18.078 1.00   39.96 ? 112  SER A CB  1 
ATOM   902  O OG  . SER A 1 112 ? 3.140   57.338 -18.282 1.00   46.48 ? 112  SER A OG  1 
ATOM   903  N N   . GLY A 1 113 ? 6.711   59.915 -17.059 1.00   37.65 ? 113  GLY A N   1 
ATOM   904  C CA  . GLY A 1 113 ? 8.106   60.267 -16.851 1.00   38.07 ? 113  GLY A CA  1 
ATOM   905  C C   . GLY A 1 113 ? 8.390   61.763 -16.899 1.00   35.93 ? 113  GLY A C   1 
ATOM   906  O O   . GLY A 1 113 ? 9.376   62.236 -16.335 1.00   34.40 ? 113  GLY A O   1 
ATOM   907  N N   . GLU A 1 114 ? 7.546   62.513 -17.593 1.00   35.18 ? 114  GLU A N   1 
ATOM   908  C CA  . GLU A 1 114 ? 7.772   63.955 -17.711 1.00   34.24 ? 114  GLU A CA  1 
ATOM   909  C C   . GLU A 1 114 ? 7.400   64.658 -16.419 1.00   33.50 ? 114  GLU A C   1 
ATOM   910  O O   . GLU A 1 114 ? 6.398   64.323 -15.789 1.00   37.66 ? 114  GLU A O   1 
ATOM   911  C CB  . GLU A 1 114 ? 6.955   64.537 -18.874 1.00   34.20 ? 114  GLU A CB  1 
ATOM   912  C CG  . GLU A 1 114 ? 7.504   64.184 -20.240 1.00   32.84 ? 114  GLU A CG  1 
ATOM   913  C CD  . GLU A 1 114 ? 6.832   64.963 -21.353 1.00   36.53 ? 114  GLU A CD  1 
ATOM   914  O OE1 . GLU A 1 114 ? 7.351   66.033 -21.707 1.00   37.51 ? 114  GLU A OE1 1 
ATOM   915  O OE2 . GLU A 1 114 ? 5.774   64.505 -21.872 1.00   34.74 ? 114  GLU A OE2 1 
ATOM   916  N N   . LYS A 1 115 ? 8.188   65.658 -16.043 1.00   33.33 ? 115  LYS A N   1 
ATOM   917  C CA  . LYS A 1 115 ? 7.908   66.432 -14.848 1.00   37.17 ? 115  LYS A CA  1 
ATOM   918  C C   . LYS A 1 115 ? 6.843   67.469 -15.133 1.00   33.61 ? 115  LYS A C   1 
ATOM   919  O O   . LYS A 1 115 ? 6.955   68.230 -16.084 1.00   32.58 ? 115  LYS A O   1 
ATOM   920  C CB  . LYS A 1 115 ? 9.178   67.112 -14.346 1.00   37.09 ? 115  LYS A CB  1 
ATOM   921  C CG  . LYS A 1 115 ? 10.287  66.125 -14.000 1.00   51.78 ? 115  LYS A CG  1 
ATOM   922  C CD  . LYS A 1 115 ? 11.277  66.725 -13.038 1.00   53.23 ? 115  LYS A CD  1 
ATOM   923  C CE  . LYS A 1 115 ? 12.513  67.221 -13.755 1.00   62.78 ? 115  LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 115 ? 13.765  66.845 -13.015 1.00   73.83 ? 115  LYS A NZ  1 
ATOM   925  N N   . VAL A 1 116 ? 5.803   67.488 -14.312 1.00   30.71 ? 116  VAL A N   1 
ATOM   926  C CA  . VAL A 1 116 ? 4.690   68.392 -14.540 1.00   29.13 ? 116  VAL A CA  1 
ATOM   927  C C   . VAL A 1 116 ? 4.582   69.323 -13.356 1.00   29.89 ? 116  VAL A C   1 
ATOM   928  O O   . VAL A 1 116 ? 4.674   68.888 -12.201 1.00   30.53 ? 116  VAL A O   1 
ATOM   929  C CB  . VAL A 1 116 ? 3.358   67.624 -14.725 1.00   35.22 ? 116  VAL A CB  1 
ATOM   930  C CG1 . VAL A 1 116 ? 2.168   68.589 -14.714 1.00   31.93 ? 116  VAL A CG1 1 
ATOM   931  C CG2 . VAL A 1 116 ? 3.376   66.778 -16.022 1.00   30.10 ? 116  VAL A CG2 1 
ATOM   932  N N   . THR A 1 117 ? 4.404   70.614 -13.632 1.00   30.97 ? 117  THR A N   1 
ATOM   933  C CA  . THR A 1 117 ? 4.186   71.582 -12.576 1.00   29.15 ? 117  THR A CA  1 
ATOM   934  C C   . THR A 1 117 ? 2.977   72.446 -12.898 1.00   30.68 ? 117  THR A C   1 
ATOM   935  O O   . THR A 1 117 ? 2.859   72.943 -13.994 1.00   29.42 ? 117  THR A O   1 
ATOM   936  C CB  . THR A 1 117 ? 5.433   72.461 -12.402 1.00   32.07 ? 117  THR A CB  1 
ATOM   937  O OG1 . THR A 1 117 ? 6.573   71.623 -12.146 1.00   31.23 ? 117  THR A OG1 1 
ATOM   938  C CG2 . THR A 1 117 ? 5.322   73.301 -11.158 1.00   29.22 ? 117  THR A CG2 1 
ATOM   939  N N   . PHE A 1 118 ? 2.085   72.628 -11.925 1.00   29.83 ? 118  PHE A N   1 
ATOM   940  C CA  . PHE A 1 118 ? 0.985   73.596 -12.076 1.00   30.29 ? 118  PHE A CA  1 
ATOM   941  C C   . PHE A 1 118 ? 1.322   74.918 -11.375 1.00   31.69 ? 118  PHE A C   1 
ATOM   942  O O   . PHE A 1 118 ? 2.089   74.940 -10.396 1.00   30.27 ? 118  PHE A O   1 
ATOM   943  C CB  . PHE A 1 118 ? -0.326  73.026 -11.527 1.00   30.51 ? 118  PHE A CB  1 
ATOM   944  C CG  . PHE A 1 118 ? -0.985  72.022 -12.440 1.00   28.53 ? 118  PHE A CG  1 
ATOM   945  C CD1 . PHE A 1 118 ? -1.792  72.440 -13.488 1.00   26.73 ? 118  PHE A CD1 1 
ATOM   946  C CD2 . PHE A 1 118 ? -0.815  70.660 -12.233 1.00   32.55 ? 118  PHE A CD2 1 
ATOM   947  C CE1 . PHE A 1 118 ? -2.416  71.513 -14.325 1.00   28.03 ? 118  PHE A CE1 1 
ATOM   948  C CE2 . PHE A 1 118 ? -1.428  69.736 -13.060 1.00   34.85 ? 118  PHE A CE2 1 
ATOM   949  C CZ  . PHE A 1 118 ? -2.229  70.165 -14.111 1.00   36.94 ? 118  PHE A CZ  1 
ATOM   950  N N   . TYR A 1 119 ? 0.772   76.014 -11.902 1.00   27.91 ? 119  TYR A N   1 
ATOM   951  C CA  . TYR A 1 119 ? 0.941   77.338 -11.319 1.00   29.57 ? 119  TYR A CA  1 
ATOM   952  C C   . TYR A 1 119 ? -0.422  78.017 -11.197 1.00   31.24 ? 119  TYR A C   1 
ATOM   953  O O   . TYR A 1 119 ? -1.196  78.075 -12.155 1.00   33.23 ? 119  TYR A O   1 
ATOM   954  C CB  . TYR A 1 119 ? 1.870   78.209 -12.179 1.00   31.19 ? 119  TYR A CB  1 
ATOM   955  C CG  . TYR A 1 119 ? 3.214   77.580 -12.494 1.00   29.75 ? 119  TYR A CG  1 
ATOM   956  C CD1 . TYR A 1 119 ? 4.324   77.791 -11.673 1.00   36.45 ? 119  TYR A CD1 1 
ATOM   957  C CD2 . TYR A 1 119 ? 3.373   76.777 -13.615 1.00   42.66 ? 119  TYR A CD2 1 
ATOM   958  C CE1 . TYR A 1 119 ? 5.567   77.199 -11.970 1.00   37.69 ? 119  TYR A CE1 1 
ATOM   959  C CE2 . TYR A 1 119 ? 4.590   76.186 -13.909 1.00   33.41 ? 119  TYR A CE2 1 
ATOM   960  C CZ  . TYR A 1 119 ? 5.682   76.406 -13.093 1.00   40.68 ? 119  TYR A CZ  1 
ATOM   961  O OH  . TYR A 1 119 ? 6.885   75.810 -13.416 1.00   53.54 ? 119  TYR A OH  1 
ATOM   962  N N   . CYS A 1 120 ? -0.716  78.504 -10.006 1.00   32.55 ? 120  CYS A N   1 
ATOM   963  C CA  . CYS A 1 120 ? -1.969  79.204 -9.744  1.00   34.09 ? 120  CYS A CA  1 
ATOM   964  C C   . CYS A 1 120 ? -1.653  80.655 -9.453  1.00   31.12 ? 120  CYS A C   1 
ATOM   965  O O   . CYS A 1 120 ? -0.766  80.945 -8.669  1.00   34.94 ? 120  CYS A O   1 
ATOM   966  C CB  . CYS A 1 120 ? -2.654  78.595 -8.510  1.00   34.12 ? 120  CYS A CB  1 
ATOM   967  S SG  . CYS A 1 120 ? -4.385  79.065 -8.355  1.00   36.14 ? 120  CYS A SG  1 
ATOM   968  N N   . ARG A 1 121 ? -2.402  81.563 -10.062 1.00   34.73 ? 121  ARG A N   1 
ATOM   969  C CA  . ARG A 1 121 ? -2.120  82.985 -9.938  1.00   37.44 ? 121  ARG A CA  1 
ATOM   970  C C   . ARG A 1 121 ? -3.384  83.751 -9.554  1.00   32.56 ? 121  ARG A C   1 
ATOM   971  O O   . ARG A 1 121 ? -4.429  83.574 -10.159 1.00   35.63 ? 121  ARG A O   1 
ATOM   972  C CB  . ARG A 1 121 ? -1.568  83.527 -11.271 1.00   39.17 ? 121  ARG A CB  1 
ATOM   973  C CG  . ARG A 1 121 ? -0.761  84.793 -11.137 1.00   53.90 ? 121  ARG A CG  1 
ATOM   974  C CD  . ARG A 1 121 ? -0.498  85.505 -12.464 1.00   58.53 ? 121  ARG A CD  1 
ATOM   975  N NE  . ARG A 1 121 ? 0.112   86.816 -12.258 1.00   65.55 ? 121  ARG A NE  1 
ATOM   976  C CZ  . ARG A 1 121 ? 1.328   87.003 -11.758 1.00   80.99 ? 121  ARG A CZ  1 
ATOM   977  N NH1 . ARG A 1 121 ? 2.071   85.956 -11.401 1.00   73.06 ? 121  ARG A NH1 1 
ATOM   978  N NH2 . ARG A 1 121 ? 1.803   88.237 -11.612 1.00   78.16 ? 121  ARG A NH2 1 
ATOM   979  N N   . LEU A 1 122 ? -3.278  84.613 -8.555  1.00   33.29 ? 122  LEU A N   1 
ATOM   980  C CA  . LEU A 1 122 ? -4.402  85.476 -8.199  1.00   39.98 ? 122  LEU A CA  1 
ATOM   981  C C   . LEU A 1 122 ? -3.912  86.727 -7.503  1.00   42.01 ? 122  LEU A C   1 
ATOM   982  O O   . LEU A 1 122 ? -3.056  86.659 -6.611  1.00   43.98 ? 122  LEU A O   1 
ATOM   983  C CB  . LEU A 1 122 ? -5.394  84.726 -7.307  1.00   40.21 ? 122  LEU A CB  1 
ATOM   984  C CG  . LEU A 1 122 ? -6.652  85.498 -6.911  1.00   36.83 ? 122  LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 122 ? -7.559  85.679 -8.144  1.00   39.77 ? 122  LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 122 ? -7.389  84.766 -5.788  1.00   37.85 ? 122  LEU A CD2 1 
ATOM   987  N N   . ASP A 1 123 ? -4.452  87.873 -7.904  1.00   43.98 ? 123  ASP A N   1 
ATOM   988  C CA  . ASP A 1 123 ? -3.764  89.143 -7.694  1.00   50.92 ? 123  ASP A CA  1 
ATOM   989  C C   . ASP A 1 123 ? -3.960  89.782 -6.322  1.00   54.18 ? 123  ASP A C   1 
ATOM   990  O O   . ASP A 1 123 ? -3.006  90.302 -5.728  1.00   61.74 ? 123  ASP A O   1 
ATOM   991  C CB  . ASP A 1 123 ? -4.116  90.140 -8.791  1.00   54.44 ? 123  ASP A CB  1 
ATOM   992  C CG  . ASP A 1 123 ? -2.954  90.431 -9.683  1.00   60.58 ? 123  ASP A CG  1 
ATOM   993  O OD1 . ASP A 1 123 ? -3.083  90.226 -10.906 1.00   72.70 ? 123  ASP A OD1 1 
ATOM   994  O OD2 . ASP A 1 123 ? -1.857  90.854 -9.246  1.00   70.18 ? 123  ASP A OD2 1 
ATOM   995  N N   . THR A 1 124 ? -5.185  89.787 -5.828  1.00   50.59 ? 124  THR A N   1 
ATOM   996  C CA  . THR A 1 124 ? -5.466  90.530 -4.600  1.00   51.36 ? 124  THR A CA  1 
ATOM   997  C C   . THR A 1 124 ? -5.927  89.606 -3.475  1.00   46.13 ? 124  THR A C   1 
ATOM   998  O O   . THR A 1 124 ? -7.013  89.768 -2.936  1.00   41.96 ? 124  THR A O   1 
ATOM   999  C CB  . THR A 1 124 ? -6.509  91.640 -4.860  1.00   54.25 ? 124  THR A CB  1 
ATOM   1000 O OG1 . THR A 1 124 ? -6.173  92.340 -6.070  1.00   58.11 ? 124  THR A OG1 1 
ATOM   1001 C CG2 . THR A 1 124 ? -6.414  92.726 -3.783  1.00   56.93 ? 124  THR A CG2 1 
ATOM   1002 N N   . ALA A 1 125 ? -5.086  88.635 -3.135  1.00   44.39 ? 125  ALA A N   1 
ATOM   1003 C CA  . ALA A 1 125 ? -5.463  87.586 -2.186  1.00   44.32 ? 125  ALA A CA  1 
ATOM   1004 C C   . ALA A 1 125 ? -4.292  87.300 -1.270  1.00   42.34 ? 125  ALA A C   1 
ATOM   1005 O O   . ALA A 1 125 ? -3.325  88.069 -1.229  1.00   44.23 ? 125  ALA A O   1 
ATOM   1006 C CB  . ALA A 1 125 ? -5.891  86.306 -2.941  1.00   41.00 ? 125  ALA A CB  1 
ATOM   1007 N N   . THR A 1 126 ? -4.364  86.202 -0.525  1.00   37.51 ? 126  THR A N   1 
ATOM   1008 C CA  . THR A 1 126 ? -3.246  85.816 0.339   1.00   35.24 ? 126  THR A CA  1 
ATOM   1009 C C   . THR A 1 126 ? -2.221  85.026 -0.434  1.00   35.10 ? 126  THR A C   1 
ATOM   1010 O O   . THR A 1 126 ? -2.342  84.841 -1.647  1.00   36.08 ? 126  THR A O   1 
ATOM   1011 C CB  . THR A 1 126 ? -3.724  84.981 1.555   1.00   37.64 ? 126  THR A CB  1 
ATOM   1012 O OG1 . THR A 1 126 ? -4.240  83.719 1.102   1.00   36.75 ? 126  THR A OG1 1 
ATOM   1013 C CG2 . THR A 1 126 ? -4.916  85.644 2.229   1.00   35.33 ? 126  THR A CG2 1 
ATOM   1014 N N   . SER A 1 127 ? -1.228  84.524 0.281   1.00   36.40 ? 127  SER A N   1 
ATOM   1015 C CA  . SER A 1 127 ? -0.166  83.729 -0.329  1.00   40.62 ? 127  SER A CA  1 
ATOM   1016 C C   . SER A 1 127 ? -0.545  82.250 -0.467  1.00   38.00 ? 127  SER A C   1 
ATOM   1017 O O   . SER A 1 127 ? 0.236   81.447 -0.979  1.00   37.27 ? 127  SER A O   1 
ATOM   1018 C CB  . SER A 1 127 ? 1.093   83.842 0.512   1.00   44.27 ? 127  SER A CB  1 
ATOM   1019 O OG  . SER A 1 127 ? 0.871   83.290 1.805   1.00   53.72 ? 127  SER A OG  1 
ATOM   1020 N N   . MET A 1 128 ? -1.732  81.885 0.007   1.00   37.70 ? 128  MET A N   1 
ATOM   1021 C CA  . MET A 1 128 ? -2.116  80.470 0.043   1.00   36.89 ? 128  MET A CA  1 
ATOM   1022 C C   . MET A 1 128 ? -2.993  80.080 -1.142  1.00   31.60 ? 128  MET A C   1 
ATOM   1023 O O   . MET A 1 128 ? -4.065  80.664 -1.359  1.00   34.79 ? 128  MET A O   1 
ATOM   1024 C CB  . MET A 1 128 ? -2.838  80.137 1.355   1.00   34.07 ? 128  MET A CB  1 
ATOM   1025 C CG  . MET A 1 128 ? -3.134  78.667 1.523   1.00   36.91 ? 128  MET A CG  1 
ATOM   1026 S SD  . MET A 1 128 ? -4.006  78.301 3.048   1.00   46.74 ? 128  MET A SD  1 
ATOM   1027 C CE  . MET A 1 128 ? -5.693  78.129 2.449   1.00   39.00 ? 128  MET A CE  1 
ATOM   1028 N N   . PHE A 1 129 ? -2.558  79.061 -1.882  1.00   29.90 ? 129  PHE A N   1 
ATOM   1029 C CA  . PHE A 1 129 ? -3.311  78.578 -3.018  1.00   29.45 ? 129  PHE A CA  1 
ATOM   1030 C C   . PHE A 1 129 ? -3.603  77.118 -2.851  1.00   29.02 ? 129  PHE A C   1 
ATOM   1031 O O   . PHE A 1 129 ? -2.924  76.432 -2.097  1.00   29.45 ? 129  PHE A O   1 
ATOM   1032 C CB  . PHE A 1 129 ? -2.543  78.817 -4.315  1.00   30.83 ? 129  PHE A CB  1 
ATOM   1033 C CG  . PHE A 1 129 ? -2.369  80.263 -4.649  1.00   28.98 ? 129  PHE A CG  1 
ATOM   1034 C CD1 . PHE A 1 129 ? -1.411  81.029 -3.998  1.00   38.47 ? 129  PHE A CD1 1 
ATOM   1035 C CD2 . PHE A 1 129 ? -3.168  80.866 -5.605  1.00   35.90 ? 129  PHE A CD2 1 
ATOM   1036 C CE1 . PHE A 1 129 ? -1.253  82.380 -4.297  1.00   34.65 ? 129  PHE A CE1 1 
ATOM   1037 C CE2 . PHE A 1 129 ? -3.006  82.211 -5.923  1.00   36.73 ? 129  PHE A CE2 1 
ATOM   1038 C CZ  . PHE A 1 129 ? -2.043  82.970 -5.255  1.00   29.08 ? 129  PHE A CZ  1 
ATOM   1039 N N   . LEU A 1 130 ? -4.635  76.648 -3.537  1.00   28.47 ? 130  LEU A N   1 
ATOM   1040 C CA  . LEU A 1 130 ? -5.012  75.254 -3.480  1.00   28.41 ? 130  LEU A CA  1 
ATOM   1041 C C   . LEU A 1 130 ? -5.108  74.648 -4.854  1.00   29.21 ? 130  LEU A C   1 
ATOM   1042 O O   . LEU A 1 130 ? -5.642  75.261 -5.782  1.00   30.80 ? 130  LEU A O   1 
ATOM   1043 C CB  . LEU A 1 130 ? -6.315  75.101 -2.699  1.00   30.96 ? 130  LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 130 ? -6.034  75.843 -1.390  1.00   42.87 ? 130  LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 130 ? -6.937  77.013 -1.050  1.00   30.94 ? 130  LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 130 ? -5.671  74.979 -0.208  1.00   29.28 ? 130  LEU A CD2 1 
ATOM   1047 N N   . LEU A 1 131 ? -4.554  73.452 -5.002  1.00   31.32 ? 131  LEU A N   1 
ATOM   1048 C CA  . LEU A 1 131 ? -4.708  72.722 -6.239  1.00   30.63 ? 131  LEU A CA  1 
ATOM   1049 C C   . LEU A 1 131 ? -5.627  71.545 -6.012  1.00   27.86 ? 131  LEU A C   1 
ATOM   1050 O O   . LEU A 1 131 ? -5.335  70.682 -5.192  1.00   27.79 ? 131  LEU A O   1 
ATOM   1051 C CB  . LEU A 1 131 ? -3.362  72.224 -6.754  1.00   28.23 ? 131  LEU A CB  1 
ATOM   1052 C CG  . LEU A 1 131 ? -3.428  71.578 -8.142  1.00   33.17 ? 131  LEU A CG  1 
ATOM   1053 C CD1 . LEU A 1 131 ? -3.853  72.608 -9.180  1.00   27.00 ? 131  LEU A CD1 1 
ATOM   1054 C CD2 . LEU A 1 131 ? -2.083  70.903 -8.540  1.00   31.27 ? 131  LEU A CD2 1 
ATOM   1055 N N   . LEU A 1 132 ? -6.727  71.509 -6.759  1.00   30.26 ? 132  LEU A N   1 
ATOM   1056 C CA  . LEU A 1 132 ? -7.724  70.443 -6.634  1.00   31.26 ? 132  LEU A CA  1 
ATOM   1057 C C   . LEU A 1 132 ? -7.674  69.529 -7.841  1.00   31.52 ? 132  LEU A C   1 
ATOM   1058 O O   . LEU A 1 132 ? -7.838  69.980 -8.973  1.00   34.35 ? 132  LEU A O   1 
ATOM   1059 C CB  . LEU A 1 132 ? -9.130  71.051 -6.511  1.00   31.39 ? 132  LEU A CB  1 
ATOM   1060 C CG  . LEU A 1 132 ? -10.319 70.090 -6.693  1.00   37.42 ? 132  LEU A CG  1 
ATOM   1061 C CD1 . LEU A 1 132 ? -10.477 69.209 -5.446  1.00   31.84 ? 132  LEU A CD1 1 
ATOM   1062 C CD2 . LEU A 1 132 ? -11.619 70.857 -6.973  1.00   33.90 ? 132  LEU A CD2 1 
ATOM   1063 N N   . LYS A 1 133 ? -7.460  68.237 -7.609  1.00   28.15 ? 133  LYS A N   1 
ATOM   1064 C CA  . LYS A 1 133 ? -7.617  67.258 -8.671  1.00   32.20 ? 133  LYS A CA  1 
ATOM   1065 C C   . LYS A 1 133 ? -8.950  66.541 -8.533  1.00   34.83 ? 133  LYS A C   1 
ATOM   1066 O O   . LYS A 1 133 ? -9.252  66.004 -7.483  1.00   32.20 ? 133  LYS A O   1 
ATOM   1067 C CB  . LYS A 1 133 ? -6.492  66.235 -8.636  1.00   36.42 ? 133  LYS A CB  1 
ATOM   1068 C CG  . LYS A 1 133 ? -6.690  65.100 -9.625  1.00   48.55 ? 133  LYS A CG  1 
ATOM   1069 C CD  . LYS A 1 133 ? -5.746  63.946 -9.341  1.00   48.04 ? 133  LYS A CD  1 
ATOM   1070 C CE  . LYS A 1 133 ? -5.435  63.181 -10.609 1.00   59.23 ? 133  LYS A CE  1 
ATOM   1071 N NZ  . LYS A 1 133 ? -4.972  61.798 -10.319 1.00   55.95 ? 133  LYS A NZ  1 
ATOM   1072 N N   . GLU A 1 134 ? -9.752  66.561 -9.602  1.00   37.52 ? 134  GLU A N   1 
ATOM   1073 C CA  . GLU A 1 134 ? -11.092 65.987 -9.522  1.00   48.54 ? 134  GLU A CA  1 
ATOM   1074 C C   . GLU A 1 134 ? -11.191 64.527 -10.005 1.00   54.90 ? 134  GLU A C   1 
ATOM   1075 O O   . GLU A 1 134 ? -10.281 64.008 -10.646 1.00   51.79 ? 134  GLU A O   1 
ATOM   1076 C CB  . GLU A 1 134 ? -12.087 66.903 -10.224 1.00   49.11 ? 134  GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 134 ? -12.937 67.684 -9.252  1.00   59.62 ? 134  GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 134 ? -13.438 68.987 -9.842  1.00   67.53 ? 134  GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 134 ? -13.192 69.235 -11.051 1.00   70.32 ? 134  GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 134 ? -14.080 69.767 -9.095  1.00   69.69 ? 134  GLU A OE2 1 
ATOM   1081 N N   . GLY A 1 135 ? -12.317 63.861 -9.658  1.00   63.31 ? 135  GLY A N   1 
ATOM   1082 C CA  . GLY A 1 135 ? -12.550 62.477 -10.046 1.00   67.77 ? 135  GLY A CA  1 
ATOM   1083 C C   . GLY A 1 135 ? -12.290 61.460 -8.909  1.00   70.79 ? 135  GLY A C   1 
ATOM   1084 O O   . GLY A 1 135 ? -12.525 61.747 -7.727  1.00   71.30 ? 135  GLY A O   1 
ATOM   1085 N N   . ARG A 1 136 ? -11.782 60.237 -9.252  1.00   76.65 ? 136  ARG A N   1 
ATOM   1086 C CA  . ARG A 1 136 ? -11.453 59.161 -8.267  1.00   76.48 ? 136  ARG A CA  1 
ATOM   1087 C C   . ARG A 1 136 ? -10.193 59.453 -7.461  1.00   75.52 ? 136  ARG A C   1 
ATOM   1088 O O   . ARG A 1 136 ? -10.226 59.295 -6.245  1.00   74.91 ? 136  ARG A O   1 
ATOM   1089 C CB  . ARG A 1 136 ? -11.324 57.815 -8.975  0.0000 97.02 ? 136  ARG A CB  1 
ATOM   1090 C CG  . ARG A 1 136 ? -12.611 57.274 -9.577  0.0000 95.77 ? 136  ARG A CG  1 
ATOM   1091 C CD  . ARG A 1 136 ? -12.381 55.938 -10.263 0.0000 35.27 ? 136  ARG A CD  1 
ATOM   1092 N NE  . ARG A 1 136 ? -11.498 56.062 -11.420 0.0000 30.77 ? 136  ARG A NE  1 
ATOM   1093 C CZ  . ARG A 1 136 ? -10.228 55.671 -11.435 0.0000 28.61 ? 136  ARG A CZ  1 
ATOM   1094 N NH1 . ARG A 1 136 ? -9.688  55.128 -10.353 0.0000 27.07 ? 136  ARG A NH1 1 
ATOM   1095 N NH2 . ARG A 1 136 ? -9.501  55.824 -12.534 0.0000 27.07 ? 136  ARG A NH2 1 
ATOM   1096 N N   . SER A 1 137 ? -9.091  59.832 -8.087  0.0000 48.09 ? 137  SER A N   1 
ATOM   1097 C CA  . SER A 1 137 ? -7.871  60.164 -7.299  0.0000 47.59 ? 137  SER A CA  1 
ATOM   1098 C C   . SER A 1 137 ? -7.917  61.653 -6.997  0.0000 47.19 ? 137  SER A C   1 
ATOM   1099 O O   . SER A 1 137 ? -7.075  62.470 -7.401  0.0000 47.31 ? 137  SER A O   1 
ATOM   1100 C CB  . SER A 1 137 ? -6.613  59.717 -8.046  0.0000 47.72 ? 137  SER A CB  1 
ATOM   1101 O OG  . SER A 1 137 ? -6.568  58.306 -8.172  0.0000 47.89 ? 137  SER A OG  1 
ATOM   1102 N N   . SER A 1 138 ? -8.939  61.921 -6.272  1.00   56.29 ? 138  SER A N   1 
ATOM   1103 C CA  . SER A 1 138 ? -9.404  63.294 -6.047  1.00   54.59 ? 138  SER A CA  1 
ATOM   1104 C C   . SER A 1 138 ? -8.969  63.819 -4.680  1.00   55.14 ? 138  SER A C   1 
ATOM   1105 O O   . SER A 1 138 ? -9.325  63.252 -3.647  1.00   52.89 ? 138  SER A O   1 
ATOM   1106 C CB  . SER A 1 138 ? -10.923 63.377 -6.173  1.00   52.66 ? 138  SER A CB  1 
ATOM   1107 O OG  . SER A 1 138 ? -11.385 64.669 -5.822  1.00   57.56 ? 138  SER A OG  1 
ATOM   1108 N N   . HIS A 1 139 ? -8.205  64.911 -4.684  1.00   50.87 ? 139  HIS A N   1 
ATOM   1109 C CA  . HIS A 1 139 ? -7.583  65.434 -3.462  1.00   47.96 ? 139  HIS A CA  1 
ATOM   1110 C C   . HIS A 1 139 ? -7.186  66.899 -3.645  1.00   40.84 ? 139  HIS A C   1 
ATOM   1111 O O   . HIS A 1 139 ? -7.136  67.393 -4.769  1.00   32.79 ? 139  HIS A O   1 
ATOM   1112 C CB  . HIS A 1 139 ? -6.347  64.609 -3.090  1.00   51.68 ? 139  HIS A CB  1 
ATOM   1113 C CG  . HIS A 1 139 ? -5.474  64.265 -4.261  1.00   69.43 ? 139  HIS A CG  1 
ATOM   1114 N ND1 . HIS A 1 139 ? -4.576  65.158 -4.808  1.00   69.97 ? 139  HIS A ND1 1 
ATOM   1115 C CD2 . HIS A 1 139 ? -5.366  63.127 -4.990  1.00   70.18 ? 139  HIS A CD2 1 
ATOM   1116 C CE1 . HIS A 1 139 ? -3.954  64.585 -5.825  1.00   74.75 ? 139  HIS A CE1 1 
ATOM   1117 N NE2 . HIS A 1 139 ? -4.417  63.353 -5.956  1.00   70.92 ? 139  HIS A NE2 1 
ATOM   1118 N N   . VAL A 1 140 ? -6.914  67.580 -2.534  1.00   36.64 ? 140  VAL A N   1 
ATOM   1119 C CA  . VAL A 1 140 ? -6.506  68.983 -2.552  1.00   39.05 ? 140  VAL A CA  1 
ATOM   1120 C C   . VAL A 1 140 ? -5.122  69.148 -1.940  1.00   39.53 ? 140  VAL A C   1 
ATOM   1121 O O   . VAL A 1 140 ? -4.854  68.639 -0.841  1.00   35.35 ? 140  VAL A O   1 
ATOM   1122 C CB  . VAL A 1 140 ? -7.478  69.874 -1.737  1.00   44.37 ? 140  VAL A CB  1 
ATOM   1123 C CG1 . VAL A 1 140 ? -7.143  71.340 -1.938  1.00   40.70 ? 140  VAL A CG1 1 
ATOM   1124 C CG2 . VAL A 1 140 ? -8.916  69.591 -2.117  1.00   42.48 ? 140  VAL A CG2 1 
ATOM   1125 N N   . GLN A 1 141 ? -4.263  69.895 -2.640  1.00   33.36 ? 141  GLN A N   1 
ATOM   1126 C CA  . GLN A 1 141 ? -2.925  70.239 -2.151  1.00   32.61 ? 141  GLN A CA  1 
ATOM   1127 C C   . GLN A 1 141 ? -2.866  71.733 -1.854  1.00   32.46 ? 141  GLN A C   1 
ATOM   1128 O O   . GLN A 1 141 ? -3.391  72.550 -2.609  1.00   29.90 ? 141  GLN A O   1 
ATOM   1129 C CB  . GLN A 1 141 ? -1.874  69.955 -3.234  1.00   32.76 ? 141  GLN A CB  1 
ATOM   1130 C CG  . GLN A 1 141 ? -1.842  68.548 -3.771  1.00   50.27 ? 141  GLN A CG  1 
ATOM   1131 C CD  . GLN A 1 141 ? -0.859  68.416 -4.931  1.00   63.87 ? 141  GLN A CD  1 
ATOM   1132 O OE1 . GLN A 1 141 ? 0.282   68.892 -4.840  1.00   64.56 ? 141  GLN A OE1 1 
ATOM   1133 N NE2 . GLN A 1 141 ? -1.304  67.800 -6.031  1.00   63.94 ? 141  GLN A NE2 1 
ATOM   1134 N N   . ARG A 1 142 ? -2.167  72.101 -0.795  1.00   27.60 ? 142  ARG A N   1 
ATOM   1135 C CA  . ARG A 1 142 ? -2.014  73.502 -0.474  1.00   29.64 ? 142  ARG A CA  1 
ATOM   1136 C C   . ARG A 1 142 ? -0.590  73.956 -0.837  1.00   32.62 ? 142  ARG A C   1 
ATOM   1137 O O   . ARG A 1 142 ? 0.357   73.218 -0.654  1.00   31.92 ? 142  ARG A O   1 
ATOM   1138 C CB  . ARG A 1 142 ? -2.337  73.708 1.005   1.00   30.27 ? 142  ARG A CB  1 
ATOM   1139 C CG  . ARG A 1 142 ? -1.778  74.921 1.640   1.00   36.30 ? 142  ARG A CG  1 
ATOM   1140 C CD  . ARG A 1 142 ? -2.270  75.092 3.080   1.00   50.89 ? 142  ARG A CD  1 
ATOM   1141 N NE  . ARG A 1 142 ? -1.408  74.408 4.041   1.00   47.50 ? 142  ARG A NE  1 
ATOM   1142 C CZ  . ARG A 1 142 ? -1.708  74.223 5.328   1.00   59.84 ? 142  ARG A CZ  1 
ATOM   1143 N NH1 . ARG A 1 142 ? -2.866  74.658 5.821   1.00   38.39 ? 142  ARG A NH1 1 
ATOM   1144 N NH2 . ARG A 1 142 ? -0.849  73.600 6.121   1.00   48.35 ? 142  ARG A NH2 1 
ATOM   1145 N N   . GLY A 1 143 ? -0.467  75.147 -1.411  1.00   32.47 ? 143  GLY A N   1 
ATOM   1146 C CA  . GLY A 1 143 ? 0.838   75.712 -1.708  1.00   34.79 ? 143  GLY A CA  1 
ATOM   1147 C C   . GLY A 1 143 ? 0.884   77.193 -1.388  1.00   35.40 ? 143  GLY A C   1 
ATOM   1148 O O   . GLY A 1 143 ? -0.156  77.843 -1.278  1.00   36.41 ? 143  GLY A O   1 
ATOM   1149 N N   . TYR A 1 144 ? 2.090   77.731 -1.251  1.00   31.72 ? 144  TYR A N   1 
ATOM   1150 C CA  . TYR A 1 144 ? 2.266   79.133 -0.907  1.00   38.27 ? 144  TYR A CA  1 
ATOM   1151 C C   . TYR A 1 144 ? 3.165   79.833 -1.925  1.00   41.26 ? 144  TYR A C   1 
ATOM   1152 O O   . TYR A 1 144 ? 4.142   79.249 -2.424  1.00   39.52 ? 144  TYR A O   1 
ATOM   1153 C CB  . TYR A 1 144 ? 2.855   79.279 0.502   1.00   39.53 ? 144  TYR A CB  1 
ATOM   1154 C CG  . TYR A 1 144 ? 1.977   78.697 1.591   1.00   36.45 ? 144  TYR A CG  1 
ATOM   1155 C CD1 . TYR A 1 144 ? 0.973   79.455 2.174   1.00   37.76 ? 144  TYR A CD1 1 
ATOM   1156 C CD2 . TYR A 1 144 ? 2.159   77.392 2.037   1.00   43.41 ? 144  TYR A CD2 1 
ATOM   1157 C CE1 . TYR A 1 144 ? 0.168   78.935 3.172   1.00   37.18 ? 144  TYR A CE1 1 
ATOM   1158 C CE2 . TYR A 1 144 ? 1.356   76.857 3.036   1.00   39.82 ? 144  TYR A CE2 1 
ATOM   1159 C CZ  . TYR A 1 144 ? 0.362   77.633 3.597   1.00   37.15 ? 144  TYR A CZ  1 
ATOM   1160 O OH  . TYR A 1 144 ? -0.442  77.115 4.590   1.00   39.61 ? 144  TYR A OH  1 
ATOM   1161 N N   . GLY A 1 145 ? 2.875   81.103 -2.151  1.00   41.10 ? 145  GLY A N   1 
ATOM   1162 C CA  . GLY A 1 145 ? 3.664   81.935 -3.039  1.00   44.94 ? 145  GLY A CA  1 
ATOM   1163 C C   . GLY A 1 145 ? 3.082   83.347 -3.064  1.00   41.97 ? 145  GLY A C   1 
ATOM   1164 O O   . GLY A 1 145 ? 1.907   83.540 -2.736  1.00   40.15 ? 145  GLY A O   1 
ATOM   1165 N N   . LYS A 1 146 ? 3.873   84.347 -3.468  1.00   43.22 ? 146  LYS A N   1 
ATOM   1166 C CA  . LYS A 1 146 ? 3.341   85.696 -3.605  1.00   43.12 ? 146  LYS A CA  1 
ATOM   1167 C C   . LYS A 1 146 ? 2.722   85.834 -4.993  1.00   42.59 ? 146  LYS A C   1 
ATOM   1168 O O   . LYS A 1 146 ? 3.423   85.747 -6.015  1.00   43.71 ? 146  LYS A O   1 
ATOM   1169 C CB  . LYS A 1 146 ? 4.429   86.733 -3.317  1.00   51.90 ? 146  LYS A CB  1 
ATOM   1170 C CG  . LYS A 1 146 ? 3.943   88.172 -3.367  0.0000 20.00 ? 146  LYS A CG  1 
ATOM   1171 C CD  . LYS A 1 146 ? 5.072   89.146 -3.072  0.0000 20.00 ? 146  LYS A CD  1 
ATOM   1172 C CE  . LYS A 1 146 ? 6.106   89.147 -4.186  0.0000 20.00 ? 146  LYS A CE  1 
ATOM   1173 N NZ  . LYS A 1 146 ? 7.219   90.097 -3.911  0.0000 20.00 ? 146  LYS A NZ  1 
ATOM   1174 N N   . VAL A 1 147 ? 1.436   86.061 -5.023  1.00   38.36 ? 147  VAL A N   1 
ATOM   1175 C CA  . VAL A 1 147 ? 0.663   86.220 -6.267  1.00   43.66 ? 147  VAL A CA  1 
ATOM   1176 C C   . VAL A 1 147 ? 0.711   85.047 -7.247  1.00   42.43 ? 147  VAL A C   1 
ATOM   1177 O O   . VAL A 1 147 ? -0.038  85.070 -8.238  1.00   43.24 ? 147  VAL A O   1 
ATOM   1178 C CB  . VAL A 1 147 ? 1.032   87.566 -6.958  1.00   45.66 ? 147  VAL A CB  1 
ATOM   1179 C CG1 . VAL A 1 147 ? 0.080   87.860 -8.102  1.00   52.02 ? 147  VAL A CG1 1 
ATOM   1180 C CG2 . VAL A 1 147 ? 1.013   88.712 -5.957  1.00   53.20 ? 147  VAL A CG2 1 
ATOM   1181 N N   . GLN A 1 148 ? 1.547   84.030 -7.022  1.00   38.98 ? 148  GLN A N   1 
ATOM   1182 C CA  . GLN A 1 148 ? 1.586   82.828 -7.850  1.00   43.20 ? 148  GLN A CA  1 
ATOM   1183 C C   . GLN A 1 148 ? 2.174   81.745 -6.988  1.00   45.05 ? 148  GLN A C   1 
ATOM   1184 O O   . GLN A 1 148 ? 3.153   81.973 -6.289  1.00   42.50 ? 148  GLN A O   1 
ATOM   1185 C CB  . GLN A 1 148 ? 2.439   83.002 -9.114  1.00   46.68 ? 148  GLN A CB  1 
ATOM   1186 C CG  . GLN A 1 148 ? 2.551   81.755 -9.983  1.00   49.11 ? 148  GLN A CG  1 
ATOM   1187 C CD  . GLN A 1 148 ? 2.967   82.086 -11.409 1.00   51.66 ? 148  GLN A CD  1 
ATOM   1188 O OE1 . GLN A 1 148 ? 2.224   82.744 -12.129 1.00   58.63 ? 148  GLN A OE1 1 
ATOM   1189 N NE2 . GLN A 1 148 ? 4.096   81.722 -12.003 1.00   41.69 ? 148  GLN A NE2 1 
ATOM   1190 N N   . ALA A 1 149 ? 1.578   80.565 -7.040  1.00   38.05 ? 149  ALA A N   1 
ATOM   1191 C CA  . ALA A 1 149 ? 2.126   79.420 -6.287  1.00   36.71 ? 149  ALA A CA  1 
ATOM   1192 C C   . ALA A 1 149 ? 2.446   78.294 -7.259  1.00   35.75 ? 149  ALA A C   1 
ATOM   1193 O O   . ALA A 1 149 ? 1.739   78.089 -8.255  1.00   32.52 ? 149  ALA A O   1 
ATOM   1194 C CB  . ALA A 1 149 ? 1.135   78.926 -5.244  1.00   36.22 ? 149  ALA A CB  1 
ATOM   1195 N N   . GLU A 1 150 ? 3.504   77.554 -6.972  1.00   34.96 ? 150  GLU A N   1 
ATOM   1196 C CA  . GLU A 1 150 ? 3.827   76.404 -7.791  1.00   31.36 ? 150  GLU A CA  1 
ATOM   1197 C C   . GLU A 1 150 ? 3.470   75.090 -7.116  1.00   32.95 ? 150  GLU A C   1 
ATOM   1198 O O   . GLU A 1 150 ? 3.496   74.981 -5.890  1.00   33.04 ? 150  GLU A O   1 
ATOM   1199 C CB  . GLU A 1 150 ? 5.291   76.439 -8.244  1.00   36.12 ? 150  GLU A CB  1 
ATOM   1200 C CG  . GLU A 1 150 ? 6.268   75.755 -7.320  1.00   47.40 ? 150  GLU A CG  1 
ATOM   1201 C CD  . GLU A 1 150 ? 7.613   75.541 -7.989  1.00   63.14 ? 150  GLU A CD  1 
ATOM   1202 O OE1 . GLU A 1 150 ? 8.172   76.536 -8.508  1.00   39.73 ? 150  GLU A OE1 1 
ATOM   1203 O OE2 . GLU A 1 150 ? 8.093   74.375 -8.028  1.00   56.41 ? 150  GLU A OE2 1 
ATOM   1204 N N   . PHE A 1 151 ? 3.109   74.106 -7.943  1.00   31.10 ? 151  PHE A N   1 
ATOM   1205 C CA  . PHE A 1 151 ? 2.683   72.802 -7.489  1.00   31.03 ? 151  PHE A CA  1 
ATOM   1206 C C   . PHE A 1 151 ? 3.396   71.742 -8.341  1.00   30.10 ? 151  PHE A C   1 
ATOM   1207 O O   . PHE A 1 151 ? 2.865   71.285 -9.358  1.00   30.30 ? 151  PHE A O   1 
ATOM   1208 C CB  . PHE A 1 151 ? 1.159   72.667 -7.670  1.00   25.53 ? 151  PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 151 ? 0.352   73.535 -6.737  1.00   30.35 ? 151  PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 151 ? -0.115  74.783 -7.152  1.00   27.26 ? 151  PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 151 ? 0.049   73.100 -5.447  1.00   34.24 ? 151  PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 151 ? -0.866  75.590 -6.304  1.00   31.06 ? 151  PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 151 ? -0.684  73.893 -4.587  1.00   31.61 ? 151  PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 151 ? -1.150  75.155 -5.015  1.00   31.67 ? 151  PHE A CZ  1 
ATOM   1215 N N   . PRO A 1 152 ? 4.613   71.376 -7.958  1.00   32.77 ? 152  PRO A N   1 
ATOM   1216 C CA  . PRO A 1 152 ? 5.355   70.364 -8.707  1.00   31.69 ? 152  PRO A CA  1 
ATOM   1217 C C   . PRO A 1 152 ? 4.782   68.970 -8.464  1.00   34.62 ? 152  PRO A C   1 
ATOM   1218 O O   . PRO A 1 152 ? 4.542   68.603 -7.318  1.00   33.20 ? 152  PRO A O   1 
ATOM   1219 C CB  . PRO A 1 152 ? 6.793   70.491 -8.162  1.00   34.43 ? 152  PRO A CB  1 
ATOM   1220 C CG  . PRO A 1 152 ? 6.644   71.123 -6.792  1.00   39.64 ? 152  PRO A CG  1 
ATOM   1221 C CD  . PRO A 1 152 ? 5.380   71.929 -6.817  1.00   32.71 ? 152  PRO A CD  1 
ATOM   1222 N N   . LEU A 1 153 ? 4.537   68.225 -9.541  1.00   31.05 ? 153  LEU A N   1 
ATOM   1223 C CA  . LEU A 1 153 ? 4.018   66.864 -9.436  1.00   35.08 ? 153  LEU A CA  1 
ATOM   1224 C C   . LEU A 1 153 ? 5.174   65.882 -9.438  1.00   39.36 ? 153  LEU A C   1 
ATOM   1225 O O   . LEU A 1 153 ? 5.019   64.735 -9.023  1.00   40.08 ? 153  LEU A O   1 
ATOM   1226 C CB  . LEU A 1 153 ? 3.072   66.551 -10.602 1.00   30.42 ? 153  LEU A CB  1 
ATOM   1227 C CG  . LEU A 1 153 ? 1.575   66.780 -10.354 1.00   44.43 ? 153  LEU A CG  1 
ATOM   1228 C CD1 . LEU A 1 153 ? 1.330   67.936 -9.424  1.00   41.66 ? 153  LEU A CD1 1 
ATOM   1229 C CD2 . LEU A 1 153 ? 0.798   66.949 -11.634 1.00   37.83 ? 153  LEU A CD2 1 
ATOM   1230 N N   . GLY A 1 154 ? 6.333   66.339 -9.916  1.00   37.18 ? 154  GLY A N   1 
ATOM   1231 C CA  . GLY A 1 154 ? 7.428   65.440 -10.265 1.00   37.75 ? 154  GLY A CA  1 
ATOM   1232 C C   . GLY A 1 154 ? 7.157   64.663 -11.545 1.00   34.79 ? 154  GLY A C   1 
ATOM   1233 O O   . GLY A 1 154 ? 6.226   64.974 -12.274 1.00   31.70 ? 154  GLY A O   1 
ATOM   1234 N N   . PRO A 1 155 ? 7.973   63.643 -11.807 1.00   36.11 ? 155  PRO A N   1 
ATOM   1235 C CA  . PRO A 1 155 ? 7.742   62.731 -12.939 1.00   38.64 ? 155  PRO A CA  1 
ATOM   1236 C C   . PRO A 1 155 ? 6.378   62.054 -12.813 1.00   39.55 ? 155  PRO A C   1 
ATOM   1237 O O   . PRO A 1 155 ? 6.134   61.370 -11.822 1.00   37.19 ? 155  PRO A O   1 
ATOM   1238 C CB  . PRO A 1 155 ? 8.871   61.686 -12.789 1.00   40.85 ? 155  PRO A CB  1 
ATOM   1239 C CG  . PRO A 1 155 ? 9.955   62.407 -11.979 1.00   42.28 ? 155  PRO A CG  1 
ATOM   1240 C CD  . PRO A 1 155 ? 9.178   63.285 -11.023 1.00   37.32 ? 155  PRO A CD  1 
ATOM   1241 N N   . VAL A 1 156 ? 5.493   62.267 -13.786 1.00   35.86 ? 156  VAL A N   1 
ATOM   1242 C CA  . VAL A 1 156 ? 4.111   61.792 -13.661 1.00   34.94 ? 156  VAL A CA  1 
ATOM   1243 C C   . VAL A 1 156 ? 3.949   60.350 -14.104 1.00   32.95 ? 156  VAL A C   1 
ATOM   1244 O O   . VAL A 1 156 ? 4.724   59.839 -14.918 1.00   37.04 ? 156  VAL A O   1 
ATOM   1245 C CB  . VAL A 1 156 ? 3.106   62.677 -14.436 1.00   37.28 ? 156  VAL A CB  1 
ATOM   1246 C CG1 . VAL A 1 156 ? 3.021   64.070 -13.817 1.00   35.60 ? 156  VAL A CG1 1 
ATOM   1247 C CG2 . VAL A 1 156 ? 3.451   62.732 -15.937 1.00   36.14 ? 156  VAL A CG2 1 
ATOM   1248 N N   . THR A 1 157 ? 2.929   59.703 -13.574 1.00   39.47 ? 157  THR A N   1 
ATOM   1249 C CA  . THR A 1 157 ? 2.462   58.439 -14.116 1.00   41.66 ? 157  THR A CA  1 
ATOM   1250 C C   . THR A 1 157 ? 1.015   58.606 -14.556 1.00   43.80 ? 157  THR A C   1 
ATOM   1251 O O   . THR A 1 157 ? 0.468   59.704 -14.499 1.00   43.87 ? 157  THR A O   1 
ATOM   1252 C CB  . THR A 1 157 ? 2.557   57.332 -13.046 1.00   37.77 ? 157  THR A CB  1 
ATOM   1253 O OG1 . THR A 1 157 ? 1.660   57.638 -11.969 1.00   42.83 ? 157  THR A OG1 1 
ATOM   1254 C CG2 . THR A 1 157 ? 3.924   57.347 -12.377 1.00   38.19 ? 157  THR A CG2 1 
ATOM   1255 N N   . THR A 1 158 ? 0.389   57.516 -14.981 1.00   41.83 ? 158  THR A N   1 
ATOM   1256 C CA  . THR A 1 158 ? -1.014  57.563 -15.374 1.00   41.54 ? 158  THR A CA  1 
ATOM   1257 C C   . THR A 1 158 ? -1.877  57.941 -14.192 1.00   37.42 ? 158  THR A C   1 
ATOM   1258 O O   . THR A 1 158 ? -3.009  58.389 -14.359 1.00   44.44 ? 158  THR A O   1 
ATOM   1259 C CB  . THR A 1 158 ? -1.473  56.198 -15.952 1.00   47.32 ? 158  THR A CB  1 
ATOM   1260 O OG1 . THR A 1 158 ? -0.916  55.139 -15.166 1.00   47.62 ? 158  THR A OG1 1 
ATOM   1261 C CG2 . THR A 1 158 ? -0.867  55.972 -17.333 1.00   45.00 ? 158  THR A CG2 1 
ATOM   1262 N N   . ALA A 1 159 ? -1.331  57.778 -12.995 1.00   38.80 ? 159  ALA A N   1 
ATOM   1263 C CA  . ALA A 1 159 ? -2.049  58.102 -11.785 1.00   42.79 ? 159  ALA A CA  1 
ATOM   1264 C C   . ALA A 1 159 ? -2.326  59.605 -11.695 1.00   45.47 ? 159  ALA A C   1 
ATOM   1265 O O   . ALA A 1 159 ? -3.207  60.037 -10.946 1.00   40.82 ? 159  ALA A O   1 
ATOM   1266 C CB  . ALA A 1 159 ? -1.275  57.625 -10.565 1.00   43.92 ? 159  ALA A CB  1 
ATOM   1267 N N   . HIS A 1 160 ? -1.572  60.400 -12.463 1.00   41.49 ? 160  HIS A N   1 
ATOM   1268 C CA  . HIS A 1 160 ? -1.701  61.855 -12.393 1.00   37.20 ? 160  HIS A CA  1 
ATOM   1269 C C   . HIS A 1 160 ? -2.754  62.403 -13.349 1.00   38.76 ? 160  HIS A C   1 
ATOM   1270 O O   . HIS A 1 160 ? -3.106  63.575 -13.273 1.00   39.82 ? 160  HIS A O   1 
ATOM   1271 C CB  . HIS A 1 160 ? -0.342  62.538 -12.635 1.00   37.43 ? 160  HIS A CB  1 
ATOM   1272 C CG  . HIS A 1 160 ? 0.696   62.170 -11.630 1.00   29.91 ? 160  HIS A CG  1 
ATOM   1273 N ND1 . HIS A 1 160 ? 0.844   62.841 -10.436 1.00   40.64 ? 160  HIS A ND1 1 
ATOM   1274 C CD2 . HIS A 1 160 ? 1.604   61.169 -11.615 1.00   31.56 ? 160  HIS A CD2 1 
ATOM   1275 C CE1 . HIS A 1 160 ? 1.818   62.285 -9.740  1.00   37.49 ? 160  HIS A CE1 1 
ATOM   1276 N NE2 . HIS A 1 160 ? 2.291   61.264 -10.430 1.00   48.82 ? 160  HIS A NE2 1 
ATOM   1277 N N   . ARG A 1 161 ? -3.254  61.560 -14.248 1.00   41.18 ? 161  ARG A N   1 
ATOM   1278 C CA  . ARG A 1 161 ? -4.356  61.966 -15.135 1.00   42.73 ? 161  ARG A CA  1 
ATOM   1279 C C   . ARG A 1 161 ? -5.490  62.549 -14.325 1.00   43.45 ? 161  ARG A C   1 
ATOM   1280 O O   . ARG A 1 161 ? -5.768  62.094 -13.210 1.00   42.24 ? 161  ARG A O   1 
ATOM   1281 C CB  . ARG A 1 161 ? -4.890  60.777 -15.931 1.00   43.44 ? 161  ARG A CB  1 
ATOM   1282 C CG  . ARG A 1 161 ? -3.861  60.003 -16.670 1.00   47.63 ? 161  ARG A CG  1 
ATOM   1283 C CD  . ARG A 1 161 ? -4.390  58.687 -17.213 1.00   55.96 ? 161  ARG A CD  1 
ATOM   1284 N NE  . ARG A 1 161 ? -3.685  58.259 -18.412 1.00   49.59 ? 161  ARG A NE  1 
ATOM   1285 C CZ  . ARG A 1 161 ? -3.717  57.025 -18.890 1.00   57.76 ? 161  ARG A CZ  1 
ATOM   1286 N NH1 . ARG A 1 161 ? -4.420  56.088 -18.265 1.00   54.84 ? 161  ARG A NH1 1 
ATOM   1287 N NH2 . ARG A 1 161 ? -3.043  56.721 -19.991 1.00   54.32 ? 161  ARG A NH2 1 
ATOM   1288 N N   . GLY A 1 162 ? -6.157  63.554 -14.881 1.00   41.90 ? 162  GLY A N   1 
ATOM   1289 C CA  . GLY A 1 162 ? -7.302  64.137 -14.216 1.00   37.45 ? 162  GLY A CA  1 
ATOM   1290 C C   . GLY A 1 162 ? -7.549  65.562 -14.629 1.00   38.70 ? 162  GLY A C   1 
ATOM   1291 O O   . GLY A 1 162 ? -6.819  66.119 -15.450 1.00   34.51 ? 162  GLY A O   1 
ATOM   1292 N N   . THR A 1 163 ? -8.588  66.151 -14.059 1.00   37.89 ? 163  THR A N   1 
ATOM   1293 C CA  . THR A 1 163 ? -8.908  67.538 -14.292 1.00   39.86 ? 163  THR A CA  1 
ATOM   1294 C C   . THR A 1 163 ? -8.549  68.365 -13.068 1.00   38.56 ? 163  THR A C   1 
ATOM   1295 O O   . THR A 1 163 ? -9.077  68.138 -11.977 1.00   38.49 ? 163  THR A O   1 
ATOM   1296 C CB  . THR A 1 163 ? -10.402 67.677 -14.624 1.00   41.85 ? 163  THR A CB  1 
ATOM   1297 O OG1 . THR A 1 163 ? -10.681 66.953 -15.827 1.00   38.33 ? 163  THR A OG1 1 
ATOM   1298 C CG2 . THR A 1 163 ? -10.750 69.122 -14.984 1.00   37.71 ? 163  THR A CG2 1 
ATOM   1299 N N   . TYR A 1 164 ? -7.642  69.324 -13.257 1.00   32.59 ? 164  TYR A N   1 
ATOM   1300 C CA  . TYR A 1 164 ? -7.198  70.201 -12.174 1.00   29.15 ? 164  TYR A CA  1 
ATOM   1301 C C   . TYR A 1 164 ? -7.849  71.576 -12.231 1.00   30.12 ? 164  TYR A C   1 
ATOM   1302 O O   . TYR A 1 164 ? -8.043  72.150 -13.314 1.00   28.52 ? 164  TYR A O   1 
ATOM   1303 C CB  . TYR A 1 164 ? -5.669  70.337 -12.192 1.00   29.37 ? 164  TYR A CB  1 
ATOM   1304 C CG  . TYR A 1 164 ? -4.944  69.016 -12.039 1.00   32.15 ? 164  TYR A CG  1 
ATOM   1305 C CD1 . TYR A 1 164 ? -4.900  68.101 -13.080 1.00   31.80 ? 164  TYR A CD1 1 
ATOM   1306 C CD2 . TYR A 1 164 ? -4.319  68.680 -10.838 1.00   31.66 ? 164  TYR A CD2 1 
ATOM   1307 C CE1 . TYR A 1 164 ? -4.240  66.888 -12.938 1.00   31.61 ? 164  TYR A CE1 1 
ATOM   1308 C CE2 . TYR A 1 164 ? -3.651  67.482 -10.684 1.00   33.64 ? 164  TYR A CE2 1 
ATOM   1309 C CZ  . TYR A 1 164 ? -3.616  66.591 -11.732 1.00   32.90 ? 164  TYR A CZ  1 
ATOM   1310 O OH  . TYR A 1 164 ? -2.965  65.412 -11.578 1.00   29.78 ? 164  TYR A OH  1 
ATOM   1311 N N   . ARG A 1 165 ? -8.208  72.082 -11.057 1.00   26.83 ? 165  ARG A N   1 
ATOM   1312 C CA  . ARG A 1 165 ? -8.559  73.476 -10.875 1.00   33.02 ? 165  ARG A CA  1 
ATOM   1313 C C   . ARG A 1 165 ? -7.788  73.988 -9.688  1.00   33.00 ? 165  ARG A C   1 
ATOM   1314 O O   . ARG A 1 165 ? -7.433  73.231 -8.799  1.00   34.80 ? 165  ARG A O   1 
ATOM   1315 C CB  . ARG A 1 165 ? -10.046 73.610 -10.570 1.00   29.28 ? 165  ARG A CB  1 
ATOM   1316 C CG  . ARG A 1 165 ? -10.953 73.276 -11.733 1.00   33.58 ? 165  ARG A CG  1 
ATOM   1317 C CD  . ARG A 1 165 ? -12.437 73.347 -11.369 1.00   37.84 ? 165  ARG A CD  1 
ATOM   1318 N NE  . ARG A 1 165 ? -13.302 73.229 -12.538 1.00   40.44 ? 165  ARG A NE  1 
ATOM   1319 C CZ  . ARG A 1 165 ? -13.674 72.076 -13.068 1.00   55.06 ? 165  ARG A CZ  1 
ATOM   1320 N NH1 . ARG A 1 165 ? -13.243 70.933 -12.540 1.00   48.64 ? 165  ARG A NH1 1 
ATOM   1321 N NH2 . ARG A 1 165 ? -14.479 72.059 -14.128 1.00   48.28 ? 165  ARG A NH2 1 
ATOM   1322 N N   . CYS A 1 166 ? -7.568  75.282 -9.638  1.00   30.95 ? 166  CYS A N   1 
ATOM   1323 C CA  . CYS A 1 166 ? -6.896  75.832 -8.503  1.00   32.26 ? 166  CYS A CA  1 
ATOM   1324 C C   . CYS A 1 166 ? -7.711  76.939 -7.853  1.00   32.84 ? 166  CYS A C   1 
ATOM   1325 O O   . CYS A 1 166 ? -8.611  77.508 -8.476  1.00   33.58 ? 166  CYS A O   1 
ATOM   1326 C CB  . CYS A 1 166 ? -5.488  76.292 -8.885  1.00   30.46 ? 166  CYS A CB  1 
ATOM   1327 S SG  . CYS A 1 166 ? -5.376  77.909 -9.693  1.00   33.91 ? 166  CYS A SG  1 
ATOM   1328 N N   . PHE A 1 167 ? -7.409  77.222 -6.591  1.00   31.25 ? 167  PHE A N   1 
ATOM   1329 C CA  . PHE A 1 167 ? -8.082  78.286 -5.849  1.00   30.21 ? 167  PHE A CA  1 
ATOM   1330 C C   . PHE A 1 167 ? -7.045  79.194 -5.212  1.00   30.60 ? 167  PHE A C   1 
ATOM   1331 O O   . PHE A 1 167 ? -6.019  78.723 -4.705  1.00   30.01 ? 167  PHE A O   1 
ATOM   1332 C CB  . PHE A 1 167 ? -8.925  77.693 -4.710  1.00   28.49 ? 167  PHE A CB  1 
ATOM   1333 C CG  . PHE A 1 167 ? -10.034 76.829 -5.163  1.00   30.41 ? 167  PHE A CG  1 
ATOM   1334 C CD1 . PHE A 1 167 ? -9.794  75.513 -5.551  1.00   33.46 ? 167  PHE A CD1 1 
ATOM   1335 C CD2 . PHE A 1 167 ? -11.329 77.307 -5.188  1.00   29.89 ? 167  PHE A CD2 1 
ATOM   1336 C CE1 . PHE A 1 167 ? -10.832 74.698 -5.960  1.00   40.26 ? 167  PHE A CE1 1 
ATOM   1337 C CE2 . PHE A 1 167 ? -12.381 76.490 -5.596  1.00   29.61 ? 167  PHE A CE2 1 
ATOM   1338 C CZ  . PHE A 1 167 ? -12.134 75.188 -5.985  1.00   37.49 ? 167  PHE A CZ  1 
ATOM   1339 N N   . GLY A 1 168 ? -7.336  80.488 -5.182  1.00   29.86 ? 168  GLY A N   1 
ATOM   1340 C CA  . GLY A 1 168 ? -6.703  81.377 -4.229  1.00   30.48 ? 168  GLY A CA  1 
ATOM   1341 C C   . GLY A 1 168 ? -7.524  81.428 -2.960  1.00   28.82 ? 168  GLY A C   1 
ATOM   1342 O O   . GLY A 1 168 ? -8.576  80.787 -2.864  1.00   31.88 ? 168  GLY A O   1 
ATOM   1343 N N   . SER A 1 169 ? -7.056  82.187 -1.980  1.00   30.70 ? 169  SER A N   1 
ATOM   1344 C CA  . SER A 1 169 ? -7.757  82.274 -0.710  1.00   31.71 ? 169  SER A CA  1 
ATOM   1345 C C   . SER A 1 169 ? -7.684  83.670 -0.114  1.00   32.23 ? 169  SER A C   1 
ATOM   1346 O O   . SER A 1 169 ? -6.703  84.388 -0.307  1.00   33.64 ? 169  SER A O   1 
ATOM   1347 C CB  . SER A 1 169 ? -7.222  81.228 0.281   1.00   28.12 ? 169  SER A CB  1 
ATOM   1348 O OG  . SER A 1 169 ? -5.851  81.447 0.583   1.00   32.66 ? 169  SER A OG  1 
ATOM   1349 N N   . TYR A 1 170 ? -8.688  84.063 0.636   1.00   33.38 ? 170  TYR A N   1 
ATOM   1350 C CA  . TYR A 1 170 ? -8.627  85.361 1.280   1.00   34.68 ? 170  TYR A CA  1 
ATOM   1351 C C   . TYR A 1 170 ? -8.260  85.195 2.787   1.00   37.25 ? 170  TYR A C   1 
ATOM   1352 O O   . TYR A 1 170 ? -7.774  86.103 3.451   1.00   34.22 ? 170  TYR A O   1 
ATOM   1353 C CB  . TYR A 1 170 ? -9.921  86.088 0.915   1.00   32.76 ? 170  TYR A CB  1 
ATOM   1354 C CG  . TYR A 1 170 ? -10.085 86.183 -0.601  1.00   40.71 ? 170  TYR A CG  1 
ATOM   1355 C CD1 . TYR A 1 170 ? -9.436  87.192 -1.276  1.00   44.00 ? 170  TYR A CD1 1 
ATOM   1356 C CD2 . TYR A 1 170 ? -10.826 85.275 -1.347  1.00   37.41 ? 170  TYR A CD2 1 
ATOM   1357 C CE1 . TYR A 1 170 ? -9.545  87.310 -2.654  1.00   42.27 ? 170  TYR A CE1 1 
ATOM   1358 C CE2 . TYR A 1 170 ? -10.937 85.382 -2.723  1.00   38.53 ? 170  TYR A CE2 1 
ATOM   1359 C CZ  . TYR A 1 170 ? -10.297 86.408 -3.367  1.00   37.22 ? 170  TYR A CZ  1 
ATOM   1360 O OH  . TYR A 1 170 ? -10.403 86.549 -4.728  1.00   36.68 ? 170  TYR A OH  1 
ATOM   1361 N N   . ASN A 1 171 ? -8.536  83.976 3.263   1.00   35.22 ? 171  ASN A N   1 
ATOM   1362 C CA  . ASN A 1 171 ? -8.200  83.469 4.604   1.00   33.97 ? 171  ASN A CA  1 
ATOM   1363 C C   . ASN A 1 171 ? -8.222  81.948 4.492   1.00   31.86 ? 171  ASN A C   1 
ATOM   1364 O O   . ASN A 1 171 ? -8.629  81.395 3.457   1.00   29.88 ? 171  ASN A O   1 
ATOM   1365 C CB  . ASN A 1 171 ? -9.076  84.060 5.715   1.00   30.45 ? 171  ASN A CB  1 
ATOM   1366 C CG  . ASN A 1 171 ? -10.514 83.580 5.727   1.00   42.49 ? 171  ASN A CG  1 
ATOM   1367 O OD1 . ASN A 1 171 ? -10.795 82.389 5.670   1.00   36.80 ? 171  ASN A OD1 1 
ATOM   1368 N ND2 . ASN A 1 171 ? -11.432 84.540 5.795   1.00   32.42 ? 171  ASN A ND2 1 
ATOM   1369 N N   . ASN A 1 172 ? -7.791  81.259 5.539   1.00   30.39 ? 172  ASN A N   1 
ATOM   1370 C CA  . ASN A 1 172 ? -7.605  79.806 5.406   1.00   29.70 ? 172  ASN A CA  1 
ATOM   1371 C C   . ASN A 1 172 ? -8.913  79.061 5.095   1.00   32.46 ? 172  ASN A C   1 
ATOM   1372 O O   . ASN A 1 172 ? -8.898  77.949 4.556   1.00   31.63 ? 172  ASN A O   1 
ATOM   1373 C CB  . ASN A 1 172 ? -6.902  79.213 6.630   1.00   28.91 ? 172  ASN A CB  1 
ATOM   1374 C CG  . ASN A 1 172 ? -5.407  79.417 6.587   1.00   31.10 ? 172  ASN A CG  1 
ATOM   1375 O OD1 . ASN A 1 172 ? -4.656  78.551 6.140   1.00   28.82 ? 172  ASN A OD1 1 
ATOM   1376 N ND2 . ASN A 1 172 ? -4.964  80.579 7.037   1.00   29.21 ? 172  ASN A ND2 1 
ATOM   1377 N N   . HIS A 1 173 ? -10.040 79.700 5.386   1.00   28.60 ? 173  HIS A N   1 
ATOM   1378 C CA  . HIS A 1 173 ? -11.349 79.065 5.218   1.00   27.85 ? 173  HIS A CA  1 
ATOM   1379 C C   . HIS A 1 173 ? -12.220 79.689 4.140   1.00   30.80 ? 173  HIS A C   1 
ATOM   1380 O O   . HIS A 1 173 ? -13.367 79.273 3.944   1.00   30.69 ? 173  HIS A O   1 
ATOM   1381 C CB  . HIS A 1 173 ? -12.107 79.101 6.538   1.00   30.66 ? 173  HIS A CB  1 
ATOM   1382 C CG  . HIS A 1 173 ? -11.599 78.130 7.550   1.00   33.41 ? 173  HIS A CG  1 
ATOM   1383 N ND1 . HIS A 1 173 ? -10.701 78.482 8.536   1.00   30.22 ? 173  HIS A ND1 1 
ATOM   1384 C CD2 . HIS A 1 173 ? -11.878 76.817 7.741   1.00   27.37 ? 173  HIS A CD2 1 
ATOM   1385 C CE1 . HIS A 1 173 ? -10.445 77.426 9.289   1.00   33.29 ? 173  HIS A CE1 1 
ATOM   1386 N NE2 . HIS A 1 173 ? -11.149 76.404 8.833   1.00   31.38 ? 173  HIS A NE2 1 
ATOM   1387 N N   . ALA A 1 174 ? -11.703 80.706 3.454   1.00   29.31 ? 174  ALA A N   1 
ATOM   1388 C CA  . ALA A 1 174 ? -12.500 81.385 2.435   1.00   28.93 ? 174  ALA A CA  1 
ATOM   1389 C C   . ALA A 1 174 ? -11.705 81.456 1.150   1.00   29.44 ? 174  ALA A C   1 
ATOM   1390 O O   . ALA A 1 174 ? -10.732 82.196 1.053   1.00   31.13 ? 174  ALA A O   1 
ATOM   1391 C CB  . ALA A 1 174 ? -12.884 82.817 2.904   1.00   29.92 ? 174  ALA A CB  1 
ATOM   1392 N N   . TRP A 1 175 ? -12.150 80.713 0.159   1.00   29.46 ? 175  TRP A N   1 
ATOM   1393 C CA  . TRP A 1 175 ? -11.399 80.545 -1.066  1.00   29.62 ? 175  TRP A CA  1 
ATOM   1394 C C   . TRP A 1 175 ? -12.086 81.252 -2.244  1.00   32.21 ? 175  TRP A C   1 
ATOM   1395 O O   . TRP A 1 175 ? -13.277 81.600 -2.182  1.00   30.81 ? 175  TRP A O   1 
ATOM   1396 C CB  . TRP A 1 175 ? -11.238 79.054 -1.382  1.00   27.74 ? 175  TRP A CB  1 
ATOM   1397 C CG  . TRP A 1 175 ? -10.524 78.265 -0.301  1.00   27.97 ? 175  TRP A CG  1 
ATOM   1398 C CD1 . TRP A 1 175 ? -10.009 78.744 0.884   1.00   27.25 ? 175  TRP A CD1 1 
ATOM   1399 C CD2 . TRP A 1 175 ? -10.244 76.865 -0.320  1.00   32.46 ? 175  TRP A CD2 1 
ATOM   1400 N NE1 . TRP A 1 175 ? -9.430  77.713 1.598   1.00   31.22 ? 175  TRP A NE1 1 
ATOM   1401 C CE2 . TRP A 1 175 ? -9.568  76.549 0.882   1.00   30.22 ? 175  TRP A CE2 1 
ATOM   1402 C CE3 . TRP A 1 175 ? -10.500 75.833 -1.233  1.00   25.51 ? 175  TRP A CE3 1 
ATOM   1403 C CZ2 . TRP A 1 175 ? -9.158  75.261 1.183   1.00   27.82 ? 175  TRP A CZ2 1 
ATOM   1404 C CZ3 . TRP A 1 175 ? -10.087 74.560 -0.928  1.00   31.15 ? 175  TRP A CZ3 1 
ATOM   1405 C CH2 . TRP A 1 175 ? -9.425  74.282 0.263   1.00   27.15 ? 175  TRP A CH2 1 
ATOM   1406 N N   . SER A 1 176 ? -11.327 81.443 -3.320  1.00   32.94 ? 176  SER A N   1 
ATOM   1407 C CA  . SER A 1 176 ? -11.831 82.096 -4.525  1.00   30.01 ? 176  SER A CA  1 
ATOM   1408 C C   . SER A 1 176 ? -12.791 81.164 -5.254  1.00   32.98 ? 176  SER A C   1 
ATOM   1409 O O   . SER A 1 176 ? -13.039 80.039 -4.806  1.00   35.26 ? 176  SER A O   1 
ATOM   1410 C CB  . SER A 1 176 ? -10.651 82.430 -5.454  1.00   32.57 ? 176  SER A CB  1 
ATOM   1411 O OG  . SER A 1 176 ? -10.000 81.232 -5.878  1.00   33.24 ? 176  SER A OG  1 
ATOM   1412 N N   . PHE A 1 177 ? -13.324 81.630 -6.387  1.00   30.48 ? 177  PHE A N   1 
ATOM   1413 C CA  . PHE A 1 177 ? -13.787 80.727 -7.435  1.00   32.41 ? 177  PHE A CA  1 
ATOM   1414 C C   . PHE A 1 177 ? -12.653 79.817 -7.865  1.00   31.55 ? 177  PHE A C   1 
ATOM   1415 O O   . PHE A 1 177 ? -11.481 80.183 -7.757  1.00   32.09 ? 177  PHE A O   1 
ATOM   1416 C CB  . PHE A 1 177 ? -14.277 81.515 -8.656  1.00   35.07 ? 177  PHE A CB  1 
ATOM   1417 C CG  . PHE A 1 177 ? -15.544 82.257 -8.425  1.00   31.94 ? 177  PHE A CG  1 
ATOM   1418 C CD1 . PHE A 1 177 ? -16.747 81.771 -8.915  1.00   40.44 ? 177  PHE A CD1 1 
ATOM   1419 C CD2 . PHE A 1 177 ? -15.543 83.450 -7.702  1.00   36.55 ? 177  PHE A CD2 1 
ATOM   1420 C CE1 . PHE A 1 177 ? -17.936 82.467 -8.694  1.00   37.38 ? 177  PHE A CE1 1 
ATOM   1421 C CE2 . PHE A 1 177 ? -16.726 84.146 -7.477  1.00   43.42 ? 177  PHE A CE2 1 
ATOM   1422 C CZ  . PHE A 1 177 ? -17.916 83.659 -7.980  1.00   34.04 ? 177  PHE A CZ  1 
ATOM   1423 N N   . PRO A 1 178 ? -13.009 78.630 -8.349  1.00   33.36 ? 178  PRO A N   1 
ATOM   1424 C CA  . PRO A 1 178 ? -12.050 77.733 -8.993  1.00   34.30 ? 178  PRO A CA  1 
ATOM   1425 C C   . PRO A 1 178 ? -11.576 78.331 -10.317 1.00   38.15 ? 178  PRO A C   1 
ATOM   1426 O O   . PRO A 1 178 ? -12.340 79.028 -10.983 1.00   35.48 ? 178  PRO A O   1 
ATOM   1427 C CB  . PRO A 1 178 ? -12.870 76.459 -9.233  1.00   37.90 ? 178  PRO A CB  1 
ATOM   1428 C CG  . PRO A 1 178 ? -14.311 76.928 -9.271  1.00   37.08 ? 178  PRO A CG  1 
ATOM   1429 C CD  . PRO A 1 178 ? -14.373 78.071 -8.313  1.00   36.32 ? 178  PRO A CD  1 
ATOM   1430 N N   . SER A 1 179 ? -10.320 78.088 -10.675 1.00   37.24 ? 179  SER A N   1 
ATOM   1431 C CA  . SER A 1 179 ? -9.827  78.425 -12.006 1.00   35.75 ? 179  SER A CA  1 
ATOM   1432 C C   . SER A 1 179 ? -10.606 77.645 -13.055 1.00   38.01 ? 179  SER A C   1 
ATOM   1433 O O   . SER A 1 179 ? -11.250 76.635 -12.746 1.00   35.28 ? 179  SER A O   1 
ATOM   1434 C CB  . SER A 1 179 ? -8.355  78.041 -12.120 1.00   32.19 ? 179  SER A CB  1 
ATOM   1435 O OG  . SER A 1 179 ? -8.241  76.631 -12.091 1.00   28.49 ? 179  SER A OG  1 
ATOM   1436 N N   . GLU A 1 180 ? -10.507 78.079 -14.310 1.00   39.25 ? 180  GLU A N   1 
ATOM   1437 C CA  . GLU A 1 180 ? -10.853 77.205 -15.428 1.00   38.94 ? 180  GLU A CA  1 
ATOM   1438 C C   . GLU A 1 180 ? -10.033 75.947 -15.298 1.00   36.09 ? 180  GLU A C   1 
ATOM   1439 O O   . GLU A 1 180 ? -8.894  75.996 -14.831 1.00   36.63 ? 180  GLU A O   1 
ATOM   1440 C CB  . GLU A 1 180 ? -10.549 77.885 -16.774 1.00   38.99 ? 180  GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 180 ? -11.593 78.903 -17.200 1.00   51.92 ? 180  GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 180 ? -12.999 78.339 -17.180 1.00   58.49 ? 180  GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 180 ? -13.270 77.393 -17.951 1.00   66.07 ? 180  GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 180 ? -13.836 78.840 -16.391 1.00   67.57 ? 180  GLU A OE2 1 
ATOM   1445 N N   . PRO A 1 181 ? -10.604 74.817 -15.705 1.00   36.10 ? 181  PRO A N   1 
ATOM   1446 C CA  . PRO A 1 181 ? -9.964  73.517 -15.505 1.00   35.48 ? 181  PRO A CA  1 
ATOM   1447 C C   . PRO A 1 181 ? -8.837  73.277 -16.488 1.00   34.53 ? 181  PRO A C   1 
ATOM   1448 O O   . PRO A 1 181 ? -8.818  73.844 -17.583 1.00   32.22 ? 181  PRO A O   1 
ATOM   1449 C CB  . PRO A 1 181 ? -11.103 72.526 -15.763 1.00   38.82 ? 181  PRO A CB  1 
ATOM   1450 C CG  . PRO A 1 181 ? -12.000 73.234 -16.734 1.00   42.06 ? 181  PRO A CG  1 
ATOM   1451 C CD  . PRO A 1 181 ? -11.908 74.700 -16.384 1.00   41.06 ? 181  PRO A CD  1 
ATOM   1452 N N   . VAL A 1 182 ? -7.887  72.444 -16.087 1.00   33.25 ? 182  VAL A N   1 
ATOM   1453 C CA  . VAL A 1 182 ? -6.908  71.917 -17.004 1.00   32.51 ? 182  VAL A CA  1 
ATOM   1454 C C   . VAL A 1 182 ? -6.946  70.410 -16.926 1.00   33.12 ? 182  VAL A C   1 
ATOM   1455 O O   . VAL A 1 182 ? -6.825  69.827 -15.845 1.00   33.76 ? 182  VAL A O   1 
ATOM   1456 C CB  . VAL A 1 182 ? -5.472  72.426 -16.667 1.00   31.37 ? 182  VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 182 ? -4.438  71.688 -17.503 1.00   29.98 ? 182  VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 182 ? -5.380  73.936 -16.899 1.00   38.91 ? 182  VAL A CG2 1 
ATOM   1459 N N   . LYS A 1 183 ? -7.149  69.772 -18.066 1.00   29.48 ? 183  LYS A N   1 
ATOM   1460 C CA  . LYS A 1 183 ? -7.204  68.327 -18.103 1.00   32.68 ? 183  LYS A CA  1 
ATOM   1461 C C   . LYS A 1 183 ? -5.852  67.773 -18.517 1.00   31.78 ? 183  LYS A C   1 
ATOM   1462 O O   . LYS A 1 183 ? -5.430  67.946 -19.650 1.00   33.05 ? 183  LYS A O   1 
ATOM   1463 C CB  . LYS A 1 183 ? -8.296  67.852 -19.072 1.00   31.62 ? 183  LYS A CB  1 
ATOM   1464 C CG  . LYS A 1 183 ? -8.432  66.312 -19.153 1.00   40.49 ? 183  LYS A CG  1 
ATOM   1465 C CD  . LYS A 1 183 ? -9.742  65.909 -19.872 1.00   41.42 ? 183  LYS A CD  1 
ATOM   1466 C CE  . LYS A 1 183 ? -10.022 64.406 -19.745 1.00   56.44 ? 183  LYS A CE  1 
ATOM   1467 N NZ  . LYS A 1 183 ? -10.893 63.914 -20.865 1.00   58.03 ? 183  LYS A NZ  1 
ATOM   1468 N N   . LEU A 1 184 ? -5.169  67.122 -17.582 1.00   30.57 ? 184  LEU A N   1 
ATOM   1469 C CA  . LEU A 1 184 ? -3.836  66.582 -17.848 1.00   30.50 ? 184  LEU A CA  1 
ATOM   1470 C C   . LEU A 1 184 ? -3.924  65.192 -18.480 1.00   31.79 ? 184  LEU A C   1 
ATOM   1471 O O   . LEU A 1 184 ? -4.409  64.252 -17.856 1.00   31.29 ? 184  LEU A O   1 
ATOM   1472 C CB  . LEU A 1 184 ? -3.033  66.494 -16.546 1.00   30.80 ? 184  LEU A CB  1 
ATOM   1473 C CG  . LEU A 1 184 ? -1.615  65.943 -16.696 1.00   33.73 ? 184  LEU A CG  1 
ATOM   1474 C CD1 . LEU A 1 184 ? -0.750  66.925 -17.507 1.00   29.01 ? 184  LEU A CD1 1 
ATOM   1475 C CD2 . LEU A 1 184 ? -0.999  65.668 -15.317 1.00   32.80 ? 184  LEU A CD2 1 
ATOM   1476 N N   . LEU A 1 185 ? -3.454  65.071 -19.711 1.00   32.34 ? 185  LEU A N   1 
ATOM   1477 C CA  . LEU A 1 185 ? -3.426  63.784 -20.388 1.00   36.25 ? 185  LEU A CA  1 
ATOM   1478 C C   . LEU A 1 185 ? -2.040  63.200 -20.290 1.00   38.58 ? 185  LEU A C   1 
ATOM   1479 O O   . LEU A 1 185 ? -1.045  63.873 -20.591 1.00   39.04 ? 185  LEU A O   1 
ATOM   1480 C CB  . LEU A 1 185 ? -3.836  63.927 -21.840 1.00   33.69 ? 185  LEU A CB  1 
ATOM   1481 C CG  . LEU A 1 185 ? -5.073  64.796 -22.074 1.00   36.05 ? 185  LEU A CG  1 
ATOM   1482 C CD1 . LEU A 1 185 ? -5.323  64.959 -23.558 1.00   35.40 ? 185  LEU A CD1 1 
ATOM   1483 C CD2 . LEU A 1 185 ? -6.308  64.190 -21.368 1.00   44.04 ? 185  LEU A CD2 1 
ATOM   1484 N N   . VAL A 1 186 ? -1.971  61.964 -19.815 1.00   35.18 ? 186  VAL A N   1 
ATOM   1485 C CA  . VAL A 1 186 ? -0.706  61.278 -19.639 1.00   35.34 ? 186  VAL A CA  1 
ATOM   1486 C C   . VAL A 1 186 ? -0.746  59.970 -20.407 1.00   43.94 ? 186  VAL A C   1 
ATOM   1487 O O   . VAL A 1 186 ? -1.632  59.126 -20.172 1.00   39.90 ? 186  VAL A O   1 
ATOM   1488 C CB  . VAL A 1 186 ? -0.451  60.945 -18.182 1.00   32.21 ? 186  VAL A CB  1 
ATOM   1489 C CG1 . VAL A 1 186 ? 0.914   60.233 -18.025 1.00   37.36 ? 186  VAL A CG1 1 
ATOM   1490 C CG2 . VAL A 1 186 ? -0.534  62.209 -17.304 1.00   36.10 ? 186  VAL A CG2 1 
ATOM   1491 N N   . THR A 1 187 ? 0.215   59.799 -21.309 1.00   44.24 ? 187  THR A N   1 
ATOM   1492 C CA  . THR A 1 187 ? 0.340   58.578 -22.102 1.00   51.57 ? 187  THR A CA  1 
ATOM   1493 C C   . THR A 1 187 ? 1.270   57.566 -21.447 1.00   56.57 ? 187  THR A C   1 
ATOM   1494 O O   . THR A 1 187 ? 2.169   57.932 -20.691 1.00   53.62 ? 187  THR A O   1 
ATOM   1495 C CB  . THR A 1 187 ? 0.864   58.913 -23.500 1.00   50.93 ? 187  THR A CB  1 
ATOM   1496 O OG1 . THR A 1 187 ? -0.056  59.800 -24.160 1.00   49.80 ? 187  THR A OG1 1 
ATOM   1497 C CG2 . THR A 1 187 ? 0.867   57.667 -24.378 1.00   53.10 ? 187  THR A CG2 1 
ATOM   1498 N N   . GLY A 1 188 ? 1.047   56.287 -21.746 1.00   65.17 ? 188  GLY A N   1 
ATOM   1499 C CA  . GLY A 1 188 ? 2.116   55.300 -21.728 1.00   69.25 ? 188  GLY A CA  1 
ATOM   1500 C C   . GLY A 1 188 ? 2.011   54.325 -20.573 1.00   72.81 ? 188  GLY A C   1 
ATOM   1501 O O   . GLY A 1 188 ? 3.018   54.021 -19.925 1.00   73.24 ? 188  GLY A O   1 
ATOM   1502 O OXT . GLY A 1 188 ? 0.923   53.818 -20.270 1.00   73.81 ? 188  GLY A OXT 1 
HETATM 1503 C C1  . EDO B 2 .   ? -16.111 73.013 17.527  1.00   34.13 ? 1189 EDO A C1  1 
HETATM 1504 O O1  . EDO B 2 .   ? -16.241 73.890 18.659  1.00   33.48 ? 1189 EDO A O1  1 
HETATM 1505 C C2  . EDO B 2 .   ? -14.624 72.805 17.220  1.00   31.18 ? 1189 EDO A C2  1 
HETATM 1506 O O2  . EDO B 2 .   ? -14.003 74.069 16.959  1.00   37.82 ? 1189 EDO A O2  1 
HETATM 1507 O O   . HOH C 3 .   ? -15.578 59.061 23.889  1.00   39.18 ? 2001 HOH A O   1 
HETATM 1508 O O   . HOH C 3 .   ? -9.084  63.727 15.900  1.00   55.37 ? 2002 HOH A O   1 
HETATM 1509 O O   . HOH C 3 .   ? -9.833  64.068 19.769  0.50   52.96 ? 2003 HOH A O   1 
HETATM 1510 O O   . HOH C 3 .   ? -14.080 55.877 16.988  1.00   45.32 ? 2004 HOH A O   1 
HETATM 1511 O O   . HOH C 3 .   ? -9.833  64.068 19.769  1.00   62.96 ? 2005 HOH A O   1 
HETATM 1512 O O   . HOH C 3 .   ? -12.449 66.852 5.171   1.00   35.06 ? 2006 HOH A O   1 
HETATM 1513 O O   . HOH C 3 .   ? -18.689 71.757 -5.413  1.00   41.45 ? 2007 HOH A O   1 
HETATM 1514 O O   . HOH C 3 .   ? -12.782 60.120 15.055  1.00   47.46 ? 2008 HOH A O   1 
HETATM 1515 O O   . HOH C 3 .   ? -13.575 63.498 7.746   1.00   40.93 ? 2009 HOH A O   1 
HETATM 1516 O O   . HOH C 3 .   ? -16.268 63.468 2.460   1.00   56.18 ? 2010 HOH A O   1 
HETATM 1517 O O   . HOH C 3 .   ? -15.010 65.383 5.087   1.00   43.12 ? 2011 HOH A O   1 
HETATM 1518 O O   . HOH C 3 .   ? -21.198 71.678 -4.361  1.00   43.14 ? 2012 HOH A O   1 
HETATM 1519 O O   . HOH C 3 .   ? -23.666 58.758 3.342   1.00   49.45 ? 2013 HOH A O   1 
HETATM 1520 O O   . HOH C 3 .   ? -19.543 60.257 1.607   1.00   55.73 ? 2014 HOH A O   1 
HETATM 1521 O O   . HOH C 3 .   ? -26.087 68.165 0.715   0.50   55.94 ? 2015 HOH A O   1 
HETATM 1522 O O   . HOH C 3 .   ? -19.465 70.689 -0.537  1.00   34.30 ? 2016 HOH A O   1 
HETATM 1523 O O   . HOH C 3 .   ? -14.272 66.239 2.154   1.00   40.60 ? 2017 HOH A O   1 
HETATM 1524 O O   . HOH C 3 .   ? -21.747 71.421 -1.493  1.00   45.32 ? 2018 HOH A O   1 
HETATM 1525 O O   . HOH C 3 .   ? -35.946 50.824 16.525  1.00   50.95 ? 2019 HOH A O   1 
HETATM 1526 O O   . HOH C 3 .   ? -25.268 66.040 1.118   0.50   52.39 ? 2020 HOH A O   1 
HETATM 1527 O O   . HOH C 3 .   ? -24.840 62.071 7.229   0.50   40.42 ? 2021 HOH A O   1 
HETATM 1528 O O   . HOH C 3 .   ? -18.037 56.191 16.498  1.00   40.77 ? 2022 HOH A O   1 
HETATM 1529 O O   . HOH C 3 .   ? -12.751 70.265 20.605  1.00   41.58 ? 2023 HOH A O   1 
HETATM 1530 O O   . HOH C 3 .   ? -22.824 48.065 12.488  1.00   51.90 ? 2024 HOH A O   1 
HETATM 1531 O O   . HOH C 3 .   ? -30.524 54.153 24.136  1.00   43.09 ? 2025 HOH A O   1 
HETATM 1532 O O   . HOH C 3 .   ? -33.235 60.380 21.419  1.00   31.20 ? 2026 HOH A O   1 
HETATM 1533 O O   . HOH C 3 .   ? -28.702 67.440 26.732  1.00   38.54 ? 2027 HOH A O   1 
HETATM 1534 O O   . HOH C 3 .   ? -10.796 68.388 20.256  1.00   40.19 ? 2028 HOH A O   1 
HETATM 1535 O O   . HOH C 3 .   ? -7.043  67.989 15.353  1.00   49.13 ? 2029 HOH A O   1 
HETATM 1536 O O   . HOH C 3 .   ? -9.325  70.710 5.144   1.00   45.73 ? 2030 HOH A O   1 
HETATM 1537 O O   . HOH C 3 .   ? -7.082  70.105 13.156  1.00   47.00 ? 2031 HOH A O   1 
HETATM 1538 O O   . HOH C 3 .   ? -10.482 82.630 -15.818 1.00   46.33 ? 2032 HOH A O   1 
HETATM 1539 O O   . HOH C 3 .   ? -18.814 80.069 16.447  1.00   36.95 ? 2033 HOH A O   1 
HETATM 1540 O O   . HOH C 3 .   ? -11.078 77.822 13.096  1.00   35.76 ? 2034 HOH A O   1 
HETATM 1541 O O   . HOH C 3 .   ? -13.166 80.591 10.704  1.00   49.79 ? 2035 HOH A O   1 
HETATM 1542 O O   . HOH C 3 .   ? -15.614 81.945 11.499  1.00   55.91 ? 2036 HOH A O   1 
HETATM 1543 O O   . HOH C 3 .   ? -27.852 76.410 18.810  1.00   58.68 ? 2037 HOH A O   1 
HETATM 1544 O O   . HOH C 3 .   ? -29.713 74.040 13.927  1.00   57.51 ? 2038 HOH A O   1 
HETATM 1545 O O   . HOH C 3 .   ? 9.819   69.870 -10.429 1.00   38.95 ? 2039 HOH A O   1 
HETATM 1546 O O   . HOH C 3 .   ? 10.427  70.858 -14.284 1.00   46.15 ? 2040 HOH A O   1 
HETATM 1547 O O   . HOH C 3 .   ? -30.455 68.410 13.317  1.00   45.91 ? 2041 HOH A O   1 
HETATM 1548 O O   . HOH C 3 .   ? -30.972 71.668 15.603  1.00   41.80 ? 2042 HOH A O   1 
HETATM 1549 O O   . HOH C 3 .   ? -33.287 63.166 13.200  1.00   55.24 ? 2043 HOH A O   1 
HETATM 1550 O O   . HOH C 3 .   ? -31.901 60.408 13.791  1.00   40.62 ? 2044 HOH A O   1 
HETATM 1551 O O   . HOH C 3 .   ? -33.988 65.422 16.286  1.00   39.53 ? 2045 HOH A O   1 
HETATM 1552 O O   . HOH C 3 .   ? 1.006   87.554 -1.531  1.00   53.82 ? 2046 HOH A O   1 
HETATM 1553 O O   . HOH C 3 .   ? -34.312 59.189 14.555  1.00   37.87 ? 2047 HOH A O   1 
HETATM 1554 O O   . HOH C 3 .   ? -34.580 56.522 14.280  1.00   38.70 ? 2048 HOH A O   1 
HETATM 1555 O O   . HOH C 3 .   ? -33.708 52.694 15.652  1.00   38.60 ? 2049 HOH A O   1 
HETATM 1556 O O   . HOH C 3 .   ? -28.523 49.834 20.527  1.00   44.50 ? 2050 HOH A O   1 
HETATM 1557 O O   . HOH C 3 .   ? -36.751 50.393 19.380  1.00   47.34 ? 2051 HOH A O   1 
HETATM 1558 O O   . HOH C 3 .   ? -30.948 51.200 11.148  1.00   35.08 ? 2052 HOH A O   1 
HETATM 1559 O O   . HOH C 3 .   ? -36.961 48.490 15.829  1.00   40.33 ? 2053 HOH A O   1 
HETATM 1560 O O   . HOH C 3 .   ? -27.666 57.044 17.699  1.00   31.24 ? 2054 HOH A O   1 
HETATM 1561 O O   . HOH C 3 .   ? -30.069 59.652 11.807  1.00   25.18 ? 2055 HOH A O   1 
HETATM 1562 O O   . HOH C 3 .   ? -23.504 51.551 9.268   1.00   41.99 ? 2056 HOH A O   1 
HETATM 1563 O O   . HOH C 3 .   ? 7.657   62.368 -7.307  1.00   50.68 ? 2057 HOH A O   1 
HETATM 1564 O O   . HOH C 3 .   ? -25.362 61.077 8.557   0.50   30.51 ? 2058 HOH A O   1 
HETATM 1565 O O   . HOH C 3 .   ? -32.251 62.562 4.559   1.00   50.71 ? 2059 HOH A O   1 
HETATM 1566 O O   . HOH C 3 .   ? -30.011 62.172 10.857  1.00   31.25 ? 2060 HOH A O   1 
HETATM 1567 O O   . HOH C 3 .   ? -28.960 59.367 5.522   1.00   52.64 ? 2061 HOH A O   1 
HETATM 1568 O O   . HOH C 3 .   ? 4.816   58.102 -9.120  1.00   52.10 ? 2062 HOH A O   1 
HETATM 1569 O O   . HOH C 3 .   ? -29.016 70.339 11.162  1.00   49.79 ? 2063 HOH A O   1 
HETATM 1570 O O   . HOH C 3 .   ? -24.691 82.694 1.133   1.00   54.99 ? 2064 HOH A O   1 
HETATM 1571 O O   . HOH C 3 .   ? -17.976 82.705 12.049  1.00   40.16 ? 2065 HOH A O   1 
HETATM 1572 O O   . HOH C 3 .   ? -5.365  73.380 -21.376 1.00   44.30 ? 2066 HOH A O   1 
HETATM 1573 O O   . HOH C 3 .   ? -8.517  67.628 -23.099 1.00   47.91 ? 2067 HOH A O   1 
HETATM 1574 O O   . HOH C 3 .   ? 3.481   58.921 -27.091 1.00   40.90 ? 2068 HOH A O   1 
HETATM 1575 O O   . HOH C 3 .   ? -15.547 70.271 20.673  1.00   41.30 ? 2069 HOH A O   1 
HETATM 1576 O O   . HOH C 3 .   ? -31.868 60.610 28.617  1.00   53.73 ? 2070 HOH A O   1 
HETATM 1577 O O   . HOH C 3 .   ? -25.928 57.462 32.424  1.00   54.16 ? 2071 HOH A O   1 
HETATM 1578 O O   . HOH C 3 .   ? -26.468 66.858 29.170  1.00   46.19 ? 2072 HOH A O   1 
HETATM 1579 O O   . HOH C 3 .   ? -20.323 63.752 30.366  1.00   41.68 ? 2073 HOH A O   1 
HETATM 1580 O O   . HOH C 3 .   ? -10.437 64.904 23.304  1.00   52.58 ? 2074 HOH A O   1 
HETATM 1581 O O   . HOH C 3 .   ? -11.463 63.688 21.143  0.50   45.88 ? 2075 HOH A O   1 
HETATM 1582 O O   . HOH C 3 .   ? -10.806 66.282 18.489  1.00   38.81 ? 2076 HOH A O   1 
HETATM 1583 O O   . HOH C 3 .   ? -11.013 65.814 10.379  1.00   38.82 ? 2077 HOH A O   1 
HETATM 1584 O O   . HOH C 3 .   ? -9.009  66.271 14.286  1.00   39.92 ? 2078 HOH A O   1 
HETATM 1585 O O   . HOH C 3 .   ? -9.506  71.120 11.948  1.00   35.77 ? 2079 HOH A O   1 
HETATM 1586 O O   . HOH C 3 .   ? -11.758 69.443 5.821   1.00   33.42 ? 2080 HOH A O   1 
HETATM 1587 O O   . HOH C 3 .   ? -10.819 68.796 8.181   1.00   33.29 ? 2081 HOH A O   1 
HETATM 1588 O O   . HOH C 3 .   ? -15.910 75.381 -5.580  0.50   29.51 ? 2082 HOH A O   1 
HETATM 1589 O O   . HOH C 3 .   ? -17.035 75.753 -7.521  0.50   36.47 ? 2083 HOH A O   1 
HETATM 1590 O O   . HOH C 3 .   ? -18.125 86.968 -3.623  1.00   47.21 ? 2084 HOH A O   1 
HETATM 1591 O O   . HOH C 3 .   ? -17.371 87.864 -7.383  1.00   50.47 ? 2085 HOH A O   1 
HETATM 1592 O O   . HOH C 3 .   ? -9.758  84.826 -14.351 1.00   43.19 ? 2086 HOH A O   1 
HETATM 1593 O O   . HOH C 3 .   ? -14.824 85.943 -10.116 1.00   57.41 ? 2087 HOH A O   1 
HETATM 1594 O O   . HOH C 3 .   ? -11.271 87.552 -10.949 1.00   47.60 ? 2088 HOH A O   1 
HETATM 1595 O O   . HOH C 3 .   ? -15.294 82.225 -12.292 1.00   47.66 ? 2089 HOH A O   1 
HETATM 1596 O O   . HOH C 3 .   ? -9.122  80.491 -14.645 1.00   36.79 ? 2090 HOH A O   1 
HETATM 1597 O O   . HOH C 3 .   ? -6.831  77.158 -16.786 1.00   52.21 ? 2091 HOH A O   1 
HETATM 1598 O O   . HOH C 3 .   ? -6.747  79.802 -16.070 1.00   44.16 ? 2092 HOH A O   1 
HETATM 1599 O O   . HOH C 3 .   ? -0.935  76.287 -19.340 1.00   40.58 ? 2093 HOH A O   1 
HETATM 1600 O O   . HOH C 3 .   ? 1.317   75.001 -21.107 1.00   44.67 ? 2094 HOH A O   1 
HETATM 1601 O O   . HOH C 3 .   ? 5.814   75.301 -21.634 1.00   49.74 ? 2095 HOH A O   1 
HETATM 1602 O O   . HOH C 3 .   ? -1.942  63.222 -25.456 1.00   39.48 ? 2096 HOH A O   1 
HETATM 1603 O O   . HOH C 3 .   ? -4.645  69.447 -24.558 1.00   44.15 ? 2097 HOH A O   1 
HETATM 1604 O O   . HOH C 3 .   ? 2.133   63.430 -24.879 1.00   41.05 ? 2098 HOH A O   1 
HETATM 1605 O O   . HOH C 3 .   ? -0.321  62.406 -23.336 1.00   44.31 ? 2099 HOH A O   1 
HETATM 1606 O O   . HOH C 3 .   ? 2.678   55.510 -16.130 1.00   50.03 ? 2100 HOH A O   1 
HETATM 1607 O O   . HOH C 3 .   ? 6.933   57.219 -21.010 1.00   42.47 ? 2101 HOH A O   1 
HETATM 1608 O O   . HOH C 3 .   ? 4.825   64.453 -24.509 1.00   41.23 ? 2102 HOH A O   1 
HETATM 1609 O O   . HOH C 3 .   ? 8.875   68.880 -17.845 1.00   33.95 ? 2103 HOH A O   1 
HETATM 1610 O O   . HOH C 3 .   ? 7.582   70.935 -14.581 1.00   38.30 ? 2104 HOH A O   1 
HETATM 1611 O O   . HOH C 3 .   ? 8.689   72.584 -10.749 1.00   36.45 ? 2105 HOH A O   1 
HETATM 1612 O O   . HOH C 3 .   ? -1.286  80.517 -13.724 1.00   38.85 ? 2106 HOH A O   1 
HETATM 1613 O O   . HOH C 3 .   ? -2.249  87.978 -4.295  1.00   41.63 ? 2107 HOH A O   1 
HETATM 1614 O O   . HOH C 3 .   ? -4.451  83.202 -2.706  1.00   33.72 ? 2108 HOH A O   1 
HETATM 1615 O O   . HOH C 3 .   ? -0.714  86.160 -3.288  1.00   44.17 ? 2109 HOH A O   1 
HETATM 1616 O O   . HOH C 3 .   ? -14.316 61.953 -5.450  1.00   57.78 ? 2110 HOH A O   1 
HETATM 1617 O O   . HOH C 3 .   ? -14.672 65.369 -8.564  1.00   53.68 ? 2111 HOH A O   1 
HETATM 1618 O O   . HOH C 3 .   ? 2.484   70.148 -5.669  1.00   44.77 ? 2112 HOH A O   1 
HETATM 1619 O O   . HOH C 3 .   ? -4.192  67.789 -5.977  1.00   39.04 ? 2113 HOH A O   1 
HETATM 1620 O O   . HOH C 3 .   ? -5.034  75.744 5.161   1.00   41.16 ? 2114 HOH A O   1 
HETATM 1621 O O   . HOH C 3 .   ? 2.298   73.775 5.591   1.00   51.01 ? 2115 HOH A O   1 
HETATM 1622 O O   . HOH C 3 .   ? -1.414  69.953 1.131   1.00   49.60 ? 2116 HOH A O   1 
HETATM 1623 O O   . HOH C 3 .   ? 4.361   75.780 -1.253  1.00   47.82 ? 2117 HOH A O   1 
HETATM 1624 O O   . HOH C 3 .   ? -1.981  78.655 6.057   1.00   31.94 ? 2118 HOH A O   1 
HETATM 1625 O O   . HOH C 3 .   ? 5.109   78.255 -4.728  1.00   45.10 ? 2119 HOH A O   1 
HETATM 1626 O O   . HOH C 3 .   ? 6.479   83.330 -4.176  1.00   54.24 ? 2120 HOH A O   1 
HETATM 1627 O O   . HOH C 3 .   ? 6.248   80.557 -5.946  1.00   53.07 ? 2121 HOH A O   1 
HETATM 1628 O O   . HOH C 3 .   ? 3.839   74.058 -3.599  1.00   50.62 ? 2122 HOH A O   1 
HETATM 1629 O O   . HOH C 3 .   ? 5.931   62.225 -9.207  1.00   38.26 ? 2123 HOH A O   1 
HETATM 1630 O O   . HOH C 3 .   ? 2.966   63.907 -7.412  1.00   48.76 ? 2124 HOH A O   1 
HETATM 1631 O O   . HOH C 3 .   ? 7.423   68.682 -11.140 1.00   32.87 ? 2125 HOH A O   1 
HETATM 1632 O O   . HOH C 3 .   ? 6.919   57.683 -14.480 1.00   51.65 ? 2126 HOH A O   1 
HETATM 1633 O O   . HOH C 3 .   ? 4.484   60.410 -8.122  1.00   48.54 ? 2127 HOH A O   1 
HETATM 1634 O O   . HOH C 3 .   ? -10.888 64.375 -16.169 1.00   52.96 ? 2128 HOH A O   1 
HETATM 1635 O O   . HOH C 3 .   ? -1.739  64.770 -8.983  1.00   41.64 ? 2129 HOH A O   1 
HETATM 1636 O O   . HOH C 3 .   ? -5.066  81.731 3.678   1.00   36.81 ? 2130 HOH A O   1 
HETATM 1637 O O   . HOH C 3 .   ? -9.582  80.746 9.319   1.00   41.17 ? 2131 HOH A O   1 
HETATM 1638 O O   . HOH C 3 .   ? -6.276  68.798 -21.916 1.00   33.16 ? 2132 HOH A O   1 
HETATM 1639 O O   . HOH C 3 .   ? -7.156  71.015 -20.606 1.00   44.19 ? 2133 HOH A O   1 
HETATM 1640 O O   . HOH C 3 .   ? -6.908  62.940 -18.074 1.00   48.40 ? 2134 HOH A O   1 
HETATM 1641 O O   . HOH C 3 .   ? -4.627  60.568 -20.269 1.00   39.31 ? 2135 HOH A O   1 
HETATM 1642 O O   . HOH C 3 .   ? 1.916   60.866 -25.997 1.00   46.08 ? 2136 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   1   1   THR THR A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   TRP 8   8   8   TRP TRP A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  CYS 24  24  24  CYS CYS A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 CYS 120 120 120 CYS CYS A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 CYS 166 166 166 CYS CYS A . n 
A 1 167 PHE 167 167 167 PHE PHE A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 TYR 170 170 170 TYR TYR A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 TRP 175 175 175 TRP TRP A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1   1189 1189 EDO EDO A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-09-04 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-03-06 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow              
2 4 'Structure model' pdbx_database_proc              
3 4 'Structure model' pdbx_database_status            
4 4 'Structure model' pdbx_unobs_or_zero_occ_atoms    
5 4 'Structure model' pdbx_unobs_or_zero_occ_residues 
6 5 'Structure model' diffrn_source                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.temp'                    
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       . ? 1 
DENZO     'data reduction' . ? 2 
SCALEPACK 'data scaling'   . ? 3 
AMoRE     phasing          . ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A GLN 20 ? ? CD A GLN 20 ? ? 1.826 1.506 0.320 0.023 N 
2 1 CG A LYS 58 ? ? CD A LYS 58 ? ? 1.824 1.520 0.304 0.034 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A GLN 20 ? ? CG A GLN 20 ? ? CD A GLN 20 ? ? 95.12  111.60 -16.48 2.60 N 
2 1 CB A LYS 58 ? ? CG A LYS 58 ? ? CD A LYS 58 ? ? 90.78  111.60 -20.82 2.60 N 
3 1 CG A LYS 58 ? ? CD A LYS 58 ? ? CE A LYS 58 ? ? 135.52 111.90 23.62  3.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 12  ? ? -173.11 -173.79 
2 1 GLU A 18  ? ? 75.79   -8.38   
3 1 THR A 94  ? ? -113.95 -162.88 
4 1 TYR A 97  ? ? 74.16   -123.15 
5 1 THR A 124 ? ? -117.32 58.17   
6 1 VAL A 147 ? ? 58.08   -7.76   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 water          HOH 
#