data_1OO9
# 
_entry.id   1OO9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OO9         
RCSB  RCSB018496   
WWPDB D_1000018496 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UEA 
_pdbx_database_related.details        'Crystal structure of MMP-3 with full length TIMP-1.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OO9 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arumugam, S.'    1 
'Van Doren, S.R.' 2 
# 
_citation.id                        primary 
_citation.title                     'Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                7950 
_citation.page_last                 7958 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12834347 
_citation.pdbx_database_id_DOI      10.1021/bi034545s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arumugam, S.'    1 
primary 'Van Doren, S.R.' 2 
# 
_cell.entry_id           1OO9 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OO9 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Stromelysin-1                   18887.029 1 3.4.24.17 ? 'CATALYTIC DOMAIN'  ? 
2 polymer man 'Metalloproteinase inhibitor 1' 14269.307 1 ?         ? 'N-TERMINAL DOMAIN' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Matrix metalloproteinase-3, MMP-3, Transin-1, SL-1' 
2 
;TIMP-1, Erythroid potentiating activity, EPA, Tissue inhibitor of metalloproteinases, Fibroblast collagenase inhibitor, Collagenase inhibitor
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGN
VLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGI
QSLYGPPP
;
;FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGN
VLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGI
QSLYGPPP
;
A ? 
2 'polypeptide(L)' no no 
;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS
EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
;
;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS
EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   ARG n 
1 3   THR n 
1 4   PHE n 
1 5   PRO n 
1 6   GLY n 
1 7   ILE n 
1 8   PRO n 
1 9   LYS n 
1 10  TRP n 
1 11  ARG n 
1 12  LYS n 
1 13  THR n 
1 14  HIS n 
1 15  LEU n 
1 16  THR n 
1 17  TYR n 
1 18  ARG n 
1 19  ILE n 
1 20  VAL n 
1 21  ASN n 
1 22  TYR n 
1 23  THR n 
1 24  PRO n 
1 25  ASP n 
1 26  LEU n 
1 27  PRO n 
1 28  LYS n 
1 29  ASP n 
1 30  ALA n 
1 31  VAL n 
1 32  ASP n 
1 33  SER n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  ALA n 
1 39  LEU n 
1 40  LYS n 
1 41  VAL n 
1 42  TRP n 
1 43  GLU n 
1 44  GLU n 
1 45  VAL n 
1 46  THR n 
1 47  PRO n 
1 48  LEU n 
1 49  THR n 
1 50  PHE n 
1 51  SER n 
1 52  ARG n 
1 53  LEU n 
1 54  TYR n 
1 55  GLU n 
1 56  GLY n 
1 57  GLU n 
1 58  ALA n 
1 59  ASP n 
1 60  ILE n 
1 61  MET n 
1 62  ILE n 
1 63  SER n 
1 64  PHE n 
1 65  ALA n 
1 66  VAL n 
1 67  ARG n 
1 68  GLU n 
1 69  HIS n 
1 70  GLY n 
1 71  ASP n 
1 72  PHE n 
1 73  TYR n 
1 74  PRO n 
1 75  PHE n 
1 76  ASP n 
1 77  GLY n 
1 78  PRO n 
1 79  GLY n 
1 80  ASN n 
1 81  VAL n 
1 82  LEU n 
1 83  ALA n 
1 84  HIS n 
1 85  ALA n 
1 86  TYR n 
1 87  ALA n 
1 88  PRO n 
1 89  GLY n 
1 90  PRO n 
1 91  GLY n 
1 92  ILE n 
1 93  ASN n 
1 94  GLY n 
1 95  ASP n 
1 96  ALA n 
1 97  HIS n 
1 98  PHE n 
1 99  ASP n 
1 100 ASP n 
1 101 ASP n 
1 102 GLU n 
1 103 GLN n 
1 104 TRP n 
1 105 THR n 
1 106 LYS n 
1 107 ASP n 
1 108 THR n 
1 109 THR n 
1 110 GLY n 
1 111 THR n 
1 112 ASN n 
1 113 LEU n 
1 114 PHE n 
1 115 LEU n 
1 116 VAL n 
1 117 ALA n 
1 118 ALA n 
1 119 HIS n 
1 120 GLU n 
1 121 ILE n 
1 122 GLY n 
1 123 HIS n 
1 124 SER n 
1 125 LEU n 
1 126 GLY n 
1 127 LEU n 
1 128 PHE n 
1 129 HIS n 
1 130 SER n 
1 131 ALA n 
1 132 ASN n 
1 133 THR n 
1 134 GLU n 
1 135 ALA n 
1 136 LEU n 
1 137 MET n 
1 138 TYR n 
1 139 PRO n 
1 140 LEU n 
1 141 TYR n 
1 142 HIS n 
1 143 SER n 
1 144 LEU n 
1 145 THR n 
1 146 ASP n 
1 147 LEU n 
1 148 THR n 
1 149 ARG n 
1 150 PHE n 
1 151 ARG n 
1 152 LEU n 
1 153 SER n 
1 154 GLN n 
1 155 ASP n 
1 156 ASP n 
1 157 ILE n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 GLN n 
1 162 SER n 
1 163 LEU n 
1 164 TYR n 
1 165 GLY n 
1 166 PRO n 
1 167 PRO n 
1 168 PRO n 
2 1   CYS n 
2 2   THR n 
2 3   CYS n 
2 4   VAL n 
2 5   PRO n 
2 6   PRO n 
2 7   HIS n 
2 8   PRO n 
2 9   GLN n 
2 10  THR n 
2 11  ALA n 
2 12  PHE n 
2 13  CYS n 
2 14  ASN n 
2 15  SER n 
2 16  ASP n 
2 17  LEU n 
2 18  VAL n 
2 19  ILE n 
2 20  ARG n 
2 21  ALA n 
2 22  LYS n 
2 23  PHE n 
2 24  VAL n 
2 25  GLY n 
2 26  THR n 
2 27  PRO n 
2 28  GLU n 
2 29  VAL n 
2 30  ASN n 
2 31  GLN n 
2 32  THR n 
2 33  THR n 
2 34  LEU n 
2 35  TYR n 
2 36  GLN n 
2 37  ARG n 
2 38  TYR n 
2 39  GLU n 
2 40  ILE n 
2 41  LYS n 
2 42  MET n 
2 43  THR n 
2 44  LYS n 
2 45  MET n 
2 46  TYR n 
2 47  LYS n 
2 48  GLY n 
2 49  PHE n 
2 50  GLN n 
2 51  ALA n 
2 52  LEU n 
2 53  GLY n 
2 54  ASP n 
2 55  ALA n 
2 56  ALA n 
2 57  ASP n 
2 58  ILE n 
2 59  ARG n 
2 60  PHE n 
2 61  VAL n 
2 62  TYR n 
2 63  THR n 
2 64  PRO n 
2 65  ALA n 
2 66  MET n 
2 67  GLU n 
2 68  SER n 
2 69  VAL n 
2 70  CYS n 
2 71  GLY n 
2 72  TYR n 
2 73  PHE n 
2 74  HIS n 
2 75  ARG n 
2 76  SER n 
2 77  HIS n 
2 78  ASN n 
2 79  ARG n 
2 80  SER n 
2 81  GLU n 
2 82  GLU n 
2 83  PHE n 
2 84  LEU n 
2 85  ILE n 
2 86  ALA n 
2 87  GLY n 
2 88  LYS n 
2 89  LEU n 
2 90  GLN n 
2 91  ASP n 
2 92  GLY n 
2 93  LEU n 
2 94  LEU n 
2 95  HIS n 
2 96  ILE n 
2 97  THR n 
2 98  THR n 
2 99  CYS n 
2 100 SER n 
2 101 PHE n 
2 102 VAL n 
2 103 ALA n 
2 104 PRO n 
2 105 TRP n 
2 106 ASN n 
2 107 SER n 
2 108 LEU n 
2 109 SER n 
2 110 LEU n 
2 111 ALA n 
2 112 GLN n 
2 113 ARG n 
2 114 ARG n 
2 115 GLY n 
2 116 PHE n 
2 117 THR n 
2 118 LYS n 
2 119 THR n 
2 120 TYR n 
2 121 THR n 
2 122 VAL n 
2 123 GLY n 
2 124 CYS n 
2 125 GLU n 
2 126 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'MMP3 OR STMY1'         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pGEMEX-MMP-3(DC)E202Q' ? ? 
2 1 sample ? ? ? human Homo 'TIMP1 OR TIMP OR CLGI' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET3a-N-TIMP-1          ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MMP3_HUMAN  P08254 1 
;FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGN
VLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGI
QSLYGPPP
;
100 ? 
2 UNP TIMP1_HUMAN P01033 2 
;CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRS
EEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
;
24  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OO9 A 1 ? 168 ? P08254 100 ? 267 ? 83  250 
2 2 1OO9 B 1 ? 126 ? P01033 24  ? 149 ? 301 426 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 '15N-separated NOESY; HNCA; HNCO; HN(CO)CA'           
2 1 1 'HCCH-TOCSY; HCCH-COSY;'                              
3 3 2 '15N-separated NOESY; HNCA; HNCO; HN(CO)CA'           
4 4 2 '15N-separated NOESY'                                 
5 2 1 '15N-separated NOESY'                                 
6 5 2 '15N-separated NOESY'                                 
7 6 2 'coupled 15N-HSQC; coupled 13C-HSQC; Ha-coupled HNCA' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 310 ambient 6.6 '20mM Tris-d11; 100 mM NaCl; 15 mM CaCl2; 3uM ZnCl2; 1mM Sodium Azide' ? K 
2 307 ambient 6.7 '20mM Tris-d11; 125mM NaCl; 15 mM CaCl2; 50uM ZnCl2;1mM Sodium Azide'  ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 
;0.8mM MMP-3 U-15N, 13C; 0.8mM N-TIMP-1;  
20mM Tris-d11; 100 mM NaCl; 15 mM CaCl2; 3uM ZnCl2;  
1mM Sodium Azide; 93% H2O, 7% D2O
;
'93% H2O/7% D2O'                            
2 
;0.5mM MMP-3 U-2H, 15N; 0.5mM N-TIMP-1;  
20mM Tris-d11; 100 mM NaCl; 15 mM CaCl2; 3uM ZnCl2;  
1mM Sodium Azide; 93% H2O, 7% D2O
;
'93% H2O/7% D2O'                            
3 
;0.66mM N-TIMP-1 U-15N, 13C; 0.66mM MMP-3(E202Q);  
20mM Tris-d11; 125mM NaCl; 15 mM CaCl2; 50uM ZnCl2;  
1mM Sodium Azide; 93% H2O; 7% D2O
;
'93% H2O/7% D2O'                            
4 
;0.3mM 98% 2H/15N N-TIMP-1; 0.3mM MMP-3 (E202Q);  
20mM Tris-d11; 125mM NaCl; 15 mM CaCl2; 50uM ZnCl2;  
1mM Sodium Azide; 93% H2O; 7% D2O
;
'93% H2O/7% D2O'                            
5 
;0.3mM 98% 2H/15N N-TIMP-1; 0.3mM (15N-IV, 15N, 13C-L)MMP-3(E202Q);  
20mM Tris-d11; 125mM NaCl; 15 mM CaCl2; 50uM ZnCl2;  
1mM Sodium Azide; 93% H2O; 7% D2O
;
'93% H2O/7% D2O'                            
6 
;0.3mM 98% 2H/15N N-TIMP-1; 0.3mM (15N-IV, 15N, 13C-L)MMP-3(E202Q);  
20mM Tris-d11; 125mM NaCl; 15 mM CaCl2; 50uM ZnCl2;  
1mM Sodium Azide; 93% H2O; 7% D2O  
5% PEG(C12E6)/1-hexanol
;
;93% H2O; 7% D2O  
5% PEG(C12E6)/1-hexanol
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX       500 
2 ? Varian UNITYPLUS 720 
3 ? Bruker DRX       750 
4 ? Varian INOVA     600 
# 
_pdbx_nmr_refine.entry_id           1OO9 
_pdbx_nmr_refine.method             'RIGID BODY MINIMIZATION FOLLOWED BY RESTRAINED SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            
;STRUCTURES WERE CALCULATED USING XPLOR-NIH. REFINEMENTS WERE CARRIED OUT FIRST BY RIGID BODY MINIMIZATION (CLORE(2000) PROC.NATL.ACAD.SCI. 97, 9021-9025) FOLLOWED BY RESTRAINED SIMULATED ANNEALING (WANG ET AL. EMBO J. (2000) 19,5635-5649).      
      
THE CRYSTAL STRUCTURE OF THE COMPLEX BY BODE ET AL. (NATURE (1997), 389, 77-81; PDB CODE: 1UEA) HAS       
BEEN USED AS A STARTING POINT WITH PROTONS ATTACHED AND TAKING ONLY N-TERMINAL 126 RESIDUES OF TIMP-1.      
INTERFACIAL SIDE CHAINS OF THE FOLLOWING RESIDUES WERE ALLOWED TO BE FLEXIBLE: CHAIN A (MMP-3(DC)): 162-169,198-202,      
205-206, 211 AND 221-223; CHAIN B (N-TIMP-1): 302-304, 329, 333-335,366-369;  A TOTAL OF 49 NOE (46 INTERMOLECULAR       
AND 3 INTRAMOLECULAR) 75 NH DIPOLAR COULINGS FOR N-TIMP-1, 19 NH DIPOLAR COUPLINGS AND 8 CaHa DIPOLAR       
COUPLINGS FOR MMP-3 WERE USED FOR REFINEMENT. TARGET FUNCTIONS INCLUDE TERMS FOR NOE RESTRAINTS, DIPOLAR     
COUPLING RESTRAINTS AND RADIUS OF GYRATION.     
     
     
ALSO, MODULE ( DOSSET ET AL. J. BIOMOL. NMR, (2001),20,223-231) AND PALES (ZWECKSTETTER AND BAX, J. AM. CHEM. SOC     
(2000), 122, 3791-3792) WERE USED FOR EVALUATING THE ORIENTATION AND STRUCTURES.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1OO9 
_pdbx_nmr_ensemble.conformers_calculated_total_number            25 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'lowest energy structure' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XPLOR  NIH            refinement      BRUNGER                1 
PALES  'SGI Irix 6.2' 'data analysis' 'ZWECKSTETTER AND BAX' 2 
MODULE 1.0            'data analysis' 'DOSSET ET AL'         3 
# 
_exptl.entry_id          1OO9 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1OO9 
_struct.title                     'Orientation in Solution of MMP-3 Catalytic Domain and N-TIMP-1 from Residual Dipolar Couplings' 
_struct.pdbx_descriptor           'Stromelysin-1 (E.C.3.4.24.17), Metalloproteinase inhibitor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OO9 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PROTEIN-PROTEIN COMPLEX, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 27  ? GLU A 44  ? PRO A 109 GLU A 126 1 ? 18 
HELX_P HELX_P2 2 LEU A 113 ? LEU A 125 ? LEU A 195 LEU A 207 1 ? 13 
HELX_P HELX_P3 3 ASP A 146 ? PHE A 150 ? ASP A 228 PHE A 232 5 ? 5  
HELX_P HELX_P4 4 SER A 153 ? GLY A 165 ? SER A 235 GLY A 247 1 ? 13 
HELX_P HELX_P5 5 HIS B 7   ? SER B 15  ? HIS B 307 SER B 315 1 ? 9  
HELX_P HELX_P6 6 MET B 66  ? CYS B 70  ? MET B 366 CYS B 370 5 ? 5  
HELX_P HELX_P7 7 ASN B 106 ? LEU B 108 ? ASN B 406 LEU B 408 5 ? 3  
HELX_P HELX_P8 8 SER B 109 ? LYS B 118 ? SER B 409 LYS B 418 1 ? 10 
HELX_P HELX_P9 9 THR B 119 ? GLU B 125 ? THR B 419 GLU B 425 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 3  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 303 B CYS 399 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf2 disulf ? ? B CYS 13 SG ? ? ? 1_555 B CYS 124 SG ? ? B CYS 313 B CYS 424 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? B CYS 1  SG ? ? ? 1_555 B CYS 70  SG ? ? B CYS 301 B CYS 370 1_555 ? ? ? ? ? ? ? 2.057 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
C 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 49  ? ARG A 52  ? THR A 131 ARG A 134 
A 2 HIS A 14  ? ILE A 19  ? HIS A 96  ILE A 101 
A 3 ILE A 60  ? ALA A 65  ? ILE A 142 ALA A 147 
A 4 ALA A 96  ? ASP A 99  ? ALA A 178 ASP A 181 
A 5 VAL A 81  ? ALA A 85  ? VAL A 163 ALA A 167 
A 6 THR B 2   ? CYS B 3   ? THR B 302 CYS B 303 
B 1 TRP A 104 ? THR A 105 ? TRP A 186 THR A 187 
B 2 THR A 111 ? ASN A 112 ? THR A 193 ASN A 194 
C 1 VAL B 102 ? PRO B 104 ? VAL B 402 PRO B 404 
C 2 PHE B 83  ? GLN B 90  ? PHE B 383 GLN B 390 
C 3 LEU B 93  ? HIS B 95  ? LEU B 393 HIS B 395 
C 4 PHE B 60  ? PRO B 64  ? PHE B 360 PRO B 364 
C 5 TYR B 35  ? LYS B 47  ? TYR B 335 LYS B 347 
C 6 GLU B 28  ? VAL B 29  ? GLU B 328 VAL B 329 
C 7 TYR B 35  ? LYS B 47  ? TYR B 335 LYS B 347 
C 8 LEU B 17  ? PHE B 23  ? LEU B 317 PHE B 323 
C 9 PHE B 83  ? GLN B 90  ? PHE B 383 GLN B 390 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 49  ? O THR A 131 N LEU A 15  ? N LEU A 97  
A 2 3 N ARG A 18  ? N ARG A 100 O ILE A 60  ? O ILE A 142 
A 3 4 N SER A 63  ? N SER A 145 O ALA A 96  ? O ALA A 178 
A 4 5 N ASP A 99  ? N ASP A 181 O LEU A 82  ? O LEU A 164 
A 5 6 O ALA A 83  ? O ALA A 165 N THR B 2   ? N THR B 302 
B 1 2 N THR A 105 ? N THR A 187 O THR A 111 ? O THR A 193 
C 1 2 O ALA B 103 ? O ALA B 403 N LEU B 84  ? N LEU B 384 
C 2 3 O GLN B 90  ? O GLN B 390 N LEU B 93  ? N LEU B 393 
C 3 4 N LEU B 94  ? N LEU B 394 O PHE B 60  ? O PHE B 360 
C 4 5 O THR B 63  ? O THR B 363 N GLN B 36  ? N GLN B 336 
C 5 6 N ARG B 37  ? N ARG B 337 O GLU B 28  ? O GLU B 328 
C 6 7 O GLU B 28  ? O GLU B 328 N ARG B 37  ? N ARG B 337 
C 7 8 N TYR B 46  ? N TYR B 346 O VAL B 18  ? O VAL B 318 
C 8 9 O ALA B 21  ? O ALA B 321 N PHE B 83  ? N PHE B 383 
# 
_database_PDB_matrix.entry_id          1OO9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OO9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . PHE A 1 1   ? 57.669  84.408  21.631 1.00 43.61 ? 83  PHE A N    1 
ATOM 2    C CA   . PHE A 1 1   ? 57.087  85.720  21.882 1.00 44.17 ? 83  PHE A CA   1 
ATOM 3    C C    . PHE A 1 1   ? 57.041  86.460  20.562 1.00 46.50 ? 83  PHE A C    1 
ATOM 4    O O    . PHE A 1 1   ? 57.013  85.845  19.519 1.00 46.35 ? 83  PHE A O    1 
ATOM 5    C CB   . PHE A 1 1   ? 57.971  86.461  22.901 1.00 42.12 ? 83  PHE A CB   1 
ATOM 6    C CG   . PHE A 1 1   ? 57.952  85.883  24.296 1.00 43.73 ? 83  PHE A CG   1 
ATOM 7    C CD1  . PHE A 1 1   ? 56.962  86.250  25.212 1.00 41.83 ? 83  PHE A CD1  1 
ATOM 8    C CD2  . PHE A 1 1   ? 58.950  84.986  24.675 1.00 43.56 ? 83  PHE A CD2  1 
ATOM 9    C CE1  . PHE A 1 1   ? 56.978  85.711  26.502 1.00 41.45 ? 83  PHE A CE1  1 
ATOM 10   C CE2  . PHE A 1 1   ? 58.963  84.448  25.956 1.00 39.18 ? 83  PHE A CE2  1 
ATOM 11   C CZ   . PHE A 1 1   ? 57.969  84.815  26.877 1.00 39.48 ? 83  PHE A CZ   1 
ATOM 12   H HA   . PHE A 1 1   ? 56.076  85.613  22.296 1.00 0.00  ? 83  PHE A HA   1 
ATOM 13   H HB2  . PHE A 1 1   ? 58.996  86.530  22.526 1.00 0.00  ? 83  PHE A HB2  1 
ATOM 14   H HB3  . PHE A 1 1   ? 57.621  87.487  23.138 1.00 0.00  ? 83  PHE A HB3  1 
ATOM 15   H HD1  . PHE A 1 1   ? 56.184  86.952  24.926 1.00 0.00  ? 83  PHE A HD1  1 
ATOM 16   H HD2  . PHE A 1 1   ? 59.718  84.709  23.963 1.00 0.00  ? 83  PHE A HD2  1 
ATOM 17   H HE1  . PHE A 1 1   ? 56.207  86.000  27.208 1.00 0.00  ? 83  PHE A HE1  1 
ATOM 18   H HE2  . PHE A 1 1   ? 59.735  83.750  26.249 1.00 0.00  ? 83  PHE A HE2  1 
ATOM 19   H HZ   . PHE A 1 1   ? 57.984  84.394  27.877 1.00 0.00  ? 83  PHE A HZ   1 
ATOM 20   N N    . ARG A 1 2   ? 57.031  87.804  20.573 1.00 48.60 ? 84  ARG A N    1 
ATOM 21   C CA   . ARG A 1 2   ? 56.950  88.629  19.399 1.00 49.75 ? 84  ARG A CA   1 
ATOM 22   C C    . ARG A 1 2   ? 58.149  88.518  18.490 1.00 47.20 ? 84  ARG A C    1 
ATOM 23   O O    . ARG A 1 2   ? 57.984  88.515  17.283 1.00 44.85 ? 84  ARG A O    1 
ATOM 24   C CB   . ARG A 1 2   ? 56.776  90.100  19.839 1.00 56.41 ? 84  ARG A CB   1 
ATOM 25   C CG   . ARG A 1 2   ? 56.031  90.907  18.789 1.00 60.21 ? 84  ARG A CG   1 
ATOM 26   C CD   . ARG A 1 2   ? 54.499  90.709  18.855 1.00 65.05 ? 84  ARG A CD   1 
ATOM 27   N NE   . ARG A 1 2   ? 53.839  90.958  17.581 1.00 71.06 ? 84  ARG A NE   1 
ATOM 28   C CZ   . ARG A 1 2   ? 53.932  92.075  16.879 1.00 71.73 ? 84  ARG A CZ   1 
ATOM 29   N NH1  . ARG A 1 2   ? 54.622  93.121  17.271 1.00 74.25 ? 84  ARG A NH1  1 
ATOM 30   N NH2  . ARG A 1 2   ? 53.295  92.177  15.747 1.00 70.68 ? 84  ARG A NH2  1 
ATOM 31   H H    . ARG A 1 2   ? 57.036  88.339  21.423 1.00 0.00  ? 84  ARG A H    1 
ATOM 32   H HA   . ARG A 1 2   ? 56.065  88.306  18.857 1.00 0.00  ? 84  ARG A HA   1 
ATOM 33   H HB2  . ARG A 1 2   ? 56.186  90.170  20.773 1.00 0.00  ? 84  ARG A HB2  1 
ATOM 34   H HB3  . ARG A 1 2   ? 57.774  90.549  20.008 1.00 0.00  ? 84  ARG A HB3  1 
ATOM 35   H HG2  . ARG A 1 2   ? 56.371  91.922  19.095 1.00 0.00  ? 84  ARG A HG2  1 
ATOM 36   H HG3  . ARG A 1 2   ? 56.399  90.687  17.782 1.00 0.00  ? 84  ARG A HG3  1 
ATOM 37   H HD2  . ARG A 1 2   ? 54.317  89.661  19.150 1.00 0.00  ? 84  ARG A HD2  1 
ATOM 38   H HD3  . ARG A 1 2   ? 54.074  91.358  19.632 1.00 0.00  ? 84  ARG A HD3  1 
ATOM 39   H HH11 . ARG A 1 2   ? 55.056  93.138  18.203 1.00 0.00  ? 84  ARG A HH11 1 
ATOM 40   H HH12 . ARG A 1 2   ? 54.718  93.961  16.752 1.00 0.00  ? 84  ARG A HH12 1 
ATOM 41   H HH21 . ARG A 1 2   ? 52.724  91.400  15.393 1.00 0.00  ? 84  ARG A HH21 1 
ATOM 42   H HH22 . ARG A 1 2   ? 53.348  93.047  15.191 1.00 0.00  ? 84  ARG A HH22 1 
ATOM 43   N N    . THR A 1 3   ? 59.359  88.435  19.060 1.00 47.29 ? 85  THR A N    1 
ATOM 44   C CA   . THR A 1 3   ? 60.548  88.318  18.220 1.00 46.74 ? 85  THR A CA   1 
ATOM 45   C C    . THR A 1 3   ? 61.427  87.144  18.587 1.00 47.67 ? 85  THR A C    1 
ATOM 46   O O    . THR A 1 3   ? 61.855  86.402  17.721 1.00 49.27 ? 85  THR A O    1 
ATOM 47   C CB   . THR A 1 3   ? 61.367  89.615  18.295 1.00 44.79 ? 85  THR A CB   1 
ATOM 48   O OG1  . THR A 1 3   ? 60.489  90.725  18.062 1.00 45.61 ? 85  THR A OG1  1 
ATOM 49   C CG2  . THR A 1 3   ? 62.446  89.612  17.202 1.00 46.06 ? 85  THR A CG2  1 
ATOM 50   H H    . THR A 1 3   ? 59.442  88.473  20.055 1.00 0.00  ? 85  THR A H    1 
ATOM 51   H HA   . THR A 1 3   ? 60.233  88.184  17.177 1.00 0.00  ? 85  THR A HA   1 
ATOM 52   H HB   . THR A 1 3   ? 61.838  89.709  19.290 1.00 0.00  ? 85  THR A HB   1 
ATOM 53   H HG1  . THR A 1 3   ? 60.977  91.540  18.100 1.00 0.00  ? 85  THR A HG1  1 
ATOM 54   H HG21 . THR A 1 3   ? 62.182  88.914  16.398 1.00 0.00  ? 85  THR A HG21 1 
ATOM 55   H HG22 . THR A 1 3   ? 62.563  90.617  16.783 1.00 0.00  ? 85  THR A HG22 1 
ATOM 56   H HG23 . THR A 1 3   ? 63.390  89.306  17.641 1.00 0.00  ? 85  THR A HG23 1 
ATOM 57   N N    . PHE A 1 4   ? 61.710  86.986  19.882 1.00 48.69 ? 86  PHE A N    1 
ATOM 58   C CA   . PHE A 1 4   ? 62.477  85.830  20.334 1.00 51.01 ? 86  PHE A CA   1 
ATOM 59   C C    . PHE A 1 4   ? 61.487  84.709  20.614 1.00 49.23 ? 86  PHE A C    1 
ATOM 60   O O    . PHE A 1 4   ? 60.376  85.006  21.015 1.00 50.63 ? 86  PHE A O    1 
ATOM 61   C CB   . PHE A 1 4   ? 63.323  86.160  21.590 1.00 56.09 ? 86  PHE A CB   1 
ATOM 62   C CG   . PHE A 1 4   ? 62.996  87.537  22.145 1.00 64.46 ? 86  PHE A CG   1 
ATOM 63   C CD1  . PHE A 1 4   ? 63.508  88.670  21.521 1.00 69.75 ? 86  PHE A CD1  1 
ATOM 64   C CD2  . PHE A 1 4   ? 62.120  87.667  23.224 1.00 67.28 ? 86  PHE A CD2  1 
ATOM 65   C CE1  . PHE A 1 4   ? 63.124  89.946  21.945 1.00 74.95 ? 86  PHE A CE1  1 
ATOM 66   C CE2  . PHE A 1 4   ? 61.734  88.940  23.655 1.00 71.95 ? 86  PHE A CE2  1 
ATOM 67   C CZ   . PHE A 1 4   ? 62.234  90.074  23.010 1.00 75.12 ? 86  PHE A CZ   1 
ATOM 68   H H    . PHE A 1 4   ? 61.358  87.637  20.543 1.00 0.00  ? 86  PHE A H    1 
ATOM 69   H HA   . PHE A 1 4   ? 63.173  85.526  19.538 1.00 0.00  ? 86  PHE A HA   1 
ATOM 70   H HB2  . PHE A 1 4   ? 63.118  85.417  22.374 1.00 0.00  ? 86  PHE A HB2  1 
ATOM 71   H HB3  . PHE A 1 4   ? 64.397  86.148  21.342 1.00 0.00  ? 86  PHE A HB3  1 
ATOM 72   H HD1  . PHE A 1 4   ? 64.185  88.561  20.696 1.00 0.00  ? 86  PHE A HD1  1 
ATOM 73   H HD2  . PHE A 1 4   ? 61.730  86.783  23.714 1.00 0.00  ? 86  PHE A HD2  1 
ATOM 74   H HE1  . PHE A 1 4   ? 63.516  90.817  21.441 1.00 0.00  ? 86  PHE A HE1  1 
ATOM 75   H HE2  . PHE A 1 4   ? 61.046  89.034  24.483 1.00 0.00  ? 86  PHE A HE2  1 
ATOM 76   H HZ   . PHE A 1 4   ? 61.933  91.062  23.345 1.00 0.00  ? 86  PHE A HZ   1 
ATOM 77   N N    . PRO A 1 5   ? 61.872  83.428  20.418 1.00 43.64 ? 87  PRO A N    1 
ATOM 78   C CA   . PRO A 1 5   ? 60.954  82.334  20.671 1.00 36.62 ? 87  PRO A CA   1 
ATOM 79   C C    . PRO A 1 5   ? 60.659  82.210  22.145 1.00 35.34 ? 87  PRO A C    1 
ATOM 80   O O    . PRO A 1 5   ? 61.428  82.670  22.972 1.00 34.62 ? 87  PRO A O    1 
ATOM 81   C CB   . PRO A 1 5   ? 61.752  81.126  20.151 1.00 36.02 ? 87  PRO A CB   1 
ATOM 82   C CG   . PRO A 1 5   ? 63.200  81.547  20.416 1.00 37.66 ? 87  PRO A CG   1 
ATOM 83   C CD   . PRO A 1 5   ? 63.193  83.011  19.964 1.00 41.56 ? 87  PRO A CD   1 
ATOM 84   H HA   . PRO A 1 5   ? 60.030  82.445  20.094 1.00 0.00  ? 87  PRO A HA   1 
ATOM 85   H HB2  . PRO A 1 5   ? 61.507  80.193  20.682 1.00 0.00  ? 87  PRO A HB2  1 
ATOM 86   H HB3  . PRO A 1 5   ? 61.608  80.984  19.061 1.00 0.00  ? 87  PRO A HB3  1 
ATOM 87   H HG2  . PRO A 1 5   ? 63.420  81.467  21.501 1.00 0.00  ? 87  PRO A HG2  1 
ATOM 88   H HG3  . PRO A 1 5   ? 63.915  80.925  19.846 1.00 0.00  ? 87  PRO A HG3  1 
ATOM 89   H HD2  . PRO A 1 5   ? 64.023  83.545  20.445 1.00 0.00  ? 87  PRO A HD2  1 
ATOM 90   H HD3  . PRO A 1 5   ? 63.285  83.046  18.864 1.00 0.00  ? 87  PRO A HD3  1 
ATOM 91   N N    . GLY A 1 6   ? 59.511  81.580  22.449 1.00 36.28 ? 88  GLY A N    1 
ATOM 92   C CA   . GLY A 1 6   ? 59.119  81.397  23.837 1.00 34.50 ? 88  GLY A CA   1 
ATOM 93   C C    . GLY A 1 6   ? 57.675  81.780  24.100 1.00 34.83 ? 88  GLY A C    1 
ATOM 94   O O    . GLY A 1 6   ? 57.114  82.603  23.403 1.00 32.90 ? 88  GLY A O    1 
ATOM 95   H H    . GLY A 1 6   ? 58.912  81.227  21.728 1.00 0.00  ? 88  GLY A H    1 
ATOM 96   H HA2  . GLY A 1 6   ? 59.268  80.340  24.092 1.00 0.00  ? 88  GLY A HA2  1 
ATOM 97   H HA3  . GLY A 1 6   ? 59.757  82.007  24.490 1.00 0.00  ? 88  GLY A HA3  1 
ATOM 98   N N    . ILE A 1 7   ? 57.093  81.160  25.152 1.00 31.13 ? 89  ILE A N    1 
ATOM 99   C CA   . ILE A 1 7   ? 55.708  81.435  25.534 1.00 28.48 ? 89  ILE A CA   1 
ATOM 100  C C    . ILE A 1 7   ? 55.601  81.899  26.987 1.00 28.65 ? 89  ILE A C    1 
ATOM 101  O O    . ILE A 1 7   ? 56.444  81.538  27.788 1.00 30.57 ? 89  ILE A O    1 
ATOM 102  C CB   . ILE A 1 7   ? 54.804  80.195  25.274 1.00 28.38 ? 89  ILE A CB   1 
ATOM 103  C CG1  . ILE A 1 7   ? 55.256  78.991  26.118 1.00 29.39 ? 89  ILE A CG1  1 
ATOM 104  C CG2  . ILE A 1 7   ? 54.829  79.819  23.781 1.00 25.42 ? 89  ILE A CG2  1 
ATOM 105  C CD1  . ILE A 1 7   ? 54.354  77.758  25.971 1.00 24.72 ? 89  ILE A CD1  1 
ATOM 106  H H    . ILE A 1 7   ? 57.613  80.502  25.686 1.00 0.00  ? 89  ILE A H    1 
ATOM 107  H HA   . ILE A 1 7   ? 55.336  82.244  24.897 1.00 0.00  ? 89  ILE A HA   1 
ATOM 108  H HB   . ILE A 1 7   ? 53.764  80.410  25.554 1.00 0.00  ? 89  ILE A HB   1 
ATOM 109  H HG12 . ILE A 1 7   ? 56.270  78.708  25.821 1.00 0.00  ? 89  ILE A HG12 1 
ATOM 110  H HG13 . ILE A 1 7   ? 55.233  79.289  27.169 1.00 0.00  ? 89  ILE A HG13 1 
ATOM 111  H HG21 . ILE A 1 7   ? 55.858  79.574  23.480 1.00 0.00  ? 89  ILE A HG21 1 
ATOM 112  H HG22 . ILE A 1 7   ? 54.177  78.965  23.573 1.00 0.00  ? 89  ILE A HG22 1 
ATOM 113  H HG23 . ILE A 1 7   ? 54.449  80.653  23.182 1.00 0.00  ? 89  ILE A HG23 1 
ATOM 114  H HD11 . ILE A 1 7   ? 54.345  77.392  24.941 1.00 0.00  ? 89  ILE A HD11 1 
ATOM 115  H HD12 . ILE A 1 7   ? 54.744  76.944  26.592 1.00 0.00  ? 89  ILE A HD12 1 
ATOM 116  H HD13 . ILE A 1 7   ? 53.330  78.011  26.273 1.00 0.00  ? 89  ILE A HD13 1 
ATOM 117  N N    . PRO A 1 8   ? 54.571  82.699  27.350 1.00 28.46 ? 90  PRO A N    1 
ATOM 118  C CA   . PRO A 1 8   ? 54.434  83.201  28.718 1.00 30.46 ? 90  PRO A CA   1 
ATOM 119  C C    . PRO A 1 8   ? 54.338  82.156  29.810 1.00 31.74 ? 90  PRO A C    1 
ATOM 120  O O    . PRO A 1 8   ? 54.835  82.377  30.900 1.00 35.51 ? 90  PRO A O    1 
ATOM 121  C CB   . PRO A 1 8   ? 53.131  84.025  28.615 1.00 28.22 ? 90  PRO A CB   1 
ATOM 122  C CG   . PRO A 1 8   ? 52.393  83.426  27.412 1.00 28.20 ? 90  PRO A CG   1 
ATOM 123  C CD   . PRO A 1 8   ? 53.538  83.168  26.433 1.00 27.46 ? 90  PRO A CD   1 
ATOM 124  H HA   . PRO A 1 8   ? 55.267  83.871  28.941 1.00 0.00  ? 90  PRO A HA   1 
ATOM 125  H HB2  . PRO A 1 8   ? 52.513  83.949  29.524 1.00 0.00  ? 90  PRO A HB2  1 
ATOM 126  H HB3  . PRO A 1 8   ? 53.349  85.091  28.406 1.00 0.00  ? 90  PRO A HB3  1 
ATOM 127  H HG2  . PRO A 1 8   ? 51.894  82.483  27.703 1.00 0.00  ? 90  PRO A HG2  1 
ATOM 128  H HG3  . PRO A 1 8   ? 51.638  84.124  27.007 1.00 0.00  ? 90  PRO A HG3  1 
ATOM 129  H HD2  . PRO A 1 8   ? 53.205  82.444  25.687 1.00 0.00  ? 90  PRO A HD2  1 
ATOM 130  H HD3  . PRO A 1 8   ? 53.818  84.107  25.933 1.00 0.00  ? 90  PRO A HD3  1 
ATOM 131  N N    . LYS A 1 9   ? 53.685  81.023  29.503 1.00 32.84 ? 91  LYS A N    1 
ATOM 132  C CA   . LYS A 1 9   ? 53.550  79.940  30.463 1.00 29.18 ? 91  LYS A CA   1 
ATOM 133  C C    . LYS A 1 9   ? 53.448  78.611  29.742 1.00 30.19 ? 91  LYS A C    1 
ATOM 134  O O    . LYS A 1 9   ? 53.118  78.555  28.576 1.00 28.98 ? 91  LYS A O    1 
ATOM 135  C CB   . LYS A 1 9   ? 52.326  80.142  31.366 1.00 27.53 ? 91  LYS A CB   1 
ATOM 136  C CG   . LYS A 1 9   ? 51.054  80.549  30.611 1.00 29.05 ? 91  LYS A CG   1 
ATOM 137  C CD   . LYS A 1 9   ? 49.878  80.761  31.580 1.00 29.70 ? 91  LYS A CD   1 
ATOM 138  C CE   . LYS A 1 9   ? 49.300  79.400  31.973 1.00 37.47 ? 91  LYS A CE   1 
ATOM 139  N NZ   . LYS A 1 9   ? 48.326  79.539  33.077 1.00 40.67 ? 91  LYS A NZ   1 
ATOM 140  H H    . LYS A 1 9   ? 53.276  80.907  28.605 1.00 0.00  ? 91  LYS A H    1 
ATOM 141  H HA   . LYS A 1 9   ? 54.438  79.913  31.108 1.00 0.00  ? 91  LYS A HA   1 
ATOM 142  H HB2  . LYS A 1 9   ? 52.152  79.229  31.940 1.00 0.00  ? 91  LYS A HB2  1 
ATOM 143  H HB3  . LYS A 1 9   ? 52.573  80.956  32.043 1.00 0.00  ? 91  LYS A HB3  1 
ATOM 144  H HG2  . LYS A 1 9   ? 51.231  81.492  30.072 1.00 0.00  ? 91  LYS A HG2  1 
ATOM 145  H HG3  . LYS A 1 9   ? 50.797  79.751  29.898 1.00 0.00  ? 91  LYS A HG3  1 
ATOM 146  H HD2  . LYS A 1 9   ? 50.226  81.296  32.480 1.00 0.00  ? 91  LYS A HD2  1 
ATOM 147  H HD3  . LYS A 1 9   ? 49.096  81.355  31.079 1.00 0.00  ? 91  LYS A HD3  1 
ATOM 148  H HE2  . LYS A 1 9   ? 48.788  78.959  31.111 1.00 0.00  ? 91  LYS A HE2  1 
ATOM 149  H HE3  . LYS A 1 9   ? 50.093  78.732  32.318 1.00 0.00  ? 91  LYS A HE3  1 
ATOM 150  H HZ1  . LYS A 1 9   ? 47.516  80.185  32.801 1.00 0.00  ? 91  LYS A HZ1  1 
ATOM 151  H HZ2  . LYS A 1 9   ? 47.924  78.582  33.345 1.00 0.00  ? 91  LYS A HZ2  1 
ATOM 152  H HZ3  . LYS A 1 9   ? 48.798  79.949  33.941 1.00 0.00  ? 91  LYS A HZ3  1 
ATOM 153  N N    . TRP A 1 10  ? 53.754  77.532  30.475 1.00 30.94 ? 92  TRP A N    1 
ATOM 154  C CA   . TRP A 1 10  ? 53.660  76.200  29.909 1.00 31.10 ? 92  TRP A CA   1 
ATOM 155  C C    . TRP A 1 10  ? 52.195  75.829  29.815 1.00 33.33 ? 92  TRP A C    1 
ATOM 156  O O    . TRP A 1 10  ? 51.467  75.928  30.788 1.00 36.65 ? 92  TRP A O    1 
ATOM 157  C CB   . TRP A 1 10  ? 54.376  75.193  30.837 1.00 27.56 ? 92  TRP A CB   1 
ATOM 158  C CG   . TRP A 1 10  ? 55.865  75.350  30.969 1.00 18.04 ? 92  TRP A CG   1 
ATOM 159  C CD1  . TRP A 1 10  ? 56.600  75.831  31.978 1.00 18.52 ? 92  TRP A CD1  1 
ATOM 160  C CD2  . TRP A 1 10  ? 56.864  74.887  29.910 1.00 13.72 ? 92  TRP A CD2  1 
ATOM 161  N NE1  . TRP A 1 10  ? 57.900  75.703  31.729 1.00 18.84 ? 92  TRP A NE1  1 
ATOM 162  C CE2  . TRP A 1 10  ? 58.072  75.141  30.507 1.00 13.32 ? 92  TRP A CE2  1 
ATOM 163  C CE3  . TRP A 1 10  ? 56.715  74.346  28.683 1.00 15.51 ? 92  TRP A CE3  1 
ATOM 164  C CZ2  . TRP A 1 10  ? 59.266  74.810  29.845 1.00 13.45 ? 92  TRP A CZ2  1 
ATOM 165  C CZ3  . TRP A 1 10  ? 57.920  74.011  27.991 1.00 18.07 ? 92  TRP A CZ3  1 
ATOM 166  C CH2  . TRP A 1 10  ? 59.149  74.250  28.572 1.00 12.27 ? 92  TRP A CH2  1 
ATOM 167  H H    . TRP A 1 10  ? 54.054  77.636  31.417 1.00 0.00  ? 92  TRP A H    1 
ATOM 168  H HA   . TRP A 1 10  ? 54.140  76.168  28.921 1.00 0.00  ? 92  TRP A HA   1 
ATOM 169  H HB2  . TRP A 1 10  ? 53.959  75.302  31.848 1.00 0.00  ? 92  TRP A HB2  1 
ATOM 170  H HB3  . TRP A 1 10  ? 54.159  74.178  30.471 1.00 0.00  ? 92  TRP A HB3  1 
ATOM 171  H HD1  . TRP A 1 10  ? 56.156  76.244  32.873 1.00 0.00  ? 92  TRP A HD1  1 
ATOM 172  H HE1  . TRP A 1 10  ? 58.653  75.964  32.351 1.00 0.00  ? 92  TRP A HE1  1 
ATOM 173  H HE3  . TRP A 1 10  ? 55.747  74.159  28.225 1.00 0.00  ? 92  TRP A HE3  1 
ATOM 174  H HZ2  . TRP A 1 10  ? 60.209  74.976  30.308 1.00 0.00  ? 92  TRP A HZ2  1 
ATOM 175  H HZ3  . TRP A 1 10  ? 57.845  73.576  27.007 1.00 0.00  ? 92  TRP A HZ3  1 
ATOM 176  H HH2  . TRP A 1 10  ? 60.060  73.994  28.021 1.00 0.00  ? 92  TRP A HH2  1 
ATOM 177  N N    . ARG A 1 11  ? 51.758  75.347  28.641 1.00 36.06 ? 93  ARG A N    1 
ATOM 178  C CA   . ARG A 1 11  ? 50.352  74.967  28.470 1.00 37.04 ? 93  ARG A CA   1 
ATOM 179  C C    . ARG A 1 11  ? 50.016  73.564  28.955 1.00 35.39 ? 93  ARG A C    1 
ATOM 180  O O    . ARG A 1 11  ? 49.195  72.865  28.387 1.00 33.26 ? 93  ARG A O    1 
ATOM 181  C CB   . ARG A 1 11  ? 49.972  75.162  26.996 1.00 40.93 ? 93  ARG A CB   1 
ATOM 182  C CG   . ARG A 1 11  ? 50.156  76.633  26.587 1.00 49.76 ? 93  ARG A CG   1 
ATOM 183  C CD   . ARG A 1 11  ? 49.584  76.855  25.189 1.00 58.58 ? 93  ARG A CD   1 
ATOM 184  N NE   . ARG A 1 11  ? 50.540  76.641  24.112 1.00 63.91 ? 93  ARG A NE   1 
ATOM 185  C CZ   . ARG A 1 11  ? 51.031  77.590  23.329 1.00 65.87 ? 93  ARG A CZ   1 
ATOM 186  N NH1  . ARG A 1 11  ? 50.735  78.871  23.450 1.00 66.61 ? 93  ARG A NH1  1 
ATOM 187  N NH2  . ARG A 1 11  ? 51.860  77.235  22.370 1.00 67.01 ? 93  ARG A NH2  1 
ATOM 188  H H    . ARG A 1 11  ? 52.392  75.243  27.871 1.00 0.00  ? 93  ARG A H    1 
ATOM 189  H HA   . ARG A 1 11  ? 49.741  75.666  29.063 1.00 0.00  ? 93  ARG A HA   1 
ATOM 190  H HB2  . ARG A 1 11  ? 50.614  74.531  26.363 1.00 0.00  ? 93  ARG A HB2  1 
ATOM 191  H HB3  . ARG A 1 11  ? 48.917  74.874  26.864 1.00 0.00  ? 93  ARG A HB3  1 
ATOM 192  H HG2  . ARG A 1 11  ? 49.631  77.277  27.322 1.00 0.00  ? 93  ARG A HG2  1 
ATOM 193  H HG3  . ARG A 1 11  ? 51.224  76.889  26.579 1.00 0.00  ? 93  ARG A HG3  1 
ATOM 194  H HD2  . ARG A 1 11  ? 48.683  76.270  25.036 1.00 0.00  ? 93  ARG A HD2  1 
ATOM 195  H HD3  . ARG A 1 11  ? 49.154  77.877  25.267 1.00 0.00  ? 93  ARG A HD3  1 
ATOM 196  H HH11 . ARG A 1 11  ? 50.100  79.245  24.169 1.00 0.00  ? 93  ARG A HH11 1 
ATOM 197  H HH12 . ARG A 1 11  ? 51.117  79.559  22.848 1.00 0.00  ? 93  ARG A HH12 1 
ATOM 198  H HH21 . ARG A 1 11  ? 52.120  76.250  22.215 1.00 0.00  ? 93  ARG A HH21 1 
ATOM 199  H HH22 . ARG A 1 11  ? 52.264  77.952  21.741 1.00 0.00  ? 93  ARG A HH22 1 
ATOM 200  N N    . LYS A 1 12  ? 50.674  73.182  30.058 1.00 32.16 ? 94  LYS A N    1 
ATOM 201  C CA   . LYS A 1 12  ? 50.476  71.891  30.688 1.00 29.59 ? 94  LYS A CA   1 
ATOM 202  C C    . LYS A 1 12  ? 51.013  72.001  32.102 1.00 27.92 ? 94  LYS A C    1 
ATOM 203  O O    . LYS A 1 12  ? 51.864  72.835  32.363 1.00 28.62 ? 94  LYS A O    1 
ATOM 204  C CB   . LYS A 1 12  ? 51.159  70.756  29.902 1.00 31.72 ? 94  LYS A CB   1 
ATOM 205  C CG   . LYS A 1 12  ? 52.649  70.983  29.601 1.00 31.68 ? 94  LYS A CG   1 
ATOM 206  C CD   . LYS A 1 12  ? 53.165  69.766  28.808 1.00 32.91 ? 94  LYS A CD   1 
ATOM 207  C CE   . LYS A 1 12  ? 54.689  69.680  28.811 1.00 30.89 ? 94  LYS A CE   1 
ATOM 208  N NZ   . LYS A 1 12  ? 55.271  70.472  27.702 1.00 37.65 ? 94  LYS A NZ   1 
ATOM 209  H H    . LYS A 1 12  ? 51.327  73.785  30.489 1.00 0.00  ? 94  LYS A H    1 
ATOM 210  H HA   . LYS A 1 12  ? 49.400  71.657  30.729 1.00 0.00  ? 94  LYS A HA   1 
ATOM 211  H HB2  . LYS A 1 12  ? 51.067  69.825  30.485 1.00 0.00  ? 94  LYS A HB2  1 
ATOM 212  H HB3  . LYS A 1 12  ? 50.641  70.641  28.937 1.00 0.00  ? 94  LYS A HB3  1 
ATOM 213  H HG2  . LYS A 1 12  ? 52.786  71.898  29.002 1.00 0.00  ? 94  LYS A HG2  1 
ATOM 214  H HG3  . LYS A 1 12  ? 53.199  71.076  30.549 1.00 0.00  ? 94  LYS A HG3  1 
ATOM 215  H HD2  . LYS A 1 12  ? 52.779  68.842  29.269 1.00 0.00  ? 94  LYS A HD2  1 
ATOM 216  H HD3  . LYS A 1 12  ? 52.801  69.835  27.769 1.00 0.00  ? 94  LYS A HD3  1 
ATOM 217  H HE2  . LYS A 1 12  ? 55.081  70.071  29.746 1.00 0.00  ? 94  LYS A HE2  1 
ATOM 218  H HE3  . LYS A 1 12  ? 54.996  68.636  28.695 1.00 0.00  ? 94  LYS A HE3  1 
ATOM 219  H HZ1  . LYS A 1 12  ? 54.994  71.506  27.776 1.00 0.00  ? 94  LYS A HZ1  1 
ATOM 220  H HZ2  . LYS A 1 12  ? 56.342  70.408  27.723 1.00 0.00  ? 94  LYS A HZ2  1 
ATOM 221  H HZ3  . LYS A 1 12  ? 54.935  70.098  26.752 1.00 0.00  ? 94  LYS A HZ3  1 
ATOM 222  N N    . THR A 1 13  ? 50.483  71.166  33.008 1.00 26.72 ? 95  THR A N    1 
ATOM 223  C CA   . THR A 1 13  ? 50.889  71.215  34.405 1.00 26.54 ? 95  THR A CA   1 
ATOM 224  C C    . THR A 1 13  ? 51.991  70.253  34.762 1.00 28.08 ? 95  THR A C    1 
ATOM 225  O O    . THR A 1 13  ? 52.748  70.487  35.686 1.00 30.42 ? 95  THR A O    1 
ATOM 226  C CB   . THR A 1 13  ? 49.706  70.773  35.292 1.00 28.90 ? 95  THR A CB   1 
ATOM 227  O OG1  . THR A 1 13  ? 48.464  70.978  34.602 1.00 32.41 ? 95  THR A OG1  1 
ATOM 228  C CG2  . THR A 1 13  ? 49.703  71.570  36.595 1.00 30.77 ? 95  THR A CG2  1 
ATOM 229  H H    . THR A 1 13  ? 49.783  70.508  32.726 1.00 0.00  ? 95  THR A H    1 
ATOM 230  H HA   . THR A 1 13  ? 51.202  72.242  34.623 1.00 0.00  ? 95  THR A HA   1 
ATOM 231  H HB   . THR A 1 13  ? 49.798  69.694  35.528 1.00 0.00  ? 95  THR A HB   1 
ATOM 232  H HG1  . THR A 1 13  ? 47.737  70.700  35.148 1.00 0.00  ? 95  THR A HG1  1 
ATOM 233  H HG21 . THR A 1 13  ? 50.253  72.508  36.505 1.00 0.00  ? 95  THR A HG21 1 
ATOM 234  H HG22 . THR A 1 13  ? 48.680  71.803  36.900 1.00 0.00  ? 95  THR A HG22 1 
ATOM 235  H HG23 . THR A 1 13  ? 50.183  70.951  37.345 1.00 0.00  ? 95  THR A HG23 1 
ATOM 236  N N    . HIS A 1 14  ? 52.016  69.124  34.035 1.00 28.69 ? 96  HIS A N    1 
ATOM 237  C CA   . HIS A 1 14  ? 52.982  68.087  34.331 1.00 28.65 ? 96  HIS A CA   1 
ATOM 238  C C    . HIS A 1 14  ? 54.196  68.232  33.448 1.00 29.52 ? 96  HIS A C    1 
ATOM 239  O O    . HIS A 1 14  ? 54.185  67.811  32.305 1.00 27.76 ? 96  HIS A O    1 
ATOM 240  C CB   . HIS A 1 14  ? 52.338  66.694  34.208 1.00 26.36 ? 96  HIS A CB   1 
ATOM 241  C CG   . HIS A 1 14  ? 50.983  66.616  34.865 1.00 28.03 ? 96  HIS A CG   1 
ATOM 242  N ND1  . HIS A 1 14  ? 50.804  66.585  36.188 1.00 26.86 ? 96  HIS A ND1  1 
ATOM 243  C CD2  . HIS A 1 14  ? 49.780  66.575  34.264 1.00 26.33 ? 96  HIS A CD2  1 
ATOM 244  C CE1  . HIS A 1 14  ? 49.522  66.525  36.452 1.00 27.23 ? 96  HIS A CE1  1 
ATOM 245  N NE2  . HIS A 1 14  ? 48.884  66.517  35.385 1.00 25.71 ? 96  HIS A NE2  1 
ATOM 246  H H    . HIS A 1 14  ? 51.364  68.964  33.299 1.00 0.00  ? 96  HIS A H    1 
ATOM 247  H HA   . HIS A 1 14  ? 53.299  68.218  35.364 1.00 0.00  ? 96  HIS A HA   1 
ATOM 248  H HB2  . HIS A 1 14  ? 52.252  66.467  33.131 1.00 0.00  ? 96  HIS A HB2  1 
ATOM 249  H HB3  . HIS A 1 14  ? 53.025  65.961  34.662 1.00 0.00  ? 96  HIS A HB3  1 
ATOM 250  H HD2  . HIS A 1 14  ? 49.526  66.582  33.215 1.00 0.00  ? 96  HIS A HD2  1 
ATOM 251  H HE1  . HIS A 1 14  ? 49.103  66.491  37.449 1.00 0.00  ? 96  HIS A HE1  1 
ATOM 252  N N    . LEU A 1 15  ? 55.246  68.846  34.024 1.00 31.41 ? 97  LEU A N    1 
ATOM 253  C CA   . LEU A 1 15  ? 56.486  69.037  33.303 1.00 33.06 ? 97  LEU A CA   1 
ATOM 254  C C    . LEU A 1 15  ? 57.495  67.942  33.612 1.00 37.17 ? 97  LEU A C    1 
ATOM 255  O O    . LEU A 1 15  ? 57.482  67.313  34.641 1.00 36.53 ? 97  LEU A O    1 
ATOM 256  C CB   . LEU A 1 15  ? 57.148  70.392  33.645 1.00 31.40 ? 97  LEU A CB   1 
ATOM 257  C CG   . LEU A 1 15  ? 56.523  71.714  33.135 1.00 25.19 ? 97  LEU A CG   1 
ATOM 258  C CD1  . LEU A 1 15  ? 55.898  71.516  31.759 1.00 26.00 ? 97  LEU A CD1  1 
ATOM 259  C CD2  . LEU A 1 15  ? 55.456  72.238  34.102 1.00 25.40 ? 97  LEU A CD2  1 
ATOM 260  H H    . LEU A 1 15  ? 55.194  69.189  34.959 1.00 0.00  ? 97  LEU A H    1 
ATOM 261  H HA   . LEU A 1 15  ? 56.276  68.996  32.226 1.00 0.00  ? 97  LEU A HA   1 
ATOM 262  H HB2  . LEU A 1 15  ? 57.185  70.466  34.738 1.00 0.00  ? 97  LEU A HB2  1 
ATOM 263  H HB3  . LEU A 1 15  ? 58.166  70.376  33.236 1.00 0.00  ? 97  LEU A HB3  1 
ATOM 264  H HG   . LEU A 1 15  ? 57.317  72.485  33.058 1.00 0.00  ? 97  LEU A HG   1 
ATOM 265  H HD11 . LEU A 1 15  ? 55.106  70.762  31.847 1.00 0.00  ? 97  LEU A HD11 1 
ATOM 266  H HD12 . LEU A 1 15  ? 55.455  72.454  31.417 1.00 0.00  ? 97  LEU A HD12 1 
ATOM 267  H HD13 . LEU A 1 15  ? 56.684  71.198  31.066 1.00 0.00  ? 97  LEU A HD13 1 
ATOM 268  H HD21 . LEU A 1 15  ? 55.923  72.403  35.084 1.00 0.00  ? 97  LEU A HD21 1 
ATOM 269  H HD22 . LEU A 1 15  ? 55.054  73.188  33.716 1.00 0.00  ? 97  LEU A HD22 1 
ATOM 270  H HD23 . LEU A 1 15  ? 54.650  71.495  34.184 1.00 0.00  ? 97  LEU A HD23 1 
ATOM 271  N N    . THR A 1 16  ? 58.395  67.766  32.636 1.00 37.94 ? 98  THR A N    1 
ATOM 272  C CA   . THR A 1 16  ? 59.472  66.797  32.685 1.00 35.80 ? 98  THR A CA   1 
ATOM 273  C C    . THR A 1 16  ? 60.783  67.546  32.530 1.00 36.17 ? 98  THR A C    1 
ATOM 274  O O    . THR A 1 16  ? 60.829  68.540  31.832 1.00 40.19 ? 98  THR A O    1 
ATOM 275  C CB   . THR A 1 16  ? 59.328  65.806  31.529 1.00 35.58 ? 98  THR A CB   1 
ATOM 276  O OG1  . THR A 1 16  ? 60.590  65.193  31.341 1.00 42.06 ? 98  THR A OG1  1 
ATOM 277  C CG2  . THR A 1 16  ? 58.903  66.491  30.215 1.00 36.24 ? 98  THR A CG2  1 
ATOM 278  H H    . THR A 1 16  ? 58.326  68.385  31.871 1.00 0.00  ? 98  THR A H    1 
ATOM 279  H HA   . THR A 1 16  ? 59.450  66.232  33.622 1.00 0.00  ? 98  THR A HA   1 
ATOM 280  H HB   . THR A 1 16  ? 58.558  65.042  31.774 1.00 0.00  ? 98  THR A HB   1 
ATOM 281  H HG1  . THR A 1 16  ? 60.329  64.617  30.597 1.00 0.00  ? 98  THR A HG1  1 
ATOM 282  H HG21 . THR A 1 16  ? 59.198  67.516  30.238 1.00 0.00  ? 98  THR A HG21 1 
ATOM 283  H HG22 . THR A 1 16  ? 59.421  66.092  29.343 1.00 0.00  ? 98  THR A HG22 1 
ATOM 284  H HG23 . THR A 1 16  ? 57.821  66.420  30.082 1.00 0.00  ? 98  THR A HG23 1 
ATOM 285  N N    . TYR A 1 17  ? 61.850  67.044  33.177 1.00 36.14 ? 99  TYR A N    1 
ATOM 286  C CA   . TYR A 1 17  ? 63.157  67.699  33.128 1.00 39.54 ? 99  TYR A CA   1 
ATOM 287  C C    . TYR A 1 17  ? 64.286  66.680  33.127 1.00 42.33 ? 99  TYR A C    1 
ATOM 288  O O    . TYR A 1 17  ? 64.066  65.550  33.525 1.00 45.39 ? 99  TYR A O    1 
ATOM 289  C CB   . TYR A 1 17  ? 63.327  68.619  34.349 1.00 34.68 ? 99  TYR A CB   1 
ATOM 290  C CG   . TYR A 1 17  ? 63.402  67.838  35.654 1.00 35.24 ? 99  TYR A CG   1 
ATOM 291  C CD1  . TYR A 1 17  ? 62.236  67.360  36.260 1.00 34.32 ? 99  TYR A CD1  1 
ATOM 292  C CD2  . TYR A 1 17  ? 64.641  67.598  36.256 1.00 36.97 ? 99  TYR A CD2  1 
ATOM 293  C CE1  . TYR A 1 17  ? 62.306  66.648  37.455 1.00 33.63 ? 99  TYR A CE1  1 
ATOM 294  C CE2  . TYR A 1 17  ? 64.715  66.885  37.452 1.00 35.16 ? 99  TYR A CE2  1 
ATOM 295  C CZ   . TYR A 1 17  ? 63.550  66.417  38.053 1.00 33.76 ? 99  TYR A CZ   1 
ATOM 296  O OH   . TYR A 1 17  ? 63.633  65.722  39.249 1.00 31.29 ? 99  TYR A OH   1 
ATOM 297  H H    . TYR A 1 17  ? 61.759  66.211  33.715 1.00 0.00  ? 99  TYR A H    1 
ATOM 298  H HA   . TYR A 1 17  ? 63.233  68.335  32.235 1.00 0.00  ? 99  TYR A HA   1 
ATOM 299  H HB2  . TYR A 1 17  ? 64.255  69.204  34.235 1.00 0.00  ? 99  TYR A HB2  1 
ATOM 300  H HB3  . TYR A 1 17  ? 62.464  69.301  34.410 1.00 0.00  ? 99  TYR A HB3  1 
ATOM 301  H HD1  . TYR A 1 17  ? 61.274  67.543  35.801 1.00 0.00  ? 99  TYR A HD1  1 
ATOM 302  H HD2  . TYR A 1 17  ? 65.549  67.967  35.797 1.00 0.00  ? 99  TYR A HD2  1 
ATOM 303  H HE1  . TYR A 1 17  ? 61.406  66.269  37.923 1.00 0.00  ? 99  TYR A HE1  1 
ATOM 304  H HE2  . TYR A 1 17  ? 65.677  66.694  37.916 1.00 0.00  ? 99  TYR A HE2  1 
ATOM 305  H HH   . TYR A 1 17  ? 62.770  65.457  39.545 1.00 0.00  ? 99  TYR A HH   1 
ATOM 306  N N    . ARG A 1 18  ? 65.495  67.099  32.696 1.00 41.00 ? 100 ARG A N    1 
ATOM 307  C CA   . ARG A 1 18  ? 66.652  66.202  32.688 1.00 38.36 ? 100 ARG A CA   1 
ATOM 308  C C    . ARG A 1 18  ? 67.952  66.909  33.048 1.00 35.41 ? 100 ARG A C    1 
ATOM 309  O O    . ARG A 1 18  ? 68.259  67.966  32.530 1.00 36.62 ? 100 ARG A O    1 
ATOM 310  C CB   . ARG A 1 18  ? 66.834  65.487  31.329 1.00 38.70 ? 100 ARG A CB   1 
ATOM 311  C CG   . ARG A 1 18  ? 68.260  64.908  31.173 1.00 39.72 ? 100 ARG A CG   1 
ATOM 312  C CD   . ARG A 1 18  ? 68.263  63.569  30.444 1.00 37.56 ? 100 ARG A CD   1 
ATOM 313  N NE   . ARG A 1 18  ? 68.123  63.693  29.004 1.00 36.04 ? 100 ARG A NE   1 
ATOM 314  C CZ   . ARG A 1 18  ? 69.047  63.365  28.115 1.00 39.50 ? 100 ARG A CZ   1 
ATOM 315  N NH1  . ARG A 1 18  ? 70.236  62.881  28.427 1.00 37.06 ? 100 ARG A NH1  1 
ATOM 316  N NH2  . ARG A 1 18  ? 68.771  63.536  26.842 1.00 40.83 ? 100 ARG A NH2  1 
ATOM 317  H H    . ARG A 1 18  ? 65.613  68.032  32.365 1.00 0.00  ? 100 ARG A H    1 
ATOM 318  H HA   . ARG A 1 18  ? 66.470  65.420  33.442 1.00 0.00  ? 100 ARG A HA   1 
ATOM 319  H HB2  . ARG A 1 18  ? 66.091  64.676  31.253 1.00 0.00  ? 100 ARG A HB2  1 
ATOM 320  H HB3  . ARG A 1 18  ? 66.658  66.208  30.517 1.00 0.00  ? 100 ARG A HB3  1 
ATOM 321  H HG2  . ARG A 1 18  ? 68.892  65.617  30.619 1.00 0.00  ? 100 ARG A HG2  1 
ATOM 322  H HG3  . ARG A 1 18  ? 68.703  64.737  32.167 1.00 0.00  ? 100 ARG A HG3  1 
ATOM 323  H HD2  . ARG A 1 18  ? 69.208  63.106  30.813 1.00 0.00  ? 100 ARG A HD2  1 
ATOM 324  H HD3  . ARG A 1 18  ? 67.517  62.901  30.852 1.00 0.00  ? 100 ARG A HD3  1 
ATOM 325  H HH11 . ARG A 1 18  ? 70.553  62.724  29.394 1.00 0.00  ? 100 ARG A HH11 1 
ATOM 326  H HH12 . ARG A 1 18  ? 70.904  62.643  27.736 1.00 0.00  ? 100 ARG A HH12 1 
ATOM 327  H HH21 . ARG A 1 18  ? 67.867  63.913  26.532 1.00 0.00  ? 100 ARG A HH21 1 
ATOM 328  H HH22 . ARG A 1 18  ? 69.469  63.292  26.118 1.00 0.00  ? 100 ARG A HH22 1 
ATOM 329  N N    . ILE A 1 19  ? 68.744  66.272  33.932 1.00 28.63 ? 101 ILE A N    1 
ATOM 330  C CA   . ILE A 1 19  ? 70.049  66.803  34.284 1.00 26.24 ? 101 ILE A CA   1 
ATOM 331  C C    . ILE A 1 19  ? 71.058  66.229  33.315 1.00 29.53 ? 101 ILE A C    1 
ATOM 332  O O    . ILE A 1 19  ? 71.680  65.223  33.579 1.00 31.84 ? 101 ILE A O    1 
ATOM 333  C CB   . ILE A 1 19  ? 70.417  66.389  35.716 1.00 20.88 ? 101 ILE A CB   1 
ATOM 334  C CG1  . ILE A 1 19  ? 69.255  66.736  36.665 1.00 19.43 ? 101 ILE A CG1  1 
ATOM 335  C CG2  . ILE A 1 19  ? 71.693  67.122  36.149 1.00 21.23 ? 101 ILE A CG2  1 
ATOM 336  C CD1  . ILE A 1 19  ? 69.624  66.532  38.135 1.00 23.55 ? 101 ILE A CD1  1 
ATOM 337  H H    . ILE A 1 19  ? 68.473  65.390  34.325 1.00 0.00  ? 101 ILE A H    1 
ATOM 338  H HA   . ILE A 1 19  ? 70.031  67.900  34.242 1.00 0.00  ? 101 ILE A HA   1 
ATOM 339  H HB   . ILE A 1 19  ? 70.593  65.300  35.745 1.00 0.00  ? 101 ILE A HB   1 
ATOM 340  H HG12 . ILE A 1 19  ? 68.967  67.787  36.510 1.00 0.00  ? 101 ILE A HG12 1 
ATOM 341  H HG13 . ILE A 1 19  ? 68.404  66.076  36.442 1.00 0.00  ? 101 ILE A HG13 1 
ATOM 342  H HG21 . ILE A 1 19  ? 71.516  68.209  36.133 1.00 0.00  ? 101 ILE A HG21 1 
ATOM 343  H HG22 . ILE A 1 19  ? 72.005  66.797  37.145 1.00 0.00  ? 101 ILE A HG22 1 
ATOM 344  H HG23 . ILE A 1 19  ? 72.513  66.856  35.482 1.00 0.00  ? 101 ILE A HG23 1 
ATOM 345  H HD11 . ILE A 1 19  ? 70.432  67.204  38.435 1.00 0.00  ? 101 ILE A HD11 1 
ATOM 346  H HD12 . ILE A 1 19  ? 68.767  66.795  38.758 1.00 0.00  ? 101 ILE A HD12 1 
ATOM 347  H HD13 . ILE A 1 19  ? 69.917  65.484  38.303 1.00 0.00  ? 101 ILE A HD13 1 
ATOM 348  N N    . VAL A 1 20  ? 71.217  66.887  32.178 1.00 32.70 ? 102 VAL A N    1 
ATOM 349  C CA   . VAL A 1 20  ? 72.084  66.413  31.109 1.00 38.46 ? 102 VAL A CA   1 
ATOM 350  C C    . VAL A 1 20  ? 73.445  65.881  31.531 1.00 44.06 ? 102 VAL A C    1 
ATOM 351  O O    . VAL A 1 20  ? 73.735  64.723  31.284 1.00 47.07 ? 102 VAL A O    1 
ATOM 352  C CB   . VAL A 1 20  ? 72.271  67.484  30.036 1.00 37.30 ? 102 VAL A CB   1 
ATOM 353  C CG1  . VAL A 1 20  ? 73.131  66.967  28.885 1.00 40.63 ? 102 VAL A CG1  1 
ATOM 354  C CG2  . VAL A 1 20  ? 70.938  67.995  29.493 1.00 39.99 ? 102 VAL A CG2  1 
ATOM 355  H H    . VAL A 1 20  ? 70.661  67.712  32.102 1.00 0.00  ? 102 VAL A H    1 
ATOM 356  H HA   . VAL A 1 20  ? 71.556  65.595  30.615 1.00 0.00  ? 102 VAL A HA   1 
ATOM 357  H HB   . VAL A 1 20  ? 72.834  68.291  30.510 1.00 0.00  ? 102 VAL A HB   1 
ATOM 358  H HG11 . VAL A 1 20  ? 72.616  66.100  28.450 1.00 0.00  ? 102 VAL A HG11 1 
ATOM 359  H HG12 . VAL A 1 20  ? 73.257  67.750  28.125 1.00 0.00  ? 102 VAL A HG12 1 
ATOM 360  H HG13 . VAL A 1 20  ? 74.116  66.666  29.266 1.00 0.00  ? 102 VAL A HG13 1 
ATOM 361  H HG21 . VAL A 1 20  ? 70.303  68.452  30.254 1.00 0.00  ? 102 VAL A HG21 1 
ATOM 362  H HG22 . VAL A 1 20  ? 71.097  68.779  28.754 1.00 0.00  ? 102 VAL A HG22 1 
ATOM 363  H HG23 . VAL A 1 20  ? 70.404  67.141  29.060 1.00 0.00  ? 102 VAL A HG23 1 
ATOM 364  N N    . ASN A 1 21  ? 74.291  66.733  32.133 1.00 46.50 ? 103 ASN A N    1 
ATOM 365  C CA   . ASN A 1 21  ? 75.609  66.280  32.570 1.00 46.12 ? 103 ASN A CA   1 
ATOM 366  C C    . ASN A 1 21  ? 75.856  66.741  33.989 1.00 45.74 ? 103 ASN A C    1 
ATOM 367  O O    . ASN A 1 21  ? 75.031  67.435  34.555 1.00 46.13 ? 103 ASN A O    1 
ATOM 368  C CB   . ASN A 1 21  ? 76.720  66.783  31.623 1.00 46.64 ? 103 ASN A CB   1 
ATOM 369  C CG   . ASN A 1 21  ? 76.790  68.290  31.549 1.00 47.97 ? 103 ASN A CG   1 
ATOM 370  O OD1  . ASN A 1 21  ? 76.496  68.989  32.504 1.00 48.72 ? 103 ASN A OD1  1 
ATOM 371  N ND2  . ASN A 1 21  ? 77.196  68.803  30.379 1.00 50.17 ? 103 ASN A ND2  1 
ATOM 372  H H    . ASN A 1 21  ? 74.037  67.684  32.292 1.00 0.00  ? 103 ASN A H    1 
ATOM 373  H HA   . ASN A 1 21  ? 75.646  65.180  32.565 1.00 0.00  ? 103 ASN A HA   1 
ATOM 374  H HB2  . ASN A 1 21  ? 77.698  66.409  31.960 1.00 0.00  ? 103 ASN A HB2  1 
ATOM 375  H HB3  . ASN A 1 21  ? 76.533  66.381  30.616 1.00 0.00  ? 103 ASN A HB3  1 
ATOM 376  N N    . TYR A 1 22  ? 77.012  66.345  34.549 1.00 45.10 ? 104 TYR A N    1 
ATOM 377  C CA   . TYR A 1 22  ? 77.320  66.697  35.924 1.00 43.91 ? 104 TYR A CA   1 
ATOM 378  C C    . TYR A 1 22  ? 78.586  67.517  36.091 1.00 43.20 ? 104 TYR A C    1 
ATOM 379  O O    . TYR A 1 22  ? 79.489  67.499  35.277 1.00 43.56 ? 104 TYR A O    1 
ATOM 380  C CB   . TYR A 1 22  ? 77.437  65.427  36.792 1.00 46.38 ? 104 TYR A CB   1 
ATOM 381  C CG   . TYR A 1 22  ? 76.100  64.731  37.045 1.00 49.74 ? 104 TYR A CG   1 
ATOM 382  C CD1  . TYR A 1 22  ? 75.484  63.975  36.044 1.00 45.84 ? 104 TYR A CD1  1 
ATOM 383  C CD2  . TYR A 1 22  ? 75.477  64.831  38.290 1.00 50.06 ? 104 TYR A CD2  1 
ATOM 384  C CE1  . TYR A 1 22  ? 74.278  63.320  36.300 1.00 46.01 ? 104 TYR A CE1  1 
ATOM 385  C CE2  . TYR A 1 22  ? 74.283  64.176  38.554 1.00 46.07 ? 104 TYR A CE2  1 
ATOM 386  C CZ   . TYR A 1 22  ? 73.683  63.413  37.554 1.00 45.31 ? 104 TYR A CZ   1 
ATOM 387  O OH   . TYR A 1 22  ? 72.495  62.749  37.829 1.00 50.94 ? 104 TYR A OH   1 
ATOM 388  H H    . TYR A 1 22  ? 77.662  65.774  34.052 1.00 0.00  ? 104 TYR A H    1 
ATOM 389  H HA   . TYR A 1 22  ? 76.494  67.300  36.324 1.00 0.00  ? 104 TYR A HA   1 
ATOM 390  H HB2  . TYR A 1 22  ? 78.110  64.718  36.287 1.00 0.00  ? 104 TYR A HB2  1 
ATOM 391  H HB3  . TYR A 1 22  ? 77.876  65.705  37.763 1.00 0.00  ? 104 TYR A HB3  1 
ATOM 392  H HD1  . TYR A 1 22  ? 75.940  63.888  35.069 1.00 0.00  ? 104 TYR A HD1  1 
ATOM 393  H HD2  . TYR A 1 22  ? 75.938  65.424  39.051 1.00 0.00  ? 104 TYR A HD2  1 
ATOM 394  H HE1  . TYR A 1 22  ? 73.807  62.733  35.516 1.00 0.00  ? 104 TYR A HE1  1 
ATOM 395  H HE2  . TYR A 1 22  ? 73.817  64.249  39.517 1.00 0.00  ? 104 TYR A HE2  1 
ATOM 396  H HH   . TYR A 1 22  ? 72.213  62.271  37.057 1.00 0.00  ? 104 TYR A HH   1 
ATOM 397  N N    . THR A 1 23  ? 78.606  68.246  37.224 1.00 43.83 ? 105 THR A N    1 
ATOM 398  C CA   . THR A 1 23  ? 79.749  69.047  37.595 1.00 45.94 ? 105 THR A CA   1 
ATOM 399  C C    . THR A 1 23  ? 80.675  68.228  38.476 1.00 51.67 ? 105 THR A C    1 
ATOM 400  O O    . THR A 1 23  ? 80.218  67.566  39.390 1.00 54.60 ? 105 THR A O    1 
ATOM 401  C CB   . THR A 1 23  ? 79.335  70.326  38.329 1.00 45.39 ? 105 THR A CB   1 
ATOM 402  O OG1  . THR A 1 23  ? 80.551  70.938  38.723 1.00 46.74 ? 105 THR A OG1  1 
ATOM 403  C CG2  . THR A 1 23  ? 78.470  69.988  39.554 1.00 42.87 ? 105 THR A CG2  1 
ATOM 404  H H    . THR A 1 23  ? 77.830  68.220  37.847 1.00 0.00  ? 105 THR A H    1 
ATOM 405  H HA   . THR A 1 23  ? 80.215  69.393  36.669 1.00 0.00  ? 105 THR A HA   1 
ATOM 406  H HB   . THR A 1 23  ? 78.768  70.985  37.653 1.00 0.00  ? 105 THR A HB   1 
ATOM 407  H HG1  . THR A 1 23  ? 80.319  71.731  39.256 1.00 0.00  ? 105 THR A HG1  1 
ATOM 408  H HG21 . THR A 1 23  ? 78.612  68.957  39.873 1.00 0.00  ? 105 THR A HG21 1 
ATOM 409  H HG22 . THR A 1 23  ? 78.721  70.630  40.402 1.00 0.00  ? 105 THR A HG22 1 
ATOM 410  H HG23 . THR A 1 23  ? 77.413  70.103  39.305 1.00 0.00  ? 105 THR A HG23 1 
ATOM 411  N N    . PRO A 1 24  ? 81.994  68.234  38.219 1.00 54.96 ? 106 PRO A N    1 
ATOM 412  C CA   . PRO A 1 24  ? 82.914  67.513  39.083 1.00 56.57 ? 106 PRO A CA   1 
ATOM 413  C C    . PRO A 1 24  ? 82.843  68.044  40.496 1.00 57.62 ? 106 PRO A C    1 
ATOM 414  O O    . PRO A 1 24  ? 82.849  67.265  41.431 1.00 58.23 ? 106 PRO A O    1 
ATOM 415  C CB   . PRO A 1 24  ? 84.255  67.855  38.407 1.00 58.08 ? 106 PRO A CB   1 
ATOM 416  C CG   . PRO A 1 24  ? 83.876  68.033  36.931 1.00 58.50 ? 106 PRO A CG   1 
ATOM 417  C CD   . PRO A 1 24  ? 82.604  68.867  37.056 1.00 58.25 ? 106 PRO A CD   1 
ATOM 418  H HA   . PRO A 1 24  ? 82.722  66.434  39.025 1.00 0.00  ? 106 PRO A HA   1 
ATOM 419  H HB2  . PRO A 1 24  ? 84.670  68.806  38.791 1.00 0.00  ? 106 PRO A HB2  1 
ATOM 420  H HB3  . PRO A 1 24  ? 84.999  67.054  38.529 1.00 0.00  ? 106 PRO A HB3  1 
ATOM 421  H HG2  . PRO A 1 24  ? 84.666  68.549  36.357 1.00 0.00  ? 106 PRO A HG2  1 
ATOM 422  H HG3  . PRO A 1 24  ? 83.667  67.046  36.466 1.00 0.00  ? 106 PRO A HG3  1 
ATOM 423  H HD2  . PRO A 1 24  ? 82.855  69.924  37.229 1.00 0.00  ? 106 PRO A HD2  1 
ATOM 424  H HD3  . PRO A 1 24  ? 82.074  68.735  36.105 1.00 0.00  ? 106 PRO A HD3  1 
ATOM 425  N N    . ASP A 1 25  ? 82.767  69.386  40.602 1.00 59.28 ? 107 ASP A N    1 
ATOM 426  C CA   . ASP A 1 25  ? 82.698  70.090  41.885 1.00 57.77 ? 107 ASP A CA   1 
ATOM 427  C C    . ASP A 1 25  ? 81.982  69.288  42.959 1.00 57.46 ? 107 ASP A C    1 
ATOM 428  O O    . ASP A 1 25  ? 82.454  69.214  44.082 1.00 57.97 ? 107 ASP A O    1 
ATOM 429  C CB   . ASP A 1 25  ? 81.966  71.446  41.706 1.00 59.68 ? 107 ASP A CB   1 
ATOM 430  C CG   . ASP A 1 25  ? 82.773  72.502  40.973 1.00 64.05 ? 107 ASP A CG   1 
ATOM 431  O OD1  . ASP A 1 25  ? 82.821  72.496  39.714 1.00 62.50 ? 107 ASP A OD1  1 
ATOM 432  O OD2  . ASP A 1 25  ? 83.367  73.364  41.665 1.00 65.73 ? 107 ASP A OD2  1 
ATOM 433  H H    . ASP A 1 25  ? 82.764  69.940  39.769 1.00 0.00  ? 107 ASP A H    1 
ATOM 434  H HA   . ASP A 1 25  ? 83.721  70.293  42.226 1.00 0.00  ? 107 ASP A HA   1 
ATOM 435  H HB2  . ASP A 1 25  ? 81.040  71.256  41.169 1.00 0.00  ? 107 ASP A HB2  1 
ATOM 436  H HB3  . ASP A 1 25  ? 81.693  71.836  42.696 1.00 0.00  ? 107 ASP A HB3  1 
ATOM 437  N N    . LEU A 1 26  ? 80.836  68.680  42.578 1.00 57.13 ? 108 LEU A N    1 
ATOM 438  C CA   . LEU A 1 26  ? 79.998  67.949  43.511 1.00 53.67 ? 108 LEU A CA   1 
ATOM 439  C C    . LEU A 1 26  ? 79.613  66.531  43.106 1.00 53.47 ? 108 LEU A C    1 
ATOM 440  O O    . LEU A 1 26  ? 79.388  66.304  41.934 1.00 50.23 ? 108 LEU A O    1 
ATOM 441  C CB   . LEU A 1 26  ? 78.748  68.779  43.833 1.00 51.63 ? 108 LEU A CB   1 
ATOM 442  C CG   . LEU A 1 26  ? 78.412  69.166  45.291 1.00 49.53 ? 108 LEU A CG   1 
ATOM 443  C CD1  . LEU A 1 26  ? 79.586  69.835  46.016 1.00 54.23 ? 108 LEU A CD1  1 
ATOM 444  C CD2  . LEU A 1 26  ? 77.215  70.123  45.240 1.00 49.30 ? 108 LEU A CD2  1 
ATOM 445  H H    . LEU A 1 26  ? 80.522  68.748  41.639 1.00 0.00  ? 108 LEU A H    1 
ATOM 446  H HA   . LEU A 1 26  ? 80.618  67.916  44.396 1.00 0.00  ? 108 LEU A HA   1 
ATOM 447  H HB2  . LEU A 1 26  ? 78.845  69.722  43.278 1.00 0.00  ? 108 LEU A HB2  1 
ATOM 448  H HB3  . LEU A 1 26  ? 77.887  68.213  43.459 1.00 0.00  ? 108 LEU A HB3  1 
ATOM 449  H HG   . LEU A 1 26  ? 78.106  68.285  45.864 1.00 0.00  ? 108 LEU A HG   1 
ATOM 450  H HD11 . LEU A 1 26  ? 79.893  70.720  45.458 1.00 0.00  ? 108 LEU A HD11 1 
ATOM 451  H HD12 . LEU A 1 26  ? 79.287  70.112  47.033 1.00 0.00  ? 108 LEU A HD12 1 
ATOM 452  H HD13 . LEU A 1 26  ? 80.431  69.151  46.088 1.00 0.00  ? 108 LEU A HD13 1 
ATOM 453  H HD21 . LEU A 1 26  ? 76.355  69.622  44.771 1.00 0.00  ? 108 LEU A HD21 1 
ATOM 454  H HD22 . LEU A 1 26  ? 76.964  70.424  46.252 1.00 0.00  ? 108 LEU A HD22 1 
ATOM 455  H HD23 . LEU A 1 26  ? 77.478  71.028  44.677 1.00 0.00  ? 108 LEU A HD23 1 
ATOM 456  N N    . PRO A 1 27  ? 79.501  65.602  44.087 1.00 51.48 ? 109 PRO A N    1 
ATOM 457  C CA   . PRO A 1 27  ? 79.110  64.227  43.820 1.00 50.25 ? 109 PRO A CA   1 
ATOM 458  C C    . PRO A 1 27  ? 77.785  64.164  43.111 1.00 48.81 ? 109 PRO A C    1 
ATOM 459  O O    . PRO A 1 27  ? 76.840  64.790  43.548 1.00 46.80 ? 109 PRO A O    1 
ATOM 460  C CB   . PRO A 1 27  ? 78.966  63.667  45.251 1.00 52.25 ? 109 PRO A CB   1 
ATOM 461  C CG   . PRO A 1 27  ? 79.963  64.496  46.063 1.00 49.84 ? 109 PRO A CG   1 
ATOM 462  C CD   . PRO A 1 27  ? 79.725  65.883  45.496 1.00 50.27 ? 109 PRO A CD   1 
ATOM 463  H HA   . PRO A 1 27  ? 79.910  63.687  43.292 1.00 0.00  ? 109 PRO A HA   1 
ATOM 464  H HB2  . PRO A 1 27  ? 77.948  63.838  45.650 1.00 0.00  ? 109 PRO A HB2  1 
ATOM 465  H HB3  . PRO A 1 27  ? 79.211  62.596  45.319 1.00 0.00  ? 109 PRO A HB3  1 
ATOM 466  H HG2  . PRO A 1 27  ? 79.762  64.452  47.148 1.00 0.00  ? 109 PRO A HG2  1 
ATOM 467  H HG3  . PRO A 1 27  ? 81.001  64.161  45.861 1.00 0.00  ? 109 PRO A HG3  1 
ATOM 468  H HD2  . PRO A 1 27  ? 78.846  66.314  45.972 1.00 0.00  ? 109 PRO A HD2  1 
ATOM 469  H HD3  . PRO A 1 27  ? 80.632  66.436  45.763 1.00 0.00  ? 109 PRO A HD3  1 
ATOM 470  N N    . LYS A 1 28  ? 77.722  63.394  42.022 1.00 48.30 ? 110 LYS A N    1 
ATOM 471  C CA   . LYS A 1 28  ? 76.489  63.283  41.258 1.00 49.59 ? 110 LYS A CA   1 
ATOM 472  C C    . LYS A 1 28  ? 75.229  63.261  42.103 1.00 53.61 ? 110 LYS A C    1 
ATOM 473  O O    . LYS A 1 28  ? 74.290  63.992  41.857 1.00 57.03 ? 110 LYS A O    1 
ATOM 474  C CB   . LYS A 1 28  ? 76.528  62.026  40.381 1.00 49.08 ? 110 LYS A CB   1 
ATOM 475  C CG   . LYS A 1 28  ? 77.605  62.076  39.285 1.00 52.85 ? 110 LYS A CG   1 
ATOM 476  C CD   . LYS A 1 28  ? 77.422  60.856  38.369 1.00 55.91 ? 110 LYS A CD   1 
ATOM 477  C CE   . LYS A 1 28  ? 78.346  60.945  37.155 1.00 56.90 ? 110 LYS A CE   1 
ATOM 478  N NZ   . LYS A 1 28  ? 77.817  60.066  36.083 1.00 60.36 ? 110 LYS A NZ   1 
ATOM 479  H H    . LYS A 1 28  ? 78.539  62.905  41.723 1.00 0.00  ? 110 LYS A H    1 
ATOM 480  H HA   . LYS A 1 28  ? 76.442  64.150  40.616 1.00 0.00  ? 110 LYS A HA   1 
ATOM 481  H HB2  . LYS A 1 28  ? 76.734  61.154  41.022 1.00 0.00  ? 110 LYS A HB2  1 
ATOM 482  H HB3  . LYS A 1 28  ? 75.545  61.909  39.897 1.00 0.00  ? 110 LYS A HB3  1 
ATOM 483  H HG2  . LYS A 1 28  ? 77.495  63.002  38.699 1.00 0.00  ? 110 LYS A HG2  1 
ATOM 484  H HG3  . LYS A 1 28  ? 78.612  62.037  39.725 1.00 0.00  ? 110 LYS A HG3  1 
ATOM 485  H HD2  . LYS A 1 28  ? 77.655  59.938  38.934 1.00 0.00  ? 110 LYS A HD2  1 
ATOM 486  H HD3  . LYS A 1 28  ? 76.374  60.821  38.028 1.00 0.00  ? 110 LYS A HD3  1 
ATOM 487  H HE2  . LYS A 1 28  ? 78.377  61.973  36.774 1.00 0.00  ? 110 LYS A HE2  1 
ATOM 488  H HE3  . LYS A 1 28  ? 79.353  60.607  37.428 1.00 0.00  ? 110 LYS A HE3  1 
ATOM 489  H HZ1  . LYS A 1 28  ? 76.826  60.365  35.790 1.00 0.00  ? 110 LYS A HZ1  1 
ATOM 490  H HZ2  . LYS A 1 28  ? 78.445  60.117  35.214 1.00 0.00  ? 110 LYS A HZ2  1 
ATOM 491  H HZ3  . LYS A 1 28  ? 77.775  59.043  36.409 1.00 0.00  ? 110 LYS A HZ3  1 
ATOM 492  N N    . ASP A 1 29  ? 75.221  62.400  43.129 1.00 55.28 ? 111 ASP A N    1 
ATOM 493  C CA   . ASP A 1 29  ? 74.061  62.297  44.021 1.00 55.92 ? 111 ASP A CA   1 
ATOM 494  C C    . ASP A 1 29  ? 73.663  63.600  44.696 1.00 54.66 ? 111 ASP A C    1 
ATOM 495  O O    . ASP A 1 29  ? 72.502  63.800  45.009 1.00 58.30 ? 111 ASP A O    1 
ATOM 496  C CB   . ASP A 1 29  ? 74.312  61.218  45.098 1.00 59.72 ? 111 ASP A CB   1 
ATOM 497  C CG   . ASP A 1 29  ? 73.495  59.964  44.867 1.00 63.83 ? 111 ASP A CG   1 
ATOM 498  O OD1  . ASP A 1 29  ? 72.772  59.862  43.841 1.00 65.71 ? 111 ASP A OD1  1 
ATOM 499  O OD2  . ASP A 1 29  ? 73.563  59.048  45.724 1.00 66.06 ? 111 ASP A OD2  1 
ATOM 500  H H    . ASP A 1 29  ? 76.030  61.828  43.275 1.00 0.00  ? 111 ASP A H    1 
ATOM 501  H HA   . ASP A 1 29  ? 73.210  62.003  43.398 1.00 0.00  ? 111 ASP A HA   1 
ATOM 502  H HB2  . ASP A 1 29  ? 75.377  60.939  45.117 1.00 0.00  ? 111 ASP A HB2  1 
ATOM 503  H HB3  . ASP A 1 29  ? 74.059  61.629  46.087 1.00 0.00  ? 111 ASP A HB3  1 
ATOM 504  N N    . ALA A 1 30  ? 74.641  64.482  44.950 1.00 48.74 ? 112 ALA A N    1 
ATOM 505  C CA   . ALA A 1 30  ? 74.344  65.773  45.575 1.00 44.17 ? 112 ALA A CA   1 
ATOM 506  C C    . ALA A 1 30  ? 73.726  66.776  44.612 1.00 42.51 ? 112 ALA A C    1 
ATOM 507  O O    . ALA A 1 30  ? 72.988  67.654  45.023 1.00 41.93 ? 112 ALA A O    1 
ATOM 508  C CB   . ALA A 1 30  ? 75.635  66.352  46.171 1.00 40.34 ? 112 ALA A CB   1 
ATOM 509  H H    . ALA A 1 30  ? 75.583  64.257  44.700 1.00 0.00  ? 112 ALA A H    1 
ATOM 510  H HA   . ALA A 1 30  ? 73.645  65.602  46.405 1.00 0.00  ? 112 ALA A HA   1 
ATOM 511  H HB1  . ALA A 1 30  ? 75.416  67.322  46.643 1.00 0.00  ? 112 ALA A HB1  1 
ATOM 512  H HB2  . ALA A 1 30  ? 76.035  65.656  46.929 1.00 0.00  ? 112 ALA A HB2  1 
ATOM 513  H HB3  . ALA A 1 30  ? 76.383  66.493  45.375 1.00 0.00  ? 112 ALA A HB3  1 
ATOM 514  N N    . VAL A 1 31  ? 74.044  66.642  43.315 1.00 38.60 ? 113 VAL A N    1 
ATOM 515  C CA   . VAL A 1 31  ? 73.450  67.514  42.306 1.00 37.32 ? 113 VAL A CA   1 
ATOM 516  C C    . VAL A 1 31  ? 71.965  67.230  42.236 1.00 41.31 ? 113 VAL A C    1 
ATOM 517  O O    . VAL A 1 31  ? 71.152  68.133  42.212 1.00 46.18 ? 113 VAL A O    1 
ATOM 518  C CB   . VAL A 1 31  ? 74.091  67.243  40.920 1.00 34.36 ? 113 VAL A CB   1 
ATOM 519  C CG1  . VAL A 1 31  ? 73.423  68.093  39.835 1.00 29.65 ? 113 VAL A CG1  1 
ATOM 520  C CG2  . VAL A 1 31  ? 75.591  67.561  40.957 1.00 33.32 ? 113 VAL A CG2  1 
ATOM 521  H H    . VAL A 1 31  ? 74.667  65.912  43.039 1.00 0.00  ? 113 VAL A H    1 
ATOM 522  H HA   . VAL A 1 31  ? 73.629  68.562  42.575 1.00 0.00  ? 113 VAL A HA   1 
ATOM 523  H HB   . VAL A 1 31  ? 73.966  66.184  40.653 1.00 0.00  ? 113 VAL A HB   1 
ATOM 524  H HG11 . VAL A 1 31  ? 73.533  69.152  40.093 1.00 0.00  ? 113 VAL A HG11 1 
ATOM 525  H HG12 . VAL A 1 31  ? 73.900  67.898  38.865 1.00 0.00  ? 113 VAL A HG12 1 
ATOM 526  H HG13 . VAL A 1 31  ? 72.360  67.834  39.781 1.00 0.00  ? 113 VAL A HG13 1 
ATOM 527  H HG21 . VAL A 1 31  ? 76.086  66.927  41.700 1.00 0.00  ? 113 VAL A HG21 1 
ATOM 528  H HG22 . VAL A 1 31  ? 76.036  67.378  39.972 1.00 0.00  ? 113 VAL A HG22 1 
ATOM 529  H HG23 . VAL A 1 31  ? 75.733  68.619  41.217 1.00 0.00  ? 113 VAL A HG23 1 
ATOM 530  N N    . ASP A 1 32  ? 71.638  65.926  42.208 1.00 39.57 ? 114 ASP A N    1 
ATOM 531  C CA   . ASP A 1 32  ? 70.249  65.480  42.168 1.00 36.38 ? 114 ASP A CA   1 
ATOM 532  C C    . ASP A 1 32  ? 69.486  66.064  43.338 1.00 36.71 ? 114 ASP A C    1 
ATOM 533  O O    . ASP A 1 32  ? 68.359  66.473  43.180 1.00 37.32 ? 114 ASP A O    1 
ATOM 534  C CB   . ASP A 1 32  ? 70.213  63.942  42.285 1.00 37.05 ? 114 ASP A CB   1 
ATOM 535  C CG   . ASP A 1 32  ? 70.954  63.244  41.171 1.00 40.15 ? 114 ASP A CG   1 
ATOM 536  O OD1  . ASP A 1 32  ? 71.802  63.884  40.509 1.00 38.24 ? 114 ASP A OD1  1 
ATOM 537  O OD2  . ASP A 1 32  ? 70.681  62.039  40.945 1.00 40.22 ? 114 ASP A OD2  1 
ATOM 538  H H    . ASP A 1 32  ? 72.361  65.235  42.239 1.00 0.00  ? 114 ASP A H    1 
ATOM 539  H HA   . ASP A 1 32  ? 69.786  65.783  41.217 1.00 0.00  ? 114 ASP A HA   1 
ATOM 540  H HB2  . ASP A 1 32  ? 70.673  63.646  43.239 1.00 0.00  ? 114 ASP A HB2  1 
ATOM 541  H HB3  . ASP A 1 32  ? 69.163  63.612  42.274 1.00 0.00  ? 114 ASP A HB3  1 
ATOM 542  N N    . SER A 1 33  ? 70.116  66.105  44.519 1.00 37.82 ? 115 SER A N    1 
ATOM 543  C CA   . SER A 1 33  ? 69.468  66.654  45.707 1.00 41.15 ? 115 SER A CA   1 
ATOM 544  C C    . SER A 1 33  ? 69.166  68.131  45.532 1.00 42.99 ? 115 SER A C    1 
ATOM 545  O O    . SER A 1 33  ? 68.056  68.574  45.756 1.00 46.59 ? 115 SER A O    1 
ATOM 546  C CB   . SER A 1 33  ? 70.406  66.430  46.915 1.00 41.30 ? 115 SER A CB   1 
ATOM 547  O OG   . SER A 1 33  ? 69.818  66.924  48.121 1.00 45.45 ? 115 SER A OG   1 
ATOM 548  H H    . SER A 1 33  ? 71.050  65.751  44.580 1.00 0.00  ? 115 SER A H    1 
ATOM 549  H HA   . SER A 1 33  ? 68.530  66.112  45.889 1.00 0.00  ? 115 SER A HA   1 
ATOM 550  H HB2  . SER A 1 33  ? 70.602  65.348  47.026 1.00 0.00  ? 115 SER A HB2  1 
ATOM 551  H HB3  . SER A 1 33  ? 71.361  66.953  46.745 1.00 0.00  ? 115 SER A HB3  1 
ATOM 552  H HG   . SER A 1 33  ? 70.409  66.776  48.853 1.00 0.00  ? 115 SER A HG   1 
ATOM 553  N N    . ALA A 1 34  ? 70.188  68.894  45.117 1.00 41.46 ? 116 ALA A N    1 
ATOM 554  C CA   . ALA A 1 34  ? 70.014  70.329  44.924 1.00 37.50 ? 116 ALA A CA   1 
ATOM 555  C C    . ALA A 1 34  ? 68.952  70.656  43.903 1.00 35.45 ? 116 ALA A C    1 
ATOM 556  O O    . ALA A 1 34  ? 68.066  71.444  44.174 1.00 37.40 ? 116 ALA A O    1 
ATOM 557  C CB   . ALA A 1 34  ? 71.344  70.957  44.504 1.00 41.77 ? 116 ALA A CB   1 
ATOM 558  H H    . ALA A 1 34  ? 71.080  68.479  44.930 1.00 0.00  ? 116 ALA A H    1 
ATOM 559  H HA   . ALA A 1 34  ? 69.686  70.784  45.858 1.00 0.00  ? 116 ALA A HA   1 
ATOM 560  H HB1  . ALA A 1 34  ? 71.225  72.037  44.373 1.00 0.00  ? 116 ALA A HB1  1 
ATOM 561  H HB2  . ALA A 1 34  ? 72.091  70.779  45.272 1.00 0.00  ? 116 ALA A HB2  1 
ATOM 562  H HB3  . ALA A 1 34  ? 71.694  70.494  43.575 1.00 0.00  ? 116 ALA A HB3  1 
ATOM 563  N N    . VAL A 1 35  ? 69.053  70.041  42.715 1.00 26.93 ? 117 VAL A N    1 
ATOM 564  C CA   . VAL A 1 35  ? 68.085  70.310  41.655 1.00 27.03 ? 117 VAL A CA   1 
ATOM 565  C C    . VAL A 1 35  ? 66.676  69.953  42.072 1.00 33.93 ? 117 VAL A C    1 
ATOM 566  O O    . VAL A 1 35  ? 65.741  70.702  41.875 1.00 36.84 ? 117 VAL A O    1 
ATOM 567  C CB   . VAL A 1 35  ? 68.425  69.500  40.374 1.00 23.10 ? 117 VAL A CB   1 
ATOM 568  C CG1  . VAL A 1 35  ? 67.329  69.696  39.312 1.00 20.48 ? 117 VAL A CG1  1 
ATOM 569  C CG2  . VAL A 1 35  ? 69.762  69.971  39.785 1.00 21.61 ? 117 VAL A CG2  1 
ATOM 570  H H    . VAL A 1 35  ? 69.799  69.393  42.566 1.00 0.00  ? 117 VAL A H    1 
ATOM 571  H HA   . VAL A 1 35  ? 68.127  71.379  41.413 1.00 0.00  ? 117 VAL A HA   1 
ATOM 572  H HB   . VAL A 1 35  ? 68.502  68.424  40.614 1.00 0.00  ? 117 VAL A HB   1 
ATOM 573  H HG11 . VAL A 1 35  ? 67.239  70.768  39.075 1.00 0.00  ? 117 VAL A HG11 1 
ATOM 574  H HG12 . VAL A 1 35  ? 67.592  69.135  38.404 1.00 0.00  ? 117 VAL A HG12 1 
ATOM 575  H HG13 . VAL A 1 35  ? 66.373  69.322  39.699 1.00 0.00  ? 117 VAL A HG13 1 
ATOM 576  H HG21 . VAL A 1 35  ? 70.563  69.821  40.516 1.00 0.00  ? 117 VAL A HG21 1 
ATOM 577  H HG22 . VAL A 1 35  ? 69.989  69.395  38.878 1.00 0.00  ? 117 VAL A HG22 1 
ATOM 578  H HG23 . VAL A 1 35  ? 69.695  71.038  39.532 1.00 0.00  ? 117 VAL A HG23 1 
ATOM 579  N N    . GLU A 1 36  ? 66.514  68.748  42.629 1.00 38.29 ? 118 GLU A N    1 
ATOM 580  C CA   . GLU A 1 36  ? 65.189  68.291  43.027 1.00 37.88 ? 118 GLU A CA   1 
ATOM 581  C C    . GLU A 1 36  ? 64.609  69.120  44.147 1.00 33.80 ? 118 GLU A C    1 
ATOM 582  O O    . GLU A 1 36  ? 63.451  69.500  44.099 1.00 34.53 ? 118 GLU A O    1 
ATOM 583  C CB   . GLU A 1 36  ? 65.218  66.785  43.374 1.00 42.80 ? 118 GLU A CB   1 
ATOM 584  C CG   . GLU A 1 36  ? 64.712  65.905  42.209 1.00 50.71 ? 118 GLU A CG   1 
ATOM 585  C CD   . GLU A 1 36  ? 65.644  64.788  41.801 1.00 54.00 ? 118 GLU A CD   1 
ATOM 586  O OE1  . GLU A 1 36  ? 66.611  65.063  41.042 1.00 52.99 ? 118 GLU A OE1  1 
ATOM 587  O OE2  . GLU A 1 36  ? 65.408  63.626  42.223 1.00 54.09 ? 118 GLU A OE2  1 
ATOM 588  H H    . GLU A 1 36  ? 67.314  68.166  42.760 1.00 0.00  ? 118 GLU A H    1 
ATOM 589  H HA   . GLU A 1 36  ? 64.513  68.451  42.183 1.00 0.00  ? 118 GLU A HA   1 
ATOM 590  H HB2  . GLU A 1 36  ? 66.229  66.478  43.628 1.00 0.00  ? 118 GLU A HB2  1 
ATOM 591  H HB3  . GLU A 1 36  ? 64.609  66.605  44.269 1.00 0.00  ? 118 GLU A HB3  1 
ATOM 592  H HG2  . GLU A 1 36  ? 63.745  65.478  42.507 1.00 0.00  ? 118 GLU A HG2  1 
ATOM 593  H HG3  . GLU A 1 36  ? 64.554  66.524  41.318 1.00 0.00  ? 118 GLU A HG3  1 
ATOM 594  N N    . LYS A 1 37  ? 65.418  69.409  45.174 1.00 30.47 ? 119 LYS A N    1 
ATOM 595  C CA   . LYS A 1 37  ? 64.911  70.260  46.236 1.00 32.77 ? 119 LYS A CA   1 
ATOM 596  C C    . LYS A 1 37  ? 64.501  71.576  45.605 1.00 36.82 ? 119 LYS A C    1 
ATOM 597  O O    . LYS A 1 37  ? 63.488  72.135  45.972 1.00 41.37 ? 119 LYS A O    1 
ATOM 598  C CB   . LYS A 1 37  ? 65.979  70.434  47.341 1.00 31.55 ? 119 LYS A CB   1 
ATOM 599  C CG   . LYS A 1 37  ? 65.636  71.499  48.392 1.00 37.86 ? 119 LYS A CG   1 
ATOM 600  C CD   . LYS A 1 37  ? 64.216  71.380  48.965 1.00 43.74 ? 119 LYS A CD   1 
ATOM 601  C CE   . LYS A 1 37  ? 63.706  72.751  49.414 1.00 45.17 ? 119 LYS A CE   1 
ATOM 602  N NZ   . LYS A 1 37  ? 62.302  72.733  49.900 1.00 45.05 ? 119 LYS A NZ   1 
ATOM 603  H H    . LYS A 1 37  ? 66.367  69.089  45.185 1.00 0.00  ? 119 LYS A H    1 
ATOM 604  H HA   . LYS A 1 37  ? 64.035  69.738  46.644 1.00 0.00  ? 119 LYS A HA   1 
ATOM 605  H HB2  . LYS A 1 37  ? 66.097  69.475  47.870 1.00 0.00  ? 119 LYS A HB2  1 
ATOM 606  H HB3  . LYS A 1 37  ? 66.932  70.714  46.864 1.00 0.00  ? 119 LYS A HB3  1 
ATOM 607  H HG2  . LYS A 1 37  ? 66.365  71.459  49.209 1.00 0.00  ? 119 LYS A HG2  1 
ATOM 608  H HG3  . LYS A 1 37  ? 65.740  72.459  47.932 1.00 0.00  ? 119 LYS A HG3  1 
ATOM 609  H HD2  . LYS A 1 37  ? 63.514  71.009  48.218 1.00 0.00  ? 119 LYS A HD2  1 
ATOM 610  H HD3  . LYS A 1 37  ? 64.231  70.678  49.807 1.00 0.00  ? 119 LYS A HD3  1 
ATOM 611  H HE2  . LYS A 1 37  ? 64.343  73.110  50.226 1.00 0.00  ? 119 LYS A HE2  1 
ATOM 612  H HE3  . LYS A 1 37  ? 63.739  73.437  48.566 1.00 0.00  ? 119 LYS A HE3  1 
ATOM 613  H HZ1  . LYS A 1 37  ? 62.192  72.072  50.739 1.00 0.00  ? 119 LYS A HZ1  1 
ATOM 614  H HZ2  . LYS A 1 37  ? 62.002  73.717  50.216 1.00 0.00  ? 119 LYS A HZ2  1 
ATOM 615  H HZ3  . LYS A 1 37  ? 61.623  72.417  49.131 1.00 0.00  ? 119 LYS A HZ3  1 
ATOM 616  N N    . ALA A 1 38  ? 65.294  72.045  44.630 1.00 37.29 ? 120 ALA A N    1 
ATOM 617  C CA   . ALA A 1 38  ? 64.983  73.270  43.892 1.00 31.70 ? 120 ALA A CA   1 
ATOM 618  C C    . ALA A 1 38  ? 63.622  73.298  43.273 1.00 29.18 ? 120 ALA A C    1 
ATOM 619  O O    . ALA A 1 38  ? 62.831  74.200  43.481 1.00 28.00 ? 120 ALA A O    1 
ATOM 620  C CB   . ALA A 1 38  ? 66.089  73.634  42.918 1.00 32.19 ? 120 ALA A CB   1 
ATOM 621  H H    . ALA A 1 38  ? 66.096  71.525  44.341 1.00 0.00  ? 120 ALA A H    1 
ATOM 622  H HA   . ALA A 1 38  ? 64.973  74.207  44.489 1.00 0.00  ? 120 ALA A HA   1 
ATOM 623  H HB1  . ALA A 1 38  ? 65.859  74.582  42.420 1.00 0.00  ? 120 ALA A HB1  1 
ATOM 624  H HB2  . ALA A 1 38  ? 67.058  73.720  43.418 1.00 0.00  ? 120 ALA A HB2  1 
ATOM 625  H HB3  . ALA A 1 38  ? 66.150  72.855  42.174 1.00 0.00  ? 120 ALA A HB3  1 
ATOM 626  N N    . LEU A 1 39  ? 63.365  72.270  42.476 1.00 29.23 ? 121 LEU A N    1 
ATOM 627  C CA   . LEU A 1 39  ? 62.077  72.161  41.806 1.00 27.78 ? 121 LEU A CA   1 
ATOM 628  C C    . LEU A 1 39  ? 60.901  72.110  42.760 1.00 28.96 ? 121 LEU A C    1 
ATOM 629  O O    . LEU A 1 39  ? 59.861  72.694  42.508 1.00 25.29 ? 121 LEU A O    1 
ATOM 630  C CB   . LEU A 1 39  ? 62.080  70.877  40.966 1.00 24.90 ? 121 LEU A CB   1 
ATOM 631  C CG   . LEU A 1 39  ? 63.036  70.962  39.760 1.00 24.69 ? 121 LEU A CG   1 
ATOM 632  C CD1  . LEU A 1 39  ? 63.171  69.565  39.155 1.00 24.38 ? 121 LEU A CD1  1 
ATOM 633  C CD2  . LEU A 1 39  ? 62.453  71.911  38.708 1.00 28.16 ? 121 LEU A CD2  1 
ATOM 634  H H    . LEU A 1 39  ? 64.064  71.560  42.352 1.00 0.00  ? 121 LEU A H    1 
ATOM 635  H HA   . LEU A 1 39  ? 61.943  73.042  41.177 1.00 0.00  ? 121 LEU A HA   1 
ATOM 636  H HB2  . LEU A 1 39  ? 62.399  70.036  41.600 1.00 0.00  ? 121 LEU A HB2  1 
ATOM 637  H HB3  . LEU A 1 39  ? 61.064  70.690  40.588 1.00 0.00  ? 121 LEU A HB3  1 
ATOM 638  H HG   . LEU A 1 39  ? 64.035  71.317  40.068 1.00 0.00  ? 121 LEU A HG   1 
ATOM 639  H HD11 . LEU A 1 39  ? 62.175  69.207  38.851 1.00 0.00  ? 121 LEU A HD11 1 
ATOM 640  H HD12 . LEU A 1 39  ? 63.837  69.616  38.283 1.00 0.00  ? 121 LEU A HD12 1 
ATOM 641  H HD13 . LEU A 1 39  ? 63.595  68.888  39.911 1.00 0.00  ? 121 LEU A HD13 1 
ATOM 642  H HD21 . LEU A 1 39  ? 62.346  72.902  39.132 1.00 0.00  ? 121 LEU A HD21 1 
ATOM 643  H HD22 . LEU A 1 39  ? 63.130  71.972  37.851 1.00 0.00  ? 121 LEU A HD22 1 
ATOM 644  H HD23 . LEU A 1 39  ? 61.467  71.552  38.390 1.00 0.00  ? 121 LEU A HD23 1 
ATOM 645  N N    . LYS A 1 40  ? 61.084  71.380  43.874 1.00 32.63 ? 122 LYS A N    1 
ATOM 646  C CA   . LYS A 1 40  ? 60.010  71.235  44.851 1.00 39.49 ? 122 LYS A CA   1 
ATOM 647  C C    . LYS A 1 40  ? 59.520  72.578  45.352 1.00 38.80 ? 122 LYS A C    1 
ATOM 648  O O    . LYS A 1 40  ? 58.343  72.760  45.574 1.00 42.27 ? 122 LYS A O    1 
ATOM 649  C CB   . LYS A 1 40  ? 60.487  70.365  46.032 1.00 44.07 ? 122 LYS A CB   1 
ATOM 650  C CG   . LYS A 1 40  ? 59.315  69.916  46.915 1.00 47.85 ? 122 LYS A CG   1 
ATOM 651  C CD   . LYS A 1 40  ? 59.816  69.467  48.295 1.00 51.68 ? 122 LYS A CD   1 
ATOM 652  C CE   . LYS A 1 40  ? 58.675  68.854  49.117 1.00 55.13 ? 122 LYS A CE   1 
ATOM 653  N NZ   . LYS A 1 40  ? 57.586  69.809  49.434 1.00 50.99 ? 122 LYS A NZ   1 
ATOM 654  H H    . LYS A 1 40  ? 61.966  70.934  44.037 1.00 0.00  ? 122 LYS A H    1 
ATOM 655  H HA   . LYS A 1 40  ? 59.182  70.717  44.360 1.00 0.00  ? 122 LYS A HA   1 
ATOM 656  H HB2  . LYS A 1 40  ? 60.984  69.461  45.641 1.00 0.00  ? 122 LYS A HB2  1 
ATOM 657  H HB3  . LYS A 1 40  ? 61.199  70.941  46.643 1.00 0.00  ? 122 LYS A HB3  1 
ATOM 658  H HG2  . LYS A 1 40  ? 58.630  70.760  47.046 1.00 0.00  ? 122 LYS A HG2  1 
ATOM 659  H HG3  . LYS A 1 40  ? 58.786  69.081  46.428 1.00 0.00  ? 122 LYS A HG3  1 
ATOM 660  H HD2  . LYS A 1 40  ? 60.597  68.700  48.155 1.00 0.00  ? 122 LYS A HD2  1 
ATOM 661  H HD3  . LYS A 1 40  ? 60.242  70.333  48.826 1.00 0.00  ? 122 LYS A HD3  1 
ATOM 662  H HE2  . LYS A 1 40  ? 58.238  68.021  48.555 1.00 0.00  ? 122 LYS A HE2  1 
ATOM 663  H HE3  . LYS A 1 40  ? 59.082  68.505  50.067 1.00 0.00  ? 122 LYS A HE3  1 
ATOM 664  H HZ1  . LYS A 1 40  ? 57.153  70.134  48.522 1.00 0.00  ? 122 LYS A HZ1  1 
ATOM 665  H HZ2  . LYS A 1 40  ? 56.803  69.337  49.993 1.00 0.00  ? 122 LYS A HZ2  1 
ATOM 666  H HZ3  . LYS A 1 40  ? 57.938  70.647  49.996 1.00 0.00  ? 122 LYS A HZ3  1 
ATOM 667  N N    . VAL A 1 41  ? 60.444  73.535  45.495 1.00 38.03 ? 123 VAL A N    1 
ATOM 668  C CA   . VAL A 1 41  ? 60.107  74.868  45.980 1.00 36.46 ? 123 VAL A CA   1 
ATOM 669  C C    . VAL A 1 41  ? 58.929  75.456  45.229 1.00 34.47 ? 123 VAL A C    1 
ATOM 670  O O    . VAL A 1 41  ? 58.094  76.112  45.828 1.00 33.09 ? 123 VAL A O    1 
ATOM 671  C CB   . VAL A 1 41  ? 61.338  75.804  45.854 1.00 36.70 ? 123 VAL A CB   1 
ATOM 672  C CG1  . VAL A 1 41  ? 60.998  77.202  46.375 1.00 37.89 ? 123 VAL A CG1  1 
ATOM 673  C CG2  . VAL A 1 41  ? 62.514  75.270  46.682 1.00 37.14 ? 123 VAL A CG2  1 
ATOM 674  H H    . VAL A 1 41  ? 61.368  73.305  45.220 1.00 0.00  ? 123 VAL A H    1 
ATOM 675  H HA   . VAL A 1 41  ? 59.841  74.787  47.042 1.00 0.00  ? 123 VAL A HA   1 
ATOM 676  H HB   . VAL A 1 41  ? 61.644  75.893  44.799 1.00 0.00  ? 123 VAL A HB   1 
ATOM 677  H HG11 . VAL A 1 41  ? 60.681  77.133  47.429 1.00 0.00  ? 123 VAL A HG11 1 
ATOM 678  H HG12 . VAL A 1 41  ? 61.884  77.852  46.294 1.00 0.00  ? 123 VAL A HG12 1 
ATOM 679  H HG13 . VAL A 1 41  ? 60.183  77.620  45.764 1.00 0.00  ? 123 VAL A HG13 1 
ATOM 680  H HG21 . VAL A 1 41  ? 62.819  74.295  46.324 1.00 0.00  ? 123 VAL A HG21 1 
ATOM 681  H HG22 . VAL A 1 41  ? 63.371  75.940  46.566 1.00 0.00  ? 123 VAL A HG22 1 
ATOM 682  H HG23 . VAL A 1 41  ? 62.223  75.185  47.736 1.00 0.00  ? 123 VAL A HG23 1 
ATOM 683  N N    . TRP A 1 42  ? 58.875  75.212  43.904 1.00 33.64 ? 124 TRP A N    1 
ATOM 684  C CA   . TRP A 1 42  ? 57.773  75.719  43.085 1.00 36.24 ? 124 TRP A CA   1 
ATOM 685  C C    . TRP A 1 42  ? 56.554  74.799  43.047 1.00 38.61 ? 124 TRP A C    1 
ATOM 686  O O    . TRP A 1 42  ? 55.449  75.262  42.826 1.00 40.81 ? 124 TRP A O    1 
ATOM 687  C CB   . TRP A 1 42  ? 58.269  76.017  41.647 1.00 35.67 ? 124 TRP A CB   1 
ATOM 688  C CG   . TRP A 1 42  ? 59.336  77.083  41.538 1.00 38.83 ? 124 TRP A CG   1 
ATOM 689  C CD1  . TRP A 1 42  ? 60.608  76.995  41.123 1.00 40.54 ? 124 TRP A CD1  1 
ATOM 690  C CD2  . TRP A 1 42  ? 59.132  78.561  41.901 1.00 39.40 ? 124 TRP A CD2  1 
ATOM 691  N NE1  . TRP A 1 42  ? 61.227  78.172  41.169 1.00 40.81 ? 124 TRP A NE1  1 
ATOM 692  C CE2  . TRP A 1 42  ? 60.365  79.116  41.629 1.00 38.63 ? 124 TRP A CE2  1 
ATOM 693  C CE3  . TRP A 1 42  ? 58.079  79.249  42.370 1.00 39.17 ? 124 TRP A CE3  1 
ATOM 694  C CZ2  . TRP A 1 42  ? 60.589  80.487  41.834 1.00 37.30 ? 124 TRP A CZ2  1 
ATOM 695  C CZ3  . TRP A 1 42  ? 58.278  80.652  42.599 1.00 37.04 ? 124 TRP A CZ3  1 
ATOM 696  C CH2  . TRP A 1 42  ? 59.500  81.213  42.325 1.00 34.95 ? 124 TRP A CH2  1 
ATOM 697  H H    . TRP A 1 42  ? 59.591  74.659  43.473 1.00 0.00  ? 124 TRP A H    1 
ATOM 698  H HA   . TRP A 1 42  ? 57.457  76.670  43.517 1.00 0.00  ? 124 TRP A HA   1 
ATOM 699  H HB2  . TRP A 1 42  ? 58.683  75.086  41.227 1.00 0.00  ? 124 TRP A HB2  1 
ATOM 700  H HB3  . TRP A 1 42  ? 57.390  76.317  41.046 1.00 0.00  ? 124 TRP A HB3  1 
ATOM 701  H HD1  . TRP A 1 42  ? 61.045  76.061  40.800 1.00 0.00  ? 124 TRP A HD1  1 
ATOM 702  H HE1  . TRP A 1 42  ? 62.193  78.344  40.907 1.00 0.00  ? 124 TRP A HE1  1 
ATOM 703  H HE3  . TRP A 1 42  ? 57.118  78.797  42.577 1.00 0.00  ? 124 TRP A HE3  1 
ATOM 704  H HZ2  . TRP A 1 42  ? 61.524  80.964  41.617 1.00 0.00  ? 124 TRP A HZ2  1 
ATOM 705  H HZ3  . TRP A 1 42  ? 57.455  81.235  42.980 1.00 0.00  ? 124 TRP A HZ3  1 
ATOM 706  H HH2  . TRP A 1 42  ? 59.670  82.274  42.468 1.00 0.00  ? 124 TRP A HH2  1 
ATOM 707  N N    . GLU A 1 43  ? 56.742  73.487  43.250 1.00 39.67 ? 125 GLU A N    1 
ATOM 708  C CA   . GLU A 1 43  ? 55.604  72.558  43.251 1.00 38.03 ? 125 GLU A CA   1 
ATOM 709  C C    . GLU A 1 43  ? 54.685  72.788  44.432 1.00 35.58 ? 125 GLU A C    1 
ATOM 710  O O    . GLU A 1 43  ? 53.482  72.626  44.344 1.00 36.81 ? 125 GLU A O    1 
ATOM 711  C CB   . GLU A 1 43  ? 56.093  71.099  43.364 1.00 42.02 ? 125 GLU A CB   1 
ATOM 712  C CG   . GLU A 1 43  ? 56.445  70.455  42.027 1.00 48.93 ? 125 GLU A CG   1 
ATOM 713  C CD   . GLU A 1 43  ? 56.562  68.946  42.119 1.00 53.64 ? 125 GLU A CD   1 
ATOM 714  O OE1  . GLU A 1 43  ? 55.779  68.336  42.885 1.00 58.31 ? 125 GLU A OE1  1 
ATOM 715  O OE2  . GLU A 1 43  ? 57.421  68.322  41.454 1.00 54.59 ? 125 GLU A OE2  1 
ATOM 716  H H    . GLU A 1 43  ? 57.663  73.142  43.425 1.00 0.00  ? 125 GLU A H    1 
ATOM 717  H HA   . GLU A 1 43  ? 55.029  72.687  42.326 1.00 0.00  ? 125 GLU A HA   1 
ATOM 718  H HB2  . GLU A 1 43  ? 56.985  71.068  44.003 1.00 0.00  ? 125 GLU A HB2  1 
ATOM 719  H HB3  . GLU A 1 43  ? 55.302  70.496  43.824 1.00 0.00  ? 125 GLU A HB3  1 
ATOM 720  H HG2  . GLU A 1 43  ? 55.696  70.721  41.284 1.00 0.00  ? 125 GLU A HG2  1 
ATOM 721  H HG3  . GLU A 1 43  ? 57.387  70.944  41.769 1.00 0.00  ? 125 GLU A HG3  1 
ATOM 722  N N    . GLU A 1 44  ? 55.280  73.149  45.568 1.00 33.76 ? 126 GLU A N    1 
ATOM 723  C CA   . GLU A 1 44  ? 54.499  73.390  46.772 1.00 38.51 ? 126 GLU A CA   1 
ATOM 724  C C    . GLU A 1 44  ? 53.527  74.541  46.602 1.00 41.54 ? 126 GLU A C    1 
ATOM 725  O O    . GLU A 1 44  ? 52.453  74.511  47.178 1.00 49.31 ? 126 GLU A O    1 
ATOM 726  C CB   . GLU A 1 44  ? 55.457  73.723  47.932 1.00 40.59 ? 126 GLU A CB   1 
ATOM 727  C CG   . GLU A 1 44  ? 56.472  72.613  48.197 1.00 48.12 ? 126 GLU A CG   1 
ATOM 728  C CD   . GLU A 1 44  ? 57.512  72.997  49.210 1.00 53.70 ? 126 GLU A CD   1 
ATOM 729  O OE1  . GLU A 1 44  ? 57.133  73.602  50.244 1.00 55.14 ? 126 GLU A OE1  1 
ATOM 730  O OE2  . GLU A 1 44  ? 58.712  72.687  48.988 1.00 59.17 ? 126 GLU A OE2  1 
ATOM 731  H H    . GLU A 1 44  ? 56.271  73.275  45.562 1.00 0.00  ? 126 GLU A H    1 
ATOM 732  H HA   . GLU A 1 44  ? 53.935  72.477  47.012 1.00 0.00  ? 126 GLU A HA   1 
ATOM 733  H HB2  . GLU A 1 44  ? 56.007  74.645  47.694 1.00 0.00  ? 126 GLU A HB2  1 
ATOM 734  H HB3  . GLU A 1 44  ? 54.861  73.860  48.847 1.00 0.00  ? 126 GLU A HB3  1 
ATOM 735  H HG2  . GLU A 1 44  ? 55.892  71.756  48.535 1.00 0.00  ? 126 GLU A HG2  1 
ATOM 736  H HG3  . GLU A 1 44  ? 56.990  72.340  47.286 1.00 0.00  ? 126 GLU A HG3  1 
ATOM 737  N N    . VAL A 1 45  ? 53.914  75.563  45.820 1.00 40.81 ? 127 VAL A N    1 
ATOM 738  C CA   . VAL A 1 45  ? 53.057  76.736  45.636 1.00 37.49 ? 127 VAL A CA   1 
ATOM 739  C C    . VAL A 1 45  ? 52.164  76.711  44.414 1.00 36.96 ? 127 VAL A C    1 
ATOM 740  O O    . VAL A 1 45  ? 51.470  77.683  44.158 1.00 35.44 ? 127 VAL A O    1 
ATOM 741  C CB   . VAL A 1 45  ? 53.893  78.039  45.649 1.00 38.21 ? 127 VAL A CB   1 
ATOM 742  C CG1  . VAL A 1 45  ? 54.690  78.122  46.957 1.00 41.49 ? 127 VAL A CG1  1 
ATOM 743  C CG2  . VAL A 1 45  ? 54.865  78.118  44.466 1.00 34.54 ? 127 VAL A CG2  1 
ATOM 744  H H    . VAL A 1 45  ? 54.799  75.501  45.364 1.00 0.00  ? 127 VAL A H    1 
ATOM 745  H HA   . VAL A 1 45  ? 52.374  76.783  46.489 1.00 0.00  ? 127 VAL A HA   1 
ATOM 746  H HB   . VAL A 1 45  ? 53.218  78.906  45.598 1.00 0.00  ? 127 VAL A HB   1 
ATOM 747  H HG11 . VAL A 1 45  ? 55.363  77.257  47.042 1.00 0.00  ? 127 VAL A HG11 1 
ATOM 748  H HG12 . VAL A 1 45  ? 55.288  79.040  46.963 1.00 0.00  ? 127 VAL A HG12 1 
ATOM 749  H HG13 . VAL A 1 45  ? 53.994  78.139  47.806 1.00 0.00  ? 127 VAL A HG13 1 
ATOM 750  H HG21 . VAL A 1 45  ? 54.317  78.090  43.535 1.00 0.00  ? 127 VAL A HG21 1 
ATOM 751  H HG22 . VAL A 1 45  ? 55.434  79.048  44.517 1.00 0.00  ? 127 VAL A HG22 1 
ATOM 752  H HG23 . VAL A 1 45  ? 55.561  77.287  44.477 1.00 0.00  ? 127 VAL A HG23 1 
ATOM 753  N N    . THR A 1 46  ? 52.176  75.597  43.664 1.00 33.42 ? 128 THR A N    1 
ATOM 754  C CA   . THR A 1 46  ? 51.365  75.492  42.451 1.00 32.44 ? 128 THR A CA   1 
ATOM 755  C C    . THR A 1 46  ? 50.890  74.067  42.250 1.00 33.28 ? 128 THR A C    1 
ATOM 756  O O    . THR A 1 46  ? 51.291  73.206  43.013 1.00 38.06 ? 128 THR A O    1 
ATOM 757  C CB   . THR A 1 46  ? 52.231  75.892  41.243 1.00 33.02 ? 128 THR A CB   1 
ATOM 758  O OG1  . THR A 1 46  ? 53.315  74.982  41.127 1.00 37.04 ? 128 THR A OG1  1 
ATOM 759  C CG2  . THR A 1 46  ? 52.716  77.329  41.308 1.00 34.86 ? 128 THR A CG2  1 
ATOM 760  H H    . THR A 1 46  ? 52.736  74.815  43.927 1.00 0.00  ? 128 THR A H    1 
ATOM 761  H HA   . THR A 1 46  ? 50.494  76.151  42.522 1.00 0.00  ? 128 THR A HA   1 
ATOM 762  H HB   . THR A 1 46  ? 51.695  75.816  40.291 1.00 0.00  ? 128 THR A HB   1 
ATOM 763  H HG1  . THR A 1 46  ? 53.926  75.044  41.847 1.00 0.00  ? 128 THR A HG1  1 
ATOM 764  H HG21 . THR A 1 46  ? 52.709  77.648  42.327 1.00 0.00  ? 128 THR A HG21 1 
ATOM 765  H HG22 . THR A 1 46  ? 53.741  77.387  40.941 1.00 0.00  ? 128 THR A HG22 1 
ATOM 766  H HG23 . THR A 1 46  ? 52.055  78.008  40.769 1.00 0.00  ? 128 THR A HG23 1 
ATOM 767  N N    . PRO A 1 47  ? 50.035  73.796  41.247 1.00 33.23 ? 129 PRO A N    1 
ATOM 768  C CA   . PRO A 1 47  ? 49.656  72.425  40.939 1.00 33.75 ? 129 PRO A CA   1 
ATOM 769  C C    . PRO A 1 47  ? 50.602  71.717  40.009 1.00 35.00 ? 129 PRO A C    1 
ATOM 770  O O    . PRO A 1 47  ? 50.267  70.670  39.492 1.00 38.90 ? 129 PRO A O    1 
ATOM 771  C CB   . PRO A 1 47  ? 48.380  72.661  40.156 1.00 34.62 ? 129 PRO A CB   1 
ATOM 772  C CG   . PRO A 1 47  ? 48.533  74.010  39.503 1.00 29.80 ? 129 PRO A CG   1 
ATOM 773  C CD   . PRO A 1 47  ? 49.211  74.808  40.608 1.00 32.24 ? 129 PRO A CD   1 
ATOM 774  H HA   . PRO A 1 47  ? 49.494  71.852  41.856 1.00 0.00  ? 129 PRO A HA   1 
ATOM 775  H HB2  . PRO A 1 47  ? 48.061  71.872  39.494 1.00 0.00  ? 129 PRO A HB2  1 
ATOM 776  H HB3  . PRO A 1 47  ? 47.533  72.801  40.868 1.00 0.00  ? 129 PRO A HB3  1 
ATOM 777  H HG2  . PRO A 1 47  ? 49.192  73.860  38.634 1.00 0.00  ? 129 PRO A HG2  1 
ATOM 778  H HG3  . PRO A 1 47  ? 47.573  74.456  39.184 1.00 0.00  ? 129 PRO A HG3  1 
ATOM 779  H HD2  . PRO A 1 47  ? 49.688  75.660  40.133 1.00 0.00  ? 129 PRO A HD2  1 
ATOM 780  H HD3  . PRO A 1 47  ? 48.478  75.190  41.314 1.00 0.00  ? 129 PRO A HD3  1 
ATOM 781  N N    . LEU A 1 48  ? 51.793  72.295  39.828 1.00 34.87 ? 130 LEU A N    1 
ATOM 782  C CA   . LEU A 1 48  ? 52.782  71.748  38.920 1.00 35.12 ? 130 LEU A CA   1 
ATOM 783  C C    . LEU A 1 48  ? 53.461  70.506  39.446 1.00 36.84 ? 130 LEU A C    1 
ATOM 784  O O    . LEU A 1 48  ? 53.621  70.353  40.640 1.00 35.52 ? 130 LEU A O    1 
ATOM 785  C CB   . LEU A 1 48  ? 53.879  72.789  38.646 1.00 35.11 ? 130 LEU A CB   1 
ATOM 786  C CG   . LEU A 1 48  ? 53.384  74.097  37.988 1.00 33.99 ? 130 LEU A CG   1 
ATOM 787  C CD1  . LEU A 1 48  ? 54.408  75.212  38.250 1.00 33.39 ? 130 LEU A CD1  1 
ATOM 788  C CD2  . LEU A 1 48  ? 53.194  73.901  36.478 1.00 30.24 ? 130 LEU A CD2  1 
ATOM 789  H H    . LEU A 1 48  ? 52.034  73.119  40.321 1.00 0.00  ? 130 LEU A H    1 
ATOM 790  H HA   . LEU A 1 48  ? 52.288  71.503  37.977 1.00 0.00  ? 130 LEU A HA   1 
ATOM 791  H HB2  . LEU A 1 48  ? 54.339  73.050  39.610 1.00 0.00  ? 130 LEU A HB2  1 
ATOM 792  H HB3  . LEU A 1 48  ? 54.636  72.340  37.987 1.00 0.00  ? 130 LEU A HB3  1 
ATOM 793  H HG   . LEU A 1 48  ? 52.420  74.402  38.422 1.00 0.00  ? 130 LEU A HG   1 
ATOM 794  H HD11 . LEU A 1 48  ? 55.393  74.916  37.864 1.00 0.00  ? 130 LEU A HD11 1 
ATOM 795  H HD12 . LEU A 1 48  ? 54.075  76.144  37.777 1.00 0.00  ? 130 LEU A HD12 1 
ATOM 796  H HD13 . LEU A 1 48  ? 54.505  75.383  39.323 1.00 0.00  ? 130 LEU A HD13 1 
ATOM 797  H HD21 . LEU A 1 48  ? 52.449  73.123  36.318 1.00 0.00  ? 130 LEU A HD21 1 
ATOM 798  H HD22 . LEU A 1 48  ? 52.855  74.836  36.025 1.00 0.00  ? 130 LEU A HD22 1 
ATOM 799  H HD23 . LEU A 1 48  ? 54.141  73.598  36.021 1.00 0.00  ? 130 LEU A HD23 1 
ATOM 800  N N    . THR A 1 49  ? 53.844  69.626  38.494 1.00 38.70 ? 131 THR A N    1 
ATOM 801  C CA   . THR A 1 49  ? 54.502  68.368  38.827 1.00 40.46 ? 131 THR A CA   1 
ATOM 802  C C    . THR A 1 49  ? 55.742  68.244  37.967 1.00 43.68 ? 131 THR A C    1 
ATOM 803  O O    . THR A 1 49  ? 55.752  68.713  36.843 1.00 43.59 ? 131 THR A O    1 
ATOM 804  C CB   . THR A 1 49  ? 53.584  67.153  38.555 1.00 36.19 ? 131 THR A CB   1 
ATOM 805  O OG1  . THR A 1 49  ? 53.386  67.013  37.156 1.00 36.36 ? 131 THR A OG1  1 
ATOM 806  C CG2  . THR A 1 49  ? 52.212  67.335  39.229 1.00 31.46 ? 131 THR A CG2  1 
ATOM 807  H H    . THR A 1 49  ? 53.668  69.818  37.532 1.00 0.00  ? 131 THR A H    1 
ATOM 808  H HA   . THR A 1 49  ? 54.769  68.355  39.894 1.00 0.00  ? 131 THR A HA   1 
ATOM 809  H HB   . THR A 1 49  ? 54.059  66.229  38.923 1.00 0.00  ? 131 THR A HB   1 
ATOM 810  H HG1  . THR A 1 49  ? 52.844  66.261  36.957 1.00 0.00  ? 131 THR A HG1  1 
ATOM 811  H HG21 . THR A 1 49  ? 52.024  68.395  39.430 1.00 0.00  ? 131 THR A HG21 1 
ATOM 812  H HG22 . THR A 1 49  ? 51.409  66.962  38.579 1.00 0.00  ? 131 THR A HG22 1 
ATOM 813  H HG23 . THR A 1 49  ? 52.193  66.777  40.175 1.00 0.00  ? 131 THR A HG23 1 
ATOM 814  N N    . PHE A 1 50  ? 56.779  67.597  38.529 1.00 44.94 ? 132 PHE A N    1 
ATOM 815  C CA   . PHE A 1 50  ? 58.038  67.427  37.822 1.00 44.85 ? 132 PHE A CA   1 
ATOM 816  C C    . PHE A 1 50  ? 58.490  65.984  37.832 1.00 46.84 ? 132 PHE A C    1 
ATOM 817  O O    . PHE A 1 50  ? 58.685  65.402  38.882 1.00 49.06 ? 132 PHE A O    1 
ATOM 818  C CB   . PHE A 1 50  ? 59.147  68.269  38.461 1.00 41.56 ? 132 PHE A CB   1 
ATOM 819  C CG   . PHE A 1 50  ? 58.913  69.757  38.287 1.00 40.80 ? 132 PHE A CG   1 
ATOM 820  C CD1  . PHE A 1 50  ? 59.338  70.422  37.151 1.00 41.11 ? 132 PHE A CD1  1 
ATOM 821  C CD2  . PHE A 1 50  ? 58.264  70.479  39.269 1.00 40.26 ? 132 PHE A CD2  1 
ATOM 822  C CE1  . PHE A 1 50  ? 59.105  71.791  37.010 1.00 41.68 ? 132 PHE A CE1  1 
ATOM 823  C CE2  . PHE A 1 50  ? 58.019  71.844  39.166 1.00 39.94 ? 132 PHE A CE2  1 
ATOM 824  C CZ   . PHE A 1 50  ? 58.447  72.491  38.019 1.00 40.96 ? 132 PHE A CZ   1 
ATOM 825  H H    . PHE A 1 50  ? 56.710  67.232  39.454 1.00 0.00  ? 132 PHE A H    1 
ATOM 826  H HA   . PHE A 1 50  ? 57.921  67.778  36.797 1.00 0.00  ? 132 PHE A HA   1 
ATOM 827  H HB2  . PHE A 1 50  ? 59.207  68.028  39.530 1.00 0.00  ? 132 PHE A HB2  1 
ATOM 828  H HB3  . PHE A 1 50  ? 60.101  68.042  37.979 1.00 0.00  ? 132 PHE A HB3  1 
ATOM 829  H HD1  . PHE A 1 50  ? 59.855  69.874  36.374 1.00 0.00  ? 132 PHE A HD1  1 
ATOM 830  H HD2  . PHE A 1 50  ? 57.962  69.915  40.107 1.00 0.00  ? 132 PHE A HD2  1 
ATOM 831  H HE1  . PHE A 1 50  ? 59.436  72.301  36.116 1.00 0.00  ? 132 PHE A HE1  1 
ATOM 832  H HE2  . PHE A 1 50  ? 57.506  72.383  39.949 1.00 0.00  ? 132 PHE A HE2  1 
ATOM 833  H HZ   . PHE A 1 50  ? 58.263  73.552  37.917 1.00 0.00  ? 132 PHE A HZ   1 
ATOM 834  N N    . SER A 1 51  ? 58.668  65.431  36.618 1.00 46.95 ? 133 SER A N    1 
ATOM 835  C CA   . SER A 1 51  ? 59.116  64.058  36.474 1.00 48.45 ? 133 SER A CA   1 
ATOM 836  C C    . SER A 1 51  ? 60.511  64.038  35.883 1.00 46.59 ? 133 SER A C    1 
ATOM 837  O O    . SER A 1 51  ? 60.751  64.617  34.840 1.00 47.47 ? 133 SER A O    1 
ATOM 838  C CB   . SER A 1 51  ? 58.134  63.298  35.564 1.00 53.34 ? 133 SER A CB   1 
ATOM 839  O OG   . SER A 1 51  ? 57.773  64.092  34.427 1.00 59.95 ? 133 SER A OG   1 
ATOM 840  H H    . SER A 1 51  ? 58.502  65.952  35.784 1.00 0.00  ? 133 SER A H    1 
ATOM 841  H HA   . SER A 1 51  ? 59.112  63.556  37.453 1.00 0.00  ? 133 SER A HA   1 
ATOM 842  H HB2  . SER A 1 51  ? 58.610  62.365  35.221 1.00 0.00  ? 133 SER A HB2  1 
ATOM 843  H HB3  . SER A 1 51  ? 57.220  63.060  36.138 1.00 0.00  ? 133 SER A HB3  1 
ATOM 844  H HG   . SER A 1 51  ? 57.165  63.608  33.876 1.00 0.00  ? 133 SER A HG   1 
ATOM 845  N N    . ARG A 1 52  ? 61.445  63.357  36.563 1.00 44.88 ? 134 ARG A N    1 
ATOM 846  C CA   . ARG A 1 52  ? 62.811  63.303  36.064 1.00 43.67 ? 134 ARG A CA   1 
ATOM 847  C C    . ARG A 1 52  ? 62.961  62.274  34.966 1.00 41.19 ? 134 ARG A C    1 
ATOM 848  O O    . ARG A 1 52  ? 62.356  61.219  35.026 1.00 43.61 ? 134 ARG A O    1 
ATOM 849  C CB   . ARG A 1 52  ? 63.771  62.983  37.221 1.00 46.58 ? 134 ARG A CB   1 
ATOM 850  C CG   . ARG A 1 52  ? 65.256  63.089  36.833 1.00 46.58 ? 134 ARG A CG   1 
ATOM 851  C CD   . ARG A 1 52  ? 66.121  63.116  38.098 1.00 46.79 ? 134 ARG A CD   1 
ATOM 852  N NE   . ARG A 1 52  ? 67.537  63.029  37.782 1.00 50.24 ? 134 ARG A NE   1 
ATOM 853  C CZ   . ARG A 1 52  ? 68.441  62.561  38.618 1.00 53.33 ? 134 ARG A CZ   1 
ATOM 854  N NH1  . ARG A 1 52  ? 68.119  62.173  39.832 1.00 55.05 ? 134 ARG A NH1  1 
ATOM 855  N NH2  . ARG A 1 52  ? 69.689  62.471  38.215 1.00 51.68 ? 134 ARG A NH2  1 
ATOM 856  H H    . ARG A 1 52  ? 61.223  62.887  37.418 1.00 0.00  ? 134 ARG A H    1 
ATOM 857  H HA   . ARG A 1 52  ? 63.074  64.299  35.675 1.00 0.00  ? 134 ARG A HA   1 
ATOM 858  H HB2  . ARG A 1 52  ? 63.573  63.691  38.036 1.00 0.00  ? 134 ARG A HB2  1 
ATOM 859  H HB3  . ARG A 1 52  ? 63.573  61.960  37.577 1.00 0.00  ? 134 ARG A HB3  1 
ATOM 860  H HG2  . ARG A 1 52  ? 65.531  62.215  36.220 1.00 0.00  ? 134 ARG A HG2  1 
ATOM 861  H HG3  . ARG A 1 52  ? 65.427  64.017  36.266 1.00 0.00  ? 134 ARG A HG3  1 
ATOM 862  H HD2  . ARG A 1 52  ? 65.912  64.046  38.652 1.00 0.00  ? 134 ARG A HD2  1 
ATOM 863  H HD3  . ARG A 1 52  ? 65.770  62.248  38.679 1.00 0.00  ? 134 ARG A HD3  1 
ATOM 864  H HH11 . ARG A 1 52  ? 67.166  62.211  40.190 1.00 0.00  ? 134 ARG A HH11 1 
ATOM 865  H HH12 . ARG A 1 52  ? 68.821  61.813  40.470 1.00 0.00  ? 134 ARG A HH12 1 
ATOM 866  H HH21 . ARG A 1 52  ? 69.951  62.737  37.258 1.00 0.00  ? 134 ARG A HH21 1 
ATOM 867  H HH22 . ARG A 1 52  ? 70.418  62.112  38.850 1.00 0.00  ? 134 ARG A HH22 1 
ATOM 868  N N    . LEU A 1 53  ? 63.791  62.605  33.967 1.00 38.47 ? 135 LEU A N    1 
ATOM 869  C CA   . LEU A 1 53  ? 64.027  61.708  32.844 1.00 39.11 ? 135 LEU A CA   1 
ATOM 870  C C    . LEU A 1 53  ? 65.522  61.497  32.720 1.00 42.22 ? 135 LEU A C    1 
ATOM 871  O O    . LEU A 1 53  ? 66.298  62.223  33.312 1.00 39.63 ? 135 LEU A O    1 
ATOM 872  C CB   . LEU A 1 53  ? 63.483  62.338  31.540 1.00 33.25 ? 135 LEU A CB   1 
ATOM 873  C CG   . LEU A 1 53  ? 62.191  61.726  30.950 1.00 30.25 ? 135 LEU A CG   1 
ATOM 874  C CD1  . LEU A 1 53  ? 61.041  61.756  31.968 1.00 28.69 ? 135 LEU A CD1  1 
ATOM 875  C CD2  . LEU A 1 53  ? 61.821  62.457  29.667 1.00 23.21 ? 135 LEU A CD2  1 
ATOM 876  H H    . LEU A 1 53  ? 64.266  63.488  33.969 1.00 0.00  ? 135 LEU A H    1 
ATOM 877  H HA   . LEU A 1 53  ? 63.547  60.733  33.010 1.00 0.00  ? 135 LEU A HA   1 
ATOM 878  H HB2  . LEU A 1 53  ? 63.288  63.402  31.736 1.00 0.00  ? 135 LEU A HB2  1 
ATOM 879  H HB3  . LEU A 1 53  ? 64.251  62.243  30.760 1.00 0.00  ? 135 LEU A HB3  1 
ATOM 880  H HG   . LEU A 1 53  ? 62.369  60.692  30.634 1.00 0.00  ? 135 LEU A HG   1 
ATOM 881  H HD11 . LEU A 1 53  ? 60.861  62.785  32.307 1.00 0.00  ? 135 LEU A HD11 1 
ATOM 882  H HD12 . LEU A 1 53  ? 60.131  61.347  31.509 1.00 0.00  ? 135 LEU A HD12 1 
ATOM 883  H HD13 . LEU A 1 53  ? 61.316  61.132  32.824 1.00 0.00  ? 135 LEU A HD13 1 
ATOM 884  H HD21 . LEU A 1 53  ? 62.611  62.481  28.939 1.00 0.00  ? 135 LEU A HD21 1 
ATOM 885  H HD22 . LEU A 1 53  ? 60.858  62.140  29.253 1.00 0.00  ? 135 LEU A HD22 1 
ATOM 886  H HD23 . LEU A 1 53  ? 61.796  63.545  29.903 1.00 0.00  ? 135 LEU A HD23 1 
ATOM 887  N N    . TYR A 1 54  ? 65.910  60.481  31.925 1.00 45.23 ? 136 TYR A N    1 
ATOM 888  C CA   . TYR A 1 54  ? 67.330  60.189  31.712 1.00 45.29 ? 136 TYR A CA   1 
ATOM 889  C C    . TYR A 1 54  ? 67.689  59.955  30.260 1.00 45.79 ? 136 TYR A C    1 
ATOM 890  O O    . TYR A 1 54  ? 68.809  59.608  29.930 1.00 48.17 ? 136 TYR A O    1 
ATOM 891  C CB   . TYR A 1 54  ? 67.729  58.946  32.518 1.00 42.09 ? 136 TYR A CB   1 
ATOM 892  C CG   . TYR A 1 54  ? 67.666  59.205  34.015 1.00 40.52 ? 136 TYR A CG   1 
ATOM 893  C CD1  . TYR A 1 54  ? 66.440  59.206  34.680 1.00 38.88 ? 136 TYR A CD1  1 
ATOM 894  C CD2  . TYR A 1 54  ? 68.844  59.439  34.733 1.00 40.30 ? 136 TYR A CD2  1 
ATOM 895  C CE1  . TYR A 1 54  ? 66.390  59.434  36.053 1.00 39.93 ? 136 TYR A CE1  1 
ATOM 896  C CE2  . TYR A 1 54  ? 68.797  59.662  36.104 1.00 40.36 ? 136 TYR A CE2  1 
ATOM 897  C CZ   . TYR A 1 54  ? 67.569  59.656  36.765 1.00 39.54 ? 136 TYR A CZ   1 
ATOM 898  O OH   . TYR A 1 54  ? 67.534  59.867  38.137 1.00 42.10 ? 136 TYR A OH   1 
ATOM 899  H H    . TYR A 1 54  ? 65.205  59.895  31.521 1.00 0.00  ? 136 TYR A H    1 
ATOM 900  H HA   . TYR A 1 54  ? 67.937  61.031  32.061 1.00 0.00  ? 136 TYR A HA   1 
ATOM 901  H HB2  . TYR A 1 54  ? 67.047  58.119  32.273 1.00 0.00  ? 136 TYR A HB2  1 
ATOM 902  H HB3  . TYR A 1 54  ? 68.759  58.663  32.252 1.00 0.00  ? 136 TYR A HB3  1 
ATOM 903  H HD1  . TYR A 1 54  ? 65.524  59.023  34.134 1.00 0.00  ? 136 TYR A HD1  1 
ATOM 904  H HD2  . TYR A 1 54  ? 69.799  59.441  34.220 1.00 0.00  ? 136 TYR A HD2  1 
ATOM 905  H HE1  . TYR A 1 54  ? 65.433  59.437  36.564 1.00 0.00  ? 136 TYR A HE1  1 
ATOM 906  H HE2  . TYR A 1 54  ? 69.711  59.838  36.661 1.00 0.00  ? 136 TYR A HE2  1 
ATOM 907  H HH   . TYR A 1 54  ? 66.638  59.837  38.452 1.00 0.00  ? 136 TYR A HH   1 
ATOM 908  N N    . GLU A 1 55  ? 66.713  60.161  29.372 1.00 45.04 ? 137 GLU A N    1 
ATOM 909  C CA   . GLU A 1 55  ? 66.931  59.971  27.963 1.00 51.12 ? 137 GLU A CA   1 
ATOM 910  C C    . GLU A 1 55  ? 65.845  60.751  27.260 1.00 51.11 ? 137 GLU A C    1 
ATOM 911  O O    . GLU A 1 55  ? 64.789  60.984  27.824 1.00 49.34 ? 137 GLU A O    1 
ATOM 912  C CB   . GLU A 1 55  ? 66.882  58.469  27.603 1.00 60.25 ? 137 GLU A CB   1 
ATOM 913  C CG   . GLU A 1 55  ? 65.572  57.776  28.035 1.00 73.51 ? 137 GLU A CG   1 
ATOM 914  C CD   . GLU A 1 55  ? 65.618  56.271  27.847 1.00 78.54 ? 137 GLU A CD   1 
ATOM 915  O OE1  . GLU A 1 55  ? 65.589  55.803  26.678 1.00 84.40 ? 137 GLU A OE1  1 
ATOM 916  O OE2  . GLU A 1 55  ? 65.675  55.541  28.871 1.00 81.76 ? 137 GLU A OE2  1 
ATOM 917  H H    . GLU A 1 55  ? 65.805  60.468  29.622 1.00 0.00  ? 137 GLU A H    1 
ATOM 918  H HA   . GLU A 1 55  ? 67.919  60.372  27.685 1.00 0.00  ? 137 GLU A HA   1 
ATOM 919  H HB2  . GLU A 1 55  ? 66.993  58.371  26.512 1.00 0.00  ? 137 GLU A HB2  1 
ATOM 920  H HB3  . GLU A 1 55  ? 67.726  57.968  28.105 1.00 0.00  ? 137 GLU A HB3  1 
ATOM 921  H HG2  . GLU A 1 55  ? 65.391  57.997  29.098 1.00 0.00  ? 137 GLU A HG2  1 
ATOM 922  H HG3  . GLU A 1 55  ? 64.746  58.187  27.436 1.00 0.00  ? 137 GLU A HG3  1 
ATOM 923  N N    . GLY A 1 56  ? 66.139  61.155  26.018 1.00 50.69 ? 138 GLY A N    1 
ATOM 924  C CA   . GLY A 1 56  ? 65.174  61.931  25.269 1.00 51.41 ? 138 GLY A CA   1 
ATOM 925  C C    . GLY A 1 56  ? 65.240  63.387  25.668 1.00 53.50 ? 138 GLY A C    1 
ATOM 926  O O    . GLY A 1 56  ? 66.071  63.783  26.464 1.00 51.55 ? 138 GLY A O    1 
ATOM 927  H H    . GLY A 1 56  ? 67.027  60.946  25.608 1.00 0.00  ? 138 GLY A H    1 
ATOM 928  H HA2  . GLY A 1 56  ? 65.395  61.838  24.195 1.00 0.00  ? 138 GLY A HA2  1 
ATOM 929  H HA3  . GLY A 1 56  ? 64.161  61.543  25.456 1.00 0.00  ? 138 GLY A HA3  1 
ATOM 930  N N    . GLU A 1 57  ? 64.329  64.184  25.081 1.00 55.34 ? 139 GLU A N    1 
ATOM 931  C CA   . GLU A 1 57  ? 64.282  65.610  25.371 1.00 54.57 ? 139 GLU A CA   1 
ATOM 932  C C    . GLU A 1 57  ? 63.183  65.918  26.376 1.00 51.63 ? 139 GLU A C    1 
ATOM 933  O O    . GLU A 1 57  ? 62.009  65.720  26.122 1.00 50.13 ? 139 GLU A O    1 
ATOM 934  C CB   . GLU A 1 57  ? 64.032  66.412  24.076 1.00 59.36 ? 139 GLU A CB   1 
ATOM 935  C CG   . GLU A 1 57  ? 65.086  66.185  22.971 1.00 63.49 ? 139 GLU A CG   1 
ATOM 936  C CD   . GLU A 1 57  ? 66.323  67.023  23.175 1.00 64.75 ? 139 GLU A CD   1 
ATOM 937  O OE1  . GLU A 1 57  ? 66.204  68.278  23.151 1.00 63.06 ? 139 GLU A OE1  1 
ATOM 938  O OE2  . GLU A 1 57  ? 67.418  66.430  23.354 1.00 63.84 ? 139 GLU A OE2  1 
ATOM 939  H H    . GLU A 1 57  ? 63.674  63.799  24.430 1.00 0.00  ? 139 GLU A H    1 
ATOM 940  H HA   . GLU A 1 57  ? 65.260  65.926  25.764 1.00 0.00  ? 139 GLU A HA   1 
ATOM 941  H HB2  . GLU A 1 57  ? 63.050  66.111  23.676 1.00 0.00  ? 139 GLU A HB2  1 
ATOM 942  H HB3  . GLU A 1 57  ? 64.014  67.483  24.325 1.00 0.00  ? 139 GLU A HB3  1 
ATOM 943  H HG2  . GLU A 1 57  ? 65.365  65.121  22.950 1.00 0.00  ? 139 GLU A HG2  1 
ATOM 944  H HG3  . GLU A 1 57  ? 64.636  66.458  22.002 1.00 0.00  ? 139 GLU A HG3  1 
ATOM 945  N N    . ALA A 1 58  ? 63.603  66.420  27.545 1.00 48.66 ? 140 ALA A N    1 
ATOM 946  C CA   . ALA A 1 58  ? 62.650  66.842  28.557 1.00 46.00 ? 140 ALA A CA   1 
ATOM 947  C C    . ALA A 1 58  ? 62.339  68.295  28.272 1.00 43.93 ? 140 ALA A C    1 
ATOM 948  O O    . ALA A 1 58  ? 62.911  68.883  27.374 1.00 46.39 ? 140 ALA A O    1 
ATOM 949  C CB   . ALA A 1 58  ? 63.293  66.682  29.944 1.00 44.86 ? 140 ALA A CB   1 
ATOM 950  H H    . ALA A 1 58  ? 64.572  66.542  27.736 1.00 0.00  ? 140 ALA A H    1 
ATOM 951  H HA   . ALA A 1 58  ? 61.736  66.228  28.521 1.00 0.00  ? 140 ALA A HA   1 
ATOM 952  H HB1  . ALA A 1 58  ? 62.562  66.965  30.703 1.00 0.00  ? 140 ALA A HB1  1 
ATOM 953  H HB2  . ALA A 1 58  ? 63.578  65.633  30.111 1.00 0.00  ? 140 ALA A HB2  1 
ATOM 954  H HB3  . ALA A 1 58  ? 64.183  67.324  30.016 1.00 0.00  ? 140 ALA A HB3  1 
ATOM 955  N N    . ASP A 1 59  ? 61.426  68.892  29.037 1.00 40.71 ? 141 ASP A N    1 
ATOM 956  C CA   . ASP A 1 59  ? 61.111  70.297  28.842 1.00 36.31 ? 141 ASP A CA   1 
ATOM 957  C C    . ASP A 1 59  ? 62.321  71.100  29.289 1.00 34.57 ? 141 ASP A C    1 
ATOM 958  O O    . ASP A 1 59  ? 62.906  71.862  28.541 1.00 33.97 ? 141 ASP A O    1 
ATOM 959  C CB   . ASP A 1 59  ? 59.878  70.672  29.691 1.00 35.33 ? 141 ASP A CB   1 
ATOM 960  C CG   . ASP A 1 59  ? 58.658  69.847  29.360 1.00 36.40 ? 141 ASP A CG   1 
ATOM 961  O OD1  . ASP A 1 59  ? 58.352  69.689  28.153 1.00 37.63 ? 141 ASP A OD1  1 
ATOM 962  O OD2  . ASP A 1 59  ? 57.985  69.360  30.304 1.00 34.21 ? 141 ASP A OD2  1 
ATOM 963  H H    . ASP A 1 59  ? 60.989  68.382  29.761 1.00 0.00  ? 141 ASP A H    1 
ATOM 964  H HA   . ASP A 1 59  ? 60.892  70.487  27.782 1.00 0.00  ? 141 ASP A HA   1 
ATOM 965  H HB2  . ASP A 1 59  ? 60.097  70.536  30.755 1.00 0.00  ? 141 ASP A HB2  1 
ATOM 966  H HB3  . ASP A 1 59  ? 59.645  71.728  29.523 1.00 0.00  ? 141 ASP A HB3  1 
ATOM 967  N N    . ILE A 1 60  ? 62.679  70.879  30.564 1.00 29.43 ? 142 ILE A N    1 
ATOM 968  C CA   . ILE A 1 60  ? 63.773  71.590  31.193 1.00 25.66 ? 142 ILE A CA   1 
ATOM 969  C C    . ILE A 1 60  ? 65.049  70.769  31.144 1.00 29.10 ? 142 ILE A C    1 
ATOM 970  O O    . ILE A 1 60  ? 65.228  69.828  31.896 1.00 28.09 ? 142 ILE A O    1 
ATOM 971  C CB   . ILE A 1 60  ? 63.354  71.927  32.640 1.00 24.41 ? 142 ILE A CB   1 
ATOM 972  C CG1  . ILE A 1 60  ? 62.089  72.817  32.588 1.00 23.08 ? 142 ILE A CG1  1 
ATOM 973  C CG2  . ILE A 1 60  ? 64.522  72.559  33.399 1.00 22.77 ? 142 ILE A CG2  1 
ATOM 974  C CD1  . ILE A 1 60  ? 61.335  72.982  33.921 1.00 14.88 ? 142 ILE A CD1  1 
ATOM 975  H H    . ILE A 1 60  ? 62.195  70.202  31.115 1.00 0.00  ? 142 ILE A H    1 
ATOM 976  H HA   . ILE A 1 60  ? 63.923  72.549  30.672 1.00 0.00  ? 142 ILE A HA   1 
ATOM 977  H HB   . ILE A 1 60  ? 63.092  70.998  33.149 1.00 0.00  ? 142 ILE A HB   1 
ATOM 978  H HG12 . ILE A 1 60  ? 62.384  73.809  32.232 1.00 0.00  ? 142 ILE A HG12 1 
ATOM 979  H HG13 . ILE A 1 60  ? 61.382  72.377  31.872 1.00 0.00  ? 142 ILE A HG13 1 
ATOM 980  H HG21 . ILE A 1 60  ? 64.887  73.453  32.888 1.00 0.00  ? 142 ILE A HG21 1 
ATOM 981  H HG22 . ILE A 1 60  ? 64.243  72.783  34.430 1.00 0.00  ? 142 ILE A HG22 1 
ATOM 982  H HG23 . ILE A 1 60  ? 65.322  71.833  33.415 1.00 0.00  ? 142 ILE A HG23 1 
ATOM 983  H HD11 . ILE A 1 60  ? 61.991  73.444  34.672 1.00 0.00  ? 142 ILE A HD11 1 
ATOM 984  H HD12 . ILE A 1 60  ? 60.458  73.631  33.763 1.00 0.00  ? 142 ILE A HD12 1 
ATOM 985  H HD13 . ILE A 1 60  ? 60.997  71.998  34.281 1.00 0.00  ? 142 ILE A HD13 1 
ATOM 986  N N    . MET A 1 61  ? 65.943  71.176  30.231 1.00 33.87 ? 143 MET A N    1 
ATOM 987  C CA   . MET A 1 61  ? 67.248  70.547  30.092 1.00 35.68 ? 143 MET A CA   1 
ATOM 988  C C    . MET A 1 61  ? 68.260  71.286  30.957 1.00 35.98 ? 143 MET A C    1 
ATOM 989  O O    . MET A 1 61  ? 68.748  72.344  30.606 1.00 35.50 ? 143 MET A O    1 
ATOM 990  C CB   . MET A 1 61  ? 67.703  70.596  28.619 1.00 42.29 ? 143 MET A CB   1 
ATOM 991  C CG   . MET A 1 61  ? 66.802  69.806  27.644 1.00 46.05 ? 143 MET A CG   1 
ATOM 992  S SD   . MET A 1 61  ? 66.826  68.011  28.062 1.00 54.61 ? 143 MET A SD   1 
ATOM 993  C CE   . MET A 1 61  ? 67.797  67.299  26.669 1.00 47.83 ? 143 MET A CE   1 
ATOM 994  H H    . MET A 1 61  ? 65.720  71.928  29.617 1.00 0.00  ? 143 MET A H    1 
ATOM 995  H HA   . MET A 1 61  ? 67.183  69.487  30.383 1.00 0.00  ? 143 MET A HA   1 
ATOM 996  H HB2  . MET A 1 61  ? 67.732  71.650  28.315 1.00 0.00  ? 143 MET A HB2  1 
ATOM 997  H HB3  . MET A 1 61  ? 68.721  70.190  28.549 1.00 0.00  ? 143 MET A HB3  1 
ATOM 998  H HG2  . MET A 1 61  ? 65.785  70.234  27.685 1.00 0.00  ? 143 MET A HG2  1 
ATOM 999  H HG3  . MET A 1 61  ? 67.196  69.956  26.626 1.00 0.00  ? 143 MET A HG3  1 
ATOM 1000 H HE1  . MET A 1 61  ? 68.801  67.746  26.635 1.00 0.00  ? 143 MET A HE1  1 
ATOM 1001 H HE2  . MET A 1 61  ? 67.916  66.210  26.761 1.00 0.00  ? 143 MET A HE2  1 
ATOM 1002 H HE3  . MET A 1 61  ? 67.296  67.505  25.713 1.00 0.00  ? 143 MET A HE3  1 
ATOM 1003 N N    . ILE A 1 62  ? 68.575  70.689  32.112 1.00 35.08 ? 144 ILE A N    1 
ATOM 1004 C CA   . ILE A 1 62  ? 69.541  71.270  33.027 1.00 33.25 ? 144 ILE A CA   1 
ATOM 1005 C C    . ILE A 1 62  ? 70.938  70.773  32.704 1.00 36.63 ? 144 ILE A C    1 
ATOM 1006 O O    . ILE A 1 62  ? 71.131  69.585  32.518 1.00 38.97 ? 144 ILE A O    1 
ATOM 1007 C CB   . ILE A 1 62  ? 69.099  70.888  34.453 1.00 31.16 ? 144 ILE A CB   1 
ATOM 1008 C CG1  . ILE A 1 62  ? 67.703  71.477  34.714 1.00 28.59 ? 144 ILE A CG1  1 
ATOM 1009 C CG2  . ILE A 1 62  ? 70.116  71.268  35.494 1.00 25.93 ? 144 ILE A CG2  1 
ATOM 1010 C CD1  . ILE A 1 62  ? 67.160  71.236  36.117 1.00 32.54 ? 144 ILE A CD1  1 
ATOM 1011 H H    . ILE A 1 62  ? 68.145  69.822  32.362 1.00 0.00  ? 144 ILE A H    1 
ATOM 1012 H HA   . ILE A 1 62  ? 69.500  72.364  32.953 1.00 0.00  ? 144 ILE A HA   1 
ATOM 1013 H HB   . ILE A 1 62  ? 69.042  69.807  34.547 1.00 0.00  ? 144 ILE A HB   1 
ATOM 1014 H HG12 . ILE A 1 62  ? 67.707  72.556  34.519 1.00 0.00  ? 144 ILE A HG12 1 
ATOM 1015 H HG13 . ILE A 1 62  ? 67.047  70.953  34.016 1.00 0.00  ? 144 ILE A HG13 1 
ATOM 1016 H HG21 . ILE A 1 62  ? 70.179  72.379  35.396 1.00 0.00  ? 144 ILE A HG21 1 
ATOM 1017 H HG22 . ILE A 1 62  ? 69.818  71.097  36.510 1.00 0.00  ? 144 ILE A HG22 1 
ATOM 1018 H HG23 . ILE A 1 62  ? 71.109  70.911  35.286 1.00 0.00  ? 144 ILE A HG23 1 
ATOM 1019 H HD11 . ILE A 1 62  ? 67.808  71.728  36.850 1.00 0.00  ? 144 ILE A HD11 1 
ATOM 1020 H HD12 . ILE A 1 62  ? 66.158  71.677  36.200 1.00 0.00  ? 144 ILE A HD12 1 
ATOM 1021 H HD13 . ILE A 1 62  ? 67.113  70.154  36.307 1.00 0.00  ? 144 ILE A HD13 1 
ATOM 1022 N N    . SER A 1 63  ? 71.917  71.697  32.645 1.00 37.29 ? 145 SER A N    1 
ATOM 1023 C CA   . SER A 1 63  ? 73.285  71.299  32.333 1.00 38.41 ? 145 SER A CA   1 
ATOM 1024 C C    . SER A 1 63  ? 74.370  72.279  32.745 1.00 39.19 ? 145 SER A C    1 
ATOM 1025 O O    . SER A 1 63  ? 74.138  73.459  32.893 1.00 41.52 ? 145 SER A O    1 
ATOM 1026 C CB   . SER A 1 63  ? 73.458  71.025  30.845 1.00 37.57 ? 145 SER A CB   1 
ATOM 1027 O OG   . SER A 1 63  ? 73.024  72.090  30.052 1.00 37.56 ? 145 SER A OG   1 
ATOM 1028 H H    . SER A 1 63  ? 71.720  72.664  32.786 1.00 0.00  ? 145 SER A H    1 
ATOM 1029 H HA   . SER A 1 63  ? 73.479  70.353  32.855 1.00 0.00  ? 145 SER A HA   1 
ATOM 1030 H HB2  . SER A 1 63  ? 74.479  70.770  30.578 1.00 0.00  ? 145 SER A HB2  1 
ATOM 1031 H HB3  . SER A 1 63  ? 72.747  70.264  30.539 1.00 0.00  ? 145 SER A HB3  1 
ATOM 1032 H HG   . SER A 1 63  ? 73.117  71.959  29.115 1.00 0.00  ? 145 SER A HG   1 
ATOM 1033 N N    . PHE A 1 64  ? 75.588  71.732  32.927 1.00 37.40 ? 146 PHE A N    1 
ATOM 1034 C CA   . PHE A 1 64  ? 76.746  72.535  33.301 1.00 36.41 ? 146 PHE A CA   1 
ATOM 1035 C C    . PHE A 1 64  ? 77.645  72.752  32.104 1.00 37.67 ? 146 PHE A C    1 
ATOM 1036 O O    . PHE A 1 64  ? 77.875  71.842  31.328 1.00 38.09 ? 146 PHE A O    1 
ATOM 1037 C CB   . PHE A 1 64  ? 77.593  71.819  34.367 1.00 32.34 ? 146 PHE A CB   1 
ATOM 1038 C CG   . PHE A 1 64  ? 76.850  71.653  35.683 1.00 30.14 ? 146 PHE A CG   1 
ATOM 1039 C CD1  . PHE A 1 64  ? 76.057  70.532  35.892 1.00 30.18 ? 146 PHE A CD1  1 
ATOM 1040 C CD2  . PHE A 1 64  ? 76.981  72.617  36.680 1.00 29.79 ? 146 PHE A CD2  1 
ATOM 1041 C CE1  . PHE A 1 64  ? 75.394  70.371  37.112 1.00 29.10 ? 146 PHE A CE1  1 
ATOM 1042 C CE2  . PHE A 1 64  ? 76.322  72.459  37.898 1.00 28.42 ? 146 PHE A CE2  1 
ATOM 1043 C CZ   . PHE A 1 64  ? 75.528  71.332  38.103 1.00 28.33 ? 146 PHE A CZ   1 
ATOM 1044 H H    . PHE A 1 64  ? 75.723  70.755  32.792 1.00 0.00  ? 146 PHE A H    1 
ATOM 1045 H HA   . PHE A 1 64  ? 76.415  73.494  33.721 1.00 0.00  ? 146 PHE A HA   1 
ATOM 1046 H HB2  . PHE A 1 64  ? 77.862  70.816  34.005 1.00 0.00  ? 146 PHE A HB2  1 
ATOM 1047 H HB3  . PHE A 1 64  ? 78.508  72.396  34.566 1.00 0.00  ? 146 PHE A HB3  1 
ATOM 1048 H HD1  . PHE A 1 64  ? 75.953  69.783  35.116 1.00 0.00  ? 146 PHE A HD1  1 
ATOM 1049 H HD2  . PHE A 1 64  ? 77.600  73.484  36.502 1.00 0.00  ? 146 PHE A HD2  1 
ATOM 1050 H HE1  . PHE A 1 64  ? 74.781  69.494  37.266 1.00 0.00  ? 146 PHE A HE1  1 
ATOM 1051 H HE2  . PHE A 1 64  ? 76.430  73.204  38.673 1.00 0.00  ? 146 PHE A HE2  1 
ATOM 1052 H HZ   . PHE A 1 64  ? 75.016  71.204  39.049 1.00 0.00  ? 146 PHE A HZ   1 
ATOM 1053 N N    . ALA A 1 65  ? 78.166  73.988  31.993 1.00 35.45 ? 147 ALA A N    1 
ATOM 1054 C CA   . ALA A 1 65  ? 79.039  74.331  30.890 1.00 32.96 ? 147 ALA A CA   1 
ATOM 1055 C C    . ALA A 1 65  ? 80.006  75.422  31.305 1.00 34.94 ? 147 ALA A C    1 
ATOM 1056 O O    . ALA A 1 65  ? 79.883  75.985  32.377 1.00 34.51 ? 147 ALA A O    1 
ATOM 1057 C CB   . ALA A 1 65  ? 78.180  74.777  29.719 1.00 28.95 ? 147 ALA A CB   1 
ATOM 1058 H H    . ALA A 1 65  ? 77.960  74.697  32.661 1.00 0.00  ? 147 ALA A H    1 
ATOM 1059 H HA   . ALA A 1 65  ? 79.620  73.448  30.578 1.00 0.00  ? 147 ALA A HA   1 
ATOM 1060 H HB1  . ALA A 1 65  ? 78.900  75.002  28.930 1.00 0.00  ? 147 ALA A HB1  1 
ATOM 1061 H HB2  . ALA A 1 65  ? 77.539  73.971  29.357 1.00 0.00  ? 147 ALA A HB2  1 
ATOM 1062 H HB3  . ALA A 1 65  ? 77.608  75.677  29.955 1.00 0.00  ? 147 ALA A HB3  1 
ATOM 1063 N N    . VAL A 1 66  ? 80.974  75.685  30.407 1.00 35.30 ? 148 VAL A N    1 
ATOM 1064 C CA   . VAL A 1 66  ? 82.006  76.676  30.648 1.00 35.43 ? 148 VAL A CA   1 
ATOM 1065 C C    . VAL A 1 66  ? 82.208  77.429  29.347 1.00 36.36 ? 148 VAL A C    1 
ATOM 1066 O O    . VAL A 1 66  ? 82.189  76.834  28.284 1.00 36.97 ? 148 VAL A O    1 
ATOM 1067 C CB   . VAL A 1 66  ? 83.334  75.974  31.044 1.00 35.67 ? 148 VAL A CB   1 
ATOM 1068 C CG1  . VAL A 1 66  ? 84.503  76.967  31.033 1.00 40.45 ? 148 VAL A CG1  1 
ATOM 1069 C CG2  . VAL A 1 66  ? 83.228  75.346  32.443 1.00 35.29 ? 148 VAL A CG2  1 
ATOM 1070 H H    . VAL A 1 66  ? 81.019  75.173  29.553 1.00 0.00  ? 148 VAL A H    1 
ATOM 1071 H HA   . VAL A 1 66  ? 81.703  77.363  31.453 1.00 0.00  ? 148 VAL A HA   1 
ATOM 1072 H HB   . VAL A 1 66  ? 83.550  75.174  30.316 1.00 0.00  ? 148 VAL A HB   1 
ATOM 1073 H HG11 . VAL A 1 66  ? 84.297  77.795  31.728 1.00 0.00  ? 148 VAL A HG11 1 
ATOM 1074 H HG12 . VAL A 1 66  ? 85.435  76.462  31.319 1.00 0.00  ? 148 VAL A HG12 1 
ATOM 1075 H HG13 . VAL A 1 66  ? 84.618  77.333  30.010 1.00 0.00  ? 148 VAL A HG13 1 
ATOM 1076 H HG21 . VAL A 1 66  ? 82.416  74.606  32.435 1.00 0.00  ? 148 VAL A HG21 1 
ATOM 1077 H HG22 . VAL A 1 66  ? 84.176  74.847  32.703 1.00 0.00  ? 148 VAL A HG22 1 
ATOM 1078 H HG23 . VAL A 1 66  ? 83.015  76.131  33.185 1.00 0.00  ? 148 VAL A HG23 1 
ATOM 1079 N N    . ARG A 1 67  ? 82.405  78.754  29.456 1.00 33.00 ? 149 ARG A N    1 
ATOM 1080 C CA   . ARG A 1 67  ? 82.650  79.571  28.277 1.00 34.58 ? 149 ARG A CA   1 
ATOM 1081 C C    . ARG A 1 67  ? 81.652  79.246  27.184 1.00 38.57 ? 149 ARG A C    1 
ATOM 1082 O O    . ARG A 1 67  ? 80.465  79.231  27.444 1.00 43.41 ? 149 ARG A O    1 
ATOM 1083 C CB   . ARG A 1 67  ? 84.109  79.373  27.822 1.00 37.05 ? 149 ARG A CB   1 
ATOM 1084 C CG   . ARG A 1 67  ? 85.167  79.818  28.843 1.00 39.31 ? 149 ARG A CG   1 
ATOM 1085 C CD   . ARG A 1 67  ? 85.213  81.350  28.989 1.00 40.38 ? 149 ARG A CD   1 
ATOM 1086 N NE   . ARG A 1 67  ? 86.135  81.793  30.024 1.00 38.50 ? 149 ARG A NE   1 
ATOM 1087 C CZ   . ARG A 1 67  ? 86.297  83.056  30.373 1.00 41.15 ? 149 ARG A CZ   1 
ATOM 1088 N NH1  . ARG A 1 67  ? 85.617  84.014  29.783 1.00 37.92 ? 149 ARG A NH1  1 
ATOM 1089 N NH2  . ARG A 1 67  ? 87.155  83.350  31.329 1.00 39.58 ? 149 ARG A NH2  1 
ATOM 1090 H H    . ARG A 1 67  ? 82.397  79.198  30.352 1.00 0.00  ? 149 ARG A H    1 
ATOM 1091 H HA   . ARG A 1 67  ? 82.501  80.621  28.536 1.00 0.00  ? 149 ARG A HA   1 
ATOM 1092 H HB2  . ARG A 1 67  ? 84.254  78.301  27.596 1.00 0.00  ? 149 ARG A HB2  1 
ATOM 1093 H HB3  . ARG A 1 67  ? 84.319  80.005  26.942 1.00 0.00  ? 149 ARG A HB3  1 
ATOM 1094 H HG2  . ARG A 1 67  ? 84.925  79.403  29.819 1.00 0.00  ? 149 ARG A HG2  1 
ATOM 1095 H HG3  . ARG A 1 67  ? 86.148  79.451  28.507 1.00 0.00  ? 149 ARG A HG3  1 
ATOM 1096 H HD2  . ARG A 1 67  ? 85.508  81.775  28.016 1.00 0.00  ? 149 ARG A HD2  1 
ATOM 1097 H HD3  . ARG A 1 67  ? 84.210  81.703  29.251 1.00 0.00  ? 149 ARG A HD3  1 
ATOM 1098 H HH11 . ARG A 1 67  ? 84.942  83.813  29.041 1.00 0.00  ? 149 ARG A HH11 1 
ATOM 1099 H HH12 . ARG A 1 67  ? 85.750  84.995  30.058 1.00 0.00  ? 149 ARG A HH12 1 
ATOM 1100 H HH21 . ARG A 1 67  ? 87.687  82.611  31.807 1.00 0.00  ? 149 ARG A HH21 1 
ATOM 1101 H HH22 . ARG A 1 67  ? 87.300  84.330  31.619 1.00 0.00  ? 149 ARG A HH22 1 
ATOM 1102 N N    . GLU A 1 68  ? 82.108  78.962  25.951 1.00 43.24 ? 150 GLU A N    1 
ATOM 1103 C CA   . GLU A 1 68  ? 81.219  78.625  24.861 1.00 50.49 ? 150 GLU A CA   1 
ATOM 1104 C C    . GLU A 1 68  ? 80.540  77.289  25.104 1.00 50.37 ? 150 GLU A C    1 
ATOM 1105 O O    . GLU A 1 68  ? 81.203  76.307  25.394 1.00 49.62 ? 150 GLU A O    1 
ATOM 1106 C CB   . GLU A 1 68  ? 82.004  78.606  23.524 1.00 59.37 ? 150 GLU A CB   1 
ATOM 1107 C CG   . GLU A 1 68  ? 81.198  78.080  22.311 1.00 74.00 ? 150 GLU A CG   1 
ATOM 1108 C CD   . GLU A 1 68  ? 79.925  78.853  22.011 1.00 81.27 ? 150 GLU A CD   1 
ATOM 1109 O OE1  . GLU A 1 68  ? 79.905  80.097  22.188 1.00 86.59 ? 150 GLU A OE1  1 
ATOM 1110 O OE2  . GLU A 1 68  ? 78.930  78.213  21.584 1.00 83.33 ? 150 GLU A OE2  1 
ATOM 1111 H H    . GLU A 1 68  ? 83.070  78.936  25.707 1.00 0.00  ? 150 GLU A H    1 
ATOM 1112 H HA   . GLU A 1 68  ? 80.472  79.425  24.791 1.00 0.00  ? 150 GLU A HA   1 
ATOM 1113 H HB2  . GLU A 1 68  ? 82.345  79.633  23.304 1.00 0.00  ? 150 GLU A HB2  1 
ATOM 1114 H HB3  . GLU A 1 68  ? 82.893  77.960  23.657 1.00 0.00  ? 150 GLU A HB3  1 
ATOM 1115 H HG2  . GLU A 1 68  ? 81.854  78.125  21.428 1.00 0.00  ? 150 GLU A HG2  1 
ATOM 1116 H HG3  . GLU A 1 68  ? 80.941  77.028  22.502 1.00 0.00  ? 150 GLU A HG3  1 
ATOM 1117 N N    . HIS A 1 69  ? 79.196  77.269  24.954 1.00 47.95 ? 151 HIS A N    1 
ATOM 1118 C CA   . HIS A 1 69  ? 78.433  76.039  25.189 1.00 48.62 ? 151 HIS A CA   1 
ATOM 1119 C C    . HIS A 1 69  ? 77.179  75.817  24.356 1.00 50.28 ? 151 HIS A C    1 
ATOM 1120 O O    . HIS A 1 69  ? 76.228  75.218  24.833 1.00 51.03 ? 151 HIS A O    1 
ATOM 1121 C CB   . HIS A 1 69  ? 78.030  75.965  26.667 1.00 44.93 ? 151 HIS A CB   1 
ATOM 1122 C CG   . HIS A 1 69  ? 77.256  77.140  27.189 1.00 44.71 ? 151 HIS A CG   1 
ATOM 1123 N ND1  . HIS A 1 69  ? 77.802  78.269  27.653 1.00 44.39 ? 151 HIS A ND1  1 
ATOM 1124 C CD2  . HIS A 1 69  ? 75.917  77.237  27.260 1.00 44.15 ? 151 HIS A CD2  1 
ATOM 1125 C CE1  . HIS A 1 69  ? 76.834  79.084  28.009 1.00 43.66 ? 151 HIS A CE1  1 
ATOM 1126 N NE2  . HIS A 1 69  ? 75.728  78.549  27.807 1.00 41.30 ? 151 HIS A NE2  1 
ATOM 1127 H H    . HIS A 1 69  ? 78.700  78.098  24.699 1.00 0.00  ? 151 HIS A H    1 
ATOM 1128 H HA   . HIS A 1 69  ? 79.101  75.195  24.953 1.00 0.00  ? 151 HIS A HA   1 
ATOM 1129 H HB2  . HIS A 1 69  ? 77.474  75.020  26.833 1.00 0.00  ? 151 HIS A HB2  1 
ATOM 1130 H HB3  . HIS A 1 69  ? 79.016  75.925  27.157 1.00 0.00  ? 151 HIS A HB3  1 
ATOM 1131 H HD2  . HIS A 1 69  ? 75.160  76.526  26.980 1.00 0.00  ? 151 HIS A HD2  1 
ATOM 1132 H HE1  . HIS A 1 69  ? 76.979  80.069  28.418 1.00 0.00  ? 151 HIS A HE1  1 
ATOM 1133 N N    . GLY A 1 70  ? 77.169  76.281  23.094 1.00 51.09 ? 152 GLY A N    1 
ATOM 1134 C CA   . GLY A 1 70  ? 76.012  76.046  22.228 1.00 52.08 ? 152 GLY A CA   1 
ATOM 1135 C C    . GLY A 1 70  ? 75.145  77.256  21.928 1.00 53.42 ? 152 GLY A C    1 
ATOM 1136 O O    . GLY A 1 70  ? 75.035  77.672  20.787 1.00 54.35 ? 152 GLY A O    1 
ATOM 1137 H H    . GLY A 1 70  ? 77.967  76.762  22.728 1.00 0.00  ? 152 GLY A H    1 
ATOM 1138 H HA2  . GLY A 1 70  ? 76.378  75.645  21.274 1.00 0.00  ? 152 GLY A HA2  1 
ATOM 1139 H HA3  . GLY A 1 70  ? 75.362  75.291  22.692 1.00 0.00  ? 152 GLY A HA3  1 
ATOM 1140 N N    . ASP A 1 71  ? 74.497  77.806  22.969 1.00 51.74 ? 153 ASP A N    1 
ATOM 1141 C CA   . ASP A 1 71  ? 73.637  78.972  22.779 1.00 48.78 ? 153 ASP A CA   1 
ATOM 1142 C C    . ASP A 1 71  ? 74.458  80.225  22.533 1.00 46.59 ? 153 ASP A C    1 
ATOM 1143 O O    . ASP A 1 71  ? 75.674  80.198  22.580 1.00 49.51 ? 153 ASP A O    1 
ATOM 1144 C CB   . ASP A 1 71  ? 72.672  79.160  23.976 1.00 45.18 ? 153 ASP A CB   1 
ATOM 1145 C CG   . ASP A 1 71  ? 73.349  79.091  25.328 1.00 41.36 ? 153 ASP A CG   1 
ATOM 1146 O OD1  . ASP A 1 71  ? 74.558  79.417  25.430 1.00 40.74 ? 153 ASP A OD1  1 
ATOM 1147 O OD2  . ASP A 1 71  ? 72.668  78.710  26.312 1.00 38.93 ? 153 ASP A OD2  1 
ATOM 1148 H H    . ASP A 1 71  ? 74.599  77.411  23.881 1.00 0.00  ? 153 ASP A H    1 
ATOM 1149 H HA   . ASP A 1 71  ? 73.017  78.801  21.883 1.00 0.00  ? 153 ASP A HA   1 
ATOM 1150 H HB2  . ASP A 1 71  ? 72.155  80.122  23.907 1.00 0.00  ? 153 ASP A HB2  1 
ATOM 1151 H HB3  . ASP A 1 71  ? 71.907  78.380  23.921 1.00 0.00  ? 153 ASP A HB3  1 
ATOM 1152 N N    . PHE A 1 72  ? 73.761  81.349  22.274 1.00 43.45 ? 154 PHE A N    1 
ATOM 1153 C CA   . PHE A 1 72  ? 74.428  82.609  21.966 1.00 37.39 ? 154 PHE A CA   1 
ATOM 1154 C C    . PHE A 1 72  ? 74.881  83.406  23.170 1.00 35.27 ? 154 PHE A C    1 
ATOM 1155 O O    . PHE A 1 72  ? 75.148  84.591  23.048 1.00 36.88 ? 154 PHE A O    1 
ATOM 1156 C CB   . PHE A 1 72  ? 73.489  83.492  21.130 1.00 44.05 ? 154 PHE A CB   1 
ATOM 1157 C CG   . PHE A 1 72  ? 73.228  82.910  19.746 1.00 51.63 ? 154 PHE A CG   1 
ATOM 1158 C CD1  . PHE A 1 72  ? 72.163  82.029  19.539 1.00 52.49 ? 154 PHE A CD1  1 
ATOM 1159 C CD2  . PHE A 1 72  ? 74.051  83.265  18.673 1.00 52.00 ? 154 PHE A CD2  1 
ATOM 1160 C CE1  . PHE A 1 72  ? 71.922  81.500  18.269 1.00 53.63 ? 154 PHE A CE1  1 
ATOM 1161 C CE2  . PHE A 1 72  ? 73.808  82.739  17.399 1.00 54.67 ? 154 PHE A CE2  1 
ATOM 1162 C CZ   . PHE A 1 72  ? 72.748  81.857  17.199 1.00 55.00 ? 154 PHE A CZ   1 
ATOM 1163 H H    . PHE A 1 72  ? 72.765  81.342  22.279 1.00 0.00  ? 154 PHE A H    1 
ATOM 1164 H HA   . PHE A 1 72  ? 75.324  82.388  21.372 1.00 0.00  ? 154 PHE A HA   1 
ATOM 1165 H HB2  . PHE A 1 72  ? 72.532  83.604  21.662 1.00 0.00  ? 154 PHE A HB2  1 
ATOM 1166 H HB3  . PHE A 1 72  ? 73.959  84.475  21.020 1.00 0.00  ? 154 PHE A HB3  1 
ATOM 1167 H HD1  . PHE A 1 72  ? 71.516  81.755  20.363 1.00 0.00  ? 154 PHE A HD1  1 
ATOM 1168 H HD2  . PHE A 1 72  ? 74.869  83.960  18.821 1.00 0.00  ? 154 PHE A HD2  1 
ATOM 1169 H HE1  . PHE A 1 72  ? 71.098  80.813  18.116 1.00 0.00  ? 154 PHE A HE1  1 
ATOM 1170 H HE2  . PHE A 1 72  ? 74.450  83.020  16.572 1.00 0.00  ? 154 PHE A HE2  1 
ATOM 1171 H HZ   . PHE A 1 72  ? 72.562  81.442  16.213 1.00 0.00  ? 154 PHE A HZ   1 
ATOM 1172 N N    . TYR A 1 73  ? 74.988  82.760  24.342 1.00 33.18 ? 155 TYR A N    1 
ATOM 1173 C CA   . TYR A 1 73  ? 75.432  83.486  25.525 1.00 33.19 ? 155 TYR A CA   1 
ATOM 1174 C C    . TYR A 1 73  ? 76.499  82.713  26.292 1.00 35.77 ? 155 TYR A C    1 
ATOM 1175 O O    . TYR A 1 73  ? 76.166  82.054  27.261 1.00 34.42 ? 155 TYR A O    1 
ATOM 1176 C CB   . TYR A 1 73  ? 74.218  83.828  26.416 1.00 31.84 ? 155 TYR A CB   1 
ATOM 1177 C CG   . TYR A 1 73  ? 73.123  84.610  25.691 1.00 33.91 ? 155 TYR A CG   1 
ATOM 1178 C CD1  . TYR A 1 73  ? 73.169  86.006  25.631 1.00 35.26 ? 155 TYR A CD1  1 
ATOM 1179 C CD2  . TYR A 1 73  ? 72.052  83.941  25.091 1.00 35.42 ? 155 TYR A CD2  1 
ATOM 1180 C CE1  . TYR A 1 73  ? 72.166  86.714  24.980 1.00 34.22 ? 155 TYR A CE1  1 
ATOM 1181 C CE2  . TYR A 1 73  ? 71.044  84.646  24.443 1.00 34.92 ? 155 TYR A CE2  1 
ATOM 1182 C CZ   . TYR A 1 73  ? 71.103  86.037  24.387 1.00 34.14 ? 155 TYR A CZ   1 
ATOM 1183 O OH   . TYR A 1 73  ? 70.094  86.728  23.732 1.00 37.59 ? 155 TYR A OH   1 
ATOM 1184 H H    . TYR A 1 73  ? 74.757  81.792  24.421 1.00 0.00  ? 155 TYR A H    1 
ATOM 1185 H HA   . TYR A 1 73  ? 75.878  84.442  25.218 1.00 0.00  ? 155 TYR A HA   1 
ATOM 1186 H HB2  . TYR A 1 73  ? 73.785  82.891  26.792 1.00 0.00  ? 155 TYR A HB2  1 
ATOM 1187 H HB3  . TYR A 1 73  ? 74.576  84.432  27.264 1.00 0.00  ? 155 TYR A HB3  1 
ATOM 1188 H HD1  . TYR A 1 73  ? 73.987  86.543  26.092 1.00 0.00  ? 155 TYR A HD1  1 
ATOM 1189 H HD2  . TYR A 1 73  ? 72.002  82.860  25.132 1.00 0.00  ? 155 TYR A HD2  1 
ATOM 1190 H HE1  . TYR A 1 73  ? 72.213  87.797  24.928 1.00 0.00  ? 155 TYR A HE1  1 
ATOM 1191 H HE2  . TYR A 1 73  ? 70.212  84.126  23.977 1.00 0.00  ? 155 TYR A HE2  1 
ATOM 1192 H HH   . TYR A 1 73  ? 70.272  87.658  23.771 1.00 0.00  ? 155 TYR A HH   1 
ATOM 1193 N N    . PRO A 1 74  ? 77.781  82.798  25.867 1.00 38.12 ? 156 PRO A N    1 
ATOM 1194 C CA   . PRO A 1 74  ? 78.871  82.128  26.556 1.00 38.35 ? 156 PRO A CA   1 
ATOM 1195 C C    . PRO A 1 74  ? 79.048  82.627  27.962 1.00 43.32 ? 156 PRO A C    1 
ATOM 1196 O O    . PRO A 1 74  ? 78.804  83.784  28.249 1.00 46.32 ? 156 PRO A O    1 
ATOM 1197 C CB   . PRO A 1 74  ? 80.085  82.530  25.700 1.00 34.37 ? 156 PRO A CB   1 
ATOM 1198 C CG   . PRO A 1 74  ? 79.465  82.737  24.316 1.00 39.37 ? 156 PRO A CG   1 
ATOM 1199 C CD   . PRO A 1 74  ? 78.185  83.502  24.659 1.00 38.53 ? 156 PRO A CD   1 
ATOM 1200 H HA   . PRO A 1 74  ? 78.739  81.037  26.510 1.00 0.00  ? 156 PRO A HA   1 
ATOM 1201 H HB2  . PRO A 1 74  ? 80.524  83.486  26.045 1.00 0.00  ? 156 PRO A HB2  1 
ATOM 1202 H HB3  . PRO A 1 74  ? 80.867  81.754  25.669 1.00 0.00  ? 156 PRO A HB3  1 
ATOM 1203 H HG2  . PRO A 1 74  ? 80.137  83.306  23.648 1.00 0.00  ? 156 PRO A HG2  1 
ATOM 1204 H HG3  . PRO A 1 74  ? 79.229  81.755  23.862 1.00 0.00  ? 156 PRO A HG3  1 
ATOM 1205 H HD2  . PRO A 1 74  ? 78.428  84.557  24.860 1.00 0.00  ? 156 PRO A HD2  1 
ATOM 1206 H HD3  . PRO A 1 74  ? 77.471  83.414  23.832 1.00 0.00  ? 156 PRO A HD3  1 
ATOM 1207 N N    . PHE A 1 75  ? 79.487  81.713  28.834 1.00 44.32 ? 157 PHE A N    1 
ATOM 1208 C CA   . PHE A 1 75  ? 79.664  82.080  30.220 1.00 43.98 ? 157 PHE A CA   1 
ATOM 1209 C C    . PHE A 1 75  ? 80.990  82.785  30.426 1.00 44.04 ? 157 PHE A C    1 
ATOM 1210 O O    . PHE A 1 75  ? 81.962  82.526  29.749 1.00 45.80 ? 157 PHE A O    1 
ATOM 1211 C CB   . PHE A 1 75  ? 79.513  80.853  31.141 1.00 44.51 ? 157 PHE A CB   1 
ATOM 1212 C CG   . PHE A 1 75  ? 78.057  80.493  31.443 1.00 38.65 ? 157 PHE A CG   1 
ATOM 1213 C CD1  . PHE A 1 75  ? 77.174  81.451  31.948 1.00 35.89 ? 157 PHE A CD1  1 
ATOM 1214 C CD2  . PHE A 1 75  ? 77.602  79.188  31.239 1.00 38.87 ? 157 PHE A CD2  1 
ATOM 1215 C CE1  . PHE A 1 75  ? 75.861  81.110  32.263 1.00 30.98 ? 157 PHE A CE1  1 
ATOM 1216 C CE2  . PHE A 1 75  ? 76.291  78.848  31.559 1.00 35.19 ? 157 PHE A CE2  1 
ATOM 1217 C CZ   . PHE A 1 75  ? 75.419  79.804  32.068 1.00 32.51 ? 157 PHE A CZ   1 
ATOM 1218 H H    . PHE A 1 75  ? 79.695  80.780  28.545 1.00 0.00  ? 157 PHE A H    1 
ATOM 1219 H HA   . PHE A 1 75  ? 78.872  82.794  30.471 1.00 0.00  ? 157 PHE A HA   1 
ATOM 1220 H HB2  . PHE A 1 75  ? 80.000  79.993  30.662 1.00 0.00  ? 157 PHE A HB2  1 
ATOM 1221 H HB3  . PHE A 1 75  ? 80.010  81.058  32.096 1.00 0.00  ? 157 PHE A HB3  1 
ATOM 1222 H HD1  . PHE A 1 75  ? 77.500  82.470  32.113 1.00 0.00  ? 157 PHE A HD1  1 
ATOM 1223 H HD2  . PHE A 1 75  ? 78.269  78.432  30.840 1.00 0.00  ? 157 PHE A HD2  1 
ATOM 1224 H HE1  . PHE A 1 75  ? 75.183  81.859  32.658 1.00 0.00  ? 157 PHE A HE1  1 
ATOM 1225 H HE2  . PHE A 1 75  ? 75.965  77.834  31.414 1.00 0.00  ? 157 PHE A HE2  1 
ATOM 1226 H HZ   . PHE A 1 75  ? 74.401  79.531  32.309 1.00 0.00  ? 157 PHE A HZ   1 
ATOM 1227 N N    . ASP A 1 76  ? 80.988  83.705  31.407 1.00 43.15 ? 158 ASP A N    1 
ATOM 1228 C CA   . ASP A 1 76  ? 82.135  84.565  31.696 1.00 42.05 ? 158 ASP A CA   1 
ATOM 1229 C C    . ASP A 1 76  ? 83.251  84.048  32.584 1.00 43.19 ? 158 ASP A C    1 
ATOM 1230 O O    . ASP A 1 76  ? 83.902  84.819  33.271 1.00 45.02 ? 158 ASP A O    1 
ATOM 1231 C CB   . ASP A 1 76  ? 81.578  85.836  32.353 1.00 40.04 ? 158 ASP A CB   1 
ATOM 1232 C CG   . ASP A 1 76  ? 80.726  85.533  33.566 1.00 37.83 ? 158 ASP A CG   1 
ATOM 1233 O OD1  . ASP A 1 76  ? 80.593  84.349  33.981 1.00 36.54 ? 158 ASP A OD1  1 
ATOM 1234 O OD2  . ASP A 1 76  ? 80.156  86.509  34.094 1.00 37.55 ? 158 ASP A OD2  1 
ATOM 1235 H H    . ASP A 1 76  ? 80.147  83.838  31.930 1.00 0.00  ? 158 ASP A H    1 
ATOM 1236 H HA   . ASP A 1 76  ? 82.602  84.837  30.739 1.00 0.00  ? 158 ASP A HA   1 
ATOM 1237 H HB2  . ASP A 1 76  ? 82.410  86.485  32.652 1.00 0.00  ? 158 ASP A HB2  1 
ATOM 1238 H HB3  . ASP A 1 76  ? 80.964  86.366  31.608 1.00 0.00  ? 158 ASP A HB3  1 
ATOM 1239 N N    . GLY A 1 77  ? 83.514  82.742  32.576 1.00 41.81 ? 159 GLY A N    1 
ATOM 1240 C CA   . GLY A 1 77  ? 84.579  82.273  33.437 1.00 42.64 ? 159 GLY A CA   1 
ATOM 1241 C C    . GLY A 1 77  ? 84.215  82.336  34.904 1.00 44.40 ? 159 GLY A C    1 
ATOM 1242 O O    . GLY A 1 77  ? 83.043  82.499  35.192 1.00 51.00 ? 159 GLY A O    1 
ATOM 1243 H H    . GLY A 1 77  ? 82.996  82.109  31.997 1.00 0.00  ? 159 GLY A H    1 
ATOM 1244 H HA2  . GLY A 1 77  ? 84.755  81.250  33.145 1.00 0.00  ? 159 GLY A HA2  1 
ATOM 1245 H HA3  . GLY A 1 77  ? 85.500  82.827  33.244 1.00 0.00  ? 159 GLY A HA3  1 
ATOM 1246 N N    . PRO A 1 78  ? 85.174  82.215  35.846 1.00 41.30 ? 160 PRO A N    1 
ATOM 1247 C CA   . PRO A 1 78  ? 84.841  82.332  37.256 1.00 39.70 ? 160 PRO A CA   1 
ATOM 1248 C C    . PRO A 1 78  ? 84.295  83.679  37.645 1.00 40.69 ? 160 PRO A C    1 
ATOM 1249 O O    . PRO A 1 78  ? 84.754  84.699  37.165 1.00 42.90 ? 160 PRO A O    1 
ATOM 1250 C CB   . PRO A 1 78  ? 86.200  82.086  37.926 1.00 36.89 ? 160 PRO A CB   1 
ATOM 1251 C CG   . PRO A 1 78  ? 86.918  81.180  36.925 1.00 36.88 ? 160 PRO A CG   1 
ATOM 1252 C CD   . PRO A 1 78  ? 86.554  81.826  35.582 1.00 40.23 ? 160 PRO A CD   1 
ATOM 1253 H HA   . PRO A 1 78  ? 84.152  81.522  37.529 1.00 0.00  ? 160 PRO A HA   1 
ATOM 1254 H HB2  . PRO A 1 78  ? 86.775  83.026  38.031 1.00 0.00  ? 160 PRO A HB2  1 
ATOM 1255 H HB3  . PRO A 1 78  ? 86.106  81.594  38.909 1.00 0.00  ? 160 PRO A HB3  1 
ATOM 1256 H HG2  . PRO A 1 78  ? 88.003  81.147  37.113 1.00 0.00  ? 160 PRO A HG2  1 
ATOM 1257 H HG3  . PRO A 1 78  ? 86.534  80.150  37.016 1.00 0.00  ? 160 PRO A HG3  1 
ATOM 1258 H HD2  . PRO A 1 78  ? 87.209  82.694  35.413 1.00 0.00  ? 160 PRO A HD2  1 
ATOM 1259 H HD3  . PRO A 1 78  ? 86.668  81.091  34.777 1.00 0.00  ? 160 PRO A HD3  1 
ATOM 1260 N N    . GLY A 1 79  ? 83.307  83.651  38.548 1.00 42.36 ? 161 GLY A N    1 
ATOM 1261 C CA   . GLY A 1 79  ? 82.686  84.875  39.019 1.00 42.01 ? 161 GLY A CA   1 
ATOM 1262 C C    . GLY A 1 79  ? 81.592  85.438  38.127 1.00 44.14 ? 161 GLY A C    1 
ATOM 1263 O O    . GLY A 1 79  ? 81.162  84.822  37.170 1.00 41.86 ? 161 GLY A O    1 
ATOM 1264 H H    . GLY A 1 79  ? 82.994  82.785  38.932 1.00 0.00  ? 161 GLY A H    1 
ATOM 1265 H HA2  . GLY A 1 79  ? 82.244  84.675  40.009 1.00 0.00  ? 161 GLY A HA2  1 
ATOM 1266 H HA3  . GLY A 1 79  ? 83.472  85.638  39.135 1.00 0.00  ? 161 GLY A HA3  1 
ATOM 1267 N N    . ASN A 1 80  ? 81.154  86.657  38.517 1.00 44.75 ? 162 ASN A N    1 
ATOM 1268 C CA   . ASN A 1 80  ? 80.116  87.409  37.815 1.00 46.24 ? 162 ASN A CA   1 
ATOM 1269 C C    . ASN A 1 80  ? 78.847  86.621  37.529 1.00 46.78 ? 162 ASN A C    1 
ATOM 1270 O O    . ASN A 1 80  ? 78.065  86.423  38.437 1.00 51.20 ? 162 ASN A O    1 
ATOM 1271 C CB   . ASN A 1 80  ? 80.705  88.095  36.562 1.00 47.77 ? 162 ASN A CB   1 
ATOM 1272 C CG   . ASN A 1 80  ? 81.664  89.208  36.949 1.00 50.32 ? 162 ASN A CG   1 
ATOM 1273 O OD1  . ASN A 1 80  ? 81.655  89.664  38.080 1.00 51.46 ? 162 ASN A OD1  1 
ATOM 1274 N ND2  . ASN A 1 80  ? 82.505  89.672  36.027 1.00 47.88 ? 162 ASN A ND2  1 
ATOM 1275 H H    . ASN A 1 80  ? 81.572  87.083  39.321 1.00 0.00  ? 162 ASN A H    1 
ATOM 1276 H HA   . ASN A 1 80  ? 79.809  88.228  38.488 1.00 0.00  ? 162 ASN A HA   1 
ATOM 1277 H HB2  . ASN A 1 80  ? 81.259  87.351  35.974 1.00 0.00  ? 162 ASN A HB2  1 
ATOM 1278 H HB3  . ASN A 1 80  ? 79.891  88.517  35.953 1.00 0.00  ? 162 ASN A HB3  1 
ATOM 1279 N N    . VAL A 1 81  ? 78.631  86.192  36.273 1.00 40.09 ? 163 VAL A N    1 
ATOM 1280 C CA   . VAL A 1 81  ? 77.437  85.471  35.884 1.00 35.74 ? 163 VAL A CA   1 
ATOM 1281 C C    . VAL A 1 81  ? 77.573  83.998  36.176 1.00 35.83 ? 163 VAL A C    1 
ATOM 1282 O O    . VAL A 1 81  ? 78.346  83.300  35.549 1.00 36.34 ? 163 VAL A O    1 
ATOM 1283 C CB   . VAL A 1 81  ? 77.055  85.721  34.406 1.00 37.86 ? 163 VAL A CB   1 
ATOM 1284 C CG1  . VAL A 1 81  ? 75.772  84.945  34.043 1.00 41.20 ? 163 VAL A CG1  1 
ATOM 1285 C CG2  . VAL A 1 81  ? 76.809  87.227  34.168 1.00 34.23 ? 163 VAL A CG2  1 
ATOM 1286 H H    . VAL A 1 81  ? 79.304  86.337  35.569 1.00 0.00  ? 163 VAL A H    1 
ATOM 1287 H HA   . VAL A 1 81  ? 76.618  85.884  36.455 1.00 0.00  ? 163 VAL A HA   1 
ATOM 1288 H HB   . VAL A 1 81  ? 77.868  85.385  33.752 1.00 0.00  ? 163 VAL A HB   1 
ATOM 1289 H HG11 . VAL A 1 81  ? 75.372  85.304  33.084 1.00 0.00  ? 163 VAL A HG11 1 
ATOM 1290 H HG12 . VAL A 1 81  ? 75.017  85.096  34.827 1.00 0.00  ? 163 VAL A HG12 1 
ATOM 1291 H HG13 . VAL A 1 81  ? 76.004  83.877  33.962 1.00 0.00  ? 163 VAL A HG13 1 
ATOM 1292 H HG21 . VAL A 1 81  ? 76.862  87.453  33.094 1.00 0.00  ? 163 VAL A HG21 1 
ATOM 1293 H HG22 . VAL A 1 81  ? 77.569  87.815  34.696 1.00 0.00  ? 163 VAL A HG22 1 
ATOM 1294 H HG23 . VAL A 1 81  ? 75.814  87.504  34.540 1.00 0.00  ? 163 VAL A HG23 1 
ATOM 1295 N N    . LEU A 1 82  ? 76.782  83.540  37.164 1.00 34.24 ? 164 LEU A N    1 
ATOM 1296 C CA   . LEU A 1 82  ? 76.848  82.150  37.606 1.00 29.97 ? 164 LEU A CA   1 
ATOM 1297 C C    . LEU A 1 82  ? 75.979  81.205  36.813 1.00 31.29 ? 164 LEU A C    1 
ATOM 1298 O O    . LEU A 1 82  ? 76.293  80.028  36.754 1.00 31.25 ? 164 LEU A O    1 
ATOM 1299 C CB   . LEU A 1 82  ? 76.380  82.073  39.069 1.00 30.05 ? 164 LEU A CB   1 
ATOM 1300 C CG   . LEU A 1 82  ? 77.480  82.483  40.093 1.00 30.66 ? 164 LEU A CG   1 
ATOM 1301 C CD1  . LEU A 1 82  ? 78.505  83.485  39.531 1.00 29.33 ? 164 LEU A CD1  1 
ATOM 1302 C CD2  . LEU A 1 82  ? 76.827  83.121  41.335 1.00 34.63 ? 164 LEU A CD2  1 
ATOM 1303 H H    . LEU A 1 82  ? 76.149  84.159  37.634 1.00 0.00  ? 164 LEU A H    1 
ATOM 1304 H HA   . LEU A 1 82  ? 77.881  81.798  37.538 1.00 0.00  ? 164 LEU A HA   1 
ATOM 1305 H HB2  . LEU A 1 82  ? 75.502  82.723  39.187 1.00 0.00  ? 164 LEU A HB2  1 
ATOM 1306 H HB3  . LEU A 1 82  ? 76.061  81.046  39.295 1.00 0.00  ? 164 LEU A HB3  1 
ATOM 1307 H HG   . LEU A 1 82  ? 78.023  81.593  40.419 1.00 0.00  ? 164 LEU A HG   1 
ATOM 1308 H HD11 . LEU A 1 82  ? 79.205  83.003  38.849 1.00 0.00  ? 164 LEU A HD11 1 
ATOM 1309 H HD12 . LEU A 1 82  ? 79.076  83.947  40.341 1.00 0.00  ? 164 LEU A HD12 1 
ATOM 1310 H HD13 . LEU A 1 82  ? 77.978  84.266  39.004 1.00 0.00  ? 164 LEU A HD13 1 
ATOM 1311 H HD21 . LEU A 1 82  ? 77.532  83.111  42.176 1.00 0.00  ? 164 LEU A HD21 1 
ATOM 1312 H HD22 . LEU A 1 82  ? 75.913  82.578  41.600 1.00 0.00  ? 164 LEU A HD22 1 
ATOM 1313 H HD23 . LEU A 1 82  ? 76.567  84.157  41.126 1.00 0.00  ? 164 LEU A HD23 1 
ATOM 1314 N N    . ALA A 1 83  ? 74.878  81.717  36.236 1.00 32.71 ? 165 ALA A N    1 
ATOM 1315 C CA   . ALA A 1 83  ? 74.002  80.869  35.445 1.00 32.31 ? 165 ALA A CA   1 
ATOM 1316 C C    . ALA A 1 83  ? 72.917  81.652  34.740 1.00 33.27 ? 165 ALA A C    1 
ATOM 1317 O O    . ALA A 1 83  ? 72.638  82.781  35.102 1.00 35.16 ? 165 ALA A O    1 
ATOM 1318 C CB   . ALA A 1 83  ? 73.322  79.836  36.352 1.00 35.00 ? 165 ALA A CB   1 
ATOM 1319 H H    . ALA A 1 83  ? 74.642  82.676  36.352 1.00 0.00  ? 165 ALA A H    1 
ATOM 1320 H HA   . ALA A 1 83  ? 74.605  80.330  34.700 1.00 0.00  ? 165 ALA A HA   1 
ATOM 1321 H HB1  . ALA A 1 83  ? 72.518  80.316  36.922 1.00 0.00  ? 165 ALA A HB1  1 
ATOM 1322 H HB2  . ALA A 1 83  ? 74.039  79.395  37.049 1.00 0.00  ? 165 ALA A HB2  1 
ATOM 1323 H HB3  . ALA A 1 83  ? 72.913  79.030  35.748 1.00 0.00  ? 165 ALA A HB3  1 
ATOM 1324 N N    . HIS A 1 84  ? 72.307  80.995  33.733 1.00 32.60 ? 166 HIS A N    1 
ATOM 1325 C CA   . HIS A 1 84  ? 71.236  81.605  32.963 1.00 30.85 ? 166 HIS A CA   1 
ATOM 1326 C C    . HIS A 1 84  ? 70.202  80.569  32.565 1.00 30.27 ? 166 HIS A C    1 
ATOM 1327 O O    . HIS A 1 84  ? 70.479  79.383  32.568 1.00 28.70 ? 166 HIS A O    1 
ATOM 1328 C CB   . HIS A 1 84  ? 71.793  82.334  31.712 1.00 30.70 ? 166 HIS A CB   1 
ATOM 1329 C CG   . HIS A 1 84  ? 72.127  81.374  30.598 1.00 29.29 ? 166 HIS A CG   1 
ATOM 1330 N ND1  . HIS A 1 84  ? 71.205  80.611  30.001 1.00 31.12 ? 166 HIS A ND1  1 
ATOM 1331 C CD2  . HIS A 1 84  ? 73.327  81.137  30.040 1.00 33.66 ? 166 HIS A CD2  1 
ATOM 1332 C CE1  . HIS A 1 84  ? 71.797  79.892  29.077 1.00 34.69 ? 166 HIS A CE1  1 
ATOM 1333 N NE2  . HIS A 1 84  ? 73.018  80.143  29.048 1.00 36.41 ? 166 HIS A NE2  1 
ATOM 1334 H H    . HIS A 1 84  ? 72.577  80.064  33.509 1.00 0.00  ? 166 HIS A H    1 
ATOM 1335 H HA   . HIS A 1 84  ? 70.733  82.348  33.599 1.00 0.00  ? 166 HIS A HA   1 
ATOM 1336 H HB2  . HIS A 1 84  ? 71.034  83.050  31.371 1.00 0.00  ? 166 HIS A HB2  1 
ATOM 1337 H HB3  . HIS A 1 84  ? 72.677  82.925  32.016 1.00 0.00  ? 166 HIS A HB3  1 
ATOM 1338 H HD2  . HIS A 1 84  ? 74.286  81.561  30.250 1.00 0.00  ? 166 HIS A HD2  1 
ATOM 1339 H HE1  . HIS A 1 84  ? 71.293  79.194  28.448 1.00 0.00  ? 166 HIS A HE1  1 
ATOM 1340 N N    . ALA A 1 85  ? 69.000  81.050  32.201 1.00 27.02 ? 167 ALA A N    1 
ATOM 1341 C CA   . ALA A 1 85  ? 67.914  80.147  31.849 1.00 26.10 ? 167 ALA A CA   1 
ATOM 1342 C C    . ALA A 1 85  ? 66.983  80.746  30.819 1.00 25.55 ? 167 ALA A C    1 
ATOM 1343 O O    . ALA A 1 85  ? 66.996  81.939  30.588 1.00 27.27 ? 167 ALA A O    1 
ATOM 1344 C CB   . ALA A 1 85  ? 67.107  79.786  33.109 1.00 27.48 ? 167 ALA A CB   1 
ATOM 1345 H H    . ALA A 1 85  ? 68.826  82.033  32.189 1.00 0.00  ? 167 ALA A H    1 
ATOM 1346 H HA   . ALA A 1 85  ? 68.332  79.224  31.429 1.00 0.00  ? 167 ALA A HA   1 
ATOM 1347 H HB1  . ALA A 1 85  ? 67.079  80.648  33.789 1.00 0.00  ? 167 ALA A HB1  1 
ATOM 1348 H HB2  . ALA A 1 85  ? 67.593  78.945  33.615 1.00 0.00  ? 167 ALA A HB2  1 
ATOM 1349 H HB3  . ALA A 1 85  ? 66.079  79.493  32.852 1.00 0.00  ? 167 ALA A HB3  1 
ATOM 1350 N N    . TYR A 1 86  ? 66.166  79.863  30.215 1.00 20.73 ? 168 TYR A N    1 
ATOM 1351 C CA   . TYR A 1 86  ? 65.243  80.304  29.187 1.00 22.75 ? 168 TYR A CA   1 
ATOM 1352 C C    . TYR A 1 86  ? 63.797  80.152  29.584 1.00 23.98 ? 168 TYR A C    1 
ATOM 1353 O O    . TYR A 1 86  ? 63.472  79.317  30.395 1.00 29.64 ? 168 TYR A O    1 
ATOM 1354 C CB   . TYR A 1 86  ? 65.508  79.516  27.898 1.00 24.10 ? 168 TYR A CB   1 
ATOM 1355 C CG   . TYR A 1 86  ? 66.896  79.841  27.364 1.00 28.66 ? 168 TYR A CG   1 
ATOM 1356 C CD1  . TYR A 1 86  ? 67.187  81.132  26.913 1.00 26.16 ? 168 TYR A CD1  1 
ATOM 1357 C CD2  . TYR A 1 86  ? 67.873  78.843  27.321 1.00 32.81 ? 168 TYR A CD2  1 
ATOM 1358 C CE1  . TYR A 1 86  ? 68.457  81.421  26.409 1.00 35.00 ? 168 TYR A CE1  1 
ATOM 1359 C CE2  . TYR A 1 86  ? 69.137  79.133  26.814 1.00 37.61 ? 168 TYR A CE2  1 
ATOM 1360 C CZ   . TYR A 1 86  ? 69.433  80.424  26.362 1.00 38.45 ? 168 TYR A CZ   1 
ATOM 1361 O OH   . TYR A 1 86  ? 70.691  80.719  25.869 1.00 41.88 ? 168 TYR A OH   1 
ATOM 1362 H H    . TYR A 1 86  ? 66.185  78.892  30.455 1.00 0.00  ? 168 TYR A H    1 
ATOM 1363 H HA   . TYR A 1 86  ? 65.418  81.364  28.971 1.00 0.00  ? 168 TYR A HA   1 
ATOM 1364 H HB2  . TYR A 1 86  ? 65.421  78.440  28.106 1.00 0.00  ? 168 TYR A HB2  1 
ATOM 1365 H HB3  . TYR A 1 86  ? 64.765  79.805  27.145 1.00 0.00  ? 168 TYR A HB3  1 
ATOM 1366 H HD1  . TYR A 1 86  ? 66.432  81.907  26.947 1.00 0.00  ? 168 TYR A HD1  1 
ATOM 1367 H HD2  . TYR A 1 86  ? 67.653  77.850  27.675 1.00 0.00  ? 168 TYR A HD2  1 
ATOM 1368 H HE1  . TYR A 1 86  ? 68.679  82.418  26.054 1.00 0.00  ? 168 TYR A HE1  1 
ATOM 1369 H HE2  . TYR A 1 86  ? 69.887  78.357  26.773 1.00 0.00  ? 168 TYR A HE2  1 
ATOM 1370 H HH   . TYR A 1 86  ? 71.332  80.156  26.291 1.00 0.00  ? 168 TYR A HH   1 
ATOM 1371 N N    . ALA A 1 87  ? 62.941  80.982  28.975 1.00 27.03 ? 169 ALA A N    1 
ATOM 1372 C CA   . ALA A 1 87  ? 61.513  80.974  29.272 1.00 25.27 ? 169 ALA A CA   1 
ATOM 1373 C C    . ALA A 1 87  ? 60.772  79.789  28.693 1.00 25.83 ? 169 ALA A C    1 
ATOM 1374 O O    . ALA A 1 87  ? 61.327  79.159  27.827 1.00 28.07 ? 169 ALA A O    1 
ATOM 1375 C CB   . ALA A 1 87  ? 60.897  82.282  28.750 1.00 23.36 ? 169 ALA A CB   1 
ATOM 1376 H H    . ALA A 1 87  ? 63.308  81.620  28.302 1.00 0.00  ? 169 ALA A H    1 
ATOM 1377 H HA   . ALA A 1 87  ? 61.391  80.957  30.353 1.00 0.00  ? 169 ALA A HA   1 
ATOM 1378 H HB1  . ALA A 1 87  ? 61.534  82.727  27.976 1.00 0.00  ? 169 ALA A HB1  1 
ATOM 1379 H HB2  . ALA A 1 87  ? 60.794  83.010  29.570 1.00 0.00  ? 169 ALA A HB2  1 
ATOM 1380 H HB3  . ALA A 1 87  ? 59.916  82.106  28.294 1.00 0.00  ? 169 ALA A HB3  1 
ATOM 1381 N N    . PRO A 1 88  ? 59.538  79.492  29.148 1.00 23.58 ? 170 PRO A N    1 
ATOM 1382 C CA   . PRO A 1 88  ? 58.798  78.372  28.609 1.00 24.17 ? 170 PRO A CA   1 
ATOM 1383 C C    . PRO A 1 88  ? 58.767  78.362  27.106 1.00 25.56 ? 170 PRO A C    1 
ATOM 1384 O O    . PRO A 1 88  ? 58.848  79.412  26.494 1.00 22.72 ? 170 PRO A O    1 
ATOM 1385 C CB   . PRO A 1 88  ? 57.399  78.653  29.169 1.00 25.45 ? 170 PRO A CB   1 
ATOM 1386 C CG   . PRO A 1 88  ? 57.625  79.382  30.488 1.00 21.59 ? 170 PRO A CG   1 
ATOM 1387 C CD   . PRO A 1 88  ? 58.879  80.225  30.225 1.00 22.73 ? 170 PRO A CD   1 
ATOM 1388 H HA   . PRO A 1 88  ? 59.175  77.430  29.023 1.00 0.00  ? 170 PRO A HA   1 
ATOM 1389 H HB2  . PRO A 1 88  ? 56.874  79.345  28.514 1.00 0.00  ? 170 PRO A HB2  1 
ATOM 1390 H HB3  . PRO A 1 88  ? 56.805  77.744  29.324 1.00 0.00  ? 170 PRO A HB3  1 
ATOM 1391 H HG2  . PRO A 1 88  ? 56.749  79.993  30.752 1.00 0.00  ? 170 PRO A HG2  1 
ATOM 1392 H HG3  . PRO A 1 88  ? 57.802  78.633  31.270 1.00 0.00  ? 170 PRO A HG3  1 
ATOM 1393 H HD2  . PRO A 1 88  ? 58.568  81.231  29.925 1.00 0.00  ? 170 PRO A HD2  1 
ATOM 1394 H HD3  . PRO A 1 88  ? 59.461  80.247  31.146 1.00 0.00  ? 170 PRO A HD3  1 
ATOM 1395 N N    . GLY A 1 89  ? 58.660  77.162  26.519 1.00 30.33 ? 171 GLY A N    1 
ATOM 1396 C CA   . GLY A 1 89  ? 58.596  77.069  25.066 1.00 30.90 ? 171 GLY A CA   1 
ATOM 1397 C C    . GLY A 1 89  ? 59.235  75.831  24.459 1.00 29.11 ? 171 GLY A C    1 
ATOM 1398 O O    . GLY A 1 89  ? 59.721  74.992  25.197 1.00 31.26 ? 171 GLY A O    1 
ATOM 1399 H H    . GLY A 1 89  ? 58.607  76.329  27.062 1.00 0.00  ? 171 GLY A H    1 
ATOM 1400 H HA2  . GLY A 1 89  ? 57.541  77.073  24.766 1.00 0.00  ? 171 GLY A HA2  1 
ATOM 1401 H HA3  . GLY A 1 89  ? 59.101  77.948  24.643 1.00 0.00  ? 171 GLY A HA3  1 
ATOM 1402 N N    . PRO A 1 90  ? 59.247  75.715  23.113 1.00 31.78 ? 172 PRO A N    1 
ATOM 1403 C CA   . PRO A 1 90  ? 59.867  74.576  22.454 1.00 35.67 ? 172 PRO A CA   1 
ATOM 1404 C C    . PRO A 1 90  ? 61.384  74.639  22.394 1.00 39.59 ? 172 PRO A C    1 
ATOM 1405 O O    . PRO A 1 90  ? 61.986  75.696  22.396 1.00 41.64 ? 172 PRO A O    1 
ATOM 1406 C CB   . PRO A 1 90  ? 59.273  74.696  21.038 1.00 34.56 ? 172 PRO A CB   1 
ATOM 1407 C CG   . PRO A 1 90  ? 59.132  76.216  20.858 1.00 35.84 ? 172 PRO A CG   1 
ATOM 1408 C CD   . PRO A 1 90  ? 58.559  76.641  22.218 1.00 34.62 ? 172 PRO A CD   1 
ATOM 1409 H HA   . PRO A 1 90  ? 59.530  73.639  22.916 1.00 0.00  ? 172 PRO A HA   1 
ATOM 1410 H HB2  . PRO A 1 90  ? 59.929  74.262  20.266 1.00 0.00  ? 172 PRO A HB2  1 
ATOM 1411 H HB3  . PRO A 1 90  ? 58.271  74.225  20.974 1.00 0.00  ? 172 PRO A HB3  1 
ATOM 1412 H HG2  . PRO A 1 90  ? 60.127  76.669  20.684 1.00 0.00  ? 172 PRO A HG2  1 
ATOM 1413 H HG3  . PRO A 1 90  ? 58.463  76.469  20.017 1.00 0.00  ? 172 PRO A HG3  1 
ATOM 1414 H HD2  . PRO A 1 90  ? 58.786  77.696  22.412 1.00 0.00  ? 172 PRO A HD2  1 
ATOM 1415 H HD3  . PRO A 1 90  ? 57.471  76.468  22.232 1.00 0.00  ? 172 PRO A HD3  1 
ATOM 1416 N N    . GLY A 1 91  ? 61.995  73.441  22.326 1.00 40.28 ? 173 GLY A N    1 
ATOM 1417 C CA   . GLY A 1 91  ? 63.444  73.333  22.206 1.00 38.38 ? 173 GLY A CA   1 
ATOM 1418 C C    . GLY A 1 91  ? 64.291  73.742  23.401 1.00 39.40 ? 173 GLY A C    1 
ATOM 1419 O O    . GLY A 1 91  ? 64.188  73.182  24.478 1.00 35.58 ? 173 GLY A O    1 
ATOM 1420 H H    . GLY A 1 91  ? 61.457  72.596  22.321 1.00 0.00  ? 173 GLY A H    1 
ATOM 1421 H HA2  . GLY A 1 91  ? 63.689  72.283  21.990 1.00 0.00  ? 173 GLY A HA2  1 
ATOM 1422 H HA3  . GLY A 1 91  ? 63.735  73.935  21.334 1.00 0.00  ? 173 GLY A HA3  1 
ATOM 1423 N N    . ILE A 1 92  ? 65.171  74.742  23.173 1.00 39.00 ? 174 ILE A N    1 
ATOM 1424 C CA   . ILE A 1 92  ? 66.066  75.221  24.223 1.00 38.67 ? 174 ILE A CA   1 
ATOM 1425 C C    . ILE A 1 92  ? 65.332  75.940  25.336 1.00 37.62 ? 174 ILE A C    1 
ATOM 1426 O O    . ILE A 1 92  ? 65.888  76.228  26.378 1.00 35.31 ? 174 ILE A O    1 
ATOM 1427 C CB   . ILE A 1 92  ? 67.145  76.160  23.620 1.00 39.46 ? 174 ILE A CB   1 
ATOM 1428 C CG1  . ILE A 1 92  ? 68.328  76.297  24.604 1.00 39.36 ? 174 ILE A CG1  1 
ATOM 1429 C CG2  . ILE A 1 92  ? 66.531  77.537  23.294 1.00 40.52 ? 174 ILE A CG2  1 
ATOM 1430 C CD1  . ILE A 1 92  ? 69.532  77.059  24.026 1.00 42.55 ? 174 ILE A CD1  1 
ATOM 1431 H H    . ILE A 1 92  ? 65.206  75.189  22.277 1.00 0.00  ? 174 ILE A H    1 
ATOM 1432 H HA   . ILE A 1 92  ? 66.561  74.344  24.645 1.00 0.00  ? 174 ILE A HA   1 
ATOM 1433 H HB   . ILE A 1 92  ? 67.525  75.716  22.684 1.00 0.00  ? 174 ILE A HB   1 
ATOM 1434 H HG12 . ILE A 1 92  ? 67.987  76.831  25.498 1.00 0.00  ? 174 ILE A HG12 1 
ATOM 1435 H HG13 . ILE A 1 92  ? 68.668  75.289  24.886 1.00 0.00  ? 174 ILE A HG13 1 
ATOM 1436 H HG21 . ILE A 1 92  ? 66.123  77.997  24.206 1.00 0.00  ? 174 ILE A HG21 1 
ATOM 1437 H HG22 . ILE A 1 92  ? 67.288  78.204  22.870 1.00 0.00  ? 174 ILE A HG22 1 
ATOM 1438 H HG23 . ILE A 1 92  ? 65.730  77.422  22.553 1.00 0.00  ? 174 ILE A HG23 1 
ATOM 1439 H HD11 . ILE A 1 92  ? 69.255  78.084  23.755 1.00 0.00  ? 174 ILE A HD11 1 
ATOM 1440 H HD12 . ILE A 1 92  ? 70.313  77.108  24.791 1.00 0.00  ? 174 ILE A HD12 1 
ATOM 1441 H HD13 . ILE A 1 92  ? 69.921  76.533  23.142 1.00 0.00  ? 174 ILE A HD13 1 
ATOM 1442 N N    . ASN A 1 93  ? 64.056  76.259  25.091 1.00 35.11 ? 175 ASN A N    1 
ATOM 1443 C CA   . ASN A 1 93  ? 63.271  76.971  26.079 1.00 32.57 ? 175 ASN A CA   1 
ATOM 1444 C C    . ASN A 1 93  ? 63.074  76.169  27.343 1.00 31.02 ? 175 ASN A C    1 
ATOM 1445 O O    . ASN A 1 93  ? 63.113  74.951  27.337 1.00 36.90 ? 175 ASN A O    1 
ATOM 1446 C CB   . ASN A 1 93  ? 61.927  77.390  25.492 1.00 31.99 ? 175 ASN A CB   1 
ATOM 1447 C CG   . ASN A 1 93  ? 62.079  78.576  24.581 1.00 35.31 ? 175 ASN A CG   1 
ATOM 1448 O OD1  . ASN A 1 93  ? 61.951  79.709  25.013 1.00 35.83 ? 175 ASN A OD1  1 
ATOM 1449 N ND2  . ASN A 1 93  ? 62.377  78.312  23.301 1.00 36.74 ? 175 ASN A ND2  1 
ATOM 1450 H H    . ASN A 1 93  ? 63.625  76.035  24.224 1.00 0.00  ? 175 ASN A H    1 
ATOM 1451 H HA   . ASN A 1 93  ? 63.815  77.884  26.343 1.00 0.00  ? 175 ASN A HA   1 
ATOM 1452 H HB2  . ASN A 1 93  ? 61.519  76.547  24.937 1.00 0.00  ? 175 ASN A HB2  1 
ATOM 1453 H HB3  . ASN A 1 93  ? 61.231  77.619  26.293 1.00 0.00  ? 175 ASN A HB3  1 
ATOM 1454 N N    . GLY A 1 94  ? 62.933  76.892  28.468 1.00 28.23 ? 176 GLY A N    1 
ATOM 1455 C CA   . GLY A 1 94  ? 62.802  76.226  29.746 1.00 23.94 ? 176 GLY A CA   1 
ATOM 1456 C C    . GLY A 1 94  ? 64.095  75.717  30.315 1.00 22.59 ? 176 GLY A C    1 
ATOM 1457 O O    . GLY A 1 94  ? 64.225  75.497  31.502 1.00 21.16 ? 176 GLY A O    1 
ATOM 1458 H H    . GLY A 1 94  ? 62.976  77.894  28.444 1.00 0.00  ? 176 GLY A H    1 
ATOM 1459 H HA2  . GLY A 1 94  ? 62.360  76.924  30.438 1.00 0.00  ? 176 GLY A HA2  1 
ATOM 1460 H HA3  . GLY A 1 94  ? 62.124  75.391  29.625 1.00 0.00  ? 176 GLY A HA3  1 
ATOM 1461 N N    . ASP A 1 95  ? 65.081  75.515  29.432 1.00 22.00 ? 177 ASP A N    1 
ATOM 1462 C CA   . ASP A 1 95  ? 66.357  74.972  29.840 1.00 24.39 ? 177 ASP A CA   1 
ATOM 1463 C C    . ASP A 1 95  ? 67.100  75.897  30.779 1.00 25.08 ? 177 ASP A C    1 
ATOM 1464 O O    . ASP A 1 95  ? 66.859  77.090  30.815 1.00 29.07 ? 177 ASP A O    1 
ATOM 1465 C CB   . ASP A 1 95  ? 67.228  74.645  28.609 1.00 23.67 ? 177 ASP A CB   1 
ATOM 1466 C CG   . ASP A 1 95  ? 66.564  73.666  27.660 1.00 31.24 ? 177 ASP A CG   1 
ATOM 1467 O OD1  . ASP A 1 95  ? 65.405  73.239  27.905 1.00 33.13 ? 177 ASP A OD1  1 
ATOM 1468 O OD2  . ASP A 1 95  ? 67.220  73.287  26.658 1.00 34.02 ? 177 ASP A OD2  1 
ATOM 1469 H H    . ASP A 1 95  ? 64.982  75.730  28.475 1.00 0.00  ? 177 ASP A H    1 
ATOM 1470 H HA   . ASP A 1 95  ? 66.169  74.034  30.374 1.00 0.00  ? 177 ASP A HA   1 
ATOM 1471 H HB2  . ASP A 1 95  ? 67.429  75.576  28.068 1.00 0.00  ? 177 ASP A HB2  1 
ATOM 1472 H HB3  . ASP A 1 95  ? 68.189  74.233  28.950 1.00 0.00  ? 177 ASP A HB3  1 
ATOM 1473 N N    . ALA A 1 96  ? 68.029  75.296  31.543 1.00 24.34 ? 178 ALA A N    1 
ATOM 1474 C CA   . ALA A 1 96  ? 68.818  76.057  32.492 1.00 27.94 ? 178 ALA A CA   1 
ATOM 1475 C C    . ALA A 1 96  ? 70.254  75.587  32.405 1.00 30.02 ? 178 ALA A C    1 
ATOM 1476 O O    . ALA A 1 96  ? 70.513  74.401  32.468 1.00 35.07 ? 178 ALA A O    1 
ATOM 1477 C CB   . ALA A 1 96  ? 68.254  75.862  33.908 1.00 26.91 ? 178 ALA A CB   1 
ATOM 1478 H H    . ALA A 1 96  ? 68.184  74.309  31.482 1.00 0.00  ? 178 ALA A H    1 
ATOM 1479 H HA   . ALA A 1 96  ? 68.757  77.126  32.252 1.00 0.00  ? 178 ALA A HA   1 
ATOM 1480 H HB1  . ALA A 1 96  ? 68.856  76.437  34.627 1.00 0.00  ? 178 ALA A HB1  1 
ATOM 1481 H HB2  . ALA A 1 96  ? 67.207  76.205  33.941 1.00 0.00  ? 178 ALA A HB2  1 
ATOM 1482 H HB3  . ALA A 1 96  ? 68.295  74.796  34.168 1.00 0.00  ? 178 ALA A HB3  1 
ATOM 1483 N N    . HIS A 1 97  ? 71.182  76.542  32.246 1.00 30.76 ? 179 HIS A N    1 
ATOM 1484 C CA   . HIS A 1 97  ? 72.595  76.214  32.158 1.00 31.50 ? 179 HIS A CA   1 
ATOM 1485 C C    . HIS A 1 97  ? 73.315  76.787  33.355 1.00 35.29 ? 179 HIS A C    1 
ATOM 1486 O O    . HIS A 1 97  ? 72.903  77.810  33.859 1.00 34.68 ? 179 HIS A O    1 
ATOM 1487 C CB   . HIS A 1 97  ? 73.204  76.815  30.880 1.00 32.48 ? 179 HIS A CB   1 
ATOM 1488 C CG   . HIS A 1 97  ? 72.667  76.233  29.614 1.00 36.54 ? 179 HIS A CG   1 
ATOM 1489 N ND1  . HIS A 1 97  ? 72.243  76.959  28.596 1.00 36.92 ? 179 HIS A ND1  1 
ATOM 1490 C CD2  . HIS A 1 97  ? 72.532  74.936  29.323 1.00 37.58 ? 179 HIS A CD2  1 
ATOM 1491 C CE1  . HIS A 1 97  ? 71.837  76.144  27.654 1.00 37.40 ? 179 HIS A CE1  1 
ATOM 1492 N NE2  . HIS A 1 97  ? 71.979  74.962  28.006 1.00 38.37 ? 179 HIS A NE2  1 
ATOM 1493 H H    . HIS A 1 97  ? 70.925  77.502  32.184 1.00 0.00  ? 179 HIS A H    1 
ATOM 1494 H HA   . HIS A 1 97  ? 72.730  75.128  32.124 1.00 0.00  ? 179 HIS A HA   1 
ATOM 1495 H HB2  . HIS A 1 97  ? 73.009  77.897  30.885 1.00 0.00  ? 179 HIS A HB2  1 
ATOM 1496 H HB3  . HIS A 1 97  ? 74.285  76.634  30.904 1.00 0.00  ? 179 HIS A HB3  1 
ATOM 1497 H HD2  . HIS A 1 97  ? 72.787  74.136  29.950 1.00 0.00  ? 179 HIS A HD2  1 
ATOM 1498 H HE1  . HIS A 1 97  ? 71.438  76.459  26.711 1.00 0.00  ? 179 HIS A HE1  1 
ATOM 1499 N N    . PHE A 1 98  ? 74.408  76.111  33.767 1.00 34.91 ? 180 PHE A N    1 
ATOM 1500 C CA   . PHE A 1 98  ? 75.161  76.539  34.937 1.00 36.80 ? 180 PHE A CA   1 
ATOM 1501 C C    . PHE A 1 98  ? 76.661  76.663  34.678 1.00 37.65 ? 180 PHE A C    1 
ATOM 1502 O O    . PHE A 1 98  ? 77.261  75.821  34.039 1.00 36.61 ? 180 PHE A O    1 
ATOM 1503 C CB   . PHE A 1 98  ? 74.900  75.556  36.088 1.00 37.79 ? 180 PHE A CB   1 
ATOM 1504 C CG   . PHE A 1 98  ? 73.437  75.476  36.480 1.00 38.02 ? 180 PHE A CG   1 
ATOM 1505 C CD1  . PHE A 1 98  ? 72.570  74.716  35.711 1.00 39.65 ? 180 PHE A CD1  1 
ATOM 1506 C CD2  . PHE A 1 98  ? 72.952  76.158  37.598 1.00 37.82 ? 180 PHE A CD2  1 
ATOM 1507 C CE1  . PHE A 1 98  ? 71.229  74.733  36.046 1.00 40.68 ? 180 PHE A CE1  1 
ATOM 1508 C CE2  . PHE A 1 98  ? 71.602  76.084  37.934 1.00 39.34 ? 180 PHE A CE2  1 
ATOM 1509 C CZ   . PHE A 1 98  ? 70.714  75.357  37.174 1.00 39.00 ? 180 PHE A CZ   1 
ATOM 1510 H H    . PHE A 1 98  ? 74.702  75.293  33.281 1.00 0.00  ? 180 PHE A H    1 
ATOM 1511 H HA   . PHE A 1 98  ? 74.781  77.518  35.250 1.00 0.00  ? 180 PHE A HA   1 
ATOM 1512 H HB2  . PHE A 1 98  ? 75.249  74.557  35.808 1.00 0.00  ? 180 PHE A HB2  1 
ATOM 1513 H HB3  . PHE A 1 98  ? 75.453  75.870  36.968 1.00 0.00  ? 180 PHE A HB3  1 
ATOM 1514 H HD1  . PHE A 1 98  ? 72.918  74.173  34.849 1.00 0.00  ? 180 PHE A HD1  1 
ATOM 1515 H HD2  . PHE A 1 98  ? 73.636  76.737  38.207 1.00 0.00  ? 180 PHE A HD2  1 
ATOM 1516 H HE1  . PHE A 1 98  ? 70.508  74.275  35.383 1.00 0.00  ? 180 PHE A HE1  1 
ATOM 1517 H HE2  . PHE A 1 98  ? 71.204  76.598  38.786 1.00 0.00  ? 180 PHE A HE2  1 
ATOM 1518 H HZ   . PHE A 1 98  ? 69.662  75.305  37.404 1.00 0.00  ? 180 PHE A HZ   1 
ATOM 1519 N N    . ASP A 1 99  ? 77.251  77.755  35.211 1.00 40.97 ? 181 ASP A N    1 
ATOM 1520 C CA   . ASP A 1 99  ? 78.678  78.055  35.038 1.00 44.04 ? 181 ASP A CA   1 
ATOM 1521 C C    . ASP A 1 99  ? 79.555  77.149  35.894 1.00 45.07 ? 181 ASP A C    1 
ATOM 1522 O O    . ASP A 1 99  ? 79.676  77.339  37.090 1.00 45.33 ? 181 ASP A O    1 
ATOM 1523 C CB   . ASP A 1 99  ? 78.939  79.542  35.374 1.00 41.84 ? 181 ASP A CB   1 
ATOM 1524 C CG   . ASP A 1 99  ? 80.200  80.115  34.769 1.00 40.38 ? 181 ASP A CG   1 
ATOM 1525 O OD1  . ASP A 1 99  ? 81.125  79.327  34.471 1.00 42.98 ? 181 ASP A OD1  1 
ATOM 1526 O OD2  . ASP A 1 99  ? 80.267  81.353  34.555 1.00 35.74 ? 181 ASP A OD2  1 
ATOM 1527 H H    . ASP A 1 99  ? 76.701  78.400  35.739 1.00 0.00  ? 181 ASP A H    1 
ATOM 1528 H HA   . ASP A 1 99  ? 78.930  77.929  33.976 1.00 0.00  ? 181 ASP A HA   1 
ATOM 1529 H HB2  . ASP A 1 99  ? 78.089  80.152  35.060 1.00 0.00  ? 181 ASP A HB2  1 
ATOM 1530 H HB3  . ASP A 1 99  ? 78.960  79.633  36.455 1.00 0.00  ? 181 ASP A HB3  1 
ATOM 1531 N N    . ASP A 1 100 ? 80.194  76.148  35.260 1.00 45.30 ? 182 ASP A N    1 
ATOM 1532 C CA   . ASP A 1 100 ? 81.040  75.201  35.995 1.00 45.44 ? 182 ASP A CA   1 
ATOM 1533 C C    . ASP A 1 100 ? 82.276  75.830  36.612 1.00 48.94 ? 182 ASP A C    1 
ATOM 1534 O O    . ASP A 1 100 ? 82.792  75.354  37.605 1.00 53.78 ? 182 ASP A O    1 
ATOM 1535 C CB   . ASP A 1 100 ? 81.467  74.042  35.076 1.00 41.38 ? 182 ASP A CB   1 
ATOM 1536 C CG   . ASP A 1 100 ? 81.514  72.721  35.802 1.00 35.96 ? 182 ASP A CG   1 
ATOM 1537 O OD1  . ASP A 1 100 ? 81.658  72.718  37.053 1.00 30.98 ? 182 ASP A OD1  1 
ATOM 1538 O OD2  . ASP A 1 100 ? 81.399  71.673  35.118 1.00 36.06 ? 182 ASP A OD2  1 
ATOM 1539 H H    . ASP A 1 100 ? 80.104  76.061  34.266 1.00 0.00  ? 182 ASP A H    1 
ATOM 1540 H HA   . ASP A 1 100 ? 80.435  74.787  36.804 1.00 0.00  ? 182 ASP A HA   1 
ATOM 1541 H HB2  . ASP A 1 100 ? 80.749  73.948  34.245 1.00 0.00  ? 182 ASP A HB2  1 
ATOM 1542 H HB3  . ASP A 1 100 ? 82.466  74.253  34.676 1.00 0.00  ? 182 ASP A HB3  1 
ATOM 1543 N N    . ASP A 1 101 ? 82.727  76.944  35.995 1.00 46.81 ? 183 ASP A N    1 
ATOM 1544 C CA   . ASP A 1 101 ? 83.873  77.686  36.518 1.00 44.89 ? 183 ASP A CA   1 
ATOM 1545 C C    . ASP A 1 101 ? 83.642  78.163  37.939 1.00 45.53 ? 183 ASP A C    1 
ATOM 1546 O O    . ASP A 1 101 ? 84.566  78.582  38.614 1.00 48.91 ? 183 ASP A O    1 
ATOM 1547 C CB   . ASP A 1 101 ? 84.192  78.882  35.600 1.00 45.07 ? 183 ASP A CB   1 
ATOM 1548 C CG   . ASP A 1 101 ? 85.089  78.491  34.454 1.00 46.41 ? 183 ASP A CG   1 
ATOM 1549 O OD1  . ASP A 1 101 ? 85.531  77.337  34.343 1.00 51.05 ? 183 ASP A OD1  1 
ATOM 1550 O OD2  . ASP A 1 101 ? 85.410  79.325  33.594 1.00 41.97 ? 183 ASP A OD2  1 
ATOM 1551 H H    . ASP A 1 101 ? 82.244  77.297  35.196 1.00 0.00  ? 183 ASP A H    1 
ATOM 1552 H HA   . ASP A 1 101 ? 84.737  77.010  36.532 1.00 0.00  ? 183 ASP A HA   1 
ATOM 1553 H HB2  . ASP A 1 101 ? 83.271  79.319  35.222 1.00 0.00  ? 183 ASP A HB2  1 
ATOM 1554 H HB3  . ASP A 1 101 ? 84.671  79.653  36.190 1.00 0.00  ? 183 ASP A HB3  1 
ATOM 1555 N N    . GLU A 1 102 ? 82.383  78.097  38.390 1.00 40.98 ? 184 GLU A N    1 
ATOM 1556 C CA   . GLU A 1 102 ? 82.079  78.474  39.752 1.00 39.45 ? 184 GLU A CA   1 
ATOM 1557 C C    . GLU A 1 102 ? 82.299  77.265  40.635 1.00 39.62 ? 184 GLU A C    1 
ATOM 1558 O O    . GLU A 1 102 ? 82.416  76.153  40.156 1.00 39.15 ? 184 GLU A O    1 
ATOM 1559 C CB   . GLU A 1 102 ? 80.619  78.957  39.865 1.00 42.34 ? 184 GLU A CB   1 
ATOM 1560 C CG   . GLU A 1 102 ? 80.256  80.040  38.846 1.00 41.26 ? 184 GLU A CG   1 
ATOM 1561 C CD   . GLU A 1 102 ? 81.104  81.271  38.916 1.00 43.42 ? 184 GLU A CD   1 
ATOM 1562 O OE1  . GLU A 1 102 ? 81.586  81.611  40.027 1.00 44.70 ? 184 GLU A OE1  1 
ATOM 1563 O OE2  . GLU A 1 102 ? 81.295  81.920  37.856 1.00 45.57 ? 184 GLU A OE2  1 
ATOM 1564 H H    . GLU A 1 102 ? 81.636  77.763  37.827 1.00 0.00  ? 184 GLU A H    1 
ATOM 1565 H HA   . GLU A 1 102 ? 82.740  79.294  40.071 1.00 0.00  ? 184 GLU A HA   1 
ATOM 1566 H HB2  . GLU A 1 102 ? 79.955  78.091  39.707 1.00 0.00  ? 184 GLU A HB2  1 
ATOM 1567 H HB3  . GLU A 1 102 ? 80.454  79.376  40.867 1.00 0.00  ? 184 GLU A HB3  1 
ATOM 1568 H HG2  . GLU A 1 102 ? 80.425  79.605  37.863 1.00 0.00  ? 184 GLU A HG2  1 
ATOM 1569 H HG3  . GLU A 1 102 ? 79.203  80.307  38.974 1.00 0.00  ? 184 GLU A HG3  1 
ATOM 1570 N N    . GLN A 1 103 ? 82.361  77.536  41.954 1.00 41.64 ? 185 GLN A N    1 
ATOM 1571 C CA   . GLN A 1 103 ? 82.546  76.487  42.945 1.00 42.94 ? 185 GLN A CA   1 
ATOM 1572 C C    . GLN A 1 103 ? 81.166  76.133  43.451 1.00 40.63 ? 185 GLN A C    1 
ATOM 1573 O O    . GLN A 1 103 ? 80.600  76.824  44.278 1.00 39.53 ? 185 GLN A O    1 
ATOM 1574 C CB   . GLN A 1 103 ? 83.458  77.021  44.072 1.00 48.47 ? 185 GLN A CB   1 
ATOM 1575 C CG   . GLN A 1 103 ? 83.887  75.972  45.112 1.00 53.06 ? 185 GLN A CG   1 
ATOM 1576 C CD   . GLN A 1 103 ? 84.573  74.771  44.497 1.00 59.83 ? 185 GLN A CD   1 
ATOM 1577 O OE1  . GLN A 1 103 ? 85.097  74.827  43.398 1.00 64.01 ? 185 GLN A OE1  1 
ATOM 1578 N NE2  . GLN A 1 103 ? 84.566  73.652  45.241 1.00 59.21 ? 185 GLN A NE2  1 
ATOM 1579 H H    . GLN A 1 103 ? 82.284  78.481  42.269 1.00 0.00  ? 185 GLN A H    1 
ATOM 1580 H HA   . GLN A 1 103 ? 83.035  75.619  42.486 1.00 0.00  ? 185 GLN A HA   1 
ATOM 1581 H HB2  . GLN A 1 103 ? 84.370  77.432  43.612 1.00 0.00  ? 185 GLN A HB2  1 
ATOM 1582 H HB3  . GLN A 1 103 ? 82.918  77.823  44.599 1.00 0.00  ? 185 GLN A HB3  1 
ATOM 1583 H HG2  . GLN A 1 103 ? 84.581  76.457  45.822 1.00 0.00  ? 185 GLN A HG2  1 
ATOM 1584 H HG3  . GLN A 1 103 ? 82.992  75.642  45.661 1.00 0.00  ? 185 GLN A HG3  1 
ATOM 1585 H HE21 . GLN A 1 103 ? 84.120  73.639  46.137 1.00 0.00  ? 185 GLN A HE21 1 
ATOM 1586 H HE22 . GLN A 1 103 ? 85.001  72.822  44.892 1.00 0.00  ? 185 GLN A HE22 1 
ATOM 1587 N N    . TRP A 1 104 ? 80.630  75.034  42.905 1.00 40.34 ? 186 TRP A N    1 
ATOM 1588 C CA   . TRP A 1 104 ? 79.312  74.578  43.295 1.00 41.65 ? 186 TRP A CA   1 
ATOM 1589 C C    . TRP A 1 104 ? 79.323  73.806  44.591 1.00 45.74 ? 186 TRP A C    1 
ATOM 1590 O O    . TRP A 1 104 ? 80.077  72.861  44.709 1.00 48.68 ? 186 TRP A O    1 
ATOM 1591 C CB   . TRP A 1 104 ? 78.732  73.683  42.187 1.00 37.07 ? 186 TRP A CB   1 
ATOM 1592 C CG   . TRP A 1 104 ? 78.420  74.414  40.933 1.00 36.03 ? 186 TRP A CG   1 
ATOM 1593 C CD1  . TRP A 1 104 ? 78.825  74.231  39.681 1.00 35.63 ? 186 TRP A CD1  1 
ATOM 1594 C CD2  . TRP A 1 104 ? 77.490  75.610  40.825 1.00 34.83 ? 186 TRP A CD2  1 
ATOM 1595 N NE1  . TRP A 1 104 ? 78.282  75.046  38.803 1.00 35.42 ? 186 TRP A NE1  1 
ATOM 1596 C CE2  . TRP A 1 104 ? 77.485  75.888  39.472 1.00 35.81 ? 186 TRP A CE2  1 
ATOM 1597 C CE3  . TRP A 1 104 ? 76.791  76.285  41.728 1.00 32.23 ? 186 TRP A CE3  1 
ATOM 1598 C CZ2  . TRP A 1 104 ? 76.711  76.952  38.983 1.00 35.13 ? 186 TRP A CZ2  1 
ATOM 1599 C CZ3  . TRP A 1 104 ? 75.967  77.346  41.246 1.00 26.87 ? 186 TRP A CZ3  1 
ATOM 1600 C CH2  . TRP A 1 104 ? 75.964  77.670  39.919 1.00 32.10 ? 186 TRP A CH2  1 
ATOM 1601 H H    . TRP A 1 104 ? 81.127  74.523  42.206 1.00 0.00  ? 186 TRP A H    1 
ATOM 1602 H HA   . TRP A 1 104 ? 78.682  75.458  43.415 1.00 0.00  ? 186 TRP A HA   1 
ATOM 1603 H HB2  . TRP A 1 104 ? 79.464  72.899  41.955 1.00 0.00  ? 186 TRP A HB2  1 
ATOM 1604 H HB3  . TRP A 1 104 ? 77.803  73.218  42.555 1.00 0.00  ? 186 TRP A HB3  1 
ATOM 1605 H HD1  . TRP A 1 104 ? 79.527  73.474  39.427 1.00 0.00  ? 186 TRP A HD1  1 
ATOM 1606 H HE1  . TRP A 1 104 ? 78.454  75.037  37.817 1.00 0.00  ? 186 TRP A HE1  1 
ATOM 1607 H HE3  . TRP A 1 104 ? 76.769  76.040  42.762 1.00 0.00  ? 186 TRP A HE3  1 
ATOM 1608 H HZ2  . TRP A 1 104 ? 76.692  77.230  37.952 1.00 0.00  ? 186 TRP A HZ2  1 
ATOM 1609 H HZ3  . TRP A 1 104 ? 75.325  77.839  41.946 1.00 0.00  ? 186 TRP A HZ3  1 
ATOM 1610 H HH2  . TRP A 1 104 ? 75.341  78.503  39.578 1.00 0.00  ? 186 TRP A HH2  1 
ATOM 1611 N N    . THR A 1 105 ? 78.486  74.223  45.563 1.00 47.28 ? 187 THR A N    1 
ATOM 1612 C CA   . THR A 1 105 ? 78.437  73.523  46.840 1.00 48.48 ? 187 THR A CA   1 
ATOM 1613 C C    . THR A 1 105 ? 77.016  73.320  47.290 1.00 51.42 ? 187 THR A C    1 
ATOM 1614 O O    . THR A 1 105 ? 76.145  74.107  46.992 1.00 51.41 ? 187 THR A O    1 
ATOM 1615 C CB   . THR A 1 105 ? 79.207  74.235  47.972 1.00 47.29 ? 187 THR A CB   1 
ATOM 1616 O OG1  . THR A 1 105 ? 78.507  75.419  48.375 1.00 44.65 ? 187 THR A OG1  1 
ATOM 1617 C CG2  . THR A 1 105 ? 80.611  74.537  47.476 1.00 48.39 ? 187 THR A CG2  1 
ATOM 1618 H H    . THR A 1 105 ? 77.913  75.032  45.442 1.00 0.00  ? 187 THR A H    1 
ATOM 1619 H HA   . THR A 1 105 ? 78.892  72.536  46.706 1.00 0.00  ? 187 THR A HA   1 
ATOM 1620 H HB   . THR A 1 105 ? 79.308  73.561  48.838 1.00 0.00  ? 187 THR A HB   1 
ATOM 1621 H HG1  . THR A 1 105 ? 78.980  75.857  49.071 1.00 0.00  ? 187 THR A HG1  1 
ATOM 1622 H HG21 . THR A 1 105 ? 80.672  74.680  46.403 1.00 0.00  ? 187 THR A HG21 1 
ATOM 1623 H HG22 . THR A 1 105 ? 80.940  75.469  47.945 1.00 0.00  ? 187 THR A HG22 1 
ATOM 1624 H HG23 . THR A 1 105 ? 81.353  73.850  47.843 1.00 0.00  ? 187 THR A HG23 1 
ATOM 1625 N N    . LYS A 1 106 ? 76.807  72.217  48.033 1.00 55.93 ? 188 LYS A N    1 
ATOM 1626 C CA   . LYS A 1 106 ? 75.505  71.932  48.602 1.00 57.22 ? 188 LYS A CA   1 
ATOM 1627 C C    . LYS A 1 106 ? 75.374  72.526  49.986 1.00 58.70 ? 188 LYS A C    1 
ATOM 1628 O O    . LYS A 1 106 ? 74.419  72.270  50.697 1.00 58.73 ? 188 LYS A O    1 
ATOM 1629 C CB   . LYS A 1 106 ? 75.299  70.412  48.662 1.00 60.96 ? 188 LYS A CB   1 
ATOM 1630 C CG   . LYS A 1 106 ? 73.862  69.991  48.983 1.00 70.53 ? 188 LYS A CG   1 
ATOM 1631 C CD   . LYS A 1 106 ? 72.849  70.624  48.020 1.00 77.51 ? 188 LYS A CD   1 
ATOM 1632 C CE   . LYS A 1 106 ? 71.423  70.187  48.324 1.00 82.93 ? 188 LYS A CE   1 
ATOM 1633 N NZ   . LYS A 1 106 ? 70.963  70.636  49.659 1.00 86.48 ? 188 LYS A NZ   1 
ATOM 1634 H H    . LYS A 1 106 ? 77.568  71.615  48.263 1.00 0.00  ? 188 LYS A H    1 
ATOM 1635 H HA   . LYS A 1 106 ? 74.784  72.396  47.929 1.00 0.00  ? 188 LYS A HA   1 
ATOM 1636 H HB2  . LYS A 1 106 ? 75.539  69.969  47.694 1.00 0.00  ? 188 LYS A HB2  1 
ATOM 1637 H HB3  . LYS A 1 106 ? 75.974  69.995  49.425 1.00 0.00  ? 188 LYS A HB3  1 
ATOM 1638 H HG2  . LYS A 1 106 ? 73.788  68.896  48.917 1.00 0.00  ? 188 LYS A HG2  1 
ATOM 1639 H HG3  . LYS A 1 106 ? 73.642  70.293  50.006 1.00 0.00  ? 188 LYS A HG3  1 
ATOM 1640 H HD2  . LYS A 1 106 ? 72.852  71.716  48.090 1.00 0.00  ? 188 LYS A HD2  1 
ATOM 1641 H HD3  . LYS A 1 106 ? 73.132  70.308  47.014 1.00 0.00  ? 188 LYS A HD3  1 
ATOM 1642 H HE2  . LYS A 1 106 ? 70.760  70.651  47.609 1.00 0.00  ? 188 LYS A HE2  1 
ATOM 1643 H HE3  . LYS A 1 106 ? 71.345  69.105  48.265 1.00 0.00  ? 188 LYS A HE3  1 
ATOM 1644 H HZ1  . LYS A 1 106 ? 71.010  71.704  49.759 1.00 0.00  ? 188 LYS A HZ1  1 
ATOM 1645 H HZ2  . LYS A 1 106 ? 69.950  70.330  49.841 1.00 0.00  ? 188 LYS A HZ2  1 
ATOM 1646 H HZ3  . LYS A 1 106 ? 71.551  70.203  50.440 1.00 0.00  ? 188 LYS A HZ3  1 
ATOM 1647 N N    . ASP A 1 107 ? 76.363  73.340  50.378 1.00 60.81 ? 189 ASP A N    1 
ATOM 1648 C CA   . ASP A 1 107 ? 76.310  73.990  51.674 1.00 62.50 ? 189 ASP A CA   1 
ATOM 1649 C C    . ASP A 1 107 ? 76.695  75.452  51.564 1.00 64.25 ? 189 ASP A C    1 
ATOM 1650 O O    . ASP A 1 107 ? 77.018  75.939  50.496 1.00 59.84 ? 189 ASP A O    1 
ATOM 1651 C CB   . ASP A 1 107 ? 77.191  73.250  52.705 1.00 63.76 ? 189 ASP A CB   1 
ATOM 1652 C CG   . ASP A 1 107 ? 78.661  73.284  52.367 1.00 66.70 ? 189 ASP A CG   1 
ATOM 1653 O OD1  . ASP A 1 107 ? 79.110  72.440  51.549 1.00 68.59 ? 189 ASP A OD1  1 
ATOM 1654 O OD2  . ASP A 1 107 ? 79.376  74.149  52.932 1.00 65.89 ? 189 ASP A OD2  1 
ATOM 1655 H H    . ASP A 1 107 ? 77.159  73.519  49.816 1.00 0.00  ? 189 ASP A H    1 
ATOM 1656 H HA   . ASP A 1 107 ? 75.277  73.963  52.047 1.00 0.00  ? 189 ASP A HA   1 
ATOM 1657 H HB2  . ASP A 1 107 ? 77.056  73.694  53.701 1.00 0.00  ? 189 ASP A HB2  1 
ATOM 1658 H HB3  . ASP A 1 107 ? 76.858  72.205  52.768 1.00 0.00  ? 189 ASP A HB3  1 
ATOM 1659 N N    . THR A 1 108 ? 76.663  76.149  52.717 1.00 70.32 ? 190 THR A N    1 
ATOM 1660 C CA   . THR A 1 108 ? 76.987  77.569  52.788 1.00 74.73 ? 190 THR A CA   1 
ATOM 1661 C C    . THR A 1 108 ? 78.485  77.836  52.759 1.00 77.26 ? 190 THR A C    1 
ATOM 1662 O O    . THR A 1 108 ? 79.014  78.539  53.602 1.00 78.80 ? 190 THR A O    1 
ATOM 1663 C CB   . THR A 1 108 ? 76.378  78.172  54.083 1.00 75.83 ? 190 THR A CB   1 
ATOM 1664 O OG1  . THR A 1 108 ? 75.116  77.546  54.368 1.00 76.49 ? 190 THR A OG1  1 
ATOM 1665 C CG2  . THR A 1 108 ? 76.168  79.684  53.912 1.00 78.71 ? 190 THR A CG2  1 
ATOM 1666 H H    . THR A 1 108 ? 76.376  75.707  53.562 1.00 0.00  ? 190 THR A H    1 
ATOM 1667 H HA   . THR A 1 108 ? 76.522  78.046  51.912 1.00 0.00  ? 190 THR A HA   1 
ATOM 1668 H HB   . THR A 1 108 ? 77.061  77.989  54.933 1.00 0.00  ? 190 THR A HB   1 
ATOM 1669 H HG1  . THR A 1 108 ? 74.740  77.904  55.167 1.00 0.00  ? 190 THR A HG1  1 
ATOM 1670 H HG21 . THR A 1 108 ? 76.086  79.957  52.856 1.00 0.00  ? 190 THR A HG21 1 
ATOM 1671 H HG22 . THR A 1 108 ? 75.229  79.965  54.382 1.00 0.00  ? 190 THR A HG22 1 
ATOM 1672 H HG23 . THR A 1 108 ? 76.995  80.236  54.374 1.00 0.00  ? 190 THR A HG23 1 
ATOM 1673 N N    . THR A 1 109 ? 79.169  77.263  51.756 1.00 78.26 ? 191 THR A N    1 
ATOM 1674 C CA   . THR A 1 109 ? 80.605  77.451  51.589 1.00 79.44 ? 191 THR A CA   1 
ATOM 1675 C C    . THR A 1 109 ? 80.935  77.333  50.114 1.00 75.75 ? 191 THR A C    1 
ATOM 1676 O O    . THR A 1 109 ? 81.705  76.490  49.704 1.00 76.70 ? 191 THR A O    1 
ATOM 1677 C CB   . THR A 1 109 ? 81.439  76.432  52.401 1.00 84.83 ? 191 THR A CB   1 
ATOM 1678 O OG1  . THR A 1 109 ? 80.987  76.409  53.763 1.00 87.40 ? 191 THR A OG1  1 
ATOM 1679 C CG2  . THR A 1 109 ? 82.931  76.835  52.377 1.00 88.97 ? 191 THR A CG2  1 
ATOM 1680 H H    . THR A 1 109 ? 78.690  76.698  51.099 1.00 0.00  ? 191 THR A H    1 
ATOM 1681 H HA   . THR A 1 109 ? 80.865  78.466  51.925 1.00 0.00  ? 191 THR A HA   1 
ATOM 1682 H HB   . THR A 1 109 ? 81.320  75.428  51.958 1.00 0.00  ? 191 THR A HB   1 
ATOM 1683 H HG1  . THR A 1 109 ? 81.491  75.781  54.270 1.00 0.00  ? 191 THR A HG1  1 
ATOM 1684 H HG21 . THR A 1 109 ? 83.037  77.906  52.153 1.00 0.00  ? 191 THR A HG21 1 
ATOM 1685 H HG22 . THR A 1 109 ? 83.391  76.640  53.358 1.00 0.00  ? 191 THR A HG22 1 
ATOM 1686 H HG23 . THR A 1 109 ? 83.465  76.253  51.611 1.00 0.00  ? 191 THR A HG23 1 
ATOM 1687 N N    . GLY A 1 110 ? 80.295  78.230  49.347 1.00 72.91 ? 192 GLY A N    1 
ATOM 1688 C CA   . GLY A 1 110 ? 80.468  78.326  47.917 1.00 66.64 ? 192 GLY A CA   1 
ATOM 1689 C C    . GLY A 1 110 ? 79.182  78.771  47.304 1.00 61.94 ? 192 GLY A C    1 
ATOM 1690 O O    . GLY A 1 110 ? 78.364  79.308  48.021 1.00 63.33 ? 192 GLY A O    1 
ATOM 1691 H H    . GLY A 1 110 ? 79.692  78.903  49.755 1.00 0.00  ? 192 GLY A H    1 
ATOM 1692 H HA2  . GLY A 1 110 ? 81.317  78.926  47.631 1.00 0.00  ? 192 GLY A HA2  1 
ATOM 1693 H HA3  . GLY A 1 110 ? 80.683  77.350  47.440 1.00 0.00  ? 192 GLY A HA3  1 
ATOM 1694 N N    . THR A 1 111 ? 79.018  78.579  45.986 1.00 57.28 ? 193 THR A N    1 
ATOM 1695 C CA   . THR A 1 111 ? 77.795  79.023  45.345 1.00 54.70 ? 193 THR A CA   1 
ATOM 1696 C C    . THR A 1 111 ? 76.778  77.902  45.398 1.00 54.88 ? 193 THR A C    1 
ATOM 1697 O O    . THR A 1 111 ? 76.879  76.940  44.690 1.00 55.68 ? 193 THR A O    1 
ATOM 1698 C CB   . THR A 1 111 ? 78.098  79.446  43.899 1.00 52.66 ? 193 THR A CB   1 
ATOM 1699 O OG1  . THR A 1 111 ? 79.147  80.424  43.902 1.00 52.84 ? 193 THR A OG1  1 
ATOM 1700 C CG2  . THR A 1 111 ? 76.865  80.104  43.306 1.00 51.69 ? 193 THR A CG2  1 
ATOM 1701 H H    . THR A 1 111 ? 79.721  78.124  45.442 1.00 0.00  ? 193 THR A H    1 
ATOM 1702 H HA   . THR A 1 111 ? 77.416  79.914  45.868 1.00 0.00  ? 193 THR A HA   1 
ATOM 1703 H HB   . THR A 1 111 ? 78.406  78.563  43.309 1.00 0.00  ? 193 THR A HB   1 
ATOM 1704 H HG1  . THR A 1 111 ? 79.346  80.696  43.012 1.00 0.00  ? 193 THR A HG1  1 
ATOM 1705 H HG21 . THR A 1 111 ? 76.159  80.435  44.063 1.00 0.00  ? 193 THR A HG21 1 
ATOM 1706 H HG22 . THR A 1 111 ? 77.131  80.905  42.638 1.00 0.00  ? 193 THR A HG22 1 
ATOM 1707 H HG23 . THR A 1 111 ? 76.362  79.375  42.688 1.00 0.00  ? 193 THR A HG23 1 
ATOM 1708 N N    . ASN A 1 112 ? 75.784  78.018  46.276 1.00 51.41 ? 194 ASN A N    1 
ATOM 1709 C CA   . ASN A 1 112 ? 74.753  77.035  46.512 1.00 46.67 ? 194 ASN A CA   1 
ATOM 1710 C C    . ASN A 1 112 ? 73.938  76.699  45.286 1.00 43.38 ? 194 ASN A C    1 
ATOM 1711 O O    . ASN A 1 112 ? 73.085  77.458  44.866 1.00 44.40 ? 194 ASN A O    1 
ATOM 1712 C CB   . ASN A 1 112 ? 73.822  77.485  47.646 1.00 49.31 ? 194 ASN A CB   1 
ATOM 1713 C CG   . ASN A 1 112 ? 72.883  76.407  48.090 1.00 50.31 ? 194 ASN A CG   1 
ATOM 1714 O OD1  . ASN A 1 112 ? 71.731  76.418  47.726 1.00 53.61 ? 194 ASN A OD1  1 
ATOM 1715 N ND2  . ASN A 1 112 ? 73.379  75.454  48.884 1.00 52.19 ? 194 ASN A ND2  1 
ATOM 1716 H H    . ASN A 1 112 ? 75.778  78.799  46.850 1.00 0.00  ? 194 ASN A H    1 
ATOM 1717 H HA   . ASN A 1 112 ? 75.255  76.147  46.882 1.00 0.00  ? 194 ASN A HA   1 
ATOM 1718 H HB2  . ASN A 1 112 ? 74.415  77.810  48.510 1.00 0.00  ? 194 ASN A HB2  1 
ATOM 1719 H HB3  . ASN A 1 112 ? 73.259  78.325  47.252 1.00 0.00  ? 194 ASN A HB3  1 
ATOM 1720 N N    . LEU A 1 113 ? 74.212  75.502  44.732 1.00 39.00 ? 195 LEU A N    1 
ATOM 1721 C CA   . LEU A 1 113 ? 73.515  75.046  43.542 1.00 34.29 ? 195 LEU A CA   1 
ATOM 1722 C C    . LEU A 1 113 ? 72.010  75.138  43.684 1.00 37.92 ? 195 LEU A C    1 
ATOM 1723 O O    . LEU A 1 113 ? 71.324  75.542  42.762 1.00 41.62 ? 195 LEU A O    1 
ATOM 1724 C CB   . LEU A 1 113 ? 73.942  73.596  43.227 1.00 23.23 ? 195 LEU A CB   1 
ATOM 1725 C CG   . LEU A 1 113 ? 73.257  73.029  41.967 1.00 18.81 ? 195 LEU A CG   1 
ATOM 1726 C CD1  . LEU A 1 113 ? 73.465  73.985  40.793 1.00 17.35 ? 195 LEU A CD1  1 
ATOM 1727 C CD2  . LEU A 1 113 ? 73.845  71.662  41.605 1.00 16.87 ? 195 LEU A CD2  1 
ATOM 1728 H H    . LEU A 1 113 ? 74.911  74.905  45.132 1.00 0.00  ? 195 LEU A H    1 
ATOM 1729 H HA   . LEU A 1 113 ? 73.852  75.713  42.743 1.00 0.00  ? 195 LEU A HA   1 
ATOM 1730 H HB2  . LEU A 1 113 ? 75.034  73.572  43.070 1.00 0.00  ? 195 LEU A HB2  1 
ATOM 1731 H HB3  . LEU A 1 113 ? 73.676  72.947  44.073 1.00 0.00  ? 195 LEU A HB3  1 
ATOM 1732 H HG   . LEU A 1 113 ? 72.175  72.912  42.149 1.00 0.00  ? 195 LEU A HG   1 
ATOM 1733 H HD11 . LEU A 1 113 ? 74.545  74.133  40.632 1.00 0.00  ? 195 LEU A HD11 1 
ATOM 1734 H HD12 . LEU A 1 113 ? 72.994  73.568  39.898 1.00 0.00  ? 195 LEU A HD12 1 
ATOM 1735 H HD13 . LEU A 1 113 ? 72.971  74.937  41.001 1.00 0.00  ? 195 LEU A HD13 1 
ATOM 1736 H HD21 . LEU A 1 113 ? 73.685  70.975  42.443 1.00 0.00  ? 195 LEU A HD21 1 
ATOM 1737 H HD22 . LEU A 1 113 ? 73.330  71.291  40.709 1.00 0.00  ? 195 LEU A HD22 1 
ATOM 1738 H HD23 . LEU A 1 113 ? 74.923  71.763  41.409 1.00 0.00  ? 195 LEU A HD23 1 
ATOM 1739 N N    . PHE A 1 114 ? 71.494  74.755  44.861 1.00 36.77 ? 196 PHE A N    1 
ATOM 1740 C CA   . PHE A 1 114 ? 70.053  74.803  45.089 1.00 34.38 ? 196 PHE A CA   1 
ATOM 1741 C C    . PHE A 1 114 ? 69.519  76.204  44.866 1.00 33.66 ? 196 PHE A C    1 
ATOM 1742 O O    . PHE A 1 114 ? 68.648  76.423  44.046 1.00 34.35 ? 196 PHE A O    1 
ATOM 1743 C CB   . PHE A 1 114 ? 69.760  74.306  46.517 1.00 30.74 ? 196 PHE A CB   1 
ATOM 1744 C CG   . PHE A 1 114 ? 68.356  74.627  46.985 1.00 28.13 ? 196 PHE A CG   1 
ATOM 1745 C CD1  . PHE A 1 114 ? 67.272  74.078  46.322 1.00 25.36 ? 196 PHE A CD1  1 
ATOM 1746 C CD2  . PHE A 1 114 ? 68.151  75.469  48.081 1.00 24.51 ? 196 PHE A CD2  1 
ATOM 1747 C CE1  . PHE A 1 114 ? 66.000  74.374  46.807 1.00 22.44 ? 196 PHE A CE1  1 
ATOM 1748 C CE2  . PHE A 1 114 ? 66.862  75.768  48.511 1.00 24.12 ? 196 PHE A CE2  1 
ATOM 1749 C CZ   . PHE A 1 114 ? 65.775  75.237  47.856 1.00 22.76 ? 196 PHE A CZ   1 
ATOM 1750 H H    . PHE A 1 114 ? 72.108  74.436  45.588 1.00 0.00  ? 196 PHE A H    1 
ATOM 1751 H HA   . PHE A 1 114 ? 69.558  74.120  44.387 1.00 0.00  ? 196 PHE A HA   1 
ATOM 1752 H HB2  . PHE A 1 114 ? 69.922  73.225  46.574 1.00 0.00  ? 196 PHE A HB2  1 
ATOM 1753 H HB3  . PHE A 1 114 ? 70.450  74.766  47.217 1.00 0.00  ? 196 PHE A HB3  1 
ATOM 1754 H HD1  . PHE A 1 114 ? 67.417  73.396  45.509 1.00 0.00  ? 196 PHE A HD1  1 
ATOM 1755 H HD2  . PHE A 1 114 ? 68.994  75.903  48.603 1.00 0.00  ? 196 PHE A HD2  1 
ATOM 1756 H HE1  . PHE A 1 114 ? 65.100  73.893  46.458 1.00 0.00  ? 196 PHE A HE1  1 
ATOM 1757 H HE2  . PHE A 1 114 ? 66.701  76.415  49.356 1.00 0.00  ? 196 PHE A HE2  1 
ATOM 1758 H HZ   . PHE A 1 114 ? 64.770  75.436  48.189 1.00 0.00  ? 196 PHE A HZ   1 
ATOM 1759 N N    . LEU A 1 115 ? 70.074  77.162  45.614 1.00 32.88 ? 197 LEU A N    1 
ATOM 1760 C CA   . LEU A 1 115 ? 69.649  78.541  45.486 1.00 35.18 ? 197 LEU A CA   1 
ATOM 1761 C C    . LEU A 1 115 ? 69.580  79.025  44.066 1.00 37.16 ? 197 LEU A C    1 
ATOM 1762 O O    . LEU A 1 115 ? 68.595  79.612  43.651 1.00 37.48 ? 197 LEU A O    1 
ATOM 1763 C CB   . LEU A 1 115 ? 70.529  79.444  46.354 1.00 34.27 ? 197 LEU A CB   1 
ATOM 1764 C CG   . LEU A 1 115 ? 70.285  79.185  47.851 1.00 34.45 ? 197 LEU A CG   1 
ATOM 1765 C CD1  . LEU A 1 115 ? 71.275  79.983  48.703 1.00 38.23 ? 197 LEU A CD1  1 
ATOM 1766 C CD2  . LEU A 1 115 ? 68.855  79.581  48.231 1.00 32.38 ? 197 LEU A CD2  1 
ATOM 1767 H H    . LEU A 1 115 ? 70.808  76.926  46.247 1.00 0.00  ? 197 LEU A H    1 
ATOM 1768 H HA   . LEU A 1 115 ? 68.600  78.576  45.794 1.00 0.00  ? 197 LEU A HA   1 
ATOM 1769 H HB2  . LEU A 1 115 ? 71.575  79.227  46.112 1.00 0.00  ? 197 LEU A HB2  1 
ATOM 1770 H HB3  . LEU A 1 115 ? 70.312  80.497  46.132 1.00 0.00  ? 197 LEU A HB3  1 
ATOM 1771 H HG   . LEU A 1 115 ? 70.406  78.128  48.088 1.00 0.00  ? 197 LEU A HG   1 
ATOM 1772 H HD11 . LEU A 1 115 ? 71.175  81.051  48.482 1.00 0.00  ? 197 LEU A HD11 1 
ATOM 1773 H HD12 . LEU A 1 115 ? 71.090  79.789  49.764 1.00 0.00  ? 197 LEU A HD12 1 
ATOM 1774 H HD13 . LEU A 1 115 ? 72.295  79.686  48.482 1.00 0.00  ? 197 LEU A HD13 1 
ATOM 1775 H HD21 . LEU A 1 115 ? 68.100  78.974  47.721 1.00 0.00  ? 197 LEU A HD21 1 
ATOM 1776 H HD22 . LEU A 1 115 ? 68.675  79.386  49.284 1.00 0.00  ? 197 LEU A HD22 1 
ATOM 1777 H HD23 . LEU A 1 115 ? 68.689  80.638  47.987 1.00 0.00  ? 197 LEU A HD23 1 
ATOM 1778 N N    . VAL A 1 116 ? 70.653  78.764  43.311 1.00 36.07 ? 198 VAL A N    1 
ATOM 1779 C CA   . VAL A 1 116 ? 70.664  79.181  41.916 1.00 31.63 ? 198 VAL A CA   1 
ATOM 1780 C C    . VAL A 1 116 ? 69.661  78.418  41.069 1.00 33.92 ? 198 VAL A C    1 
ATOM 1781 O O    . VAL A 1 116 ? 68.943  79.015  40.287 1.00 36.05 ? 198 VAL A O    1 
ATOM 1782 C CB   . VAL A 1 116 ? 72.100  79.091  41.338 1.00 27.88 ? 198 VAL A CB   1 
ATOM 1783 C CG1  . VAL A 1 116 ? 72.085  79.221  39.807 1.00 24.35 ? 198 VAL A CG1  1 
ATOM 1784 C CG2  . VAL A 1 116 ? 72.955  80.233  41.916 1.00 28.40 ? 198 VAL A CG2  1 
ATOM 1785 H H    . VAL A 1 116 ? 71.437  78.277  43.704 1.00 0.00  ? 198 VAL A H    1 
ATOM 1786 H HA   . VAL A 1 116 ? 70.370  80.238  41.887 1.00 0.00  ? 198 VAL A HA   1 
ATOM 1787 H HB   . VAL A 1 116 ? 72.563  78.127  41.618 1.00 0.00  ? 198 VAL A HB   1 
ATOM 1788 H HG11 . VAL A 1 116 ? 71.111  79.566  39.454 1.00 0.00  ? 198 VAL A HG11 1 
ATOM 1789 H HG12 . VAL A 1 116 ? 72.855  79.912  39.456 1.00 0.00  ? 198 VAL A HG12 1 
ATOM 1790 H HG13 . VAL A 1 116 ? 72.308  78.254  39.377 1.00 0.00  ? 198 VAL A HG13 1 
ATOM 1791 H HG21 . VAL A 1 116 ? 72.485  81.198  41.685 1.00 0.00  ? 198 VAL A HG21 1 
ATOM 1792 H HG22 . VAL A 1 116 ? 73.024  80.121  43.005 1.00 0.00  ? 198 VAL A HG22 1 
ATOM 1793 H HG23 . VAL A 1 116 ? 73.962  80.204  41.473 1.00 0.00  ? 198 VAL A HG23 1 
ATOM 1794 N N    . ALA A 1 117 ? 69.605  77.086  41.199 1.00 28.52 ? 199 ALA A N    1 
ATOM 1795 C CA   . ALA A 1 117 ? 68.654  76.328  40.393 1.00 23.78 ? 199 ALA A CA   1 
ATOM 1796 C C    . ALA A 1 117 ? 67.251  76.822  40.666 1.00 23.34 ? 199 ALA A C    1 
ATOM 1797 O O    . ALA A 1 117 ? 66.498  77.047  39.743 1.00 20.94 ? 199 ALA A O    1 
ATOM 1798 C CB   . ALA A 1 117 ? 68.781  74.827  40.682 1.00 21.93 ? 199 ALA A CB   1 
ATOM 1799 H H    . ALA A 1 117 ? 70.190  76.619  41.861 1.00 0.00  ? 199 ALA A H    1 
ATOM 1800 H HA   . ALA A 1 117 ? 68.883  76.488  39.332 1.00 0.00  ? 199 ALA A HA   1 
ATOM 1801 H HB1  . ALA A 1 117 ? 68.058  74.274  40.063 1.00 0.00  ? 199 ALA A HB1  1 
ATOM 1802 H HB2  . ALA A 1 117 ? 69.805  74.496  40.441 1.00 0.00  ? 199 ALA A HB2  1 
ATOM 1803 H HB3  . ALA A 1 117 ? 68.579  74.642  41.747 1.00 0.00  ? 199 ALA A HB3  1 
ATOM 1804 N N    . ALA A 1 118 ? 66.914  77.042  41.942 1.00 20.68 ? 200 ALA A N    1 
ATOM 1805 C CA   . ALA A 1 118 ? 65.575  77.514  42.288 1.00 20.42 ? 200 ALA A CA   1 
ATOM 1806 C C    . ALA A 1 118 ? 65.231  78.776  41.527 1.00 23.66 ? 200 ALA A C    1 
ATOM 1807 O O    . ALA A 1 118 ? 64.134  78.930  41.023 1.00 27.22 ? 200 ALA A O    1 
ATOM 1808 C CB   . ALA A 1 118 ? 65.529  77.792  43.797 1.00 15.81 ? 200 ALA A CB   1 
ATOM 1809 H H    . ALA A 1 118 ? 67.601  76.919  42.657 1.00 0.00  ? 200 ALA A H    1 
ATOM 1810 H HA   . ALA A 1 118 ? 64.837  76.733  42.063 1.00 0.00  ? 200 ALA A HA   1 
ATOM 1811 H HB1  . ALA A 1 118 ? 66.249  78.582  44.053 1.00 0.00  ? 200 ALA A HB1  1 
ATOM 1812 H HB2  . ALA A 1 118 ? 65.790  76.875  44.348 1.00 0.00  ? 200 ALA A HB2  1 
ATOM 1813 H HB3  . ALA A 1 118 ? 64.518  78.111  44.082 1.00 0.00  ? 200 ALA A HB3  1 
ATOM 1814 N N    . HIS A 1 119 ? 66.222  79.680  41.464 1.00 27.63 ? 201 HIS A N    1 
ATOM 1815 C CA   . HIS A 1 119 ? 66.055  80.935  40.738 1.00 24.97 ? 201 HIS A CA   1 
ATOM 1816 C C    . HIS A 1 119 ? 65.886  80.665  39.263 1.00 23.51 ? 201 HIS A C    1 
ATOM 1817 O O    . HIS A 1 119 ? 64.935  81.134  38.662 1.00 26.14 ? 201 HIS A O    1 
ATOM 1818 C CB   . HIS A 1 119 ? 67.288  81.852  40.953 1.00 25.15 ? 201 HIS A CB   1 
ATOM 1819 C CG   . HIS A 1 119 ? 67.119  83.161  40.229 1.00 25.24 ? 201 HIS A CG   1 
ATOM 1820 N ND1  . HIS A 1 119 ? 66.954  84.325  40.865 1.00 30.72 ? 201 HIS A ND1  1 
ATOM 1821 C CD2  . HIS A 1 119 ? 67.107  83.372  38.900 1.00 27.09 ? 201 HIS A CD2  1 
ATOM 1822 C CE1  . HIS A 1 119 ? 66.839  85.275  39.966 1.00 31.70 ? 201 HIS A CE1  1 
ATOM 1823 N NE2  . HIS A 1 119 ? 66.914  84.793  38.819 1.00 29.68 ? 201 HIS A NE2  1 
ATOM 1824 H H    . HIS A 1 119 ? 67.098  79.490  41.908 1.00 0.00  ? 201 HIS A H    1 
ATOM 1825 H HA   . HIS A 1 119 ? 65.168  81.460  41.116 1.00 0.00  ? 201 HIS A HA   1 
ATOM 1826 H HB2  . HIS A 1 119 ? 67.409  82.015  42.037 1.00 0.00  ? 201 HIS A HB2  1 
ATOM 1827 H HB3  . HIS A 1 119 ? 68.190  81.324  40.601 1.00 0.00  ? 201 HIS A HB3  1 
ATOM 1828 H HD2  . HIS A 1 119 ? 67.213  82.688  38.083 1.00 0.00  ? 201 HIS A HD2  1 
ATOM 1829 H HE1  . HIS A 1 119 ? 66.706  86.311  40.186 1.00 0.00  ? 201 HIS A HE1  1 
ATOM 1830 N N    . GLU A 1 120 ? 66.822  79.915  38.665 1.00 21.26 ? 202 GLU A N    1 
ATOM 1831 C CA   . GLU A 1 120 ? 66.736  79.662  37.232 1.00 24.44 ? 202 GLU A CA   1 
ATOM 1832 C C    . GLU A 1 120 ? 65.458  78.961  36.816 1.00 25.22 ? 202 GLU A C    1 
ATOM 1833 O O    . GLU A 1 120 ? 64.890  79.283  35.791 1.00 29.08 ? 202 GLU A O    1 
ATOM 1834 C CB   . GLU A 1 120 ? 67.961  78.853  36.763 1.00 21.15 ? 202 GLU A CB   1 
ATOM 1835 C CG   . GLU A 1 120 ? 69.187  79.781  36.691 1.00 23.21 ? 202 GLU A CG   1 
ATOM 1836 C CD   . GLU A 1 120 ? 70.370  78.981  36.217 1.00 21.10 ? 202 GLU A CD   1 
ATOM 1837 O OE1  . GLU A 1 120 ? 70.586  78.901  34.990 1.00 20.99 ? 202 GLU A OE1  1 
ATOM 1838 O OE2  . GLU A 1 120 ? 71.077  78.438  37.086 1.00 20.44 ? 202 GLU A OE2  1 
ATOM 1839 H H    . GLU A 1 120 ? 67.578  79.533  39.203 1.00 0.00  ? 202 GLU A H    1 
ATOM 1840 H HA   . GLU A 1 120 ? 66.759  80.631  36.727 1.00 0.00  ? 202 GLU A HA   1 
ATOM 1841 H HB2  . GLU A 1 120 ? 68.162  78.031  37.460 1.00 0.00  ? 202 GLU A HB2  1 
ATOM 1842 H HB3  . GLU A 1 120 ? 67.771  78.429  35.775 1.00 0.00  ? 202 GLU A HB3  1 
ATOM 1843 H HG2  . GLU A 1 120 ? 68.995  80.599  35.989 1.00 0.00  ? 202 GLU A HG2  1 
ATOM 1844 H HG3  . GLU A 1 120 ? 69.391  80.193  37.683 1.00 0.00  ? 202 GLU A HG3  1 
ATOM 1845 N N    . ILE A 1 121 ? 64.993  77.993  37.615 1.00 28.12 ? 203 ILE A N    1 
ATOM 1846 C CA   . ILE A 1 121 ? 63.771  77.265  37.287 1.00 27.69 ? 203 ILE A CA   1 
ATOM 1847 C C    . ILE A 1 121 ? 62.617  78.249  37.204 1.00 25.19 ? 203 ILE A C    1 
ATOM 1848 O O    . ILE A 1 121 ? 61.738  78.142  36.370 1.00 19.68 ? 203 ILE A O    1 
ATOM 1849 C CB   . ILE A 1 121 ? 63.486  76.160  38.338 1.00 30.81 ? 203 ILE A CB   1 
ATOM 1850 C CG1  . ILE A 1 121 ? 64.633  75.112  38.472 1.00 33.17 ? 203 ILE A CG1  1 
ATOM 1851 C CG2  . ILE A 1 121 ? 62.195  75.392  37.962 1.00 35.00 ? 203 ILE A CG2  1 
ATOM 1852 C CD1  . ILE A 1 121 ? 65.485  74.968  37.193 1.00 34.15 ? 203 ILE A CD1  1 
ATOM 1853 H H    . ILE A 1 121 ? 65.483  77.776  38.454 1.00 0.00  ? 203 ILE A H    1 
ATOM 1854 H HA   . ILE A 1 121 ? 63.928  76.776  36.320 1.00 0.00  ? 203 ILE A HA   1 
ATOM 1855 H HB   . ILE A 1 121 ? 63.331  76.648  39.310 1.00 0.00  ? 203 ILE A HB   1 
ATOM 1856 H HG12 . ILE A 1 121 ? 65.280  75.344  39.301 1.00 0.00  ? 203 ILE A HG12 1 
ATOM 1857 H HG13 . ILE A 1 121 ? 64.240  74.129  38.725 1.00 0.00  ? 203 ILE A HG13 1 
ATOM 1858 H HG21 . ILE A 1 121 ? 61.489  76.024  37.437 1.00 0.00  ? 203 ILE A HG21 1 
ATOM 1859 H HG22 . ILE A 1 121 ? 61.696  75.033  38.864 1.00 0.00  ? 203 ILE A HG22 1 
ATOM 1860 H HG23 . ILE A 1 121 ? 62.428  74.538  37.316 1.00 0.00  ? 203 ILE A HG23 1 
ATOM 1861 H HD11 . ILE A 1 121 ? 64.839  74.668  36.358 1.00 0.00  ? 203 ILE A HD11 1 
ATOM 1862 H HD12 . ILE A 1 121 ? 66.256  74.202  37.339 1.00 0.00  ? 203 ILE A HD12 1 
ATOM 1863 H HD13 . ILE A 1 121 ? 65.988  75.912  36.953 1.00 0.00  ? 203 ILE A HD13 1 
ATOM 1864 N N    . GLY A 1 122 ? 62.605  79.266  38.070 1.00 26.18 ? 204 GLY A N    1 
ATOM 1865 C CA   . GLY A 1 122 ? 61.560  80.280  38.018 1.00 18.82 ? 204 GLY A CA   1 
ATOM 1866 C C    . GLY A 1 122 ? 61.444  80.848  36.615 1.00 21.71 ? 204 GLY A C    1 
ATOM 1867 O O    . GLY A 1 122 ? 60.359  81.135  36.154 1.00 24.06 ? 204 GLY A O    1 
ATOM 1868 H H    . GLY A 1 122 ? 63.339  79.340  38.734 1.00 0.00  ? 204 GLY A H    1 
ATOM 1869 H HA2  . GLY A 1 122 ? 60.603  79.828  38.317 1.00 0.00  ? 204 GLY A HA2  1 
ATOM 1870 H HA3  . GLY A 1 122 ? 61.813  81.081  38.729 1.00 0.00  ? 204 GLY A HA3  1 
ATOM 1871 N N    . HIS A 1 123 ? 62.583  80.984  35.911 1.00 23.04 ? 205 HIS A N    1 
ATOM 1872 C CA   . HIS A 1 123 ? 62.590  81.503  34.537 1.00 22.30 ? 205 HIS A CA   1 
ATOM 1873 C C    . HIS A 1 123 ? 62.035  80.492  33.558 1.00 26.43 ? 205 HIS A C    1 
ATOM 1874 O O    . HIS A 1 123 ? 61.307  80.849  32.655 1.00 31.29 ? 205 HIS A O    1 
ATOM 1875 C CB   . HIS A 1 123 ? 64.025  81.850  34.071 1.00 23.21 ? 205 HIS A CB   1 
ATOM 1876 C CG   . HIS A 1 123 ? 64.572  83.114  34.682 1.00 22.99 ? 205 HIS A CG   1 
ATOM 1877 N ND1  . HIS A 1 123 ? 63.918  84.277  34.712 1.00 26.09 ? 205 HIS A ND1  1 
ATOM 1878 C CD2  . HIS A 1 123 ? 65.766  83.260  35.282 1.00 24.90 ? 205 HIS A CD2  1 
ATOM 1879 C CE1  . HIS A 1 123 ? 64.661  85.155  35.344 1.00 25.07 ? 205 HIS A CE1  1 
ATOM 1880 N NE2  . HIS A 1 123 ? 65.732  84.630  35.693 1.00 25.94 ? 205 HIS A NE2  1 
ATOM 1881 H H    . HIS A 1 123 ? 63.442  80.690  36.319 1.00 0.00  ? 205 HIS A H    1 
ATOM 1882 H HA   . HIS A 1 123 ? 61.984  82.418  34.494 1.00 0.00  ? 205 HIS A HA   1 
ATOM 1883 H HB2  . HIS A 1 123 ? 64.685  81.008  34.326 1.00 0.00  ? 205 HIS A HB2  1 
ATOM 1884 H HB3  . HIS A 1 123 ? 64.022  81.940  32.970 1.00 0.00  ? 205 HIS A HB3  1 
ATOM 1885 H HD2  . HIS A 1 123 ? 66.560  82.553  35.431 1.00 0.00  ? 205 HIS A HD2  1 
ATOM 1886 H HE1  . HIS A 1 123 ? 64.383  86.181  35.534 1.00 0.00  ? 205 HIS A HE1  1 
ATOM 1887 N N    . SER A 1 124 ? 62.405  79.218  33.755 1.00 25.91 ? 206 SER A N    1 
ATOM 1888 C CA   . SER A 1 124 ? 61.889  78.146  32.924 1.00 23.49 ? 206 SER A CA   1 
ATOM 1889 C C    . SER A 1 124 ? 60.386  78.053  32.969 1.00 25.92 ? 206 SER A C    1 
ATOM 1890 O O    . SER A 1 124 ? 59.765  77.600  32.025 1.00 29.49 ? 206 SER A O    1 
ATOM 1891 C CB   . SER A 1 124 ? 62.485  76.823  33.413 1.00 21.55 ? 206 SER A CB   1 
ATOM 1892 O OG   . SER A 1 124 ? 61.858  76.424  34.619 1.00 26.85 ? 206 SER A OG   1 
ATOM 1893 H H    . SER A 1 124 ? 63.022  79.005  34.510 1.00 0.00  ? 206 SER A H    1 
ATOM 1894 H HA   . SER A 1 124 ? 62.214  78.341  31.915 1.00 0.00  ? 206 SER A HA   1 
ATOM 1895 H HB2  . SER A 1 124 ? 62.270  76.037  32.694 1.00 0.00  ? 206 SER A HB2  1 
ATOM 1896 H HB3  . SER A 1 124 ? 63.576  76.919  33.545 1.00 0.00  ? 206 SER A HB3  1 
ATOM 1897 H HG   . SER A 1 124 ? 62.125  77.060  35.269 1.00 0.00  ? 206 SER A HG   1 
ATOM 1898 N N    . LEU A 1 125 ? 59.826  78.476  34.113 1.00 27.39 ? 207 LEU A N    1 
ATOM 1899 C CA   . LEU A 1 125 ? 58.380  78.475  34.317 1.00 21.78 ? 207 LEU A CA   1 
ATOM 1900 C C    . LEU A 1 125 ? 57.692  79.737  33.866 1.00 21.50 ? 207 LEU A C    1 
ATOM 1901 O O    . LEU A 1 125 ? 56.478  79.768  33.788 1.00 18.38 ? 207 LEU A O    1 
ATOM 1902 C CB   . LEU A 1 125 ? 58.051  78.306  35.807 1.00 12.00 ? 207 LEU A CB   1 
ATOM 1903 C CG   . LEU A 1 125 ? 58.622  77.030  36.453 1.00 7.65  ? 207 LEU A CG   1 
ATOM 1904 C CD1  . LEU A 1 125 ? 58.150  76.960  37.908 1.00 6.51  ? 207 LEU A CD1  1 
ATOM 1905 C CD2  . LEU A 1 125 ? 58.145  75.786  35.697 1.00 7.42  ? 207 LEU A CD2  1 
ATOM 1906 H H    . LEU A 1 125 ? 60.401  78.826  34.851 1.00 0.00  ? 207 LEU A H    1 
ATOM 1907 H HA   . LEU A 1 125 ? 57.930  77.660  33.750 1.00 0.00  ? 207 LEU A HA   1 
ATOM 1908 H HB2  . LEU A 1 125 ? 58.459  79.167  36.359 1.00 0.00  ? 207 LEU A HB2  1 
ATOM 1909 H HB3  . LEU A 1 125 ? 56.958  78.273  35.922 1.00 0.00  ? 207 LEU A HB3  1 
ATOM 1910 H HG   . LEU A 1 125 ? 59.716  77.057  36.441 1.00 0.00  ? 207 LEU A HG   1 
ATOM 1911 H HD11 . LEU A 1 125 ? 57.048  76.943  37.929 1.00 0.00  ? 207 LEU A HD11 1 
ATOM 1912 H HD12 . LEU A 1 125 ? 58.544  76.046  38.376 1.00 0.00  ? 207 LEU A HD12 1 
ATOM 1913 H HD13 . LEU A 1 125 ? 58.518  77.845  38.449 1.00 0.00  ? 207 LEU A HD13 1 
ATOM 1914 H HD21 . LEU A 1 125 ? 58.510  75.821  34.672 1.00 0.00  ? 207 LEU A HD21 1 
ATOM 1915 H HD22 . LEU A 1 125 ? 58.566  74.892  36.160 1.00 0.00  ? 207 LEU A HD22 1 
ATOM 1916 H HD23 . LEU A 1 125 ? 57.047  75.747  35.714 1.00 0.00  ? 207 LEU A HD23 1 
ATOM 1917 N N    . GLY A 1 126 ? 58.458  80.799  33.579 1.00 20.59 ? 208 GLY A N    1 
ATOM 1918 C CA   . GLY A 1 126 ? 57.849  82.029  33.085 1.00 23.73 ? 208 GLY A CA   1 
ATOM 1919 C C    . GLY A 1 126 ? 57.988  83.258  33.956 1.00 25.41 ? 208 GLY A C    1 
ATOM 1920 O O    . GLY A 1 126 ? 57.352  84.264  33.693 1.00 26.75 ? 208 GLY A O    1 
ATOM 1921 H H    . GLY A 1 126 ? 59.449  80.745  33.685 1.00 0.00  ? 208 GLY A H    1 
ATOM 1922 H HA2  . GLY A 1 126 ? 58.306  82.260  32.116 1.00 0.00  ? 208 GLY A HA2  1 
ATOM 1923 H HA3  . GLY A 1 126 ? 56.776  81.868  32.945 1.00 0.00  ? 208 GLY A HA3  1 
ATOM 1924 N N    . LEU A 1 127 ? 58.831  83.187  34.994 1.00 26.53 ? 209 LEU A N    1 
ATOM 1925 C CA   . LEU A 1 127 ? 59.052  84.335  35.857 1.00 26.30 ? 209 LEU A CA   1 
ATOM 1926 C C    . LEU A 1 127 ? 60.159  85.253  35.354 1.00 29.68 ? 209 LEU A C    1 
ATOM 1927 O O    . LEU A 1 127 ? 60.997  84.854  34.570 1.00 29.88 ? 209 LEU A O    1 
ATOM 1928 C CB   . LEU A 1 127 ? 59.306  83.837  37.280 1.00 23.87 ? 209 LEU A CB   1 
ATOM 1929 C CG   . LEU A 1 127 ? 58.234  84.053  38.348 1.00 25.29 ? 209 LEU A CG   1 
ATOM 1930 C CD1  . LEU A 1 127 ? 56.868  83.585  37.855 1.00 27.81 ? 209 LEU A CD1  1 
ATOM 1931 C CD2  . LEU A 1 127 ? 58.591  83.266  39.612 1.00 20.73 ? 209 LEU A CD2  1 
ATOM 1932 H H    . LEU A 1 127 ? 59.322  82.341  35.174 1.00 0.00  ? 209 LEU A H    1 
ATOM 1933 H HA   . LEU A 1 127 ? 58.148  84.945  35.874 1.00 0.00  ? 209 LEU A HA   1 
ATOM 1934 H HB2  . LEU A 1 127 ? 59.534  82.781  37.290 1.00 0.00  ? 209 LEU A HB2  1 
ATOM 1935 H HB3  . LEU A 1 127 ? 60.147  84.394  37.670 1.00 0.00  ? 209 LEU A HB3  1 
ATOM 1936 H HG   . LEU A 1 127 ? 58.173  85.125  38.597 1.00 0.00  ? 209 LEU A HG   1 
ATOM 1937 H HD11 . LEU A 1 127 ? 56.920  82.529  37.573 1.00 0.00  ? 209 LEU A HD11 1 
ATOM 1938 H HD12 . LEU A 1 127 ? 56.132  83.742  38.648 1.00 0.00  ? 209 LEU A HD12 1 
ATOM 1939 H HD13 . LEU A 1 127 ? 56.553  84.171  36.993 1.00 0.00  ? 209 LEU A HD13 1 
ATOM 1940 H HD21 . LEU A 1 127 ? 59.543  83.605  39.995 1.00 0.00  ? 209 LEU A HD21 1 
ATOM 1941 H HD22 . LEU A 1 127 ? 57.833  83.430  40.382 1.00 0.00  ? 209 LEU A HD22 1 
ATOM 1942 H HD23 . LEU A 1 127 ? 58.700  82.201  39.386 1.00 0.00  ? 209 LEU A HD23 1 
ATOM 1943 N N    . PHE A 1 128 ? 60.135  86.509  35.838 1.00 33.81 ? 210 PHE A N    1 
ATOM 1944 C CA   . PHE A 1 128 ? 61.139  87.502  35.453 1.00 32.63 ? 210 PHE A CA   1 
ATOM 1945 C C    . PHE A 1 128 ? 61.915  87.918  36.683 1.00 31.17 ? 210 PHE A C    1 
ATOM 1946 O O    . PHE A 1 128 ? 61.641  87.452  37.773 1.00 36.67 ? 210 PHE A O    1 
ATOM 1947 C CB   . PHE A 1 128 ? 60.448  88.764  34.890 1.00 30.80 ? 210 PHE A CB   1 
ATOM 1948 C CG   . PHE A 1 128 ? 59.904  88.556  33.485 1.00 28.28 ? 210 PHE A CG   1 
ATOM 1949 C CD1  . PHE A 1 128 ? 60.720  88.771  32.374 1.00 31.87 ? 210 PHE A CD1  1 
ATOM 1950 C CD2  . PHE A 1 128 ? 58.581  88.152  33.303 1.00 31.89 ? 210 PHE A CD2  1 
ATOM 1951 C CE1  . PHE A 1 128 ? 60.234  88.569  31.088 1.00 33.06 ? 210 PHE A CE1  1 
ATOM 1952 C CE2  . PHE A 1 128 ? 58.093  87.948  32.012 1.00 34.09 ? 210 PHE A CE2  1 
ATOM 1953 C CZ   . PHE A 1 128 ? 58.910  88.150  30.908 1.00 34.84 ? 210 PHE A CZ   1 
ATOM 1954 H H    . PHE A 1 128 ? 59.422  86.789  36.478 1.00 0.00  ? 210 PHE A H    1 
ATOM 1955 H HA   . PHE A 1 128 ? 61.833  87.104  34.698 1.00 0.00  ? 210 PHE A HA   1 
ATOM 1956 H HB2  . PHE A 1 128 ? 59.616  89.050  35.547 1.00 0.00  ? 210 PHE A HB2  1 
ATOM 1957 H HB3  . PHE A 1 128 ? 61.152  89.605  34.832 1.00 0.00  ? 210 PHE A HB3  1 
ATOM 1958 H HD1  . PHE A 1 128 ? 61.746  89.099  32.517 1.00 0.00  ? 210 PHE A HD1  1 
ATOM 1959 H HD2  . PHE A 1 128 ? 57.939  87.998  34.164 1.00 0.00  ? 210 PHE A HD2  1 
ATOM 1960 H HE1  . PHE A 1 128 ? 60.875  88.729  30.229 1.00 0.00  ? 210 PHE A HE1  1 
ATOM 1961 H HE2  . PHE A 1 128 ? 57.066  87.626  31.879 1.00 0.00  ? 210 PHE A HE2  1 
ATOM 1962 H HZ   . PHE A 1 128 ? 58.532  87.987  29.903 1.00 0.00  ? 210 PHE A HZ   1 
ATOM 1963 N N    . HIS A 1 129 ? 62.898  88.817  36.507 1.00 26.84 ? 211 HIS A N    1 
ATOM 1964 C CA   . HIS A 1 129 ? 63.644  89.289  37.659 1.00 26.94 ? 211 HIS A CA   1 
ATOM 1965 C C    . HIS A 1 129 ? 62.781  90.203  38.510 1.00 27.38 ? 211 HIS A C    1 
ATOM 1966 O O    . HIS A 1 129 ? 61.952  90.935  38.003 1.00 24.85 ? 211 HIS A O    1 
ATOM 1967 C CB   . HIS A 1 129 ? 64.955  89.983  37.222 1.00 26.70 ? 211 HIS A CB   1 
ATOM 1968 C CG   . HIS A 1 129 ? 65.976  88.979  36.753 1.00 25.54 ? 211 HIS A CG   1 
ATOM 1969 N ND1  . HIS A 1 129 ? 65.990  87.711  37.177 1.00 26.58 ? 211 HIS A ND1  1 
ATOM 1970 C CD2  . HIS A 1 129 ? 66.988  89.174  35.889 1.00 28.56 ? 211 HIS A CD2  1 
ATOM 1971 C CE1  . HIS A 1 129 ? 66.987  87.096  36.594 1.00 29.12 ? 211 HIS A CE1  1 
ATOM 1972 N NE2  . HIS A 1 129 ? 67.602  87.876  35.843 1.00 29.26 ? 211 HIS A NE2  1 
ATOM 1973 H H    . HIS A 1 129 ? 63.134  89.168  35.600 1.00 0.00  ? 211 HIS A H    1 
ATOM 1974 H HA   . HIS A 1 129 ? 63.929  88.408  38.252 1.00 0.00  ? 211 HIS A HA   1 
ATOM 1975 H HB2  . HIS A 1 129 ? 64.712  90.704  36.421 1.00 0.00  ? 211 HIS A HB2  1 
ATOM 1976 H HB3  . HIS A 1 129 ? 65.341  90.562  38.074 1.00 0.00  ? 211 HIS A HB3  1 
ATOM 1977 H HD2  . HIS A 1 129 ? 67.293  90.051  35.358 1.00 0.00  ? 211 HIS A HD2  1 
ATOM 1978 H HE1  . HIS A 1 129 ? 67.222  86.071  36.758 1.00 0.00  ? 211 HIS A HE1  1 
ATOM 1979 N N    . SER A 1 130 ? 63.014  90.120  39.832 1.00 27.68 ? 212 SER A N    1 
ATOM 1980 C CA   . SER A 1 130 ? 62.296  90.949  40.783 1.00 30.09 ? 212 SER A CA   1 
ATOM 1981 C C    . SER A 1 130 ? 63.197  92.063  41.267 1.00 34.41 ? 212 SER A C    1 
ATOM 1982 O O    . SER A 1 130 ? 64.409  91.965  41.223 1.00 35.16 ? 212 SER A O    1 
ATOM 1983 C CB   . SER A 1 130 ? 61.835  90.096  41.982 1.00 30.32 ? 212 SER A CB   1 
ATOM 1984 O OG   . SER A 1 130 ? 61.312  90.925  43.021 1.00 26.96 ? 212 SER A OG   1 
ATOM 1985 H H    . SER A 1 130 ? 63.694  89.483  40.189 1.00 0.00  ? 212 SER A H    1 
ATOM 1986 H HA   . SER A 1 130 ? 61.401  91.381  40.307 1.00 0.00  ? 212 SER A HA   1 
ATOM 1987 H HB2  . SER A 1 130 ? 61.052  89.394  41.645 1.00 0.00  ? 212 SER A HB2  1 
ATOM 1988 H HB3  . SER A 1 130 ? 62.697  89.527  42.371 1.00 0.00  ? 212 SER A HB3  1 
ATOM 1989 H HG   . SER A 1 130 ? 61.006  90.372  43.728 1.00 0.00  ? 212 SER A HG   1 
ATOM 1990 N N    . ALA A 1 131 ? 62.553  93.150  41.721 1.00 37.52 ? 213 ALA A N    1 
ATOM 1991 C CA   . ALA A 1 131 ? 63.295  94.268  42.295 1.00 41.71 ? 213 ALA A CA   1 
ATOM 1992 C C    . ALA A 1 131 ? 63.354  94.078  43.799 1.00 45.11 ? 213 ALA A C    1 
ATOM 1993 O O    . ALA A 1 131 ? 64.249  94.581  44.453 1.00 47.39 ? 213 ALA A O    1 
ATOM 1994 C CB   . ALA A 1 131 ? 62.580  95.586  41.933 1.00 40.25 ? 213 ALA A CB   1 
ATOM 1995 H H    . ALA A 1 131 ? 61.550  93.183  41.698 1.00 0.00  ? 213 ALA A H    1 
ATOM 1996 H HA   . ALA A 1 131 ? 64.311  94.299  41.875 1.00 0.00  ? 213 ALA A HA   1 
ATOM 1997 H HB1  . ALA A 1 131 ? 63.147  96.435  42.345 1.00 0.00  ? 213 ALA A HB1  1 
ATOM 1998 H HB2  . ALA A 1 131 ? 62.519  95.688  40.836 1.00 0.00  ? 213 ALA A HB2  1 
ATOM 1999 H HB3  . ALA A 1 131 ? 61.562  95.588  42.353 1.00 0.00  ? 213 ALA A HB3  1 
ATOM 2000 N N    . ASN A 1 132 ? 62.381  93.331  44.347 1.00 45.91 ? 214 ASN A N    1 
ATOM 2001 C CA   . ASN A 1 132 ? 62.355  93.047  45.769 1.00 45.78 ? 214 ASN A CA   1 
ATOM 2002 C C    . ASN A 1 132 ? 63.582  92.216  46.094 1.00 46.73 ? 214 ASN A C    1 
ATOM 2003 O O    . ASN A 1 132 ? 63.691  91.076  45.687 1.00 50.31 ? 214 ASN A O    1 
ATOM 2004 C CB   . ASN A 1 132 ? 61.058  92.305  46.142 1.00 45.34 ? 214 ASN A CB   1 
ATOM 2005 C CG   . ASN A 1 132 ? 60.899  92.110  47.625 1.00 45.91 ? 214 ASN A CG   1 
ATOM 2006 O OD1  . ASN A 1 132 ? 61.832  92.311  48.382 1.00 50.72 ? 214 ASN A OD1  1 
ATOM 2007 N ND2  . ASN A 1 132 ? 59.690  91.719  48.049 1.00 49.18 ? 214 ASN A ND2  1 
ATOM 2008 H H    . ASN A 1 132 ? 61.651  92.933  43.805 1.00 0.00  ? 214 ASN A H    1 
ATOM 2009 H HA   . ASN A 1 132 ? 62.350  94.000  46.321 1.00 0.00  ? 214 ASN A HA   1 
ATOM 2010 H HB2  . ASN A 1 132 ? 60.194  92.865  45.754 1.00 0.00  ? 214 ASN A HB2  1 
ATOM 2011 H HB3  . ASN A 1 132 ? 61.078  91.326  45.671 1.00 0.00  ? 214 ASN A HB3  1 
ATOM 2012 N N    . THR A 1 133 ? 64.512  92.829  46.846 1.00 47.40 ? 215 THR A N    1 
ATOM 2013 C CA   . THR A 1 133 ? 65.759  92.172  47.240 1.00 44.17 ? 215 THR A CA   1 
ATOM 2014 C C    . THR A 1 133 ? 65.574  90.910  48.048 1.00 45.11 ? 215 THR A C    1 
ATOM 2015 O O    . THR A 1 133 ? 66.448  90.062  48.077 1.00 46.40 ? 215 THR A O    1 
ATOM 2016 C CB   . THR A 1 133 ? 66.613  93.146  48.083 1.00 43.99 ? 215 THR A CB   1 
ATOM 2017 O OG1  . THR A 1 133 ? 65.839  93.667  49.178 1.00 39.92 ? 215 THR A OG1  1 
ATOM 2018 C CG2  . THR A 1 133 ? 67.093  94.314  47.200 1.00 43.58 ? 215 THR A CG2  1 
ATOM 2019 H H    . THR A 1 133 ? 64.358  93.772  47.145 1.00 0.00  ? 215 THR A H    1 
ATOM 2020 H HA   . THR A 1 133 ? 66.315  91.924  46.333 1.00 0.00  ? 215 THR A HA   1 
ATOM 2021 H HB   . THR A 1 133 ? 67.492  92.609  48.480 1.00 0.00  ? 215 THR A HB   1 
ATOM 2022 H HG1  . THR A 1 133 ? 66.363  94.264  49.702 1.00 0.00  ? 215 THR A HG1  1 
ATOM 2023 H HG21 . THR A 1 133 ? 66.439  94.421  46.323 1.00 0.00  ? 215 THR A HG21 1 
ATOM 2024 H HG22 . THR A 1 133 ? 67.073  95.253  47.773 1.00 0.00  ? 215 THR A HG22 1 
ATOM 2025 H HG23 . THR A 1 133 ? 68.121  94.118  46.865 1.00 0.00  ? 215 THR A HG23 1 
ATOM 2026 N N    . GLU A 1 134 ? 64.419  90.819  48.723 1.00 45.68 ? 216 GLU A N    1 
ATOM 2027 C CA   . GLU A 1 134 ? 64.079  89.638  49.515 1.00 46.38 ? 216 GLU A CA   1 
ATOM 2028 C C    . GLU A 1 134 ? 63.504  88.510  48.672 1.00 46.04 ? 216 GLU A C    1 
ATOM 2029 O O    . GLU A 1 134 ? 63.398  87.384  49.128 1.00 50.99 ? 216 GLU A O    1 
ATOM 2030 C CB   . GLU A 1 134 ? 63.067  90.069  50.600 1.00 49.97 ? 216 GLU A CB   1 
ATOM 2031 C CG   . GLU A 1 134 ? 63.712  90.439  51.957 1.00 59.20 ? 216 GLU A CG   1 
ATOM 2032 C CD   . GLU A 1 134 ? 65.070  91.104  51.847 1.00 65.03 ? 216 GLU A CD   1 
ATOM 2033 O OE1  . GLU A 1 134 ? 65.122  92.310  51.497 1.00 67.68 ? 216 GLU A OE1  1 
ATOM 2034 O OE2  . GLU A 1 134 ? 66.096  90.424  52.117 1.00 66.13 ? 216 GLU A OE2  1 
ATOM 2035 H H    . GLU A 1 134 ? 63.762  91.569  48.644 1.00 0.00  ? 216 GLU A H    1 
ATOM 2036 H HA   . GLU A 1 134 ? 64.986  89.263  50.003 1.00 0.00  ? 216 GLU A HA   1 
ATOM 2037 H HB2  . GLU A 1 134 ? 62.495  90.941  50.252 1.00 0.00  ? 216 GLU A HB2  1 
ATOM 2038 H HB3  . GLU A 1 134 ? 62.353  89.246  50.763 1.00 0.00  ? 216 GLU A HB3  1 
ATOM 2039 H HG2  . GLU A 1 134 ? 63.023  91.116  52.487 1.00 0.00  ? 216 GLU A HG2  1 
ATOM 2040 H HG3  . GLU A 1 134 ? 63.815  89.512  52.543 1.00 0.00  ? 216 GLU A HG3  1 
ATOM 2041 N N    . ALA A 1 135 ? 63.126  88.833  47.427 1.00 42.19 ? 217 ALA A N    1 
ATOM 2042 C CA   . ALA A 1 135 ? 62.561  87.851  46.526 1.00 38.16 ? 217 ALA A CA   1 
ATOM 2043 C C    . ALA A 1 135 ? 63.603  86.964  45.896 1.00 38.13 ? 217 ALA A C    1 
ATOM 2044 O O    . ALA A 1 135 ? 64.611  87.464  45.438 1.00 39.42 ? 217 ALA A O    1 
ATOM 2045 C CB   . ALA A 1 135 ? 61.735  88.544  45.439 1.00 38.78 ? 217 ALA A CB   1 
ATOM 2046 H H    . ALA A 1 135 ? 63.248  89.755  47.080 1.00 0.00  ? 217 ALA A H    1 
ATOM 2047 H HA   . ALA A 1 135 ? 61.890  87.221  47.086 1.00 0.00  ? 217 ALA A HA   1 
ATOM 2048 H HB1  . ALA A 1 135 ? 61.292  87.809  44.757 1.00 0.00  ? 217 ALA A HB1  1 
ATOM 2049 H HB2  . ALA A 1 135 ? 60.930  89.133  45.903 1.00 0.00  ? 217 ALA A HB2  1 
ATOM 2050 H HB3  . ALA A 1 135 ? 62.416  89.197  44.877 1.00 0.00  ? 217 ALA A HB3  1 
ATOM 2051 N N    . LEU A 1 136 ? 63.348  85.642  45.860 1.00 35.84 ? 218 LEU A N    1 
ATOM 2052 C CA   . LEU A 1 136 ? 64.286  84.699  45.240 1.00 33.13 ? 218 LEU A CA   1 
ATOM 2053 C C    . LEU A 1 136 ? 64.623  85.138  43.833 1.00 33.82 ? 218 LEU A C    1 
ATOM 2054 O O    . LEU A 1 136 ? 65.765  85.074  43.410 1.00 34.87 ? 218 LEU A O    1 
ATOM 2055 C CB   . LEU A 1 136 ? 63.628  83.308  45.139 1.00 28.45 ? 218 LEU A CB   1 
ATOM 2056 C CG   . LEU A 1 136 ? 64.417  82.275  44.297 1.00 28.55 ? 218 LEU A CG   1 
ATOM 2057 C CD1  . LEU A 1 136 ? 65.676  81.793  45.044 1.00 23.06 ? 218 LEU A CD1  1 
ATOM 2058 C CD2  . LEU A 1 136 ? 63.498  81.088  43.965 1.00 26.85 ? 218 LEU A CD2  1 
ATOM 2059 H H    . LEU A 1 136 ? 62.494  85.288  46.250 1.00 0.00  ? 218 LEU A H    1 
ATOM 2060 H HA   . LEU A 1 136 ? 65.195  84.641  45.851 1.00 0.00  ? 218 LEU A HA   1 
ATOM 2061 H HB2  . LEU A 1 136 ? 63.509  82.904  46.157 1.00 0.00  ? 218 LEU A HB2  1 
ATOM 2062 H HB3  . LEU A 1 136 ? 62.634  83.430  44.679 1.00 0.00  ? 218 LEU A HB3  1 
ATOM 2063 H HG   . LEU A 1 136 ? 64.733  82.729  43.346 1.00 0.00  ? 218 LEU A HG   1 
ATOM 2064 H HD11 . LEU A 1 136 ? 65.395  81.352  45.998 1.00 0.00  ? 218 LEU A HD11 1 
ATOM 2065 H HD12 . LEU A 1 136 ? 66.203  81.040  44.447 1.00 0.00  ? 218 LEU A HD12 1 
ATOM 2066 H HD13 . LEU A 1 136 ? 66.339  82.641  45.240 1.00 0.00  ? 218 LEU A HD13 1 
ATOM 2067 H HD21 . LEU A 1 136 ? 62.636  81.461  43.404 1.00 0.00  ? 218 LEU A HD21 1 
ATOM 2068 H HD22 . LEU A 1 136 ? 64.042  80.357  43.355 1.00 0.00  ? 218 LEU A HD22 1 
ATOM 2069 H HD23 . LEU A 1 136 ? 63.142  80.614  44.890 1.00 0.00  ? 218 LEU A HD23 1 
ATOM 2070 N N    . MET A 1 137 ? 63.597  85.608  43.104 1.00 35.41 ? 219 MET A N    1 
ATOM 2071 C CA   . MET A 1 137 ? 63.799  86.043  41.726 1.00 37.58 ? 219 MET A CA   1 
ATOM 2072 C C    . MET A 1 137 ? 64.674  87.287  41.555 1.00 40.09 ? 219 MET A C    1 
ATOM 2073 O O    . MET A 1 137 ? 64.842  87.774  40.451 1.00 40.82 ? 219 MET A O    1 
ATOM 2074 C CB   . MET A 1 137 ? 62.433  86.184  41.026 1.00 33.29 ? 219 MET A CB   1 
ATOM 2075 C CG   . MET A 1 137 ? 61.733  84.828  40.750 1.00 26.59 ? 219 MET A CG   1 
ATOM 2076 S SD   . MET A 1 137 ? 62.777  83.490  40.005 1.00 27.95 ? 219 MET A SD   1 
ATOM 2077 C CE   . MET A 1 137 ? 63.043  83.995  38.269 1.00 21.96 ? 219 MET A CE   1 
ATOM 2078 H H    . MET A 1 137 ? 62.680  85.660  43.509 1.00 0.00  ? 219 MET A H    1 
ATOM 2079 H HA   . MET A 1 137 ? 64.330  85.226  41.225 1.00 0.00  ? 219 MET A HA   1 
ATOM 2080 H HB2  . MET A 1 137 ? 61.780  86.819  41.659 1.00 0.00  ? 219 MET A HB2  1 
ATOM 2081 H HB3  . MET A 1 137 ? 62.593  86.697  40.067 1.00 0.00  ? 219 MET A HB3  1 
ATOM 2082 H HG2  . MET A 1 137 ? 61.282  84.479  41.695 1.00 0.00  ? 219 MET A HG2  1 
ATOM 2083 H HG3  . MET A 1 137 ? 60.933  85.105  40.052 1.00 0.00  ? 219 MET A HG3  1 
ATOM 2084 H HE1  . MET A 1 137 ? 63.475  84.993  38.204 1.00 0.00  ? 219 MET A HE1  1 
ATOM 2085 H HE2  . MET A 1 137 ? 63.634  83.283  37.690 1.00 0.00  ? 219 MET A HE2  1 
ATOM 2086 H HE3  . MET A 1 137 ? 62.098  84.034  37.738 1.00 0.00  ? 219 MET A HE3  1 
ATOM 2087 N N    . TYR A 1 138 ? 65.241  87.799  42.655 1.00 36.39 ? 220 TYR A N    1 
ATOM 2088 C CA   . TYR A 1 138 ? 66.209  88.890  42.604 1.00 31.01 ? 220 TYR A CA   1 
ATOM 2089 C C    . TYR A 1 138 ? 67.462  88.227  42.044 1.00 28.76 ? 220 TYR A C    1 
ATOM 2090 O O    . TYR A 1 138 ? 67.857  87.208  42.580 1.00 32.13 ? 220 TYR A O    1 
ATOM 2091 C CB   . TYR A 1 138 ? 66.453  89.388  44.049 1.00 31.03 ? 220 TYR A CB   1 
ATOM 2092 C CG   . TYR A 1 138 ? 67.268  90.667  44.166 1.00 31.61 ? 220 TYR A CG   1 
ATOM 2093 C CD1  . TYR A 1 138 ? 66.703  91.912  43.851 1.00 34.21 ? 220 TYR A CD1  1 
ATOM 2094 C CD2  . TYR A 1 138 ? 68.587  90.615  44.621 1.00 31.59 ? 220 TYR A CD2  1 
ATOM 2095 C CE1  . TYR A 1 138 ? 67.441  93.078  44.004 1.00 34.75 ? 220 TYR A CE1  1 
ATOM 2096 C CE2  . TYR A 1 138 ? 69.311  91.783  44.781 1.00 33.23 ? 220 TYR A CE2  1 
ATOM 2097 C CZ   . TYR A 1 138 ? 68.761  93.024  44.468 1.00 34.62 ? 220 TYR A CZ   1 
ATOM 2098 O OH   . TYR A 1 138 ? 69.512  94.178  44.633 1.00 28.84 ? 220 TYR A OH   1 
ATOM 2099 H H    . TYR A 1 138 ? 65.043  87.413  43.543 1.00 0.00  ? 220 TYR A H    1 
ATOM 2100 H HA   . TYR A 1 138 ? 65.821  89.727  42.005 1.00 0.00  ? 220 TYR A HA   1 
ATOM 2101 H HB2  . TYR A 1 138 ? 65.481  89.572  44.536 1.00 0.00  ? 220 TYR A HB2  1 
ATOM 2102 H HB3  . TYR A 1 138 ? 66.980  88.588  44.592 1.00 0.00  ? 220 TYR A HB3  1 
ATOM 2103 H HD1  . TYR A 1 138 ? 65.680  91.957  43.503 1.00 0.00  ? 220 TYR A HD1  1 
ATOM 2104 H HD2  . TYR A 1 138 ? 69.034  89.658  44.864 1.00 0.00  ? 220 TYR A HD2  1 
ATOM 2105 H HE1  . TYR A 1 138 ? 67.000  94.039  43.769 1.00 0.00  ? 220 TYR A HE1  1 
ATOM 2106 H HE2  . TYR A 1 138 ? 70.307  91.771  45.169 1.00 0.00  ? 220 TYR A HE2  1 
ATOM 2107 H HH   . TYR A 1 138 ? 69.003  94.944  44.391 1.00 0.00  ? 220 TYR A HH   1 
ATOM 2108 N N    . PRO A 1 139 ? 68.071  88.774  40.978 1.00 26.02 ? 221 PRO A N    1 
ATOM 2109 C CA   . PRO A 1 139 ? 69.222  88.152  40.340 1.00 27.86 ? 221 PRO A CA   1 
ATOM 2110 C C    . PRO A 1 139 ? 70.514  88.114  41.118 1.00 29.67 ? 221 PRO A C    1 
ATOM 2111 O O    . PRO A 1 139 ? 71.282  87.203  40.961 1.00 31.29 ? 221 PRO A O    1 
ATOM 2112 C CB   . PRO A 1 139 ? 69.373  89.015  39.081 1.00 25.44 ? 221 PRO A CB   1 
ATOM 2113 C CG   . PRO A 1 139 ? 68.769  90.373  39.430 1.00 28.90 ? 221 PRO A CG   1 
ATOM 2114 C CD   . PRO A 1 139 ? 67.614  90.020  40.366 1.00 28.02 ? 221 PRO A CD   1 
ATOM 2115 H HA   . PRO A 1 139 ? 68.982  87.136  40.038 1.00 0.00  ? 221 PRO A HA   1 
ATOM 2116 H HB2  . PRO A 1 139 ? 70.421  89.129  38.784 1.00 0.00  ? 221 PRO A HB2  1 
ATOM 2117 H HB3  . PRO A 1 139 ? 68.790  88.594  38.246 1.00 0.00  ? 221 PRO A HB3  1 
ATOM 2118 H HG2  . PRO A 1 139 ? 69.529  90.983  39.947 1.00 0.00  ? 221 PRO A HG2  1 
ATOM 2119 H HG3  . PRO A 1 139 ? 68.418  90.892  38.524 1.00 0.00  ? 221 PRO A HG3  1 
ATOM 2120 H HD2  . PRO A 1 139 ? 67.509  90.839  41.084 1.00 0.00  ? 221 PRO A HD2  1 
ATOM 2121 H HD3  . PRO A 1 139 ? 66.700  89.871  39.783 1.00 0.00  ? 221 PRO A HD3  1 
ATOM 2122 N N    . LEU A 1 140 ? 70.770  89.086  41.975 1.00 34.47 ? 222 LEU A N    1 
ATOM 2123 C CA   . LEU A 1 140 ? 71.977  89.145  42.766 1.00 34.61 ? 222 LEU A CA   1 
ATOM 2124 C C    . LEU A 1 140 ? 72.008  88.099  43.861 1.00 34.17 ? 222 LEU A C    1 
ATOM 2125 O O    . LEU A 1 140 ? 71.250  88.181  44.804 1.00 33.68 ? 222 LEU A O    1 
ATOM 2126 C CB   . LEU A 1 140 ? 72.222  90.552  43.308 1.00 34.32 ? 222 LEU A CB   1 
ATOM 2127 C CG   . LEU A 1 140 ? 71.743  91.633  42.322 1.00 32.83 ? 222 LEU A CG   1 
ATOM 2128 C CD1  . LEU A 1 140 ? 72.065  93.030  42.851 1.00 29.66 ? 222 LEU A CD1  1 
ATOM 2129 C CD2  . LEU A 1 140 ? 72.423  91.409  40.962 1.00 34.53 ? 222 LEU A CD2  1 
ATOM 2130 H H    . LEU A 1 140 ? 70.036  89.732  42.078 1.00 0.00  ? 222 LEU A H    1 
ATOM 2131 H HA   . LEU A 1 140 ? 72.784  89.017  42.057 1.00 0.00  ? 222 LEU A HA   1 
ATOM 2132 H HB2  . LEU A 1 140 ? 71.696  90.606  44.239 1.00 0.00  ? 222 LEU A HB2  1 
ATOM 2133 H HB3  . LEU A 1 140 ? 73.272  90.729  43.540 1.00 0.00  ? 222 LEU A HB3  1 
ATOM 2134 H HG   . LEU A 1 140 ? 70.653  91.663  42.202 1.00 0.00  ? 222 LEU A HG   1 
ATOM 2135 H HD11 . LEU A 1 140 ? 73.139  93.204  42.750 1.00 0.00  ? 222 LEU A HD11 1 
ATOM 2136 H HD12 . LEU A 1 140 ? 71.779  93.104  43.904 1.00 0.00  ? 222 LEU A HD12 1 
ATOM 2137 H HD13 . LEU A 1 140 ? 71.510  93.778  42.267 1.00 0.00  ? 222 LEU A HD13 1 
ATOM 2138 H HD21 . LEU A 1 140 ? 71.989  90.543  40.450 1.00 0.00  ? 222 LEU A HD21 1 
ATOM 2139 H HD22 . LEU A 1 140 ? 73.493  91.234  41.127 1.00 0.00  ? 222 LEU A HD22 1 
ATOM 2140 H HD23 . LEU A 1 140 ? 72.289  92.295  40.335 1.00 0.00  ? 222 LEU A HD23 1 
ATOM 2141 N N    . TYR A 1 141 ? 72.904  87.114  43.715 1.00 36.73 ? 223 TYR A N    1 
ATOM 2142 C CA   . TYR A 1 141 ? 73.063  86.022  44.661 1.00 44.64 ? 223 TYR A CA   1 
ATOM 2143 C C    . TYR A 1 141 ? 73.363  86.511  46.065 1.00 49.77 ? 223 TYR A C    1 
ATOM 2144 O O    . TYR A 1 141 ? 74.466  86.941  46.356 1.00 50.82 ? 223 TYR A O    1 
ATOM 2145 C CB   . TYR A 1 141 ? 74.202  85.105  44.161 1.00 46.47 ? 223 TYR A CB   1 
ATOM 2146 C CG   . TYR A 1 141 ? 74.401  83.897  45.065 1.00 48.65 ? 223 TYR A CG   1 
ATOM 2147 C CD1  . TYR A 1 141 ? 73.342  83.009  45.292 1.00 49.69 ? 223 TYR A CD1  1 
ATOM 2148 C CD2  . TYR A 1 141 ? 75.648  83.676  45.655 1.00 50.76 ? 223 TYR A CD2  1 
ATOM 2149 C CE1  . TYR A 1 141 ? 73.538  81.900  46.118 1.00 51.64 ? 223 TYR A CE1  1 
ATOM 2150 C CE2  . TYR A 1 141 ? 75.840  82.562  46.468 1.00 50.09 ? 223 TYR A CE2  1 
ATOM 2151 C CZ   . TYR A 1 141 ? 74.783  81.671  46.702 1.00 49.75 ? 223 TYR A CZ   1 
ATOM 2152 O OH   . TYR A 1 141 ? 74.982  80.567  47.517 1.00 47.48 ? 223 TYR A OH   1 
ATOM 2153 H H    . TYR A 1 141 ? 73.481  87.099  42.913 1.00 0.00  ? 223 TYR A H    1 
ATOM 2154 H HA   . TYR A 1 141 ? 72.137  85.436  44.653 1.00 0.00  ? 223 TYR A HA   1 
ATOM 2155 H HB2  . TYR A 1 141 ? 73.967  84.744  43.149 1.00 0.00  ? 223 TYR A HB2  1 
ATOM 2156 H HB3  . TYR A 1 141 ? 75.130  85.689  44.111 1.00 0.00  ? 223 TYR A HB3  1 
ATOM 2157 H HD1  . TYR A 1 141 ? 72.378  83.171  44.832 1.00 0.00  ? 223 TYR A HD1  1 
ATOM 2158 H HD2  . TYR A 1 141 ? 76.470  84.357  45.487 1.00 0.00  ? 223 TYR A HD2  1 
ATOM 2159 H HE1  . TYR A 1 141 ? 72.722  81.220  46.299 1.00 0.00  ? 223 TYR A HE1  1 
ATOM 2160 H HE2  . TYR A 1 141 ? 76.810  82.392  46.922 1.00 0.00  ? 223 TYR A HE2  1 
ATOM 2161 H HH   . TYR A 1 141 ? 75.895  80.571  47.793 1.00 0.00  ? 223 TYR A HH   1 
ATOM 2162 N N    . HIS A 1 142 ? 72.349  86.426  46.947 1.00 57.71 ? 224 HIS A N    1 
ATOM 2163 C CA   . HIS A 1 142 ? 72.497  86.919  48.320 1.00 63.22 ? 224 HIS A CA   1 
ATOM 2164 C C    . HIS A 1 142 ? 72.862  85.906  49.402 1.00 65.12 ? 224 HIS A C    1 
ATOM 2165 O O    . HIS A 1 142 ? 72.748  86.224  50.574 1.00 68.83 ? 224 HIS A O    1 
ATOM 2166 C CB   . HIS A 1 142 ? 71.210  87.688  48.720 1.00 68.55 ? 224 HIS A CB   1 
ATOM 2167 C CG   . HIS A 1 142 ? 71.183  89.076  48.127 1.00 75.89 ? 224 HIS A CG   1 
ATOM 2168 N ND1  . HIS A 1 142 ? 70.315  90.013  48.524 1.00 78.04 ? 224 HIS A ND1  1 
ATOM 2169 C CD2  . HIS A 1 142 ? 71.982  89.589  47.172 1.00 77.29 ? 224 HIS A CD2  1 
ATOM 2170 C CE1  . HIS A 1 142 ? 70.554  91.117  47.852 1.00 77.79 ? 224 HIS A CE1  1 
ATOM 2171 N NE2  . HIS A 1 142 ? 71.504  90.940  47.063 1.00 79.15 ? 224 HIS A NE2  1 
ATOM 2172 H H    . HIS A 1 142 ? 71.471  86.028  46.670 1.00 0.00  ? 224 HIS A H    1 
ATOM 2173 H HA   . HIS A 1 142 ? 73.315  87.650  48.322 1.00 0.00  ? 224 HIS A HA   1 
ATOM 2174 H HB2  . HIS A 1 142 ? 70.336  87.097  48.396 1.00 0.00  ? 224 HIS A HB2  1 
ATOM 2175 H HB3  . HIS A 1 142 ? 71.160  87.760  49.817 1.00 0.00  ? 224 HIS A HB3  1 
ATOM 2176 H HD2  . HIS A 1 142 ? 72.782  89.152  46.610 1.00 0.00  ? 224 HIS A HD2  1 
ATOM 2177 H HE1  . HIS A 1 142 ? 70.010  92.035  47.968 1.00 0.00  ? 224 HIS A HE1  1 
ATOM 2178 N N    . SER A 1 143 ? 73.303  84.699  49.016 1.00 62.57 ? 225 SER A N    1 
ATOM 2179 C CA   . SER A 1 143 ? 73.720  83.653  49.959 1.00 64.68 ? 225 SER A CA   1 
ATOM 2180 C C    . SER A 1 143 ? 73.350  83.752  51.436 1.00 66.31 ? 225 SER A C    1 
ATOM 2181 O O    . SER A 1 143 ? 73.951  84.486  52.194 1.00 69.13 ? 225 SER A O    1 
ATOM 2182 C CB   . SER A 1 143 ? 75.239  83.426  49.872 1.00 66.08 ? 225 SER A CB   1 
ATOM 2183 O OG   . SER A 1 143 ? 75.957  84.658  49.761 1.00 65.39 ? 225 SER A OG   1 
ATOM 2184 H H    . SER A 1 143 ? 73.359  84.496  48.039 1.00 0.00  ? 225 SER A H    1 
ATOM 2185 H HA   . SER A 1 143 ? 73.258  82.734  49.569 1.00 0.00  ? 225 SER A HA   1 
ATOM 2186 H HB2  . SER A 1 143 ? 75.582  82.887  50.771 1.00 0.00  ? 225 SER A HB2  1 
ATOM 2187 H HB3  . SER A 1 143 ? 75.456  82.811  48.988 1.00 0.00  ? 225 SER A HB3  1 
ATOM 2188 H HG   . SER A 1 143 ? 76.891  84.483  49.703 1.00 0.00  ? 225 SER A HG   1 
ATOM 2189 N N    . LEU A 1 144 ? 72.382  82.943  51.862 1.00 69.46 ? 226 LEU A N    1 
ATOM 2190 C CA   . LEU A 1 144 ? 71.937  82.926  53.245 1.00 71.89 ? 226 LEU A CA   1 
ATOM 2191 C C    . LEU A 1 144 ? 72.628  81.850  54.068 1.00 76.18 ? 226 LEU A C    1 
ATOM 2192 O O    . LEU A 1 144 ? 72.923  80.775  53.584 1.00 76.42 ? 226 LEU A O    1 
ATOM 2193 C CB   . LEU A 1 144 ? 70.405  82.805  53.346 1.00 71.28 ? 226 LEU A CB   1 
ATOM 2194 C CG   . LEU A 1 144 ? 69.724  81.966  52.249 1.00 70.16 ? 226 LEU A CG   1 
ATOM 2195 C CD1  . LEU A 1 144 ? 69.966  80.465  52.446 1.00 70.07 ? 226 LEU A CD1  1 
ATOM 2196 C CD2  . LEU A 1 144 ? 68.249  82.295  52.254 1.00 70.43 ? 226 LEU A CD2  1 
ATOM 2197 H H    . LEU A 1 144 ? 72.040  82.274  51.214 1.00 0.00  ? 226 LEU A H    1 
ATOM 2198 H HA   . LEU A 1 144 ? 72.191  83.908  53.678 1.00 0.00  ? 226 LEU A HA   1 
ATOM 2199 H HB2  . LEU A 1 144 ? 70.149  82.345  54.313 1.00 0.00  ? 226 LEU A HB2  1 
ATOM 2200 H HB3  . LEU A 1 144 ? 69.974  83.818  53.299 1.00 0.00  ? 226 LEU A HB3  1 
ATOM 2201 H HG   . LEU A 1 144 ? 70.023  82.261  51.228 1.00 0.00  ? 226 LEU A HG   1 
ATOM 2202 H HD11 . LEU A 1 144 ? 69.568  80.168  53.426 1.00 0.00  ? 226 LEU A HD11 1 
ATOM 2203 H HD12 . LEU A 1 144 ? 69.462  79.900  51.653 1.00 0.00  ? 226 LEU A HD12 1 
ATOM 2204 H HD13 . LEU A 1 144 ? 71.038  80.260  52.401 1.00 0.00  ? 226 LEU A HD13 1 
ATOM 2205 H HD21 . LEU A 1 144 ? 68.078  83.350  52.034 1.00 0.00  ? 226 LEU A HD21 1 
ATOM 2206 H HD22 . LEU A 1 144 ? 67.836  81.730  51.419 1.00 0.00  ? 226 LEU A HD22 1 
ATOM 2207 H HD23 . LEU A 1 144 ? 67.796  82.000  53.203 1.00 0.00  ? 226 LEU A HD23 1 
ATOM 2208 N N    . THR A 1 145 ? 72.869  82.182  55.352 1.00 81.41 ? 227 THR A N    1 
ATOM 2209 C CA   . THR A 1 145 ? 73.560  81.299  56.284 1.00 84.59 ? 227 THR A CA   1 
ATOM 2210 C C    . THR A 1 145 ? 72.983  79.903  56.443 1.00 84.58 ? 227 THR A C    1 
ATOM 2211 O O    . THR A 1 145 ? 73.408  78.964  55.804 1.00 84.05 ? 227 THR A O    1 
ATOM 2212 C CB   . THR A 1 145 ? 73.680  81.990  57.666 1.00 86.12 ? 227 THR A CB   1 
ATOM 2213 O OG1  . THR A 1 145 ? 74.061  83.356  57.523 1.00 87.39 ? 227 THR A OG1  1 
ATOM 2214 C CG2  . THR A 1 145 ? 74.655  81.248  58.591 1.00 86.83 ? 227 THR A CG2  1 
ATOM 2215 H H    . THR A 1 145 ? 72.603  83.088  55.683 1.00 0.00  ? 227 THR A H    1 
ATOM 2216 H HA   . THR A 1 145 ? 74.590  81.209  55.936 1.00 0.00  ? 227 THR A HA   1 
ATOM 2217 H HB   . THR A 1 145 ? 72.709  82.097  58.195 1.00 0.00  ? 227 THR A HB   1 
ATOM 2218 H HG1  . THR A 1 145 ? 74.103  83.787  58.374 1.00 0.00  ? 227 THR A HG1  1 
ATOM 2219 H HG21 . THR A 1 145 ? 75.368  80.680  57.980 1.00 0.00  ? 227 THR A HG21 1 
ATOM 2220 H HG22 . THR A 1 145 ? 75.209  81.978  59.197 1.00 0.00  ? 227 THR A HG22 1 
ATOM 2221 H HG23 . THR A 1 145 ? 74.112  80.560  59.256 1.00 0.00  ? 227 THR A HG23 1 
ATOM 2222 N N    . ASP A 1 146 ? 71.993  79.725  57.329 1.00 83.68 ? 228 ASP A N    1 
ATOM 2223 C CA   . ASP A 1 146 ? 71.388  78.445  57.571 1.00 83.34 ? 228 ASP A CA   1 
ATOM 2224 C C    . ASP A 1 146 ? 70.384  78.143  56.473 1.00 82.66 ? 228 ASP A C    1 
ATOM 2225 O O    . ASP A 1 146 ? 69.366  78.798  56.347 1.00 83.66 ? 228 ASP A O    1 
ATOM 2226 C CB   . ASP A 1 146 ? 70.709  78.434  58.958 1.00 84.77 ? 228 ASP A CB   1 
ATOM 2227 C CG   . ASP A 1 146 ? 70.369  77.034  59.389 1.00 85.17 ? 228 ASP A CG   1 
ATOM 2228 O OD1  . ASP A 1 146 ? 71.304  76.255  59.705 1.00 84.32 ? 228 ASP A OD1  1 
ATOM 2229 O OD2  . ASP A 1 146 ? 69.161  76.714  59.421 1.00 84.68 ? 228 ASP A OD2  1 
ATOM 2230 H H    . ASP A 1 146 ? 71.566  80.460  57.859 1.00 0.00  ? 228 ASP A H    1 
ATOM 2231 H HA   . ASP A 1 146 ? 72.192  77.706  57.596 1.00 0.00  ? 228 ASP A HA   1 
ATOM 2232 H HB2  . ASP A 1 146 ? 71.395  78.878  59.698 1.00 0.00  ? 228 ASP A HB2  1 
ATOM 2233 H HB3  . ASP A 1 146 ? 69.792  79.041  58.909 1.00 0.00  ? 228 ASP A HB3  1 
ATOM 2234 N N    . LEU A 1 147 ? 70.697  77.108  55.675 1.00 79.35 ? 229 LEU A N    1 
ATOM 2235 C CA   . LEU A 1 147 ? 69.845  76.714  54.544 1.00 77.83 ? 229 LEU A CA   1 
ATOM 2236 C C    . LEU A 1 147 ? 68.464  76.225  54.972 1.00 79.01 ? 229 LEU A C    1 
ATOM 2237 O O    . LEU A 1 147 ? 67.485  76.454  54.285 1.00 77.71 ? 229 LEU A O    1 
ATOM 2238 C CB   . LEU A 1 147 ? 70.599  75.608  53.761 1.00 76.18 ? 229 LEU A CB   1 
ATOM 2239 C CG   . LEU A 1 147 ? 70.320  75.458  52.243 1.00 74.64 ? 229 LEU A CG   1 
ATOM 2240 C CD1  . LEU A 1 147 ? 71.622  75.687  51.444 1.00 70.85 ? 229 LEU A CD1  1 
ATOM 2241 C CD2  . LEU A 1 147 ? 69.776  74.044  51.943 1.00 74.76 ? 229 LEU A CD2  1 
ATOM 2242 H H    . LEU A 1 147 ? 71.541  76.595  55.860 1.00 0.00  ? 229 LEU A H    1 
ATOM 2243 H HA   . LEU A 1 147 ? 69.724  77.592  53.900 1.00 0.00  ? 229 LEU A HA   1 
ATOM 2244 H HB2  . LEU A 1 147 ? 71.678  75.801  53.858 1.00 0.00  ? 229 LEU A HB2  1 
ATOM 2245 H HB3  . LEU A 1 147 ? 70.368  74.651  54.246 1.00 0.00  ? 229 LEU A HB3  1 
ATOM 2246 H HG   . LEU A 1 147 ? 69.572  76.200  51.921 1.00 0.00  ? 229 LEU A HG   1 
ATOM 2247 H HD11 . LEU A 1 147 ? 72.392  74.965  51.768 1.00 0.00  ? 229 LEU A HD11 1 
ATOM 2248 H HD12 . LEU A 1 147 ? 71.421  75.552  50.373 1.00 0.00  ? 229 LEU A HD12 1 
ATOM 2249 H HD13 . LEU A 1 147 ? 71.981  76.712  51.627 1.00 0.00  ? 229 LEU A HD13 1 
ATOM 2250 H HD21 . LEU A 1 147 ? 68.838  73.896  52.499 1.00 0.00  ? 229 LEU A HD21 1 
ATOM 2251 H HD22 . LEU A 1 147 ? 69.584  73.942  50.864 1.00 0.00  ? 229 LEU A HD22 1 
ATOM 2252 H HD23 . LEU A 1 147 ? 70.514  73.286  52.257 1.00 0.00  ? 229 LEU A HD23 1 
ATOM 2253 N N    . THR A 1 148 ? 68.405  75.540  56.130 1.00 82.07 ? 230 THR A N    1 
ATOM 2254 C CA   . THR A 1 148 ? 67.157  74.967  56.639 1.00 84.03 ? 230 THR A CA   1 
ATOM 2255 C C    . THR A 1 148 ? 65.980  75.921  56.694 1.00 82.02 ? 230 THR A C    1 
ATOM 2256 O O    . THR A 1 148 ? 64.850  75.516  56.473 1.00 82.62 ? 230 THR A O    1 
ATOM 2257 C CB   . THR A 1 148 ? 67.394  74.414  58.065 1.00 87.60 ? 230 THR A CB   1 
ATOM 2258 O OG1  . THR A 1 148 ? 68.572  73.592  58.064 1.00 91.15 ? 230 THR A OG1  1 
ATOM 2259 C CG2  . THR A 1 148 ? 66.180  73.592  58.544 1.00 90.15 ? 230 THR A CG2  1 
ATOM 2260 H H    . THR A 1 148 ? 69.246  75.393  56.653 1.00 0.00  ? 230 THR A H    1 
ATOM 2261 H HA   . THR A 1 148 ? 66.885  74.134  55.980 1.00 0.00  ? 230 THR A HA   1 
ATOM 2262 H HB   . THR A 1 148 ? 67.540  75.252  58.760 1.00 0.00  ? 230 THR A HB   1 
ATOM 2263 H HG1  . THR A 1 148 ? 68.740  73.242  58.933 1.00 0.00  ? 230 THR A HG1  1 
ATOM 2264 H HG21 . THR A 1 148 ? 65.593  73.247  57.681 1.00 0.00  ? 230 THR A HG21 1 
ATOM 2265 H HG22 . THR A 1 148 ? 66.520  72.712  59.111 1.00 0.00  ? 230 THR A HG22 1 
ATOM 2266 H HG23 . THR A 1 148 ? 65.542  74.213  59.191 1.00 0.00  ? 230 THR A HG23 1 
ATOM 2267 N N    . ARG A 1 149 ? 66.251  77.201  56.998 1.00 81.76 ? 231 ARG A N    1 
ATOM 2268 C CA   . ARG A 1 149 ? 65.170  78.177  57.087 1.00 81.45 ? 231 ARG A CA   1 
ATOM 2269 C C    . ARG A 1 149 ? 64.935  78.987  55.820 1.00 81.88 ? 231 ARG A C    1 
ATOM 2270 O O    . ARG A 1 149 ? 64.467  80.111  55.879 1.00 84.58 ? 231 ARG A O    1 
ATOM 2271 C CB   . ARG A 1 149 ? 65.434  79.118  58.269 1.00 80.78 ? 231 ARG A CB   1 
ATOM 2272 C CG   . ARG A 1 149 ? 65.352  78.419  59.636 1.00 82.30 ? 231 ARG A CG   1 
ATOM 2273 C CD   . ARG A 1 149 ? 65.515  79.441  60.780 1.00 83.12 ? 231 ARG A CD   1 
ATOM 2274 N NE   . ARG A 1 149 ? 66.798  80.137  60.721 1.00 85.52 ? 231 ARG A NE   1 
ATOM 2275 C CZ   . ARG A 1 149 ? 67.006  81.288  60.110 1.00 87.05 ? 231 ARG A CZ   1 
ATOM 2276 N NH1  . ARG A 1 149 ? 66.055  81.932  59.468 1.00 88.99 ? 231 ARG A NH1  1 
ATOM 2277 N NH2  . ARG A 1 149 ? 68.213  81.809  60.134 1.00 89.33 ? 231 ARG A NH2  1 
ATOM 2278 H H    . ARG A 1 149 ? 67.198  77.489  57.159 1.00 0.00  ? 231 ARG A H    1 
ATOM 2279 H HA   . ARG A 1 149 ? 64.234  77.639  57.298 1.00 0.00  ? 231 ARG A HA   1 
ATOM 2280 H HB2  . ARG A 1 149 ? 66.435  79.560  58.157 1.00 0.00  ? 231 ARG A HB2  1 
ATOM 2281 H HB3  . ARG A 1 149 ? 64.660  79.892  58.231 1.00 0.00  ? 231 ARG A HB3  1 
ATOM 2282 H HG2  . ARG A 1 149 ? 64.371  77.920  59.730 1.00 0.00  ? 231 ARG A HG2  1 
ATOM 2283 H HG3  . ARG A 1 149 ? 66.157  77.672  59.710 1.00 0.00  ? 231 ARG A HG3  1 
ATOM 2284 H HD2  . ARG A 1 149 ? 64.656  80.123  60.759 1.00 0.00  ? 231 ARG A HD2  1 
ATOM 2285 H HD3  . ARG A 1 149 ? 65.415  78.911  61.733 1.00 0.00  ? 231 ARG A HD3  1 
ATOM 2286 H HH11 . ARG A 1 149 ? 65.104  81.593  59.408 1.00 0.00  ? 231 ARG A HH11 1 
ATOM 2287 H HH12 . ARG A 1 149 ? 66.229  82.807  58.999 1.00 0.00  ? 231 ARG A HH12 1 
ATOM 2288 H HH21 . ARG A 1 149 ? 68.986  81.334  60.619 1.00 0.00  ? 231 ARG A HH21 1 
ATOM 2289 H HH22 . ARG A 1 149 ? 68.405  82.706  59.659 1.00 0.00  ? 231 ARG A HH22 1 
ATOM 2290 N N    . PHE A 1 150 ? 65.253  78.401  54.656 1.00 78.88 ? 232 PHE A N    1 
ATOM 2291 C CA   . PHE A 1 150 ? 65.008  79.085  53.392 1.00 75.16 ? 232 PHE A CA   1 
ATOM 2292 C C    . PHE A 1 150 ? 63.512  79.221  53.167 1.00 73.97 ? 232 PHE A C    1 
ATOM 2293 O O    . PHE A 1 150 ? 62.760  78.293  53.405 1.00 74.83 ? 232 PHE A O    1 
ATOM 2294 C CB   . PHE A 1 150 ? 65.656  78.302  52.229 1.00 74.04 ? 232 PHE A CB   1 
ATOM 2295 C CG   . PHE A 1 150 ? 65.274  78.832  50.853 1.00 71.96 ? 232 PHE A CG   1 
ATOM 2296 C CD1  . PHE A 1 150 ? 65.641  80.107  50.445 1.00 70.76 ? 232 PHE A CD1  1 
ATOM 2297 C CD2  . PHE A 1 150 ? 64.534  78.059  49.969 1.00 69.94 ? 232 PHE A CD2  1 
ATOM 2298 C CE1  . PHE A 1 150 ? 65.324  80.624  49.196 1.00 68.12 ? 232 PHE A CE1  1 
ATOM 2299 C CE2  . PHE A 1 150 ? 64.186  78.552  48.716 1.00 67.85 ? 232 PHE A CE2  1 
ATOM 2300 C CZ   . PHE A 1 150 ? 64.578  79.830  48.337 1.00 65.85 ? 232 PHE A CZ   1 
ATOM 2301 H H    . PHE A 1 150 ? 65.647  77.485  54.646 1.00 0.00  ? 232 PHE A H    1 
ATOM 2302 H HA   . PHE A 1 150 ? 65.486  80.078  53.434 1.00 0.00  ? 232 PHE A HA   1 
ATOM 2303 H HB2  . PHE A 1 150 ? 66.753  78.346  52.327 1.00 0.00  ? 232 PHE A HB2  1 
ATOM 2304 H HB3  . PHE A 1 150 ? 65.328  77.253  52.291 1.00 0.00  ? 232 PHE A HB3  1 
ATOM 2305 H HD1  . PHE A 1 150 ? 66.169  80.702  51.151 1.00 0.00  ? 232 PHE A HD1  1 
ATOM 2306 H HD2  . PHE A 1 150 ? 64.226  77.061  50.257 1.00 0.00  ? 232 PHE A HD2  1 
ATOM 2307 H HE1  . PHE A 1 150 ? 65.632  81.620  48.911 1.00 0.00  ? 232 PHE A HE1  1 
ATOM 2308 H HE2  . PHE A 1 150 ? 63.606  77.939  48.039 1.00 0.00  ? 232 PHE A HE2  1 
ATOM 2309 H HZ   . PHE A 1 150 ? 64.284  80.198  47.369 1.00 0.00  ? 232 PHE A HZ   1 
ATOM 2310 N N    . ARG A 1 151 ? 63.103  80.404  52.682 1.00 73.57 ? 233 ARG A N    1 
ATOM 2311 C CA   . ARG A 1 151 ? 61.686  80.700  52.488 1.00 72.64 ? 233 ARG A CA   1 
ATOM 2312 C C    . ARG A 1 151 ? 61.482  81.529  51.228 1.00 67.78 ? 233 ARG A C    1 
ATOM 2313 O O    . ARG A 1 151 ? 62.303  82.353  50.871 1.00 73.03 ? 233 ARG A O    1 
ATOM 2314 C CB   . ARG A 1 151 ? 61.059  81.444  53.695 1.00 76.21 ? 233 ARG A CB   1 
ATOM 2315 C CG   . ARG A 1 151 ? 62.075  82.001  54.706 1.00 79.57 ? 233 ARG A CG   1 
ATOM 2316 C CD   . ARG A 1 151 ? 61.830  83.477  55.059 1.00 82.94 ? 233 ARG A CD   1 
ATOM 2317 N NE   . ARG A 1 151 ? 61.964  84.382  53.919 1.00 84.80 ? 233 ARG A NE   1 
ATOM 2318 C CZ   . ARG A 1 151 ? 63.095  84.644  53.292 1.00 85.07 ? 233 ARG A CZ   1 
ATOM 2319 N NH1  . ARG A 1 151 ? 64.236  84.090  53.638 1.00 83.68 ? 233 ARG A NH1  1 
ATOM 2320 N NH2  . ARG A 1 151 ? 63.081  85.503  52.294 1.00 84.05 ? 233 ARG A NH2  1 
ATOM 2321 H H    . ARG A 1 151 ? 63.767  81.126  52.488 1.00 0.00  ? 233 ARG A H    1 
ATOM 2322 H HA   . ARG A 1 151 ? 61.148  79.746  52.370 1.00 0.00  ? 233 ARG A HA   1 
ATOM 2323 H HB2  . ARG A 1 151 ? 60.453  82.284  53.324 1.00 0.00  ? 233 ARG A HB2  1 
ATOM 2324 H HB3  . ARG A 1 151 ? 60.405  80.751  54.250 1.00 0.00  ? 233 ARG A HB3  1 
ATOM 2325 H HG2  . ARG A 1 151 ? 62.091  81.390  55.614 1.00 0.00  ? 233 ARG A HG2  1 
ATOM 2326 H HG3  . ARG A 1 151 ? 63.060  81.908  54.288 1.00 0.00  ? 233 ARG A HG3  1 
ATOM 2327 H HD2  . ARG A 1 151 ? 60.803  83.537  55.463 1.00 0.00  ? 233 ARG A HD2  1 
ATOM 2328 H HD3  . ARG A 1 151 ? 62.532  83.771  55.855 1.00 0.00  ? 233 ARG A HD3  1 
ATOM 2329 H HH11 . ARG A 1 151 ? 64.318  83.479  54.444 1.00 0.00  ? 233 ARG A HH11 1 
ATOM 2330 H HH12 . ARG A 1 151 ? 65.097  84.291  53.137 1.00 0.00  ? 233 ARG A HH12 1 
ATOM 2331 H HH21 . ARG A 1 151 ? 62.209  85.970  52.011 1.00 0.00  ? 233 ARG A HH21 1 
ATOM 2332 H HH22 . ARG A 1 151 ? 63.950  85.730  51.786 1.00 0.00  ? 233 ARG A HH22 1 
ATOM 2333 N N    . LEU A 1 152 ? 60.340  81.296  50.565 1.00 55.61 ? 234 LEU A N    1 
ATOM 2334 C CA   . LEU A 1 152 ? 60.006  82.019  49.344 1.00 46.03 ? 234 LEU A CA   1 
ATOM 2335 C C    . LEU A 1 152 ? 59.438  83.371  49.709 1.00 41.71 ? 234 LEU A C    1 
ATOM 2336 O O    . LEU A 1 152 ? 58.756  83.489  50.711 1.00 43.12 ? 234 LEU A O    1 
ATOM 2337 C CB   . LEU A 1 152 ? 58.930  81.195  48.611 1.00 45.09 ? 234 LEU A CB   1 
ATOM 2338 C CG   . LEU A 1 152 ? 58.977  81.101  47.082 1.00 47.65 ? 234 LEU A CG   1 
ATOM 2339 C CD1  . LEU A 1 152 ? 60.279  80.473  46.601 1.00 42.87 ? 234 LEU A CD1  1 
ATOM 2340 C CD2  . LEU A 1 152 ? 57.822  80.232  46.604 1.00 48.08 ? 234 LEU A CD2  1 
ATOM 2341 H H    . LEU A 1 152 ? 59.694  80.623  50.929 1.00 0.00  ? 234 LEU A H    1 
ATOM 2342 H HA   . LEU A 1 152 ? 60.906  82.142  48.732 1.00 0.00  ? 234 LEU A HA   1 
ATOM 2343 H HB2  . LEU A 1 152 ? 58.998  80.152  48.954 1.00 0.00  ? 234 LEU A HB2  1 
ATOM 2344 H HB3  . LEU A 1 152 ? 57.954  81.613  48.886 1.00 0.00  ? 234 LEU A HB3  1 
ATOM 2345 H HG   . LEU A 1 152 ? 58.897  82.101  46.673 1.00 0.00  ? 234 LEU A HG   1 
ATOM 2346 H HD11 . LEU A 1 152 ? 60.366  79.487  47.059 1.00 0.00  ? 234 LEU A HD11 1 
ATOM 2347 H HD12 . LEU A 1 152 ? 60.275  80.395  45.508 1.00 0.00  ? 234 LEU A HD12 1 
ATOM 2348 H HD13 . LEU A 1 152 ? 61.132  81.079  46.904 1.00 0.00  ? 234 LEU A HD13 1 
ATOM 2349 H HD21 . LEU A 1 152 ? 56.921  80.710  46.973 1.00 0.00  ? 234 LEU A HD21 1 
ATOM 2350 H HD22 . LEU A 1 152 ? 57.757  80.188  45.520 1.00 0.00  ? 234 LEU A HD22 1 
ATOM 2351 H HD23 . LEU A 1 152 ? 57.850  79.241  47.054 1.00 0.00  ? 234 LEU A HD23 1 
ATOM 2352 N N    . SER A 1 153 ? 59.704  84.396  48.892 1.00 40.79 ? 235 SER A N    1 
ATOM 2353 C CA   . SER A 1 153 ? 59.112  85.691  49.193 1.00 43.25 ? 235 SER A CA   1 
ATOM 2354 C C    . SER A 1 153 ? 57.676  85.652  48.736 1.00 42.11 ? 235 SER A C    1 
ATOM 2355 O O    . SER A 1 153 ? 57.377  85.065  47.712 1.00 44.23 ? 235 SER A O    1 
ATOM 2356 C CB   . SER A 1 153 ? 59.837  86.836  48.479 1.00 47.51 ? 235 SER A CB   1 
ATOM 2357 O OG   . SER A 1 153 ? 59.163  88.084  48.639 1.00 51.73 ? 235 SER A OG   1 
ATOM 2358 H H    . SER A 1 153 ? 60.281  84.283  48.083 1.00 0.00  ? 235 SER A H    1 
ATOM 2359 H HA   . SER A 1 153 ? 59.176  85.881  50.278 1.00 0.00  ? 235 SER A HA   1 
ATOM 2360 H HB2  . SER A 1 153 ? 60.849  86.912  48.907 1.00 0.00  ? 235 SER A HB2  1 
ATOM 2361 H HB3  . SER A 1 153 ? 59.862  86.604  47.408 1.00 0.00  ? 235 SER A HB3  1 
ATOM 2362 H HG   . SER A 1 153 ? 59.634  88.772  48.181 1.00 0.00  ? 235 SER A HG   1 
ATOM 2363 N N    . GLN A 1 154 ? 56.786  86.294  49.514 1.00 37.72 ? 236 GLN A N    1 
ATOM 2364 C CA   . GLN A 1 154 ? 55.378  86.323  49.138 1.00 37.09 ? 236 GLN A CA   1 
ATOM 2365 C C    . GLN A 1 154 ? 55.328  86.676  47.673 1.00 34.59 ? 236 GLN A C    1 
ATOM 2366 O O    . GLN A 1 154 ? 54.678  86.019  46.886 1.00 32.56 ? 236 GLN A O    1 
ATOM 2367 C CB   . GLN A 1 154 ? 54.622  87.384  49.971 1.00 39.50 ? 236 GLN A CB   1 
ATOM 2368 C CG   . GLN A 1 154 ? 53.092  87.275  49.844 1.00 41.51 ? 236 GLN A CG   1 
ATOM 2369 C CD   . GLN A 1 154 ? 52.586  85.911  50.271 1.00 46.09 ? 236 GLN A CD   1 
ATOM 2370 O OE1  . GLN A 1 154 ? 52.876  85.454  51.364 1.00 45.89 ? 236 GLN A OE1  1 
ATOM 2371 N NE2  . GLN A 1 154 ? 51.822  85.248  49.388 1.00 46.32 ? 236 GLN A NE2  1 
ATOM 2372 H H    . GLN A 1 154 ? 57.090  86.764  50.346 1.00 0.00  ? 236 GLN A H    1 
ATOM 2373 H HA   . GLN A 1 154 ? 54.937  85.336  49.313 1.00 0.00  ? 236 GLN A HA   1 
ATOM 2374 H HB2  . GLN A 1 154 ? 54.889  87.259  51.033 1.00 0.00  ? 236 GLN A HB2  1 
ATOM 2375 H HB3  . GLN A 1 154 ? 54.932  88.388  49.637 1.00 0.00  ? 236 GLN A HB3  1 
ATOM 2376 H HG2  . GLN A 1 154 ? 52.634  88.050  50.477 1.00 0.00  ? 236 GLN A HG2  1 
ATOM 2377 H HG3  . GLN A 1 154 ? 52.824  87.474  48.796 1.00 0.00  ? 236 GLN A HG3  1 
ATOM 2378 H HE21 . GLN A 1 154 ? 51.614  85.638  48.490 1.00 0.00  ? 236 GLN A HE21 1 
ATOM 2379 H HE22 . GLN A 1 154 ? 51.457  84.345  49.620 1.00 0.00  ? 236 GLN A HE22 1 
ATOM 2380 N N    . ASP A 1 155 ? 56.084  87.727  47.314 1.00 30.67 ? 237 ASP A N    1 
ATOM 2381 C CA   . ASP A 1 155 ? 56.117  88.204  45.938 1.00 32.55 ? 237 ASP A CA   1 
ATOM 2382 C C    . ASP A 1 155 ? 56.293  87.117  44.892 1.00 32.39 ? 237 ASP A C    1 
ATOM 2383 O O    . ASP A 1 155 ? 55.655  87.168  43.854 1.00 33.93 ? 237 ASP A O    1 
ATOM 2384 C CB   . ASP A 1 155 ? 57.217  89.279  45.801 1.00 40.71 ? 237 ASP A CB   1 
ATOM 2385 C CG   . ASP A 1 155 ? 56.780  90.619  46.360 1.00 48.47 ? 237 ASP A CG   1 
ATOM 2386 O OD1  . ASP A 1 155 ? 55.710  90.694  47.023 1.00 50.25 ? 237 ASP A OD1  1 
ATOM 2387 O OD2  . ASP A 1 155 ? 57.506  91.618  46.128 1.00 50.84 ? 237 ASP A OD2  1 
ATOM 2388 H H    . ASP A 1 155 ? 56.637  88.197  48.006 1.00 0.00  ? 237 ASP A H    1 
ATOM 2389 H HA   . ASP A 1 155 ? 55.150  88.680  45.737 1.00 0.00  ? 237 ASP A HA   1 
ATOM 2390 H HB2  . ASP A 1 155 ? 58.120  88.940  46.329 1.00 0.00  ? 237 ASP A HB2  1 
ATOM 2391 H HB3  . ASP A 1 155 ? 57.456  89.398  44.734 1.00 0.00  ? 237 ASP A HB3  1 
ATOM 2392 N N    . ASP A 1 156 ? 57.170  86.135  45.156 1.00 29.49 ? 238 ASP A N    1 
ATOM 2393 C CA   . ASP A 1 156 ? 57.370  85.058  44.188 1.00 27.49 ? 238 ASP A CA   1 
ATOM 2394 C C    . ASP A 1 156 ? 56.128  84.199  44.121 1.00 26.31 ? 238 ASP A C    1 
ATOM 2395 O O    . ASP A 1 156 ? 55.748  83.737  43.065 1.00 23.24 ? 238 ASP A O    1 
ATOM 2396 C CB   . ASP A 1 156 ? 58.544  84.177  44.613 1.00 25.71 ? 238 ASP A CB   1 
ATOM 2397 C CG   . ASP A 1 156 ? 59.813  84.930  44.852 1.00 23.58 ? 238 ASP A CG   1 
ATOM 2398 O OD1  . ASP A 1 156 ? 60.328  85.550  43.889 1.00 25.02 ? 238 ASP A OD1  1 
ATOM 2399 O OD2  . ASP A 1 156 ? 60.301  84.901  46.007 1.00 17.70 ? 238 ASP A OD2  1 
ATOM 2400 H H    . ASP A 1 156 ? 57.651  86.118  46.033 1.00 0.00  ? 238 ASP A H    1 
ATOM 2401 H HA   . ASP A 1 156 ? 57.585  85.489  43.202 1.00 0.00  ? 238 ASP A HA   1 
ATOM 2402 H HB2  . ASP A 1 156 ? 58.254  83.657  45.515 1.00 0.00  ? 238 ASP A HB2  1 
ATOM 2403 H HB3  . ASP A 1 156 ? 58.709  83.443  43.840 1.00 0.00  ? 238 ASP A HB3  1 
ATOM 2404 N N    . ILE A 1 157 ? 55.499  84.002  45.287 1.00 24.00 ? 239 ILE A N    1 
ATOM 2405 C CA   . ILE A 1 157 ? 54.294  83.198  45.354 1.00 22.49 ? 239 ILE A CA   1 
ATOM 2406 C C    . ILE A 1 157 ? 53.207  83.861  44.543 1.00 21.39 ? 239 ILE A C    1 
ATOM 2407 O O    . ILE A 1 157 ? 52.608  83.230  43.692 1.00 23.11 ? 239 ILE A O    1 
ATOM 2408 C CB   . ILE A 1 157 ? 53.862  83.020  46.825 1.00 25.95 ? 239 ILE A CB   1 
ATOM 2409 C CG1  . ILE A 1 157 ? 54.975  82.316  47.602 1.00 23.31 ? 239 ILE A CG1  1 
ATOM 2410 C CG2  . ILE A 1 157 ? 52.574  82.193  46.886 1.00 27.50 ? 239 ILE A CG2  1 
ATOM 2411 C CD1  . ILE A 1 157 ? 54.659  82.077  49.065 1.00 21.30 ? 239 ILE A CD1  1 
ATOM 2412 H H    . ILE A 1 157 ? 55.854  84.440  46.111 1.00 0.00  ? 239 ILE A H    1 
ATOM 2413 H HA   . ILE A 1 157 ? 54.502  82.203  44.944 1.00 0.00  ? 239 ILE A HA   1 
ATOM 2414 H HB   . ILE A 1 157 ? 53.679  83.991  47.294 1.00 0.00  ? 239 ILE A HB   1 
ATOM 2415 H HG12 . ILE A 1 157 ? 55.040  81.332  47.123 1.00 0.00  ? 239 ILE A HG12 1 
ATOM 2416 H HG13 . ILE A 1 157 ? 55.918  82.871  47.548 1.00 0.00  ? 239 ILE A HG13 1 
ATOM 2417 H HG21 . ILE A 1 157 ? 52.745  81.209  46.429 1.00 0.00  ? 239 ILE A HG21 1 
ATOM 2418 H HG22 . ILE A 1 157 ? 52.240  82.073  47.919 1.00 0.00  ? 239 ILE A HG22 1 
ATOM 2419 H HG23 . ILE A 1 157 ? 51.777  82.724  46.362 1.00 0.00  ? 239 ILE A HG23 1 
ATOM 2420 H HD11 . ILE A 1 157 ? 53.776  81.442  49.179 1.00 0.00  ? 239 ILE A HD11 1 
ATOM 2421 H HD12 . ILE A 1 157 ? 55.490  81.550  49.544 1.00 0.00  ? 239 ILE A HD12 1 
ATOM 2422 H HD13 . ILE A 1 157 ? 54.491  83.048  49.544 1.00 0.00  ? 239 ILE A HD13 1 
ATOM 2423 N N    . ASN A 1 158 ? 52.957  85.152  44.809 1.00 25.61 ? 240 ASN A N    1 
ATOM 2424 C CA   . ASN A 1 158 ? 51.957  85.879  44.030 1.00 27.00 ? 240 ASN A CA   1 
ATOM 2425 C C    . ASN A 1 158 ? 52.332  85.813  42.558 1.00 25.10 ? 240 ASN A C    1 
ATOM 2426 O O    . ASN A 1 158 ? 51.479  85.748  41.694 1.00 25.58 ? 240 ASN A O    1 
ATOM 2427 C CB   . ASN A 1 158 ? 51.904  87.361  44.468 1.00 29.59 ? 240 ASN A CB   1 
ATOM 2428 C CG   . ASN A 1 158 ? 51.384  87.559  45.879 1.00 32.27 ? 240 ASN A CG   1 
ATOM 2429 O OD1  . ASN A 1 158 ? 50.648  86.746  46.413 1.00 31.56 ? 240 ASN A OD1  1 
ATOM 2430 N ND2  . ASN A 1 158 ? 51.770  88.686  46.496 1.00 34.45 ? 240 ASN A ND2  1 
ATOM 2431 H H    . ASN A 1 158 ? 53.494  85.632  45.506 1.00 0.00  ? 240 ASN A H    1 
ATOM 2432 H HA   . ASN A 1 158 ? 50.974  85.414  44.188 1.00 0.00  ? 240 ASN A HA   1 
ATOM 2433 H HB2  . ASN A 1 158 ? 52.918  87.786  44.396 1.00 0.00  ? 240 ASN A HB2  1 
ATOM 2434 H HB3  . ASN A 1 158 ? 51.244  87.904  43.774 1.00 0.00  ? 240 ASN A HB3  1 
ATOM 2435 N N    . GLY A 1 159 ? 53.646  85.830  42.282 1.00 25.26 ? 241 GLY A N    1 
ATOM 2436 C CA   . GLY A 1 159 ? 54.123  85.817  40.906 1.00 27.10 ? 241 GLY A CA   1 
ATOM 2437 C C    . GLY A 1 159 ? 53.831  84.535  40.157 1.00 28.94 ? 241 GLY A C    1 
ATOM 2438 O O    . GLY A 1 159 ? 53.226  84.550  39.101 1.00 26.18 ? 241 GLY A O    1 
ATOM 2439 H H    . GLY A 1 159 ? 54.317  85.874  43.024 1.00 0.00  ? 241 GLY A H    1 
ATOM 2440 H HA2  . GLY A 1 159 ? 53.653  86.648  40.364 1.00 0.00  ? 241 GLY A HA2  1 
ATOM 2441 H HA3  . GLY A 1 159 ? 55.215  85.966  40.921 1.00 0.00  ? 241 GLY A HA3  1 
ATOM 2442 N N    . ILE A 1 160 ? 54.298  83.412  40.728 1.00 30.19 ? 242 ILE A N    1 
ATOM 2443 C CA   . ILE A 1 160 ? 54.107  82.119  40.107 1.00 26.44 ? 242 ILE A CA   1 
ATOM 2444 C C    . ILE A 1 160 ? 52.662  81.660  40.062 1.00 28.74 ? 242 ILE A C    1 
ATOM 2445 O O    . ILE A 1 160 ? 52.220  81.031  39.117 1.00 30.41 ? 242 ILE A O    1 
ATOM 2446 C CB   . ILE A 1 160 ? 55.056  81.083  40.743 1.00 20.94 ? 242 ILE A CB   1 
ATOM 2447 C CG1  . ILE A 1 160 ? 55.085  79.798  39.900 1.00 20.93 ? 242 ILE A CG1  1 
ATOM 2448 C CG2  . ILE A 1 160 ? 54.621  80.787  42.181 1.00 20.86 ? 242 ILE A CG2  1 
ATOM 2449 C CD1  . ILE A 1 160 ? 55.542  80.061  38.462 1.00 15.65 ? 242 ILE A CD1  1 
ATOM 2450 H H    . ILE A 1 160 ? 54.793  83.488  41.586 1.00 0.00  ? 242 ILE A H    1 
ATOM 2451 H HA   . ILE A 1 160 ? 54.416  82.308  39.083 1.00 0.00  ? 242 ILE A HA   1 
ATOM 2452 H HB   . ILE A 1 160 ? 56.080  81.493  40.776 1.00 0.00  ? 242 ILE A HB   1 
ATOM 2453 H HG12 . ILE A 1 160 ? 55.792  79.086  40.356 1.00 0.00  ? 242 ILE A HG12 1 
ATOM 2454 H HG13 . ILE A 1 160 ? 54.076  79.367  39.875 1.00 0.00  ? 242 ILE A HG13 1 
ATOM 2455 H HG21 . ILE A 1 160 ? 53.598  80.403  42.205 1.00 0.00  ? 242 ILE A HG21 1 
ATOM 2456 H HG22 . ILE A 1 160 ? 55.293  80.053  42.607 1.00 0.00  ? 242 ILE A HG22 1 
ATOM 2457 H HG23 . ILE A 1 160 ? 54.681  81.686  42.784 1.00 0.00  ? 242 ILE A HG23 1 
ATOM 2458 H HD11 . ILE A 1 160 ? 56.541  80.513  38.471 1.00 0.00  ? 242 ILE A HD11 1 
ATOM 2459 H HD12 . ILE A 1 160 ? 55.558  79.126  37.907 1.00 0.00  ? 242 ILE A HD12 1 
ATOM 2460 H HD13 . ILE A 1 160 ? 54.847  80.703  37.909 1.00 0.00  ? 242 ILE A HD13 1 
ATOM 2461 N N    . GLN A 1 161 ? 51.907  81.989  41.117 1.00 29.34 ? 243 GLN A N    1 
ATOM 2462 C CA   . GLN A 1 161 ? 50.498  81.605  41.149 1.00 32.09 ? 243 GLN A CA   1 
ATOM 2463 C C    . GLN A 1 161 ? 49.641  82.413  40.186 1.00 35.45 ? 243 GLN A C    1 
ATOM 2464 O O    . GLN A 1 161 ? 48.696  81.885  39.628 1.00 42.36 ? 243 GLN A O    1 
ATOM 2465 C CB   . GLN A 1 161 ? 49.942  81.740  42.577 1.00 32.30 ? 243 GLN A CB   1 
ATOM 2466 C CG   . GLN A 1 161 ? 50.454  80.616  43.495 1.00 39.70 ? 243 GLN A CG   1 
ATOM 2467 C CD   . GLN A 1 161 ? 49.877  80.700  44.892 1.00 41.21 ? 243 GLN A CD   1 
ATOM 2468 O OE1  . GLN A 1 161 ? 49.125  81.602  45.218 1.00 43.41 ? 243 GLN A OE1  1 
ATOM 2469 N NE2  . GLN A 1 161 ? 50.243  79.725  45.737 1.00 42.70 ? 243 GLN A NE2  1 
ATOM 2470 H H    . GLN A 1 161 ? 52.301  82.511  41.878 1.00 0.00  ? 243 GLN A H    1 
ATOM 2471 H HA   . GLN A 1 161 ? 50.429  80.550  40.852 1.00 0.00  ? 243 GLN A HA   1 
ATOM 2472 H HB2  . GLN A 1 161 ? 50.247  82.710  42.997 1.00 0.00  ? 243 GLN A HB2  1 
ATOM 2473 H HB3  . GLN A 1 161 ? 48.844  81.685  42.534 1.00 0.00  ? 243 GLN A HB3  1 
ATOM 2474 H HG2  . GLN A 1 161 ? 50.174  79.651  43.050 1.00 0.00  ? 243 GLN A HG2  1 
ATOM 2475 H HG3  . GLN A 1 161 ? 51.550  80.677  43.557 1.00 0.00  ? 243 GLN A HG3  1 
ATOM 2476 H HE21 . GLN A 1 161 ? 50.856  78.998  45.431 1.00 0.00  ? 243 GLN A HE21 1 
ATOM 2477 H HE22 . GLN A 1 161 ? 49.899  79.720  46.677 1.00 0.00  ? 243 GLN A HE22 1 
ATOM 2478 N N    . SER A 1 162 ? 49.991  83.685  39.931 1.00 34.29 ? 244 SER A N    1 
ATOM 2479 C CA   . SER A 1 162 ? 49.235  84.478  38.949 1.00 33.48 ? 244 SER A CA   1 
ATOM 2480 C C    . SER A 1 162 ? 49.315  83.886  37.549 1.00 35.03 ? 244 SER A C    1 
ATOM 2481 O O    . SER A 1 162 ? 48.658  84.333  36.627 1.00 35.10 ? 244 SER A O    1 
ATOM 2482 C CB   . SER A 1 162 ? 49.782  85.918  38.899 1.00 32.86 ? 244 SER A CB   1 
ATOM 2483 O OG   . SER A 1 162 ? 50.958  85.994  38.087 1.00 33.03 ? 244 SER A OG   1 
ATOM 2484 H H    . SER A 1 162 ? 50.820  84.068  40.348 1.00 0.00  ? 244 SER A H    1 
ATOM 2485 H HA   . SER A 1 162 ? 48.186  84.507  39.278 1.00 0.00  ? 244 SER A HA   1 
ATOM 2486 H HB2  . SER A 1 162 ? 49.009  86.584  38.484 1.00 0.00  ? 244 SER A HB2  1 
ATOM 2487 H HB3  . SER A 1 162 ? 50.025  86.251  39.919 1.00 0.00  ? 244 SER A HB3  1 
ATOM 2488 H HG   . SER A 1 162 ? 51.280  86.889  38.064 1.00 0.00  ? 244 SER A HG   1 
ATOM 2489 N N    . LEU A 1 163 ? 50.162  82.855  37.410 1.00 33.03 ? 245 LEU A N    1 
ATOM 2490 C CA   . LEU A 1 163 ? 50.371  82.178  36.149 1.00 30.59 ? 245 LEU A CA   1 
ATOM 2491 C C    . LEU A 1 163 ? 49.742  80.802  36.232 1.00 32.80 ? 245 LEU A C    1 
ATOM 2492 O O    . LEU A 1 163 ? 48.831  80.500  35.487 1.00 31.29 ? 245 LEU A O    1 
ATOM 2493 C CB   . LEU A 1 163 ? 51.903  82.073  35.971 1.00 25.47 ? 245 LEU A CB   1 
ATOM 2494 C CG   . LEU A 1 163 ? 52.600  82.442  34.657 1.00 23.18 ? 245 LEU A CG   1 
ATOM 2495 C CD1  . LEU A 1 163 ? 52.131  83.777  34.086 1.00 21.68 ? 245 LEU A CD1  1 
ATOM 2496 C CD2  . LEU A 1 163 ? 54.110  82.506  34.939 1.00 24.44 ? 245 LEU A CD2  1 
ATOM 2497 H H    . LEU A 1 163 ? 50.719  82.536  38.170 1.00 0.00  ? 245 LEU A H    1 
ATOM 2498 H HA   . LEU A 1 163 ? 49.910  82.746  35.343 1.00 0.00  ? 245 LEU A HA   1 
ATOM 2499 H HB2  . LEU A 1 163 ? 52.366  82.718  36.727 1.00 0.00  ? 245 LEU A HB2  1 
ATOM 2500 H HB3  . LEU A 1 163 ? 52.188  81.035  36.147 1.00 0.00  ? 245 LEU A HB3  1 
ATOM 2501 H HG   . LEU A 1 163 ? 52.395  81.652  33.940 1.00 0.00  ? 245 LEU A HG   1 
ATOM 2502 H HD11 . LEU A 1 163 ? 52.323  84.563  34.829 1.00 0.00  ? 245 LEU A HD11 1 
ATOM 2503 H HD12 . LEU A 1 163 ? 52.677  83.988  33.157 1.00 0.00  ? 245 LEU A HD12 1 
ATOM 2504 H HD13 . LEU A 1 163 ? 51.064  83.727  33.854 1.00 0.00  ? 245 LEU A HD13 1 
ATOM 2505 H HD21 . LEU A 1 163 ? 54.447  81.544  35.326 1.00 0.00  ? 245 LEU A HD21 1 
ATOM 2506 H HD22 . LEU A 1 163 ? 54.658  82.746  34.021 1.00 0.00  ? 245 LEU A HD22 1 
ATOM 2507 H HD23 . LEU A 1 163 ? 54.307  83.275  35.700 1.00 0.00  ? 245 LEU A HD23 1 
ATOM 2508 N N    . TYR A 1 164 ? 50.241  79.963  37.158 1.00 33.39 ? 246 TYR A N    1 
ATOM 2509 C CA   . TYR A 1 164 ? 49.792  78.571  37.260 1.00 31.68 ? 246 TYR A CA   1 
ATOM 2510 C C    . TYR A 1 164 ? 48.763  78.256  38.331 1.00 33.38 ? 246 TYR A C    1 
ATOM 2511 O O    . TYR A 1 164 ? 48.414  77.103  38.520 1.00 34.64 ? 246 TYR A O    1 
ATOM 2512 C CB   . TYR A 1 164 ? 51.021  77.686  37.512 1.00 29.94 ? 246 TYR A CB   1 
ATOM 2513 C CG   . TYR A 1 164 ? 52.005  77.787  36.355 1.00 26.31 ? 246 TYR A CG   1 
ATOM 2514 C CD1  . TYR A 1 164 ? 51.805  77.022  35.214 1.00 26.59 ? 246 TYR A CD1  1 
ATOM 2515 C CD2  . TYR A 1 164 ? 53.096  78.650  36.425 1.00 20.33 ? 246 TYR A CD2  1 
ATOM 2516 C CE1  . TYR A 1 164 ? 52.672  77.130  34.132 1.00 22.42 ? 246 TYR A CE1  1 
ATOM 2517 C CE2  . TYR A 1 164 ? 53.962  78.759  35.341 1.00 20.58 ? 246 TYR A CE2  1 
ATOM 2518 C CZ   . TYR A 1 164 ? 53.742  78.006  34.197 1.00 17.94 ? 246 TYR A CZ   1 
ATOM 2519 O OH   . TYR A 1 164 ? 54.577  78.097  33.090 1.00 24.48 ? 246 TYR A OH   1 
ATOM 2520 H H    . TYR A 1 164 ? 50.926  80.290  37.810 1.00 0.00  ? 246 TYR A H    1 
ATOM 2521 H HA   . TYR A 1 164 ? 49.342  78.284  36.302 1.00 0.00  ? 246 TYR A HA   1 
ATOM 2522 H HB2  . TYR A 1 164 ? 51.523  78.005  38.436 1.00 0.00  ? 246 TYR A HB2  1 
ATOM 2523 H HB3  . TYR A 1 164 ? 50.702  76.638  37.608 1.00 0.00  ? 246 TYR A HB3  1 
ATOM 2524 H HD1  . TYR A 1 164 ? 50.975  76.329  35.154 1.00 0.00  ? 246 TYR A HD1  1 
ATOM 2525 H HD2  . TYR A 1 164 ? 53.260  79.234  37.314 1.00 0.00  ? 246 TYR A HD2  1 
ATOM 2526 H HE1  . TYR A 1 164 ? 52.510  76.538  33.240 1.00 0.00  ? 246 TYR A HE1  1 
ATOM 2527 H HE2  . TYR A 1 164 ? 54.803  79.429  35.399 1.00 0.00  ? 246 TYR A HE2  1 
ATOM 2528 H HH   . TYR A 1 164 ? 55.305  78.690  33.218 1.00 0.00  ? 246 TYR A HH   1 
ATOM 2529 N N    . GLY A 1 165 ? 48.272  79.289  39.033 1.00 33.74 ? 247 GLY A N    1 
ATOM 2530 C CA   . GLY A 1 165 ? 47.297  79.078  40.098 1.00 29.45 ? 247 GLY A CA   1 
ATOM 2531 C C    . GLY A 1 165 ? 47.912  78.425  41.325 1.00 31.35 ? 247 GLY A C    1 
ATOM 2532 O O    . GLY A 1 165 ? 49.030  77.950  41.233 1.00 34.72 ? 247 GLY A O    1 
ATOM 2533 H H    . GLY A 1 165 ? 48.568  80.219  38.827 1.00 0.00  ? 247 GLY A H    1 
ATOM 2534 H HA2  . GLY A 1 165 ? 46.890  80.057  40.391 1.00 0.00  ? 247 GLY A HA2  1 
ATOM 2535 H HA3  . GLY A 1 165 ? 46.475  78.452  39.715 1.00 0.00  ? 247 GLY A HA3  1 
ATOM 2536 N N    . PRO A 1 166 ? 47.215  78.397  42.481 1.00 32.51 ? 248 PRO A N    1 
ATOM 2537 C CA   . PRO A 1 166 ? 47.748  77.731  43.661 1.00 34.40 ? 248 PRO A CA   1 
ATOM 2538 C C    . PRO A 1 166 ? 47.423  76.251  43.650 1.00 38.30 ? 248 PRO A C    1 
ATOM 2539 O O    . PRO A 1 166 ? 46.638  75.831  42.815 1.00 38.66 ? 248 PRO A O    1 
ATOM 2540 C CB   . PRO A 1 166 ? 46.960  78.449  44.765 1.00 34.40 ? 248 PRO A CB   1 
ATOM 2541 C CG   . PRO A 1 166 ? 45.593  78.642  44.113 1.00 31.95 ? 248 PRO A CG   1 
ATOM 2542 C CD   . PRO A 1 166 ? 45.956  79.103  42.697 1.00 32.50 ? 248 PRO A CD   1 
ATOM 2543 H HA   . PRO A 1 166 ? 48.818  77.903  43.789 1.00 0.00  ? 248 PRO A HA   1 
ATOM 2544 H HB2  . PRO A 1 166 ? 46.846  77.859  45.683 1.00 0.00  ? 248 PRO A HB2  1 
ATOM 2545 H HB3  . PRO A 1 166 ? 47.396  79.436  45.014 1.00 0.00  ? 248 PRO A HB3  1 
ATOM 2546 H HG2  . PRO A 1 166 ? 45.056  77.671  44.092 1.00 0.00  ? 248 PRO A HG2  1 
ATOM 2547 H HG3  . PRO A 1 166 ? 44.992  79.386  44.665 1.00 0.00  ? 248 PRO A HG3  1 
ATOM 2548 H HD2  . PRO A 1 166 ? 45.161  78.823  41.995 1.00 0.00  ? 248 PRO A HD2  1 
ATOM 2549 H HD3  . PRO A 1 166 ? 46.112  80.194  42.704 1.00 0.00  ? 248 PRO A HD3  1 
ATOM 2550 N N    . PRO A 1 167 ? 47.990  75.446  44.570 1.00 41.24 ? 249 PRO A N    1 
ATOM 2551 C CA   . PRO A 1 167 ? 47.693  74.029  44.548 1.00 44.29 ? 249 PRO A CA   1 
ATOM 2552 C C    . PRO A 1 167 ? 46.230  73.759  44.872 1.00 49.60 ? 249 PRO A C    1 
ATOM 2553 O O    . PRO A 1 167 ? 45.663  74.456  45.691 1.00 49.50 ? 249 PRO A O    1 
ATOM 2554 C CB   . PRO A 1 167 ? 48.677  73.477  45.595 1.00 41.02 ? 249 PRO A CB   1 
ATOM 2555 C CG   . PRO A 1 167 ? 48.810  74.645  46.577 1.00 42.53 ? 249 PRO A CG   1 
ATOM 2556 C CD   . PRO A 1 167 ? 48.883  75.864  45.646 1.00 40.14 ? 249 PRO A CD   1 
ATOM 2557 H HA   . PRO A 1 167 ? 47.986  73.653  43.570 1.00 0.00  ? 249 PRO A HA   1 
ATOM 2558 H HB2  . PRO A 1 167 ? 48.288  72.578  46.096 1.00 0.00  ? 249 PRO A HB2  1 
ATOM 2559 H HB3  . PRO A 1 167 ? 49.671  73.259  45.155 1.00 0.00  ? 249 PRO A HB3  1 
ATOM 2560 H HG2  . PRO A 1 167 ? 47.909  74.684  47.222 1.00 0.00  ? 249 PRO A HG2  1 
ATOM 2561 H HG3  . PRO A 1 167 ? 49.710  74.531  47.210 1.00 0.00  ? 249 PRO A HG3  1 
ATOM 2562 H HD2  . PRO A 1 167 ? 48.562  76.745  46.205 1.00 0.00  ? 249 PRO A HD2  1 
ATOM 2563 H HD3  . PRO A 1 167 ? 49.918  75.999  45.315 1.00 0.00  ? 249 PRO A HD3  1 
ATOM 2564 N N    . PRO A 1 168 ? 45.630  72.738  44.210 1.00 52.27 ? 250 PRO A N    1 
ATOM 2565 C CA   . PRO A 1 168 ? 44.245  72.342  44.406 1.00 53.70 ? 250 PRO A CA   1 
ATOM 2566 C C    . PRO A 1 168 ? 44.024  71.393  45.557 1.00 55.03 ? 250 PRO A C    1 
ATOM 2567 O O    . PRO A 1 168 ? 42.923  70.867  45.698 1.00 55.17 ? 250 PRO A O    1 
ATOM 2568 C CB   . PRO A 1 168 ? 43.965  71.607  43.077 1.00 52.33 ? 250 PRO A CB   1 
ATOM 2569 C CG   . PRO A 1 168 ? 45.306  70.938  42.775 1.00 50.50 ? 250 PRO A CG   1 
ATOM 2570 C CD   . PRO A 1 168 ? 46.268  72.048  43.124 1.00 49.61 ? 250 PRO A CD   1 
ATOM 2571 H HA   . PRO A 1 168 ? 43.580  73.203  44.490 1.00 0.00  ? 250 PRO A HA   1 
ATOM 2572 H HB2  . PRO A 1 168 ? 43.170  70.847  43.154 1.00 0.00  ? 250 PRO A HB2  1 
ATOM 2573 H HB3  . PRO A 1 168 ? 43.715  72.315  42.258 1.00 0.00  ? 250 PRO A HB3  1 
ATOM 2574 H HG2  . PRO A 1 168 ? 45.476  70.096  43.464 1.00 0.00  ? 250 PRO A HG2  1 
ATOM 2575 H HG3  . PRO A 1 168 ? 45.377  70.600  41.728 1.00 0.00  ? 250 PRO A HG3  1 
ATOM 2576 H HD2  . PRO A 1 168 ? 47.271  71.658  43.310 1.00 0.00  ? 250 PRO A HD2  1 
ATOM 2577 H HD3  . PRO A 1 168 ? 46.212  72.792  42.298 1.00 0.00  ? 250 PRO A HD3  1 
ATOM 2578 N N    . CYS B 2 1   ? 68.419  84.871  35.086 1.00 24.57 ? 301 CYS B N    1 
ATOM 2579 C CA   . CYS B 2 1   ? 69.824  85.144  35.334 1.00 27.57 ? 301 CYS B CA   1 
ATOM 2580 C C    . CYS B 2 1   ? 70.039  85.461  36.785 1.00 28.19 ? 301 CYS B C    1 
ATOM 2581 O O    . CYS B 2 1   ? 69.386  86.312  37.354 1.00 30.08 ? 301 CYS B O    1 
ATOM 2582 C CB   . CYS B 2 1   ? 70.279  86.346  34.488 1.00 30.80 ? 301 CYS B CB   1 
ATOM 2583 S SG   . CYS B 2 1   ? 72.034  86.756  34.576 1.00 29.91 ? 301 CYS B SG   1 
ATOM 2584 H HA   . CYS B 2 1   ? 70.414  84.276  35.026 1.00 0.00  ? 301 CYS B HA   1 
ATOM 2585 H HB2  . CYS B 2 1   ? 70.273  86.043  33.466 1.00 0.00  ? 301 CYS B HB2  1 
ATOM 2586 H HB3  . CYS B 2 1   ? 69.568  87.182  34.611 1.00 0.00  ? 301 CYS B HB3  1 
ATOM 2587 N N    . THR B 2 2   ? 70.998  84.766  37.402 1.00 26.56 ? 302 THR B N    1 
ATOM 2588 C CA   . THR B 2 2   ? 71.289  85.037  38.790 1.00 28.59 ? 302 THR B CA   1 
ATOM 2589 C C    . THR B 2 2   ? 72.775  85.238  38.859 1.00 29.74 ? 302 THR B C    1 
ATOM 2590 O O    . THR B 2 2   ? 73.502  84.632  38.096 1.00 29.56 ? 302 THR B O    1 
ATOM 2591 C CB   . THR B 2 2   ? 70.797  83.899  39.715 1.00 28.90 ? 302 THR B CB   1 
ATOM 2592 O OG1  . THR B 2 2   ? 70.889  84.287  41.088 1.00 29.11 ? 302 THR B OG1  1 
ATOM 2593 C CG2  . THR B 2 2   ? 71.672  82.657  39.497 1.00 30.08 ? 302 THR B CG2  1 
ATOM 2594 H H    . THR B 2 2   ? 71.529  84.073  36.925 1.00 0.00  ? 302 THR B H    1 
ATOM 2595 H HA   . THR B 2 2   ? 70.777  85.952  39.092 1.00 0.00  ? 302 THR B HA   1 
ATOM 2596 H HB   . THR B 2 2   ? 69.756  83.643  39.473 1.00 0.00  ? 302 THR B HB   1 
ATOM 2597 H HG1  . THR B 2 2   ? 70.828  85.235  41.166 1.00 0.00  ? 302 THR B HG1  1 
ATOM 2598 H HG21 . THR B 2 2   ? 71.813  82.473  38.428 1.00 0.00  ? 302 THR B HG21 1 
ATOM 2599 H HG22 . THR B 2 2   ? 71.170  81.796  39.938 1.00 0.00  ? 302 THR B HG22 1 
ATOM 2600 H HG23 . THR B 2 2   ? 72.652  82.811  39.970 1.00 0.00  ? 302 THR B HG23 1 
ATOM 2601 N N    . CYS B 2 3   ? 73.224  86.104  39.776 1.00 31.49 ? 303 CYS B N    1 
ATOM 2602 C CA   . CYS B 2 3   ? 74.624  86.350  39.879 1.00 35.04 ? 303 CYS B CA   1 
ATOM 2603 C C    . CYS B 2 3   ? 75.136  87.082  41.079 1.00 34.39 ? 303 CYS B C    1 
ATOM 2604 O O    . CYS B 2 3   ? 74.437  87.751  41.770 1.00 34.80 ? 303 CYS B O    1 
ATOM 2605 C CB   . CYS B 2 3   ? 75.110  87.094  38.636 1.00 40.28 ? 303 CYS B CB   1 
ATOM 2606 S SG   . CYS B 2 3   ? 74.093  88.461  38.125 1.00 44.00 ? 303 CYS B SG   1 
ATOM 2607 H H    . CYS B 2 3   ? 72.615  86.599  40.364 1.00 0.00  ? 303 CYS B H    1 
ATOM 2608 H HA   . CYS B 2 3   ? 75.111  85.378  39.896 1.00 0.00  ? 303 CYS B HA   1 
ATOM 2609 H HB2  . CYS B 2 3   ? 76.084  87.554  38.772 1.00 0.00  ? 303 CYS B HB2  1 
ATOM 2610 H HB3  . CYS B 2 3   ? 75.118  86.404  37.803 1.00 0.00  ? 303 CYS B HB3  1 
ATOM 2611 N N    . VAL B 2 4   ? 76.435  86.922  41.340 1.00 31.04 ? 304 VAL B N    1 
ATOM 2612 C CA   . VAL B 2 4   ? 77.065  87.599  42.442 1.00 29.37 ? 304 VAL B CA   1 
ATOM 2613 C C    . VAL B 2 4   ? 77.778  88.786  41.839 1.00 29.18 ? 304 VAL B C    1 
ATOM 2614 O O    . VAL B 2 4   ? 78.683  88.596  41.047 1.00 28.62 ? 304 VAL B O    1 
ATOM 2615 C CB   . VAL B 2 4   ? 78.016  86.653  43.196 1.00 30.30 ? 304 VAL B CB   1 
ATOM 2616 C CG1  . VAL B 2 4   ? 79.238  86.312  42.321 1.00 32.83 ? 304 VAL B CG1  1 
ATOM 2617 C CG2  . VAL B 2 4   ? 78.493  87.332  44.496 1.00 30.71 ? 304 VAL B CG2  1 
ATOM 2618 H H    . VAL B 2 4   ? 76.950  86.353  40.739 1.00 0.00  ? 304 VAL B H    1 
ATOM 2619 H HA   . VAL B 2 4   ? 76.294  87.878  43.158 1.00 0.00  ? 304 VAL B HA   1 
ATOM 2620 H HB   . VAL B 2 4   ? 77.483  85.726  43.447 1.00 0.00  ? 304 VAL B HB   1 
ATOM 2621 H HG11 . VAL B 2 4   ? 78.952  86.172  41.280 1.00 0.00  ? 304 VAL B HG11 1 
ATOM 2622 H HG12 . VAL B 2 4   ? 79.699  85.387  42.671 1.00 0.00  ? 304 VAL B HG12 1 
ATOM 2623 H HG13 . VAL B 2 4   ? 79.975  87.121  42.363 1.00 0.00  ? 304 VAL B HG13 1 
ATOM 2624 H HG21 . VAL B 2 4   ? 77.625  87.638  45.094 1.00 0.00  ? 304 VAL B HG21 1 
ATOM 2625 H HG22 . VAL B 2 4   ? 79.091  88.219  44.250 1.00 0.00  ? 304 VAL B HG22 1 
ATOM 2626 H HG23 . VAL B 2 4   ? 79.103  86.627  45.074 1.00 0.00  ? 304 VAL B HG23 1 
ATOM 2627 N N    . PRO B 2 5   ? 77.370  90.013  42.187 1.00 33.14 ? 305 PRO B N    1 
ATOM 2628 C CA   . PRO B 2 5   ? 78.010  91.183  41.632 1.00 35.48 ? 305 PRO B CA   1 
ATOM 2629 C C    . PRO B 2 5   ? 79.461  91.311  42.034 1.00 36.83 ? 305 PRO B C    1 
ATOM 2630 O O    . PRO B 2 5   ? 79.882  90.682  42.989 1.00 39.45 ? 305 PRO B O    1 
ATOM 2631 C CB   . PRO B 2 5   ? 77.153  92.316  42.225 1.00 36.51 ? 305 PRO B CB   1 
ATOM 2632 C CG   . PRO B 2 5   ? 76.472  91.741  43.461 1.00 35.64 ? 305 PRO B CG   1 
ATOM 2633 C CD   . PRO B 2 5   ? 76.256  90.277  43.099 1.00 35.07 ? 305 PRO B CD   1 
ATOM 2634 H HA   . PRO B 2 5   ? 77.909  91.193  40.546 1.00 0.00  ? 305 PRO B HA   1 
ATOM 2635 H HB2  . PRO B 2 5   ? 77.756  93.185  42.520 1.00 0.00  ? 305 PRO B HB2  1 
ATOM 2636 H HB3  . PRO B 2 5   ? 76.363  92.624  41.521 1.00 0.00  ? 305 PRO B HB3  1 
ATOM 2637 H HG2  . PRO B 2 5   ? 77.150  91.836  44.330 1.00 0.00  ? 305 PRO B HG2  1 
ATOM 2638 H HG3  . PRO B 2 5   ? 75.516  92.253  43.665 1.00 0.00  ? 305 PRO B HG3  1 
ATOM 2639 H HD2  . PRO B 2 5   ? 76.297  89.750  44.055 1.00 0.00  ? 305 PRO B HD2  1 
ATOM 2640 H HD3  . PRO B 2 5   ? 75.293  90.152  42.595 1.00 0.00  ? 305 PRO B HD3  1 
ATOM 2641 N N    . PRO B 2 6   ? 80.243  92.126  41.306 1.00 36.37 ? 306 PRO B N    1 
ATOM 2642 C CA   . PRO B 2 6   ? 81.634  92.268  41.651 1.00 32.48 ? 306 PRO B CA   1 
ATOM 2643 C C    . PRO B 2 6   ? 81.799  93.409  42.616 1.00 30.71 ? 306 PRO B C    1 
ATOM 2644 O O    . PRO B 2 6   ? 80.969  94.282  42.736 1.00 30.94 ? 306 PRO B O    1 
ATOM 2645 C CB   . PRO B 2 6   ? 82.232  92.648  40.290 1.00 29.98 ? 306 PRO B CB   1 
ATOM 2646 C CG   . PRO B 2 6   ? 81.139  93.526  39.675 1.00 30.17 ? 306 PRO B CG   1 
ATOM 2647 C CD   . PRO B 2 6   ? 79.812  92.895  40.142 1.00 34.01 ? 306 PRO B CD   1 
ATOM 2648 H HA   . PRO B 2 6   ? 82.072  91.338  42.023 1.00 0.00  ? 306 PRO B HA   1 
ATOM 2649 H HB2  . PRO B 2 6   ? 83.180  93.197  40.390 1.00 0.00  ? 306 PRO B HB2  1 
ATOM 2650 H HB3  . PRO B 2 6   ? 82.371  91.755  39.659 1.00 0.00  ? 306 PRO B HB3  1 
ATOM 2651 H HG2  . PRO B 2 6   ? 81.235  94.539  40.086 1.00 0.00  ? 306 PRO B HG2  1 
ATOM 2652 H HG3  . PRO B 2 6   ? 81.233  93.547  38.579 1.00 0.00  ? 306 PRO B HG3  1 
ATOM 2653 H HD2  . PRO B 2 6   ? 79.094  93.687  40.390 1.00 0.00  ? 306 PRO B HD2  1 
ATOM 2654 H HD3  . PRO B 2 6   ? 79.440  92.257  39.333 1.00 0.00  ? 306 PRO B HD3  1 
ATOM 2655 N N    . HIS B 2 7   ? 82.920  93.382  43.329 1.00 27.16 ? 307 HIS B N    1 
ATOM 2656 C CA   . HIS B 2 7   ? 83.336  94.465  44.184 1.00 27.90 ? 307 HIS B CA   1 
ATOM 2657 C C    . HIS B 2 7   ? 83.726  95.562  43.193 1.00 30.50 ? 307 HIS B C    1 
ATOM 2658 O O    . HIS B 2 7   ? 84.128  95.282  42.081 1.00 34.84 ? 307 HIS B O    1 
ATOM 2659 C CB   . HIS B 2 7   ? 84.525  94.022  45.081 1.00 28.48 ? 307 HIS B CB   1 
ATOM 2660 C CG   . HIS B 2 7   ? 84.570  94.795  46.375 1.00 25.95 ? 307 HIS B CG   1 
ATOM 2661 N ND1  . HIS B 2 7   ? 85.532  95.679  46.658 1.00 26.48 ? 307 HIS B ND1  1 
ATOM 2662 C CD2  . HIS B 2 7   ? 83.705  94.733  47.403 1.00 26.63 ? 307 HIS B CD2  1 
ATOM 2663 C CE1  . HIS B 2 7   ? 85.297  96.186  47.848 1.00 27.81 ? 307 HIS B CE1  1 
ATOM 2664 N NE2  . HIS B 2 7   ? 84.260  95.684  48.330 1.00 27.94 ? 307 HIS B NE2  1 
ATOM 2665 H H    . HIS B 2 7   ? 83.465  92.565  43.323 1.00 0.00  ? 307 HIS B H    1 
ATOM 2666 H HA   . HIS B 2 7   ? 82.501  94.762  44.826 1.00 0.00  ? 307 HIS B HA   1 
ATOM 2667 H HB2  . HIS B 2 7   ? 84.433  92.937  45.287 1.00 0.00  ? 307 HIS B HB2  1 
ATOM 2668 H HB3  . HIS B 2 7   ? 85.455  94.169  44.516 1.00 0.00  ? 307 HIS B HB3  1 
ATOM 2669 H HD2  . HIS B 2 7   ? 82.819  94.145  47.534 1.00 0.00  ? 307 HIS B HD2  1 
ATOM 2670 H HE1  . HIS B 2 7   ? 85.910  96.923  48.331 1.00 0.00  ? 307 HIS B HE1  1 
ATOM 2671 N N    . PRO B 2 8   ? 83.612  96.859  43.477 1.00 27.90 ? 308 PRO B N    1 
ATOM 2672 C CA   . PRO B 2 8   ? 84.035  97.835  42.475 1.00 24.48 ? 308 PRO B CA   1 
ATOM 2673 C C    . PRO B 2 8   ? 85.421  97.618  41.918 1.00 25.83 ? 308 PRO B C    1 
ATOM 2674 O O    . PRO B 2 8   ? 85.645  97.793  40.739 1.00 27.42 ? 308 PRO B O    1 
ATOM 2675 C CB   . PRO B 2 8   ? 83.965  99.124  43.294 1.00 21.69 ? 308 PRO B CB   1 
ATOM 2676 C CG   . PRO B 2 8   ? 82.800  98.828  44.201 1.00 25.09 ? 308 PRO B CG   1 
ATOM 2677 C CD   . PRO B 2 8   ? 82.992  97.397  44.665 1.00 27.56 ? 308 PRO B CD   1 
ATOM 2678 H HA   . PRO B 2 8   ? 83.287  97.867  41.677 1.00 0.00  ? 308 PRO B HA   1 
ATOM 2679 H HB2  . PRO B 2 8   ? 84.866  99.273  43.915 1.00 0.00  ? 308 PRO B HB2  1 
ATOM 2680 H HB3  . PRO B 2 8   ? 83.793  100.013 42.664 1.00 0.00  ? 308 PRO B HB3  1 
ATOM 2681 H HG2  . PRO B 2 8   ? 82.820  99.538  45.014 1.00 0.00  ? 308 PRO B HG2  1 
ATOM 2682 H HG3  . PRO B 2 8   ? 81.888  98.986  43.642 1.00 0.00  ? 308 PRO B HG3  1 
ATOM 2683 H HD2  . PRO B 2 8   ? 83.667  97.393  45.532 1.00 0.00  ? 308 PRO B HD2  1 
ATOM 2684 H HD3  . PRO B 2 8   ? 82.020  96.955  44.923 1.00 0.00  ? 308 PRO B HD3  1 
ATOM 2685 N N    . GLN B 2 9   ? 86.383  97.243  42.767 1.00 26.53 ? 309 GLN B N    1 
ATOM 2686 C CA   . GLN B 2 9   ? 87.741  97.006  42.274 1.00 25.18 ? 309 GLN B CA   1 
ATOM 2687 C C    . GLN B 2 9   ? 87.796  95.908  41.231 1.00 27.54 ? 309 GLN B C    1 
ATOM 2688 O O    . GLN B 2 9   ? 88.424  96.060  40.202 1.00 30.49 ? 309 GLN B O    1 
ATOM 2689 C CB   . GLN B 2 9   ? 88.681  96.641  43.444 1.00 23.20 ? 309 GLN B CB   1 
ATOM 2690 C CG   . GLN B 2 9   ? 90.048  96.155  42.932 1.00 19.75 ? 309 GLN B CG   1 
ATOM 2691 C CD   . GLN B 2 9   ? 91.091  96.069  44.020 1.00 24.00 ? 309 GLN B CD   1 
ATOM 2692 O OE1  . GLN B 2 9   ? 90.968  96.672  45.073 1.00 22.92 ? 309 GLN B OE1  1 
ATOM 2693 N NE2  . GLN B 2 9   ? 92.152  95.297  43.742 1.00 28.52 ? 309 GLN B NE2  1 
ATOM 2694 H H    . GLN B 2 9   ? 86.177  97.134  43.739 1.00 0.00  ? 309 GLN B H    1 
ATOM 2695 H HA   . GLN B 2 9   ? 88.110  97.933  41.817 1.00 0.00  ? 309 GLN B HA   1 
ATOM 2696 H HB2  . GLN B 2 9   ? 88.830  97.532  44.073 1.00 0.00  ? 309 GLN B HB2  1 
ATOM 2697 H HB3  . GLN B 2 9   ? 88.229  95.838  44.051 1.00 0.00  ? 309 GLN B HB3  1 
ATOM 2698 H HG2  . GLN B 2 9   ? 89.915  95.156  42.486 1.00 0.00  ? 309 GLN B HG2  1 
ATOM 2699 H HG3  . GLN B 2 9   ? 90.407  96.855  42.162 1.00 0.00  ? 309 GLN B HG3  1 
ATOM 2700 H HE21 . GLN B 2 9   ? 92.219  94.822  42.863 1.00 0.00  ? 309 GLN B HE21 1 
ATOM 2701 H HE22 . GLN B 2 9   ? 92.877  95.192  44.422 1.00 0.00  ? 309 GLN B HE22 1 
ATOM 2702 N N    . THR B 2 10  ? 87.161  94.768  41.507 1.00 28.47 ? 310 THR B N    1 
ATOM 2703 C CA   . THR B 2 10  ? 87.142  93.694  40.516 1.00 27.00 ? 310 THR B CA   1 
ATOM 2704 C C    . THR B 2 10  ? 86.414  94.174  39.277 1.00 25.48 ? 310 THR B C    1 
ATOM 2705 O O    . THR B 2 10  ? 86.781  93.814  38.173 1.00 29.09 ? 310 THR B O    1 
ATOM 2706 C CB   . THR B 2 10  ? 86.575  92.350  41.034 1.00 22.98 ? 310 THR B CB   1 
ATOM 2707 O OG1  . THR B 2 10  ? 85.922  91.631  39.979 1.00 25.10 ? 310 THR B OG1  1 
ATOM 2708 C CG2  . THR B 2 10  ? 85.599  92.505  42.158 1.00 28.45 ? 310 THR B CG2  1 
ATOM 2709 H H    . THR B 2 10  ? 86.736  94.720  42.408 1.00 0.00  ? 310 THR B H    1 
ATOM 2710 H HA   . THR B 2 10  ? 88.181  93.490  40.238 1.00 0.00  ? 310 THR B HA   1 
ATOM 2711 H HB   . THR B 2 10  ? 87.387  91.740  41.458 1.00 0.00  ? 310 THR B HB   1 
ATOM 2712 H HG1  . THR B 2 10  ? 85.571  90.804  40.298 1.00 0.00  ? 310 THR B HG1  1 
ATOM 2713 H HG21 . THR B 2 10  ? 85.133  93.483  42.061 1.00 0.00  ? 310 THR B HG21 1 
ATOM 2714 H HG22 . THR B 2 10  ? 84.788  91.813  42.001 1.00 0.00  ? 310 THR B HG22 1 
ATOM 2715 H HG23 . THR B 2 10  ? 86.056  92.429  43.140 1.00 0.00  ? 310 THR B HG23 1 
ATOM 2716 N N    . ALA B 2 11  ? 85.384  95.015  39.477 1.00 23.69 ? 311 ALA B N    1 
ATOM 2717 C CA   . ALA B 2 11  ? 84.643  95.581  38.353 1.00 23.24 ? 311 ALA B CA   1 
ATOM 2718 C C    . ALA B 2 11  ? 85.593  96.368  37.471 1.00 23.78 ? 311 ALA B C    1 
ATOM 2719 O O    . ALA B 2 11  ? 85.534  96.288  36.260 1.00 25.04 ? 311 ALA B O    1 
ATOM 2720 C CB   . ALA B 2 11  ? 83.522  96.498  38.873 1.00 17.60 ? 311 ALA B CB   1 
ATOM 2721 H H    . ALA B 2 11  ? 85.139  95.294  40.406 1.00 0.00  ? 311 ALA B H    1 
ATOM 2722 H HA   . ALA B 2 11  ? 84.183  94.768  37.776 1.00 0.00  ? 311 ALA B HA   1 
ATOM 2723 H HB1  . ALA B 2 11  ? 82.960  96.921  38.036 1.00 0.00  ? 311 ALA B HB1  1 
ATOM 2724 H HB2  . ALA B 2 11  ? 82.851  95.933  39.527 1.00 0.00  ? 311 ALA B HB2  1 
ATOM 2725 H HB3  . ALA B 2 11  ? 83.933  97.326  39.446 1.00 0.00  ? 311 ALA B HB3  1 
ATOM 2726 N N    . PHE B 2 12  ? 86.490  97.134  38.112 1.00 24.68 ? 312 PHE B N    1 
ATOM 2727 C CA   . PHE B 2 12  ? 87.452  97.946  37.372 1.00 23.76 ? 312 PHE B CA   1 
ATOM 2728 C C    . PHE B 2 12  ? 88.521  97.119  36.683 1.00 25.67 ? 312 PHE B C    1 
ATOM 2729 O O    . PHE B 2 12  ? 88.829  97.335  35.524 1.00 30.13 ? 312 PHE B O    1 
ATOM 2730 C CB   . PHE B 2 12  ? 88.093  98.959  38.345 1.00 20.05 ? 312 PHE B CB   1 
ATOM 2731 C CG   . PHE B 2 12  ? 89.086  99.862  37.650 1.00 19.16 ? 312 PHE B CG   1 
ATOM 2732 C CD1  . PHE B 2 12  ? 90.380  99.425  37.453 1.00 18.14 ? 312 PHE B CD1  1 
ATOM 2733 C CD2  . PHE B 2 12  ? 88.707  101.118 37.175 1.00 19.78 ? 312 PHE B CD2  1 
ATOM 2734 C CE1  . PHE B 2 12  ? 91.249  100.209 36.714 1.00 14.62 ? 312 PHE B CE1  1 
ATOM 2735 C CE2  . PHE B 2 12  ? 89.605  101.936 36.497 1.00 15.40 ? 312 PHE B CE2  1 
ATOM 2736 C CZ   . PHE B 2 12  ? 90.902  101.488 36.272 1.00 14.12 ? 312 PHE B CZ   1 
ATOM 2737 H H    . PHE B 2 12  ? 86.500  97.147  39.114 1.00 0.00  ? 312 PHE B H    1 
ATOM 2738 H HA   . PHE B 2 12  ? 86.908  98.506  36.603 1.00 0.00  ? 312 PHE B HA   1 
ATOM 2739 H HB2  . PHE B 2 12  ? 87.302  99.585  38.785 1.00 0.00  ? 312 PHE B HB2  1 
ATOM 2740 H HB3  . PHE B 2 12  ? 88.618  98.423  39.150 1.00 0.00  ? 312 PHE B HB3  1 
ATOM 2741 H HD1  . PHE B 2 12  ? 90.717  98.464  37.814 1.00 0.00  ? 312 PHE B HD1  1 
ATOM 2742 H HD2  . PHE B 2 12  ? 87.705  101.448 37.320 1.00 0.00  ? 312 PHE B HD2  1 
ATOM 2743 H HE1  . PHE B 2 12  ? 92.188  99.711  36.499 1.00 0.00  ? 312 PHE B HE1  1 
ATOM 2744 H HE2  . PHE B 2 12  ? 89.285  102.902 36.130 1.00 0.00  ? 312 PHE B HE2  1 
ATOM 2745 H HZ   . PHE B 2 12  ? 91.605  102.107 35.725 1.00 0.00  ? 312 PHE B HZ   1 
ATOM 2746 N N    . CYS B 2 13  ? 89.116  96.160  37.398 1.00 22.69 ? 313 CYS B N    1 
ATOM 2747 C CA   . CYS B 2 13  ? 90.187  95.393  36.778 1.00 25.94 ? 313 CYS B CA   1 
ATOM 2748 C C    . CYS B 2 13  ? 89.747  94.525  35.616 1.00 26.38 ? 313 CYS B C    1 
ATOM 2749 O O    . CYS B 2 13  ? 90.344  94.558  34.554 1.00 32.62 ? 313 CYS B O    1 
ATOM 2750 C CB   . CYS B 2 13  ? 90.879  94.532  37.840 1.00 25.68 ? 313 CYS B CB   1 
ATOM 2751 S SG   . CYS B 2 13  ? 91.505  95.589  39.184 1.00 29.04 ? 313 CYS B SG   1 
ATOM 2752 H H    . CYS B 2 13  ? 88.856  95.993  38.354 1.00 0.00  ? 313 CYS B H    1 
ATOM 2753 H HA   . CYS B 2 13  ? 90.921  96.104  36.383 1.00 0.00  ? 313 CYS B HA   1 
ATOM 2754 H HB2  . CYS B 2 13  ? 90.160  93.810  38.256 1.00 0.00  ? 313 CYS B HB2  1 
ATOM 2755 H HB3  . CYS B 2 13  ? 91.716  93.997  37.371 1.00 0.00  ? 313 CYS B HB3  1 
ATOM 2756 N N    . ASN B 2 14  ? 88.695  93.724  35.824 1.00 28.62 ? 314 ASN B N    1 
ATOM 2757 C CA   . ASN B 2 14  ? 88.276  92.799  34.773 1.00 27.92 ? 314 ASN B CA   1 
ATOM 2758 C C    . ASN B 2 14  ? 87.524  93.398  33.603 1.00 27.19 ? 314 ASN B C    1 
ATOM 2759 O O    . ASN B 2 14  ? 87.390  92.764  32.569 1.00 28.07 ? 314 ASN B O    1 
ATOM 2760 C CB   . ASN B 2 14  ? 87.499  91.650  35.415 1.00 28.25 ? 314 ASN B CB   1 
ATOM 2761 C CG   . ASN B 2 14  ? 88.376  90.943  36.423 1.00 32.71 ? 314 ASN B CG   1 
ATOM 2762 O OD1  . ASN B 2 14  ? 89.408  90.392  36.080 1.00 35.09 ? 314 ASN B OD1  1 
ATOM 2763 N ND2  . ASN B 2 14  ? 87.953  90.972  37.695 1.00 34.31 ? 314 ASN B ND2  1 
ATOM 2764 H H    . ASN B 2 14  ? 88.208  93.753  36.702 1.00 0.00  ? 314 ASN B H    1 
ATOM 2765 H HA   . ASN B 2 14  ? 89.187  92.374  34.338 1.00 0.00  ? 314 ASN B HA   1 
ATOM 2766 H HB2  . ASN B 2 14  ? 86.600  92.061  35.899 1.00 0.00  ? 314 ASN B HB2  1 
ATOM 2767 H HB3  . ASN B 2 14  ? 87.194  90.945  34.633 1.00 0.00  ? 314 ASN B HB3  1 
ATOM 2768 H HD21 . ASN B 2 14  ? 87.118  91.460  37.951 1.00 0.00  ? 314 ASN B HD21 1 
ATOM 2769 H HD22 . ASN B 2 14  ? 88.484  90.509  38.403 1.00 0.00  ? 314 ASN B HD22 1 
ATOM 2770 N N    . SER B 2 15  ? 87.036  94.633  33.762 1.00 21.69 ? 315 SER B N    1 
ATOM 2771 C CA   . SER B 2 15  ? 86.333  95.266  32.665 1.00 19.68 ? 315 SER B CA   1 
ATOM 2772 C C    . SER B 2 15  ? 87.315  95.738  31.626 1.00 22.42 ? 315 SER B C    1 
ATOM 2773 O O    . SER B 2 15  ? 88.499  95.837  31.890 1.00 28.64 ? 315 SER B O    1 
ATOM 2774 C CB   . SER B 2 15  ? 85.521  96.438  33.202 1.00 25.01 ? 315 SER B CB   1 
ATOM 2775 O OG   . SER B 2 15  ? 84.562  95.799  34.039 1.00 29.75 ? 315 SER B OG   1 
ATOM 2776 H H    . SER B 2 15  ? 87.180  95.139  34.611 1.00 0.00  ? 315 SER B H    1 
ATOM 2777 H HA   . SER B 2 15  ? 85.640  94.537  32.207 1.00 0.00  ? 315 SER B HA   1 
ATOM 2778 H HB2  . SER B 2 15  ? 86.169  97.119  33.773 1.00 0.00  ? 315 SER B HB2  1 
ATOM 2779 H HB3  . SER B 2 15  ? 85.033  96.976  32.378 1.00 0.00  ? 315 SER B HB3  1 
ATOM 2780 H HG   . SER B 2 15  ? 83.958  96.454  34.350 1.00 0.00  ? 315 SER B HG   1 
ATOM 2781 N N    . ASP B 2 16  ? 86.794  96.015  30.423 1.00 23.87 ? 316 ASP B N    1 
ATOM 2782 C CA   . ASP B 2 16  ? 87.627  96.528  29.343 1.00 23.54 ? 316 ASP B CA   1 
ATOM 2783 C C    . ASP B 2 16  ? 87.541  98.039  29.306 1.00 23.60 ? 316 ASP B C    1 
ATOM 2784 O O    . ASP B 2 16  ? 88.522  98.697  29.000 1.00 23.72 ? 316 ASP B O    1 
ATOM 2785 C CB   . ASP B 2 16  ? 87.178  95.922  27.998 1.00 28.66 ? 316 ASP B CB   1 
ATOM 2786 C CG   . ASP B 2 16  ? 87.547  94.457  27.876 1.00 34.25 ? 316 ASP B CG   1 
ATOM 2787 O OD1  . ASP B 2 16  ? 88.762  94.154  27.781 1.00 37.98 ? 316 ASP B OD1  1 
ATOM 2788 O OD2  . ASP B 2 16  ? 86.638  93.590  27.862 1.00 36.68 ? 316 ASP B OD2  1 
ATOM 2789 H H    . ASP B 2 16  ? 85.819  95.862  30.264 1.00 0.00  ? 316 ASP B H    1 
ATOM 2790 H HA   . ASP B 2 16  ? 88.673  96.240  29.515 1.00 0.00  ? 316 ASP B HA   1 
ATOM 2791 H HB2  . ASP B 2 16  ? 86.092  96.043  27.896 1.00 0.00  ? 316 ASP B HB2  1 
ATOM 2792 H HB3  . ASP B 2 16  ? 87.668  96.478  27.186 1.00 0.00  ? 316 ASP B HB3  1 
ATOM 2793 N N    . LEU B 2 17  ? 86.359  98.589  29.615 1.00 20.99 ? 317 LEU B N    1 
ATOM 2794 C CA   . LEU B 2 17  ? 86.189  100.030 29.630 1.00 22.32 ? 317 LEU B CA   1 
ATOM 2795 C C    . LEU B 2 17  ? 85.418  100.412 30.872 1.00 25.34 ? 317 LEU B C    1 
ATOM 2796 O O    . LEU B 2 17  ? 84.463  99.751  31.233 1.00 27.09 ? 317 LEU B O    1 
ATOM 2797 C CB   . LEU B 2 17  ? 85.321  100.518 28.467 1.00 25.46 ? 317 LEU B CB   1 
ATOM 2798 C CG   . LEU B 2 17  ? 85.958  100.850 27.114 1.00 30.62 ? 317 LEU B CG   1 
ATOM 2799 C CD1  . LEU B 2 17  ? 86.373  99.585  26.386 1.00 32.72 ? 317 LEU B CD1  1 
ATOM 2800 C CD2  . LEU B 2 17  ? 84.922  101.544 26.246 1.00 28.57 ? 317 LEU B CD2  1 
ATOM 2801 H H    . LEU B 2 17  ? 85.567  98.030  29.846 1.00 0.00  ? 317 LEU B H    1 
ATOM 2802 H HA   . LEU B 2 17  ? 87.164  100.531 29.603 1.00 0.00  ? 317 LEU B HA   1 
ATOM 2803 H HB2  . LEU B 2 17  ? 84.589  99.731  28.285 1.00 0.00  ? 317 LEU B HB2  1 
ATOM 2804 H HB3  . LEU B 2 17  ? 84.814  101.425 28.801 1.00 0.00  ? 317 LEU B HB3  1 
ATOM 2805 H HG   . LEU B 2 17  ? 86.827  101.488 27.238 1.00 0.00  ? 317 LEU B HG   1 
ATOM 2806 H HD11 . LEU B 2 17  ? 85.464  98.987  26.268 1.00 0.00  ? 317 LEU B HD11 1 
ATOM 2807 H HD12 . LEU B 2 17  ? 86.791  99.844  25.408 1.00 0.00  ? 317 LEU B HD12 1 
ATOM 2808 H HD13 . LEU B 2 17  ? 87.113  99.051  26.983 1.00 0.00  ? 317 LEU B HD13 1 
ATOM 2809 H HD21 . LEU B 2 17  ? 84.572  102.478 26.706 1.00 0.00  ? 317 LEU B HD21 1 
ATOM 2810 H HD22 . LEU B 2 17  ? 85.313  101.862 25.298 1.00 0.00  ? 317 LEU B HD22 1 
ATOM 2811 H HD23 . LEU B 2 17  ? 84.026  100.962 26.136 1.00 0.00  ? 317 LEU B HD23 1 
ATOM 2812 N N    . VAL B 2 18  ? 85.847  101.530 31.487 1.00 22.62 ? 318 VAL B N    1 
ATOM 2813 C CA   . VAL B 2 18  ? 85.167  102.052 32.651 1.00 21.73 ? 318 VAL B CA   1 
ATOM 2814 C C    . VAL B 2 18  ? 84.897  103.479 32.256 1.00 27.32 ? 318 VAL B C    1 
ATOM 2815 O O    . VAL B 2 18  ? 85.686  104.381 32.460 1.00 34.35 ? 318 VAL B O    1 
ATOM 2816 C CB   . VAL B 2 18  ? 86.033  101.948 33.907 1.00 17.42 ? 318 VAL B CB   1 
ATOM 2817 C CG1  . VAL B 2 18  ? 85.254  102.448 35.124 1.00 16.51 ? 318 VAL B CG1  1 
ATOM 2818 C CG2  . VAL B 2 18  ? 86.436  100.488 34.118 1.00 9.95  ? 318 VAL B CG2  1 
ATOM 2819 H H    . VAL B 2 18  ? 86.637  102.031 31.141 1.00 0.00  ? 318 VAL B H    1 
ATOM 2820 H HA   . VAL B 2 18  ? 84.237  101.497 32.854 1.00 0.00  ? 318 VAL B HA   1 
ATOM 2821 H HB   . VAL B 2 18  ? 86.919  102.582 33.794 1.00 0.00  ? 318 VAL B HB   1 
ATOM 2822 H HG11 . VAL B 2 18  ? 84.348  101.838 35.241 1.00 0.00  ? 318 VAL B HG11 1 
ATOM 2823 H HG12 . VAL B 2 18  ? 85.886  102.356 36.016 1.00 0.00  ? 318 VAL B HG12 1 
ATOM 2824 H HG13 . VAL B 2 18  ? 84.982  103.499 34.965 1.00 0.00  ? 318 VAL B HG13 1 
ATOM 2825 H HG21 . VAL B 2 18  ? 86.983  100.130 33.239 1.00 0.00  ? 318 VAL B HG21 1 
ATOM 2826 H HG22 . VAL B 2 18  ? 87.072  100.423 35.011 1.00 0.00  ? 318 VAL B HG22 1 
ATOM 2827 H HG23 . VAL B 2 18  ? 85.533  99.876  34.248 1.00 0.00  ? 318 VAL B HG23 1 
ATOM 2828 N N    . ILE B 2 19  ? 83.730  103.599 31.625 1.00 32.50 ? 319 ILE B N    1 
ATOM 2829 C CA   . ILE B 2 19  ? 83.226  104.846 31.120 1.00 34.26 ? 319 ILE B CA   1 
ATOM 2830 C C    . ILE B 2 19  ? 82.294  105.501 32.107 1.00 38.69 ? 319 ILE B C    1 
ATOM 2831 O O    . ILE B 2 19  ? 81.853  104.871 33.047 1.00 42.68 ? 319 ILE B O    1 
ATOM 2832 C CB   . ILE B 2 19  ? 82.550  104.508 29.759 1.00 32.84 ? 319 ILE B CB   1 
ATOM 2833 C CG1  . ILE B 2 19  ? 83.284  105.158 28.589 1.00 37.53 ? 319 ILE B CG1  1 
ATOM 2834 C CG2  . ILE B 2 19  ? 81.060  104.841 29.728 1.00 33.48 ? 319 ILE B CG2  1 
ATOM 2835 C CD1  . ILE B 2 19  ? 84.613  104.559 28.474 1.00 42.21 ? 319 ILE B CD1  1 
ATOM 2836 H H    . ILE B 2 19  ? 83.188  102.776 31.472 1.00 0.00  ? 319 ILE B H    1 
ATOM 2837 H HA   . ILE B 2 19  ? 84.043  105.538 30.967 1.00 0.00  ? 319 ILE B HA   1 
ATOM 2838 H HB   . ILE B 2 19  ? 82.605  103.424 29.564 1.00 0.00  ? 319 ILE B HB   1 
ATOM 2839 H HG12 . ILE B 2 19  ? 82.742  105.001 27.646 1.00 0.00  ? 319 ILE B HG12 1 
ATOM 2840 H HG13 . ILE B 2 19  ? 83.463  106.216 28.802 1.00 0.00  ? 319 ILE B HG13 1 
ATOM 2841 H HG21 . ILE B 2 19  ? 80.912  105.910 29.911 1.00 0.00  ? 319 ILE B HG21 1 
ATOM 2842 H HG22 . ILE B 2 19  ? 80.639  104.587 28.744 1.00 0.00  ? 319 ILE B HG22 1 
ATOM 2843 H HG23 . ILE B 2 19  ? 80.554  104.256 30.506 1.00 0.00  ? 319 ILE B HG23 1 
ATOM 2844 H HD11 . ILE B 2 19  ? 84.545  103.494 28.363 1.00 0.00  ? 319 ILE B HD11 1 
ATOM 2845 H HD12 . ILE B 2 19  ? 85.099  105.055 27.633 1.00 0.00  ? 319 ILE B HD12 1 
ATOM 2846 H HD13 . ILE B 2 19  ? 85.102  104.628 29.414 1.00 0.00  ? 319 ILE B HD13 1 
ATOM 2847 N N    . ARG B 2 20  ? 81.991  106.784 31.862 1.00 37.10 ? 320 ARG B N    1 
ATOM 2848 C CA   . ARG B 2 20  ? 80.989  107.502 32.631 1.00 33.88 ? 320 ARG B CA   1 
ATOM 2849 C C    . ARG B 2 20  ? 80.098  108.041 31.533 1.00 34.53 ? 320 ARG B C    1 
ATOM 2850 O O    . ARG B 2 20  ? 80.616  108.593 30.576 1.00 33.39 ? 320 ARG B O    1 
ATOM 2851 C CB   . ARG B 2 20  ? 81.632  108.629 33.454 1.00 31.98 ? 320 ARG B CB   1 
ATOM 2852 C CG   . ARG B 2 20  ? 80.597  109.508 34.171 1.00 36.19 ? 320 ARG B CG   1 
ATOM 2853 C CD   . ARG B 2 20  ? 80.840  109.565 35.689 1.00 37.25 ? 320 ARG B CD   1 
ATOM 2854 N NE   . ARG B 2 20  ? 81.978  110.397 36.081 1.00 39.88 ? 320 ARG B NE   1 
ATOM 2855 C CZ   . ARG B 2 20  ? 81.925  111.702 36.254 1.00 39.32 ? 320 ARG B CZ   1 
ATOM 2856 N NH1  . ARG B 2 20  ? 80.832  112.391 36.026 1.00 38.48 ? 320 ARG B NH1  1 
ATOM 2857 N NH2  . ARG B 2 20  ? 82.996  112.337 36.675 1.00 39.87 ? 320 ARG B NH2  1 
ATOM 2858 H H    . ARG B 2 20  ? 82.435  107.274 31.113 1.00 0.00  ? 320 ARG B H    1 
ATOM 2859 H HA   . ARG B 2 20  ? 80.457  106.842 33.329 1.00 0.00  ? 320 ARG B HA   1 
ATOM 2860 H HB2  . ARG B 2 20  ? 82.329  108.204 34.185 1.00 0.00  ? 320 ARG B HB2  1 
ATOM 2861 H HB3  . ARG B 2 20  ? 82.211  109.245 32.780 1.00 0.00  ? 320 ARG B HB3  1 
ATOM 2862 H HG2  . ARG B 2 20  ? 80.669  110.526 33.797 1.00 0.00  ? 320 ARG B HG2  1 
ATOM 2863 H HG3  . ARG B 2 20  ? 79.588  109.119 33.971 1.00 0.00  ? 320 ARG B HG3  1 
ATOM 2864 H HD2  . ARG B 2 20  ? 79.918  109.914 36.165 1.00 0.00  ? 320 ARG B HD2  1 
ATOM 2865 H HD3  . ARG B 2 20  ? 80.995  108.536 36.044 1.00 0.00  ? 320 ARG B HD3  1 
ATOM 2866 H HH11 . ARG B 2 20  ? 79.972  111.948 35.712 1.00 0.00  ? 320 ARG B HH11 1 
ATOM 2867 H HH12 . ARG B 2 20  ? 80.810  113.403 36.155 1.00 0.00  ? 320 ARG B HH12 1 
ATOM 2868 H HH21 . ARG B 2 20  ? 83.850  111.822 36.893 1.00 0.00  ? 320 ARG B HH21 1 
ATOM 2869 H HH22 . ARG B 2 20  ? 82.987  113.359 36.811 1.00 0.00  ? 320 ARG B HH22 1 
ATOM 2870 N N    . ALA B 2 21  ? 78.774  107.851 31.664 1.00 32.40 ? 321 ALA B N    1 
ATOM 2871 C CA   . ALA B 2 21  ? 77.864  108.295 30.617 1.00 30.84 ? 321 ALA B CA   1 
ATOM 2872 C C    . ALA B 2 21  ? 76.425  108.463 31.072 1.00 30.36 ? 321 ALA B C    1 
ATOM 2873 O O    . ALA B 2 21  ? 76.095  108.185 32.209 1.00 34.71 ? 321 ALA B O    1 
ATOM 2874 C CB   . ALA B 2 21  ? 77.902  107.294 29.455 1.00 33.48 ? 321 ALA B CB   1 
ATOM 2875 H H    . ALA B 2 21  ? 78.407  107.373 32.456 1.00 0.00  ? 321 ALA B H    1 
ATOM 2876 H HA   . ALA B 2 21  ? 78.202  109.274 30.258 1.00 0.00  ? 321 ALA B HA   1 
ATOM 2877 H HB1  . ALA B 2 21  ? 77.246  107.610 28.633 1.00 0.00  ? 321 ALA B HB1  1 
ATOM 2878 H HB2  . ALA B 2 21  ? 78.925  107.172 29.088 1.00 0.00  ? 321 ALA B HB2  1 
ATOM 2879 H HB3  . ALA B 2 21  ? 77.625  106.299 29.788 1.00 0.00  ? 321 ALA B HB3  1 
ATOM 2880 N N    . LYS B 2 22  ? 75.574  108.934 30.141 1.00 30.02 ? 322 LYS B N    1 
ATOM 2881 C CA   . LYS B 2 22  ? 74.160  109.122 30.421 1.00 33.01 ? 322 LYS B CA   1 
ATOM 2882 C C    . LYS B 2 22  ? 73.381  108.272 29.431 1.00 35.97 ? 322 LYS B C    1 
ATOM 2883 O O    . LYS B 2 22  ? 73.776  108.129 28.289 1.00 30.33 ? 322 LYS B O    1 
ATOM 2884 C CB   . LYS B 2 22  ? 73.734  110.592 30.219 1.00 38.07 ? 322 LYS B CB   1 
ATOM 2885 C CG   . LYS B 2 22  ? 74.687  111.660 30.791 1.00 44.65 ? 322 LYS B CG   1 
ATOM 2886 C CD   . LYS B 2 22  ? 74.424  112.998 30.070 1.00 44.38 ? 322 LYS B CD   1 
ATOM 2887 C CE   . LYS B 2 22  ? 75.485  114.047 30.383 1.00 45.62 ? 322 LYS B CE   1 
ATOM 2888 N NZ   . LYS B 2 22  ? 75.408  115.185 29.428 1.00 43.09 ? 322 LYS B NZ   1 
ATOM 2889 H H    . LYS B 2 22  ? 75.892  109.191 29.232 1.00 0.00  ? 322 LYS B H    1 
ATOM 2890 H HA   . LYS B 2 22  ? 73.932  108.833 31.459 1.00 0.00  ? 322 LYS B HA   1 
ATOM 2891 H HB2  . LYS B 2 22  ? 73.644  110.755 29.136 1.00 0.00  ? 322 LYS B HB2  1 
ATOM 2892 H HB3  . LYS B 2 22  ? 72.756  110.737 30.690 1.00 0.00  ? 322 LYS B HB3  1 
ATOM 2893 H HG2  . LYS B 2 22  ? 74.517  111.773 31.873 1.00 0.00  ? 322 LYS B HG2  1 
ATOM 2894 H HG3  . LYS B 2 22  ? 75.731  111.363 30.609 1.00 0.00  ? 322 LYS B HG3  1 
ATOM 2895 H HD2  . LYS B 2 22  ? 74.374  112.842 28.986 1.00 0.00  ? 322 LYS B HD2  1 
ATOM 2896 H HD3  . LYS B 2 22  ? 73.467  113.389 30.392 1.00 0.00  ? 322 LYS B HD3  1 
ATOM 2897 H HE2  . LYS B 2 22  ? 75.343  114.434 31.398 1.00 0.00  ? 322 LYS B HE2  1 
ATOM 2898 H HE3  . LYS B 2 22  ? 76.471  113.591 30.282 1.00 0.00  ? 322 LYS B HE3  1 
ATOM 2899 H HZ1  . LYS B 2 22  ? 74.451  115.670 29.476 1.00 0.00  ? 322 LYS B HZ1  1 
ATOM 2900 H HZ2  . LYS B 2 22  ? 76.163  115.917 29.651 1.00 0.00  ? 322 LYS B HZ2  1 
ATOM 2901 H HZ3  . LYS B 2 22  ? 75.563  114.859 28.416 1.00 0.00  ? 322 LYS B HZ3  1 
ATOM 2902 N N    . PHE B 2 23  ? 72.257  107.714 29.901 1.00 39.91 ? 323 PHE B N    1 
ATOM 2903 C CA   . PHE B 2 23  ? 71.396  106.913 29.044 1.00 42.33 ? 323 PHE B CA   1 
ATOM 2904 C C    . PHE B 2 23  ? 70.474  107.796 28.238 1.00 44.22 ? 323 PHE B C    1 
ATOM 2905 O O    . PHE B 2 23  ? 69.567  108.388 28.781 1.00 42.71 ? 323 PHE B O    1 
ATOM 2906 C CB   . PHE B 2 23  ? 70.563  105.939 29.875 1.00 40.99 ? 323 PHE B CB   1 
ATOM 2907 C CG   . PHE B 2 23  ? 71.370  104.760 30.392 1.00 41.45 ? 323 PHE B CG   1 
ATOM 2908 C CD1  . PHE B 2 23  ? 71.505  103.627 29.595 1.00 39.90 ? 323 PHE B CD1  1 
ATOM 2909 C CD2  . PHE B 2 23  ? 71.960  104.802 31.652 1.00 38.37 ? 323 PHE B CD2  1 
ATOM 2910 C CE1  . PHE B 2 23  ? 72.224  102.525 30.060 1.00 41.57 ? 323 PHE B CE1  1 
ATOM 2911 C CE2  . PHE B 2 23  ? 72.679  103.699 32.120 1.00 38.88 ? 323 PHE B CE2  1 
ATOM 2912 C CZ   . PHE B 2 23  ? 72.808  102.566 31.323 1.00 39.45 ? 323 PHE B CZ   1 
ATOM 2913 H H    . PHE B 2 23  ? 72.000  107.847 30.854 1.00 0.00  ? 323 PHE B H    1 
ATOM 2914 H HA   . PHE B 2 23  ? 72.007  106.307 28.375 1.00 0.00  ? 323 PHE B HA   1 
ATOM 2915 H HB2  . PHE B 2 23  ? 70.190  106.504 30.727 1.00 0.00  ? 323 PHE B HB2  1 
ATOM 2916 H HB3  . PHE B 2 23  ? 69.726  105.554 29.281 1.00 0.00  ? 323 PHE B HB3  1 
ATOM 2917 H HD1  . PHE B 2 23  ? 71.048  103.601 28.617 1.00 0.00  ? 323 PHE B HD1  1 
ATOM 2918 H HD2  . PHE B 2 23  ? 71.861  105.684 32.274 1.00 0.00  ? 323 PHE B HD2  1 
ATOM 2919 H HE1  . PHE B 2 23  ? 72.322  101.646 29.437 1.00 0.00  ? 323 PHE B HE1  1 
ATOM 2920 H HE2  . PHE B 2 23  ? 73.132  103.734 33.103 1.00 0.00  ? 323 PHE B HE2  1 
ATOM 2921 H HZ   . PHE B 2 23  ? 73.368  101.709 31.688 1.00 0.00  ? 323 PHE B HZ   1 
ATOM 2922 N N    . VAL B 2 24  ? 70.740  107.847 26.922 1.00 45.95 ? 324 VAL B N    1 
ATOM 2923 C CA   . VAL B 2 24  ? 69.995  108.700 26.017 1.00 47.78 ? 324 VAL B CA   1 
ATOM 2924 C C    . VAL B 2 24  ? 68.727  108.076 25.476 1.00 48.84 ? 324 VAL B C    1 
ATOM 2925 O O    . VAL B 2 24  ? 67.751  108.783 25.278 1.00 48.84 ? 324 VAL B O    1 
ATOM 2926 C CB   . VAL B 2 24  ? 70.959  109.144 24.884 1.00 48.80 ? 324 VAL B CB   1 
ATOM 2927 C CG1  . VAL B 2 24  ? 70.182  109.677 23.669 1.00 53.29 ? 324 VAL B CG1  1 
ATOM 2928 C CG2  . VAL B 2 24  ? 71.918  110.229 25.420 1.00 46.59 ? 324 VAL B CG2  1 
ATOM 2929 H H    . VAL B 2 24  ? 71.474  107.286 26.549 1.00 0.00  ? 324 VAL B H    1 
ATOM 2930 H HA   . VAL B 2 24  ? 69.702  109.597 26.560 1.00 0.00  ? 324 VAL B HA   1 
ATOM 2931 H HB   . VAL B 2 24  ? 71.561  108.287 24.540 1.00 0.00  ? 324 VAL B HB   1 
ATOM 2932 H HG11 . VAL B 2 24  ? 69.555  110.528 23.978 1.00 0.00  ? 324 VAL B HG11 1 
ATOM 2933 H HG12 . VAL B 2 24  ? 70.889  110.003 22.891 1.00 0.00  ? 324 VAL B HG12 1 
ATOM 2934 H HG13 . VAL B 2 24  ? 69.545  108.878 23.261 1.00 0.00  ? 324 VAL B HG13 1 
ATOM 2935 H HG21 . VAL B 2 24  ? 72.502  109.820 26.258 1.00 0.00  ? 324 VAL B HG21 1 
ATOM 2936 H HG22 . VAL B 2 24  ? 72.598  110.550 24.617 1.00 0.00  ? 324 VAL B HG22 1 
ATOM 2937 H HG23 . VAL B 2 24  ? 71.339  111.099 25.769 1.00 0.00  ? 324 VAL B HG23 1 
ATOM 2938 N N    . GLY B 2 25  ? 68.736  106.760 25.218 1.00 49.61 ? 325 GLY B N    1 
ATOM 2939 C CA   . GLY B 2 25  ? 67.544  106.153 24.645 1.00 46.25 ? 325 GLY B CA   1 
ATOM 2940 C C    . GLY B 2 25  ? 67.111  104.846 25.270 1.00 42.18 ? 325 GLY B C    1 
ATOM 2941 O O    . GLY B 2 25  ? 67.884  104.159 25.912 1.00 43.35 ? 325 GLY B O    1 
ATOM 2942 H H    . GLY B 2 25  ? 69.549  106.201 25.382 1.00 0.00  ? 325 GLY B H    1 
ATOM 2943 H HA2  . GLY B 2 25  ? 66.701  106.852 24.752 1.00 0.00  ? 325 GLY B HA2  1 
ATOM 2944 H HA3  . GLY B 2 25  ? 67.721  105.979 23.575 1.00 0.00  ? 325 GLY B HA3  1 
ATOM 2945 N N    . THR B 2 26  ? 65.825  104.522 25.033 1.00 40.76 ? 326 THR B N    1 
ATOM 2946 C CA   . THR B 2 26  ? 65.251  103.267 25.497 1.00 40.84 ? 326 THR B CA   1 
ATOM 2947 C C    . THR B 2 26  ? 65.778  102.101 24.668 1.00 37.63 ? 326 THR B C    1 
ATOM 2948 O O    . THR B 2 26  ? 66.135  102.323 23.525 1.00 35.47 ? 326 THR B O    1 
ATOM 2949 C CB   . THR B 2 26  ? 63.698  103.343 25.390 1.00 43.61 ? 326 THR B CB   1 
ATOM 2950 O OG1  . THR B 2 26  ? 63.312  104.576 24.752 1.00 46.40 ? 326 THR B OG1  1 
ATOM 2951 C CG2  . THR B 2 26  ? 63.030  103.283 26.782 1.00 45.14 ? 326 THR B CG2  1 
ATOM 2952 H H    . THR B 2 26  ? 65.243  105.139 24.502 1.00 0.00  ? 326 THR B H    1 
ATOM 2953 H HA   . THR B 2 26  ? 65.558  103.138 26.544 1.00 0.00  ? 326 THR B HA   1 
ATOM 2954 H HB   . THR B 2 26  ? 63.330  102.499 24.779 1.00 0.00  ? 326 THR B HB   1 
ATOM 2955 H HG1  . THR B 2 26  ? 62.366  104.633 24.664 1.00 0.00  ? 326 THR B HG1  1 
ATOM 2956 H HG21 . THR B 2 26  ? 63.731  103.598 27.567 1.00 0.00  ? 326 THR B HG21 1 
ATOM 2957 H HG22 . THR B 2 26  ? 62.164  103.957 26.821 1.00 0.00  ? 326 THR B HG22 1 
ATOM 2958 H HG23 . THR B 2 26  ? 62.687  102.258 26.984 1.00 0.00  ? 326 THR B HG23 1 
ATOM 2959 N N    . PRO B 2 27  ? 65.820  100.872 25.224 1.00 39.28 ? 327 PRO B N    1 
ATOM 2960 C CA   . PRO B 2 27  ? 66.315  99.705  24.506 1.00 41.20 ? 327 PRO B CA   1 
ATOM 2961 C C    . PRO B 2 27  ? 65.648  99.354  23.191 1.00 42.46 ? 327 PRO B C    1 
ATOM 2962 O O    . PRO B 2 27  ? 64.436  99.345  23.069 1.00 44.33 ? 327 PRO B O    1 
ATOM 2963 C CB   . PRO B 2 27  ? 66.134  98.572  25.539 1.00 38.88 ? 327 PRO B CB   1 
ATOM 2964 C CG   . PRO B 2 27  ? 65.123  99.136  26.557 1.00 44.31 ? 327 PRO B CG   1 
ATOM 2965 C CD   . PRO B 2 27  ? 65.492  100.615 26.617 1.00 39.99 ? 327 PRO B CD   1 
ATOM 2966 H HA   . PRO B 2 27  ? 67.389  99.849  24.348 1.00 0.00  ? 327 PRO B HA   1 
ATOM 2967 H HB2  . PRO B 2 27  ? 65.745  97.649  25.082 1.00 0.00  ? 327 PRO B HB2  1 
ATOM 2968 H HB3  . PRO B 2 27  ? 67.088  98.347  26.056 1.00 0.00  ? 327 PRO B HB3  1 
ATOM 2969 H HG2  . PRO B 2 27  ? 64.089  99.017  26.180 1.00 0.00  ? 327 PRO B HG2  1 
ATOM 2970 H HG3  . PRO B 2 27  ? 65.214  98.652  27.544 1.00 0.00  ? 327 PRO B HG3  1 
ATOM 2971 H HD2  . PRO B 2 27  ? 64.645  101.186 26.997 1.00 0.00  ? 327 PRO B HD2  1 
ATOM 2972 H HD3  . PRO B 2 27  ? 66.365  100.759 27.264 1.00 0.00  ? 327 PRO B HD3  1 
ATOM 2973 N N    . GLU B 2 28  ? 66.510  99.027  22.207 1.00 43.98 ? 328 GLU B N    1 
ATOM 2974 C CA   . GLU B 2 28  ? 66.043  98.677  20.876 1.00 46.12 ? 328 GLU B CA   1 
ATOM 2975 C C    . GLU B 2 28  ? 66.921  97.576  20.309 1.00 48.33 ? 328 GLU B C    1 
ATOM 2976 O O    . GLU B 2 28  ? 68.128  97.625  20.468 1.00 50.81 ? 328 GLU B O    1 
ATOM 2977 C CB   . GLU B 2 28  ? 66.131  99.912  19.954 1.00 51.17 ? 328 GLU B CB   1 
ATOM 2978 C CG   . GLU B 2 28  ? 65.010  99.966  18.893 1.00 60.02 ? 328 GLU B CG   1 
ATOM 2979 C CD   . GLU B 2 28  ? 65.527  100.076 17.474 1.00 63.07 ? 328 GLU B CD   1 
ATOM 2980 O OE1  . GLU B 2 28  ? 66.720  100.426 17.266 1.00 63.61 ? 328 GLU B OE1  1 
ATOM 2981 O OE2  . GLU B 2 28  ? 64.731  99.813  16.539 1.00 65.85 ? 328 GLU B OE2  1 
ATOM 2982 H H    . GLU B 2 28  ? 67.497  99.037  22.353 1.00 0.00  ? 328 GLU B H    1 
ATOM 2983 H HA   . GLU B 2 28  ? 65.000  98.336  20.946 1.00 0.00  ? 328 GLU B HA   1 
ATOM 2984 H HB2  . GLU B 2 28  ? 66.074  100.817 20.583 1.00 0.00  ? 328 GLU B HB2  1 
ATOM 2985 H HB3  . GLU B 2 28  ? 67.112  99.892  19.458 1.00 0.00  ? 328 GLU B HB3  1 
ATOM 2986 H HG2  . GLU B 2 28  ? 64.394  99.058  18.963 1.00 0.00  ? 328 GLU B HG2  1 
ATOM 2987 H HG3  . GLU B 2 28  ? 64.373  100.838 19.110 1.00 0.00  ? 328 GLU B HG3  1 
ATOM 2988 N N    . VAL B 2 29  ? 66.295  96.591  19.646 1.00 50.04 ? 329 VAL B N    1 
ATOM 2989 C CA   . VAL B 2 29  ? 67.047  95.510  19.028 1.00 50.43 ? 329 VAL B CA   1 
ATOM 2990 C C    . VAL B 2 29  ? 67.706  96.040  17.767 1.00 53.79 ? 329 VAL B C    1 
ATOM 2991 O O    . VAL B 2 29  ? 67.018  96.400  16.829 1.00 56.13 ? 329 VAL B O    1 
ATOM 2992 C CB   . VAL B 2 29  ? 66.105  94.316  18.703 1.00 49.02 ? 329 VAL B CB   1 
ATOM 2993 C CG1  . VAL B 2 29  ? 66.701  93.422  17.618 1.00 47.19 ? 329 VAL B CG1  1 
ATOM 2994 C CG2  . VAL B 2 29  ? 65.827  93.474  19.965 1.00 49.49 ? 329 VAL B CG2  1 
ATOM 2995 H H    . VAL B 2 29  ? 65.300  96.598  19.571 1.00 0.00  ? 329 VAL B H    1 
ATOM 2996 H HA   . VAL B 2 29  ? 67.807  95.150  19.738 1.00 0.00  ? 329 VAL B HA   1 
ATOM 2997 H HB   . VAL B 2 29  ? 65.148  94.695  18.311 1.00 0.00  ? 329 VAL B HB   1 
ATOM 2998 H HG11 . VAL B 2 29  ? 66.670  93.913  16.645 1.00 0.00  ? 329 VAL B HG11 1 
ATOM 2999 H HG12 . VAL B 2 29  ? 67.739  93.266  17.882 1.00 0.00  ? 329 VAL B HG12 1 
ATOM 3000 H HG13 . VAL B 2 29  ? 66.168  92.471  17.564 1.00 0.00  ? 329 VAL B HG13 1 
ATOM 3001 H HG21 . VAL B 2 29  ? 65.314  94.102  20.706 1.00 0.00  ? 329 VAL B HG21 1 
ATOM 3002 H HG22 . VAL B 2 29  ? 65.184  92.616  19.708 1.00 0.00  ? 329 VAL B HG22 1 
ATOM 3003 H HG23 . VAL B 2 29  ? 66.778  93.102  20.379 1.00 0.00  ? 329 VAL B HG23 1 
ATOM 3004 N N    . ASN B 2 30  ? 69.056  96.075  17.767 1.00 53.10 ? 330 ASN B N    1 
ATOM 3005 C CA   . ASN B 2 30  ? 69.830  96.591  16.636 1.00 50.00 ? 330 ASN B CA   1 
ATOM 3006 C C    . ASN B 2 30  ? 69.845  95.635  15.445 1.00 48.54 ? 330 ASN B C    1 
ATOM 3007 O O    . ASN B 2 30  ? 68.831  95.436  14.796 1.00 48.22 ? 330 ASN B O    1 
ATOM 3008 C CB   . ASN B 2 30  ? 71.264  96.933  17.087 1.00 0.00  ? 330 ASN B CB   1 
ATOM 3009 C CG   . ASN B 2 30  ? 71.884  97.454  15.818 1.00 0.00  ? 330 ASN B CG   1 
ATOM 3010 O OD1  . ASN B 2 30  ? 72.436  96.794  14.956 1.00 0.00  ? 330 ASN B OD1  1 
ATOM 3011 N ND2  . ASN B 2 30  ? 71.685  98.709  15.474 1.00 0.00  ? 330 ASN B ND2  1 
ATOM 3012 H H    . ASN B 2 30  ? 69.563  95.777  18.574 1.00 0.00  ? 330 ASN B H    1 
ATOM 3013 H HA   . ASN B 2 30  ? 69.347  97.520  16.287 1.00 0.00  ? 330 ASN B HA   1 
ATOM 3014 N N    . GLN B 2 31  ? 71.011  95.036  15.131 1.00 48.53 ? 331 GLN B N    1 
ATOM 3015 C CA   . GLN B 2 31  ? 71.123  94.132  13.999 1.00 46.38 ? 331 GLN B CA   1 
ATOM 3016 C C    . GLN B 2 31  ? 71.194  92.694  14.467 1.00 46.38 ? 331 GLN B C    1 
ATOM 3017 O O    . GLN B 2 31  ? 71.723  91.843  13.774 1.00 46.47 ? 331 GLN B O    1 
ATOM 3018 C CB   . GLN B 2 31  ? 72.328  94.490  13.106 1.00 47.46 ? 331 GLN B CB   1 
ATOM 3019 C CG   . GLN B 2 31  ? 73.705  94.251  13.760 1.00 53.38 ? 331 GLN B CG   1 
ATOM 3020 C CD   . GLN B 2 31  ? 74.812  94.118  12.733 1.00 57.05 ? 331 GLN B CD   1 
ATOM 3021 O OE1  . GLN B 2 31  ? 75.784  93.415  12.948 1.00 57.85 ? 331 GLN B OE1  1 
ATOM 3022 N NE2  . GLN B 2 31  ? 74.664  94.811  11.591 1.00 58.24 ? 331 GLN B NE2  1 
ATOM 3023 H H    . GLN B 2 31  ? 71.850  95.187  15.643 1.00 0.00  ? 331 GLN B H    1 
ATOM 3024 H HA   . GLN B 2 31  ? 70.231  94.249  13.376 1.00 0.00  ? 331 GLN B HA   1 
ATOM 3025 H HB2  . GLN B 2 31  ? 72.261  93.868  12.197 1.00 0.00  ? 331 GLN B HB2  1 
ATOM 3026 H HB3  . GLN B 2 31  ? 72.239  95.558  12.836 1.00 0.00  ? 331 GLN B HB3  1 
ATOM 3027 H HG2  . GLN B 2 31  ? 73.938  95.094  14.422 1.00 0.00  ? 331 GLN B HG2  1 
ATOM 3028 H HG3  . GLN B 2 31  ? 73.661  93.328  14.352 1.00 0.00  ? 331 GLN B HG3  1 
ATOM 3029 H HE21 . GLN B 2 31  ? 73.873  95.388  11.421 1.00 0.00  ? 331 GLN B HE21 1 
ATOM 3030 H HE22 . GLN B 2 31  ? 75.359  94.762  10.878 1.00 0.00  ? 331 GLN B HE22 1 
ATOM 3031 N N    . THR B 2 32  ? 70.638  92.443  15.663 1.00 47.51 ? 332 THR B N    1 
ATOM 3032 C CA   . THR B 2 32  ? 70.598  91.097  16.213 1.00 44.14 ? 332 THR B CA   1 
ATOM 3033 C C    . THR B 2 32  ? 69.467  90.984  17.204 1.00 44.47 ? 332 THR B C    1 
ATOM 3034 O O    . THR B 2 32  ? 69.321  91.865  18.020 1.00 42.67 ? 332 THR B O    1 
ATOM 3035 C CB   . THR B 2 32  ? 71.888  90.766  16.978 1.00 43.31 ? 332 THR B CB   1 
ATOM 3036 O OG1  . THR B 2 32  ? 73.018  90.973  16.133 1.00 50.46 ? 332 THR B OG1  1 
ATOM 3037 C CG2  . THR B 2 32  ? 71.902  89.298  17.359 1.00 43.32 ? 332 THR B CG2  1 
ATOM 3038 H H    . THR B 2 32  ? 70.234  93.172  16.202 1.00 0.00  ? 332 THR B H    1 
ATOM 3039 H HA   . THR B 2 32  ? 70.466  90.374  15.396 1.00 0.00  ? 332 THR B HA   1 
ATOM 3040 H HB   . THR B 2 32  ? 71.963  91.416  17.874 1.00 0.00  ? 332 THR B HB   1 
ATOM 3041 H HG1  . THR B 2 32  ? 73.821  90.770  16.601 1.00 0.00  ? 332 THR B HG1  1 
ATOM 3042 H HG21 . THR B 2 32  ? 71.182  88.699  16.802 1.00 0.00  ? 332 THR B HG21 1 
ATOM 3043 H HG22 . THR B 2 32  ? 72.887  88.862  17.325 1.00 0.00  ? 332 THR B HG22 1 
ATOM 3044 H HG23 . THR B 2 32  ? 71.653  89.334  18.418 1.00 0.00  ? 332 THR B HG23 1 
ATOM 3045 N N    . THR B 2 33  ? 68.704  89.878  17.144 1.00 45.88 ? 333 THR B N    1 
ATOM 3046 C CA   . THR B 2 33  ? 67.620  89.642  18.094 1.00 45.77 ? 333 THR B CA   1 
ATOM 3047 C C    . THR B 2 33  ? 68.121  89.343  19.493 1.00 43.24 ? 333 THR B C    1 
ATOM 3048 O O    . THR B 2 33  ? 67.426  89.517  20.464 1.00 41.87 ? 333 THR B O    1 
ATOM 3049 C CB   . THR B 2 33  ? 66.791  88.436  17.593 1.00 47.80 ? 333 THR B CB   1 
ATOM 3050 O OG1  . THR B 2 33  ? 66.316  88.700  16.265 1.00 54.23 ? 333 THR B OG1  1 
ATOM 3051 C CG2  . THR B 2 33  ? 65.593  88.175  18.512 1.00 51.17 ? 333 THR B CG2  1 
ATOM 3052 H H    . THR B 2 33  ? 68.933  89.168  16.485 1.00 0.00  ? 333 THR B H    1 
ATOM 3053 H HA   . THR B 2 33  ? 66.984  90.525  18.126 1.00 0.00  ? 333 THR B HA   1 
ATOM 3054 H HB   . THR B 2 33  ? 67.421  87.530  17.575 1.00 0.00  ? 333 THR B HB   1 
ATOM 3055 H HG1  . THR B 2 33  ? 65.980  89.587  16.206 1.00 0.00  ? 333 THR B HG1  1 
ATOM 3056 H HG21 . THR B 2 33  ? 65.213  89.145  18.866 1.00 0.00  ? 333 THR B HG21 1 
ATOM 3057 H HG22 . THR B 2 33  ? 64.815  87.633  17.953 1.00 0.00  ? 333 THR B HG22 1 
ATOM 3058 H HG23 . THR B 2 33  ? 65.910  87.564  19.369 1.00 0.00  ? 333 THR B HG23 1 
ATOM 3059 N N    . LEU B 2 34  ? 69.348  88.869  19.577 1.00 40.93 ? 334 LEU B N    1 
ATOM 3060 C CA   . LEU B 2 34  ? 70.013  88.451  20.794 1.00 37.98 ? 334 LEU B CA   1 
ATOM 3061 C C    . LEU B 2 34  ? 70.394  89.547  21.757 1.00 38.96 ? 334 LEU B C    1 
ATOM 3062 O O    . LEU B 2 34  ? 70.401  89.308  22.952 1.00 38.54 ? 334 LEU B O    1 
ATOM 3063 C CB   . LEU B 2 34  ? 71.292  87.674  20.470 1.00 37.02 ? 334 LEU B CB   1 
ATOM 3064 C CG   . LEU B 2 34  ? 71.079  86.526  19.465 1.00 37.63 ? 334 LEU B CG   1 
ATOM 3065 C CD1  . LEU B 2 34  ? 72.440  86.078  18.939 1.00 38.77 ? 334 LEU B CD1  1 
ATOM 3066 C CD2  . LEU B 2 34  ? 70.341  85.362  20.139 1.00 36.58 ? 334 LEU B CD2  1 
ATOM 3067 H H    . LEU B 2 34  ? 69.764  88.742  18.695 1.00 0.00  ? 334 LEU B H    1 
ATOM 3068 H HA   . LEU B 2 34  ? 69.327  87.774  21.306 1.00 0.00  ? 334 LEU B HA   1 
ATOM 3069 H HB2  . LEU B 2 34  ? 72.070  88.336  20.095 1.00 0.00  ? 334 LEU B HB2  1 
ATOM 3070 H HB3  . LEU B 2 34  ? 71.720  87.273  21.389 1.00 0.00  ? 334 LEU B HB3  1 
ATOM 3071 H HG   . LEU B 2 34  ? 70.487  86.823  18.591 1.00 0.00  ? 334 LEU B HG   1 
ATOM 3072 H HD11 . LEU B 2 34  ? 72.801  86.799  18.201 1.00 0.00  ? 334 LEU B HD11 1 
ATOM 3073 H HD12 . LEU B 2 34  ? 73.148  86.037  19.770 1.00 0.00  ? 334 LEU B HD12 1 
ATOM 3074 H HD13 . LEU B 2 34  ? 72.343  85.099  18.460 1.00 0.00  ? 334 LEU B HD13 1 
ATOM 3075 H HD21 . LEU B 2 34  ? 69.274  85.610  20.210 1.00 0.00  ? 334 LEU B HD21 1 
ATOM 3076 H HD22 . LEU B 2 34  ? 70.462  84.449  19.539 1.00 0.00  ? 334 LEU B HD22 1 
ATOM 3077 H HD23 . LEU B 2 34  ? 70.755  85.198  21.143 1.00 0.00  ? 334 LEU B HD23 1 
ATOM 3078 N N    . TYR B 2 35  ? 70.731  90.739  21.246 1.00 35.38 ? 335 TYR B N    1 
ATOM 3079 C CA   . TYR B 2 35  ? 71.123  91.816  22.137 1.00 35.13 ? 335 TYR B CA   1 
ATOM 3080 C C    . TYR B 2 35  ? 70.271  93.039  21.894 1.00 38.15 ? 335 TYR B C    1 
ATOM 3081 O O    . TYR B 2 35  ? 69.853  93.307  20.783 1.00 39.28 ? 335 TYR B O    1 
ATOM 3082 C CB   . TYR B 2 35  ? 72.614  92.175  21.958 1.00 33.75 ? 335 TYR B CB   1 
ATOM 3083 C CG   . TYR B 2 35  ? 73.560  91.032  22.316 1.00 33.73 ? 335 TYR B CG   1 
ATOM 3084 C CD1  . TYR B 2 35  ? 73.932  90.100  21.334 1.00 35.32 ? 335 TYR B CD1  1 
ATOM 3085 C CD2  . TYR B 2 35  ? 74.099  90.915  23.598 1.00 35.63 ? 335 TYR B CD2  1 
ATOM 3086 C CE1  . TYR B 2 35  ? 74.850  89.101  21.625 1.00 34.09 ? 335 TYR B CE1  1 
ATOM 3087 C CE2  . TYR B 2 35  ? 75.026  89.913  23.898 1.00 32.92 ? 335 TYR B CE2  1 
ATOM 3088 C CZ   . TYR B 2 35  ? 75.413  89.016  22.901 1.00 31.45 ? 335 TYR B CZ   1 
ATOM 3089 O OH   . TYR B 2 35  ? 76.363  88.042  23.166 1.00 30.83 ? 335 TYR B OH   1 
ATOM 3090 H H    . TYR B 2 35  ? 70.732  90.894  20.260 1.00 0.00  ? 335 TYR B H    1 
ATOM 3091 H HA   . TYR B 2 35  ? 70.979  91.499  23.178 1.00 0.00  ? 335 TYR B HA   1 
ATOM 3092 H HB2  . TYR B 2 35  ? 72.781  92.454  20.907 1.00 0.00  ? 335 TYR B HB2  1 
ATOM 3093 H HB3  . TYR B 2 35  ? 72.854  93.034  22.602 1.00 0.00  ? 335 TYR B HB3  1 
ATOM 3094 H HD1  . TYR B 2 35  ? 73.511  90.171  20.340 1.00 0.00  ? 335 TYR B HD1  1 
ATOM 3095 H HD2  . TYR B 2 35  ? 73.809  91.615  24.367 1.00 0.00  ? 335 TYR B HD2  1 
ATOM 3096 H HE1  . TYR B 2 35  ? 75.148  88.385  20.866 1.00 0.00  ? 335 TYR B HE1  1 
ATOM 3097 H HE2  . TYR B 2 35  ? 75.452  89.836  24.893 1.00 0.00  ? 335 TYR B HE2  1 
ATOM 3098 H HH   . TYR B 2 35  ? 75.921  87.225  23.370 1.00 0.00  ? 335 TYR B HH   1 
ATOM 3099 N N    . GLN B 2 36  ? 70.027  93.766  22.997 1.00 41.07 ? 336 GLN B N    1 
ATOM 3100 C CA   . GLN B 2 36  ? 69.310  95.024  22.941 1.00 40.65 ? 336 GLN B CA   1 
ATOM 3101 C C    . GLN B 2 36  ? 70.358  96.055  23.261 1.00 40.22 ? 336 GLN B C    1 
ATOM 3102 O O    . GLN B 2 36  ? 71.260  95.760  24.026 1.00 41.45 ? 336 GLN B O    1 
ATOM 3103 C CB   . GLN B 2 36  ? 68.233  95.087  24.038 1.00 46.35 ? 336 GLN B CB   1 
ATOM 3104 C CG   . GLN B 2 36  ? 66.934  94.397  23.651 1.00 54.09 ? 336 GLN B CG   1 
ATOM 3105 C CD   . GLN B 2 36  ? 65.768  94.803  24.481 1.00 58.87 ? 336 GLN B CD   1 
ATOM 3106 O OE1  . GLN B 2 36  ? 64.778  95.227  23.921 1.00 60.94 ? 336 GLN B OE1  1 
ATOM 3107 N NE2  . GLN B 2 36  ? 65.891  94.726  25.816 1.00 59.64 ? 336 GLN B NE2  1 
ATOM 3108 H H    . GLN B 2 36  ? 70.362  93.470  23.888 1.00 0.00  ? 336 GLN B H    1 
ATOM 3109 H HA   . GLN B 2 36  ? 68.851  95.203  21.957 1.00 0.00  ? 336 GLN B HA   1 
ATOM 3110 H HB2  . GLN B 2 36  ? 68.652  94.659  24.964 1.00 0.00  ? 336 GLN B HB2  1 
ATOM 3111 H HB3  . GLN B 2 36  ? 67.950  96.134  24.204 1.00 0.00  ? 336 GLN B HB3  1 
ATOM 3112 H HG2  . GLN B 2 36  ? 66.739  94.442  22.597 1.00 0.00  ? 336 GLN B HG2  1 
ATOM 3113 H HG3  . GLN B 2 36  ? 67.048  93.307  23.822 1.00 0.00  ? 336 GLN B HG3  1 
ATOM 3114 H HE21 . GLN B 2 36  ? 66.729  94.383  26.238 1.00 0.00  ? 336 GLN B HE21 1 
ATOM 3115 H HE22 . GLN B 2 36  ? 65.137  95.035  26.396 1.00 0.00  ? 336 GLN B HE22 1 
ATOM 3116 N N    . ARG B 2 37  ? 70.228  97.257  22.682 1.00 38.74 ? 337 ARG B N    1 
ATOM 3117 C CA   . ARG B 2 37  ? 71.225  98.278  22.951 1.00 37.23 ? 337 ARG B CA   1 
ATOM 3118 C C    . ARG B 2 37  ? 70.637  99.596  23.387 1.00 37.36 ? 337 ARG B C    1 
ATOM 3119 O O    . ARG B 2 37  ? 69.547  99.955  22.982 1.00 40.49 ? 337 ARG B O    1 
ATOM 3120 C CB   . ARG B 2 37  ? 72.117  98.484  21.724 1.00 33.76 ? 337 ARG B CB   1 
ATOM 3121 C CG   . ARG B 2 37  ? 71.398  99.213  20.579 1.00 34.85 ? 337 ARG B CG   1 
ATOM 3122 C CD   . ARG B 2 37  ? 72.269  99.077  19.330 1.00 39.67 ? 337 ARG B CD   1 
ATOM 3123 N NE   . ARG B 2 37  ? 71.986  100.085 18.327 1.00 41.94 ? 337 ARG B NE   1 
ATOM 3124 C CZ   . ARG B 2 37  ? 72.602  100.124 17.166 1.00 44.41 ? 337 ARG B CZ   1 
ATOM 3125 N NH1  . ARG B 2 37  ? 73.487  99.208  16.824 1.00 43.67 ? 337 ARG B NH1  1 
ATOM 3126 N NH2  . ARG B 2 37  ? 72.304  101.092 16.324 1.00 47.85 ? 337 ARG B NH2  1 
ATOM 3127 H H    . ARG B 2 37  ? 69.476  97.450  22.054 1.00 0.00  ? 337 ARG B H    1 
ATOM 3128 H HA   . ARG B 2 37  ? 71.882  97.923  23.752 1.00 0.00  ? 337 ARG B HA   1 
ATOM 3129 H HB2  . ARG B 2 37  ? 72.994  99.089  22.012 1.00 0.00  ? 337 ARG B HB2  1 
ATOM 3130 H HB3  . ARG B 2 37  ? 72.446  97.497  21.356 1.00 0.00  ? 337 ARG B HB3  1 
ATOM 3131 H HG2  . ARG B 2 37  ? 70.409  98.761  20.397 1.00 0.00  ? 337 ARG B HG2  1 
ATOM 3132 H HG3  . ARG B 2 37  ? 71.277  100.280 20.830 1.00 0.00  ? 337 ARG B HG3  1 
ATOM 3133 H HD2  . ARG B 2 37  ? 73.325  99.155  19.637 1.00 0.00  ? 337 ARG B HD2  1 
ATOM 3134 H HD3  . ARG B 2 37  ? 72.088  98.070  18.942 1.00 0.00  ? 337 ARG B HD3  1 
ATOM 3135 H HH11 . ARG B 2 37  ? 73.712  98.422  17.442 1.00 0.00  ? 337 ARG B HH11 1 
ATOM 3136 H HH12 . ARG B 2 37  ? 73.915  99.213  15.886 1.00 0.00  ? 337 ARG B HH12 1 
ATOM 3137 H HH21 . ARG B 2 37  ? 71.648  101.836 16.591 1.00 0.00  ? 337 ARG B HH21 1 
ATOM 3138 H HH22 . ARG B 2 37  ? 72.744  101.128 15.391 1.00 0.00  ? 337 ARG B HH22 1 
ATOM 3139 N N    . TYR B 2 38  ? 71.414  100.304 24.223 1.00 37.85 ? 338 TYR B N    1 
ATOM 3140 C CA   . TYR B 2 38  ? 71.008  101.610 24.711 1.00 40.22 ? 338 TYR B CA   1 
ATOM 3141 C C    . TYR B 2 38  ? 71.931  102.652 24.104 1.00 45.66 ? 338 TYR B C    1 
ATOM 3142 O O    . TYR B 2 38  ? 73.133  102.468 24.109 1.00 51.43 ? 338 TYR B O    1 
ATOM 3143 C CB   . TYR B 2 38  ? 71.173  101.686 26.236 1.00 34.85 ? 338 TYR B CB   1 
ATOM 3144 C CG   . TYR B 2 38  ? 70.344  100.737 27.088 1.00 31.12 ? 338 TYR B CG   1 
ATOM 3145 C CD1  . TYR B 2 38  ? 70.657  99.380  27.205 1.00 29.83 ? 338 TYR B CD1  1 
ATOM 3146 C CD2  . TYR B 2 38  ? 69.264  101.253 27.807 1.00 31.63 ? 338 TYR B CD2  1 
ATOM 3147 C CE1  . TYR B 2 38  ? 69.913  98.565  28.059 1.00 29.67 ? 338 TYR B CE1  1 
ATOM 3148 C CE2  . TYR B 2 38  ? 68.526  100.439 28.655 1.00 30.07 ? 338 TYR B CE2  1 
ATOM 3149 C CZ   . TYR B 2 38  ? 68.849  99.095  28.789 1.00 29.37 ? 338 TYR B CZ   1 
ATOM 3150 O OH   . TYR B 2 38  ? 68.094  98.309  29.647 1.00 25.92 ? 338 TYR B OH   1 
ATOM 3151 H H    . TYR B 2 38  ? 72.300  99.949  24.519 1.00 0.00  ? 338 TYR B H    1 
ATOM 3152 H HA   . TYR B 2 38  ? 69.956  101.815 24.471 1.00 0.00  ? 338 TYR B HA   1 
ATOM 3153 H HB2  . TYR B 2 38  ? 72.196  101.464 26.465 1.00 0.00  ? 338 TYR B HB2  1 
ATOM 3154 H HB3  . TYR B 2 38  ? 70.982  102.711 26.554 1.00 0.00  ? 338 TYR B HB3  1 
ATOM 3155 H HD1  . TYR B 2 38  ? 71.482  98.963  26.644 1.00 0.00  ? 338 TYR B HD1  1 
ATOM 3156 H HD2  . TYR B 2 38  ? 68.995  102.297 27.714 1.00 0.00  ? 338 TYR B HD2  1 
ATOM 3157 H HE1  . TYR B 2 38  ? 70.159  97.524  28.171 1.00 0.00  ? 338 TYR B HE1  1 
ATOM 3158 H HE2  . TYR B 2 38  ? 67.692  100.843 29.211 1.00 0.00  ? 338 TYR B HE2  1 
ATOM 3159 H HH   . TYR B 2 38  ? 68.411  97.415  29.645 1.00 0.00  ? 338 TYR B HH   1 
ATOM 3160 N N    . GLU B 2 39  ? 71.368  103.756 23.586 1.00 46.72 ? 339 GLU B N    1 
ATOM 3161 C CA   . GLU B 2 39  ? 72.207  104.833 23.076 1.00 44.24 ? 339 GLU B CA   1 
ATOM 3162 C C    . GLU B 2 39  ? 72.682  105.560 24.316 1.00 41.53 ? 339 GLU B C    1 
ATOM 3163 O O    . GLU B 2 39  ? 71.878  105.866 25.179 1.00 36.04 ? 339 GLU B O    1 
ATOM 3164 C CB   . GLU B 2 39  ? 71.398  105.763 22.139 1.00 48.75 ? 339 GLU B CB   1 
ATOM 3165 C CG   . GLU B 2 39  ? 72.260  106.796 21.383 1.00 54.25 ? 339 GLU B CG   1 
ATOM 3166 C CD   . GLU B 2 39  ? 71.455  107.680 20.446 1.00 59.29 ? 339 GLU B CD   1 
ATOM 3167 O OE1  . GLU B 2 39  ? 70.414  108.242 20.874 1.00 63.19 ? 339 GLU B OE1  1 
ATOM 3168 O OE2  . GLU B 2 39  ? 71.862  107.830 19.265 1.00 60.29 ? 339 GLU B OE2  1 
ATOM 3169 H H    . GLU B 2 39  ? 70.377  103.867 23.578 1.00 0.00  ? 339 GLU B H    1 
ATOM 3170 H HA   . GLU B 2 39  ? 73.043  104.411 22.499 1.00 0.00  ? 339 GLU B HA   1 
ATOM 3171 H HB2  . GLU B 2 39  ? 70.874  105.142 21.396 1.00 0.00  ? 339 GLU B HB2  1 
ATOM 3172 H HB3  . GLU B 2 39  ? 70.657  106.298 22.750 1.00 0.00  ? 339 GLU B HB3  1 
ATOM 3173 H HG2  . GLU B 2 39  ? 72.760  107.430 22.128 1.00 0.00  ? 339 GLU B HG2  1 
ATOM 3174 H HG3  . GLU B 2 39  ? 73.020  106.254 20.799 1.00 0.00  ? 339 GLU B HG3  1 
ATOM 3175 N N    . ILE B 2 40  ? 73.998  105.815 24.396 1.00 39.84 ? 340 ILE B N    1 
ATOM 3176 C CA   . ILE B 2 40  ? 74.562  106.484 25.559 1.00 41.01 ? 340 ILE B CA   1 
ATOM 3177 C C    . ILE B 2 40  ? 75.460  107.649 25.177 1.00 43.11 ? 340 ILE B C    1 
ATOM 3178 O O    . ILE B 2 40  ? 76.095  107.638 24.139 1.00 43.76 ? 340 ILE B O    1 
ATOM 3179 C CB   . ILE B 2 40  ? 75.367  105.505 26.451 1.00 38.33 ? 340 ILE B CB   1 
ATOM 3180 C CG1  . ILE B 2 40  ? 76.319  104.679 25.559 1.00 41.85 ? 340 ILE B CG1  1 
ATOM 3181 C CG2  . ILE B 2 40  ? 74.418  104.580 27.231 1.00 37.58 ? 340 ILE B CG2  1 
ATOM 3182 C CD1  . ILE B 2 40  ? 77.312  103.818 26.338 1.00 44.14 ? 340 ILE B CD1  1 
ATOM 3183 H H    . ILE B 2 40  ? 74.612  105.528 23.665 1.00 0.00  ? 340 ILE B H    1 
ATOM 3184 H HA   . ILE B 2 40  ? 73.737  106.877 26.161 1.00 0.00  ? 340 ILE B HA   1 
ATOM 3185 H HB   . ILE B 2 40  ? 75.965  106.076 27.180 1.00 0.00  ? 340 ILE B HB   1 
ATOM 3186 H HG12 . ILE B 2 40  ? 75.721  104.011 24.921 1.00 0.00  ? 340 ILE B HG12 1 
ATOM 3187 H HG13 . ILE B 2 40  ? 76.902  105.373 24.939 1.00 0.00  ? 340 ILE B HG13 1 
ATOM 3188 H HG21 . ILE B 2 40  ? 73.787  104.017 26.531 1.00 0.00  ? 340 ILE B HG21 1 
ATOM 3189 H HG22 . ILE B 2 40  ? 74.982  103.891 27.867 1.00 0.00  ? 340 ILE B HG22 1 
ATOM 3190 H HG23 . ILE B 2 40  ? 73.791  105.184 27.888 1.00 0.00  ? 340 ILE B HG23 1 
ATOM 3191 H HD11 . ILE B 2 40  ? 76.767  103.130 26.972 1.00 0.00  ? 340 ILE B HD11 1 
ATOM 3192 H HD12 . ILE B 2 40  ? 77.930  103.246 25.634 1.00 0.00  ? 340 ILE B HD12 1 
ATOM 3193 H HD13 . ILE B 2 40  ? 77.938  104.444 26.981 1.00 0.00  ? 340 ILE B HD13 1 
ATOM 3194 N N    . LYS B 2 41  ? 75.492  108.659 26.072 1.00 44.78 ? 341 LYS B N    1 
ATOM 3195 C CA   . LYS B 2 41  ? 76.325  109.842 25.898 1.00 44.26 ? 341 LYS B CA   1 
ATOM 3196 C C    . LYS B 2 41  ? 77.496  109.769 26.866 1.00 41.82 ? 341 LYS B C    1 
ATOM 3197 O O    . LYS B 2 41  ? 77.355  110.075 28.034 1.00 37.79 ? 341 LYS B O    1 
ATOM 3198 C CB   . LYS B 2 41  ? 75.466  111.102 26.167 1.00 49.07 ? 341 LYS B CB   1 
ATOM 3199 C CG   . LYS B 2 41  ? 76.258  112.423 26.246 1.00 57.97 ? 341 LYS B CG   1 
ATOM 3200 C CD   . LYS B 2 41  ? 77.224  112.572 25.058 1.00 63.52 ? 341 LYS B CD   1 
ATOM 3201 C CE   . LYS B 2 41  ? 78.152  113.773 25.262 1.00 67.27 ? 341 LYS B CE   1 
ATOM 3202 N NZ   . LYS B 2 41  ? 79.359  113.631 24.404 1.00 73.27 ? 341 LYS B NZ   1 
ATOM 3203 H H    . LYS B 2 41  ? 74.934  108.605 26.897 1.00 0.00  ? 341 LYS B H    1 
ATOM 3204 H HA   . LYS B 2 41  ? 76.674  109.881 24.854 1.00 0.00  ? 341 LYS B HA   1 
ATOM 3205 H HB2  . LYS B 2 41  ? 74.724  111.199 25.362 1.00 0.00  ? 341 LYS B HB2  1 
ATOM 3206 H HB3  . LYS B 2 41  ? 74.948  110.971 27.128 1.00 0.00  ? 341 LYS B HB3  1 
ATOM 3207 H HG2  . LYS B 2 41  ? 75.550  113.270 26.234 1.00 0.00  ? 341 LYS B HG2  1 
ATOM 3208 H HG3  . LYS B 2 41  ? 76.830  112.444 27.188 1.00 0.00  ? 341 LYS B HG3  1 
ATOM 3209 H HD2  . LYS B 2 41  ? 77.852  111.677 24.978 1.00 0.00  ? 341 LYS B HD2  1 
ATOM 3210 H HD3  . LYS B 2 41  ? 76.648  112.705 24.129 1.00 0.00  ? 341 LYS B HD3  1 
ATOM 3211 H HE2  . LYS B 2 41  ? 77.627  114.693 24.984 1.00 0.00  ? 341 LYS B HE2  1 
ATOM 3212 H HE3  . LYS B 2 41  ? 78.481  113.824 26.307 1.00 0.00  ? 341 LYS B HE3  1 
ATOM 3213 H HZ1  . LYS B 2 41  ? 79.093  113.567 23.365 1.00 0.00  ? 341 LYS B HZ1  1 
ATOM 3214 H HZ2  . LYS B 2 41  ? 80.012  114.473 24.528 1.00 0.00  ? 341 LYS B HZ2  1 
ATOM 3215 H HZ3  . LYS B 2 41  ? 79.916  112.747 24.657 1.00 0.00  ? 341 LYS B HZ3  1 
ATOM 3216 N N    . MET B 2 42  ? 78.664  109.359 26.341 1.00 41.21 ? 342 MET B N    1 
ATOM 3217 C CA   . MET B 2 42  ? 79.861  109.239 27.148 1.00 43.18 ? 342 MET B CA   1 
ATOM 3218 C C    . MET B 2 42  ? 80.551  110.511 27.560 1.00 43.02 ? 342 MET B C    1 
ATOM 3219 O O    . MET B 2 42  ? 81.035  111.228 26.709 1.00 46.50 ? 342 MET B O    1 
ATOM 3220 C CB   . MET B 2 42  ? 80.867  108.283 26.505 1.00 40.86 ? 342 MET B CB   1 
ATOM 3221 C CG   . MET B 2 42  ? 82.106  108.093 27.376 1.00 39.67 ? 342 MET B CG   1 
ATOM 3222 S SD   . MET B 2 42  ? 83.451  107.448 26.345 1.00 46.70 ? 342 MET B SD   1 
ATOM 3223 C CE   . MET B 2 42  ? 84.544  108.886 26.362 1.00 47.11 ? 342 MET B CE   1 
ATOM 3224 H H    . MET B 2 42  ? 78.734  109.123 25.377 1.00 0.00  ? 342 MET B H    1 
ATOM 3225 H HA   . MET B 2 42  ? 79.553  108.780 28.079 1.00 0.00  ? 342 MET B HA   1 
ATOM 3226 H HB2  . MET B 2 42  ? 80.400  107.298 26.329 1.00 0.00  ? 342 MET B HB2  1 
ATOM 3227 H HB3  . MET B 2 42  ? 81.170  108.734 25.548 1.00 0.00  ? 342 MET B HB3  1 
ATOM 3228 H HG2  . MET B 2 42  ? 82.414  109.042 27.829 1.00 0.00  ? 342 MET B HG2  1 
ATOM 3229 H HG3  . MET B 2 42  ? 81.846  107.387 28.167 1.00 0.00  ? 342 MET B HG3  1 
ATOM 3230 H HE1  . MET B 2 42  ? 84.822  109.133 27.395 1.00 0.00  ? 342 MET B HE1  1 
ATOM 3231 H HE2  . MET B 2 42  ? 85.439  108.644 25.779 1.00 0.00  ? 342 MET B HE2  1 
ATOM 3232 H HE3  . MET B 2 42  ? 84.021  109.734 25.912 1.00 0.00  ? 342 MET B HE3  1 
ATOM 3233 N N    . THR B 2 43  ? 80.653  110.751 28.885 1.00 40.09 ? 343 THR B N    1 
ATOM 3234 C CA   . THR B 2 43  ? 81.311  111.953 29.372 1.00 35.93 ? 343 THR B CA   1 
ATOM 3235 C C    . THR B 2 43  ? 82.762  111.681 29.700 1.00 39.68 ? 343 THR B C    1 
ATOM 3236 O O    . THR B 2 43  ? 83.631  112.033 28.926 1.00 46.76 ? 343 THR B O    1 
ATOM 3237 C CB   . THR B 2 43  ? 80.552  112.529 30.591 1.00 30.67 ? 343 THR B CB   1 
ATOM 3238 O OG1  . THR B 2 43  ? 80.575  111.598 31.679 1.00 32.25 ? 343 THR B OG1  1 
ATOM 3239 C CG2  . THR B 2 43  ? 79.082  112.777 30.213 1.00 30.35 ? 343 THR B CG2  1 
ATOM 3240 H H    . THR B 2 43  ? 80.280  110.117 29.564 1.00 0.00  ? 343 THR B H    1 
ATOM 3241 H HA   . THR B 2 43  ? 81.270  112.718 28.586 1.00 0.00  ? 343 THR B HA   1 
ATOM 3242 H HB   . THR B 2 43  ? 81.025  113.476 30.909 1.00 0.00  ? 343 THR B HB   1 
ATOM 3243 H HG1  . THR B 2 43  ? 80.106  111.981 32.412 1.00 0.00  ? 343 THR B HG1  1 
ATOM 3244 H HG21 . THR B 2 43  ? 78.802  112.156 29.353 1.00 0.00  ? 343 THR B HG21 1 
ATOM 3245 H HG22 . THR B 2 43  ? 78.424  112.516 31.053 1.00 0.00  ? 343 THR B HG22 1 
ATOM 3246 H HG23 . THR B 2 43  ? 78.948  113.837 29.958 1.00 0.00  ? 343 THR B HG23 1 
ATOM 3247 N N    . LYS B 2 44  ? 83.019  111.054 30.852 1.00 39.55 ? 344 LYS B N    1 
ATOM 3248 C CA   . LYS B 2 44  ? 84.369  110.747 31.278 1.00 37.83 ? 344 LYS B CA   1 
ATOM 3249 C C    . LYS B 2 44  ? 84.689  109.286 31.065 1.00 36.30 ? 344 LYS B C    1 
ATOM 3250 O O    . LYS B 2 44  ? 83.822  108.463 31.276 1.00 39.76 ? 344 LYS B O    1 
ATOM 3251 C CB   . LYS B 2 44  ? 84.523  111.151 32.760 1.00 44.07 ? 344 LYS B CB   1 
ATOM 3252 C CG   . LYS B 2 44  ? 85.922  111.653 33.160 1.00 54.98 ? 344 LYS B CG   1 
ATOM 3253 C CD   . LYS B 2 44  ? 86.365  112.896 32.353 1.00 63.25 ? 344 LYS B CD   1 
ATOM 3254 C CE   . LYS B 2 44  ? 85.432  114.109 32.501 1.00 66.84 ? 344 LYS B CE   1 
ATOM 3255 N NZ   . LYS B 2 44  ? 85.498  114.721 33.855 1.00 66.56 ? 344 LYS B NZ   1 
ATOM 3256 H H    . LYS B 2 44  ? 82.257  110.799 31.426 1.00 0.00  ? 344 LYS B H    1 
ATOM 3257 H HA   . LYS B 2 44  ? 85.036  111.322 30.638 1.00 0.00  ? 344 LYS B HA   1 
ATOM 3258 H HB2  . LYS B 2 44  ? 83.785  111.930 32.991 1.00 0.00  ? 344 LYS B HB2  1 
ATOM 3259 H HB3  . LYS B 2 44  ? 84.281  110.278 33.378 1.00 0.00  ? 344 LYS B HB3  1 
ATOM 3260 H HG2  . LYS B 2 44  ? 85.904  111.911 34.230 1.00 0.00  ? 344 LYS B HG2  1 
ATOM 3261 H HG3  . LYS B 2 44  ? 86.644  110.837 33.002 1.00 0.00  ? 344 LYS B HG3  1 
ATOM 3262 H HD2  . LYS B 2 44  ? 87.379  113.167 32.654 1.00 0.00  ? 344 LYS B HD2  1 
ATOM 3263 H HD3  . LYS B 2 44  ? 86.432  112.667 31.287 1.00 0.00  ? 344 LYS B HD3  1 
ATOM 3264 H HE2  . LYS B 2 44  ? 85.719  114.875 31.775 1.00 0.00  ? 344 LYS B HE2  1 
ATOM 3265 H HE3  . LYS B 2 44  ? 84.395  113.837 32.311 1.00 0.00  ? 344 LYS B HE3  1 
ATOM 3266 H HZ1  . LYS B 2 44  ? 86.493  115.054 34.084 1.00 0.00  ? 344 LYS B HZ1  1 
ATOM 3267 H HZ2  . LYS B 2 44  ? 84.846  115.574 33.923 1.00 0.00  ? 344 LYS B HZ2  1 
ATOM 3268 H HZ3  . LYS B 2 44  ? 85.195  114.034 34.620 1.00 0.00  ? 344 LYS B HZ3  1 
ATOM 3269 N N    . MET B 2 45  ? 85.929  108.966 30.648 1.00 30.77 ? 345 MET B N    1 
ATOM 3270 C CA   . MET B 2 45  ? 86.372  107.585 30.474 1.00 28.12 ? 345 MET B CA   1 
ATOM 3271 C C    . MET B 2 45  ? 87.519  107.296 31.422 1.00 31.75 ? 345 MET B C    1 
ATOM 3272 O O    . MET B 2 45  ? 88.610  107.793 31.214 1.00 36.20 ? 345 MET B O    1 
ATOM 3273 C CB   . MET B 2 45  ? 86.811  107.306 29.020 1.00 26.50 ? 345 MET B CB   1 
ATOM 3274 C CG   . MET B 2 45  ? 87.618  106.007 28.870 1.00 28.12 ? 345 MET B CG   1 
ATOM 3275 S SD   . MET B 2 45  ? 88.485  105.644 27.339 1.00 34.14 ? 345 MET B SD   1 
ATOM 3276 C CE   . MET B 2 45  ? 87.523  104.324 26.574 1.00 24.85 ? 345 MET B CE   1 
ATOM 3277 H H    . MET B 2 45  ? 86.580  109.687 30.432 1.00 0.00  ? 345 MET B H    1 
ATOM 3278 H HA   . MET B 2 45  ? 85.545  106.920 30.695 1.00 0.00  ? 345 MET B HA   1 
ATOM 3279 H HB2  . MET B 2 45  ? 85.929  107.301 28.366 1.00 0.00  ? 345 MET B HB2  1 
ATOM 3280 H HB3  . MET B 2 45  ? 87.498  108.104 28.715 1.00 0.00  ? 345 MET B HB3  1 
ATOM 3281 H HG2  . MET B 2 45  ? 88.285  105.848 29.693 1.00 0.00  ? 345 MET B HG2  1 
ATOM 3282 H HG3  . MET B 2 45  ? 86.945  105.128 28.961 1.00 0.00  ? 345 MET B HG3  1 
ATOM 3283 H HE1  . MET B 2 45  ? 86.534  104.700 26.310 1.00 0.00  ? 345 MET B HE1  1 
ATOM 3284 H HE2  . MET B 2 45  ? 87.949  104.033 25.625 1.00 0.00  ? 345 MET B HE2  1 
ATOM 3285 H HE3  . MET B 2 45  ? 87.456  103.485 27.264 1.00 0.00  ? 345 MET B HE3  1 
ATOM 3286 N N    . TYR B 2 46  ? 87.295  106.460 32.449 1.00 31.31 ? 346 TYR B N    1 
ATOM 3287 C CA   . TYR B 2 46  ? 88.375  106.131 33.382 1.00 27.79 ? 346 TYR B CA   1 
ATOM 3288 C C    . TYR B 2 46  ? 89.277  104.989 32.945 1.00 28.37 ? 346 TYR B C    1 
ATOM 3289 O O    . TYR B 2 46  ? 90.372  104.849 33.467 1.00 28.35 ? 346 TYR B O    1 
ATOM 3290 C CB   . TYR B 2 46  ? 87.789  105.814 34.769 1.00 28.50 ? 346 TYR B CB   1 
ATOM 3291 C CG   . TYR B 2 46  ? 87.119  107.039 35.382 1.00 32.93 ? 346 TYR B CG   1 
ATOM 3292 C CD1  . TYR B 2 46  ? 87.881  108.158 35.725 1.00 35.06 ? 346 TYR B CD1  1 
ATOM 3293 C CD2  . TYR B 2 46  ? 85.738  107.056 35.598 1.00 35.53 ? 346 TYR B CD2  1 
ATOM 3294 C CE1  . TYR B 2 46  ? 87.269  109.288 36.253 1.00 38.43 ? 346 TYR B CE1  1 
ATOM 3295 C CE2  . TYR B 2 46  ? 85.122  108.185 36.128 1.00 37.92 ? 346 TYR B CE2  1 
ATOM 3296 C CZ   . TYR B 2 46  ? 85.887  109.304 36.445 1.00 38.98 ? 346 TYR B CZ   1 
ATOM 3297 O OH   . TYR B 2 46  ? 85.268  110.439 36.948 1.00 44.05 ? 346 TYR B OH   1 
ATOM 3298 H H    . TYR B 2 46  ? 86.389  106.054 32.581 1.00 0.00  ? 346 TYR B H    1 
ATOM 3299 H HA   . TYR B 2 46  ? 89.010  107.019 33.481 1.00 0.00  ? 346 TYR B HA   1 
ATOM 3300 H HB2  . TYR B 2 46  ? 87.049  105.007 34.674 1.00 0.00  ? 346 TYR B HB2  1 
ATOM 3301 H HB3  . TYR B 2 46  ? 88.602  105.489 35.436 1.00 0.00  ? 346 TYR B HB3  1 
ATOM 3302 H HD1  . TYR B 2 46  ? 88.952  108.156 35.580 1.00 0.00  ? 346 TYR B HD1  1 
ATOM 3303 H HD2  . TYR B 2 46  ? 85.141  106.189 35.349 1.00 0.00  ? 346 TYR B HD2  1 
ATOM 3304 H HE1  . TYR B 2 46  ? 87.864  110.160 36.510 1.00 0.00  ? 346 TYR B HE1  1 
ATOM 3305 H HE2  . TYR B 2 46  ? 84.049  108.200 36.289 1.00 0.00  ? 346 TYR B HE2  1 
ATOM 3306 H HH   . TYR B 2 46  ? 85.925  111.105 37.120 1.00 0.00  ? 346 TYR B HH   1 
ATOM 3307 N N    . LYS B 2 47  ? 88.816  104.172 31.983 1.00 26.15 ? 347 LYS B N    1 
ATOM 3308 C CA   . LYS B 2 47  ? 89.619  103.048 31.523 1.00 27.16 ? 347 LYS B CA   1 
ATOM 3309 C C    . LYS B 2 47  ? 89.221  102.586 30.136 1.00 31.87 ? 347 LYS B C    1 
ATOM 3310 O O    . LYS B 2 47  ? 88.079  102.715 29.741 1.00 32.99 ? 347 LYS B O    1 
ATOM 3311 C CB   . LYS B 2 47  ? 89.500  101.874 32.506 1.00 24.60 ? 347 LYS B CB   1 
ATOM 3312 C CG   . LYS B 2 47  ? 90.093  100.566 31.976 1.00 17.77 ? 347 LYS B CG   1 
ATOM 3313 C CD   . LYS B 2 47  ? 90.135  99.480  33.054 1.00 13.05 ? 347 LYS B CD   1 
ATOM 3314 C CE   . LYS B 2 47  ? 90.924  98.305  32.474 1.00 16.22 ? 347 LYS B CE   1 
ATOM 3315 N NZ   . LYS B 2 47  ? 91.003  97.158  33.412 1.00 14.60 ? 347 LYS B NZ   1 
ATOM 3316 H H    . LYS B 2 47  ? 87.919  104.320 31.579 1.00 0.00  ? 347 LYS B H    1 
ATOM 3317 H HA   . LYS B 2 47  ? 90.674  103.360 31.498 1.00 0.00  ? 347 LYS B HA   1 
ATOM 3318 H HB2  . LYS B 2 47  ? 89.990  102.136 33.451 1.00 0.00  ? 347 LYS B HB2  1 
ATOM 3319 H HB3  . LYS B 2 47  ? 88.449  101.682 32.680 1.00 0.00  ? 347 LYS B HB3  1 
ATOM 3320 H HG2  . LYS B 2 47  ? 89.486  100.192 31.132 1.00 0.00  ? 347 LYS B HG2  1 
ATOM 3321 H HG3  . LYS B 2 47  ? 91.127  100.755 31.651 1.00 0.00  ? 347 LYS B HG3  1 
ATOM 3322 H HD2  . LYS B 2 47  ? 90.638  99.870  33.954 1.00 0.00  ? 347 LYS B HD2  1 
ATOM 3323 H HD3  . LYS B 2 47  ? 89.110  99.167  33.305 1.00 0.00  ? 347 LYS B HD3  1 
ATOM 3324 H HE2  . LYS B 2 47  ? 90.429  97.964  31.557 1.00 0.00  ? 347 LYS B HE2  1 
ATOM 3325 H HE3  . LYS B 2 47  ? 91.948  98.637  32.259 1.00 0.00  ? 347 LYS B HE3  1 
ATOM 3326 H HZ1  . LYS B 2 47  ? 90.024  96.792  33.658 1.00 0.00  ? 347 LYS B HZ1  1 
ATOM 3327 H HZ2  . LYS B 2 47  ? 91.556  96.355  32.963 1.00 0.00  ? 347 LYS B HZ2  1 
ATOM 3328 H HZ3  . LYS B 2 47  ? 91.499  97.437  34.322 1.00 0.00  ? 347 LYS B HZ3  1 
ATOM 3329 N N    . GLY B 2 48  ? 90.210  102.025 29.414 1.00 35.06 ? 348 GLY B N    1 
ATOM 3330 C CA   . GLY B 2 48  ? 89.962  101.514 28.077 1.00 40.32 ? 348 GLY B CA   1 
ATOM 3331 C C    . GLY B 2 48  ? 90.477  102.411 26.982 1.00 43.32 ? 348 GLY B C    1 
ATOM 3332 O O    . GLY B 2 48  ? 89.966  102.401 25.877 1.00 42.51 ? 348 GLY B O    1 
ATOM 3333 H H    . GLY B 2 48  ? 91.132  101.939 29.794 1.00 0.00  ? 348 GLY B H    1 
ATOM 3334 H HA2  . GLY B 2 48  ? 90.445  100.532 27.981 1.00 0.00  ? 348 GLY B HA2  1 
ATOM 3335 H HA3  . GLY B 2 48  ? 88.892  101.394 27.929 1.00 0.00  ? 348 GLY B HA3  1 
ATOM 3336 N N    . PHE B 2 49  ? 91.560  103.156 27.268 1.00 48.01 ? 349 PHE B N    1 
ATOM 3337 C CA   . PHE B 2 49  ? 92.132  104.043 26.262 1.00 51.73 ? 349 PHE B CA   1 
ATOM 3338 C C    . PHE B 2 49  ? 92.691  103.334 25.046 1.00 57.02 ? 349 PHE B C    1 
ATOM 3339 O O    . PHE B 2 49  ? 93.058  103.970 24.071 1.00 55.75 ? 349 PHE B O    1 
ATOM 3340 C CB   . PHE B 2 49  ? 93.183  104.963 26.890 1.00 46.07 ? 349 PHE B CB   1 
ATOM 3341 C CG   . PHE B 2 49  ? 92.526  105.964 27.830 1.00 44.54 ? 349 PHE B CG   1 
ATOM 3342 C CD1  . PHE B 2 49  ? 91.727  106.983 27.312 1.00 42.88 ? 349 PHE B CD1  1 
ATOM 3343 C CD2  . PHE B 2 49  ? 92.713  105.865 29.212 1.00 44.76 ? 349 PHE B CD2  1 
ATOM 3344 C CE1  . PHE B 2 49  ? 91.106  107.894 28.167 1.00 43.47 ? 349 PHE B CE1  1 
ATOM 3345 C CE2  . PHE B 2 49  ? 92.095  106.775 30.068 1.00 45.88 ? 349 PHE B CE2  1 
ATOM 3346 C CZ   . PHE B 2 49  ? 91.290  107.789 29.546 1.00 45.15 ? 349 PHE B CZ   1 
ATOM 3347 H H    . PHE B 2 49  ? 92.003  103.095 28.159 1.00 0.00  ? 349 PHE B H    1 
ATOM 3348 H HA   . PHE B 2 49  ? 91.310  104.672 25.900 1.00 0.00  ? 349 PHE B HA   1 
ATOM 3349 H HB2  . PHE B 2 49  ? 93.907  104.357 27.453 1.00 0.00  ? 349 PHE B HB2  1 
ATOM 3350 H HB3  . PHE B 2 49  ? 93.698  105.519 26.094 1.00 0.00  ? 349 PHE B HB3  1 
ATOM 3351 H HD1  . PHE B 2 49  ? 91.588  107.067 26.239 1.00 0.00  ? 349 PHE B HD1  1 
ATOM 3352 H HD2  . PHE B 2 49  ? 93.340  105.078 29.617 1.00 0.00  ? 349 PHE B HD2  1 
ATOM 3353 H HE1  . PHE B 2 49  ? 90.482  108.679 27.757 1.00 0.00  ? 349 PHE B HE1  1 
ATOM 3354 H HE2  . PHE B 2 49  ? 92.240  106.691 31.138 1.00 0.00  ? 349 PHE B HE2  1 
ATOM 3355 H HZ   . PHE B 2 49  ? 90.810  108.498 30.210 1.00 0.00  ? 349 PHE B HZ   1 
ATOM 3356 N N    . GLN B 2 50  ? 92.657  101.983 25.064 1.00 65.79 ? 350 GLN B N    1 
ATOM 3357 C CA   . GLN B 2 50  ? 92.981  101.172 23.883 1.00 71.96 ? 350 GLN B CA   1 
ATOM 3358 C C    . GLN B 2 50  ? 91.697  100.938 23.081 1.00 73.33 ? 350 GLN B C    1 
ATOM 3359 O O    . GLN B 2 50  ? 91.428  99.888  22.538 1.00 71.71 ? 350 GLN B O    1 
ATOM 3360 C CB   . GLN B 2 50  ? 93.560  99.817  24.341 1.00 73.62 ? 350 GLN B CB   1 
ATOM 3361 C CG   . GLN B 2 50  ? 94.927  99.463  23.708 1.00 80.09 ? 350 GLN B CG   1 
ATOM 3362 C CD   . GLN B 2 50  ? 94.968  99.566  22.193 1.00 82.16 ? 350 GLN B CD   1 
ATOM 3363 O OE1  . GLN B 2 50  ? 95.349  100.590 21.648 1.00 82.34 ? 350 GLN B OE1  1 
ATOM 3364 N NE2  . GLN B 2 50  ? 94.582  98.487  21.497 1.00 82.08 ? 350 GLN B NE2  1 
ATOM 3365 H H    . GLN B 2 50  ? 92.289  101.500 25.849 1.00 0.00  ? 350 GLN B H    1 
ATOM 3366 H HA   . GLN B 2 50  ? 93.730  101.705 23.277 1.00 0.00  ? 350 GLN B HA   1 
ATOM 3367 H HB2  . GLN B 2 50  ? 93.687  99.834  25.438 1.00 0.00  ? 350 GLN B HB2  1 
ATOM 3368 H HB3  . GLN B 2 50  ? 92.847  99.017  24.099 1.00 0.00  ? 350 GLN B HB3  1 
ATOM 3369 H HG2  . GLN B 2 50  ? 95.687  100.132 24.132 1.00 0.00  ? 350 GLN B HG2  1 
ATOM 3370 H HG3  . GLN B 2 50  ? 95.167  98.429  24.004 1.00 0.00  ? 350 GLN B HG3  1 
ATOM 3371 H HE21 . GLN B 2 50  ? 94.291  97.655  21.971 1.00 0.00  ? 350 GLN B HE21 1 
ATOM 3372 H HE22 . GLN B 2 50  ? 94.596  98.502  20.494 1.00 0.00  ? 350 GLN B HE22 1 
ATOM 3373 N N    . ALA B 2 51  ? 90.858  101.960 23.038 1.00 76.31 ? 351 ALA B N    1 
ATOM 3374 C CA   . ALA B 2 51  ? 89.589  102.009 22.335 1.00 79.83 ? 351 ALA B CA   1 
ATOM 3375 C C    . ALA B 2 51  ? 89.083  103.441 22.159 1.00 84.41 ? 351 ALA B C    1 
ATOM 3376 O O    . ALA B 2 51  ? 87.964  103.656 21.740 1.00 83.95 ? 351 ALA B O    1 
ATOM 3377 C CB   . ALA B 2 51  ? 88.556  101.191 23.125 1.00 78.04 ? 351 ALA B CB   1 
ATOM 3378 H H    . ALA B 2 51  ? 91.097  102.646 23.661 1.00 0.00  ? 351 ALA B H    1 
ATOM 3379 H HA   . ALA B 2 51  ? 89.728  101.548 21.351 1.00 0.00  ? 351 ALA B HA   1 
ATOM 3380 H HB1  . ALA B 2 51  ? 87.598  101.193 22.583 1.00 0.00  ? 351 ALA B HB1  1 
ATOM 3381 H HB2  . ALA B 2 51  ? 88.912  100.155 23.236 1.00 0.00  ? 351 ALA B HB2  1 
ATOM 3382 H HB3  . ALA B 2 51  ? 88.412  101.636 24.121 1.00 0.00  ? 351 ALA B HB3  1 
ATOM 3383 N N    . LEU B 2 52  ? 89.908  104.446 22.483 1.00 89.86 ? 352 LEU B N    1 
ATOM 3384 C CA   . LEU B 2 52  ? 89.617  105.843 22.373 1.00 93.77 ? 352 LEU B CA   1 
ATOM 3385 C C    . LEU B 2 52  ? 88.363  106.295 23.003 1.00 94.44 ? 352 LEU B C    1 
ATOM 3386 O O    . LEU B 2 52  ? 88.267  106.432 24.202 1.00 98.31 ? 352 LEU B O    1 
ATOM 3387 C CB   . LEU B 2 52  ? 89.825  106.327 20.933 1.00 94.50 ? 352 LEU B CB   1 
ATOM 3388 C CG   . LEU B 2 52  ? 91.281  106.431 20.432 1.00 96.02 ? 352 LEU B CG   1 
ATOM 3389 C CD1  . LEU B 2 52  ? 92.109  107.315 21.386 1.00 94.73 ? 352 LEU B CD1  1 
ATOM 3390 C CD2  . LEU B 2 52  ? 91.924  105.048 20.247 1.00 95.27 ? 352 LEU B CD2  1 
ATOM 3391 H H    . LEU B 2 52  ? 90.833  104.338 22.792 1.00 0.00  ? 352 LEU B H    1 
ATOM 3392 H HA   . LEU B 2 52  ? 90.335  106.358 23.041 1.00 0.00  ? 352 LEU B HA   1 
ATOM 3393 H HB2  . LEU B 2 52  ? 89.286  105.629 20.273 1.00 0.00  ? 352 LEU B HB2  1 
ATOM 3394 H HB3  . LEU B 2 52  ? 89.396  107.338 20.850 1.00 0.00  ? 352 LEU B HB3  1 
ATOM 3395 H HG   . LEU B 2 52  ? 91.271  106.918 19.440 1.00 0.00  ? 352 LEU B HG   1 
ATOM 3396 H HD11 . LEU B 2 52  ? 92.198  106.880 22.388 1.00 0.00  ? 352 LEU B HD11 1 
ATOM 3397 H HD12 . LEU B 2 52  ? 93.139  107.381 21.045 1.00 0.00  ? 352 LEU B HD12 1 
ATOM 3398 H HD13 . LEU B 2 52  ? 91.656  108.314 21.455 1.00 0.00  ? 352 LEU B HD13 1 
ATOM 3399 H HD21 . LEU B 2 52  ? 91.333  104.437 19.557 1.00 0.00  ? 352 LEU B HD21 1 
ATOM 3400 H HD22 . LEU B 2 52  ? 92.949  105.144 19.895 1.00 0.00  ? 352 LEU B HD22 1 
ATOM 3401 H HD23 . LEU B 2 52  ? 92.010  104.523 21.182 1.00 0.00  ? 352 LEU B HD23 1 
ATOM 3402 N N    . GLY B 2 53  ? 87.384  106.587 22.187 1.00 89.80 ? 353 GLY B N    1 
ATOM 3403 C CA   . GLY B 2 53  ? 86.171  107.132 22.959 1.00 86.26 ? 353 GLY B CA   1 
ATOM 3404 C C    . GLY B 2 53  ? 85.817  108.549 23.089 1.00 86.37 ? 353 GLY B C    1 
ATOM 3405 O O    . GLY B 2 53  ? 84.732  109.048 23.041 1.00 86.01 ? 353 GLY B O    1 
ATOM 3406 H H    . GLY B 2 53  ? 87.369  106.557 21.170 1.00 0.00  ? 353 GLY B H    1 
ATOM 3407 H HA2  . GLY B 2 53  ? 85.284  107.093 22.585 1.00 0.00  ? 353 GLY B HA2  1 
ATOM 3408 H HA3  . GLY B 2 53  ? 85.931  106.409 23.748 1.00 0.00  ? 353 GLY B HA3  1 
ATOM 3409 N N    . ASP B 2 54  ? 86.943  109.236 23.355 1.00 88.35 ? 354 ASP B N    1 
ATOM 3410 C CA   . ASP B 2 54  ? 86.961  110.659 23.721 1.00 88.17 ? 354 ASP B CA   1 
ATOM 3411 C C    . ASP B 2 54  ? 85.743  111.295 24.377 1.00 84.07 ? 354 ASP B C    1 
ATOM 3412 O O    . ASP B 2 54  ? 85.766  111.734 25.511 1.00 84.57 ? 354 ASP B O    1 
ATOM 3413 C CB   . ASP B 2 54  ? 87.481  111.523 22.536 1.00 91.98 ? 354 ASP B CB   1 
ATOM 3414 C CG   . ASP B 2 54  ? 86.511  111.709 21.383 1.00 94.70 ? 354 ASP B CG   1 
ATOM 3415 O OD1  . ASP B 2 54  ? 86.330  110.754 20.586 1.00 96.53 ? 354 ASP B OD1  1 
ATOM 3416 O OD2  . ASP B 2 54  ? 85.851  112.782 21.322 1.00 95.43 ? 354 ASP B OD2  1 
ATOM 3417 H H    . ASP B 2 54  ? 87.819  108.763 23.334 1.00 0.00  ? 354 ASP B H    1 
ATOM 3418 H HA   . ASP B 2 54  ? 87.729  110.720 24.502 1.00 0.00  ? 354 ASP B HA   1 
ATOM 3419 H HB2  . ASP B 2 54  ? 87.740  112.518 22.931 1.00 0.00  ? 354 ASP B HB2  1 
ATOM 3420 H HB3  . ASP B 2 54  ? 88.390  111.054 22.134 1.00 0.00  ? 354 ASP B HB3  1 
ATOM 3421 N N    . ALA B 2 55  ? 84.649  111.388 23.633 1.00 77.39 ? 355 ALA B N    1 
ATOM 3422 C CA   . ALA B 2 55  ? 83.376  111.948 24.077 1.00 71.07 ? 355 ALA B CA   1 
ATOM 3423 C C    . ALA B 2 55  ? 82.221  111.429 23.237 1.00 67.86 ? 355 ALA B C    1 
ATOM 3424 O O    . ALA B 2 55  ? 81.075  111.705 23.555 1.00 66.23 ? 355 ALA B O    1 
ATOM 3425 C CB   . ALA B 2 55  ? 83.450  113.478 23.993 1.00 70.00 ? 355 ALA B CB   1 
ATOM 3426 H H    . ALA B 2 55  ? 84.856  111.114 22.747 1.00 0.00  ? 355 ALA B H    1 
ATOM 3427 H HA   . ALA B 2 55  ? 83.216  111.662 25.117 1.00 0.00  ? 355 ALA B HA   1 
ATOM 3428 H HB1  . ALA B 2 55  ? 82.505  113.907 24.360 1.00 0.00  ? 355 ALA B HB1  1 
ATOM 3429 H HB2  . ALA B 2 55  ? 84.281  113.842 24.618 1.00 0.00  ? 355 ALA B HB2  1 
ATOM 3430 H HB3  . ALA B 2 55  ? 83.615  113.787 22.950 1.00 0.00  ? 355 ALA B HB3  1 
ATOM 3431 N N    . ALA B 2 56  ? 82.488  110.661 22.157 1.00 64.78 ? 356 ALA B N    1 
ATOM 3432 C CA   . ALA B 2 56  ? 81.453  110.133 21.302 1.00 63.59 ? 356 ALA B CA   1 
ATOM 3433 C C    . ALA B 2 56  ? 81.930  109.069 20.320 1.00 63.70 ? 356 ALA B C    1 
ATOM 3434 O O    . ALA B 2 56  ? 81.571  109.118 19.157 1.00 62.58 ? 356 ALA B O    1 
ATOM 3435 C CB   . ALA B 2 56  ? 80.808  111.292 20.551 1.00 62.17 ? 356 ALA B CB   1 
ATOM 3436 H H    . ALA B 2 56  ? 83.337  110.353 21.818 1.00 0.00  ? 356 ALA B H    1 
ATOM 3437 H HA   . ALA B 2 56  ? 80.737  109.668 21.971 1.00 0.00  ? 356 ALA B HA   1 
ATOM 3438 H HB1  . ALA B 2 56  ? 80.025  110.884 19.901 1.00 0.00  ? 356 ALA B HB1  1 
ATOM 3439 H HB2  . ALA B 2 56  ? 80.356  111.990 21.268 1.00 0.00  ? 356 ALA B HB2  1 
ATOM 3440 H HB3  . ALA B 2 56  ? 81.557  111.823 19.944 1.00 0.00  ? 356 ALA B HB3  1 
ATOM 3441 N N    . ASP B 2 57  ? 82.727  108.095 20.774 1.00 64.52 ? 357 ASP B N    1 
ATOM 3442 C CA   . ASP B 2 57  ? 83.044  106.976 19.895 1.00 67.32 ? 357 ASP B CA   1 
ATOM 3443 C C    . ASP B 2 57  ? 82.256  105.764 20.332 1.00 65.19 ? 357 ASP B C    1 
ATOM 3444 O O    . ASP B 2 57  ? 81.887  104.922 19.540 1.00 64.57 ? 357 ASP B O    1 
ATOM 3445 C CB   . ASP B 2 57  ? 84.549  106.663 19.870 1.00 69.41 ? 357 ASP B CB   1 
ATOM 3446 C CG   . ASP B 2 57  ? 85.120  105.762 18.828 1.00 72.41 ? 357 ASP B CG   1 
ATOM 3447 O OD1  . ASP B 2 57  ? 84.528  104.699 18.484 1.00 72.37 ? 357 ASP B OD1  1 
ATOM 3448 O OD2  . ASP B 2 57  ? 86.222  106.095 18.311 1.00 70.40 ? 357 ASP B OD2  1 
ATOM 3449 H H    . ASP B 2 57  ? 83.064  108.160 21.714 1.00 0.00  ? 357 ASP B H    1 
ATOM 3450 H HA   . ASP B 2 57  ? 82.882  107.209 18.852 1.00 0.00  ? 357 ASP B HA   1 
ATOM 3451 H HB2  . ASP B 2 57  ? 85.225  107.564 20.051 1.00 0.00  ? 357 ASP B HB2  1 
ATOM 3452 H HB3  . ASP B 2 57  ? 84.572  105.712 20.399 1.00 0.00  ? 357 ASP B HB3  1 
ATOM 3453 N N    . ILE B 2 58  ? 82.031  105.680 21.656 1.00 60.69 ? 358 ILE B N    1 
ATOM 3454 C CA   . ILE B 2 58  ? 81.198  104.665 22.225 1.00 54.24 ? 358 ILE B CA   1 
ATOM 3455 C C    . ILE B 2 58  ? 79.888  105.389 22.366 1.00 55.28 ? 358 ILE B C    1 
ATOM 3456 O O    . ILE B 2 58  ? 79.770  106.272 23.200 1.00 55.18 ? 358 ILE B O    1 
ATOM 3457 C CB   . ILE B 2 58  ? 81.714  104.226 23.623 1.00 50.69 ? 358 ILE B CB   1 
ATOM 3458 C CG1  . ILE B 2 58  ? 82.910  103.259 23.494 1.00 49.73 ? 358 ILE B CG1  1 
ATOM 3459 C CG2  . ILE B 2 58  ? 80.599  103.511 24.400 1.00 48.10 ? 358 ILE B CG2  1 
ATOM 3460 C CD1  . ILE B 2 58  ? 84.250  103.975 23.313 1.00 48.89 ? 358 ILE B CD1  1 
ATOM 3461 H H    . ILE B 2 58  ? 82.389  106.329 22.309 1.00 0.00  ? 358 ILE B H    1 
ATOM 3462 H HA   . ILE B 2 58  ? 81.133  103.789 21.566 1.00 0.00  ? 358 ILE B HA   1 
ATOM 3463 H HB   . ILE B 2 58  ? 82.020  105.114 24.201 1.00 0.00  ? 358 ILE B HB   1 
ATOM 3464 H HG12 . ILE B 2 58  ? 82.977  102.647 24.407 1.00 0.00  ? 358 ILE B HG12 1 
ATOM 3465 H HG13 . ILE B 2 58  ? 82.747  102.600 22.629 1.00 0.00  ? 358 ILE B HG13 1 
ATOM 3466 H HG21 . ILE B 2 58  ? 80.264  102.627 23.835 1.00 0.00  ? 358 ILE B HG21 1 
ATOM 3467 H HG22 . ILE B 2 58  ? 80.976  103.202 25.387 1.00 0.00  ? 358 ILE B HG22 1 
ATOM 3468 H HG23 . ILE B 2 58  ? 79.758  104.199 24.549 1.00 0.00  ? 358 ILE B HG23 1 
ATOM 3469 H HD11 . ILE B 2 58  ? 84.436  104.625 24.181 1.00 0.00  ? 358 ILE B HD11 1 
ATOM 3470 H HD12 . ILE B 2 58  ? 85.047  103.220 23.238 1.00 0.00  ? 358 ILE B HD12 1 
ATOM 3471 H HD13 . ILE B 2 58  ? 84.224  104.573 22.394 1.00 0.00  ? 358 ILE B HD13 1 
ATOM 3472 N N    . ARG B 2 59  ? 78.910  105.015 21.527 1.00 56.56 ? 359 ARG B N    1 
ATOM 3473 C CA   . ARG B 2 59  ? 77.585  105.615 21.637 1.00 58.83 ? 359 ARG B CA   1 
ATOM 3474 C C    . ARG B 2 59  ? 76.502  104.601 21.929 1.00 53.86 ? 359 ARG B C    1 
ATOM 3475 O O    . ARG B 2 59  ? 75.337  104.947 21.998 1.00 50.76 ? 359 ARG B O    1 
ATOM 3476 C CB   . ARG B 2 59  ? 77.260  106.442 20.377 1.00 63.43 ? 359 ARG B CB   1 
ATOM 3477 C CG   . ARG B 2 59  ? 77.976  107.804 20.400 1.00 72.00 ? 359 ARG B CG   1 
ATOM 3478 C CD   . ARG B 2 59  ? 77.126  108.881 19.719 1.00 77.14 ? 359 ARG B CD   1 
ATOM 3479 N NE   . ARG B 2 59  ? 75.839  109.134 20.361 1.00 81.36 ? 359 ARG B NE   1 
ATOM 3480 C CZ   . ARG B 2 59  ? 75.368  110.322 20.705 1.00 82.32 ? 359 ARG B CZ   1 
ATOM 3481 N NH1  . ARG B 2 59  ? 76.038  111.445 20.536 1.00 83.62 ? 359 ARG B NH1  1 
ATOM 3482 N NH2  . ARG B 2 59  ? 74.161  110.395 21.225 1.00 82.48 ? 359 ARG B NH2  1 
ATOM 3483 H H    . ARG B 2 59  ? 79.089  104.333 20.814 1.00 0.00  ? 359 ARG B H    1 
ATOM 3484 H HA   . ARG B 2 59  ? 77.572  106.289 22.499 1.00 0.00  ? 359 ARG B HA   1 
ATOM 3485 H HB2  . ARG B 2 59  ? 77.574  105.884 19.481 1.00 0.00  ? 359 ARG B HB2  1 
ATOM 3486 H HB3  . ARG B 2 59  ? 76.174  106.613 20.336 1.00 0.00  ? 359 ARG B HB3  1 
ATOM 3487 H HG2  . ARG B 2 59  ? 78.169  108.123 21.437 1.00 0.00  ? 359 ARG B HG2  1 
ATOM 3488 H HG3  . ARG B 2 59  ? 78.945  107.712 19.871 1.00 0.00  ? 359 ARG B HG3  1 
ATOM 3489 H HD2  . ARG B 2 59  ? 77.840  109.727 19.738 1.00 0.00  ? 359 ARG B HD2  1 
ATOM 3490 H HD3  . ARG B 2 59  ? 76.988  108.640 18.664 1.00 0.00  ? 359 ARG B HD3  1 
ATOM 3491 H HH11 . ARG B 2 59  ? 76.967  111.488 20.103 1.00 0.00  ? 359 ARG B HH11 1 
ATOM 3492 H HH12 . ARG B 2 59  ? 75.665  112.328 20.808 1.00 0.00  ? 359 ARG B HH12 1 
ATOM 3493 H HH21 . ARG B 2 59  ? 73.577  109.558 21.349 1.00 0.00  ? 359 ARG B HH21 1 
ATOM 3494 H HH22 . ARG B 2 59  ? 73.765  111.310 21.501 1.00 0.00  ? 359 ARG B HH22 1 
ATOM 3495 N N    . PHE B 2 60  ? 76.906  103.337 22.126 1.00 47.69 ? 360 PHE B N    1 
ATOM 3496 C CA   . PHE B 2 60  ? 75.952  102.287 22.403 1.00 44.69 ? 360 PHE B CA   1 
ATOM 3497 C C    . PHE B 2 60  ? 76.522  101.270 23.367 1.00 41.43 ? 360 PHE B C    1 
ATOM 3498 O O    . PHE B 2 60  ? 77.661  100.862 23.241 1.00 43.90 ? 360 PHE B O    1 
ATOM 3499 C CB   . PHE B 2 60  ? 75.548  101.549 21.117 1.00 49.73 ? 360 PHE B CB   1 
ATOM 3500 C CG   . PHE B 2 60  ? 74.649  102.381 20.212 1.00 55.82 ? 360 PHE B CG   1 
ATOM 3501 C CD1  . PHE B 2 60  ? 73.298  102.553 20.530 1.00 58.06 ? 360 PHE B CD1  1 
ATOM 3502 C CD2  . PHE B 2 60  ? 75.166  102.965 19.055 1.00 55.82 ? 360 PHE B CD2  1 
ATOM 3503 C CE1  . PHE B 2 60  ? 72.467  103.296 19.695 1.00 57.08 ? 360 PHE B CE1  1 
ATOM 3504 C CE2  . PHE B 2 60  ? 74.332  103.712 18.217 1.00 56.10 ? 360 PHE B CE2  1 
ATOM 3505 C CZ   . PHE B 2 60  ? 72.989  103.881 18.537 1.00 54.90 ? 360 PHE B CZ   1 
ATOM 3506 H H    . PHE B 2 60  ? 77.863  103.077 22.103 1.00 0.00  ? 360 PHE B H    1 
ATOM 3507 H HA   . PHE B 2 60  ? 75.060  102.745 22.837 1.00 0.00  ? 360 PHE B HA   1 
ATOM 3508 H HB2  . PHE B 2 60  ? 76.462  101.289 20.565 1.00 0.00  ? 360 PHE B HB2  1 
ATOM 3509 H HB3  . PHE B 2 60  ? 75.004  100.630 21.384 1.00 0.00  ? 360 PHE B HB3  1 
ATOM 3510 H HD1  . PHE B 2 60  ? 72.897  102.101 21.430 1.00 0.00  ? 360 PHE B HD1  1 
ATOM 3511 H HD2  . PHE B 2 60  ? 76.212  102.838 18.801 1.00 0.00  ? 360 PHE B HD2  1 
ATOM 3512 H HE1  . PHE B 2 60  ? 71.421  103.420 19.940 1.00 0.00  ? 360 PHE B HE1  1 
ATOM 3513 H HE2  . PHE B 2 60  ? 74.741  104.158 17.318 1.00 0.00  ? 360 PHE B HE2  1 
ATOM 3514 H HZ   . PHE B 2 60  ? 72.343  104.466 17.889 1.00 0.00  ? 360 PHE B HZ   1 
ATOM 3515 N N    . VAL B 2 61  ? 75.673  100.868 24.324 1.00 35.98 ? 361 VAL B N    1 
ATOM 3516 C CA   . VAL B 2 61  ? 76.028  99.837  25.273 1.00 30.63 ? 361 VAL B CA   1 
ATOM 3517 C C    . VAL B 2 61  ? 75.087  98.684  25.012 1.00 29.91 ? 361 VAL B C    1 
ATOM 3518 O O    . VAL B 2 61  ? 73.879  98.822  25.018 1.00 27.50 ? 361 VAL B O    1 
ATOM 3519 C CB   . VAL B 2 61  ? 75.872  100.306 26.725 1.00 27.89 ? 361 VAL B CB   1 
ATOM 3520 C CG1  . VAL B 2 61  ? 74.469  100.830 26.992 1.00 26.66 ? 361 VAL B CG1  1 
ATOM 3521 C CG2  . VAL B 2 61  ? 76.172  99.161  27.684 1.00 27.71 ? 361 VAL B CG2  1 
ATOM 3522 H H    . VAL B 2 61  ? 74.758  101.253 24.357 1.00 0.00  ? 361 VAL B H    1 
ATOM 3523 H HA   . VAL B 2 61  ? 77.078  99.541  25.143 1.00 0.00  ? 361 VAL B HA   1 
ATOM 3524 H HB   . VAL B 2 61  ? 76.597  101.094 26.925 1.00 0.00  ? 361 VAL B HB   1 
ATOM 3525 H HG11 . VAL B 2 61  ? 73.749  100.026 26.823 1.00 0.00  ? 361 VAL B HG11 1 
ATOM 3526 H HG12 . VAL B 2 61  ? 74.364  101.154 28.027 1.00 0.00  ? 361 VAL B HG12 1 
ATOM 3527 H HG13 . VAL B 2 61  ? 74.286  101.688 26.344 1.00 0.00  ? 361 VAL B HG13 1 
ATOM 3528 H HG21 . VAL B 2 61  ? 77.200  98.814  27.512 1.00 0.00  ? 361 VAL B HG21 1 
ATOM 3529 H HG22 . VAL B 2 61  ? 76.059  99.512  28.720 1.00 0.00  ? 361 VAL B HG22 1 
ATOM 3530 H HG23 . VAL B 2 61  ? 75.464  98.346  27.488 1.00 0.00  ? 361 VAL B HG23 1 
ATOM 3531 N N    . TYR B 2 62  ? 75.668  97.512  24.762 1.00 30.01 ? 362 TYR B N    1 
ATOM 3532 C CA   . TYR B 2 62  ? 74.857  96.347  24.478 1.00 31.89 ? 362 TYR B CA   1 
ATOM 3533 C C    . TYR B 2 62  ? 74.673  95.472  25.693 1.00 29.73 ? 362 TYR B C    1 
ATOM 3534 O O    . TYR B 2 62  ? 75.474  95.501  26.595 1.00 31.93 ? 362 TYR B O    1 
ATOM 3535 C CB   . TYR B 2 62  ? 75.505  95.504  23.366 1.00 33.26 ? 362 TYR B CB   1 
ATOM 3536 C CG   . TYR B 2 62  ? 75.537  96.202  22.008 1.00 38.36 ? 362 TYR B CG   1 
ATOM 3537 C CD1  . TYR B 2 62  ? 76.254  97.384  21.825 1.00 42.03 ? 362 TYR B CD1  1 
ATOM 3538 C CD2  . TYR B 2 62  ? 74.860  95.646  20.915 1.00 40.28 ? 362 TYR B CD2  1 
ATOM 3539 C CE1  . TYR B 2 62  ? 76.311  97.999  20.580 1.00 45.29 ? 362 TYR B CE1  1 
ATOM 3540 C CE2  . TYR B 2 62  ? 74.912  96.255  19.663 1.00 44.14 ? 362 TYR B CE2  1 
ATOM 3541 C CZ   . TYR B 2 62  ? 75.638  97.433  19.496 1.00 46.74 ? 362 TYR B CZ   1 
ATOM 3542 O OH   . TYR B 2 62  ? 75.690  98.039  18.246 1.00 49.20 ? 362 TYR B OH   1 
ATOM 3543 H H    . TYR B 2 62  ? 76.658  97.425  24.744 1.00 0.00  ? 362 TYR B H    1 
ATOM 3544 H HA   . TYR B 2 62  ? 73.870  96.665  24.124 1.00 0.00  ? 362 TYR B HA   1 
ATOM 3545 H HB2  . TYR B 2 62  ? 76.542  95.271  23.654 1.00 0.00  ? 362 TYR B HB2  1 
ATOM 3546 H HB3  . TYR B 2 62  ? 74.940  94.566  23.266 1.00 0.00  ? 362 TYR B HB3  1 
ATOM 3547 H HD1  . TYR B 2 62  ? 76.790  97.841  22.636 1.00 0.00  ? 362 TYR B HD1  1 
ATOM 3548 H HD2  . TYR B 2 62  ? 74.295  94.731  21.039 1.00 0.00  ? 362 TYR B HD2  1 
ATOM 3549 H HE1  . TYR B 2 62  ? 76.882  98.911  20.455 1.00 0.00  ? 362 TYR B HE1  1 
ATOM 3550 H HE2  . TYR B 2 62  ? 74.391  95.813  18.819 1.00 0.00  ? 362 TYR B HE2  1 
ATOM 3551 H HH   . TYR B 2 62  ? 76.218  98.829  18.279 1.00 0.00  ? 362 TYR B HH   1 
ATOM 3552 N N    . THR B 2 63  ? 73.610  94.656  25.661 1.00 29.05 ? 363 THR B N    1 
ATOM 3553 C CA   . THR B 2 63  ? 73.274  93.746  26.743 1.00 25.74 ? 363 THR B CA   1 
ATOM 3554 C C    . THR B 2 63  ? 72.335  92.706  26.145 1.00 25.88 ? 363 THR B C    1 
ATOM 3555 O O    . THR B 2 63  ? 71.711  93.020  25.140 1.00 27.09 ? 363 THR B O    1 
ATOM 3556 C CB   . THR B 2 63  ? 72.585  94.525  27.879 1.00 22.53 ? 363 THR B CB   1 
ATOM 3557 O OG1  . THR B 2 63  ? 72.430  93.722  29.042 1.00 22.57 ? 363 THR B OG1  1 
ATOM 3558 C CG2  . THR B 2 63  ? 71.228  95.059  27.450 1.00 24.16 ? 363 THR B CG2  1 
ATOM 3559 H H    . THR B 2 63  ? 73.028  94.657  24.855 1.00 0.00  ? 363 THR B H    1 
ATOM 3560 H HA   . THR B 2 63  ? 74.175  93.274  27.137 1.00 0.00  ? 363 THR B HA   1 
ATOM 3561 H HB   . THR B 2 63  ? 73.171  95.405  28.115 1.00 0.00  ? 363 THR B HB   1 
ATOM 3562 H HG1  . THR B 2 63  ? 73.275  93.456  29.376 1.00 0.00  ? 363 THR B HG1  1 
ATOM 3563 H HG21 . THR B 2 63  ? 70.828  94.482  26.622 1.00 0.00  ? 363 THR B HG21 1 
ATOM 3564 H HG22 . THR B 2 63  ? 70.516  94.990  28.279 1.00 0.00  ? 363 THR B HG22 1 
ATOM 3565 H HG23 . THR B 2 63  ? 71.330  96.093  27.107 1.00 0.00  ? 363 THR B HG23 1 
ATOM 3566 N N    . PRO B 2 64  ? 72.216  91.487  26.689 1.00 28.26 ? 364 PRO B N    1 
ATOM 3567 C CA   . PRO B 2 64  ? 71.270  90.531  26.150 1.00 31.32 ? 364 PRO B CA   1 
ATOM 3568 C C    . PRO B 2 64  ? 69.856  91.030  25.977 1.00 33.25 ? 364 PRO B C    1 
ATOM 3569 O O    . PRO B 2 64  ? 69.433  91.966  26.627 1.00 35.29 ? 364 PRO B O    1 
ATOM 3570 C CB   . PRO B 2 64  ? 71.361  89.425  27.207 1.00 32.04 ? 364 PRO B CB   1 
ATOM 3571 C CG   . PRO B 2 64  ? 72.852  89.432  27.538 1.00 30.64 ? 364 PRO B CG   1 
ATOM 3572 C CD   . PRO B 2 64  ? 73.146  90.937  27.667 1.00 31.97 ? 364 PRO B CD   1 
ATOM 3573 H HA   . PRO B 2 64  ? 71.676  90.153  25.203 1.00 0.00  ? 364 PRO B HA   1 
ATOM 3574 H HB2  . PRO B 2 64  ? 70.783  89.674  28.114 1.00 0.00  ? 364 PRO B HB2  1 
ATOM 3575 H HB3  . PRO B 2 64  ? 71.034  88.446  26.829 1.00 0.00  ? 364 PRO B HB3  1 
ATOM 3576 H HG2  . PRO B 2 64  ? 73.053  88.862  28.462 1.00 0.00  ? 364 PRO B HG2  1 
ATOM 3577 H HG3  . PRO B 2 64  ? 73.411  88.974  26.696 1.00 0.00  ? 364 PRO B HG3  1 
ATOM 3578 H HD2  . PRO B 2 64  ? 72.935  91.262  28.689 1.00 0.00  ? 364 PRO B HD2  1 
ATOM 3579 H HD3  . PRO B 2 64  ? 74.197  91.113  27.417 1.00 0.00  ? 364 PRO B HD3  1 
ATOM 3580 N N    . ALA B 2 65  ? 69.131  90.357  25.076 1.00 35.52 ? 365 ALA B N    1 
ATOM 3581 C CA   . ALA B 2 65  ? 67.762  90.697  24.777 1.00 36.61 ? 365 ALA B CA   1 
ATOM 3582 C C    . ALA B 2 65  ? 66.720  90.597  25.851 1.00 35.99 ? 365 ALA B C    1 
ATOM 3583 O O    . ALA B 2 65  ? 65.766  91.358  25.880 1.00 35.97 ? 365 ALA B O    1 
ATOM 3584 C CB   . ALA B 2 65  ? 67.285  90.049  23.486 1.00 35.82 ? 365 ALA B CB   1 
ATOM 3585 H H    . ALA B 2 65  ? 69.524  89.596  24.583 1.00 0.00  ? 365 ALA B H    1 
ATOM 3586 H HA   . ALA B 2 65  ? 67.890  91.778  24.578 1.00 0.00  ? 365 ALA B HA   1 
ATOM 3587 H HB1  . ALA B 2 65  ? 67.362  88.966  23.636 1.00 0.00  ? 365 ALA B HB1  1 
ATOM 3588 H HB2  . ALA B 2 65  ? 67.921  90.355  22.646 1.00 0.00  ? 365 ALA B HB2  1 
ATOM 3589 H HB3  . ALA B 2 65  ? 66.243  90.323  23.277 1.00 0.00  ? 365 ALA B HB3  1 
ATOM 3590 N N    . MET B 2 66  ? 66.923  89.605  26.723 1.00 36.54 ? 366 MET B N    1 
ATOM 3591 C CA   . MET B 2 66  ? 65.981  89.347  27.804 1.00 30.92 ? 366 MET B CA   1 
ATOM 3592 C C    . MET B 2 66  ? 66.645  89.178  29.159 1.00 28.74 ? 366 MET B C    1 
ATOM 3593 O O    . MET B 2 66  ? 67.676  88.548  29.282 1.00 26.91 ? 366 MET B O    1 
ATOM 3594 C CB   . MET B 2 66  ? 65.143  88.090  27.506 1.00 33.25 ? 366 MET B CB   1 
ATOM 3595 C CG   . MET B 2 66  ? 66.012  86.827  27.604 1.00 37.41 ? 366 MET B CG   1 
ATOM 3596 S SD   . MET B 2 66  ? 65.199  85.423  26.814 1.00 47.92 ? 366 MET B SD   1 
ATOM 3597 C CE   . MET B 2 66  ? 63.608  85.559  27.672 1.00 42.68 ? 366 MET B CE   1 
ATOM 3598 H H    . MET B 2 66  ? 67.725  89.022  26.625 1.00 0.00  ? 366 MET B H    1 
ATOM 3599 H HA   . MET B 2 66  ? 65.275  90.190  27.852 1.00 0.00  ? 366 MET B HA   1 
ATOM 3600 H HB2  . MET B 2 66  ? 64.318  88.027  28.230 1.00 0.00  ? 366 MET B HB2  1 
ATOM 3601 H HB3  . MET B 2 66  ? 64.732  88.152  26.491 1.00 0.00  ? 366 MET B HB3  1 
ATOM 3602 H HG2  . MET B 2 66  ? 66.968  87.000  27.123 1.00 0.00  ? 366 MET B HG2  1 
ATOM 3603 H HG3  . MET B 2 66  ? 66.162  86.590  28.649 1.00 0.00  ? 366 MET B HG3  1 
ATOM 3604 H HE1  . MET B 2 66  ? 63.759  85.817  28.724 1.00 0.00  ? 366 MET B HE1  1 
ATOM 3605 H HE2  . MET B 2 66  ? 63.075  84.607  27.607 1.00 0.00  ? 366 MET B HE2  1 
ATOM 3606 H HE3  . MET B 2 66  ? 62.999  86.347  27.215 1.00 0.00  ? 366 MET B HE3  1 
ATOM 3607 N N    . GLU B 2 67  ? 66.000  89.749  30.189 1.00 26.58 ? 367 GLU B N    1 
ATOM 3608 C CA   . GLU B 2 67  ? 66.496  89.708  31.561 1.00 20.63 ? 367 GLU B CA   1 
ATOM 3609 C C    . GLU B 2 67  ? 66.869  88.303  31.988 1.00 22.40 ? 367 GLU B C    1 
ATOM 3610 O O    . GLU B 2 67  ? 67.948  88.102  32.517 1.00 21.86 ? 367 GLU B O    1 
ATOM 3611 C CB   . GLU B 2 67  ? 65.420  90.268  32.528 1.00 16.63 ? 367 GLU B CB   1 
ATOM 3612 C CG   . GLU B 2 67  ? 65.090  91.739  32.192 1.00 18.43 ? 367 GLU B CG   1 
ATOM 3613 C CD   . GLU B 2 67  ? 66.330  92.596  32.318 1.00 22.73 ? 367 GLU B CD   1 
ATOM 3614 O OE1  . GLU B 2 67  ? 67.028  92.467  33.351 1.00 25.01 ? 367 GLU B OE1  1 
ATOM 3615 O OE2  . GLU B 2 67  ? 66.606  93.387  31.385 1.00 23.62 ? 367 GLU B OE2  1 
ATOM 3616 H H    . GLU B 2 67  ? 65.142  90.206  29.987 1.00 0.00  ? 367 GLU B H    1 
ATOM 3617 H HA   . GLU B 2 67  ? 67.381  90.351  31.629 1.00 0.00  ? 367 GLU B HA   1 
ATOM 3618 H HB2  . GLU B 2 67  ? 64.500  89.670  32.460 1.00 0.00  ? 367 GLU B HB2  1 
ATOM 3619 H HB3  . GLU B 2 67  ? 65.787  90.221  33.560 1.00 0.00  ? 367 GLU B HB3  1 
ATOM 3620 H HG2  . GLU B 2 67  ? 64.699  91.834  31.182 1.00 0.00  ? 367 GLU B HG2  1 
ATOM 3621 H HG3  . GLU B 2 67  ? 64.316  92.109  32.867 1.00 0.00  ? 367 GLU B HG3  1 
ATOM 3622 N N    . SER B 2 68  ? 65.976  87.326  31.744 1.00 24.63 ? 368 SER B N    1 
ATOM 3623 C CA   . SER B 2 68  ? 66.229  85.940  32.147 1.00 24.47 ? 368 SER B CA   1 
ATOM 3624 C C    . SER B 2 68  ? 67.605  85.455  31.748 1.00 25.77 ? 368 SER B C    1 
ATOM 3625 O O    . SER B 2 68  ? 68.217  84.667  32.443 1.00 28.95 ? 368 SER B O    1 
ATOM 3626 C CB   . SER B 2 68  ? 65.155  85.003  31.547 1.00 23.71 ? 368 SER B CB   1 
ATOM 3627 O OG   . SER B 2 68  ? 65.380  84.830  30.148 1.00 18.04 ? 368 SER B OG   1 
ATOM 3628 H H    . SER B 2 68  ? 65.121  87.555  31.275 1.00 0.00  ? 368 SER B H    1 
ATOM 3629 H HA   . SER B 2 68  ? 66.157  85.882  33.237 1.00 0.00  ? 368 SER B HA   1 
ATOM 3630 H HB2  . SER B 2 68  ? 65.210  84.020  32.033 1.00 0.00  ? 368 SER B HB2  1 
ATOM 3631 H HB3  . SER B 2 68  ? 64.154  85.431  31.722 1.00 0.00  ? 368 SER B HB3  1 
ATOM 3632 H HG   . SER B 2 68  ? 64.741  84.211  29.805 1.00 0.00  ? 368 SER B HG   1 
ATOM 3633 N N    . VAL B 2 69  ? 68.098  85.964  30.607 1.00 27.88 ? 369 VAL B N    1 
ATOM 3634 C CA   . VAL B 2 69  ? 69.407  85.570  30.114 1.00 26.04 ? 369 VAL B CA   1 
ATOM 3635 C C    . VAL B 2 69  ? 70.490  86.631  30.316 1.00 29.93 ? 369 VAL B C    1 
ATOM 3636 O O    . VAL B 2 69  ? 71.469  86.702  29.596 1.00 29.76 ? 369 VAL B O    1 
ATOM 3637 C CB   . VAL B 2 69  ? 69.224  85.048  28.679 1.00 20.54 ? 369 VAL B CB   1 
ATOM 3638 C CG1  . VAL B 2 69  ? 69.487  86.174  27.661 1.00 19.76 ? 369 VAL B CG1  1 
ATOM 3639 C CG2  . VAL B 2 69  ? 70.201  83.883  28.411 1.00 19.76 ? 369 VAL B CG2  1 
ATOM 3640 H H    . VAL B 2 69  ? 67.604  86.674  30.125 1.00 0.00  ? 369 VAL B H    1 
ATOM 3641 H HA   . VAL B 2 69  ? 69.717  84.713  30.710 1.00 0.00  ? 369 VAL B HA   1 
ATOM 3642 H HB   . VAL B 2 69  ? 68.193  84.681  28.553 1.00 0.00  ? 369 VAL B HB   1 
ATOM 3643 H HG11 . VAL B 2 69  ? 68.994  85.935  26.714 1.00 0.00  ? 369 VAL B HG11 1 
ATOM 3644 H HG12 . VAL B 2 69  ? 70.560  86.268  27.479 1.00 0.00  ? 369 VAL B HG12 1 
ATOM 3645 H HG13 . VAL B 2 69  ? 69.106  87.123  28.048 1.00 0.00  ? 369 VAL B HG13 1 
ATOM 3646 H HG21 . VAL B 2 69  ? 70.165  83.610  27.353 1.00 0.00  ? 369 VAL B HG21 1 
ATOM 3647 H HG22 . VAL B 2 69  ? 69.920  83.015  29.022 1.00 0.00  ? 369 VAL B HG22 1 
ATOM 3648 H HG23 . VAL B 2 69  ? 71.221  84.195  28.667 1.00 0.00  ? 369 VAL B HG23 1 
ATOM 3649 N N    . CYS B 2 70  ? 70.262  87.451  31.357 1.00 33.68 ? 370 CYS B N    1 
ATOM 3650 C CA   . CYS B 2 70  ? 71.189  88.473  31.834 1.00 32.12 ? 370 CYS B CA   1 
ATOM 3651 C C    . CYS B 2 70  ? 71.124  89.902  31.327 1.00 34.09 ? 370 CYS B C    1 
ATOM 3652 O O    . CYS B 2 70  ? 71.978  90.715  31.642 1.00 35.82 ? 370 CYS B O    1 
ATOM 3653 C CB   . CYS B 2 70  ? 72.624  87.964  31.914 1.00 28.00 ? 370 CYS B CB   1 
ATOM 3654 S SG   . CYS B 2 70  ? 72.612  86.313  32.652 1.00 32.61 ? 370 CYS B SG   1 
ATOM 3655 H H    . CYS B 2 70  ? 69.423  87.316  31.878 1.00 0.00  ? 370 CYS B H    1 
ATOM 3656 H HA   . CYS B 2 70  ? 70.888  88.564  32.867 1.00 0.00  ? 370 CYS B HA   1 
ATOM 3657 H HB2  . CYS B 2 70  ? 73.114  88.152  30.924 1.00 0.00  ? 370 CYS B HB2  1 
ATOM 3658 H HB3  . CYS B 2 70  ? 73.182  88.488  32.676 1.00 0.00  ? 370 CYS B HB3  1 
ATOM 3659 N N    . GLY B 2 71  ? 70.098  90.230  30.530 1.00 31.52 ? 371 GLY B N    1 
ATOM 3660 C CA   . GLY B 2 71  ? 69.997  91.584  30.001 1.00 29.15 ? 371 GLY B CA   1 
ATOM 3661 C C    . GLY B 2 71  ? 69.868  92.602  31.114 1.00 29.21 ? 371 GLY B C    1 
ATOM 3662 O O    . GLY B 2 71  ? 69.171  92.350  32.077 1.00 28.80 ? 371 GLY B O    1 
ATOM 3663 H H    . GLY B 2 71  ? 69.399  89.555  30.297 1.00 0.00  ? 371 GLY B H    1 
ATOM 3664 H HA2  . GLY B 2 71  ? 70.893  91.795  29.409 1.00 0.00  ? 371 GLY B HA2  1 
ATOM 3665 H HA3  . GLY B 2 71  ? 69.123  91.656  29.339 1.00 0.00  ? 371 GLY B HA3  1 
ATOM 3666 N N    . TYR B 2 72  ? 70.544  93.756  30.980 1.00 31.13 ? 372 TYR B N    1 
ATOM 3667 C CA   . TYR B 2 72  ? 70.483  94.808  31.990 1.00 32.64 ? 372 TYR B CA   1 
ATOM 3668 C C    . TYR B 2 72  ? 69.270  95.695  31.784 1.00 32.21 ? 372 TYR B C    1 
ATOM 3669 O O    . TYR B 2 72  ? 68.946  96.016  30.656 1.00 30.86 ? 372 TYR B O    1 
ATOM 3670 C CB   . TYR B 2 72  ? 71.767  95.666  31.939 1.00 33.07 ? 372 TYR B CB   1 
ATOM 3671 C CG   . TYR B 2 72  ? 71.713  96.890  32.851 1.00 32.76 ? 372 TYR B CG   1 
ATOM 3672 C CD1  . TYR B 2 72  ? 71.954  96.765  34.224 1.00 36.18 ? 372 TYR B CD1  1 
ATOM 3673 C CD2  . TYR B 2 72  ? 71.430  98.145  32.321 1.00 31.49 ? 372 TYR B CD2  1 
ATOM 3674 C CE1  . TYR B 2 72  ? 71.891  97.869  35.062 1.00 33.47 ? 372 TYR B CE1  1 
ATOM 3675 C CE2  . TYR B 2 72  ? 71.420  99.240  33.175 1.00 33.76 ? 372 TYR B CE2  1 
ATOM 3676 C CZ   . TYR B 2 72  ? 71.597  99.125  34.543 1.00 35.18 ? 372 TYR B CZ   1 
ATOM 3677 O OH   . TYR B 2 72  ? 71.523  100.247 35.355 1.00 39.89 ? 372 TYR B OH   1 
ATOM 3678 H H    . TYR B 2 72  ? 71.103  93.906  30.174 1.00 0.00  ? 372 TYR B H    1 
ATOM 3679 H HA   . TYR B 2 72  ? 70.433  94.336  32.982 1.00 0.00  ? 372 TYR B HA   1 
ATOM 3680 H HB2  . TYR B 2 72  ? 72.625  95.039  32.238 1.00 0.00  ? 372 TYR B HB2  1 
ATOM 3681 H HB3  . TYR B 2 72  ? 71.919  96.008  30.903 1.00 0.00  ? 372 TYR B HB3  1 
ATOM 3682 H HD1  . TYR B 2 72  ? 72.186  95.794  34.643 1.00 0.00  ? 372 TYR B HD1  1 
ATOM 3683 H HD2  . TYR B 2 72  ? 71.260  98.277  31.263 1.00 0.00  ? 372 TYR B HD2  1 
ATOM 3684 H HE1  . TYR B 2 72  ? 72.068  97.764  36.126 1.00 0.00  ? 372 TYR B HE1  1 
ATOM 3685 H HE2  . TYR B 2 72  ? 71.305  100.236 32.781 1.00 0.00  ? 372 TYR B HE2  1 
ATOM 3686 H HH   . TYR B 2 72  ? 71.699  100.001 36.256 1.00 0.00  ? 372 TYR B HH   1 
ATOM 3687 N N    . PHE B 2 73  ? 68.616  96.095  32.896 1.00 31.26 ? 373 PHE B N    1 
ATOM 3688 C CA   . PHE B 2 73  ? 67.419  96.928  32.793 1.00 36.41 ? 373 PHE B CA   1 
ATOM 3689 C C    . PHE B 2 73  ? 67.510  98.285  33.478 1.00 40.30 ? 373 PHE B C    1 
ATOM 3690 O O    . PHE B 2 73  ? 67.462  98.384  34.691 1.00 41.88 ? 373 PHE B O    1 
ATOM 3691 C CB   . PHE B 2 73  ? 66.208  96.165  33.342 1.00 37.70 ? 373 PHE B CB   1 
ATOM 3692 C CG   . PHE B 2 73  ? 64.906  96.889  33.039 1.00 37.77 ? 373 PHE B CG   1 
ATOM 3693 C CD1  . PHE B 2 73  ? 64.314  96.769  31.778 1.00 39.60 ? 373 PHE B CD1  1 
ATOM 3694 C CD2  . PHE B 2 73  ? 64.314  97.679  34.016 1.00 39.26 ? 373 PHE B CD2  1 
ATOM 3695 C CE1  . PHE B 2 73  ? 63.142  97.474  31.492 1.00 42.52 ? 373 PHE B CE1  1 
ATOM 3696 C CE2  . PHE B 2 73  ? 63.139  98.369  33.727 1.00 39.04 ? 373 PHE B CE2  1 
ATOM 3697 C CZ   . PHE B 2 73  ? 62.558  98.283  32.465 1.00 41.93 ? 373 PHE B CZ   1 
ATOM 3698 H H    . PHE B 2 73  ? 68.928  95.811  33.803 1.00 0.00  ? 373 PHE B H    1 
ATOM 3699 H HA   . PHE B 2 73  ? 67.216  97.092  31.730 1.00 0.00  ? 373 PHE B HA   1 
ATOM 3700 H HB2  . PHE B 2 73  ? 66.164  95.173  32.881 1.00 0.00  ? 373 PHE B HB2  1 
ATOM 3701 H HB3  . PHE B 2 73  ? 66.309  96.055  34.430 1.00 0.00  ? 373 PHE B HB3  1 
ATOM 3702 H HD1  . PHE B 2 73  ? 64.768  96.134  31.025 1.00 0.00  ? 373 PHE B HD1  1 
ATOM 3703 H HD2  . PHE B 2 73  ? 64.756  97.760  35.002 1.00 0.00  ? 373 PHE B HD2  1 
ATOM 3704 H HE1  . PHE B 2 73  ? 62.694  97.391  30.511 1.00 0.00  ? 373 PHE B HE1  1 
ATOM 3705 H HE2  . PHE B 2 73  ? 62.696  98.954  34.504 1.00 0.00  ? 373 PHE B HE2  1 
ATOM 3706 H HZ   . PHE B 2 73  ? 61.651  98.836  32.246 1.00 0.00  ? 373 PHE B HZ   1 
ATOM 3707 N N    . HIS B 2 74  ? 67.608  99.344  32.647 1.00 40.56 ? 374 HIS B N    1 
ATOM 3708 C CA   . HIS B 2 74  ? 67.730  100.713 33.148 1.00 42.70 ? 374 HIS B CA   1 
ATOM 3709 C C    . HIS B 2 74  ? 66.432  101.505 33.209 1.00 47.90 ? 374 HIS B C    1 
ATOM 3710 O O    . HIS B 2 74  ? 65.776  101.666 32.195 1.00 49.33 ? 374 HIS B O    1 
ATOM 3711 C CB   . HIS B 2 74  ? 68.645  101.516 32.216 1.00 41.27 ? 374 HIS B CB   1 
ATOM 3712 C CG   . HIS B 2 74  ? 68.933  102.920 32.613 1.00 43.02 ? 374 HIS B CG   1 
ATOM 3713 N ND1  . HIS B 2 74  ? 68.603  103.941 31.822 1.00 44.23 ? 374 HIS B ND1  1 
ATOM 3714 C CD2  . HIS B 2 74  ? 69.477  103.374 33.755 1.00 44.26 ? 374 HIS B CD2  1 
ATOM 3715 C CE1  . HIS B 2 74  ? 68.891  105.050 32.460 1.00 48.23 ? 374 HIS B CE1  1 
ATOM 3716 N NE2  . HIS B 2 74  ? 69.404  104.792 33.561 1.00 49.17 ? 374 HIS B NE2  1 
ATOM 3717 H H    . HIS B 2 74  ? 67.591  99.212  31.657 1.00 0.00  ? 374 HIS B H    1 
ATOM 3718 H HA   . HIS B 2 74  ? 68.193  100.672 34.144 1.00 0.00  ? 374 HIS B HA   1 
ATOM 3719 H HB2  . HIS B 2 74  ? 69.593  100.957 32.152 1.00 0.00  ? 374 HIS B HB2  1 
ATOM 3720 H HB3  . HIS B 2 74  ? 68.289  101.462 31.202 1.00 0.00  ? 374 HIS B HB3  1 
ATOM 3721 H HD2  . HIS B 2 74  ? 69.860  102.842 34.613 1.00 0.00  ? 374 HIS B HD2  1 
ATOM 3722 H HE1  . HIS B 2 74  ? 68.689  106.045 32.095 1.00 0.00  ? 374 HIS B HE1  1 
ATOM 3723 N N    . ARG B 2 75  ? 66.094  102.037 34.407 1.00 56.38 ? 375 ARG B N    1 
ATOM 3724 C CA   . ARG B 2 75  ? 64.860  102.824 34.586 1.00 65.67 ? 375 ARG B CA   1 
ATOM 3725 C C    . ARG B 2 75  ? 64.998  104.084 35.446 1.00 72.64 ? 375 ARG B C    1 
ATOM 3726 O O    . ARG B 2 75  ? 64.536  104.152 36.574 1.00 76.83 ? 375 ARG B O    1 
ATOM 3727 C CB   . ARG B 2 75  ? 63.753  101.941 35.201 1.00 63.55 ? 375 ARG B CB   1 
ATOM 3728 C CG   . ARG B 2 75  ? 62.649  101.525 34.215 1.00 57.29 ? 375 ARG B CG   1 
ATOM 3729 C CD   . ARG B 2 75  ? 61.854  102.724 33.679 1.00 52.83 ? 375 ARG B CD   1 
ATOM 3730 N NE   . ARG B 2 75  ? 62.348  103.161 32.380 1.00 48.54 ? 375 ARG B NE   1 
ATOM 3731 C CZ   . ARG B 2 75  ? 61.734  104.053 31.633 1.00 46.64 ? 375 ARG B CZ   1 
ATOM 3732 N NH1  . ARG B 2 75  ? 60.625  104.627 32.042 1.00 45.06 ? 375 ARG B NH1  1 
ATOM 3733 N NH2  . ARG B 2 75  ? 62.240  104.363 30.460 1.00 45.02 ? 375 ARG B NH2  1 
ATOM 3734 H H    . ARG B 2 75  ? 66.684  101.894 35.202 1.00 0.00  ? 375 ARG B H    1 
ATOM 3735 H HA   . ARG B 2 75  ? 64.530  103.154 33.593 1.00 0.00  ? 375 ARG B HA   1 
ATOM 3736 H HB2  . ARG B 2 75  ? 64.205  101.031 35.614 1.00 0.00  ? 375 ARG B HB2  1 
ATOM 3737 H HB3  . ARG B 2 75  ? 63.236  102.472 36.013 1.00 0.00  ? 375 ARG B HB3  1 
ATOM 3738 H HG2  . ARG B 2 75  ? 63.104  100.989 33.368 1.00 0.00  ? 375 ARG B HG2  1 
ATOM 3739 H HG3  . ARG B 2 75  ? 61.934  100.882 34.762 1.00 0.00  ? 375 ARG B HG3  1 
ATOM 3740 H HD2  . ARG B 2 75  ? 60.802  102.400 33.592 1.00 0.00  ? 375 ARG B HD2  1 
ATOM 3741 H HD3  . ARG B 2 75  ? 61.928  103.548 34.408 1.00 0.00  ? 375 ARG B HD3  1 
ATOM 3742 H HH11 . ARG B 2 75  ? 60.203  104.397 32.945 1.00 0.00  ? 375 ARG B HH11 1 
ATOM 3743 H HH12 . ARG B 2 75  ? 60.152  105.323 31.458 1.00 0.00  ? 375 ARG B HH12 1 
ATOM 3744 H HH21 . ARG B 2 75  ? 63.097  103.907 30.120 1.00 0.00  ? 375 ARG B HH21 1 
ATOM 3745 H HH22 . ARG B 2 75  ? 61.777  105.062 29.859 1.00 0.00  ? 375 ARG B HH22 1 
ATOM 3746 N N    . SER B 2 76  ? 65.627  105.127 34.886 1.00 76.02 ? 376 SER B N    1 
ATOM 3747 C CA   . SER B 2 76  ? 65.762  106.388 35.607 1.00 77.76 ? 376 SER B CA   1 
ATOM 3748 C C    . SER B 2 76  ? 64.909  107.461 34.947 1.00 79.55 ? 376 SER B C    1 
ATOM 3749 O O    . SER B 2 76  ? 64.637  107.425 33.773 1.00 79.91 ? 376 SER B O    1 
ATOM 3750 C CB   . SER B 2 76  ? 67.218  106.875 35.627 1.00 76.12 ? 376 SER B CB   1 
ATOM 3751 O OG   . SER B 2 76  ? 67.944  106.136 36.597 1.00 74.56 ? 376 SER B OG   1 
ATOM 3752 H H    . SER B 2 76  ? 65.994  105.061 33.963 1.00 0.00  ? 376 SER B H    1 
ATOM 3753 H HA   . SER B 2 76  ? 65.456  106.248 36.659 1.00 0.00  ? 376 SER B HA   1 
ATOM 3754 H HB2  . SER B 2 76  ? 67.670  106.723 34.631 1.00 0.00  ? 376 SER B HB2  1 
ATOM 3755 H HB3  . SER B 2 76  ? 67.255  107.953 35.884 1.00 0.00  ? 376 SER B HB3  1 
ATOM 3756 H HG   . SER B 2 76  ? 68.811  106.566 36.590 1.00 0.00  ? 376 SER B HG   1 
ATOM 3757 N N    . HIS B 2 77  ? 64.469  108.431 35.739 1.00 80.84 ? 377 HIS B N    1 
ATOM 3758 C CA   . HIS B 2 77  ? 63.625  109.550 35.349 1.00 82.75 ? 377 HIS B CA   1 
ATOM 3759 C C    . HIS B 2 77  ? 64.328  110.706 34.660 1.00 82.30 ? 377 HIS B C    1 
ATOM 3760 O O    . HIS B 2 77  ? 63.767  111.291 33.751 1.00 80.49 ? 377 HIS B O    1 
ATOM 3761 C CB   . HIS B 2 77  ? 62.826  110.077 36.574 1.00 85.51 ? 377 HIS B CB   1 
ATOM 3762 C CG   . HIS B 2 77  ? 63.640  110.391 37.809 1.00 89.84 ? 377 HIS B CG   1 
ATOM 3763 N ND1  . HIS B 2 77  ? 63.146  111.081 38.842 1.00 92.32 ? 377 HIS B ND1  1 
ATOM 3764 C CD2  . HIS B 2 77  ? 64.927  110.104 38.090 1.00 91.79 ? 377 HIS B CD2  1 
ATOM 3765 C CE1  . HIS B 2 77  ? 64.078  111.202 39.763 1.00 93.97 ? 377 HIS B CE1  1 
ATOM 3766 N NE2  . HIS B 2 77  ? 65.119  110.636 39.398 1.00 93.45 ? 377 HIS B NE2  1 
ATOM 3767 H H    . HIS B 2 77  ? 64.619  108.210 36.704 1.00 0.00  ? 377 HIS B H    1 
ATOM 3768 H HA   . HIS B 2 77  ? 62.916  109.126 34.629 1.00 0.00  ? 377 HIS B HA   1 
ATOM 3769 H HB2  . HIS B 2 77  ? 62.303  110.994 36.249 1.00 0.00  ? 377 HIS B HB2  1 
ATOM 3770 H HB3  . HIS B 2 77  ? 62.068  109.316 36.831 1.00 0.00  ? 377 HIS B HB3  1 
ATOM 3771 H HD2  . HIS B 2 77  ? 65.779  109.610 37.659 1.00 0.00  ? 377 HIS B HD2  1 
ATOM 3772 H HE1  . HIS B 2 77  ? 63.972  111.719 40.698 1.00 0.00  ? 377 HIS B HE1  1 
ATOM 3773 N N    . ASN B 2 78  ? 65.544  111.056 35.100 1.00 82.61 ? 378 ASN B N    1 
ATOM 3774 C CA   . ASN B 2 78  ? 66.298  112.163 34.536 1.00 80.25 ? 378 ASN B CA   1 
ATOM 3775 C C    . ASN B 2 78  ? 67.397  111.639 33.638 1.00 80.42 ? 378 ASN B C    1 
ATOM 3776 O O    . ASN B 2 78  ? 68.327  111.008 34.105 1.00 80.32 ? 378 ASN B O    1 
ATOM 3777 C CB   . ASN B 2 78  ? 66.937  113.006 35.656 1.00 0.00  ? 378 ASN B CB   1 
ATOM 3778 C CG   . ASN B 2 78  ? 67.718  114.174 35.104 1.00 0.00  ? 378 ASN B CG   1 
ATOM 3779 O OD1  . ASN B 2 78  ? 68.671  114.008 34.360 1.00 0.00  ? 378 ASN B OD1  1 
ATOM 3780 N ND2  . ASN B 2 78  ? 67.291  115.380 35.490 1.00 0.00  ? 378 ASN B ND2  1 
ATOM 3781 H H    . ASN B 2 78  ? 65.982  110.542 35.812 1.00 0.00  ? 378 ASN B H    1 
ATOM 3782 H HA   . ASN B 2 78  ? 65.617  112.817 33.975 1.00 0.00  ? 378 ASN B HA   1 
ATOM 3783 N N    . ARG B 2 79  ? 67.281  111.935 32.329 1.00 81.65 ? 379 ARG B N    1 
ATOM 3784 C CA   . ARG B 2 79  ? 68.270  111.472 31.357 1.00 84.36 ? 379 ARG B CA   1 
ATOM 3785 C C    . ARG B 2 79  ? 69.653  112.095 31.404 1.00 85.01 ? 379 ARG B C    1 
ATOM 3786 O O    . ARG B 2 79  ? 70.580  111.518 30.867 1.00 85.03 ? 379 ARG B O    1 
ATOM 3787 C CB   . ARG B 2 79  ? 67.723  111.671 29.936 1.00 86.07 ? 379 ARG B CB   1 
ATOM 3788 C CG   . ARG B 2 79  ? 66.830  110.485 29.558 1.00 89.46 ? 379 ARG B CG   1 
ATOM 3789 C CD   . ARG B 2 79  ? 67.043  110.124 28.074 1.00 91.25 ? 379 ARG B CD   1 
ATOM 3790 N NE   . ARG B 2 79  ? 66.251  109.028 27.558 1.00 92.71 ? 379 ARG B NE   1 
ATOM 3791 C CZ   . ARG B 2 79  ? 64.929  109.023 27.502 1.00 93.94 ? 379 ARG B CZ   1 
ATOM 3792 N NH1  . ARG B 2 79  ? 64.193  110.030 27.916 1.00 95.15 ? 379 ARG B NH1  1 
ATOM 3793 N NH2  . ARG B 2 79  ? 64.326  107.977 26.992 1.00 92.86 ? 379 ARG B NH2  1 
ATOM 3794 H H    . ARG B 2 79  ? 66.499  112.474 32.011 1.00 0.00  ? 379 ARG B H    1 
ATOM 3795 H HA   . ARG B 2 79  ? 68.419  110.402 31.538 1.00 0.00  ? 379 ARG B HA   1 
ATOM 3796 H HB2  . ARG B 2 79  ? 67.161  112.623 29.864 1.00 0.00  ? 379 ARG B HB2  1 
ATOM 3797 H HB3  . ARG B 2 79  ? 68.558  111.713 29.225 1.00 0.00  ? 379 ARG B HB3  1 
ATOM 3798 H HG2  . ARG B 2 79  ? 66.960  109.613 30.188 1.00 0.00  ? 379 ARG B HG2  1 
ATOM 3799 H HG3  . ARG B 2 79  ? 65.819  110.833 29.860 1.00 0.00  ? 379 ARG B HG3  1 
ATOM 3800 H HD2  . ARG B 2 79  ? 66.910  111.018 27.458 1.00 0.00  ? 379 ARG B HD2  1 
ATOM 3801 H HD3  . ARG B 2 79  ? 68.097  109.846 28.009 1.00 0.00  ? 379 ARG B HD3  1 
ATOM 3802 H HH11 . ARG B 2 79  ? 64.618  110.916 28.220 1.00 0.00  ? 379 ARG B HH11 1 
ATOM 3803 H HH12 . ARG B 2 79  ? 63.193  110.021 27.902 1.00 0.00  ? 379 ARG B HH12 1 
ATOM 3804 H HH21 . ARG B 2 79  ? 64.856  107.167 26.648 1.00 0.00  ? 379 ARG B HH21 1 
ATOM 3805 H HH22 . ARG B 2 79  ? 63.294  107.956 26.922 1.00 0.00  ? 379 ARG B HH22 1 
ATOM 3806 N N    . SER B 2 80  ? 69.803  113.279 32.016 1.00 84.09 ? 380 SER B N    1 
ATOM 3807 C CA   . SER B 2 80  ? 71.127  113.874 32.168 1.00 80.64 ? 380 SER B CA   1 
ATOM 3808 C C    . SER B 2 80  ? 71.931  113.271 33.305 1.00 76.84 ? 380 SER B C    1 
ATOM 3809 O O    . SER B 2 80  ? 73.086  113.604 33.508 1.00 77.01 ? 380 SER B O    1 
ATOM 3810 C CB   . SER B 2 80  ? 71.022  115.398 32.343 1.00 82.46 ? 380 SER B CB   1 
ATOM 3811 O OG   . SER B 2 80  ? 70.580  116.035 31.138 1.00 80.93 ? 380 SER B OG   1 
ATOM 3812 H H    . SER B 2 80  ? 69.011  113.732 32.420 1.00 0.00  ? 380 SER B H    1 
ATOM 3813 H HA   . SER B 2 80  ? 71.641  113.697 31.232 1.00 0.00  ? 380 SER B HA   1 
ATOM 3814 H HB2  . SER B 2 80  ? 70.301  115.611 33.149 1.00 0.00  ? 380 SER B HB2  1 
ATOM 3815 H HB3  . SER B 2 80  ? 72.010  115.801 32.618 1.00 0.00  ? 380 SER B HB3  1 
ATOM 3816 H HG   . SER B 2 80  ? 70.518  116.976 31.271 1.00 0.00  ? 380 SER B HG   1 
ATOM 3817 N N    . GLU B 2 81  ? 71.287  112.371 34.063 1.00 71.34 ? 381 GLU B N    1 
ATOM 3818 C CA   . GLU B 2 81  ? 71.953  111.720 35.176 1.00 66.05 ? 381 GLU B CA   1 
ATOM 3819 C C    . GLU B 2 81  ? 73.119  110.885 34.688 1.00 64.23 ? 381 GLU B C    1 
ATOM 3820 O O    . GLU B 2 81  ? 73.046  110.276 33.636 1.00 64.76 ? 381 GLU B O    1 
ATOM 3821 C CB   . GLU B 2 81  ? 70.942  110.840 35.944 1.00 62.79 ? 381 GLU B CB   1 
ATOM 3822 C CG   . GLU B 2 81  ? 71.586  110.124 37.140 1.00 59.00 ? 381 GLU B CG   1 
ATOM 3823 C CD   . GLU B 2 81  ? 70.573  109.757 38.188 1.00 58.53 ? 381 GLU B CD   1 
ATOM 3824 O OE1  . GLU B 2 81  ? 69.507  109.197 37.819 1.00 59.63 ? 381 GLU B OE1  1 
ATOM 3825 O OE2  . GLU B 2 81  ? 70.844  110.034 39.386 1.00 58.12 ? 381 GLU B OE2  1 
ATOM 3826 H H    . GLU B 2 81  ? 70.334  112.136 33.890 1.00 0.00  ? 381 GLU B H    1 
ATOM 3827 H HA   . GLU B 2 81  ? 72.310  112.500 35.867 1.00 0.00  ? 381 GLU B HA   1 
ATOM 3828 H HB2  . GLU B 2 81  ? 70.122  111.483 36.313 1.00 0.00  ? 381 GLU B HB2  1 
ATOM 3829 H HB3  . GLU B 2 81  ? 70.535  110.081 35.256 1.00 0.00  ? 381 GLU B HB3  1 
ATOM 3830 H HG2  . GLU B 2 81  ? 72.078  109.209 36.777 1.00 0.00  ? 381 GLU B HG2  1 
ATOM 3831 H HG3  . GLU B 2 81  ? 72.332  110.793 37.592 1.00 0.00  ? 381 GLU B HG3  1 
ATOM 3832 N N    . GLU B 2 82  ? 74.202  110.878 35.487 1.00 60.79 ? 382 GLU B N    1 
ATOM 3833 C CA   . GLU B 2 82  ? 75.400  110.142 35.111 1.00 54.12 ? 382 GLU B CA   1 
ATOM 3834 C C    . GLU B 2 82  ? 75.621  108.843 35.869 1.00 49.82 ? 382 GLU B C    1 
ATOM 3835 O O    . GLU B 2 82  ? 75.403  108.767 37.062 1.00 48.63 ? 382 GLU B O    1 
ATOM 3836 C CB   . GLU B 2 82  ? 76.648  111.029 35.288 1.00 55.39 ? 382 GLU B CB   1 
ATOM 3837 C CG   . GLU B 2 82  ? 76.729  112.144 34.229 1.00 57.72 ? 382 GLU B CG   1 
ATOM 3838 C CD   . GLU B 2 82  ? 78.007  112.933 34.356 1.00 58.51 ? 382 GLU B CD   1 
ATOM 3839 O OE1  . GLU B 2 82  ? 78.213  113.570 35.420 1.00 59.52 ? 382 GLU B OE1  1 
ATOM 3840 O OE2  . GLU B 2 82  ? 78.819  112.918 33.398 1.00 54.41 ? 382 GLU B OE2  1 
ATOM 3841 H H    . GLU B 2 82  ? 74.216  111.398 36.340 1.00 0.00  ? 382 GLU B H    1 
ATOM 3842 H HA   . GLU B 2 82  ? 75.321  109.911 34.040 1.00 0.00  ? 382 GLU B HA   1 
ATOM 3843 H HB2  . GLU B 2 82  ? 76.617  111.491 36.288 1.00 0.00  ? 382 GLU B HB2  1 
ATOM 3844 H HB3  . GLU B 2 82  ? 77.548  110.399 35.201 1.00 0.00  ? 382 GLU B HB3  1 
ATOM 3845 H HG2  . GLU B 2 82  ? 76.687  111.685 33.229 1.00 0.00  ? 382 GLU B HG2  1 
ATOM 3846 H HG3  . GLU B 2 82  ? 75.872  112.821 34.362 1.00 0.00  ? 382 GLU B HG3  1 
ATOM 3847 N N    . PHE B 2 83  ? 76.104  107.841 35.096 1.00 45.22 ? 383 PHE B N    1 
ATOM 3848 C CA   . PHE B 2 83  ? 76.372  106.497 35.582 1.00 39.84 ? 383 PHE B CA   1 
ATOM 3849 C C    . PHE B 2 83  ? 77.800  106.033 35.383 1.00 39.34 ? 383 PHE B C    1 
ATOM 3850 O O    . PHE B 2 83  ? 78.481  106.524 34.508 1.00 41.46 ? 383 PHE B O    1 
ATOM 3851 C CB   . PHE B 2 83  ? 75.469  105.490 34.854 1.00 33.77 ? 383 PHE B CB   1 
ATOM 3852 C CG   . PHE B 2 83  ? 74.036  105.523 35.358 1.00 26.17 ? 383 PHE B CG   1 
ATOM 3853 C CD1  . PHE B 2 83  ? 73.138  106.459 34.859 1.00 24.33 ? 383 PHE B CD1  1 
ATOM 3854 C CD2  . PHE B 2 83  ? 73.633  104.604 36.330 1.00 25.31 ? 383 PHE B CD2  1 
ATOM 3855 C CE1  . PHE B 2 83  ? 71.835  106.507 35.340 1.00 21.31 ? 383 PHE B CE1  1 
ATOM 3856 C CE2  . PHE B 2 83  ? 72.342  104.634 36.811 1.00 29.08 ? 383 PHE B CE2  1 
ATOM 3857 C CZ   . PHE B 2 83  ? 71.478  105.589 36.313 1.00 24.94 ? 383 PHE B CZ   1 
ATOM 3858 H H    . PHE B 2 83  ? 76.303  108.000 34.135 1.00 0.00  ? 383 PHE B H    1 
ATOM 3859 H HA   . PHE B 2 83  ? 76.173  106.444 36.641 1.00 0.00  ? 383 PHE B HA   1 
ATOM 3860 H HB2  . PHE B 2 83  ? 75.456  105.732 33.781 1.00 0.00  ? 383 PHE B HB2  1 
ATOM 3861 H HB3  . PHE B 2 83  ? 75.854  104.469 34.994 1.00 0.00  ? 383 PHE B HB3  1 
ATOM 3862 H HD1  . PHE B 2 83  ? 73.450  107.160 34.092 1.00 0.00  ? 383 PHE B HD1  1 
ATOM 3863 H HD2  . PHE B 2 83  ? 74.328  103.867 36.706 1.00 0.00  ? 383 PHE B HD2  1 
ATOM 3864 H HE1  . PHE B 2 83  ? 71.136  107.238 34.965 1.00 0.00  ? 383 PHE B HE1  1 
ATOM 3865 H HE2  . PHE B 2 83  ? 72.002  103.931 37.548 1.00 0.00  ? 383 PHE B HE2  1 
ATOM 3866 H HZ   . PHE B 2 83  ? 70.497  105.559 36.741 1.00 0.00  ? 383 PHE B HZ   1 
ATOM 3867 N N    . LEU B 2 84  ? 78.230  105.050 36.206 1.00 35.22 ? 384 LEU B N    1 
ATOM 3868 C CA   . LEU B 2 84  ? 79.554  104.450 36.065 1.00 29.65 ? 384 LEU B CA   1 
ATOM 3869 C C    . LEU B 2 84  ? 79.258  103.076 35.517 1.00 27.33 ? 384 LEU B C    1 
ATOM 3870 O O    . LEU B 2 84  ? 78.672  102.269 36.205 1.00 31.12 ? 384 LEU B O    1 
ATOM 3871 C CB   . LEU B 2 84  ? 80.256  104.373 37.440 1.00 27.58 ? 384 LEU B CB   1 
ATOM 3872 C CG   . LEU B 2 84  ? 81.758  103.990 37.505 1.00 23.64 ? 384 LEU B CG   1 
ATOM 3873 C CD1  . LEU B 2 84  ? 82.010  102.569 36.987 1.00 24.96 ? 384 LEU B CD1  1 
ATOM 3874 C CD2  . LEU B 2 84  ? 82.631  104.983 36.734 1.00 14.59 ? 384 LEU B CD2  1 
ATOM 3875 H H    . LEU B 2 84  ? 77.626  104.693 36.916 1.00 0.00  ? 384 LEU B H    1 
ATOM 3876 H HA   . LEU B 2 84  ? 80.167  105.045 35.379 1.00 0.00  ? 384 LEU B HA   1 
ATOM 3877 H HB2  . LEU B 2 84  ? 80.165  105.362 37.903 1.00 0.00  ? 384 LEU B HB2  1 
ATOM 3878 H HB3  . LEU B 2 84  ? 79.719  103.632 38.041 1.00 0.00  ? 384 LEU B HB3  1 
ATOM 3879 H HG   . LEU B 2 84  ? 82.071  104.026 38.564 1.00 0.00  ? 384 LEU B HG   1 
ATOM 3880 H HD11 . LEU B 2 84  ? 81.685  102.499 35.941 1.00 0.00  ? 384 LEU B HD11 1 
ATOM 3881 H HD12 . LEU B 2 84  ? 83.081  102.343 37.059 1.00 0.00  ? 384 LEU B HD12 1 
ATOM 3882 H HD13 . LEU B 2 84  ? 81.449  101.861 37.607 1.00 0.00  ? 384 LEU B HD13 1 
ATOM 3883 H HD21 . LEU B 2 84  ? 82.484  105.983 37.152 1.00 0.00  ? 384 LEU B HD21 1 
ATOM 3884 H HD22 . LEU B 2 84  ? 83.686  104.687 36.826 1.00 0.00  ? 384 LEU B HD22 1 
ATOM 3885 H HD23 . LEU B 2 84  ? 82.346  104.983 35.677 1.00 0.00  ? 384 LEU B HD23 1 
ATOM 3886 N N    . ILE B 2 85  ? 79.671  102.845 34.261 1.00 20.86 ? 385 ILE B N    1 
ATOM 3887 C CA   . ILE B 2 85  ? 79.435  101.579 33.597 1.00 18.20 ? 385 ILE B CA   1 
ATOM 3888 C C    . ILE B 2 85  ? 80.784  100.926 33.420 1.00 19.33 ? 385 ILE B C    1 
ATOM 3889 O O    . ILE B 2 85  ? 81.643  101.481 32.758 1.00 21.48 ? 385 ILE B O    1 
ATOM 3890 C CB   . ILE B 2 85  ? 78.809  101.802 32.188 1.00 16.78 ? 385 ILE B CB   1 
ATOM 3891 C CG1  . ILE B 2 85  ? 77.536  102.669 32.289 1.00 17.63 ? 385 ILE B CG1  1 
ATOM 3892 C CG2  . ILE B 2 85  ? 78.487  100.454 31.508 1.00 10.96 ? 385 ILE B CG2  1 
ATOM 3893 C CD1  . ILE B 2 85  ? 76.963  103.069 30.910 1.00 22.07 ? 385 ILE B CD1  1 
ATOM 3894 H H    . ILE B 2 85  ? 80.147  103.559 33.758 1.00 0.00  ? 385 ILE B H    1 
ATOM 3895 H HA   . ILE B 2 85  ? 78.765  100.953 34.199 1.00 0.00  ? 385 ILE B HA   1 
ATOM 3896 H HB   . ILE B 2 85  ? 79.539  102.336 31.562 1.00 0.00  ? 385 ILE B HB   1 
ATOM 3897 H HG12 . ILE B 2 85  ? 76.768  102.107 32.840 1.00 0.00  ? 385 ILE B HG12 1 
ATOM 3898 H HG13 . ILE B 2 85  ? 77.780  103.592 32.837 1.00 0.00  ? 385 ILE B HG13 1 
ATOM 3899 H HG21 . ILE B 2 85  ? 77.773  99.885  32.117 1.00 0.00  ? 385 ILE B HG21 1 
ATOM 3900 H HG22 . ILE B 2 85  ? 78.059  100.607 30.512 1.00 0.00  ? 385 ILE B HG22 1 
ATOM 3901 H HG23 . ILE B 2 85  ? 79.405  99.872  31.375 1.00 0.00  ? 385 ILE B HG23 1 
ATOM 3902 H HD11 . ILE B 2 85  ? 76.673  102.187 30.328 1.00 0.00  ? 385 ILE B HD11 1 
ATOM 3903 H HD12 . ILE B 2 85  ? 76.058  103.674 31.049 1.00 0.00  ? 385 ILE B HD12 1 
ATOM 3904 H HD13 . ILE B 2 85  ? 77.712  103.646 30.346 1.00 0.00  ? 385 ILE B HD13 1 
ATOM 3905 N N    . ALA B 2 86  ? 80.963  99.742  34.019 1.00 18.60 ? 386 ALA B N    1 
ATOM 3906 C CA   . ALA B 2 86  ? 82.198  99.013  33.822 1.00 19.08 ? 386 ALA B CA   1 
ATOM 3907 C C    . ALA B 2 86  ? 81.844  97.850  32.931 1.00 19.48 ? 386 ALA B C    1 
ATOM 3908 O O    . ALA B 2 86  ? 81.097  96.983  33.352 1.00 23.96 ? 386 ALA B O    1 
ATOM 3909 C CB   . ALA B 2 86  ? 82.665  98.577  35.210 1.00 18.05 ? 386 ALA B CB   1 
ATOM 3910 H H    . ALA B 2 86  ? 80.248  99.335  34.589 1.00 0.00  ? 386 ALA B H    1 
ATOM 3911 H HA   . ALA B 2 86  ? 82.982  99.640  33.382 1.00 0.00  ? 386 ALA B HA   1 
ATOM 3912 H HB1  . ALA B 2 86  ? 83.681  98.206  35.178 1.00 0.00  ? 386 ALA B HB1  1 
ATOM 3913 H HB2  . ALA B 2 86  ? 82.865  99.408  35.872 1.00 0.00  ? 386 ALA B HB2  1 
ATOM 3914 H HB3  . ALA B 2 86  ? 81.977  97.842  35.653 1.00 0.00  ? 386 ALA B HB3  1 
ATOM 3915 N N    . GLY B 2 87  ? 82.359  97.838  31.690 1.00 18.60 ? 387 GLY B N    1 
ATOM 3916 C CA   . GLY B 2 87  ? 81.964  96.768  30.786 1.00 20.08 ? 387 GLY B CA   1 
ATOM 3917 C C    . GLY B 2 87  ? 83.073  96.141  29.974 1.00 21.47 ? 387 GLY B C    1 
ATOM 3918 O O    . GLY B 2 87  ? 84.193  96.613  29.960 1.00 24.77 ? 387 GLY B O    1 
ATOM 3919 H H    . GLY B 2 87  ? 82.963  98.566  31.362 1.00 0.00  ? 387 GLY B H    1 
ATOM 3920 H HA2  . GLY B 2 87  ? 81.508  95.954  31.368 1.00 0.00  ? 387 GLY B HA2  1 
ATOM 3921 H HA3  . GLY B 2 87  ? 81.214  97.163  30.087 1.00 0.00  ? 387 GLY B HA3  1 
ATOM 3922 N N    . LYS B 2 88  ? 82.705  95.046  29.282 1.00 21.13 ? 388 LYS B N    1 
ATOM 3923 C CA   . LYS B 2 88  ? 83.642  94.317  28.442 1.00 21.49 ? 388 LYS B CA   1 
ATOM 3924 C C    . LYS B 2 88  ? 83.462  94.709  26.994 1.00 25.25 ? 388 LYS B C    1 
ATOM 3925 O O    . LYS B 2 88  ? 82.496  95.364  26.659 1.00 29.35 ? 388 LYS B O    1 
ATOM 3926 C CB   . LYS B 2 88  ? 83.384  92.803  28.581 1.00 20.70 ? 388 LYS B CB   1 
ATOM 3927 C CG   . LYS B 2 88  ? 83.641  92.250  30.000 1.00 23.49 ? 388 LYS B CG   1 
ATOM 3928 C CD   . LYS B 2 88  ? 85.002  91.526  30.067 1.00 31.10 ? 388 LYS B CD   1 
ATOM 3929 C CE   . LYS B 2 88  ? 85.170  90.833  31.428 1.00 36.06 ? 388 LYS B CE   1 
ATOM 3930 N NZ   . LYS B 2 88  ? 86.490  90.153  31.561 1.00 33.56 ? 388 LYS B NZ   1 
ATOM 3931 H H    . LYS B 2 88  ? 81.760  94.722  29.325 1.00 0.00  ? 388 LYS B H    1 
ATOM 3932 H HA   . LYS B 2 88  ? 84.667  94.517  28.762 1.00 0.00  ? 388 LYS B HA   1 
ATOM 3933 H HB2  . LYS B 2 88  ? 82.332  92.605  28.324 1.00 0.00  ? 388 LYS B HB2  1 
ATOM 3934 H HB3  . LYS B 2 88  ? 84.030  92.261  27.875 1.00 0.00  ? 388 LYS B HB3  1 
ATOM 3935 H HG2  . LYS B 2 88  ? 83.632  93.079  30.728 1.00 0.00  ? 388 LYS B HG2  1 
ATOM 3936 H HG3  . LYS B 2 88  ? 82.841  91.532  30.256 1.00 0.00  ? 388 LYS B HG3  1 
ATOM 3937 H HD2  . LYS B 2 88  ? 85.045  90.770  29.264 1.00 0.00  ? 388 LYS B HD2  1 
ATOM 3938 H HD3  . LYS B 2 88  ? 85.800  92.269  29.917 1.00 0.00  ? 388 LYS B HD3  1 
ATOM 3939 H HE2  . LYS B 2 88  ? 85.094  91.581  32.222 1.00 0.00  ? 388 LYS B HE2  1 
ATOM 3940 H HE3  . LYS B 2 88  ? 84.389  90.074  31.546 1.00 0.00  ? 388 LYS B HE3  1 
ATOM 3941 H HZ1  . LYS B 2 88  ? 87.304  90.846  31.458 1.00 0.00  ? 388 LYS B HZ1  1 
ATOM 3942 H HZ2  . LYS B 2 88  ? 86.581  89.686  32.525 1.00 0.00  ? 388 LYS B HZ2  1 
ATOM 3943 H HZ3  . LYS B 2 88  ? 86.615  89.386  30.819 1.00 0.00  ? 388 LYS B HZ3  1 
ATOM 3944 N N    . LEU B 2 89  ? 84.396  94.287  26.129 1.00 24.89 ? 389 LEU B N    1 
ATOM 3945 C CA   . LEU B 2 89  ? 84.312  94.644  24.724 1.00 31.48 ? 389 LEU B CA   1 
ATOM 3946 C C    . LEU B 2 89  ? 84.239  93.388  23.879 1.00 41.04 ? 389 LEU B C    1 
ATOM 3947 O O    . LEU B 2 89  ? 85.260  92.781  23.601 1.00 47.22 ? 389 LEU B O    1 
ATOM 3948 C CB   . LEU B 2 89  ? 85.581  95.376  24.261 1.00 31.37 ? 389 LEU B CB   1 
ATOM 3949 C CG   . LEU B 2 89  ? 85.839  96.878  24.444 1.00 30.83 ? 389 LEU B CG   1 
ATOM 3950 C CD1  . LEU B 2 89  ? 87.229  97.152  23.834 1.00 31.03 ? 389 LEU B CD1  1 
ATOM 3951 C CD2  . LEU B 2 89  ? 84.802  97.742  23.719 1.00 28.77 ? 389 LEU B CD2  1 
ATOM 3952 H H    . LEU B 2 89  ? 85.161  93.719  26.437 1.00 0.00  ? 389 LEU B H    1 
ATOM 3953 H HA   . LEU B 2 89  ? 83.438  95.269  24.546 1.00 0.00  ? 389 LEU B HA   1 
ATOM 3954 H HB2  . LEU B 2 89  ? 86.407  94.875  24.778 1.00 0.00  ? 389 LEU B HB2  1 
ATOM 3955 H HB3  . LEU B 2 89  ? 85.638  95.220  23.177 1.00 0.00  ? 389 LEU B HB3  1 
ATOM 3956 H HG   . LEU B 2 89  ? 85.857  97.097  25.514 1.00 0.00  ? 389 LEU B HG   1 
ATOM 3957 H HD11 . LEU B 2 89  ? 87.226  96.866  22.769 1.00 0.00  ? 389 LEU B HD11 1 
ATOM 3958 H HD12 . LEU B 2 89  ? 87.478  98.216  23.916 1.00 0.00  ? 389 LEU B HD12 1 
ATOM 3959 H HD13 . LEU B 2 89  ? 87.988  96.558  24.367 1.00 0.00  ? 389 LEU B HD13 1 
ATOM 3960 H HD21 . LEU B 2 89  ? 83.810  97.527  24.130 1.00 0.00  ? 389 LEU B HD21 1 
ATOM 3961 H HD22 . LEU B 2 89  ? 85.043  98.804  23.864 1.00 0.00  ? 389 LEU B HD22 1 
ATOM 3962 H HD23 . LEU B 2 89  ? 84.826  97.504  22.646 1.00 0.00  ? 389 LEU B HD23 1 
ATOM 3963 N N    . GLN B 2 90  ? 83.030  93.003  23.447 1.00 50.92 ? 390 GLN B N    1 
ATOM 3964 C CA   . GLN B 2 90  ? 82.917  91.887  22.513 1.00 57.11 ? 390 GLN B CA   1 
ATOM 3965 C C    . GLN B 2 90  ? 83.017  92.581  21.176 1.00 59.84 ? 390 GLN B C    1 
ATOM 3966 O O    . GLN B 2 90  ? 82.258  93.508  20.959 1.00 61.18 ? 390 GLN B O    1 
ATOM 3967 C CB   . GLN B 2 90  ? 81.554  91.187  22.690 1.00 61.36 ? 390 GLN B CB   1 
ATOM 3968 C CG   . GLN B 2 90  ? 81.454  89.816  21.997 1.00 63.74 ? 390 GLN B CG   1 
ATOM 3969 C CD   . GLN B 2 90  ? 80.076  89.203  22.171 1.00 65.61 ? 390 GLN B CD   1 
ATOM 3970 O OE1  . GLN B 2 90  ? 79.558  89.106  23.271 1.00 64.45 ? 390 GLN B OE1  1 
ATOM 3971 N NE2  . GLN B 2 90  ? 79.473  88.779  21.048 1.00 62.80 ? 390 GLN B NE2  1 
ATOM 3972 H H    . GLN B 2 90  ? 82.210  93.501  23.722 1.00 0.00  ? 390 GLN B H    1 
ATOM 3973 H HA   . GLN B 2 90  ? 83.718  91.146  22.678 1.00 0.00  ? 390 GLN B HA   1 
ATOM 3974 H HB2  . GLN B 2 90  ? 81.374  91.038  23.767 1.00 0.00  ? 390 GLN B HB2  1 
ATOM 3975 H HB3  . GLN B 2 90  ? 80.780  91.844  22.272 1.00 0.00  ? 390 GLN B HB3  1 
ATOM 3976 H HG2  . GLN B 2 90  ? 81.678  89.961  20.929 1.00 0.00  ? 390 GLN B HG2  1 
ATOM 3977 H HG3  . GLN B 2 90  ? 82.205  89.137  22.427 1.00 0.00  ? 390 GLN B HG3  1 
ATOM 3978 H HE21 . GLN B 2 90  ? 79.917  88.874  20.157 1.00 0.00  ? 390 GLN B HE21 1 
ATOM 3979 H HE22 . GLN B 2 90  ? 78.564  88.363  21.095 1.00 0.00  ? 390 GLN B HE22 1 
ATOM 3980 N N    . ASP B 2 91  ? 83.965  92.144  20.328 1.00 60.13 ? 391 ASP B N    1 
ATOM 3981 C CA   . ASP B 2 91  ? 84.229  92.841  19.074 1.00 60.46 ? 391 ASP B CA   1 
ATOM 3982 C C    . ASP B 2 91  ? 84.753  94.190  19.524 1.00 57.68 ? 391 ASP B C    1 
ATOM 3983 O O    . ASP B 2 91  ? 85.673  94.248  20.318 1.00 58.67 ? 391 ASP B O    1 
ATOM 3984 C CB   . ASP B 2 91  ? 82.963  92.937  18.190 1.00 66.21 ? 391 ASP B CB   1 
ATOM 3985 C CG   . ASP B 2 91  ? 82.604  91.692  17.431 1.00 71.35 ? 391 ASP B CG   1 
ATOM 3986 O OD1  . ASP B 2 91  ? 83.526  91.031  16.896 1.00 70.83 ? 391 ASP B OD1  1 
ATOM 3987 O OD2  . ASP B 2 91  ? 81.393  91.378  17.346 1.00 72.94 ? 391 ASP B OD2  1 
ATOM 3988 H H    . ASP B 2 91  ? 84.535  91.363  20.574 1.00 0.00  ? 391 ASP B H    1 
ATOM 3989 H HA   . ASP B 2 91  ? 85.002  92.311  18.493 1.00 0.00  ? 391 ASP B HA   1 
ATOM 3990 H HB2  . ASP B 2 91  ? 82.100  93.243  18.789 1.00 0.00  ? 391 ASP B HB2  1 
ATOM 3991 H HB3  . ASP B 2 91  ? 83.097  93.650  17.360 1.00 0.00  ? 391 ASP B HB3  1 
ATOM 3992 N N    . GLY B 2 92  ? 84.173  95.309  19.059 1.00 51.74 ? 392 GLY B N    1 
ATOM 3993 C CA   . GLY B 2 92  ? 84.579  96.611  19.503 1.00 46.00 ? 392 GLY B CA   1 
ATOM 3994 C C    . GLY B 2 92  ? 83.431  97.263  20.237 1.00 45.01 ? 392 GLY B C    1 
ATOM 3995 O O    . GLY B 2 92  ? 83.410  98.472  20.380 1.00 46.21 ? 392 GLY B O    1 
ATOM 3996 H H    . GLY B 2 92  ? 83.355  95.353  18.474 1.00 0.00  ? 392 GLY B H    1 
ATOM 3997 H HA2  . GLY B 2 92  ? 85.430  96.529  20.173 1.00 0.00  ? 392 GLY B HA2  1 
ATOM 3998 H HA3  . GLY B 2 92  ? 84.858  97.207  18.623 1.00 0.00  ? 392 GLY B HA3  1 
ATOM 3999 N N    . LEU B 2 93  ? 82.489  96.421  20.716 1.00 43.55 ? 393 LEU B N    1 
ATOM 4000 C CA   . LEU B 2 93  ? 81.293  96.914  21.376 1.00 38.68 ? 393 LEU B CA   1 
ATOM 4001 C C    . LEU B 2 93  ? 81.247  96.678  22.871 1.00 35.15 ? 393 LEU B C    1 
ATOM 4002 O O    . LEU B 2 93  ? 81.612  95.628  23.346 1.00 33.91 ? 393 LEU B O    1 
ATOM 4003 C CB   . LEU B 2 93  ? 80.048  96.289  20.726 1.00 37.51 ? 393 LEU B CB   1 
ATOM 4004 C CG   . LEU B 2 93  ? 80.058  96.365  19.181 1.00 37.72 ? 393 LEU B CG   1 
ATOM 4005 C CD1  . LEU B 2 93  ? 78.843  95.598  18.636 1.00 41.21 ? 393 LEU B CD1  1 
ATOM 4006 C CD2  . LEU B 2 93  ? 80.033  97.824  18.685 1.00 34.91 ? 393 LEU B CD2  1 
ATOM 4007 H H    . LEU B 2 93  ? 82.573  95.434  20.623 1.00 0.00  ? 393 LEU B H    1 
ATOM 4008 H HA   . LEU B 2 93  ? 81.244  97.994  21.215 1.00 0.00  ? 393 LEU B HA   1 
ATOM 4009 H HB2  . LEU B 2 93  ? 79.997  95.227  21.011 1.00 0.00  ? 393 LEU B HB2  1 
ATOM 4010 H HB3  . LEU B 2 93  ? 79.152  96.813  21.096 1.00 0.00  ? 393 LEU B HB3  1 
ATOM 4011 H HG   . LEU B 2 93  ? 80.968  95.880  18.794 1.00 0.00  ? 393 LEU B HG   1 
ATOM 4012 H HD11 . LEU B 2 93  ? 77.918  96.036  19.040 1.00 0.00  ? 393 LEU B HD11 1 
ATOM 4013 H HD12 . LEU B 2 93  ? 78.833  95.660  17.537 1.00 0.00  ? 393 LEU B HD12 1 
ATOM 4014 H HD13 . LEU B 2 93  ? 78.914  94.543  18.943 1.00 0.00  ? 393 LEU B HD13 1 
ATOM 4015 H HD21 . LEU B 2 93  ? 80.924  98.350  19.047 1.00 0.00  ? 393 LEU B HD21 1 
ATOM 4016 H HD22 . LEU B 2 93  ? 80.039  97.838  17.586 1.00 0.00  ? 393 LEU B HD22 1 
ATOM 4017 H HD23 . LEU B 2 93  ? 79.128  98.328  19.056 1.00 0.00  ? 393 LEU B HD23 1 
ATOM 4018 N N    . LEU B 2 94  ? 80.783  97.711  23.602 1.00 31.91 ? 394 LEU B N    1 
ATOM 4019 C CA   . LEU B 2 94  ? 80.681  97.649  25.049 1.00 31.09 ? 394 LEU B CA   1 
ATOM 4020 C C    . LEU B 2 94  ? 79.473  96.844  25.442 1.00 29.80 ? 394 LEU B C    1 
ATOM 4021 O O    . LEU B 2 94  ? 78.375  97.167  25.030 1.00 30.25 ? 394 LEU B O    1 
ATOM 4022 C CB   . LEU B 2 94  ? 80.532  99.078  25.609 1.00 30.87 ? 394 LEU B CB   1 
ATOM 4023 C CG   . LEU B 2 94  ? 80.663  99.219  27.139 1.00 30.82 ? 394 LEU B CG   1 
ATOM 4024 C CD1  . LEU B 2 94  ? 82.101  98.883  27.557 1.00 29.03 ? 394 LEU B CD1  1 
ATOM 4025 C CD2  . LEU B 2 94  ? 80.301  100.662 27.558 1.00 22.95 ? 394 LEU B CD2  1 
ATOM 4026 H H    . LEU B 2 94  ? 80.494  98.549  23.152 1.00 0.00  ? 394 LEU B H    1 
ATOM 4027 H HA   . LEU B 2 94  ? 81.599  97.194  25.422 1.00 0.00  ? 394 LEU B HA   1 
ATOM 4028 H HB2  . LEU B 2 94  ? 81.306  99.707  25.143 1.00 0.00  ? 394 LEU B HB2  1 
ATOM 4029 H HB3  . LEU B 2 94  ? 79.537  99.445  25.322 1.00 0.00  ? 394 LEU B HB3  1 
ATOM 4030 H HG   . LEU B 2 94  ? 79.974  98.523  27.641 1.00 0.00  ? 394 LEU B HG   1 
ATOM 4031 H HD11 . LEU B 2 94  ? 82.778  99.544  27.026 1.00 0.00  ? 394 LEU B HD11 1 
ATOM 4032 H HD12 . LEU B 2 94  ? 82.225  99.017  28.634 1.00 0.00  ? 394 LEU B HD12 1 
ATOM 4033 H HD13 . LEU B 2 94  ? 82.351  97.856  27.300 1.00 0.00  ? 394 LEU B HD13 1 
ATOM 4034 H HD21 . LEU B 2 94  ? 79.265  100.882 27.257 1.00 0.00  ? 394 LEU B HD21 1 
ATOM 4035 H HD22 . LEU B 2 94  ? 80.391  100.763 28.650 1.00 0.00  ? 394 LEU B HD22 1 
ATOM 4036 H HD23 . LEU B 2 94  ? 80.983  101.376 27.069 1.00 0.00  ? 394 LEU B HD23 1 
ATOM 4037 N N    . HIS B 2 95  ? 79.701  95.798  26.247 1.00 28.70 ? 395 HIS B N    1 
ATOM 4038 C CA   . HIS B 2 95  ? 78.609  94.971  26.714 1.00 26.01 ? 395 HIS B CA   1 
ATOM 4039 C C    . HIS B 2 95  ? 78.484  95.096  28.214 1.00 26.20 ? 395 HIS B C    1 
ATOM 4040 O O    . HIS B 2 95  ? 79.453  95.285  28.927 1.00 29.20 ? 395 HIS B O    1 
ATOM 4041 C CB   . HIS B 2 95  ? 78.814  93.484  26.366 1.00 31.08 ? 395 HIS B CB   1 
ATOM 4042 C CG   . HIS B 2 95  ? 78.578  93.140  24.919 1.00 33.97 ? 395 HIS B CG   1 
ATOM 4043 N ND1  . HIS B 2 95  ? 77.691  92.228  24.519 1.00 35.12 ? 395 HIS B ND1  1 
ATOM 4044 C CD2  . HIS B 2 95  ? 79.187  93.651  23.841 1.00 34.67 ? 395 HIS B CD2  1 
ATOM 4045 C CE1  . HIS B 2 95  ? 77.735  92.146  23.209 1.00 35.25 ? 395 HIS B CE1  1 
ATOM 4046 N NE2  . HIS B 2 95  ? 78.577  92.940  22.761 1.00 32.68 ? 395 HIS B NE2  1 
ATOM 4047 H H    . HIS B 2 95  ? 80.622  95.559  26.542 1.00 0.00  ? 395 HIS B H    1 
ATOM 4048 H HA   . HIS B 2 95  ? 77.681  95.293  26.230 1.00 0.00  ? 395 HIS B HA   1 
ATOM 4049 H HB2  . HIS B 2 95  ? 79.848  93.218  26.651 1.00 0.00  ? 395 HIS B HB2  1 
ATOM 4050 H HB3  . HIS B 2 95  ? 78.119  92.887  26.984 1.00 0.00  ? 395 HIS B HB3  1 
ATOM 4051 H HD2  . HIS B 2 95  ? 79.932  94.394  23.786 1.00 0.00  ? 395 HIS B HD2  1 
ATOM 4052 H HE1  . HIS B 2 95  ? 77.124  91.481  22.611 1.00 0.00  ? 395 HIS B HE1  1 
ATOM 4053 N N    . ILE B 2 96  ? 77.216  94.940  28.637 1.00 27.31 ? 396 ILE B N    1 
ATOM 4054 C CA   . ILE B 2 96  ? 76.824  95.072  30.001 1.00 29.73 ? 396 ILE B CA   1 
ATOM 4055 C C    . ILE B 2 96  ? 75.882  93.928  30.290 1.00 30.79 ? 396 ILE B C    1 
ATOM 4056 O O    . ILE B 2 96  ? 75.263  93.467  29.366 1.00 30.06 ? 396 ILE B O    1 
ATOM 4057 C CB   . ILE B 2 96  ? 76.198  96.439  30.227 1.00 34.94 ? 396 ILE B CB   1 
ATOM 4058 C CG1  . ILE B 2 96  ? 75.991  96.707  31.690 1.00 41.48 ? 396 ILE B CG1  1 
ATOM 4059 C CG2  . ILE B 2 96  ? 74.851  96.439  29.526 1.00 36.73 ? 396 ILE B CG2  1 
ATOM 4060 C CD1  . ILE B 2 96  ? 75.011  97.895  31.732 1.00 41.55 ? 396 ILE B CD1  1 
ATOM 4061 H H    . ILE B 2 96  ? 76.497  94.707  28.011 1.00 0.00  ? 396 ILE B H    1 
ATOM 4062 H HA   . ILE B 2 96  ? 77.795  95.077  30.502 1.00 0.00  ? 396 ILE B HA   1 
ATOM 4063 H HB   . ILE B 2 96  ? 76.842  97.224  29.804 1.00 0.00  ? 396 ILE B HB   1 
ATOM 4064 H HG12 . ILE B 2 96  ? 75.467  95.885  32.173 1.00 0.00  ? 396 ILE B HG12 1 
ATOM 4065 H HG13 . ILE B 2 96  ? 76.905  96.995  32.194 1.00 0.00  ? 396 ILE B HG13 1 
ATOM 4066 H HG21 . ILE B 2 96  ? 74.203  95.670  29.961 1.00 0.00  ? 396 ILE B HG21 1 
ATOM 4067 H HG22 . ILE B 2 96  ? 74.355  97.405  29.488 1.00 0.00  ? 396 ILE B HG22 1 
ATOM 4068 H HG23 . ILE B 2 96  ? 75.020  96.305  28.491 1.00 0.00  ? 396 ILE B HG23 1 
ATOM 4069 H HD11 . ILE B 2 96  ? 74.060  97.794  31.402 1.00 0.00  ? 396 ILE B HD11 1 
ATOM 4070 H HD12 . ILE B 2 96  ? 74.325  97.715  32.457 1.00 0.00  ? 396 ILE B HD12 1 
ATOM 4071 H HD13 . ILE B 2 96  ? 75.423  98.920  31.389 1.00 0.00  ? 396 ILE B HD13 1 
ATOM 4072 N N    . THR B 2 97  ? 75.709  93.466  31.529 1.00 27.77 ? 397 THR B N    1 
ATOM 4073 C CA   . THR B 2 97  ? 74.804  92.442  31.933 1.00 24.28 ? 397 THR B CA   1 
ATOM 4074 C C    . THR B 2 97  ? 74.248  92.783  33.312 1.00 27.73 ? 397 THR B C    1 
ATOM 4075 O O    . THR B 2 97  ? 74.635  93.767  33.913 1.00 32.75 ? 397 THR B O    1 
ATOM 4076 C CB   . THR B 2 97  ? 75.491  91.068  32.044 1.00 18.49 ? 397 THR B CB   1 
ATOM 4077 O OG1  . THR B 2 97  ? 76.373  91.038  33.176 1.00 25.54 ? 397 THR B OG1  1 
ATOM 4078 C CG2  . THR B 2 97  ? 76.276  90.727  30.774 1.00 18.94 ? 397 THR B CG2  1 
ATOM 4079 H H    . THR B 2 97  ? 76.171  93.840  32.333 1.00 0.00  ? 397 THR B H    1 
ATOM 4080 H HA   . THR B 2 97  ? 74.012  92.392  31.203 1.00 0.00  ? 397 THR B HA   1 
ATOM 4081 H HB   . THR B 2 97  ? 74.728  90.281  32.166 1.00 0.00  ? 397 THR B HB   1 
ATOM 4082 H HG1  . THR B 2 97  ? 76.782  90.183  33.255 1.00 0.00  ? 397 THR B HG1  1 
ATOM 4083 H HG21 . THR B 2 97  ? 76.543  91.637  30.239 1.00 0.00  ? 397 THR B HG21 1 
ATOM 4084 H HG22 . THR B 2 97  ? 77.206  90.207  31.037 1.00 0.00  ? 397 THR B HG22 1 
ATOM 4085 H HG23 . THR B 2 97  ? 75.665  90.089  30.120 1.00 0.00  ? 397 THR B HG23 1 
ATOM 4086 N N    . THR B 2 98  ? 73.346  91.913  33.797 1.00 27.34 ? 398 THR B N    1 
ATOM 4087 C CA   . THR B 2 98  ? 72.692  92.101  35.085 1.00 27.67 ? 398 THR B CA   1 
ATOM 4088 C C    . THR B 2 98  ? 73.659  92.354  36.220 1.00 30.94 ? 398 THR B C    1 
ATOM 4089 O O    . THR B 2 98  ? 73.351  93.049  37.172 1.00 31.16 ? 398 THR B O    1 
ATOM 4090 C CB   . THR B 2 98  ? 71.886  90.823  35.449 1.00 30.15 ? 398 THR B CB   1 
ATOM 4091 O OG1  . THR B 2 98  ? 71.134  90.379  34.316 1.00 32.72 ? 398 THR B OG1  1 
ATOM 4092 C CG2  . THR B 2 98  ? 70.907  91.107  36.603 1.00 21.72 ? 398 THR B CG2  1 
ATOM 4093 H H    . THR B 2 98  ? 73.094  91.112  33.263 1.00 0.00  ? 398 THR B H    1 
ATOM 4094 H HA   . THR B 2 98  ? 72.014  92.957  34.990 1.00 0.00  ? 398 THR B HA   1 
ATOM 4095 H HB   . THR B 2 98  ? 72.579  90.017  35.752 1.00 0.00  ? 398 THR B HB   1 
ATOM 4096 H HG1  . THR B 2 98  ? 70.624  89.622  34.584 1.00 0.00  ? 398 THR B HG1  1 
ATOM 4097 H HG21 . THR B 2 98  ? 70.700  92.183  36.669 1.00 0.00  ? 398 THR B HG21 1 
ATOM 4098 H HG22 . THR B 2 98  ? 69.954  90.579  36.440 1.00 0.00  ? 398 THR B HG22 1 
ATOM 4099 H HG23 . THR B 2 98  ? 71.353  90.770  37.548 1.00 0.00  ? 398 THR B HG23 1 
ATOM 4100 N N    . CYS B 2 99  ? 74.852  91.752  36.097 1.00 33.20 ? 399 CYS B N    1 
ATOM 4101 C CA   . CYS B 2 99  ? 75.853  91.853  37.153 1.00 33.72 ? 399 CYS B CA   1 
ATOM 4102 C C    . CYS B 2 99  ? 76.807  93.007  36.946 1.00 32.26 ? 399 CYS B C    1 
ATOM 4103 O O    . CYS B 2 99  ? 77.384  93.497  37.901 1.00 37.45 ? 399 CYS B O    1 
ATOM 4104 C CB   . CYS B 2 99  ? 76.588  90.492  37.227 1.00 39.44 ? 399 CYS B CB   1 
ATOM 4105 S SG   . CYS B 2 99  ? 75.444  89.102  36.705 1.00 46.65 ? 399 CYS B SG   1 
ATOM 4106 H H    . CYS B 2 99  ? 75.062  91.221  35.274 1.00 0.00  ? 399 CYS B H    1 
ATOM 4107 H HA   . CYS B 2 99  ? 75.346  92.004  38.114 1.00 0.00  ? 399 CYS B HA   1 
ATOM 4108 H HB2  . CYS B 2 99  ? 77.518  90.608  36.580 1.00 0.00  ? 399 CYS B HB2  1 
ATOM 4109 H HB3  . CYS B 2 99  ? 76.943  90.342  38.254 1.00 0.00  ? 399 CYS B HB3  1 
ATOM 4110 N N    . SER B 2 100 ? 76.976  93.432  35.683 1.00 22.67 ? 400 SER B N    1 
ATOM 4111 C CA   . SER B 2 100 ? 77.876  94.534  35.414 1.00 17.21 ? 400 SER B CA   1 
ATOM 4112 C C    . SER B 2 100 ? 77.667  95.643  36.412 1.00 16.89 ? 400 SER B C    1 
ATOM 4113 O O    . SER B 2 100 ? 76.538  95.975  36.727 1.00 19.50 ? 400 SER B O    1 
ATOM 4114 C CB   . SER B 2 100 ? 77.627  95.092  34.026 1.00 16.08 ? 400 SER B CB   1 
ATOM 4115 O OG   . SER B 2 100 ? 78.016  94.035  33.171 1.00 23.74 ? 400 SER B OG   1 
ATOM 4116 H H    . SER B 2 100 ? 76.504  92.997  34.919 1.00 0.00  ? 400 SER B H    1 
ATOM 4117 H HA   . SER B 2 100 ? 78.913  94.159  35.457 1.00 0.00  ? 400 SER B HA   1 
ATOM 4118 H HB2  . SER B 2 100 ? 76.562  95.312  33.933 1.00 0.00  ? 400 SER B HB2  1 
ATOM 4119 H HB3  . SER B 2 100 ? 78.221  96.010  33.874 1.00 0.00  ? 400 SER B HB3  1 
ATOM 4120 H HG   . SER B 2 100 ? 78.148  94.498  32.300 1.00 0.00  ? 400 SER B HG   1 
ATOM 4121 N N    . PHE B 2 101 ? 78.784  96.196  36.915 1.00 15.61 ? 401 PHE B N    1 
ATOM 4122 C CA   . PHE B 2 101 ? 78.709  97.287  37.875 1.00 17.81 ? 401 PHE B CA   1 
ATOM 4123 C C    . PHE B 2 101 ? 78.235  98.552  37.185 1.00 20.92 ? 401 PHE B C    1 
ATOM 4124 O O    . PHE B 2 101 ? 78.965  99.180  36.438 1.00 19.61 ? 401 PHE B O    1 
ATOM 4125 C CB   . PHE B 2 101 ? 80.090  97.528  38.515 1.00 16.15 ? 401 PHE B CB   1 
ATOM 4126 C CG   . PHE B 2 101 ? 80.041  98.550  39.642 1.00 7.52  ? 401 PHE B CG   1 
ATOM 4127 C CD1  . PHE B 2 101 ? 79.915  99.909  39.359 1.00 4.98  ? 401 PHE B CD1  1 
ATOM 4128 C CD2  . PHE B 2 101 ? 80.112  98.132  40.975 1.00 6.63  ? 401 PHE B CD2  1 
ATOM 4129 C CE1  . PHE B 2 101 ? 79.836  100.842 40.396 1.00 7.35  ? 401 PHE B CE1  1 
ATOM 4130 C CE2  . PHE B 2 101 ? 80.006  99.059  42.000 1.00 5.16  ? 401 PHE B CE2  1 
ATOM 4131 C CZ   . PHE B 2 101 ? 79.889  100.426 41.716 1.00 3.98  ? 401 PHE B CZ   1 
ATOM 4132 H H    . PHE B 2 101 ? 79.685  95.848  36.649 1.00 0.00  ? 401 PHE B H    1 
ATOM 4133 H HA   . PHE B 2 101 ? 78.016  96.992  38.681 1.00 0.00  ? 401 PHE B HA   1 
ATOM 4134 H HB2  . PHE B 2 101 ? 80.465  96.576  38.918 1.00 0.00  ? 401 PHE B HB2  1 
ATOM 4135 H HB3  . PHE B 2 101 ? 80.779  97.894  37.742 1.00 0.00  ? 401 PHE B HB3  1 
ATOM 4136 H HD1  . PHE B 2 101 ? 79.880  100.249 38.334 1.00 0.00  ? 401 PHE B HD1  1 
ATOM 4137 H HD2  . PHE B 2 101 ? 80.226  97.079  41.208 1.00 0.00  ? 401 PHE B HD2  1 
ATOM 4138 H HE1  . PHE B 2 101 ? 79.726  101.894 40.160 1.00 0.00  ? 401 PHE B HE1  1 
ATOM 4139 H HE2  . PHE B 2 101 ? 79.978  98.720  43.023 1.00 0.00  ? 401 PHE B HE2  1 
ATOM 4140 H HZ   . PHE B 2 101 ? 79.821  101.143 42.528 1.00 0.00  ? 401 PHE B HZ   1 
ATOM 4141 N N    . VAL B 2 102 ? 76.974  98.907  37.480 1.00 24.47 ? 402 VAL B N    1 
ATOM 4142 C CA   . VAL B 2 102 ? 76.370  100.107 36.952 1.00 22.30 ? 402 VAL B CA   1 
ATOM 4143 C C    . VAL B 2 102 ? 75.657  100.770 38.087 1.00 26.17 ? 402 VAL B C    1 
ATOM 4144 O O    . VAL B 2 102 ? 74.739  100.209 38.654 1.00 31.76 ? 402 VAL B O    1 
ATOM 4145 C CB   . VAL B 2 102 ? 75.378  99.755  35.853 1.00 19.06 ? 402 VAL B CB   1 
ATOM 4146 C CG1  . VAL B 2 102 ? 74.693  101.071 35.306 1.00 19.48 ? 402 VAL B CG1  1 
ATOM 4147 C CG2  . VAL B 2 102 ? 76.212  99.098  34.900 1.00 20.68 ? 402 VAL B CG2  1 
ATOM 4148 H H    . VAL B 2 102 ? 76.406  98.345  38.074 1.00 0.00  ? 402 VAL B H    1 
ATOM 4149 H HA   . VAL B 2 102 ? 77.119  100.750 36.496 1.00 0.00  ? 402 VAL B HA   1 
ATOM 4150 H HB   . VAL B 2 102 ? 74.548  99.124  36.329 1.00 0.00  ? 402 VAL B HB   1 
ATOM 4151 H HG11 . VAL B 2 102 ? 75.476  101.709 34.876 1.00 0.00  ? 402 VAL B HG11 1 
ATOM 4152 H HG12 . VAL B 2 102 ? 73.966  100.797 34.506 1.00 0.00  ? 402 VAL B HG12 1 
ATOM 4153 H HG13 . VAL B 2 102 ? 74.161  101.570 36.122 1.00 0.00  ? 402 VAL B HG13 1 
ATOM 4154 H HG21 . VAL B 2 102 ? 76.515  97.993  35.112 1.00 0.00  ? 402 VAL B HG21 1 
ATOM 4155 H HG22 . VAL B 2 102 ? 75.368  99.134  34.405 1.00 0.00  ? 402 VAL B HG22 1 
ATOM 4156 H HG23 . VAL B 2 102 ? 76.931  99.683  34.224 1.00 0.00  ? 402 VAL B HG23 1 
ATOM 4157 N N    . ALA B 2 103 ? 76.112  101.980 38.415 1.00 25.65 ? 403 ALA B N    1 
ATOM 4158 C CA   . ALA B 2 103 ? 75.500  102.704 39.509 1.00 30.00 ? 403 ALA B CA   1 
ATOM 4159 C C    . ALA B 2 103 ? 75.601  104.169 39.165 1.00 35.32 ? 403 ALA B C    1 
ATOM 4160 O O    . ALA B 2 103 ? 76.549  104.528 38.484 1.00 40.59 ? 403 ALA B O    1 
ATOM 4161 C CB   . ALA B 2 103 ? 76.241  102.388 40.815 1.00 28.19 ? 403 ALA B CB   1 
ATOM 4162 H H    . ALA B 2 103 ? 76.889  102.394 37.942 1.00 0.00  ? 403 ALA B H    1 
ATOM 4163 H HA   . ALA B 2 103 ? 74.446  102.416 39.617 1.00 0.00  ? 403 ALA B HA   1 
ATOM 4164 H HB1  . ALA B 2 103 ? 75.776  102.946 41.641 1.00 0.00  ? 403 ALA B HB1  1 
ATOM 4165 H HB2  . ALA B 2 103 ? 76.181  101.306 41.014 1.00 0.00  ? 403 ALA B HB2  1 
ATOM 4166 H HB3  . ALA B 2 103 ? 77.294  102.685 40.709 1.00 0.00  ? 403 ALA B HB3  1 
ATOM 4167 N N    . PRO B 2 104 ? 74.654  105.017 39.591 1.00 37.33 ? 404 PRO B N    1 
ATOM 4168 C CA   . PRO B 2 104 ? 74.803  106.421 39.294 1.00 36.98 ? 404 PRO B CA   1 
ATOM 4169 C C    . PRO B 2 104 ? 76.014  106.989 40.000 1.00 38.73 ? 404 PRO B C    1 
ATOM 4170 O O    . PRO B 2 104 ? 76.220  106.723 41.167 1.00 38.34 ? 404 PRO B O    1 
ATOM 4171 C CB   . PRO B 2 104 ? 73.463  107.006 39.753 1.00 36.17 ? 404 PRO B CB   1 
ATOM 4172 C CG   . PRO B 2 104 ? 72.957  106.000 40.788 1.00 34.42 ? 404 PRO B CG   1 
ATOM 4173 C CD   . PRO B 2 104 ? 73.408  104.648 40.249 1.00 34.14 ? 404 PRO B CD   1 
ATOM 4174 H HA   . PRO B 2 104 ? 74.852  106.549 38.221 1.00 0.00  ? 404 PRO B HA   1 
ATOM 4175 H HB2  . PRO B 2 104 ? 73.592  108.005 40.193 1.00 0.00  ? 404 PRO B HB2  1 
ATOM 4176 H HB3  . PRO B 2 104 ? 72.730  107.055 38.925 1.00 0.00  ? 404 PRO B HB3  1 
ATOM 4177 H HG2  . PRO B 2 104 ? 73.451  106.213 41.732 1.00 0.00  ? 404 PRO B HG2  1 
ATOM 4178 H HG3  . PRO B 2 104 ? 71.870  106.072 40.944 1.00 0.00  ? 404 PRO B HG3  1 
ATOM 4179 H HD2  . PRO B 2 104 ? 73.494  103.917 41.063 1.00 0.00  ? 404 PRO B HD2  1 
ATOM 4180 H HD3  . PRO B 2 104 ? 72.649  104.308 39.539 1.00 0.00  ? 404 PRO B HD3  1 
ATOM 4181 N N    . TRP B 2 105 ? 76.813  107.788 39.272 1.00 38.70 ? 405 TRP B N    1 
ATOM 4182 C CA   . TRP B 2 105 ? 78.016  108.411 39.823 1.00 40.52 ? 405 TRP B CA   1 
ATOM 4183 C C    . TRP B 2 105 ? 77.790  109.110 41.138 1.00 39.68 ? 405 TRP B C    1 
ATOM 4184 O O    . TRP B 2 105 ? 78.571  109.026 42.058 1.00 38.66 ? 405 TRP B O    1 
ATOM 4185 C CB   . TRP B 2 105 ? 78.607  109.432 38.824 1.00 44.67 ? 405 TRP B CB   1 
ATOM 4186 C CG   . TRP B 2 105 ? 79.894  110.127 39.205 1.00 49.41 ? 405 TRP B CG   1 
ATOM 4187 C CD1  . TRP B 2 105 ? 80.123  111.407 39.533 1.00 50.18 ? 405 TRP B CD1  1 
ATOM 4188 C CD2  . TRP B 2 105 ? 81.273  109.445 39.228 1.00 51.27 ? 405 TRP B CD2  1 
ATOM 4189 N NE1  . TRP B 2 105 ? 81.420  111.640 39.727 1.00 48.41 ? 405 TRP B NE1  1 
ATOM 4190 C CE2  . TRP B 2 105 ? 82.122  110.490 39.548 1.00 50.08 ? 405 TRP B CE2  1 
ATOM 4191 C CE3  . TRP B 2 105 ? 81.675  108.188 39.002 1.00 49.13 ? 405 TRP B CE3  1 
ATOM 4192 C CZ2  . TRP B 2 105 ? 83.512  110.266 39.643 1.00 47.60 ? 405 TRP B CZ2  1 
ATOM 4193 C CZ3  . TRP B 2 105 ? 83.085  107.933 39.096 1.00 44.25 ? 405 TRP B CZ3  1 
ATOM 4194 C CH2  . TRP B 2 105 ? 83.952  108.959 39.400 1.00 45.07 ? 405 TRP B CH2  1 
ATOM 4195 H H    . TRP B 2 105 ? 76.599  107.959 38.313 1.00 0.00  ? 405 TRP B H    1 
ATOM 4196 H HA   . TRP B 2 105 ? 78.757  107.642 39.954 1.00 0.00  ? 405 TRP B HA   1 
ATOM 4197 H HB2  . TRP B 2 105 ? 78.755  108.898 37.869 1.00 0.00  ? 405 TRP B HB2  1 
ATOM 4198 H HB3  . TRP B 2 105 ? 77.843  110.210 38.669 1.00 0.00  ? 405 TRP B HB3  1 
ATOM 4199 H HD1  . TRP B 2 105 ? 79.329  112.143 39.610 1.00 0.00  ? 405 TRP B HD1  1 
ATOM 4200 H HE1  . TRP B 2 105 ? 81.830  112.542 39.961 1.00 0.00  ? 405 TRP B HE1  1 
ATOM 4201 H HE3  . TRP B 2 105 ? 81.000  107.376 38.751 1.00 0.00  ? 405 TRP B HE3  1 
ATOM 4202 H HZ2  . TRP B 2 105 ? 84.212  111.048 39.890 1.00 0.00  ? 405 TRP B HZ2  1 
ATOM 4203 H HZ3  . TRP B 2 105 ? 83.449  106.933 38.929 1.00 0.00  ? 405 TRP B HZ3  1 
ATOM 4204 H HH2  . TRP B 2 105 ? 85.026  108.747 39.457 1.00 0.00  ? 405 TRP B HH2  1 
ATOM 4205 N N    . ASN B 2 106 ? 76.681  109.847 41.208 1.00 44.81 ? 406 ASN B N    1 
ATOM 4206 C CA   . ASN B 2 106 ? 76.280  110.558 42.398 1.00 45.00 ? 406 ASN B CA   1 
ATOM 4207 C C    . ASN B 2 106 ? 76.000  109.795 43.651 1.00 45.09 ? 406 ASN B C    1 
ATOM 4208 O O    . ASN B 2 106 ? 75.977  110.337 44.744 1.00 52.60 ? 406 ASN B O    1 
ATOM 4209 C CB   . ASN B 2 106 ? 75.268  111.652 42.122 1.00 48.41 ? 406 ASN B CB   1 
ATOM 4210 C CG   . ASN B 2 106 ? 75.778  112.750 41.202 1.00 51.32 ? 406 ASN B CG   1 
ATOM 4211 O OD1  . ASN B 2 106 ? 76.790  113.379 41.466 1.00 53.86 ? 406 ASN B OD1  1 
ATOM 4212 N ND2  . ASN B 2 106 ? 75.048  112.989 40.103 1.00 53.85 ? 406 ASN B ND2  1 
ATOM 4213 H H    . ASN B 2 106 ? 76.066  109.892 40.440 1.00 0.00  ? 406 ASN B H    1 
ATOM 4214 H HA   . ASN B 2 106 ? 77.139  111.212 42.670 1.00 0.00  ? 406 ASN B HA   1 
ATOM 4215 H HB2  . ASN B 2 106 ? 74.432  111.119 41.666 1.00 0.00  ? 406 ASN B HB2  1 
ATOM 4216 H HB3  . ASN B 2 106 ? 74.942  112.102 43.069 1.00 0.00  ? 406 ASN B HB3  1 
ATOM 4217 H HD21 . ASN B 2 106 ? 74.224  112.456 39.906 1.00 0.00  ? 406 ASN B HD21 1 
ATOM 4218 H HD22 . ASN B 2 106 ? 75.327  113.708 39.465 1.00 0.00  ? 406 ASN B HD22 1 
ATOM 4219 N N    . SER B 2 107 ? 75.715  108.508 43.464 1.00 41.13 ? 407 SER B N    1 
ATOM 4220 C CA   . SER B 2 107 ? 75.442  107.660 44.619 1.00 38.98 ? 407 SER B CA   1 
ATOM 4221 C C    . SER B 2 107 ? 76.733  107.095 45.181 1.00 40.35 ? 407 SER B C    1 
ATOM 4222 O O    . SER B 2 107 ? 76.783  106.630 46.304 1.00 41.03 ? 407 SER B O    1 
ATOM 4223 C CB   . SER B 2 107 ? 74.496  106.518 44.201 1.00 40.34 ? 407 SER B CB   1 
ATOM 4224 O OG   . SER B 2 107 ? 75.121  105.608 43.285 1.00 36.81 ? 407 SER B OG   1 
ATOM 4225 H H    . SER B 2 107 ? 75.756  108.101 42.547 1.00 0.00  ? 407 SER B H    1 
ATOM 4226 H HA   . SER B 2 107 ? 74.935  108.259 45.389 1.00 0.00  ? 407 SER B HA   1 
ATOM 4227 H HB2  . SER B 2 107 ? 74.197  105.961 45.101 1.00 0.00  ? 407 SER B HB2  1 
ATOM 4228 H HB3  . SER B 2 107 ? 73.599  106.968 43.746 1.00 0.00  ? 407 SER B HB3  1 
ATOM 4229 H HG   . SER B 2 107 ? 74.522  104.902 43.066 1.00 0.00  ? 407 SER B HG   1 
ATOM 4230 N N    . LEU B 2 108 ? 77.786  107.155 44.352 1.00 39.07 ? 408 LEU B N    1 
ATOM 4231 C CA   . LEU B 2 108 ? 79.097  106.655 44.700 1.00 36.91 ? 408 LEU B CA   1 
ATOM 4232 C C    . LEU B 2 108 ? 79.816  107.408 45.782 1.00 39.30 ? 408 LEU B C    1 
ATOM 4233 O O    . LEU B 2 108 ? 79.921  108.616 45.721 1.00 40.43 ? 408 LEU B O    1 
ATOM 4234 C CB   . LEU B 2 108 ? 80.003  106.588 43.459 1.00 35.14 ? 408 LEU B CB   1 
ATOM 4235 C CG   . LEU B 2 108 ? 80.101  105.245 42.720 1.00 34.49 ? 408 LEU B CG   1 
ATOM 4236 C CD1  . LEU B 2 108 ? 78.796  104.446 42.814 1.00 33.15 ? 408 LEU B CD1  1 
ATOM 4237 C CD2  . LEU B 2 108 ? 80.488  105.478 41.249 1.00 33.43 ? 408 LEU B CD2  1 
ATOM 4238 H H    . LEU B 2 108 ? 77.689  107.559 43.457 1.00 0.00  ? 408 LEU B H    1 
ATOM 4239 H HA   . LEU B 2 108 ? 78.960  105.660 45.124 1.00 0.00  ? 408 LEU B HA   1 
ATOM 4240 H HB2  . LEU B 2 108 ? 79.642  107.301 42.731 1.00 0.00  ? 408 LEU B HB2  1 
ATOM 4241 H HB3  . LEU B 2 108 ? 81.012  106.895 43.729 1.00 0.00  ? 408 LEU B HB3  1 
ATOM 4242 H HG   . LEU B 2 108 ? 80.904  104.656 43.182 1.00 0.00  ? 408 LEU B HG   1 
ATOM 4243 H HD11 . LEU B 2 108 ? 77.961  105.035 42.414 1.00 0.00  ? 408 LEU B HD11 1 
ATOM 4244 H HD12 . LEU B 2 108 ? 78.903  103.502 42.287 1.00 0.00  ? 408 LEU B HD12 1 
ATOM 4245 H HD13 . LEU B 2 108 ? 78.571  104.145 43.842 1.00 0.00  ? 408 LEU B HD13 1 
ATOM 4246 H HD21 . LEU B 2 108 ? 81.431  106.031 41.189 1.00 0.00  ? 408 LEU B HD21 1 
ATOM 4247 H HD22 . LEU B 2 108 ? 80.555  104.531 40.715 1.00 0.00  ? 408 LEU B HD22 1 
ATOM 4248 H HD23 . LEU B 2 108 ? 79.704  106.053 40.772 1.00 0.00  ? 408 LEU B HD23 1 
ATOM 4249 N N    . SER B 2 109 ? 80.346  106.647 46.760 1.00 37.43 ? 409 SER B N    1 
ATOM 4250 C CA   . SER B 2 109 ? 81.084  107.258 47.847 1.00 35.06 ? 409 SER B CA   1 
ATOM 4251 C C    . SER B 2 109 ? 82.298  107.936 47.264 1.00 36.69 ? 409 SER B C    1 
ATOM 4252 O O    . SER B 2 109 ? 82.777  107.593 46.199 1.00 37.04 ? 409 SER B O    1 
ATOM 4253 C CB   . SER B 2 109 ? 81.525  106.195 48.876 1.00 35.08 ? 409 SER B CB   1 
ATOM 4254 O OG   . SER B 2 109 ? 82.556  105.365 48.334 1.00 32.82 ? 409 SER B OG   1 
ATOM 4255 H H    . SER B 2 109 ? 80.264  105.651 46.762 1.00 0.00  ? 409 SER B H    1 
ATOM 4256 H HA   . SER B 2 109 ? 80.436  107.990 48.363 1.00 0.00  ? 409 SER B HA   1 
ATOM 4257 H HB2  . SER B 2 109 ? 81.902  106.691 49.786 1.00 0.00  ? 409 SER B HB2  1 
ATOM 4258 H HB3  . SER B 2 109 ? 80.656  105.568 49.139 1.00 0.00  ? 409 SER B HB3  1 
ATOM 4259 H HG   . SER B 2 109 ? 82.804  104.710 48.979 1.00 0.00  ? 409 SER B HG   1 
ATOM 4260 N N    . LEU B 2 110 ? 82.864  108.872 48.032 1.00 40.17 ? 410 LEU B N    1 
ATOM 4261 C CA   . LEU B 2 110 ? 84.055  109.653 47.653 1.00 38.69 ? 410 LEU B CA   1 
ATOM 4262 C C    . LEU B 2 110 ? 85.202  108.696 47.487 1.00 32.76 ? 410 LEU B C    1 
ATOM 4263 O O    . LEU B 2 110 ? 86.036  108.886 46.629 1.00 27.10 ? 410 LEU B O    1 
ATOM 4264 C CB   . LEU B 2 110 ? 84.345  110.693 48.761 1.00 40.14 ? 410 LEU B CB   1 
ATOM 4265 C CG   . LEU B 2 110 ? 83.154  111.626 49.096 1.00 40.66 ? 410 LEU B CG   1 
ATOM 4266 C CD1  . LEU B 2 110 ? 82.124  110.999 50.087 1.00 38.13 ? 410 LEU B CD1  1 
ATOM 4267 C CD2  . LEU B 2 110 ? 83.680  112.880 49.791 1.00 41.85 ? 410 LEU B CD2  1 
ATOM 4268 H H    . LEU B 2 110 ? 82.666  108.704 48.931 1.00 0.00  ? 410 LEU B H    1 
ATOM 4269 H HA   . LEU B 2 110 ? 83.834  110.157 46.732 1.00 0.00  ? 410 LEU B HA   1 
ATOM 4270 H HB2  . LEU B 2 110 ? 84.665  110.185 49.683 1.00 0.00  ? 410 LEU B HB2  1 
ATOM 4271 H HB3  . LEU B 2 110 ? 85.170  111.324 48.390 1.00 0.00  ? 410 LEU B HB3  1 
ATOM 4272 H HG   . LEU B 2 110 ? 82.625  111.913 48.176 1.00 0.00  ? 410 LEU B HG   1 
ATOM 4273 H HD11 . LEU B 2 110 ? 82.641  110.625 51.002 1.00 0.00  ? 410 LEU B HD11 1 
ATOM 4274 H HD12 . LEU B 2 110 ? 81.342  111.700 50.324 1.00 0.00  ? 410 LEU B HD12 1 
ATOM 4275 H HD13 . LEU B 2 110 ? 81.429  110.296 49.702 1.00 0.00  ? 410 LEU B HD13 1 
ATOM 4276 H HD21 . LEU B 2 110 ? 84.367  113.401 49.109 1.00 0.00  ? 410 LEU B HD21 1 
ATOM 4277 H HD22 . LEU B 2 110 ? 82.836  113.545 50.039 1.00 0.00  ? 410 LEU B HD22 1 
ATOM 4278 H HD23 . LEU B 2 110 ? 84.214  112.597 50.715 1.00 0.00  ? 410 LEU B HD23 1 
ATOM 4279 N N    . ALA B 2 111 ? 85.215  107.646 48.328 1.00 33.98 ? 411 ALA B N    1 
ATOM 4280 C CA   . ALA B 2 111 ? 86.246  106.625 48.257 1.00 35.52 ? 411 ALA B CA   1 
ATOM 4281 C C    . ALA B 2 111 ? 86.149  105.905 46.928 1.00 38.19 ? 411 ALA B C    1 
ATOM 4282 O O    . ALA B 2 111 ? 87.112  105.870 46.186 1.00 41.54 ? 411 ALA B O    1 
ATOM 4283 C CB   . ALA B 2 111 ? 86.034  105.633 49.411 1.00 35.95 ? 411 ALA B CB   1 
ATOM 4284 H H    . ALA B 2 111 ? 84.497  107.528 49.008 1.00 0.00  ? 411 ALA B H    1 
ATOM 4285 H HA   . ALA B 2 111 ? 87.237  107.088 48.378 1.00 0.00  ? 411 ALA B HA   1 
ATOM 4286 H HB1  . ALA B 2 111 ? 86.810  104.855 49.374 1.00 0.00  ? 411 ALA B HB1  1 
ATOM 4287 H HB2  . ALA B 2 111 ? 86.084  106.168 50.374 1.00 0.00  ? 411 ALA B HB2  1 
ATOM 4288 H HB3  . ALA B 2 111 ? 85.048  105.159 49.328 1.00 0.00  ? 411 ALA B HB3  1 
ATOM 4289 N N    . GLN B 2 112 ? 84.970  105.334 46.631 1.00 38.72 ? 412 GLN B N    1 
ATOM 4290 C CA   . GLN B 2 112 ? 84.769  104.628 45.364 1.00 38.63 ? 412 GLN B CA   1 
ATOM 4291 C C    . GLN B 2 112 ? 85.156  105.488 44.170 1.00 41.92 ? 412 GLN B C    1 
ATOM 4292 O O    . GLN B 2 112 ? 85.772  105.006 43.236 1.00 47.34 ? 412 GLN B O    1 
ATOM 4293 C CB   . GLN B 2 112 ? 83.289  104.193 45.220 1.00 33.11 ? 412 GLN B CB   1 
ATOM 4294 C CG   . GLN B 2 112 ? 82.974  102.832 45.872 1.00 32.16 ? 412 GLN B CG   1 
ATOM 4295 C CD   . GLN B 2 112 ? 81.481  102.627 46.077 1.00 31.85 ? 412 GLN B CD   1 
ATOM 4296 O OE1  . GLN B 2 112 ? 80.709  103.560 46.161 1.00 31.72 ? 412 GLN B OE1  1 
ATOM 4297 N NE2  . GLN B 2 112 ? 81.040  101.380 46.183 1.00 29.82 ? 412 GLN B NE2  1 
ATOM 4298 H H    . GLN B 2 112 ? 84.213  105.402 47.276 1.00 0.00  ? 412 GLN B H    1 
ATOM 4299 H HA   . GLN B 2 112 ? 85.398  103.731 45.364 1.00 0.00  ? 412 GLN B HA   1 
ATOM 4300 H HB2  . GLN B 2 112 ? 82.648  104.956 45.683 1.00 0.00  ? 412 GLN B HB2  1 
ATOM 4301 H HB3  . GLN B 2 112 ? 83.046  104.115 44.149 1.00 0.00  ? 412 GLN B HB3  1 
ATOM 4302 H HG2  . GLN B 2 112 ? 83.374  102.037 45.219 1.00 0.00  ? 412 GLN B HG2  1 
ATOM 4303 H HG3  . GLN B 2 112 ? 83.475  102.780 46.849 1.00 0.00  ? 412 GLN B HG3  1 
ATOM 4304 H HE21 . GLN B 2 112 ? 81.689  100.638 46.203 1.00 0.00  ? 412 GLN B HE21 1 
ATOM 4305 H HE22 . GLN B 2 112 ? 80.090  101.148 46.313 1.00 0.00  ? 412 GLN B HE22 1 
ATOM 4306 N N    . ARG B 2 113 ? 84.781  106.776 44.209 1.00 42.59 ? 413 ARG B N    1 
ATOM 4307 C CA   . ARG B 2 113 ? 85.124  107.687 43.120 1.00 38.61 ? 413 ARG B CA   1 
ATOM 4308 C C    . ARG B 2 113 ? 86.635  107.728 42.965 1.00 36.63 ? 413 ARG B C    1 
ATOM 4309 O O    . ARG B 2 113 ? 87.157  107.585 41.876 1.00 29.38 ? 413 ARG B O    1 
ATOM 4310 C CB   . ARG B 2 113 ? 84.591  109.100 43.443 1.00 44.48 ? 413 ARG B CB   1 
ATOM 4311 C CG   . ARG B 2 113 ? 83.049  109.207 43.465 1.00 47.66 ? 413 ARG B CG   1 
ATOM 4312 C CD   . ARG B 2 113 ? 82.632  110.658 43.697 1.00 51.80 ? 413 ARG B CD   1 
ATOM 4313 N NE   . ARG B 2 113 ? 81.225  110.920 43.466 1.00 54.42 ? 413 ARG B NE   1 
ATOM 4314 C CZ   . ARG B 2 113 ? 80.362  111.226 44.413 1.00 55.73 ? 413 ARG B CZ   1 
ATOM 4315 N NH1  . ARG B 2 113 ? 80.608  111.322 45.684 1.00 56.84 ? 413 ARG B NH1  1 
ATOM 4316 N NH2  . ARG B 2 113 ? 79.148  111.475 44.035 1.00 58.57 ? 413 ARG B NH2  1 
ATOM 4317 H H    . ARG B 2 113 ? 84.286  107.119 45.008 1.00 0.00  ? 413 ARG B H    1 
ATOM 4318 H HA   . ARG B 2 113 ? 84.665  107.338 42.184 1.00 0.00  ? 413 ARG B HA   1 
ATOM 4319 H HB2  . ARG B 2 113 ? 84.971  109.408 44.429 1.00 0.00  ? 413 ARG B HB2  1 
ATOM 4320 H HB3  . ARG B 2 113 ? 84.965  109.792 42.674 1.00 0.00  ? 413 ARG B HB3  1 
ATOM 4321 H HG2  . ARG B 2 113 ? 82.633  108.884 42.508 1.00 0.00  ? 413 ARG B HG2  1 
ATOM 4322 H HG3  . ARG B 2 113 ? 82.637  108.578 44.256 1.00 0.00  ? 413 ARG B HG3  1 
ATOM 4323 H HD2  . ARG B 2 113 ? 82.998  110.871 44.720 1.00 0.00  ? 413 ARG B HD2  1 
ATOM 4324 H HD3  . ARG B 2 113 ? 83.247  111.330 43.107 1.00 0.00  ? 413 ARG B HD3  1 
ATOM 4325 H HH11 . ARG B 2 113 ? 81.537  111.153 46.061 1.00 0.00  ? 413 ARG B HH11 1 
ATOM 4326 H HH12 . ARG B 2 113 ? 79.911  111.561 46.342 1.00 0.00  ? 413 ARG B HH12 1 
ATOM 4327 H HH21 . ARG B 2 113 ? 79.010  111.490 43.018 1.00 0.00  ? 413 ARG B HH21 1 
ATOM 4328 H HH22 . ARG B 2 113 ? 78.362  111.718 44.689 1.00 0.00  ? 413 ARG B HH22 1 
ATOM 4329 N N    . ARG B 2 114 ? 87.324  107.913 44.104 1.00 39.39 ? 414 ARG B N    1 
ATOM 4330 C CA   . ARG B 2 114 ? 88.785  107.966 44.129 1.00 41.15 ? 414 ARG B CA   1 
ATOM 4331 C C    . ARG B 2 114 ? 89.424  106.679 43.643 1.00 36.89 ? 414 ARG B C    1 
ATOM 4332 O O    . ARG B 2 114 ? 90.479  106.690 43.033 1.00 36.23 ? 414 ARG B O    1 
ATOM 4333 C CB   . ARG B 2 114 ? 89.227  108.232 45.584 1.00 47.70 ? 414 ARG B CB   1 
ATOM 4334 C CG   . ARG B 2 114 ? 90.708  108.633 45.713 1.00 56.08 ? 414 ARG B CG   1 
ATOM 4335 C CD   . ARG B 2 114 ? 90.949  110.049 45.163 1.00 61.73 ? 414 ARG B CD   1 
ATOM 4336 N NE   . ARG B 2 114 ? 92.345  110.446 45.277 1.00 66.51 ? 414 ARG B NE   1 
ATOM 4337 C CZ   . ARG B 2 114 ? 92.843  111.212 46.230 1.00 67.87 ? 414 ARG B CZ   1 
ATOM 4338 N NH1  . ARG B 2 114 ? 92.113  111.702 47.212 1.00 71.04 ? 414 ARG B NH1  1 
ATOM 4339 N NH2  . ARG B 2 114 ? 94.129  111.491 46.199 1.00 68.57 ? 414 ARG B NH2  1 
ATOM 4340 H H    . ARG B 2 114 ? 86.820  107.987 44.968 1.00 0.00  ? 414 ARG B H    1 
ATOM 4341 H HA   . ARG B 2 114 ? 89.095  108.788 43.481 1.00 0.00  ? 414 ARG B HA   1 
ATOM 4342 H HB2  . ARG B 2 114 ? 88.615  109.049 46.008 1.00 0.00  ? 414 ARG B HB2  1 
ATOM 4343 H HB3  . ARG B 2 114 ? 89.071  107.318 46.178 1.00 0.00  ? 414 ARG B HB3  1 
ATOM 4344 H HG2  . ARG B 2 114 ? 90.988  108.603 46.780 1.00 0.00  ? 414 ARG B HG2  1 
ATOM 4345 H HG3  . ARG B 2 114 ? 91.325  107.919 45.149 1.00 0.00  ? 414 ARG B HG3  1 
ATOM 4346 H HD2  . ARG B 2 114 ? 90.647  110.104 44.119 1.00 0.00  ? 414 ARG B HD2  1 
ATOM 4347 H HD3  . ARG B 2 114 ? 90.246  110.723 45.664 1.00 0.00  ? 414 ARG B HD3  1 
ATOM 4348 H HH11 . ARG B 2 114 ? 91.116  111.515 47.311 1.00 0.00  ? 414 ARG B HH11 1 
ATOM 4349 H HH12 . ARG B 2 114 ? 92.518  112.283 47.929 1.00 0.00  ? 414 ARG B HH12 1 
ATOM 4350 H HH21 . ARG B 2 114 ? 94.734  111.130 45.449 1.00 0.00  ? 414 ARG B HH21 1 
ATOM 4351 H HH22 . ARG B 2 114 ? 94.554  112.081 46.934 1.00 0.00  ? 414 ARG B HH22 1 
ATOM 4352 N N    . GLY B 2 115 ? 88.759  105.552 43.943 1.00 29.29 ? 415 GLY B N    1 
ATOM 4353 C CA   . GLY B 2 115 ? 89.249  104.259 43.498 1.00 21.05 ? 415 GLY B CA   1 
ATOM 4354 C C    . GLY B 2 115 ? 89.152  104.153 41.997 1.00 23.31 ? 415 GLY B C    1 
ATOM 4355 O O    . GLY B 2 115 ? 90.083  103.754 41.321 1.00 22.42 ? 415 GLY B O    1 
ATOM 4356 H H    . GLY B 2 115 ? 87.910  105.589 44.472 1.00 0.00  ? 415 GLY B H    1 
ATOM 4357 H HA2  . GLY B 2 115 ? 90.288  104.150 43.796 1.00 0.00  ? 415 GLY B HA2  1 
ATOM 4358 H HA3  . GLY B 2 115 ? 88.656  103.461 43.966 1.00 0.00  ? 415 GLY B HA3  1 
ATOM 4359 N N    . PHE B 2 116 ? 87.980  104.516 41.465 1.00 23.46 ? 416 PHE B N    1 
ATOM 4360 C CA   . PHE B 2 116 ? 87.808  104.461 40.024 1.00 25.81 ? 416 PHE B CA   1 
ATOM 4361 C C    . PHE B 2 116 ? 88.770  105.385 39.322 1.00 30.52 ? 416 PHE B C    1 
ATOM 4362 O O    . PHE B 2 116 ? 89.352  105.016 38.317 1.00 35.85 ? 416 PHE B O    1 
ATOM 4363 C CB   . PHE B 2 116 ? 86.370  104.826 39.622 1.00 25.06 ? 416 PHE B CB   1 
ATOM 4364 C CG   . PHE B 2 116 ? 85.387  103.681 39.811 1.00 24.72 ? 416 PHE B CG   1 
ATOM 4365 C CD1  . PHE B 2 116 ? 85.662  102.409 39.326 1.00 23.21 ? 416 PHE B CD1  1 
ATOM 4366 C CD2  . PHE B 2 116 ? 84.177  103.897 40.469 1.00 25.29 ? 416 PHE B CD2  1 
ATOM 4367 C CE1  . PHE B 2 116 ? 84.767  101.358 39.474 1.00 22.97 ? 416 PHE B CE1  1 
ATOM 4368 C CE2  . PHE B 2 116 ? 83.269  102.852 40.627 1.00 25.65 ? 416 PHE B CE2  1 
ATOM 4369 C CZ   . PHE B 2 116 ? 83.564  101.586 40.127 1.00 24.96 ? 416 PHE B CZ   1 
ATOM 4370 H H    . PHE B 2 116 ? 87.230  104.832 42.049 1.00 0.00  ? 416 PHE B H    1 
ATOM 4371 H HA   . PHE B 2 116 ? 88.050  103.458 39.691 1.00 0.00  ? 416 PHE B HA   1 
ATOM 4372 H HB2  . PHE B 2 116 ? 86.041  105.678 40.235 1.00 0.00  ? 416 PHE B HB2  1 
ATOM 4373 H HB3  . PHE B 2 116 ? 86.355  105.106 38.560 1.00 0.00  ? 416 PHE B HB3  1 
ATOM 4374 H HD1  . PHE B 2 116 ? 86.579  102.228 38.824 1.00 0.00  ? 416 PHE B HD1  1 
ATOM 4375 H HD2  . PHE B 2 116 ? 83.940  104.882 40.854 1.00 0.00  ? 416 PHE B HD2  1 
ATOM 4376 H HE1  . PHE B 2 116 ? 85.006  100.377 39.084 1.00 0.00  ? 416 PHE B HE1  1 
ATOM 4377 H HE2  . PHE B 2 116 ? 82.331  103.027 41.138 1.00 0.00  ? 416 PHE B HE2  1 
ATOM 4378 H HZ   . PHE B 2 116 ? 82.854  100.774 40.247 1.00 0.00  ? 416 PHE B HZ   1 
ATOM 4379 N N    . THR B 2 117 ? 88.926  106.604 39.860 1.00 31.38 ? 417 THR B N    1 
ATOM 4380 C CA   . THR B 2 117 ? 89.796  107.578 39.215 1.00 31.95 ? 417 THR B CA   1 
ATOM 4381 C C    . THR B 2 117 ? 91.273  107.271 39.305 1.00 34.24 ? 417 THR B C    1 
ATOM 4382 O O    . THR B 2 117 ? 91.995  107.526 38.354 1.00 35.19 ? 417 THR B O    1 
ATOM 4383 C CB   . THR B 2 117 ? 89.593  108.981 39.829 1.00 30.96 ? 417 THR B CB   1 
ATOM 4384 O OG1  . THR B 2 117 ? 88.204  109.202 40.118 1.00 36.43 ? 417 THR B OG1  1 
ATOM 4385 C CG2  . THR B 2 117 ? 90.031  110.036 38.812 1.00 29.67 ? 417 THR B CG2  1 
ATOM 4386 H H    . THR B 2 117 ? 88.436  106.854 40.696 1.00 0.00  ? 417 THR B H    1 
ATOM 4387 H HA   . THR B 2 117 ? 89.508  107.585 38.155 1.00 0.00  ? 417 THR B HA   1 
ATOM 4388 H HB   . THR B 2 117 ? 90.192  109.082 40.755 1.00 0.00  ? 417 THR B HB   1 
ATOM 4389 H HG1  . THR B 2 117 ? 88.081  110.068 40.495 1.00 0.00  ? 417 THR B HG1  1 
ATOM 4390 H HG21 . THR B 2 117 ? 90.008  109.630 37.792 1.00 0.00  ? 417 THR B HG21 1 
ATOM 4391 H HG22 . THR B 2 117 ? 89.346  110.895 38.851 1.00 0.00  ? 417 THR B HG22 1 
ATOM 4392 H HG23 . THR B 2 117 ? 91.053  110.363 39.047 1.00 0.00  ? 417 THR B HG23 1 
ATOM 4393 N N    . LYS B 2 118 ? 91.718  106.733 40.461 1.00 40.00 ? 418 LYS B N    1 
ATOM 4394 C CA   . LYS B 2 118 ? 93.145  106.492 40.650 1.00 40.17 ? 418 LYS B CA   1 
ATOM 4395 C C    . LYS B 2 118 ? 93.620  105.181 41.259 1.00 38.12 ? 418 LYS B C    1 
ATOM 4396 O O    . LYS B 2 118 ? 94.559  104.592 40.746 1.00 39.39 ? 418 LYS B O    1 
ATOM 4397 C CB   . LYS B 2 118 ? 93.726  107.659 41.470 1.00 47.52 ? 418 LYS B CB   1 
ATOM 4398 C CG   . LYS B 2 118 ? 95.265  107.727 41.454 1.00 55.82 ? 418 LYS B CG   1 
ATOM 4399 C CD   . LYS B 2 118 ? 95.819  107.771 40.014 1.00 62.50 ? 418 LYS B CD   1 
ATOM 4400 C CE   . LYS B 2 118 ? 95.262  108.971 39.240 1.00 63.47 ? 418 LYS B CE   1 
ATOM 4401 N NZ   . LYS B 2 118 ? 95.489  108.844 37.784 1.00 63.83 ? 418 LYS B NZ   1 
ATOM 4402 H H    . LYS B 2 118 ? 91.071  106.544 41.199 1.00 0.00  ? 418 LYS B H    1 
ATOM 4403 H HA   . LYS B 2 118 ? 93.549  106.496 39.642 1.00 0.00  ? 418 LYS B HA   1 
ATOM 4404 H HB2  . LYS B 2 118 ? 93.298  108.600 41.107 1.00 0.00  ? 418 LYS B HB2  1 
ATOM 4405 H HB3  . LYS B 2 118 ? 93.389  107.581 42.503 1.00 0.00  ? 418 LYS B HB3  1 
ATOM 4406 H HG2  . LYS B 2 118 ? 95.588  108.634 41.993 1.00 0.00  ? 418 LYS B HG2  1 
ATOM 4407 H HG3  . LYS B 2 118 ? 95.665  106.837 41.969 1.00 0.00  ? 418 LYS B HG3  1 
ATOM 4408 H HD2  . LYS B 2 118 ? 96.911  107.849 40.050 1.00 0.00  ? 418 LYS B HD2  1 
ATOM 4409 H HD3  . LYS B 2 118 ? 95.587  106.838 39.491 1.00 0.00  ? 418 LYS B HD3  1 
ATOM 4410 H HE2  . LYS B 2 118 ? 94.177  109.055 39.312 1.00 0.00  ? 418 LYS B HE2  1 
ATOM 4411 H HE3  . LYS B 2 118 ? 95.720  109.893 39.600 1.00 0.00  ? 418 LYS B HE3  1 
ATOM 4412 H HZ1  . LYS B 2 118 ? 95.031  107.955 37.389 1.00 0.00  ? 418 LYS B HZ1  1 
ATOM 4413 H HZ2  . LYS B 2 118 ? 95.074  109.687 37.259 1.00 0.00  ? 418 LYS B HZ2  1 
ATOM 4414 H HZ3  . LYS B 2 118 ? 96.538  108.803 37.573 1.00 0.00  ? 418 LYS B HZ3  1 
ATOM 4415 N N    . THR B 2 119 ? 93.008  104.708 42.361 1.00 34.93 ? 419 THR B N    1 
ATOM 4416 C CA   . THR B 2 119 ? 93.579  103.573 43.112 1.00 33.40 ? 419 THR B CA   1 
ATOM 4417 C C    . THR B 2 119 ? 93.292  102.129 42.724 1.00 32.44 ? 419 THR B C    1 
ATOM 4418 O O    . THR B 2 119 ? 94.098  101.270 43.015 1.00 37.79 ? 419 THR B O    1 
ATOM 4419 C CB   . THR B 2 119 ? 93.324  103.720 44.628 1.00 34.34 ? 419 THR B CB   1 
ATOM 4420 O OG1  . THR B 2 119 ? 91.997  103.303 44.952 1.00 43.94 ? 419 THR B OG1  1 
ATOM 4421 C CG2  . THR B 2 119 ? 93.493  105.186 45.076 1.00 38.78 ? 419 THR B CG2  1 
ATOM 4422 H H    . THR B 2 119 ? 92.196  105.192 42.694 1.00 0.00  ? 419 THR B H    1 
ATOM 4423 H HA   . THR B 2 119 ? 94.662  103.668 42.985 1.00 0.00  ? 419 THR B HA   1 
ATOM 4424 H HB   . THR B 2 119 ? 94.037  103.082 45.179 1.00 0.00  ? 419 THR B HB   1 
ATOM 4425 H HG1  . THR B 2 119 ? 91.824  103.398 45.882 1.00 0.00  ? 419 THR B HG1  1 
ATOM 4426 H HG21 . THR B 2 119 ? 93.388  105.901 44.262 1.00 0.00  ? 419 THR B HG21 1 
ATOM 4427 H HG22 . THR B 2 119 ? 92.739  105.448 45.825 1.00 0.00  ? 419 THR B HG22 1 
ATOM 4428 H HG23 . THR B 2 119 ? 94.496  105.341 45.477 1.00 0.00  ? 419 THR B HG23 1 
ATOM 4429 N N    . TYR B 2 120 ? 92.162  101.802 42.091 1.00 27.68 ? 420 TYR B N    1 
ATOM 4430 C CA   . TYR B 2 120 ? 91.896  100.408 41.735 1.00 19.74 ? 420 TYR B CA   1 
ATOM 4431 C C    . TYR B 2 120 ? 92.943  99.764  40.848 1.00 22.75 ? 420 TYR B C    1 
ATOM 4432 O O    . TYR B 2 120 ? 93.284  98.613  41.067 1.00 27.51 ? 420 TYR B O    1 
ATOM 4433 C CB   . TYR B 2 120 ? 90.498  100.265 41.109 1.00 21.97 ? 420 TYR B CB   1 
ATOM 4434 C CG   . TYR B 2 120 ? 89.370  100.561 42.099 1.00 25.58 ? 420 TYR B CG   1 
ATOM 4435 C CD1  . TYR B 2 120 ? 89.442  100.164 43.430 1.00 20.75 ? 420 TYR B CD1  1 
ATOM 4436 C CD2  . TYR B 2 120 ? 88.220  101.237 41.672 1.00 26.24 ? 420 TYR B CD2  1 
ATOM 4437 C CE1  . TYR B 2 120 ? 88.409  100.440 44.322 1.00 19.07 ? 420 TYR B CE1  1 
ATOM 4438 C CE2  . TYR B 2 120 ? 87.185  101.523 42.552 1.00 23.95 ? 420 TYR B CE2  1 
ATOM 4439 C CZ   . TYR B 2 120 ? 87.283  101.120 43.884 1.00 23.32 ? 420 TYR B CZ   1 
ATOM 4440 O OH   . TYR B 2 120 ? 86.246  101.410 44.765 1.00 23.76 ? 420 TYR B OH   1 
ATOM 4441 H H    . TYR B 2 120 ? 91.497  102.511 41.875 1.00 0.00  ? 420 TYR B H    1 
ATOM 4442 H HA   . TYR B 2 120 ? 91.949  99.824  42.655 1.00 0.00  ? 420 TYR B HA   1 
ATOM 4443 H HB2  . TYR B 2 120 ? 90.430  100.967 40.264 1.00 0.00  ? 420 TYR B HB2  1 
ATOM 4444 H HB3  . TYR B 2 120 ? 90.378  99.234  40.745 1.00 0.00  ? 420 TYR B HB3  1 
ATOM 4445 H HD1  . TYR B 2 120 ? 90.278  99.620  43.831 1.00 0.00  ? 420 TYR B HD1  1 
ATOM 4446 H HD2  . TYR B 2 120 ? 88.141  101.530 40.641 1.00 0.00  ? 420 TYR B HD2  1 
ATOM 4447 H HE1  . TYR B 2 120 ? 88.497  100.116 45.354 1.00 0.00  ? 420 TYR B HE1  1 
ATOM 4448 H HE2  . TYR B 2 120 ? 86.302  102.055 42.214 1.00 0.00  ? 420 TYR B HE2  1 
ATOM 4449 H HH   . TYR B 2 120 ? 86.447  101.081 45.634 1.00 0.00  ? 420 TYR B HH   1 
ATOM 4450 N N    . THR B 2 121 ? 93.456  100.494 39.844 1.00 22.63 ? 421 THR B N    1 
ATOM 4451 C CA   . THR B 2 121 ? 94.499  99.938  38.969 1.00 21.01 ? 421 THR B CA   1 
ATOM 4452 C C    . THR B 2 121 ? 95.629  99.335  39.771 1.00 20.57 ? 421 THR B C    1 
ATOM 4453 O O    . THR B 2 121 ? 96.151  98.289  39.433 1.00 26.92 ? 421 THR B O    1 
ATOM 4454 C CB   . THR B 2 121 ? 95.209  101.036 38.139 1.00 19.86 ? 421 THR B CB   1 
ATOM 4455 O OG1  . THR B 2 121 ? 95.326  102.228 38.923 1.00 26.13 ? 421 THR B OG1  1 
ATOM 4456 C CG2  . THR B 2 121 ? 94.521  101.384 36.837 1.00 25.09 ? 421 THR B CG2  1 
ATOM 4457 H H    . THR B 2 121 ? 93.131  101.430 39.696 1.00 0.00  ? 421 THR B H    1 
ATOM 4458 H HA   . THR B 2 121 ? 94.058  99.188  38.302 1.00 0.00  ? 421 THR B HA   1 
ATOM 4459 H HB   . THR B 2 121 ? 96.206  100.686 37.837 1.00 0.00  ? 421 THR B HB   1 
ATOM 4460 H HG1  . THR B 2 121 ? 95.756  102.914 38.423 1.00 0.00  ? 421 THR B HG1  1 
ATOM 4461 H HG21 . THR B 2 121 ? 93.443  101.178 37.045 1.00 0.00  ? 421 THR B HG21 1 
ATOM 4462 H HG22 . THR B 2 121 ? 94.463  102.436 36.626 1.00 0.00  ? 421 THR B HG22 1 
ATOM 4463 H HG23 . THR B 2 121 ? 94.866  100.787 35.990 1.00 0.00  ? 421 THR B HG23 1 
ATOM 4464 N N    . VAL B 2 122 ? 96.010  100.045 40.839 1.00 18.15 ? 422 VAL B N    1 
ATOM 4465 C CA   . VAL B 2 122 ? 97.091  99.587  41.695 1.00 18.73 ? 422 VAL B CA   1 
ATOM 4466 C C    . VAL B 2 122 ? 96.928  98.150  42.131 1.00 22.63 ? 422 VAL B C    1 
ATOM 4467 O O    . VAL B 2 122 ? 97.912  97.445  42.284 1.00 29.04 ? 422 VAL B O    1 
ATOM 4468 C CB   . VAL B 2 122 ? 97.169  100.519 42.923 1.00 17.00 ? 422 VAL B CB   1 
ATOM 4469 C CG1  . VAL B 2 122 ? 98.075  99.949  44.018 1.00 17.34 ? 422 VAL B CG1  1 
ATOM 4470 C CG2  . VAL B 2 122 ? 97.700  101.878 42.474 1.00 11.40 ? 422 VAL B CG2  1 
ATOM 4471 H H    . VAL B 2 122 ? 95.538  100.907 41.032 1.00 0.00  ? 422 VAL B H    1 
ATOM 4472 H HA   . VAL B 2 122 ? 98.033  99.664  41.141 1.00 0.00  ? 422 VAL B HA   1 
ATOM 4473 H HB   . VAL B 2 122 ? 96.175  100.654 43.361 1.00 0.00  ? 422 VAL B HB   1 
ATOM 4474 H HG11 . VAL B 2 122 ? 99.083  99.797  43.604 1.00 0.00  ? 422 VAL B HG11 1 
ATOM 4475 H HG12 . VAL B 2 122 ? 98.116  100.653 44.861 1.00 0.00  ? 422 VAL B HG12 1 
ATOM 4476 H HG13 . VAL B 2 122 ? 97.659  98.994  44.363 1.00 0.00  ? 422 VAL B HG13 1 
ATOM 4477 H HG21 . VAL B 2 122 ? 97.031  102.311 41.721 1.00 0.00  ? 422 VAL B HG21 1 
ATOM 4478 H HG22 . VAL B 2 122 ? 97.753  102.551 43.341 1.00 0.00  ? 422 VAL B HG22 1 
ATOM 4479 H HG23 . VAL B 2 122 ? 98.702  101.740 42.040 1.00 0.00  ? 422 VAL B HG23 1 
ATOM 4480 N N    . GLY B 2 123 ? 95.683  97.710  42.350 1.00 20.52 ? 423 GLY B N    1 
ATOM 4481 C CA   . GLY B 2 123 ? 95.497  96.342  42.814 1.00 19.72 ? 423 GLY B CA   1 
ATOM 4482 C C    . GLY B 2 123 ? 95.199  95.309  41.750 1.00 21.70 ? 423 GLY B C    1 
ATOM 4483 O O    . GLY B 2 123 ? 95.065  94.143  42.079 1.00 27.23 ? 423 GLY B O    1 
ATOM 4484 H H    . GLY B 2 123 ? 94.886  98.297  42.189 1.00 0.00  ? 423 GLY B H    1 
ATOM 4485 H HA2  . GLY B 2 123 ? 96.411  96.013  43.322 1.00 0.00  ? 423 GLY B HA2  1 
ATOM 4486 H HA3  . GLY B 2 123 ? 94.676  96.349  43.538 1.00 0.00  ? 423 GLY B HA3  1 
ATOM 4487 N N    . CYS B 2 124 ? 95.100  95.703  40.474 1.00 24.72 ? 424 CYS B N    1 
ATOM 4488 C CA   . CYS B 2 124 ? 94.690  94.754  39.437 1.00 28.74 ? 424 CYS B CA   1 
ATOM 4489 C C    . CYS B 2 124 ? 95.611  93.595  39.074 1.00 31.93 ? 424 CYS B C    1 
ATOM 4490 O O    . CYS B 2 124 ? 95.185  92.451  39.067 1.00 36.66 ? 424 CYS B O    1 
ATOM 4491 C CB   . CYS B 2 124 ? 94.361  95.510  38.138 1.00 30.84 ? 424 CYS B CB   1 
ATOM 4492 S SG   . CYS B 2 124 ? 92.970  96.677  38.292 1.00 32.57 ? 424 CYS B SG   1 
ATOM 4493 H H    . CYS B 2 124 ? 95.267  96.661  40.235 1.00 0.00  ? 424 CYS B H    1 
ATOM 4494 H HA   . CYS B 2 124 ? 93.771  94.286  39.798 1.00 0.00  ? 424 CYS B HA   1 
ATOM 4495 H HB2  . CYS B 2 124 ? 95.248  96.078  37.817 1.00 0.00  ? 424 CYS B HB2  1 
ATOM 4496 H HB3  . CYS B 2 124 ? 94.100  94.772  37.368 1.00 0.00  ? 424 CYS B HB3  1 
ATOM 4497 N N    . GLU B 2 125 ? 96.874  93.873  38.719 1.00 37.90 ? 425 GLU B N    1 
ATOM 4498 C CA   . GLU B 2 125 ? 97.760  92.803  38.254 1.00 43.27 ? 425 GLU B CA   1 
ATOM 4499 C C    . GLU B 2 125 ? 98.135  91.753  39.286 1.00 39.60 ? 425 GLU B C    1 
ATOM 4500 O O    . GLU B 2 125 ? 98.495  90.649  38.910 1.00 38.15 ? 425 GLU B O    1 
ATOM 4501 C CB   . GLU B 2 125 ? 99.042  93.404  37.642 1.00 53.89 ? 425 GLU B CB   1 
ATOM 4502 C CG   . GLU B 2 125 ? 98.781  94.304  36.406 1.00 71.10 ? 425 GLU B CG   1 
ATOM 4503 C CD   . GLU B 2 125 ? 98.178  93.603  35.194 1.00 75.92 ? 425 GLU B CD   1 
ATOM 4504 O OE1  . GLU B 2 125 ? 98.937  92.963  34.420 1.00 81.49 ? 425 GLU B OE1  1 
ATOM 4505 O OE2  . GLU B 2 125 ? 96.939  93.705  34.994 1.00 78.69 ? 425 GLU B OE2  1 
ATOM 4506 H H    . GLU B 2 125 ? 97.191  94.822  38.745 1.00 0.00  ? 425 GLU B H    1 
ATOM 4507 H HA   . GLU B 2 125 ? 97.227  92.261  37.467 1.00 0.00  ? 425 GLU B HA   1 
ATOM 4508 H HB2  . GLU B 2 125 ? 99.548  94.000  38.423 1.00 0.00  ? 425 GLU B HB2  1 
ATOM 4509 H HB3  . GLU B 2 125 ? 99.697  92.574  37.341 1.00 0.00  ? 425 GLU B HB3  1 
ATOM 4510 H HG2  . GLU B 2 125 ? 98.114  95.124  36.703 1.00 0.00  ? 425 GLU B HG2  1 
ATOM 4511 H HG3  . GLU B 2 125 ? 99.747  94.743  36.114 1.00 0.00  ? 425 GLU B HG3  1 
ATOM 4512 N N    . GLU B 2 126 ? 98.055  92.092  40.583 1.00 37.29 ? 426 GLU B N    1 
ATOM 4513 C CA   . GLU B 2 126 ? 98.514  91.156  41.609 1.00 40.18 ? 426 GLU B CA   1 
ATOM 4514 C C    . GLU B 2 126 ? 97.438  90.695  42.567 1.00 39.10 ? 426 GLU B C    1 
ATOM 4515 O O    . GLU B 2 126 ? 97.352  89.515  42.878 1.00 41.82 ? 426 GLU B O    1 
ATOM 4516 C CB   . GLU B 2 126 ? 99.709  91.793  42.355 1.00 43.12 ? 426 GLU B CB   1 
ATOM 4517 C CG   . GLU B 2 126 ? 101.040 91.004  42.231 1.00 48.19 ? 426 GLU B CG   1 
ATOM 4518 C CD   . GLU B 2 126 ? 101.619 90.956  40.826 1.00 49.98 ? 426 GLU B CD   1 
ATOM 4519 O OE1  . GLU B 2 126 ? 102.215 91.968  40.376 1.00 48.71 ? 426 GLU B OE1  1 
ATOM 4520 O OE2  . GLU B 2 126 ? 101.498 89.891  40.164 1.00 52.82 ? 426 GLU B OE2  1 
ATOM 4521 H H    . GLU B 2 126 ? 97.715  92.999  40.847 1.00 0.00  ? 426 GLU B H    1 
ATOM 4522 H HA   . GLU B 2 126 ? 98.876  90.250  41.111 1.00 0.00  ? 426 GLU B HA   1 
ATOM 4523 H HB2  . GLU B 2 126 ? 99.874  92.809  41.963 1.00 0.00  ? 426 GLU B HB2  1 
ATOM 4524 H HB3  . GLU B 2 126 ? 99.442  91.865  43.423 1.00 0.00  ? 426 GLU B HB3  1 
ATOM 4525 H HG2  . GLU B 2 126 ? 101.774 91.481  42.899 1.00 0.00  ? 426 GLU B HG2  1 
ATOM 4526 H HG3  . GLU B 2 126 ? 100.865 89.976  42.581 1.00 0.00  ? 426 GLU B HG3  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PHE 1   83  83  PHE PHE A . n 
A 1 2   ARG 2   84  84  ARG ARG A . n 
A 1 3   THR 3   85  85  THR THR A . n 
A 1 4   PHE 4   86  86  PHE PHE A . n 
A 1 5   PRO 5   87  87  PRO PRO A . n 
A 1 6   GLY 6   88  88  GLY GLY A . n 
A 1 7   ILE 7   89  89  ILE ILE A . n 
A 1 8   PRO 8   90  90  PRO PRO A . n 
A 1 9   LYS 9   91  91  LYS LYS A . n 
A 1 10  TRP 10  92  92  TRP TRP A . n 
A 1 11  ARG 11  93  93  ARG ARG A . n 
A 1 12  LYS 12  94  94  LYS LYS A . n 
A 1 13  THR 13  95  95  THR THR A . n 
A 1 14  HIS 14  96  96  HIS HIS A . n 
A 1 15  LEU 15  97  97  LEU LEU A . n 
A 1 16  THR 16  98  98  THR THR A . n 
A 1 17  TYR 17  99  99  TYR TYR A . n 
A 1 18  ARG 18  100 100 ARG ARG A . n 
A 1 19  ILE 19  101 101 ILE ILE A . n 
A 1 20  VAL 20  102 102 VAL VAL A . n 
A 1 21  ASN 21  103 103 ASN ASN A . n 
A 1 22  TYR 22  104 104 TYR TYR A . n 
A 1 23  THR 23  105 105 THR THR A . n 
A 1 24  PRO 24  106 106 PRO PRO A . n 
A 1 25  ASP 25  107 107 ASP ASP A . n 
A 1 26  LEU 26  108 108 LEU LEU A . n 
A 1 27  PRO 27  109 109 PRO PRO A . n 
A 1 28  LYS 28  110 110 LYS LYS A . n 
A 1 29  ASP 29  111 111 ASP ASP A . n 
A 1 30  ALA 30  112 112 ALA ALA A . n 
A 1 31  VAL 31  113 113 VAL VAL A . n 
A 1 32  ASP 32  114 114 ASP ASP A . n 
A 1 33  SER 33  115 115 SER SER A . n 
A 1 34  ALA 34  116 116 ALA ALA A . n 
A 1 35  VAL 35  117 117 VAL VAL A . n 
A 1 36  GLU 36  118 118 GLU GLU A . n 
A 1 37  LYS 37  119 119 LYS LYS A . n 
A 1 38  ALA 38  120 120 ALA ALA A . n 
A 1 39  LEU 39  121 121 LEU LEU A . n 
A 1 40  LYS 40  122 122 LYS LYS A . n 
A 1 41  VAL 41  123 123 VAL VAL A . n 
A 1 42  TRP 42  124 124 TRP TRP A . n 
A 1 43  GLU 43  125 125 GLU GLU A . n 
A 1 44  GLU 44  126 126 GLU GLU A . n 
A 1 45  VAL 45  127 127 VAL VAL A . n 
A 1 46  THR 46  128 128 THR THR A . n 
A 1 47  PRO 47  129 129 PRO PRO A . n 
A 1 48  LEU 48  130 130 LEU LEU A . n 
A 1 49  THR 49  131 131 THR THR A . n 
A 1 50  PHE 50  132 132 PHE PHE A . n 
A 1 51  SER 51  133 133 SER SER A . n 
A 1 52  ARG 52  134 134 ARG ARG A . n 
A 1 53  LEU 53  135 135 LEU LEU A . n 
A 1 54  TYR 54  136 136 TYR TYR A . n 
A 1 55  GLU 55  137 137 GLU GLU A . n 
A 1 56  GLY 56  138 138 GLY GLY A . n 
A 1 57  GLU 57  139 139 GLU GLU A . n 
A 1 58  ALA 58  140 140 ALA ALA A . n 
A 1 59  ASP 59  141 141 ASP ASP A . n 
A 1 60  ILE 60  142 142 ILE ILE A . n 
A 1 61  MET 61  143 143 MET MET A . n 
A 1 62  ILE 62  144 144 ILE ILE A . n 
A 1 63  SER 63  145 145 SER SER A . n 
A 1 64  PHE 64  146 146 PHE PHE A . n 
A 1 65  ALA 65  147 147 ALA ALA A . n 
A 1 66  VAL 66  148 148 VAL VAL A . n 
A 1 67  ARG 67  149 149 ARG ARG A . n 
A 1 68  GLU 68  150 150 GLU GLU A . n 
A 1 69  HIS 69  151 151 HIS HIS A . n 
A 1 70  GLY 70  152 152 GLY GLY A . n 
A 1 71  ASP 71  153 153 ASP ASP A . n 
A 1 72  PHE 72  154 154 PHE PHE A . n 
A 1 73  TYR 73  155 155 TYR TYR A . n 
A 1 74  PRO 74  156 156 PRO PRO A . n 
A 1 75  PHE 75  157 157 PHE PHE A . n 
A 1 76  ASP 76  158 158 ASP ASP A . n 
A 1 77  GLY 77  159 159 GLY GLY A . n 
A 1 78  PRO 78  160 160 PRO PRO A . n 
A 1 79  GLY 79  161 161 GLY GLY A . n 
A 1 80  ASN 80  162 162 ASN ASN A . n 
A 1 81  VAL 81  163 163 VAL VAL A . n 
A 1 82  LEU 82  164 164 LEU LEU A . n 
A 1 83  ALA 83  165 165 ALA ALA A . n 
A 1 84  HIS 84  166 166 HIS HIS A . n 
A 1 85  ALA 85  167 167 ALA ALA A . n 
A 1 86  TYR 86  168 168 TYR TYR A . n 
A 1 87  ALA 87  169 169 ALA ALA A . n 
A 1 88  PRO 88  170 170 PRO PRO A . n 
A 1 89  GLY 89  171 171 GLY GLY A . n 
A 1 90  PRO 90  172 172 PRO PRO A . n 
A 1 91  GLY 91  173 173 GLY GLY A . n 
A 1 92  ILE 92  174 174 ILE ILE A . n 
A 1 93  ASN 93  175 175 ASN ASN A . n 
A 1 94  GLY 94  176 176 GLY GLY A . n 
A 1 95  ASP 95  177 177 ASP ASP A . n 
A 1 96  ALA 96  178 178 ALA ALA A . n 
A 1 97  HIS 97  179 179 HIS HIS A . n 
A 1 98  PHE 98  180 180 PHE PHE A . n 
A 1 99  ASP 99  181 181 ASP ASP A . n 
A 1 100 ASP 100 182 182 ASP ASP A . n 
A 1 101 ASP 101 183 183 ASP ASP A . n 
A 1 102 GLU 102 184 184 GLU GLU A . n 
A 1 103 GLN 103 185 185 GLN GLN A . n 
A 1 104 TRP 104 186 186 TRP TRP A . n 
A 1 105 THR 105 187 187 THR THR A . n 
A 1 106 LYS 106 188 188 LYS LYS A . n 
A 1 107 ASP 107 189 189 ASP ASP A . n 
A 1 108 THR 108 190 190 THR THR A . n 
A 1 109 THR 109 191 191 THR THR A . n 
A 1 110 GLY 110 192 192 GLY GLY A . n 
A 1 111 THR 111 193 193 THR THR A . n 
A 1 112 ASN 112 194 194 ASN ASN A . n 
A 1 113 LEU 113 195 195 LEU LEU A . n 
A 1 114 PHE 114 196 196 PHE PHE A . n 
A 1 115 LEU 115 197 197 LEU LEU A . n 
A 1 116 VAL 116 198 198 VAL VAL A . n 
A 1 117 ALA 117 199 199 ALA ALA A . n 
A 1 118 ALA 118 200 200 ALA ALA A . n 
A 1 119 HIS 119 201 201 HIS HIS A . n 
A 1 120 GLU 120 202 202 GLU GLU A . n 
A 1 121 ILE 121 203 203 ILE ILE A . n 
A 1 122 GLY 122 204 204 GLY GLY A . n 
A 1 123 HIS 123 205 205 HIS HIS A . n 
A 1 124 SER 124 206 206 SER SER A . n 
A 1 125 LEU 125 207 207 LEU LEU A . n 
A 1 126 GLY 126 208 208 GLY GLY A . n 
A 1 127 LEU 127 209 209 LEU LEU A . n 
A 1 128 PHE 128 210 210 PHE PHE A . n 
A 1 129 HIS 129 211 211 HIS HIS A . n 
A 1 130 SER 130 212 212 SER SER A . n 
A 1 131 ALA 131 213 213 ALA ALA A . n 
A 1 132 ASN 132 214 214 ASN ASN A . n 
A 1 133 THR 133 215 215 THR THR A . n 
A 1 134 GLU 134 216 216 GLU GLU A . n 
A 1 135 ALA 135 217 217 ALA ALA A . n 
A 1 136 LEU 136 218 218 LEU LEU A . n 
A 1 137 MET 137 219 219 MET MET A . n 
A 1 138 TYR 138 220 220 TYR TYR A . n 
A 1 139 PRO 139 221 221 PRO PRO A . n 
A 1 140 LEU 140 222 222 LEU LEU A . n 
A 1 141 TYR 141 223 223 TYR TYR A . n 
A 1 142 HIS 142 224 224 HIS HIS A . n 
A 1 143 SER 143 225 225 SER SER A . n 
A 1 144 LEU 144 226 226 LEU LEU A . n 
A 1 145 THR 145 227 227 THR THR A . n 
A 1 146 ASP 146 228 228 ASP ASP A . n 
A 1 147 LEU 147 229 229 LEU LEU A . n 
A 1 148 THR 148 230 230 THR THR A . n 
A 1 149 ARG 149 231 231 ARG ARG A . n 
A 1 150 PHE 150 232 232 PHE PHE A . n 
A 1 151 ARG 151 233 233 ARG ARG A . n 
A 1 152 LEU 152 234 234 LEU LEU A . n 
A 1 153 SER 153 235 235 SER SER A . n 
A 1 154 GLN 154 236 236 GLN GLN A . n 
A 1 155 ASP 155 237 237 ASP ASP A . n 
A 1 156 ASP 156 238 238 ASP ASP A . n 
A 1 157 ILE 157 239 239 ILE ILE A . n 
A 1 158 ASN 158 240 240 ASN ASN A . n 
A 1 159 GLY 159 241 241 GLY GLY A . n 
A 1 160 ILE 160 242 242 ILE ILE A . n 
A 1 161 GLN 161 243 243 GLN GLN A . n 
A 1 162 SER 162 244 244 SER SER A . n 
A 1 163 LEU 163 245 245 LEU LEU A . n 
A 1 164 TYR 164 246 246 TYR TYR A . n 
A 1 165 GLY 165 247 247 GLY GLY A . n 
A 1 166 PRO 166 248 248 PRO PRO A . n 
A 1 167 PRO 167 249 249 PRO PRO A . n 
A 1 168 PRO 168 250 250 PRO PRO A . n 
B 2 1   CYS 1   301 301 CYS CYS B . n 
B 2 2   THR 2   302 302 THR THR B . n 
B 2 3   CYS 3   303 303 CYS CYS B . n 
B 2 4   VAL 4   304 304 VAL VAL B . n 
B 2 5   PRO 5   305 305 PRO PRO B . n 
B 2 6   PRO 6   306 306 PRO PRO B . n 
B 2 7   HIS 7   307 307 HIS HIS B . n 
B 2 8   PRO 8   308 308 PRO PRO B . n 
B 2 9   GLN 9   309 309 GLN GLN B . n 
B 2 10  THR 10  310 310 THR THR B . n 
B 2 11  ALA 11  311 311 ALA ALA B . n 
B 2 12  PHE 12  312 312 PHE PHE B . n 
B 2 13  CYS 13  313 313 CYS CYS B . n 
B 2 14  ASN 14  314 314 ASN ASN B . n 
B 2 15  SER 15  315 315 SER SER B . n 
B 2 16  ASP 16  316 316 ASP ASP B . n 
B 2 17  LEU 17  317 317 LEU LEU B . n 
B 2 18  VAL 18  318 318 VAL VAL B . n 
B 2 19  ILE 19  319 319 ILE ILE B . n 
B 2 20  ARG 20  320 320 ARG ARG B . n 
B 2 21  ALA 21  321 321 ALA ALA B . n 
B 2 22  LYS 22  322 322 LYS LYS B . n 
B 2 23  PHE 23  323 323 PHE PHE B . n 
B 2 24  VAL 24  324 324 VAL VAL B . n 
B 2 25  GLY 25  325 325 GLY GLY B . n 
B 2 26  THR 26  326 326 THR THR B . n 
B 2 27  PRO 27  327 327 PRO PRO B . n 
B 2 28  GLU 28  328 328 GLU GLU B . n 
B 2 29  VAL 29  329 329 VAL VAL B . n 
B 2 30  ASN 30  330 330 ASN ASN B . n 
B 2 31  GLN 31  331 331 GLN GLN B . n 
B 2 32  THR 32  332 332 THR THR B . n 
B 2 33  THR 33  333 333 THR THR B . n 
B 2 34  LEU 34  334 334 LEU LEU B . n 
B 2 35  TYR 35  335 335 TYR TYR B . n 
B 2 36  GLN 36  336 336 GLN GLN B . n 
B 2 37  ARG 37  337 337 ARG ARG B . n 
B 2 38  TYR 38  338 338 TYR TYR B . n 
B 2 39  GLU 39  339 339 GLU GLU B . n 
B 2 40  ILE 40  340 340 ILE ILE B . n 
B 2 41  LYS 41  341 341 LYS LYS B . n 
B 2 42  MET 42  342 342 MET MET B . n 
B 2 43  THR 43  343 343 THR THR B . n 
B 2 44  LYS 44  344 344 LYS LYS B . n 
B 2 45  MET 45  345 345 MET MET B . n 
B 2 46  TYR 46  346 346 TYR TYR B . n 
B 2 47  LYS 47  347 347 LYS LYS B . n 
B 2 48  GLY 48  348 348 GLY GLY B . n 
B 2 49  PHE 49  349 349 PHE PHE B . n 
B 2 50  GLN 50  350 350 GLN GLN B . n 
B 2 51  ALA 51  351 351 ALA ALA B . n 
B 2 52  LEU 52  352 352 LEU LEU B . n 
B 2 53  GLY 53  353 353 GLY GLY B . n 
B 2 54  ASP 54  354 354 ASP ASP B . n 
B 2 55  ALA 55  355 355 ALA ALA B . n 
B 2 56  ALA 56  356 356 ALA ALA B . n 
B 2 57  ASP 57  357 357 ASP ASP B . n 
B 2 58  ILE 58  358 358 ILE ILE B . n 
B 2 59  ARG 59  359 359 ARG ARG B . n 
B 2 60  PHE 60  360 360 PHE PHE B . n 
B 2 61  VAL 61  361 361 VAL VAL B . n 
B 2 62  TYR 62  362 362 TYR TYR B . n 
B 2 63  THR 63  363 363 THR THR B . n 
B 2 64  PRO 64  364 364 PRO PRO B . n 
B 2 65  ALA 65  365 365 ALA ALA B . n 
B 2 66  MET 66  366 366 MET MET B . n 
B 2 67  GLU 67  367 367 GLU GLU B . n 
B 2 68  SER 68  368 368 SER SER B . n 
B 2 69  VAL 69  369 369 VAL VAL B . n 
B 2 70  CYS 70  370 370 CYS CYS B . n 
B 2 71  GLY 71  371 371 GLY GLY B . n 
B 2 72  TYR 72  372 372 TYR TYR B . n 
B 2 73  PHE 73  373 373 PHE PHE B . n 
B 2 74  HIS 74  374 374 HIS HIS B . n 
B 2 75  ARG 75  375 375 ARG ARG B . n 
B 2 76  SER 76  376 376 SER SER B . n 
B 2 77  HIS 77  377 377 HIS HIS B . n 
B 2 78  ASN 78  378 378 ASN ASN B . n 
B 2 79  ARG 79  379 379 ARG ARG B . n 
B 2 80  SER 80  380 380 SER SER B . n 
B 2 81  GLU 81  381 381 GLU GLU B . n 
B 2 82  GLU 82  382 382 GLU GLU B . n 
B 2 83  PHE 83  383 383 PHE PHE B . n 
B 2 84  LEU 84  384 384 LEU LEU B . n 
B 2 85  ILE 85  385 385 ILE ILE B . n 
B 2 86  ALA 86  386 386 ALA ALA B . n 
B 2 87  GLY 87  387 387 GLY GLY B . n 
B 2 88  LYS 88  388 388 LYS LYS B . n 
B 2 89  LEU 89  389 389 LEU LEU B . n 
B 2 90  GLN 90  390 390 GLN GLN B . n 
B 2 91  ASP 91  391 391 ASP ASP B . n 
B 2 92  GLY 92  392 392 GLY GLY B . n 
B 2 93  LEU 93  393 393 LEU LEU B . n 
B 2 94  LEU 94  394 394 LEU LEU B . n 
B 2 95  HIS 95  395 395 HIS HIS B . n 
B 2 96  ILE 96  396 396 ILE ILE B . n 
B 2 97  THR 97  397 397 THR THR B . n 
B 2 98  THR 98  398 398 THR THR B . n 
B 2 99  CYS 99  399 399 CYS CYS B . n 
B 2 100 SER 100 400 400 SER SER B . n 
B 2 101 PHE 101 401 401 PHE PHE B . n 
B 2 102 VAL 102 402 402 VAL VAL B . n 
B 2 103 ALA 103 403 403 ALA ALA B . n 
B 2 104 PRO 104 404 404 PRO PRO B . n 
B 2 105 TRP 105 405 405 TRP TRP B . n 
B 2 106 ASN 106 406 406 ASN ASN B . n 
B 2 107 SER 107 407 407 SER SER B . n 
B 2 108 LEU 108 408 408 LEU LEU B . n 
B 2 109 SER 109 409 409 SER SER B . n 
B 2 110 LEU 110 410 410 LEU LEU B . n 
B 2 111 ALA 111 411 411 ALA ALA B . n 
B 2 112 GLN 112 412 412 GLN GLN B . n 
B 2 113 ARG 113 413 413 ARG ARG B . n 
B 2 114 ARG 114 414 414 ARG ARG B . n 
B 2 115 GLY 115 415 415 GLY GLY B . n 
B 2 116 PHE 116 416 416 PHE PHE B . n 
B 2 117 THR 117 417 417 THR THR B . n 
B 2 118 LYS 118 418 418 LYS LYS B . n 
B 2 119 THR 119 419 419 THR THR B . n 
B 2 120 TYR 120 420 420 TYR TYR B . n 
B 2 121 THR 121 421 421 THR THR B . n 
B 2 122 VAL 122 422 422 VAL VAL B . n 
B 2 123 GLY 123 423 423 GLY GLY B . n 
B 2 124 CYS 124 424 424 CYS CYS B . n 
B 2 125 GLU 125 425 425 GLU GLU B . n 
B 2 126 GLU 126 426 426 GLU GLU B . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-07-29 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A PRO 221 ? ? H  B CYS 303 ? ? 1.58 
2 1 O A ILE 203 ? ? HG A SER 206 ? ? 1.59 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CE1 A HIS 96  ? ? NE2 A HIS 96  ? ? 1.243 1.317 -0.074 0.011 N 
2  1 CG  A TRP 124 ? ? CD2 A TRP 124 ? ? 1.536 1.432 0.104  0.017 N 
3  1 CE1 A HIS 151 ? ? NE2 A HIS 151 ? ? 1.245 1.317 -0.072 0.011 N 
4  1 CE1 A HIS 166 ? ? NE2 A HIS 166 ? ? 1.247 1.317 -0.070 0.011 N 
5  1 CE1 A HIS 179 ? ? NE2 A HIS 179 ? ? 1.241 1.317 -0.076 0.011 N 
6  1 CE1 A HIS 201 ? ? NE2 A HIS 201 ? ? 1.246 1.317 -0.071 0.011 N 
7  1 CE1 A HIS 205 ? ? NE2 A HIS 205 ? ? 1.243 1.317 -0.074 0.011 N 
8  1 CE1 A HIS 211 ? ? NE2 A HIS 211 ? ? 1.245 1.317 -0.072 0.011 N 
9  1 CE1 A HIS 224 ? ? NE2 A HIS 224 ? ? 1.248 1.317 -0.069 0.011 N 
10 1 CE1 B HIS 307 ? ? NE2 B HIS 307 ? ? 1.249 1.317 -0.068 0.011 N 
11 1 CE1 B HIS 374 ? ? NE2 B HIS 374 ? ? 1.242 1.317 -0.075 0.011 N 
12 1 CE1 B HIS 377 ? ? NE2 B HIS 377 ? ? 1.240 1.317 -0.077 0.011 N 
13 1 CE1 B HIS 395 ? ? NE2 B HIS 395 ? ? 1.241 1.317 -0.076 0.011 N 
14 1 CG  B TRP 405 ? ? CD2 B TRP 405 ? ? 1.539 1.432 0.107  0.017 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 84  ? ? CZ A ARG 84  ? ? NH1 A ARG 84  ? ? 123.46 120.30 3.16  0.50 N 
2 1 NE A ARG 93  ? ? CZ A ARG 93  ? ? NH1 A ARG 93  ? ? 123.90 120.30 3.60  0.50 N 
3 1 NE A ARG 100 ? ? CZ A ARG 100 ? ? NH1 A ARG 100 ? ? 124.09 120.30 3.79  0.50 N 
4 1 NE B ARG 359 ? ? CZ B ARG 359 ? ? NH1 B ARG 359 ? ? 123.39 120.30 3.09  0.50 N 
5 1 NE B ARG 413 ? ? CZ B ARG 413 ? ? NH1 B ARG 413 ? ? 126.65 120.30 6.35  0.50 N 
6 1 NE B ARG 413 ? ? CZ B ARG 413 ? ? NH2 B ARG 413 ? ? 116.66 120.30 -3.64 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 93  ? ? -83.75  36.52   
2  1 ARG A 149 ? ? 47.05   -128.57 
3  1 HIS A 151 ? ? -147.85 33.34   
4  1 ASP A 158 ? ? -84.05  30.89   
5  1 ASN A 162 ? ? 50.39   -104.54 
6  1 PRO A 170 ? ? -49.27  151.40  
7  1 THR A 191 ? ? -151.06 59.27   
8  1 ASN A 194 ? ? -58.67  105.53  
9  1 MET A 219 ? ? -66.51  4.49    
10 1 TYR A 223 ? ? -57.12  105.66  
11 1 SER A 225 ? ? 15.40   105.45  
12 1 THR A 227 ? ? -54.55  -85.91  
13 1 LEU A 245 ? ? -108.91 -62.02  
14 1 ASN B 330 ? ? -74.00  -111.56 
15 1 THR B 343 ? ? -95.06  -77.82  
16 1 GLN B 350 ? ? -89.65  37.51   
17 1 ALA B 351 ? ? -163.37 8.89    
18 1 LEU B 352 ? ? 51.84   -106.22 
19 1 ASP B 354 ? ? 25.66   -66.65  
20 1 ALA B 355 ? ? -157.51 -6.14   
21 1 ALA B 356 ? ? -168.05 45.80   
22 1 CYS B 370 ? ? 91.94   6.81    
23 1 ASP B 391 ? ? 65.01   -126.42 
24 1 LYS B 418 ? ? -135.94 -46.09  
#