data_1OQY
# 
_entry.id   1OQY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OQY         
RCSB  RCSB018582   
WWPDB D_1000018582 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1qze 
_pdbx_database_related.details        'HHR23a protein structure based on residual dipolar coupling data' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OQY 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walters, K.J.' 1 
'Lech, P.J.'    2 
'Goh, A.M.'     3 
'Wang, Q.'      4 
'Howley, P.M.'  5 
# 
_citation.id                        primary 
_citation.title                     'DNA-repair protein hHR23a alters its protein structure upon binding proteasomal subunit S5a' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            100 
_citation.page_first                12694 
_citation.page_last                 12699 
_citation.year                      2003 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14557549 
_citation.pdbx_database_id_DOI      10.1073/pnas.1634989100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walters, K.J.' 1 
primary 'Lech, P.J.'    2 
primary 'Goh, A.M.'     3 
primary 'Wang, Q.'      4 
primary 'Howley, P.M.'  5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'UV excision repair protein RAD23 homolog A' 
_entity.formula_weight             40009.324 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HHR23A 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSSAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVM
VTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAAS
TLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFL
RDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQ
VTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSSAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVM
VTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAAS
TLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFL
RDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQ
VTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   ALA n 
1 8   VAL n 
1 9   THR n 
1 10  ILE n 
1 11  THR n 
1 12  LEU n 
1 13  LYS n 
1 14  THR n 
1 15  LEU n 
1 16  GLN n 
1 17  GLN n 
1 18  GLN n 
1 19  THR n 
1 20  PHE n 
1 21  LYS n 
1 22  ILE n 
1 23  ARG n 
1 24  MET n 
1 25  GLU n 
1 26  PRO n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  LYS n 
1 32  VAL n 
1 33  LEU n 
1 34  LYS n 
1 35  GLU n 
1 36  LYS n 
1 37  ILE n 
1 38  GLU n 
1 39  ALA n 
1 40  GLU n 
1 41  LYS n 
1 42  GLY n 
1 43  ARG n 
1 44  ASP n 
1 45  ALA n 
1 46  PHE n 
1 47  PRO n 
1 48  VAL n 
1 49  ALA n 
1 50  GLY n 
1 51  GLN n 
1 52  LYS n 
1 53  LEU n 
1 54  ILE n 
1 55  TYR n 
1 56  ALA n 
1 57  GLY n 
1 58  LYS n 
1 59  ILE n 
1 60  LEU n 
1 61  SER n 
1 62  ASP n 
1 63  ASP n 
1 64  VAL n 
1 65  PRO n 
1 66  ILE n 
1 67  ARG n 
1 68  ASP n 
1 69  TYR n 
1 70  ARG n 
1 71  ILE n 
1 72  ASP n 
1 73  GLU n 
1 74  LYS n 
1 75  ASN n 
1 76  PHE n 
1 77  VAL n 
1 78  VAL n 
1 79  VAL n 
1 80  MET n 
1 81  VAL n 
1 82  THR n 
1 83  LYS n 
1 84  THR n 
1 85  LYS n 
1 86  ALA n 
1 87  GLY n 
1 88  GLN n 
1 89  GLY n 
1 90  THR n 
1 91  SER n 
1 92  ALA n 
1 93  PRO n 
1 94  PRO n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  PRO n 
1 99  THR n 
1 100 ALA n 
1 101 ALA n 
1 102 PRO n 
1 103 GLU n 
1 104 SER n 
1 105 SER n 
1 106 THR n 
1 107 SER n 
1 108 PHE n 
1 109 PRO n 
1 110 PRO n 
1 111 ALA n 
1 112 PRO n 
1 113 THR n 
1 114 SER n 
1 115 GLY n 
1 116 MET n 
1 117 SER n 
1 118 HIS n 
1 119 PRO n 
1 120 PRO n 
1 121 PRO n 
1 122 ALA n 
1 123 ALA n 
1 124 ARG n 
1 125 GLU n 
1 126 ASP n 
1 127 LYS n 
1 128 SER n 
1 129 PRO n 
1 130 SER n 
1 131 GLU n 
1 132 GLU n 
1 133 SER n 
1 134 ALA n 
1 135 PRO n 
1 136 THR n 
1 137 THR n 
1 138 SER n 
1 139 PRO n 
1 140 GLU n 
1 141 SER n 
1 142 VAL n 
1 143 SER n 
1 144 GLY n 
1 145 SER n 
1 146 VAL n 
1 147 PRO n 
1 148 SER n 
1 149 SER n 
1 150 GLY n 
1 151 SER n 
1 152 SER n 
1 153 GLY n 
1 154 ARG n 
1 155 GLU n 
1 156 GLU n 
1 157 ASP n 
1 158 ALA n 
1 159 ALA n 
1 160 SER n 
1 161 THR n 
1 162 LEU n 
1 163 VAL n 
1 164 THR n 
1 165 GLY n 
1 166 SER n 
1 167 GLU n 
1 168 TYR n 
1 169 GLU n 
1 170 THR n 
1 171 MET n 
1 172 LEU n 
1 173 THR n 
1 174 GLU n 
1 175 ILE n 
1 176 MET n 
1 177 SER n 
1 178 MET n 
1 179 GLY n 
1 180 TYR n 
1 181 GLU n 
1 182 ARG n 
1 183 GLU n 
1 184 ARG n 
1 185 VAL n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 LEU n 
1 190 ARG n 
1 191 ALA n 
1 192 SER n 
1 193 TYR n 
1 194 ASN n 
1 195 ASN n 
1 196 PRO n 
1 197 HIS n 
1 198 ARG n 
1 199 ALA n 
1 200 VAL n 
1 201 GLU n 
1 202 TYR n 
1 203 LEU n 
1 204 LEU n 
1 205 THR n 
1 206 GLY n 
1 207 ILE n 
1 208 PRO n 
1 209 GLY n 
1 210 SER n 
1 211 PRO n 
1 212 GLU n 
1 213 PRO n 
1 214 GLU n 
1 215 HIS n 
1 216 GLY n 
1 217 SER n 
1 218 VAL n 
1 219 GLN n 
1 220 GLU n 
1 221 SER n 
1 222 GLN n 
1 223 VAL n 
1 224 SER n 
1 225 GLU n 
1 226 GLN n 
1 227 PRO n 
1 228 ALA n 
1 229 THR n 
1 230 GLU n 
1 231 ALA n 
1 232 ALA n 
1 233 GLY n 
1 234 GLU n 
1 235 ASN n 
1 236 PRO n 
1 237 LEU n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 ARG n 
1 242 ASP n 
1 243 GLN n 
1 244 PRO n 
1 245 GLN n 
1 246 PHE n 
1 247 GLN n 
1 248 ASN n 
1 249 MET n 
1 250 ARG n 
1 251 GLN n 
1 252 VAL n 
1 253 ILE n 
1 254 GLN n 
1 255 GLN n 
1 256 ASN n 
1 257 PRO n 
1 258 ALA n 
1 259 LEU n 
1 260 LEU n 
1 261 PRO n 
1 262 ALA n 
1 263 LEU n 
1 264 LEU n 
1 265 GLN n 
1 266 GLN n 
1 267 LEU n 
1 268 GLY n 
1 269 GLN n 
1 270 GLU n 
1 271 ASN n 
1 272 PRO n 
1 273 GLN n 
1 274 LEU n 
1 275 LEU n 
1 276 GLN n 
1 277 GLN n 
1 278 ILE n 
1 279 SER n 
1 280 ARG n 
1 281 HIS n 
1 282 GLN n 
1 283 GLU n 
1 284 GLN n 
1 285 PHE n 
1 286 ILE n 
1 287 GLN n 
1 288 MET n 
1 289 LEU n 
1 290 ASN n 
1 291 GLU n 
1 292 PRO n 
1 293 PRO n 
1 294 GLY n 
1 295 GLU n 
1 296 LEU n 
1 297 ALA n 
1 298 ASP n 
1 299 ILE n 
1 300 SER n 
1 301 ASP n 
1 302 VAL n 
1 303 GLU n 
1 304 GLY n 
1 305 GLU n 
1 306 VAL n 
1 307 GLY n 
1 308 ALA n 
1 309 ILE n 
1 310 GLY n 
1 311 GLU n 
1 312 GLU n 
1 313 ALA n 
1 314 PRO n 
1 315 GLN n 
1 316 MET n 
1 317 ASN n 
1 318 TYR n 
1 319 ILE n 
1 320 GLN n 
1 321 VAL n 
1 322 THR n 
1 323 PRO n 
1 324 GLN n 
1 325 GLU n 
1 326 LYS n 
1 327 GLU n 
1 328 ALA n 
1 329 ILE n 
1 330 GLU n 
1 331 ARG n 
1 332 LEU n 
1 333 LYS n 
1 334 ALA n 
1 335 LEU n 
1 336 GLY n 
1 337 PHE n 
1 338 PRO n 
1 339 GLU n 
1 340 SER n 
1 341 LEU n 
1 342 VAL n 
1 343 ILE n 
1 344 GLN n 
1 345 ALA n 
1 346 TYR n 
1 347 PHE n 
1 348 ALA n 
1 349 CYS n 
1 350 GLU n 
1 351 LYS n 
1 352 ASN n 
1 353 GLU n 
1 354 ASN n 
1 355 LEU n 
1 356 ALA n 
1 357 ALA n 
1 358 ASN n 
1 359 PHE n 
1 360 LEU n 
1 361 LEU n 
1 362 SER n 
1 363 GLN n 
1 364 ASN n 
1 365 PHE n 
1 366 ASP n 
1 367 ASP n 
1 368 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 RAD23A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RD23A_HUMAN 
_struct_ref.pdbx_db_accession          P54725 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTK
AGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTG
SEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQE
KEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OQY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 368 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P54725 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  363 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       363 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1OQY GLY A 1 ? UNP P54725 ?   ? 'CLONING ARTIFACT' -4 1 
1 1OQY PRO A 2 ? UNP P54725 ?   ? 'CLONING ARTIFACT' -3 2 
1 1OQY LEU A 3 ? UNP P54725 ?   ? 'CLONING ARTIFACT' -2 3 
1 1OQY GLY A 4 ? UNP P54725 ?   ? 'CLONING ARTIFACT' -1 4 
1 1OQY SER A 5 ? UNP P54725 ?   ? 'CLONING ARTIFACT' 0  5 
1 1OQY SER A 6 ? UNP P54725 MET 1 'see remark 999'   1  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 2 2 3D_15N-separated_NOESY 
3 3 3 '2D NOESY'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.5 mM 13C,15N,2H hHR23a; 20 mM NaPO4 pH 6.5; 100 mM NaCl; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 800 
2 ? Varian INOVA 600 
# 
_pdbx_nmr_refine.entry_id           1OQY 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1OQY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            45 
_pdbx_nmr_ensemble.conformers_submitted_total_number             12 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1OQY 
_pdbx_nmr_representative.conformer_id         7 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
X-PLOR 3.851 'structure solution' Brunger 1 
X-PLOR 3.851 refinement           Brunger 2 
# 
_exptl.entry_id          1OQY 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1OQY 
_struct.title                     'Structure of the DNA repair protein hHR23a' 
_struct.pdbx_descriptor           'UV excision repair protein RAD23 homolog A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OQY 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            'DNA repair, proteasome-mediated degradation, protein-protein interaction, REPLICATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 29  ? LYS A 41  ? THR A 24  LYS A 36  1 ? 13 
HELX_P HELX_P2  2  GLU A 167 ? SER A 177 ? GLU A 162 SER A 172 1 ? 11 
HELX_P HELX_P3  3  ARG A 182 ? SER A 192 ? ARG A 177 SER A 187 1 ? 11 
HELX_P HELX_P4  4  HIS A 197 ? TYR A 202 ? HIS A 192 TYR A 197 1 ? 6  
HELX_P HELX_P5  5  LEU A 237 ? GLN A 243 ? LEU A 232 GLN A 238 1 ? 7  
HELX_P HELX_P6  6  GLN A 243 ? VAL A 252 ? GLN A 238 VAL A 247 1 ? 10 
HELX_P HELX_P7  7  ALA A 258 ? GLN A 265 ? ALA A 253 GLN A 260 1 ? 8  
HELX_P HELX_P8  8  ASN A 271 ? GLU A 291 ? ASN A 266 GLU A 286 1 ? 21 
HELX_P HELX_P9  9  GLU A 325 ? LEU A 335 ? GLU A 320 LEU A 330 1 ? 11 
HELX_P HELX_P10 10 GLU A 339 ? TYR A 346 ? GLU A 334 TYR A 341 1 ? 8  
HELX_P HELX_P11 11 ASN A 354 ? PHE A 365 ? ASN A 349 PHE A 360 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 18 ? ILE A 22 ? GLN A 13 ILE A 17 
A 2 ILE A 10 ? THR A 14 ? ILE A 5  THR A 9  
A 3 VAL A 77 ? THR A 82 ? VAL A 72 THR A 77 
A 4 GLY A 50 ? ILE A 54 ? GLY A 45 ILE A 49 
A 5 ILE A 59 ? LEU A 60 ? ILE A 54 LEU A 55 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 20 ? O PHE A 15 N LEU A 12 ? N LEU A 7  
A 2 3 N LYS A 13 ? N LYS A 8  O VAL A 77 ? O VAL A 72 
A 3 4 O MET A 80 ? O MET A 75 N LYS A 52 ? N LYS A 47 
A 4 5 N LEU A 53 ? N LEU A 48 O LEU A 60 ? O LEU A 55 
# 
_database_PDB_matrix.entry_id          1OQY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OQY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 6   ? -47.199  43.867   -12.312  1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 6   ? -47.042  43.294   -10.945  1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 6   ? -45.597  43.462   -10.464  1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 6   ? -44.658  43.249   -11.206  1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 6   ? -47.390  41.814   -11.094  1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 6   ? -48.803  41.659   -11.065  1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H HA   . SER A 1 6   ? -47.725  43.766   -10.257  1.00 0.00 ? 1   SER A HA   1  
ATOM 8     H HB2  . SER A 1 6   ? -47.012  41.446   -12.033  1.00 0.00 ? 1   SER A HB2  1  
ATOM 9     H HB3  . SER A 1 6   ? -46.940  41.255   -10.284  1.00 0.00 ? 1   SER A HB3  1  
ATOM 10    H HG   . SER A 1 6   ? -49.176  42.215   -11.753  1.00 0.00 ? 1   SER A HG   1  
ATOM 11    N N    . ALA A 1 7   ? -45.414  43.842   -9.228   1.00 0.00 ? 2   ALA A N    1  
ATOM 12    C CA   . ALA A 1 7   ? -44.032  44.025   -8.696   1.00 0.00 ? 2   ALA A CA   1  
ATOM 13    C C    . ALA A 1 7   ? -44.062  44.107   -7.167   1.00 0.00 ? 2   ALA A C    1  
ATOM 14    O O    . ALA A 1 7   ? -45.023  43.717   -6.534   1.00 0.00 ? 2   ALA A O    1  
ATOM 15    C CB   . ALA A 1 7   ? -43.551  45.347   -9.293   1.00 0.00 ? 2   ALA A CB   1  
ATOM 16    H H    . ALA A 1 7   ? -46.187  44.009   -8.648   1.00 0.00 ? 2   ALA A H    1  
ATOM 17    H HA   . ALA A 1 7   ? -43.392  43.219   -9.019   1.00 0.00 ? 2   ALA A HA   1  
ATOM 18    H HB1  . ALA A 1 7   ? -43.644  45.312   -10.369  1.00 0.00 ? 2   ALA A HB1  1  
ATOM 19    H HB2  . ALA A 1 7   ? -42.516  45.507   -9.027   1.00 0.00 ? 2   ALA A HB2  1  
ATOM 20    H HB3  . ALA A 1 7   ? -44.151  46.157   -8.906   1.00 0.00 ? 2   ALA A HB3  1  
ATOM 21    N N    . VAL A 1 8   ? -43.016  44.615   -6.570   1.00 0.00 ? 3   VAL A N    1  
ATOM 22    C CA   . VAL A 1 8   ? -42.980  44.727   -5.085   1.00 0.00 ? 3   VAL A CA   1  
ATOM 23    C C    . VAL A 1 8   ? -41.809  45.617   -4.664   1.00 0.00 ? 3   VAL A C    1  
ATOM 24    O O    . VAL A 1 8   ? -40.661  45.293   -4.893   1.00 0.00 ? 3   VAL A O    1  
ATOM 25    C CB   . VAL A 1 8   ? -42.787  43.294   -4.577   1.00 0.00 ? 3   VAL A CB   1  
ATOM 26    C CG1  . VAL A 1 8   ? -41.496  42.704   -5.153   1.00 0.00 ? 3   VAL A CG1  1  
ATOM 27    C CG2  . VAL A 1 8   ? -42.702  43.301   -3.048   1.00 0.00 ? 3   VAL A CG2  1  
ATOM 28    H H    . VAL A 1 8   ? -42.252  44.927   -7.100   1.00 0.00 ? 3   VAL A H    1  
ATOM 29    H HA   . VAL A 1 8   ? -43.911  45.128   -4.714   1.00 0.00 ? 3   VAL A HA   1  
ATOM 30    H HB   . VAL A 1 8   ? -43.626  42.688   -4.888   1.00 0.00 ? 3   VAL A HB   1  
ATOM 31    H HG11 . VAL A 1 8   ? -41.501  41.632   -5.026   1.00 0.00 ? 3   VAL A HG11 1  
ATOM 32    H HG12 . VAL A 1 8   ? -40.646  43.121   -4.635   1.00 0.00 ? 3   VAL A HG12 1  
ATOM 33    H HG13 . VAL A 1 8   ? -41.429  42.941   -6.205   1.00 0.00 ? 3   VAL A HG13 1  
ATOM 34    H HG21 . VAL A 1 8   ? -43.675  43.518   -2.634   1.00 0.00 ? 3   VAL A HG21 1  
ATOM 35    H HG22 . VAL A 1 8   ? -41.999  44.057   -2.730   1.00 0.00 ? 3   VAL A HG22 1  
ATOM 36    H HG23 . VAL A 1 8   ? -42.371  42.333   -2.701   1.00 0.00 ? 3   VAL A HG23 1  
ATOM 37    N N    . THR A 1 9   ? -42.087  46.740   -4.058   1.00 0.00 ? 4   THR A N    1  
ATOM 38    C CA   . THR A 1 9   ? -40.979  47.643   -3.632   1.00 0.00 ? 4   THR A CA   1  
ATOM 39    C C    . THR A 1 9   ? -40.131  46.948   -2.566   1.00 0.00 ? 4   THR A C    1  
ATOM 40    O O    . THR A 1 9   ? -40.631  46.184   -1.765   1.00 0.00 ? 4   THR A O    1  
ATOM 41    C CB   . THR A 1 9   ? -41.663  48.884   -3.059   1.00 0.00 ? 4   THR A CB   1  
ATOM 42    O OG1  . THR A 1 9   ? -42.444  49.504   -4.074   1.00 0.00 ? 4   THR A OG1  1  
ATOM 43    C CG2  . THR A 1 9   ? -40.603  49.869   -2.548   1.00 0.00 ? 4   THR A CG2  1  
ATOM 44    H H    . THR A 1 9   ? -43.019  46.990   -3.887   1.00 0.00 ? 4   THR A H    1  
ATOM 45    H HA   . THR A 1 9   ? -40.372  47.914   -4.478   1.00 0.00 ? 4   THR A HA   1  
ATOM 46    H HB   . THR A 1 9   ? -42.303  48.591   -2.244   1.00 0.00 ? 4   THR A HB   1  
ATOM 47    H HG1  . THR A 1 9   ? -41.852  50.000   -4.645   1.00 0.00 ? 4   THR A HG1  1  
ATOM 48    H HG21 . THR A 1 9   ? -39.932  50.128   -3.355   1.00 0.00 ? 4   THR A HG21 1  
ATOM 49    H HG22 . THR A 1 9   ? -40.040  49.411   -1.748   1.00 0.00 ? 4   THR A HG22 1  
ATOM 50    H HG23 . THR A 1 9   ? -41.087  50.762   -2.182   1.00 0.00 ? 4   THR A HG23 1  
ATOM 51    N N    . ILE A 1 10  ? -38.850  47.200   -2.555   1.00 0.00 ? 5   ILE A N    1  
ATOM 52    C CA   . ILE A 1 10  ? -37.973  46.543   -1.545   1.00 0.00 ? 5   ILE A CA   1  
ATOM 53    C C    . ILE A 1 10  ? -37.315  47.591   -0.649   1.00 0.00 ? 5   ILE A C    1  
ATOM 54    O O    . ILE A 1 10  ? -36.761  48.565   -1.119   1.00 0.00 ? 5   ILE A O    1  
ATOM 55    C CB   . ILE A 1 10  ? -36.911  45.791   -2.356   1.00 0.00 ? 5   ILE A CB   1  
ATOM 56    C CG1  . ILE A 1 10  ? -37.579  44.922   -3.433   1.00 0.00 ? 5   ILE A CG1  1  
ATOM 57    C CG2  . ILE A 1 10  ? -36.098  44.896   -1.419   1.00 0.00 ? 5   ILE A CG2  1  
ATOM 58    C CD1  . ILE A 1 10  ? -38.740  44.127   -2.827   1.00 0.00 ? 5   ILE A CD1  1  
ATOM 59    H H    . ILE A 1 10  ? -38.465  47.814   -3.213   1.00 0.00 ? 5   ILE A H    1  
ATOM 60    H HA   . ILE A 1 10  ? -38.542  45.848   -0.950   1.00 0.00 ? 5   ILE A HA   1  
ATOM 61    H HB   . ILE A 1 10  ? -36.251  46.505   -2.828   1.00 0.00 ? 5   ILE A HB   1  
ATOM 62    H HG12 . ILE A 1 10  ? -37.954  45.556   -4.223   1.00 0.00 ? 5   ILE A HG12 1  
ATOM 63    H HG13 . ILE A 1 10  ? -36.852  44.235   -3.840   1.00 0.00 ? 5   ILE A HG13 1  
ATOM 64    H HG21 . ILE A 1 10  ? -35.326  44.392   -1.983   1.00 0.00 ? 5   ILE A HG21 1  
ATOM 65    H HG22 . ILE A 1 10  ? -36.749  44.163   -0.966   1.00 0.00 ? 5   ILE A HG22 1  
ATOM 66    H HG23 . ILE A 1 10  ? -35.643  45.500   -0.648   1.00 0.00 ? 5   ILE A HG23 1  
ATOM 67    H HD11 . ILE A 1 10  ? -39.676  44.593   -3.101   1.00 0.00 ? 5   ILE A HD11 1  
ATOM 68    H HD12 . ILE A 1 10  ? -38.646  44.113   -1.751   1.00 0.00 ? 5   ILE A HD12 1  
ATOM 69    H HD13 . ILE A 1 10  ? -38.719  43.115   -3.202   1.00 0.00 ? 5   ILE A HD13 1  
ATOM 70    N N    . THR A 1 11  ? -37.368  47.391   0.639    1.00 0.00 ? 6   THR A N    1  
ATOM 71    C CA   . THR A 1 11  ? -36.741  48.366   1.573    1.00 0.00 ? 6   THR A CA   1  
ATOM 72    C C    . THR A 1 11  ? -35.228  48.147   1.597    1.00 0.00 ? 6   THR A C    1  
ATOM 73    O O    . THR A 1 11  ? -34.744  47.165   2.125    1.00 0.00 ? 6   THR A O    1  
ATOM 74    C CB   . THR A 1 11  ? -37.353  48.059   2.942    1.00 0.00 ? 6   THR A CB   1  
ATOM 75    O OG1  . THR A 1 11  ? -38.642  47.483   2.772    1.00 0.00 ? 6   THR A OG1  1  
ATOM 76    C CG2  . THR A 1 11  ? -37.477  49.350   3.748    1.00 0.00 ? 6   THR A CG2  1  
ATOM 77    H H    . THR A 1 11  ? -37.816  46.595   0.993    1.00 0.00 ? 6   THR A H    1  
ATOM 78    H HA   . THR A 1 11  ? -36.974  49.378   1.279    1.00 0.00 ? 6   THR A HA   1  
ATOM 79    H HB   . THR A 1 11  ? -36.718  47.368   3.473    1.00 0.00 ? 6   THR A HB   1  
ATOM 80    H HG1  . THR A 1 11  ? -39.209  48.139   2.361    1.00 0.00 ? 6   THR A HG1  1  
ATOM 81    H HG21 . THR A 1 11  ? -38.355  49.300   4.374    1.00 0.00 ? 6   THR A HG21 1  
ATOM 82    H HG22 . THR A 1 11  ? -37.563  50.188   3.072    1.00 0.00 ? 6   THR A HG22 1  
ATOM 83    H HG23 . THR A 1 11  ? -36.600  49.474   4.365    1.00 0.00 ? 6   THR A HG23 1  
ATOM 84    N N    . LEU A 1 12  ? -34.477  49.046   1.020    1.00 0.00 ? 7   LEU A N    1  
ATOM 85    C CA   . LEU A 1 12  ? -32.995  48.876   1.003    1.00 0.00 ? 7   LEU A CA   1  
ATOM 86    C C    . LEU A 1 12  ? -32.351  49.745   2.087    1.00 0.00 ? 7   LEU A C    1  
ATOM 87    O O    . LEU A 1 12  ? -32.511  50.949   2.105    1.00 0.00 ? 7   LEU A O    1  
ATOM 88    C CB   . LEU A 1 12  ? -32.561  49.337   -0.388   1.00 0.00 ? 7   LEU A CB   1  
ATOM 89    C CG   . LEU A 1 12  ? -31.290  48.591   -0.813   1.00 0.00 ? 7   LEU A CG   1  
ATOM 90    C CD1  . LEU A 1 12  ? -30.171  48.857   0.195    1.00 0.00 ? 7   LEU A CD1  1  
ATOM 91    C CD2  . LEU A 1 12  ? -31.571  47.085   -0.873   1.00 0.00 ? 7   LEU A CD2  1  
ATOM 92    H H    . LEU A 1 12  ? -34.886  49.828   0.594    1.00 0.00 ? 7   LEU A H    1  
ATOM 93    H HA   . LEU A 1 12  ? -32.734  47.840   1.141    1.00 0.00 ? 7   LEU A HA   1  
ATOM 94    H HB2  . LEU A 1 12  ? -33.352  49.135   -1.095   1.00 0.00 ? 7   LEU A HB2  1  
ATOM 95    H HB3  . LEU A 1 12  ? -32.364  50.396   -0.364   1.00 0.00 ? 7   LEU A HB3  1  
ATOM 96    H HG   . LEU A 1 12  ? -30.982  48.938   -1.789   1.00 0.00 ? 7   LEU A HG   1  
ATOM 97    H HD11 . LEU A 1 12  ? -30.191  48.098   0.963    1.00 0.00 ? 7   LEU A HD11 1  
ATOM 98    H HD12 . LEU A 1 12  ? -30.316  49.828   0.646    1.00 0.00 ? 7   LEU A HD12 1  
ATOM 99    H HD13 . LEU A 1 12  ? -29.217  48.833   -0.310   1.00 0.00 ? 7   LEU A HD13 1  
ATOM 100   H HD21 . LEU A 1 12  ? -31.007  46.646   -1.683   1.00 0.00 ? 7   LEU A HD21 1  
ATOM 101   H HD22 . LEU A 1 12  ? -32.625  46.921   -1.039   1.00 0.00 ? 7   LEU A HD22 1  
ATOM 102   H HD23 . LEU A 1 12  ? -31.277  46.626   0.060    1.00 0.00 ? 7   LEU A HD23 1  
ATOM 103   N N    . LYS A 1 13  ? -31.626  49.142   2.991    1.00 0.00 ? 8   LYS A N    1  
ATOM 104   C CA   . LYS A 1 13  ? -30.973  49.932   4.076    1.00 0.00 ? 8   LYS A CA   1  
ATOM 105   C C    . LYS A 1 13  ? -29.455  49.744   4.034    1.00 0.00 ? 8   LYS A C    1  
ATOM 106   O O    . LYS A 1 13  ? -28.964  48.636   4.020    1.00 0.00 ? 8   LYS A O    1  
ATOM 107   C CB   . LYS A 1 13  ? -31.540  49.359   5.377    1.00 0.00 ? 8   LYS A CB   1  
ATOM 108   C CG   . LYS A 1 13  ? -31.711  50.476   6.413    1.00 0.00 ? 8   LYS A CG   1  
ATOM 109   C CD   . LYS A 1 13  ? -30.448  51.344   6.462    1.00 0.00 ? 8   LYS A CD   1  
ATOM 110   C CE   . LYS A 1 13  ? -30.572  52.373   7.586    1.00 0.00 ? 8   LYS A CE   1  
ATOM 111   N NZ   . LYS A 1 13  ? -29.731  51.838   8.692    1.00 0.00 ? 8   LYS A NZ   1  
ATOM 112   H H    . LYS A 1 13  ? -31.512  48.169   2.958    1.00 0.00 ? 8   LYS A H    1  
ATOM 113   H HA   . LYS A 1 13  ? -31.229  50.976   3.990    1.00 0.00 ? 8   LYS A HA   1  
ATOM 114   H HB2  . LYS A 1 13  ? -32.499  48.903   5.179    1.00 0.00 ? 8   LYS A HB2  1  
ATOM 115   H HB3  . LYS A 1 13  ? -30.863  48.613   5.766    1.00 0.00 ? 8   LYS A HB3  1  
ATOM 116   H HG2  . LYS A 1 13  ? -32.558  51.087   6.142    1.00 0.00 ? 8   LYS A HG2  1  
ATOM 117   H HG3  . LYS A 1 13  ? -31.881  50.040   7.386    1.00 0.00 ? 8   LYS A HG3  1  
ATOM 118   H HD2  . LYS A 1 13  ? -29.587  50.716   6.640    1.00 0.00 ? 8   LYS A HD2  1  
ATOM 119   H HD3  . LYS A 1 13  ? -30.329  51.858   5.520    1.00 0.00 ? 8   LYS A HD3  1  
ATOM 120   H HE2  . LYS A 1 13  ? -30.200  53.334   7.256    1.00 0.00 ? 8   LYS A HE2  1  
ATOM 121   H HE3  . LYS A 1 13  ? -31.599  52.457   7.909    1.00 0.00 ? 8   LYS A HE3  1  
ATOM 122   H HZ1  . LYS A 1 13  ? -30.031  50.869   8.919    1.00 0.00 ? 8   LYS A HZ1  1  
ATOM 123   H HZ2  . LYS A 1 13  ? -29.839  52.441   9.533    1.00 0.00 ? 8   LYS A HZ2  1  
ATOM 124   H HZ3  . LYS A 1 13  ? -28.734  51.829   8.397    1.00 0.00 ? 8   LYS A HZ3  1  
ATOM 125   N N    . THR A 1 14  ? -28.708  50.815   4.018    1.00 0.00 ? 9   THR A N    1  
ATOM 126   C CA   . THR A 1 14  ? -27.221  50.684   3.981    1.00 0.00 ? 9   THR A CA   1  
ATOM 127   C C    . THR A 1 14  ? -26.630  50.931   5.372    1.00 0.00 ? 9   THR A C    1  
ATOM 128   O O    . THR A 1 14  ? -27.050  51.825   6.085    1.00 0.00 ? 9   THR A O    1  
ATOM 129   C CB   . THR A 1 14  ? -26.748  51.752   2.996    1.00 0.00 ? 9   THR A CB   1  
ATOM 130   O OG1  . THR A 1 14  ? -27.154  53.035   3.454    1.00 0.00 ? 9   THR A OG1  1  
ATOM 131   C CG2  . THR A 1 14  ? -27.358  51.476   1.621    1.00 0.00 ? 9   THR A CG2  1  
ATOM 132   H H    . THR A 1 14  ? -29.122  51.703   4.032    1.00 0.00 ? 9   THR A H    1  
ATOM 133   H HA   . THR A 1 14  ? -26.941  49.706   3.624    1.00 0.00 ? 9   THR A HA   1  
ATOM 134   H HB   . THR A 1 14  ? -25.672  51.721   2.920    1.00 0.00 ? 9   THR A HB   1  
ATOM 135   H HG1  . THR A 1 14  ? -28.081  53.151   3.235    1.00 0.00 ? 9   THR A HG1  1  
ATOM 136   H HG21 . THR A 1 14  ? -27.095  52.273   0.942    1.00 0.00 ? 9   THR A HG21 1  
ATOM 137   H HG22 . THR A 1 14  ? -28.432  51.417   1.709    1.00 0.00 ? 9   THR A HG22 1  
ATOM 138   H HG23 . THR A 1 14  ? -26.977  50.539   1.241    1.00 0.00 ? 9   THR A HG23 1  
ATOM 139   N N    . LEU A 1 15  ? -25.656  50.138   5.754    1.00 0.00 ? 10  LEU A N    1  
ATOM 140   C CA   . LEU A 1 15  ? -25.013  50.295   7.099    1.00 0.00 ? 10  LEU A CA   1  
ATOM 141   C C    . LEU A 1 15  ? -24.706  51.767   7.394    1.00 0.00 ? 10  LEU A C    1  
ATOM 142   O O    . LEU A 1 15  ? -24.670  52.186   8.535    1.00 0.00 ? 10  LEU A O    1  
ATOM 143   C CB   . LEU A 1 15  ? -23.717  49.489   7.011    1.00 0.00 ? 10  LEU A CB   1  
ATOM 144   C CG   . LEU A 1 15  ? -23.233  49.143   8.421    1.00 0.00 ? 10  LEU A CG   1  
ATOM 145   C CD1  . LEU A 1 15  ? -22.604  47.749   8.417    1.00 0.00 ? 10  LEU A CD1  1  
ATOM 146   C CD2  . LEU A 1 15  ? -22.191  50.171   8.867    1.00 0.00 ? 10  LEU A CD2  1  
ATOM 147   H H    . LEU A 1 15  ? -25.347  49.430   5.151    1.00 0.00 ? 10  LEU A H    1  
ATOM 148   H HA   . LEU A 1 15  ? -25.648  49.884   7.868    1.00 0.00 ? 10  LEU A HA   1  
ATOM 149   H HB2  . LEU A 1 15  ? -23.897  48.579   6.458    1.00 0.00 ? 10  LEU A HB2  1  
ATOM 150   H HB3  . LEU A 1 15  ? -22.963  50.074   6.507    1.00 0.00 ? 10  LEU A HB3  1  
ATOM 151   H HG   . LEU A 1 15  ? -24.072  49.158   9.102    1.00 0.00 ? 10  LEU A HG   1  
ATOM 152   H HD11 . LEU A 1 15  ? -22.004  47.622   9.306    1.00 0.00 ? 10  LEU A HD11 1  
ATOM 153   H HD12 . LEU A 1 15  ? -21.980  47.638   7.542    1.00 0.00 ? 10  LEU A HD12 1  
ATOM 154   H HD13 . LEU A 1 15  ? -23.384  47.002   8.399    1.00 0.00 ? 10  LEU A HD13 1  
ATOM 155   H HD21 . LEU A 1 15  ? -21.218  49.880   8.500    1.00 0.00 ? 10  LEU A HD21 1  
ATOM 156   H HD22 . LEU A 1 15  ? -22.169  50.216   9.946    1.00 0.00 ? 10  LEU A HD22 1  
ATOM 157   H HD23 . LEU A 1 15  ? -22.450  51.142   8.471    1.00 0.00 ? 10  LEU A HD23 1  
ATOM 158   N N    . GLN A 1 16  ? -24.499  52.555   6.375    1.00 0.00 ? 11  GLN A N    1  
ATOM 159   C CA   . GLN A 1 16  ? -24.209  54.005   6.592    1.00 0.00 ? 11  GLN A CA   1  
ATOM 160   C C    . GLN A 1 16  ? -25.433  54.710   7.195    1.00 0.00 ? 11  GLN A C    1  
ATOM 161   O O    . GLN A 1 16  ? -25.389  55.889   7.490    1.00 0.00 ? 11  GLN A O    1  
ATOM 162   C CB   . GLN A 1 16  ? -23.899  54.566   5.200    1.00 0.00 ? 11  GLN A CB   1  
ATOM 163   C CG   . GLN A 1 16  ? -22.502  55.191   5.198    1.00 0.00 ? 11  GLN A CG   1  
ATOM 164   C CD   . GLN A 1 16  ? -21.447  54.086   5.290    1.00 0.00 ? 11  GLN A CD   1  
ATOM 165   O OE1  . GLN A 1 16  ? -20.560  54.145   6.118    1.00 0.00 ? 11  GLN A OE1  1  
ATOM 166   N NE2  . GLN A 1 16  ? -21.507  53.074   4.469    1.00 0.00 ? 11  GLN A NE2  1  
ATOM 167   H H    . GLN A 1 16  ? -24.542  52.197   5.464    1.00 0.00 ? 11  GLN A H    1  
ATOM 168   H HA   . GLN A 1 16  ? -23.352  54.123   7.236    1.00 0.00 ? 11  GLN A HA   1  
ATOM 169   H HB2  . GLN A 1 16  ? -23.938  53.769   4.472    1.00 0.00 ? 11  GLN A HB2  1  
ATOM 170   H HB3  . GLN A 1 16  ? -24.628  55.321   4.945    1.00 0.00 ? 11  GLN A HB3  1  
ATOM 171   H HG2  . GLN A 1 16  ? -22.360  55.750   4.285    1.00 0.00 ? 11  GLN A HG2  1  
ATOM 172   H HG3  . GLN A 1 16  ? -22.402  55.852   6.045    1.00 0.00 ? 11  GLN A HG3  1  
ATOM 173   H HE21 . GLN A 1 16  ? -22.223  53.026   3.801    1.00 0.00 ? 11  GLN A HE21 1  
ATOM 174   H HE22 . GLN A 1 16  ? -20.836  52.361   4.520    1.00 0.00 ? 11  GLN A HE22 1  
ATOM 175   N N    . GLN A 1 17  ? -26.530  54.000   7.357    1.00 0.00 ? 12  GLN A N    1  
ATOM 176   C CA   . GLN A 1 17  ? -27.781  54.607   7.917    1.00 0.00 ? 12  GLN A CA   1  
ATOM 177   C C    . GLN A 1 17  ? -28.512  55.363   6.812    1.00 0.00 ? 12  GLN A C    1  
ATOM 178   O O    . GLN A 1 17  ? -29.224  56.317   7.058    1.00 0.00 ? 12  GLN A O    1  
ATOM 179   C CB   . GLN A 1 17  ? -27.351  55.554   9.045    1.00 0.00 ? 12  GLN A CB   1  
ATOM 180   C CG   . GLN A 1 17  ? -28.385  55.508   10.172   1.00 0.00 ? 12  GLN A CG   1  
ATOM 181   C CD   . GLN A 1 17  ? -27.947  54.490   11.226   1.00 0.00 ? 12  GLN A CD   1  
ATOM 182   O OE1  . GLN A 1 17  ? -28.001  54.762   12.409   1.00 0.00 ? 12  GLN A OE1  1  
ATOM 183   N NE2  . GLN A 1 17  ? -27.512  53.319   10.846   1.00 0.00 ? 12  GLN A NE2  1  
ATOM 184   H H    . GLN A 1 17  ? -26.539  53.061   7.090    1.00 0.00 ? 12  GLN A H    1  
ATOM 185   H HA   . GLN A 1 17  ? -28.420  53.831   8.313    1.00 0.00 ? 12  GLN A HA   1  
ATOM 186   H HB2  . GLN A 1 17  ? -26.388  55.246   9.426    1.00 0.00 ? 12  GLN A HB2  1  
ATOM 187   H HB3  . GLN A 1 17  ? -27.282  56.561   8.663    1.00 0.00 ? 12  GLN A HB3  1  
ATOM 188   H HG2  . GLN A 1 17  ? -28.466  56.485   10.625   1.00 0.00 ? 12  GLN A HG2  1  
ATOM 189   H HG3  . GLN A 1 17  ? -29.344  55.217   9.770    1.00 0.00 ? 12  GLN A HG3  1  
ATOM 190   H HE21 . GLN A 1 17  ? -27.468  53.099   9.892    1.00 0.00 ? 12  GLN A HE21 1  
ATOM 191   H HE22 . GLN A 1 17  ? -27.230  52.660   11.514   1.00 0.00 ? 12  GLN A HE22 1  
ATOM 192   N N    . GLN A 1 18  ? -28.348  54.926   5.593    1.00 0.00 ? 13  GLN A N    1  
ATOM 193   C CA   . GLN A 1 18  ? -29.038  55.594   4.453    1.00 0.00 ? 13  GLN A CA   1  
ATOM 194   C C    . GLN A 1 18  ? -29.986  54.595   3.794    1.00 0.00 ? 13  GLN A C    1  
ATOM 195   O O    . GLN A 1 18  ? -29.564  53.724   3.057    1.00 0.00 ? 13  GLN A O    1  
ATOM 196   C CB   . GLN A 1 18  ? -27.921  55.996   3.488    1.00 0.00 ? 13  GLN A CB   1  
ATOM 197   C CG   . GLN A 1 18  ? -27.726  57.513   3.531    1.00 0.00 ? 13  GLN A CG   1  
ATOM 198   C CD   . GLN A 1 18  ? -27.071  57.907   4.856    1.00 0.00 ? 13  GLN A CD   1  
ATOM 199   O OE1  . GLN A 1 18  ? -25.904  57.645   5.072    1.00 0.00 ? 13  GLN A OE1  1  
ATOM 200   N NE2  . GLN A 1 18  ? -27.778  58.529   5.760    1.00 0.00 ? 13  GLN A NE2  1  
ATOM 201   H H    . GLN A 1 18  ? -27.776  54.146   5.428    1.00 0.00 ? 13  GLN A H    1  
ATOM 202   H HA   . GLN A 1 18  ? -29.576  56.466   4.791    1.00 0.00 ? 13  GLN A HA   1  
ATOM 203   H HB2  . GLN A 1 18  ? -27.002  55.507   3.776    1.00 0.00 ? 13  GLN A HB2  1  
ATOM 204   H HB3  . GLN A 1 18  ? -28.187  55.699   2.484    1.00 0.00 ? 13  GLN A HB3  1  
ATOM 205   H HG2  . GLN A 1 18  ? -27.093  57.818   2.710    1.00 0.00 ? 13  GLN A HG2  1  
ATOM 206   H HG3  . GLN A 1 18  ? -28.685  58.002   3.447    1.00 0.00 ? 13  GLN A HG3  1  
ATOM 207   H HE21 . GLN A 1 18  ? -28.719  58.740   5.586    1.00 0.00 ? 13  GLN A HE21 1  
ATOM 208   H HE22 . GLN A 1 18  ? -27.367  58.785   6.612    1.00 0.00 ? 13  GLN A HE22 1  
ATOM 209   N N    . THR A 1 19  ? -31.258  54.692   4.067    1.00 0.00 ? 14  THR A N    1  
ATOM 210   C CA   . THR A 1 19  ? -32.212  53.722   3.467    1.00 0.00 ? 14  THR A CA   1  
ATOM 211   C C    . THR A 1 19  ? -33.000  54.342   2.322    1.00 0.00 ? 14  THR A C    1  
ATOM 212   O O    . THR A 1 19  ? -33.226  55.535   2.265    1.00 0.00 ? 14  THR A O    1  
ATOM 213   C CB   . THR A 1 19  ? -33.168  53.340   4.591    1.00 0.00 ? 14  THR A CB   1  
ATOM 214   O OG1  . THR A 1 19  ? -32.441  53.166   5.797    1.00 0.00 ? 14  THR A OG1  1  
ATOM 215   C CG2  . THR A 1 19  ? -33.881  52.040   4.216    1.00 0.00 ? 14  THR A CG2  1  
ATOM 216   H H    . THR A 1 19  ? -31.581  55.386   4.675    1.00 0.00 ? 14  THR A H    1  
ATOM 217   H HA   . THR A 1 19  ? -31.688  52.844   3.126    1.00 0.00 ? 14  THR A HA   1  
ATOM 218   H HB   . THR A 1 19  ? -33.902  54.119   4.720    1.00 0.00 ? 14  THR A HB   1  
ATOM 219   H HG1  . THR A 1 19  ? -32.421  54.009   6.256    1.00 0.00 ? 14  THR A HG1  1  
ATOM 220   H HG21 . THR A 1 19  ? -33.185  51.217   4.282    1.00 0.00 ? 14  THR A HG21 1  
ATOM 221   H HG22 . THR A 1 19  ? -34.255  52.115   3.201    1.00 0.00 ? 14  THR A HG22 1  
ATOM 222   H HG23 . THR A 1 19  ? -34.704  51.873   4.892    1.00 0.00 ? 14  THR A HG23 1  
ATOM 223   N N    . PHE A 1 20  ? -33.438  53.513   1.426    1.00 0.00 ? 15  PHE A N    1  
ATOM 224   C CA   . PHE A 1 20  ? -34.244  53.986   0.274    1.00 0.00 ? 15  PHE A CA   1  
ATOM 225   C C    . PHE A 1 20  ? -35.228  52.869   -0.110   1.00 0.00 ? 15  PHE A C    1  
ATOM 226   O O    . PHE A 1 20  ? -35.711  52.155   0.749    1.00 0.00 ? 15  PHE A O    1  
ATOM 227   C CB   . PHE A 1 20  ? -33.241  54.325   -0.852   1.00 0.00 ? 15  PHE A CB   1  
ATOM 228   C CG   . PHE A 1 20  ? -32.008  53.446   -0.787   1.00 0.00 ? 15  PHE A CG   1  
ATOM 229   C CD1  . PHE A 1 20  ? -31.005  53.702   0.161    1.00 0.00 ? 15  PHE A CD1  1  
ATOM 230   C CD2  . PHE A 1 20  ? -31.860  52.387   -1.688   1.00 0.00 ? 15  PHE A CD2  1  
ATOM 231   C CE1  . PHE A 1 20  ? -29.863  52.898   0.206    1.00 0.00 ? 15  PHE A CE1  1  
ATOM 232   C CE2  . PHE A 1 20  ? -30.716  51.582   -1.641   1.00 0.00 ? 15  PHE A CE2  1  
ATOM 233   C CZ   . PHE A 1 20  ? -29.718  51.837   -0.694   1.00 0.00 ? 15  PHE A CZ   1  
ATOM 234   H H    . PHE A 1 20  ? -33.248  52.557   1.523    1.00 0.00 ? 15  PHE A H    1  
ATOM 235   H HA   . PHE A 1 20  ? -34.792  54.873   0.555    1.00 0.00 ? 15  PHE A HA   1  
ATOM 236   H HB2  . PHE A 1 20  ? -33.715  54.194   -1.809   1.00 0.00 ? 15  PHE A HB2  1  
ATOM 237   H HB3  . PHE A 1 20  ? -32.940  55.357   -0.751   1.00 0.00 ? 15  PHE A HB3  1  
ATOM 238   H HD1  . PHE A 1 20  ? -31.114  54.518   0.859    1.00 0.00 ? 15  PHE A HD1  1  
ATOM 239   H HD2  . PHE A 1 20  ? -32.630  52.189   -2.419   1.00 0.00 ? 15  PHE A HD2  1  
ATOM 240   H HE1  . PHE A 1 20  ? -29.093  53.097   0.935    1.00 0.00 ? 15  PHE A HE1  1  
ATOM 241   H HE2  . PHE A 1 20  ? -30.605  50.764   -2.336   1.00 0.00 ? 15  PHE A HE2  1  
ATOM 242   H HZ   . PHE A 1 20  ? -28.835  51.215   -0.658   1.00 0.00 ? 15  PHE A HZ   1  
ATOM 243   N N    . LYS A 1 21  ? -35.542  52.698   -1.364   1.00 0.00 ? 16  LYS A N    1  
ATOM 244   C CA   . LYS A 1 21  ? -36.504  51.625   -1.737   1.00 0.00 ? 16  LYS A CA   1  
ATOM 245   C C    . LYS A 1 21  ? -36.348  51.247   -3.208   1.00 0.00 ? 16  LYS A C    1  
ATOM 246   O O    . LYS A 1 21  ? -36.221  52.091   -4.073   1.00 0.00 ? 16  LYS A O    1  
ATOM 247   C CB   . LYS A 1 21  ? -37.887  52.229   -1.482   1.00 0.00 ? 16  LYS A CB   1  
ATOM 248   C CG   . LYS A 1 21  ? -38.463  51.669   -0.177   1.00 0.00 ? 16  LYS A CG   1  
ATOM 249   C CD   . LYS A 1 21  ? -39.009  52.815   0.676    1.00 0.00 ? 16  LYS A CD   1  
ATOM 250   C CE   . LYS A 1 21  ? -40.466  53.087   0.295    1.00 0.00 ? 16  LYS A CE   1  
ATOM 251   N NZ   . LYS A 1 21  ? -41.158  53.352   1.587    1.00 0.00 ? 16  LYS A NZ   1  
ATOM 252   H H    . LYS A 1 21  ? -35.158  53.264   -2.051   1.00 0.00 ? 16  LYS A H    1  
ATOM 253   H HA   . LYS A 1 21  ? -36.361  50.760   -1.110   1.00 0.00 ? 16  LYS A HA   1  
ATOM 254   H HB2  . LYS A 1 21  ? -37.801  53.304   -1.408   1.00 0.00 ? 16  LYS A HB2  1  
ATOM 255   H HB3  . LYS A 1 21  ? -38.545  51.977   -2.300   1.00 0.00 ? 16  LYS A HB3  1  
ATOM 256   H HG2  . LYS A 1 21  ? -39.260  50.977   -0.405   1.00 0.00 ? 16  LYS A HG2  1  
ATOM 257   H HG3  . LYS A 1 21  ? -37.686  51.155   0.369    1.00 0.00 ? 16  LYS A HG3  1  
ATOM 258   H HD2  . LYS A 1 21  ? -38.954  52.543   1.721    1.00 0.00 ? 16  LYS A HD2  1  
ATOM 259   H HD3  . LYS A 1 21  ? -38.422  53.705   0.504    1.00 0.00 ? 16  LYS A HD3  1  
ATOM 260   H HE2  . LYS A 1 21  ? -40.529  53.951   -0.353   1.00 0.00 ? 16  LYS A HE2  1  
ATOM 261   H HE3  . LYS A 1 21  ? -40.898  52.223   -0.185   1.00 0.00 ? 16  LYS A HE3  1  
ATOM 262   H HZ1  . LYS A 1 21  ? -42.117  53.706   1.401    1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 263   H HZ2  . LYS A 1 21  ? -40.623  54.064   2.126    1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 264   H HZ3  . LYS A 1 21  ? -41.216  52.472   2.136    1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 265   N N    . ILE A 1 22  ? -36.367  49.978   -3.488   1.00 0.00 ? 17  ILE A N    1  
ATOM 266   C CA   . ILE A 1 22  ? -36.233  49.506   -4.894   1.00 0.00 ? 17  ILE A CA   1  
ATOM 267   C C    . ILE A 1 22  ? -37.511  48.752   -5.263   1.00 0.00 ? 17  ILE A C    1  
ATOM 268   O O    . ILE A 1 22  ? -38.525  48.919   -4.616   1.00 0.00 ? 17  ILE A O    1  
ATOM 269   C CB   . ILE A 1 22  ? -35.003  48.589   -4.886   1.00 0.00 ? 17  ILE A CB   1  
ATOM 270   C CG1  . ILE A 1 22  ? -33.942  49.185   -3.944   1.00 0.00 ? 17  ILE A CG1  1  
ATOM 271   C CG2  . ILE A 1 22  ? -34.430  48.486   -6.304   1.00 0.00 ? 17  ILE A CG2  1  
ATOM 272   C CD1  . ILE A 1 22  ? -32.653  48.369   -4.008   1.00 0.00 ? 17  ILE A CD1  1  
ATOM 273   H H    . ILE A 1 22  ? -36.478  49.325   -2.766   1.00 0.00 ? 17  ILE A H    1  
ATOM 274   H HA   . ILE A 1 22  ? -36.076  50.337   -5.562   1.00 0.00 ? 17  ILE A HA   1  
ATOM 275   H HB   . ILE A 1 22  ? -35.286  47.606   -4.538   1.00 0.00 ? 17  ILE A HB   1  
ATOM 276   H HG12 . ILE A 1 22  ? -33.734  50.203   -4.239   1.00 0.00 ? 17  ILE A HG12 1  
ATOM 277   H HG13 . ILE A 1 22  ? -34.317  49.176   -2.931   1.00 0.00 ? 17  ILE A HG13 1  
ATOM 278   H HG21 . ILE A 1 22  ? -35.103  48.963   -7.002   1.00 0.00 ? 17  ILE A HG21 1  
ATOM 279   H HG22 . ILE A 1 22  ? -34.315  47.446   -6.570   1.00 0.00 ? 17  ILE A HG22 1  
ATOM 280   H HG23 . ILE A 1 22  ? -33.467  48.976   -6.342   1.00 0.00 ? 17  ILE A HG23 1  
ATOM 281   H HD11 . ILE A 1 22  ? -32.374  48.064   -3.008   1.00 0.00 ? 17  ILE A HD11 1  
ATOM 282   H HD12 . ILE A 1 22  ? -31.866  48.977   -4.433   1.00 0.00 ? 17  ILE A HD12 1  
ATOM 283   H HD13 . ILE A 1 22  ? -32.808  47.495   -4.625   1.00 0.00 ? 17  ILE A HD13 1  
ATOM 284   N N    . ARG A 1 23  ? -37.499  47.935   -6.280   1.00 0.00 ? 18  ARG A N    1  
ATOM 285   C CA   . ARG A 1 23  ? -38.752  47.206   -6.631   1.00 0.00 ? 18  ARG A CA   1  
ATOM 286   C C    . ARG A 1 23  ? -38.462  45.999   -7.518   1.00 0.00 ? 18  ARG A C    1  
ATOM 287   O O    . ARG A 1 23  ? -38.800  44.885   -7.174   1.00 0.00 ? 18  ARG A O    1  
ATOM 288   C CB   . ARG A 1 23  ? -39.612  48.227   -7.376   1.00 0.00 ? 18  ARG A CB   1  
ATOM 289   C CG   . ARG A 1 23  ? -41.044  48.173   -6.835   1.00 0.00 ? 18  ARG A CG   1  
ATOM 290   C CD   . ARG A 1 23  ? -42.035  48.077   -7.999   1.00 0.00 ? 18  ARG A CD   1  
ATOM 291   N NE   . ARG A 1 23  ? -42.592  49.451   -8.148   1.00 0.00 ? 18  ARG A NE   1  
ATOM 292   C CZ   . ARG A 1 23  ? -43.407  49.722   -9.131   1.00 0.00 ? 18  ARG A CZ   1  
ATOM 293   N NH1  . ARG A 1 23  ? -44.519  49.051   -9.261   1.00 0.00 ? 18  ARG A NH1  1  
ATOM 294   N NH2  . ARG A 1 23  ? -43.110  50.664   -9.984   1.00 0.00 ? 18  ARG A NH2  1  
ATOM 295   H H    . ARG A 1 23  ? -36.684  47.802   -6.804   1.00 0.00 ? 18  ARG A H    1  
ATOM 296   H HA   . ARG A 1 23  ? -39.259  46.892   -5.734   1.00 0.00 ? 18  ARG A HA   1  
ATOM 297   H HB2  . ARG A 1 23  ? -39.207  49.218   -7.226   1.00 0.00 ? 18  ARG A HB2  1  
ATOM 298   H HB3  . ARG A 1 23  ? -39.617  47.995   -8.431   1.00 0.00 ? 18  ARG A HB3  1  
ATOM 299   H HG2  . ARG A 1 23  ? -41.152  47.307   -6.197   1.00 0.00 ? 18  ARG A HG2  1  
ATOM 300   H HG3  . ARG A 1 23  ? -41.246  49.066   -6.265   1.00 0.00 ? 18  ARG A HG3  1  
ATOM 301   H HD2  . ARG A 1 23  ? -41.524  47.775   -8.903   1.00 0.00 ? 18  ARG A HD2  1  
ATOM 302   H HD3  . ARG A 1 23  ? -42.825  47.382   -7.763   1.00 0.00 ? 18  ARG A HD3  1  
ATOM 303   H HE   . ARG A 1 23  ? -42.348  50.152   -7.508   1.00 0.00 ? 18  ARG A HE   1  
ATOM 304   H HH11 . ARG A 1 23  ? -44.747  48.330   -8.607   1.00 0.00 ? 18  ARG A HH11 1  
ATOM 305   H HH12 . ARG A 1 23  ? -45.143  49.259   -10.014  1.00 0.00 ? 18  ARG A HH12 1  
ATOM 306   H HH21 . ARG A 1 23  ? -42.258  51.179   -9.884   1.00 0.00 ? 18  ARG A HH21 1  
ATOM 307   H HH22 . ARG A 1 23  ? -43.734  50.872   -10.737  1.00 0.00 ? 18  ARG A HH22 1  
ATOM 308   N N    . MET A 1 24  ? -37.853  46.212   -8.658   1.00 0.00 ? 19  MET A N    1  
ATOM 309   C CA   . MET A 1 24  ? -37.546  45.077   -9.588   1.00 0.00 ? 19  MET A CA   1  
ATOM 310   C C    . MET A 1 24  ? -38.701  44.062   -9.598   1.00 0.00 ? 19  MET A C    1  
ATOM 311   O O    . MET A 1 24  ? -39.853  44.428   -9.467   1.00 0.00 ? 19  MET A O    1  
ATOM 312   C CB   . MET A 1 24  ? -36.233  44.464   -9.064   1.00 0.00 ? 19  MET A CB   1  
ATOM 313   C CG   . MET A 1 24  ? -36.471  43.628   -7.797   1.00 0.00 ? 19  MET A CG   1  
ATOM 314   S SD   . MET A 1 24  ? -35.958  44.571   -6.338   1.00 0.00 ? 19  MET A SD   1  
ATOM 315   C CE   . MET A 1 24  ? -34.215  44.747   -6.786   1.00 0.00 ? 19  MET A CE   1  
ATOM 316   H H    . MET A 1 24  ? -37.602  47.125   -8.910   1.00 0.00 ? 19  MET A H    1  
ATOM 317   H HA   . MET A 1 24  ? -37.391  45.458   -10.585  1.00 0.00 ? 19  MET A HA   1  
ATOM 318   H HB2  . MET A 1 24  ? -35.808  43.832   -9.829   1.00 0.00 ? 19  MET A HB2  1  
ATOM 319   H HB3  . MET A 1 24  ? -35.538  45.261   -8.838   1.00 0.00 ? 19  MET A HB3  1  
ATOM 320   H HG2  . MET A 1 24  ? -37.514  43.376   -7.712   1.00 0.00 ? 19  MET A HG2  1  
ATOM 321   H HG3  . MET A 1 24  ? -35.889  42.720   -7.855   1.00 0.00 ? 19  MET A HG3  1  
ATOM 322   H HE1  . MET A 1 24  ? -33.654  45.069   -5.921   1.00 0.00 ? 19  MET A HE1  1  
ATOM 323   H HE2  . MET A 1 24  ? -34.114  45.482   -7.569   1.00 0.00 ? 19  MET A HE2  1  
ATOM 324   H HE3  . MET A 1 24  ? -33.838  43.794   -7.135   1.00 0.00 ? 19  MET A HE3  1  
ATOM 325   N N    . GLU A 1 25  ? -38.410  42.798   -9.744   1.00 0.00 ? 20  GLU A N    1  
ATOM 326   C CA   . GLU A 1 25  ? -39.501  41.782   -9.750   1.00 0.00 ? 20  GLU A CA   1  
ATOM 327   C C    . GLU A 1 25  ? -39.390  40.889   -8.509   1.00 0.00 ? 20  GLU A C    1  
ATOM 328   O O    . GLU A 1 25  ? -38.323  40.747   -7.945   1.00 0.00 ? 20  GLU A O    1  
ATOM 329   C CB   . GLU A 1 25  ? -39.279  40.962   -11.020  1.00 0.00 ? 20  GLU A CB   1  
ATOM 330   C CG   . GLU A 1 25  ? -39.360  41.876   -12.245  1.00 0.00 ? 20  GLU A CG   1  
ATOM 331   C CD   . GLU A 1 25  ? -38.474  41.315   -13.359  1.00 0.00 ? 20  GLU A CD   1  
ATOM 332   O OE1  . GLU A 1 25  ? -38.514  40.115   -13.573  1.00 0.00 ? 20  GLU A OE1  1  
ATOM 333   O OE2  . GLU A 1 25  ? -37.771  42.096   -13.980  1.00 0.00 ? 20  GLU A OE2  1  
ATOM 334   H H    . GLU A 1 25  ? -37.478  42.517   -9.843   1.00 0.00 ? 20  GLU A H    1  
ATOM 335   H HA   . GLU A 1 25  ? -40.465  42.264   -9.784   1.00 0.00 ? 20  GLU A HA   1  
ATOM 336   H HB2  . GLU A 1 25  ? -38.306  40.496   -10.980  1.00 0.00 ? 20  GLU A HB2  1  
ATOM 337   H HB3  . GLU A 1 25  ? -40.041  40.202   -11.091  1.00 0.00 ? 20  GLU A HB3  1  
ATOM 338   H HG2  . GLU A 1 25  ? -40.383  41.928   -12.589  1.00 0.00 ? 20  GLU A HG2  1  
ATOM 339   H HG3  . GLU A 1 25  ? -39.018  42.866   -11.981  1.00 0.00 ? 20  GLU A HG3  1  
ATOM 340   N N    . PRO A 1 26  ? -40.499  40.310   -8.122   1.00 0.00 ? 21  PRO A N    1  
ATOM 341   C CA   . PRO A 1 26  ? -40.516  39.420   -6.936   1.00 0.00 ? 21  PRO A CA   1  
ATOM 342   C C    . PRO A 1 26  ? -39.964  38.031   -7.285   1.00 0.00 ? 21  PRO A C    1  
ATOM 343   O O    . PRO A 1 26  ? -40.486  37.024   -6.850   1.00 0.00 ? 21  PRO A O    1  
ATOM 344   C CB   . PRO A 1 26  ? -41.995  39.327   -6.581   1.00 0.00 ? 21  PRO A CB   1  
ATOM 345   C CG   . PRO A 1 26  ? -42.729  39.604   -7.857   1.00 0.00 ? 21  PRO A CG   1  
ATOM 346   C CD   . PRO A 1 26  ? -41.826  40.433   -8.738   1.00 0.00 ? 21  PRO A CD   1  
ATOM 347   H HA   . PRO A 1 26  ? -39.966  39.858   -6.119   1.00 0.00 ? 21  PRO A HA   1  
ATOM 348   H HB2  . PRO A 1 26  ? -42.229  38.336   -6.218   1.00 0.00 ? 21  PRO A HB2  1  
ATOM 349   H HB3  . PRO A 1 26  ? -42.250  40.068   -5.841   1.00 0.00 ? 21  PRO A HB3  1  
ATOM 350   H HG2  . PRO A 1 26  ? -42.971  38.672   -8.349   1.00 0.00 ? 21  PRO A HG2  1  
ATOM 351   H HG3  . PRO A 1 26  ? -43.633  40.154   -7.648   1.00 0.00 ? 21  PRO A HG3  1  
ATOM 352   H HD2  . PRO A 1 26  ? -41.816  40.037   -9.745   1.00 0.00 ? 21  PRO A HD2  1  
ATOM 353   H HD3  . PRO A 1 26  ? -42.141  41.464   -8.739   1.00 0.00 ? 21  PRO A HD3  1  
ATOM 354   N N    . ASP A 1 27  ? -38.914  37.968   -8.063   1.00 0.00 ? 22  ASP A N    1  
ATOM 355   C CA   . ASP A 1 27  ? -38.333  36.643   -8.436   1.00 0.00 ? 22  ASP A CA   1  
ATOM 356   C C    . ASP A 1 27  ? -37.042  36.836   -9.240   1.00 0.00 ? 22  ASP A C    1  
ATOM 357   O O    . ASP A 1 27  ? -36.676  36.008   -10.051  1.00 0.00 ? 22  ASP A O    1  
ATOM 358   C CB   . ASP A 1 27  ? -39.398  35.964   -9.300   1.00 0.00 ? 22  ASP A CB   1  
ATOM 359   C CG   . ASP A 1 27  ? -38.973  34.525   -9.597   1.00 0.00 ? 22  ASP A CG   1  
ATOM 360   O OD1  . ASP A 1 27  ? -39.046  33.709   -8.694   1.00 0.00 ? 22  ASP A OD1  1  
ATOM 361   O OD2  . ASP A 1 27  ? -38.582  34.265   -10.723  1.00 0.00 ? 22  ASP A OD2  1  
ATOM 362   H H    . ASP A 1 27  ? -38.506  38.789   -8.400   1.00 0.00 ? 22  ASP A H    1  
ATOM 363   H HA   . ASP A 1 27  ? -38.144  36.055   -7.553   1.00 0.00 ? 22  ASP A HA   1  
ATOM 364   H HB2  . ASP A 1 27  ? -40.341  35.960   -8.773   1.00 0.00 ? 22  ASP A HB2  1  
ATOM 365   H HB3  . ASP A 1 27  ? -39.507  36.504   -10.228  1.00 0.00 ? 22  ASP A HB3  1  
ATOM 366   N N    . GLU A 1 28  ? -36.354  37.924   -9.023   1.00 0.00 ? 23  GLU A N    1  
ATOM 367   C CA   . GLU A 1 28  ? -35.092  38.179   -9.770   1.00 0.00 ? 23  GLU A CA   1  
ATOM 368   C C    . GLU A 1 28  ? -33.886  37.764   -8.925   1.00 0.00 ? 23  GLU A C    1  
ATOM 369   O O    . GLU A 1 28  ? -33.817  38.048   -7.745   1.00 0.00 ? 23  GLU A O    1  
ATOM 370   C CB   . GLU A 1 28  ? -35.084  39.691   -10.011  1.00 0.00 ? 23  GLU A CB   1  
ATOM 371   C CG   . GLU A 1 28  ? -33.811  40.093   -10.760  1.00 0.00 ? 23  GLU A CG   1  
ATOM 372   C CD   . GLU A 1 28  ? -34.076  40.069   -12.266  1.00 0.00 ? 23  GLU A CD   1  
ATOM 373   O OE1  . GLU A 1 28  ? -34.446  39.019   -12.766  1.00 0.00 ? 23  GLU A OE1  1  
ATOM 374   O OE2  . GLU A 1 28  ? -33.907  41.100   -12.894  1.00 0.00 ? 23  GLU A OE2  1  
ATOM 375   H H    . GLU A 1 28  ? -36.667  38.576   -8.368   1.00 0.00 ? 23  GLU A H    1  
ATOM 376   H HA   . GLU A 1 28  ? -35.095  37.654   -10.712  1.00 0.00 ? 23  GLU A HA   1  
ATOM 377   H HB2  . GLU A 1 28  ? -35.948  39.966   -10.598  1.00 0.00 ? 23  GLU A HB2  1  
ATOM 378   H HB3  . GLU A 1 28  ? -35.117  40.207   -9.062   1.00 0.00 ? 23  GLU A HB3  1  
ATOM 379   H HG2  . GLU A 1 28  ? -33.518  41.090   -10.461  1.00 0.00 ? 23  GLU A HG2  1  
ATOM 380   H HG3  . GLU A 1 28  ? -33.018  39.400   -10.525  1.00 0.00 ? 23  GLU A HG3  1  
ATOM 381   N N    . THR A 1 29  ? -32.931  37.104   -9.525   1.00 0.00 ? 24  THR A N    1  
ATOM 382   C CA   . THR A 1 29  ? -31.715  36.676   -8.768   1.00 0.00 ? 24  THR A CA   1  
ATOM 383   C C    . THR A 1 29  ? -31.142  37.866   -7.994   1.00 0.00 ? 24  THR A C    1  
ATOM 384   O O    . THR A 1 29  ? -31.016  38.953   -8.525   1.00 0.00 ? 24  THR A O    1  
ATOM 385   C CB   . THR A 1 29  ? -30.722  36.209   -9.837   1.00 0.00 ? 24  THR A CB   1  
ATOM 386   O OG1  . THR A 1 29  ? -31.432  35.733   -10.974  1.00 0.00 ? 24  THR A OG1  1  
ATOM 387   C CG2  . THR A 1 29  ? -29.856  35.085   -9.272   1.00 0.00 ? 24  THR A CG2  1  
ATOM 388   H H    . THR A 1 29  ? -33.010  36.896   -10.478  1.00 0.00 ? 24  THR A H    1  
ATOM 389   H HA   . THR A 1 29  ? -31.945  35.863   -8.100   1.00 0.00 ? 24  THR A HA   1  
ATOM 390   H HB   . THR A 1 29  ? -30.089  37.033   -10.127  1.00 0.00 ? 24  THR A HB   1  
ATOM 391   H HG1  . THR A 1 29  ? -32.043  35.054   -10.679  1.00 0.00 ? 24  THR A HG1  1  
ATOM 392   H HG21 . THR A 1 29  ? -30.436  34.502   -8.572   1.00 0.00 ? 24  THR A HG21 1  
ATOM 393   H HG22 . THR A 1 29  ? -29.001  35.509   -8.766   1.00 0.00 ? 24  THR A HG22 1  
ATOM 394   H HG23 . THR A 1 29  ? -29.520  34.449   -10.078  1.00 0.00 ? 24  THR A HG23 1  
ATOM 395   N N    . VAL A 1 30  ? -30.791  37.680   -6.746   1.00 0.00 ? 25  VAL A N    1  
ATOM 396   C CA   . VAL A 1 30  ? -30.229  38.821   -5.964   1.00 0.00 ? 25  VAL A CA   1  
ATOM 397   C C    . VAL A 1 30  ? -29.006  39.397   -6.689   1.00 0.00 ? 25  VAL A C    1  
ATOM 398   O O    . VAL A 1 30  ? -28.588  40.506   -6.423   1.00 0.00 ? 25  VAL A O    1  
ATOM 399   C CB   . VAL A 1 30  ? -29.848  38.247   -4.595   1.00 0.00 ? 25  VAL A CB   1  
ATOM 400   C CG1  . VAL A 1 30  ? -29.048  39.289   -3.806   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 401   C CG2  . VAL A 1 30  ? -31.121  37.902   -3.817   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 402   H H    . VAL A 1 30  ? -30.896  36.800   -6.329   1.00 0.00 ? 25  VAL A H    1  
ATOM 403   H HA   . VAL A 1 30  ? -30.979  39.588   -5.841   1.00 0.00 ? 25  VAL A HA   1  
ATOM 404   H HB   . VAL A 1 30  ? -29.254  37.356   -4.730   1.00 0.00 ? 25  VAL A HB   1  
ATOM 405   H HG11 . VAL A 1 30  ? -28.036  39.329   -4.179   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 406   H HG12 . VAL A 1 30  ? -29.037  39.019   -2.760   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 407   H HG13 . VAL A 1 30  ? -29.511  40.258   -3.920   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 408   H HG21 . VAL A 1 30  ? -30.973  36.980   -3.274   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 409   H HG22 . VAL A 1 30  ? -31.945  37.784   -4.507   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 410   H HG23 . VAL A 1 30  ? -31.346  38.697   -3.122   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 411   N N    . LYS A 1 31  ? -28.444  38.668   -7.623   1.00 0.00 ? 26  LYS A N    1  
ATOM 412   C CA   . LYS A 1 31  ? -27.272  39.205   -8.378   1.00 0.00 ? 26  LYS A CA   1  
ATOM 413   C C    . LYS A 1 31  ? -27.650  40.566   -8.968   1.00 0.00 ? 26  LYS A C    1  
ATOM 414   O O    . LYS A 1 31  ? -26.884  41.514   -8.933   1.00 0.00 ? 26  LYS A O    1  
ATOM 415   C CB   . LYS A 1 31  ? -27.006  38.185   -9.487   1.00 0.00 ? 26  LYS A CB   1  
ATOM 416   C CG   . LYS A 1 31  ? -25.812  38.641   -10.329  1.00 0.00 ? 26  LYS A CG   1  
ATOM 417   C CD   . LYS A 1 31  ? -24.511  38.297   -9.600   1.00 0.00 ? 26  LYS A CD   1  
ATOM 418   C CE   . LYS A 1 31  ? -23.320  38.602   -10.510  1.00 0.00 ? 26  LYS A CE   1  
ATOM 419   N NZ   . LYS A 1 31  ? -22.939  40.005   -10.185  1.00 0.00 ? 26  LYS A NZ   1  
ATOM 420   H H    . LYS A 1 31  ? -28.802  37.782   -7.840   1.00 0.00 ? 26  LYS A H    1  
ATOM 421   H HA   . LYS A 1 31  ? -26.411  39.294   -7.734   1.00 0.00 ? 26  LYS A HA   1  
ATOM 422   H HB2  . LYS A 1 31  ? -26.789  37.223   -9.046   1.00 0.00 ? 26  LYS A HB2  1  
ATOM 423   H HB3  . LYS A 1 31  ? -27.878  38.103   -10.118  1.00 0.00 ? 26  LYS A HB3  1  
ATOM 424   H HG2  . LYS A 1 31  ? -25.833  38.138   -11.285  1.00 0.00 ? 26  LYS A HG2  1  
ATOM 425   H HG3  . LYS A 1 31  ? -25.865  39.708   -10.482  1.00 0.00 ? 26  LYS A HG3  1  
ATOM 426   H HD2  . LYS A 1 31  ? -24.438  38.888   -8.698   1.00 0.00 ? 26  LYS A HD2  1  
ATOM 427   H HD3  . LYS A 1 31  ? -24.507  37.248   -9.345   1.00 0.00 ? 26  LYS A HD3  1  
ATOM 428   H HE2  . LYS A 1 31  ? -22.502  37.928   -10.295  1.00 0.00 ? 26  LYS A HE2  1  
ATOM 429   H HE3  . LYS A 1 31  ? -23.608  38.528   -11.547  1.00 0.00 ? 26  LYS A HE3  1  
ATOM 430   H HZ1  . LYS A 1 31  ? -22.605  40.055   -9.202   1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 431   H HZ2  . LYS A 1 31  ? -23.767  40.624   -10.303  1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 432   H HZ3  . LYS A 1 31  ? -22.180  40.315   -10.823  1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 433   N N    . VAL A 1 32  ? -28.851  40.673   -9.477   1.00 0.00 ? 27  VAL A N    1  
ATOM 434   C CA   . VAL A 1 32  ? -29.310  41.974   -10.035  1.00 0.00 ? 27  VAL A CA   1  
ATOM 435   C C    . VAL A 1 32  ? -29.359  42.995   -8.900   1.00 0.00 ? 27  VAL A C    1  
ATOM 436   O O    . VAL A 1 32  ? -29.173  44.176   -9.104   1.00 0.00 ? 27  VAL A O    1  
ATOM 437   C CB   . VAL A 1 32  ? -30.711  41.705   -10.590  1.00 0.00 ? 27  VAL A CB   1  
ATOM 438   C CG1  . VAL A 1 32  ? -31.306  43.005   -11.137  1.00 0.00 ? 27  VAL A CG1  1  
ATOM 439   C CG2  . VAL A 1 32  ? -30.620  40.674   -11.717  1.00 0.00 ? 27  VAL A CG2  1  
ATOM 440   H H    . VAL A 1 32  ? -29.458  39.904   -9.465   1.00 0.00 ? 27  VAL A H    1  
ATOM 441   H HA   . VAL A 1 32  ? -28.651  42.306   -10.821  1.00 0.00 ? 27  VAL A HA   1  
ATOM 442   H HB   . VAL A 1 32  ? -31.343  41.324   -9.801   1.00 0.00 ? 27  VAL A HB   1  
ATOM 443   H HG11 . VAL A 1 32  ? -30.545  43.549   -11.677  1.00 0.00 ? 27  VAL A HG11 1  
ATOM 444   H HG12 . VAL A 1 32  ? -31.666  43.608   -10.317  1.00 0.00 ? 27  VAL A HG12 1  
ATOM 445   H HG13 . VAL A 1 32  ? -32.125  42.774   -11.801  1.00 0.00 ? 27  VAL A HG13 1  
ATOM 446   H HG21 . VAL A 1 32  ? -29.789  40.010   -11.532  1.00 0.00 ? 27  VAL A HG21 1  
ATOM 447   H HG22 . VAL A 1 32  ? -30.471  41.183   -12.659  1.00 0.00 ? 27  VAL A HG22 1  
ATOM 448   H HG23 . VAL A 1 32  ? -31.535  40.103   -11.758  1.00 0.00 ? 27  VAL A HG23 1  
ATOM 449   N N    . LEU A 1 33  ? -29.586  42.532   -7.695   1.00 0.00 ? 28  LEU A N    1  
ATOM 450   C CA   . LEU A 1 33  ? -29.623  43.456   -6.527   1.00 0.00 ? 28  LEU A CA   1  
ATOM 451   C C    . LEU A 1 33  ? -28.264  44.138   -6.390   1.00 0.00 ? 28  LEU A C    1  
ATOM 452   O O    . LEU A 1 33  ? -28.165  45.349   -6.373   1.00 0.00 ? 28  LEU A O    1  
ATOM 453   C CB   . LEU A 1 33  ? -29.890  42.561   -5.315   1.00 0.00 ? 28  LEU A CB   1  
ATOM 454   C CG   . LEU A 1 33  ? -30.681  43.333   -4.258   1.00 0.00 ? 28  LEU A CG   1  
ATOM 455   C CD1  . LEU A 1 33  ? -30.007  44.681   -3.982   1.00 0.00 ? 28  LEU A CD1  1  
ATOM 456   C CD2  . LEU A 1 33  ? -32.105  43.567   -4.764   1.00 0.00 ? 28  LEU A CD2  1  
ATOM 457   H H    . LEU A 1 33  ? -29.717  41.571   -7.560   1.00 0.00 ? 28  LEU A H    1  
ATOM 458   H HA   . LEU A 1 33  ? -30.410  44.184   -6.639   1.00 0.00 ? 28  LEU A HA   1  
ATOM 459   H HB2  . LEU A 1 33  ? -30.458  41.696   -5.627   1.00 0.00 ? 28  LEU A HB2  1  
ATOM 460   H HB3  . LEU A 1 33  ? -28.950  42.239   -4.893   1.00 0.00 ? 28  LEU A HB3  1  
ATOM 461   H HG   . LEU A 1 33  ? -30.713  42.756   -3.346   1.00 0.00 ? 28  LEU A HG   1  
ATOM 462   H HD11 . LEU A 1 33  ? -30.313  45.396   -4.731   1.00 0.00 ? 28  LEU A HD11 1  
ATOM 463   H HD12 . LEU A 1 33  ? -28.935  44.559   -4.017   1.00 0.00 ? 28  LEU A HD12 1  
ATOM 464   H HD13 . LEU A 1 33  ? -30.298  45.036   -3.004   1.00 0.00 ? 28  LEU A HD13 1  
ATOM 465   H HD21 . LEU A 1 33  ? -32.115  43.523   -5.844   1.00 0.00 ? 28  LEU A HD21 1  
ATOM 466   H HD22 . LEU A 1 33  ? -32.448  44.538   -4.439   1.00 0.00 ? 28  LEU A HD22 1  
ATOM 467   H HD23 . LEU A 1 33  ? -32.758  42.804   -4.367   1.00 0.00 ? 28  LEU A HD23 1  
ATOM 468   N N    . LYS A 1 34  ? -27.212  43.360   -6.310   1.00 0.00 ? 29  LYS A N    1  
ATOM 469   C CA   . LYS A 1 34  ? -25.843  43.948   -6.196   1.00 0.00 ? 29  LYS A CA   1  
ATOM 470   C C    . LYS A 1 34  ? -25.675  45.042   -7.250   1.00 0.00 ? 29  LYS A C    1  
ATOM 471   O O    . LYS A 1 34  ? -25.174  46.118   -6.977   1.00 0.00 ? 29  LYS A O    1  
ATOM 472   C CB   . LYS A 1 34  ? -24.885  42.788   -6.479   1.00 0.00 ? 29  LYS A CB   1  
ATOM 473   C CG   . LYS A 1 34  ? -24.588  42.031   -5.184   1.00 0.00 ? 29  LYS A CG   1  
ATOM 474   C CD   . LYS A 1 34  ? -23.592  40.905   -5.471   1.00 0.00 ? 29  LYS A CD   1  
ATOM 475   C CE   . LYS A 1 34  ? -22.681  40.705   -4.257   1.00 0.00 ? 29  LYS A CE   1  
ATOM 476   N NZ   . LYS A 1 34  ? -22.114  39.335   -4.417   1.00 0.00 ? 29  LYS A NZ   1  
ATOM 477   H H    . LYS A 1 34  ? -27.325  42.387   -6.338   1.00 0.00 ? 29  LYS A H    1  
ATOM 478   H HA   . LYS A 1 34  ? -25.676  44.340   -5.205   1.00 0.00 ? 29  LYS A HA   1  
ATOM 479   H HB2  . LYS A 1 34  ? -25.338  42.116   -7.193   1.00 0.00 ? 29  LYS A HB2  1  
ATOM 480   H HB3  . LYS A 1 34  ? -23.963  43.176   -6.886   1.00 0.00 ? 29  LYS A HB3  1  
ATOM 481   H HG2  . LYS A 1 34  ? -24.164  42.711   -4.460   1.00 0.00 ? 29  LYS A HG2  1  
ATOM 482   H HG3  . LYS A 1 34  ? -25.502  41.611   -4.793   1.00 0.00 ? 29  LYS A HG3  1  
ATOM 483   H HD2  . LYS A 1 34  ? -24.132  39.991   -5.673   1.00 0.00 ? 29  LYS A HD2  1  
ATOM 484   H HD3  . LYS A 1 34  ? -22.992  41.165   -6.330   1.00 0.00 ? 29  LYS A HD3  1  
ATOM 485   H HE2  . LYS A 1 34  ? -21.891  41.443   -4.257   1.00 0.00 ? 29  LYS A HE2  1  
ATOM 486   H HE3  . LYS A 1 34  ? -23.253  40.763   -3.344   1.00 0.00 ? 29  LYS A HE3  1  
ATOM 487   H HZ1  . LYS A 1 34  ? -21.264  39.241   -3.827   1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 488   H HZ2  . LYS A 1 34  ? -21.863  39.176   -5.415   1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 489   H HZ3  . LYS A 1 34  ? -22.819  38.632   -4.120   1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 490   N N    . GLU A 1 35  ? -26.117  44.776   -8.450   1.00 0.00 ? 30  GLU A N    1  
ATOM 491   C CA   . GLU A 1 35  ? -26.012  45.799   -9.525   1.00 0.00 ? 30  GLU A CA   1  
ATOM 492   C C    . GLU A 1 35  ? -27.073  46.880   -9.299   1.00 0.00 ? 30  GLU A C    1  
ATOM 493   O O    . GLU A 1 35  ? -26.880  48.034   -9.627   1.00 0.00 ? 30  GLU A O    1  
ATOM 494   C CB   . GLU A 1 35  ? -26.278  45.042   -10.828  1.00 0.00 ? 30  GLU A CB   1  
ATOM 495   C CG   . GLU A 1 35  ? -24.948  44.602   -11.445  1.00 0.00 ? 30  GLU A CG   1  
ATOM 496   C CD   . GLU A 1 35  ? -25.101  43.205   -12.051  1.00 0.00 ? 30  GLU A CD   1  
ATOM 497   O OE1  . GLU A 1 35  ? -25.462  42.299   -11.318  1.00 0.00 ? 30  GLU A OE1  1  
ATOM 498   O OE2  . GLU A 1 35  ? -24.853  43.066   -13.237  1.00 0.00 ? 30  GLU A OE2  1  
ATOM 499   H H    . GLU A 1 35  ? -26.533  43.908   -8.637   1.00 0.00 ? 30  GLU A H    1  
ATOM 500   H HA   . GLU A 1 35  ? -25.023  46.232   -9.540   1.00 0.00 ? 30  GLU A HA   1  
ATOM 501   H HB2  . GLU A 1 35  ? -26.885  44.173   -10.620  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 502   H HB3  . GLU A 1 35  ? -26.798  45.687   -11.520  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 503   H HG2  . GLU A 1 35  ? -24.662  45.301   -12.218  1.00 0.00 ? 30  GLU A HG2  1  
ATOM 504   H HG3  . GLU A 1 35  ? -24.185  44.579   -10.681  1.00 0.00 ? 30  GLU A HG3  1  
ATOM 505   N N    . LYS A 1 36  ? -28.190  46.509   -8.725   1.00 0.00 ? 31  LYS A N    1  
ATOM 506   C CA   . LYS A 1 36  ? -29.266  47.508   -8.457   1.00 0.00 ? 31  LYS A CA   1  
ATOM 507   C C    . LYS A 1 36  ? -28.781  48.501   -7.402   1.00 0.00 ? 31  LYS A C    1  
ATOM 508   O O    . LYS A 1 36  ? -29.106  49.671   -7.438   1.00 0.00 ? 31  LYS A O    1  
ATOM 509   C CB   . LYS A 1 36  ? -30.449  46.696   -7.927   1.00 0.00 ? 31  LYS A CB   1  
ATOM 510   C CG   . LYS A 1 36  ? -31.729  47.530   -8.033   1.00 0.00 ? 31  LYS A CG   1  
ATOM 511   C CD   . LYS A 1 36  ? -32.102  47.713   -9.508   1.00 0.00 ? 31  LYS A CD   1  
ATOM 512   C CE   . LYS A 1 36  ? -33.325  46.853   -9.839   1.00 0.00 ? 31  LYS A CE   1  
ATOM 513   N NZ   . LYS A 1 36  ? -33.701  47.240   -11.228  1.00 0.00 ? 31  LYS A NZ   1  
ATOM 514   H H    . LYS A 1 36  ? -28.314  45.575   -8.460   1.00 0.00 ? 31  LYS A H    1  
ATOM 515   H HA   . LYS A 1 36  ? -29.545  48.021   -9.362   1.00 0.00 ? 31  LYS A HA   1  
ATOM 516   H HB2  . LYS A 1 36  ? -30.557  45.794   -8.511   1.00 0.00 ? 31  LYS A HB2  1  
ATOM 517   H HB3  . LYS A 1 36  ? -30.275  46.438   -6.893   1.00 0.00 ? 31  LYS A HB3  1  
ATOM 518   H HG2  . LYS A 1 36  ? -32.531  47.023   -7.516   1.00 0.00 ? 31  LYS A HG2  1  
ATOM 519   H HG3  . LYS A 1 36  ? -31.565  48.498   -7.583   1.00 0.00 ? 31  LYS A HG3  1  
ATOM 520   H HD2  . LYS A 1 36  ? -32.332  48.752   -9.693   1.00 0.00 ? 31  LYS A HD2  1  
ATOM 521   H HD3  . LYS A 1 36  ? -31.274  47.411   -10.131  1.00 0.00 ? 31  LYS A HD3  1  
ATOM 522   H HE2  . LYS A 1 36  ? -33.068  45.803   -9.795   1.00 0.00 ? 31  LYS A HE2  1  
ATOM 523   H HE3  . LYS A 1 36  ? -34.135  47.073   -9.162   1.00 0.00 ? 31  LYS A HE3  1  
ATOM 524   H HZ1  . LYS A 1 36  ? -32.976  46.902   -11.891  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM 525   H HZ2  . LYS A 1 36  ? -33.774  48.276   -11.291  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM 526   H HZ3  . LYS A 1 36  ? -34.617  46.811   -11.471  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM 527   N N    . ILE A 1 37  ? -27.994  48.038   -6.468   1.00 0.00 ? 32  ILE A N    1  
ATOM 528   C CA   . ILE A 1 37  ? -27.469  48.947   -5.411   1.00 0.00 ? 32  ILE A CA   1  
ATOM 529   C C    . ILE A 1 37  ? -26.446  49.906   -6.025   1.00 0.00 ? 32  ILE A C    1  
ATOM 530   O O    . ILE A 1 37  ? -26.394  51.073   -5.688   1.00 0.00 ? 32  ILE A O    1  
ATOM 531   C CB   . ILE A 1 37  ? -26.804  48.024   -4.388   1.00 0.00 ? 32  ILE A CB   1  
ATOM 532   C CG1  . ILE A 1 37  ? -27.854  47.080   -3.797   1.00 0.00 ? 32  ILE A CG1  1  
ATOM 533   C CG2  . ILE A 1 37  ? -26.183  48.858   -3.266   1.00 0.00 ? 32  ILE A CG2  1  
ATOM 534   C CD1  . ILE A 1 37  ? -27.155  45.964   -3.020   1.00 0.00 ? 32  ILE A CD1  1  
ATOM 535   H H    . ILE A 1 37  ? -27.742  47.091   -6.469   1.00 0.00 ? 32  ILE A H    1  
ATOM 536   H HA   . ILE A 1 37  ? -28.275  49.496   -4.949   1.00 0.00 ? 32  ILE A HA   1  
ATOM 537   H HB   . ILE A 1 37  ? -26.032  47.446   -4.875   1.00 0.00 ? 32  ILE A HB   1  
ATOM 538   H HG12 . ILE A 1 37  ? -28.500  47.634   -3.131   1.00 0.00 ? 32  ILE A HG12 1  
ATOM 539   H HG13 . ILE A 1 37  ? -28.441  46.649   -4.593   1.00 0.00 ? 32  ILE A HG13 1  
ATOM 540   H HG21 . ILE A 1 37  ? -26.616  49.848   -3.270   1.00 0.00 ? 32  ILE A HG21 1  
ATOM 541   H HG22 . ILE A 1 37  ? -25.117  48.932   -3.422   1.00 0.00 ? 32  ILE A HG22 1  
ATOM 542   H HG23 . ILE A 1 37  ? -26.375  48.385   -2.315   1.00 0.00 ? 32  ILE A HG23 1  
ATOM 543   H HD11 . ILE A 1 37  ? -26.233  46.339   -2.600   1.00 0.00 ? 32  ILE A HD11 1  
ATOM 544   H HD12 . ILE A 1 37  ? -26.938  45.142   -3.687   1.00 0.00 ? 32  ILE A HD12 1  
ATOM 545   H HD13 . ILE A 1 37  ? -27.800  45.621   -2.225   1.00 0.00 ? 32  ILE A HD13 1  
ATOM 546   N N    . GLU A 1 38  ? -25.639  49.422   -6.933   1.00 0.00 ? 33  GLU A N    1  
ATOM 547   C CA   . GLU A 1 38  ? -24.625  50.307   -7.579   1.00 0.00 ? 33  GLU A CA   1  
ATOM 548   C C    . GLU A 1 38  ? -25.330  51.440   -8.329   1.00 0.00 ? 33  GLU A C    1  
ATOM 549   O O    . GLU A 1 38  ? -24.813  52.532   -8.454   1.00 0.00 ? 33  GLU A O    1  
ATOM 550   C CB   . GLU A 1 38  ? -23.869  49.404   -8.556   1.00 0.00 ? 33  GLU A CB   1  
ATOM 551   C CG   . GLU A 1 38  ? -22.741  48.683   -7.816   1.00 0.00 ? 33  GLU A CG   1  
ATOM 552   C CD   . GLU A 1 38  ? -21.596  48.393   -8.789   1.00 0.00 ? 33  GLU A CD   1  
ATOM 553   O OE1  . GLU A 1 38  ? -21.857  47.792   -9.818   1.00 0.00 ? 33  GLU A OE1  1  
ATOM 554   O OE2  . GLU A 1 38  ? -20.478  48.777   -8.488   1.00 0.00 ? 33  GLU A OE2  1  
ATOM 555   H H    . GLU A 1 38  ? -25.704  48.479   -7.193   1.00 0.00 ? 33  GLU A H    1  
ATOM 556   H HA   . GLU A 1 38  ? -23.946  50.705   -6.842   1.00 0.00 ? 33  GLU A HA   1  
ATOM 557   H HB2  . GLU A 1 38  ? -24.550  48.677   -8.974   1.00 0.00 ? 33  GLU A HB2  1  
ATOM 558   H HB3  . GLU A 1 38  ? -23.451  50.004   -9.350   1.00 0.00 ? 33  GLU A HB3  1  
ATOM 559   H HG2  . GLU A 1 38  ? -22.381  49.309   -7.012   1.00 0.00 ? 33  GLU A HG2  1  
ATOM 560   H HG3  . GLU A 1 38  ? -23.111  47.754   -7.412   1.00 0.00 ? 33  GLU A HG3  1  
ATOM 561   N N    . ALA A 1 39  ? -26.513  51.185   -8.821   1.00 0.00 ? 34  ALA A N    1  
ATOM 562   C CA   . ALA A 1 39  ? -27.265  52.242   -9.556   1.00 0.00 ? 34  ALA A CA   1  
ATOM 563   C C    . ALA A 1 39  ? -28.250  52.933   -8.610   1.00 0.00 ? 34  ALA A C    1  
ATOM 564   O O    . ALA A 1 39  ? -28.595  54.085   -8.787   1.00 0.00 ? 34  ALA A O    1  
ATOM 565   C CB   . ALA A 1 39  ? -28.013  51.501   -10.664  1.00 0.00 ? 34  ALA A CB   1  
ATOM 566   H H    . ALA A 1 39  ? -26.910  50.297   -8.701   1.00 0.00 ? 34  ALA A H    1  
ATOM 567   H HA   . ALA A 1 39  ? -26.584  52.961   -9.986   1.00 0.00 ? 34  ALA A HA   1  
ATOM 568   H HB1  . ALA A 1 39  ? -28.139  52.155   -11.514  1.00 0.00 ? 34  ALA A HB1  1  
ATOM 569   H HB2  . ALA A 1 39  ? -28.982  51.193   -10.300  1.00 0.00 ? 34  ALA A HB2  1  
ATOM 570   H HB3  . ALA A 1 39  ? -27.447  50.630   -10.961  1.00 0.00 ? 34  ALA A HB3  1  
ATOM 571   N N    . GLU A 1 40  ? -28.701  52.234   -7.601   1.00 0.00 ? 35  GLU A N    1  
ATOM 572   C CA   . GLU A 1 40  ? -29.660  52.842   -6.634   1.00 0.00 ? 35  GLU A CA   1  
ATOM 573   C C    . GLU A 1 40  ? -28.949  53.914   -5.801   1.00 0.00 ? 35  GLU A C    1  
ATOM 574   O O    . GLU A 1 40  ? -29.363  55.056   -5.755   1.00 0.00 ? 35  GLU A O    1  
ATOM 575   C CB   . GLU A 1 40  ? -30.115  51.684   -5.744   1.00 0.00 ? 35  GLU A CB   1  
ATOM 576   C CG   . GLU A 1 40  ? -31.106  52.200   -4.699   1.00 0.00 ? 35  GLU A CG   1  
ATOM 577   C CD   . GLU A 1 40  ? -32.366  52.715   -5.397   1.00 0.00 ? 35  GLU A CD   1  
ATOM 578   O OE1  . GLU A 1 40  ? -32.768  52.108   -6.376   1.00 0.00 ? 35  GLU A OE1  1  
ATOM 579   O OE2  . GLU A 1 40  ? -32.908  53.709   -4.941   1.00 0.00 ? 35  GLU A OE2  1  
ATOM 580   H H    . GLU A 1 40  ? -28.404  51.308   -7.478   1.00 0.00 ? 35  GLU A H    1  
ATOM 581   H HA   . GLU A 1 40  ? -30.506  53.262   -7.152   1.00 0.00 ? 35  GLU A HA   1  
ATOM 582   H HB2  . GLU A 1 40  ? -30.592  50.930   -6.352   1.00 0.00 ? 35  GLU A HB2  1  
ATOM 583   H HB3  . GLU A 1 40  ? -29.259  51.256   -5.244   1.00 0.00 ? 35  GLU A HB3  1  
ATOM 584   H HG2  . GLU A 1 40  ? -31.370  51.396   -4.028   1.00 0.00 ? 35  GLU A HG2  1  
ATOM 585   H HG3  . GLU A 1 40  ? -30.652  53.004   -4.139   1.00 0.00 ? 35  GLU A HG3  1  
ATOM 586   N N    . LYS A 1 41  ? -27.880  53.549   -5.146   1.00 0.00 ? 36  LYS A N    1  
ATOM 587   C CA   . LYS A 1 41  ? -27.131  54.537   -4.315   1.00 0.00 ? 36  LYS A CA   1  
ATOM 588   C C    . LYS A 1 41  ? -26.009  55.172   -5.144   1.00 0.00 ? 36  LYS A C    1  
ATOM 589   O O    . LYS A 1 41  ? -25.584  56.281   -4.883   1.00 0.00 ? 36  LYS A O    1  
ATOM 590   C CB   . LYS A 1 41  ? -26.559  53.714   -3.153   1.00 0.00 ? 36  LYS A CB   1  
ATOM 591   C CG   . LYS A 1 41  ? -25.520  54.536   -2.380   1.00 0.00 ? 36  LYS A CG   1  
ATOM 592   C CD   . LYS A 1 41  ? -26.193  55.753   -1.741   1.00 0.00 ? 36  LYS A CD   1  
ATOM 593   C CE   . LYS A 1 41  ? -26.551  55.437   -0.285   1.00 0.00 ? 36  LYS A CE   1  
ATOM 594   N NZ   . LYS A 1 41  ? -28.032  55.282   -0.277   1.00 0.00 ? 36  LYS A NZ   1  
ATOM 595   H H    . LYS A 1 41  ? -27.566  52.622   -5.201   1.00 0.00 ? 36  LYS A H    1  
ATOM 596   H HA   . LYS A 1 41  ? -27.799  55.295   -3.939   1.00 0.00 ? 36  LYS A HA   1  
ATOM 597   H HB2  . LYS A 1 41  ? -27.362  53.434   -2.486   1.00 0.00 ? 36  LYS A HB2  1  
ATOM 598   H HB3  . LYS A 1 41  ? -26.091  52.823   -3.543   1.00 0.00 ? 36  LYS A HB3  1  
ATOM 599   H HG2  . LYS A 1 41  ? -25.079  53.920   -1.608   1.00 0.00 ? 36  LYS A HG2  1  
ATOM 600   H HG3  . LYS A 1 41  ? -24.747  54.868   -3.057   1.00 0.00 ? 36  LYS A HG3  1  
ATOM 601   H HD2  . LYS A 1 41  ? -25.517  56.594   -1.771   1.00 0.00 ? 36  LYS A HD2  1  
ATOM 602   H HD3  . LYS A 1 41  ? -27.093  55.995   -2.285   1.00 0.00 ? 36  LYS A HD3  1  
ATOM 603   H HE2  . LYS A 1 41  ? -26.072  54.519   0.029    1.00 0.00 ? 36  LYS A HE2  1  
ATOM 604   H HE3  . LYS A 1 41  ? -26.261  56.253   0.358    1.00 0.00 ? 36  LYS A HE3  1  
ATOM 605   H HZ1  . LYS A 1 41  ? -28.338  54.922   0.649    1.00 0.00 ? 36  LYS A HZ1  1  
ATOM 606   H HZ2  . LYS A 1 41  ? -28.314  54.612   -1.022   1.00 0.00 ? 36  LYS A HZ2  1  
ATOM 607   H HZ3  . LYS A 1 41  ? -28.479  56.204   -0.452   1.00 0.00 ? 36  LYS A HZ3  1  
ATOM 608   N N    . GLY A 1 42  ? -25.528  54.476   -6.139   1.00 0.00 ? 37  GLY A N    1  
ATOM 609   C CA   . GLY A 1 42  ? -24.434  55.035   -6.983   1.00 0.00 ? 37  GLY A CA   1  
ATOM 610   C C    . GLY A 1 42  ? -23.210  54.122   -6.903   1.00 0.00 ? 37  GLY A C    1  
ATOM 611   O O    . GLY A 1 42  ? -23.308  52.969   -6.530   1.00 0.00 ? 37  GLY A O    1  
ATOM 612   H H    . GLY A 1 42  ? -25.885  53.584   -6.330   1.00 0.00 ? 37  GLY A H    1  
ATOM 613   H HA2  . GLY A 1 42  ? -24.770  55.102   -8.008   1.00 0.00 ? 37  GLY A HA2  1  
ATOM 614   H HA3  . GLY A 1 42  ? -24.169  56.018   -6.625   1.00 0.00 ? 37  GLY A HA3  1  
ATOM 615   N N    . ARG A 1 43  ? -22.058  54.628   -7.252   1.00 0.00 ? 38  ARG A N    1  
ATOM 616   C CA   . ARG A 1 43  ? -20.825  53.789   -7.199   1.00 0.00 ? 38  ARG A CA   1  
ATOM 617   C C    . ARG A 1 43  ? -19.672  54.574   -6.565   1.00 0.00 ? 38  ARG A C    1  
ATOM 618   O O    . ARG A 1 43  ? -18.516  54.335   -6.855   1.00 0.00 ? 38  ARG A O    1  
ATOM 619   C CB   . ARG A 1 43  ? -20.508  53.458   -8.657   1.00 0.00 ? 38  ARG A CB   1  
ATOM 620   C CG   . ARG A 1 43  ? -21.632  52.602   -9.244   1.00 0.00 ? 38  ARG A CG   1  
ATOM 621   C CD   . ARG A 1 43  ? -21.065  51.702   -10.345  1.00 0.00 ? 38  ARG A CD   1  
ATOM 622   N NE   . ARG A 1 43  ? -20.683  52.631   -11.445  1.00 0.00 ? 38  ARG A NE   1  
ATOM 623   C CZ   . ARG A 1 43  ? -20.450  52.166   -12.642  1.00 0.00 ? 38  ARG A CZ   1  
ATOM 624   N NH1  . ARG A 1 43  ? -19.288  51.642   -12.923  1.00 0.00 ? 38  ARG A NH1  1  
ATOM 625   N NH2  . ARG A 1 43  ? -21.378  52.225   -13.557  1.00 0.00 ? 38  ARG A NH2  1  
ATOM 626   H H    . ARG A 1 43  ? -22.004  55.559   -7.550   1.00 0.00 ? 38  ARG A H    1  
ATOM 627   H HA   . ARG A 1 43  ? -21.011  52.881   -6.648   1.00 0.00 ? 38  ARG A HA   1  
ATOM 628   H HB2  . ARG A 1 43  ? -20.419  54.375   -9.223   1.00 0.00 ? 38  ARG A HB2  1  
ATOM 629   H HB3  . ARG A 1 43  ? -19.578  52.912   -8.708   1.00 0.00 ? 38  ARG A HB3  1  
ATOM 630   H HG2  . ARG A 1 43  ? -22.064  51.992   -8.465   1.00 0.00 ? 38  ARG A HG2  1  
ATOM 631   H HG3  . ARG A 1 43  ? -22.392  53.244   -9.663   1.00 0.00 ? 38  ARG A HG3  1  
ATOM 632   H HD2  . ARG A 1 43  ? -20.198  51.168   -9.982   1.00 0.00 ? 38  ARG A HD2  1  
ATOM 633   H HD3  . ARG A 1 43  ? -21.817  51.010   -10.690  1.00 0.00 ? 38  ARG A HD3  1  
ATOM 634   H HE   . ARG A 1 43  ? -20.608  53.593   -11.270  1.00 0.00 ? 38  ARG A HE   1  
ATOM 635   H HH11 . ARG A 1 43  ? -18.577  51.597   -12.222  1.00 0.00 ? 38  ARG A HH11 1  
ATOM 636   H HH12 . ARG A 1 43  ? -19.110  51.285   -13.840  1.00 0.00 ? 38  ARG A HH12 1  
ATOM 637   H HH21 . ARG A 1 43  ? -22.267  52.628   -13.342  1.00 0.00 ? 38  ARG A HH21 1  
ATOM 638   H HH22 . ARG A 1 43  ? -21.199  51.868   -14.474  1.00 0.00 ? 38  ARG A HH22 1  
ATOM 639   N N    . ASP A 1 44  ? -19.976  55.503   -5.698   1.00 0.00 ? 39  ASP A N    1  
ATOM 640   C CA   . ASP A 1 44  ? -18.895  56.297   -5.044   1.00 0.00 ? 39  ASP A CA   1  
ATOM 641   C C    . ASP A 1 44  ? -18.271  55.483   -3.908   1.00 0.00 ? 39  ASP A C    1  
ATOM 642   O O    . ASP A 1 44  ? -17.066  55.364   -3.802   1.00 0.00 ? 39  ASP A O    1  
ATOM 643   C CB   . ASP A 1 44  ? -19.593  57.541   -4.493   1.00 0.00 ? 39  ASP A CB   1  
ATOM 644   C CG   . ASP A 1 44  ? -18.550  58.615   -4.176   1.00 0.00 ? 39  ASP A CG   1  
ATOM 645   O OD1  . ASP A 1 44  ? -17.770  58.404   -3.262   1.00 0.00 ? 39  ASP A OD1  1  
ATOM 646   O OD2  . ASP A 1 44  ? -18.550  59.631   -4.852   1.00 0.00 ? 39  ASP A OD2  1  
ATOM 647   H H    . ASP A 1 44  ? -20.914  55.676   -5.475   1.00 0.00 ? 39  ASP A H    1  
ATOM 648   H HA   . ASP A 1 44  ? -18.144  56.581   -5.764   1.00 0.00 ? 39  ASP A HA   1  
ATOM 649   H HB2  . ASP A 1 44  ? -20.288  57.919   -5.229   1.00 0.00 ? 39  ASP A HB2  1  
ATOM 650   H HB3  . ASP A 1 44  ? -20.128  57.285   -3.591   1.00 0.00 ? 39  ASP A HB3  1  
ATOM 651   N N    . ALA A 1 45  ? -19.090  54.916   -3.065   1.00 0.00 ? 40  ALA A N    1  
ATOM 652   C CA   . ALA A 1 45  ? -18.563  54.098   -1.935   1.00 0.00 ? 40  ALA A CA   1  
ATOM 653   C C    . ALA A 1 45  ? -19.409  52.833   -1.777   1.00 0.00 ? 40  ALA A C    1  
ATOM 654   O O    . ALA A 1 45  ? -19.494  52.258   -0.710   1.00 0.00 ? 40  ALA A O    1  
ATOM 655   C CB   . ALA A 1 45  ? -18.699  54.994   -0.704   1.00 0.00 ? 40  ALA A CB   1  
ATOM 656   H H    . ALA A 1 45  ? -20.057  55.024   -3.178   1.00 0.00 ? 40  ALA A H    1  
ATOM 657   H HA   . ALA A 1 45  ? -17.527  53.846   -2.099   1.00 0.00 ? 40  ALA A HA   1  
ATOM 658   H HB1  . ALA A 1 45  ? -17.842  54.855   -0.061   1.00 0.00 ? 40  ALA A HB1  1  
ATOM 659   H HB2  . ALA A 1 45  ? -19.599  54.733   -0.167   1.00 0.00 ? 40  ALA A HB2  1  
ATOM 660   H HB3  . ALA A 1 45  ? -18.752  56.026   -1.016   1.00 0.00 ? 40  ALA A HB3  1  
ATOM 661   N N    . PHE A 1 46  ? -20.041  52.402   -2.837   1.00 0.00 ? 41  PHE A N    1  
ATOM 662   C CA   . PHE A 1 46  ? -20.893  51.180   -2.765   1.00 0.00 ? 41  PHE A CA   1  
ATOM 663   C C    . PHE A 1 46  ? -20.394  50.131   -3.767   1.00 0.00 ? 41  PHE A C    1  
ATOM 664   O O    . PHE A 1 46  ? -20.961  49.977   -4.831   1.00 0.00 ? 41  PHE A O    1  
ATOM 665   C CB   . PHE A 1 46  ? -22.291  51.663   -3.153   1.00 0.00 ? 41  PHE A CB   1  
ATOM 666   C CG   . PHE A 1 46  ? -23.098  51.959   -1.911   1.00 0.00 ? 41  PHE A CG   1  
ATOM 667   C CD1  . PHE A 1 46  ? -22.650  52.914   -0.989   1.00 0.00 ? 41  PHE A CD1  1  
ATOM 668   C CD2  . PHE A 1 46  ? -24.300  51.282   -1.688   1.00 0.00 ? 41  PHE A CD2  1  
ATOM 669   C CE1  . PHE A 1 46  ? -23.408  53.189   0.156    1.00 0.00 ? 41  PHE A CE1  1  
ATOM 670   C CE2  . PHE A 1 46  ? -25.057  51.556   -0.544   1.00 0.00 ? 41  PHE A CE2  1  
ATOM 671   C CZ   . PHE A 1 46  ? -24.612  52.509   0.379    1.00 0.00 ? 41  PHE A CZ   1  
ATOM 672   H H    . PHE A 1 46  ? -19.959  52.887   -3.684   1.00 0.00 ? 41  PHE A H    1  
ATOM 673   H HA   . PHE A 1 46  ? -20.902  50.780   -1.764   1.00 0.00 ? 41  PHE A HA   1  
ATOM 674   H HB2  . PHE A 1 46  ? -22.207  52.560   -3.749   1.00 0.00 ? 41  PHE A HB2  1  
ATOM 675   H HB3  . PHE A 1 46  ? -22.788  50.895   -3.728   1.00 0.00 ? 41  PHE A HB3  1  
ATOM 676   H HD1  . PHE A 1 46  ? -21.722  53.437   -1.162   1.00 0.00 ? 41  PHE A HD1  1  
ATOM 677   H HD2  . PHE A 1 46  ? -24.644  50.547   -2.398   1.00 0.00 ? 41  PHE A HD2  1  
ATOM 678   H HE1  . PHE A 1 46  ? -23.063  53.925   0.868    1.00 0.00 ? 41  PHE A HE1  1  
ATOM 679   H HE2  . PHE A 1 46  ? -25.985  51.031   -0.374   1.00 0.00 ? 41  PHE A HE2  1  
ATOM 680   H HZ   . PHE A 1 46  ? -25.198  52.722   1.261    1.00 0.00 ? 41  PHE A HZ   1  
ATOM 681   N N    . PRO A 1 47  ? -19.344  49.441   -3.399   1.00 0.00 ? 42  PRO A N    1  
ATOM 682   C CA   . PRO A 1 47  ? -18.774  48.405   -4.290   1.00 0.00 ? 42  PRO A CA   1  
ATOM 683   C C    . PRO A 1 47  ? -19.619  47.130   -4.238   1.00 0.00 ? 42  PRO A C    1  
ATOM 684   O O    . PRO A 1 47  ? -20.734  47.129   -3.752   1.00 0.00 ? 42  PRO A O    1  
ATOM 685   C CB   . PRO A 1 47  ? -17.385  48.159   -3.713   1.00 0.00 ? 42  PRO A CB   1  
ATOM 686   C CG   . PRO A 1 47  ? -17.479  48.552   -2.271   1.00 0.00 ? 42  PRO A CG   1  
ATOM 687   C CD   . PRO A 1 47  ? -18.597  49.557   -2.140   1.00 0.00 ? 42  PRO A CD   1  
ATOM 688   H HA   . PRO A 1 47  ? -18.696  48.772   -5.301   1.00 0.00 ? 42  PRO A HA   1  
ATOM 689   H HB2  . PRO A 1 47  ? -17.123  47.114   -3.804   1.00 0.00 ? 42  PRO A HB2  1  
ATOM 690   H HB3  . PRO A 1 47  ? -16.655  48.775   -4.215   1.00 0.00 ? 42  PRO A HB3  1  
ATOM 691   H HG2  . PRO A 1 47  ? -17.694  47.680   -1.669   1.00 0.00 ? 42  PRO A HG2  1  
ATOM 692   H HG3  . PRO A 1 47  ? -16.551  49.000   -1.952   1.00 0.00 ? 42  PRO A HG3  1  
ATOM 693   H HD2  . PRO A 1 47  ? -19.229  49.305   -1.300   1.00 0.00 ? 42  PRO A HD2  1  
ATOM 694   H HD3  . PRO A 1 47  ? -18.201  50.554   -2.033   1.00 0.00 ? 42  PRO A HD3  1  
ATOM 695   N N    . VAL A 1 48  ? -19.093  46.044   -4.736   1.00 0.00 ? 43  VAL A N    1  
ATOM 696   C CA   . VAL A 1 48  ? -19.856  44.762   -4.721   1.00 0.00 ? 43  VAL A CA   1  
ATOM 697   C C    . VAL A 1 48  ? -19.174  43.753   -3.790   1.00 0.00 ? 43  VAL A C    1  
ATOM 698   O O    . VAL A 1 48  ? -19.824  42.973   -3.123   1.00 0.00 ? 43  VAL A O    1  
ATOM 699   C CB   . VAL A 1 48  ? -19.835  44.268   -6.171   1.00 0.00 ? 43  VAL A CB   1  
ATOM 700   C CG1  . VAL A 1 48  ? -20.616  42.956   -6.279   1.00 0.00 ? 43  VAL A CG1  1  
ATOM 701   C CG2  . VAL A 1 48  ? -20.485  45.317   -7.078   1.00 0.00 ? 43  VAL A CG2  1  
ATOM 702   H H    . VAL A 1 48  ? -18.193  46.071   -5.122   1.00 0.00 ? 43  VAL A H    1  
ATOM 703   H HA   . VAL A 1 48  ? -20.873  44.936   -4.408   1.00 0.00 ? 43  VAL A HA   1  
ATOM 704   H HB   . VAL A 1 48  ? -18.812  44.105   -6.480   1.00 0.00 ? 43  VAL A HB   1  
ATOM 705   H HG11 . VAL A 1 48  ? -21.651  43.171   -6.502   1.00 0.00 ? 43  VAL A HG11 1  
ATOM 706   H HG12 . VAL A 1 48  ? -20.553  42.421   -5.343   1.00 0.00 ? 43  VAL A HG12 1  
ATOM 707   H HG13 . VAL A 1 48  ? -20.196  42.351   -7.068   1.00 0.00 ? 43  VAL A HG13 1  
ATOM 708   H HG21 . VAL A 1 48  ? -19.775  46.104   -7.285   1.00 0.00 ? 43  VAL A HG21 1  
ATOM 709   H HG22 . VAL A 1 48  ? -21.350  45.733   -6.584   1.00 0.00 ? 43  VAL A HG22 1  
ATOM 710   H HG23 . VAL A 1 48  ? -20.788  44.853   -8.005   1.00 0.00 ? 43  VAL A HG23 1  
ATOM 711   N N    . ALA A 1 49  ? -17.866  43.759   -3.753   1.00 0.00 ? 44  ALA A N    1  
ATOM 712   C CA   . ALA A 1 49  ? -17.121  42.798   -2.877   1.00 0.00 ? 44  ALA A CA   1  
ATOM 713   C C    . ALA A 1 49  ? -17.727  42.738   -1.467   1.00 0.00 ? 44  ALA A C    1  
ATOM 714   O O    . ALA A 1 49  ? -17.875  41.674   -0.897   1.00 0.00 ? 44  ALA A O    1  
ATOM 715   C CB   . ALA A 1 49  ? -15.695  43.345   -2.818   1.00 0.00 ? 44  ALA A CB   1  
ATOM 716   H H    . ALA A 1 49  ? -17.368  44.394   -4.309   1.00 0.00 ? 44  ALA A H    1  
ATOM 717   H HA   . ALA A 1 49  ? -17.115  41.816   -3.323   1.00 0.00 ? 44  ALA A HA   1  
ATOM 718   H HB1  . ALA A 1 49  ? -15.725  44.424   -2.774   1.00 0.00 ? 44  ALA A HB1  1  
ATOM 719   H HB2  . ALA A 1 49  ? -15.153  43.036   -3.700   1.00 0.00 ? 44  ALA A HB2  1  
ATOM 720   H HB3  . ALA A 1 49  ? -15.198  42.963   -1.939   1.00 0.00 ? 44  ALA A HB3  1  
ATOM 721   N N    . GLY A 1 50  ? -18.075  43.863   -0.899   1.00 0.00 ? 45  GLY A N    1  
ATOM 722   C CA   . GLY A 1 50  ? -18.665  43.851   0.472    1.00 0.00 ? 45  GLY A CA   1  
ATOM 723   C C    . GLY A 1 50  ? -20.180  44.019   0.380    1.00 0.00 ? 45  GLY A C    1  
ATOM 724   O O    . GLY A 1 50  ? -20.804  44.580   1.258    1.00 0.00 ? 45  GLY A O    1  
ATOM 725   H H    . GLY A 1 50  ? -17.949  44.714   -1.370   1.00 0.00 ? 45  GLY A H    1  
ATOM 726   H HA2  . GLY A 1 50  ? -18.436  42.912   0.955    1.00 0.00 ? 45  GLY A HA2  1  
ATOM 727   H HA3  . GLY A 1 50  ? -18.252  44.663   1.051    1.00 0.00 ? 45  GLY A HA3  1  
ATOM 728   N N    . GLN A 1 51  ? -20.775  43.542   -0.680   1.00 0.00 ? 46  GLN A N    1  
ATOM 729   C CA   . GLN A 1 51  ? -22.252  43.681   -0.830   1.00 0.00 ? 46  GLN A CA   1  
ATOM 730   C C    . GLN A 1 51  ? -22.982  42.526   -0.139   1.00 0.00 ? 46  GLN A C    1  
ATOM 731   O O    . GLN A 1 51  ? -23.204  41.481   -0.719   1.00 0.00 ? 46  GLN A O    1  
ATOM 732   C CB   . GLN A 1 51  ? -22.508  43.648   -2.336   1.00 0.00 ? 46  GLN A CB   1  
ATOM 733   C CG   . GLN A 1 51  ? -23.816  44.381   -2.645   1.00 0.00 ? 46  GLN A CG   1  
ATOM 734   C CD   . GLN A 1 51  ? -23.646  45.221   -3.913   1.00 0.00 ? 46  GLN A CD   1  
ATOM 735   O OE1  . GLN A 1 51  ? -23.262  44.711   -4.947   1.00 0.00 ? 46  GLN A OE1  1  
ATOM 736   N NE2  . GLN A 1 51  ? -23.918  46.497   -3.877   1.00 0.00 ? 46  GLN A NE2  1  
ATOM 737   H H    . GLN A 1 51  ? -20.251  43.099   -1.378   1.00 0.00 ? 46  GLN A H    1  
ATOM 738   H HA   . GLN A 1 51  ? -22.581  44.623   -0.428   1.00 0.00 ? 46  GLN A HA   1  
ATOM 739   H HB2  . GLN A 1 51  ? -21.691  44.133   -2.849   1.00 0.00 ? 46  GLN A HB2  1  
ATOM 740   H HB3  . GLN A 1 51  ? -22.585  42.623   -2.667   1.00 0.00 ? 46  GLN A HB3  1  
ATOM 741   H HG2  . GLN A 1 51  ? -24.606  43.660   -2.793   1.00 0.00 ? 46  GLN A HG2  1  
ATOM 742   H HG3  . GLN A 1 51  ? -24.070  45.029   -1.820   1.00 0.00 ? 46  GLN A HG3  1  
ATOM 743   H HE21 . GLN A 1 51  ? -24.228  46.908   -3.043   1.00 0.00 ? 46  GLN A HE21 1  
ATOM 744   H HE22 . GLN A 1 51  ? -23.812  47.044   -4.683   1.00 0.00 ? 46  GLN A HE22 1  
ATOM 745   N N    . LYS A 1 52  ? -23.368  42.717   1.093    1.00 0.00 ? 47  LYS A N    1  
ATOM 746   C CA   . LYS A 1 52  ? -24.101  41.651   1.832    1.00 0.00 ? 47  LYS A CA   1  
ATOM 747   C C    . LYS A 1 52  ? -25.468  42.211   2.234    1.00 0.00 ? 47  LYS A C    1  
ATOM 748   O O    . LYS A 1 52  ? -25.562  43.100   3.057    1.00 0.00 ? 47  LYS A O    1  
ATOM 749   C CB   . LYS A 1 52  ? -23.233  41.348   3.061    1.00 0.00 ? 47  LYS A CB   1  
ATOM 750   C CG   . LYS A 1 52  ? -21.752  41.395   2.674    1.00 0.00 ? 47  LYS A CG   1  
ATOM 751   C CD   . LYS A 1 52  ? -20.905  40.807   3.806    1.00 0.00 ? 47  LYS A CD   1  
ATOM 752   C CE   . LYS A 1 52  ? -20.744  39.298   3.597    1.00 0.00 ? 47  LYS A CE   1  
ATOM 753   N NZ   . LYS A 1 52  ? -19.277  39.051   3.678    1.00 0.00 ? 47  LYS A NZ   1  
ATOM 754   H H    . LYS A 1 52  ? -23.186  43.569   1.536    1.00 0.00 ? 47  LYS A H    1  
ATOM 755   H HA   . LYS A 1 52  ? -24.213  40.769   1.220    1.00 0.00 ? 47  LYS A HA   1  
ATOM 756   H HB2  . LYS A 1 52  ? -23.429  42.080   3.831    1.00 0.00 ? 47  LYS A HB2  1  
ATOM 757   H HB3  . LYS A 1 52  ? -23.467  40.365   3.432    1.00 0.00 ? 47  LYS A HB3  1  
ATOM 758   H HG2  . LYS A 1 52  ? -21.600  40.820   1.772    1.00 0.00 ? 47  LYS A HG2  1  
ATOM 759   H HG3  . LYS A 1 52  ? -21.459  42.419   2.502    1.00 0.00 ? 47  LYS A HG3  1  
ATOM 760   H HD2  . LYS A 1 52  ? -19.933  41.278   3.808    1.00 0.00 ? 47  LYS A HD2  1  
ATOM 761   H HD3  . LYS A 1 52  ? -21.394  40.987   4.752    1.00 0.00 ? 47  LYS A HD3  1  
ATOM 762   H HE2  . LYS A 1 52  ? -21.263  38.755   4.375    1.00 0.00 ? 47  LYS A HE2  1  
ATOM 763   H HE3  . LYS A 1 52  ? -21.114  39.010   2.625    1.00 0.00 ? 47  LYS A HE3  1  
ATOM 764   H HZ1  . LYS A 1 52  ? -19.100  38.028   3.737    1.00 0.00 ? 47  LYS A HZ1  1  
ATOM 765   H HZ2  . LYS A 1 52  ? -18.893  39.520   4.524    1.00 0.00 ? 47  LYS A HZ2  1  
ATOM 766   H HZ3  . LYS A 1 52  ? -18.813  39.432   2.829    1.00 0.00 ? 47  LYS A HZ3  1  
ATOM 767   N N    . LEU A 1 53  ? -26.524  41.734   1.627    1.00 0.00 ? 48  LEU A N    1  
ATOM 768   C CA   . LEU A 1 53  ? -27.880  42.287   1.943    1.00 0.00 ? 48  LEU A CA   1  
ATOM 769   C C    . LEU A 1 53  ? -28.415  41.750   3.273    1.00 0.00 ? 48  LEU A C    1  
ATOM 770   O O    . LEU A 1 53  ? -29.156  40.791   3.304    1.00 0.00 ? 48  LEU A O    1  
ATOM 771   C CB   . LEU A 1 53  ? -28.761  41.826   0.782    1.00 0.00 ? 48  LEU A CB   1  
ATOM 772   C CG   . LEU A 1 53  ? -28.434  42.648   -0.469   1.00 0.00 ? 48  LEU A CG   1  
ATOM 773   C CD1  . LEU A 1 53  ? -28.368  41.723   -1.687   1.00 0.00 ? 48  LEU A CD1  1  
ATOM 774   C CD2  . LEU A 1 53  ? -29.523  43.701   -0.689   1.00 0.00 ? 48  LEU A CD2  1  
ATOM 775   H H    . LEU A 1 53  ? -26.423  41.036   0.942    1.00 0.00 ? 48  LEU A H    1  
ATOM 776   H HA   . LEU A 1 53  ? -27.847  43.364   1.963    1.00 0.00 ? 48  LEU A HA   1  
ATOM 777   H HB2  . LEU A 1 53  ? -28.572  40.782   0.585    1.00 0.00 ? 48  LEU A HB2  1  
ATOM 778   H HB3  . LEU A 1 53  ? -29.801  41.962   1.040    1.00 0.00 ? 48  LEU A HB3  1  
ATOM 779   H HG   . LEU A 1 53  ? -27.479  43.137   -0.339   1.00 0.00 ? 48  LEU A HG   1  
ATOM 780   H HD11 . LEU A 1 53  ? -28.583  42.290   -2.581   1.00 0.00 ? 48  LEU A HD11 1  
ATOM 781   H HD12 . LEU A 1 53  ? -29.096  40.933   -1.579   1.00 0.00 ? 48  LEU A HD12 1  
ATOM 782   H HD13 . LEU A 1 53  ? -27.379  41.295   -1.762   1.00 0.00 ? 48  LEU A HD13 1  
ATOM 783   H HD21 . LEU A 1 53  ? -29.205  44.394   -1.453   1.00 0.00 ? 48  LEU A HD21 1  
ATOM 784   H HD22 . LEU A 1 53  ? -29.697  44.237   0.233    1.00 0.00 ? 48  LEU A HD22 1  
ATOM 785   H HD23 . LEU A 1 53  ? -30.436  43.215   -1.001   1.00 0.00 ? 48  LEU A HD23 1  
ATOM 786   N N    . ILE A 1 54  ? -28.066  42.368   4.374    1.00 0.00 ? 49  ILE A N    1  
ATOM 787   C CA   . ILE A 1 54  ? -28.579  41.871   5.686    1.00 0.00 ? 49  ILE A CA   1  
ATOM 788   C C    . ILE A 1 54  ? -30.080  42.134   5.802    1.00 0.00 ? 49  ILE A C    1  
ATOM 789   O O    . ILE A 1 54  ? -30.525  43.261   5.729    1.00 0.00 ? 49  ILE A O    1  
ATOM 790   C CB   . ILE A 1 54  ? -27.839  42.663   6.774    1.00 0.00 ? 49  ILE A CB   1  
ATOM 791   C CG1  . ILE A 1 54  ? -26.431  42.109   6.958    1.00 0.00 ? 49  ILE A CG1  1  
ATOM 792   C CG2  . ILE A 1 54  ? -28.593  42.538   8.100    1.00 0.00 ? 49  ILE A CG2  1  
ATOM 793   C CD1  . ILE A 1 54  ? -25.614  42.394   5.708    1.00 0.00 ? 49  ILE A CD1  1  
ATOM 794   H H    . ILE A 1 54  ? -27.480  43.153   4.336    1.00 0.00 ? 49  ILE A H    1  
ATOM 795   H HA   . ILE A 1 54  ? -28.368  40.818   5.790    1.00 0.00 ? 49  ILE A HA   1  
ATOM 796   H HB   . ILE A 1 54  ? -27.788  43.701   6.490    1.00 0.00 ? 49  ILE A HB   1  
ATOM 797   H HG12 . ILE A 1 54  ? -25.966  42.583   7.811    1.00 0.00 ? 49  ILE A HG12 1  
ATOM 798   H HG13 . ILE A 1 54  ? -26.483  41.044   7.121    1.00 0.00 ? 49  ILE A HG13 1  
ATOM 799   H HG21 . ILE A 1 54  ? -29.202  41.646   8.080    1.00 0.00 ? 49  ILE A HG21 1  
ATOM 800   H HG22 . ILE A 1 54  ? -29.225  43.402   8.239    1.00 0.00 ? 49  ILE A HG22 1  
ATOM 801   H HG23 . ILE A 1 54  ? -27.886  42.473   8.914    1.00 0.00 ? 49  ILE A HG23 1  
ATOM 802   H HD11 . ILE A 1 54  ? -25.885  41.686   4.939    1.00 0.00 ? 49  ILE A HD11 1  
ATOM 803   H HD12 . ILE A 1 54  ? -24.564  42.301   5.936    1.00 0.00 ? 49  ILE A HD12 1  
ATOM 804   H HD13 . ILE A 1 54  ? -25.822  43.395   5.365    1.00 0.00 ? 49  ILE A HD13 1  
ATOM 805   N N    . TYR A 1 55  ? -30.857  41.114   6.021    1.00 0.00 ? 50  TYR A N    1  
ATOM 806   C CA   . TYR A 1 55  ? -32.318  41.321   6.187    1.00 0.00 ? 50  TYR A CA   1  
ATOM 807   C C    . TYR A 1 55  ? -32.692  41.067   7.654    1.00 0.00 ? 50  TYR A C    1  
ATOM 808   O O    . TYR A 1 55  ? -33.706  41.533   8.136    1.00 0.00 ? 50  TYR A O    1  
ATOM 809   C CB   . TYR A 1 55  ? -32.986  40.304   5.256    1.00 0.00 ? 50  TYR A CB   1  
ATOM 810   C CG   . TYR A 1 55  ? -34.456  40.194   5.595    1.00 0.00 ? 50  TYR A CG   1  
ATOM 811   C CD1  . TYR A 1 55  ? -35.203  41.347   5.875    1.00 0.00 ? 50  TYR A CD1  1  
ATOM 812   C CD2  . TYR A 1 55  ? -35.065  38.937   5.645    1.00 0.00 ? 50  TYR A CD2  1  
ATOM 813   C CE1  . TYR A 1 55  ? -36.556  41.240   6.203    1.00 0.00 ? 50  TYR A CE1  1  
ATOM 814   C CE2  . TYR A 1 55  ? -36.419  38.830   5.976    1.00 0.00 ? 50  TYR A CE2  1  
ATOM 815   C CZ   . TYR A 1 55  ? -37.166  39.981   6.256    1.00 0.00 ? 50  TYR A CZ   1  
ATOM 816   O OH   . TYR A 1 55  ? -38.503  39.874   6.582    1.00 0.00 ? 50  TYR A OH   1  
ATOM 817   H H    . TYR A 1 55  ? -30.479  40.216   6.105    1.00 0.00 ? 50  TYR A H    1  
ATOM 818   H HA   . TYR A 1 55  ? -32.590  42.325   5.898    1.00 0.00 ? 50  TYR A HA   1  
ATOM 819   H HB2  . TYR A 1 55  ? -32.876  40.628   4.232    1.00 0.00 ? 50  TYR A HB2  1  
ATOM 820   H HB3  . TYR A 1 55  ? -32.516  39.340   5.380    1.00 0.00 ? 50  TYR A HB3  1  
ATOM 821   H HD1  . TYR A 1 55  ? -34.735  42.320   5.834    1.00 0.00 ? 50  TYR A HD1  1  
ATOM 822   H HD2  . TYR A 1 55  ? -34.492  38.049   5.424    1.00 0.00 ? 50  TYR A HD2  1  
ATOM 823   H HE1  . TYR A 1 55  ? -37.128  42.128   6.418    1.00 0.00 ? 50  TYR A HE1  1  
ATOM 824   H HE2  . TYR A 1 55  ? -36.887  37.859   6.015    1.00 0.00 ? 50  TYR A HE2  1  
ATOM 825   H HH   . TYR A 1 55  ? -38.901  39.227   5.996    1.00 0.00 ? 50  TYR A HH   1  
ATOM 826   N N    . ALA A 1 56  ? -31.872  40.334   8.369    1.00 0.00 ? 51  ALA A N    1  
ATOM 827   C CA   . ALA A 1 56  ? -32.174  40.055   9.804    1.00 0.00 ? 51  ALA A CA   1  
ATOM 828   C C    . ALA A 1 56  ? -31.001  39.330   10.480   1.00 0.00 ? 51  ALA A C    1  
ATOM 829   O O    . ALA A 1 56  ? -31.195  38.565   11.404   1.00 0.00 ? 51  ALA A O    1  
ATOM 830   C CB   . ALA A 1 56  ? -33.413  39.157   9.782    1.00 0.00 ? 51  ALA A CB   1  
ATOM 831   H H    . ALA A 1 56  ? -31.058  39.972   7.963    1.00 0.00 ? 51  ALA A H    1  
ATOM 832   H HA   . ALA A 1 56  ? -32.398  40.973   10.325   1.00 0.00 ? 51  ALA A HA   1  
ATOM 833   H HB1  . ALA A 1 56  ? -33.581  38.798   8.777    1.00 0.00 ? 51  ALA A HB1  1  
ATOM 834   H HB2  . ALA A 1 56  ? -34.273  39.722   10.110   1.00 0.00 ? 51  ALA A HB2  1  
ATOM 835   H HB3  . ALA A 1 56  ? -33.262  38.316   10.443   1.00 0.00 ? 51  ALA A HB3  1  
ATOM 836   N N    . GLY A 1 57  ? -29.787  39.560   10.038   1.00 0.00 ? 52  GLY A N    1  
ATOM 837   C CA   . GLY A 1 57  ? -28.627  38.872   10.680   1.00 0.00 ? 52  GLY A CA   1  
ATOM 838   C C    . GLY A 1 57  ? -27.761  38.215   9.606    1.00 0.00 ? 52  GLY A C    1  
ATOM 839   O O    . GLY A 1 57  ? -26.591  38.516   9.469    1.00 0.00 ? 52  GLY A O    1  
ATOM 840   H H    . GLY A 1 57  ? -29.637  40.183   9.290    1.00 0.00 ? 52  GLY A H    1  
ATOM 841   H HA2  . GLY A 1 57  ? -28.038  39.595   11.226   1.00 0.00 ? 52  GLY A HA2  1  
ATOM 842   H HA3  . GLY A 1 57  ? -28.988  38.114   11.359   1.00 0.00 ? 52  GLY A HA3  1  
ATOM 843   N N    . LYS A 1 58  ? -28.329  37.326   8.835    1.00 0.00 ? 53  LYS A N    1  
ATOM 844   C CA   . LYS A 1 58  ? -27.540  36.658   7.762    1.00 0.00 ? 53  LYS A CA   1  
ATOM 845   C C    . LYS A 1 58  ? -27.671  37.466   6.473    1.00 0.00 ? 53  LYS A C    1  
ATOM 846   O O    . LYS A 1 58  ? -28.763  37.730   6.007    1.00 0.00 ? 53  LYS A O    1  
ATOM 847   C CB   . LYS A 1 58  ? -28.171  35.275   7.600    1.00 0.00 ? 53  LYS A CB   1  
ATOM 848   C CG   . LYS A 1 58  ? -27.365  34.464   6.584    1.00 0.00 ? 53  LYS A CG   1  
ATOM 849   C CD   . LYS A 1 58  ? -28.158  33.220   6.175    1.00 0.00 ? 53  LYS A CD   1  
ATOM 850   C CE   . LYS A 1 58  ? -29.284  33.621   5.217    1.00 0.00 ? 53  LYS A CE   1  
ATOM 851   N NZ   . LYS A 1 58  ? -28.601  33.958   3.936    1.00 0.00 ? 53  LYS A NZ   1  
ATOM 852   H H    . LYS A 1 58  ? -29.275  37.104   8.958    1.00 0.00 ? 53  LYS A H    1  
ATOM 853   H HA   . LYS A 1 58  ? -26.505  36.567   8.051    1.00 0.00 ? 53  LYS A HA   1  
ATOM 854   H HB2  . LYS A 1 58  ? -28.169  34.765   8.553    1.00 0.00 ? 53  LYS A HB2  1  
ATOM 855   H HB3  . LYS A 1 58  ? -29.187  35.381   7.250    1.00 0.00 ? 53  LYS A HB3  1  
ATOM 856   H HG2  . LYS A 1 58  ? -27.171  35.071   5.712    1.00 0.00 ? 53  LYS A HG2  1  
ATOM 857   H HG3  . LYS A 1 58  ? -26.429  34.161   7.027    1.00 0.00 ? 53  LYS A HG3  1  
ATOM 858   H HD2  . LYS A 1 58  ? -27.499  32.519   5.684    1.00 0.00 ? 53  LYS A HD2  1  
ATOM 859   H HD3  . LYS A 1 58  ? -28.584  32.759   7.054    1.00 0.00 ? 53  LYS A HD3  1  
ATOM 860   H HE2  . LYS A 1 58  ? -29.967  32.794   5.076    1.00 0.00 ? 53  LYS A HE2  1  
ATOM 861   H HE3  . LYS A 1 58  ? -29.810  34.484   5.594    1.00 0.00 ? 53  LYS A HE3  1  
ATOM 862   H HZ1  . LYS A 1 58  ? -28.173  34.902   4.008    1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 863   H HZ2  . LYS A 1 58  ? -29.297  33.951   3.162    1.00 0.00 ? 53  LYS A HZ2  1  
ATOM 864   H HZ3  . LYS A 1 58  ? -27.859  33.257   3.741    1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 865   N N    . ILE A 1 59  ? -26.573  37.885   5.907    1.00 0.00 ? 54  ILE A N    1  
ATOM 866   C CA   . ILE A 1 59  ? -26.654  38.702   4.664    1.00 0.00 ? 54  ILE A CA   1  
ATOM 867   C C    . ILE A 1 59  ? -27.208  37.880   3.498    1.00 0.00 ? 54  ILE A C    1  
ATOM 868   O O    . ILE A 1 59  ? -26.694  36.831   3.161    1.00 0.00 ? 54  ILE A O    1  
ATOM 869   C CB   . ILE A 1 59  ? -25.221  39.164   4.348    1.00 0.00 ? 54  ILE A CB   1  
ATOM 870   C CG1  . ILE A 1 59  ? -24.391  38.002   3.797    1.00 0.00 ? 54  ILE A CG1  1  
ATOM 871   C CG2  . ILE A 1 59  ? -24.535  39.713   5.595    1.00 0.00 ? 54  ILE A CG2  1  
ATOM 872   C CD1  . ILE A 1 59  ? -24.425  38.056   2.273    1.00 0.00 ? 54  ILE A CD1  1  
ATOM 873   H H    . ILE A 1 59  ? -25.703  37.679   6.307    1.00 0.00 ? 54  ILE A H    1  
ATOM 874   H HA   . ILE A 1 59  ? -27.279  39.564   4.832    1.00 0.00 ? 54  ILE A HA   1  
ATOM 875   H HB   . ILE A 1 59  ? -25.268  39.946   3.605    1.00 0.00 ? 54  ILE A HB   1  
ATOM 876   H HG12 . ILE A 1 59  ? -23.370  38.093   4.141    1.00 0.00 ? 54  ILE A HG12 1  
ATOM 877   H HG13 . ILE A 1 59  ? -24.805  37.065   4.135    1.00 0.00 ? 54  ILE A HG13 1  
ATOM 878   H HG21 . ILE A 1 59  ? -25.278  39.982   6.326    1.00 0.00 ? 54  ILE A HG21 1  
ATOM 879   H HG22 . ILE A 1 59  ? -23.958  40.587   5.325    1.00 0.00 ? 54  ILE A HG22 1  
ATOM 880   H HG23 . ILE A 1 59  ? -23.879  38.961   6.006    1.00 0.00 ? 54  ILE A HG23 1  
ATOM 881   H HD11 . ILE A 1 59  ? -23.607  38.665   1.918    1.00 0.00 ? 54  ILE A HD11 1  
ATOM 882   H HD12 . ILE A 1 59  ? -25.362  38.492   1.954    1.00 0.00 ? 54  ILE A HD12 1  
ATOM 883   H HD13 . ILE A 1 59  ? -24.335  37.058   1.873    1.00 0.00 ? 54  ILE A HD13 1  
ATOM 884   N N    . LEU A 1 60  ? -28.234  38.363   2.859    1.00 0.00 ? 55  LEU A N    1  
ATOM 885   C CA   . LEU A 1 60  ? -28.784  37.624   1.691    1.00 0.00 ? 55  LEU A CA   1  
ATOM 886   C C    . LEU A 1 60  ? -27.708  37.587   0.601    1.00 0.00 ? 55  LEU A C    1  
ATOM 887   O O    . LEU A 1 60  ? -27.063  38.591   0.322    1.00 0.00 ? 55  LEU A O    1  
ATOM 888   C CB   . LEU A 1 60  ? -30.009  38.420   1.232    1.00 0.00 ? 55  LEU A CB   1  
ATOM 889   C CG   . LEU A 1 60  ? -31.025  38.515   2.375    1.00 0.00 ? 55  LEU A CG   1  
ATOM 890   C CD1  . LEU A 1 60  ? -32.253  39.295   1.901    1.00 0.00 ? 55  LEU A CD1  1  
ATOM 891   C CD2  . LEU A 1 60  ? -31.450  37.106   2.806    1.00 0.00 ? 55  LEU A CD2  1  
ATOM 892   H H    . LEU A 1 60  ? -28.624  39.217   3.131    1.00 0.00 ? 55  LEU A H    1  
ATOM 893   H HA   . LEU A 1 60  ? -29.070  36.623   1.977    1.00 0.00 ? 55  LEU A HA   1  
ATOM 894   H HB2  . LEU A 1 60  ? -29.705  39.412   0.940    1.00 0.00 ? 55  LEU A HB2  1  
ATOM 895   H HB3  . LEU A 1 60  ? -30.466  37.922   0.390    1.00 0.00 ? 55  LEU A HB3  1  
ATOM 896   H HG   . LEU A 1 60  ? -30.576  39.029   3.213    1.00 0.00 ? 55  LEU A HG   1  
ATOM 897   H HD11 . LEU A 1 60  ? -32.975  39.351   2.702    1.00 0.00 ? 55  LEU A HD11 1  
ATOM 898   H HD12 . LEU A 1 60  ? -32.693  38.792   1.053    1.00 0.00 ? 55  LEU A HD12 1  
ATOM 899   H HD13 . LEU A 1 60  ? -31.957  40.293   1.613    1.00 0.00 ? 55  LEU A HD13 1  
ATOM 900   H HD21 . LEU A 1 60  ? -31.065  36.383   2.102    1.00 0.00 ? 55  LEU A HD21 1  
ATOM 901   H HD22 . LEU A 1 60  ? -32.528  37.046   2.832    1.00 0.00 ? 55  LEU A HD22 1  
ATOM 902   H HD23 . LEU A 1 60  ? -31.055  36.896   3.789    1.00 0.00 ? 55  LEU A HD23 1  
ATOM 903   N N    . SER A 1 61  ? -27.488  36.437   0.013    1.00 0.00 ? 56  SER A N    1  
ATOM 904   C CA   . SER A 1 61  ? -26.434  36.309   -1.034   1.00 0.00 ? 56  SER A CA   1  
ATOM 905   C C    . SER A 1 61  ? -26.970  36.698   -2.411   1.00 0.00 ? 56  SER A C    1  
ATOM 906   O O    . SER A 1 61  ? -28.125  37.040   -2.570   1.00 0.00 ? 56  SER A O    1  
ATOM 907   C CB   . SER A 1 61  ? -26.040  34.833   -1.014   1.00 0.00 ? 56  SER A CB   1  
ATOM 908   O OG   . SER A 1 61  ? -25.587  34.485   0.288    1.00 0.00 ? 56  SER A OG   1  
ATOM 909   H H    . SER A 1 61  ? -28.005  35.649   0.278    1.00 0.00 ? 56  SER A H    1  
ATOM 910   H HA   . SER A 1 61  ? -25.582  36.914   -0.781   1.00 0.00 ? 56  SER A HA   1  
ATOM 911   H HB2  . SER A 1 61  ? -26.894  34.227   -1.267   1.00 0.00 ? 56  SER A HB2  1  
ATOM 912   H HB3  . SER A 1 61  ? -25.254  34.662   -1.738   1.00 0.00 ? 56  SER A HB3  1  
ATOM 913   H HG   . SER A 1 61  ? -24.726  34.888   0.420    1.00 0.00 ? 56  SER A HG   1  
ATOM 914   N N    . ASP A 1 62  ? -26.126  36.647   -3.405   1.00 0.00 ? 57  ASP A N    1  
ATOM 915   C CA   . ASP A 1 62  ? -26.558  37.013   -4.785   1.00 0.00 ? 57  ASP A CA   1  
ATOM 916   C C    . ASP A 1 62  ? -26.798  35.756   -5.628   1.00 0.00 ? 57  ASP A C    1  
ATOM 917   O O    . ASP A 1 62  ? -26.789  35.804   -6.843   1.00 0.00 ? 57  ASP A O    1  
ATOM 918   C CB   . ASP A 1 62  ? -25.398  37.833   -5.352   1.00 0.00 ? 57  ASP A CB   1  
ATOM 919   C CG   . ASP A 1 62  ? -24.132  36.973   -5.402   1.00 0.00 ? 57  ASP A CG   1  
ATOM 920   O OD1  . ASP A 1 62  ? -23.530  36.779   -4.359   1.00 0.00 ? 57  ASP A OD1  1  
ATOM 921   O OD2  . ASP A 1 62  ? -23.788  36.523   -6.483   1.00 0.00 ? 57  ASP A OD2  1  
ATOM 922   H H    . ASP A 1 62  ? -25.203  36.367   -3.241   1.00 0.00 ? 57  ASP A H    1  
ATOM 923   H HA   . ASP A 1 62  ? -27.447  37.617   -4.751   1.00 0.00 ? 57  ASP A HA   1  
ATOM 924   H HB2  . ASP A 1 62  ? -25.647  38.165   -6.349   1.00 0.00 ? 57  ASP A HB2  1  
ATOM 925   H HB3  . ASP A 1 62  ? -25.223  38.690   -4.720   1.00 0.00 ? 57  ASP A HB3  1  
ATOM 926   N N    . ASP A 1 63  ? -27.016  34.635   -4.995   1.00 0.00 ? 58  ASP A N    1  
ATOM 927   C CA   . ASP A 1 63  ? -27.260  33.378   -5.761   1.00 0.00 ? 58  ASP A CA   1  
ATOM 928   C C    . ASP A 1 63  ? -28.717  32.933   -5.597   1.00 0.00 ? 58  ASP A C    1  
ATOM 929   O O    . ASP A 1 63  ? -29.075  31.819   -5.927   1.00 0.00 ? 58  ASP A O    1  
ATOM 930   C CB   . ASP A 1 63  ? -26.313  32.350   -5.143   1.00 0.00 ? 58  ASP A CB   1  
ATOM 931   C CG   . ASP A 1 63  ? -24.910  32.532   -5.725   1.00 0.00 ? 58  ASP A CG   1  
ATOM 932   O OD1  . ASP A 1 63  ? -24.763  32.368   -6.926   1.00 0.00 ? 58  ASP A OD1  1  
ATOM 933   O OD2  . ASP A 1 63  ? -24.007  32.831   -4.962   1.00 0.00 ? 58  ASP A OD2  1  
ATOM 934   H H    . ASP A 1 63  ? -27.023  34.619   -4.016   1.00 0.00 ? 58  ASP A H    1  
ATOM 935   H HA   . ASP A 1 63  ? -27.023  33.519   -6.803   1.00 0.00 ? 58  ASP A HA   1  
ATOM 936   H HB2  . ASP A 1 63  ? -26.280  32.489   -4.072   1.00 0.00 ? 58  ASP A HB2  1  
ATOM 937   H HB3  . ASP A 1 63  ? -26.667  31.354   -5.366   1.00 0.00 ? 58  ASP A HB3  1  
ATOM 938   N N    . VAL A 1 64  ? -29.558  33.793   -5.085   1.00 0.00 ? 59  VAL A N    1  
ATOM 939   C CA   . VAL A 1 64  ? -30.990  33.422   -4.894   1.00 0.00 ? 59  VAL A CA   1  
ATOM 940   C C    . VAL A 1 64  ? -31.883  34.564   -5.394   1.00 0.00 ? 59  VAL A C    1  
ATOM 941   O O    . VAL A 1 64  ? -31.527  35.715   -5.265   1.00 0.00 ? 59  VAL A O    1  
ATOM 942   C CB   . VAL A 1 64  ? -31.154  33.236   -3.379   1.00 0.00 ? 59  VAL A CB   1  
ATOM 943   C CG1  . VAL A 1 64  ? -32.380  32.368   -3.097   1.00 0.00 ? 59  VAL A CG1  1  
ATOM 944   C CG2  . VAL A 1 64  ? -29.909  32.556   -2.796   1.00 0.00 ? 59  VAL A CG2  1  
ATOM 945   H H    . VAL A 1 64  ? -29.250  34.685   -4.821   1.00 0.00 ? 59  VAL A H    1  
ATOM 946   H HA   . VAL A 1 64  ? -31.217  32.503   -5.410   1.00 0.00 ? 59  VAL A HA   1  
ATOM 947   H HB   . VAL A 1 64  ? -31.287  34.202   -2.916   1.00 0.00 ? 59  VAL A HB   1  
ATOM 948   H HG11 . VAL A 1 64  ? -32.405  32.112   -2.048   1.00 0.00 ? 59  VAL A HG11 1  
ATOM 949   H HG12 . VAL A 1 64  ? -32.325  31.465   -3.687   1.00 0.00 ? 59  VAL A HG12 1  
ATOM 950   H HG13 . VAL A 1 64  ? -33.274  32.914   -3.355   1.00 0.00 ? 59  VAL A HG13 1  
ATOM 951   H HG21 . VAL A 1 64  ? -29.524  31.839   -3.506   1.00 0.00 ? 59  VAL A HG21 1  
ATOM 952   H HG22 . VAL A 1 64  ? -30.172  32.049   -1.880   1.00 0.00 ? 59  VAL A HG22 1  
ATOM 953   H HG23 . VAL A 1 64  ? -29.153  33.302   -2.590   1.00 0.00 ? 59  VAL A HG23 1  
ATOM 954   N N    . PRO A 1 65  ? -33.015  34.218   -5.952   1.00 0.00 ? 60  PRO A N    1  
ATOM 955   C CA   . PRO A 1 65  ? -33.946  35.255   -6.466   1.00 0.00 ? 60  PRO A CA   1  
ATOM 956   C C    . PRO A 1 65  ? -34.584  36.022   -5.306   1.00 0.00 ? 60  PRO A C    1  
ATOM 957   O O    . PRO A 1 65  ? -34.921  35.452   -4.287   1.00 0.00 ? 60  PRO A O    1  
ATOM 958   C CB   . PRO A 1 65  ? -34.991  34.450   -7.236   1.00 0.00 ? 60  PRO A CB   1  
ATOM 959   C CG   . PRO A 1 65  ? -34.951  33.086   -6.625   1.00 0.00 ? 60  PRO A CG   1  
ATOM 960   C CD   . PRO A 1 65  ? -33.538  32.859   -6.158   1.00 0.00 ? 60  PRO A CD   1  
ATOM 961   H HA   . PRO A 1 65  ? -33.436  35.931   -7.131   1.00 0.00 ? 60  PRO A HA   1  
ATOM 962   H HB2  . PRO A 1 65  ? -35.970  34.893   -7.113   1.00 0.00 ? 60  PRO A HB2  1  
ATOM 963   H HB3  . PRO A 1 65  ? -34.729  34.394   -8.281   1.00 0.00 ? 60  PRO A HB3  1  
ATOM 964   H HG2  . PRO A 1 65  ? -35.633  33.039   -5.786   1.00 0.00 ? 60  PRO A HG2  1  
ATOM 965   H HG3  . PRO A 1 65  ? -35.215  32.343   -7.360   1.00 0.00 ? 60  PRO A HG3  1  
ATOM 966   H HD2  . PRO A 1 65  ? -33.532  32.300   -5.233   1.00 0.00 ? 60  PRO A HD2  1  
ATOM 967   H HD3  . PRO A 1 65  ? -32.963  32.351   -6.916   1.00 0.00 ? 60  PRO A HD3  1  
ATOM 968   N N    . ILE A 1 66  ? -34.749  37.314   -5.452   1.00 0.00 ? 61  ILE A N    1  
ATOM 969   C CA   . ILE A 1 66  ? -35.364  38.119   -4.354   1.00 0.00 ? 61  ILE A CA   1  
ATOM 970   C C    . ILE A 1 66  ? -36.686  37.478   -3.918   1.00 0.00 ? 61  ILE A C    1  
ATOM 971   O O    . ILE A 1 66  ? -37.275  36.704   -4.647   1.00 0.00 ? 61  ILE A O    1  
ATOM 972   C CB   . ILE A 1 66  ? -35.592  39.513   -4.952   1.00 0.00 ? 61  ILE A CB   1  
ATOM 973   C CG1  . ILE A 1 66  ? -36.088  40.465   -3.862   1.00 0.00 ? 61  ILE A CG1  1  
ATOM 974   C CG2  . ILE A 1 66  ? -36.631  39.442   -6.071   1.00 0.00 ? 61  ILE A CG2  1  
ATOM 975   C CD1  . ILE A 1 66  ? -34.985  40.668   -2.824   1.00 0.00 ? 61  ILE A CD1  1  
ATOM 976   H H    . ILE A 1 66  ? -34.467  37.752   -6.282   1.00 0.00 ? 61  ILE A H    1  
ATOM 977   H HA   . ILE A 1 66  ? -34.688  38.185   -3.517   1.00 0.00 ? 61  ILE A HA   1  
ATOM 978   H HB   . ILE A 1 66  ? -34.660  39.884   -5.355   1.00 0.00 ? 61  ILE A HB   1  
ATOM 979   H HG12 . ILE A 1 66  ? -36.346  41.416   -4.305   1.00 0.00 ? 61  ILE A HG12 1  
ATOM 980   H HG13 . ILE A 1 66  ? -36.958  40.042   -3.382   1.00 0.00 ? 61  ILE A HG13 1  
ATOM 981   H HG21 . ILE A 1 66  ? -37.594  39.749   -5.689   1.00 0.00 ? 61  ILE A HG21 1  
ATOM 982   H HG22 . ILE A 1 66  ? -36.696  38.429   -6.436   1.00 0.00 ? 61  ILE A HG22 1  
ATOM 983   H HG23 . ILE A 1 66  ? -36.337  40.100   -6.877   1.00 0.00 ? 61  ILE A HG23 1  
ATOM 984   H HD11 . ILE A 1 66  ? -34.827  39.748   -2.282   1.00 0.00 ? 61  ILE A HD11 1  
ATOM 985   H HD12 . ILE A 1 66  ? -35.279  41.446   -2.135   1.00 0.00 ? 61  ILE A HD12 1  
ATOM 986   H HD13 . ILE A 1 66  ? -34.071  40.954   -3.323   1.00 0.00 ? 61  ILE A HD13 1  
ATOM 987   N N    . ARG A 1 67  ? -37.139  37.780   -2.727   1.00 0.00 ? 62  ARG A N    1  
ATOM 988   C CA   . ARG A 1 67  ? -38.414  37.182   -2.212   1.00 0.00 ? 62  ARG A CA   1  
ATOM 989   C C    . ARG A 1 67  ? -38.203  35.714   -1.811   1.00 0.00 ? 62  ARG A C    1  
ATOM 990   O O    . ARG A 1 67  ? -39.052  35.110   -1.184   1.00 0.00 ? 62  ARG A O    1  
ATOM 991   C CB   . ARG A 1 67  ? -39.431  37.291   -3.354   1.00 0.00 ? 62  ARG A CB   1  
ATOM 992   C CG   . ARG A 1 67  ? -40.822  37.540   -2.773   1.00 0.00 ? 62  ARG A CG   1  
ATOM 993   C CD   . ARG A 1 67  ? -40.935  38.999   -2.325   1.00 0.00 ? 62  ARG A CD   1  
ATOM 994   N NE   . ARG A 1 67  ? -41.720  38.953   -1.061   1.00 0.00 ? 62  ARG A NE   1  
ATOM 995   C CZ   . ARG A 1 67  ? -43.022  38.876   -1.104   1.00 0.00 ? 62  ARG A CZ   1  
ATOM 996   N NH1  . ARG A 1 67  ? -43.733  39.951   -1.308   1.00 0.00 ? 62  ARG A NH1  1  
ATOM 997   N NH2  . ARG A 1 67  ? -43.612  37.724   -0.942   1.00 0.00 ? 62  ARG A NH2  1  
ATOM 998   H H    . ARG A 1 67  ? -36.630  38.395   -2.159   1.00 0.00 ? 62  ARG A H    1  
ATOM 999   H HA   . ARG A 1 67  ? -38.765  37.746   -1.362   1.00 0.00 ? 62  ARG A HA   1  
ATOM 1000  H HB2  . ARG A 1 67  ? -39.157  38.111   -4.002   1.00 0.00 ? 62  ARG A HB2  1  
ATOM 1001  H HB3  . ARG A 1 67  ? -39.438  36.371   -3.919   1.00 0.00 ? 62  ARG A HB3  1  
ATOM 1002  H HG2  . ARG A 1 67  ? -41.569  37.334   -3.526   1.00 0.00 ? 62  ARG A HG2  1  
ATOM 1003  H HG3  . ARG A 1 67  ? -40.978  36.892   -1.923   1.00 0.00 ? 62  ARG A HG3  1  
ATOM 1004  H HD2  . ARG A 1 67  ? -39.951  39.413   -2.146   1.00 0.00 ? 62  ARG A HD2  1  
ATOM 1005  H HD3  . ARG A 1 67  ? -41.460  39.581   -3.066   1.00 0.00 ? 62  ARG A HD3  1  
ATOM 1006  H HE   . ARG A 1 67  ? -41.259  38.981   -0.196   1.00 0.00 ? 62  ARG A HE   1  
ATOM 1007  H HH11 . ARG A 1 67  ? -43.280  40.834   -1.432   1.00 0.00 ? 62  ARG A HH11 1  
ATOM 1008  H HH12 . ARG A 1 67  ? -44.731  39.891   -1.342   1.00 0.00 ? 62  ARG A HH12 1  
ATOM 1009  H HH21 . ARG A 1 67  ? -43.067  36.900   -0.785   1.00 0.00 ? 62  ARG A HH21 1  
ATOM 1010  H HH22 . ARG A 1 67  ? -44.610  37.664   -0.975   1.00 0.00 ? 62  ARG A HH22 1  
ATOM 1011  N N    . ASP A 1 68  ? -37.075  35.137   -2.149   1.00 0.00 ? 63  ASP A N    1  
ATOM 1012  C CA   . ASP A 1 68  ? -36.817  33.718   -1.764   1.00 0.00 ? 63  ASP A CA   1  
ATOM 1013  C C    . ASP A 1 68  ? -36.472  33.653   -0.275   1.00 0.00 ? 63  ASP A C    1  
ATOM 1014  O O    . ASP A 1 68  ? -36.682  32.653   0.382    1.00 0.00 ? 63  ASP A O    1  
ATOM 1015  C CB   . ASP A 1 68  ? -35.624  33.281   -2.616   1.00 0.00 ? 63  ASP A CB   1  
ATOM 1016  C CG   . ASP A 1 68  ? -35.369  31.787   -2.408   1.00 0.00 ? 63  ASP A CG   1  
ATOM 1017  O OD1  . ASP A 1 68  ? -35.303  31.371   -1.263   1.00 0.00 ? 63  ASP A OD1  1  
ATOM 1018  O OD2  . ASP A 1 68  ? -35.244  31.084   -3.397   1.00 0.00 ? 63  ASP A OD2  1  
ATOM 1019  H H    . ASP A 1 68  ? -36.396  35.637   -2.640   1.00 0.00 ? 63  ASP A H    1  
ATOM 1020  H HA   . ASP A 1 68  ? -37.676  33.103   -1.983   1.00 0.00 ? 63  ASP A HA   1  
ATOM 1021  H HB2  . ASP A 1 68  ? -35.838  33.469   -3.658   1.00 0.00 ? 63  ASP A HB2  1  
ATOM 1022  H HB3  . ASP A 1 68  ? -34.747  33.838   -2.322   1.00 0.00 ? 63  ASP A HB3  1  
ATOM 1023  N N    . TYR A 1 69  ? -35.967  34.732   0.261    1.00 0.00 ? 64  TYR A N    1  
ATOM 1024  C CA   . TYR A 1 69  ? -35.629  34.771   1.707    1.00 0.00 ? 64  TYR A CA   1  
ATOM 1025  C C    . TYR A 1 69  ? -36.860  35.217   2.493    1.00 0.00 ? 64  TYR A C    1  
ATOM 1026  O O    . TYR A 1 69  ? -36.850  35.267   3.707    1.00 0.00 ? 64  TYR A O    1  
ATOM 1027  C CB   . TYR A 1 69  ? -34.521  35.816   1.828    1.00 0.00 ? 64  TYR A CB   1  
ATOM 1028  C CG   . TYR A 1 69  ? -33.246  35.280   1.227    1.00 0.00 ? 64  TYR A CG   1  
ATOM 1029  C CD1  . TYR A 1 69  ? -32.465  34.370   1.947    1.00 0.00 ? 64  TYR A CD1  1  
ATOM 1030  C CD2  . TYR A 1 69  ? -32.839  35.702   -0.044   1.00 0.00 ? 64  TYR A CD2  1  
ATOM 1031  C CE1  . TYR A 1 69  ? -31.276  33.879   1.396    1.00 0.00 ? 64  TYR A CE1  1  
ATOM 1032  C CE2  . TYR A 1 69  ? -31.650  35.214   -0.594   1.00 0.00 ? 64  TYR A CE2  1  
ATOM 1033  C CZ   . TYR A 1 69  ? -30.868  34.302   0.125    1.00 0.00 ? 64  TYR A CZ   1  
ATOM 1034  O OH   . TYR A 1 69  ? -29.693  33.822   -0.416   1.00 0.00 ? 64  TYR A OH   1  
ATOM 1035  H H    . TYR A 1 69  ? -35.832  35.528   -0.284   1.00 0.00 ? 64  TYR A H    1  
ATOM 1036  H HA   . TYR A 1 69  ? -35.280  33.810   2.048    1.00 0.00 ? 64  TYR A HA   1  
ATOM 1037  H HB2  . TYR A 1 69  ? -34.816  36.713   1.304    1.00 0.00 ? 64  TYR A HB2  1  
ATOM 1038  H HB3  . TYR A 1 69  ? -34.357  36.046   2.870    1.00 0.00 ? 64  TYR A HB3  1  
ATOM 1039  H HD1  . TYR A 1 69  ? -32.780  34.044   2.927    1.00 0.00 ? 64  TYR A HD1  1  
ATOM 1040  H HD2  . TYR A 1 69  ? -33.444  36.404   -0.602   1.00 0.00 ? 64  TYR A HD2  1  
ATOM 1041  H HE1  . TYR A 1 69  ? -30.674  33.176   1.950    1.00 0.00 ? 64  TYR A HE1  1  
ATOM 1042  H HE2  . TYR A 1 69  ? -31.337  35.541   -1.573   1.00 0.00 ? 64  TYR A HE2  1  
ATOM 1043  H HH   . TYR A 1 69  ? -29.608  32.898   -0.168   1.00 0.00 ? 64  TYR A HH   1  
ATOM 1044  N N    . ARG A 1 70  ? -37.924  35.545   1.796    1.00 0.00 ? 65  ARG A N    1  
ATOM 1045  C CA   . ARG A 1 70  ? -39.174  35.992   2.474    1.00 0.00 ? 65  ARG A CA   1  
ATOM 1046  C C    . ARG A 1 70  ? -38.963  37.361   3.124    1.00 0.00 ? 65  ARG A C    1  
ATOM 1047  O O    . ARG A 1 70  ? -39.391  37.605   4.235    1.00 0.00 ? 65  ARG A O    1  
ATOM 1048  C CB   . ARG A 1 70  ? -39.457  34.920   3.523    1.00 0.00 ? 65  ARG A CB   1  
ATOM 1049  C CG   . ARG A 1 70  ? -40.968  34.713   3.658    1.00 0.00 ? 65  ARG A CG   1  
ATOM 1050  C CD   . ARG A 1 70  ? -41.375  33.418   2.950    1.00 0.00 ? 65  ARG A CD   1  
ATOM 1051  N NE   . ARG A 1 70  ? -42.705  33.070   3.521    1.00 0.00 ? 65  ARG A NE   1  
ATOM 1052  C CZ   . ARG A 1 70  ? -42.785  32.266   4.546    1.00 0.00 ? 65  ARG A CZ   1  
ATOM 1053  N NH1  . ARG A 1 70  ? -42.482  31.004   4.411    1.00 0.00 ? 65  ARG A NH1  1  
ATOM 1054  N NH2  . ARG A 1 70  ? -43.167  32.725   5.706    1.00 0.00 ? 65  ARG A NH2  1  
ATOM 1055  H H    . ARG A 1 70  ? -37.897  35.497   0.818    1.00 0.00 ? 65  ARG A H    1  
ATOM 1056  H HA   . ARG A 1 70  ? -39.987  36.036   1.767    1.00 0.00 ? 65  ARG A HA   1  
ATOM 1057  H HB2  . ARG A 1 70  ? -38.987  33.996   3.213    1.00 0.00 ? 65  ARG A HB2  1  
ATOM 1058  H HB3  . ARG A 1 70  ? -39.049  35.230   4.472    1.00 0.00 ? 65  ARG A HB3  1  
ATOM 1059  H HG2  . ARG A 1 70  ? -41.230  34.649   4.704    1.00 0.00 ? 65  ARG A HG2  1  
ATOM 1060  H HG3  . ARG A 1 70  ? -41.488  35.545   3.207    1.00 0.00 ? 65  ARG A HG3  1  
ATOM 1061  H HD2  . ARG A 1 70  ? -41.451  33.582   1.884    1.00 0.00 ? 65  ARG A HD2  1  
ATOM 1062  H HD3  . ARG A 1 70  ? -40.665  32.634   3.162    1.00 0.00 ? 65  ARG A HD3  1  
ATOM 1063  H HE   . ARG A 1 70  ? -43.521  33.445   3.127    1.00 0.00 ? 65  ARG A HE   1  
ATOM 1064  H HH11 . ARG A 1 70  ? -42.190  30.652   3.521    1.00 0.00 ? 65  ARG A HH11 1  
ATOM 1065  H HH12 . ARG A 1 70  ? -42.543  30.388   5.197    1.00 0.00 ? 65  ARG A HH12 1  
ATOM 1066  H HH21 . ARG A 1 70  ? -43.399  33.692   5.810    1.00 0.00 ? 65  ARG A HH21 1  
ATOM 1067  H HH22 . ARG A 1 70  ? -43.228  32.109   6.492    1.00 0.00 ? 65  ARG A HH22 1  
ATOM 1068  N N    . ILE A 1 71  ? -38.310  38.259   2.432    1.00 0.00 ? 66  ILE A N    1  
ATOM 1069  C CA   . ILE A 1 71  ? -38.075  39.614   2.994    1.00 0.00 ? 66  ILE A CA   1  
ATOM 1070  C C    . ILE A 1 71  ? -39.413  40.299   3.264    1.00 0.00 ? 66  ILE A C    1  
ATOM 1071  O O    . ILE A 1 71  ? -40.455  39.846   2.834    1.00 0.00 ? 66  ILE A O    1  
ATOM 1072  C CB   . ILE A 1 71  ? -37.291  40.364   1.913    1.00 0.00 ? 66  ILE A CB   1  
ATOM 1073  C CG1  . ILE A 1 71  ? -35.954  39.661   1.671    1.00 0.00 ? 66  ILE A CG1  1  
ATOM 1074  C CG2  . ILE A 1 71  ? -37.028  41.801   2.369    1.00 0.00 ? 66  ILE A CG2  1  
ATOM 1075  C CD1  . ILE A 1 71  ? -35.251  40.306   0.476    1.00 0.00 ? 66  ILE A CD1  1  
ATOM 1076  H H    . ILE A 1 71  ? -37.980  38.043   1.542    1.00 0.00 ? 66  ILE A H    1  
ATOM 1077  H HA   . ILE A 1 71  ? -37.492  39.552   3.895    1.00 0.00 ? 66  ILE A HA   1  
ATOM 1078  H HB   . ILE A 1 71  ? -37.864  40.378   0.997    1.00 0.00 ? 66  ILE A HB   1  
ATOM 1079  H HG12 . ILE A 1 71  ? -35.333  39.756   2.550    1.00 0.00 ? 66  ILE A HG12 1  
ATOM 1080  H HG13 . ILE A 1 71  ? -36.127  38.616   1.463    1.00 0.00 ? 66  ILE A HG13 1  
ATOM 1081  H HG21 . ILE A 1 71  ? -36.666  41.795   3.387    1.00 0.00 ? 66  ILE A HG21 1  
ATOM 1082  H HG22 . ILE A 1 71  ? -37.945  42.369   2.317    1.00 0.00 ? 66  ILE A HG22 1  
ATOM 1083  H HG23 . ILE A 1 71  ? -36.288  42.254   1.726    1.00 0.00 ? 66  ILE A HG23 1  
ATOM 1084  H HD11 . ILE A 1 71  ? -35.498  41.357   0.439    1.00 0.00 ? 66  ILE A HD11 1  
ATOM 1085  H HD12 . ILE A 1 71  ? -35.577  39.828   -0.435   1.00 0.00 ? 66  ILE A HD12 1  
ATOM 1086  H HD13 . ILE A 1 71  ? -34.182  40.191   0.582    1.00 0.00 ? 66  ILE A HD13 1  
ATOM 1087  N N    . ASP A 1 72  ? -39.385  41.386   3.973    1.00 0.00 ? 67  ASP A N    1  
ATOM 1088  C CA   . ASP A 1 72  ? -40.650  42.114   4.281    1.00 0.00 ? 67  ASP A CA   1  
ATOM 1089  C C    . ASP A 1 72  ? -40.469  43.613   4.039    1.00 0.00 ? 67  ASP A C    1  
ATOM 1090  O O    . ASP A 1 72  ? -39.647  44.257   4.662    1.00 0.00 ? 67  ASP A O    1  
ATOM 1091  C CB   . ASP A 1 72  ? -40.915  41.836   5.761    1.00 0.00 ? 67  ASP A CB   1  
ATOM 1092  C CG   . ASP A 1 72  ? -41.891  40.666   5.896    1.00 0.00 ? 67  ASP A CG   1  
ATOM 1093  O OD1  . ASP A 1 72  ? -41.583  39.602   5.386    1.00 0.00 ? 67  ASP A OD1  1  
ATOM 1094  O OD2  . ASP A 1 72  ? -42.930  40.854   6.507    1.00 0.00 ? 67  ASP A OD2  1  
ATOM 1095  H H    . ASP A 1 72  ? -38.530  41.724   4.304    1.00 0.00 ? 67  ASP A H    1  
ATOM 1096  H HA   . ASP A 1 72  ? -41.461  41.730   3.683    1.00 0.00 ? 67  ASP A HA   1  
ATOM 1097  H HB2  . ASP A 1 72  ? -39.985  41.589   6.253    1.00 0.00 ? 67  ASP A HB2  1  
ATOM 1098  H HB3  . ASP A 1 72  ? -41.344  42.714   6.221    1.00 0.00 ? 67  ASP A HB3  1  
ATOM 1099  N N    . GLU A 1 73  ? -41.234  44.176   3.140    1.00 0.00 ? 68  GLU A N    1  
ATOM 1100  C CA   . GLU A 1 73  ? -41.110  45.638   2.860    1.00 0.00 ? 68  GLU A CA   1  
ATOM 1101  C C    . GLU A 1 73  ? -41.253  46.434   4.160    1.00 0.00 ? 68  GLU A C    1  
ATOM 1102  O O    . GLU A 1 73  ? -40.630  47.462   4.342    1.00 0.00 ? 68  GLU A O    1  
ATOM 1103  C CB   . GLU A 1 73  ? -42.260  45.957   1.902    1.00 0.00 ? 68  GLU A CB   1  
ATOM 1104  C CG   . GLU A 1 73  ? -42.260  47.452   1.574    1.00 0.00 ? 68  GLU A CG   1  
ATOM 1105  C CD   . GLU A 1 73  ? -43.088  48.205   2.617    1.00 0.00 ? 68  GLU A CD   1  
ATOM 1106  O OE1  . GLU A 1 73  ? -44.266  47.909   2.736    1.00 0.00 ? 68  GLU A OE1  1  
ATOM 1107  O OE2  . GLU A 1 73  ? -42.530  49.063   3.281    1.00 0.00 ? 68  GLU A OE2  1  
ATOM 1108  H H    . GLU A 1 73  ? -41.891  43.637   2.652    1.00 0.00 ? 68  GLU A H    1  
ATOM 1109  H HA   . GLU A 1 73  ? -40.165  45.853   2.387    1.00 0.00 ? 68  GLU A HA   1  
ATOM 1110  H HB2  . GLU A 1 73  ? -42.137  45.389   0.991    1.00 0.00 ? 68  GLU A HB2  1  
ATOM 1111  H HB3  . GLU A 1 73  ? -43.198  45.693   2.367    1.00 0.00 ? 68  GLU A HB3  1  
ATOM 1112  H HG2  . GLU A 1 73  ? -41.245  47.822   1.583    1.00 0.00 ? 68  GLU A HG2  1  
ATOM 1113  H HG3  . GLU A 1 73  ? -42.691  47.606   0.596    1.00 0.00 ? 68  GLU A HG3  1  
ATOM 1114  N N    . LYS A 1 74  ? -42.066  45.961   5.066    1.00 0.00 ? 69  LYS A N    1  
ATOM 1115  C CA   . LYS A 1 74  ? -42.248  46.684   6.358    1.00 0.00 ? 69  LYS A CA   1  
ATOM 1116  C C    . LYS A 1 74  ? -40.916  46.762   7.110    1.00 0.00 ? 69  LYS A C    1  
ATOM 1117  O O    . LYS A 1 74  ? -40.727  47.603   7.967    1.00 0.00 ? 69  LYS A O    1  
ATOM 1118  C CB   . LYS A 1 74  ? -43.261  45.851   7.144    1.00 0.00 ? 69  LYS A CB   1  
ATOM 1119  C CG   . LYS A 1 74  ? -44.681  46.247   6.728    1.00 0.00 ? 69  LYS A CG   1  
ATOM 1120  C CD   . LYS A 1 74  ? -45.607  46.201   7.948    1.00 0.00 ? 69  LYS A CD   1  
ATOM 1121  C CE   . LYS A 1 74  ? -46.286  47.561   8.130    1.00 0.00 ? 69  LYS A CE   1  
ATOM 1122  N NZ   . LYS A 1 74  ? -45.203  48.472   8.591    1.00 0.00 ? 69  LYS A NZ   1  
ATOM 1123  H H    . LYS A 1 74  ? -42.554  45.128   4.898    1.00 0.00 ? 69  LYS A H    1  
ATOM 1124  H HA   . LYS A 1 74  ? -42.640  47.673   6.183    1.00 0.00 ? 69  LYS A HA   1  
ATOM 1125  H HB2  . LYS A 1 74  ? -43.103  44.803   6.937    1.00 0.00 ? 69  LYS A HB2  1  
ATOM 1126  H HB3  . LYS A 1 74  ? -43.134  46.033   8.201    1.00 0.00 ? 69  LYS A HB3  1  
ATOM 1127  H HG2  . LYS A 1 74  ? -44.669  47.248   6.320    1.00 0.00 ? 69  LYS A HG2  1  
ATOM 1128  H HG3  . LYS A 1 74  ? -45.041  45.558   5.980    1.00 0.00 ? 69  LYS A HG3  1  
ATOM 1129  H HD2  . LYS A 1 74  ? -46.359  45.439   7.799    1.00 0.00 ? 69  LYS A HD2  1  
ATOM 1130  H HD3  . LYS A 1 74  ? -45.031  45.968   8.831    1.00 0.00 ? 69  LYS A HD3  1  
ATOM 1131  H HE2  . LYS A 1 74  ? -46.696  47.903   7.189    1.00 0.00 ? 69  LYS A HE2  1  
ATOM 1132  H HE3  . LYS A 1 74  ? -47.061  47.498   8.878    1.00 0.00 ? 69  LYS A HE3  1  
ATOM 1133  H HZ1  . LYS A 1 74  ? -44.833  48.139   9.504    1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 1134  H HZ2  . LYS A 1 74  ? -45.583  49.435   8.700    1.00 0.00 ? 69  LYS A HZ2  1  
ATOM 1135  H HZ3  . LYS A 1 74  ? -44.434  48.480   7.891    1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 1136  N N    . ASN A 1 75  ? -39.989  45.895   6.793    1.00 0.00 ? 70  ASN A N    1  
ATOM 1137  C CA   . ASN A 1 75  ? -38.671  45.926   7.486    1.00 0.00 ? 70  ASN A CA   1  
ATOM 1138  C C    . ASN A 1 75  ? -37.628  46.596   6.590    1.00 0.00 ? 70  ASN A C    1  
ATOM 1139  O O    . ASN A 1 75  ? -37.957  47.216   5.598    1.00 0.00 ? 70  ASN A O    1  
ATOM 1140  C CB   . ASN A 1 75  ? -38.312  44.459   7.724    1.00 0.00 ? 70  ASN A CB   1  
ATOM 1141  C CG   . ASN A 1 75  ? -39.363  43.814   8.630    1.00 0.00 ? 70  ASN A CG   1  
ATOM 1142  O OD1  . ASN A 1 75  ? -40.020  44.491   9.395    1.00 0.00 ? 70  ASN A OD1  1  
ATOM 1143  N ND2  . ASN A 1 75  ? -39.550  42.524   8.575    1.00 0.00 ? 70  ASN A ND2  1  
ATOM 1144  H H    . ASN A 1 75  ? -40.157  45.226   6.095    1.00 0.00 ? 70  ASN A H    1  
ATOM 1145  H HA   . ASN A 1 75  ? -38.751  46.445   8.429    1.00 0.00 ? 70  ASN A HA   1  
ATOM 1146  H HB2  . ASN A 1 75  ? -38.282  43.938   6.778    1.00 0.00 ? 70  ASN A HB2  1  
ATOM 1147  H HB3  . ASN A 1 75  ? -37.344  44.398   8.199    1.00 0.00 ? 70  ASN A HB3  1  
ATOM 1148  H HD21 . ASN A 1 75  ? -39.020  41.978   7.958    1.00 0.00 ? 70  ASN A HD21 1  
ATOM 1149  H HD22 . ASN A 1 75  ? -40.221  42.101   9.151    1.00 0.00 ? 70  ASN A HD22 1  
ATOM 1150  N N    . PHE A 1 76  ? -36.375  46.474   6.931    1.00 0.00 ? 71  PHE A N    1  
ATOM 1151  C CA   . PHE A 1 76  ? -35.311  47.102   6.096    1.00 0.00 ? 71  PHE A CA   1  
ATOM 1152  C C    . PHE A 1 76  ? -34.109  46.162   5.986    1.00 0.00 ? 71  PHE A C    1  
ATOM 1153  O O    . PHE A 1 76  ? -33.749  45.486   6.930    1.00 0.00 ? 71  PHE A O    1  
ATOM 1154  C CB   . PHE A 1 76  ? -34.931  48.390   6.830    1.00 0.00 ? 71  PHE A CB   1  
ATOM 1155  C CG   . PHE A 1 76  ? -34.485  48.066   8.237    1.00 0.00 ? 71  PHE A CG   1  
ATOM 1156  C CD1  . PHE A 1 76  ? -33.158  47.693   8.482    1.00 0.00 ? 71  PHE A CD1  1  
ATOM 1157  C CD2  . PHE A 1 76  ? -35.398  48.140   9.295    1.00 0.00 ? 71  PHE A CD2  1  
ATOM 1158  C CE1  . PHE A 1 76  ? -32.745  47.393   9.786    1.00 0.00 ? 71  PHE A CE1  1  
ATOM 1159  C CE2  . PHE A 1 76  ? -34.985  47.841   10.599   1.00 0.00 ? 71  PHE A CE2  1  
ATOM 1160  C CZ   . PHE A 1 76  ? -33.658  47.467   10.844   1.00 0.00 ? 71  PHE A CZ   1  
ATOM 1161  H H    . PHE A 1 76  ? -36.133  45.968   7.734    1.00 0.00 ? 71  PHE A H    1  
ATOM 1162  H HA   . PHE A 1 76  ? -35.694  47.337   5.117    1.00 0.00 ? 71  PHE A HA   1  
ATOM 1163  H HB2  . PHE A 1 76  ? -34.128  48.880   6.301    1.00 0.00 ? 71  PHE A HB2  1  
ATOM 1164  H HB3  . PHE A 1 76  ? -35.788  49.046   6.868    1.00 0.00 ? 71  PHE A HB3  1  
ATOM 1165  H HD1  . PHE A 1 76  ? -32.453  47.636   7.666    1.00 0.00 ? 71  PHE A HD1  1  
ATOM 1166  H HD2  . PHE A 1 76  ? -36.422  48.428   9.106    1.00 0.00 ? 71  PHE A HD2  1  
ATOM 1167  H HE1  . PHE A 1 76  ? -31.721  47.106   9.975    1.00 0.00 ? 71  PHE A HE1  1  
ATOM 1168  H HE2  . PHE A 1 76  ? -35.690  47.898   11.415   1.00 0.00 ? 71  PHE A HE2  1  
ATOM 1169  H HZ   . PHE A 1 76  ? -33.340  47.236   11.850   1.00 0.00 ? 71  PHE A HZ   1  
ATOM 1170  N N    . VAL A 1 77  ? -33.488  46.113   4.839    1.00 0.00 ? 72  VAL A N    1  
ATOM 1171  C CA   . VAL A 1 77  ? -32.311  45.213   4.665    1.00 0.00 ? 72  VAL A CA   1  
ATOM 1172  C C    . VAL A 1 77  ? -31.013  46.012   4.807    1.00 0.00 ? 72  VAL A C    1  
ATOM 1173  O O    . VAL A 1 77  ? -30.666  46.810   3.958    1.00 0.00 ? 72  VAL A O    1  
ATOM 1174  C CB   . VAL A 1 77  ? -32.444  44.650   3.248    1.00 0.00 ? 72  VAL A CB   1  
ATOM 1175  C CG1  . VAL A 1 77  ? -31.300  43.671   2.976    1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1176  C CG2  . VAL A 1 77  ? -33.781  43.917   3.111    1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1177  H H    . VAL A 1 77  ? -33.798  46.664   4.091    1.00 0.00 ? 72  VAL A H    1  
ATOM 1178  H HA   . VAL A 1 77  ? -32.343  44.412   5.384    1.00 0.00 ? 72  VAL A HA   1  
ATOM 1179  H HB   . VAL A 1 77  ? -32.401  45.460   2.534    1.00 0.00 ? 72  VAL A HB   1  
ATOM 1180  H HG11 . VAL A 1 77  ? -31.610  42.672   3.247    1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1181  H HG12 . VAL A 1 77  ? -30.438  43.951   3.562    1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1182  H HG13 . VAL A 1 77  ? -31.047  43.696   1.926    1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1183  H HG21 . VAL A 1 77  ? -34.558  44.626   2.868    1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1184  H HG22 . VAL A 1 77  ? -34.020  43.427   4.044    1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1185  H HG23 . VAL A 1 77  ? -33.709  43.179   2.326    1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1186  N N    . VAL A 1 78  ? -30.295  45.801   5.877    1.00 0.00 ? 73  VAL A N    1  
ATOM 1187  C CA   . VAL A 1 78  ? -29.018  46.545   6.084    1.00 0.00 ? 73  VAL A CA   1  
ATOM 1188  C C    . VAL A 1 78  ? -27.936  46.011   5.138    1.00 0.00 ? 73  VAL A C    1  
ATOM 1189  O O    . VAL A 1 78  ? -27.025  45.320   5.547    1.00 0.00 ? 73  VAL A O    1  
ATOM 1190  C CB   . VAL A 1 78  ? -28.634  46.282   7.542    1.00 0.00 ? 73  VAL A CB   1  
ATOM 1191  C CG1  . VAL A 1 78  ? -27.345  47.036   7.877    1.00 0.00 ? 73  VAL A CG1  1  
ATOM 1192  C CG2  . VAL A 1 78  ? -29.758  46.769   8.461    1.00 0.00 ? 73  VAL A CG2  1  
ATOM 1193  H H    . VAL A 1 78  ? -30.598  45.152   6.547    1.00 0.00 ? 73  VAL A H    1  
ATOM 1194  H HA   . VAL A 1 78  ? -29.167  47.600   5.928    1.00 0.00 ? 73  VAL A HA   1  
ATOM 1195  H HB   . VAL A 1 78  ? -28.480  45.223   7.688    1.00 0.00 ? 73  VAL A HB   1  
ATOM 1196  H HG11 . VAL A 1 78  ? -26.540  46.664   7.261    1.00 0.00 ? 73  VAL A HG11 1  
ATOM 1197  H HG12 . VAL A 1 78  ? -27.101  46.885   8.918    1.00 0.00 ? 73  VAL A HG12 1  
ATOM 1198  H HG13 . VAL A 1 78  ? -27.485  48.090   7.689    1.00 0.00 ? 73  VAL A HG13 1  
ATOM 1199  H HG21 . VAL A 1 78  ? -30.140  47.711   8.095    1.00 0.00 ? 73  VAL A HG21 1  
ATOM 1200  H HG22 . VAL A 1 78  ? -29.374  46.900   9.461    1.00 0.00 ? 73  VAL A HG22 1  
ATOM 1201  H HG23 . VAL A 1 78  ? -30.554  46.039   8.473    1.00 0.00 ? 73  VAL A HG23 1  
ATOM 1202  N N    . VAL A 1 79  ? -28.026  46.328   3.875    1.00 0.00 ? 74  VAL A N    1  
ATOM 1203  C CA   . VAL A 1 79  ? -26.996  45.836   2.916    1.00 0.00 ? 74  VAL A CA   1  
ATOM 1204  C C    . VAL A 1 79  ? -25.624  46.412   3.279    1.00 0.00 ? 74  VAL A C    1  
ATOM 1205  O O    . VAL A 1 79  ? -25.496  47.569   3.635    1.00 0.00 ? 74  VAL A O    1  
ATOM 1206  C CB   . VAL A 1 79  ? -27.453  46.322   1.535    1.00 0.00 ? 74  VAL A CB   1  
ATOM 1207  C CG1  . VAL A 1 79  ? -27.569  47.849   1.524    1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1208  C CG2  . VAL A 1 79  ? -26.435  45.884   0.479    1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1209  H H    . VAL A 1 79  ? -28.765  46.888   3.559    1.00 0.00 ? 74  VAL A H    1  
ATOM 1210  H HA   . VAL A 1 79  ? -26.962  44.760   2.931    1.00 0.00 ? 74  VAL A HA   1  
ATOM 1211  H HB   . VAL A 1 79  ? -28.416  45.890   1.305    1.00 0.00 ? 74  VAL A HB   1  
ATOM 1212  H HG11 . VAL A 1 79  ? -26.761  48.279   2.093    1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1213  H HG12 . VAL A 1 79  ? -28.512  48.141   1.960    1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1214  H HG13 . VAL A 1 79  ? -27.520  48.205   0.505    1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1215  H HG21 . VAL A 1 79  ? -26.951  45.636   -0.437   1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1216  H HG22 . VAL A 1 79  ? -25.897  45.018   0.835    1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1217  H HG23 . VAL A 1 79  ? -25.739  46.689   0.293    1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1218  N N    . MET A 1 80  ? -24.598  45.610   3.194    1.00 0.00 ? 75  MET A N    1  
ATOM 1219  C CA   . MET A 1 80  ? -23.233  46.104   3.531    1.00 0.00 ? 75  MET A CA   1  
ATOM 1220  C C    . MET A 1 80  ? -22.484  46.468   2.248    1.00 0.00 ? 75  MET A C    1  
ATOM 1221  O O    . MET A 1 80  ? -22.827  46.014   1.175    1.00 0.00 ? 75  MET A O    1  
ATOM 1222  C CB   . MET A 1 80  ? -22.548  44.934   4.241    1.00 0.00 ? 75  MET A CB   1  
ATOM 1223  C CG   . MET A 1 80  ? -22.447  45.231   5.739    1.00 0.00 ? 75  MET A CG   1  
ATOM 1224  S SD   . MET A 1 80  ? -22.049  43.707   6.630    1.00 0.00 ? 75  MET A SD   1  
ATOM 1225  C CE   . MET A 1 80  ? -20.814  44.415   7.747    1.00 0.00 ? 75  MET A CE   1  
ATOM 1226  H H    . MET A 1 80  ? -24.725  44.680   2.909    1.00 0.00 ? 75  MET A H    1  
ATOM 1227  H HA   . MET A 1 80  ? -23.291  46.956   4.191    1.00 0.00 ? 75  MET A HA   1  
ATOM 1228  H HB2  . MET A 1 80  ? -23.127  44.034   4.090    1.00 0.00 ? 75  MET A HB2  1  
ATOM 1229  H HB3  . MET A 1 80  ? -21.557  44.797   3.836    1.00 0.00 ? 75  MET A HB3  1  
ATOM 1230  H HG2  . MET A 1 80  ? -21.670  45.962   5.909    1.00 0.00 ? 75  MET A HG2  1  
ATOM 1231  H HG3  . MET A 1 80  ? -23.391  45.619   6.093    1.00 0.00 ? 75  MET A HG3  1  
ATOM 1232  H HE1  . MET A 1 80  ? -20.311  45.235   7.253    1.00 0.00 ? 75  MET A HE1  1  
ATOM 1233  H HE2  . MET A 1 80  ? -20.091  43.660   8.012    1.00 0.00 ? 75  MET A HE2  1  
ATOM 1234  H HE3  . MET A 1 80  ? -21.303  44.772   8.643    1.00 0.00 ? 75  MET A HE3  1  
ATOM 1235  N N    . VAL A 1 81  ? -21.468  47.281   2.350    1.00 0.00 ? 76  VAL A N    1  
ATOM 1236  C CA   . VAL A 1 81  ? -20.699  47.673   1.132    1.00 0.00 ? 76  VAL A CA   1  
ATOM 1237  C C    . VAL A 1 81  ? -19.229  47.904   1.488    1.00 0.00 ? 76  VAL A C    1  
ATOM 1238  O O    . VAL A 1 81  ? -18.684  48.967   1.264    1.00 0.00 ? 76  VAL A O    1  
ATOM 1239  C CB   . VAL A 1 81  ? -21.355  48.969   0.649    1.00 0.00 ? 76  VAL A CB   1  
ATOM 1240  C CG1  . VAL A 1 81  ? -22.800  48.682   0.244    1.00 0.00 ? 76  VAL A CG1  1  
ATOM 1241  C CG2  . VAL A 1 81  ? -21.336  50.008   1.774    1.00 0.00 ? 76  VAL A CG2  1  
ATOM 1242  H H    . VAL A 1 81  ? -21.210  47.635   3.227    1.00 0.00 ? 76  VAL A H    1  
ATOM 1243  H HA   . VAL A 1 81  ? -20.786  46.912   0.373    1.00 0.00 ? 76  VAL A HA   1  
ATOM 1244  H HB   . VAL A 1 81  ? -20.814  49.351   -0.205   1.00 0.00 ? 76  VAL A HB   1  
ATOM 1245  H HG11 . VAL A 1 81  ? -23.419  48.634   1.128    1.00 0.00 ? 76  VAL A HG11 1  
ATOM 1246  H HG12 . VAL A 1 81  ? -22.845  47.737   -0.279   1.00 0.00 ? 76  VAL A HG12 1  
ATOM 1247  H HG13 . VAL A 1 81  ? -23.156  49.469   -0.404   1.00 0.00 ? 76  VAL A HG13 1  
ATOM 1248  H HG21 . VAL A 1 81  ? -22.260  49.951   2.332    1.00 0.00 ? 76  VAL A HG21 1  
ATOM 1249  H HG22 . VAL A 1 81  ? -21.232  50.996   1.351    1.00 0.00 ? 76  VAL A HG22 1  
ATOM 1250  H HG23 . VAL A 1 81  ? -20.505  49.809   2.434    1.00 0.00 ? 76  VAL A HG23 1  
ATOM 1251  N N    . THR A 1 82  ? -18.586  46.912   2.042    1.00 0.00 ? 77  THR A N    1  
ATOM 1252  C CA   . THR A 1 82  ? -17.150  47.063   2.418    1.00 0.00 ? 77  THR A CA   1  
ATOM 1253  C C    . THR A 1 82  ? -16.276  46.200   1.497    1.00 0.00 ? 77  THR A C    1  
ATOM 1254  O O    . THR A 1 82  ? -16.612  45.966   0.352    1.00 0.00 ? 77  THR A O    1  
ATOM 1255  C CB   . THR A 1 82  ? -17.070  46.573   3.868    1.00 0.00 ? 77  THR A CB   1  
ATOM 1256  O OG1  . THR A 1 82  ? -17.475  45.212   3.928    1.00 0.00 ? 77  THR A OG1  1  
ATOM 1257  C CG2  . THR A 1 82  ? -17.989  47.420   4.752    1.00 0.00 ? 77  THR A CG2  1  
ATOM 1258  H H    . THR A 1 82  ? -19.049  46.065   2.213    1.00 0.00 ? 77  THR A H    1  
ATOM 1259  H HA   . THR A 1 82  ? -16.852  48.098   2.360    1.00 0.00 ? 77  THR A HA   1  
ATOM 1260  H HB   . THR A 1 82  ? -16.056  46.663   4.224    1.00 0.00 ? 77  THR A HB   1  
ATOM 1261  H HG1  . THR A 1 82  ? -16.715  44.688   4.192    1.00 0.00 ? 77  THR A HG1  1  
ATOM 1262  H HG21 . THR A 1 82  ? -17.397  48.130   5.310    1.00 0.00 ? 77  THR A HG21 1  
ATOM 1263  H HG22 . THR A 1 82  ? -18.521  46.777   5.438    1.00 0.00 ? 77  THR A HG22 1  
ATOM 1264  H HG23 . THR A 1 82  ? -18.698  47.950   4.133    1.00 0.00 ? 77  THR A HG23 1  
ATOM 1265  N N    . LYS A 1 83  ? -15.156  45.726   1.985    1.00 0.00 ? 78  LYS A N    1  
ATOM 1266  C CA   . LYS A 1 83  ? -14.261  44.879   1.136    1.00 0.00 ? 78  LYS A CA   1  
ATOM 1267  C C    . LYS A 1 83  ? -13.902  45.614   -0.159   1.00 0.00 ? 78  LYS A C    1  
ATOM 1268  O O    . LYS A 1 83  ? -14.395  45.295   -1.223   1.00 0.00 ? 78  LYS A O    1  
ATOM 1269  C CB   . LYS A 1 83  ? -15.073  43.617   0.831    1.00 0.00 ? 78  LYS A CB   1  
ATOM 1270  C CG   . LYS A 1 83  ? -14.138  42.513   0.332    1.00 0.00 ? 78  LYS A CG   1  
ATOM 1271  C CD   . LYS A 1 83  ? -13.422  41.867   1.523    1.00 0.00 ? 78  LYS A CD   1  
ATOM 1272  C CE   . LYS A 1 83  ? -13.588  40.346   1.459    1.00 0.00 ? 78  LYS A CE   1  
ATOM 1273  N NZ   . LYS A 1 83  ? -13.069  39.847   2.763    1.00 0.00 ? 78  LYS A NZ   1  
ATOM 1274  H H    . LYS A 1 83  ? -14.901  45.926   2.908    1.00 0.00 ? 78  LYS A H    1  
ATOM 1275  H HA   . LYS A 1 83  ? -13.367  44.617   1.679    1.00 0.00 ? 78  LYS A HA   1  
ATOM 1276  H HB2  . LYS A 1 83  ? -15.573  43.286   1.730    1.00 0.00 ? 78  LYS A HB2  1  
ATOM 1277  H HB3  . LYS A 1 83  ? -15.807  43.836   0.071    1.00 0.00 ? 78  LYS A HB3  1  
ATOM 1278  H HG2  . LYS A 1 83  ? -14.715  41.765   -0.193   1.00 0.00 ? 78  LYS A HG2  1  
ATOM 1279  H HG3  . LYS A 1 83  ? -13.405  42.938   -0.338   1.00 0.00 ? 78  LYS A HG3  1  
ATOM 1280  H HD2  . LYS A 1 83  ? -12.371  42.116   1.488    1.00 0.00 ? 78  LYS A HD2  1  
ATOM 1281  H HD3  . LYS A 1 83  ? -13.848  42.234   2.444    1.00 0.00 ? 78  LYS A HD3  1  
ATOM 1282  H HE2  . LYS A 1 83  ? -14.632  40.088   1.343    1.00 0.00 ? 78  LYS A HE2  1  
ATOM 1283  H HE3  . LYS A 1 83  ? -13.006  39.937   0.648    1.00 0.00 ? 78  LYS A HE3  1  
ATOM 1284  H HZ1  . LYS A 1 83  ? -12.037  39.965   2.794    1.00 0.00 ? 78  LYS A HZ1  1  
ATOM 1285  H HZ2  . LYS A 1 83  ? -13.308  38.839   2.867    1.00 0.00 ? 78  LYS A HZ2  1  
ATOM 1286  H HZ3  . LYS A 1 83  ? -13.501  40.388   3.538    1.00 0.00 ? 78  LYS A HZ3  1  
ATOM 1287  N N    . THR A 1 84  ? -13.044  46.596   -0.074   1.00 0.00 ? 79  THR A N    1  
ATOM 1288  C CA   . THR A 1 84  ? -12.650  47.353   -1.298   1.00 0.00 ? 79  THR A CA   1  
ATOM 1289  C C    . THR A 1 84  ? -11.269  46.898   -1.777   1.00 0.00 ? 79  THR A C    1  
ATOM 1290  O O    . THR A 1 84  ? -10.275  47.562   -1.556   1.00 0.00 ? 79  THR A O    1  
ATOM 1291  C CB   . THR A 1 84  ? -12.611  48.818   -0.862   1.00 0.00 ? 79  THR A CB   1  
ATOM 1292  O OG1  . THR A 1 84  ? -11.770  48.949   0.275    1.00 0.00 ? 79  THR A OG1  1  
ATOM 1293  C CG2  . THR A 1 84  ? -14.024  49.287   -0.513   1.00 0.00 ? 79  THR A CG2  1  
ATOM 1294  H H    . THR A 1 84  ? -12.658  46.835   0.794    1.00 0.00 ? 79  THR A H    1  
ATOM 1295  H HA   . THR A 1 84  ? -13.383  47.219   -2.077   1.00 0.00 ? 79  THR A HA   1  
ATOM 1296  H HB   . THR A 1 84  ? -12.225  49.424   -1.668   1.00 0.00 ? 79  THR A HB   1  
ATOM 1297  H HG1  . THR A 1 84  ? -10.878  49.120   -0.034   1.00 0.00 ? 79  THR A HG1  1  
ATOM 1298  H HG21 . THR A 1 84  ? -14.740  48.759   -1.125   1.00 0.00 ? 79  THR A HG21 1  
ATOM 1299  H HG22 . THR A 1 84  ? -14.107  50.348   -0.695   1.00 0.00 ? 79  THR A HG22 1  
ATOM 1300  H HG23 . THR A 1 84  ? -14.223  49.084   0.529    1.00 0.00 ? 79  THR A HG23 1  
ATOM 1301  N N    . LYS A 1 85  ? -11.201  45.769   -2.432   1.00 0.00 ? 80  LYS A N    1  
ATOM 1302  C CA   . LYS A 1 85  ? -9.885   45.270   -2.926   1.00 0.00 ? 80  LYS A CA   1  
ATOM 1303  C C    . LYS A 1 85  ? -9.895   45.178   -4.455   1.00 0.00 ? 80  LYS A C    1  
ATOM 1304  O O    . LYS A 1 85  ? -10.012  44.109   -5.022   1.00 0.00 ? 80  LYS A O    1  
ATOM 1305  C CB   . LYS A 1 85  ? -9.729   43.882   -2.303   1.00 0.00 ? 80  LYS A CB   1  
ATOM 1306  C CG   . LYS A 1 85  ? -8.273   43.671   -1.883   1.00 0.00 ? 80  LYS A CG   1  
ATOM 1307  C CD   . LYS A 1 85  ? -8.101   42.259   -1.315   1.00 0.00 ? 80  LYS A CD   1  
ATOM 1308  C CE   . LYS A 1 85  ? -8.083   42.319   0.215    1.00 0.00 ? 80  LYS A CE   1  
ATOM 1309  N NZ   . LYS A 1 85  ? -9.495   42.586   0.610    1.00 0.00 ? 80  LYS A NZ   1  
ATOM 1310  H H    . LYS A 1 85  ? -12.015  45.250   -2.598   1.00 0.00 ? 80  LYS A H    1  
ATOM 1311  H HA   . LYS A 1 85  ? -9.088   45.915   -2.592   1.00 0.00 ? 80  LYS A HA   1  
ATOM 1312  H HB2  . LYS A 1 85  ? -10.370  43.803   -1.437   1.00 0.00 ? 80  LYS A HB2  1  
ATOM 1313  H HB3  . LYS A 1 85  ? -10.005  43.129   -3.025   1.00 0.00 ? 80  LYS A HB3  1  
ATOM 1314  H HG2  . LYS A 1 85  ? -7.630   43.794   -2.742   1.00 0.00 ? 80  LYS A HG2  1  
ATOM 1315  H HG3  . LYS A 1 85  ? -8.007   44.395   -1.128   1.00 0.00 ? 80  LYS A HG3  1  
ATOM 1316  H HD2  . LYS A 1 85  ? -8.922   41.637   -1.642   1.00 0.00 ? 80  LYS A HD2  1  
ATOM 1317  H HD3  . LYS A 1 85  ? -7.171   41.840   -1.667   1.00 0.00 ? 80  LYS A HD3  1  
ATOM 1318  H HE2  . LYS A 1 85  ? -7.748   41.375   0.623    1.00 0.00 ? 80  LYS A HE2  1  
ATOM 1319  H HE3  . LYS A 1 85  ? -7.447   43.122   0.553    1.00 0.00 ? 80  LYS A HE3  1  
ATOM 1320  H HZ1  . LYS A 1 85  ? -9.622   42.360   1.617    1.00 0.00 ? 80  LYS A HZ1  1  
ATOM 1321  H HZ2  . LYS A 1 85  ? -10.134  41.995   0.038    1.00 0.00 ? 80  LYS A HZ2  1  
ATOM 1322  H HZ3  . LYS A 1 85  ? -9.716   43.589   0.452    1.00 0.00 ? 80  LYS A HZ3  1  
ATOM 1323  N N    . ALA A 1 86  ? -9.772   46.293   -5.124   1.00 0.00 ? 81  ALA A N    1  
ATOM 1324  C CA   . ALA A 1 86  ? -9.775   46.275   -6.616   1.00 0.00 ? 81  ALA A CA   1  
ATOM 1325  C C    . ALA A 1 86  ? -8.479   46.887   -7.154   1.00 0.00 ? 81  ALA A C    1  
ATOM 1326  O O    . ALA A 1 86  ? -8.475   47.568   -8.161   1.00 0.00 ? 81  ALA A O    1  
ATOM 1327  C CB   . ALA A 1 86  ? -10.978  47.127   -7.019   1.00 0.00 ? 81  ALA A CB   1  
ATOM 1328  H H    . ALA A 1 86  ? -9.679   47.143   -4.646   1.00 0.00 ? 81  ALA A H    1  
ATOM 1329  H HA   . ALA A 1 86  ? -9.897   45.268   -6.981   1.00 0.00 ? 81  ALA A HA   1  
ATOM 1330  H HB1  . ALA A 1 86  ? -11.391  46.754   -7.944   1.00 0.00 ? 81  ALA A HB1  1  
ATOM 1331  H HB2  . ALA A 1 86  ? -10.665  48.152   -7.153   1.00 0.00 ? 81  ALA A HB2  1  
ATOM 1332  H HB3  . ALA A 1 86  ? -11.729  47.079   -6.244   1.00 0.00 ? 81  ALA A HB3  1  
ATOM 1333  N N    . GLY A 1 87  ? -7.379   46.650   -6.489   1.00 0.00 ? 82  GLY A N    1  
ATOM 1334  C CA   . GLY A 1 87  ? -6.083   47.218   -6.960   1.00 0.00 ? 82  GLY A CA   1  
ATOM 1335  C C    . GLY A 1 87  ? -5.846   48.572   -6.290   1.00 0.00 ? 82  GLY A C    1  
ATOM 1336  O O    . GLY A 1 87  ? -4.890   48.756   -5.562   1.00 0.00 ? 82  GLY A O    1  
ATOM 1337  H H    . GLY A 1 87  ? -7.406   46.099   -5.680   1.00 0.00 ? 82  GLY A H    1  
ATOM 1338  H HA2  . GLY A 1 87  ? -5.280   46.542   -6.704   1.00 0.00 ? 82  GLY A HA2  1  
ATOM 1339  H HA3  . GLY A 1 87  ? -6.115   47.351   -8.030   1.00 0.00 ? 82  GLY A HA3  1  
ATOM 1340  N N    . GLN A 1 88  ? -6.711   49.521   -6.529   1.00 0.00 ? 83  GLN A N    1  
ATOM 1341  C CA   . GLN A 1 88  ? -6.540   50.866   -5.907   1.00 0.00 ? 83  GLN A CA   1  
ATOM 1342  C C    . GLN A 1 88  ? -7.906   51.521   -5.680   1.00 0.00 ? 83  GLN A C    1  
ATOM 1343  O O    . GLN A 1 88  ? -8.555   51.960   -6.609   1.00 0.00 ? 83  GLN A O    1  
ATOM 1344  C CB   . GLN A 1 88  ? -5.721   51.670   -6.917   1.00 0.00 ? 83  GLN A CB   1  
ATOM 1345  C CG   . GLN A 1 88  ? -4.279   51.157   -6.929   1.00 0.00 ? 83  GLN A CG   1  
ATOM 1346  C CD   . GLN A 1 88  ? -3.392   52.146   -7.686   1.00 0.00 ? 83  GLN A CD   1  
ATOM 1347  O OE1  . GLN A 1 88  ? -2.768   53.001   -7.090   1.00 0.00 ? 83  GLN A OE1  1  
ATOM 1348  N NE2  . GLN A 1 88  ? -3.308   52.065   -8.986   1.00 0.00 ? 83  GLN A NE2  1  
ATOM 1349  H H    . GLN A 1 88  ? -7.475   49.349   -7.119   1.00 0.00 ? 83  GLN A H    1  
ATOM 1350  H HA   . GLN A 1 88  ? -6.001   50.785   -4.976   1.00 0.00 ? 83  GLN A HA   1  
ATOM 1351  H HB2  . GLN A 1 88  ? -6.152   51.556   -7.901   1.00 0.00 ? 83  GLN A HB2  1  
ATOM 1352  H HB3  . GLN A 1 88  ? -5.728   52.713   -6.639   1.00 0.00 ? 83  GLN A HB3  1  
ATOM 1353  H HG2  . GLN A 1 88  ? -3.925   51.058   -5.913   1.00 0.00 ? 83  GLN A HG2  1  
ATOM 1354  H HG3  . GLN A 1 88  ? -4.243   50.196   -7.418   1.00 0.00 ? 83  GLN A HG3  1  
ATOM 1355  H HE21 . GLN A 1 88  ? -3.811   51.376   -9.468   1.00 0.00 ? 83  GLN A HE21 1  
ATOM 1356  H HE22 . GLN A 1 88  ? -2.741   52.694   -9.481   1.00 0.00 ? 83  GLN A HE22 1  
ATOM 1357  N N    . GLY A 1 89  ? -8.345   51.588   -4.451   1.00 0.00 ? 84  GLY A N    1  
ATOM 1358  C CA   . GLY A 1 89  ? -9.668   52.213   -4.163   1.00 0.00 ? 84  GLY A CA   1  
ATOM 1359  C C    . GLY A 1 89  ? -9.581   53.024   -2.870   1.00 0.00 ? 84  GLY A C    1  
ATOM 1360  O O    . GLY A 1 89  ? -8.726   53.875   -2.715   1.00 0.00 ? 84  GLY A O    1  
ATOM 1361  H H    . GLY A 1 89  ? -7.804   51.227   -3.718   1.00 0.00 ? 84  GLY A H    1  
ATOM 1362  H HA2  . GLY A 1 89  ? -9.943   52.865   -4.981   1.00 0.00 ? 84  GLY A HA2  1  
ATOM 1363  H HA3  . GLY A 1 89  ? -10.414  51.441   -4.050   1.00 0.00 ? 84  GLY A HA3  1  
ATOM 1364  N N    . THR A 1 90  ? -10.461  52.768   -1.939   1.00 0.00 ? 85  THR A N    1  
ATOM 1365  C CA   . THR A 1 90  ? -10.433  53.524   -0.654   1.00 0.00 ? 85  THR A CA   1  
ATOM 1366  C C    . THR A 1 90  ? -9.652   52.742   0.406    1.00 0.00 ? 85  THR A C    1  
ATOM 1367  O O    . THR A 1 90  ? -9.668   51.527   0.431    1.00 0.00 ? 85  THR A O    1  
ATOM 1368  C CB   . THR A 1 90  ? -11.901  53.662   -0.245   1.00 0.00 ? 85  THR A CB   1  
ATOM 1369  O OG1  . THR A 1 90  ? -12.545  52.402   -0.366   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1370  C CG2  . THR A 1 90  ? -12.592  54.681   -1.152   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1371  H H    . THR A 1 90  ? -11.142  52.078   -2.086   1.00 0.00 ? 85  THR A H    1  
ATOM 1372  H HA   . THR A 1 90  ? -9.998   54.500   -0.800   1.00 0.00 ? 85  THR A HA   1  
ATOM 1373  H HB   . THR A 1 90  ? -11.960  54.000   0.778    1.00 0.00 ? 85  THR A HB   1  
ATOM 1374  H HG1  . THR A 1 90  ? -13.352  52.430   0.153    1.00 0.00 ? 85  THR A HG1  1  
ATOM 1375  H HG21 . THR A 1 90  ? -12.458  55.673   -0.748   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1376  H HG22 . THR A 1 90  ? -13.647  54.455   -1.209   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1377  H HG23 . THR A 1 90  ? -12.160  54.634   -2.141   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1378  N N    . SER A 1 91  ? -8.969   53.432   1.280    1.00 0.00 ? 86  SER A N    1  
ATOM 1379  C CA   . SER A 1 91  ? -8.186   52.733   2.340    1.00 0.00 ? 86  SER A CA   1  
ATOM 1380  C C    . SER A 1 91  ? -8.250   53.522   3.651    1.00 0.00 ? 86  SER A C    1  
ATOM 1381  O O    . SER A 1 91  ? -9.014   54.459   3.784    1.00 0.00 ? 86  SER A O    1  
ATOM 1382  C CB   . SER A 1 91  ? -6.753   52.689   1.810    1.00 0.00 ? 86  SER A CB   1  
ATOM 1383  O OG   . SER A 1 91  ? -6.212   54.003   1.811    1.00 0.00 ? 86  SER A OG   1  
ATOM 1384  H H    . SER A 1 91  ? -8.972   54.411   1.240    1.00 0.00 ? 86  SER A H    1  
ATOM 1385  H HA   . SER A 1 91  ? -8.557   51.730   2.484    1.00 0.00 ? 86  SER A HA   1  
ATOM 1386  H HB2  . SER A 1 91  ? -6.152   52.057   2.442    1.00 0.00 ? 86  SER A HB2  1  
ATOM 1387  H HB3  . SER A 1 91  ? -6.755   52.290   0.804    1.00 0.00 ? 86  SER A HB3  1  
ATOM 1388  H HG   . SER A 1 91  ? -6.241   54.337   0.912    1.00 0.00 ? 86  SER A HG   1  
ATOM 1389  N N    . ALA A 1 92  ? -7.454   53.152   4.618    1.00 0.00 ? 87  ALA A N    1  
ATOM 1390  C CA   . ALA A 1 92  ? -7.470   53.881   5.920    1.00 0.00 ? 87  ALA A CA   1  
ATOM 1391  C C    . ALA A 1 92  ? -6.039   54.065   6.443    1.00 0.00 ? 87  ALA A C    1  
ATOM 1392  O O    . ALA A 1 92  ? -5.228   53.166   6.346    1.00 0.00 ? 87  ALA A O    1  
ATOM 1393  C CB   . ALA A 1 92  ? -8.275   52.987   6.864    1.00 0.00 ? 87  ALA A CB   1  
ATOM 1394  H H    . ALA A 1 92  ? -6.846   52.394   4.489    1.00 0.00 ? 87  ALA A H    1  
ATOM 1395  H HA   . ALA A 1 92  ? -7.960   54.835   5.809    1.00 0.00 ? 87  ALA A HA   1  
ATOM 1396  H HB1  . ALA A 1 92  ? -7.895   53.091   7.869    1.00 0.00 ? 87  ALA A HB1  1  
ATOM 1397  H HB2  . ALA A 1 92  ? -8.184   51.958   6.549    1.00 0.00 ? 87  ALA A HB2  1  
ATOM 1398  H HB3  . ALA A 1 92  ? -9.314   53.281   6.839    1.00 0.00 ? 87  ALA A HB3  1  
ATOM 1399  N N    . PRO A 1 93  ? -5.772   55.229   6.985    1.00 0.00 ? 88  PRO A N    1  
ATOM 1400  C CA   . PRO A 1 93  ? -4.421   55.519   7.526    1.00 0.00 ? 88  PRO A CA   1  
ATOM 1401  C C    . PRO A 1 93  ? -4.201   54.770   8.846    1.00 0.00 ? 88  PRO A C    1  
ATOM 1402  O O    . PRO A 1 93  ? -5.134   54.241   9.418    1.00 0.00 ? 88  PRO A O    1  
ATOM 1403  C CB   . PRO A 1 93  ? -4.442   57.027   7.757    1.00 0.00 ? 88  PRO A CB   1  
ATOM 1404  C CG   . PRO A 1 93  ? -5.886   57.374   7.934    1.00 0.00 ? 88  PRO A CG   1  
ATOM 1405  C CD   . PRO A 1 93  ? -6.685   56.369   7.145    1.00 0.00 ? 88  PRO A CD   1  
ATOM 1406  H HA   . PRO A 1 93  ? -3.658   55.264   6.809    1.00 0.00 ? 88  PRO A HA   1  
ATOM 1407  H HB2  . PRO A 1 93  ? -3.880   57.278   8.647    1.00 0.00 ? 88  PRO A HB2  1  
ATOM 1408  H HB3  . PRO A 1 93  ? -4.041   57.545   6.900    1.00 0.00 ? 88  PRO A HB3  1  
ATOM 1409  H HG2  . PRO A 1 93  ? -6.151   57.319   8.981    1.00 0.00 ? 88  PRO A HG2  1  
ATOM 1410  H HG3  . PRO A 1 93  ? -6.077   58.366   7.556    1.00 0.00 ? 88  PRO A HG3  1  
ATOM 1411  H HD2  . PRO A 1 93  ? -7.570   56.076   7.695    1.00 0.00 ? 88  PRO A HD2  1  
ATOM 1412  H HD3  . PRO A 1 93  ? -6.952   56.770   6.180    1.00 0.00 ? 88  PRO A HD3  1  
ATOM 1413  N N    . PRO A 1 94  ? -2.970   54.751   9.290    1.00 0.00 ? 89  PRO A N    1  
ATOM 1414  C CA   . PRO A 1 94  ? -2.632   54.059   10.558   1.00 0.00 ? 89  PRO A CA   1  
ATOM 1415  C C    . PRO A 1 94  ? -3.138   54.867   11.757   1.00 0.00 ? 89  PRO A C    1  
ATOM 1416  O O    . PRO A 1 94  ? -3.411   54.326   12.811   1.00 0.00 ? 89  PRO A O    1  
ATOM 1417  C CB   . PRO A 1 94  ? -1.107   54.007   10.543   1.00 0.00 ? 89  PRO A CB   1  
ATOM 1418  C CG   . PRO A 1 94  ? -0.687   55.144   9.667    1.00 0.00 ? 89  PRO A CG   1  
ATOM 1419  C CD   . PRO A 1 94  ? -1.789   55.362   8.663    1.00 0.00 ? 89  PRO A CD   1  
ATOM 1420  H HA   . PRO A 1 94  ? -3.037   53.061   10.569   1.00 0.00 ? 89  PRO A HA   1  
ATOM 1421  H HB2  . PRO A 1 94  ? -0.718   54.136   11.545   1.00 0.00 ? 89  PRO A HB2  1  
ATOM 1422  H HB3  . PRO A 1 94  ? -0.766   53.073   10.124   1.00 0.00 ? 89  PRO A HB3  1  
ATOM 1423  H HG2  . PRO A 1 94  ? -0.547   56.035   10.264   1.00 0.00 ? 89  PRO A HG2  1  
ATOM 1424  H HG3  . PRO A 1 94  ? 0.228    54.896   9.153    1.00 0.00 ? 89  PRO A HG3  1  
ATOM 1425  H HD2  . PRO A 1 94  ? -1.948   56.420   8.500    1.00 0.00 ? 89  PRO A HD2  1  
ATOM 1426  H HD3  . PRO A 1 94  ? -1.561   54.863   7.735    1.00 0.00 ? 89  PRO A HD3  1  
ATOM 1427  N N    . GLU A 1 95  ? -3.265   56.158   11.602   1.00 0.00 ? 90  GLU A N    1  
ATOM 1428  C CA   . GLU A 1 95  ? -3.754   57.004   12.730   1.00 0.00 ? 90  GLU A CA   1  
ATOM 1429  C C    . GLU A 1 95  ? -5.285   57.039   12.740   1.00 0.00 ? 90  GLU A C    1  
ATOM 1430  O O    . GLU A 1 95  ? -5.902   57.802   12.022   1.00 0.00 ? 90  GLU A O    1  
ATOM 1431  C CB   . GLU A 1 95  ? -3.187   58.397   12.452   1.00 0.00 ? 90  GLU A CB   1  
ATOM 1432  C CG   . GLU A 1 95  ? -3.511   59.325   13.624   1.00 0.00 ? 90  GLU A CG   1  
ATOM 1433  C CD   . GLU A 1 95  ? -2.708   60.620   13.488   1.00 0.00 ? 90  GLU A CD   1  
ATOM 1434  O OE1  . GLU A 1 95  ? -1.534   60.604   13.823   1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1435  O OE2  . GLU A 1 95  ? -3.279   61.605   13.051   1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1436  H H    . GLU A 1 95  ? -3.039   56.572   10.743   1.00 0.00 ? 90  GLU A H    1  
ATOM 1437  H HA   . GLU A 1 95  ? -3.378   56.633   13.670   1.00 0.00 ? 90  GLU A HA   1  
ATOM 1438  H HB2  . GLU A 1 95  ? -2.115   58.331   12.330   1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1439  H HB3  . GLU A 1 95  ? -3.629   58.793   11.550   1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1440  H HG2  . GLU A 1 95  ? -4.567   59.553   13.621   1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1441  H HG3  . GLU A 1 95  ? -3.250   58.838   14.552   1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1442  N N    . ALA A 1 96  ? -5.901   56.219   13.549   1.00 0.00 ? 91  ALA A N    1  
ATOM 1443  C CA   . ALA A 1 96  ? -7.392   56.203   13.608   1.00 0.00 ? 91  ALA A CA   1  
ATOM 1444  C C    . ALA A 1 96  ? -7.864   55.544   14.907   1.00 0.00 ? 91  ALA A C    1  
ATOM 1445  O O    . ALA A 1 96  ? -7.080   54.991   15.653   1.00 0.00 ? 91  ALA A O    1  
ATOM 1446  C CB   . ALA A 1 96  ? -7.827   55.376   12.398   1.00 0.00 ? 91  ALA A CB   1  
ATOM 1447  H H    . ALA A 1 96  ? -5.383   55.613   14.119   1.00 0.00 ? 91  ALA A H    1  
ATOM 1448  H HA   . ALA A 1 96  ? -7.783   57.205   13.529   1.00 0.00 ? 91  ALA A HA   1  
ATOM 1449  H HB1  . ALA A 1 96  ? -8.807   54.960   12.580   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1450  H HB2  . ALA A 1 96  ? -7.120   54.575   12.236   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1451  H HB3  . ALA A 1 96  ? -7.861   56.008   11.523   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1452  N N    . SER A 1 97  ? -9.140   55.599   15.181   1.00 0.00 ? 92  SER A N    1  
ATOM 1453  C CA   . SER A 1 97  ? -9.665   54.975   16.432   1.00 0.00 ? 92  SER A CA   1  
ATOM 1454  C C    . SER A 1 97  ? -10.524  53.750   16.091   1.00 0.00 ? 92  SER A C    1  
ATOM 1455  O O    . SER A 1 97  ? -11.224  53.747   15.098   1.00 0.00 ? 92  SER A O    1  
ATOM 1456  C CB   . SER A 1 97  ? -10.515  56.061   17.089   1.00 0.00 ? 92  SER A CB   1  
ATOM 1457  O OG   . SER A 1 97  ? -10.982  55.595   18.348   1.00 0.00 ? 92  SER A OG   1  
ATOM 1458  H H    . SER A 1 97  ? -9.754   56.050   14.565   1.00 0.00 ? 92  SER A H    1  
ATOM 1459  H HA   . SER A 1 97  ? -8.851   54.699   17.083   1.00 0.00 ? 92  SER A HA   1  
ATOM 1460  H HB2  . SER A 1 97  ? -9.920   56.947   17.237   1.00 0.00 ? 92  SER A HB2  1  
ATOM 1461  H HB3  . SER A 1 97  ? -11.353  56.298   16.447   1.00 0.00 ? 92  SER A HB3  1  
ATOM 1462  H HG   . SER A 1 97  ? -11.898  55.867   18.443   1.00 0.00 ? 92  SER A HG   1  
ATOM 1463  N N    . PRO A 1 98  ? -10.445  52.745   16.928   1.00 0.00 ? 93  PRO A N    1  
ATOM 1464  C CA   . PRO A 1 98  ? -11.231  51.507   16.699   1.00 0.00 ? 93  PRO A CA   1  
ATOM 1465  C C    . PRO A 1 98  ? -12.709  51.743   17.022   1.00 0.00 ? 93  PRO A C    1  
ATOM 1466  O O    . PRO A 1 98  ? -13.046  52.500   17.911   1.00 0.00 ? 93  PRO A O    1  
ATOM 1467  C CB   . PRO A 1 98  ? -10.617  50.506   17.672   1.00 0.00 ? 93  PRO A CB   1  
ATOM 1468  C CG   . PRO A 1 98  ? -10.011  51.337   18.758   1.00 0.00 ? 93  PRO A CG   1  
ATOM 1469  C CD   . PRO A 1 98  ? -9.629   52.662   18.147   1.00 0.00 ? 93  PRO A CD   1  
ATOM 1470  H HA   . PRO A 1 98  ? -11.111  51.160   15.685   1.00 0.00 ? 93  PRO A HA   1  
ATOM 1471  H HB2  . PRO A 1 98  ? -11.383  49.857   18.074   1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1472  H HB3  . PRO A 1 98  ? -9.851   49.925   17.181   1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1473  H HG2  . PRO A 1 98  ? -10.731  51.488   19.550   1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1474  H HG3  . PRO A 1 98  ? -9.130   50.850   19.147   1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1475  H HD2  . PRO A 1 98  ? -9.870   53.471   18.823   1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1476  H HD3  . PRO A 1 98  ? -8.581   52.675   17.895   1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1477  N N    . THR A 1 99  ? -13.591  51.099   16.306   1.00 0.00 ? 94  THR A N    1  
ATOM 1478  C CA   . THR A 1 99  ? -15.048  51.282   16.569   1.00 0.00 ? 94  THR A CA   1  
ATOM 1479  C C    . THR A 1 99  ? -15.716  49.926   16.810   1.00 0.00 ? 94  THR A C    1  
ATOM 1480  O O    . THR A 1 99  ? -16.830  49.687   16.385   1.00 0.00 ? 94  THR A O    1  
ATOM 1481  C CB   . THR A 1 99  ? -15.601  51.936   15.302   1.00 0.00 ? 94  THR A CB   1  
ATOM 1482  O OG1  . THR A 1 99  ? -14.767  53.025   14.931   1.00 0.00 ? 94  THR A OG1  1  
ATOM 1483  C CG2  . THR A 1 99  ? -17.019  52.444   15.564   1.00 0.00 ? 94  THR A CG2  1  
ATOM 1484  H H    . THR A 1 99  ? -13.296  50.493   15.595   1.00 0.00 ? 94  THR A H    1  
ATOM 1485  H HA   . THR A 1 99  ? -15.199  51.933   17.416   1.00 0.00 ? 94  THR A HA   1  
ATOM 1486  H HB   . THR A 1 99  ? -15.625  51.211   14.503   1.00 0.00 ? 94  THR A HB   1  
ATOM 1487  H HG1  . THR A 1 99  ? -14.708  53.621   15.681   1.00 0.00 ? 94  THR A HG1  1  
ATOM 1488  H HG21 . THR A 1 99  ? -17.036  53.004   16.487   1.00 0.00 ? 94  THR A HG21 1  
ATOM 1489  H HG22 . THR A 1 99  ? -17.695  51.605   15.640   1.00 0.00 ? 94  THR A HG22 1  
ATOM 1490  H HG23 . THR A 1 99  ? -17.329  53.083   14.750   1.00 0.00 ? 94  THR A HG23 1  
ATOM 1491  N N    . ALA A 1 100 ? -15.043  49.035   17.489   1.00 0.00 ? 95  ALA A N    1  
ATOM 1492  C CA   . ALA A 1 100 ? -15.636  47.693   17.759   1.00 0.00 ? 95  ALA A CA   1  
ATOM 1493  C C    . ALA A 1 100 ? -15.772  47.467   19.268   1.00 0.00 ? 95  ALA A C    1  
ATOM 1494  O O    . ALA A 1 100 ? -15.089  46.645   19.846   1.00 0.00 ? 95  ALA A O    1  
ATOM 1495  C CB   . ALA A 1 100 ? -14.649  46.695   17.152   1.00 0.00 ? 95  ALA A CB   1  
ATOM 1496  H H    . ALA A 1 100 ? -14.146  49.249   17.822   1.00 0.00 ? 95  ALA A H    1  
ATOM 1497  H HA   . ALA A 1 100 ? -16.596  47.602   17.276   1.00 0.00 ? 95  ALA A HA   1  
ATOM 1498  H HB1  . ALA A 1 100 ? -15.182  45.814   16.827   1.00 0.00 ? 95  ALA A HB1  1  
ATOM 1499  H HB2  . ALA A 1 100 ? -13.915  46.419   17.894   1.00 0.00 ? 95  ALA A HB2  1  
ATOM 1500  H HB3  . ALA A 1 100 ? -14.154  47.149   16.306   1.00 0.00 ? 95  ALA A HB3  1  
ATOM 1501  N N    . ALA A 1 101 ? -16.651  48.192   19.907   1.00 0.00 ? 96  ALA A N    1  
ATOM 1502  C CA   . ALA A 1 101 ? -16.834  48.021   21.379   1.00 0.00 ? 96  ALA A CA   1  
ATOM 1503  C C    . ALA A 1 101 ? -17.288  46.590   21.701   1.00 0.00 ? 96  ALA A C    1  
ATOM 1504  O O    . ALA A 1 101 ? -16.664  45.913   22.494   1.00 0.00 ? 96  ALA A O    1  
ATOM 1505  C CB   . ALA A 1 101 ? -17.916  49.030   21.769   1.00 0.00 ? 96  ALA A CB   1  
ATOM 1506  H H    . ALA A 1 101 ? -17.191  48.848   19.420   1.00 0.00 ? 96  ALA A H    1  
ATOM 1507  H HA   . ALA A 1 101 ? -15.917  48.249   21.899   1.00 0.00 ? 96  ALA A HA   1  
ATOM 1508  H HB1  . ALA A 1 101 ? -18.603  48.570   22.463   1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1509  H HB2  . ALA A 1 101 ? -18.452  49.342   20.885   1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1510  H HB3  . ALA A 1 101 ? -17.456  49.889   22.233   1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1511  N N    . PRO A 1 102 ? -18.363  46.171   21.078   1.00 0.00 ? 97  PRO A N    1  
ATOM 1512  C CA   . PRO A 1 102 ? -18.887  44.804   21.319   1.00 0.00 ? 97  PRO A CA   1  
ATOM 1513  C C    . PRO A 1 102 ? -17.997  43.763   20.635   1.00 0.00 ? 97  PRO A C    1  
ATOM 1514  O O    . PRO A 1 102 ? -17.706  42.721   21.189   1.00 0.00 ? 97  PRO A O    1  
ATOM 1515  C CB   . PRO A 1 102 ? -20.275  44.833   20.687   1.00 0.00 ? 97  PRO A CB   1  
ATOM 1516  C CG   . PRO A 1 102 ? -20.209  45.906   19.648   1.00 0.00 ? 97  PRO A CG   1  
ATOM 1517  C CD   . PRO A 1 102 ? -19.183  46.910   20.106   1.00 0.00 ? 97  PRO A CD   1  
ATOM 1518  H HA   . PRO A 1 102 ? -18.965  44.606   22.376   1.00 0.00 ? 97  PRO A HA   1  
ATOM 1519  H HB2  . PRO A 1 102 ? -20.499  43.878   20.232   1.00 0.00 ? 97  PRO A HB2  1  
ATOM 1520  H HB3  . PRO A 1 102 ? -21.020  45.081   21.427   1.00 0.00 ? 97  PRO A HB3  1  
ATOM 1521  H HG2  . PRO A 1 102 ? -19.914  45.480   18.699   1.00 0.00 ? 97  PRO A HG2  1  
ATOM 1522  H HG3  . PRO A 1 102 ? -21.170  46.387   19.554   1.00 0.00 ? 97  PRO A HG3  1  
ATOM 1523  H HD2  . PRO A 1 102 ? -18.583  47.239   19.269   1.00 0.00 ? 97  PRO A HD2  1  
ATOM 1524  H HD3  . PRO A 1 102 ? -19.661  47.750   20.584   1.00 0.00 ? 97  PRO A HD3  1  
ATOM 1525  N N    . GLU A 1 103 ? -17.562  44.038   19.434   1.00 0.00 ? 98  GLU A N    1  
ATOM 1526  C CA   . GLU A 1 103 ? -16.690  43.066   18.712   1.00 0.00 ? 98  GLU A CA   1  
ATOM 1527  C C    . GLU A 1 103 ? -15.216  43.443   18.891   1.00 0.00 ? 98  GLU A C    1  
ATOM 1528  O O    . GLU A 1 103 ? -14.542  43.815   17.951   1.00 0.00 ? 98  GLU A O    1  
ATOM 1529  C CB   . GLU A 1 103 ? -17.099  43.179   17.243   1.00 0.00 ? 98  GLU A CB   1  
ATOM 1530  C CG   . GLU A 1 103 ? -18.530  42.664   17.069   1.00 0.00 ? 98  GLU A CG   1  
ATOM 1531  C CD   . GLU A 1 103 ? -18.572  41.163   17.362   1.00 0.00 ? 98  GLU A CD   1  
ATOM 1532  O OE1  . GLU A 1 103 ? -17.715  40.457   16.856   1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1533  O OE2  . GLU A 1 103 ? -19.459  40.746   18.087   1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1534  H H    . GLU A 1 103 ? -17.808  44.885   19.006   1.00 0.00 ? 98  GLU A H    1  
ATOM 1535  H HA   . GLU A 1 103 ? -16.868  42.063   19.068   1.00 0.00 ? 98  GLU A HA   1  
ATOM 1536  H HB2  . GLU A 1 103 ? -17.048  44.214   16.935   1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1537  H HB3  . GLU A 1 103 ? -16.430  42.589   16.636   1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1538  H HG2  . GLU A 1 103 ? -19.185  43.184   17.754   1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1539  H HG3  . GLU A 1 103 ? -18.855  42.840   16.055   1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1540  N N    . SER A 1 104 ? -14.714  43.350   20.093   1.00 0.00 ? 99  SER A N    1  
ATOM 1541  C CA   . SER A 1 104 ? -13.285  43.702   20.337   1.00 0.00 ? 99  SER A CA   1  
ATOM 1542  C C    . SER A 1 104 ? -12.388  42.491   20.069   1.00 0.00 ? 99  SER A C    1  
ATOM 1543  O O    . SER A 1 104 ? -12.619  41.411   20.577   1.00 0.00 ? 99  SER A O    1  
ATOM 1544  C CB   . SER A 1 104 ? -13.222  44.100   21.811   1.00 0.00 ? 99  SER A CB   1  
ATOM 1545  O OG   . SER A 1 104 ? -11.910  44.550   22.120   1.00 0.00 ? 99  SER A OG   1  
ATOM 1546  H H    . SER A 1 104 ? -15.276  43.048   20.837   1.00 0.00 ? 99  SER A H    1  
ATOM 1547  H HA   . SER A 1 104 ? -12.990  44.535   19.718   1.00 0.00 ? 99  SER A HA   1  
ATOM 1548  H HB2  . SER A 1 104 ? -13.924  44.894   22.002   1.00 0.00 ? 99  SER A HB2  1  
ATOM 1549  H HB3  . SER A 1 104 ? -13.474  43.245   22.424   1.00 0.00 ? 99  SER A HB3  1  
ATOM 1550  H HG   . SER A 1 104 ? -11.358  43.779   22.268   1.00 0.00 ? 99  SER A HG   1  
ATOM 1551  N N    . SER A 1 105 ? -11.366  42.663   19.274   1.00 0.00 ? 100 SER A N    1  
ATOM 1552  C CA   . SER A 1 105 ? -10.452  41.521   18.972   1.00 0.00 ? 100 SER A CA   1  
ATOM 1553  C C    . SER A 1 105 ? -9.587   41.201   20.194   1.00 0.00 ? 100 SER A C    1  
ATOM 1554  O O    . SER A 1 105 ? -9.166   42.083   20.917   1.00 0.00 ? 100 SER A O    1  
ATOM 1555  C CB   . SER A 1 105 ? -9.582   42.003   17.812   1.00 0.00 ? 100 SER A CB   1  
ATOM 1556  O OG   . SER A 1 105 ? -10.282  41.813   16.589   1.00 0.00 ? 100 SER A OG   1  
ATOM 1557  H H    . SER A 1 105 ? -11.198  43.542   18.876   1.00 0.00 ? 100 SER A H    1  
ATOM 1558  H HA   . SER A 1 105 ? -11.019  40.654   18.673   1.00 0.00 ? 100 SER A HA   1  
ATOM 1559  H HB2  . SER A 1 105 ? -9.363   43.051   17.935   1.00 0.00 ? 100 SER A HB2  1  
ATOM 1560  H HB3  . SER A 1 105 ? -8.657   41.443   17.800   1.00 0.00 ? 100 SER A HB3  1  
ATOM 1561  H HG   . SER A 1 105 ? -9.885   42.384   15.928   1.00 0.00 ? 100 SER A HG   1  
ATOM 1562  N N    . THR A 1 106 ? -9.318   39.944   20.428   1.00 0.00 ? 101 THR A N    1  
ATOM 1563  C CA   . THR A 1 106 ? -8.480   39.565   21.603   1.00 0.00 ? 101 THR A CA   1  
ATOM 1564  C C    . THR A 1 106 ? -7.324   38.665   21.159   1.00 0.00 ? 101 THR A C    1  
ATOM 1565  O O    . THR A 1 106 ? -6.167   38.990   21.340   1.00 0.00 ? 101 THR A O    1  
ATOM 1566  C CB   . THR A 1 106 ? -9.424   38.806   22.536   1.00 0.00 ? 101 THR A CB   1  
ATOM 1567  O OG1  . THR A 1 106 ? -10.538  39.630   22.852   1.00 0.00 ? 101 THR A OG1  1  
ATOM 1568  C CG2  . THR A 1 106 ? -8.684   38.430   23.820   1.00 0.00 ? 101 THR A CG2  1  
ATOM 1569  H H    . THR A 1 106 ? -9.667   39.250   19.832   1.00 0.00 ? 101 THR A H    1  
ATOM 1570  H HA   . THR A 1 106 ? -8.103   40.447   22.098   1.00 0.00 ? 101 THR A HA   1  
ATOM 1571  H HB   . THR A 1 106 ? -9.768   37.907   22.047   1.00 0.00 ? 101 THR A HB   1  
ATOM 1572  H HG1  . THR A 1 106 ? -10.205  40.443   23.239   1.00 0.00 ? 101 THR A HG1  1  
ATOM 1573  H HG21 . THR A 1 106 ? -7.626   38.349   23.616   1.00 0.00 ? 101 THR A HG21 1  
ATOM 1574  H HG22 . THR A 1 106 ? -9.053   37.483   24.185   1.00 0.00 ? 101 THR A HG22 1  
ATOM 1575  H HG23 . THR A 1 106 ? -8.849   39.193   24.567   1.00 0.00 ? 101 THR A HG23 1  
ATOM 1576  N N    . SER A 1 107 ? -7.630   37.534   20.581   1.00 0.00 ? 102 SER A N    1  
ATOM 1577  C CA   . SER A 1 107 ? -6.549   36.611   20.125   1.00 0.00 ? 102 SER A CA   1  
ATOM 1578  C C    . SER A 1 107 ? -5.798   37.221   18.939   1.00 0.00 ? 102 SER A C    1  
ATOM 1579  O O    . SER A 1 107 ? -6.245   38.177   18.335   1.00 0.00 ? 102 SER A O    1  
ATOM 1580  C CB   . SER A 1 107 ? -7.271   35.332   19.702   1.00 0.00 ? 102 SER A CB   1  
ATOM 1581  O OG   . SER A 1 107 ? -7.208   34.386   20.760   1.00 0.00 ? 102 SER A OG   1  
ATOM 1582  H H    . SER A 1 107 ? -8.570   37.293   20.446   1.00 0.00 ? 102 SER A H    1  
ATOM 1583  H HA   . SER A 1 107 ? -5.868   36.399   20.934   1.00 0.00 ? 102 SER A HA   1  
ATOM 1584  H HB2  . SER A 1 107 ? -8.302   35.553   19.484   1.00 0.00 ? 102 SER A HB2  1  
ATOM 1585  H HB3  . SER A 1 107 ? -6.796   34.929   18.816   1.00 0.00 ? 102 SER A HB3  1  
ATOM 1586  H HG   . SER A 1 107 ? -7.529   34.812   21.559   1.00 0.00 ? 102 SER A HG   1  
ATOM 1587  N N    . PHE A 1 108 ? -4.661   36.674   18.601   1.00 0.00 ? 103 PHE A N    1  
ATOM 1588  C CA   . PHE A 1 108 ? -3.879   37.219   17.454   1.00 0.00 ? 103 PHE A CA   1  
ATOM 1589  C C    . PHE A 1 108 ? -3.660   36.130   16.397   1.00 0.00 ? 103 PHE A C    1  
ATOM 1590  O O    . PHE A 1 108 ? -2.559   35.645   16.227   1.00 0.00 ? 103 PHE A O    1  
ATOM 1591  C CB   . PHE A 1 108 ? -2.546   37.660   18.060   1.00 0.00 ? 103 PHE A CB   1  
ATOM 1592  C CG   . PHE A 1 108 ? -1.701   38.317   16.995   1.00 0.00 ? 103 PHE A CG   1  
ATOM 1593  C CD1  . PHE A 1 108 ? -2.179   39.446   16.320   1.00 0.00 ? 103 PHE A CD1  1  
ATOM 1594  C CD2  . PHE A 1 108 ? -0.439   37.798   16.684   1.00 0.00 ? 103 PHE A CD2  1  
ATOM 1595  C CE1  . PHE A 1 108 ? -1.395   40.056   15.334   1.00 0.00 ? 103 PHE A CE1  1  
ATOM 1596  C CE2  . PHE A 1 108 ? 0.345    38.408   15.697   1.00 0.00 ? 103 PHE A CE2  1  
ATOM 1597  C CZ   . PHE A 1 108 ? -0.133   39.537   15.022   1.00 0.00 ? 103 PHE A CZ   1  
ATOM 1598  H H    . PHE A 1 108 ? -4.321   35.903   19.103   1.00 0.00 ? 103 PHE A H    1  
ATOM 1599  H HA   . PHE A 1 108 ? -4.386   38.068   17.022   1.00 0.00 ? 103 PHE A HA   1  
ATOM 1600  H HB2  . PHE A 1 108 ? -2.728   38.362   18.860   1.00 0.00 ? 103 PHE A HB2  1  
ATOM 1601  H HB3  . PHE A 1 108 ? -2.025   36.798   18.449   1.00 0.00 ? 103 PHE A HB3  1  
ATOM 1602  H HD1  . PHE A 1 108 ? -3.153   39.847   16.560   1.00 0.00 ? 103 PHE A HD1  1  
ATOM 1603  H HD2  . PHE A 1 108 ? -0.070   36.926   17.204   1.00 0.00 ? 103 PHE A HD2  1  
ATOM 1604  H HE1  . PHE A 1 108 ? -1.764   40.928   14.813   1.00 0.00 ? 103 PHE A HE1  1  
ATOM 1605  H HE2  . PHE A 1 108 ? 1.319    38.007   15.458   1.00 0.00 ? 103 PHE A HE2  1  
ATOM 1606  H HZ   . PHE A 1 108 ? 0.472    40.008   14.262   1.00 0.00 ? 103 PHE A HZ   1  
ATOM 1607  N N    . PRO A 1 109 ? -4.723   35.779   15.717   1.00 0.00 ? 104 PRO A N    1  
ATOM 1608  C CA   . PRO A 1 109 ? -4.639   34.734   14.666   1.00 0.00 ? 104 PRO A CA   1  
ATOM 1609  C C    . PRO A 1 109 ? -3.928   35.285   13.421   1.00 0.00 ? 104 PRO A C    1  
ATOM 1610  O O    . PRO A 1 109 ? -4.316   36.310   12.896   1.00 0.00 ? 104 PRO A O    1  
ATOM 1611  C CB   . PRO A 1 109 ? -6.100   34.417   14.359   1.00 0.00 ? 104 PRO A CB   1  
ATOM 1612  C CG   . PRO A 1 109 ? -6.856   35.648   14.746   1.00 0.00 ? 104 PRO A CG   1  
ATOM 1613  C CD   . PRO A 1 109 ? -6.085   36.312   15.858   1.00 0.00 ? 104 PRO A CD   1  
ATOM 1614  H HA   . PRO A 1 109 ? -4.140   33.856   15.041   1.00 0.00 ? 104 PRO A HA   1  
ATOM 1615  H HB2  . PRO A 1 109 ? -6.225   34.212   13.305   1.00 0.00 ? 104 PRO A HB2  1  
ATOM 1616  H HB3  . PRO A 1 109 ? -6.435   33.578   14.949   1.00 0.00 ? 104 PRO A HB3  1  
ATOM 1617  H HG2  . PRO A 1 109 ? -6.931   36.314   13.898   1.00 0.00 ? 104 PRO A HG2  1  
ATOM 1618  H HG3  . PRO A 1 109 ? -7.841   35.382   15.096   1.00 0.00 ? 104 PRO A HG3  1  
ATOM 1619  H HD2  . PRO A 1 109 ? -6.090   37.386   15.732   1.00 0.00 ? 104 PRO A HD2  1  
ATOM 1620  H HD3  . PRO A 1 109 ? -6.493   36.039   16.819   1.00 0.00 ? 104 PRO A HD3  1  
ATOM 1621  N N    . PRO A 1 110 ? -2.907   34.587   12.985   1.00 0.00 ? 105 PRO A N    1  
ATOM 1622  C CA   . PRO A 1 110 ? -2.148   35.029   11.789   1.00 0.00 ? 105 PRO A CA   1  
ATOM 1623  C C    . PRO A 1 110 ? -2.967   34.790   10.518   1.00 0.00 ? 105 PRO A C    1  
ATOM 1624  O O    . PRO A 1 110 ? -3.125   33.670   10.072   1.00 0.00 ? 105 PRO A O    1  
ATOM 1625  C CB   . PRO A 1 110 ? -0.902   34.148   11.806   1.00 0.00 ? 105 PRO A CB   1  
ATOM 1626  C CG   . PRO A 1 110 ? -1.302   32.925   12.568   1.00 0.00 ? 105 PRO A CG   1  
ATOM 1627  C CD   . PRO A 1 110 ? -2.366   33.343   13.550   1.00 0.00 ? 105 PRO A CD   1  
ATOM 1628  H HA   . PRO A 1 110 ? -1.869   36.067   11.875   1.00 0.00 ? 105 PRO A HA   1  
ATOM 1629  H HB2  . PRO A 1 110 ? -0.614   33.888   10.796   1.00 0.00 ? 105 PRO A HB2  1  
ATOM 1630  H HB3  . PRO A 1 110 ? -0.093   34.650   12.312   1.00 0.00 ? 105 PRO A HB3  1  
ATOM 1631  H HG2  . PRO A 1 110 ? -1.695   32.182   11.888   1.00 0.00 ? 105 PRO A HG2  1  
ATOM 1632  H HG3  . PRO A 1 110 ? -0.452   32.528   13.100   1.00 0.00 ? 105 PRO A HG3  1  
ATOM 1633  H HD2  . PRO A 1 110 ? -3.137   32.586   13.615   1.00 0.00 ? 105 PRO A HD2  1  
ATOM 1634  H HD3  . PRO A 1 110 ? -1.934   33.532   14.520   1.00 0.00 ? 105 PRO A HD3  1  
ATOM 1635  N N    . ALA A 1 111 ? -3.489   35.835   9.932    1.00 0.00 ? 106 ALA A N    1  
ATOM 1636  C CA   . ALA A 1 111 ? -4.298   35.670   8.689    1.00 0.00 ? 106 ALA A CA   1  
ATOM 1637  C C    . ALA A 1 111 ? -3.448   35.042   7.575    1.00 0.00 ? 106 ALA A C    1  
ATOM 1638  O O    . ALA A 1 111 ? -3.821   34.029   7.017    1.00 0.00 ? 106 ALA A O    1  
ATOM 1639  C CB   . ALA A 1 111 ? -4.733   37.085   8.302    1.00 0.00 ? 106 ALA A CB   1  
ATOM 1640  H H    . ALA A 1 111 ? -3.347   36.728   10.310   1.00 0.00 ? 106 ALA A H    1  
ATOM 1641  H HA   . ALA A 1 111 ? -5.166   35.061   8.886    1.00 0.00 ? 106 ALA A HA   1  
ATOM 1642  H HB1  . ALA A 1 111 ? -4.091   37.804   8.789    1.00 0.00 ? 106 ALA A HB1  1  
ATOM 1643  H HB2  . ALA A 1 111 ? -5.755   37.245   8.614    1.00 0.00 ? 106 ALA A HB2  1  
ATOM 1644  H HB3  . ALA A 1 111 ? -4.661   37.204   7.232    1.00 0.00 ? 106 ALA A HB3  1  
ATOM 1645  N N    . PRO A 1 112 ? -2.330   35.663   7.280    1.00 0.00 ? 107 PRO A N    1  
ATOM 1646  C CA   . PRO A 1 112 ? -1.437   35.139   6.218    1.00 0.00 ? 107 PRO A CA   1  
ATOM 1647  C C    . PRO A 1 112 ? -0.703   33.887   6.706    1.00 0.00 ? 107 PRO A C    1  
ATOM 1648  O O    . PRO A 1 112 ? -1.071   33.288   7.698    1.00 0.00 ? 107 PRO A O    1  
ATOM 1649  C CB   . PRO A 1 112 ? -0.458   36.284   5.972    1.00 0.00 ? 107 PRO A CB   1  
ATOM 1650  C CG   . PRO A 1 112 ? -0.445   37.066   7.247    1.00 0.00 ? 107 PRO A CG   1  
ATOM 1651  C CD   . PRO A 1 112 ? -1.795   36.888   7.894    1.00 0.00 ? 107 PRO A CD   1  
ATOM 1652  H HA   . PRO A 1 112 ? -1.995   34.930   5.319    1.00 0.00 ? 107 PRO A HA   1  
ATOM 1653  H HB2  . PRO A 1 112 ? 0.528    35.893   5.758    1.00 0.00 ? 107 PRO A HB2  1  
ATOM 1654  H HB3  . PRO A 1 112 ? -0.801   36.906   5.161    1.00 0.00 ? 107 PRO A HB3  1  
ATOM 1655  H HG2  . PRO A 1 112 ? 0.332    36.692   7.899    1.00 0.00 ? 107 PRO A HG2  1  
ATOM 1656  H HG3  . PRO A 1 112 ? -0.279   38.111   7.036    1.00 0.00 ? 107 PRO A HG3  1  
ATOM 1657  H HD2  . PRO A 1 112 ? -1.683   36.765   8.962    1.00 0.00 ? 107 PRO A HD2  1  
ATOM 1658  H HD3  . PRO A 1 112 ? -2.435   37.726   7.672    1.00 0.00 ? 107 PRO A HD3  1  
ATOM 1659  N N    . THR A 1 113 ? 0.334    33.487   6.015    1.00 0.00 ? 108 THR A N    1  
ATOM 1660  C CA   . THR A 1 113 ? 1.099    32.272   6.434    1.00 0.00 ? 108 THR A CA   1  
ATOM 1661  C C    . THR A 1 113 ? 0.159    31.067   6.550    1.00 0.00 ? 108 THR A C    1  
ATOM 1662  O O    . THR A 1 113 ? -1.017   31.156   6.254    1.00 0.00 ? 108 THR A O    1  
ATOM 1663  C CB   . THR A 1 113 ? 1.701    32.618   7.800    1.00 0.00 ? 108 THR A CB   1  
ATOM 1664  O OG1  . THR A 1 113 ? 2.004    34.006   7.848    1.00 0.00 ? 108 THR A OG1  1  
ATOM 1665  C CG2  . THR A 1 113 ? 2.981    31.809   8.014    1.00 0.00 ? 108 THR A CG2  1  
ATOM 1666  H H    . THR A 1 113 ? 0.611    33.987   5.219    1.00 0.00 ? 108 THR A H    1  
ATOM 1667  H HA   . THR A 1 113 ? 1.887    32.064   5.727    1.00 0.00 ? 108 THR A HA   1  
ATOM 1668  H HB   . THR A 1 113 ? 0.994    32.376   8.578    1.00 0.00 ? 108 THR A HB   1  
ATOM 1669  H HG1  . THR A 1 113 ? 2.642    34.196   7.157    1.00 0.00 ? 108 THR A HG1  1  
ATOM 1670  H HG21 . THR A 1 113 ? 3.689    32.397   8.580    1.00 0.00 ? 108 THR A HG21 1  
ATOM 1671  H HG22 . THR A 1 113 ? 3.410    31.554   7.057    1.00 0.00 ? 108 THR A HG22 1  
ATOM 1672  H HG23 . THR A 1 113 ? 2.749    30.905   8.557    1.00 0.00 ? 108 THR A HG23 1  
ATOM 1673  N N    . SER A 1 114 ? 0.669    29.942   6.978    1.00 0.00 ? 109 SER A N    1  
ATOM 1674  C CA   . SER A 1 114 ? -0.195   28.732   7.112    1.00 0.00 ? 109 SER A CA   1  
ATOM 1675  C C    . SER A 1 114 ? -0.221   28.256   8.567    1.00 0.00 ? 109 SER A C    1  
ATOM 1676  O O    . SER A 1 114 ? 0.183    28.964   9.469    1.00 0.00 ? 109 SER A O    1  
ATOM 1677  C CB   . SER A 1 114 ? 0.457    27.679   6.217    1.00 0.00 ? 109 SER A CB   1  
ATOM 1678  O OG   . SER A 1 114 ? 1.669    27.240   6.815    1.00 0.00 ? 109 SER A OG   1  
ATOM 1679  H H    . SER A 1 114 ? 1.619    29.892   7.210    1.00 0.00 ? 109 SER A H    1  
ATOM 1680  H HA   . SER A 1 114 ? -1.194   28.942   6.766    1.00 0.00 ? 109 SER A HA   1  
ATOM 1681  H HB2  . SER A 1 114 ? -0.208   26.839   6.104    1.00 0.00 ? 109 SER A HB2  1  
ATOM 1682  H HB3  . SER A 1 114 ? 0.657    28.109   5.244    1.00 0.00 ? 109 SER A HB3  1  
ATOM 1683  H HG   . SER A 1 114 ? 2.241    28.004   6.920    1.00 0.00 ? 109 SER A HG   1  
ATOM 1684  N N    . GLY A 1 115 ? -0.695   27.061   8.800    1.00 0.00 ? 110 GLY A N    1  
ATOM 1685  C CA   . GLY A 1 115 ? -0.749   26.536   10.195   1.00 0.00 ? 110 GLY A CA   1  
ATOM 1686  C C    . GLY A 1 115 ? -1.954   25.604   10.343   1.00 0.00 ? 110 GLY A C    1  
ATOM 1687  O O    . GLY A 1 115 ? -2.961   25.768   9.682    1.00 0.00 ? 110 GLY A O    1  
ATOM 1688  H H    . GLY A 1 115 ? -1.015   26.509   8.057    1.00 0.00 ? 110 GLY A H    1  
ATOM 1689  H HA2  . GLY A 1 115 ? 0.159    25.990   10.409   1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1690  H HA3  . GLY A 1 115 ? -0.848   27.358   10.886   1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1691  N N    . MET A 1 116 ? -1.858   24.627   11.205   1.00 0.00 ? 111 MET A N    1  
ATOM 1692  C CA   . MET A 1 116 ? -2.998   23.684   11.397   1.00 0.00 ? 111 MET A CA   1  
ATOM 1693  C C    . MET A 1 116 ? -3.591   23.849   12.800   1.00 0.00 ? 111 MET A C    1  
ATOM 1694  O O    . MET A 1 116 ? -3.637   22.916   13.578   1.00 0.00 ? 111 MET A O    1  
ATOM 1695  C CB   . MET A 1 116 ? -2.391   22.290   11.230   1.00 0.00 ? 111 MET A CB   1  
ATOM 1696  C CG   . MET A 1 116 ? -2.476   21.867   9.763    1.00 0.00 ? 111 MET A CG   1  
ATOM 1697  S SD   . MET A 1 116 ? -4.204   21.561   9.322    1.00 0.00 ? 111 MET A SD   1  
ATOM 1698  C CE   . MET A 1 116 ? -3.891   20.711   7.756    1.00 0.00 ? 111 MET A CE   1  
ATOM 1699  H H    . MET A 1 116 ? -1.036   24.514   11.727   1.00 0.00 ? 111 MET A H    1  
ATOM 1700  H HA   . MET A 1 116 ? -3.754   23.848   10.646   1.00 0.00 ? 111 MET A HA   1  
ATOM 1701  H HB2  . MET A 1 116 ? -1.356   22.309   11.541   1.00 0.00 ? 111 MET A HB2  1  
ATOM 1702  H HB3  . MET A 1 116 ? -2.937   21.584   11.838   1.00 0.00 ? 111 MET A HB3  1  
ATOM 1703  H HG2  . MET A 1 116 ? -2.079   22.654   9.138    1.00 0.00 ? 111 MET A HG2  1  
ATOM 1704  H HG3  . MET A 1 116 ? -1.901   20.965   9.614    1.00 0.00 ? 111 MET A HG3  1  
ATOM 1705  H HE1  . MET A 1 116 ? -4.615   21.035   7.020    1.00 0.00 ? 111 MET A HE1  1  
ATOM 1706  H HE2  . MET A 1 116 ? -3.979   19.646   7.898    1.00 0.00 ? 111 MET A HE2  1  
ATOM 1707  H HE3  . MET A 1 116 ? -2.892   20.945   7.414    1.00 0.00 ? 111 MET A HE3  1  
ATOM 1708  N N    . SER A 1 117 ? -4.045   25.029   13.126   1.00 0.00 ? 112 SER A N    1  
ATOM 1709  C CA   . SER A 1 117 ? -4.636   25.257   14.477   1.00 0.00 ? 112 SER A CA   1  
ATOM 1710  C C    . SER A 1 117 ? -6.029   24.627   14.557   1.00 0.00 ? 112 SER A C    1  
ATOM 1711  O O    . SER A 1 117 ? -7.013   25.221   14.159   1.00 0.00 ? 112 SER A O    1  
ATOM 1712  C CB   . SER A 1 117 ? -4.726   26.776   14.622   1.00 0.00 ? 112 SER A CB   1  
ATOM 1713  O OG   . SER A 1 117 ? -3.418   27.331   14.567   1.00 0.00 ? 112 SER A OG   1  
ATOM 1714  H H    . SER A 1 117 ? -3.998   25.766   12.481   1.00 0.00 ? 112 SER A H    1  
ATOM 1715  H HA   . SER A 1 117 ? -3.994   24.851   15.243   1.00 0.00 ? 112 SER A HA   1  
ATOM 1716  H HB2  . SER A 1 117 ? -5.317   27.182   13.818   1.00 0.00 ? 112 SER A HB2  1  
ATOM 1717  H HB3  . SER A 1 117 ? -5.192   27.020   15.567   1.00 0.00 ? 112 SER A HB3  1  
ATOM 1718  H HG   . SER A 1 117 ? -3.500   28.267   14.371   1.00 0.00 ? 112 SER A HG   1  
ATOM 1719  N N    . HIS A 1 118 ? -6.120   23.429   15.069   1.00 0.00 ? 113 HIS A N    1  
ATOM 1720  C CA   . HIS A 1 118 ? -7.448   22.758   15.176   1.00 0.00 ? 113 HIS A CA   1  
ATOM 1721  C C    . HIS A 1 118 ? -7.375   21.599   16.178   1.00 0.00 ? 113 HIS A C    1  
ATOM 1722  O O    . HIS A 1 118 ? -7.542   20.452   15.813   1.00 0.00 ? 113 HIS A O    1  
ATOM 1723  C CB   . HIS A 1 118 ? -7.744   22.241   13.764   1.00 0.00 ? 113 HIS A CB   1  
ATOM 1724  C CG   . HIS A 1 118 ? -9.128   22.664   13.352   1.00 0.00 ? 113 HIS A CG   1  
ATOM 1725  N ND1  . HIS A 1 118 ? -10.213  21.803   13.412   1.00 0.00 ? 113 HIS A ND1  1  
ATOM 1726  C CD2  . HIS A 1 118 ? -9.619   23.852   12.871   1.00 0.00 ? 113 HIS A CD2  1  
ATOM 1727  C CE1  . HIS A 1 118 ? -11.292  22.480   12.978   1.00 0.00 ? 113 HIS A CE1  1  
ATOM 1728  N NE2  . HIS A 1 118 ? -10.986  23.734   12.636   1.00 0.00 ? 113 HIS A NE2  1  
ATOM 1729  H H    . HIS A 1 118 ? -5.313   22.969   15.383   1.00 0.00 ? 113 HIS A H    1  
ATOM 1730  H HA   . HIS A 1 118 ? -8.204   23.468   15.475   1.00 0.00 ? 113 HIS A HA   1  
ATOM 1731  H HB2  . HIS A 1 118 ? -7.023   22.651   13.072   1.00 0.00 ? 113 HIS A HB2  1  
ATOM 1732  H HB3  . HIS A 1 118 ? -7.680   21.164   13.752   1.00 0.00 ? 113 HIS A HB3  1  
ATOM 1733  H HD1  . HIS A 1 118 ? -10.197  20.871   13.716   1.00 0.00 ? 113 HIS A HD1  1  
ATOM 1734  H HD2  . HIS A 1 118 ? -9.033   24.744   12.701   1.00 0.00 ? 113 HIS A HD2  1  
ATOM 1735  H HE1  . HIS A 1 118 ? -12.285  22.060   12.915   1.00 0.00 ? 113 HIS A HE1  1  
ATOM 1736  N N    . PRO A 1 119 ? -7.125   21.938   17.418   1.00 0.00 ? 114 PRO A N    1  
ATOM 1737  C CA   . PRO A 1 119 ? -7.028   20.906   18.480   1.00 0.00 ? 114 PRO A CA   1  
ATOM 1738  C C    . PRO A 1 119 ? -8.419   20.354   18.818   1.00 0.00 ? 114 PRO A C    1  
ATOM 1739  O O    . PRO A 1 119 ? -9.389   21.086   18.819   1.00 0.00 ? 114 PRO A O    1  
ATOM 1740  C CB   . PRO A 1 119 ? -6.443   21.668   19.667   1.00 0.00 ? 114 PRO A CB   1  
ATOM 1741  C CG   . PRO A 1 119 ? -6.818   23.097   19.434   1.00 0.00 ? 114 PRO A CG   1  
ATOM 1742  C CD   . PRO A 1 119 ? -6.910   23.293   17.943   1.00 0.00 ? 114 PRO A CD   1  
ATOM 1743  H HA   . PRO A 1 119 ? -6.360   20.115   18.183   1.00 0.00 ? 114 PRO A HA   1  
ATOM 1744  H HB2  . PRO A 1 119 ? -6.875   21.309   20.591   1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1745  H HB3  . PRO A 1 119 ? -5.370   21.566   19.687   1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1746  H HG2  . PRO A 1 119 ? -7.773   23.306   19.897   1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1747  H HG3  . PRO A 1 119 ? -6.059   23.748   19.840   1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1748  H HD2  . PRO A 1 119 ? -7.746   23.935   17.698   1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1749  H HD3  . PRO A 1 119 ? -5.990   23.700   17.556   1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1750  N N    . PRO A 1 120 ? -8.475   19.074   19.094   1.00 0.00 ? 115 PRO A N    1  
ATOM 1751  C CA   . PRO A 1 120 ? -9.768   18.430   19.433   1.00 0.00 ? 115 PRO A CA   1  
ATOM 1752  C C    . PRO A 1 120 ? -10.201  18.815   20.853   1.00 0.00 ? 115 PRO A C    1  
ATOM 1753  O O    . PRO A 1 120 ? -9.373   19.083   21.700   1.00 0.00 ? 115 PRO A O    1  
ATOM 1754  C CB   . PRO A 1 120 ? -9.460   16.938   19.347   1.00 0.00 ? 115 PRO A CB   1  
ATOM 1755  C CG   . PRO A 1 120 ? -7.987   16.828   19.585   1.00 0.00 ? 115 PRO A CG   1  
ATOM 1756  C CD   . PRO A 1 120 ? -7.360   18.117   19.115   1.00 0.00 ? 115 PRO A CD   1  
ATOM 1757  H HA   . PRO A 1 120 ? -10.526  18.694   18.715   1.00 0.00 ? 115 PRO A HA   1  
ATOM 1758  H HB2  . PRO A 1 120 ? -10.007  16.398   20.108   1.00 0.00 ? 115 PRO A HB2  1  
ATOM 1759  H HB3  . PRO A 1 120 ? -9.704   16.559   18.367   1.00 0.00 ? 115 PRO A HB3  1  
ATOM 1760  H HG2  . PRO A 1 120 ? -7.795   16.686   20.639   1.00 0.00 ? 115 PRO A HG2  1  
ATOM 1761  H HG3  . PRO A 1 120 ? -7.583   16.002   19.021   1.00 0.00 ? 115 PRO A HG3  1  
ATOM 1762  H HD2  . PRO A 1 120 ? -6.595   18.438   19.808   1.00 0.00 ? 115 PRO A HD2  1  
ATOM 1763  H HD3  . PRO A 1 120 ? -6.952   18.000   18.124   1.00 0.00 ? 115 PRO A HD3  1  
ATOM 1764  N N    . PRO A 1 121 ? -11.493  18.828   21.069   1.00 0.00 ? 116 PRO A N    1  
ATOM 1765  C CA   . PRO A 1 121 ? -12.034  19.184   22.404   1.00 0.00 ? 116 PRO A CA   1  
ATOM 1766  C C    . PRO A 1 121 ? -11.804  18.039   23.396   1.00 0.00 ? 116 PRO A C    1  
ATOM 1767  O O    . PRO A 1 121 ? -11.907  16.878   23.052   1.00 0.00 ? 116 PRO A O    1  
ATOM 1768  C CB   . PRO A 1 121 ? -13.525  19.386   22.145   1.00 0.00 ? 116 PRO A CB   1  
ATOM 1769  C CG   . PRO A 1 121 ? -13.823  18.572   20.926   1.00 0.00 ? 116 PRO A CG   1  
ATOM 1770  C CD   . PRO A 1 121 ? -12.560  18.520   20.106   1.00 0.00 ? 116 PRO A CD   1  
ATOM 1771  H HA   . PRO A 1 121 ? -11.593  20.099   22.765   1.00 0.00 ? 116 PRO A HA   1  
ATOM 1772  H HB2  . PRO A 1 121 ? -14.103  19.032   22.988   1.00 0.00 ? 116 PRO A HB2  1  
ATOM 1773  H HB3  . PRO A 1 121 ? -13.736  20.427   21.954   1.00 0.00 ? 116 PRO A HB3  1  
ATOM 1774  H HG2  . PRO A 1 121 ? -14.120  17.573   21.215   1.00 0.00 ? 116 PRO A HG2  1  
ATOM 1775  H HG3  . PRO A 1 121 ? -14.609  19.040   20.353   1.00 0.00 ? 116 PRO A HG3  1  
ATOM 1776  H HD2  . PRO A 1 121 ? -12.423  17.532   19.687   1.00 0.00 ? 116 PRO A HD2  1  
ATOM 1777  H HD3  . PRO A 1 121 ? -12.583  19.265   19.326   1.00 0.00 ? 116 PRO A HD3  1  
ATOM 1778  N N    . ALA A 1 122 ? -11.494  18.361   24.626   1.00 0.00 ? 117 ALA A N    1  
ATOM 1779  C CA   . ALA A 1 122 ? -11.256  17.297   25.650   1.00 0.00 ? 117 ALA A CA   1  
ATOM 1780  C C    . ALA A 1 122 ? -10.234  16.276   25.137   1.00 0.00 ? 117 ALA A C    1  
ATOM 1781  O O    . ALA A 1 122 ? -9.599   16.477   24.120   1.00 0.00 ? 117 ALA A O    1  
ATOM 1782  C CB   . ALA A 1 122 ? -12.618  16.632   25.863   1.00 0.00 ? 117 ALA A CB   1  
ATOM 1783  H H    . ALA A 1 122 ? -11.417  19.305   24.878   1.00 0.00 ? 117 ALA A H    1  
ATOM 1784  H HA   . ALA A 1 122 ? -10.914  17.736   26.574   1.00 0.00 ? 117 ALA A HA   1  
ATOM 1785  H HB1  . ALA A 1 122 ? -13.138  17.129   26.669   1.00 0.00 ? 117 ALA A HB1  1  
ATOM 1786  H HB2  . ALA A 1 122 ? -12.475  15.592   26.115   1.00 0.00 ? 117 ALA A HB2  1  
ATOM 1787  H HB3  . ALA A 1 122 ? -13.201  16.707   24.958   1.00 0.00 ? 117 ALA A HB3  1  
ATOM 1788  N N    . ALA A 1 123 ? -10.073  15.183   25.834   1.00 0.00 ? 118 ALA A N    1  
ATOM 1789  C CA   . ALA A 1 123 ? -9.095   14.148   25.390   1.00 0.00 ? 118 ALA A CA   1  
ATOM 1790  C C    . ALA A 1 123 ? -9.832   12.925   24.838   1.00 0.00 ? 118 ALA A C    1  
ATOM 1791  O O    . ALA A 1 123 ? -10.133  11.993   25.558   1.00 0.00 ? 118 ALA A O    1  
ATOM 1792  C CB   . ALA A 1 123 ? -8.310   13.778   26.649   1.00 0.00 ? 118 ALA A CB   1  
ATOM 1793  H H    . ALA A 1 123 ? -10.596  15.043   26.651   1.00 0.00 ? 118 ALA A H    1  
ATOM 1794  H HA   . ALA A 1 123 ? -8.427   14.555   24.646   1.00 0.00 ? 118 ALA A HA   1  
ATOM 1795  H HB1  . ALA A 1 123 ? -8.232   14.643   27.292   1.00 0.00 ? 118 ALA A HB1  1  
ATOM 1796  H HB2  . ALA A 1 123 ? -7.321   13.445   26.372   1.00 0.00 ? 118 ALA A HB2  1  
ATOM 1797  H HB3  . ALA A 1 123 ? -8.824   12.985   27.173   1.00 0.00 ? 118 ALA A HB3  1  
ATOM 1798  N N    . ARG A 1 124 ? -10.123  12.922   23.564   1.00 0.00 ? 119 ARG A N    1  
ATOM 1799  C CA   . ARG A 1 124 ? -10.841  11.760   22.963   1.00 0.00 ? 119 ARG A CA   1  
ATOM 1800  C C    . ARG A 1 124 ? -10.061  11.224   21.759   1.00 0.00 ? 119 ARG A C    1  
ATOM 1801  O O    . ARG A 1 124 ? -8.895   11.519   21.582   1.00 0.00 ? 119 ARG A O    1  
ATOM 1802  C CB   . ARG A 1 124 ? -12.195  12.316   22.522   1.00 0.00 ? 119 ARG A CB   1  
ATOM 1803  C CG   . ARG A 1 124 ? -12.967  12.814   23.746   1.00 0.00 ? 119 ARG A CG   1  
ATOM 1804  C CD   . ARG A 1 124 ? -14.466  12.600   23.527   1.00 0.00 ? 119 ARG A CD   1  
ATOM 1805  N NE   . ARG A 1 124 ? -14.998  12.207   24.862   1.00 0.00 ? 119 ARG A NE   1  
ATOM 1806  C CZ   . ARG A 1 124 ? -16.128  11.561   24.950   1.00 0.00 ? 119 ARG A CZ   1  
ATOM 1807  N NH1  . ARG A 1 124 ? -16.317  10.478   24.248   1.00 0.00 ? 119 ARG A NH1  1  
ATOM 1808  N NH2  . ARG A 1 124 ? -17.070  11.998   25.741   1.00 0.00 ? 119 ARG A NH2  1  
ATOM 1809  H H    . ARG A 1 124 ? -9.870   13.684   23.003   1.00 0.00 ? 119 ARG A H    1  
ATOM 1810  H HA   . ARG A 1 124 ? -10.983  10.983   23.697   1.00 0.00 ? 119 ARG A HA   1  
ATOM 1811  H HB2  . ARG A 1 124 ? -12.041  13.136   21.835   1.00 0.00 ? 119 ARG A HB2  1  
ATOM 1812  H HB3  . ARG A 1 124 ? -12.763  11.539   22.033   1.00 0.00 ? 119 ARG A HB3  1  
ATOM 1813  H HG2  . ARG A 1 124 ? -12.647  12.264   24.620   1.00 0.00 ? 119 ARG A HG2  1  
ATOM 1814  H HG3  . ARG A 1 124 ? -12.773  13.866   23.891   1.00 0.00 ? 119 ARG A HG3  1  
ATOM 1815  H HD2  . ARG A 1 124 ? -14.930  13.516   23.189   1.00 0.00 ? 119 ARG A HD2  1  
ATOM 1816  H HD3  . ARG A 1 124 ? -14.633  11.807   22.815   1.00 0.00 ? 119 ARG A HD3  1  
ATOM 1817  H HE   . ARG A 1 124 ? -14.499  12.435   25.675   1.00 0.00 ? 119 ARG A HE   1  
ATOM 1818  H HH11 . ARG A 1 124 ? -15.596  10.143   23.642   1.00 0.00 ? 119 ARG A HH11 1  
ATOM 1819  H HH12 . ARG A 1 124 ? -17.183  9.983    24.316   1.00 0.00 ? 119 ARG A HH12 1  
ATOM 1820  H HH21 . ARG A 1 124 ? -16.925  12.828   26.280   1.00 0.00 ? 119 ARG A HH21 1  
ATOM 1821  H HH22 . ARG A 1 124 ? -17.936  11.503   25.809   1.00 0.00 ? 119 ARG A HH22 1  
ATOM 1822  N N    . GLU A 1 125 ? -10.696  10.438   20.930   1.00 0.00 ? 120 GLU A N    1  
ATOM 1823  C CA   . GLU A 1 125 ? -9.993   9.880    19.736   1.00 0.00 ? 120 GLU A CA   1  
ATOM 1824  C C    . GLU A 1 125 ? -9.467   11.016   18.853   1.00 0.00 ? 120 GLU A C    1  
ATOM 1825  O O    . GLU A 1 125 ? -10.214  11.655   18.139   1.00 0.00 ? 120 GLU A O    1  
ATOM 1826  C CB   . GLU A 1 125 ? -11.054  9.070    18.991   1.00 0.00 ? 120 GLU A CB   1  
ATOM 1827  C CG   . GLU A 1 125 ? -10.421  7.801    18.418   1.00 0.00 ? 120 GLU A CG   1  
ATOM 1828  C CD   . GLU A 1 125 ? -11.137  7.412    17.123   1.00 0.00 ? 120 GLU A CD   1  
ATOM 1829  O OE1  . GLU A 1 125 ? -12.357  7.378    17.132   1.00 0.00 ? 120 GLU A OE1  1  
ATOM 1830  O OE2  . GLU A 1 125 ? -10.454  7.156    16.145   1.00 0.00 ? 120 GLU A OE2  1  
ATOM 1831  H H    . GLU A 1 125 ? -11.636  10.213   21.093   1.00 0.00 ? 120 GLU A H    1  
ATOM 1832  H HA   . GLU A 1 125 ? -9.184   9.235    20.042   1.00 0.00 ? 120 GLU A HA   1  
ATOM 1833  H HB2  . GLU A 1 125 ? -11.847  8.801    19.674   1.00 0.00 ? 120 GLU A HB2  1  
ATOM 1834  H HB3  . GLU A 1 125 ? -11.460  9.663    18.185   1.00 0.00 ? 120 GLU A HB3  1  
ATOM 1835  H HG2  . GLU A 1 125 ? -9.376   7.982    18.212   1.00 0.00 ? 120 GLU A HG2  1  
ATOM 1836  H HG3  . GLU A 1 125 ? -10.513  6.997    19.133   1.00 0.00 ? 120 GLU A HG3  1  
ATOM 1837  N N    . ASP A 1 126 ? -8.186   11.270   18.897   1.00 0.00 ? 121 ASP A N    1  
ATOM 1838  C CA   . ASP A 1 126 ? -7.611   12.364   18.061   1.00 0.00 ? 121 ASP A CA   1  
ATOM 1839  C C    . ASP A 1 126 ? -7.767   12.032   16.574   1.00 0.00 ? 121 ASP A C    1  
ATOM 1840  O O    . ASP A 1 126 ? -8.404   12.754   15.832   1.00 0.00 ? 121 ASP A O    1  
ATOM 1841  C CB   . ASP A 1 126 ? -6.131   12.423   18.444   1.00 0.00 ? 121 ASP A CB   1  
ATOM 1842  C CG   . ASP A 1 126 ? -5.532   13.745   17.964   1.00 0.00 ? 121 ASP A CG   1  
ATOM 1843  O OD1  . ASP A 1 126 ? -5.802   14.121   16.835   1.00 0.00 ? 121 ASP A OD1  1  
ATOM 1844  O OD2  . ASP A 1 126 ? -4.812   14.361   18.734   1.00 0.00 ? 121 ASP A OD2  1  
ATOM 1845  H H    . ASP A 1 126 ? -7.603   10.741   19.481   1.00 0.00 ? 121 ASP A H    1  
ATOM 1846  H HA   . ASP A 1 126 ? -8.088   13.304   18.290   1.00 0.00 ? 121 ASP A HA   1  
ATOM 1847  H HB2  . ASP A 1 126 ? -6.035   12.351   19.518   1.00 0.00 ? 121 ASP A HB2  1  
ATOM 1848  H HB3  . ASP A 1 126 ? -5.606   11.602   17.980   1.00 0.00 ? 121 ASP A HB3  1  
ATOM 1849  N N    . LYS A 1 127 ? -7.190   10.946   16.136   1.00 0.00 ? 122 LYS A N    1  
ATOM 1850  C CA   . LYS A 1 127 ? -7.304   10.566   14.696   1.00 0.00 ? 122 LYS A CA   1  
ATOM 1851  C C    . LYS A 1 127 ? -8.766   10.289   14.337   1.00 0.00 ? 122 LYS A C    1  
ATOM 1852  O O    . LYS A 1 127 ? -9.584   10.010   15.192   1.00 0.00 ? 122 LYS A O    1  
ATOM 1853  C CB   . LYS A 1 127 ? -6.467   9.293    14.552   1.00 0.00 ? 122 LYS A CB   1  
ATOM 1854  C CG   . LYS A 1 127 ? -5.111   9.638    13.933   1.00 0.00 ? 122 LYS A CG   1  
ATOM 1855  C CD   . LYS A 1 127 ? -4.450   8.363    13.404   1.00 0.00 ? 122 LYS A CD   1  
ATOM 1856  C CE   . LYS A 1 127 ? -3.647   8.688    12.142   1.00 0.00 ? 122 LYS A CE   1  
ATOM 1857  N NZ   . LYS A 1 127 ? -2.450   9.428    12.629   1.00 0.00 ? 122 LYS A NZ   1  
ATOM 1858  H H    . LYS A 1 127 ? -6.681   10.379   16.753   1.00 0.00 ? 122 LYS A H    1  
ATOM 1859  H HA   . LYS A 1 127 ? -6.902   11.345   14.068   1.00 0.00 ? 122 LYS A HA   1  
ATOM 1860  H HB2  . LYS A 1 127 ? -6.316   8.849    15.525   1.00 0.00 ? 122 LYS A HB2  1  
ATOM 1861  H HB3  . LYS A 1 127 ? -6.984   8.593    13.913   1.00 0.00 ? 122 LYS A HB3  1  
ATOM 1862  H HG2  . LYS A 1 127 ? -5.254   10.335   13.119   1.00 0.00 ? 122 LYS A HG2  1  
ATOM 1863  H HG3  . LYS A 1 127 ? -4.476   10.085   14.683   1.00 0.00 ? 122 LYS A HG3  1  
ATOM 1864  H HD2  . LYS A 1 127 ? -3.790   7.960    14.158   1.00 0.00 ? 122 LYS A HD2  1  
ATOM 1865  H HD3  . LYS A 1 127 ? -5.212   7.636    13.165   1.00 0.00 ? 122 LYS A HD3  1  
ATOM 1866  H HE2  . LYS A 1 127 ? -3.351   7.777    11.641   1.00 0.00 ? 122 LYS A HE2  1  
ATOM 1867  H HE3  . LYS A 1 127 ? -4.224   9.314    11.479   1.00 0.00 ? 122 LYS A HE3  1  
ATOM 1868  H HZ1  . LYS A 1 127 ? -1.882   9.742    11.816   1.00 0.00 ? 122 LYS A HZ1  1  
ATOM 1869  H HZ2  . LYS A 1 127 ? -1.877   8.802    13.232   1.00 0.00 ? 122 LYS A HZ2  1  
ATOM 1870  H HZ3  . LYS A 1 127 ? -2.753   10.257   13.177   1.00 0.00 ? 122 LYS A HZ3  1  
ATOM 1871  N N    . SER A 1 128 ? -9.100   10.364   13.076   1.00 0.00 ? 123 SER A N    1  
ATOM 1872  C CA   . SER A 1 128 ? -10.508  10.105   12.655   1.00 0.00 ? 123 SER A CA   1  
ATOM 1873  C C    . SER A 1 128 ? -10.530  9.378    11.306   1.00 0.00 ? 123 SER A C    1  
ATOM 1874  O O    . SER A 1 128 ? -10.761  9.986    10.279   1.00 0.00 ? 123 SER A O    1  
ATOM 1875  C CB   . SER A 1 128 ? -11.145  11.489   12.531   1.00 0.00 ? 123 SER A CB   1  
ATOM 1876  O OG   . SER A 1 128 ? -10.444  12.241   11.549   1.00 0.00 ? 123 SER A OG   1  
ATOM 1877  H H    . SER A 1 128 ? -8.423   10.590   12.404   1.00 0.00 ? 123 SER A H    1  
ATOM 1878  H HA   . SER A 1 128 ? -11.025  9.527    13.405   1.00 0.00 ? 123 SER A HA   1  
ATOM 1879  H HB2  . SER A 1 128 ? -12.175  11.387   12.231   1.00 0.00 ? 123 SER A HB2  1  
ATOM 1880  H HB3  . SER A 1 128 ? -11.098  11.993   13.487   1.00 0.00 ? 123 SER A HB3  1  
ATOM 1881  H HG   . SER A 1 128 ? -10.741  11.950   10.684   1.00 0.00 ? 123 SER A HG   1  
ATOM 1882  N N    . PRO A 1 129 ? -10.285  8.092    11.351   1.00 0.00 ? 124 PRO A N    1  
ATOM 1883  C CA   . PRO A 1 129 ? -10.276  7.278    10.111   1.00 0.00 ? 124 PRO A CA   1  
ATOM 1884  C C    . PRO A 1 129 ? -11.702  7.078    9.590    1.00 0.00 ? 124 PRO A C    1  
ATOM 1885  O O    . PRO A 1 129 ? -12.630  6.886    10.352   1.00 0.00 ? 124 PRO A O    1  
ATOM 1886  C CB   . PRO A 1 129 ? -9.670   5.950    10.558   1.00 0.00 ? 124 PRO A CB   1  
ATOM 1887  C CG   . PRO A 1 129 ? -9.949   5.870    12.025   1.00 0.00 ? 124 PRO A CG   1  
ATOM 1888  C CD   . PRO A 1 129 ? -9.997   7.284    12.544   1.00 0.00 ? 124 PRO A CD   1  
ATOM 1889  H HA   . PRO A 1 129 ? -9.654   7.734    9.358    1.00 0.00 ? 124 PRO A HA   1  
ATOM 1890  H HB2  . PRO A 1 129 ? -10.143  5.129    10.037   1.00 0.00 ? 124 PRO A HB2  1  
ATOM 1891  H HB3  . PRO A 1 129 ? -8.606   5.944    10.384   1.00 0.00 ? 124 PRO A HB3  1  
ATOM 1892  H HG2  . PRO A 1 129 ? -10.899  5.381    12.192   1.00 0.00 ? 124 PRO A HG2  1  
ATOM 1893  H HG3  . PRO A 1 129 ? -9.161   5.328    12.522   1.00 0.00 ? 124 PRO A HG3  1  
ATOM 1894  H HD2  . PRO A 1 129 ? -10.785  7.391    13.277   1.00 0.00 ? 124 PRO A HD2  1  
ATOM 1895  H HD3  . PRO A 1 129 ? -9.045   7.567    12.963   1.00 0.00 ? 124 PRO A HD3  1  
ATOM 1896  N N    . SER A 1 130 ? -11.883  7.120    8.295    1.00 0.00 ? 125 SER A N    1  
ATOM 1897  C CA   . SER A 1 130 ? -13.248  6.932    7.714    1.00 0.00 ? 125 SER A CA   1  
ATOM 1898  C C    . SER A 1 130 ? -14.249  7.886    8.375    1.00 0.00 ? 125 SER A C    1  
ATOM 1899  O O    . SER A 1 130 ? -13.874  8.837    9.032    1.00 0.00 ? 125 SER A O    1  
ATOM 1900  C CB   . SER A 1 130 ? -13.614  5.478    8.015    1.00 0.00 ? 125 SER A CB   1  
ATOM 1901  O OG   . SER A 1 130 ? -12.544  4.633    7.615    1.00 0.00 ? 125 SER A OG   1  
ATOM 1902  H H    . SER A 1 130 ? -11.119  7.276    7.702    1.00 0.00 ? 125 SER A H    1  
ATOM 1903  H HA   . SER A 1 130 ? -13.227  7.091    6.648    1.00 0.00 ? 125 SER A HA   1  
ATOM 1904  H HB2  . SER A 1 130 ? -13.785  5.359    9.071    1.00 0.00 ? 125 SER A HB2  1  
ATOM 1905  H HB3  . SER A 1 130 ? -14.515  5.216    7.475    1.00 0.00 ? 125 SER A HB3  1  
ATOM 1906  H HG   . SER A 1 130 ? -12.175  4.228    8.404    1.00 0.00 ? 125 SER A HG   1  
ATOM 1907  N N    . GLU A 1 131 ? -15.521  7.637    8.204    1.00 0.00 ? 126 GLU A N    1  
ATOM 1908  C CA   . GLU A 1 131 ? -16.548  8.526    8.821    1.00 0.00 ? 126 GLU A CA   1  
ATOM 1909  C C    . GLU A 1 131 ? -17.677  7.688    9.428    1.00 0.00 ? 126 GLU A C    1  
ATOM 1910  O O    . GLU A 1 131 ? -17.534  6.500    9.641    1.00 0.00 ? 126 GLU A O    1  
ATOM 1911  C CB   . GLU A 1 131 ? -17.073  9.382    7.666    1.00 0.00 ? 126 GLU A CB   1  
ATOM 1912  C CG   . GLU A 1 131 ? -17.211  10.835   8.126    1.00 0.00 ? 126 GLU A CG   1  
ATOM 1913  C CD   . GLU A 1 131 ? -17.787  11.678   6.988    1.00 0.00 ? 126 GLU A CD   1  
ATOM 1914  O OE1  . GLU A 1 131 ? -17.165  11.728   5.940    1.00 0.00 ? 126 GLU A OE1  1  
ATOM 1915  O OE2  . GLU A 1 131 ? -18.842  12.260   7.183    1.00 0.00 ? 126 GLU A OE2  1  
ATOM 1916  H H    . GLU A 1 131 ? -15.800  6.864    7.670    1.00 0.00 ? 126 GLU A H    1  
ATOM 1917  H HA   . GLU A 1 131 ? -16.099  9.156    9.572    1.00 0.00 ? 126 GLU A HA   1  
ATOM 1918  H HB2  . GLU A 1 131 ? -16.382  9.330    6.837    1.00 0.00 ? 126 GLU A HB2  1  
ATOM 1919  H HB3  . GLU A 1 131 ? -18.038  9.013    7.354    1.00 0.00 ? 126 GLU A HB3  1  
ATOM 1920  H HG2  . GLU A 1 131 ? -17.871  10.881   8.980    1.00 0.00 ? 126 GLU A HG2  1  
ATOM 1921  H HG3  . GLU A 1 131 ? -16.240  11.220   8.400    1.00 0.00 ? 126 GLU A HG3  1  
ATOM 1922  N N    . GLU A 1 132 ? -18.797  8.299    9.707    1.00 0.00 ? 127 GLU A N    1  
ATOM 1923  C CA   . GLU A 1 132 ? -19.937  7.540    10.301   1.00 0.00 ? 127 GLU A CA   1  
ATOM 1924  C C    . GLU A 1 132 ? -21.252  7.943    9.625    1.00 0.00 ? 127 GLU A C    1  
ATOM 1925  O O    . GLU A 1 132 ? -22.305  7.914    10.231   1.00 0.00 ? 127 GLU A O    1  
ATOM 1926  C CB   . GLU A 1 132 ? -19.949  7.929    11.781   1.00 0.00 ? 127 GLU A CB   1  
ATOM 1927  C CG   . GLU A 1 132 ? -20.095  9.447    11.916   1.00 0.00 ? 127 GLU A CG   1  
ATOM 1928  C CD   . GLU A 1 132 ? -19.982  9.841    13.390   1.00 0.00 ? 127 GLU A CD   1  
ATOM 1929  O OE1  . GLU A 1 132 ? -20.931  9.607    14.120   1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1930  O OE2  . GLU A 1 132 ? -18.949  10.372   13.763   1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1931  H H    . GLU A 1 132 ? -18.890  9.258    9.527    1.00 0.00 ? 127 GLU A H    1  
ATOM 1932  H HA   . GLU A 1 132 ? -19.773  6.478    10.201   1.00 0.00 ? 127 GLU A HA   1  
ATOM 1933  H HB2  . GLU A 1 132 ? -20.779  7.442    12.273   1.00 0.00 ? 127 GLU A HB2  1  
ATOM 1934  H HB3  . GLU A 1 132 ? -19.025  7.616    12.243   1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1935  H HG2  . GLU A 1 132 ? -19.314  9.935    11.351   1.00 0.00 ? 127 GLU A HG2  1  
ATOM 1936  H HG3  . GLU A 1 132 ? -21.059  9.751    11.537   1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1937  N N    . SER A 1 133 ? -21.196  8.318    8.375    1.00 0.00 ? 128 SER A N    1  
ATOM 1938  C CA   . SER A 1 133 ? -22.439  8.723    7.657    1.00 0.00 ? 128 SER A CA   1  
ATOM 1939  C C    . SER A 1 133 ? -22.241  8.586    6.144    1.00 0.00 ? 128 SER A C    1  
ATOM 1940  O O    . SER A 1 133 ? -21.129  8.504    5.661    1.00 0.00 ? 128 SER A O    1  
ATOM 1941  C CB   . SER A 1 133 ? -22.659  10.185   8.040    1.00 0.00 ? 128 SER A CB   1  
ATOM 1942  O OG   . SER A 1 133 ? -23.612  10.257   9.092    1.00 0.00 ? 128 SER A OG   1  
ATOM 1943  H H    . SER A 1 133 ? -20.335  8.332    7.908    1.00 0.00 ? 128 SER A H    1  
ATOM 1944  H HA   . SER A 1 133 ? -23.276  8.126    7.984    1.00 0.00 ? 128 SER A HA   1  
ATOM 1945  H HB2  . SER A 1 133 ? -21.729  10.616   8.373    1.00 0.00 ? 128 SER A HB2  1  
ATOM 1946  H HB3  . SER A 1 133 ? -23.018  10.732   7.178    1.00 0.00 ? 128 SER A HB3  1  
ATOM 1947  H HG   . SER A 1 133 ? -23.146  10.137   9.923    1.00 0.00 ? 128 SER A HG   1  
ATOM 1948  N N    . ALA A 1 134 ? -23.311  8.561    5.395    1.00 0.00 ? 129 ALA A N    1  
ATOM 1949  C CA   . ALA A 1 134 ? -23.183  8.429    3.914    1.00 0.00 ? 129 ALA A CA   1  
ATOM 1950  C C    . ALA A 1 134 ? -24.397  9.054    3.216    1.00 0.00 ? 129 ALA A C    1  
ATOM 1951  O O    . ALA A 1 134 ? -25.374  8.381    2.955    1.00 0.00 ? 129 ALA A O    1  
ATOM 1952  C CB   . ALA A 1 134 ? -23.132  6.924    3.653    1.00 0.00 ? 129 ALA A CB   1  
ATOM 1953  H H    . ALA A 1 134 ? -24.198  8.628    5.806    1.00 0.00 ? 129 ALA A H    1  
ATOM 1954  H HA   . ALA A 1 134 ? -22.271  8.893    3.572    1.00 0.00 ? 129 ALA A HA   1  
ATOM 1955  H HB1  . ALA A 1 134 ? -22.622  6.737    2.719    1.00 0.00 ? 129 ALA A HB1  1  
ATOM 1956  H HB2  . ALA A 1 134 ? -24.138  6.534    3.598    1.00 0.00 ? 129 ALA A HB2  1  
ATOM 1957  H HB3  . ALA A 1 134 ? -22.600  6.436    4.457    1.00 0.00 ? 129 ALA A HB3  1  
ATOM 1958  N N    . PRO A 1 135 ? -24.295  10.329   2.934    1.00 0.00 ? 130 PRO A N    1  
ATOM 1959  C CA   . PRO A 1 135 ? -25.404  11.045   2.257    1.00 0.00 ? 130 PRO A CA   1  
ATOM 1960  C C    . PRO A 1 135 ? -25.477  10.642   0.781    1.00 0.00 ? 130 PRO A C    1  
ATOM 1961  O O    . PRO A 1 135 ? -24.595  10.946   0.002    1.00 0.00 ? 130 PRO A O    1  
ATOM 1962  C CB   . PRO A 1 135 ? -25.022  12.516   2.401    1.00 0.00 ? 130 PRO A CB   1  
ATOM 1963  C CG   . PRO A 1 135 ? -23.535  12.518   2.561    1.00 0.00 ? 130 PRO A CG   1  
ATOM 1964  C CD   . PRO A 1 135 ? -23.156  11.213   3.214    1.00 0.00 ? 130 PRO A CD   1  
ATOM 1965  H HA   . PRO A 1 135 ? -26.342  10.855   2.754    1.00 0.00 ? 130 PRO A HA   1  
ATOM 1966  H HB2  . PRO A 1 135 ? -25.308  13.065   1.514    1.00 0.00 ? 130 PRO A HB2  1  
ATOM 1967  H HB3  . PRO A 1 135 ? -25.488  12.942   3.275    1.00 0.00 ? 130 PRO A HB3  1  
ATOM 1968  H HG2  . PRO A 1 135 ? -23.061  12.599   1.592    1.00 0.00 ? 130 PRO A HG2  1  
ATOM 1969  H HG3  . PRO A 1 135 ? -23.232  13.340   3.190    1.00 0.00 ? 130 PRO A HG3  1  
ATOM 1970  H HD2  . PRO A 1 135 ? -22.250  10.820   2.773    1.00 0.00 ? 130 PRO A HD2  1  
ATOM 1971  H HD3  . PRO A 1 135 ? -23.038  11.342   4.278    1.00 0.00 ? 130 PRO A HD3  1  
ATOM 1972  N N    . THR A 1 136 ? -26.521  9.958    0.394    1.00 0.00 ? 131 THR A N    1  
ATOM 1973  C CA   . THR A 1 136 ? -26.651  9.534    -1.031   1.00 0.00 ? 131 THR A CA   1  
ATOM 1974  C C    . THR A 1 136 ? -26.889  10.753   -1.927   1.00 0.00 ? 131 THR A C    1  
ATOM 1975  O O    . THR A 1 136 ? -27.682  11.619   -1.614   1.00 0.00 ? 131 THR A O    1  
ATOM 1976  C CB   . THR A 1 136 ? -27.863  8.601    -1.060   1.00 0.00 ? 131 THR A CB   1  
ATOM 1977  O OG1  . THR A 1 136 ? -28.978  9.259    -0.475   1.00 0.00 ? 131 THR A OG1  1  
ATOM 1978  C CG2  . THR A 1 136 ? -27.549  7.327    -0.274   1.00 0.00 ? 131 THR A CG2  1  
ATOM 1979  H H    . THR A 1 136 ? -27.219  9.724    1.041    1.00 0.00 ? 131 THR A H    1  
ATOM 1980  H HA   . THR A 1 136 ? -25.769  9.000    -1.347   1.00 0.00 ? 131 THR A HA   1  
ATOM 1981  H HB   . THR A 1 136 ? -28.094  8.341    -2.082   1.00 0.00 ? 131 THR A HB   1  
ATOM 1982  H HG1  . THR A 1 136 ? -29.699  8.627    -0.417   1.00 0.00 ? 131 THR A HG1  1  
ATOM 1983  H HG21 . THR A 1 136 ? -27.314  7.584    0.748    1.00 0.00 ? 131 THR A HG21 1  
ATOM 1984  H HG22 . THR A 1 136 ? -26.703  6.827    -0.723   1.00 0.00 ? 131 THR A HG22 1  
ATOM 1985  H HG23 . THR A 1 136 ? -28.406  6.671    -0.293   1.00 0.00 ? 131 THR A HG23 1  
ATOM 1986  N N    . THR A 1 137 ? -26.207  10.824   -3.039   1.00 0.00 ? 132 THR A N    1  
ATOM 1987  C CA   . THR A 1 137 ? -26.391  11.986   -3.957   1.00 0.00 ? 132 THR A CA   1  
ATOM 1988  C C    . THR A 1 137 ? -27.573  11.736   -4.898   1.00 0.00 ? 132 THR A C    1  
ATOM 1989  O O    . THR A 1 137 ? -28.496  12.523   -4.971   1.00 0.00 ? 132 THR A O    1  
ATOM 1990  C CB   . THR A 1 137 ? -25.085  12.075   -4.749   1.00 0.00 ? 132 THR A CB   1  
ATOM 1991  O OG1  . THR A 1 137 ? -24.791  10.807   -5.317   1.00 0.00 ? 132 THR A OG1  1  
ATOM 1992  C CG2  . THR A 1 137 ? -23.948  12.497   -3.818   1.00 0.00 ? 132 THR A CG2  1  
ATOM 1993  H H    . THR A 1 137 ? -25.573  10.114   -3.271   1.00 0.00 ? 132 THR A H    1  
ATOM 1994  H HA   . THR A 1 137 ? -26.542  12.892   -3.393   1.00 0.00 ? 132 THR A HA   1  
ATOM 1995  H HB   . THR A 1 137 ? -25.190  12.807   -5.536   1.00 0.00 ? 132 THR A HB   1  
ATOM 1996  H HG1  . THR A 1 137 ? -24.925  10.868   -6.266   1.00 0.00 ? 132 THR A HG1  1  
ATOM 1997  H HG21 . THR A 1 137 ? -23.830  11.760   -3.037   1.00 0.00 ? 132 THR A HG21 1  
ATOM 1998  H HG22 . THR A 1 137 ? -24.179  13.455   -3.377   1.00 0.00 ? 132 THR A HG22 1  
ATOM 1999  H HG23 . THR A 1 137 ? -23.030  12.573   -4.383   1.00 0.00 ? 132 THR A HG23 1  
ATOM 2000  N N    . SER A 1 138 ? -27.550  10.645   -5.617   1.00 0.00 ? 133 SER A N    1  
ATOM 2001  C CA   . SER A 1 138 ? -28.672  10.342   -6.554   1.00 0.00 ? 133 SER A CA   1  
ATOM 2002  C C    . SER A 1 138 ? -29.811  9.640    -5.806   1.00 0.00 ? 133 SER A C    1  
ATOM 2003  O O    . SER A 1 138 ? -29.581  8.974    -4.816   1.00 0.00 ? 133 SER A O    1  
ATOM 2004  C CB   . SER A 1 138 ? -28.068  9.414    -7.607   1.00 0.00 ? 133 SER A CB   1  
ATOM 2005  O OG   . SER A 1 138 ? -28.524  9.806    -8.896   1.00 0.00 ? 133 SER A OG   1  
ATOM 2006  H H    . SER A 1 138 ? -26.796  10.025   -5.542   1.00 0.00 ? 133 SER A H    1  
ATOM 2007  H HA   . SER A 1 138 ? -29.028  11.247   -7.021   1.00 0.00 ? 133 SER A HA   1  
ATOM 2008  H HB2  . SER A 1 138 ? -26.994  9.480    -7.576   1.00 0.00 ? 133 SER A HB2  1  
ATOM 2009  H HB3  . SER A 1 138 ? -28.369  8.394    -7.403   1.00 0.00 ? 133 SER A HB3  1  
ATOM 2010  H HG   . SER A 1 138 ? -28.490  9.037    -9.469   1.00 0.00 ? 133 SER A HG   1  
ATOM 2011  N N    . PRO A 1 139 ? -31.010  9.810    -6.305   1.00 0.00 ? 134 PRO A N    1  
ATOM 2012  C CA   . PRO A 1 139 ? -32.192  9.180    -5.668   1.00 0.00 ? 134 PRO A CA   1  
ATOM 2013  C C    . PRO A 1 139 ? -32.202  7.672    -5.936   1.00 0.00 ? 134 PRO A C    1  
ATOM 2014  O O    . PRO A 1 139 ? -32.464  6.877    -5.055   1.00 0.00 ? 134 PRO A O    1  
ATOM 2015  C CB   . PRO A 1 139 ? -33.375  9.861    -6.351   1.00 0.00 ? 134 PRO A CB   1  
ATOM 2016  C CG   . PRO A 1 139 ? -32.848  10.322   -7.672   1.00 0.00 ? 134 PRO A CG   1  
ATOM 2017  C CD   . PRO A 1 139 ? -31.377  10.594   -7.493   1.00 0.00 ? 134 PRO A CD   1  
ATOM 2018  H HA   . PRO A 1 139 ? -32.209  9.381    -4.609   1.00 0.00 ? 134 PRO A HA   1  
ATOM 2019  H HB2  . PRO A 1 139 ? -34.183  9.155    -6.491   1.00 0.00 ? 134 PRO A HB2  1  
ATOM 2020  H HB3  . PRO A 1 139 ? -33.709  10.707   -5.771   1.00 0.00 ? 134 PRO A HB3  1  
ATOM 2021  H HG2  . PRO A 1 139 ? -32.995  9.552    -8.416   1.00 0.00 ? 134 PRO A HG2  1  
ATOM 2022  H HG3  . PRO A 1 139 ? -33.350  11.228   -7.974   1.00 0.00 ? 134 PRO A HG3  1  
ATOM 2023  H HD2  . PRO A 1 139 ? -30.823  10.258   -8.359   1.00 0.00 ? 134 PRO A HD2  1  
ATOM 2024  H HD3  . PRO A 1 139 ? -31.203  11.644   -7.313   1.00 0.00 ? 134 PRO A HD3  1  
ATOM 2025  N N    . GLU A 1 140 ? -31.916  7.275    -7.148   1.00 0.00 ? 135 GLU A N    1  
ATOM 2026  C CA   . GLU A 1 140 ? -31.906  5.821    -7.477   1.00 0.00 ? 135 GLU A CA   1  
ATOM 2027  C C    . GLU A 1 140 ? -30.541  5.416    -8.040   1.00 0.00 ? 135 GLU A C    1  
ATOM 2028  O O    . GLU A 1 140 ? -30.425  5.001    -9.176   1.00 0.00 ? 135 GLU A O    1  
ATOM 2029  C CB   . GLU A 1 140 ? -32.997  5.647    -8.534   1.00 0.00 ? 135 GLU A CB   1  
ATOM 2030  C CG   . GLU A 1 140 ? -34.339  5.389    -7.846   1.00 0.00 ? 135 GLU A CG   1  
ATOM 2031  C CD   . GLU A 1 140 ? -35.476  5.873    -8.747   1.00 0.00 ? 135 GLU A CD   1  
ATOM 2032  O OE1  . GLU A 1 140 ? -35.386  6.987    -9.235   1.00 0.00 ? 135 GLU A OE1  1  
ATOM 2033  O OE2  . GLU A 1 140 ? -36.419  5.121    -8.933   1.00 0.00 ? 135 GLU A OE2  1  
ATOM 2034  H H    . GLU A 1 140 ? -31.706  7.935    -7.841   1.00 0.00 ? 135 GLU A H    1  
ATOM 2035  H HA   . GLU A 1 140 ? -32.143  5.235    -6.603   1.00 0.00 ? 135 GLU A HA   1  
ATOM 2036  H HB2  . GLU A 1 140 ? -33.064  6.544    -9.132   1.00 0.00 ? 135 GLU A HB2  1  
ATOM 2037  H HB3  . GLU A 1 140 ? -32.754  4.808    -9.168   1.00 0.00 ? 135 GLU A HB3  1  
ATOM 2038  H HG2  . GLU A 1 140 ? -34.450  4.331    -7.660   1.00 0.00 ? 135 GLU A HG2  1  
ATOM 2039  H HG3  . GLU A 1 140 ? -34.372  5.925    -6.909   1.00 0.00 ? 135 GLU A HG3  1  
ATOM 2040  N N    . SER A 1 141 ? -29.506  5.536    -7.251   1.00 0.00 ? 136 SER A N    1  
ATOM 2041  C CA   . SER A 1 141 ? -28.146  5.160    -7.737   1.00 0.00 ? 136 SER A CA   1  
ATOM 2042  C C    . SER A 1 141 ? -27.934  3.649    -7.605   1.00 0.00 ? 136 SER A C    1  
ATOM 2043  O O    . SER A 1 141 ? -27.630  2.970    -8.567   1.00 0.00 ? 136 SER A O    1  
ATOM 2044  C CB   . SER A 1 141 ? -27.178  5.920    -6.829   1.00 0.00 ? 136 SER A CB   1  
ATOM 2045  O OG   . SER A 1 141 ? -26.231  6.615    -7.630   1.00 0.00 ? 136 SER A OG   1  
ATOM 2046  H H    . SER A 1 141 ? -29.624  5.874    -6.339   1.00 0.00 ? 136 SER A H    1  
ATOM 2047  H HA   . SER A 1 141 ? -28.012  5.472    -8.760   1.00 0.00 ? 136 SER A HA   1  
ATOM 2048  H HB2  . SER A 1 141 ? -27.723  6.629    -6.230   1.00 0.00 ? 136 SER A HB2  1  
ATOM 2049  H HB3  . SER A 1 141 ? -26.669  5.219    -6.179   1.00 0.00 ? 136 SER A HB3  1  
ATOM 2050  H HG   . SER A 1 141 ? -25.490  6.026    -7.791   1.00 0.00 ? 136 SER A HG   1  
ATOM 2051  N N    . VAL A 1 142 ? -28.092  3.120    -6.422   1.00 0.00 ? 137 VAL A N    1  
ATOM 2052  C CA   . VAL A 1 142 ? -27.899  1.652    -6.226   1.00 0.00 ? 137 VAL A CA   1  
ATOM 2053  C C    . VAL A 1 142 ? -29.069  0.880    -6.842   1.00 0.00 ? 137 VAL A C    1  
ATOM 2054  O O    . VAL A 1 142 ? -29.981  0.464    -6.154   1.00 0.00 ? 137 VAL A O    1  
ATOM 2055  C CB   . VAL A 1 142 ? -27.861  1.452    -4.709   1.00 0.00 ? 137 VAL A CB   1  
ATOM 2056  C CG1  . VAL A 1 142 ? -27.639  -0.028   -4.392   1.00 0.00 ? 137 VAL A CG1  1  
ATOM 2057  C CG2  . VAL A 1 142 ? -26.714  2.274    -4.115   1.00 0.00 ? 137 VAL A CG2  1  
ATOM 2058  H H    . VAL A 1 142 ? -28.337  3.687    -5.661   1.00 0.00 ? 137 VAL A H    1  
ATOM 2059  H HA   . VAL A 1 142 ? -26.966  1.334    -6.664   1.00 0.00 ? 137 VAL A HA   1  
ATOM 2060  H HB   . VAL A 1 142 ? -28.798  1.776    -4.281   1.00 0.00 ? 137 VAL A HB   1  
ATOM 2061  H HG11 . VAL A 1 142 ? -27.677  -0.176   -3.323   1.00 0.00 ? 137 VAL A HG11 1  
ATOM 2062  H HG12 . VAL A 1 142 ? -26.673  -0.335   -4.764   1.00 0.00 ? 137 VAL A HG12 1  
ATOM 2063  H HG13 . VAL A 1 142 ? -28.412  -0.617   -4.865   1.00 0.00 ? 137 VAL A HG13 1  
ATOM 2064  H HG21 . VAL A 1 142 ? -25.843  2.189    -4.748   1.00 0.00 ? 137 VAL A HG21 1  
ATOM 2065  H HG22 . VAL A 1 142 ? -26.479  1.904    -3.128   1.00 0.00 ? 137 VAL A HG22 1  
ATOM 2066  H HG23 . VAL A 1 142 ? -27.011  3.311    -4.049   1.00 0.00 ? 137 VAL A HG23 1  
ATOM 2067  N N    . SER A 1 143 ? -29.049  0.686    -8.134   1.00 0.00 ? 138 SER A N    1  
ATOM 2068  C CA   . SER A 1 143 ? -30.159  -0.058   -8.798   1.00 0.00 ? 138 SER A CA   1  
ATOM 2069  C C    . SER A 1 143 ? -29.594  -1.188   -9.663   1.00 0.00 ? 138 SER A C    1  
ATOM 2070  O O    . SER A 1 143 ? -28.399  -1.404   -9.714   1.00 0.00 ? 138 SER A O    1  
ATOM 2071  C CB   . SER A 1 143 ? -30.867  0.979    -9.668   1.00 0.00 ? 138 SER A CB   1  
ATOM 2072  O OG   . SER A 1 143 ? -32.089  0.434    -10.147  1.00 0.00 ? 138 SER A OG   1  
ATOM 2073  H H    . SER A 1 143 ? -28.303  1.031    -8.669   1.00 0.00 ? 138 SER A H    1  
ATOM 2074  H HA   . SER A 1 143 ? -30.842  -0.451   -8.062   1.00 0.00 ? 138 SER A HA   1  
ATOM 2075  H HB2  . SER A 1 143 ? -31.076  1.860    -9.083   1.00 0.00 ? 138 SER A HB2  1  
ATOM 2076  H HB3  . SER A 1 143 ? -30.229  1.246    -10.500  1.00 0.00 ? 138 SER A HB3  1  
ATOM 2077  H HG   . SER A 1 143 ? -32.666  0.290    -9.392   1.00 0.00 ? 138 SER A HG   1  
ATOM 2078  N N    . GLY A 1 144 ? -30.445  -1.909   -10.343  1.00 0.00 ? 139 GLY A N    1  
ATOM 2079  C CA   . GLY A 1 144 ? -29.960  -3.025   -11.205  1.00 0.00 ? 139 GLY A CA   1  
ATOM 2080  C C    . GLY A 1 144 ? -29.812  -4.294   -10.364  1.00 0.00 ? 139 GLY A C    1  
ATOM 2081  O O    . GLY A 1 144 ? -30.159  -4.322   -9.200   1.00 0.00 ? 139 GLY A O    1  
ATOM 2082  H H    . GLY A 1 144 ? -31.404  -1.717   -10.286  1.00 0.00 ? 139 GLY A H    1  
ATOM 2083  H HA2  . GLY A 1 144 ? -30.671  -3.200   -12.001  1.00 0.00 ? 139 GLY A HA2  1  
ATOM 2084  H HA3  . GLY A 1 144 ? -29.002  -2.764   -11.628  1.00 0.00 ? 139 GLY A HA3  1  
ATOM 2085  N N    . SER A 1 145 ? -29.298  -5.346   -10.946  1.00 0.00 ? 140 SER A N    1  
ATOM 2086  C CA   . SER A 1 145 ? -29.127  -6.615   -10.182  1.00 0.00 ? 140 SER A CA   1  
ATOM 2087  C C    . SER A 1 145 ? -28.071  -7.499   -10.852  1.00 0.00 ? 140 SER A C    1  
ATOM 2088  O O    . SER A 1 145 ? -27.112  -7.914   -10.231  1.00 0.00 ? 140 SER A O    1  
ATOM 2089  C CB   . SER A 1 145 ? -30.496  -7.291   -10.225  1.00 0.00 ? 140 SER A CB   1  
ATOM 2090  O OG   . SER A 1 145 ? -30.411  -8.565   -9.600   1.00 0.00 ? 140 SER A OG   1  
ATOM 2091  H H    . SER A 1 145 ? -29.025  -5.300   -11.886  1.00 0.00 ? 140 SER A H    1  
ATOM 2092  H HA   . SER A 1 145 ? -28.851  -6.406   -9.160   1.00 0.00 ? 140 SER A HA   1  
ATOM 2093  H HB2  . SER A 1 145 ? -31.215  -6.686   -9.699   1.00 0.00 ? 140 SER A HB2  1  
ATOM 2094  H HB3  . SER A 1 145 ? -30.808  -7.404   -11.255  1.00 0.00 ? 140 SER A HB3  1  
ATOM 2095  H HG   . SER A 1 145 ? -30.298  -9.226   -10.287  1.00 0.00 ? 140 SER A HG   1  
ATOM 2096  N N    . VAL A 1 146 ? -28.241  -7.790   -12.114  1.00 0.00 ? 141 VAL A N    1  
ATOM 2097  C CA   . VAL A 1 146 ? -27.247  -8.649   -12.824  1.00 0.00 ? 141 VAL A CA   1  
ATOM 2098  C C    . VAL A 1 146 ? -25.926  -7.887   -13.003  1.00 0.00 ? 141 VAL A C    1  
ATOM 2099  O O    . VAL A 1 146 ? -25.932  -6.712   -13.313  1.00 0.00 ? 141 VAL A O    1  
ATOM 2100  C CB   . VAL A 1 146 ? -27.882  -8.952   -14.184  1.00 0.00 ? 141 VAL A CB   1  
ATOM 2101  C CG1  . VAL A 1 146 ? -26.934  -9.824   -15.011  1.00 0.00 ? 141 VAL A CG1  1  
ATOM 2102  C CG2  . VAL A 1 146 ? -29.203  -9.697   -13.977  1.00 0.00 ? 141 VAL A CG2  1  
ATOM 2103  H H    . VAL A 1 146 ? -29.023  -7.445   -12.594  1.00 0.00 ? 141 VAL A H    1  
ATOM 2104  H HA   . VAL A 1 146 ? -27.087  -9.565   -12.280  1.00 0.00 ? 141 VAL A HA   1  
ATOM 2105  H HB   . VAL A 1 146 ? -28.068  -8.026   -14.709  1.00 0.00 ? 141 VAL A HB   1  
ATOM 2106  H HG11 . VAL A 1 146 ? -27.355  -9.982   -15.993  1.00 0.00 ? 141 VAL A HG11 1  
ATOM 2107  H HG12 . VAL A 1 146 ? -26.799  -10.776  -14.520  1.00 0.00 ? 141 VAL A HG12 1  
ATOM 2108  H HG13 . VAL A 1 146 ? -25.979  -9.328   -15.104  1.00 0.00 ? 141 VAL A HG13 1  
ATOM 2109  H HG21 . VAL A 1 146 ? -29.029  -10.762  -14.032  1.00 0.00 ? 141 VAL A HG21 1  
ATOM 2110  H HG22 . VAL A 1 146 ? -29.905  -9.407   -14.745  1.00 0.00 ? 141 VAL A HG22 1  
ATOM 2111  H HG23 . VAL A 1 146 ? -29.609  -9.449   -13.007  1.00 0.00 ? 141 VAL A HG23 1  
ATOM 2112  N N    . PRO A 1 147 ? -24.832  -8.580   -12.804  1.00 0.00 ? 142 PRO A N    1  
ATOM 2113  C CA   . PRO A 1 147 ? -23.498  -7.946   -12.949  1.00 0.00 ? 142 PRO A CA   1  
ATOM 2114  C C    . PRO A 1 147 ? -23.174  -7.721   -14.429  1.00 0.00 ? 142 PRO A C    1  
ATOM 2115  O O    . PRO A 1 147 ? -23.419  -8.571   -15.263  1.00 0.00 ? 142 PRO A O    1  
ATOM 2116  C CB   . PRO A 1 147 ? -22.545  -8.966   -12.334  1.00 0.00 ? 142 PRO A CB   1  
ATOM 2117  C CG   . PRO A 1 147 ? -23.248  -10.280  -12.457  1.00 0.00 ? 142 PRO A CG   1  
ATOM 2118  C CD   . PRO A 1 147 ? -24.728  -9.998   -12.428  1.00 0.00 ? 142 PRO A CD   1  
ATOM 2119  H HA   . PRO A 1 147 ? -23.454  -7.018   -12.402  1.00 0.00 ? 142 PRO A HA   1  
ATOM 2120  H HB2  . PRO A 1 147 ? -21.611  -8.983   -12.880  1.00 0.00 ? 142 PRO A HB2  1  
ATOM 2121  H HB3  . PRO A 1 147 ? -22.370  -8.737   -11.294  1.00 0.00 ? 142 PRO A HB3  1  
ATOM 2122  H HG2  . PRO A 1 147 ? -22.979  -10.755  -13.390  1.00 0.00 ? 142 PRO A HG2  1  
ATOM 2123  H HG3  . PRO A 1 147 ? -22.985  -10.918  -11.628  1.00 0.00 ? 142 PRO A HG3  1  
ATOM 2124  H HD2  . PRO A 1 147 ? -25.245  -10.621  -13.146  1.00 0.00 ? 142 PRO A HD2  1  
ATOM 2125  H HD3  . PRO A 1 147 ? -25.125  -10.149  -11.437  1.00 0.00 ? 142 PRO A HD3  1  
ATOM 2126  N N    . SER A 1 148 ? -22.625  -6.583   -14.760  1.00 0.00 ? 143 SER A N    1  
ATOM 2127  C CA   . SER A 1 148 ? -22.284  -6.302   -16.186  1.00 0.00 ? 143 SER A CA   1  
ATOM 2128  C C    . SER A 1 148 ? -20.766  -6.208   -16.359  1.00 0.00 ? 143 SER A C    1  
ATOM 2129  O O    . SER A 1 148 ? -20.218  -6.639   -17.355  1.00 0.00 ? 143 SER A O    1  
ATOM 2130  C CB   . SER A 1 148 ? -22.943  -4.959   -16.493  1.00 0.00 ? 143 SER A CB   1  
ATOM 2131  O OG   . SER A 1 148 ? -24.250  -5.183   -17.005  1.00 0.00 ? 143 SER A OG   1  
ATOM 2132  H H    . SER A 1 148 ? -22.436  -5.912   -14.071  1.00 0.00 ? 143 SER A H    1  
ATOM 2133  H HA   . SER A 1 148 ? -22.691  -7.067   -16.828  1.00 0.00 ? 143 SER A HA   1  
ATOM 2134  H HB2  . SER A 1 148 ? -23.012  -4.374   -15.591  1.00 0.00 ? 143 SER A HB2  1  
ATOM 2135  H HB3  . SER A 1 148 ? -22.347  -4.425   -17.221  1.00 0.00 ? 143 SER A HB3  1  
ATOM 2136  H HG   . SER A 1 148 ? -24.772  -4.394   -16.842  1.00 0.00 ? 143 SER A HG   1  
ATOM 2137  N N    . SER A 1 149 ? -20.084  -5.648   -15.395  1.00 0.00 ? 144 SER A N    1  
ATOM 2138  C CA   . SER A 1 149 ? -18.601  -5.526   -15.501  1.00 0.00 ? 144 SER A CA   1  
ATOM 2139  C C    . SER A 1 149 ? -17.929  -6.178   -14.290  1.00 0.00 ? 144 SER A C    1  
ATOM 2140  O O    . SER A 1 149 ? -17.695  -5.541   -13.281  1.00 0.00 ? 144 SER A O    1  
ATOM 2141  C CB   . SER A 1 149 ? -18.329  -4.022   -15.521  1.00 0.00 ? 144 SER A CB   1  
ATOM 2142  O OG   . SER A 1 149 ? -17.047  -3.785   -16.088  1.00 0.00 ? 144 SER A OG   1  
ATOM 2143  H H    . SER A 1 149 ? -20.547  -5.309   -14.601  1.00 0.00 ? 144 SER A H    1  
ATOM 2144  H HA   . SER A 1 149 ? -18.249  -5.976   -16.416  1.00 0.00 ? 144 SER A HA   1  
ATOM 2145  H HB2  . SER A 1 149 ? -19.077  -3.527   -16.116  1.00 0.00 ? 144 SER A HB2  1  
ATOM 2146  H HB3  . SER A 1 149 ? -18.363  -3.638   -14.510  1.00 0.00 ? 144 SER A HB3  1  
ATOM 2147  H HG   . SER A 1 149 ? -16.385  -3.999   -15.426  1.00 0.00 ? 144 SER A HG   1  
ATOM 2148  N N    . GLY A 1 150 ? -17.621  -7.443   -14.382  1.00 0.00 ? 145 GLY A N    1  
ATOM 2149  C CA   . GLY A 1 150 ? -16.966  -8.139   -13.237  1.00 0.00 ? 145 GLY A CA   1  
ATOM 2150  C C    . GLY A 1 150 ? -15.513  -7.677   -13.119  1.00 0.00 ? 145 GLY A C    1  
ATOM 2151  O O    . GLY A 1 150 ? -14.593  -8.404   -13.440  1.00 0.00 ? 145 GLY A O    1  
ATOM 2152  H H    . GLY A 1 150 ? -17.820  -7.937   -15.205  1.00 0.00 ? 145 GLY A H    1  
ATOM 2153  H HA2  . GLY A 1 150 ? -17.496  -7.905   -12.324  1.00 0.00 ? 145 GLY A HA2  1  
ATOM 2154  H HA3  . GLY A 1 150 ? -16.988  -9.206   -13.403  1.00 0.00 ? 145 GLY A HA3  1  
ATOM 2155  N N    . SER A 1 151 ? -15.300  -6.473   -12.659  1.00 0.00 ? 146 SER A N    1  
ATOM 2156  C CA   . SER A 1 151 ? -13.905  -5.962   -12.518  1.00 0.00 ? 146 SER A CA   1  
ATOM 2157  C C    . SER A 1 151 ? -13.311  -6.413   -11.180  1.00 0.00 ? 146 SER A C    1  
ATOM 2158  O O    . SER A 1 151 ? -13.040  -5.611   -10.308  1.00 0.00 ? 146 SER A O    1  
ATOM 2159  C CB   . SER A 1 151 ? -14.035  -4.440   -12.563  1.00 0.00 ? 146 SER A CB   1  
ATOM 2160  O OG   . SER A 1 151 ? -14.980  -4.020   -11.587  1.00 0.00 ? 146 SER A OG   1  
ATOM 2161  H H    . SER A 1 151 ? -16.057  -5.905   -12.406  1.00 0.00 ? 146 SER A H    1  
ATOM 2162  H HA   . SER A 1 151 ? -13.293  -6.304   -13.337  1.00 0.00 ? 146 SER A HA   1  
ATOM 2163  H HB2  . SER A 1 151 ? -13.081  -3.988   -12.350  1.00 0.00 ? 146 SER A HB2  1  
ATOM 2164  H HB3  . SER A 1 151 ? -14.362  -4.137   -13.549  1.00 0.00 ? 146 SER A HB3  1  
ATOM 2165  H HG   . SER A 1 151 ? -15.795  -3.793   -12.041  1.00 0.00 ? 146 SER A HG   1  
ATOM 2166  N N    . SER A 1 152 ? -13.107  -7.693   -11.014  1.00 0.00 ? 147 SER A N    1  
ATOM 2167  C CA   . SER A 1 152 ? -12.532  -8.200   -9.735   1.00 0.00 ? 147 SER A CA   1  
ATOM 2168  C C    . SER A 1 152 ? -11.011  -8.334   -9.854   1.00 0.00 ? 147 SER A C    1  
ATOM 2169  O O    . SER A 1 152 ? -10.437  -9.340   -9.483   1.00 0.00 ? 147 SER A O    1  
ATOM 2170  C CB   . SER A 1 152 ? -13.175  -9.570   -9.527   1.00 0.00 ? 147 SER A CB   1  
ATOM 2171  O OG   . SER A 1 152 ? -14.561  -9.403   -9.258   1.00 0.00 ? 147 SER A OG   1  
ATOM 2172  H H    . SER A 1 152 ? -13.334  -8.321   -11.732  1.00 0.00 ? 147 SER A H    1  
ATOM 2173  H HA   . SER A 1 152 ? -12.790  -7.544   -8.919   1.00 0.00 ? 147 SER A HA   1  
ATOM 2174  H HB2  . SER A 1 152 ? -13.057  -10.165  -10.418  1.00 0.00 ? 147 SER A HB2  1  
ATOM 2175  H HB3  . SER A 1 152 ? -12.694  -10.071  -8.697   1.00 0.00 ? 147 SER A HB3  1  
ATOM 2176  H HG   . SER A 1 152 ? -15.039  -10.094  -9.723   1.00 0.00 ? 147 SER A HG   1  
ATOM 2177  N N    . GLY A 1 153 ? -10.356  -7.328   -10.368  1.00 0.00 ? 148 GLY A N    1  
ATOM 2178  C CA   . GLY A 1 153 ? -8.873   -7.395   -10.511  1.00 0.00 ? 148 GLY A CA   1  
ATOM 2179  C C    . GLY A 1 153 ? -8.509   -7.558   -11.988  1.00 0.00 ? 148 GLY A C    1  
ATOM 2180  O O    . GLY A 1 153 ? -8.854   -8.540   -12.617  1.00 0.00 ? 148 GLY A O    1  
ATOM 2181  H H    . GLY A 1 153 ? -10.840  -6.527   -10.660  1.00 0.00 ? 148 GLY A H    1  
ATOM 2182  H HA2  . GLY A 1 153 ? -8.433   -6.486   -10.128  1.00 0.00 ? 148 GLY A HA2  1  
ATOM 2183  H HA3  . GLY A 1 153 ? -8.496   -8.240   -9.956   1.00 0.00 ? 148 GLY A HA3  1  
ATOM 2184  N N    . ARG A 1 154 ? -7.814   -6.603   -12.546  1.00 0.00 ? 149 ARG A N    1  
ATOM 2185  C CA   . ARG A 1 154 ? -7.425   -6.702   -13.984  1.00 0.00 ? 149 ARG A CA   1  
ATOM 2186  C C    . ARG A 1 154 ? -6.415   -7.836   -14.181  1.00 0.00 ? 149 ARG A C    1  
ATOM 2187  O O    . ARG A 1 154 ? -6.257   -8.692   -13.332  1.00 0.00 ? 149 ARG A O    1  
ATOM 2188  C CB   . ARG A 1 154 ? -6.792   -5.349   -14.322  1.00 0.00 ? 149 ARG A CB   1  
ATOM 2189  C CG   . ARG A 1 154 ? -7.756   -4.532   -15.188  1.00 0.00 ? 149 ARG A CG   1  
ATOM 2190  C CD   . ARG A 1 154 ? -7.766   -3.077   -14.713  1.00 0.00 ? 149 ARG A CD   1  
ATOM 2191  N NE   . ARG A 1 154 ? -8.978   -2.961   -13.856  1.00 0.00 ? 149 ARG A NE   1  
ATOM 2192  C CZ   . ARG A 1 154 ? -10.016  -2.293   -14.279  1.00 0.00 ? 149 ARG A CZ   1  
ATOM 2193  N NH1  . ARG A 1 154 ? -10.897  -2.874   -15.047  1.00 0.00 ? 149 ARG A NH1  1  
ATOM 2194  N NH2  . ARG A 1 154 ? -10.173  -1.044   -13.935  1.00 0.00 ? 149 ARG A NH2  1  
ATOM 2195  H H    . ARG A 1 154 ? -7.547   -5.821   -12.018  1.00 0.00 ? 149 ARG A H    1  
ATOM 2196  H HA   . ARG A 1 154 ? -8.297   -6.865   -14.598  1.00 0.00 ? 149 ARG A HA   1  
ATOM 2197  H HB2  . ARG A 1 154 ? -6.583   -4.811   -13.408  1.00 0.00 ? 149 ARG A HB2  1  
ATOM 2198  H HB3  . ARG A 1 154 ? -5.872   -5.507   -14.864  1.00 0.00 ? 149 ARG A HB3  1  
ATOM 2199  H HG2  . ARG A 1 154 ? -7.435   -4.573   -16.219  1.00 0.00 ? 149 ARG A HG2  1  
ATOM 2200  H HG3  . ARG A 1 154 ? -8.752   -4.942   -15.105  1.00 0.00 ? 149 ARG A HG3  1  
ATOM 2201  H HD2  . ARG A 1 154 ? -6.874   -2.863   -14.140  1.00 0.00 ? 149 ARG A HD2  1  
ATOM 2202  H HD3  . ARG A 1 154 ? -7.844   -2.407   -15.555  1.00 0.00 ? 149 ARG A HD3  1  
ATOM 2203  H HE   . ARG A 1 154 ? -8.996   -3.387   -12.973  1.00 0.00 ? 149 ARG A HE   1  
ATOM 2204  H HH11 . ARG A 1 154 ? -10.777  -3.831   -15.311  1.00 0.00 ? 149 ARG A HH11 1  
ATOM 2205  H HH12 . ARG A 1 154 ? -11.693  -2.362   -15.372  1.00 0.00 ? 149 ARG A HH12 1  
ATOM 2206  H HH21 . ARG A 1 154 ? -9.498   -0.599   -13.346  1.00 0.00 ? 149 ARG A HH21 1  
ATOM 2207  H HH22 . ARG A 1 154 ? -10.968  -0.532   -14.259  1.00 0.00 ? 149 ARG A HH22 1  
ATOM 2208  N N    . GLU A 1 155 ? -5.731   -7.849   -15.294  1.00 0.00 ? 150 GLU A N    1  
ATOM 2209  C CA   . GLU A 1 155 ? -4.732   -8.929   -15.545  1.00 0.00 ? 150 GLU A CA   1  
ATOM 2210  C C    . GLU A 1 155 ? -3.480   -8.352   -16.213  1.00 0.00 ? 150 GLU A C    1  
ATOM 2211  O O    . GLU A 1 155 ? -3.557   -7.677   -17.221  1.00 0.00 ? 150 GLU A O    1  
ATOM 2212  C CB   . GLU A 1 155 ? -5.439   -9.915   -16.480  1.00 0.00 ? 150 GLU A CB   1  
ATOM 2213  C CG   . GLU A 1 155 ? -5.807   -9.215   -17.793  1.00 0.00 ? 150 GLU A CG   1  
ATOM 2214  C CD   . GLU A 1 155 ? -7.196   -9.670   -18.245  1.00 0.00 ? 150 GLU A CD   1  
ATOM 2215  O OE1  . GLU A 1 155 ? -8.083   -9.719   -17.409  1.00 0.00 ? 150 GLU A OE1  1  
ATOM 2216  O OE2  . GLU A 1 155 ? -7.349   -9.961   -19.420  1.00 0.00 ? 150 GLU A OE2  1  
ATOM 2217  H H    . GLU A 1 155 ? -5.875   -7.150   -15.965  1.00 0.00 ? 150 GLU A H    1  
ATOM 2218  H HA   . GLU A 1 155 ? -4.472   -9.422   -14.622  1.00 0.00 ? 150 GLU A HA   1  
ATOM 2219  H HB2  . GLU A 1 155 ? -4.781   -10.746  -16.688  1.00 0.00 ? 150 GLU A HB2  1  
ATOM 2220  H HB3  . GLU A 1 155 ? -6.338   -10.278  -16.004  1.00 0.00 ? 150 GLU A HB3  1  
ATOM 2221  H HG2  . GLU A 1 155 ? -5.808   -8.145   -17.643  1.00 0.00 ? 150 GLU A HG2  1  
ATOM 2222  H HG3  . GLU A 1 155 ? -5.083   -9.471   -18.551  1.00 0.00 ? 150 GLU A HG3  1  
ATOM 2223  N N    . GLU A 1 156 ? -2.326   -8.615   -15.658  1.00 0.00 ? 151 GLU A N    1  
ATOM 2224  C CA   . GLU A 1 156 ? -1.067   -8.086   -16.259  1.00 0.00 ? 151 GLU A CA   1  
ATOM 2225  C C    . GLU A 1 156 ? -0.495   -9.096   -17.258  1.00 0.00 ? 151 GLU A C    1  
ATOM 2226  O O    . GLU A 1 156 ? -0.023   -8.735   -18.318  1.00 0.00 ? 151 GLU A O    1  
ATOM 2227  C CB   . GLU A 1 156 ? -0.111   -7.896   -15.077  1.00 0.00 ? 151 GLU A CB   1  
ATOM 2228  C CG   . GLU A 1 156 ? 0.196    -6.407   -14.899  1.00 0.00 ? 151 GLU A CG   1  
ATOM 2229  C CD   . GLU A 1 156 ? -0.859   -5.772   -13.992  1.00 0.00 ? 151 GLU A CD   1  
ATOM 2230  O OE1  . GLU A 1 156 ? -1.047   -6.272   -12.894  1.00 0.00 ? 151 GLU A OE1  1  
ATOM 2231  O OE2  . GLU A 1 156 ? -1.462   -4.798   -14.410  1.00 0.00 ? 151 GLU A OE2  1  
ATOM 2232  H H    . GLU A 1 156 ? -2.288   -9.163   -14.846  1.00 0.00 ? 151 GLU A H    1  
ATOM 2233  H HA   . GLU A 1 156 ? -1.250   -7.139   -16.743  1.00 0.00 ? 151 GLU A HA   1  
ATOM 2234  H HB2  . GLU A 1 156 ? -0.571   -8.279   -14.177  1.00 0.00 ? 151 GLU A HB2  1  
ATOM 2235  H HB3  . GLU A 1 156 ? 0.808    -8.430   -15.267  1.00 0.00 ? 151 GLU A HB3  1  
ATOM 2236  H HG2  . GLU A 1 156 ? 1.173    -6.293   -14.450  1.00 0.00 ? 151 GLU A HG2  1  
ATOM 2237  H HG3  . GLU A 1 156 ? 0.182    -5.918   -15.861  1.00 0.00 ? 151 GLU A HG3  1  
ATOM 2238  N N    . ASP A 1 157 ? -0.535   -10.361  -16.926  1.00 0.00 ? 152 ASP A N    1  
ATOM 2239  C CA   . ASP A 1 157 ? 0.004    -11.405  -17.851  1.00 0.00 ? 152 ASP A CA   1  
ATOM 2240  C C    . ASP A 1 157 ? 1.436    -11.062  -18.273  1.00 0.00 ? 152 ASP A C    1  
ATOM 2241  O O    . ASP A 1 157 ? 2.088    -10.231  -17.671  1.00 0.00 ? 152 ASP A O    1  
ATOM 2242  C CB   . ASP A 1 157 ? -0.932   -11.389  -19.063  1.00 0.00 ? 152 ASP A CB   1  
ATOM 2243  C CG   . ASP A 1 157 ? -1.867   -12.599  -19.004  1.00 0.00 ? 152 ASP A CG   1  
ATOM 2244  O OD1  . ASP A 1 157 ? -2.279   -12.953  -17.912  1.00 0.00 ? 152 ASP A OD1  1  
ATOM 2245  O OD2  . ASP A 1 157 ? -2.155   -13.152  -20.053  1.00 0.00 ? 152 ASP A OD2  1  
ATOM 2246  H H    . ASP A 1 157 ? -0.921   -10.626  -16.065  1.00 0.00 ? 152 ASP A H    1  
ATOM 2247  H HA   . ASP A 1 157 ? -0.024   -12.374  -17.378  1.00 0.00 ? 152 ASP A HA   1  
ATOM 2248  H HB2  . ASP A 1 157 ? -1.517   -10.481  -19.054  1.00 0.00 ? 152 ASP A HB2  1  
ATOM 2249  H HB3  . ASP A 1 157 ? -0.349   -11.432  -19.970  1.00 0.00 ? 152 ASP A HB3  1  
ATOM 2250  N N    . ALA A 1 158 ? 1.928    -11.697  -19.304  1.00 0.00 ? 153 ALA A N    1  
ATOM 2251  C CA   . ALA A 1 158 ? 3.317    -11.411  -19.767  1.00 0.00 ? 153 ALA A CA   1  
ATOM 2252  C C    . ALA A 1 158 ? 3.287    -10.666  -21.104  1.00 0.00 ? 153 ALA A C    1  
ATOM 2253  O O    . ALA A 1 158 ? 2.785    -11.165  -22.092  1.00 0.00 ? 153 ALA A O    1  
ATOM 2254  C CB   . ALA A 1 158 ? 3.969    -12.784  -19.933  1.00 0.00 ? 153 ALA A CB   1  
ATOM 2255  H H    . ALA A 1 158 ? 1.384    -12.364  -19.773  1.00 0.00 ? 153 ALA A H    1  
ATOM 2256  H HA   . ALA A 1 158 ? 3.851    -10.837  -19.027  1.00 0.00 ? 153 ALA A HA   1  
ATOM 2257  H HB1  . ALA A 1 158 ? 3.859    -13.114  -20.956  1.00 0.00 ? 153 ALA A HB1  1  
ATOM 2258  H HB2  . ALA A 1 158 ? 3.490    -13.492  -19.273  1.00 0.00 ? 153 ALA A HB2  1  
ATOM 2259  H HB3  . ALA A 1 158 ? 5.019    -12.717  -19.688  1.00 0.00 ? 153 ALA A HB3  1  
ATOM 2260  N N    . ALA A 1 159 ? 3.822    -9.475   -21.142  1.00 0.00 ? 154 ALA A N    1  
ATOM 2261  C CA   . ALA A 1 159 ? 3.825    -8.696   -22.415  1.00 0.00 ? 154 ALA A CA   1  
ATOM 2262  C C    . ALA A 1 159 ? 5.263    -8.409   -22.855  1.00 0.00 ? 154 ALA A C    1  
ATOM 2263  O O    . ALA A 1 159 ? 5.657    -8.722   -23.962  1.00 0.00 ? 154 ALA A O    1  
ATOM 2264  C CB   . ALA A 1 159 ? 3.095    -7.394   -22.085  1.00 0.00 ? 154 ALA A CB   1  
ATOM 2265  H H    . ALA A 1 159 ? 4.221    -9.092   -20.333  1.00 0.00 ? 154 ALA A H    1  
ATOM 2266  H HA   . ALA A 1 159 ? 3.294    -9.231   -23.186  1.00 0.00 ? 154 ALA A HA   1  
ATOM 2267  H HB1  . ALA A 1 159 ? 3.390    -7.055   -21.103  1.00 0.00 ? 154 ALA A HB1  1  
ATOM 2268  H HB2  . ALA A 1 159 ? 2.029    -7.565   -22.101  1.00 0.00 ? 154 ALA A HB2  1  
ATOM 2269  H HB3  . ALA A 1 159 ? 3.351    -6.642   -22.817  1.00 0.00 ? 154 ALA A HB3  1  
ATOM 2270  N N    . SER A 1 160 ? 6.049    -7.817   -21.996  1.00 0.00 ? 155 SER A N    1  
ATOM 2271  C CA   . SER A 1 160 ? 7.462    -7.509   -22.363  1.00 0.00 ? 155 SER A CA   1  
ATOM 2272  C C    . SER A 1 160 ? 8.291    -8.796   -22.397  1.00 0.00 ? 155 SER A C    1  
ATOM 2273  O O    . SER A 1 160 ? 9.163    -9.007   -21.576  1.00 0.00 ? 155 SER A O    1  
ATOM 2274  C CB   . SER A 1 160 ? 7.964    -6.575   -21.261  1.00 0.00 ? 155 SER A CB   1  
ATOM 2275  O OG   . SER A 1 160 ? 7.206    -5.373   -21.285  1.00 0.00 ? 155 SER A OG   1  
ATOM 2276  H H    . SER A 1 160 ? 5.709    -7.574   -21.109  1.00 0.00 ? 155 SER A H    1  
ATOM 2277  H HA   . SER A 1 160 ? 7.504    -7.009   -23.317  1.00 0.00 ? 155 SER A HA   1  
ATOM 2278  H HB2  . SER A 1 160 ? 7.846    -7.051   -20.302  1.00 0.00 ? 155 SER A HB2  1  
ATOM 2279  H HB3  . SER A 1 160 ? 9.011    -6.357   -21.426  1.00 0.00 ? 155 SER A HB3  1  
ATOM 2280  H HG   . SER A 1 160 ? 7.095    -5.075   -20.379  1.00 0.00 ? 155 SER A HG   1  
ATOM 2281  N N    . THR A 1 161 ? 8.024    -9.658   -23.341  1.00 0.00 ? 156 THR A N    1  
ATOM 2282  C CA   . THR A 1 161 ? 8.794    -10.933  -23.431  1.00 0.00 ? 156 THR A CA   1  
ATOM 2283  C C    . THR A 1 161 ? 9.750    -10.891  -24.626  1.00 0.00 ? 156 THR A C    1  
ATOM 2284  O O    . THR A 1 161 ? 10.777   -11.541  -24.634  1.00 0.00 ? 156 THR A O    1  
ATOM 2285  C CB   . THR A 1 161 ? 7.738    -12.021  -23.627  1.00 0.00 ? 156 THR A CB   1  
ATOM 2286  O OG1  . THR A 1 161 ? 6.725    -11.877  -22.641  1.00 0.00 ? 156 THR A OG1  1  
ATOM 2287  C CG2  . THR A 1 161 ? 8.390    -13.398  -23.495  1.00 0.00 ? 156 THR A CG2  1  
ATOM 2288  H H    . THR A 1 161 ? 7.317    -9.467   -23.992  1.00 0.00 ? 156 THR A H    1  
ATOM 2289  H HA   . THR A 1 161 ? 9.340    -11.109  -22.518  1.00 0.00 ? 156 THR A HA   1  
ATOM 2290  H HB   . THR A 1 161 ? 7.301    -11.927  -24.609  1.00 0.00 ? 156 THR A HB   1  
ATOM 2291  H HG1  . THR A 1 161 ? 5.964    -12.391  -22.921  1.00 0.00 ? 156 THR A HG1  1  
ATOM 2292  H HG21 . THR A 1 161 ? 9.393    -13.361  -23.892  1.00 0.00 ? 156 THR A HG21 1  
ATOM 2293  H HG22 . THR A 1 161 ? 7.811    -14.124  -24.047  1.00 0.00 ? 156 THR A HG22 1  
ATOM 2294  H HG23 . THR A 1 161 ? 8.425    -13.682  -22.454  1.00 0.00 ? 156 THR A HG23 1  
ATOM 2295  N N    . LEU A 1 162 ? 9.420    -10.128  -25.634  1.00 0.00 ? 157 LEU A N    1  
ATOM 2296  C CA   . LEU A 1 162 ? 10.307   -10.040  -26.830  1.00 0.00 ? 157 LEU A CA   1  
ATOM 2297  C C    . LEU A 1 162 ? 10.156   -8.672   -27.501  1.00 0.00 ? 157 LEU A C    1  
ATOM 2298  O O    . LEU A 1 162 ? 11.071   -8.180   -28.129  1.00 0.00 ? 157 LEU A O    1  
ATOM 2299  C CB   . LEU A 1 162 ? 9.834    -11.154  -27.765  1.00 0.00 ? 157 LEU A CB   1  
ATOM 2300  C CG   . LEU A 1 162 ? 10.515   -12.472  -27.380  1.00 0.00 ? 157 LEU A CG   1  
ATOM 2301  C CD1  . LEU A 1 162 ? 9.492    -13.412  -26.740  1.00 0.00 ? 157 LEU A CD1  1  
ATOM 2302  C CD2  . LEU A 1 162 ? 11.096   -13.133  -28.633  1.00 0.00 ? 157 LEU A CD2  1  
ATOM 2303  H H    . LEU A 1 162 ? 8.589    -9.613   -25.603  1.00 0.00 ? 157 LEU A H    1  
ATOM 2304  H HA   . LEU A 1 162 ? 11.334   -10.207  -26.548  1.00 0.00 ? 157 LEU A HA   1  
ATOM 2305  H HB2  . LEU A 1 162 ? 8.762    -11.261  -27.682  1.00 0.00 ? 157 LEU A HB2  1  
ATOM 2306  H HB3  . LEU A 1 162 ? 10.093   -10.900  -28.781  1.00 0.00 ? 157 LEU A HB3  1  
ATOM 2307  H HG   . LEU A 1 162 ? 11.310   -12.274  -26.675  1.00 0.00 ? 157 LEU A HG   1  
ATOM 2308  H HD11 . LEU A 1 162 ? 9.060    -12.937  -25.872  1.00 0.00 ? 157 LEU A HD11 1  
ATOM 2309  H HD12 . LEU A 1 162 ? 9.980    -14.328  -26.443  1.00 0.00 ? 157 LEU A HD12 1  
ATOM 2310  H HD13 . LEU A 1 162 ? 8.712    -13.635  -27.453  1.00 0.00 ? 157 LEU A HD13 1  
ATOM 2311  H HD21 . LEU A 1 162 ? 10.377   -13.077  -29.436  1.00 0.00 ? 157 LEU A HD21 1  
ATOM 2312  H HD22 . LEU A 1 162 ? 11.320   -14.169  -28.422  1.00 0.00 ? 157 LEU A HD22 1  
ATOM 2313  H HD23 . LEU A 1 162 ? 12.002   -12.621  -28.923  1.00 0.00 ? 157 LEU A HD23 1  
ATOM 2314  N N    . VAL A 1 163 ? 9.006    -8.058   -27.374  1.00 0.00 ? 158 VAL A N    1  
ATOM 2315  C CA   . VAL A 1 163 ? 8.782    -6.721   -27.999  1.00 0.00 ? 158 VAL A CA   1  
ATOM 2316  C C    . VAL A 1 163 ? 9.973    -5.791   -27.746  1.00 0.00 ? 158 VAL A C    1  
ATOM 2317  O O    . VAL A 1 163 ? 10.384   -5.581   -26.622  1.00 0.00 ? 158 VAL A O    1  
ATOM 2318  C CB   . VAL A 1 163 ? 7.523    -6.172   -27.323  1.00 0.00 ? 158 VAL A CB   1  
ATOM 2319  C CG1  . VAL A 1 163 ? 6.340    -7.095   -27.622  1.00 0.00 ? 158 VAL A CG1  1  
ATOM 2320  C CG2  . VAL A 1 163 ? 7.740    -6.097   -25.809  1.00 0.00 ? 158 VAL A CG2  1  
ATOM 2321  H H    . VAL A 1 163 ? 8.284    -8.478   -26.871  1.00 0.00 ? 158 VAL A H    1  
ATOM 2322  H HA   . VAL A 1 163 ? 8.611    -6.829   -29.054  1.00 0.00 ? 158 VAL A HA   1  
ATOM 2323  H HB   . VAL A 1 163 ? 7.314    -5.185   -27.707  1.00 0.00 ? 158 VAL A HB   1  
ATOM 2324  H HG11 . VAL A 1 163 ? 6.233    -7.814   -26.823  1.00 0.00 ? 158 VAL A HG11 1  
ATOM 2325  H HG12 . VAL A 1 163 ? 6.515    -7.615   -28.552  1.00 0.00 ? 158 VAL A HG12 1  
ATOM 2326  H HG13 . VAL A 1 163 ? 5.437    -6.508   -27.701  1.00 0.00 ? 158 VAL A HG13 1  
ATOM 2327  H HG21 . VAL A 1 163 ? 8.157    -7.030   -25.457  1.00 0.00 ? 158 VAL A HG21 1  
ATOM 2328  H HG22 . VAL A 1 163 ? 6.795    -5.918   -25.318  1.00 0.00 ? 158 VAL A HG22 1  
ATOM 2329  H HG23 . VAL A 1 163 ? 8.422    -5.291   -25.582  1.00 0.00 ? 158 VAL A HG23 1  
ATOM 2330  N N    . THR A 1 164 ? 10.520   -5.231   -28.789  1.00 0.00 ? 159 THR A N    1  
ATOM 2331  C CA   . THR A 1 164 ? 11.687   -4.304   -28.615  1.00 0.00 ? 159 THR A CA   1  
ATOM 2332  C C    . THR A 1 164 ? 11.454   -3.021   -29.425  1.00 0.00 ? 159 THR A C    1  
ATOM 2333  O O    . THR A 1 164 ? 10.359   -2.493   -29.444  1.00 0.00 ? 159 THR A O    1  
ATOM 2334  C CB   . THR A 1 164 ? 12.899   -5.079   -29.141  1.00 0.00 ? 159 THR A CB   1  
ATOM 2335  O OG1  . THR A 1 164 ? 12.705   -5.380   -30.514  1.00 0.00 ? 159 THR A OG1  1  
ATOM 2336  C CG2  . THR A 1 164 ? 13.071   -6.378   -28.351  1.00 0.00 ? 159 THR A CG2  1  
ATOM 2337  H H    . THR A 1 164 ? 10.156   -5.418   -29.690  1.00 0.00 ? 159 THR A H    1  
ATOM 2338  H HA   . THR A 1 164 ? 11.824   -4.068   -27.572  1.00 0.00 ? 159 THR A HA   1  
ATOM 2339  H HB   . THR A 1 164 ? 13.787   -4.477   -29.028  1.00 0.00 ? 159 THR A HB   1  
ATOM 2340  H HG1  . THR A 1 164 ? 13.489   -5.100   -30.993  1.00 0.00 ? 159 THR A HG1  1  
ATOM 2341  H HG21 . THR A 1 164 ? 12.377   -6.393   -27.524  1.00 0.00 ? 159 THR A HG21 1  
ATOM 2342  H HG22 . THR A 1 164 ? 14.081   -6.438   -27.972  1.00 0.00 ? 159 THR A HG22 1  
ATOM 2343  H HG23 . THR A 1 164 ? 12.880   -7.221   -28.998  1.00 0.00 ? 159 THR A HG23 1  
ATOM 2344  N N    . GLY A 1 165 ? 12.459   -2.515   -30.106  1.00 0.00 ? 160 GLY A N    1  
ATOM 2345  C CA   . GLY A 1 165 ? 12.259   -1.276   -30.919  1.00 0.00 ? 160 GLY A CA   1  
ATOM 2346  C C    . GLY A 1 165 ? 11.059   -1.488   -31.844  1.00 0.00 ? 160 GLY A C    1  
ATOM 2347  O O    . GLY A 1 165 ? 10.181   -0.654   -31.947  1.00 0.00 ? 160 GLY A O    1  
ATOM 2348  H H    . GLY A 1 165 ? 13.334   -2.952   -30.092  1.00 0.00 ? 160 GLY A H    1  
ATOM 2349  H HA2  . GLY A 1 165 ? 12.071   -0.438   -30.262  1.00 0.00 ? 160 GLY A HA2  1  
ATOM 2350  H HA3  . GLY A 1 165 ? 13.139   -1.084   -31.512  1.00 0.00 ? 160 GLY A HA3  1  
ATOM 2351  N N    . SER A 1 166 ? 11.009   -2.620   -32.492  1.00 0.00 ? 161 SER A N    1  
ATOM 2352  C CA   . SER A 1 166 ? 9.859    -2.927   -33.389  1.00 0.00 ? 161 SER A CA   1  
ATOM 2353  C C    . SER A 1 166 ? 8.835    -3.772   -32.630  1.00 0.00 ? 161 SER A C    1  
ATOM 2354  O O    . SER A 1 166 ? 7.912    -4.314   -33.201  1.00 0.00 ? 161 SER A O    1  
ATOM 2355  C CB   . SER A 1 166 ? 10.466   -3.700   -34.559  1.00 0.00 ? 161 SER A CB   1  
ATOM 2356  O OG   . SER A 1 166 ? 10.090   -3.075   -35.780  1.00 0.00 ? 161 SER A OG   1  
ATOM 2357  H H    . SER A 1 166 ? 11.721   -3.282   -32.370  1.00 0.00 ? 161 SER A H    1  
ATOM 2358  H HA   . SER A 1 166 ? 9.395    -2.022   -33.740  1.00 0.00 ? 161 SER A HA   1  
ATOM 2359  H HB2  . SER A 1 166 ? 11.540   -3.698   -34.477  1.00 0.00 ? 161 SER A HB2  1  
ATOM 2360  H HB3  . SER A 1 166 ? 10.109   -4.719   -34.540  1.00 0.00 ? 161 SER A HB3  1  
ATOM 2361  H HG   . SER A 1 166 ? 10.436   -2.180   -35.773  1.00 0.00 ? 161 SER A HG   1  
ATOM 2362  N N    . GLU A 1 167 ? 8.991    -3.858   -31.334  1.00 0.00 ? 162 GLU A N    1  
ATOM 2363  C CA   . GLU A 1 167 ? 8.040    -4.630   -30.485  1.00 0.00 ? 162 GLU A CA   1  
ATOM 2364  C C    . GLU A 1 167 ? 7.636    -5.969   -31.135  1.00 0.00 ? 162 GLU A C    1  
ATOM 2365  O O    . GLU A 1 167 ? 8.384    -6.937   -31.139  1.00 0.00 ? 162 GLU A O    1  
ATOM 2366  C CB   . GLU A 1 167 ? 6.837    -3.691   -30.325  1.00 0.00 ? 162 GLU A CB   1  
ATOM 2367  C CG   . GLU A 1 167 ? 5.782    -4.347   -29.428  1.00 0.00 ? 162 GLU A CG   1  
ATOM 2368  C CD   . GLU A 1 167 ? 4.384    -4.000   -29.944  1.00 0.00 ? 162 GLU A CD   1  
ATOM 2369  O OE1  . GLU A 1 167 ? 4.131    -2.828   -30.169  1.00 0.00 ? 162 GLU A OE1  1  
ATOM 2370  O OE2  . GLU A 1 167 ? 3.590    -4.912   -30.104  1.00 0.00 ? 162 GLU A OE2  1  
ATOM 2371  H H    . GLU A 1 167 ? 9.733    -3.390   -30.910  1.00 0.00 ? 162 GLU A H    1  
ATOM 2372  H HA   . GLU A 1 167 ? 8.473    -4.810   -29.518  1.00 0.00 ? 162 GLU A HA   1  
ATOM 2373  H HB2  . GLU A 1 167 ? 7.164    -2.765   -29.876  1.00 0.00 ? 162 GLU A HB2  1  
ATOM 2374  H HB3  . GLU A 1 167 ? 6.407    -3.486   -31.294  1.00 0.00 ? 162 GLU A HB3  1  
ATOM 2375  H HG2  . GLU A 1 167 ? 5.915    -5.419   -29.440  1.00 0.00 ? 162 GLU A HG2  1  
ATOM 2376  H HG3  . GLU A 1 167 ? 5.892    -3.981   -28.419  1.00 0.00 ? 162 GLU A HG3  1  
ATOM 2377  N N    . TYR A 1 168 ? 6.460    -6.025   -31.680  1.00 0.00 ? 163 TYR A N    1  
ATOM 2378  C CA   . TYR A 1 168 ? 5.980    -7.280   -32.313  1.00 0.00 ? 163 TYR A CA   1  
ATOM 2379  C C    . TYR A 1 168 ? 6.655    -7.472   -33.661  1.00 0.00 ? 163 TYR A C    1  
ATOM 2380  O O    . TYR A 1 168 ? 6.738    -8.571   -34.165  1.00 0.00 ? 163 TYR A O    1  
ATOM 2381  C CB   . TYR A 1 168 ? 4.458    -7.099   -32.450  1.00 0.00 ? 163 TYR A CB   1  
ATOM 2382  C CG   . TYR A 1 168 ? 4.050    -7.090   -33.909  1.00 0.00 ? 163 TYR A CG   1  
ATOM 2383  C CD1  . TYR A 1 168 ? 4.146    -8.262   -34.669  1.00 0.00 ? 163 TYR A CD1  1  
ATOM 2384  C CD2  . TYR A 1 168 ? 3.590    -5.907   -34.500  1.00 0.00 ? 163 TYR A CD2  1  
ATOM 2385  C CE1  . TYR A 1 168 ? 3.784    -8.251   -36.018  1.00 0.00 ? 163 TYR A CE1  1  
ATOM 2386  C CE2  . TYR A 1 168 ? 3.225    -5.898   -35.851  1.00 0.00 ? 163 TYR A CE2  1  
ATOM 2387  C CZ   . TYR A 1 168 ? 3.323    -7.070   -36.611  1.00 0.00 ? 163 TYR A CZ   1  
ATOM 2388  O OH   . TYR A 1 168 ? 2.966    -7.060   -37.944  1.00 0.00 ? 163 TYR A OH   1  
ATOM 2389  H H    . TYR A 1 168 ? 5.896    -5.236   -31.678  1.00 0.00 ? 163 TYR A H    1  
ATOM 2390  H HA   . TYR A 1 168 ? 6.186    -8.123   -31.673  1.00 0.00 ? 163 TYR A HA   1  
ATOM 2391  H HB2  . TYR A 1 168 ? 3.958    -7.912   -31.945  1.00 0.00 ? 163 TYR A HB2  1  
ATOM 2392  H HB3  . TYR A 1 168 ? 4.169    -6.165   -31.992  1.00 0.00 ? 163 TYR A HB3  1  
ATOM 2393  H HD1  . TYR A 1 168 ? 4.502    -9.175   -34.212  1.00 0.00 ? 163 TYR A HD1  1  
ATOM 2394  H HD2  . TYR A 1 168 ? 3.515    -5.004   -33.914  1.00 0.00 ? 163 TYR A HD2  1  
ATOM 2395  H HE1  . TYR A 1 168 ? 3.860    -9.155   -36.601  1.00 0.00 ? 163 TYR A HE1  1  
ATOM 2396  H HE2  . TYR A 1 168 ? 2.869    -4.986   -36.308  1.00 0.00 ? 163 TYR A HE2  1  
ATOM 2397  H HH   . TYR A 1 168 ? 2.058    -6.756   -38.006  1.00 0.00 ? 163 TYR A HH   1  
ATOM 2398  N N    . GLU A 1 169 ? 7.148    -6.419   -34.245  1.00 0.00 ? 164 GLU A N    1  
ATOM 2399  C CA   . GLU A 1 169 ? 7.823    -6.574   -35.554  1.00 0.00 ? 164 GLU A CA   1  
ATOM 2400  C C    . GLU A 1 169 ? 9.184    -7.210   -35.317  1.00 0.00 ? 164 GLU A C    1  
ATOM 2401  O O    . GLU A 1 169 ? 9.657    -8.007   -36.104  1.00 0.00 ? 164 GLU A O    1  
ATOM 2402  C CB   . GLU A 1 169 ? 7.959    -5.170   -36.128  1.00 0.00 ? 164 GLU A CB   1  
ATOM 2403  C CG   . GLU A 1 169 ? 6.586    -4.661   -36.577  1.00 0.00 ? 164 GLU A CG   1  
ATOM 2404  C CD   . GLU A 1 169 ? 6.402    -3.212   -36.118  1.00 0.00 ? 164 GLU A CD   1  
ATOM 2405  O OE1  . GLU A 1 169 ? 6.744    -2.923   -34.983  1.00 0.00 ? 164 GLU A OE1  1  
ATOM 2406  O OE2  . GLU A 1 169 ? 5.922    -2.418   -36.909  1.00 0.00 ? 164 GLU A OE2  1  
ATOM 2407  H H    . GLU A 1 169 ? 7.088    -5.538   -33.816  1.00 0.00 ? 164 GLU A H    1  
ATOM 2408  H HA   . GLU A 1 169 ? 7.225    -7.187   -36.205  1.00 0.00 ? 164 GLU A HA   1  
ATOM 2409  H HB2  . GLU A 1 169 ? 8.359    -4.514   -35.374  1.00 0.00 ? 164 GLU A HB2  1  
ATOM 2410  H HB3  . GLU A 1 169 ? 8.624    -5.199   -36.976  1.00 0.00 ? 164 GLU A HB3  1  
ATOM 2411  H HG2  . GLU A 1 169 ? 6.520    -4.709   -37.654  1.00 0.00 ? 164 GLU A HG2  1  
ATOM 2412  H HG3  . GLU A 1 169 ? 5.812    -5.275   -36.141  1.00 0.00 ? 164 GLU A HG3  1  
ATOM 2413  N N    . THR A 1 170 ? 9.800    -6.896   -34.206  1.00 0.00 ? 165 THR A N    1  
ATOM 2414  C CA   . THR A 1 170 ? 11.111   -7.523   -33.891  1.00 0.00 ? 165 THR A CA   1  
ATOM 2415  C C    . THR A 1 170 ? 10.870   -9.016   -33.716  1.00 0.00 ? 165 THR A C    1  
ATOM 2416  O O    . THR A 1 170 ? 11.670   -9.844   -34.108  1.00 0.00 ? 165 THR A O    1  
ATOM 2417  C CB   . THR A 1 170 ? 11.573   -6.887   -32.580  1.00 0.00 ? 165 THR A CB   1  
ATOM 2418  O OG1  . THR A 1 170 ? 11.701   -5.483   -32.759  1.00 0.00 ? 165 THR A OG1  1  
ATOM 2419  C CG2  . THR A 1 170 ? 12.925   -7.479   -32.176  1.00 0.00 ? 165 THR A CG2  1  
ATOM 2420  H H    . THR A 1 170 ? 9.383    -6.277   -33.569  1.00 0.00 ? 165 THR A H    1  
ATOM 2421  H HA   . THR A 1 170 ? 11.825   -7.337   -34.678  1.00 0.00 ? 165 THR A HA   1  
ATOM 2422  H HB   . THR A 1 170 ? 10.850   -7.088   -31.806  1.00 0.00 ? 165 THR A HB   1  
ATOM 2423  H HG1  . THR A 1 170 ? 12.376   -5.329   -33.424  1.00 0.00 ? 165 THR A HG1  1  
ATOM 2424  H HG21 . THR A 1 170 ? 12.980   -7.547   -31.099  1.00 0.00 ? 165 THR A HG21 1  
ATOM 2425  H HG22 . THR A 1 170 ? 13.719   -6.843   -32.537  1.00 0.00 ? 165 THR A HG22 1  
ATOM 2426  H HG23 . THR A 1 170 ? 13.029   -8.465   -32.605  1.00 0.00 ? 165 THR A HG23 1  
ATOM 2427  N N    . MET A 1 171 ? 9.732    -9.361   -33.169  1.00 0.00 ? 166 MET A N    1  
ATOM 2428  C CA   . MET A 1 171 ? 9.389    -10.792  -33.010  1.00 0.00 ? 166 MET A CA   1  
ATOM 2429  C C    . MET A 1 171 ? 8.877    -11.300  -34.358  1.00 0.00 ? 166 MET A C    1  
ATOM 2430  O O    . MET A 1 171 ? 9.108    -12.428  -34.746  1.00 0.00 ? 166 MET A O    1  
ATOM 2431  C CB   . MET A 1 171 ? 8.282    -10.830  -31.952  1.00 0.00 ? 166 MET A CB   1  
ATOM 2432  C CG   . MET A 1 171 ? 8.762    -11.628  -30.735  1.00 0.00 ? 166 MET A CG   1  
ATOM 2433  S SD   . MET A 1 171 ? 8.093    -13.311  -30.797  1.00 0.00 ? 166 MET A SD   1  
ATOM 2434  C CE   . MET A 1 171 ? 8.511    -13.671  -32.520  1.00 0.00 ? 166 MET A CE   1  
ATOM 2435  H H    . MET A 1 171 ? 9.091    -8.676   -32.899  1.00 0.00 ? 166 MET A H    1  
ATOM 2436  H HA   . MET A 1 171 ? 10.246   -11.357  -32.683  1.00 0.00 ? 166 MET A HA   1  
ATOM 2437  H HB2  . MET A 1 171 ? 8.040    -9.821   -31.648  1.00 0.00 ? 166 MET A HB2  1  
ATOM 2438  H HB3  . MET A 1 171 ? 7.403    -11.301  -32.366  1.00 0.00 ? 166 MET A HB3  1  
ATOM 2439  H HG2  . MET A 1 171 ? 9.841    -11.671  -30.738  1.00 0.00 ? 166 MET A HG2  1  
ATOM 2440  H HG3  . MET A 1 171 ? 8.426    -11.141  -29.832  1.00 0.00 ? 166 MET A HG3  1  
ATOM 2441  H HE1  . MET A 1 171 ? 9.502    -13.294  -32.739  1.00 0.00 ? 166 MET A HE1  1  
ATOM 2442  H HE2  . MET A 1 171 ? 7.795    -13.191  -33.170  1.00 0.00 ? 166 MET A HE2  1  
ATOM 2443  H HE3  . MET A 1 171 ? 8.483    -14.739  -32.683  1.00 0.00 ? 166 MET A HE3  1  
ATOM 2444  N N    . LEU A 1 172 ? 8.199    -10.450  -35.090  1.00 0.00 ? 167 LEU A N    1  
ATOM 2445  C CA   . LEU A 1 172 ? 7.683    -10.858  -36.425  1.00 0.00 ? 167 LEU A CA   1  
ATOM 2446  C C    . LEU A 1 172 ? 8.838    -11.399  -37.261  1.00 0.00 ? 167 LEU A C    1  
ATOM 2447  O O    . LEU A 1 172 ? 8.691    -12.346  -38.004  1.00 0.00 ? 167 LEU A O    1  
ATOM 2448  C CB   . LEU A 1 172 ? 7.097    -9.587   -37.048  1.00 0.00 ? 167 LEU A CB   1  
ATOM 2449  C CG   . LEU A 1 172 ? 6.169    -9.958   -38.212  1.00 0.00 ? 167 LEU A CG   1  
ATOM 2450  C CD1  . LEU A 1 172 ? 5.092    -10.941  -37.735  1.00 0.00 ? 167 LEU A CD1  1  
ATOM 2451  C CD2  . LEU A 1 172 ? 5.498    -8.692   -38.749  1.00 0.00 ? 167 LEU A CD2  1  
ATOM 2452  H H    . LEU A 1 172 ? 8.046    -9.541   -34.765  1.00 0.00 ? 167 LEU A H    1  
ATOM 2453  H HA   . LEU A 1 172 ? 6.917    -11.599  -36.314  1.00 0.00 ? 167 LEU A HA   1  
ATOM 2454  H HB2  . LEU A 1 172 ? 6.536    -9.047   -36.300  1.00 0.00 ? 167 LEU A HB2  1  
ATOM 2455  H HB3  . LEU A 1 172 ? 7.899    -8.964   -37.415  1.00 0.00 ? 167 LEU A HB3  1  
ATOM 2456  H HG   . LEU A 1 172 ? 6.750    -10.419  -38.998  1.00 0.00 ? 167 LEU A HG   1  
ATOM 2457  H HD11 . LEU A 1 172 ? 4.150    -10.709  -38.213  1.00 0.00 ? 167 LEU A HD11 1  
ATOM 2458  H HD12 . LEU A 1 172 ? 4.979    -10.863  -36.663  1.00 0.00 ? 167 LEU A HD12 1  
ATOM 2459  H HD13 . LEU A 1 172 ? 5.387    -11.945  -37.992  1.00 0.00 ? 167 LEU A HD13 1  
ATOM 2460  H HD21 . LEU A 1 172 ? 4.485    -8.919   -39.045  1.00 0.00 ? 167 LEU A HD21 1  
ATOM 2461  H HD22 . LEU A 1 172 ? 6.050    -8.327   -39.603  1.00 0.00 ? 167 LEU A HD22 1  
ATOM 2462  H HD23 . LEU A 1 172 ? 5.487    -7.936   -37.977  1.00 0.00 ? 167 LEU A HD23 1  
ATOM 2463  N N    . THR A 1 173 ? 9.998    -10.820  -37.112  1.00 0.00 ? 168 THR A N    1  
ATOM 2464  C CA   . THR A 1 173 ? 11.180   -11.315  -37.864  1.00 0.00 ? 168 THR A CA   1  
ATOM 2465  C C    . THR A 1 173 ? 11.707   -12.569  -37.171  1.00 0.00 ? 168 THR A C    1  
ATOM 2466  O O    . THR A 1 173 ? 12.244   -13.463  -37.797  1.00 0.00 ? 168 THR A O    1  
ATOM 2467  C CB   . THR A 1 173 ? 12.205   -10.183  -37.787  1.00 0.00 ? 168 THR A CB   1  
ATOM 2468  O OG1  . THR A 1 173 ? 11.583   -8.959   -38.155  1.00 0.00 ? 168 THR A OG1  1  
ATOM 2469  C CG2  . THR A 1 173 ? 13.366   -10.474  -38.738  1.00 0.00 ? 168 THR A CG2  1  
ATOM 2470  H H    . THR A 1 173 ? 10.096   -10.077  -36.483  1.00 0.00 ? 168 THR A H    1  
ATOM 2471  H HA   . THR A 1 173 ? 10.923   -11.522  -38.891  1.00 0.00 ? 168 THR A HA   1  
ATOM 2472  H HB   . THR A 1 173 ? 12.580   -10.108  -36.779  1.00 0.00 ? 168 THR A HB   1  
ATOM 2473  H HG1  . THR A 1 173 ? 11.160   -9.086   -39.007  1.00 0.00 ? 168 THR A HG1  1  
ATOM 2474  H HG21 . THR A 1 173 ? 13.677   -11.502  -38.623  1.00 0.00 ? 168 THR A HG21 1  
ATOM 2475  H HG22 . THR A 1 173 ? 14.194   -9.820   -38.507  1.00 0.00 ? 168 THR A HG22 1  
ATOM 2476  H HG23 . THR A 1 173 ? 13.048   -10.306  -39.757  1.00 0.00 ? 168 THR A HG23 1  
ATOM 2477  N N    . GLU A 1 174 ? 11.539   -12.642  -35.874  1.00 0.00 ? 169 GLU A N    1  
ATOM 2478  C CA   . GLU A 1 174 ? 12.011   -13.840  -35.126  1.00 0.00 ? 169 GLU A CA   1  
ATOM 2479  C C    . GLU A 1 174 ? 11.265   -15.078  -35.617  1.00 0.00 ? 169 GLU A C    1  
ATOM 2480  O O    . GLU A 1 174 ? 11.819   -16.158  -35.695  1.00 0.00 ? 169 GLU A O    1  
ATOM 2481  C CB   . GLU A 1 174 ? 11.688   -13.560  -33.658  1.00 0.00 ? 169 GLU A CB   1  
ATOM 2482  C CG   . GLU A 1 174 ? 12.987   -13.486  -32.851  1.00 0.00 ? 169 GLU A CG   1  
ATOM 2483  C CD   . GLU A 1 174 ? 13.556   -14.894  -32.670  1.00 0.00 ? 169 GLU A CD   1  
ATOM 2484  O OE1  . GLU A 1 174 ? 12.823   -15.755  -32.212  1.00 0.00 ? 169 GLU A OE1  1  
ATOM 2485  O OE2  . GLU A 1 174 ? 14.717   -15.088  -32.993  1.00 0.00 ? 169 GLU A OE2  1  
ATOM 2486  H H    . GLU A 1 174 ? 11.093   -11.911  -35.398  1.00 0.00 ? 169 GLU A H    1  
ATOM 2487  H HA   . GLU A 1 174 ? 13.066   -13.964  -35.250  1.00 0.00 ? 169 GLU A HA   1  
ATOM 2488  H HB2  . GLU A 1 174 ? 11.162   -12.622  -33.579  1.00 0.00 ? 169 GLU A HB2  1  
ATOM 2489  H HB3  . GLU A 1 174 ? 11.070   -14.354  -33.267  1.00 0.00 ? 169 GLU A HB3  1  
ATOM 2490  H HG2  . GLU A 1 174 ? 13.703   -12.872  -33.377  1.00 0.00 ? 169 GLU A HG2  1  
ATOM 2491  H HG3  . GLU A 1 174 ? 12.785   -13.054  -31.882  1.00 0.00 ? 169 GLU A HG3  1  
ATOM 2492  N N    . ILE A 1 175 ? 10.011   -14.930  -35.953  1.00 0.00 ? 170 ILE A N    1  
ATOM 2493  C CA   . ILE A 1 175 ? 9.234    -16.109  -36.444  1.00 0.00 ? 170 ILE A CA   1  
ATOM 2494  C C    . ILE A 1 175 ? 9.142    -16.095  -37.977  1.00 0.00 ? 170 ILE A C    1  
ATOM 2495  O O    . ILE A 1 175 ? 9.534    -17.038  -38.631  1.00 0.00 ? 170 ILE A O    1  
ATOM 2496  C CB   . ILE A 1 175 ? 7.849    -15.980  -35.801  1.00 0.00 ? 170 ILE A CB   1  
ATOM 2497  C CG1  . ILE A 1 175 ? 7.880    -16.636  -34.418  1.00 0.00 ? 170 ILE A CG1  1  
ATOM 2498  C CG2  . ILE A 1 175 ? 6.798    -16.683  -36.668  1.00 0.00 ? 170 ILE A CG2  1  
ATOM 2499  C CD1  . ILE A 1 175 ? 6.671    -16.173  -33.607  1.00 0.00 ? 170 ILE A CD1  1  
ATOM 2500  H H    . ILE A 1 175 ? 9.583    -14.043  -35.881  1.00 0.00 ? 170 ILE A H    1  
ATOM 2501  H HA   . ILE A 1 175 ? 9.703    -17.022  -36.112  1.00 0.00 ? 170 ILE A HA   1  
ATOM 2502  H HB   . ILE A 1 175 ? 7.593    -14.937  -35.700  1.00 0.00 ? 170 ILE A HB   1  
ATOM 2503  H HG12 . ILE A 1 175 ? 7.851    -17.710  -34.528  1.00 0.00 ? 170 ILE A HG12 1  
ATOM 2504  H HG13 . ILE A 1 175 ? 8.786    -16.351  -33.905  1.00 0.00 ? 170 ILE A HG13 1  
ATOM 2505  H HG21 . ILE A 1 175 ? 5.841    -16.655  -36.169  1.00 0.00 ? 170 ILE A HG21 1  
ATOM 2506  H HG22 . ILE A 1 175 ? 7.092    -17.710  -36.828  1.00 0.00 ? 170 ILE A HG22 1  
ATOM 2507  H HG23 . ILE A 1 175 ? 6.722    -16.179  -37.621  1.00 0.00 ? 170 ILE A HG23 1  
ATOM 2508  H HD11 . ILE A 1 175 ? 5.811    -16.768  -33.872  1.00 0.00 ? 170 ILE A HD11 1  
ATOM 2509  H HD12 . ILE A 1 175 ? 6.472    -15.136  -33.825  1.00 0.00 ? 170 ILE A HD12 1  
ATOM 2510  H HD13 . ILE A 1 175 ? 6.879    -16.286  -32.554  1.00 0.00 ? 170 ILE A HD13 1  
ATOM 2511  N N    . MET A 1 176 ? 8.622    -15.035  -38.550  1.00 0.00 ? 171 MET A N    1  
ATOM 2512  C CA   . MET A 1 176 ? 8.498    -14.955  -40.044  1.00 0.00 ? 171 MET A CA   1  
ATOM 2513  C C    . MET A 1 176 ? 9.727    -15.563  -40.724  1.00 0.00 ? 171 MET A C    1  
ATOM 2514  O O    . MET A 1 176 ? 9.614    -16.357  -41.636  1.00 0.00 ? 171 MET A O    1  
ATOM 2515  C CB   . MET A 1 176 ? 8.398    -13.463  -40.363  1.00 0.00 ? 171 MET A CB   1  
ATOM 2516  C CG   . MET A 1 176 ? 8.169    -13.276  -41.864  1.00 0.00 ? 171 MET A CG   1  
ATOM 2517  S SD   . MET A 1 176 ? 7.747    -11.548  -42.198  1.00 0.00 ? 171 MET A SD   1  
ATOM 2518  C CE   . MET A 1 176 ? 9.299    -10.821  -41.620  1.00 0.00 ? 171 MET A CE   1  
ATOM 2519  H H    . MET A 1 176 ? 8.310    -14.289  -37.997  1.00 0.00 ? 171 MET A H    1  
ATOM 2520  H HA   . MET A 1 176 ? 7.603    -15.459  -40.371  1.00 0.00 ? 171 MET A HA   1  
ATOM 2521  H HB2  . MET A 1 176 ? 7.572    -13.033  -39.815  1.00 0.00 ? 171 MET A HB2  1  
ATOM 2522  H HB3  . MET A 1 176 ? 9.316    -12.971  -40.077  1.00 0.00 ? 171 MET A HB3  1  
ATOM 2523  H HG2  . MET A 1 176 ? 9.069    -13.537  -42.401  1.00 0.00 ? 171 MET A HG2  1  
ATOM 2524  H HG3  . MET A 1 176 ? 7.360    -13.914  -42.187  1.00 0.00 ? 171 MET A HG3  1  
ATOM 2525  H HE1  . MET A 1 176 ? 9.258    -10.693  -40.547  1.00 0.00 ? 171 MET A HE1  1  
ATOM 2526  H HE2  . MET A 1 176 ? 9.445    -9.861   -42.088  1.00 0.00 ? 171 MET A HE2  1  
ATOM 2527  H HE3  . MET A 1 176 ? 10.121   -11.474  -41.879  1.00 0.00 ? 171 MET A HE3  1  
ATOM 2528  N N    . SER A 1 177 ? 10.897   -15.183  -40.284  1.00 0.00 ? 172 SER A N    1  
ATOM 2529  C CA   . SER A 1 177 ? 12.159   -15.716  -40.888  1.00 0.00 ? 172 SER A CA   1  
ATOM 2530  C C    . SER A 1 177 ? 12.050   -17.221  -41.180  1.00 0.00 ? 172 SER A C    1  
ATOM 2531  O O    . SER A 1 177 ? 12.662   -17.723  -42.103  1.00 0.00 ? 172 SER A O    1  
ATOM 2532  C CB   . SER A 1 177 ? 13.232   -15.455  -39.831  1.00 0.00 ? 172 SER A CB   1  
ATOM 2533  O OG   . SER A 1 177 ? 14.357   -16.287  -40.084  1.00 0.00 ? 172 SER A OG   1  
ATOM 2534  H H    . SER A 1 177 ? 10.948   -14.537  -39.548  1.00 0.00 ? 172 SER A H    1  
ATOM 2535  H HA   . SER A 1 177 ? 12.399   -15.176  -41.790  1.00 0.00 ? 172 SER A HA   1  
ATOM 2536  H HB2  . SER A 1 177 ? 13.537   -14.423  -39.874  1.00 0.00 ? 172 SER A HB2  1  
ATOM 2537  H HB3  . SER A 1 177 ? 12.826   -15.667  -38.850  1.00 0.00 ? 172 SER A HB3  1  
ATOM 2538  H HG   . SER A 1 177 ? 14.469   -16.871  -39.331  1.00 0.00 ? 172 SER A HG   1  
ATOM 2539  N N    . MET A 1 178 ? 11.277   -17.943  -40.409  1.00 0.00 ? 173 MET A N    1  
ATOM 2540  C CA   . MET A 1 178 ? 11.139   -19.411  -40.662  1.00 0.00 ? 173 MET A CA   1  
ATOM 2541  C C    . MET A 1 178 ? 10.596   -19.652  -42.073  1.00 0.00 ? 173 MET A C    1  
ATOM 2542  O O    . MET A 1 178 ? 10.812   -20.693  -42.663  1.00 0.00 ? 173 MET A O    1  
ATOM 2543  C CB   . MET A 1 178 ? 10.144   -19.917  -39.613  1.00 0.00 ? 173 MET A CB   1  
ATOM 2544  C CG   . MET A 1 178 ? 10.770   -21.070  -38.823  1.00 0.00 ? 173 MET A CG   1  
ATOM 2545  S SD   . MET A 1 178 ? 11.835   -20.402  -37.520  1.00 0.00 ? 173 MET A SD   1  
ATOM 2546  C CE   . MET A 1 178 ? 10.548   -19.515  -36.609  1.00 0.00 ? 173 MET A CE   1  
ATOM 2547  H H    . MET A 1 178 ? 10.788   -17.522  -39.671  1.00 0.00 ? 173 MET A H    1  
ATOM 2548  H HA   . MET A 1 178 ? 12.088   -19.903  -40.538  1.00 0.00 ? 173 MET A HA   1  
ATOM 2549  H HB2  . MET A 1 178 ? 9.892    -19.115  -38.938  1.00 0.00 ? 173 MET A HB2  1  
ATOM 2550  H HB3  . MET A 1 178 ? 9.249    -20.267  -40.104  1.00 0.00 ? 173 MET A HB3  1  
ATOM 2551  H HG2  . MET A 1 178 ? 9.989    -21.667  -38.378  1.00 0.00 ? 173 MET A HG2  1  
ATOM 2552  H HG3  . MET A 1 178 ? 11.358   -21.684  -39.489  1.00 0.00 ? 173 MET A HG3  1  
ATOM 2553  H HE1  . MET A 1 178 ? 10.369   -18.559  -37.083  1.00 0.00 ? 173 MET A HE1  1  
ATOM 2554  H HE2  . MET A 1 178 ? 10.868   -19.356  -35.592  1.00 0.00 ? 173 MET A HE2  1  
ATOM 2555  H HE3  . MET A 1 178 ? 9.638    -20.099  -36.611  1.00 0.00 ? 173 MET A HE3  1  
ATOM 2556  N N    . GLY A 1 179 ? 9.896    -18.694  -42.616  1.00 0.00 ? 174 GLY A N    1  
ATOM 2557  C CA   . GLY A 1 179 ? 9.337    -18.858  -43.989  1.00 0.00 ? 174 GLY A CA   1  
ATOM 2558  C C    . GLY A 1 179 ? 7.827    -18.606  -43.966  1.00 0.00 ? 174 GLY A C    1  
ATOM 2559  O O    . GLY A 1 179 ? 7.108    -19.020  -44.855  1.00 0.00 ? 174 GLY A O    1  
ATOM 2560  H H    . GLY A 1 179 ? 9.737    -17.864  -42.119  1.00 0.00 ? 174 GLY A H    1  
ATOM 2561  H HA2  . GLY A 1 179 ? 9.811    -18.152  -44.655  1.00 0.00 ? 174 GLY A HA2  1  
ATOM 2562  H HA3  . GLY A 1 179 ? 9.525    -19.863  -44.336  1.00 0.00 ? 174 GLY A HA3  1  
ATOM 2563  N N    . TYR A 1 180 ? 7.339    -17.933  -42.957  1.00 0.00 ? 175 TYR A N    1  
ATOM 2564  C CA   . TYR A 1 180 ? 5.874    -17.657  -42.880  1.00 0.00 ? 175 TYR A CA   1  
ATOM 2565  C C    . TYR A 1 180 ? 5.545    -16.339  -43.584  1.00 0.00 ? 175 TYR A C    1  
ATOM 2566  O O    . TYR A 1 180 ? 6.329    -15.821  -44.354  1.00 0.00 ? 175 TYR A O    1  
ATOM 2567  C CB   . TYR A 1 180 ? 5.565    -17.557  -41.384  1.00 0.00 ? 175 TYR A CB   1  
ATOM 2568  C CG   . TYR A 1 180 ? 5.951    -18.845  -40.695  1.00 0.00 ? 175 TYR A CG   1  
ATOM 2569  C CD1  . TYR A 1 180 ? 5.568    -20.076  -41.242  1.00 0.00 ? 175 TYR A CD1  1  
ATOM 2570  C CD2  . TYR A 1 180 ? 6.694    -18.808  -39.509  1.00 0.00 ? 175 TYR A CD2  1  
ATOM 2571  C CE1  . TYR A 1 180 ? 5.927    -21.268  -40.604  1.00 0.00 ? 175 TYR A CE1  1  
ATOM 2572  C CE2  . TYR A 1 180 ? 7.053    -20.000  -38.871  1.00 0.00 ? 175 TYR A CE2  1  
ATOM 2573  C CZ   . TYR A 1 180 ? 6.670    -21.230  -39.418  1.00 0.00 ? 175 TYR A CZ   1  
ATOM 2574  O OH   . TYR A 1 180 ? 7.024    -22.406  -38.788  1.00 0.00 ? 175 TYR A OH   1  
ATOM 2575  H H    . TYR A 1 180 ? 7.933    -17.609  -42.249  1.00 0.00 ? 175 TYR A H    1  
ATOM 2576  H HA   . TYR A 1 180 ? 5.314    -18.469  -43.318  1.00 0.00 ? 175 TYR A HA   1  
ATOM 2577  H HB2  . TYR A 1 180 ? 6.125    -16.738  -40.956  1.00 0.00 ? 175 TYR A HB2  1  
ATOM 2578  H HB3  . TYR A 1 180 ? 4.508    -17.380  -41.247  1.00 0.00 ? 175 TYR A HB3  1  
ATOM 2579  H HD1  . TYR A 1 180 ? 4.995    -20.105  -42.158  1.00 0.00 ? 175 TYR A HD1  1  
ATOM 2580  H HD2  . TYR A 1 180 ? 6.989    -17.859  -39.087  1.00 0.00 ? 175 TYR A HD2  1  
ATOM 2581  H HE1  . TYR A 1 180 ? 5.631    -22.216  -41.026  1.00 0.00 ? 175 TYR A HE1  1  
ATOM 2582  H HE2  . TYR A 1 180 ? 7.626    -19.971  -37.956  1.00 0.00 ? 175 TYR A HE2  1  
ATOM 2583  H HH   . TYR A 1 180 ? 6.231    -22.788  -38.404  1.00 0.00 ? 175 TYR A HH   1  
ATOM 2584  N N    . GLU A 1 181 ? 4.387    -15.795  -43.322  1.00 0.00 ? 176 GLU A N    1  
ATOM 2585  C CA   . GLU A 1 181 ? 3.998    -14.509  -43.971  1.00 0.00 ? 176 GLU A CA   1  
ATOM 2586  C C    . GLU A 1 181 ? 4.242    -13.341  -43.009  1.00 0.00 ? 176 GLU A C    1  
ATOM 2587  O O    . GLU A 1 181 ? 5.124    -13.389  -42.174  1.00 0.00 ? 176 GLU A O    1  
ATOM 2588  C CB   . GLU A 1 181 ? 2.505    -14.661  -44.273  1.00 0.00 ? 176 GLU A CB   1  
ATOM 2589  C CG   . GLU A 1 181 ? 2.196    -14.058  -45.645  1.00 0.00 ? 176 GLU A CG   1  
ATOM 2590  C CD   . GLU A 1 181 ? 0.748    -13.563  -45.671  1.00 0.00 ? 176 GLU A CD   1  
ATOM 2591  O OE1  . GLU A 1 181 ? 0.445    -12.641  -44.933  1.00 0.00 ? 176 GLU A OE1  1  
ATOM 2592  O OE2  . GLU A 1 181 ? -0.033   -14.116  -46.428  1.00 0.00 ? 176 GLU A OE2  1  
ATOM 2593  H H    . GLU A 1 181 ? 3.773    -16.233  -42.696  1.00 0.00 ? 176 GLU A H    1  
ATOM 2594  H HA   . GLU A 1 181 ? 4.548    -14.366  -44.887  1.00 0.00 ? 176 GLU A HA   1  
ATOM 2595  H HB2  . GLU A 1 181 ? 2.243    -15.709  -44.272  1.00 0.00 ? 176 GLU A HB2  1  
ATOM 2596  H HB3  . GLU A 1 181 ? 1.931    -14.145  -43.518  1.00 0.00 ? 176 GLU A HB3  1  
ATOM 2597  H HG2  . GLU A 1 181 ? 2.864    -13.229  -45.833  1.00 0.00 ? 176 GLU A HG2  1  
ATOM 2598  H HG3  . GLU A 1 181 ? 2.330    -14.810  -46.408  1.00 0.00 ? 176 GLU A HG3  1  
ATOM 2599  N N    . ARG A 1 182 ? 3.468    -12.293  -43.116  1.00 0.00 ? 177 ARG A N    1  
ATOM 2600  C CA   . ARG A 1 182 ? 3.655    -11.126  -42.205  1.00 0.00 ? 177 ARG A CA   1  
ATOM 2601  C C    . ARG A 1 182 ? 2.394    -10.914  -41.363  1.00 0.00 ? 177 ARG A C    1  
ATOM 2602  O O    . ARG A 1 182 ? 2.440    -10.899  -40.149  1.00 0.00 ? 177 ARG A O    1  
ATOM 2603  C CB   . ARG A 1 182 ? 3.889    -9.932   -43.131  1.00 0.00 ? 177 ARG A CB   1  
ATOM 2604  C CG   . ARG A 1 182 ? 5.383    -9.804   -43.435  1.00 0.00 ? 177 ARG A CG   1  
ATOM 2605  C CD   . ARG A 1 182 ? 5.608    -8.648   -44.412  1.00 0.00 ? 177 ARG A CD   1  
ATOM 2606  N NE   . ARG A 1 182 ? 6.868    -7.998   -43.957  1.00 0.00 ? 177 ARG A NE   1  
ATOM 2607  C CZ   . ARG A 1 182 ? 7.566    -7.273   -44.788  1.00 0.00 ? 177 ARG A CZ   1  
ATOM 2608  N NH1  . ARG A 1 182 ? 7.872    -7.744   -45.966  1.00 0.00 ? 177 ARG A NH1  1  
ATOM 2609  N NH2  . ARG A 1 182 ? 7.957    -6.077   -44.442  1.00 0.00 ? 177 ARG A NH2  1  
ATOM 2610  H H    . ARG A 1 182 ? 2.762    -12.273  -43.795  1.00 0.00 ? 177 ARG A H    1  
ATOM 2611  H HA   . ARG A 1 182 ? 4.515    -11.277  -41.569  1.00 0.00 ? 177 ARG A HA   1  
ATOM 2612  H HB2  . ARG A 1 182 ? 3.345    -10.081  -44.052  1.00 0.00 ? 177 ARG A HB2  1  
ATOM 2613  H HB3  . ARG A 1 182 ? 3.543    -9.030   -42.649  1.00 0.00 ? 177 ARG A HB3  1  
ATOM 2614  H HG2  . ARG A 1 182 ? 5.922    -9.612   -42.518  1.00 0.00 ? 177 ARG A HG2  1  
ATOM 2615  H HG3  . ARG A 1 182 ? 5.741    -10.721  -43.878  1.00 0.00 ? 177 ARG A HG3  1  
ATOM 2616  H HD2  . ARG A 1 182 ? 5.719    -9.025   -45.420  1.00 0.00 ? 177 ARG A HD2  1  
ATOM 2617  H HD3  . ARG A 1 182 ? 4.790    -7.946   -44.360  1.00 0.00 ? 177 ARG A HD3  1  
ATOM 2618  H HE   . ARG A 1 182 ? 7.173    -8.114   -43.033  1.00 0.00 ? 177 ARG A HE   1  
ATOM 2619  H HH11 . ARG A 1 182 ? 7.572    -8.660   -46.231  1.00 0.00 ? 177 ARG A HH11 1  
ATOM 2620  H HH12 . ARG A 1 182 ? 8.407    -7.189   -46.603  1.00 0.00 ? 177 ARG A HH12 1  
ATOM 2621  H HH21 . ARG A 1 182 ? 7.723    -5.716   -43.539  1.00 0.00 ? 177 ARG A HH21 1  
ATOM 2622  H HH22 . ARG A 1 182 ? 8.492    -5.522   -45.079  1.00 0.00 ? 177 ARG A HH22 1  
ATOM 2623  N N    . GLU A 1 183 ? 1.267    -10.755  -42.004  1.00 0.00 ? 178 GLU A N    1  
ATOM 2624  C CA   . GLU A 1 183 ? -0.005   -10.548  -41.250  1.00 0.00 ? 178 GLU A CA   1  
ATOM 2625  C C    . GLU A 1 183 ? -0.433   -11.853  -40.574  1.00 0.00 ? 178 GLU A C    1  
ATOM 2626  O O    . GLU A 1 183 ? -1.045   -11.848  -39.524  1.00 0.00 ? 178 GLU A O    1  
ATOM 2627  C CB   . GLU A 1 183 ? -1.030   -10.123  -42.302  1.00 0.00 ? 178 GLU A CB   1  
ATOM 2628  C CG   . GLU A 1 183 ? -1.090   -8.596   -42.368  1.00 0.00 ? 178 GLU A CG   1  
ATOM 2629  C CD   . GLU A 1 183 ? -2.409   -8.163   -43.010  1.00 0.00 ? 178 GLU A CD   1  
ATOM 2630  O OE1  . GLU A 1 183 ? -2.773   -8.745   -44.018  1.00 0.00 ? 178 GLU A OE1  1  
ATOM 2631  O OE2  . GLU A 1 183 ? -3.032   -7.256   -42.483  1.00 0.00 ? 178 GLU A OE2  1  
ATOM 2632  H H    . GLU A 1 183 ? 1.256    -10.775  -42.984  1.00 0.00 ? 178 GLU A H    1  
ATOM 2633  H HA   . GLU A 1 183 ? 0.117    -9.767   -40.516  1.00 0.00 ? 178 GLU A HA   1  
ATOM 2634  H HB2  . GLU A 1 183 ? -0.739   -10.515  -43.267  1.00 0.00 ? 178 GLU A HB2  1  
ATOM 2635  H HB3  . GLU A 1 183 ? -2.002   -10.509  -42.035  1.00 0.00 ? 178 GLU A HB3  1  
ATOM 2636  H HG2  . GLU A 1 183 ? -1.025   -8.190   -41.368  1.00 0.00 ? 178 GLU A HG2  1  
ATOM 2637  H HG3  . GLU A 1 183 ? -0.266   -8.228   -42.960  1.00 0.00 ? 178 GLU A HG3  1  
ATOM 2638  N N    . ARG A 1 184 ? -0.116   -12.972  -41.168  1.00 0.00 ? 179 ARG A N    1  
ATOM 2639  C CA   . ARG A 1 184 ? -0.502   -14.275  -40.553  1.00 0.00 ? 179 ARG A CA   1  
ATOM 2640  C C    . ARG A 1 184 ? 0.371    -14.554  -39.334  1.00 0.00 ? 179 ARG A C    1  
ATOM 2641  O O    . ARG A 1 184 ? -0.063   -15.166  -38.378  1.00 0.00 ? 179 ARG A O    1  
ATOM 2642  C CB   . ARG A 1 184 ? -0.261   -15.323  -41.640  1.00 0.00 ? 179 ARG A CB   1  
ATOM 2643  C CG   . ARG A 1 184 ? -1.602   -15.792  -42.211  1.00 0.00 ? 179 ARG A CG   1  
ATOM 2644  C CD   . ARG A 1 184 ? -1.534   -17.291  -42.515  1.00 0.00 ? 179 ARG A CD   1  
ATOM 2645  N NE   . ARG A 1 184 ? -1.277   -17.374  -43.979  1.00 0.00 ? 179 ARG A NE   1  
ATOM 2646  C CZ   . ARG A 1 184 ? -2.010   -18.151  -44.728  1.00 0.00 ? 179 ARG A CZ   1  
ATOM 2647  N NH1  . ARG A 1 184 ? -2.233   -19.385  -44.367  1.00 0.00 ? 179 ARG A NH1  1  
ATOM 2648  N NH2  . ARG A 1 184 ? -2.521   -17.694  -45.839  1.00 0.00 ? 179 ARG A NH2  1  
ATOM 2649  H H    . ARG A 1 184 ? 0.378    -12.955  -42.014  1.00 0.00 ? 179 ARG A H    1  
ATOM 2650  H HA   . ARG A 1 184 ? -1.540   -14.266  -40.270  1.00 0.00 ? 179 ARG A HA   1  
ATOM 2651  H HB2  . ARG A 1 184 ? 0.337    -14.891  -42.430  1.00 0.00 ? 179 ARG A HB2  1  
ATOM 2652  H HB3  . ARG A 1 184 ? 0.261    -16.167  -41.215  1.00 0.00 ? 179 ARG A HB3  1  
ATOM 2653  H HG2  . ARG A 1 184 ? -2.385   -15.605  -41.490  1.00 0.00 ? 179 ARG A HG2  1  
ATOM 2654  H HG3  . ARG A 1 184 ? -1.814   -15.252  -43.122  1.00 0.00 ? 179 ARG A HG3  1  
ATOM 2655  H HD2  . ARG A 1 184 ? -0.725   -17.749  -41.962  1.00 0.00 ? 179 ARG A HD2  1  
ATOM 2656  H HD3  . ARG A 1 184 ? -2.472   -17.766  -42.276  1.00 0.00 ? 179 ARG A HD3  1  
ATOM 2657  H HE   . ARG A 1 184 ? -0.557   -16.844  -44.381  1.00 0.00 ? 179 ARG A HE   1  
ATOM 2658  H HH11 . ARG A 1 184 ? -1.842   -19.736  -43.516  1.00 0.00 ? 179 ARG A HH11 1  
ATOM 2659  H HH12 . ARG A 1 184 ? -2.795   -19.981  -44.941  1.00 0.00 ? 179 ARG A HH12 1  
ATOM 2660  H HH21 . ARG A 1 184 ? -2.351   -16.749  -46.116  1.00 0.00 ? 179 ARG A HH21 1  
ATOM 2661  H HH22 . ARG A 1 184 ? -3.083   -18.290  -46.413  1.00 0.00 ? 179 ARG A HH22 1  
ATOM 2662  N N    . VAL A 1 185 ? 1.595    -14.103  -39.353  1.00 0.00 ? 180 VAL A N    1  
ATOM 2663  C CA   . VAL A 1 185 ? 2.481    -14.342  -38.183  1.00 0.00 ? 180 VAL A CA   1  
ATOM 2664  C C    . VAL A 1 185 ? 1.994    -13.502  -37.001  1.00 0.00 ? 180 VAL A C    1  
ATOM 2665  O O    . VAL A 1 185 ? 1.684    -14.030  -35.954  1.00 0.00 ? 180 VAL A O    1  
ATOM 2666  C CB   . VAL A 1 185 ? 3.882    -13.915  -38.621  1.00 0.00 ? 180 VAL A CB   1  
ATOM 2667  C CG1  . VAL A 1 185 ? 4.889    -14.278  -37.528  1.00 0.00 ? 180 VAL A CG1  1  
ATOM 2668  C CG2  . VAL A 1 185 ? 4.262    -14.642  -39.914  1.00 0.00 ? 180 VAL A CG2  1  
ATOM 2669  H H    . VAL A 1 185 ? 1.925    -13.605  -40.130  1.00 0.00 ? 180 VAL A H    1  
ATOM 2670  H HA   . VAL A 1 185 ? 2.480    -15.388  -37.922  1.00 0.00 ? 180 VAL A HA   1  
ATOM 2671  H HB   . VAL A 1 185 ? 3.896    -12.850  -38.784  1.00 0.00 ? 180 VAL A HB   1  
ATOM 2672  H HG11 . VAL A 1 185 ? 4.559    -15.170  -37.015  1.00 0.00 ? 180 VAL A HG11 1  
ATOM 2673  H HG12 . VAL A 1 185 ? 4.965    -13.464  -36.822  1.00 0.00 ? 180 VAL A HG12 1  
ATOM 2674  H HG13 . VAL A 1 185 ? 5.856    -14.457  -37.975  1.00 0.00 ? 180 VAL A HG13 1  
ATOM 2675  H HG21 . VAL A 1 185 ? 5.309    -14.477  -40.125  1.00 0.00 ? 180 VAL A HG21 1  
ATOM 2676  H HG22 . VAL A 1 185 ? 3.666    -14.262  -40.730  1.00 0.00 ? 180 VAL A HG22 1  
ATOM 2677  H HG23 . VAL A 1 185 ? 4.081    -15.700  -39.798  1.00 0.00 ? 180 VAL A HG23 1  
ATOM 2678  N N    . VAL A 1 186 ? 1.906    -12.200  -37.157  1.00 0.00 ? 181 VAL A N    1  
ATOM 2679  C CA   . VAL A 1 186 ? 1.421    -11.352  -36.023  1.00 0.00 ? 181 VAL A CA   1  
ATOM 2680  C C    . VAL A 1 186 ? 0.103    -11.917  -35.486  1.00 0.00 ? 181 VAL A C    1  
ATOM 2681  O O    . VAL A 1 186 ? -0.113   -11.984  -34.291  1.00 0.00 ? 181 VAL A O    1  
ATOM 2682  C CB   . VAL A 1 186 ? 1.232    -9.942   -36.593  1.00 0.00 ? 181 VAL A CB   1  
ATOM 2683  C CG1  . VAL A 1 186 ? 0.019    -9.899   -37.526  1.00 0.00 ? 181 VAL A CG1  1  
ATOM 2684  C CG2  . VAL A 1 186 ? 1.019    -8.962   -35.434  1.00 0.00 ? 181 VAL A CG2  1  
ATOM 2685  H H    . VAL A 1 186 ? 2.148    -11.788  -38.012  1.00 0.00 ? 181 VAL A H    1  
ATOM 2686  H HA   . VAL A 1 186 ? 2.160    -11.331  -35.237  1.00 0.00 ? 181 VAL A HA   1  
ATOM 2687  H HB   . VAL A 1 186 ? 2.113    -9.659   -37.147  1.00 0.00 ? 181 VAL A HB   1  
ATOM 2688  H HG11 . VAL A 1 186 ? -0.873   -10.145  -36.970  1.00 0.00 ? 181 VAL A HG11 1  
ATOM 2689  H HG12 . VAL A 1 186 ? 0.157    -10.612  -38.322  1.00 0.00 ? 181 VAL A HG12 1  
ATOM 2690  H HG13 . VAL A 1 186 ? -0.078   -8.908   -37.943  1.00 0.00 ? 181 VAL A HG13 1  
ATOM 2691  H HG21 . VAL A 1 186 ? 1.043    -7.949   -35.809  1.00 0.00 ? 181 VAL A HG21 1  
ATOM 2692  H HG22 . VAL A 1 186 ? 1.806    -9.093   -34.702  1.00 0.00 ? 181 VAL A HG22 1  
ATOM 2693  H HG23 . VAL A 1 186 ? 0.063    -9.153   -34.971  1.00 0.00 ? 181 VAL A HG23 1  
ATOM 2694  N N    . ALA A 1 187 ? -0.766   -12.358  -36.360  1.00 0.00 ? 182 ALA A N    1  
ATOM 2695  C CA   . ALA A 1 187 ? -2.047   -12.954  -35.889  1.00 0.00 ? 182 ALA A CA   1  
ATOM 2696  C C    . ALA A 1 187 ? -1.710   -14.192  -35.065  1.00 0.00 ? 182 ALA A C    1  
ATOM 2697  O O    . ALA A 1 187 ? -2.307   -14.463  -34.037  1.00 0.00 ? 182 ALA A O    1  
ATOM 2698  C CB   . ALA A 1 187 ? -2.812   -13.336  -37.157  1.00 0.00 ? 182 ALA A CB   1  
ATOM 2699  H H    . ALA A 1 187 ? -0.563   -12.322  -37.320  1.00 0.00 ? 182 ALA A H    1  
ATOM 2700  H HA   . ALA A 1 187 ? -2.610   -12.243  -35.305  1.00 0.00 ? 182 ALA A HA   1  
ATOM 2701  H HB1  . ALA A 1 187 ? -3.271   -14.304  -37.022  1.00 0.00 ? 182 ALA A HB1  1  
ATOM 2702  H HB2  . ALA A 1 187 ? -2.128   -13.375  -37.992  1.00 0.00 ? 182 ALA A HB2  1  
ATOM 2703  H HB3  . ALA A 1 187 ? -3.576   -12.598  -37.352  1.00 0.00 ? 182 ALA A HB3  1  
ATOM 2704  N N    . ALA A 1 188 ? -0.713   -14.919  -35.495  1.00 0.00 ? 183 ALA A N    1  
ATOM 2705  C CA   . ALA A 1 188 ? -0.281   -16.117  -34.731  1.00 0.00 ? 183 ALA A CA   1  
ATOM 2706  C C    . ALA A 1 188 ? 0.401    -15.640  -33.448  1.00 0.00 ? 183 ALA A C    1  
ATOM 2707  O O    . ALA A 1 188 ? 0.390    -16.302  -32.429  1.00 0.00 ? 183 ALA A O    1  
ATOM 2708  C CB   . ALA A 1 188 ? 0.724    -16.824  -35.638  1.00 0.00 ? 183 ALA A CB   1  
ATOM 2709  H H    . ALA A 1 188 ? -0.225   -14.650  -36.306  1.00 0.00 ? 183 ALA A H    1  
ATOM 2710  H HA   . ALA A 1 188 ? -1.120   -16.767  -34.521  1.00 0.00 ? 183 ALA A HA   1  
ATOM 2711  H HB1  . ALA A 1 188 ? 0.504    -16.590  -36.669  1.00 0.00 ? 183 ALA A HB1  1  
ATOM 2712  H HB2  . ALA A 1 188 ? 0.656    -17.891  -35.488  1.00 0.00 ? 183 ALA A HB2  1  
ATOM 2713  H HB3  . ALA A 1 188 ? 1.722    -16.490  -35.398  1.00 0.00 ? 183 ALA A HB3  1  
ATOM 2714  N N    . LEU A 1 189 ? 0.992    -14.473  -33.508  1.00 0.00 ? 184 LEU A N    1  
ATOM 2715  C CA   . LEU A 1 189 ? 1.684    -13.900  -32.322  1.00 0.00 ? 184 LEU A CA   1  
ATOM 2716  C C    . LEU A 1 189 ? 0.731    -12.996  -31.535  1.00 0.00 ? 184 LEU A C    1  
ATOM 2717  O O    . LEU A 1 189 ? 1.138    -12.267  -30.653  1.00 0.00 ? 184 LEU A O    1  
ATOM 2718  C CB   . LEU A 1 189 ? 2.828    -13.074  -32.909  1.00 0.00 ? 184 LEU A CB   1  
ATOM 2719  C CG   . LEU A 1 189 ? 4.025    -13.979  -33.188  1.00 0.00 ? 184 LEU A CG   1  
ATOM 2720  C CD1  . LEU A 1 189 ? 3.872    -14.611  -34.574  1.00 0.00 ? 184 LEU A CD1  1  
ATOM 2721  C CD2  . LEU A 1 189 ? 5.310    -13.147  -33.141  1.00 0.00 ? 184 LEU A CD2  1  
ATOM 2722  H H    . LEU A 1 189 ? 0.975    -13.966  -34.344  1.00 0.00 ? 184 LEU A H    1  
ATOM 2723  H HA   . LEU A 1 189 ? 2.077    -14.683  -31.693  1.00 0.00 ? 184 LEU A HA   1  
ATOM 2724  H HB2  . LEU A 1 189 ? 2.501    -12.615  -33.830  1.00 0.00 ? 184 LEU A HB2  1  
ATOM 2725  H HB3  . LEU A 1 189 ? 3.115    -12.306  -32.207  1.00 0.00 ? 184 LEU A HB3  1  
ATOM 2726  H HG   . LEU A 1 189 ? 4.070    -14.758  -32.441  1.00 0.00 ? 184 LEU A HG   1  
ATOM 2727  H HD11 . LEU A 1 189 ? 2.983    -15.224  -34.594  1.00 0.00 ? 184 LEU A HD11 1  
ATOM 2728  H HD12 . LEU A 1 189 ? 4.735    -15.222  -34.791  1.00 0.00 ? 184 LEU A HD12 1  
ATOM 2729  H HD13 . LEU A 1 189 ? 3.787    -13.832  -35.317  1.00 0.00 ? 184 LEU A HD13 1  
ATOM 2730  H HD21 . LEU A 1 189 ? 6.008    -13.605  -32.457  1.00 0.00 ? 184 LEU A HD21 1  
ATOM 2731  H HD22 . LEU A 1 189 ? 5.081    -12.146  -32.805  1.00 0.00 ? 184 LEU A HD22 1  
ATOM 2732  H HD23 . LEU A 1 189 ? 5.749    -13.103  -34.127  1.00 0.00 ? 184 LEU A HD23 1  
ATOM 2733  N N    . ARG A 1 190 ? -0.534   -13.040  -31.839  1.00 0.00 ? 185 ARG A N    1  
ATOM 2734  C CA   . ARG A 1 190 ? -1.508   -12.194  -31.104  1.00 0.00 ? 185 ARG A CA   1  
ATOM 2735  C C    . ARG A 1 190 ? -2.522   -13.096  -30.407  1.00 0.00 ? 185 ARG A C    1  
ATOM 2736  O O    . ARG A 1 190 ? -3.264   -12.667  -29.545  1.00 0.00 ? 185 ARG A O    1  
ATOM 2737  C CB   . ARG A 1 190 ? -2.186   -11.342  -32.177  1.00 0.00 ? 185 ARG A CB   1  
ATOM 2738  C CG   . ARG A 1 190 ? -3.121   -10.327  -31.515  1.00 0.00 ? 185 ARG A CG   1  
ATOM 2739  C CD   . ARG A 1 190 ? -4.362   -10.130  -32.389  1.00 0.00 ? 185 ARG A CD   1  
ATOM 2740  N NE   . ARG A 1 190 ? -5.123   -9.031   -31.733  1.00 0.00 ? 185 ARG A NE   1  
ATOM 2741  C CZ   . ARG A 1 190 ? -5.292   -7.895   -32.352  1.00 0.00 ? 185 ARG A CZ   1  
ATOM 2742  N NH1  . ARG A 1 190 ? -5.738   -7.879   -33.578  1.00 0.00 ? 185 ARG A NH1  1  
ATOM 2743  N NH2  . ARG A 1 190 ? -5.014   -6.774   -31.744  1.00 0.00 ? 185 ARG A NH2  1  
ATOM 2744  H H    . ARG A 1 190 ? -0.851   -13.639  -32.546  1.00 0.00 ? 185 ARG A H    1  
ATOM 2745  H HA   . ARG A 1 190 ? -1.002   -11.564  -30.389  1.00 0.00 ? 185 ARG A HA   1  
ATOM 2746  H HB2  . ARG A 1 190 ? -1.433   -10.819  -32.749  1.00 0.00 ? 185 ARG A HB2  1  
ATOM 2747  H HB3  . ARG A 1 190 ? -2.758   -11.980  -32.834  1.00 0.00 ? 185 ARG A HB3  1  
ATOM 2748  H HG2  . ARG A 1 190 ? -3.419   -10.693  -30.543  1.00 0.00 ? 185 ARG A HG2  1  
ATOM 2749  H HG3  . ARG A 1 190 ? -2.608   -9.384   -31.404  1.00 0.00 ? 185 ARG A HG3  1  
ATOM 2750  H HD2  . ARG A 1 190 ? -4.072   -9.845   -33.391  1.00 0.00 ? 185 ARG A HD2  1  
ATOM 2751  H HD3  . ARG A 1 190 ? -4.956   -11.031  -32.409  1.00 0.00 ? 185 ARG A HD3  1  
ATOM 2752  H HE   . ARG A 1 190 ? -5.498   -9.162   -30.837  1.00 0.00 ? 185 ARG A HE   1  
ATOM 2753  H HH11 . ARG A 1 190 ? -5.951   -8.738   -34.044  1.00 0.00 ? 185 ARG A HH11 1  
ATOM 2754  H HH12 . ARG A 1 190 ? -5.867   -7.008   -34.052  1.00 0.00 ? 185 ARG A HH12 1  
ATOM 2755  H HH21 . ARG A 1 190 ? -4.672   -6.786   -30.804  1.00 0.00 ? 185 ARG A HH21 1  
ATOM 2756  H HH22 . ARG A 1 190 ? -5.144   -5.903   -32.218  1.00 0.00 ? 185 ARG A HH22 1  
ATOM 2757  N N    . ALA A 1 191 ? -2.561   -14.348  -30.784  1.00 0.00 ? 186 ALA A N    1  
ATOM 2758  C CA   . ALA A 1 191 ? -3.529   -15.278  -30.155  1.00 0.00 ? 186 ALA A CA   1  
ATOM 2759  C C    . ALA A 1 191 ? -2.815   -16.458  -29.488  1.00 0.00 ? 186 ALA A C    1  
ATOM 2760  O O    . ALA A 1 191 ? -3.411   -17.191  -28.722  1.00 0.00 ? 186 ALA A O    1  
ATOM 2761  C CB   . ALA A 1 191 ? -4.389   -15.771  -31.309  1.00 0.00 ? 186 ALA A CB   1  
ATOM 2762  H H    . ALA A 1 191 ? -1.961   -14.671  -31.488  1.00 0.00 ? 186 ALA A H    1  
ATOM 2763  H HA   . ALA A 1 191 ? -4.135   -14.752  -29.445  1.00 0.00 ? 186 ALA A HA   1  
ATOM 2764  H HB1  . ALA A 1 191 ? -4.648   -16.806  -31.145  1.00 0.00 ? 186 ALA A HB1  1  
ATOM 2765  H HB2  . ALA A 1 191 ? -3.833   -15.680  -32.230  1.00 0.00 ? 186 ALA A HB2  1  
ATOM 2766  H HB3  . ALA A 1 191 ? -5.288   -15.178  -31.368  1.00 0.00 ? 186 ALA A HB3  1  
ATOM 2767  N N    . SER A 1 192 ? -1.554   -16.663  -29.772  1.00 0.00 ? 187 SER A N    1  
ATOM 2768  C CA   . SER A 1 192 ? -0.841   -17.811  -29.145  1.00 0.00 ? 187 SER A CA   1  
ATOM 2769  C C    . SER A 1 192 ? 0.022    -17.339  -27.984  1.00 0.00 ? 187 SER A C    1  
ATOM 2770  O O    . SER A 1 192 ? 0.251    -18.075  -27.049  1.00 0.00 ? 187 SER A O    1  
ATOM 2771  C CB   . SER A 1 192 ? 0.025    -18.401  -30.254  1.00 0.00 ? 187 SER A CB   1  
ATOM 2772  O OG   . SER A 1 192 ? -0.200   -19.802  -30.317  1.00 0.00 ? 187 SER A OG   1  
ATOM 2773  H H    . SER A 1 192 ? -1.080   -16.071  -30.395  1.00 0.00 ? 187 SER A H    1  
ATOM 2774  H HA   . SER A 1 192 ? -1.543   -18.547  -28.805  1.00 0.00 ? 187 SER A HA   1  
ATOM 2775  H HB2  . SER A 1 192 ? -0.240   -17.957  -31.197  1.00 0.00 ? 187 SER A HB2  1  
ATOM 2776  H HB3  . SER A 1 192 ? 1.068    -18.202  -30.043  1.00 0.00 ? 187 SER A HB3  1  
ATOM 2777  H HG   . SER A 1 192 ? -1.139   -19.946  -30.456  1.00 0.00 ? 187 SER A HG   1  
ATOM 2778  N N    . TYR A 1 193 ? 0.493    -16.115  -28.052  1.00 0.00 ? 188 TYR A N    1  
ATOM 2779  C CA   . TYR A 1 193 ? 1.367    -15.531  -26.966  1.00 0.00 ? 188 TYR A CA   1  
ATOM 2780  C C    . TYR A 1 193 ? 2.506    -14.726  -27.610  1.00 0.00 ? 188 TYR A C    1  
ATOM 2781  O O    . TYR A 1 193 ? 3.607    -14.676  -27.098  1.00 0.00 ? 188 TYR A O    1  
ATOM 2782  C CB   . TYR A 1 193 ? 1.936    -16.724  -26.167  1.00 0.00 ? 188 TYR A CB   1  
ATOM 2783  C CG   . TYR A 1 193 ? 3.033    -16.278  -25.228  1.00 0.00 ? 188 TYR A CG   1  
ATOM 2784  C CD1  . TYR A 1 193 ? 2.851    -15.147  -24.424  1.00 0.00 ? 188 TYR A CD1  1  
ATOM 2785  C CD2  . TYR A 1 193 ? 4.231    -17.003  -25.160  1.00 0.00 ? 188 TYR A CD2  1  
ATOM 2786  C CE1  . TYR A 1 193 ? 3.866    -14.738  -23.552  1.00 0.00 ? 188 TYR A CE1  1  
ATOM 2787  C CE2  . TYR A 1 193 ? 5.246    -16.592  -24.288  1.00 0.00 ? 188 TYR A CE2  1  
ATOM 2788  C CZ   . TYR A 1 193 ? 5.064    -15.461  -23.484  1.00 0.00 ? 188 TYR A CZ   1  
ATOM 2789  O OH   . TYR A 1 193 ? 6.064    -15.057  -22.623  1.00 0.00 ? 188 TYR A OH   1  
ATOM 2790  H H    . TYR A 1 193 ? 0.265    -15.567  -28.835  1.00 0.00 ? 188 TYR A H    1  
ATOM 2791  H HA   . TYR A 1 193 ? 0.783    -14.897  -26.317  1.00 0.00 ? 188 TYR A HA   1  
ATOM 2792  H HB2  . TYR A 1 193 ? 1.144    -17.172  -25.586  1.00 0.00 ? 188 TYR A HB2  1  
ATOM 2793  H HB3  . TYR A 1 193 ? 2.332    -17.456  -26.855  1.00 0.00 ? 188 TYR A HB3  1  
ATOM 2794  H HD1  . TYR A 1 193 ? 1.927    -14.590  -24.479  1.00 0.00 ? 188 TYR A HD1  1  
ATOM 2795  H HD2  . TYR A 1 193 ? 4.374    -17.879  -25.784  1.00 0.00 ? 188 TYR A HD2  1  
ATOM 2796  H HE1  . TYR A 1 193 ? 3.726    -13.865  -22.932  1.00 0.00 ? 188 TYR A HE1  1  
ATOM 2797  H HE2  . TYR A 1 193 ? 6.170    -17.149  -24.234  1.00 0.00 ? 188 TYR A HE2  1  
ATOM 2798  H HH   . TYR A 1 193 ? 5.697    -15.021  -21.737  1.00 0.00 ? 188 TYR A HH   1  
ATOM 2799  N N    . ASN A 1 194 ? 2.248    -14.102  -28.738  1.00 0.00 ? 189 ASN A N    1  
ATOM 2800  C CA   . ASN A 1 194 ? 3.307    -13.305  -29.444  1.00 0.00 ? 189 ASN A CA   1  
ATOM 2801  C C    . ASN A 1 194 ? 4.681    -13.953  -29.280  1.00 0.00 ? 189 ASN A C    1  
ATOM 2802  O O    . ASN A 1 194 ? 5.684    -13.281  -29.142  1.00 0.00 ? 189 ASN A O    1  
ATOM 2803  C CB   . ASN A 1 194 ? 3.286    -11.905  -28.816  1.00 0.00 ? 189 ASN A CB   1  
ATOM 2804  C CG   . ASN A 1 194 ? 3.458    -11.999  -27.299  1.00 0.00 ? 189 ASN A CG   1  
ATOM 2805  O OD1  . ASN A 1 194 ? 4.565    -11.976  -26.798  1.00 0.00 ? 189 ASN A OD1  1  
ATOM 2806  N ND2  . ASN A 1 194 ? 2.400    -12.104  -26.542  1.00 0.00 ? 189 ASN A ND2  1  
ATOM 2807  H H    . ASN A 1 194 ? 1.354    -14.164  -29.130  1.00 0.00 ? 189 ASN A H    1  
ATOM 2808  H HA   . ASN A 1 194 ? 3.069    -13.230  -30.489  1.00 0.00 ? 189 ASN A HA   1  
ATOM 2809  H HB2  . ASN A 1 194 ? 4.093    -11.318  -29.233  1.00 0.00 ? 189 ASN A HB2  1  
ATOM 2810  H HB3  . ASN A 1 194 ? 2.345    -11.426  -29.040  1.00 0.00 ? 189 ASN A HB3  1  
ATOM 2811  H HD21 . ASN A 1 194 ? 1.508    -12.123  -26.947  1.00 0.00 ? 189 ASN A HD21 1  
ATOM 2812  H HD22 . ASN A 1 194 ? 2.498    -12.165  -25.568  1.00 0.00 ? 189 ASN A HD22 1  
ATOM 2813  N N    . ASN A 1 195 ? 4.732    -15.259  -29.291  1.00 0.00 ? 190 ASN A N    1  
ATOM 2814  C CA   . ASN A 1 195 ? 6.048    -15.945  -29.130  1.00 0.00 ? 190 ASN A CA   1  
ATOM 2815  C C    . ASN A 1 195 ? 6.214    -17.040  -30.186  1.00 0.00 ? 190 ASN A C    1  
ATOM 2816  O O    . ASN A 1 195 ? 5.245    -17.520  -30.734  1.00 0.00 ? 190 ASN A O    1  
ATOM 2817  C CB   . ASN A 1 195 ? 6.006    -16.554  -27.730  1.00 0.00 ? 190 ASN A CB   1  
ATOM 2818  C CG   . ASN A 1 195 ? 6.694    -15.610  -26.741  1.00 0.00 ? 190 ASN A CG   1  
ATOM 2819  O OD1  . ASN A 1 195 ? 7.779    -15.891  -26.271  1.00 0.00 ? 190 ASN A OD1  1  
ATOM 2820  N ND2  . ASN A 1 195 ? 6.106    -14.495  -26.405  1.00 0.00 ? 190 ASN A ND2  1  
ATOM 2821  H H    . ASN A 1 195 ? 3.901    -15.787  -29.400  1.00 0.00 ? 190 ASN A H    1  
ATOM 2822  H HA   . ASN A 1 195 ? 6.854    -15.232  -29.197  1.00 0.00 ? 190 ASN A HA   1  
ATOM 2823  H HB2  . ASN A 1 195 ? 4.979    -16.701  -27.435  1.00 0.00 ? 190 ASN A HB2  1  
ATOM 2824  H HB3  . ASN A 1 195 ? 6.520    -17.504  -27.735  1.00 0.00 ? 190 ASN A HB3  1  
ATOM 2825  H HD21 . ASN A 1 195 ? 5.231    -14.269  -26.785  1.00 0.00 ? 190 ASN A HD21 1  
ATOM 2826  H HD22 . ASN A 1 195 ? 6.539    -13.884  -25.773  1.00 0.00 ? 190 ASN A HD22 1  
ATOM 2827  N N    . PRO A 1 196 ? 7.447    -17.406  -30.431  1.00 0.00 ? 191 PRO A N    1  
ATOM 2828  C CA   . PRO A 1 196 ? 7.736    -18.463  -31.430  1.00 0.00 ? 191 PRO A CA   1  
ATOM 2829  C C    . PRO A 1 196 ? 7.270    -19.826  -30.909  1.00 0.00 ? 191 PRO A C    1  
ATOM 2830  O O    . PRO A 1 196 ? 7.193    -20.789  -31.646  1.00 0.00 ? 191 PRO A O    1  
ATOM 2831  C CB   . PRO A 1 196 ? 9.256    -18.418  -31.574  1.00 0.00 ? 191 PRO A CB   1  
ATOM 2832  C CG   . PRO A 1 196 ? 9.744    -17.831  -30.289  1.00 0.00 ? 191 PRO A CG   1  
ATOM 2833  C CD   . PRO A 1 196 ? 8.673    -16.886  -29.811  1.00 0.00 ? 191 PRO A CD   1  
ATOM 2834  H HA   . PRO A 1 196 ? 7.268    -18.234  -32.374  1.00 0.00 ? 191 PRO A HA   1  
ATOM 2835  H HB2  . PRO A 1 196 ? 9.649    -19.416  -31.709  1.00 0.00 ? 191 PRO A HB2  1  
ATOM 2836  H HB3  . PRO A 1 196 ? 9.538    -17.785  -32.400  1.00 0.00 ? 191 PRO A HB3  1  
ATOM 2837  H HG2  . PRO A 1 196 ? 9.902    -18.616  -29.562  1.00 0.00 ? 191 PRO A HG2  1  
ATOM 2838  H HG3  . PRO A 1 196 ? 10.661   -17.288  -30.455  1.00 0.00 ? 191 PRO A HG3  1  
ATOM 2839  H HD2  . PRO A 1 196 ? 8.599    -16.914  -28.732  1.00 0.00 ? 191 PRO A HD2  1  
ATOM 2840  H HD3  . PRO A 1 196 ? 8.869    -15.883  -30.156  1.00 0.00 ? 191 PRO A HD3  1  
ATOM 2841  N N    . HIS A 1 197 ? 6.950    -19.911  -29.644  1.00 0.00 ? 192 HIS A N    1  
ATOM 2842  C CA   . HIS A 1 197 ? 6.481    -21.207  -29.081  1.00 0.00 ? 192 HIS A CA   1  
ATOM 2843  C C    . HIS A 1 197 ? 5.012    -21.429  -29.442  1.00 0.00 ? 192 HIS A C    1  
ATOM 2844  O O    . HIS A 1 197 ? 4.664    -22.353  -30.158  1.00 0.00 ? 192 HIS A O    1  
ATOM 2845  C CB   . HIS A 1 197 ? 6.649    -21.069  -27.566  1.00 0.00 ? 192 HIS A CB   1  
ATOM 2846  C CG   . HIS A 1 197 ? 6.882    -22.427  -26.962  1.00 0.00 ? 192 HIS A CG   1  
ATOM 2847  N ND1  . HIS A 1 197 ? 7.485    -22.592  -25.725  1.00 0.00 ? 192 HIS A ND1  1  
ATOM 2848  C CD2  . HIS A 1 197 ? 6.599    -23.692  -27.413  1.00 0.00 ? 192 HIS A CD2  1  
ATOM 2849  C CE1  . HIS A 1 197 ? 7.545    -23.913  -25.477  1.00 0.00 ? 192 HIS A CE1  1  
ATOM 2850  N NE2  . HIS A 1 197 ? 7.018    -24.629  -26.474  1.00 0.00 ? 192 HIS A NE2  1  
ATOM 2851  H H    . HIS A 1 197 ? 7.014    -19.123  -29.067  1.00 0.00 ? 192 HIS A H    1  
ATOM 2852  H HA   . HIS A 1 197 ? 7.085    -22.017  -29.444  1.00 0.00 ? 192 HIS A HA   1  
ATOM 2853  H HB2  . HIS A 1 197 ? 7.495    -20.431  -27.355  1.00 0.00 ? 192 HIS A HB2  1  
ATOM 2854  H HB3  . HIS A 1 197 ? 5.756    -20.636  -27.142  1.00 0.00 ? 192 HIS A HB3  1  
ATOM 2855  H HD1  . HIS A 1 197 ? 7.810    -21.877  -25.139  1.00 0.00 ? 192 HIS A HD1  1  
ATOM 2856  H HD2  . HIS A 1 197 ? 6.123    -23.925  -28.354  1.00 0.00 ? 192 HIS A HD2  1  
ATOM 2857  H HE1  . HIS A 1 197 ? 7.967    -24.342  -24.580  1.00 0.00 ? 192 HIS A HE1  1  
ATOM 2858  N N    . ARG A 1 198 ? 4.148    -20.585  -28.951  1.00 0.00 ? 193 ARG A N    1  
ATOM 2859  C CA   . ARG A 1 198 ? 2.698    -20.735  -29.255  1.00 0.00 ? 193 ARG A CA   1  
ATOM 2860  C C    . ARG A 1 198 ? 2.412    -20.362  -30.713  1.00 0.00 ? 193 ARG A C    1  
ATOM 2861  O O    . ARG A 1 198 ? 1.653    -21.029  -31.388  1.00 0.00 ? 193 ARG A O    1  
ATOM 2862  C CB   . ARG A 1 198 ? 1.991    -19.772  -28.297  1.00 0.00 ? 193 ARG A CB   1  
ATOM 2863  C CG   . ARG A 1 198 ? 2.350    -20.133  -26.849  1.00 0.00 ? 193 ARG A CG   1  
ATOM 2864  C CD   . ARG A 1 198 ? 1.093    -20.592  -26.102  1.00 0.00 ? 193 ARG A CD   1  
ATOM 2865  N NE   . ARG A 1 198 ? 1.214    -22.075  -26.019  1.00 0.00 ? 193 ARG A NE   1  
ATOM 2866  C CZ   . ARG A 1 198 ? 0.162    -22.801  -25.755  1.00 0.00 ? 193 ARG A CZ   1  
ATOM 2867  N NH1  . ARG A 1 198 ? -0.767   -22.957  -26.658  1.00 0.00 ? 193 ARG A NH1  1  
ATOM 2868  N NH2  . ARG A 1 198 ? 0.040    -23.372  -24.588  1.00 0.00 ? 193 ARG A NH2  1  
ATOM 2869  H H    . ARG A 1 198 ? 4.454    -19.849  -28.380  1.00 0.00 ? 193 ARG A H    1  
ATOM 2870  H HA   . ARG A 1 198 ? 2.378    -21.745  -29.059  1.00 0.00 ? 193 ARG A HA   1  
ATOM 2871  H HB2  . ARG A 1 198 ? 2.309    -18.760  -28.505  1.00 0.00 ? 193 ARG A HB2  1  
ATOM 2872  H HB3  . ARG A 1 198 ? 0.924    -19.849  -28.432  1.00 0.00 ? 193 ARG A HB3  1  
ATOM 2873  H HG2  . ARG A 1 198 ? 3.080    -20.930  -26.847  1.00 0.00 ? 193 ARG A HG2  1  
ATOM 2874  H HG3  . ARG A 1 198 ? 2.763    -19.268  -26.354  1.00 0.00 ? 193 ARG A HG3  1  
ATOM 2875  H HD2  . ARG A 1 198 ? 1.068    -20.158  -25.112  1.00 0.00 ? 193 ARG A HD2  1  
ATOM 2876  H HD3  . ARG A 1 198 ? 0.206    -20.323  -26.655  1.00 0.00 ? 193 ARG A HD3  1  
ATOM 2877  H HE   . ARG A 1 198 ? 2.082    -22.505  -26.163  1.00 0.00 ? 193 ARG A HE   1  
ATOM 2878  H HH11 . ARG A 1 198 ? -0.673   -22.520  -27.553  1.00 0.00 ? 193 ARG A HH11 1  
ATOM 2879  H HH12 . ARG A 1 198 ? -1.573   -23.514  -26.455  1.00 0.00 ? 193 ARG A HH12 1  
ATOM 2880  H HH21 . ARG A 1 198 ? 0.753    -23.253  -23.896  1.00 0.00 ? 193 ARG A HH21 1  
ATOM 2881  H HH22 . ARG A 1 198 ? -0.766   -23.929  -24.385  1.00 0.00 ? 193 ARG A HH22 1  
ATOM 2882  N N    . ALA A 1 199 ? 3.012    -19.309  -31.211  1.00 0.00 ? 194 ALA A N    1  
ATOM 2883  C CA   . ALA A 1 199 ? 2.759    -18.917  -32.627  1.00 0.00 ? 194 ALA A CA   1  
ATOM 2884  C C    . ALA A 1 199 ? 3.063    -20.094  -33.552  1.00 0.00 ? 194 ALA A C    1  
ATOM 2885  O O    . ALA A 1 199 ? 2.189    -20.591  -34.215  1.00 0.00 ? 194 ALA A O    1  
ATOM 2886  C CB   . ALA A 1 199 ? 3.701    -17.747  -32.912  1.00 0.00 ? 194 ALA A CB   1  
ATOM 2887  H H    . ALA A 1 199 ? 3.622    -18.782  -30.660  1.00 0.00 ? 194 ALA A H    1  
ATOM 2888  H HA   . ALA A 1 199 ? 1.735    -18.601  -32.749  1.00 0.00 ? 194 ALA A HA   1  
ATOM 2889  H HB1  . ALA A 1 199 ? 3.464    -17.321  -33.878  1.00 0.00 ? 194 ALA A HB1  1  
ATOM 2890  H HB2  . ALA A 1 199 ? 4.722    -18.099  -32.915  1.00 0.00 ? 194 ALA A HB2  1  
ATOM 2891  H HB3  . ALA A 1 199 ? 3.581    -16.994  -32.148  1.00 0.00 ? 194 ALA A HB3  1  
ATOM 2892  N N    . VAL A 1 200 ? 4.290    -20.551  -33.592  1.00 0.00 ? 195 VAL A N    1  
ATOM 2893  C CA   . VAL A 1 200 ? 4.635    -21.710  -34.480  1.00 0.00 ? 195 VAL A CA   1  
ATOM 2894  C C    . VAL A 1 200 ? 3.587    -22.826  -34.334  1.00 0.00 ? 195 VAL A C    1  
ATOM 2895  O O    . VAL A 1 200 ? 2.896    -23.181  -35.286  1.00 0.00 ? 195 VAL A O    1  
ATOM 2896  C CB   . VAL A 1 200 ? 6.012    -22.179  -34.000  1.00 0.00 ? 195 VAL A CB   1  
ATOM 2897  C CG1  . VAL A 1 200 ? 6.388    -23.489  -34.699  1.00 0.00 ? 195 VAL A CG1  1  
ATOM 2898  C CG2  . VAL A 1 200 ? 7.055    -21.110  -34.337  1.00 0.00 ? 195 VAL A CG2  1  
ATOM 2899  H H    . VAL A 1 200 ? 4.982    -20.137  -33.035  1.00 0.00 ? 195 VAL A H    1  
ATOM 2900  H HA   . VAL A 1 200 ? 4.698    -21.387  -35.507  1.00 0.00 ? 195 VAL A HA   1  
ATOM 2901  H HB   . VAL A 1 200 ? 5.986    -22.336  -32.931  1.00 0.00 ? 195 VAL A HB   1  
ATOM 2902  H HG11 . VAL A 1 200 ? 7.461    -23.611  -34.680  1.00 0.00 ? 195 VAL A HG11 1  
ATOM 2903  H HG12 . VAL A 1 200 ? 6.046    -23.461  -35.723  1.00 0.00 ? 195 VAL A HG12 1  
ATOM 2904  H HG13 . VAL A 1 200 ? 5.922    -24.317  -34.186  1.00 0.00 ? 195 VAL A HG13 1  
ATOM 2905  H HG21 . VAL A 1 200 ? 7.187    -21.061  -35.408  1.00 0.00 ? 195 VAL A HG21 1  
ATOM 2906  H HG22 . VAL A 1 200 ? 7.995    -21.364  -33.871  1.00 0.00 ? 195 VAL A HG22 1  
ATOM 2907  H HG23 . VAL A 1 200 ? 6.720    -20.150  -33.972  1.00 0.00 ? 195 VAL A HG23 1  
ATOM 2908  N N    . GLU A 1 201 ? 3.451    -23.369  -33.146  1.00 0.00 ? 196 GLU A N    1  
ATOM 2909  C CA   . GLU A 1 201 ? 2.442    -24.448  -32.925  1.00 0.00 ? 196 GLU A CA   1  
ATOM 2910  C C    . GLU A 1 201 ? 1.083    -23.999  -33.466  1.00 0.00 ? 196 GLU A C    1  
ATOM 2911  O O    . GLU A 1 201 ? 0.384    -24.746  -34.122  1.00 0.00 ? 196 GLU A O    1  
ATOM 2912  C CB   . GLU A 1 201 ? 2.382    -24.636  -31.408  1.00 0.00 ? 196 GLU A CB   1  
ATOM 2913  C CG   . GLU A 1 201 ? 3.295    -25.794  -31.000  1.00 0.00 ? 196 GLU A CG   1  
ATOM 2914  C CD   . GLU A 1 201 ? 2.708    -26.500  -29.777  1.00 0.00 ? 196 GLU A CD   1  
ATOM 2915  O OE1  . GLU A 1 201 ? 2.274    -25.810  -28.870  1.00 0.00 ? 196 GLU A OE1  1  
ATOM 2916  O OE2  . GLU A 1 201 ? 2.703    -27.720  -29.767  1.00 0.00 ? 196 GLU A OE2  1  
ATOM 2917  H H    . GLU A 1 201 ? 4.007    -23.058  -32.401  1.00 0.00 ? 196 GLU A H    1  
ATOM 2918  H HA   . GLU A 1 201 ? 2.755    -25.364  -33.401  1.00 0.00 ? 196 GLU A HA   1  
ATOM 2919  H HB2  . GLU A 1 201 ? 2.709    -23.729  -30.920  1.00 0.00 ? 196 GLU A HB2  1  
ATOM 2920  H HB3  . GLU A 1 201 ? 1.368    -24.859  -31.112  1.00 0.00 ? 196 GLU A HB3  1  
ATOM 2921  H HG2  . GLU A 1 201 ? 3.374    -26.495  -31.819  1.00 0.00 ? 196 GLU A HG2  1  
ATOM 2922  H HG3  . GLU A 1 201 ? 4.275    -25.412  -30.757  1.00 0.00 ? 196 GLU A HG3  1  
ATOM 2923  N N    . TYR A 1 202 ? 0.718    -22.771  -33.210  1.00 0.00 ? 197 TYR A N    1  
ATOM 2924  C CA   . TYR A 1 202 ? -0.575   -22.252  -33.720  1.00 0.00 ? 197 TYR A CA   1  
ATOM 2925  C C    . TYR A 1 202 ? -0.305   -21.317  -34.901  1.00 0.00 ? 197 TYR A C    1  
ATOM 2926  O O    . TYR A 1 202 ? -0.946   -20.308  -35.078  1.00 0.00 ? 197 TYR A O    1  
ATOM 2927  C CB   . TYR A 1 202 ? -1.187   -21.501  -32.542  1.00 0.00 ? 197 TYR A CB   1  
ATOM 2928  C CG   . TYR A 1 202 ? -2.370   -20.698  -33.004  1.00 0.00 ? 197 TYR A CG   1  
ATOM 2929  C CD1  . TYR A 1 202 ? -3.373   -21.306  -33.762  1.00 0.00 ? 197 TYR A CD1  1  
ATOM 2930  C CD2  . TYR A 1 202 ? -2.461   -19.346  -32.674  1.00 0.00 ? 197 TYR A CD2  1  
ATOM 2931  C CE1  . TYR A 1 202 ? -4.471   -20.559  -34.188  1.00 0.00 ? 197 TYR A CE1  1  
ATOM 2932  C CE2  . TYR A 1 202 ? -3.555   -18.596  -33.102  1.00 0.00 ? 197 TYR A CE2  1  
ATOM 2933  C CZ   . TYR A 1 202 ? -4.565   -19.201  -33.860  1.00 0.00 ? 197 TYR A CZ   1  
ATOM 2934  O OH   . TYR A 1 202 ? -5.651   -18.461  -34.282  1.00 0.00 ? 197 TYR A OH   1  
ATOM 2935  H H    . TYR A 1 202 ? 1.305    -22.183  -32.692  1.00 0.00 ? 197 TYR A H    1  
ATOM 2936  H HA   . TYR A 1 202 ? -1.218   -23.065  -34.019  1.00 0.00 ? 197 TYR A HA   1  
ATOM 2937  H HB2  . TYR A 1 202 ? -1.509   -22.209  -31.796  1.00 0.00 ? 197 TYR A HB2  1  
ATOM 2938  H HB3  . TYR A 1 202 ? -0.451   -20.840  -32.120  1.00 0.00 ? 197 TYR A HB3  1  
ATOM 2939  H HD1  . TYR A 1 202 ? -3.293   -22.351  -34.023  1.00 0.00 ? 197 TYR A HD1  1  
ATOM 2940  H HD2  . TYR A 1 202 ? -1.682   -18.879  -32.092  1.00 0.00 ? 197 TYR A HD2  1  
ATOM 2941  H HE1  . TYR A 1 202 ? -5.240   -21.029  -34.774  1.00 0.00 ? 197 TYR A HE1  1  
ATOM 2942  H HE2  . TYR A 1 202 ? -3.618   -17.552  -32.850  1.00 0.00 ? 197 TYR A HE2  1  
ATOM 2943  H HH   . TYR A 1 202 ? -6.156   -18.208  -33.506  1.00 0.00 ? 197 TYR A HH   1  
ATOM 2944  N N    . LEU A 1 203 ? 0.647    -21.664  -35.709  1.00 0.00 ? 198 LEU A N    1  
ATOM 2945  C CA   . LEU A 1 203 ? 0.978    -20.833  -36.899  1.00 0.00 ? 198 LEU A CA   1  
ATOM 2946  C C    . LEU A 1 203 ? 0.586    -21.631  -38.126  1.00 0.00 ? 198 LEU A C    1  
ATOM 2947  O O    . LEU A 1 203 ? 0.075    -21.107  -39.097  1.00 0.00 ? 198 LEU A O    1  
ATOM 2948  C CB   . LEU A 1 203 ? 2.495    -20.627  -36.865  1.00 0.00 ? 198 LEU A CB   1  
ATOM 2949  C CG   . LEU A 1 203 ? 2.823    -19.174  -36.516  1.00 0.00 ? 198 LEU A CG   1  
ATOM 2950  C CD1  . LEU A 1 203 ? 4.337    -19.019  -36.348  1.00 0.00 ? 198 LEU A CD1  1  
ATOM 2951  C CD2  . LEU A 1 203 ? 2.345    -18.265  -37.651  1.00 0.00 ? 198 LEU A CD2  1  
ATOM 2952  H H    . LEU A 1 203 ? 1.143    -22.485  -35.538  1.00 0.00 ? 198 LEU A H    1  
ATOM 2953  H HA   . LEU A 1 203 ? 0.461    -19.887  -36.867  1.00 0.00 ? 198 LEU A HA   1  
ATOM 2954  H HB2  . LEU A 1 203 ? 2.926    -21.278  -36.128  1.00 0.00 ? 198 LEU A HB2  1  
ATOM 2955  H HB3  . LEU A 1 203 ? 2.909    -20.860  -37.834  1.00 0.00 ? 198 LEU A HB3  1  
ATOM 2956  H HG   . LEU A 1 203 ? 2.329    -18.899  -35.592  1.00 0.00 ? 198 LEU A HG   1  
ATOM 2957  H HD11 . LEU A 1 203 ? 4.839    -19.863  -36.798  1.00 0.00 ? 198 LEU A HD11 1  
ATOM 2958  H HD12 . LEU A 1 203 ? 4.580    -18.975  -35.297  1.00 0.00 ? 198 LEU A HD12 1  
ATOM 2959  H HD13 . LEU A 1 203 ? 4.663    -18.109  -36.830  1.00 0.00 ? 198 LEU A HD13 1  
ATOM 2960  H HD21 . LEU A 1 203 ? 2.743    -18.621  -38.589  1.00 0.00 ? 198 LEU A HD21 1  
ATOM 2961  H HD22 . LEU A 1 203 ? 2.689    -17.258  -37.474  1.00 0.00 ? 198 LEU A HD22 1  
ATOM 2962  H HD23 . LEU A 1 203 ? 1.266    -18.276  -37.691  1.00 0.00 ? 198 LEU A HD23 1  
ATOM 2963  N N    . LEU A 1 204 ? 0.810    -22.914  -38.070  1.00 0.00 ? 199 LEU A N    1  
ATOM 2964  C CA   . LEU A 1 204 ? 0.438    -23.783  -39.217  1.00 0.00 ? 199 LEU A CA   1  
ATOM 2965  C C    . LEU A 1 204 ? -0.289   -25.033  -38.711  1.00 0.00 ? 199 LEU A C    1  
ATOM 2966  O O    . LEU A 1 204 ? -1.341   -25.395  -39.200  1.00 0.00 ? 199 LEU A O    1  
ATOM 2967  C CB   . LEU A 1 204 ? 1.753    -24.167  -39.904  1.00 0.00 ? 199 LEU A CB   1  
ATOM 2968  C CG   . LEU A 1 204 ? 2.624    -22.924  -40.118  1.00 0.00 ? 199 LEU A CG   1  
ATOM 2969  C CD1  . LEU A 1 204 ? 3.704    -22.862  -39.037  1.00 0.00 ? 199 LEU A CD1  1  
ATOM 2970  C CD2  . LEU A 1 204 ? 3.289    -22.998  -41.494  1.00 0.00 ? 199 LEU A CD2  1  
ATOM 2971  H H    . LEU A 1 204 ? 1.214    -23.308  -37.264  1.00 0.00 ? 199 LEU A H    1  
ATOM 2972  H HA   . LEU A 1 204 ? -0.189   -23.239  -39.905  1.00 0.00 ? 199 LEU A HA   1  
ATOM 2973  H HB2  . LEU A 1 204 ? 2.285    -24.878  -39.289  1.00 0.00 ? 199 LEU A HB2  1  
ATOM 2974  H HB3  . LEU A 1 204 ? 1.533    -24.615  -40.862  1.00 0.00 ? 199 LEU A HB3  1  
ATOM 2975  H HG   . LEU A 1 204 ? 2.008    -22.038  -40.062  1.00 0.00 ? 199 LEU A HG   1  
ATOM 2976  H HD11 . LEU A 1 204 ? 3.267    -23.096  -38.077  1.00 0.00 ? 199 LEU A HD11 1  
ATOM 2977  H HD12 . LEU A 1 204 ? 4.128    -21.870  -39.007  1.00 0.00 ? 199 LEU A HD12 1  
ATOM 2978  H HD13 . LEU A 1 204 ? 4.481    -23.578  -39.263  1.00 0.00 ? 199 LEU A HD13 1  
ATOM 2979  H HD21 . LEU A 1 204 ? 4.032    -23.782  -41.493  1.00 0.00 ? 199 LEU A HD21 1  
ATOM 2980  H HD22 . LEU A 1 204 ? 3.762    -22.053  -41.717  1.00 0.00 ? 199 LEU A HD22 1  
ATOM 2981  H HD23 . LEU A 1 204 ? 2.542    -23.212  -42.244  1.00 0.00 ? 199 LEU A HD23 1  
ATOM 2982  N N    . THR A 1 205 ? 0.269    -25.698  -37.736  1.00 0.00 ? 200 THR A N    1  
ATOM 2983  C CA   . THR A 1 205 ? -0.377   -26.934  -37.201  1.00 0.00 ? 200 THR A CA   1  
ATOM 2984  C C    . THR A 1 205 ? -1.613   -26.582  -36.375  1.00 0.00 ? 200 THR A C    1  
ATOM 2985  O O    . THR A 1 205 ? -2.484   -27.405  -36.169  1.00 0.00 ? 200 THR A O    1  
ATOM 2986  C CB   . THR A 1 205 ? 0.688    -27.587  -36.318  1.00 0.00 ? 200 THR A CB   1  
ATOM 2987  O OG1  . THR A 1 205 ? 1.913    -27.664  -37.034  1.00 0.00 ? 200 THR A OG1  1  
ATOM 2988  C CG2  . THR A 1 205 ? 0.235    -28.994  -35.925  1.00 0.00 ? 200 THR A CG2  1  
ATOM 2989  H H    . THR A 1 205 ? 1.113    -25.384  -37.354  1.00 0.00 ? 200 THR A H    1  
ATOM 2990  H HA   . THR A 1 205 ? -0.641   -27.598  -38.008  1.00 0.00 ? 200 THR A HA   1  
ATOM 2991  H HB   . THR A 1 205 ? 0.828    -26.996  -35.426  1.00 0.00 ? 200 THR A HB   1  
ATOM 2992  H HG1  . THR A 1 205 ? 2.563    -27.134  -36.567  1.00 0.00 ? 200 THR A HG1  1  
ATOM 2993  H HG21 . THR A 1 205 ? -0.082   -29.530  -36.807  1.00 0.00 ? 200 THR A HG21 1  
ATOM 2994  H HG22 . THR A 1 205 ? -0.589   -28.926  -35.230  1.00 0.00 ? 200 THR A HG22 1  
ATOM 2995  H HG23 . THR A 1 205 ? 1.056    -29.519  -35.460  1.00 0.00 ? 200 THR A HG23 1  
ATOM 2996  N N    . GLY A 1 206 ? -1.698   -25.372  -35.894  1.00 0.00 ? 201 GLY A N    1  
ATOM 2997  C CA   . GLY A 1 206 ? -2.879   -24.983  -35.077  1.00 0.00 ? 201 GLY A CA   1  
ATOM 2998  C C    . GLY A 1 206 ? -3.644   -23.858  -35.769  1.00 0.00 ? 201 GLY A C    1  
ATOM 2999  O O    . GLY A 1 206 ? -4.856   -23.791  -35.700  1.00 0.00 ? 201 GLY A O    1  
ATOM 3000  H H    . GLY A 1 206 ? -0.985   -24.723  -36.065  1.00 0.00 ? 201 GLY A H    1  
ATOM 3001  H HA2  . GLY A 1 206 ? -3.529   -25.838  -34.960  1.00 0.00 ? 201 GLY A HA2  1  
ATOM 3002  H HA3  . GLY A 1 206 ? -2.550   -24.644  -34.107  1.00 0.00 ? 201 GLY A HA3  1  
ATOM 3003  N N    . ILE A 1 207 ? -2.954   -22.968  -36.433  1.00 0.00 ? 202 ILE A N    1  
ATOM 3004  C CA   . ILE A 1 207 ? -3.665   -21.852  -37.116  1.00 0.00 ? 202 ILE A CA   1  
ATOM 3005  C C    . ILE A 1 207 ? -4.379   -22.386  -38.361  1.00 0.00 ? 202 ILE A C    1  
ATOM 3006  O O    . ILE A 1 207 ? -3.977   -23.387  -38.922  1.00 0.00 ? 202 ILE A O    1  
ATOM 3007  C CB   . ILE A 1 207 ? -2.573   -20.825  -37.481  1.00 0.00 ? 202 ILE A CB   1  
ATOM 3008  C CG1  . ILE A 1 207 ? -2.816   -19.529  -36.698  1.00 0.00 ? 202 ILE A CG1  1  
ATOM 3009  C CG2  . ILE A 1 207 ? -2.602   -20.497  -38.977  1.00 0.00 ? 202 ILE A CG2  1  
ATOM 3010  C CD1  . ILE A 1 207 ? -1.698   -18.525  -36.991  1.00 0.00 ? 202 ILE A CD1  1  
ATOM 3011  H H    . ILE A 1 207 ? -1.977   -23.032  -36.476  1.00 0.00 ? 202 ILE A H    1  
ATOM 3012  H HA   . ILE A 1 207 ? -4.375   -21.405  -36.439  1.00 0.00 ? 202 ILE A HA   1  
ATOM 3013  H HB   . ILE A 1 207 ? -1.606   -21.230  -37.227  1.00 0.00 ? 202 ILE A HB   1  
ATOM 3014  H HG12 . ILE A 1 207 ? -3.763   -19.104  -36.993  1.00 0.00 ? 202 ILE A HG12 1  
ATOM 3015  H HG13 . ILE A 1 207 ? -2.834   -19.743  -35.644  1.00 0.00 ? 202 ILE A HG13 1  
ATOM 3016  H HG21 . ILE A 1 207 ? -3.603   -20.213  -39.263  1.00 0.00 ? 202 ILE A HG21 1  
ATOM 3017  H HG22 . ILE A 1 207 ? -2.294   -21.363  -39.543  1.00 0.00 ? 202 ILE A HG22 1  
ATOM 3018  H HG23 . ILE A 1 207 ? -1.926   -19.676  -39.171  1.00 0.00 ? 202 ILE A HG23 1  
ATOM 3019  H HD11 . ILE A 1 207 ? -2.128   -17.606  -37.362  1.00 0.00 ? 202 ILE A HD11 1  
ATOM 3020  H HD12 . ILE A 1 207 ? -1.028   -18.934  -37.732  1.00 0.00 ? 202 ILE A HD12 1  
ATOM 3021  H HD13 . ILE A 1 207 ? -1.152   -18.324  -36.083  1.00 0.00 ? 202 ILE A HD13 1  
ATOM 3022  N N    . PRO A 1 208 ? -5.413   -21.696  -38.758  1.00 0.00 ? 203 PRO A N    1  
ATOM 3023  C CA   . PRO A 1 208 ? -6.182   -22.107  -39.957  1.00 0.00 ? 203 PRO A CA   1  
ATOM 3024  C C    . PRO A 1 208 ? -5.368   -21.835  -41.227  1.00 0.00 ? 203 PRO A C    1  
ATOM 3025  O O    . PRO A 1 208 ? -5.825   -21.178  -42.142  1.00 0.00 ? 203 PRO A O    1  
ATOM 3026  C CB   . PRO A 1 208 ? -7.431   -21.231  -39.897  1.00 0.00 ? 203 PRO A CB   1  
ATOM 3027  C CG   . PRO A 1 208 ? -7.028   -20.035  -39.093  1.00 0.00 ? 203 PRO A CG   1  
ATOM 3028  C CD   . PRO A 1 208 ? -5.957   -20.483  -38.139  1.00 0.00 ? 203 PRO A CD   1  
ATOM 3029  H HA   . PRO A 1 208 ? -6.456   -23.148  -39.895  1.00 0.00 ? 203 PRO A HA   1  
ATOM 3030  H HB2  . PRO A 1 208 ? -7.728   -20.936  -40.894  1.00 0.00 ? 203 PRO A HB2  1  
ATOM 3031  H HB3  . PRO A 1 208 ? -8.234   -21.755  -39.403  1.00 0.00 ? 203 PRO A HB3  1  
ATOM 3032  H HG2  . PRO A 1 208 ? -6.643   -19.264  -39.745  1.00 0.00 ? 203 PRO A HG2  1  
ATOM 3033  H HG3  . PRO A 1 208 ? -7.873   -19.662  -38.536  1.00 0.00 ? 203 PRO A HG3  1  
ATOM 3034  H HD2  . PRO A 1 208 ? -5.194   -19.724  -38.049  1.00 0.00 ? 203 PRO A HD2  1  
ATOM 3035  H HD3  . PRO A 1 208 ? -6.380   -20.716  -37.174  1.00 0.00 ? 203 PRO A HD3  1  
ATOM 3036  N N    . GLY A 1 209 ? -4.163   -22.340  -41.283  1.00 0.00 ? 204 GLY A N    1  
ATOM 3037  C CA   . GLY A 1 209 ? -3.305   -22.122  -42.482  1.00 0.00 ? 204 GLY A CA   1  
ATOM 3038  C C    . GLY A 1 209 ? -2.533   -23.404  -42.810  1.00 0.00 ? 204 GLY A C    1  
ATOM 3039  O O    . GLY A 1 209 ? -1.748   -23.438  -43.738  1.00 0.00 ? 204 GLY A O    1  
ATOM 3040  H H    . GLY A 1 209 ? -3.821   -22.863  -40.532  1.00 0.00 ? 204 GLY A H    1  
ATOM 3041  H HA2  . GLY A 1 209 ? -3.924   -21.848  -43.323  1.00 0.00 ? 204 GLY A HA2  1  
ATOM 3042  H HA3  . GLY A 1 209 ? -2.600   -21.330  -42.278  1.00 0.00 ? 204 GLY A HA3  1  
ATOM 3043  N N    . SER A 1 210 ? -2.735   -24.457  -42.057  1.00 0.00 ? 205 SER A N    1  
ATOM 3044  C CA   . SER A 1 210 ? -1.995   -25.718  -42.336  1.00 0.00 ? 205 SER A CA   1  
ATOM 3045  C C    . SER A 1 210 ? -2.683   -26.901  -41.644  1.00 0.00 ? 205 SER A C    1  
ATOM 3046  O O    . SER A 1 210 ? -2.335   -27.255  -40.535  1.00 0.00 ? 205 SER A O    1  
ATOM 3047  C CB   . SER A 1 210 ? -0.604   -25.481  -41.751  1.00 0.00 ? 205 SER A CB   1  
ATOM 3048  O OG   . SER A 1 210 ? 0.359    -25.520  -42.797  1.00 0.00 ? 205 SER A OG   1  
ATOM 3049  H H    . SER A 1 210 ? -3.364   -24.417  -41.307  1.00 0.00 ? 205 SER A H    1  
ATOM 3050  H HA   . SER A 1 210 ? -1.925   -25.889  -43.399  1.00 0.00 ? 205 SER A HA   1  
ATOM 3051  H HB2  . SER A 1 210 ? -0.574   -24.513  -41.274  1.00 0.00 ? 205 SER A HB2  1  
ATOM 3052  H HB3  . SER A 1 210 ? -0.386   -26.246  -41.017  1.00 0.00 ? 205 SER A HB3  1  
ATOM 3053  H HG   . SER A 1 210 ? 0.454    -26.432  -43.079  1.00 0.00 ? 205 SER A HG   1  
ATOM 3054  N N    . PRO A 1 211 ? -3.644   -27.476  -42.324  1.00 0.00 ? 206 PRO A N    1  
ATOM 3055  C CA   . PRO A 1 211 ? -4.386   -28.631  -41.760  1.00 0.00 ? 206 PRO A CA   1  
ATOM 3056  C C    . PRO A 1 211 ? -3.500   -29.881  -41.751  1.00 0.00 ? 206 PRO A C    1  
ATOM 3057  O O    . PRO A 1 211 ? -3.345   -30.550  -42.753  1.00 0.00 ? 206 PRO A O    1  
ATOM 3058  C CB   . PRO A 1 211 ? -5.561   -28.805  -42.718  1.00 0.00 ? 206 PRO A CB   1  
ATOM 3059  C CG   . PRO A 1 211 ? -5.099   -28.209  -44.009  1.00 0.00 ? 206 PRO A CG   1  
ATOM 3060  C CD   . PRO A 1 211 ? -4.125   -27.113  -43.664  1.00 0.00 ? 206 PRO A CD   1  
ATOM 3061  H HA   . PRO A 1 211 ? -4.745   -28.409  -40.769  1.00 0.00 ? 206 PRO A HA   1  
ATOM 3062  H HB2  . PRO A 1 211 ? -5.789   -29.855  -42.845  1.00 0.00 ? 206 PRO A HB2  1  
ATOM 3063  H HB3  . PRO A 1 211 ? -6.426   -28.272  -42.355  1.00 0.00 ? 206 PRO A HB3  1  
ATOM 3064  H HG2  . PRO A 1 211 ? -4.610   -28.965  -44.609  1.00 0.00 ? 206 PRO A HG2  1  
ATOM 3065  H HG3  . PRO A 1 211 ? -5.937   -27.795  -44.547  1.00 0.00 ? 206 PRO A HG3  1  
ATOM 3066  H HD2  . PRO A 1 211 ? -3.308   -27.096  -44.373  1.00 0.00 ? 206 PRO A HD2  1  
ATOM 3067  H HD3  . PRO A 1 211 ? -4.624   -26.157  -43.633  1.00 0.00 ? 206 PRO A HD3  1  
ATOM 3068  N N    . GLU A 1 212 ? -2.918   -30.198  -40.623  1.00 0.00 ? 207 GLU A N    1  
ATOM 3069  C CA   . GLU A 1 212 ? -2.038   -31.404  -40.540  1.00 0.00 ? 207 GLU A CA   1  
ATOM 3070  C C    . GLU A 1 212 ? -0.974   -31.368  -41.647  1.00 0.00 ? 207 GLU A C    1  
ATOM 3071  O O    . GLU A 1 212 ? -1.036   -32.132  -42.590  1.00 0.00 ? 207 GLU A O    1  
ATOM 3072  C CB   . GLU A 1 212 ? -2.976   -32.598  -40.731  1.00 0.00 ? 207 GLU A CB   1  
ATOM 3073  C CG   . GLU A 1 212 ? -2.524   -33.751  -39.832  1.00 0.00 ? 207 GLU A CG   1  
ATOM 3074  C CD   . GLU A 1 212 ? -3.188   -35.050  -40.294  1.00 0.00 ? 207 GLU A CD   1  
ATOM 3075  O OE1  . GLU A 1 212 ? -3.170   -35.311  -41.485  1.00 0.00 ? 207 GLU A OE1  1  
ATOM 3076  O OE2  . GLU A 1 212 ? -3.705   -35.761  -39.447  1.00 0.00 ? 207 GLU A OE2  1  
ATOM 3077  H H    . GLU A 1 212 ? -3.058   -29.642  -39.828  1.00 0.00 ? 207 GLU A H    1  
ATOM 3078  H HA   . GLU A 1 212 ? -1.567   -31.458  -39.571  1.00 0.00 ? 207 GLU A HA   1  
ATOM 3079  H HB2  . GLU A 1 212 ? -3.983   -32.310  -40.468  1.00 0.00 ? 207 GLU A HB2  1  
ATOM 3080  H HB3  . GLU A 1 212 ? -2.950   -32.917  -41.762  1.00 0.00 ? 207 GLU A HB3  1  
ATOM 3081  H HG2  . GLU A 1 212 ? -1.450   -33.854  -39.893  1.00 0.00 ? 207 GLU A HG2  1  
ATOM 3082  H HG3  . GLU A 1 212 ? -2.809   -33.546  -38.812  1.00 0.00 ? 207 GLU A HG3  1  
ATOM 3083  N N    . PRO A 1 213 ? -0.029   -30.474  -41.495  1.00 0.00 ? 208 PRO A N    1  
ATOM 3084  C CA   . PRO A 1 213 ? 1.056    -30.341  -42.499  1.00 0.00 ? 208 PRO A CA   1  
ATOM 3085  C C    . PRO A 1 213 ? 2.017    -31.530  -42.408  1.00 0.00 ? 208 PRO A C    1  
ATOM 3086  O O    . PRO A 1 213 ? 3.039    -31.465  -41.754  1.00 0.00 ? 208 PRO A O    1  
ATOM 3087  C CB   . PRO A 1 213 ? 1.755    -29.043  -42.103  1.00 0.00 ? 208 PRO A CB   1  
ATOM 3088  C CG   . PRO A 1 213 ? 1.460    -28.874  -40.647  1.00 0.00 ? 208 PRO A CG   1  
ATOM 3089  C CD   . PRO A 1 213 ? 0.121    -29.517  -40.391  1.00 0.00 ? 208 PRO A CD   1  
ATOM 3090  H HA   . PRO A 1 213 ? 0.648    -30.254  -43.493  1.00 0.00 ? 208 PRO A HA   1  
ATOM 3091  H HB2  . PRO A 1 213 ? 2.820    -29.127  -42.267  1.00 0.00 ? 208 PRO A HB2  1  
ATOM 3092  H HB3  . PRO A 1 213 ? 1.350    -28.213  -42.660  1.00 0.00 ? 208 PRO A HB3  1  
ATOM 3093  H HG2  . PRO A 1 213 ? 2.225    -29.361  -40.058  1.00 0.00 ? 208 PRO A HG2  1  
ATOM 3094  H HG3  . PRO A 1 213 ? 1.412    -27.825  -40.399  1.00 0.00 ? 208 PRO A HG3  1  
ATOM 3095  H HD2  . PRO A 1 213 ? 0.124    -30.028  -39.438  1.00 0.00 ? 208 PRO A HD2  1  
ATOM 3096  H HD3  . PRO A 1 213 ? -0.667   -28.781  -40.428  1.00 0.00 ? 208 PRO A HD3  1  
ATOM 3097  N N    . GLU A 1 214 ? 1.695    -32.615  -43.061  1.00 0.00 ? 209 GLU A N    1  
ATOM 3098  C CA   . GLU A 1 214 ? 2.587    -33.810  -43.015  1.00 0.00 ? 209 GLU A CA   1  
ATOM 3099  C C    . GLU A 1 214 ? 2.986    -34.224  -44.434  1.00 0.00 ? 209 GLU A C    1  
ATOM 3100  O O    . GLU A 1 214 ? 3.129    -35.394  -44.732  1.00 0.00 ? 209 GLU A O    1  
ATOM 3101  C CB   . GLU A 1 214 ? 1.749    -34.905  -42.349  1.00 0.00 ? 209 GLU A CB   1  
ATOM 3102  C CG   . GLU A 1 214 ? 2.517    -35.489  -41.162  1.00 0.00 ? 209 GLU A CG   1  
ATOM 3103  C CD   . GLU A 1 214 ? 3.672    -36.351  -41.675  1.00 0.00 ? 209 GLU A CD   1  
ATOM 3104  O OE1  . GLU A 1 214 ? 3.443    -37.134  -42.582  1.00 0.00 ? 209 GLU A OE1  1  
ATOM 3105  O OE2  . GLU A 1 214 ? 4.766    -36.213  -41.152  1.00 0.00 ? 209 GLU A OE2  1  
ATOM 3106  H H    . GLU A 1 214 ? 0.865    -32.644  -43.582  1.00 0.00 ? 209 GLU A H    1  
ATOM 3107  H HA   . GLU A 1 214 ? 3.463    -33.603  -42.422  1.00 0.00 ? 209 GLU A HA   1  
ATOM 3108  H HB2  . GLU A 1 214 ? 0.816    -34.484  -42.003  1.00 0.00 ? 209 GLU A HB2  1  
ATOM 3109  H HB3  . GLU A 1 214 ? 1.546    -35.689  -43.064  1.00 0.00 ? 209 GLU A HB3  1  
ATOM 3110  H HG2  . GLU A 1 214 ? 2.908    -34.684  -40.556  1.00 0.00 ? 209 GLU A HG2  1  
ATOM 3111  H HG3  . GLU A 1 214 ? 1.853    -36.097  -40.567  1.00 0.00 ? 209 GLU A HG3  1  
ATOM 3112  N N    . HIS A 1 215 ? 3.166    -33.273  -45.311  1.00 0.00 ? 210 HIS A N    1  
ATOM 3113  C CA   . HIS A 1 215 ? 3.555    -33.608  -46.712  1.00 0.00 ? 210 HIS A CA   1  
ATOM 3114  C C    . HIS A 1 215 ? 4.841    -32.869  -47.094  1.00 0.00 ? 210 HIS A C    1  
ATOM 3115  O O    . HIS A 1 215 ? 5.071    -32.561  -48.247  1.00 0.00 ? 210 HIS A O    1  
ATOM 3116  C CB   . HIS A 1 215 ? 2.383    -33.130  -47.574  1.00 0.00 ? 210 HIS A CB   1  
ATOM 3117  C CG   . HIS A 1 215 ? 1.903    -34.259  -48.445  1.00 0.00 ? 210 HIS A CG   1  
ATOM 3118  N ND1  . HIS A 1 215 ? 1.450    -34.054  -49.739  1.00 0.00 ? 210 HIS A ND1  1  
ATOM 3119  C CD2  . HIS A 1 215 ? 1.799    -35.610  -48.222  1.00 0.00 ? 210 HIS A CD2  1  
ATOM 3120  C CE1  . HIS A 1 215 ? 1.097    -35.251  -50.240  1.00 0.00 ? 210 HIS A CE1  1  
ATOM 3121  N NE2  . HIS A 1 215 ? 1.289    -36.235  -49.356  1.00 0.00 ? 210 HIS A NE2  1  
ATOM 3122  H H    . HIS A 1 215 ? 3.045    -32.336  -45.048  1.00 0.00 ? 210 HIS A H    1  
ATOM 3123  H HA   . HIS A 1 215 ? 3.686    -34.673  -46.821  1.00 0.00 ? 210 HIS A HA   1  
ATOM 3124  H HB2  . HIS A 1 215 ? 1.577    -32.802  -46.935  1.00 0.00 ? 210 HIS A HB2  1  
ATOM 3125  H HB3  . HIS A 1 215 ? 2.706    -32.309  -48.197  1.00 0.00 ? 210 HIS A HB3  1  
ATOM 3126  H HD1  . HIS A 1 215 ? 1.396    -33.192  -50.204  1.00 0.00 ? 210 HIS A HD1  1  
ATOM 3127  H HD2  . HIS A 1 215 ? 2.070    -36.112  -47.305  1.00 0.00 ? 210 HIS A HD2  1  
ATOM 3128  H HE1  . HIS A 1 215 ? 0.706    -35.400  -51.236  1.00 0.00 ? 210 HIS A HE1  1  
ATOM 3129  N N    . GLY A 1 216 ? 5.680    -32.582  -46.134  1.00 0.00 ? 211 GLY A N    1  
ATOM 3130  C CA   . GLY A 1 216 ? 6.950    -31.863  -46.439  1.00 0.00 ? 211 GLY A CA   1  
ATOM 3131  C C    . GLY A 1 216 ? 8.134    -32.663  -45.894  1.00 0.00 ? 211 GLY A C    1  
ATOM 3132  O O    . GLY A 1 216 ? 8.809    -32.242  -44.975  1.00 0.00 ? 211 GLY A O    1  
ATOM 3133  H H    . GLY A 1 216 ? 5.473    -32.840  -45.211  1.00 0.00 ? 211 GLY A H    1  
ATOM 3134  H HA2  . GLY A 1 216 ? 7.051    -31.751  -47.510  1.00 0.00 ? 211 GLY A HA2  1  
ATOM 3135  H HA3  . GLY A 1 216 ? 6.933    -30.889  -45.975  1.00 0.00 ? 211 GLY A HA3  1  
ATOM 3136  N N    . SER A 1 217 ? 8.391    -33.815  -46.454  1.00 0.00 ? 212 SER A N    1  
ATOM 3137  C CA   . SER A 1 217 ? 9.533    -34.645  -45.970  1.00 0.00 ? 212 SER A CA   1  
ATOM 3138  C C    . SER A 1 217 ? 10.862   -34.007  -46.381  1.00 0.00 ? 212 SER A C    1  
ATOM 3139  O O    . SER A 1 217 ? 11.143   -33.835  -47.551  1.00 0.00 ? 212 SER A O    1  
ATOM 3140  C CB   . SER A 1 217 ? 9.356    -36.002  -46.651  1.00 0.00 ? 212 SER A CB   1  
ATOM 3141  O OG   . SER A 1 217 ? 7.987    -36.382  -46.591  1.00 0.00 ? 212 SER A OG   1  
ATOM 3142  H H    . SER A 1 217 ? 7.833    -34.134  -47.194  1.00 0.00 ? 212 SER A H    1  
ATOM 3143  H HA   . SER A 1 217 ? 9.486    -34.761  -44.899  1.00 0.00 ? 212 SER A HA   1  
ATOM 3144  H HB2  . SER A 1 217 ? 9.660    -35.932  -47.682  1.00 0.00 ? 212 SER A HB2  1  
ATOM 3145  H HB3  . SER A 1 217 ? 9.968    -36.739  -46.147  1.00 0.00 ? 212 SER A HB3  1  
ATOM 3146  H HG   . SER A 1 217 ? 7.872    -36.955  -45.830  1.00 0.00 ? 212 SER A HG   1  
ATOM 3147  N N    . VAL A 1 218 ? 11.682   -33.656  -45.426  1.00 0.00 ? 213 VAL A N    1  
ATOM 3148  C CA   . VAL A 1 218 ? 12.995   -33.029  -45.758  1.00 0.00 ? 213 VAL A CA   1  
ATOM 3149  C C    . VAL A 1 218 ? 14.142   -33.945  -45.325  1.00 0.00 ? 213 VAL A C    1  
ATOM 3150  O O    . VAL A 1 218 ? 15.200   -33.490  -44.936  1.00 0.00 ? 213 VAL A O    1  
ATOM 3151  C CB   . VAL A 1 218 ? 13.024   -31.718  -44.967  1.00 0.00 ? 213 VAL A CB   1  
ATOM 3152  C CG1  . VAL A 1 218 ? 11.885   -30.813  -45.439  1.00 0.00 ? 213 VAL A CG1  1  
ATOM 3153  C CG2  . VAL A 1 218 ? 12.853   -32.011  -43.473  1.00 0.00 ? 213 VAL A CG2  1  
ATOM 3154  H H    . VAL A 1 218 ? 11.434   -33.805  -44.490  1.00 0.00 ? 213 VAL A H    1  
ATOM 3155  H HA   . VAL A 1 218 ? 13.057   -32.822  -46.814  1.00 0.00 ? 213 VAL A HA   1  
ATOM 3156  H HB   . VAL A 1 218 ? 13.969   -31.221  -45.132  1.00 0.00 ? 213 VAL A HB   1  
ATOM 3157  H HG11 . VAL A 1 218 ? 10.966   -31.108  -44.955  1.00 0.00 ? 213 VAL A HG11 1  
ATOM 3158  H HG12 . VAL A 1 218 ? 11.774   -30.903  -46.510  1.00 0.00 ? 213 VAL A HG12 1  
ATOM 3159  H HG13 . VAL A 1 218 ? 12.112   -29.788  -45.186  1.00 0.00 ? 213 VAL A HG13 1  
ATOM 3160  H HG21 . VAL A 1 218 ? 11.827   -32.282  -43.275  1.00 0.00 ? 213 VAL A HG21 1  
ATOM 3161  H HG22 . VAL A 1 218 ? 13.110   -31.131  -42.902  1.00 0.00 ? 213 VAL A HG22 1  
ATOM 3162  H HG23 . VAL A 1 218 ? 13.502   -32.826  -43.190  1.00 0.00 ? 213 VAL A HG23 1  
ATOM 3163  N N    . GLN A 1 219 ? 13.939   -35.234  -45.389  1.00 0.00 ? 214 GLN A N    1  
ATOM 3164  C CA   . GLN A 1 219 ? 15.016   -36.183  -44.981  1.00 0.00 ? 214 GLN A CA   1  
ATOM 3165  C C    . GLN A 1 219 ? 15.858   -36.583  -46.196  1.00 0.00 ? 214 GLN A C    1  
ATOM 3166  O O    . GLN A 1 219 ? 15.906   -37.736  -46.578  1.00 0.00 ? 214 GLN A O    1  
ATOM 3167  C CB   . GLN A 1 219 ? 14.278   -37.397  -44.413  1.00 0.00 ? 214 GLN A CB   1  
ATOM 3168  C CG   . GLN A 1 219 ? 15.265   -38.295  -43.661  1.00 0.00 ? 214 GLN A CG   1  
ATOM 3169  C CD   . GLN A 1 219 ? 15.482   -39.591  -44.445  1.00 0.00 ? 214 GLN A CD   1  
ATOM 3170  O OE1  . GLN A 1 219 ? 14.594   -40.055  -45.132  1.00 0.00 ? 214 GLN A OE1  1  
ATOM 3171  N NE2  . GLN A 1 219 ? 16.634   -40.199  -44.371  1.00 0.00 ? 214 GLN A NE2  1  
ATOM 3172  H H    . GLN A 1 219 ? 13.078   -35.578  -45.705  1.00 0.00 ? 214 GLN A H    1  
ATOM 3173  H HA   . GLN A 1 219 ? 15.638   -35.741  -44.220  1.00 0.00 ? 214 GLN A HA   1  
ATOM 3174  H HB2  . GLN A 1 219 ? 13.506   -37.062  -43.734  1.00 0.00 ? 214 GLN A HB2  1  
ATOM 3175  H HB3  . GLN A 1 219 ? 13.828   -37.955  -45.221  1.00 0.00 ? 214 GLN A HB3  1  
ATOM 3176  H HG2  . GLN A 1 219 ? 16.209   -37.779  -43.550  1.00 0.00 ? 214 GLN A HG2  1  
ATOM 3177  H HG3  . GLN A 1 219 ? 14.867   -38.529  -42.686  1.00 0.00 ? 214 GLN A HG3  1  
ATOM 3178  H HE21 . GLN A 1 219 ? 17.351   -39.825  -43.818  1.00 0.00 ? 214 GLN A HE21 1  
ATOM 3179  H HE22 . GLN A 1 219 ? 16.783   -41.030  -44.869  1.00 0.00 ? 214 GLN A HE22 1  
ATOM 3180  N N    . GLU A 1 220 ? 16.523   -35.637  -46.805  1.00 0.00 ? 215 GLU A N    1  
ATOM 3181  C CA   . GLU A 1 220 ? 17.364   -35.958  -47.994  1.00 0.00 ? 215 GLU A CA   1  
ATOM 3182  C C    . GLU A 1 220 ? 18.849   -35.874  -47.629  1.00 0.00 ? 215 GLU A C    1  
ATOM 3183  O O    . GLU A 1 220 ? 19.634   -36.733  -47.980  1.00 0.00 ? 215 GLU A O    1  
ATOM 3184  C CB   . GLU A 1 220 ? 17.006   -34.894  -49.032  1.00 0.00 ? 215 GLU A CB   1  
ATOM 3185  C CG   . GLU A 1 220 ? 17.646   -35.254  -50.374  1.00 0.00 ? 215 GLU A CG   1  
ATOM 3186  C CD   . GLU A 1 220 ? 16.884   -34.560  -51.505  1.00 0.00 ? 215 GLU A CD   1  
ATOM 3187  O OE1  . GLU A 1 220 ? 17.191   -33.413  -51.784  1.00 0.00 ? 215 GLU A OE1  1  
ATOM 3188  O OE2  . GLU A 1 220 ? 16.005   -35.188  -52.073  1.00 0.00 ? 215 GLU A OE2  1  
ATOM 3189  H H    . GLU A 1 220 ? 16.470   -34.715  -46.478  1.00 0.00 ? 215 GLU A H    1  
ATOM 3190  H HA   . GLU A 1 220 ? 17.123   -36.939  -48.373  1.00 0.00 ? 215 GLU A HA   1  
ATOM 3191  H HB2  . GLU A 1 220 ? 15.932   -34.848  -49.144  1.00 0.00 ? 215 GLU A HB2  1  
ATOM 3192  H HB3  . GLU A 1 220 ? 17.376   -33.934  -48.705  1.00 0.00 ? 215 GLU A HB3  1  
ATOM 3193  H HG2  . GLU A 1 220 ? 18.676   -34.928  -50.380  1.00 0.00 ? 215 GLU A HG2  1  
ATOM 3194  H HG3  . GLU A 1 220 ? 17.605   -36.323  -50.518  1.00 0.00 ? 215 GLU A HG3  1  
ATOM 3195  N N    . SER A 1 221 ? 19.238   -34.844  -46.923  1.00 0.00 ? 216 SER A N    1  
ATOM 3196  C CA   . SER A 1 221 ? 20.672   -34.695  -46.527  1.00 0.00 ? 216 SER A CA   1  
ATOM 3197  C C    . SER A 1 221 ? 21.582   -34.806  -47.755  1.00 0.00 ? 216 SER A C    1  
ATOM 3198  O O    . SER A 1 221 ? 22.388   -35.710  -47.863  1.00 0.00 ? 216 SER A O    1  
ATOM 3199  C CB   . SER A 1 221 ? 20.940   -35.844  -45.554  1.00 0.00 ? 216 SER A CB   1  
ATOM 3200  O OG   . SER A 1 221 ? 21.917   -35.437  -44.605  1.00 0.00 ? 216 SER A OG   1  
ATOM 3201  H H    . SER A 1 221 ? 18.585   -34.165  -46.651  1.00 0.00 ? 216 SER A H    1  
ATOM 3202  H HA   . SER A 1 221 ? 20.827   -33.750  -46.030  1.00 0.00 ? 216 SER A HA   1  
ATOM 3203  H HB2  . SER A 1 221 ? 20.030   -36.101  -45.038  1.00 0.00 ? 216 SER A HB2  1  
ATOM 3204  H HB3  . SER A 1 221 ? 21.294   -36.705  -46.105  1.00 0.00 ? 216 SER A HB3  1  
ATOM 3205  H HG   . SER A 1 221 ? 22.045   -36.158  -43.984  1.00 0.00 ? 216 SER A HG   1  
ATOM 3206  N N    . GLN A 1 222 ? 21.460   -33.891  -48.680  1.00 0.00 ? 217 GLN A N    1  
ATOM 3207  C CA   . GLN A 1 222 ? 22.319   -33.941  -49.900  1.00 0.00 ? 217 GLN A CA   1  
ATOM 3208  C C    . GLN A 1 222 ? 23.302   -32.767  -49.903  1.00 0.00 ? 217 GLN A C    1  
ATOM 3209  O O    . GLN A 1 222 ? 23.378   -32.011  -50.852  1.00 0.00 ? 217 GLN A O    1  
ATOM 3210  C CB   . GLN A 1 222 ? 21.348   -33.838  -51.080  1.00 0.00 ? 217 GLN A CB   1  
ATOM 3211  C CG   . GLN A 1 222 ? 20.524   -32.552  -50.966  1.00 0.00 ? 217 GLN A CG   1  
ATOM 3212  C CD   . GLN A 1 222 ? 20.094   -32.096  -52.361  1.00 0.00 ? 217 GLN A CD   1  
ATOM 3213  O OE1  . GLN A 1 222 ? 20.737   -32.415  -53.342  1.00 0.00 ? 217 GLN A OE1  1  
ATOM 3214  N NE2  . GLN A 1 222 ? 19.027   -31.357  -52.493  1.00 0.00 ? 217 GLN A NE2  1  
ATOM 3215  H H    . GLN A 1 222 ? 20.805   -33.171  -48.572  1.00 0.00 ? 217 GLN A H    1  
ATOM 3216  H HA   . GLN A 1 222 ? 22.853   -34.877  -49.944  1.00 0.00 ? 217 GLN A HA   1  
ATOM 3217  H HB2  . GLN A 1 222 ? 21.907   -33.825  -52.004  1.00 0.00 ? 217 GLN A HB2  1  
ATOM 3218  H HB3  . GLN A 1 222 ? 20.684   -34.689  -51.074  1.00 0.00 ? 217 GLN A HB3  1  
ATOM 3219  H HG2  . GLN A 1 222 ? 19.648   -32.738  -50.361  1.00 0.00 ? 217 GLN A HG2  1  
ATOM 3220  H HG3  . GLN A 1 222 ? 21.122   -31.780  -50.506  1.00 0.00 ? 217 GLN A HG3  1  
ATOM 3221  H HE21 . GLN A 1 222 ? 18.508   -31.100  -51.702  1.00 0.00 ? 217 GLN A HE21 1  
ATOM 3222  H HE22 . GLN A 1 222 ? 18.743   -31.060  -53.383  1.00 0.00 ? 217 GLN A HE22 1  
ATOM 3223  N N    . VAL A 1 223 ? 24.055   -32.609  -48.846  1.00 0.00 ? 218 VAL A N    1  
ATOM 3224  C CA   . VAL A 1 223 ? 25.034   -31.485  -48.784  1.00 0.00 ? 218 VAL A CA   1  
ATOM 3225  C C    . VAL A 1 223 ? 26.453   -32.009  -49.026  1.00 0.00 ? 218 VAL A C    1  
ATOM 3226  O O    . VAL A 1 223 ? 27.278   -31.341  -49.618  1.00 0.00 ? 218 VAL A O    1  
ATOM 3227  C CB   . VAL A 1 223 ? 24.903   -30.921  -47.367  1.00 0.00 ? 218 VAL A CB   1  
ATOM 3228  C CG1  . VAL A 1 223 ? 25.841   -29.722  -47.203  1.00 0.00 ? 218 VAL A CG1  1  
ATOM 3229  C CG2  . VAL A 1 223 ? 23.460   -30.470  -47.127  1.00 0.00 ? 218 VAL A CG2  1  
ATOM 3230  H H    . VAL A 1 223 ? 23.976   -33.231  -48.093  1.00 0.00 ? 218 VAL A H    1  
ATOM 3231  H HA   . VAL A 1 223 ? 24.783   -30.726  -49.508  1.00 0.00 ? 218 VAL A HA   1  
ATOM 3232  H HB   . VAL A 1 223 ? 25.168   -31.685  -46.650  1.00 0.00 ? 218 VAL A HB   1  
ATOM 3233  H HG11 . VAL A 1 223 ? 25.326   -28.820  -47.499  1.00 0.00 ? 218 VAL A HG11 1  
ATOM 3234  H HG12 . VAL A 1 223 ? 26.713   -29.859  -47.825  1.00 0.00 ? 218 VAL A HG12 1  
ATOM 3235  H HG13 . VAL A 1 223 ? 26.144   -29.641  -46.170  1.00 0.00 ? 218 VAL A HG13 1  
ATOM 3236  H HG21 . VAL A 1 223 ? 23.380   -30.023  -46.147  1.00 0.00 ? 218 VAL A HG21 1  
ATOM 3237  H HG22 . VAL A 1 223 ? 22.801   -31.323  -47.188  1.00 0.00 ? 218 VAL A HG22 1  
ATOM 3238  H HG23 . VAL A 1 223 ? 23.180   -29.745  -47.877  1.00 0.00 ? 218 VAL A HG23 1  
ATOM 3239  N N    . SER A 1 224 ? 26.741   -33.200  -48.573  1.00 0.00 ? 219 SER A N    1  
ATOM 3240  C CA   . SER A 1 224 ? 28.105   -33.768  -48.776  1.00 0.00 ? 219 SER A CA   1  
ATOM 3241  C C    . SER A 1 224 ? 28.008   -35.211  -49.279  1.00 0.00 ? 219 SER A C    1  
ATOM 3242  O O    . SER A 1 224 ? 27.586   -36.100  -48.564  1.00 0.00 ? 219 SER A O    1  
ATOM 3243  C CB   . SER A 1 224 ? 28.761   -33.725  -47.396  1.00 0.00 ? 219 SER A CB   1  
ATOM 3244  O OG   . SER A 1 224 ? 28.615   -32.422  -46.848  1.00 0.00 ? 219 SER A OG   1  
ATOM 3245  H H    . SER A 1 224 ? 26.059   -33.721  -48.098  1.00 0.00 ? 219 SER A H    1  
ATOM 3246  H HA   . SER A 1 224 ? 28.667   -33.164  -49.470  1.00 0.00 ? 219 SER A HA   1  
ATOM 3247  H HB2  . SER A 1 224 ? 28.284   -34.439  -46.746  1.00 0.00 ? 219 SER A HB2  1  
ATOM 3248  H HB3  . SER A 1 224 ? 29.810   -33.972  -47.490  1.00 0.00 ? 219 SER A HB3  1  
ATOM 3249  H HG   . SER A 1 224 ? 28.931   -31.789  -47.497  1.00 0.00 ? 219 SER A HG   1  
ATOM 3250  N N    . GLU A 1 225 ? 28.395   -35.451  -50.503  1.00 0.00 ? 220 GLU A N    1  
ATOM 3251  C CA   . GLU A 1 225 ? 28.325   -36.836  -51.053  1.00 0.00 ? 220 GLU A CA   1  
ATOM 3252  C C    . GLU A 1 225 ? 29.150   -36.938  -52.339  1.00 0.00 ? 220 GLU A C    1  
ATOM 3253  O O    . GLU A 1 225 ? 28.615   -37.067  -53.423  1.00 0.00 ? 220 GLU A O    1  
ATOM 3254  C CB   . GLU A 1 225 ? 26.842   -37.071  -51.345  1.00 0.00 ? 220 GLU A CB   1  
ATOM 3255  C CG   . GLU A 1 225 ? 26.526   -38.566  -51.233  1.00 0.00 ? 220 GLU A CG   1  
ATOM 3256  C CD   . GLU A 1 225 ? 25.399   -38.779  -50.218  1.00 0.00 ? 220 GLU A CD   1  
ATOM 3257  O OE1  . GLU A 1 225 ? 24.296   -38.333  -50.486  1.00 0.00 ? 220 GLU A OE1  1  
ATOM 3258  O OE2  . GLU A 1 225 ? 25.660   -39.384  -49.191  1.00 0.00 ? 220 GLU A OE2  1  
ATOM 3259  H H    . GLU A 1 225 ? 28.732   -34.719  -51.062  1.00 0.00 ? 220 GLU A H    1  
ATOM 3260  H HA   . GLU A 1 225 ? 28.674   -37.549  -50.323  1.00 0.00 ? 220 GLU A HA   1  
ATOM 3261  H HB2  . GLU A 1 225 ? 26.244   -36.520  -50.634  1.00 0.00 ? 220 GLU A HB2  1  
ATOM 3262  H HB3  . GLU A 1 225 ? 26.614   -36.732  -52.345  1.00 0.00 ? 220 GLU A HB3  1  
ATOM 3263  H HG2  . GLU A 1 225 ? 26.216   -38.941  -52.198  1.00 0.00 ? 220 GLU A HG2  1  
ATOM 3264  H HG3  . GLU A 1 225 ? 27.406   -39.099  -50.906  1.00 0.00 ? 220 GLU A HG3  1  
ATOM 3265  N N    . GLN A 1 226 ? 30.451   -36.882  -52.226  1.00 0.00 ? 221 GLN A N    1  
ATOM 3266  C CA   . GLN A 1 226 ? 31.312   -36.977  -53.441  1.00 0.00 ? 221 GLN A CA   1  
ATOM 3267  C C    . GLN A 1 226 ? 31.674   -38.441  -53.720  1.00 0.00 ? 221 GLN A C    1  
ATOM 3268  O O    . GLN A 1 226 ? 31.780   -39.234  -52.806  1.00 0.00 ? 221 GLN A O    1  
ATOM 3269  C CB   . GLN A 1 226 ? 32.567   -36.171  -53.101  1.00 0.00 ? 221 GLN A CB   1  
ATOM 3270  C CG   . GLN A 1 226 ? 32.192   -34.702  -52.895  1.00 0.00 ? 221 GLN A CG   1  
ATOM 3271  C CD   . GLN A 1 226 ? 31.767   -34.091  -54.231  1.00 0.00 ? 221 GLN A CD   1  
ATOM 3272  O OE1  . GLN A 1 226 ? 32.599   -33.693  -55.022  1.00 0.00 ? 221 GLN A OE1  1  
ATOM 3273  N NE2  . GLN A 1 226 ? 30.498   -33.999  -54.519  1.00 0.00 ? 221 GLN A NE2  1  
ATOM 3274  H H    . GLN A 1 226 ? 30.861   -36.778  -51.342  1.00 0.00 ? 221 GLN A H    1  
ATOM 3275  H HA   . GLN A 1 226 ? 30.813   -36.541  -54.291  1.00 0.00 ? 221 GLN A HA   1  
ATOM 3276  H HB2  . GLN A 1 226 ? 33.010   -36.561  -52.196  1.00 0.00 ? 221 GLN A HB2  1  
ATOM 3277  H HB3  . GLN A 1 226 ? 33.276   -36.249  -53.912  1.00 0.00 ? 221 GLN A HB3  1  
ATOM 3278  H HG2  . GLN A 1 226 ? 31.375   -34.635  -52.191  1.00 0.00 ? 221 GLN A HG2  1  
ATOM 3279  H HG3  . GLN A 1 226 ? 33.044   -34.164  -52.510  1.00 0.00 ? 221 GLN A HG3  1  
ATOM 3280  H HE21 . GLN A 1 226 ? 29.826   -34.321  -53.882  1.00 0.00 ? 221 GLN A HE21 1  
ATOM 3281  H HE22 . GLN A 1 226 ? 30.216   -33.609  -55.373  1.00 0.00 ? 221 GLN A HE22 1  
ATOM 3282  N N    . PRO A 1 227 ? 31.853   -38.754  -54.979  1.00 0.00 ? 222 PRO A N    1  
ATOM 3283  C CA   . PRO A 1 227 ? 32.206   -40.141  -55.371  1.00 0.00 ? 222 PRO A CA   1  
ATOM 3284  C C    . PRO A 1 227 ? 33.664   -40.441  -55.013  1.00 0.00 ? 222 PRO A C    1  
ATOM 3285  O O    . PRO A 1 227 ? 33.967   -41.442  -54.393  1.00 0.00 ? 222 PRO A O    1  
ATOM 3286  C CB   . PRO A 1 227 ? 32.007   -40.149  -56.884  1.00 0.00 ? 222 PRO A CB   1  
ATOM 3287  C CG   . PRO A 1 227 ? 32.169   -38.723  -57.305  1.00 0.00 ? 222 PRO A CG   1  
ATOM 3288  C CD   . PRO A 1 227 ? 31.745   -37.863  -56.142  1.00 0.00 ? 222 PRO A CD   1  
ATOM 3289  H HA   . PRO A 1 227 ? 31.542   -40.851  -54.906  1.00 0.00 ? 222 PRO A HA   1  
ATOM 3290  H HB2  . PRO A 1 227 ? 32.756   -40.770  -57.356  1.00 0.00 ? 222 PRO A HB2  1  
ATOM 3291  H HB3  . PRO A 1 227 ? 31.017   -40.497  -57.131  1.00 0.00 ? 222 PRO A HB3  1  
ATOM 3292  H HG2  . PRO A 1 227 ? 33.203   -38.528  -57.553  1.00 0.00 ? 222 PRO A HG2  1  
ATOM 3293  H HG3  . PRO A 1 227 ? 31.540   -38.516  -58.157  1.00 0.00 ? 222 PRO A HG3  1  
ATOM 3294  H HD2  . PRO A 1 227 ? 32.409   -37.016  -56.038  1.00 0.00 ? 222 PRO A HD2  1  
ATOM 3295  H HD3  . PRO A 1 227 ? 30.725   -37.534  -56.265  1.00 0.00 ? 222 PRO A HD3  1  
ATOM 3296  N N    . ALA A 1 228 ? 34.570   -39.580  -55.400  1.00 0.00 ? 223 ALA A N    1  
ATOM 3297  C CA   . ALA A 1 228 ? 36.014   -39.809  -55.086  1.00 0.00 ? 223 ALA A CA   1  
ATOM 3298  C C    . ALA A 1 228 ? 36.453   -41.195  -55.570  1.00 0.00 ? 223 ALA A C    1  
ATOM 3299  O O    . ALA A 1 228 ? 37.319   -41.820  -54.988  1.00 0.00 ? 223 ALA A O    1  
ATOM 3300  C CB   . ALA A 1 228 ? 36.114   -39.716  -53.562  1.00 0.00 ? 223 ALA A CB   1  
ATOM 3301  H H    . ALA A 1 228 ? 34.301   -38.781  -55.899  1.00 0.00 ? 223 ALA A H    1  
ATOM 3302  H HA   . ALA A 1 228 ? 36.622   -39.043  -55.540  1.00 0.00 ? 223 ALA A HA   1  
ATOM 3303  H HB1  . ALA A 1 228 ? 37.153   -39.672  -53.271  1.00 0.00 ? 223 ALA A HB1  1  
ATOM 3304  H HB2  . ALA A 1 228 ? 35.652   -40.585  -53.117  1.00 0.00 ? 223 ALA A HB2  1  
ATOM 3305  H HB3  . ALA A 1 228 ? 35.607   -38.825  -53.222  1.00 0.00 ? 223 ALA A HB3  1  
ATOM 3306  N N    . THR A 1 229 ? 35.862   -41.678  -56.630  1.00 0.00 ? 224 THR A N    1  
ATOM 3307  C CA   . THR A 1 229 ? 36.243   -43.023  -57.153  1.00 0.00 ? 224 THR A CA   1  
ATOM 3308  C C    . THR A 1 229 ? 36.878   -42.892  -58.540  1.00 0.00 ? 224 THR A C    1  
ATOM 3309  O O    . THR A 1 229 ? 37.720   -43.680  -58.924  1.00 0.00 ? 224 THR A O    1  
ATOM 3310  C CB   . THR A 1 229 ? 34.931   -43.804  -57.234  1.00 0.00 ? 224 THR A CB   1  
ATOM 3311  O OG1  . THR A 1 229 ? 34.260   -43.730  -55.983  1.00 0.00 ? 224 THR A OG1  1  
ATOM 3312  C CG2  . THR A 1 229 ? 35.224   -45.266  -57.573  1.00 0.00 ? 224 THR A CG2  1  
ATOM 3313  H H    . THR A 1 229 ? 35.167   -41.157  -57.083  1.00 0.00 ? 224 THR A H    1  
ATOM 3314  H HA   . THR A 1 229 ? 36.922   -43.513  -56.473  1.00 0.00 ? 224 THR A HA   1  
ATOM 3315  H HB   . THR A 1 229 ? 34.305   -43.379  -58.004  1.00 0.00 ? 224 THR A HB   1  
ATOM 3316  H HG1  . THR A 1 229 ? 34.873   -44.014  -55.301  1.00 0.00 ? 224 THR A HG1  1  
ATOM 3317  H HG21 . THR A 1 229 ? 34.374   -45.876  -57.304  1.00 0.00 ? 224 THR A HG21 1  
ATOM 3318  H HG22 . THR A 1 229 ? 36.093   -45.596  -57.022  1.00 0.00 ? 224 THR A HG22 1  
ATOM 3319  H HG23 . THR A 1 229 ? 35.413   -45.359  -58.632  1.00 0.00 ? 224 THR A HG23 1  
ATOM 3320  N N    . GLU A 1 230 ? 36.481   -41.901  -59.294  1.00 0.00 ? 225 GLU A N    1  
ATOM 3321  C CA   . GLU A 1 230 ? 37.062   -41.719  -60.657  1.00 0.00 ? 225 GLU A CA   1  
ATOM 3322  C C    . GLU A 1 230 ? 36.834   -40.285  -61.144  1.00 0.00 ? 225 GLU A C    1  
ATOM 3323  O O    . GLU A 1 230 ? 36.452   -40.058  -62.276  1.00 0.00 ? 225 GLU A O    1  
ATOM 3324  C CB   . GLU A 1 230 ? 36.315   -42.717  -61.548  1.00 0.00 ? 225 GLU A CB   1  
ATOM 3325  C CG   . GLU A 1 230 ? 34.810   -42.433  -61.499  1.00 0.00 ? 225 GLU A CG   1  
ATOM 3326  C CD   . GLU A 1 230 ? 34.227   -42.512  -62.912  1.00 0.00 ? 225 GLU A CD   1  
ATOM 3327  O OE1  . GLU A 1 230 ? 34.695   -41.776  -63.766  1.00 0.00 ? 225 GLU A OE1  1  
ATOM 3328  O OE2  . GLU A 1 230 ? 33.324   -43.306  -63.116  1.00 0.00 ? 225 GLU A OE2  1  
ATOM 3329  H H    . GLU A 1 230 ? 35.801   -41.277  -58.965  1.00 0.00 ? 225 GLU A H    1  
ATOM 3330  H HA   . GLU A 1 230 ? 38.115   -41.950  -60.650  1.00 0.00 ? 225 GLU A HA   1  
ATOM 3331  H HB2  . GLU A 1 230 ? 36.668   -42.622  -62.565  1.00 0.00 ? 225 GLU A HB2  1  
ATOM 3332  H HB3  . GLU A 1 230 ? 36.500   -43.720  -61.195  1.00 0.00 ? 225 GLU A HB3  1  
ATOM 3333  H HG2  . GLU A 1 230 ? 34.326   -43.165  -60.869  1.00 0.00 ? 225 GLU A HG2  1  
ATOM 3334  H HG3  . GLU A 1 230 ? 34.641   -41.445  -61.098  1.00 0.00 ? 225 GLU A HG3  1  
ATOM 3335  N N    . ALA A 1 231 ? 37.065   -39.317  -60.298  1.00 0.00 ? 226 ALA A N    1  
ATOM 3336  C CA   . ALA A 1 231 ? 36.862   -37.898  -60.711  1.00 0.00 ? 226 ALA A CA   1  
ATOM 3337  C C    . ALA A 1 231 ? 38.180   -37.124  -60.609  1.00 0.00 ? 226 ALA A C    1  
ATOM 3338  O O    . ALA A 1 231 ? 38.314   -36.206  -59.823  1.00 0.00 ? 226 ALA A O    1  
ATOM 3339  C CB   . ALA A 1 231 ? 35.833   -37.342  -59.725  1.00 0.00 ? 226 ALA A CB   1  
ATOM 3340  H H    . ALA A 1 231 ? 37.373   -39.524  -59.391  1.00 0.00 ? 226 ALA A H    1  
ATOM 3341  H HA   . ALA A 1 231 ? 36.474   -37.850  -61.715  1.00 0.00 ? 226 ALA A HA   1  
ATOM 3342  H HB1  . ALA A 1 231 ? 35.063   -38.080  -59.555  1.00 0.00 ? 226 ALA A HB1  1  
ATOM 3343  H HB2  . ALA A 1 231 ? 35.390   -36.447  -60.135  1.00 0.00 ? 226 ALA A HB2  1  
ATOM 3344  H HB3  . ALA A 1 231 ? 36.320   -37.107  -58.790  1.00 0.00 ? 226 ALA A HB3  1  
ATOM 3345  N N    . ALA A 1 232 ? 39.155   -37.489  -61.399  1.00 0.00 ? 227 ALA A N    1  
ATOM 3346  C CA   . ALA A 1 232 ? 40.465   -36.777  -61.351  1.00 0.00 ? 227 ALA A CA   1  
ATOM 3347  C C    . ALA A 1 232 ? 41.249   -37.026  -62.643  1.00 0.00 ? 227 ALA A C    1  
ATOM 3348  O O    . ALA A 1 232 ? 41.551   -38.151  -62.990  1.00 0.00 ? 227 ALA A O    1  
ATOM 3349  C CB   . ALA A 1 232 ? 41.199   -37.379  -60.153  1.00 0.00 ? 227 ALA A CB   1  
ATOM 3350  H H    . ALA A 1 232 ? 39.025   -38.232  -62.025  1.00 0.00 ? 227 ALA A H    1  
ATOM 3351  H HA   . ALA A 1 232 ? 40.314   -35.720  -61.199  1.00 0.00 ? 227 ALA A HA   1  
ATOM 3352  H HB1  . ALA A 1 232 ? 41.097   -38.454  -60.171  1.00 0.00 ? 227 ALA A HB1  1  
ATOM 3353  H HB2  . ALA A 1 232 ? 40.774   -36.992  -59.239  1.00 0.00 ? 227 ALA A HB2  1  
ATOM 3354  H HB3  . ALA A 1 232 ? 42.245   -37.116  -60.203  1.00 0.00 ? 227 ALA A HB3  1  
ATOM 3355  N N    . GLY A 1 233 ? 41.580   -35.982  -63.355  1.00 0.00 ? 228 GLY A N    1  
ATOM 3356  C CA   . GLY A 1 233 ? 42.344   -36.152  -64.625  1.00 0.00 ? 228 GLY A CA   1  
ATOM 3357  C C    . GLY A 1 233 ? 42.449   -34.805  -65.341  1.00 0.00 ? 228 GLY A C    1  
ATOM 3358  O O    . GLY A 1 233 ? 41.480   -34.082  -65.468  1.00 0.00 ? 228 GLY A O    1  
ATOM 3359  H H    . GLY A 1 233 ? 41.326   -35.085  -63.055  1.00 0.00 ? 228 GLY A H    1  
ATOM 3360  H HA2  . GLY A 1 233 ? 43.335   -36.522  -64.401  1.00 0.00 ? 228 GLY A HA2  1  
ATOM 3361  H HA3  . GLY A 1 233 ? 41.832   -36.856  -65.263  1.00 0.00 ? 228 GLY A HA3  1  
ATOM 3362  N N    . GLU A 1 234 ? 43.621   -34.460  -65.811  1.00 0.00 ? 229 GLU A N    1  
ATOM 3363  C CA   . GLU A 1 234 ? 43.797   -33.155  -66.521  1.00 0.00 ? 229 GLU A CA   1  
ATOM 3364  C C    . GLU A 1 234 ? 43.264   -32.004  -65.661  1.00 0.00 ? 229 GLU A C    1  
ATOM 3365  O O    . GLU A 1 234 ? 42.163   -31.527  -65.859  1.00 0.00 ? 229 GLU A O    1  
ATOM 3366  C CB   . GLU A 1 234 ? 42.982   -33.286  -67.811  1.00 0.00 ? 229 GLU A CB   1  
ATOM 3367  C CG   . GLU A 1 234 ? 43.928   -33.492  -68.996  1.00 0.00 ? 229 GLU A CG   1  
ATOM 3368  C CD   . GLU A 1 234 ? 44.238   -32.141  -69.644  1.00 0.00 ? 229 GLU A CD   1  
ATOM 3369  O OE1  . GLU A 1 234 ? 44.702   -31.260  -68.938  1.00 0.00 ? 229 GLU A OE1  1  
ATOM 3370  O OE2  . GLU A 1 234 ? 44.005   -32.009  -70.834  1.00 0.00 ? 229 GLU A OE2  1  
ATOM 3371  H H    . GLU A 1 234 ? 44.388   -35.059  -65.695  1.00 0.00 ? 229 GLU A H    1  
ATOM 3372  H HA   . GLU A 1 234 ? 44.837   -32.995  -66.757  1.00 0.00 ? 229 GLU A HA   1  
ATOM 3373  H HB2  . GLU A 1 234 ? 42.315   -34.132  -67.731  1.00 0.00 ? 229 GLU A HB2  1  
ATOM 3374  H HB3  . GLU A 1 234 ? 42.405   -32.386  -67.966  1.00 0.00 ? 229 GLU A HB3  1  
ATOM 3375  H HG2  . GLU A 1 234 ? 44.846   -33.944  -68.649  1.00 0.00 ? 229 GLU A HG2  1  
ATOM 3376  H HG3  . GLU A 1 234 ? 43.459   -34.138  -69.723  1.00 0.00 ? 229 GLU A HG3  1  
ATOM 3377  N N    . ASN A 1 235 ? 44.038   -31.557  -64.708  1.00 0.00 ? 230 ASN A N    1  
ATOM 3378  C CA   . ASN A 1 235 ? 43.580   -30.438  -63.834  1.00 0.00 ? 230 ASN A CA   1  
ATOM 3379  C C    . ASN A 1 235 ? 44.669   -29.361  -63.741  1.00 0.00 ? 230 ASN A C    1  
ATOM 3380  O O    . ASN A 1 235 ? 45.670   -29.554  -63.079  1.00 0.00 ? 230 ASN A O    1  
ATOM 3381  C CB   . ASN A 1 235 ? 43.343   -31.081  -62.465  1.00 0.00 ? 230 ASN A CB   1  
ATOM 3382  C CG   . ASN A 1 235 ? 42.891   -30.014  -61.465  1.00 0.00 ? 230 ASN A CG   1  
ATOM 3383  O OD1  . ASN A 1 235 ? 43.309   -30.019  -60.324  1.00 0.00 ? 230 ASN A OD1  1  
ATOM 3384  N ND2  . ASN A 1 235 ? 42.049   -29.092  -61.845  1.00 0.00 ? 230 ASN A ND2  1  
ATOM 3385  H H    . ASN A 1 235 ? 44.921   -31.958  -64.568  1.00 0.00 ? 230 ASN A H    1  
ATOM 3386  H HA   . ASN A 1 235 ? 42.660   -30.020  -64.208  1.00 0.00 ? 230 ASN A HA   1  
ATOM 3387  H HB2  . ASN A 1 235 ? 42.578   -31.840  -62.553  1.00 0.00 ? 230 ASN A HB2  1  
ATOM 3388  H HB3  . ASN A 1 235 ? 44.259   -31.533  -62.117  1.00 0.00 ? 230 ASN A HB3  1  
ATOM 3389  H HD21 . ASN A 1 235 ? 41.711   -29.086  -62.765  1.00 0.00 ? 230 ASN A HD21 1  
ATOM 3390  H HD22 . ASN A 1 235 ? 41.756   -28.405  -61.211  1.00 0.00 ? 230 ASN A HD22 1  
ATOM 3391  N N    . PRO A 1 236 ? 44.441   -28.255  -64.406  1.00 0.00 ? 231 PRO A N    1  
ATOM 3392  C CA   . PRO A 1 236 ? 45.426   -27.145  -64.385  1.00 0.00 ? 231 PRO A CA   1  
ATOM 3393  C C    . PRO A 1 236 ? 45.415   -26.452  -63.018  1.00 0.00 ? 231 PRO A C    1  
ATOM 3394  O O    . PRO A 1 236 ? 44.907   -25.358  -62.871  1.00 0.00 ? 231 PRO A O    1  
ATOM 3395  C CB   . PRO A 1 236 ? 44.930   -26.203  -65.479  1.00 0.00 ? 231 PRO A CB   1  
ATOM 3396  C CG   . PRO A 1 236 ? 43.467   -26.487  -65.601  1.00 0.00 ? 231 PRO A CG   1  
ATOM 3397  C CD   . PRO A 1 236 ? 43.266   -27.932  -65.228  1.00 0.00 ? 231 PRO A CD   1  
ATOM 3398  H HA   . PRO A 1 236 ? 46.413   -27.505  -64.624  1.00 0.00 ? 231 PRO A HA   1  
ATOM 3399  H HB2  . PRO A 1 236 ? 45.094   -25.173  -65.189  1.00 0.00 ? 231 PRO A HB2  1  
ATOM 3400  H HB3  . PRO A 1 236 ? 45.427   -26.415  -66.412  1.00 0.00 ? 231 PRO A HB3  1  
ATOM 3401  H HG2  . PRO A 1 236 ? 42.911   -25.848  -64.929  1.00 0.00 ? 231 PRO A HG2  1  
ATOM 3402  H HG3  . PRO A 1 236 ? 43.143   -26.325  -66.617  1.00 0.00 ? 231 PRO A HG3  1  
ATOM 3403  H HD2  . PRO A 1 236 ? 42.355   -28.052  -64.657  1.00 0.00 ? 231 PRO A HD2  1  
ATOM 3404  H HD3  . PRO A 1 236 ? 43.248   -28.553  -66.110  1.00 0.00 ? 231 PRO A HD3  1  
ATOM 3405  N N    . LEU A 1 237 ? 45.973   -27.085  -62.019  1.00 0.00 ? 232 LEU A N    1  
ATOM 3406  C CA   . LEU A 1 237 ? 46.004   -26.477  -60.654  1.00 0.00 ? 232 LEU A CA   1  
ATOM 3407  C C    . LEU A 1 237 ? 46.727   -27.418  -59.687  1.00 0.00 ? 232 LEU A C    1  
ATOM 3408  O O    . LEU A 1 237 ? 47.422   -26.987  -58.788  1.00 0.00 ? 232 LEU A O    1  
ATOM 3409  C CB   . LEU A 1 237 ? 44.535   -26.314  -60.244  1.00 0.00 ? 232 LEU A CB   1  
ATOM 3410  C CG   . LEU A 1 237 ? 44.295   -24.886  -59.742  1.00 0.00 ? 232 LEU A CG   1  
ATOM 3411  C CD1  . LEU A 1 237 ? 43.619   -24.062  -60.840  1.00 0.00 ? 232 LEU A CD1  1  
ATOM 3412  C CD2  . LEU A 1 237 ? 43.390   -24.925  -58.508  1.00 0.00 ? 232 LEU A CD2  1  
ATOM 3413  H H    . LEU A 1 237 ? 46.376   -27.965  -62.165  1.00 0.00 ? 232 LEU A H    1  
ATOM 3414  H HA   . LEU A 1 237 ? 46.491   -25.516  -60.680  1.00 0.00 ? 232 LEU A HA   1  
ATOM 3415  H HB2  . LEU A 1 237 ? 43.898   -26.510  -61.094  1.00 0.00 ? 232 LEU A HB2  1  
ATOM 3416  H HB3  . LEU A 1 237 ? 44.302   -27.014  -59.454  1.00 0.00 ? 232 LEU A HB3  1  
ATOM 3417  H HG   . LEU A 1 237 ? 45.241   -24.433  -59.482  1.00 0.00 ? 232 LEU A HG   1  
ATOM 3418  H HD11 . LEU A 1 237 ? 42.979   -24.702  -61.429  1.00 0.00 ? 232 LEU A HD11 1  
ATOM 3419  H HD12 . LEU A 1 237 ? 44.374   -23.624  -61.477  1.00 0.00 ? 232 LEU A HD12 1  
ATOM 3420  H HD13 . LEU A 1 237 ? 43.029   -23.278  -60.390  1.00 0.00 ? 232 LEU A HD13 1  
ATOM 3421  H HD21 . LEU A 1 237 ? 43.580   -25.830  -57.951  1.00 0.00 ? 232 LEU A HD21 1  
ATOM 3422  H HD22 . LEU A 1 237 ? 42.356   -24.904  -58.820  1.00 0.00 ? 232 LEU A HD22 1  
ATOM 3423  H HD23 . LEU A 1 237 ? 43.595   -24.068  -57.884  1.00 0.00 ? 232 LEU A HD23 1  
ATOM 3424  N N    . GLU A 1 238 ? 46.565   -28.702  -59.868  1.00 0.00 ? 233 GLU A N    1  
ATOM 3425  C CA   . GLU A 1 238 ? 47.239   -29.679  -58.965  1.00 0.00 ? 233 GLU A CA   1  
ATOM 3426  C C    . GLU A 1 238 ? 48.705   -29.855  -59.370  1.00 0.00 ? 233 GLU A C    1  
ATOM 3427  O O    . GLU A 1 238 ? 49.584   -29.924  -58.533  1.00 0.00 ? 233 GLU A O    1  
ATOM 3428  C CB   . GLU A 1 238 ? 46.470   -30.988  -59.153  1.00 0.00 ? 233 GLU A CB   1  
ATOM 3429  C CG   . GLU A 1 238 ? 46.955   -32.018  -58.131  1.00 0.00 ? 233 GLU A CG   1  
ATOM 3430  C CD   . GLU A 1 238 ? 48.148   -32.783  -58.705  1.00 0.00 ? 233 GLU A CD   1  
ATOM 3431  O OE1  . GLU A 1 238 ? 48.026   -33.292  -59.807  1.00 0.00 ? 233 GLU A OE1  1  
ATOM 3432  O OE2  . GLU A 1 238 ? 49.164   -32.848  -58.032  1.00 0.00 ? 233 GLU A OE2  1  
ATOM 3433  H H    . GLU A 1 238 ? 45.999   -29.025  -60.600  1.00 0.00 ? 233 GLU A H    1  
ATOM 3434  H HA   . GLU A 1 238 ? 47.167   -29.355  -57.939  1.00 0.00 ? 233 GLU A HA   1  
ATOM 3435  H HB2  . GLU A 1 238 ? 45.414   -30.808  -59.011  1.00 0.00 ? 233 GLU A HB2  1  
ATOM 3436  H HB3  . GLU A 1 238 ? 46.640   -31.365  -60.150  1.00 0.00 ? 233 GLU A HB3  1  
ATOM 3437  H HG2  . GLU A 1 238 ? 47.252   -31.511  -57.224  1.00 0.00 ? 233 GLU A HG2  1  
ATOM 3438  H HG3  . GLU A 1 238 ? 46.157   -32.711  -57.912  1.00 0.00 ? 233 GLU A HG3  1  
ATOM 3439  N N    . PHE A 1 239 ? 48.978   -29.929  -60.648  1.00 0.00 ? 234 PHE A N    1  
ATOM 3440  C CA   . PHE A 1 239 ? 50.392   -30.102  -61.099  1.00 0.00 ? 234 PHE A CA   1  
ATOM 3441  C C    . PHE A 1 239 ? 51.246   -28.928  -60.604  1.00 0.00 ? 234 PHE A C    1  
ATOM 3442  O O    . PHE A 1 239 ? 52.384   -29.099  -60.211  1.00 0.00 ? 234 PHE A O    1  
ATOM 3443  C CB   . PHE A 1 239 ? 50.328   -30.140  -62.634  1.00 0.00 ? 234 PHE A CB   1  
ATOM 3444  C CG   . PHE A 1 239 ? 50.171   -28.742  -63.189  1.00 0.00 ? 234 PHE A CG   1  
ATOM 3445  C CD1  . PHE A 1 239 ? 48.908   -28.141  -63.231  1.00 0.00 ? 234 PHE A CD1  1  
ATOM 3446  C CD2  . PHE A 1 239 ? 51.292   -28.048  -63.660  1.00 0.00 ? 234 PHE A CD2  1  
ATOM 3447  C CE1  . PHE A 1 239 ? 48.766   -26.845  -63.744  1.00 0.00 ? 234 PHE A CE1  1  
ATOM 3448  C CE2  . PHE A 1 239 ? 51.150   -26.753  -64.173  1.00 0.00 ? 234 PHE A CE2  1  
ATOM 3449  C CZ   . PHE A 1 239 ? 49.887   -26.152  -64.215  1.00 0.00 ? 234 PHE A CZ   1  
ATOM 3450  H H    . PHE A 1 239 ? 48.256   -29.873  -61.307  1.00 0.00 ? 234 PHE A H    1  
ATOM 3451  H HA   . PHE A 1 239 ? 50.789   -31.033  -60.726  1.00 0.00 ? 234 PHE A HA   1  
ATOM 3452  H HB2  . PHE A 1 239 ? 51.239   -30.576  -63.017  1.00 0.00 ? 234 PHE A HB2  1  
ATOM 3453  H HB3  . PHE A 1 239 ? 49.487   -30.743  -62.941  1.00 0.00 ? 234 PHE A HB3  1  
ATOM 3454  H HD1  . PHE A 1 239 ? 48.044   -28.676  -62.869  1.00 0.00 ? 234 PHE A HD1  1  
ATOM 3455  H HD2  . PHE A 1 239 ? 52.267   -28.511  -63.628  1.00 0.00 ? 234 PHE A HD2  1  
ATOM 3456  H HE1  . PHE A 1 239 ? 47.791   -26.381  -63.776  1.00 0.00 ? 234 PHE A HE1  1  
ATOM 3457  H HE2  . PHE A 1 239 ? 52.015   -26.218  -64.537  1.00 0.00 ? 234 PHE A HE2  1  
ATOM 3458  H HZ   . PHE A 1 239 ? 49.777   -25.153  -64.611  1.00 0.00 ? 234 PHE A HZ   1  
ATOM 3459  N N    . LEU A 1 240 ? 50.700   -27.741  -60.614  1.00 0.00 ? 235 LEU A N    1  
ATOM 3460  C CA   . LEU A 1 240 ? 51.470   -26.557  -60.138  1.00 0.00 ? 235 LEU A CA   1  
ATOM 3461  C C    . LEU A 1 240 ? 51.579   -26.593  -58.613  1.00 0.00 ? 235 LEU A C    1  
ATOM 3462  O O    . LEU A 1 240 ? 52.625   -26.341  -58.049  1.00 0.00 ? 235 LEU A O    1  
ATOM 3463  C CB   . LEU A 1 240 ? 50.657   -25.341  -60.588  1.00 0.00 ? 235 LEU A CB   1  
ATOM 3464  C CG   . LEU A 1 240 ? 51.501   -24.070  -60.427  1.00 0.00 ? 235 LEU A CG   1  
ATOM 3465  C CD1  . LEU A 1 240 ? 51.866   -23.519  -61.808  1.00 0.00 ? 235 LEU A CD1  1  
ATOM 3466  C CD2  . LEU A 1 240 ? 50.703   -23.013  -59.650  1.00 0.00 ? 235 LEU A CD2  1  
ATOM 3467  H H    . LEU A 1 240 ? 49.779   -27.631  -60.930  1.00 0.00 ? 235 LEU A H    1  
ATOM 3468  H HA   . LEU A 1 240 ? 52.450   -26.536  -60.588  1.00 0.00 ? 235 LEU A HA   1  
ATOM 3469  H HB2  . LEU A 1 240 ? 50.377   -25.461  -61.625  1.00 0.00 ? 235 LEU A HB2  1  
ATOM 3470  H HB3  . LEU A 1 240 ? 49.767   -25.261  -59.983  1.00 0.00 ? 235 LEU A HB3  1  
ATOM 3471  H HG   . LEU A 1 240 ? 52.406   -24.306  -59.886  1.00 0.00 ? 235 LEU A HG   1  
ATOM 3472  H HD11 . LEU A 1 240 ? 52.845   -23.878  -62.091  1.00 0.00 ? 235 LEU A HD11 1  
ATOM 3473  H HD12 . LEU A 1 240 ? 51.875   -22.439  -61.774  1.00 0.00 ? 235 LEU A HD12 1  
ATOM 3474  H HD13 . LEU A 1 240 ? 51.138   -23.851  -62.533  1.00 0.00 ? 235 LEU A HD13 1  
ATOM 3475  H HD21 . LEU A 1 240 ? 49.721   -23.397  -59.419  1.00 0.00 ? 235 LEU A HD21 1  
ATOM 3476  H HD22 . LEU A 1 240 ? 50.607   -22.119  -60.249  1.00 0.00 ? 235 LEU A HD22 1  
ATOM 3477  H HD23 . LEU A 1 240 ? 51.221   -22.775  -58.733  1.00 0.00 ? 235 LEU A HD23 1  
ATOM 3478  N N    . ARG A 1 241 ? 50.501   -26.912  -57.945  1.00 0.00 ? 236 ARG A N    1  
ATOM 3479  C CA   . ARG A 1 241 ? 50.532   -26.972  -56.452  1.00 0.00 ? 236 ARG A CA   1  
ATOM 3480  C C    . ARG A 1 241 ? 51.666   -27.888  -55.980  1.00 0.00 ? 236 ARG A C    1  
ATOM 3481  O O    . ARG A 1 241 ? 52.170   -27.752  -54.882  1.00 0.00 ? 236 ARG A O    1  
ATOM 3482  C CB   . ARG A 1 241 ? 49.173   -27.548  -56.048  1.00 0.00 ? 236 ARG A CB   1  
ATOM 3483  C CG   . ARG A 1 241 ? 48.610   -26.753  -54.868  1.00 0.00 ? 236 ARG A CG   1  
ATOM 3484  C CD   . ARG A 1 241 ? 47.745   -27.670  -54.001  1.00 0.00 ? 236 ARG A CD   1  
ATOM 3485  N NE   . ARG A 1 241 ? 48.708   -28.585  -53.329  1.00 0.00 ? 236 ARG A NE   1  
ATOM 3486  C CZ   . ARG A 1 241 ? 48.389   -29.154  -52.199  1.00 0.00 ? 236 ARG A CZ   1  
ATOM 3487  N NH1  . ARG A 1 241 ? 47.345   -29.935  -52.133  1.00 0.00 ? 236 ARG A NH1  1  
ATOM 3488  N NH2  . ARG A 1 241 ? 49.114   -28.942  -51.134  1.00 0.00 ? 236 ARG A NH2  1  
ATOM 3489  H H    . ARG A 1 241 ? 49.671   -27.115  -58.426  1.00 0.00 ? 236 ARG A H    1  
ATOM 3490  H HA   . ARG A 1 241 ? 50.651   -25.983  -56.039  1.00 0.00 ? 236 ARG A HA   1  
ATOM 3491  H HB2  . ARG A 1 241 ? 48.492   -27.483  -56.884  1.00 0.00 ? 236 ARG A HB2  1  
ATOM 3492  H HB3  . ARG A 1 241 ? 49.291   -28.582  -55.759  1.00 0.00 ? 236 ARG A HB3  1  
ATOM 3493  H HG2  . ARG A 1 241 ? 49.425   -26.361  -54.277  1.00 0.00 ? 236 ARG A HG2  1  
ATOM 3494  H HG3  . ARG A 1 241 ? 48.008   -25.937  -55.238  1.00 0.00 ? 236 ARG A HG3  1  
ATOM 3495  H HD2  . ARG A 1 241 ? 47.200   -27.089  -53.269  1.00 0.00 ? 236 ARG A HD2  1  
ATOM 3496  H HD3  . ARG A 1 241 ? 47.064   -28.237  -54.616  1.00 0.00 ? 236 ARG A HD3  1  
ATOM 3497  H HE   . ARG A 1 241 ? 49.583   -28.760  -53.736  1.00 0.00 ? 236 ARG A HE   1  
ATOM 3498  H HH11 . ARG A 1 241 ? 46.790   -30.097  -52.949  1.00 0.00 ? 236 ARG A HH11 1  
ATOM 3499  H HH12 . ARG A 1 241 ? 47.101   -30.371  -51.267  1.00 0.00 ? 236 ARG A HH12 1  
ATOM 3500  H HH21 . ARG A 1 241 ? 49.914   -28.344  -51.184  1.00 0.00 ? 236 ARG A HH21 1  
ATOM 3501  H HH22 . ARG A 1 241 ? 48.869   -29.378  -50.268  1.00 0.00 ? 236 ARG A HH22 1  
ATOM 3502  N N    . ASP A 1 242 ? 52.071   -28.818  -56.804  1.00 0.00 ? 237 ASP A N    1  
ATOM 3503  C CA   . ASP A 1 242 ? 53.173   -29.742  -56.407  1.00 0.00 ? 237 ASP A CA   1  
ATOM 3504  C C    . ASP A 1 242 ? 54.476   -29.353  -57.115  1.00 0.00 ? 237 ASP A C    1  
ATOM 3505  O O    . ASP A 1 242 ? 55.551   -29.759  -56.718  1.00 0.00 ? 237 ASP A O    1  
ATOM 3506  C CB   . ASP A 1 242 ? 52.709   -31.128  -56.860  1.00 0.00 ? 237 ASP A CB   1  
ATOM 3507  C CG   . ASP A 1 242 ? 53.123   -32.170  -55.819  1.00 0.00 ? 237 ASP A CG   1  
ATOM 3508  O OD1  . ASP A 1 242 ? 54.310   -32.278  -55.557  1.00 0.00 ? 237 ASP A OD1  1  
ATOM 3509  O OD2  . ASP A 1 242 ? 52.247   -32.843  -55.302  1.00 0.00 ? 237 ASP A OD2  1  
ATOM 3510  H H    . ASP A 1 242 ? 51.651   -28.909  -57.684  1.00 0.00 ? 237 ASP A H    1  
ATOM 3511  H HA   . ASP A 1 242 ? 53.307   -29.731  -55.337  1.00 0.00 ? 237 ASP A HA   1  
ATOM 3512  H HB2  . ASP A 1 242 ? 51.634   -31.130  -56.965  1.00 0.00 ? 237 ASP A HB2  1  
ATOM 3513  H HB3  . ASP A 1 242 ? 53.165   -31.368  -57.808  1.00 0.00 ? 237 ASP A HB3  1  
ATOM 3514  N N    . GLN A 1 243 ? 54.389   -28.572  -58.161  1.00 0.00 ? 238 GLN A N    1  
ATOM 3515  C CA   . GLN A 1 243 ? 55.625   -28.160  -58.892  1.00 0.00 ? 238 GLN A CA   1  
ATOM 3516  C C    . GLN A 1 243 ? 56.309   -26.995  -58.165  1.00 0.00 ? 238 GLN A C    1  
ATOM 3517  O O    . GLN A 1 243 ? 55.781   -26.471  -57.203  1.00 0.00 ? 238 GLN A O    1  
ATOM 3518  C CB   . GLN A 1 243 ? 55.139   -27.720  -60.275  1.00 0.00 ? 238 GLN A CB   1  
ATOM 3519  C CG   . GLN A 1 243 ? 55.569   -28.749  -61.323  1.00 0.00 ? 238 GLN A CG   1  
ATOM 3520  C CD   . GLN A 1 243 ? 55.908   -28.035  -62.634  1.00 0.00 ? 238 GLN A CD   1  
ATOM 3521  O OE1  . GLN A 1 243 ? 56.301   -26.886  -62.628  1.00 0.00 ? 238 GLN A OE1  1  
ATOM 3522  N NE2  . GLN A 1 243 ? 55.771   -28.672  -63.764  1.00 0.00 ? 238 GLN A NE2  1  
ATOM 3523  H H    . GLN A 1 243 ? 53.513   -28.257  -58.466  1.00 0.00 ? 238 GLN A H    1  
ATOM 3524  H HA   . GLN A 1 243 ? 56.302   -28.994  -58.986  1.00 0.00 ? 238 GLN A HA   1  
ATOM 3525  H HB2  . GLN A 1 243 ? 54.062   -27.639  -60.270  1.00 0.00 ? 238 GLN A HB2  1  
ATOM 3526  H HB3  . GLN A 1 243 ? 55.570   -26.760  -60.519  1.00 0.00 ? 238 GLN A HB3  1  
ATOM 3527  H HG2  . GLN A 1 243 ? 56.439   -29.283  -60.968  1.00 0.00 ? 238 GLN A HG2  1  
ATOM 3528  H HG3  . GLN A 1 243 ? 54.763   -29.447  -61.494  1.00 0.00 ? 238 GLN A HG3  1  
ATOM 3529  H HE21 . GLN A 1 243 ? 55.453   -29.599  -63.769  1.00 0.00 ? 238 GLN A HE21 1  
ATOM 3530  H HE22 . GLN A 1 243 ? 55.985   -28.223  -64.609  1.00 0.00 ? 238 GLN A HE22 1  
ATOM 3531  N N    . PRO A 1 244 ? 57.467   -26.624  -58.652  1.00 0.00 ? 239 PRO A N    1  
ATOM 3532  C CA   . PRO A 1 244 ? 58.227   -25.507  -58.034  1.00 0.00 ? 239 PRO A CA   1  
ATOM 3533  C C    . PRO A 1 244 ? 57.528   -24.170  -58.297  1.00 0.00 ? 239 PRO A C    1  
ATOM 3534  O O    . PRO A 1 244 ? 57.768   -23.192  -57.616  1.00 0.00 ? 239 PRO A O    1  
ATOM 3535  C CB   . PRO A 1 244 ? 59.584   -25.566  -58.731  1.00 0.00 ? 239 PRO A CB   1  
ATOM 3536  C CG   . PRO A 1 244 ? 59.317   -26.241  -60.037  1.00 0.00 ? 239 PRO A CG   1  
ATOM 3537  C CD   . PRO A 1 244 ? 58.173   -27.194  -59.808  1.00 0.00 ? 239 PRO A CD   1  
ATOM 3538  H HA   . PRO A 1 244 ? 58.348   -25.671  -56.975  1.00 0.00 ? 239 PRO A HA   1  
ATOM 3539  H HB2  . PRO A 1 244 ? 59.966   -24.567  -58.891  1.00 0.00 ? 239 PRO A HB2  1  
ATOM 3540  H HB3  . PRO A 1 244 ? 60.281   -26.148  -58.149  1.00 0.00 ? 239 PRO A HB3  1  
ATOM 3541  H HG2  . PRO A 1 244 ? 59.047   -25.507  -60.783  1.00 0.00 ? 239 PRO A HG2  1  
ATOM 3542  H HG3  . PRO A 1 244 ? 60.189   -26.790  -60.355  1.00 0.00 ? 239 PRO A HG3  1  
ATOM 3543  H HD2  . PRO A 1 244 ? 57.528   -27.224  -60.675  1.00 0.00 ? 239 PRO A HD2  1  
ATOM 3544  H HD3  . PRO A 1 244 ? 58.541   -28.180  -59.570  1.00 0.00 ? 239 PRO A HD3  1  
ATOM 3545  N N    . GLN A 1 245 ? 56.662   -24.119  -59.276  1.00 0.00 ? 240 GLN A N    1  
ATOM 3546  C CA   . GLN A 1 245 ? 55.946   -22.843  -59.573  1.00 0.00 ? 240 GLN A CA   1  
ATOM 3547  C C    . GLN A 1 245 ? 55.116   -22.417  -58.359  1.00 0.00 ? 240 GLN A C    1  
ATOM 3548  O O    . GLN A 1 245 ? 55.296   -21.343  -57.818  1.00 0.00 ? 240 GLN A O    1  
ATOM 3549  C CB   . GLN A 1 245 ? 55.034   -23.162  -60.761  1.00 0.00 ? 240 GLN A CB   1  
ATOM 3550  C CG   . GLN A 1 245 ? 55.633   -22.581  -62.047  1.00 0.00 ? 240 GLN A CG   1  
ATOM 3551  C CD   . GLN A 1 245 ? 54.647   -21.590  -62.672  1.00 0.00 ? 240 GLN A CD   1  
ATOM 3552  O OE1  . GLN A 1 245 ? 54.283   -20.608  -62.057  1.00 0.00 ? 240 GLN A OE1  1  
ATOM 3553  N NE2  . GLN A 1 245 ? 54.197   -21.809  -63.877  1.00 0.00 ? 240 GLN A NE2  1  
ATOM 3554  H H    . GLN A 1 245 ? 56.480   -24.919  -59.811  1.00 0.00 ? 240 GLN A H    1  
ATOM 3555  H HA   . GLN A 1 245 ? 56.649   -22.069  -59.841  1.00 0.00 ? 240 GLN A HA   1  
ATOM 3556  H HB2  . GLN A 1 245 ? 54.937   -24.233  -60.862  1.00 0.00 ? 240 GLN A HB2  1  
ATOM 3557  H HB3  . GLN A 1 245 ? 54.059   -22.728  -60.591  1.00 0.00 ? 240 GLN A HB3  1  
ATOM 3558  H HG2  . GLN A 1 245 ? 56.558   -22.072  -61.818  1.00 0.00 ? 240 GLN A HG2  1  
ATOM 3559  H HG3  . GLN A 1 245 ? 55.826   -23.380  -62.746  1.00 0.00 ? 240 GLN A HG3  1  
ATOM 3560  H HE21 . GLN A 1 245 ? 54.490   -22.602  -64.372  1.00 0.00 ? 240 GLN A HE21 1  
ATOM 3561  H HE22 . GLN A 1 245 ? 53.566   -21.180  -64.286  1.00 0.00 ? 240 GLN A HE22 1  
ATOM 3562  N N    . PHE A 1 246 ? 54.211   -23.254  -57.927  1.00 0.00 ? 241 PHE A N    1  
ATOM 3563  C CA   . PHE A 1 246 ? 53.372   -22.902  -56.746  1.00 0.00 ? 241 PHE A CA   1  
ATOM 3564  C C    . PHE A 1 246 ? 54.234   -22.862  -55.483  1.00 0.00 ? 241 PHE A C    1  
ATOM 3565  O O    . PHE A 1 246 ? 54.069   -22.005  -54.637  1.00 0.00 ? 241 PHE A O    1  
ATOM 3566  C CB   . PHE A 1 246 ? 52.327   -24.014  -56.647  1.00 0.00 ? 241 PHE A CB   1  
ATOM 3567  C CG   . PHE A 1 246 ? 51.172   -23.543  -55.798  1.00 0.00 ? 241 PHE A CG   1  
ATOM 3568  C CD1  . PHE A 1 246 ? 51.368   -23.263  -54.440  1.00 0.00 ? 241 PHE A CD1  1  
ATOM 3569  C CD2  . PHE A 1 246 ? 49.904   -23.385  -56.369  1.00 0.00 ? 241 PHE A CD2  1  
ATOM 3570  C CE1  . PHE A 1 246 ? 50.296   -22.825  -53.654  1.00 0.00 ? 241 PHE A CE1  1  
ATOM 3571  C CE2  . PHE A 1 246 ? 48.832   -22.947  -55.582  1.00 0.00 ? 241 PHE A CE2  1  
ATOM 3572  C CZ   . PHE A 1 246 ? 49.028   -22.667  -54.225  1.00 0.00 ? 241 PHE A CZ   1  
ATOM 3573  H H    . PHE A 1 246 ? 54.087   -24.116  -58.378  1.00 0.00 ? 241 PHE A H    1  
ATOM 3574  H HA   . PHE A 1 246 ? 52.885   -21.952  -56.900  1.00 0.00 ? 241 PHE A HA   1  
ATOM 3575  H HB2  . PHE A 1 246 ? 51.970   -24.260  -57.637  1.00 0.00 ? 241 PHE A HB2  1  
ATOM 3576  H HB3  . PHE A 1 246 ? 52.773   -24.888  -56.196  1.00 0.00 ? 241 PHE A HB3  1  
ATOM 3577  H HD1  . PHE A 1 246 ? 52.346   -23.385  -53.999  1.00 0.00 ? 241 PHE A HD1  1  
ATOM 3578  H HD2  . PHE A 1 246 ? 49.752   -23.601  -57.416  1.00 0.00 ? 241 PHE A HD2  1  
ATOM 3579  H HE1  . PHE A 1 246 ? 50.448   -22.607  -52.608  1.00 0.00 ? 241 PHE A HE1  1  
ATOM 3580  H HE2  . PHE A 1 246 ? 47.854   -22.825  -56.023  1.00 0.00 ? 241 PHE A HE2  1  
ATOM 3581  H HZ   . PHE A 1 246 ? 48.201   -22.329  -53.618  1.00 0.00 ? 241 PHE A HZ   1  
ATOM 3582  N N    . GLN A 1 247 ? 55.156   -23.781  -55.349  1.00 0.00 ? 242 GLN A N    1  
ATOM 3583  C CA   . GLN A 1 247 ? 56.031   -23.791  -54.138  1.00 0.00 ? 242 GLN A CA   1  
ATOM 3584  C C    . GLN A 1 247 ? 56.692   -22.422  -53.961  1.00 0.00 ? 242 GLN A C    1  
ATOM 3585  O O    . GLN A 1 247 ? 56.852   -21.935  -52.859  1.00 0.00 ? 242 GLN A O    1  
ATOM 3586  C CB   . GLN A 1 247 ? 57.082   -24.867  -54.412  1.00 0.00 ? 242 GLN A CB   1  
ATOM 3587  C CG   . GLN A 1 247 ? 56.671   -26.169  -53.723  1.00 0.00 ? 242 GLN A CG   1  
ATOM 3588  C CD   . GLN A 1 247 ? 55.542   -26.832  -54.515  1.00 0.00 ? 242 GLN A CD   1  
ATOM 3589  O OE1  . GLN A 1 247 ? 55.740   -27.861  -55.129  1.00 0.00 ? 242 GLN A OE1  1  
ATOM 3590  N NE2  . GLN A 1 247 ? 54.357   -26.283  -54.527  1.00 0.00 ? 242 GLN A NE2  1  
ATOM 3591  H H    . GLN A 1 247 ? 55.273   -24.462  -56.045  1.00 0.00 ? 242 GLN A H    1  
ATOM 3592  H HA   . GLN A 1 247 ? 55.458   -24.049  -53.261  1.00 0.00 ? 242 GLN A HA   1  
ATOM 3593  H HB2  . GLN A 1 247 ? 57.160   -25.030  -55.477  1.00 0.00 ? 242 GLN A HB2  1  
ATOM 3594  H HB3  . GLN A 1 247 ? 58.038   -24.544  -54.027  1.00 0.00 ? 242 GLN A HB3  1  
ATOM 3595  H HG2  . GLN A 1 247 ? 57.520   -26.835  -53.677  1.00 0.00 ? 242 GLN A HG2  1  
ATOM 3596  H HG3  . GLN A 1 247 ? 56.327   -25.953  -52.722  1.00 0.00 ? 242 GLN A HG3  1  
ATOM 3597  H HE21 . GLN A 1 247 ? 54.196   -25.454  -54.030  1.00 0.00 ? 242 GLN A HE21 1  
ATOM 3598  H HE22 . GLN A 1 247 ? 53.629   -26.700  -55.034  1.00 0.00 ? 242 GLN A HE22 1  
ATOM 3599  N N    . ASN A 1 248 ? 57.062   -21.794  -55.044  1.00 0.00 ? 243 ASN A N    1  
ATOM 3600  C CA   . ASN A 1 248 ? 57.698   -20.448  -54.949  1.00 0.00 ? 243 ASN A CA   1  
ATOM 3601  C C    . ASN A 1 248 ? 56.628   -19.394  -54.648  1.00 0.00 ? 243 ASN A C    1  
ATOM 3602  O O    . ASN A 1 248 ? 56.907   -18.356  -54.092  1.00 0.00 ? 243 ASN A O    1  
ATOM 3603  C CB   . ASN A 1 248 ? 58.323   -20.204  -56.323  1.00 0.00 ? 243 ASN A CB   1  
ATOM 3604  C CG   . ASN A 1 248 ? 59.668   -19.494  -56.155  1.00 0.00 ? 243 ASN A CG   1  
ATOM 3605  O OD1  . ASN A 1 248 ? 59.717   -18.347  -55.755  1.00 0.00 ? 243 ASN A OD1  1  
ATOM 3606  N ND2  . ASN A 1 248 ? 60.768   -20.131  -56.445  1.00 0.00 ? 243 ASN A ND2  1  
ATOM 3607  H H    . ASN A 1 248 ? 56.911   -22.203  -55.921  1.00 0.00 ? 243 ASN A H    1  
ATOM 3608  H HA   . ASN A 1 248 ? 58.461   -20.442  -54.187  1.00 0.00 ? 243 ASN A HA   1  
ATOM 3609  H HB2  . ASN A 1 248 ? 58.476   -21.150  -56.822  1.00 0.00 ? 243 ASN A HB2  1  
ATOM 3610  H HB3  . ASN A 1 248 ? 57.664   -19.587  -56.915  1.00 0.00 ? 243 ASN A HB3  1  
ATOM 3611  H HD21 . ASN A 1 248 ? 60.728   -21.056  -56.769  1.00 0.00 ? 243 ASN A HD21 1  
ATOM 3612  H HD22 . ASN A 1 248 ? 61.635   -19.686  -56.340  1.00 0.00 ? 243 ASN A HD22 1  
ATOM 3613  N N    . MET A 1 249 ? 55.403   -19.668  -55.010  1.00 0.00 ? 244 MET A N    1  
ATOM 3614  C CA   . MET A 1 249 ? 54.294   -18.705  -54.750  1.00 0.00 ? 244 MET A CA   1  
ATOM 3615  C C    . MET A 1 249 ? 53.687   -18.971  -53.370  1.00 0.00 ? 244 MET A C    1  
ATOM 3616  O O    . MET A 1 249 ? 53.047   -18.120  -52.786  1.00 0.00 ? 244 MET A O    1  
ATOM 3617  C CB   . MET A 1 249 ? 53.270   -18.991  -55.852  1.00 0.00 ? 244 MET A CB   1  
ATOM 3618  C CG   . MET A 1 249 ? 52.985   -17.709  -56.628  1.00 0.00 ? 244 MET A CG   1  
ATOM 3619  S SD   . MET A 1 249 ? 51.358   -17.824  -57.412  1.00 0.00 ? 244 MET A SD   1  
ATOM 3620  C CE   . MET A 1 249 ? 51.907   -17.542  -59.113  1.00 0.00 ? 244 MET A CE   1  
ATOM 3621  H H    . MET A 1 249 ? 55.209   -20.514  -55.449  1.00 0.00 ? 244 MET A H    1  
ATOM 3622  H HA   . MET A 1 249 ? 54.644   -17.686  -54.821  1.00 0.00 ? 244 MET A HA   1  
ATOM 3623  H HB2  . MET A 1 249 ? 53.665   -19.737  -56.526  1.00 0.00 ? 244 MET A HB2  1  
ATOM 3624  H HB3  . MET A 1 249 ? 52.354   -19.353  -55.411  1.00 0.00 ? 244 MET A HB3  1  
ATOM 3625  H HG2  . MET A 1 249 ? 53.001   -16.869  -55.950  1.00 0.00 ? 244 MET A HG2  1  
ATOM 3626  H HG3  . MET A 1 249 ? 53.742   -17.576  -57.385  1.00 0.00 ? 244 MET A HG3  1  
ATOM 3627  H HE1  . MET A 1 249 ? 51.069   -17.206  -59.709  1.00 0.00 ? 244 MET A HE1  1  
ATOM 3628  H HE2  . MET A 1 249 ? 52.294   -18.460  -59.525  1.00 0.00 ? 244 MET A HE2  1  
ATOM 3629  H HE3  . MET A 1 249 ? 52.684   -16.790  -59.119  1.00 0.00 ? 244 MET A HE3  1  
ATOM 3630  N N    . ARG A 1 250 ? 53.896   -20.146  -52.844  1.00 0.00 ? 245 ARG A N    1  
ATOM 3631  C CA   . ARG A 1 250 ? 53.350   -20.477  -51.498  1.00 0.00 ? 245 ARG A CA   1  
ATOM 3632  C C    . ARG A 1 250 ? 54.428   -20.241  -50.437  1.00 0.00 ? 245 ARG A C    1  
ATOM 3633  O O    . ARG A 1 250 ? 54.143   -20.119  -49.262  1.00 0.00 ? 245 ARG A O    1  
ATOM 3634  C CB   . ARG A 1 250 ? 52.982   -21.959  -51.571  1.00 0.00 ? 245 ARG A CB   1  
ATOM 3635  C CG   . ARG A 1 250 ? 52.195   -22.353  -50.320  1.00 0.00 ? 245 ARG A CG   1  
ATOM 3636  C CD   . ARG A 1 250 ? 51.854   -23.845  -50.376  1.00 0.00 ? 245 ARG A CD   1  
ATOM 3637  N NE   . ARG A 1 250 ? 52.749   -24.485  -49.370  1.00 0.00 ? 245 ARG A NE   1  
ATOM 3638  C CZ   . ARG A 1 250 ? 52.911   -25.780  -49.373  1.00 0.00 ? 245 ARG A CZ   1  
ATOM 3639  N NH1  . ARG A 1 250 ? 53.237   -26.394  -50.478  1.00 0.00 ? 245 ARG A NH1  1  
ATOM 3640  N NH2  . ARG A 1 250 ? 52.749   -26.460  -48.272  1.00 0.00 ? 245 ARG A NH2  1  
ATOM 3641  H H    . ARG A 1 250 ? 54.422   -20.809  -53.332  1.00 0.00 ? 245 ARG A H    1  
ATOM 3642  H HA   . ARG A 1 250 ? 52.473   -19.886  -51.288  1.00 0.00 ? 245 ARG A HA   1  
ATOM 3643  H HB2  . ARG A 1 250 ? 52.378   -22.137  -52.449  1.00 0.00 ? 245 ARG A HB2  1  
ATOM 3644  H HB3  . ARG A 1 250 ? 53.883   -22.552  -51.628  1.00 0.00 ? 245 ARG A HB3  1  
ATOM 3645  H HG2  . ARG A 1 250 ? 52.791   -22.151  -49.442  1.00 0.00 ? 245 ARG A HG2  1  
ATOM 3646  H HG3  . ARG A 1 250 ? 51.281   -21.780  -50.275  1.00 0.00 ? 245 ARG A HG3  1  
ATOM 3647  H HD2  . ARG A 1 250 ? 50.817   -24.002  -50.113  1.00 0.00 ? 245 ARG A HD2  1  
ATOM 3648  H HD3  . ARG A 1 250 ? 52.058   -24.243  -51.358  1.00 0.00 ? 245 ARG A HD3  1  
ATOM 3649  H HE   . ARG A 1 250 ? 53.214   -23.935  -48.707  1.00 0.00 ? 245 ARG A HE   1  
ATOM 3650  H HH11 . ARG A 1 250 ? 53.362   -25.872  -51.322  1.00 0.00 ? 245 ARG A HH11 1  
ATOM 3651  H HH12 . ARG A 1 250 ? 53.362   -27.386  -50.480  1.00 0.00 ? 245 ARG A HH12 1  
ATOM 3652  H HH21 . ARG A 1 250 ? 52.499   -25.990  -47.426  1.00 0.00 ? 245 ARG A HH21 1  
ATOM 3653  H HH22 . ARG A 1 250 ? 52.873   -27.453  -48.274  1.00 0.00 ? 245 ARG A HH22 1  
ATOM 3654  N N    . GLN A 1 251 ? 55.665   -20.166  -50.852  1.00 0.00 ? 246 GLN A N    1  
ATOM 3655  C CA   . GLN A 1 251 ? 56.770   -19.926  -49.886  1.00 0.00 ? 246 GLN A CA   1  
ATOM 3656  C C    . GLN A 1 251 ? 57.051   -18.428  -49.801  1.00 0.00 ? 246 GLN A C    1  
ATOM 3657  O O    . GLN A 1 251 ? 57.291   -17.894  -48.735  1.00 0.00 ? 246 GLN A O    1  
ATOM 3658  C CB   . GLN A 1 251 ? 57.975   -20.671  -50.461  1.00 0.00 ? 246 GLN A CB   1  
ATOM 3659  C CG   . GLN A 1 251 ? 59.150   -20.571  -49.485  1.00 0.00 ? 246 GLN A CG   1  
ATOM 3660  C CD   . GLN A 1 251 ? 58.806   -21.315  -48.193  1.00 0.00 ? 246 GLN A CD   1  
ATOM 3661  O OE1  . GLN A 1 251 ? 58.203   -22.369  -48.228  1.00 0.00 ? 246 GLN A OE1  1  
ATOM 3662  N NE2  . GLN A 1 251 ? 59.168   -20.808  -47.046  1.00 0.00 ? 246 GLN A NE2  1  
ATOM 3663  H H    . GLN A 1 251 ? 55.866   -20.258  -51.803  1.00 0.00 ? 246 GLN A H    1  
ATOM 3664  H HA   . GLN A 1 251 ? 56.517   -20.322  -48.915  1.00 0.00 ? 246 GLN A HA   1  
ATOM 3665  H HB2  . GLN A 1 251 ? 57.718   -21.709  -50.612  1.00 0.00 ? 246 GLN A HB2  1  
ATOM 3666  H HB3  . GLN A 1 251 ? 58.255   -20.228  -51.405  1.00 0.00 ? 246 GLN A HB3  1  
ATOM 3667  H HG2  . GLN A 1 251 ? 60.028   -21.013  -49.934  1.00 0.00 ? 246 GLN A HG2  1  
ATOM 3668  H HG3  . GLN A 1 251 ? 59.343   -19.533  -49.260  1.00 0.00 ? 246 GLN A HG3  1  
ATOM 3669  H HE21 . GLN A 1 251 ? 59.655   -19.958  -47.018  1.00 0.00 ? 246 GLN A HE21 1  
ATOM 3670  H HE22 . GLN A 1 251 ? 58.952   -21.277  -46.213  1.00 0.00 ? 246 GLN A HE22 1  
ATOM 3671  N N    . VAL A 1 252 ? 57.010   -17.738  -50.914  1.00 0.00 ? 247 VAL A N    1  
ATOM 3672  C CA   . VAL A 1 252 ? 57.264   -16.267  -50.870  1.00 0.00 ? 247 VAL A CA   1  
ATOM 3673  C C    . VAL A 1 252 ? 56.053   -15.565  -50.251  1.00 0.00 ? 247 VAL A C    1  
ATOM 3674  O O    . VAL A 1 252 ? 56.178   -14.540  -49.609  1.00 0.00 ? 247 VAL A O    1  
ATOM 3675  C CB   . VAL A 1 252 ? 57.471   -15.821  -52.323  1.00 0.00 ? 247 VAL A CB   1  
ATOM 3676  C CG1  . VAL A 1 252 ? 58.618   -16.616  -52.951  1.00 0.00 ? 247 VAL A CG1  1  
ATOM 3677  C CG2  . VAL A 1 252 ? 56.188   -16.045  -53.128  1.00 0.00 ? 247 VAL A CG2  1  
ATOM 3678  H H    . VAL A 1 252 ? 56.803   -18.185  -51.768  1.00 0.00 ? 247 VAL A H    1  
ATOM 3679  H HA   . VAL A 1 252 ? 58.151   -16.060  -50.291  1.00 0.00 ? 247 VAL A HA   1  
ATOM 3680  H HB   . VAL A 1 252 ? 57.723   -14.771  -52.337  1.00 0.00 ? 247 VAL A HB   1  
ATOM 3681  H HG11 . VAL A 1 252 ? 58.435   -16.738  -54.009  1.00 0.00 ? 247 VAL A HG11 1  
ATOM 3682  H HG12 . VAL A 1 252 ? 58.685   -17.587  -52.484  1.00 0.00 ? 247 VAL A HG12 1  
ATOM 3683  H HG13 . VAL A 1 252 ? 59.547   -16.083  -52.807  1.00 0.00 ? 247 VAL A HG13 1  
ATOM 3684  H HG21 . VAL A 1 252 ? 55.542   -15.187  -53.021  1.00 0.00 ? 247 VAL A HG21 1  
ATOM 3685  H HG22 . VAL A 1 252 ? 55.681   -16.925  -52.762  1.00 0.00 ? 247 VAL A HG22 1  
ATOM 3686  H HG23 . VAL A 1 252 ? 56.436   -16.180  -54.170  1.00 0.00 ? 247 VAL A HG23 1  
ATOM 3687  N N    . ILE A 1 253 ? 54.882   -16.121  -50.428  1.00 0.00 ? 248 ILE A N    1  
ATOM 3688  C CA   . ILE A 1 253 ? 53.663   -15.496  -49.836  1.00 0.00 ? 248 ILE A CA   1  
ATOM 3689  C C    . ILE A 1 253 ? 53.694   -15.672  -48.315  1.00 0.00 ? 248 ILE A C    1  
ATOM 3690  O O    . ILE A 1 253 ? 53.158   -14.869  -47.578  1.00 0.00 ? 248 ILE A O    1  
ATOM 3691  C CB   . ILE A 1 253 ? 52.481   -16.248  -50.467  1.00 0.00 ? 248 ILE A CB   1  
ATOM 3692  C CG1  . ILE A 1 253 ? 51.978   -15.468  -51.684  1.00 0.00 ? 248 ILE A CG1  1  
ATOM 3693  C CG2  . ILE A 1 253 ? 51.334   -16.391  -49.460  1.00 0.00 ? 248 ILE A CG2  1  
ATOM 3694  C CD1  . ILE A 1 253 ? 53.077   -15.397  -52.745  1.00 0.00 ? 248 ILE A CD1  1  
ATOM 3695  H H    . ILE A 1 253 ? 54.807   -16.955  -50.941  1.00 0.00 ? 248 ILE A H    1  
ATOM 3696  H HA   . ILE A 1 253 ? 53.616   -14.450  -50.092  1.00 0.00 ? 248 ILE A HA   1  
ATOM 3697  H HB   . ILE A 1 253 ? 52.806   -17.228  -50.779  1.00 0.00 ? 248 ILE A HB   1  
ATOM 3698  H HG12 . ILE A 1 253 ? 51.112   -15.965  -52.096  1.00 0.00 ? 248 ILE A HG12 1  
ATOM 3699  H HG13 . ILE A 1 253 ? 51.710   -14.467  -51.381  1.00 0.00 ? 248 ILE A HG13 1  
ATOM 3700  H HG21 . ILE A 1 253 ? 51.177   -15.448  -48.956  1.00 0.00 ? 248 ILE A HG21 1  
ATOM 3701  H HG22 . ILE A 1 253 ? 51.586   -17.149  -48.733  1.00 0.00 ? 248 ILE A HG22 1  
ATOM 3702  H HG23 . ILE A 1 253 ? 50.431   -16.676  -49.979  1.00 0.00 ? 248 ILE A HG23 1  
ATOM 3703  H HD11 . ILE A 1 253 ? 53.852   -16.110  -52.509  1.00 0.00 ? 248 ILE A HD11 1  
ATOM 3704  H HD12 . ILE A 1 253 ? 53.497   -14.403  -52.764  1.00 0.00 ? 248 ILE A HD12 1  
ATOM 3705  H HD13 . ILE A 1 253 ? 52.658   -15.630  -53.713  1.00 0.00 ? 248 ILE A HD13 1  
ATOM 3706  N N    . GLN A 1 254 ? 54.325   -16.715  -47.843  1.00 0.00 ? 249 GLN A N    1  
ATOM 3707  C CA   . GLN A 1 254 ? 54.398   -16.938  -46.369  1.00 0.00 ? 249 GLN A CA   1  
ATOM 3708  C C    . GLN A 1 254 ? 55.502   -16.066  -45.761  1.00 0.00 ? 249 GLN A C    1  
ATOM 3709  O O    . GLN A 1 254 ? 56.360   -16.543  -45.045  1.00 0.00 ? 249 GLN A O    1  
ATOM 3710  C CB   . GLN A 1 254 ? 54.731   -18.423  -46.207  1.00 0.00 ? 249 GLN A CB   1  
ATOM 3711  C CG   . GLN A 1 254 ? 53.798   -19.049  -45.167  1.00 0.00 ? 249 GLN A CG   1  
ATOM 3712  C CD   . GLN A 1 254 ? 52.360   -19.021  -45.688  1.00 0.00 ? 249 GLN A CD   1  
ATOM 3713  O OE1  . GLN A 1 254 ? 51.455   -18.614  -44.985  1.00 0.00 ? 249 GLN A OE1  1  
ATOM 3714  N NE2  . GLN A 1 254 ? 52.108   -19.438  -46.898  1.00 0.00 ? 249 GLN A NE2  1  
ATOM 3715  H H    . GLN A 1 254 ? 54.755   -17.350  -48.458  1.00 0.00 ? 249 GLN A H    1  
ATOM 3716  H HA   . GLN A 1 254 ? 53.448   -16.719  -45.907  1.00 0.00 ? 249 GLN A HA   1  
ATOM 3717  H HB2  . GLN A 1 254 ? 54.603   -18.926  -47.155  1.00 0.00 ? 249 GLN A HB2  1  
ATOM 3718  H HB3  . GLN A 1 254 ? 55.754   -18.530  -45.879  1.00 0.00 ? 249 GLN A HB3  1  
ATOM 3719  H HG2  . GLN A 1 254 ? 54.096   -20.071  -44.985  1.00 0.00 ? 249 GLN A HG2  1  
ATOM 3720  H HG3  . GLN A 1 254 ? 53.857   -18.487  -44.247  1.00 0.00 ? 249 GLN A HG3  1  
ATOM 3721  H HE21 . GLN A 1 254 ? 52.837   -19.766  -47.465  1.00 0.00 ? 249 GLN A HE21 1  
ATOM 3722  H HE22 . GLN A 1 254 ? 51.190   -19.424  -47.240  1.00 0.00 ? 249 GLN A HE22 1  
ATOM 3723  N N    . GLN A 1 255 ? 55.486   -14.788  -46.046  1.00 0.00 ? 250 GLN A N    1  
ATOM 3724  C CA   . GLN A 1 255 ? 56.530   -13.873  -45.494  1.00 0.00 ? 250 GLN A CA   1  
ATOM 3725  C C    . GLN A 1 255 ? 56.288   -12.446  -45.997  1.00 0.00 ? 250 GLN A C    1  
ATOM 3726  O O    . GLN A 1 255 ? 56.505   -11.482  -45.288  1.00 0.00 ? 250 GLN A O    1  
ATOM 3727  C CB   . GLN A 1 255 ? 57.864   -14.407  -46.029  1.00 0.00 ? 250 GLN A CB   1  
ATOM 3728  C CG   . GLN A 1 255 ? 58.745   -14.853  -44.859  1.00 0.00 ? 250 GLN A CG   1  
ATOM 3729  C CD   . GLN A 1 255 ? 60.204   -14.913  -45.313  1.00 0.00 ? 250 GLN A CD   1  
ATOM 3730  O OE1  . GLN A 1 255 ? 60.832   -15.951  -45.243  1.00 0.00 ? 250 GLN A OE1  1  
ATOM 3731  N NE2  . GLN A 1 255 ? 60.776   -13.836  -45.778  1.00 0.00 ? 250 GLN A NE2  1  
ATOM 3732  H H    . GLN A 1 255 ? 54.784   -14.428  -46.625  1.00 0.00 ? 250 GLN A H    1  
ATOM 3733  H HA   . GLN A 1 255 ? 56.524   -13.900  -44.416  1.00 0.00 ? 250 GLN A HA   1  
ATOM 3734  H HB2  . GLN A 1 255 ? 57.679   -15.249  -46.681  1.00 0.00 ? 250 GLN A HB2  1  
ATOM 3735  H HB3  . GLN A 1 255 ? 58.370   -13.629  -46.581  1.00 0.00 ? 250 GLN A HB3  1  
ATOM 3736  H HG2  . GLN A 1 255 ? 58.648   -14.146  -44.047  1.00 0.00 ? 250 GLN A HG2  1  
ATOM 3737  H HG3  . GLN A 1 255 ? 58.433   -15.831  -44.525  1.00 0.00 ? 250 GLN A HG3  1  
ATOM 3738  H HE21 . GLN A 1 255 ? 60.270   -12.998  -45.834  1.00 0.00 ? 250 GLN A HE21 1  
ATOM 3739  H HE22 . GLN A 1 255 ? 61.710   -13.865  -46.071  1.00 0.00 ? 250 GLN A HE22 1  
ATOM 3740  N N    . ASN A 1 256 ? 55.842   -12.307  -47.218  1.00 0.00 ? 251 ASN A N    1  
ATOM 3741  C CA   . ASN A 1 256 ? 55.585   -10.948  -47.775  1.00 0.00 ? 251 ASN A CA   1  
ATOM 3742  C C    . ASN A 1 256 ? 54.536   -11.031  -48.892  1.00 0.00 ? 251 ASN A C    1  
ATOM 3743  O O    . ASN A 1 256 ? 54.715   -11.760  -49.848  1.00 0.00 ? 251 ASN A O    1  
ATOM 3744  C CB   . ASN A 1 256 ? 56.934   -10.496  -48.336  1.00 0.00 ? 251 ASN A CB   1  
ATOM 3745  C CG   . ASN A 1 256 ? 56.851   -9.031   -48.768  1.00 0.00 ? 251 ASN A CG   1  
ATOM 3746  O OD1  . ASN A 1 256 ? 55.990   -8.300   -48.321  1.00 0.00 ? 251 ASN A OD1  1  
ATOM 3747  N ND2  . ASN A 1 256 ? 57.718   -8.567   -49.625  1.00 0.00 ? 251 ASN A ND2  1  
ATOM 3748  H H    . ASN A 1 256 ? 55.675   -13.098  -47.771  1.00 0.00 ? 251 ASN A H    1  
ATOM 3749  H HA   . ASN A 1 256 ? 55.265   -10.275  -46.996  1.00 0.00 ? 251 ASN A HA   1  
ATOM 3750  H HB2  . ASN A 1 256 ? 57.694   -10.605  -47.576  1.00 0.00 ? 251 ASN A HB2  1  
ATOM 3751  H HB3  . ASN A 1 256 ? 57.190   -11.106  -49.189  1.00 0.00 ? 251 ASN A HB3  1  
ATOM 3752  H HD21 . ASN A 1 256 ? 58.414   -9.156   -49.986  1.00 0.00 ? 251 ASN A HD21 1  
ATOM 3753  H HD22 . ASN A 1 256 ? 57.675   -7.630   -49.909  1.00 0.00 ? 251 ASN A HD22 1  
ATOM 3754  N N    . PRO A 1 257 ? 53.468   -10.285  -48.740  1.00 0.00 ? 252 PRO A N    1  
ATOM 3755  C CA   . PRO A 1 257 ? 52.391   -10.294  -49.762  1.00 0.00 ? 252 PRO A CA   1  
ATOM 3756  C C    . PRO A 1 257 ? 52.859   -9.609   -51.052  1.00 0.00 ? 252 PRO A C    1  
ATOM 3757  O O    . PRO A 1 257 ? 52.219   -9.707   -52.081  1.00 0.00 ? 252 PRO A O    1  
ATOM 3758  C CB   . PRO A 1 257 ? 51.262   -9.506   -49.102  1.00 0.00 ? 252 PRO A CB   1  
ATOM 3759  C CG   . PRO A 1 257 ? 51.941   -8.630   -48.099  1.00 0.00 ? 252 PRO A CG   1  
ATOM 3760  C CD   . PRO A 1 257 ? 53.162   -9.375   -47.628  1.00 0.00 ? 252 PRO A CD   1  
ATOM 3761  H HA   . PRO A 1 257 ? 52.067   -11.304  -49.964  1.00 0.00 ? 252 PRO A HA   1  
ATOM 3762  H HB2  . PRO A 1 257 ? 50.742   -8.908   -49.838  1.00 0.00 ? 252 PRO A HB2  1  
ATOM 3763  H HB3  . PRO A 1 257 ? 50.576   -10.173  -48.604  1.00 0.00 ? 252 PRO A HB3  1  
ATOM 3764  H HG2  . PRO A 1 257 ? 52.230   -7.696   -48.562  1.00 0.00 ? 252 PRO A HG2  1  
ATOM 3765  H HG3  . PRO A 1 257 ? 51.284   -8.443   -47.265  1.00 0.00 ? 252 PRO A HG3  1  
ATOM 3766  H HD2  . PRO A 1 257 ? 53.980   -8.689   -47.456  1.00 0.00 ? 252 PRO A HD2  1  
ATOM 3767  H HD3  . PRO A 1 257 ? 52.942   -9.939   -46.735  1.00 0.00 ? 252 PRO A HD3  1  
ATOM 3768  N N    . ALA A 1 258 ? 53.971   -8.922   -51.007  1.00 0.00 ? 253 ALA A N    1  
ATOM 3769  C CA   . ALA A 1 258 ? 54.476   -8.240   -52.236  1.00 0.00 ? 253 ALA A CA   1  
ATOM 3770  C C    . ALA A 1 258 ? 55.023   -9.277   -53.222  1.00 0.00 ? 253 ALA A C    1  
ATOM 3771  O O    . ALA A 1 258 ? 55.119   -9.033   -54.411  1.00 0.00 ? 253 ALA A O    1  
ATOM 3772  C CB   . ALA A 1 258 ? 55.595   -7.316   -51.751  1.00 0.00 ? 253 ALA A CB   1  
ATOM 3773  H H    . ALA A 1 258 ? 54.476   -8.859   -50.170  1.00 0.00 ? 253 ALA A H    1  
ATOM 3774  H HA   . ALA A 1 258 ? 53.691   -7.661   -52.696  1.00 0.00 ? 253 ALA A HA   1  
ATOM 3775  H HB1  . ALA A 1 258 ? 55.875   -7.587   -50.744  1.00 0.00 ? 253 ALA A HB1  1  
ATOM 3776  H HB2  . ALA A 1 258 ? 55.248   -6.294   -51.766  1.00 0.00 ? 253 ALA A HB2  1  
ATOM 3777  H HB3  . ALA A 1 258 ? 56.452   -7.415   -52.402  1.00 0.00 ? 253 ALA A HB3  1  
ATOM 3778  N N    . LEU A 1 259 ? 55.379   -10.437  -52.737  1.00 0.00 ? 254 LEU A N    1  
ATOM 3779  C CA   . LEU A 1 259 ? 55.916   -11.491  -53.642  1.00 0.00 ? 254 LEU A CA   1  
ATOM 3780  C C    . LEU A 1 259 ? 54.780   -12.137  -54.441  1.00 0.00 ? 254 LEU A C    1  
ATOM 3781  O O    . LEU A 1 259 ? 54.974   -12.574  -55.556  1.00 0.00 ? 254 LEU A O    1  
ATOM 3782  C CB   . LEU A 1 259 ? 56.572   -12.514  -52.716  1.00 0.00 ? 254 LEU A CB   1  
ATOM 3783  C CG   . LEU A 1 259 ? 58.049   -12.161  -52.531  1.00 0.00 ? 254 LEU A CG   1  
ATOM 3784  C CD1  . LEU A 1 259 ? 58.533   -12.677  -51.174  1.00 0.00 ? 254 LEU A CD1  1  
ATOM 3785  C CD2  . LEU A 1 259 ? 58.870   -12.811  -53.646  1.00 0.00 ? 254 LEU A CD2  1  
ATOM 3786  H H    . LEU A 1 259 ? 55.290   -10.615  -51.778  1.00 0.00 ? 254 LEU A H    1  
ATOM 3787  H HA   . LEU A 1 259 ? 56.653   -11.073  -54.308  1.00 0.00 ? 254 LEU A HA   1  
ATOM 3788  H HB2  . LEU A 1 259 ? 56.074   -12.503  -51.757  1.00 0.00 ? 254 LEU A HB2  1  
ATOM 3789  H HB3  . LEU A 1 259 ? 56.491   -13.497  -53.153  1.00 0.00 ? 254 LEU A HB3  1  
ATOM 3790  H HG   . LEU A 1 259 ? 58.169   -11.088  -52.571  1.00 0.00 ? 254 LEU A HG   1  
ATOM 3791  H HD11 . LEU A 1 259 ? 59.544   -13.047  -51.268  1.00 0.00 ? 254 LEU A HD11 1  
ATOM 3792  H HD12 . LEU A 1 259 ? 57.887   -13.475  -50.839  1.00 0.00 ? 254 LEU A HD12 1  
ATOM 3793  H HD13 . LEU A 1 259 ? 58.512   -11.871  -50.454  1.00 0.00 ? 254 LEU A HD13 1  
ATOM 3794  H HD21 . LEU A 1 259 ? 59.877   -12.987  -53.296  1.00 0.00 ? 254 LEU A HD21 1  
ATOM 3795  H HD22 . LEU A 1 259 ? 58.897   -12.155  -54.503  1.00 0.00 ? 254 LEU A HD22 1  
ATOM 3796  H HD23 . LEU A 1 259 ? 58.417   -13.751  -53.926  1.00 0.00 ? 254 LEU A HD23 1  
ATOM 3797  N N    . LEU A 1 260 ? 53.595   -12.200  -53.882  1.00 0.00 ? 255 LEU A N    1  
ATOM 3798  C CA   . LEU A 1 260 ? 52.449   -12.821  -54.619  1.00 0.00 ? 255 LEU A CA   1  
ATOM 3799  C C    . LEU A 1 260 ? 52.344   -12.241  -56.036  1.00 0.00 ? 255 LEU A C    1  
ATOM 3800  O O    . LEU A 1 260 ? 52.344   -12.980  -57.000  1.00 0.00 ? 255 LEU A O    1  
ATOM 3801  C CB   . LEU A 1 260 ? 51.203   -12.480  -53.802  1.00 0.00 ? 255 LEU A CB   1  
ATOM 3802  C CG   . LEU A 1 260 ? 50.315   -13.721  -53.691  1.00 0.00 ? 255 LEU A CG   1  
ATOM 3803  C CD1  . LEU A 1 260 ? 49.551   -13.686  -52.365  1.00 0.00 ? 255 LEU A CD1  1  
ATOM 3804  C CD2  . LEU A 1 260 ? 49.319   -13.739  -54.852  1.00 0.00 ? 255 LEU A CD2  1  
ATOM 3805  H H    . LEU A 1 260 ? 53.460   -11.839  -52.981  1.00 0.00 ? 255 LEU A H    1  
ATOM 3806  H HA   . LEU A 1 260 ? 52.575   -13.891  -54.666  1.00 0.00 ? 255 LEU A HA   1  
ATOM 3807  H HB2  . LEU A 1 260 ? 51.496   -12.156  -52.814  1.00 0.00 ? 255 LEU A HB2  1  
ATOM 3808  H HB3  . LEU A 1 260 ? 50.652   -11.693  -54.292  1.00 0.00 ? 255 LEU A HB3  1  
ATOM 3809  H HG   . LEU A 1 260 ? 50.932   -14.609  -53.730  1.00 0.00 ? 255 LEU A HG   1  
ATOM 3810  H HD11 . LEU A 1 260 ? 50.129   -13.144  -51.630  1.00 0.00 ? 255 LEU A HD11 1  
ATOM 3811  H HD12 . LEU A 1 260 ? 49.382   -14.694  -52.019  1.00 0.00 ? 255 LEU A HD12 1  
ATOM 3812  H HD13 . LEU A 1 260 ? 48.602   -13.192  -52.511  1.00 0.00 ? 255 LEU A HD13 1  
ATOM 3813  H HD21 . LEU A 1 260 ? 48.800   -12.792  -54.896  1.00 0.00 ? 255 LEU A HD21 1  
ATOM 3814  H HD22 . LEU A 1 260 ? 48.604   -14.534  -54.702  1.00 0.00 ? 255 LEU A HD22 1  
ATOM 3815  H HD23 . LEU A 1 260 ? 49.849   -13.901  -55.779  1.00 0.00 ? 255 LEU A HD23 1  
ATOM 3816  N N    . PRO A 1 261 ? 52.276   -10.934  -56.127  1.00 0.00 ? 256 PRO A N    1  
ATOM 3817  C CA   . PRO A 1 261 ? 52.193   -10.281  -57.454  1.00 0.00 ? 256 PRO A CA   1  
ATOM 3818  C C    . PRO A 1 261 ? 53.523   -10.451  -58.191  1.00 0.00 ? 256 PRO A C    1  
ATOM 3819  O O    . PRO A 1 261 ? 53.558   -10.740  -59.371  1.00 0.00 ? 256 PRO A O    1  
ATOM 3820  C CB   . PRO A 1 261 ? 51.924   -8.815   -57.122  1.00 0.00 ? 256 PRO A CB   1  
ATOM 3821  C CG   . PRO A 1 261 ? 52.457   -8.634   -55.740  1.00 0.00 ? 256 PRO A CG   1  
ATOM 3822  C CD   . PRO A 1 261 ? 52.272   -9.951   -55.033  1.00 0.00 ? 256 PRO A CD   1  
ATOM 3823  H HA   . PRO A 1 261 ? 51.380   -10.689  -58.032  1.00 0.00 ? 256 PRO A HA   1  
ATOM 3824  H HB2  . PRO A 1 261 ? 52.444   -8.171   -57.818  1.00 0.00 ? 256 PRO A HB2  1  
ATOM 3825  H HB3  . PRO A 1 261 ? 50.864   -8.613   -57.139  1.00 0.00 ? 256 PRO A HB3  1  
ATOM 3826  H HG2  . PRO A 1 261 ? 53.506   -8.375   -55.780  1.00 0.00 ? 256 PRO A HG2  1  
ATOM 3827  H HG3  . PRO A 1 261 ? 51.903   -7.864   -55.226  1.00 0.00 ? 256 PRO A HG3  1  
ATOM 3828  H HD2  . PRO A 1 261 ? 53.088   -10.129  -54.351  1.00 0.00 ? 256 PRO A HD2  1  
ATOM 3829  H HD3  . PRO A 1 261 ? 51.327   -9.972   -54.515  1.00 0.00 ? 256 PRO A HD3  1  
ATOM 3830  N N    . ALA A 1 262 ? 54.620   -10.285  -57.497  1.00 0.00 ? 257 ALA A N    1  
ATOM 3831  C CA   . ALA A 1 262 ? 55.951   -10.450  -58.153  1.00 0.00 ? 257 ALA A CA   1  
ATOM 3832  C C    . ALA A 1 262 ? 56.101   -11.879  -58.690  1.00 0.00 ? 257 ALA A C    1  
ATOM 3833  O O    . ALA A 1 262 ? 56.827   -12.123  -59.634  1.00 0.00 ? 257 ALA A O    1  
ATOM 3834  C CB   . ALA A 1 262 ? 56.975   -10.180  -57.049  1.00 0.00 ? 257 ALA A CB   1  
ATOM 3835  H H    . ALA A 1 262 ? 54.567   -10.060  -56.544  1.00 0.00 ? 257 ALA A H    1  
ATOM 3836  H HA   . ALA A 1 262 ? 56.070   -9.732   -58.950  1.00 0.00 ? 257 ALA A HA   1  
ATOM 3837  H HB1  . ALA A 1 262 ? 56.535   -9.541   -56.299  1.00 0.00 ? 257 ALA A HB1  1  
ATOM 3838  H HB2  . ALA A 1 262 ? 57.842   -9.694   -57.473  1.00 0.00 ? 257 ALA A HB2  1  
ATOM 3839  H HB3  . ALA A 1 262 ? 57.272   -11.115  -56.597  1.00 0.00 ? 257 ALA A HB3  1  
ATOM 3840  N N    . LEU A 1 263 ? 55.416   -12.823  -58.098  1.00 0.00 ? 258 LEU A N    1  
ATOM 3841  C CA   . LEU A 1 263 ? 55.513   -14.236  -58.574  1.00 0.00 ? 258 LEU A CA   1  
ATOM 3842  C C    . LEU A 1 263 ? 54.436   -14.504  -59.628  1.00 0.00 ? 258 LEU A C    1  
ATOM 3843  O O    . LEU A 1 263 ? 54.712   -15.017  -60.695  1.00 0.00 ? 258 LEU A O    1  
ATOM 3844  C CB   . LEU A 1 263 ? 55.268   -15.095  -57.328  1.00 0.00 ? 258 LEU A CB   1  
ATOM 3845  C CG   . LEU A 1 263 ? 56.292   -16.235  -57.256  1.00 0.00 ? 258 LEU A CG   1  
ATOM 3846  C CD1  . LEU A 1 263 ? 56.129   -17.157  -58.466  1.00 0.00 ? 258 LEU A CD1  1  
ATOM 3847  C CD2  . LEU A 1 263 ? 57.710   -15.658  -57.240  1.00 0.00 ? 258 LEU A CD2  1  
ATOM 3848  H H    . LEU A 1 263 ? 54.835   -12.602  -57.341  1.00 0.00 ? 258 LEU A H    1  
ATOM 3849  H HA   . LEU A 1 263 ? 56.493   -14.434  -58.976  1.00 0.00 ? 258 LEU A HA   1  
ATOM 3850  H HB2  . LEU A 1 263 ? 55.360   -14.480  -56.447  1.00 0.00 ? 258 LEU A HB2  1  
ATOM 3851  H HB3  . LEU A 1 263 ? 54.274   -15.512  -57.371  1.00 0.00 ? 258 LEU A HB3  1  
ATOM 3852  H HG   . LEU A 1 263 ? 56.126   -16.804  -56.352  1.00 0.00 ? 258 LEU A HG   1  
ATOM 3853  H HD11 . LEU A 1 263 ? 55.672   -16.611  -59.278  1.00 0.00 ? 258 LEU A HD11 1  
ATOM 3854  H HD12 . LEU A 1 263 ? 55.501   -17.994  -58.198  1.00 0.00 ? 258 LEU A HD12 1  
ATOM 3855  H HD13 . LEU A 1 263 ? 57.098   -17.520  -58.776  1.00 0.00 ? 258 LEU A HD13 1  
ATOM 3856  H HD21 . LEU A 1 263 ? 57.693   -14.671  -56.801  1.00 0.00 ? 258 LEU A HD21 1  
ATOM 3857  H HD22 . LEU A 1 263 ? 58.085   -15.595  -58.250  1.00 0.00 ? 258 LEU A HD22 1  
ATOM 3858  H HD23 . LEU A 1 263 ? 58.353   -16.300  -56.656  1.00 0.00 ? 258 LEU A HD23 1  
ATOM 3859  N N    . LEU A 1 264 ? 53.209   -14.157  -59.336  1.00 0.00 ? 259 LEU A N    1  
ATOM 3860  C CA   . LEU A 1 264 ? 52.106   -14.386  -60.319  1.00 0.00 ? 259 LEU A CA   1  
ATOM 3861  C C    . LEU A 1 264 ? 52.473   -13.774  -61.672  1.00 0.00 ? 259 LEU A C    1  
ATOM 3862  O O    . LEU A 1 264 ? 52.091   -14.270  -62.713  1.00 0.00 ? 259 LEU A O    1  
ATOM 3863  C CB   . LEU A 1 264 ? 50.890   -13.677  -59.722  1.00 0.00 ? 259 LEU A CB   1  
ATOM 3864  C CG   . LEU A 1 264 ? 49.677   -13.885  -60.632  1.00 0.00 ? 259 LEU A CG   1  
ATOM 3865  C CD1  . LEU A 1 264 ? 49.314   -15.371  -60.672  1.00 0.00 ? 259 LEU A CD1  1  
ATOM 3866  C CD2  . LEU A 1 264 ? 48.491   -13.086  -60.089  1.00 0.00 ? 259 LEU A CD2  1  
ATOM 3867  H H    . LEU A 1 264 ? 53.013   -13.743  -58.470  1.00 0.00 ? 259 LEU A H    1  
ATOM 3868  H HA   . LEU A 1 264 ? 51.905   -15.440  -60.422  1.00 0.00 ? 259 LEU A HA   1  
ATOM 3869  H HB2  . LEU A 1 264 ? 50.681   -14.084  -58.743  1.00 0.00 ? 259 LEU A HB2  1  
ATOM 3870  H HB3  . LEU A 1 264 ? 51.097   -12.621  -59.637  1.00 0.00 ? 259 LEU A HB3  1  
ATOM 3871  H HG   . LEU A 1 264 ? 49.915   -13.546  -61.630  1.00 0.00 ? 259 LEU A HG   1  
ATOM 3872  H HD11 . LEU A 1 264 ? 49.231   -15.748  -59.663  1.00 0.00 ? 259 LEU A HD11 1  
ATOM 3873  H HD12 . LEU A 1 264 ? 50.083   -15.916  -61.198  1.00 0.00 ? 259 LEU A HD12 1  
ATOM 3874  H HD13 . LEU A 1 264 ? 48.370   -15.497  -61.182  1.00 0.00 ? 259 LEU A HD13 1  
ATOM 3875  H HD21 . LEU A 1 264 ? 47.571   -13.495  -60.480  1.00 0.00 ? 259 LEU A HD21 1  
ATOM 3876  H HD22 . LEU A 1 264 ? 48.583   -12.053  -60.392  1.00 0.00 ? 259 LEU A HD22 1  
ATOM 3877  H HD23 . LEU A 1 264 ? 48.480   -13.145  -59.010  1.00 0.00 ? 259 LEU A HD23 1  
ATOM 3878  N N    . GLN A 1 265 ? 53.217   -12.702  -61.661  1.00 0.00 ? 260 GLN A N    1  
ATOM 3879  C CA   . GLN A 1 265 ? 53.620   -12.056  -62.942  1.00 0.00 ? 260 GLN A CA   1  
ATOM 3880  C C    . GLN A 1 265 ? 54.942   -12.653  -63.434  1.00 0.00 ? 260 GLN A C    1  
ATOM 3881  O O    . GLN A 1 265 ? 55.279   -12.563  -64.599  1.00 0.00 ? 260 GLN A O    1  
ATOM 3882  C CB   . GLN A 1 265 ? 53.792   -10.575  -62.603  1.00 0.00 ? 260 GLN A CB   1  
ATOM 3883  C CG   . GLN A 1 265 ? 52.450   -9.852   -62.763  1.00 0.00 ? 260 GLN A CG   1  
ATOM 3884  C CD   . GLN A 1 265 ? 52.161   -9.023   -61.509  1.00 0.00 ? 260 GLN A CD   1  
ATOM 3885  O OE1  . GLN A 1 265 ? 52.583   -7.888   -61.407  1.00 0.00 ? 260 GLN A OE1  1  
ATOM 3886  N NE2  . GLN A 1 265 ? 51.453   -9.545   -60.545  1.00 0.00 ? 260 GLN A NE2  1  
ATOM 3887  H H    . GLN A 1 265 ? 53.516   -12.323  -60.808  1.00 0.00 ? 260 GLN A H    1  
ATOM 3888  H HA   . GLN A 1 265 ? 52.849   -12.179  -63.687  1.00 0.00 ? 260 GLN A HA   1  
ATOM 3889  H HB2  . GLN A 1 265 ? 54.137   -10.478  -61.584  1.00 0.00 ? 260 GLN A HB2  1  
ATOM 3890  H HB3  . GLN A 1 265 ? 54.516   -10.135  -63.272  1.00 0.00 ? 260 GLN A HB3  1  
ATOM 3891  H HG2  . GLN A 1 265 ? 52.494   -9.201   -63.623  1.00 0.00 ? 260 GLN A HG2  1  
ATOM 3892  H HG3  . GLN A 1 265 ? 51.663   -10.578  -62.900  1.00 0.00 ? 260 GLN A HG3  1  
ATOM 3893  H HE21 . GLN A 1 265 ? 51.112   -10.460  -60.628  1.00 0.00 ? 260 GLN A HE21 1  
ATOM 3894  H HE22 . GLN A 1 265 ? 51.262   -9.022   -59.739  1.00 0.00 ? 260 GLN A HE22 1  
ATOM 3895  N N    . GLN A 1 266 ? 55.692   -13.264  -62.554  1.00 0.00 ? 261 GLN A N    1  
ATOM 3896  C CA   . GLN A 1 266 ? 56.991   -13.870  -62.969  1.00 0.00 ? 261 GLN A CA   1  
ATOM 3897  C C    . GLN A 1 266 ? 56.777   -15.320  -63.410  1.00 0.00 ? 261 GLN A C    1  
ATOM 3898  O O    . GLN A 1 266 ? 56.991   -15.668  -64.556  1.00 0.00 ? 261 GLN A O    1  
ATOM 3899  C CB   . GLN A 1 266 ? 57.873   -13.810  -61.719  1.00 0.00 ? 261 GLN A CB   1  
ATOM 3900  C CG   . GLN A 1 266 ? 59.240   -14.435  -62.019  1.00 0.00 ? 261 GLN A CG   1  
ATOM 3901  C CD   . GLN A 1 266 ? 60.322   -13.353  -61.972  1.00 0.00 ? 261 GLN A CD   1  
ATOM 3902  O OE1  . GLN A 1 266 ? 60.463   -12.577  -62.896  1.00 0.00 ? 261 GLN A OE1  1  
ATOM 3903  N NE2  . GLN A 1 266 ? 61.098   -13.270  -60.926  1.00 0.00 ? 261 GLN A NE2  1  
ATOM 3904  H H    . GLN A 1 266 ? 55.400   -13.326  -61.619  1.00 0.00 ? 261 GLN A H    1  
ATOM 3905  H HA   . GLN A 1 266 ? 57.439   -13.295  -63.764  1.00 0.00 ? 261 GLN A HA   1  
ATOM 3906  H HB2  . GLN A 1 266 ? 58.004   -12.779  -61.422  1.00 0.00 ? 261 GLN A HB2  1  
ATOM 3907  H HB3  . GLN A 1 266 ? 57.399   -14.357  -60.919  1.00 0.00 ? 261 GLN A HB3  1  
ATOM 3908  H HG2  . GLN A 1 266 ? 59.457   -15.193  -61.282  1.00 0.00 ? 261 GLN A HG2  1  
ATOM 3909  H HG3  . GLN A 1 266 ? 59.225   -14.883  -63.002  1.00 0.00 ? 261 GLN A HG3  1  
ATOM 3910  H HE21 . GLN A 1 266 ? 60.985   -13.896  -60.181  1.00 0.00 ? 261 GLN A HE21 1  
ATOM 3911  H HE22 . GLN A 1 266 ? 61.794   -12.581  -60.886  1.00 0.00 ? 261 GLN A HE22 1  
ATOM 3912  N N    . LEU A 1 267 ? 56.355   -16.167  -62.510  1.00 0.00 ? 262 LEU A N    1  
ATOM 3913  C CA   . LEU A 1 267 ? 56.124   -17.595  -62.875  1.00 0.00 ? 262 LEU A CA   1  
ATOM 3914  C C    . LEU A 1 267 ? 54.635   -17.836  -63.133  1.00 0.00 ? 262 LEU A C    1  
ATOM 3915  O O    . LEU A 1 267 ? 54.258   -18.486  -64.089  1.00 0.00 ? 262 LEU A O    1  
ATOM 3916  C CB   . LEU A 1 267 ? 56.598   -18.399  -61.660  1.00 0.00 ? 262 LEU A CB   1  
ATOM 3917  C CG   . LEU A 1 267 ? 57.951   -19.053  -61.961  1.00 0.00 ? 262 LEU A CG   1  
ATOM 3918  C CD1  . LEU A 1 267 ? 57.810   -20.008  -63.148  1.00 0.00 ? 262 LEU A CD1  1  
ATOM 3919  C CD2  . LEU A 1 267 ? 58.981   -17.970  -62.298  1.00 0.00 ? 262 LEU A CD2  1  
ATOM 3920  H H    . LEU A 1 267 ? 56.188   -15.863  -61.593  1.00 0.00 ? 262 LEU A H    1  
ATOM 3921  H HA   . LEU A 1 267 ? 56.705   -17.861  -63.743  1.00 0.00 ? 262 LEU A HA   1  
ATOM 3922  H HB2  . LEU A 1 267 ? 56.700   -17.738  -60.811  1.00 0.00 ? 262 LEU A HB2  1  
ATOM 3923  H HB3  . LEU A 1 267 ? 55.874   -19.166  -61.432  1.00 0.00 ? 262 LEU A HB3  1  
ATOM 3924  H HG   . LEU A 1 267 ? 58.281   -19.607  -61.094  1.00 0.00 ? 262 LEU A HG   1  
ATOM 3925  H HD11 . LEU A 1 267 ? 56.808   -20.413  -63.167  1.00 0.00 ? 262 LEU A HD11 1  
ATOM 3926  H HD12 . LEU A 1 267 ? 58.522   -20.814  -63.049  1.00 0.00 ? 262 LEU A HD12 1  
ATOM 3927  H HD13 . LEU A 1 267 ? 57.998   -19.472  -64.067  1.00 0.00 ? 262 LEU A HD13 1  
ATOM 3928  H HD21 . LEU A 1 267 ? 59.918   -18.436  -62.564  1.00 0.00 ? 262 LEU A HD21 1  
ATOM 3929  H HD22 . LEU A 1 267 ? 59.126   -17.332  -61.439  1.00 0.00 ? 262 LEU A HD22 1  
ATOM 3930  H HD23 . LEU A 1 267 ? 58.624   -17.380  -63.128  1.00 0.00 ? 262 LEU A HD23 1  
ATOM 3931  N N    . GLY A 1 268 ? 53.785   -17.313  -62.289  1.00 0.00 ? 263 GLY A N    1  
ATOM 3932  C CA   . GLY A 1 268 ? 52.318   -17.506  -62.484  1.00 0.00 ? 263 GLY A CA   1  
ATOM 3933  C C    . GLY A 1 268 ? 51.910   -16.995  -63.869  1.00 0.00 ? 263 GLY A C    1  
ATOM 3934  O O    . GLY A 1 268 ? 50.914   -17.413  -64.425  1.00 0.00 ? 263 GLY A O    1  
ATOM 3935  H H    . GLY A 1 268 ? 54.112   -16.791  -61.526  1.00 0.00 ? 263 GLY A H    1  
ATOM 3936  H HA2  . GLY A 1 268 ? 52.080   -18.557  -62.402  1.00 0.00 ? 263 GLY A HA2  1  
ATOM 3937  H HA3  . GLY A 1 268 ? 51.779   -16.955  -61.728  1.00 0.00 ? 263 GLY A HA3  1  
ATOM 3938  N N    . GLN A 1 269 ? 52.674   -16.094  -64.430  1.00 0.00 ? 264 GLN A N    1  
ATOM 3939  C CA   . GLN A 1 269 ? 52.334   -15.557  -65.779  1.00 0.00 ? 264 GLN A CA   1  
ATOM 3940  C C    . GLN A 1 269 ? 53.332   -16.077  -66.818  1.00 0.00 ? 264 GLN A C    1  
ATOM 3941  O O    . GLN A 1 269 ? 53.570   -15.452  -67.833  1.00 0.00 ? 264 GLN A O    1  
ATOM 3942  C CB   . GLN A 1 269 ? 52.444   -14.037  -65.641  1.00 0.00 ? 264 GLN A CB   1  
ATOM 3943  C CG   . GLN A 1 269 ? 52.030   -13.371  -66.955  1.00 0.00 ? 264 GLN A CG   1  
ATOM 3944  C CD   . GLN A 1 269 ? 51.532   -11.952  -66.674  1.00 0.00 ? 264 GLN A CD   1  
ATOM 3945  O OE1  . GLN A 1 269 ? 51.074   -11.660  -65.587  1.00 0.00 ? 264 GLN A OE1  1  
ATOM 3946  N NE2  . GLN A 1 269 ? 51.603   -11.051  -67.615  1.00 0.00 ? 264 GLN A NE2  1  
ATOM 3947  H H    . GLN A 1 269 ? 53.473   -15.772  -63.964  1.00 0.00 ? 264 GLN A H    1  
ATOM 3948  H HA   . GLN A 1 269 ? 51.327   -15.831  -66.052  1.00 0.00 ? 264 GLN A HA   1  
ATOM 3949  H HB2  . GLN A 1 269 ? 51.794   -13.701  -64.846  1.00 0.00 ? 264 GLN A HB2  1  
ATOM 3950  H HB3  . GLN A 1 269 ? 53.464   -13.769  -65.410  1.00 0.00 ? 264 GLN A HB3  1  
ATOM 3951  H HG2  . GLN A 1 269 ? 52.880   -13.330  -67.621  1.00 0.00 ? 264 GLN A HG2  1  
ATOM 3952  H HG3  . GLN A 1 269 ? 51.239   -13.944  -67.416  1.00 0.00 ? 264 GLN A HG3  1  
ATOM 3953  H HE21 . GLN A 1 269 ? 51.972   -11.285  -68.492  1.00 0.00 ? 264 GLN A HE21 1  
ATOM 3954  H HE22 . GLN A 1 269 ? 51.286   -10.139  -67.445  1.00 0.00 ? 264 GLN A HE22 1  
ATOM 3955  N N    . GLU A 1 270 ? 53.916   -17.219  -66.569  1.00 0.00 ? 265 GLU A N    1  
ATOM 3956  C CA   . GLU A 1 270 ? 54.898   -17.786  -67.538  1.00 0.00 ? 265 GLU A CA   1  
ATOM 3957  C C    . GLU A 1 270 ? 54.366   -19.101  -68.111  1.00 0.00 ? 265 GLU A C    1  
ATOM 3958  O O    . GLU A 1 270 ? 54.594   -19.428  -69.259  1.00 0.00 ? 265 GLU A O    1  
ATOM 3959  C CB   . GLU A 1 270 ? 56.166   -18.029  -66.720  1.00 0.00 ? 265 GLU A CB   1  
ATOM 3960  C CG   . GLU A 1 270 ? 57.315   -18.408  -67.657  1.00 0.00 ? 265 GLU A CG   1  
ATOM 3961  C CD   . GLU A 1 270 ? 57.920   -17.141  -68.264  1.00 0.00 ? 265 GLU A CD   1  
ATOM 3962  O OE1  . GLU A 1 270 ? 57.258   -16.527  -69.085  1.00 0.00 ? 265 GLU A OE1  1  
ATOM 3963  O OE2  . GLU A 1 270 ? 59.034   -16.805  -67.896  1.00 0.00 ? 265 GLU A OE2  1  
ATOM 3964  H H    . GLU A 1 270 ? 53.706   -17.707  -65.745  1.00 0.00 ? 265 GLU A H    1  
ATOM 3965  H HA   . GLU A 1 270 ? 55.097   -17.081  -68.330  1.00 0.00 ? 265 GLU A HA   1  
ATOM 3966  H HB2  . GLU A 1 270 ? 56.424   -17.130  -66.180  1.00 0.00 ? 265 GLU A HB2  1  
ATOM 3967  H HB3  . GLU A 1 270 ? 55.995   -18.833  -66.021  1.00 0.00 ? 265 GLU A HB3  1  
ATOM 3968  H HG2  . GLU A 1 270 ? 58.074   -18.939  -67.099  1.00 0.00 ? 265 GLU A HG2  1  
ATOM 3969  H HG3  . GLU A 1 270 ? 56.941   -19.040  -68.448  1.00 0.00 ? 265 GLU A HG3  1  
ATOM 3970  N N    . ASN A 1 271 ? 53.653   -19.854  -67.317  1.00 0.00 ? 266 ASN A N    1  
ATOM 3971  C CA   . ASN A 1 271 ? 53.098   -21.147  -67.808  1.00 0.00 ? 266 ASN A CA   1  
ATOM 3972  C C    . ASN A 1 271 ? 51.608   -20.987  -68.137  1.00 0.00 ? 266 ASN A C    1  
ATOM 3973  O O    . ASN A 1 271 ? 50.809   -20.732  -67.257  1.00 0.00 ? 266 ASN A O    1  
ATOM 3974  C CB   . ASN A 1 271 ? 53.289   -22.125  -66.648  1.00 0.00 ? 266 ASN A CB   1  
ATOM 3975  C CG   . ASN A 1 271 ? 53.055   -23.555  -67.141  1.00 0.00 ? 266 ASN A CG   1  
ATOM 3976  O OD1  . ASN A 1 271 ? 53.272   -23.854  -68.299  1.00 0.00 ? 266 ASN A OD1  1  
ATOM 3977  N ND2  . ASN A 1 271 ? 52.617   -24.457  -66.306  1.00 0.00 ? 266 ASN A ND2  1  
ATOM 3978  H H    . ASN A 1 271 ? 53.480   -19.566  -66.396  1.00 0.00 ? 266 ASN A H    1  
ATOM 3979  H HA   . ASN A 1 271 ? 53.646   -21.488  -68.671  1.00 0.00 ? 266 ASN A HA   1  
ATOM 3980  H HB2  . ASN A 1 271 ? 54.295   -22.036  -66.265  1.00 0.00 ? 266 ASN A HB2  1  
ATOM 3981  H HB3  . ASN A 1 271 ? 52.582   -21.897  -65.865  1.00 0.00 ? 266 ASN A HB3  1  
ATOM 3982  H HD21 . ASN A 1 271 ? 52.442   -24.216  -65.372  1.00 0.00 ? 266 ASN A HD21 1  
ATOM 3983  H HD22 . ASN A 1 271 ? 52.464   -25.375  -66.612  1.00 0.00 ? 266 ASN A HD22 1  
ATOM 3984  N N    . PRO A 1 272 ? 51.276   -21.140  -69.395  1.00 0.00 ? 267 PRO A N    1  
ATOM 3985  C CA   . PRO A 1 272 ? 49.861   -21.006  -69.824  1.00 0.00 ? 267 PRO A CA   1  
ATOM 3986  C C    . PRO A 1 272 ? 49.032   -22.191  -69.319  1.00 0.00 ? 267 PRO A C    1  
ATOM 3987  O O    . PRO A 1 272 ? 47.817   -22.148  -69.310  1.00 0.00 ? 267 PRO A O    1  
ATOM 3988  C CB   . PRO A 1 272 ? 49.945   -21.006  -71.349  1.00 0.00 ? 267 PRO A CB   1  
ATOM 3989  C CG   . PRO A 1 272 ? 51.218   -21.724  -71.664  1.00 0.00 ? 267 PRO A CG   1  
ATOM 3990  C CD   . PRO A 1 272 ? 52.164   -21.451  -70.525  1.00 0.00 ? 267 PRO A CD   1  
ATOM 3991  H HA   . PRO A 1 272 ? 49.445   -20.074  -69.477  1.00 0.00 ? 267 PRO A HA   1  
ATOM 3992  H HB2  . PRO A 1 272 ? 49.099   -21.531  -71.770  1.00 0.00 ? 267 PRO A HB2  1  
ATOM 3993  H HB3  . PRO A 1 272 ? 49.989   -19.996  -71.724  1.00 0.00 ? 267 PRO A HB3  1  
ATOM 3994  H HG2  . PRO A 1 272 ? 51.031   -22.786  -71.747  1.00 0.00 ? 267 PRO A HG2  1  
ATOM 3995  H HG3  . PRO A 1 272 ? 51.637   -21.348  -72.583  1.00 0.00 ? 267 PRO A HG3  1  
ATOM 3996  H HD2  . PRO A 1 272 ? 52.763   -22.327  -70.312  1.00 0.00 ? 267 PRO A HD2  1  
ATOM 3997  H HD3  . PRO A 1 272 ? 52.793   -20.604  -70.748  1.00 0.00 ? 267 PRO A HD3  1  
ATOM 3998  N N    . GLN A 1 273 ? 49.678   -23.249  -68.899  1.00 0.00 ? 268 GLN A N    1  
ATOM 3999  C CA   . GLN A 1 273 ? 48.928   -24.438  -68.395  1.00 0.00 ? 268 GLN A CA   1  
ATOM 4000  C C    . GLN A 1 273 ? 47.983   -24.032  -67.259  1.00 0.00 ? 268 GLN A C    1  
ATOM 4001  O O    . GLN A 1 273 ? 46.938   -24.622  -67.070  1.00 0.00 ? 268 GLN A O    1  
ATOM 4002  C CB   . GLN A 1 273 ? 50.002   -25.397  -67.880  1.00 0.00 ? 268 GLN A CB   1  
ATOM 4003  C CG   . GLN A 1 273 ? 49.401   -26.793  -67.712  1.00 0.00 ? 268 GLN A CG   1  
ATOM 4004  C CD   . GLN A 1 273 ? 50.490   -27.768  -67.261  1.00 0.00 ? 268 GLN A CD   1  
ATOM 4005  O OE1  . GLN A 1 273 ? 50.369   -28.397  -66.229  1.00 0.00 ? 268 GLN A OE1  1  
ATOM 4006  N NE2  . GLN A 1 273 ? 51.558   -27.919  -67.996  1.00 0.00 ? 268 GLN A NE2  1  
ATOM 4007  H H    . GLN A 1 273 ? 50.658   -23.262  -68.916  1.00 0.00 ? 268 GLN A H    1  
ATOM 4008  H HA   . GLN A 1 273 ? 48.375   -24.902  -69.197  1.00 0.00 ? 268 GLN A HA   1  
ATOM 4009  H HB2  . GLN A 1 273 ? 50.817   -25.437  -68.588  1.00 0.00 ? 268 GLN A HB2  1  
ATOM 4010  H HB3  . GLN A 1 273 ? 50.369   -25.047  -66.927  1.00 0.00 ? 268 GLN A HB3  1  
ATOM 4011  H HG2  . GLN A 1 273 ? 48.616   -26.760  -66.970  1.00 0.00 ? 268 GLN A HG2  1  
ATOM 4012  H HG3  . GLN A 1 273 ? 48.992   -27.125  -68.655  1.00 0.00 ? 268 GLN A HG3  1  
ATOM 4013  H HE21 . GLN A 1 273 ? 51.657   -27.411  -68.828  1.00 0.00 ? 268 GLN A HE21 1  
ATOM 4014  H HE22 . GLN A 1 273 ? 52.262   -28.541  -67.715  1.00 0.00 ? 268 GLN A HE22 1  
ATOM 4015  N N    . LEU A 1 274 ? 48.341   -23.026  -66.505  1.00 0.00 ? 269 LEU A N    1  
ATOM 4016  C CA   . LEU A 1 274 ? 47.460   -22.580  -65.387  1.00 0.00 ? 269 LEU A CA   1  
ATOM 4017  C C    . LEU A 1 274 ? 46.884   -21.202  -65.700  1.00 0.00 ? 269 LEU A C    1  
ATOM 4018  O O    . LEU A 1 274 ? 45.783   -20.877  -65.309  1.00 0.00 ? 269 LEU A O    1  
ATOM 4019  C CB   . LEU A 1 274 ? 48.368   -22.510  -64.159  1.00 0.00 ? 269 LEU A CB   1  
ATOM 4020  C CG   . LEU A 1 274 ? 47.515   -22.503  -62.886  1.00 0.00 ? 269 LEU A CG   1  
ATOM 4021  C CD1  . LEU A 1 274 ? 47.196   -23.942  -62.480  1.00 0.00 ? 269 LEU A CD1  1  
ATOM 4022  C CD2  . LEU A 1 274 ? 48.287   -21.814  -61.757  1.00 0.00 ? 269 LEU A CD2  1  
ATOM 4023  H H    . LEU A 1 274 ? 49.186   -22.559  -66.678  1.00 0.00 ? 269 LEU A H    1  
ATOM 4024  H HA   . LEU A 1 274 ? 46.668   -23.294  -65.222  1.00 0.00 ? 269 LEU A HA   1  
ATOM 4025  H HB2  . LEU A 1 274 ? 49.025   -23.368  -64.148  1.00 0.00 ? 269 LEU A HB2  1  
ATOM 4026  H HB3  . LEU A 1 274 ? 48.958   -21.606  -64.199  1.00 0.00 ? 269 LEU A HB3  1  
ATOM 4027  H HG   . LEU A 1 274 ? 46.590   -21.970  -63.069  1.00 0.00 ? 269 LEU A HG   1  
ATOM 4028  H HD11 . LEU A 1 274 ? 47.015   -24.534  -63.365  1.00 0.00 ? 269 LEU A HD11 1  
ATOM 4029  H HD12 . LEU A 1 274 ? 46.317   -23.952  -61.854  1.00 0.00 ? 269 LEU A HD12 1  
ATOM 4030  H HD13 . LEU A 1 274 ? 48.032   -24.356  -61.936  1.00 0.00 ? 269 LEU A HD13 1  
ATOM 4031  H HD21 . LEU A 1 274 ? 49.115   -21.259  -62.172  1.00 0.00 ? 269 LEU A HD21 1  
ATOM 4032  H HD22 . LEU A 1 274 ? 48.661   -22.558  -61.071  1.00 0.00 ? 269 LEU A HD22 1  
ATOM 4033  H HD23 . LEU A 1 274 ? 47.628   -21.139  -61.231  1.00 0.00 ? 269 LEU A HD23 1  
ATOM 4034  N N    . LEU A 1 275 ? 47.627   -20.388  -66.403  1.00 0.00 ? 270 LEU A N    1  
ATOM 4035  C CA   . LEU A 1 275 ? 47.134   -19.019  -66.743  1.00 0.00 ? 270 LEU A CA   1  
ATOM 4036  C C    . LEU A 1 275 ? 45.734   -19.086  -67.355  1.00 0.00 ? 270 LEU A C    1  
ATOM 4037  O O    . LEU A 1 275 ? 44.868   -18.292  -67.035  1.00 0.00 ? 270 LEU A O    1  
ATOM 4038  C CB   . LEU A 1 275 ? 48.140   -18.475  -67.758  1.00 0.00 ? 270 LEU A CB   1  
ATOM 4039  C CG   . LEU A 1 275 ? 48.228   -16.952  -67.633  1.00 0.00 ? 270 LEU A CG   1  
ATOM 4040  C CD1  . LEU A 1 275 ? 48.562   -16.574  -66.189  1.00 0.00 ? 270 LEU A CD1  1  
ATOM 4041  C CD2  . LEU A 1 275 ? 49.325   -16.432  -68.563  1.00 0.00 ? 270 LEU A CD2  1  
ATOM 4042  H H    . LEU A 1 275 ? 48.515   -20.676  -66.704  1.00 0.00 ? 270 LEU A H    1  
ATOM 4043  H HA   . LEU A 1 275 ? 47.125   -18.398  -65.862  1.00 0.00 ? 270 LEU A HA   1  
ATOM 4044  H HB2  . LEU A 1 275 ? 49.111   -18.908  -67.567  1.00 0.00 ? 270 LEU A HB2  1  
ATOM 4045  H HB3  . LEU A 1 275 ? 47.820   -18.734  -68.756  1.00 0.00 ? 270 LEU A HB3  1  
ATOM 4046  H HG   . LEU A 1 275 ? 47.280   -16.513  -67.910  1.00 0.00 ? 270 LEU A HG   1  
ATOM 4047  H HD11 . LEU A 1 275 ? 49.106   -17.384  -65.725  1.00 0.00 ? 270 LEU A HD11 1  
ATOM 4048  H HD12 . LEU A 1 275 ? 47.646   -16.399  -65.644  1.00 0.00 ? 270 LEU A HD12 1  
ATOM 4049  H HD13 . LEU A 1 275 ? 49.167   -15.679  -66.179  1.00 0.00 ? 270 LEU A HD13 1  
ATOM 4050  H HD21 . LEU A 1 275 ? 49.806   -15.578  -68.109  1.00 0.00 ? 270 LEU A HD21 1  
ATOM 4051  H HD22 . LEU A 1 275 ? 48.889   -16.141  -69.507  1.00 0.00 ? 270 LEU A HD22 1  
ATOM 4052  H HD23 . LEU A 1 275 ? 50.055   -17.211  -68.728  1.00 0.00 ? 270 LEU A HD23 1  
ATOM 4053  N N    . GLN A 1 276 ? 45.499   -20.036  -68.220  1.00 0.00 ? 271 GLN A N    1  
ATOM 4054  C CA   . GLN A 1 276 ? 44.147   -20.160  -68.838  1.00 0.00 ? 271 GLN A CA   1  
ATOM 4055  C C    . GLN A 1 276 ? 43.093   -20.425  -67.755  1.00 0.00 ? 271 GLN A C    1  
ATOM 4056  O O    . GLN A 1 276 ? 41.906   -20.404  -68.015  1.00 0.00 ? 271 GLN A O    1  
ATOM 4057  C CB   . GLN A 1 276 ? 44.247   -21.351  -69.797  1.00 0.00 ? 271 GLN A CB   1  
ATOM 4058  C CG   . GLN A 1 276 ? 44.645   -22.613  -69.023  1.00 0.00 ? 271 GLN A CG   1  
ATOM 4059  C CD   . GLN A 1 276 ? 43.883   -23.820  -69.576  1.00 0.00 ? 271 GLN A CD   1  
ATOM 4060  O OE1  . GLN A 1 276 ? 43.216   -23.723  -70.588  1.00 0.00 ? 271 GLN A OE1  1  
ATOM 4061  N NE2  . GLN A 1 276 ? 43.954   -24.962  -68.950  1.00 0.00 ? 271 GLN A NE2  1  
ATOM 4062  H H    . GLN A 1 276 ? 46.207   -20.672  -68.455  1.00 0.00 ? 271 GLN A H    1  
ATOM 4063  H HA   . GLN A 1 276 ? 43.902   -19.265  -69.388  1.00 0.00 ? 271 GLN A HA   1  
ATOM 4064  H HB2  . GLN A 1 276 ? 43.290   -21.508  -70.274  1.00 0.00 ? 271 GLN A HB2  1  
ATOM 4065  H HB3  . GLN A 1 276 ? 44.993   -21.143  -70.550  1.00 0.00 ? 271 GLN A HB3  1  
ATOM 4066  H HG2  . GLN A 1 276 ? 45.707   -22.779  -69.130  1.00 0.00 ? 271 GLN A HG2  1  
ATOM 4067  H HG3  . GLN A 1 276 ? 44.405   -22.487  -67.978  1.00 0.00 ? 271 GLN A HG3  1  
ATOM 4068  H HE21 . GLN A 1 276 ? 44.492   -25.042  -68.135  1.00 0.00 ? 271 GLN A HE21 1  
ATOM 4069  H HE22 . GLN A 1 276 ? 43.470   -25.741  -69.296  1.00 0.00 ? 271 GLN A HE22 1  
ATOM 4070  N N    . GLN A 1 277 ? 43.519   -20.676  -66.541  1.00 0.00 ? 272 GLN A N    1  
ATOM 4071  C CA   . GLN A 1 277 ? 42.542   -20.943  -65.448  1.00 0.00 ? 272 GLN A CA   1  
ATOM 4072  C C    . GLN A 1 277 ? 42.682   -19.891  -64.345  1.00 0.00 ? 272 GLN A C    1  
ATOM 4073  O O    . GLN A 1 277 ? 41.715   -19.507  -63.721  1.00 0.00 ? 272 GLN A O    1  
ATOM 4074  C CB   . GLN A 1 277 ? 42.911   -22.329  -64.918  1.00 0.00 ? 272 GLN A CB   1  
ATOM 4075  C CG   . GLN A 1 277 ? 41.736   -22.900  -64.122  1.00 0.00 ? 272 GLN A CG   1  
ATOM 4076  C CD   . GLN A 1 277 ? 40.826   -23.700  -65.057  1.00 0.00 ? 272 GLN A CD   1  
ATOM 4077  O OE1  . GLN A 1 277 ? 40.585   -23.299  -66.178  1.00 0.00 ? 272 GLN A OE1  1  
ATOM 4078  N NE2  . GLN A 1 277 ? 40.308   -24.822  -64.640  1.00 0.00 ? 272 GLN A NE2  1  
ATOM 4079  H H    . GLN A 1 277 ? 44.480   -20.690  -66.349  1.00 0.00 ? 272 GLN A H    1  
ATOM 4080  H HA   . GLN A 1 277 ? 41.536   -20.952  -65.835  1.00 0.00 ? 272 GLN A HA   1  
ATOM 4081  H HB2  . GLN A 1 277 ? 43.137   -22.983  -65.748  1.00 0.00 ? 272 GLN A HB2  1  
ATOM 4082  H HB3  . GLN A 1 277 ? 43.774   -22.251  -64.275  1.00 0.00 ? 272 GLN A HB3  1  
ATOM 4083  H HG2  . GLN A 1 277 ? 42.111   -23.547  -63.342  1.00 0.00 ? 272 GLN A HG2  1  
ATOM 4084  H HG3  . GLN A 1 277 ? 41.173   -22.092  -63.681  1.00 0.00 ? 272 GLN A HG3  1  
ATOM 4085  H HE21 . GLN A 1 277 ? 40.503   -25.146  -63.736  1.00 0.00 ? 272 GLN A HE21 1  
ATOM 4086  H HE22 . GLN A 1 277 ? 39.724   -25.342  -65.231  1.00 0.00 ? 272 GLN A HE22 1  
ATOM 4087  N N    . ILE A 1 278 ? 43.879   -19.420  -64.102  1.00 0.00 ? 273 ILE A N    1  
ATOM 4088  C CA   . ILE A 1 278 ? 44.079   -18.391  -63.038  1.00 0.00 ? 273 ILE A CA   1  
ATOM 4089  C C    . ILE A 1 278 ? 43.253   -17.142  -63.355  1.00 0.00 ? 273 ILE A C    1  
ATOM 4090  O O    . ILE A 1 278 ? 42.783   -16.457  -62.468  1.00 0.00 ? 273 ILE A O    1  
ATOM 4091  C CB   . ILE A 1 278 ? 45.577   -18.071  -63.060  1.00 0.00 ? 273 ILE A CB   1  
ATOM 4092  C CG1  . ILE A 1 278 ? 46.373   -19.334  -62.720  1.00 0.00 ? 273 ILE A CG1  1  
ATOM 4093  C CG2  . ILE A 1 278 ? 45.891   -16.985  -62.025  1.00 0.00 ? 273 ILE A CG2  1  
ATOM 4094  C CD1  . ILE A 1 278 ? 47.829   -19.158  -63.160  1.00 0.00 ? 273 ILE A CD1  1  
ATOM 4095  H H    . ILE A 1 278 ? 44.643   -19.742  -64.620  1.00 0.00 ? 273 ILE A H    1  
ATOM 4096  H HA   . ILE A 1 278 ? 43.801   -18.789  -62.074  1.00 0.00 ? 273 ILE A HA   1  
ATOM 4097  H HB   . ILE A 1 278 ? 45.855   -17.721  -64.043  1.00 0.00 ? 273 ILE A HB   1  
ATOM 4098  H HG12 . ILE A 1 278 ? 46.336   -19.505  -61.654  1.00 0.00 ? 273 ILE A HG12 1  
ATOM 4099  H HG13 . ILE A 1 278 ? 45.943   -20.178  -63.234  1.00 0.00 ? 273 ILE A HG13 1  
ATOM 4100  H HG21 . ILE A 1 278 ? 45.033   -16.834  -61.387  1.00 0.00 ? 273 ILE A HG21 1  
ATOM 4101  H HG22 . ILE A 1 278 ? 46.128   -16.062  -62.533  1.00 0.00 ? 273 ILE A HG22 1  
ATOM 4102  H HG23 . ILE A 1 278 ? 46.736   -17.292  -61.425  1.00 0.00 ? 273 ILE A HG23 1  
ATOM 4103  H HD11 . ILE A 1 278 ? 48.049   -19.850  -63.959  1.00 0.00 ? 273 ILE A HD11 1  
ATOM 4104  H HD12 . ILE A 1 278 ? 48.483   -19.355  -62.323  1.00 0.00 ? 273 ILE A HD12 1  
ATOM 4105  H HD13 . ILE A 1 278 ? 47.983   -18.147  -63.507  1.00 0.00 ? 273 ILE A HD13 1  
ATOM 4106  N N    . SER A 1 279 ? 43.068   -16.844  -64.615  1.00 0.00 ? 274 SER A N    1  
ATOM 4107  C CA   . SER A 1 279 ? 42.265   -15.640  -64.984  1.00 0.00 ? 274 SER A CA   1  
ATOM 4108  C C    . SER A 1 279 ? 40.849   -15.764  -64.415  1.00 0.00 ? 274 SER A C    1  
ATOM 4109  O O    . SER A 1 279 ? 40.201   -14.781  -64.115  1.00 0.00 ? 274 SER A O    1  
ATOM 4110  C CB   . SER A 1 279 ? 42.233   -15.633  -66.512  1.00 0.00 ? 274 SER A CB   1  
ATOM 4111  O OG   . SER A 1 279 ? 41.728   -16.878  -66.976  1.00 0.00 ? 274 SER A OG   1  
ATOM 4112  H H    . SER A 1 279 ? 43.452   -17.412  -65.315  1.00 0.00 ? 274 SER A H    1  
ATOM 4113  H HA   . SER A 1 279 ? 42.740   -14.744  -64.618  1.00 0.00 ? 274 SER A HA   1  
ATOM 4114  H HB2  . SER A 1 279 ? 41.591   -14.839  -66.857  1.00 0.00 ? 274 SER A HB2  1  
ATOM 4115  H HB3  . SER A 1 279 ? 43.233   -15.474  -66.891  1.00 0.00 ? 274 SER A HB3  1  
ATOM 4116  H HG   . SER A 1 279 ? 42.152   -17.077  -67.814  1.00 0.00 ? 274 SER A HG   1  
ATOM 4117  N N    . ARG A 1 280 ? 40.371   -16.969  -64.261  1.00 0.00 ? 275 ARG A N    1  
ATOM 4118  C CA   . ARG A 1 280 ? 39.002   -17.170  -63.705  1.00 0.00 ? 275 ARG A CA   1  
ATOM 4119  C C    . ARG A 1 280 ? 39.082   -17.840  -62.329  1.00 0.00 ? 275 ARG A C    1  
ATOM 4120  O O    . ARG A 1 280 ? 38.119   -17.870  -61.587  1.00 0.00 ? 275 ARG A O    1  
ATOM 4121  C CB   . ARG A 1 280 ? 38.299   -18.087  -64.707  1.00 0.00 ? 275 ARG A CB   1  
ATOM 4122  C CG   . ARG A 1 280 ? 37.975   -17.303  -65.979  1.00 0.00 ? 275 ARG A CG   1  
ATOM 4123  C CD   . ARG A 1 280 ? 37.230   -18.210  -66.962  1.00 0.00 ? 275 ARG A CD   1  
ATOM 4124  N NE   . ARG A 1 280 ? 35.866   -18.363  -66.385  1.00 0.00 ? 275 ARG A NE   1  
ATOM 4125  C CZ   . ARG A 1 280 ? 34.835   -18.488  -67.174  1.00 0.00 ? 275 ARG A CZ   1  
ATOM 4126  N NH1  . ARG A 1 280 ? 34.247   -17.426  -67.652  1.00 0.00 ? 275 ARG A NH1  1  
ATOM 4127  N NH2  . ARG A 1 280 ? 34.391   -19.676  -67.485  1.00 0.00 ? 275 ARG A NH2  1  
ATOM 4128  H H    . ARG A 1 280 ? 40.916   -17.746  -64.506  1.00 0.00 ? 275 ARG A H    1  
ATOM 4129  H HA   . ARG A 1 280 ? 38.480   -16.228  -63.638  1.00 0.00 ? 275 ARG A HA   1  
ATOM 4130  H HB2  . ARG A 1 280 ? 38.947   -18.917  -64.949  1.00 0.00 ? 275 ARG A HB2  1  
ATOM 4131  H HB3  . ARG A 1 280 ? 37.383   -18.459  -64.273  1.00 0.00 ? 275 ARG A HB3  1  
ATOM 4132  H HG2  . ARG A 1 280 ? 37.355   -16.454  -65.731  1.00 0.00 ? 275 ARG A HG2  1  
ATOM 4133  H HG3  . ARG A 1 280 ? 38.892   -16.959  -66.434  1.00 0.00 ? 275 ARG A HG3  1  
ATOM 4134  H HD2  . ARG A 1 280 ? 37.179   -17.744  -67.937  1.00 0.00 ? 275 ARG A HD2  1  
ATOM 4135  H HD3  . ARG A 1 280 ? 37.715   -19.171  -67.028  1.00 0.00 ? 275 ARG A HD3  1  
ATOM 4136  H HE   . ARG A 1 280 ? 35.744   -18.371  -65.412  1.00 0.00 ? 275 ARG A HE   1  
ATOM 4137  H HH11 . ARG A 1 280 ? 34.588   -16.516  -67.414  1.00 0.00 ? 275 ARG A HH11 1  
ATOM 4138  H HH12 . ARG A 1 280 ? 33.457   -17.521  -68.257  1.00 0.00 ? 275 ARG A HH12 1  
ATOM 4139  H HH21 . ARG A 1 280 ? 34.841   -20.490  -67.118  1.00 0.00 ? 275 ARG A HH21 1  
ATOM 4140  H HH22 . ARG A 1 280 ? 33.600   -19.771  -68.090  1.00 0.00 ? 275 ARG A HH22 1  
ATOM 4141  N N    . HIS A 1 281 ? 40.223   -18.379  -61.983  1.00 0.00 ? 276 HIS A N    1  
ATOM 4142  C CA   . HIS A 1 281 ? 40.366   -19.047  -60.658  1.00 0.00 ? 276 HIS A CA   1  
ATOM 4143  C C    . HIS A 1 281 ? 41.226   -18.196  -59.720  1.00 0.00 ? 276 HIS A C    1  
ATOM 4144  O O    . HIS A 1 281 ? 41.717   -18.674  -58.718  1.00 0.00 ? 276 HIS A O    1  
ATOM 4145  C CB   . HIS A 1 281 ? 41.060   -20.378  -60.957  1.00 0.00 ? 276 HIS A CB   1  
ATOM 4146  C CG   . HIS A 1 281 ? 40.073   -21.330  -61.576  1.00 0.00 ? 276 HIS A CG   1  
ATOM 4147  N ND1  . HIS A 1 281 ? 40.004   -22.664  -61.208  1.00 0.00 ? 276 HIS A ND1  1  
ATOM 4148  C CD2  . HIS A 1 281 ? 39.109   -21.155  -62.537  1.00 0.00 ? 276 HIS A CD2  1  
ATOM 4149  C CE1  . HIS A 1 281 ? 39.028   -23.236  -61.938  1.00 0.00 ? 276 HIS A CE1  1  
ATOM 4150  N NE2  . HIS A 1 281 ? 38.450   -22.360  -62.764  1.00 0.00 ? 276 HIS A NE2  1  
ATOM 4151  H H    . HIS A 1 281 ? 40.986   -18.344  -62.595  1.00 0.00 ? 276 HIS A H    1  
ATOM 4152  H HA   . HIS A 1 281 ? 39.397   -19.228  -60.221  1.00 0.00 ? 276 HIS A HA   1  
ATOM 4153  H HB2  . HIS A 1 281 ? 41.881   -20.213  -61.640  1.00 0.00 ? 276 HIS A HB2  1  
ATOM 4154  H HB3  . HIS A 1 281 ? 41.438   -20.801  -60.038  1.00 0.00 ? 276 HIS A HB3  1  
ATOM 4155  H HD1  . HIS A 1 281 ? 40.564   -23.111  -60.539  1.00 0.00 ? 276 HIS A HD1  1  
ATOM 4156  H HD2  . HIS A 1 281 ? 38.894   -20.224  -63.041  1.00 0.00 ? 276 HIS A HD2  1  
ATOM 4157  H HE1  . HIS A 1 281 ? 38.747   -24.276  -61.864  1.00 0.00 ? 276 HIS A HE1  1  
ATOM 4158  N N    . GLN A 1 282 ? 41.415   -16.939  -60.033  1.00 0.00 ? 277 GLN A N    1  
ATOM 4159  C CA   . GLN A 1 282 ? 42.247   -16.066  -59.149  1.00 0.00 ? 277 GLN A CA   1  
ATOM 4160  C C    . GLN A 1 282 ? 41.756   -16.158  -57.699  1.00 0.00 ? 277 GLN A C    1  
ATOM 4161  O O    . GLN A 1 282 ? 42.515   -15.993  -56.765  1.00 0.00 ? 277 GLN A O    1  
ATOM 4162  C CB   . GLN A 1 282 ? 42.053   -14.647  -59.691  1.00 0.00 ? 277 GLN A CB   1  
ATOM 4163  C CG   . GLN A 1 282 ? 43.346   -14.168  -60.353  1.00 0.00 ? 277 GLN A CG   1  
ATOM 4164  C CD   . GLN A 1 282 ? 43.127   -12.780  -60.958  1.00 0.00 ? 277 GLN A CD   1  
ATOM 4165  O OE1  . GLN A 1 282 ? 43.513   -11.784  -60.378  1.00 0.00 ? 277 GLN A OE1  1  
ATOM 4166  N NE2  . GLN A 1 282 ? 42.519   -12.672  -62.107  1.00 0.00 ? 277 GLN A NE2  1  
ATOM 4167  H H    . GLN A 1 282 ? 41.012   -16.569  -60.847  1.00 0.00 ? 277 GLN A H    1  
ATOM 4168  H HA   . GLN A 1 282 ? 43.286   -16.347  -59.213  1.00 0.00 ? 277 GLN A HA   1  
ATOM 4169  H HB2  . GLN A 1 282 ? 41.254   -14.645  -60.418  1.00 0.00 ? 277 GLN A HB2  1  
ATOM 4170  H HB3  . GLN A 1 282 ? 41.800   -13.982  -58.878  1.00 0.00 ? 277 GLN A HB3  1  
ATOM 4171  H HG2  . GLN A 1 282 ? 44.133   -14.119  -59.613  1.00 0.00 ? 277 GLN A HG2  1  
ATOM 4172  H HG3  . GLN A 1 282 ? 43.628   -14.858  -61.134  1.00 0.00 ? 277 GLN A HG3  1  
ATOM 4173  H HE21 . GLN A 1 282 ? 42.207   -13.475  -62.574  1.00 0.00 ? 277 GLN A HE21 1  
ATOM 4174  H HE22 . GLN A 1 282 ? 42.374   -11.787  -62.503  1.00 0.00 ? 277 GLN A HE22 1  
ATOM 4175  N N    . GLU A 1 283 ? 40.493   -16.426  -57.509  1.00 0.00 ? 278 GLU A N    1  
ATOM 4176  C CA   . GLU A 1 283 ? 39.950   -16.533  -56.123  1.00 0.00 ? 278 GLU A CA   1  
ATOM 4177  C C    . GLU A 1 283 ? 40.402   -17.843  -55.472  1.00 0.00 ? 278 GLU A C    1  
ATOM 4178  O O    . GLU A 1 283 ? 40.986   -17.847  -54.406  1.00 0.00 ? 278 GLU A O    1  
ATOM 4179  C CB   . GLU A 1 283 ? 38.431   -16.520  -56.292  1.00 0.00 ? 278 GLU A CB   1  
ATOM 4180  C CG   . GLU A 1 283 ? 37.963   -15.101  -56.618  1.00 0.00 ? 278 GLU A CG   1  
ATOM 4181  C CD   . GLU A 1 283 ? 36.580   -15.156  -57.269  1.00 0.00 ? 278 GLU A CD   1  
ATOM 4182  O OE1  . GLU A 1 283 ? 36.433   -15.878  -58.240  1.00 0.00 ? 278 GLU A OE1  1  
ATOM 4183  O OE2  . GLU A 1 283 ? 35.692   -14.474  -56.784  1.00 0.00 ? 278 GLU A OE2  1  
ATOM 4184  H H    . GLU A 1 283 ? 39.900   -16.559  -58.278  1.00 0.00 ? 278 GLU A H    1  
ATOM 4185  H HA   . GLU A 1 283 ? 40.261   -15.688  -55.529  1.00 0.00 ? 278 GLU A HA   1  
ATOM 4186  H HB2  . GLU A 1 283 ? 38.155   -17.186  -57.097  1.00 0.00 ? 278 GLU A HB2  1  
ATOM 4187  H HB3  . GLU A 1 283 ? 37.964   -16.850  -55.376  1.00 0.00 ? 278 GLU A HB3  1  
ATOM 4188  H HG2  . GLU A 1 283 ? 37.912   -14.521  -55.707  1.00 0.00 ? 278 GLU A HG2  1  
ATOM 4189  H HG3  . GLU A 1 283 ? 38.662   -14.639  -57.300  1.00 0.00 ? 278 GLU A HG3  1  
ATOM 4190  N N    . GLN A 1 284 ? 40.129   -18.954  -56.103  1.00 0.00 ? 279 GLN A N    1  
ATOM 4191  C CA   . GLN A 1 284 ? 40.534   -20.268  -55.520  1.00 0.00 ? 279 GLN A CA   1  
ATOM 4192  C C    . GLN A 1 284 ? 42.056   -20.436  -55.574  1.00 0.00 ? 279 GLN A C    1  
ATOM 4193  O O    . GLN A 1 284 ? 42.679   -20.829  -54.607  1.00 0.00 ? 279 GLN A O    1  
ATOM 4194  C CB   . GLN A 1 284 ? 39.852   -21.318  -56.398  1.00 0.00 ? 279 GLN A CB   1  
ATOM 4195  C CG   . GLN A 1 284 ? 38.348   -21.318  -56.121  1.00 0.00 ? 279 GLN A CG   1  
ATOM 4196  C CD   . GLN A 1 284 ? 37.757   -22.674  -56.512  1.00 0.00 ? 279 GLN A CD   1  
ATOM 4197  O OE1  . GLN A 1 284 ? 38.205   -23.701  -56.044  1.00 0.00 ? 279 GLN A OE1  1  
ATOM 4198  N NE2  . GLN A 1 284 ? 36.764   -22.720  -57.357  1.00 0.00 ? 279 GLN A NE2  1  
ATOM 4199  H H    . GLN A 1 284 ? 39.653   -18.924  -56.959  1.00 0.00 ? 279 GLN A H    1  
ATOM 4200  H HA   . GLN A 1 284 ? 40.182   -20.354  -54.505  1.00 0.00 ? 279 GLN A HA   1  
ATOM 4201  H HB2  . GLN A 1 284 ? 40.028   -21.085  -57.439  1.00 0.00 ? 279 GLN A HB2  1  
ATOM 4202  H HB3  . GLN A 1 284 ? 40.257   -22.293  -56.174  1.00 0.00 ? 279 GLN A HB3  1  
ATOM 4203  H HG2  . GLN A 1 284 ? 38.176   -21.138  -55.070  1.00 0.00 ? 279 GLN A HG2  1  
ATOM 4204  H HG3  . GLN A 1 284 ? 37.874   -20.540  -56.702  1.00 0.00 ? 279 GLN A HG3  1  
ATOM 4205  H HE21 . GLN A 1 284 ? 36.403   -21.891  -57.735  1.00 0.00 ? 279 GLN A HE21 1  
ATOM 4206  H HE22 . GLN A 1 284 ? 36.379   -23.584  -57.613  1.00 0.00 ? 279 GLN A HE22 1  
ATOM 4207  N N    . PHE A 1 285 ? 42.657   -20.150  -56.699  1.00 0.00 ? 280 PHE A N    1  
ATOM 4208  C CA   . PHE A 1 285 ? 44.140   -20.302  -56.817  1.00 0.00 ? 280 PHE A CA   1  
ATOM 4209  C C    . PHE A 1 285 ? 44.850   -19.529  -55.700  1.00 0.00 ? 280 PHE A C    1  
ATOM 4210  O O    . PHE A 1 285 ? 45.812   -20.001  -55.125  1.00 0.00 ? 280 PHE A O    1  
ATOM 4211  C CB   . PHE A 1 285 ? 44.498   -19.723  -58.191  1.00 0.00 ? 280 PHE A CB   1  
ATOM 4212  C CG   . PHE A 1 285 ? 45.989   -19.837  -58.424  1.00 0.00 ? 280 PHE A CG   1  
ATOM 4213  C CD1  . PHE A 1 285 ? 46.678   -20.996  -58.042  1.00 0.00 ? 280 PHE A CD1  1  
ATOM 4214  C CD2  . PHE A 1 285 ? 46.683   -18.781  -59.027  1.00 0.00 ? 280 PHE A CD2  1  
ATOM 4215  C CE1  . PHE A 1 285 ? 48.056   -21.098  -58.263  1.00 0.00 ? 280 PHE A CE1  1  
ATOM 4216  C CE2  . PHE A 1 285 ? 48.062   -18.882  -59.247  1.00 0.00 ? 280 PHE A CE2  1  
ATOM 4217  C CZ   . PHE A 1 285 ? 48.748   -20.041  -58.865  1.00 0.00 ? 280 PHE A CZ   1  
ATOM 4218  H H    . PHE A 1 285 ? 42.133   -19.841  -57.466  1.00 0.00 ? 280 PHE A H    1  
ATOM 4219  H HA   . PHE A 1 285 ? 44.411   -21.345  -56.779  1.00 0.00 ? 280 PHE A HA   1  
ATOM 4220  H HB2  . PHE A 1 285 ? 43.973   -20.272  -58.960  1.00 0.00 ? 280 PHE A HB2  1  
ATOM 4221  H HB3  . PHE A 1 285 ? 44.207   -18.684  -58.230  1.00 0.00 ? 280 PHE A HB3  1  
ATOM 4222  H HD1  . PHE A 1 285 ? 46.145   -21.812  -57.576  1.00 0.00 ? 280 PHE A HD1  1  
ATOM 4223  H HD2  . PHE A 1 285 ? 46.154   -17.887  -59.323  1.00 0.00 ? 280 PHE A HD2  1  
ATOM 4224  H HE1  . PHE A 1 285 ? 48.586   -21.992  -57.968  1.00 0.00 ? 280 PHE A HE1  1  
ATOM 4225  H HE2  . PHE A 1 285 ? 48.596   -18.067  -59.712  1.00 0.00 ? 280 PHE A HE2  1  
ATOM 4226  H HZ   . PHE A 1 285 ? 49.812   -20.119  -59.035  1.00 0.00 ? 280 PHE A HZ   1  
ATOM 4227  N N    . ILE A 1 286 ? 44.380   -18.351  -55.381  1.00 0.00 ? 281 ILE A N    1  
ATOM 4228  C CA   . ILE A 1 286 ? 45.031   -17.564  -54.293  1.00 0.00 ? 281 ILE A CA   1  
ATOM 4229  C C    . ILE A 1 286 ? 44.608   -18.124  -52.932  1.00 0.00 ? 281 ILE A C    1  
ATOM 4230  O O    . ILE A 1 286 ? 45.377   -18.144  -51.989  1.00 0.00 ? 281 ILE A O    1  
ATOM 4231  C CB   . ILE A 1 286 ? 44.527   -16.131  -54.474  1.00 0.00 ? 281 ILE A CB   1  
ATOM 4232  C CG1  . ILE A 1 286 ? 45.034   -15.582  -55.810  1.00 0.00 ? 281 ILE A CG1  1  
ATOM 4233  C CG2  . ILE A 1 286 ? 45.053   -15.254  -53.334  1.00 0.00 ? 281 ILE A CG2  1  
ATOM 4234  C CD1  . ILE A 1 286 ? 44.429   -14.199  -56.056  1.00 0.00 ? 281 ILE A CD1  1  
ATOM 4235  H H    . ILE A 1 286 ? 43.599   -17.990  -55.849  1.00 0.00 ? 281 ILE A H    1  
ATOM 4236  H HA   . ILE A 1 286 ? 46.104   -17.596  -54.396  1.00 0.00 ? 281 ILE A HA   1  
ATOM 4237  H HB   . ILE A 1 286 ? 43.447   -16.124  -54.465  1.00 0.00 ? 281 ILE A HB   1  
ATOM 4238  H HG12 . ILE A 1 286 ? 46.111   -15.505  -55.783  1.00 0.00 ? 281 ILE A HG12 1  
ATOM 4239  H HG13 . ILE A 1 286 ? 44.740   -16.248  -56.608  1.00 0.00 ? 281 ILE A HG13 1  
ATOM 4240  H HG21 . ILE A 1 286 ? 45.966   -15.679  -52.944  1.00 0.00 ? 281 ILE A HG21 1  
ATOM 4241  H HG22 . ILE A 1 286 ? 44.314   -15.205  -52.547  1.00 0.00 ? 281 ILE A HG22 1  
ATOM 4242  H HG23 . ILE A 1 286 ? 45.249   -14.259  -53.706  1.00 0.00 ? 281 ILE A HG23 1  
ATOM 4243  H HD11 . ILE A 1 286 ? 43.394   -14.199  -55.748  1.00 0.00 ? 281 ILE A HD11 1  
ATOM 4244  H HD12 . ILE A 1 286 ? 44.492   -13.960  -57.107  1.00 0.00 ? 281 ILE A HD12 1  
ATOM 4245  H HD13 . ILE A 1 286 ? 44.974   -13.461  -55.486  1.00 0.00 ? 281 ILE A HD13 1  
ATOM 4246  N N    . GLN A 1 287 ? 43.390   -18.589  -52.827  1.00 0.00 ? 282 GLN A N    1  
ATOM 4247  C CA   . GLN A 1 287 ? 42.915   -19.160  -51.532  1.00 0.00 ? 282 GLN A CA   1  
ATOM 4248  C C    . GLN A 1 287 ? 43.866   -20.269  -51.076  1.00 0.00 ? 282 GLN A C    1  
ATOM 4249  O O    . GLN A 1 287 ? 44.108   -20.449  -49.898  1.00 0.00 ? 282 GLN A O    1  
ATOM 4250  C CB   . GLN A 1 287 ? 41.527   -19.731  -51.829  1.00 0.00 ? 282 GLN A CB   1  
ATOM 4251  C CG   . GLN A 1 287 ? 40.575   -19.385  -50.683  1.00 0.00 ? 282 GLN A CG   1  
ATOM 4252  C CD   . GLN A 1 287 ? 39.798   -18.113  -51.029  1.00 0.00 ? 282 GLN A CD   1  
ATOM 4253  O OE1  . GLN A 1 287 ? 38.591   -18.069  -50.898  1.00 0.00 ? 282 GLN A OE1  1  
ATOM 4254  N NE2  . GLN A 1 287 ? 40.445   -17.068  -51.469  1.00 0.00 ? 282 GLN A NE2  1  
ATOM 4255  H H    . GLN A 1 287 ? 42.791   -18.567  -53.603  1.00 0.00 ? 282 GLN A H    1  
ATOM 4256  H HA   . GLN A 1 287 ? 42.846   -18.388  -50.782  1.00 0.00 ? 282 GLN A HA   1  
ATOM 4257  H HB2  . GLN A 1 287 ? 41.153   -19.307  -52.749  1.00 0.00 ? 282 GLN A HB2  1  
ATOM 4258  H HB3  . GLN A 1 287 ? 41.593   -20.804  -51.928  1.00 0.00 ? 282 GLN A HB3  1  
ATOM 4259  H HG2  . GLN A 1 287 ? 39.883   -20.201  -50.532  1.00 0.00 ? 282 GLN A HG2  1  
ATOM 4260  H HG3  . GLN A 1 287 ? 41.143   -19.222  -49.780  1.00 0.00 ? 282 GLN A HG3  1  
ATOM 4261  H HE21 . GLN A 1 287 ? 41.418   -17.102  -51.574  1.00 0.00 ? 282 GLN A HE21 1  
ATOM 4262  H HE22 . GLN A 1 287 ? 39.956   -16.248  -51.693  1.00 0.00 ? 282 GLN A HE22 1  
ATOM 4263  N N    . MET A 1 288 ? 44.414   -21.005  -52.006  1.00 0.00 ? 283 MET A N    1  
ATOM 4264  C CA   . MET A 1 288 ? 45.359   -22.096  -51.638  1.00 0.00 ? 283 MET A CA   1  
ATOM 4265  C C    . MET A 1 288 ? 46.754   -21.511  -51.414  1.00 0.00 ? 283 MET A C    1  
ATOM 4266  O O    . MET A 1 288 ? 47.529   -22.011  -50.621  1.00 0.00 ? 283 MET A O    1  
ATOM 4267  C CB   . MET A 1 288 ? 45.359   -23.044  -52.838  1.00 0.00 ? 283 MET A CB   1  
ATOM 4268  C CG   . MET A 1 288 ? 43.956   -23.626  -53.028  1.00 0.00 ? 283 MET A CG   1  
ATOM 4269  S SD   . MET A 1 288 ? 43.629   -23.856  -54.794  1.00 0.00 ? 283 MET A SD   1  
ATOM 4270  C CE   . MET A 1 288 ? 44.785   -25.222  -55.063  1.00 0.00 ? 283 MET A CE   1  
ATOM 4271  H H    . MET A 1 288 ? 44.209   -20.834  -52.949  1.00 0.00 ? 283 MET A H    1  
ATOM 4272  H HA   . MET A 1 288 ? 45.017   -22.614  -50.756  1.00 0.00 ? 283 MET A HA   1  
ATOM 4273  H HB2  . MET A 1 288 ? 45.649   -22.500  -53.726  1.00 0.00 ? 283 MET A HB2  1  
ATOM 4274  H HB3  . MET A 1 288 ? 46.059   -23.847  -52.663  1.00 0.00 ? 283 MET A HB3  1  
ATOM 4275  H HG2  . MET A 1 288 ? 43.891   -24.578  -52.523  1.00 0.00 ? 283 MET A HG2  1  
ATOM 4276  H HG3  . MET A 1 288 ? 43.226   -22.948  -52.612  1.00 0.00 ? 283 MET A HG3  1  
ATOM 4277  H HE1  . MET A 1 288 ? 45.097   -25.621  -54.108  1.00 0.00 ? 283 MET A HE1  1  
ATOM 4278  H HE2  . MET A 1 288 ? 45.648   -24.865  -55.601  1.00 0.00 ? 283 MET A HE2  1  
ATOM 4279  H HE3  . MET A 1 288 ? 44.298   -25.995  -55.641  1.00 0.00 ? 283 MET A HE3  1  
ATOM 4280  N N    . LEU A 1 289 ? 47.075   -20.449  -52.105  1.00 0.00 ? 284 LEU A N    1  
ATOM 4281  C CA   . LEU A 1 289 ? 48.418   -19.816  -51.936  1.00 0.00 ? 284 LEU A CA   1  
ATOM 4282  C C    . LEU A 1 289 ? 48.669   -19.500  -50.458  1.00 0.00 ? 284 LEU A C    1  
ATOM 4283  O O    . LEU A 1 289 ? 49.772   -19.633  -49.963  1.00 0.00 ? 284 LEU A O    1  
ATOM 4284  C CB   . LEU A 1 289 ? 48.355   -18.522  -52.756  1.00 0.00 ? 284 LEU A CB   1  
ATOM 4285  C CG   . LEU A 1 289 ? 49.166   -18.677  -54.048  1.00 0.00 ? 284 LEU A CG   1  
ATOM 4286  C CD1  . LEU A 1 289 ? 50.622   -19.012  -53.710  1.00 0.00 ? 284 LEU A CD1  1  
ATOM 4287  C CD2  . LEU A 1 289 ? 48.562   -19.797  -54.903  1.00 0.00 ? 284 LEU A CD2  1  
ATOM 4288  H H    . LEU A 1 289 ? 46.430   -20.064  -52.736  1.00 0.00 ? 284 LEU A H    1  
ATOM 4289  H HA   . LEU A 1 289 ? 49.190   -20.462  -52.321  1.00 0.00 ? 284 LEU A HA   1  
ATOM 4290  H HB2  . LEU A 1 289 ? 47.327   -18.304  -53.003  1.00 0.00 ? 284 LEU A HB2  1  
ATOM 4291  H HB3  . LEU A 1 289 ? 48.764   -17.709  -52.174  1.00 0.00 ? 284 LEU A HB3  1  
ATOM 4292  H HG   . LEU A 1 289 ? 49.135   -17.748  -54.599  1.00 0.00 ? 284 LEU A HG   1  
ATOM 4293  H HD11 . LEU A 1 289 ? 51.272   -18.263  -54.138  1.00 0.00 ? 284 LEU A HD11 1  
ATOM 4294  H HD12 . LEU A 1 289 ? 50.874   -19.981  -54.117  1.00 0.00 ? 284 LEU A HD12 1  
ATOM 4295  H HD13 . LEU A 1 289 ? 50.751   -19.029  -52.638  1.00 0.00 ? 284 LEU A HD13 1  
ATOM 4296  H HD21 . LEU A 1 289 ? 47.966   -19.364  -55.692  1.00 0.00 ? 284 LEU A HD21 1  
ATOM 4297  H HD22 . LEU A 1 289 ? 47.939   -20.427  -54.286  1.00 0.00 ? 284 LEU A HD22 1  
ATOM 4298  H HD23 . LEU A 1 289 ? 49.356   -20.388  -55.335  1.00 0.00 ? 284 LEU A HD23 1  
ATOM 4299  N N    . ASN A 1 290 ? 47.652   -19.081  -49.751  1.00 0.00 ? 285 ASN A N    1  
ATOM 4300  C CA   . ASN A 1 290 ? 47.829   -18.755  -48.306  1.00 0.00 ? 285 ASN A CA   1  
ATOM 4301  C C    . ASN A 1 290 ? 47.315   -19.904  -47.433  1.00 0.00 ? 285 ASN A C    1  
ATOM 4302  O O    . ASN A 1 290 ? 47.736   -20.073  -46.305  1.00 0.00 ? 285 ASN A O    1  
ATOM 4303  C CB   . ASN A 1 290 ? 46.995   -17.494  -48.079  1.00 0.00 ? 285 ASN A CB   1  
ATOM 4304  C CG   . ASN A 1 290 ? 47.826   -16.261  -48.435  1.00 0.00 ? 285 ASN A CG   1  
ATOM 4305  O OD1  . ASN A 1 290 ? 48.469   -15.680  -47.582  1.00 0.00 ? 285 ASN A OD1  1  
ATOM 4306  N ND2  . ASN A 1 290 ? 47.842   -15.833  -49.667  1.00 0.00 ? 285 ASN A ND2  1  
ATOM 4307  H H    . ASN A 1 290 ? 46.773   -18.981  -50.171  1.00 0.00 ? 285 ASN A H    1  
ATOM 4308  H HA   . ASN A 1 290 ? 48.866   -18.553  -48.090  1.00 0.00 ? 285 ASN A HA   1  
ATOM 4309  H HB2  . ASN A 1 290 ? 46.114   -17.529  -48.704  1.00 0.00 ? 285 ASN A HB2  1  
ATOM 4310  H HB3  . ASN A 1 290 ? 46.699   -17.440  -47.042  1.00 0.00 ? 285 ASN A HB3  1  
ATOM 4311  H HD21 . ASN A 1 290 ? 47.324   -16.301  -50.355  1.00 0.00 ? 285 ASN A HD21 1  
ATOM 4312  H HD22 . ASN A 1 290 ? 48.371   -15.043  -49.905  1.00 0.00 ? 285 ASN A HD22 1  
ATOM 4313  N N    . GLU A 1 291 ? 46.408   -20.694  -47.944  1.00 0.00 ? 286 GLU A N    1  
ATOM 4314  C CA   . GLU A 1 291 ? 45.868   -21.831  -47.141  1.00 0.00 ? 286 GLU A CA   1  
ATOM 4315  C C    . GLU A 1 291 ? 45.307   -22.917  -48.066  1.00 0.00 ? 286 GLU A C    1  
ATOM 4316  O O    . GLU A 1 291 ? 44.141   -22.899  -48.403  1.00 0.00 ? 286 GLU A O    1  
ATOM 4317  C CB   . GLU A 1 291 ? 44.752   -21.221  -46.292  1.00 0.00 ? 286 GLU A CB   1  
ATOM 4318  C CG   . GLU A 1 291 ? 44.654   -21.969  -44.961  1.00 0.00 ? 286 GLU A CG   1  
ATOM 4319  C CD   . GLU A 1 291 ? 43.196   -22.003  -44.500  1.00 0.00 ? 286 GLU A CD   1  
ATOM 4320  O OE1  . GLU A 1 291 ? 42.419   -22.718  -45.112  1.00 0.00 ? 286 GLU A OE1  1  
ATOM 4321  O OE2  . GLU A 1 291 ? 42.881   -21.314  -43.545  1.00 0.00 ? 286 GLU A OE2  1  
ATOM 4322  H H    . GLU A 1 291 ? 46.081   -20.541  -48.856  1.00 0.00 ? 286 GLU A H    1  
ATOM 4323  H HA   . GLU A 1 291 ? 46.636   -22.238  -46.502  1.00 0.00 ? 286 GLU A HA   1  
ATOM 4324  H HB2  . GLU A 1 291 ? 44.970   -20.179  -46.106  1.00 0.00 ? 286 GLU A HB2  1  
ATOM 4325  H HB3  . GLU A 1 291 ? 43.813   -21.303  -46.819  1.00 0.00 ? 286 GLU A HB3  1  
ATOM 4326  H HG2  . GLU A 1 291 ? 45.017   -22.978  -45.089  1.00 0.00 ? 286 GLU A HG2  1  
ATOM 4327  H HG3  . GLU A 1 291 ? 45.252   -21.462  -44.219  1.00 0.00 ? 286 GLU A HG3  1  
ATOM 4328  N N    . PRO A 1 292 ? 46.161   -23.833  -48.448  1.00 0.00 ? 287 PRO A N    1  
ATOM 4329  C CA   . PRO A 1 292 ? 45.737   -24.937  -49.343  1.00 0.00 ? 287 PRO A CA   1  
ATOM 4330  C C    . PRO A 1 292 ? 44.883   -25.953  -48.571  1.00 0.00 ? 287 PRO A C    1  
ATOM 4331  O O    . PRO A 1 292 ? 45.151   -26.232  -47.420  1.00 0.00 ? 287 PRO A O    1  
ATOM 4332  C CB   . PRO A 1 292 ? 47.056   -25.565  -49.788  1.00 0.00 ? 287 PRO A CB   1  
ATOM 4333  C CG   . PRO A 1 292 ? 48.032   -25.228  -48.706  1.00 0.00 ? 287 PRO A CG   1  
ATOM 4334  C CD   . PRO A 1 292 ? 47.583   -23.929  -48.088  1.00 0.00 ? 287 PRO A CD   1  
ATOM 4335  H HA   . PRO A 1 292 ? 45.203   -24.552  -50.196  1.00 0.00 ? 287 PRO A HA   1  
ATOM 4336  H HB2  . PRO A 1 292 ? 46.947   -26.637  -49.881  1.00 0.00 ? 287 PRO A HB2  1  
ATOM 4337  H HB3  . PRO A 1 292 ? 47.380   -25.136  -50.723  1.00 0.00 ? 287 PRO A HB3  1  
ATOM 4338  H HG2  . PRO A 1 292 ? 48.038   -26.011  -47.960  1.00 0.00 ? 287 PRO A HG2  1  
ATOM 4339  H HG3  . PRO A 1 292 ? 49.019   -25.109  -49.124  1.00 0.00 ? 287 PRO A HG3  1  
ATOM 4340  H HD2  . PRO A 1 292 ? 47.704   -23.961  -47.013  1.00 0.00 ? 287 PRO A HD2  1  
ATOM 4341  H HD3  . PRO A 1 292 ? 48.129   -23.099  -48.508  1.00 0.00 ? 287 PRO A HD3  1  
ATOM 4342  N N    . PRO A 1 293 ? 43.878   -26.475  -49.231  1.00 0.00 ? 288 PRO A N    1  
ATOM 4343  C CA   . PRO A 1 293 ? 42.984   -27.467  -48.585  1.00 0.00 ? 288 PRO A CA   1  
ATOM 4344  C C    . PRO A 1 293 ? 43.689   -28.821  -48.463  1.00 0.00 ? 288 PRO A C    1  
ATOM 4345  O O    . PRO A 1 293 ? 44.797   -28.999  -48.931  1.00 0.00 ? 288 PRO A O    1  
ATOM 4346  C CB   . PRO A 1 293 ? 41.797   -27.558  -49.539  1.00 0.00 ? 288 PRO A CB   1  
ATOM 4347  C CG   . PRO A 1 293 ? 42.336   -27.144  -50.872  1.00 0.00 ? 288 PRO A CG   1  
ATOM 4348  C CD   . PRO A 1 293 ? 43.480   -26.196  -50.618  1.00 0.00 ? 288 PRO A CD   1  
ATOM 4349  H HA   . PRO A 1 293 ? 42.657   -27.117  -47.619  1.00 0.00 ? 288 PRO A HA   1  
ATOM 4350  H HB2  . PRO A 1 293 ? 41.427   -28.573  -49.579  1.00 0.00 ? 288 PRO A HB2  1  
ATOM 4351  H HB3  . PRO A 1 293 ? 41.015   -26.882  -49.232  1.00 0.00 ? 288 PRO A HB3  1  
ATOM 4352  H HG2  . PRO A 1 293 ? 42.687   -28.013  -51.412  1.00 0.00 ? 288 PRO A HG2  1  
ATOM 4353  H HG3  . PRO A 1 293 ? 41.569   -26.642  -51.440  1.00 0.00 ? 288 PRO A HG3  1  
ATOM 4354  H HD2  . PRO A 1 293 ? 44.297   -26.400  -51.297  1.00 0.00 ? 288 PRO A HD2  1  
ATOM 4355  H HD3  . PRO A 1 293 ? 43.153   -25.173  -50.712  1.00 0.00 ? 288 PRO A HD3  1  
ATOM 4356  N N    . GLY A 1 294 ? 43.054   -29.778  -47.840  1.00 0.00 ? 289 GLY A N    1  
ATOM 4357  C CA   . GLY A 1 294 ? 43.685   -31.121  -47.689  1.00 0.00 ? 289 GLY A CA   1  
ATOM 4358  C C    . GLY A 1 294 ? 43.801   -31.471  -46.205  1.00 0.00 ? 289 GLY A C    1  
ATOM 4359  O O    . GLY A 1 294 ? 44.191   -30.655  -45.393  1.00 0.00 ? 289 GLY A O    1  
ATOM 4360  H H    . GLY A 1 294 ? 42.161   -29.613  -47.471  1.00 0.00 ? 289 GLY A H    1  
ATOM 4361  H HA2  . GLY A 1 294 ? 43.076   -31.861  -48.189  1.00 0.00 ? 289 GLY A HA2  1  
ATOM 4362  H HA3  . GLY A 1 294 ? 44.670   -31.107  -48.130  1.00 0.00 ? 289 GLY A HA3  1  
ATOM 4363  N N    . GLU A 1 295 ? 43.466   -32.682  -45.844  1.00 0.00 ? 290 GLU A N    1  
ATOM 4364  C CA   . GLU A 1 295 ? 43.557   -33.090  -44.411  1.00 0.00 ? 290 GLU A CA   1  
ATOM 4365  C C    . GLU A 1 295 ? 43.702   -34.611  -44.301  1.00 0.00 ? 290 GLU A C    1  
ATOM 4366  O O    . GLU A 1 295 ? 42.982   -35.359  -44.933  1.00 0.00 ? 290 GLU A O    1  
ATOM 4367  C CB   . GLU A 1 295 ? 42.242   -32.625  -43.779  1.00 0.00 ? 290 GLU A CB   1  
ATOM 4368  C CG   . GLU A 1 295 ? 41.061   -33.278  -44.503  1.00 0.00 ? 290 GLU A CG   1  
ATOM 4369  C CD   . GLU A 1 295 ? 39.750   -32.695  -43.972  1.00 0.00 ? 290 GLU A CD   1  
ATOM 4370  O OE1  . GLU A 1 295 ? 39.645   -31.481  -43.912  1.00 0.00 ? 290 GLU A OE1  1  
ATOM 4371  O OE2  . GLU A 1 295 ? 38.873   -33.473  -43.633  1.00 0.00 ? 290 GLU A OE2  1  
ATOM 4372  H H    . GLU A 1 295 ? 43.155   -33.324  -46.516  1.00 0.00 ? 290 GLU A H    1  
ATOM 4373  H HA   . GLU A 1 295 ? 44.389   -32.597  -43.932  1.00 0.00 ? 290 GLU A HA   1  
ATOM 4374  H HB2  . GLU A 1 295 ? 42.225   -32.907  -42.736  1.00 0.00 ? 290 GLU A HB2  1  
ATOM 4375  H HB3  . GLU A 1 295 ? 42.163   -31.552  -43.863  1.00 0.00 ? 290 GLU A HB3  1  
ATOM 4376  H HG2  . GLU A 1 295 ? 41.138   -33.085  -45.564  1.00 0.00 ? 290 GLU A HG2  1  
ATOM 4377  H HG3  . GLU A 1 295 ? 41.076   -34.343  -44.329  1.00 0.00 ? 290 GLU A HG3  1  
ATOM 4378  N N    . LEU A 1 296 ? 44.628   -35.071  -43.502  1.00 0.00 ? 291 LEU A N    1  
ATOM 4379  C CA   . LEU A 1 296 ? 44.820   -36.543  -43.349  1.00 0.00 ? 291 LEU A CA   1  
ATOM 4380  C C    . LEU A 1 296 ? 44.523   -36.969  -41.908  1.00 0.00 ? 291 LEU A C    1  
ATOM 4381  O O    . LEU A 1 296 ? 45.052   -37.948  -41.419  1.00 0.00 ? 291 LEU A O    1  
ATOM 4382  C CB   . LEU A 1 296 ? 46.292   -36.791  -43.689  1.00 0.00 ? 291 LEU A CB   1  
ATOM 4383  C CG   . LEU A 1 296 ? 46.398   -37.481  -45.052  1.00 0.00 ? 291 LEU A CG   1  
ATOM 4384  C CD1  . LEU A 1 296 ? 46.783   -36.454  -46.118  1.00 0.00 ? 291 LEU A CD1  1  
ATOM 4385  C CD2  . LEU A 1 296 ? 47.468   -38.573  -44.989  1.00 0.00 ? 291 LEU A CD2  1  
ATOM 4386  H H    . LEU A 1 296 ? 45.196   -34.449  -43.002  1.00 0.00 ? 291 LEU A H    1  
ATOM 4387  H HA   . LEU A 1 296 ? 44.186   -37.079  -44.038  1.00 0.00 ? 291 LEU A HA   1  
ATOM 4388  H HB2  . LEU A 1 296 ? 46.817   -35.847  -43.720  1.00 0.00 ? 291 LEU A HB2  1  
ATOM 4389  H HB3  . LEU A 1 296 ? 46.734   -37.423  -42.933  1.00 0.00 ? 291 LEU A HB3  1  
ATOM 4390  H HG   . LEU A 1 296 ? 45.445   -37.923  -45.307  1.00 0.00 ? 291 LEU A HG   1  
ATOM 4391  H HD11 . LEU A 1 296 ? 47.622   -35.870  -45.769  1.00 0.00 ? 291 LEU A HD11 1  
ATOM 4392  H HD12 . LEU A 1 296 ? 45.944   -35.800  -46.308  1.00 0.00 ? 291 LEU A HD12 1  
ATOM 4393  H HD13 . LEU A 1 296 ? 47.054   -36.965  -47.030  1.00 0.00 ? 291 LEU A HD13 1  
ATOM 4394  H HD21 . LEU A 1 296 ? 47.416   -39.181  -45.880  1.00 0.00 ? 291 LEU A HD21 1  
ATOM 4395  H HD22 . LEU A 1 296 ? 47.300   -39.192  -44.120  1.00 0.00 ? 291 LEU A HD22 1  
ATOM 4396  H HD23 . LEU A 1 296 ? 48.445   -38.116  -44.921  1.00 0.00 ? 291 LEU A HD23 1  
ATOM 4397  N N    . ALA A 1 297 ? 43.680   -36.240  -41.227  1.00 0.00 ? 292 ALA A N    1  
ATOM 4398  C CA   . ALA A 1 297 ? 43.347   -36.601  -39.818  1.00 0.00 ? 292 ALA A CA   1  
ATOM 4399  C C    . ALA A 1 297 ? 41.964   -36.058  -39.449  1.00 0.00 ? 292 ALA A C    1  
ATOM 4400  O O    . ALA A 1 297 ? 41.836   -35.129  -38.676  1.00 0.00 ? 292 ALA A O    1  
ATOM 4401  C CB   . ALA A 1 297 ? 44.430   -35.933  -38.970  1.00 0.00 ? 292 ALA A CB   1  
ATOM 4402  H H    . ALA A 1 297 ? 43.265   -35.456  -41.642  1.00 0.00 ? 292 ALA A H    1  
ATOM 4403  H HA   . ALA A 1 297 ? 43.380   -37.670  -39.684  1.00 0.00 ? 292 ALA A HA   1  
ATOM 4404  H HB1  . ALA A 1 297 ? 44.634   -34.946  -39.358  1.00 0.00 ? 292 ALA A HB1  1  
ATOM 4405  H HB2  . ALA A 1 297 ? 45.332   -36.527  -39.006  1.00 0.00 ? 292 ALA A HB2  1  
ATOM 4406  H HB3  . ALA A 1 297 ? 44.091   -35.856  -37.948  1.00 0.00 ? 292 ALA A HB3  1  
ATOM 4407  N N    . ASP A 1 298 ? 40.927   -36.632  -39.999  1.00 0.00 ? 293 ASP A N    1  
ATOM 4408  C CA   . ASP A 1 298 ? 39.548   -36.151  -39.683  1.00 0.00 ? 293 ASP A CA   1  
ATOM 4409  C C    . ASP A 1 298 ? 39.285   -36.246  -38.177  1.00 0.00 ? 293 ASP A C    1  
ATOM 4410  O O    . ASP A 1 298 ? 39.117   -35.248  -37.504  1.00 0.00 ? 293 ASP A O    1  
ATOM 4411  C CB   . ASP A 1 298 ? 38.613   -37.088  -40.451  1.00 0.00 ? 293 ASP A CB   1  
ATOM 4412  C CG   . ASP A 1 298 ? 37.438   -36.287  -41.015  1.00 0.00 ? 293 ASP A CG   1  
ATOM 4413  O OD1  . ASP A 1 298 ? 37.681   -35.402  -41.819  1.00 0.00 ? 293 ASP A OD1  1  
ATOM 4414  O OD2  . ASP A 1 298 ? 36.315   -36.573  -40.634  1.00 0.00 ? 293 ASP A OD2  1  
ATOM 4415  H H    . ASP A 1 298 ? 41.055   -37.379  -40.620  1.00 0.00 ? 293 ASP A H    1  
ATOM 4416  H HA   . ASP A 1 298 ? 39.416   -35.137  -40.026  1.00 0.00 ? 293 ASP A HA   1  
ATOM 4417  H HB2  . ASP A 1 298 ? 39.156   -37.553  -41.261  1.00 0.00 ? 293 ASP A HB2  1  
ATOM 4418  H HB3  . ASP A 1 298 ? 38.240   -37.850  -39.784  1.00 0.00 ? 293 ASP A HB3  1  
ATOM 4419  N N    . ILE A 1 299 ? 39.248   -37.439  -37.645  1.00 0.00 ? 294 ILE A N    1  
ATOM 4420  C CA   . ILE A 1 299 ? 38.996   -37.597  -36.181  1.00 0.00 ? 294 ILE A CA   1  
ATOM 4421  C C    . ILE A 1 299 ? 39.703   -38.848  -35.646  1.00 0.00 ? 294 ILE A C    1  
ATOM 4422  O O    . ILE A 1 299 ? 40.229   -38.850  -34.550  1.00 0.00 ? 294 ILE A O    1  
ATOM 4423  C CB   . ILE A 1 299 ? 37.476   -37.732  -36.046  1.00 0.00 ? 294 ILE A CB   1  
ATOM 4424  C CG1  . ILE A 1 299 ? 36.983   -38.922  -36.880  1.00 0.00 ? 294 ILE A CG1  1  
ATOM 4425  C CG2  . ILE A 1 299 ? 36.807   -36.448  -36.543  1.00 0.00 ? 294 ILE A CG2  1  
ATOM 4426  C CD1  . ILE A 1 299 ? 35.464   -39.059  -36.742  1.00 0.00 ? 294 ILE A CD1  1  
ATOM 4427  H H    . ILE A 1 299 ? 39.387   -38.229  -38.207  1.00 0.00 ? 294 ILE A H    1  
ATOM 4428  H HA   . ILE A 1 299 ? 39.333   -36.722  -35.648  1.00 0.00 ? 294 ILE A HA   1  
ATOM 4429  H HB   . ILE A 1 299 ? 37.222   -37.889  -35.007  1.00 0.00 ? 294 ILE A HB   1  
ATOM 4430  H HG12 . ILE A 1 299 ? 37.238   -38.764  -37.917  1.00 0.00 ? 294 ILE A HG12 1  
ATOM 4431  H HG13 . ILE A 1 299 ? 37.454   -39.827  -36.528  1.00 0.00 ? 294 ILE A HG13 1  
ATOM 4432  H HG21 . ILE A 1 299 ? 35.783   -36.420  -36.201  1.00 0.00 ? 294 ILE A HG21 1  
ATOM 4433  H HG22 . ILE A 1 299 ? 36.827   -36.426  -37.622  1.00 0.00 ? 294 ILE A HG22 1  
ATOM 4434  H HG23 . ILE A 1 299 ? 37.339   -35.592  -36.155  1.00 0.00 ? 294 ILE A HG23 1  
ATOM 4435  H HD11 . ILE A 1 299 ? 35.233   -39.948  -36.174  1.00 0.00 ? 294 ILE A HD11 1  
ATOM 4436  H HD12 . ILE A 1 299 ? 35.019   -39.134  -37.724  1.00 0.00 ? 294 ILE A HD12 1  
ATOM 4437  H HD13 . ILE A 1 299 ? 35.066   -38.194  -36.233  1.00 0.00 ? 294 ILE A HD13 1  
ATOM 4438  N N    . SER A 1 300 ? 39.720   -39.911  -36.407  1.00 0.00 ? 295 SER A N    1  
ATOM 4439  C CA   . SER A 1 300 ? 40.392   -41.158  -35.936  1.00 0.00 ? 295 SER A CA   1  
ATOM 4440  C C    . SER A 1 300 ? 40.507   -42.165  -37.085  1.00 0.00 ? 295 SER A C    1  
ATOM 4441  O O    . SER A 1 300 ? 39.970   -43.254  -37.023  1.00 0.00 ? 295 SER A O    1  
ATOM 4442  C CB   . SER A 1 300 ? 39.486   -41.704  -34.834  1.00 0.00 ? 295 SER A CB   1  
ATOM 4443  O OG   . SER A 1 300 ? 39.953   -41.244  -33.572  1.00 0.00 ? 295 SER A OG   1  
ATOM 4444  H H    . SER A 1 300 ? 39.289   -39.891  -37.286  1.00 0.00 ? 295 SER A H    1  
ATOM 4445  H HA   . SER A 1 300 ? 41.367   -40.932  -35.534  1.00 0.00 ? 295 SER A HA   1  
ATOM 4446  H HB2  . SER A 1 300 ? 38.479   -41.356  -34.987  1.00 0.00 ? 295 SER A HB2  1  
ATOM 4447  H HB3  . SER A 1 300 ? 39.499   -42.786  -34.862  1.00 0.00 ? 295 SER A HB3  1  
ATOM 4448  H HG   . SER A 1 300 ? 40.694   -41.796  -33.311  1.00 0.00 ? 295 SER A HG   1  
ATOM 4449  N N    . ASP A 1 301 ? 41.205   -41.810  -38.131  1.00 0.00 ? 296 ASP A N    1  
ATOM 4450  C CA   . ASP A 1 301 ? 41.355   -42.749  -39.281  1.00 0.00 ? 296 ASP A CA   1  
ATOM 4451  C C    . ASP A 1 301 ? 42.332   -43.871  -38.920  1.00 0.00 ? 296 ASP A C    1  
ATOM 4452  O O    . ASP A 1 301 ? 43.423   -43.953  -39.451  1.00 0.00 ? 296 ASP A O    1  
ATOM 4453  C CB   . ASP A 1 301 ? 41.913   -41.895  -40.422  1.00 0.00 ? 296 ASP A CB   1  
ATOM 4454  C CG   . ASP A 1 301 ? 40.862   -40.873  -40.857  1.00 0.00 ? 296 ASP A CG   1  
ATOM 4455  O OD1  . ASP A 1 301 ? 39.698   -41.234  -40.909  1.00 0.00 ? 296 ASP A OD1  1  
ATOM 4456  O OD2  . ASP A 1 301 ? 41.238   -39.745  -41.131  1.00 0.00 ? 296 ASP A OD2  1  
ATOM 4457  H H    . ASP A 1 301 ? 41.631   -40.928  -38.158  1.00 0.00 ? 296 ASP A H    1  
ATOM 4458  H HA   . ASP A 1 301 ? 40.397   -43.158  -39.562  1.00 0.00 ? 296 ASP A HA   1  
ATOM 4459  H HB2  . ASP A 1 301 ? 42.800   -41.379  -40.084  1.00 0.00 ? 296 ASP A HB2  1  
ATOM 4460  H HB3  . ASP A 1 301 ? 42.162   -42.530  -41.258  1.00 0.00 ? 296 ASP A HB3  1  
ATOM 4461  N N    . VAL A 1 302 ? 41.948   -44.736  -38.019  1.00 0.00 ? 297 VAL A N    1  
ATOM 4462  C CA   . VAL A 1 302 ? 42.852   -45.853  -37.619  1.00 0.00 ? 297 VAL A CA   1  
ATOM 4463  C C    . VAL A 1 302 ? 42.072   -46.908  -36.826  1.00 0.00 ? 297 VAL A C    1  
ATOM 4464  O O    . VAL A 1 302 ? 42.145   -46.969  -35.614  1.00 0.00 ? 297 VAL A O    1  
ATOM 4465  C CB   . VAL A 1 302 ? 43.932   -45.201  -36.749  1.00 0.00 ? 297 VAL A CB   1  
ATOM 4466  C CG1  . VAL A 1 302 ? 43.286   -44.521  -35.538  1.00 0.00 ? 297 VAL A CG1  1  
ATOM 4467  C CG2  . VAL A 1 302 ? 44.915   -46.271  -36.267  1.00 0.00 ? 297 VAL A CG2  1  
ATOM 4468  H H    . VAL A 1 302 ? 41.065   -44.649  -37.603  1.00 0.00 ? 297 VAL A H    1  
ATOM 4469  H HA   . VAL A 1 302 ? 43.304   -46.299  -38.492  1.00 0.00 ? 297 VAL A HA   1  
ATOM 4470  H HB   . VAL A 1 302 ? 44.462   -44.461  -37.332  1.00 0.00 ? 297 VAL A HB   1  
ATOM 4471  H HG11 . VAL A 1 302 ? 43.849   -43.637  -35.279  1.00 0.00 ? 297 VAL A HG11 1  
ATOM 4472  H HG12 . VAL A 1 302 ? 43.285   -45.204  -34.701  1.00 0.00 ? 297 VAL A HG12 1  
ATOM 4473  H HG13 . VAL A 1 302 ? 42.271   -44.245  -35.777  1.00 0.00 ? 297 VAL A HG13 1  
ATOM 4474  H HG21 . VAL A 1 302 ? 45.266   -46.843  -37.112  1.00 0.00 ? 297 VAL A HG21 1  
ATOM 4475  H HG22 . VAL A 1 302 ? 44.418   -46.927  -35.568  1.00 0.00 ? 297 VAL A HG22 1  
ATOM 4476  H HG23 . VAL A 1 302 ? 45.754   -45.796  -35.780  1.00 0.00 ? 297 VAL A HG23 1  
ATOM 4477  N N    . GLU A 1 303 ? 41.326   -47.740  -37.503  1.00 0.00 ? 298 GLU A N    1  
ATOM 4478  C CA   . GLU A 1 303 ? 40.541   -48.792  -36.792  1.00 0.00 ? 298 GLU A CA   1  
ATOM 4479  C C    . GLU A 1 303 ? 41.314   -50.113  -36.781  1.00 0.00 ? 298 GLU A C    1  
ATOM 4480  O O    . GLU A 1 303 ? 41.563   -50.688  -35.740  1.00 0.00 ? 298 GLU A O    1  
ATOM 4481  C CB   . GLU A 1 303 ? 39.249   -48.932  -37.597  1.00 0.00 ? 298 GLU A CB   1  
ATOM 4482  C CG   . GLU A 1 303 ? 38.272   -47.827  -37.189  1.00 0.00 ? 298 GLU A CG   1  
ATOM 4483  C CD   . GLU A 1 303 ? 37.794   -48.072  -35.757  1.00 0.00 ? 298 GLU A CD   1  
ATOM 4484  O OE1  . GLU A 1 303 ? 37.539   -49.218  -35.426  1.00 0.00 ? 298 GLU A OE1  1  
ATOM 4485  O OE2  . GLU A 1 303 ? 37.690   -47.109  -35.015  1.00 0.00 ? 298 GLU A OE2  1  
ATOM 4486  H H    . GLU A 1 303 ? 41.283   -47.674  -38.480  1.00 0.00 ? 298 GLU A H    1  
ATOM 4487  H HA   . GLU A 1 303 ? 40.316   -48.478  -35.785  1.00 0.00 ? 298 GLU A HA   1  
ATOM 4488  H HB2  . GLU A 1 303 ? 39.470   -48.846  -38.651  1.00 0.00 ? 298 GLU A HB2  1  
ATOM 4489  H HB3  . GLU A 1 303 ? 38.803   -49.895  -37.399  1.00 0.00 ? 298 GLU A HB3  1  
ATOM 4490  H HG2  . GLU A 1 303 ? 38.769   -46.869  -37.245  1.00 0.00 ? 298 GLU A HG2  1  
ATOM 4491  H HG3  . GLU A 1 303 ? 37.423   -47.833  -37.856  1.00 0.00 ? 298 GLU A HG3  1  
ATOM 4492  N N    . GLY A 1 304 ? 41.695   -50.598  -37.933  1.00 0.00 ? 299 GLY A N    1  
ATOM 4493  C CA   . GLY A 1 304 ? 42.452   -51.882  -37.991  1.00 0.00 ? 299 GLY A CA   1  
ATOM 4494  C C    . GLY A 1 304 ? 43.901   -51.640  -37.567  1.00 0.00 ? 299 GLY A C    1  
ATOM 4495  O O    . GLY A 1 304 ? 44.293   -51.947  -36.458  1.00 0.00 ? 299 GLY A O    1  
ATOM 4496  H H    . GLY A 1 304 ? 41.483   -50.117  -38.760  1.00 0.00 ? 299 GLY A H    1  
ATOM 4497  H HA2  . GLY A 1 304 ? 41.994   -52.599  -37.324  1.00 0.00 ? 299 GLY A HA2  1  
ATOM 4498  H HA3  . GLY A 1 304 ? 42.435   -52.265  -38.999  1.00 0.00 ? 299 GLY A HA3  1  
ATOM 4499  N N    . GLU A 1 305 ? 44.700   -51.090  -38.442  1.00 0.00 ? 300 GLU A N    1  
ATOM 4500  C CA   . GLU A 1 305 ? 46.126   -50.826  -38.092  1.00 0.00 ? 300 GLU A CA   1  
ATOM 4501  C C    . GLU A 1 305 ? 46.443   -49.336  -38.253  1.00 0.00 ? 300 GLU A C    1  
ATOM 4502  O O    . GLU A 1 305 ? 46.622   -48.623  -37.285  1.00 0.00 ? 300 GLU A O    1  
ATOM 4503  C CB   . GLU A 1 305 ? 46.939   -51.656  -39.086  1.00 0.00 ? 300 GLU A CB   1  
ATOM 4504  C CG   . GLU A 1 305 ? 47.261   -53.019  -38.469  1.00 0.00 ? 300 GLU A CG   1  
ATOM 4505  C CD   . GLU A 1 305 ? 48.571   -53.549  -39.057  1.00 0.00 ? 300 GLU A CD   1  
ATOM 4506  O OE1  . GLU A 1 305 ? 48.823   -53.288  -40.222  1.00 0.00 ? 300 GLU A OE1  1  
ATOM 4507  O OE2  . GLU A 1 305 ? 49.299   -54.206  -38.331  1.00 0.00 ? 300 GLU A OE2  1  
ATOM 4508  H H    . GLU A 1 305 ? 44.362   -50.850  -39.330  1.00 0.00 ? 300 GLU A H    1  
ATOM 4509  H HA   . GLU A 1 305 ? 46.334   -51.149  -37.084  1.00 0.00 ? 300 GLU A HA   1  
ATOM 4510  H HB2  . GLU A 1 305 ? 46.365   -51.796  -39.991  1.00 0.00 ? 300 GLU A HB2  1  
ATOM 4511  H HB3  . GLU A 1 305 ? 47.859   -51.142  -39.318  1.00 0.00 ? 300 GLU A HB3  1  
ATOM 4512  H HG2  . GLU A 1 305 ? 47.362   -52.914  -37.399  1.00 0.00 ? 300 GLU A HG2  1  
ATOM 4513  H HG3  . GLU A 1 305 ? 46.463   -53.712  -38.690  1.00 0.00 ? 300 GLU A HG3  1  
ATOM 4514  N N    . VAL A 1 306 ? 46.512   -48.864  -39.469  1.00 0.00 ? 301 VAL A N    1  
ATOM 4515  C CA   . VAL A 1 306 ? 46.817   -47.421  -39.695  1.00 0.00 ? 301 VAL A CA   1  
ATOM 4516  C C    . VAL A 1 306 ? 45.552   -46.679  -40.137  1.00 0.00 ? 301 VAL A C    1  
ATOM 4517  O O    . VAL A 1 306 ? 45.353   -45.525  -39.813  1.00 0.00 ? 301 VAL A O    1  
ATOM 4518  C CB   . VAL A 1 306 ? 47.868   -47.407  -40.808  1.00 0.00 ? 301 VAL A CB   1  
ATOM 4519  C CG1  . VAL A 1 306 ? 48.253   -45.962  -41.133  1.00 0.00 ? 301 VAL A CG1  1  
ATOM 4520  C CG2  . VAL A 1 306 ? 49.111   -48.171  -40.344  1.00 0.00 ? 301 VAL A CG2  1  
ATOM 4521  H H    . VAL A 1 306 ? 46.364   -49.459  -40.233  1.00 0.00 ? 301 VAL A H    1  
ATOM 4522  H HA   . VAL A 1 306 ? 47.222   -46.976  -38.800  1.00 0.00 ? 301 VAL A HA   1  
ATOM 4523  H HB   . VAL A 1 306 ? 47.462   -47.878  -41.691  1.00 0.00 ? 301 VAL A HB   1  
ATOM 4524  H HG11 . VAL A 1 306 ? 47.601   -45.581  -41.905  1.00 0.00 ? 301 VAL A HG11 1  
ATOM 4525  H HG12 . VAL A 1 306 ? 49.276   -45.931  -41.478  1.00 0.00 ? 301 VAL A HG12 1  
ATOM 4526  H HG13 . VAL A 1 306 ? 48.154   -45.355  -40.245  1.00 0.00 ? 301 VAL A HG13 1  
ATOM 4527  H HG21 . VAL A 1 306 ? 49.444   -47.774  -39.396  1.00 0.00 ? 301 VAL A HG21 1  
ATOM 4528  H HG22 . VAL A 1 306 ? 49.896   -48.059  -41.077  1.00 0.00 ? 301 VAL A HG22 1  
ATOM 4529  H HG23 . VAL A 1 306 ? 48.869   -49.217  -40.231  1.00 0.00 ? 301 VAL A HG23 1  
ATOM 4530  N N    . GLY A 1 307 ? 44.696   -47.335  -40.875  1.00 0.00 ? 302 GLY A N    1  
ATOM 4531  C CA   . GLY A 1 307 ? 43.444   -46.671  -41.339  1.00 0.00 ? 302 GLY A CA   1  
ATOM 4532  C C    . GLY A 1 307 ? 43.501   -46.474  -42.854  1.00 0.00 ? 302 GLY A C    1  
ATOM 4533  O O    . GLY A 1 307 ? 44.283   -45.692  -43.358  1.00 0.00 ? 302 GLY A O    1  
ATOM 4534  H H    . GLY A 1 307 ? 44.877   -48.266  -41.124  1.00 0.00 ? 302 GLY A H    1  
ATOM 4535  H HA2  . GLY A 1 307 ? 42.594   -47.290  -41.086  1.00 0.00 ? 302 GLY A HA2  1  
ATOM 4536  H HA3  . GLY A 1 307 ? 43.346   -45.710  -40.857  1.00 0.00 ? 302 GLY A HA3  1  
ATOM 4537  N N    . ALA A 1 308 ? 42.678   -47.178  -43.584  1.00 0.00 ? 303 ALA A N    1  
ATOM 4538  C CA   . ALA A 1 308 ? 42.683   -47.032  -45.069  1.00 0.00 ? 303 ALA A CA   1  
ATOM 4539  C C    . ALA A 1 308 ? 41.603   -46.038  -45.507  1.00 0.00 ? 303 ALA A C    1  
ATOM 4540  O O    . ALA A 1 308 ? 41.158   -45.212  -44.734  1.00 0.00 ? 303 ALA A O    1  
ATOM 4541  C CB   . ALA A 1 308 ? 42.375   -48.431  -45.605  1.00 0.00 ? 303 ALA A CB   1  
ATOM 4542  H H    . ALA A 1 308 ? 42.056   -47.803  -43.156  1.00 0.00 ? 303 ALA A H    1  
ATOM 4543  H HA   . ALA A 1 308 ? 43.653   -46.711  -45.413  1.00 0.00 ? 303 ALA A HA   1  
ATOM 4544  H HB1  . ALA A 1 308 ? 41.318   -48.631  -45.503  1.00 0.00 ? 303 ALA A HB1  1  
ATOM 4545  H HB2  . ALA A 1 308 ? 42.936   -49.163  -45.044  1.00 0.00 ? 303 ALA A HB2  1  
ATOM 4546  H HB3  . ALA A 1 308 ? 42.652   -48.485  -46.648  1.00 0.00 ? 303 ALA A HB3  1  
ATOM 4547  N N    . ILE A 1 309 ? 41.179   -46.113  -46.740  1.00 0.00 ? 304 ILE A N    1  
ATOM 4548  C CA   . ILE A 1 309 ? 40.128   -45.173  -47.229  1.00 0.00 ? 304 ILE A CA   1  
ATOM 4549  C C    . ILE A 1 309 ? 38.841   -45.940  -47.546  1.00 0.00 ? 304 ILE A C    1  
ATOM 4550  O O    . ILE A 1 309 ? 37.754   -45.512  -47.209  1.00 0.00 ? 304 ILE A O    1  
ATOM 4551  C CB   . ILE A 1 309 ? 40.711   -44.549  -48.500  1.00 0.00 ? 304 ILE A CB   1  
ATOM 4552  C CG1  . ILE A 1 309 ? 42.012   -43.816  -48.159  1.00 0.00 ? 304 ILE A CG1  1  
ATOM 4553  C CG2  . ILE A 1 309 ? 39.708   -43.555  -49.089  1.00 0.00 ? 304 ILE A CG2  1  
ATOM 4554  C CD1  . ILE A 1 309 ? 43.205   -44.732  -48.442  1.00 0.00 ? 304 ILE A CD1  1  
ATOM 4555  H H    . ILE A 1 309 ? 41.552   -46.787  -47.346  1.00 0.00 ? 304 ILE A H    1  
ATOM 4556  H HA   . ILE A 1 309 ? 39.939   -44.405  -46.495  1.00 0.00 ? 304 ILE A HA   1  
ATOM 4557  H HB   . ILE A 1 309 ? 40.912   -45.327  -49.222  1.00 0.00 ? 304 ILE A HB   1  
ATOM 4558  H HG12 . ILE A 1 309 ? 42.091   -42.924  -48.763  1.00 0.00 ? 304 ILE A HG12 1  
ATOM 4559  H HG13 . ILE A 1 309 ? 42.009   -43.545  -47.114  1.00 0.00 ? 304 ILE A HG13 1  
ATOM 4560  H HG21 . ILE A 1 309 ? 38.756   -44.045  -49.230  1.00 0.00 ? 304 ILE A HG21 1  
ATOM 4561  H HG22 . ILE A 1 309 ? 40.073   -43.196  -50.040  1.00 0.00 ? 304 ILE A HG22 1  
ATOM 4562  H HG23 . ILE A 1 309 ? 39.587   -42.722  -48.413  1.00 0.00 ? 304 ILE A HG23 1  
ATOM 4563  H HD11 . ILE A 1 309 ? 42.881   -45.762  -48.427  1.00 0.00 ? 304 ILE A HD11 1  
ATOM 4564  H HD12 . ILE A 1 309 ? 43.961   -44.581  -47.686  1.00 0.00 ? 304 ILE A HD12 1  
ATOM 4565  H HD13 . ILE A 1 309 ? 43.615   -44.498  -49.413  1.00 0.00 ? 304 ILE A HD13 1  
ATOM 4566  N N    . GLY A 1 310 ? 38.957   -47.070  -48.192  1.00 0.00 ? 305 GLY A N    1  
ATOM 4567  C CA   . GLY A 1 310 ? 37.742   -47.865  -48.531  1.00 0.00 ? 305 GLY A CA   1  
ATOM 4568  C C    . GLY A 1 310 ? 38.028   -48.743  -49.751  1.00 0.00 ? 305 GLY A C    1  
ATOM 4569  O O    . GLY A 1 310 ? 38.928   -49.560  -49.742  1.00 0.00 ? 305 GLY A O    1  
ATOM 4570  H H    . GLY A 1 310 ? 39.843   -47.395  -48.454  1.00 0.00 ? 305 GLY A H    1  
ATOM 4571  H HA2  . GLY A 1 310 ? 37.475   -48.490  -47.690  1.00 0.00 ? 305 GLY A HA2  1  
ATOM 4572  H HA3  . GLY A 1 310 ? 36.925   -47.197  -48.756  1.00 0.00 ? 305 GLY A HA3  1  
ATOM 4573  N N    . GLU A 1 311 ? 37.268   -48.580  -50.801  1.00 0.00 ? 306 GLU A N    1  
ATOM 4574  C CA   . GLU A 1 311 ? 37.493   -49.405  -52.024  1.00 0.00 ? 306 GLU A CA   1  
ATOM 4575  C C    . GLU A 1 311 ? 38.326   -48.624  -53.044  1.00 0.00 ? 306 GLU A C    1  
ATOM 4576  O O    . GLU A 1 311 ? 37.811   -47.814  -53.789  1.00 0.00 ? 306 GLU A O    1  
ATOM 4577  C CB   . GLU A 1 311 ? 36.093   -49.685  -52.576  1.00 0.00 ? 306 GLU A CB   1  
ATOM 4578  C CG   . GLU A 1 311 ? 35.644   -51.090  -52.158  1.00 0.00 ? 306 GLU A CG   1  
ATOM 4579  C CD   . GLU A 1 311 ? 35.501   -51.975  -53.398  1.00 0.00 ? 306 GLU A CD   1  
ATOM 4580  O OE1  . GLU A 1 311 ? 36.518   -52.414  -53.909  1.00 0.00 ? 306 GLU A OE1  1  
ATOM 4581  O OE2  . GLU A 1 311 ? 34.376   -52.198  -53.815  1.00 0.00 ? 306 GLU A OE2  1  
ATOM 4582  H H    . GLU A 1 311 ? 36.547   -47.915  -50.785  1.00 0.00 ? 306 GLU A H    1  
ATOM 4583  H HA   . GLU A 1 311 ? 37.981   -50.332  -51.769  1.00 0.00 ? 306 GLU A HA   1  
ATOM 4584  H HB2  . GLU A 1 311 ? 35.401   -48.954  -52.184  1.00 0.00 ? 306 GLU A HB2  1  
ATOM 4585  H HB3  . GLU A 1 311 ? 36.113   -49.620  -53.654  1.00 0.00 ? 306 GLU A HB3  1  
ATOM 4586  H HG2  . GLU A 1 311 ? 36.378   -51.520  -51.491  1.00 0.00 ? 306 GLU A HG2  1  
ATOM 4587  H HG3  . GLU A 1 311 ? 34.692   -51.026  -51.653  1.00 0.00 ? 306 GLU A HG3  1  
ATOM 4588  N N    . GLU A 1 312 ? 39.610   -48.862  -53.081  1.00 0.00 ? 307 GLU A N    1  
ATOM 4589  C CA   . GLU A 1 312 ? 40.479   -48.135  -54.052  1.00 0.00 ? 307 GLU A CA   1  
ATOM 4590  C C    . GLU A 1 312 ? 40.776   -49.023  -55.263  1.00 0.00 ? 307 GLU A C    1  
ATOM 4591  O O    . GLU A 1 312 ? 41.866   -49.008  -55.803  1.00 0.00 ? 307 GLU A O    1  
ATOM 4592  C CB   . GLU A 1 312 ? 41.765   -47.829  -53.282  1.00 0.00 ? 307 GLU A CB   1  
ATOM 4593  C CG   . GLU A 1 312 ? 41.465   -46.831  -52.162  1.00 0.00 ? 307 GLU A CG   1  
ATOM 4594  C CD   . GLU A 1 312 ? 41.465   -45.411  -52.729  1.00 0.00 ? 307 GLU A CD   1  
ATOM 4595  O OE1  . GLU A 1 312 ? 42.536   -44.922  -53.049  1.00 0.00 ? 307 GLU A OE1  1  
ATOM 4596  O OE2  . GLU A 1 312 ? 40.394   -44.836  -52.835  1.00 0.00 ? 307 GLU A OE2  1  
ATOM 4597  H H    . GLU A 1 312 ? 40.004   -49.520  -52.470  1.00 0.00 ? 307 GLU A H    1  
ATOM 4598  H HA   . GLU A 1 312 ? 40.009   -47.215  -54.364  1.00 0.00 ? 307 GLU A HA   1  
ATOM 4599  H HB2  . GLU A 1 312 ? 42.155   -48.743  -52.857  1.00 0.00 ? 307 GLU A HB2  1  
ATOM 4600  H HB3  . GLU A 1 312 ? 42.494   -47.404  -53.955  1.00 0.00 ? 307 GLU A HB3  1  
ATOM 4601  H HG2  . GLU A 1 312 ? 40.497   -47.050  -51.735  1.00 0.00 ? 307 GLU A HG2  1  
ATOM 4602  H HG3  . GLU A 1 312 ? 42.223   -46.911  -51.397  1.00 0.00 ? 307 GLU A HG3  1  
ATOM 4603  N N    . ALA A 1 313 ? 39.816   -49.797  -55.693  1.00 0.00 ? 308 ALA A N    1  
ATOM 4604  C CA   . ALA A 1 313 ? 40.041   -50.687  -56.869  1.00 0.00 ? 308 ALA A CA   1  
ATOM 4605  C C    . ALA A 1 313 ? 38.820   -50.660  -57.796  1.00 0.00 ? 308 ALA A C    1  
ATOM 4606  O O    . ALA A 1 313 ? 37.912   -51.453  -57.645  1.00 0.00 ? 308 ALA A O    1  
ATOM 4607  C CB   . ALA A 1 313 ? 40.233   -52.084  -56.276  1.00 0.00 ? 308 ALA A CB   1  
ATOM 4608  H H    . ALA A 1 313 ? 38.945   -49.793  -55.242  1.00 0.00 ? 308 ALA A H    1  
ATOM 4609  H HA   . ALA A 1 313 ? 40.928   -50.389  -57.404  1.00 0.00 ? 308 ALA A HA   1  
ATOM 4610  H HB1  . ALA A 1 313 ? 39.791   -52.818  -56.934  1.00 0.00 ? 308 ALA A HB1  1  
ATOM 4611  H HB2  . ALA A 1 313 ? 39.755   -52.133  -55.309  1.00 0.00 ? 308 ALA A HB2  1  
ATOM 4612  H HB3  . ALA A 1 313 ? 41.288   -52.287  -56.168  1.00 0.00 ? 308 ALA A HB3  1  
ATOM 4613  N N    . PRO A 1 314 ? 38.838   -49.743  -58.730  1.00 0.00 ? 309 PRO A N    1  
ATOM 4614  C CA   . PRO A 1 314 ? 37.713   -49.616  -59.690  1.00 0.00 ? 309 PRO A CA   1  
ATOM 4615  C C    . PRO A 1 314 ? 37.737   -50.771  -60.695  1.00 0.00 ? 309 PRO A C    1  
ATOM 4616  O O    . PRO A 1 314 ? 38.682   -50.936  -61.442  1.00 0.00 ? 309 PRO A O    1  
ATOM 4617  C CB   . PRO A 1 314 ? 37.983   -48.284  -60.385  1.00 0.00 ? 309 PRO A CB   1  
ATOM 4618  C CG   . PRO A 1 314 ? 39.457   -48.069  -60.253  1.00 0.00 ? 309 PRO A CG   1  
ATOM 4619  C CD   . PRO A 1 314 ? 39.891   -48.749  -58.981  1.00 0.00 ? 309 PRO A CD   1  
ATOM 4620  H HA   . PRO A 1 314 ? 36.770   -49.579  -59.171  1.00 0.00 ? 309 PRO A HA   1  
ATOM 4621  H HB2  . PRO A 1 314 ? 37.700   -48.342  -61.428  1.00 0.00 ? 309 PRO A HB2  1  
ATOM 4622  H HB3  . PRO A 1 314 ? 37.447   -47.488  -59.893  1.00 0.00 ? 309 PRO A HB3  1  
ATOM 4623  H HG2  . PRO A 1 314 ? 39.969   -48.503  -61.100  1.00 0.00 ? 309 PRO A HG2  1  
ATOM 4624  H HG3  . PRO A 1 314 ? 39.671   -47.013  -60.191  1.00 0.00 ? 309 PRO A HG3  1  
ATOM 4625  H HD2  . PRO A 1 314 ? 40.848   -49.233  -59.120  1.00 0.00 ? 309 PRO A HD2  1  
ATOM 4626  H HD3  . PRO A 1 314 ? 39.936   -48.042  -58.167  1.00 0.00 ? 309 PRO A HD3  1  
ATOM 4627  N N    . GLN A 1 315 ? 36.702   -51.572  -60.719  1.00 0.00 ? 310 GLN A N    1  
ATOM 4628  C CA   . GLN A 1 315 ? 36.656   -52.722  -61.674  1.00 0.00 ? 310 GLN A CA   1  
ATOM 4629  C C    . GLN A 1 315 ? 37.929   -53.568  -61.555  1.00 0.00 ? 310 GLN A C    1  
ATOM 4630  O O    . GLN A 1 315 ? 38.775   -53.560  -62.428  1.00 0.00 ? 310 GLN A O    1  
ATOM 4631  C CB   . GLN A 1 315 ? 36.561   -52.085  -63.063  1.00 0.00 ? 310 GLN A CB   1  
ATOM 4632  C CG   . GLN A 1 315 ? 35.244   -51.316  -63.183  1.00 0.00 ? 310 GLN A CG   1  
ATOM 4633  C CD   . GLN A 1 315 ? 35.380   -50.236  -64.258  1.00 0.00 ? 310 GLN A CD   1  
ATOM 4634  O OE1  . GLN A 1 315 ? 35.985   -50.459  -65.287  1.00 0.00 ? 310 GLN A OE1  1  
ATOM 4635  N NE2  . GLN A 1 315 ? 34.839   -49.065  -64.060  1.00 0.00 ? 310 GLN A NE2  1  
ATOM 4636  H H    . GLN A 1 315 ? 35.953   -51.418  -60.106  1.00 0.00 ? 310 GLN A H    1  
ATOM 4637  H HA   . GLN A 1 315 ? 35.784   -53.328  -61.489  1.00 0.00 ? 310 GLN A HA   1  
ATOM 4638  H HB2  . GLN A 1 315 ? 37.390   -51.406  -63.205  1.00 0.00 ? 310 GLN A HB2  1  
ATOM 4639  H HB3  . GLN A 1 315 ? 36.595   -52.858  -63.816  1.00 0.00 ? 310 GLN A HB3  1  
ATOM 4640  H HG2  . GLN A 1 315 ? 34.453   -51.999  -63.456  1.00 0.00 ? 310 GLN A HG2  1  
ATOM 4641  H HG3  . GLN A 1 315 ? 35.010   -50.853  -62.237  1.00 0.00 ? 310 GLN A HG3  1  
ATOM 4642  H HE21 . GLN A 1 315 ? 34.351   -48.884  -63.230  1.00 0.00 ? 310 GLN A HE21 1  
ATOM 4643  H HE22 . GLN A 1 315 ? 34.920   -48.366  -64.743  1.00 0.00 ? 310 GLN A HE22 1  
ATOM 4644  N N    . MET A 1 316 ? 38.069   -54.296  -60.479  1.00 0.00 ? 311 MET A N    1  
ATOM 4645  C CA   . MET A 1 316 ? 39.285   -55.141  -60.300  1.00 0.00 ? 311 MET A CA   1  
ATOM 4646  C C    . MET A 1 316 ? 38.905   -56.492  -59.688  1.00 0.00 ? 311 MET A C    1  
ATOM 4647  O O    . MET A 1 316 ? 39.351   -57.532  -60.131  1.00 0.00 ? 311 MET A O    1  
ATOM 4648  C CB   . MET A 1 316 ? 40.178   -54.351  -59.343  1.00 0.00 ? 311 MET A CB   1  
ATOM 4649  C CG   . MET A 1 316 ? 41.533   -55.048  -59.215  1.00 0.00 ? 311 MET A CG   1  
ATOM 4650  S SD   . MET A 1 316 ? 42.584   -54.586  -60.614  1.00 0.00 ? 311 MET A SD   1  
ATOM 4651  C CE   . MET A 1 316 ? 43.425   -53.196  -59.816  1.00 0.00 ? 311 MET A CE   1  
ATOM 4652  H H    . MET A 1 316 ? 37.374   -54.286  -59.788  1.00 0.00 ? 311 MET A H    1  
ATOM 4653  H HA   . MET A 1 316 ? 39.789   -55.282  -61.243  1.00 0.00 ? 311 MET A HA   1  
ATOM 4654  H HB2  . MET A 1 316 ? 40.321   -53.351  -59.728  1.00 0.00 ? 311 MET A HB2  1  
ATOM 4655  H HB3  . MET A 1 316 ? 39.708   -54.300  -58.372  1.00 0.00 ? 311 MET A HB3  1  
ATOM 4656  H HG2  . MET A 1 316 ? 42.007   -54.746  -58.293  1.00 0.00 ? 311 MET A HG2  1  
ATOM 4657  H HG3  . MET A 1 316 ? 41.388   -56.119  -59.211  1.00 0.00 ? 311 MET A HG3  1  
ATOM 4658  H HE1  . MET A 1 316 ? 44.368   -53.533  -59.408  1.00 0.00 ? 311 MET A HE1  1  
ATOM 4659  H HE2  . MET A 1 316 ? 42.809   -52.810  -59.020  1.00 0.00 ? 311 MET A HE2  1  
ATOM 4660  H HE3  . MET A 1 316 ? 43.600   -52.416  -60.545  1.00 0.00 ? 311 MET A HE3  1  
ATOM 4661  N N    . ASN A 1 317 ? 38.086   -56.482  -58.671  1.00 0.00 ? 312 ASN A N    1  
ATOM 4662  C CA   . ASN A 1 317 ? 37.676   -57.764  -58.027  1.00 0.00 ? 312 ASN A CA   1  
ATOM 4663  C C    . ASN A 1 317 ? 36.584   -58.448  -58.855  1.00 0.00 ? 312 ASN A C    1  
ATOM 4664  O O    . ASN A 1 317 ? 36.161   -57.945  -59.877  1.00 0.00 ? 312 ASN A O    1  
ATOM 4665  C CB   . ASN A 1 317 ? 37.135   -57.362  -56.654  1.00 0.00 ? 312 ASN A CB   1  
ATOM 4666  C CG   . ASN A 1 317 ? 37.571   -58.392  -55.610  1.00 0.00 ? 312 ASN A CG   1  
ATOM 4667  O OD1  . ASN A 1 317 ? 38.746   -58.661  -55.459  1.00 0.00 ? 312 ASN A OD1  1  
ATOM 4668  N ND2  . ASN A 1 317 ? 36.667   -58.984  -54.878  1.00 0.00 ? 312 ASN A ND2  1  
ATOM 4669  H H    . ASN A 1 317 ? 37.739   -55.631  -58.330  1.00 0.00 ? 312 ASN A H    1  
ATOM 4670  H HA   . ASN A 1 317 ? 38.526   -58.417  -57.911  1.00 0.00 ? 312 ASN A HA   1  
ATOM 4671  H HB2  . ASN A 1 317 ? 37.522   -56.390  -56.385  1.00 0.00 ? 312 ASN A HB2  1  
ATOM 4672  H HB3  . ASN A 1 317 ? 36.056   -57.323  -56.689  1.00 0.00 ? 312 ASN A HB3  1  
ATOM 4673  H HD21 . ASN A 1 317 ? 35.719   -58.768  -55.000  1.00 0.00 ? 312 ASN A HD21 1  
ATOM 4674  H HD22 . ASN A 1 317 ? 36.936   -59.646  -54.207  1.00 0.00 ? 312 ASN A HD22 1  
ATOM 4675  N N    . TYR A 1 318 ? 36.127   -59.592  -58.420  1.00 0.00 ? 313 TYR A N    1  
ATOM 4676  C CA   . TYR A 1 318 ? 35.062   -60.310  -59.179  1.00 0.00 ? 313 TYR A CA   1  
ATOM 4677  C C    . TYR A 1 318 ? 33.679   -59.885  -58.679  1.00 0.00 ? 313 TYR A C    1  
ATOM 4678  O O    . TYR A 1 318 ? 32.711   -59.903  -59.413  1.00 0.00 ? 313 TYR A O    1  
ATOM 4679  C CB   . TYR A 1 318 ? 35.303   -61.792  -58.891  1.00 0.00 ? 313 TYR A CB   1  
ATOM 4680  C CG   . TYR A 1 318 ? 34.787   -62.621  -60.043  1.00 0.00 ? 313 TYR A CG   1  
ATOM 4681  C CD1  . TYR A 1 318 ? 33.410   -62.714  -60.277  1.00 0.00 ? 313 TYR A CD1  1  
ATOM 4682  C CD2  . TYR A 1 318 ? 35.686   -63.296  -60.877  1.00 0.00 ? 313 TYR A CD2  1  
ATOM 4683  C CE1  . TYR A 1 318 ? 32.932   -63.482  -61.345  1.00 0.00 ? 313 TYR A CE1  1  
ATOM 4684  C CE2  . TYR A 1 318 ? 35.208   -64.064  -61.945  1.00 0.00 ? 313 TYR A CE2  1  
ATOM 4685  C CZ   . TYR A 1 318 ? 33.831   -64.158  -62.179  1.00 0.00 ? 313 TYR A CZ   1  
ATOM 4686  O OH   . TYR A 1 318 ? 33.360   -64.915  -63.232  1.00 0.00 ? 313 TYR A OH   1  
ATOM 4687  H H    . TYR A 1 318 ? 36.483   -59.978  -57.593  1.00 0.00 ? 313 TYR A H    1  
ATOM 4688  H HA   . TYR A 1 318 ? 35.157   -60.119  -60.236  1.00 0.00 ? 313 TYR A HA   1  
ATOM 4689  H HB2  . TYR A 1 318 ? 36.362   -61.967  -58.767  1.00 0.00 ? 313 TYR A HB2  1  
ATOM 4690  H HB3  . TYR A 1 318 ? 34.783   -62.072  -57.987  1.00 0.00 ? 313 TYR A HB3  1  
ATOM 4691  H HD1  . TYR A 1 318 ? 32.716   -62.192  -59.634  1.00 0.00 ? 313 TYR A HD1  1  
ATOM 4692  H HD2  . TYR A 1 318 ? 36.748   -63.224  -60.696  1.00 0.00 ? 313 TYR A HD2  1  
ATOM 4693  H HE1  . TYR A 1 318 ? 31.869   -63.554  -61.526  1.00 0.00 ? 313 TYR A HE1  1  
ATOM 4694  H HE2  . TYR A 1 318 ? 35.902   -64.585  -62.588  1.00 0.00 ? 313 TYR A HE2  1  
ATOM 4695  H HH   . TYR A 1 318 ? 33.789   -64.607  -64.034  1.00 0.00 ? 313 TYR A HH   1  
ATOM 4696  N N    . ILE A 1 319 ? 33.581   -59.502  -57.434  1.00 0.00 ? 314 ILE A N    1  
ATOM 4697  C CA   . ILE A 1 319 ? 32.261   -59.075  -56.882  1.00 0.00 ? 314 ILE A CA   1  
ATOM 4698  C C    . ILE A 1 319 ? 32.337   -57.628  -56.385  1.00 0.00 ? 314 ILE A C    1  
ATOM 4699  O O    . ILE A 1 319 ? 33.284   -56.917  -56.660  1.00 0.00 ? 314 ILE A O    1  
ATOM 4700  C CB   . ILE A 1 319 ? 31.986   -60.030  -55.719  1.00 0.00 ? 314 ILE A CB   1  
ATOM 4701  C CG1  . ILE A 1 319 ? 33.128   -59.945  -54.701  1.00 0.00 ? 314 ILE A CG1  1  
ATOM 4702  C CG2  . ILE A 1 319 ? 31.883   -61.462  -56.248  1.00 0.00 ? 314 ILE A CG2  1  
ATOM 4703  C CD1  . ILE A 1 319 ? 32.719   -60.664  -53.414  1.00 0.00 ? 314 ILE A CD1  1  
ATOM 4704  H H    . ILE A 1 319 ? 34.375   -59.496  -56.860  1.00 0.00 ? 314 ILE A H    1  
ATOM 4705  H HA   . ILE A 1 319 ? 31.491   -59.175  -57.631  1.00 0.00 ? 314 ILE A HA   1  
ATOM 4706  H HB   . ILE A 1 319 ? 31.056   -59.756  -55.242  1.00 0.00 ? 314 ILE A HB   1  
ATOM 4707  H HG12 . ILE A 1 319 ? 34.011   -60.413  -55.112  1.00 0.00 ? 314 ILE A HG12 1  
ATOM 4708  H HG13 . ILE A 1 319 ? 33.338   -58.910  -54.481  1.00 0.00 ? 314 ILE A HG13 1  
ATOM 4709  H HG21 . ILE A 1 319 ? 32.602   -61.605  -57.041  1.00 0.00 ? 314 ILE A HG21 1  
ATOM 4710  H HG22 . ILE A 1 319 ? 30.887   -61.634  -56.629  1.00 0.00 ? 314 ILE A HG22 1  
ATOM 4711  H HG23 . ILE A 1 319 ? 32.087   -62.157  -55.447  1.00 0.00 ? 314 ILE A HG23 1  
ATOM 4712  H HD11 . ILE A 1 319 ? 33.289   -60.270  -52.586  1.00 0.00 ? 314 ILE A HD11 1  
ATOM 4713  H HD12 . ILE A 1 319 ? 32.915   -61.722  -53.515  1.00 0.00 ? 314 ILE A HD12 1  
ATOM 4714  H HD13 . ILE A 1 319 ? 31.666   -60.509  -53.234  1.00 0.00 ? 314 ILE A HD13 1  
ATOM 4715  N N    . GLN A 1 320 ? 31.347   -57.191  -55.655  1.00 0.00 ? 315 GLN A N    1  
ATOM 4716  C CA   . GLN A 1 320 ? 31.357   -55.791  -55.137  1.00 0.00 ? 315 GLN A CA   1  
ATOM 4717  C C    . GLN A 1 320 ? 30.700   -55.731  -53.755  1.00 0.00 ? 315 GLN A C    1  
ATOM 4718  O O    . GLN A 1 320 ? 30.355   -54.672  -53.270  1.00 0.00 ? 315 GLN A O    1  
ATOM 4719  C CB   . GLN A 1 320 ? 30.539   -54.994  -56.151  1.00 0.00 ? 315 GLN A CB   1  
ATOM 4720  C CG   . GLN A 1 320 ? 30.761   -53.497  -55.925  1.00 0.00 ? 315 GLN A CG   1  
ATOM 4721  C CD   . GLN A 1 320 ? 30.356   -52.726  -57.183  1.00 0.00 ? 315 GLN A CD   1  
ATOM 4722  O OE1  . GLN A 1 320 ? 29.230   -52.287  -57.304  1.00 0.00 ? 315 GLN A OE1  1  
ATOM 4723  N NE2  . GLN A 1 320 ? 31.234   -52.540  -58.130  1.00 0.00 ? 315 GLN A NE2  1  
ATOM 4724  H H    . GLN A 1 320 ? 30.593   -57.783  -55.445  1.00 0.00 ? 315 GLN A H    1  
ATOM 4725  H HA   . GLN A 1 320 ? 32.366   -55.411  -55.095  1.00 0.00 ? 315 GLN A HA   1  
ATOM 4726  H HB2  . GLN A 1 320 ? 30.849   -55.259  -57.151  1.00 0.00 ? 315 GLN A HB2  1  
ATOM 4727  H HB3  . GLN A 1 320 ? 29.492   -55.224  -56.025  1.00 0.00 ? 315 GLN A HB3  1  
ATOM 4728  H HG2  . GLN A 1 320 ? 30.161   -53.166  -55.090  1.00 0.00 ? 315 GLN A HG2  1  
ATOM 4729  H HG3  . GLN A 1 320 ? 31.804   -53.315  -55.714  1.00 0.00 ? 315 GLN A HG3  1  
ATOM 4730  H HE21 . GLN A 1 320 ? 32.143   -52.894  -58.032  1.00 0.00 ? 315 GLN A HE21 1  
ATOM 4731  H HE22 . GLN A 1 320 ? 30.985   -52.047  -58.939  1.00 0.00 ? 315 GLN A HE22 1  
ATOM 4732  N N    . VAL A 1 321 ? 30.522   -56.863  -53.122  1.00 0.00 ? 316 VAL A N    1  
ATOM 4733  C CA   . VAL A 1 321 ? 29.883   -56.889  -51.771  1.00 0.00 ? 316 VAL A CA   1  
ATOM 4734  C C    . VAL A 1 321 ? 28.503   -56.225  -51.819  1.00 0.00 ? 316 VAL A C    1  
ATOM 4735  O O    . VAL A 1 321 ? 28.151   -55.560  -52.774  1.00 0.00 ? 316 VAL A O    1  
ATOM 4736  C CB   . VAL A 1 321 ? 30.833   -56.110  -50.854  1.00 0.00 ? 316 VAL A CB   1  
ATOM 4737  C CG1  . VAL A 1 321 ? 30.261   -56.068  -49.435  1.00 0.00 ? 316 VAL A CG1  1  
ATOM 4738  C CG2  . VAL A 1 321 ? 32.196   -56.807  -50.827  1.00 0.00 ? 316 VAL A CG2  1  
ATOM 4739  H H    . VAL A 1 321 ? 30.807   -57.702  -53.537  1.00 0.00 ? 316 VAL A H    1  
ATOM 4740  H HA   . VAL A 1 321 ? 29.793   -57.906  -51.422  1.00 0.00 ? 316 VAL A HA   1  
ATOM 4741  H HB   . VAL A 1 321 ? 30.949   -55.103  -51.224  1.00 0.00 ? 316 VAL A HB   1  
ATOM 4742  H HG11 . VAL A 1 321 ? 29.372   -55.455  -49.423  1.00 0.00 ? 316 VAL A HG11 1  
ATOM 4743  H HG12 . VAL A 1 321 ? 30.996   -55.649  -48.763  1.00 0.00 ? 316 VAL A HG12 1  
ATOM 4744  H HG13 . VAL A 1 321 ? 30.013   -57.069  -49.117  1.00 0.00 ? 316 VAL A HG13 1  
ATOM 4745  H HG21 . VAL A 1 321 ? 32.840   -56.366  -51.573  1.00 0.00 ? 316 VAL A HG21 1  
ATOM 4746  H HG22 . VAL A 1 321 ? 32.067   -57.858  -51.038  1.00 0.00 ? 316 VAL A HG22 1  
ATOM 4747  H HG23 . VAL A 1 321 ? 32.642   -56.688  -49.851  1.00 0.00 ? 316 VAL A HG23 1  
ATOM 4748  N N    . THR A 1 322 ? 27.720   -56.406  -50.793  1.00 0.00 ? 317 THR A N    1  
ATOM 4749  C CA   . THR A 1 322 ? 26.361   -55.795  -50.760  1.00 0.00 ? 317 THR A CA   1  
ATOM 4750  C C    . THR A 1 322 ? 26.148   -55.135  -49.393  1.00 0.00 ? 317 THR A C    1  
ATOM 4751  O O    . THR A 1 322 ? 27.047   -55.122  -48.578  1.00 0.00 ? 317 THR A O    1  
ATOM 4752  C CB   . THR A 1 322 ? 25.385   -56.965  -50.970  1.00 0.00 ? 317 THR A CB   1  
ATOM 4753  O OG1  . THR A 1 322 ? 25.162   -57.626  -49.731  1.00 0.00 ? 317 THR A OG1  1  
ATOM 4754  C CG2  . THR A 1 322 ? 25.962   -57.959  -51.982  1.00 0.00 ? 317 THR A CG2  1  
ATOM 4755  H H    . THR A 1 322 ? 28.025   -56.947  -50.038  1.00 0.00 ? 317 THR A H    1  
ATOM 4756  H HA   . THR A 1 322 ? 26.252   -55.071  -51.553  1.00 0.00 ? 317 THR A HA   1  
ATOM 4757  H HB   . THR A 1 322 ? 24.449   -56.587  -51.348  1.00 0.00 ? 317 THR A HB   1  
ATOM 4758  H HG1  . THR A 1 322 ? 26.017   -57.793  -49.326  1.00 0.00 ? 317 THR A HG1  1  
ATOM 4759  H HG21 . THR A 1 322 ? 25.160   -58.537  -52.416  1.00 0.00 ? 317 THR A HG21 1  
ATOM 4760  H HG22 . THR A 1 322 ? 26.654   -58.621  -51.482  1.00 0.00 ? 317 THR A HG22 1  
ATOM 4761  H HG23 . THR A 1 322 ? 26.480   -57.420  -52.761  1.00 0.00 ? 317 THR A HG23 1  
ATOM 4762  N N    . PRO A 1 323 ? 24.971   -54.605  -49.175  1.00 0.00 ? 318 PRO A N    1  
ATOM 4763  C CA   . PRO A 1 323 ? 24.681   -53.946  -47.883  1.00 0.00 ? 318 PRO A CA   1  
ATOM 4764  C C    . PRO A 1 323 ? 24.345   -54.983  -46.801  1.00 0.00 ? 318 PRO A C    1  
ATOM 4765  O O    . PRO A 1 323 ? 23.950   -54.637  -45.705  1.00 0.00 ? 318 PRO A O    1  
ATOM 4766  C CB   . PRO A 1 323 ? 23.473   -53.073  -48.194  1.00 0.00 ? 318 PRO A CB   1  
ATOM 4767  C CG   . PRO A 1 323 ? 22.797   -53.720  -49.364  1.00 0.00 ? 318 PRO A CG   1  
ATOM 4768  C CD   . PRO A 1 323 ? 23.821   -54.564  -50.085  1.00 0.00 ? 318 PRO A CD   1  
ATOM 4769  H HA   . PRO A 1 323 ? 25.510   -53.331  -47.575  1.00 0.00 ? 318 PRO A HA   1  
ATOM 4770  H HB2  . PRO A 1 323 ? 22.808   -53.042  -47.343  1.00 0.00 ? 318 PRO A HB2  1  
ATOM 4771  H HB3  . PRO A 1 323 ? 23.793   -52.078  -48.458  1.00 0.00 ? 318 PRO A HB3  1  
ATOM 4772  H HG2  . PRO A 1 323 ? 21.985   -54.343  -49.017  1.00 0.00 ? 318 PRO A HG2  1  
ATOM 4773  H HG3  . PRO A 1 323 ? 22.418   -52.963  -50.033  1.00 0.00 ? 318 PRO A HG3  1  
ATOM 4774  H HD2  . PRO A 1 323 ? 23.430   -55.558  -50.250  1.00 0.00 ? 318 PRO A HD2  1  
ATOM 4775  H HD3  . PRO A 1 323 ? 24.101   -54.104  -51.020  1.00 0.00 ? 318 PRO A HD3  1  
ATOM 4776  N N    . GLN A 1 324 ? 24.500   -56.249  -47.097  1.00 0.00 ? 319 GLN A N    1  
ATOM 4777  C CA   . GLN A 1 324 ? 24.190   -57.298  -46.083  1.00 0.00 ? 319 GLN A CA   1  
ATOM 4778  C C    . GLN A 1 324 ? 25.485   -57.860  -45.487  1.00 0.00 ? 319 GLN A C    1  
ATOM 4779  O O    . GLN A 1 324 ? 25.637   -57.944  -44.284  1.00 0.00 ? 319 GLN A O    1  
ATOM 4780  C CB   . GLN A 1 324 ? 23.434   -58.384  -46.854  1.00 0.00 ? 319 GLN A CB   1  
ATOM 4781  C CG   . GLN A 1 324 ? 22.129   -58.715  -46.127  1.00 0.00 ? 319 GLN A CG   1  
ATOM 4782  C CD   . GLN A 1 324 ? 21.726   -60.160  -46.429  1.00 0.00 ? 319 GLN A CD   1  
ATOM 4783  O OE1  . GLN A 1 324 ? 22.315   -61.088  -45.913  1.00 0.00 ? 319 GLN A OE1  1  
ATOM 4784  N NE2  . GLN A 1 324 ? 20.739   -60.390  -47.251  1.00 0.00 ? 319 GLN A NE2  1  
ATOM 4785  H H    . GLN A 1 324 ? 24.818   -56.510  -47.983  1.00 0.00 ? 319 GLN A H    1  
ATOM 4786  H HA   . GLN A 1 324 ? 23.562   -56.894  -45.305  1.00 0.00 ? 319 GLN A HA   1  
ATOM 4787  H HB2  . GLN A 1 324 ? 23.212   -58.030  -47.850  1.00 0.00 ? 319 GLN A HB2  1  
ATOM 4788  H HB3  . GLN A 1 324 ? 24.044   -59.273  -46.916  1.00 0.00 ? 319 GLN A HB3  1  
ATOM 4789  H HG2  . GLN A 1 324 ? 22.270   -58.595  -45.062  1.00 0.00 ? 319 GLN A HG2  1  
ATOM 4790  H HG3  . GLN A 1 324 ? 21.350   -58.048  -46.464  1.00 0.00 ? 319 GLN A HG3  1  
ATOM 4791  H HE21 . GLN A 1 324 ? 20.263   -59.642  -47.668  1.00 0.00 ? 319 GLN A HE21 1  
ATOM 4792  H HE22 . GLN A 1 324 ? 20.473   -61.312  -47.451  1.00 0.00 ? 319 GLN A HE22 1  
ATOM 4793  N N    . GLU A 1 325 ? 26.415   -58.254  -46.318  1.00 0.00 ? 320 GLU A N    1  
ATOM 4794  C CA   . GLU A 1 325 ? 27.695   -58.820  -45.797  1.00 0.00 ? 320 GLU A CA   1  
ATOM 4795  C C    . GLU A 1 325 ? 28.709   -57.706  -45.506  1.00 0.00 ? 320 GLU A C    1  
ATOM 4796  O O    . GLU A 1 325 ? 29.658   -57.901  -44.772  1.00 0.00 ? 320 GLU A O    1  
ATOM 4797  C CB   . GLU A 1 325 ? 28.206   -59.739  -46.910  1.00 0.00 ? 320 GLU A CB   1  
ATOM 4798  C CG   . GLU A 1 325 ? 28.419   -58.937  -48.198  1.00 0.00 ? 320 GLU A CG   1  
ATOM 4799  C CD   . GLU A 1 325 ? 29.602   -59.521  -48.973  1.00 0.00 ? 320 GLU A CD   1  
ATOM 4800  O OE1  . GLU A 1 325 ? 30.642   -59.719  -48.367  1.00 0.00 ? 320 GLU A OE1  1  
ATOM 4801  O OE2  . GLU A 1 325 ? 29.447   -59.759  -50.160  1.00 0.00 ? 320 GLU A OE2  1  
ATOM 4802  H H    . GLU A 1 325 ? 26.269   -58.185  -47.284  1.00 0.00 ? 320 GLU A H    1  
ATOM 4803  H HA   . GLU A 1 325 ? 27.511   -59.397  -44.905  1.00 0.00 ? 320 GLU A HA   1  
ATOM 4804  H HB2  . GLU A 1 325 ? 29.143   -60.183  -46.605  1.00 0.00 ? 320 GLU A HB2  1  
ATOM 4805  H HB3  . GLU A 1 325 ? 27.481   -60.517  -47.091  1.00 0.00 ? 320 GLU A HB3  1  
ATOM 4806  H HG2  . GLU A 1 325 ? 27.528   -58.991  -48.806  1.00 0.00 ? 320 GLU A HG2  1  
ATOM 4807  H HG3  . GLU A 1 325 ? 28.626   -57.907  -47.953  1.00 0.00 ? 320 GLU A HG3  1  
ATOM 4808  N N    . LYS A 1 326 ? 28.524   -56.544  -46.077  1.00 0.00 ? 321 LYS A N    1  
ATOM 4809  C CA   . LYS A 1 326 ? 29.488   -55.427  -45.831  1.00 0.00 ? 321 LYS A CA   1  
ATOM 4810  C C    . LYS A 1 326 ? 29.605   -55.139  -44.330  1.00 0.00 ? 321 LYS A C    1  
ATOM 4811  O O    . LYS A 1 326 ? 30.667   -54.817  -43.834  1.00 0.00 ? 321 LYS A O    1  
ATOM 4812  C CB   . LYS A 1 326 ? 28.903   -54.220  -46.569  1.00 0.00 ? 321 LYS A CB   1  
ATOM 4813  C CG   . LYS A 1 326 ? 29.782   -52.990  -46.325  1.00 0.00 ? 321 LYS A CG   1  
ATOM 4814  C CD   . LYS A 1 326 ? 29.941   -52.206  -47.629  1.00 0.00 ? 321 LYS A CD   1  
ATOM 4815  C CE   . LYS A 1 326 ? 31.237   -51.394  -47.582  1.00 0.00 ? 321 LYS A CE   1  
ATOM 4816  N NZ   . LYS A 1 326 ? 31.246   -50.610  -48.848  1.00 0.00 ? 321 LYS A NZ   1  
ATOM 4817  H H    . LYS A 1 326 ? 27.755   -56.406  -46.669  1.00 0.00 ? 321 LYS A H    1  
ATOM 4818  H HA   . LYS A 1 326 ? 30.455   -55.673  -46.240  1.00 0.00 ? 321 LYS A HA   1  
ATOM 4819  H HB2  . LYS A 1 326 ? 28.867   -54.432  -47.627  1.00 0.00 ? 321 LYS A HB2  1  
ATOM 4820  H HB3  . LYS A 1 326 ? 27.905   -54.025  -46.206  1.00 0.00 ? 321 LYS A HB3  1  
ATOM 4821  H HG2  . LYS A 1 326 ? 29.319   -52.359  -45.579  1.00 0.00 ? 321 LYS A HG2  1  
ATOM 4822  H HG3  . LYS A 1 326 ? 30.755   -53.305  -45.976  1.00 0.00 ? 321 LYS A HG3  1  
ATOM 4823  H HD2  . LYS A 1 326 ? 29.977   -52.895  -48.461  1.00 0.00 ? 321 LYS A HD2  1  
ATOM 4824  H HD3  . LYS A 1 326 ? 29.103   -51.536  -47.751  1.00 0.00 ? 321 LYS A HD3  1  
ATOM 4825  H HE2  . LYS A 1 326 ? 31.234   -50.732  -46.726  1.00 0.00 ? 321 LYS A HE2  1  
ATOM 4826  H HE3  . LYS A 1 326 ? 32.093   -52.051  -47.548  1.00 0.00 ? 321 LYS A HE3  1  
ATOM 4827  H HZ1  . LYS A 1 326 ? 31.084   -51.247  -49.653  1.00 0.00 ? 321 LYS A HZ1  1  
ATOM 4828  H HZ2  . LYS A 1 326 ? 32.168   -50.139  -48.958  1.00 0.00 ? 321 LYS A HZ2  1  
ATOM 4829  H HZ3  . LYS A 1 326 ? 30.493   -49.894  -48.818  1.00 0.00 ? 321 LYS A HZ3  1  
ATOM 4830  N N    . GLU A 1 327 ? 28.525   -55.250  -43.603  1.00 0.00 ? 322 GLU A N    1  
ATOM 4831  C CA   . GLU A 1 327 ? 28.584   -54.980  -42.135  1.00 0.00 ? 322 GLU A CA   1  
ATOM 4832  C C    . GLU A 1 327 ? 29.565   -55.945  -41.461  1.00 0.00 ? 322 GLU A C    1  
ATOM 4833  O O    . GLU A 1 327 ? 30.283   -55.581  -40.550  1.00 0.00 ? 322 GLU A O    1  
ATOM 4834  C CB   . GLU A 1 327 ? 27.158   -55.209  -41.625  1.00 0.00 ? 322 GLU A CB   1  
ATOM 4835  C CG   . GLU A 1 327 ? 26.758   -56.671  -41.838  1.00 0.00 ? 322 GLU A CG   1  
ATOM 4836  C CD   . GLU A 1 327 ? 25.252   -56.825  -41.623  1.00 0.00 ? 322 GLU A CD   1  
ATOM 4837  O OE1  . GLU A 1 327 ? 24.503   -56.403  -42.489  1.00 0.00 ? 322 GLU A OE1  1  
ATOM 4838  O OE2  . GLU A 1 327 ? 24.872   -57.362  -40.596  1.00 0.00 ? 322 GLU A OE2  1  
ATOM 4839  H H    . GLU A 1 327 ? 27.677   -55.510  -44.021  1.00 0.00 ? 322 GLU A H    1  
ATOM 4840  H HA   . GLU A 1 327 ? 28.879   -53.958  -41.954  1.00 0.00 ? 322 GLU A HA   1  
ATOM 4841  H HB2  . GLU A 1 327 ? 27.112   -54.974  -40.571  1.00 0.00 ? 322 GLU A HB2  1  
ATOM 4842  H HB3  . GLU A 1 327 ? 26.476   -54.570  -42.165  1.00 0.00 ? 322 GLU A HB3  1  
ATOM 4843  H HG2  . GLU A 1 327 ? 27.013   -56.970  -42.844  1.00 0.00 ? 322 GLU A HG2  1  
ATOM 4844  H HG3  . GLU A 1 327 ? 27.286   -57.295  -41.133  1.00 0.00 ? 322 GLU A HG3  1  
ATOM 4845  N N    . ALA A 1 328 ? 29.599   -57.173  -41.906  1.00 0.00 ? 323 ALA A N    1  
ATOM 4846  C CA   . ALA A 1 328 ? 30.533   -58.165  -41.297  1.00 0.00 ? 323 ALA A CA   1  
ATOM 4847  C C    . ALA A 1 328 ? 31.980   -57.812  -41.651  1.00 0.00 ? 323 ALA A C    1  
ATOM 4848  O O    . ALA A 1 328 ? 32.874   -57.935  -40.839  1.00 0.00 ? 323 ALA A O    1  
ATOM 4849  C CB   . ALA A 1 328 ? 30.142   -59.509  -41.911  1.00 0.00 ? 323 ALA A CB   1  
ATOM 4850  H H    . ALA A 1 328 ? 29.011   -57.442  -42.643  1.00 0.00 ? 323 ALA A H    1  
ATOM 4851  H HA   . ALA A 1 328 ? 30.403   -58.196  -40.227  1.00 0.00 ? 323 ALA A HA   1  
ATOM 4852  H HB1  . ALA A 1 328 ? 31.022   -60.127  -42.014  1.00 0.00 ? 323 ALA A HB1  1  
ATOM 4853  H HB2  . ALA A 1 328 ? 29.700   -59.346  -42.883  1.00 0.00 ? 323 ALA A HB2  1  
ATOM 4854  H HB3  . ALA A 1 328 ? 29.428   -60.004  -41.269  1.00 0.00 ? 323 ALA A HB3  1  
ATOM 4855  N N    . ILE A 1 329 ? 32.214   -57.370  -42.858  1.00 0.00 ? 324 ILE A N    1  
ATOM 4856  C CA   . ILE A 1 329 ? 33.606   -57.005  -43.264  1.00 0.00 ? 324 ILE A CA   1  
ATOM 4857  C C    . ILE A 1 329 ? 34.015   -55.698  -42.593  1.00 0.00 ? 324 ILE A C    1  
ATOM 4858  O O    . ILE A 1 329 ? 35.109   -55.566  -42.080  1.00 0.00 ? 324 ILE A O    1  
ATOM 4859  C CB   . ILE A 1 329 ? 33.560   -56.803  -44.781  1.00 0.00 ? 324 ILE A CB   1  
ATOM 4860  C CG1  . ILE A 1 329 ? 32.879   -58.000  -45.460  1.00 0.00 ? 324 ILE A CG1  1  
ATOM 4861  C CG2  . ILE A 1 329 ? 34.988   -56.660  -45.317  1.00 0.00 ? 324 ILE A CG2  1  
ATOM 4862  C CD1  . ILE A 1 329 ? 33.616   -59.293  -45.097  1.00 0.00 ? 324 ILE A CD1  1  
ATOM 4863  H H    . ILE A 1 329 ? 31.477   -57.276  -43.495  1.00 0.00 ? 324 ILE A H    1  
ATOM 4864  H HA   . ILE A 1 329 ? 34.296   -57.794  -43.014  1.00 0.00 ? 324 ILE A HA   1  
ATOM 4865  H HB   . ILE A 1 329 ? 33.009   -55.896  -44.996  1.00 0.00 ? 324 ILE A HB   1  
ATOM 4866  H HG12 . ILE A 1 329 ? 31.853   -58.066  -45.131  1.00 0.00 ? 324 ILE A HG12 1  
ATOM 4867  H HG13 . ILE A 1 329 ? 32.903   -57.865  -46.531  1.00 0.00 ? 324 ILE A HG13 1  
ATOM 4868  H HG21 . ILE A 1 329 ? 35.290   -57.583  -45.789  1.00 0.00 ? 324 ILE A HG21 1  
ATOM 4869  H HG22 . ILE A 1 329 ? 35.660   -56.437  -44.502  1.00 0.00 ? 324 ILE A HG22 1  
ATOM 4870  H HG23 . ILE A 1 329 ? 35.022   -55.859  -46.041  1.00 0.00 ? 324 ILE A HG23 1  
ATOM 4871  H HD11 . ILE A 1 329 ? 34.607   -59.274  -45.525  1.00 0.00 ? 324 ILE A HD11 1  
ATOM 4872  H HD12 . ILE A 1 329 ? 33.071   -60.139  -45.487  1.00 0.00 ? 324 ILE A HD12 1  
ATOM 4873  H HD13 . ILE A 1 329 ? 33.689   -59.376  -44.022  1.00 0.00 ? 324 ILE A HD13 1  
ATOM 4874  N N    . GLU A 1 330 ? 33.144   -54.726  -42.610  1.00 0.00 ? 325 GLU A N    1  
ATOM 4875  C CA   . GLU A 1 330 ? 33.474   -53.413  -41.991  1.00 0.00 ? 325 GLU A CA   1  
ATOM 4876  C C    . GLU A 1 330 ? 33.973   -53.610  -40.555  1.00 0.00 ? 325 GLU A C    1  
ATOM 4877  O O    . GLU A 1 330 ? 34.988   -53.070  -40.161  1.00 0.00 ? 325 GLU A O    1  
ATOM 4878  C CB   . GLU A 1 330 ? 32.164   -52.624  -42.003  1.00 0.00 ? 325 GLU A CB   1  
ATOM 4879  C CG   . GLU A 1 330 ? 32.062   -51.825  -43.304  1.00 0.00 ? 325 GLU A CG   1  
ATOM 4880  C CD   . GLU A 1 330 ? 32.639   -50.425  -43.090  1.00 0.00 ? 325 GLU A CD   1  
ATOM 4881  O OE1  . GLU A 1 330 ? 32.169   -49.743  -42.195  1.00 0.00 ? 325 GLU A OE1  1  
ATOM 4882  O OE2  . GLU A 1 330 ? 33.541   -50.059  -43.825  1.00 0.00 ? 325 GLU A OE2  1  
ATOM 4883  H H    . GLU A 1 330 ? 32.274   -54.859  -43.041  1.00 0.00 ? 325 GLU A H    1  
ATOM 4884  H HA   . GLU A 1 330 ? 34.215   -52.905  -42.585  1.00 0.00 ? 325 GLU A HA   1  
ATOM 4885  H HB2  . GLU A 1 330 ? 31.331   -53.309  -41.933  1.00 0.00 ? 325 GLU A HB2  1  
ATOM 4886  H HB3  . GLU A 1 330 ? 32.144   -51.946  -41.164  1.00 0.00 ? 325 GLU A HB3  1  
ATOM 4887  H HG2  . GLU A 1 330 ? 32.618   -52.331  -44.081  1.00 0.00 ? 325 GLU A HG2  1  
ATOM 4888  H HG3  . GLU A 1 330 ? 31.026   -51.745  -43.597  1.00 0.00 ? 325 GLU A HG3  1  
ATOM 4889  N N    . ARG A 1 331 ? 33.268   -54.385  -39.775  1.00 0.00 ? 326 ARG A N    1  
ATOM 4890  C CA   . ARG A 1 331 ? 33.702   -54.624  -38.367  1.00 0.00 ? 326 ARG A CA   1  
ATOM 4891  C C    . ARG A 1 331 ? 34.940   -55.525  -38.347  1.00 0.00 ? 326 ARG A C    1  
ATOM 4892  O O    . ARG A 1 331 ? 35.754   -55.458  -37.447  1.00 0.00 ? 326 ARG A O    1  
ATOM 4893  C CB   . ARG A 1 331 ? 32.517   -55.319  -37.696  1.00 0.00 ? 326 ARG A CB   1  
ATOM 4894  C CG   . ARG A 1 331 ? 31.422   -54.291  -37.402  1.00 0.00 ? 326 ARG A CG   1  
ATOM 4895  C CD   . ARG A 1 331 ? 30.229   -54.987  -36.744  1.00 0.00 ? 326 ARG A CD   1  
ATOM 4896  N NE   . ARG A 1 331 ? 29.061   -54.111  -37.043  1.00 0.00 ? 326 ARG A NE   1  
ATOM 4897  C CZ   . ARG A 1 331 ? 28.284   -53.706  -36.076  1.00 0.00 ? 326 ARG A CZ   1  
ATOM 4898  N NH1  . ARG A 1 331 ? 28.802   -53.287  -34.953  1.00 0.00 ? 326 ARG A NH1  1  
ATOM 4899  N NH2  . ARG A 1 331 ? 26.989   -53.718  -36.231  1.00 0.00 ? 326 ARG A NH2  1  
ATOM 4900  H H    . ARG A 1 331 ? 32.455   -54.814  -40.116  1.00 0.00 ? 326 ARG A H    1  
ATOM 4901  H HA   . ARG A 1 331 ? 33.909   -53.687  -37.873  1.00 0.00 ? 326 ARG A HA   1  
ATOM 4902  H HB2  . ARG A 1 331 ? 32.128   -56.083  -38.354  1.00 0.00 ? 326 ARG A HB2  1  
ATOM 4903  H HB3  . ARG A 1 331 ? 32.841   -55.771  -36.771  1.00 0.00 ? 326 ARG A HB3  1  
ATOM 4904  H HG2  . ARG A 1 331 ? 31.810   -53.533  -36.737  1.00 0.00 ? 326 ARG A HG2  1  
ATOM 4905  H HG3  . ARG A 1 331 ? 31.103   -53.831  -38.325  1.00 0.00 ? 326 ARG A HG3  1  
ATOM 4906  H HD2  . ARG A 1 331 ? 30.085   -55.969  -37.172  1.00 0.00 ? 326 ARG A HD2  1  
ATOM 4907  H HD3  . ARG A 1 331 ? 30.375   -55.057  -35.677  1.00 0.00 ? 326 ARG A HD3  1  
ATOM 4908  H HE   . ARG A 1 331 ? 28.877   -53.839  -37.966  1.00 0.00 ? 326 ARG A HE   1  
ATOM 4909  H HH11 . ARG A 1 331 ? 29.795   -53.276  -34.834  1.00 0.00 ? 326 ARG A HH11 1  
ATOM 4910  H HH12 . ARG A 1 331 ? 28.206   -52.976  -34.213  1.00 0.00 ? 326 ARG A HH12 1  
ATOM 4911  H HH21 . ARG A 1 331 ? 26.591   -54.038  -37.091  1.00 0.00 ? 326 ARG A HH21 1  
ATOM 4912  H HH22 . ARG A 1 331 ? 26.393   -53.408  -35.490  1.00 0.00 ? 326 ARG A HH22 1  
ATOM 4913  N N    . LEU A 1 332 ? 35.087   -56.366  -39.337  1.00 0.00 ? 327 LEU A N    1  
ATOM 4914  C CA   . LEU A 1 332 ? 36.274   -57.271  -39.381  1.00 0.00 ? 327 LEU A CA   1  
ATOM 4915  C C    . LEU A 1 332 ? 37.538   -56.452  -39.623  1.00 0.00 ? 327 LEU A C    1  
ATOM 4916  O O    . LEU A 1 332 ? 38.398   -56.352  -38.770  1.00 0.00 ? 327 LEU A O    1  
ATOM 4917  C CB   . LEU A 1 332 ? 36.011   -58.221  -40.551  1.00 0.00 ? 327 LEU A CB   1  
ATOM 4918  C CG   . LEU A 1 332 ? 35.566   -59.586  -40.017  1.00 0.00 ? 327 LEU A CG   1  
ATOM 4919  C CD1  . LEU A 1 332 ? 34.353   -59.414  -39.095  1.00 0.00 ? 327 LEU A CD1  1  
ATOM 4920  C CD2  . LEU A 1 332 ? 35.189   -60.489  -41.194  1.00 0.00 ? 327 LEU A CD2  1  
ATOM 4921  H H    . LEU A 1 332 ? 34.419   -56.400  -40.053  1.00 0.00 ? 327 LEU A H    1  
ATOM 4922  H HA   . LEU A 1 332 ? 36.356   -57.830  -38.463  1.00 0.00 ? 327 LEU A HA   1  
ATOM 4923  H HB2  . LEU A 1 332 ? 35.236   -57.809  -41.181  1.00 0.00 ? 327 LEU A HB2  1  
ATOM 4924  H HB3  . LEU A 1 332 ? 36.917   -58.340  -41.127  1.00 0.00 ? 327 LEU A HB3  1  
ATOM 4925  H HG   . LEU A 1 332 ? 36.377   -60.035  -39.463  1.00 0.00 ? 327 LEU A HG   1  
ATOM 4926  H HD11 . LEU A 1 332 ? 34.591   -59.799  -38.114  1.00 0.00 ? 327 LEU A HD11 1  
ATOM 4927  H HD12 . LEU A 1 332 ? 33.511   -59.954  -39.499  1.00 0.00 ? 327 LEU A HD12 1  
ATOM 4928  H HD13 . LEU A 1 332 ? 34.104   -58.365  -39.017  1.00 0.00 ? 327 LEU A HD13 1  
ATOM 4929  H HD21 . LEU A 1 332 ? 34.861   -59.880  -42.023  1.00 0.00 ? 327 LEU A HD21 1  
ATOM 4930  H HD22 . LEU A 1 332 ? 34.391   -61.152  -40.897  1.00 0.00 ? 327 LEU A HD22 1  
ATOM 4931  H HD23 . LEU A 1 332 ? 36.049   -61.069  -41.491  1.00 0.00 ? 327 LEU A HD23 1  
ATOM 4932  N N    . LYS A 1 333 ? 37.651   -55.848  -40.776  1.00 0.00 ? 328 LYS A N    1  
ATOM 4933  C CA   . LYS A 1 333 ? 38.855   -55.017  -41.066  1.00 0.00 ? 328 LYS A CA   1  
ATOM 4934  C C    . LYS A 1 333 ? 39.005   -53.930  -39.996  1.00 0.00 ? 328 LYS A C    1  
ATOM 4935  O O    . LYS A 1 333 ? 40.056   -53.341  -39.839  1.00 0.00 ? 328 LYS A O    1  
ATOM 4936  C CB   . LYS A 1 333 ? 38.588   -54.386  -42.433  1.00 0.00 ? 328 LYS A CB   1  
ATOM 4937  C CG   . LYS A 1 333 ? 39.153   -55.288  -43.532  1.00 0.00 ? 328 LYS A CG   1  
ATOM 4938  C CD   . LYS A 1 333 ? 39.407   -54.459  -44.794  1.00 0.00 ? 328 LYS A CD   1  
ATOM 4939  C CE   . LYS A 1 333 ? 38.081   -53.897  -45.312  1.00 0.00 ? 328 LYS A CE   1  
ATOM 4940  N NZ   . LYS A 1 333 ? 38.436   -53.170  -46.563  1.00 0.00 ? 328 LYS A NZ   1  
ATOM 4941  H H    . LYS A 1 333 ? 36.940   -55.932  -41.445  1.00 0.00 ? 328 LYS A H    1  
ATOM 4942  H HA   . LYS A 1 333 ? 39.740   -55.632  -41.107  1.00 0.00 ? 328 LYS A HA   1  
ATOM 4943  H HB2  . LYS A 1 333 ? 37.523   -54.270  -42.573  1.00 0.00 ? 328 LYS A HB2  1  
ATOM 4944  H HB3  . LYS A 1 333 ? 39.066   -53.419  -42.482  1.00 0.00 ? 328 LYS A HB3  1  
ATOM 4945  H HG2  . LYS A 1 333 ? 40.082   -55.726  -43.196  1.00 0.00 ? 328 LYS A HG2  1  
ATOM 4946  H HG3  . LYS A 1 333 ? 38.445   -56.071  -43.755  1.00 0.00 ? 328 LYS A HG3  1  
ATOM 4947  H HD2  . LYS A 1 333 ? 40.077   -53.645  -44.560  1.00 0.00 ? 328 LYS A HD2  1  
ATOM 4948  H HD3  . LYS A 1 333 ? 39.851   -55.085  -45.553  1.00 0.00 ? 328 LYS A HD3  1  
ATOM 4949  H HE2  . LYS A 1 333 ? 37.390   -54.701  -45.524  1.00 0.00 ? 328 LYS A HE2  1  
ATOM 4950  H HE3  . LYS A 1 333 ? 37.656   -53.213  -44.594  1.00 0.00 ? 328 LYS A HE3  1  
ATOM 4951  H HZ1  . LYS A 1 333 ? 38.975   -52.313  -46.325  1.00 0.00 ? 328 LYS A HZ1  1  
ATOM 4952  H HZ2  . LYS A 1 333 ? 37.565   -52.904  -47.067  1.00 0.00 ? 328 LYS A HZ2  1  
ATOM 4953  H HZ3  . LYS A 1 333 ? 39.015   -53.784  -47.169  1.00 0.00 ? 328 LYS A HZ3  1  
ATOM 4954  N N    . ALA A 1 334 ? 37.957   -53.664  -39.256  1.00 0.00 ? 329 ALA A N    1  
ATOM 4955  C CA   . ALA A 1 334 ? 38.040   -52.620  -38.195  1.00 0.00 ? 329 ALA A CA   1  
ATOM 4956  C C    . ALA A 1 334 ? 38.656   -53.207  -36.921  1.00 0.00 ? 329 ALA A C    1  
ATOM 4957  O O    . ALA A 1 334 ? 39.172   -52.490  -36.086  1.00 0.00 ? 329 ALA A O    1  
ATOM 4958  C CB   . ALA A 1 334 ? 36.593   -52.193  -37.945  1.00 0.00 ? 329 ALA A CB   1  
ATOM 4959  H H    . ALA A 1 334 ? 37.116   -54.154  -39.397  1.00 0.00 ? 329 ALA A H    1  
ATOM 4960  H HA   . ALA A 1 334 ? 38.618   -51.778  -38.540  1.00 0.00 ? 329 ALA A HA   1  
ATOM 4961  H HB1  . ALA A 1 334 ? 36.293   -51.480  -38.699  1.00 0.00 ? 329 ALA A HB1  1  
ATOM 4962  H HB2  . ALA A 1 334 ? 36.515   -51.738  -36.969  1.00 0.00 ? 329 ALA A HB2  1  
ATOM 4963  H HB3  . ALA A 1 334 ? 35.949   -53.059  -37.991  1.00 0.00 ? 329 ALA A HB3  1  
ATOM 4964  N N    . LEU A 1 335 ? 38.607   -54.505  -36.764  1.00 0.00 ? 330 LEU A N    1  
ATOM 4965  C CA   . LEU A 1 335 ? 39.191   -55.130  -35.543  1.00 0.00 ? 330 LEU A CA   1  
ATOM 4966  C C    . LEU A 1 335 ? 40.658   -55.513  -35.785  1.00 0.00 ? 330 LEU A C    1  
ATOM 4967  O O    . LEU A 1 335 ? 41.404   -55.760  -34.857  1.00 0.00 ? 330 LEU A O    1  
ATOM 4968  C CB   . LEU A 1 335 ? 38.320   -56.367  -35.270  1.00 0.00 ? 330 LEU A CB   1  
ATOM 4969  C CG   . LEU A 1 335 ? 38.832   -57.575  -36.061  1.00 0.00 ? 330 LEU A CG   1  
ATOM 4970  C CD1  . LEU A 1 335 ? 39.816   -58.366  -35.195  1.00 0.00 ? 330 LEU A CD1  1  
ATOM 4971  C CD2  . LEU A 1 335 ? 37.652   -58.474  -36.446  1.00 0.00 ? 330 LEU A CD2  1  
ATOM 4972  H H    . LEU A 1 335 ? 38.186   -55.067  -37.448  1.00 0.00 ? 330 LEU A H    1  
ATOM 4973  H HA   . LEU A 1 335 ? 39.122   -54.448  -34.712  1.00 0.00 ? 330 LEU A HA   1  
ATOM 4974  H HB2  . LEU A 1 335 ? 38.347   -56.596  -34.217  1.00 0.00 ? 330 LEU A HB2  1  
ATOM 4975  H HB3  . LEU A 1 335 ? 37.304   -56.157  -35.564  1.00 0.00 ? 330 LEU A HB3  1  
ATOM 4976  H HG   . LEU A 1 335 ? 39.334   -57.233  -36.955  1.00 0.00 ? 330 LEU A HG   1  
ATOM 4977  H HD11 . LEU A 1 335 ? 39.819   -59.399  -35.506  1.00 0.00 ? 330 LEU A HD11 1  
ATOM 4978  H HD12 . LEU A 1 335 ? 39.516   -58.304  -34.159  1.00 0.00 ? 330 LEU A HD12 1  
ATOM 4979  H HD13 . LEU A 1 335 ? 40.808   -57.953  -35.308  1.00 0.00 ? 330 LEU A HD13 1  
ATOM 4980  H HD21 . LEU A 1 335 ? 36.725   -57.937  -36.307  1.00 0.00 ? 330 LEU A HD21 1  
ATOM 4981  H HD22 . LEU A 1 335 ? 37.651   -59.357  -35.824  1.00 0.00 ? 330 LEU A HD22 1  
ATOM 4982  H HD23 . LEU A 1 335 ? 37.744   -58.766  -37.482  1.00 0.00 ? 330 LEU A HD23 1  
ATOM 4983  N N    . GLY A 1 336 ? 41.076   -55.560  -37.023  1.00 0.00 ? 331 GLY A N    1  
ATOM 4984  C CA   . GLY A 1 336 ? 42.493   -55.922  -37.320  1.00 0.00 ? 331 GLY A CA   1  
ATOM 4985  C C    . GLY A 1 336 ? 42.544   -57.110  -38.286  1.00 0.00 ? 331 GLY A C    1  
ATOM 4986  O O    . GLY A 1 336 ? 43.555   -57.774  -38.407  1.00 0.00 ? 331 GLY A O    1  
ATOM 4987  H H    . GLY A 1 336 ? 40.460   -55.353  -37.756  1.00 0.00 ? 331 GLY A H    1  
ATOM 4988  H HA2  . GLY A 1 336 ? 42.992   -55.074  -37.767  1.00 0.00 ? 331 GLY A HA2  1  
ATOM 4989  H HA3  . GLY A 1 336 ? 42.994   -56.189  -36.402  1.00 0.00 ? 331 GLY A HA3  1  
ATOM 4990  N N    . PHE A 1 337 ? 41.467   -57.386  -38.976  1.00 0.00 ? 332 PHE A N    1  
ATOM 4991  C CA   . PHE A 1 337 ? 41.469   -58.533  -39.933  1.00 0.00 ? 332 PHE A CA   1  
ATOM 4992  C C    . PHE A 1 337 ? 42.125   -58.119  -41.256  1.00 0.00 ? 332 PHE A C    1  
ATOM 4993  O O    . PHE A 1 337 ? 42.366   -56.951  -41.488  1.00 0.00 ? 332 PHE A O    1  
ATOM 4994  C CB   . PHE A 1 337 ? 39.994   -58.873  -40.153  1.00 0.00 ? 332 PHE A CB   1  
ATOM 4995  C CG   . PHE A 1 337 ? 39.632   -60.103  -39.355  1.00 0.00 ? 332 PHE A CG   1  
ATOM 4996  C CD1  . PHE A 1 337 ? 39.727   -60.084  -37.960  1.00 0.00 ? 332 PHE A CD1  1  
ATOM 4997  C CD2  . PHE A 1 337 ? 39.198   -61.262  -40.011  1.00 0.00 ? 332 PHE A CD2  1  
ATOM 4998  C CE1  . PHE A 1 337 ? 39.390   -61.223  -37.219  1.00 0.00 ? 332 PHE A CE1  1  
ATOM 4999  C CE2  . PHE A 1 337 ? 38.862   -62.401  -39.271  1.00 0.00 ? 332 PHE A CE2  1  
ATOM 5000  C CZ   . PHE A 1 337 ? 38.958   -62.381  -37.875  1.00 0.00 ? 332 PHE A CZ   1  
ATOM 5001  H H    . PHE A 1 337 ? 40.661   -56.841  -38.868  1.00 0.00 ? 332 PHE A H    1  
ATOM 5002  H HA   . PHE A 1 337 ? 41.984   -59.379  -39.506  1.00 0.00 ? 332 PHE A HA   1  
ATOM 5003  H HB2  . PHE A 1 337 ? 39.383   -58.044  -39.833  1.00 0.00 ? 332 PHE A HB2  1  
ATOM 5004  H HB3  . PHE A 1 337 ? 39.822   -59.063  -41.202  1.00 0.00 ? 332 PHE A HB3  1  
ATOM 5005  H HD1  . PHE A 1 337 ? 40.059   -59.188  -37.454  1.00 0.00 ? 332 PHE A HD1  1  
ATOM 5006  H HD2  . PHE A 1 337 ? 39.125   -61.277  -41.088  1.00 0.00 ? 332 PHE A HD2  1  
ATOM 5007  H HE1  . PHE A 1 337 ? 39.464   -61.209  -36.142  1.00 0.00 ? 332 PHE A HE1  1  
ATOM 5008  H HE2  . PHE A 1 337 ? 38.528   -63.294  -39.776  1.00 0.00 ? 332 PHE A HE2  1  
ATOM 5009  H HZ   . PHE A 1 337 ? 38.698   -63.260  -37.303  1.00 0.00 ? 332 PHE A HZ   1  
ATOM 5010  N N    . PRO A 1 338 ? 42.391   -59.097  -42.085  1.00 0.00 ? 333 PRO A N    1  
ATOM 5011  C CA   . PRO A 1 338 ? 43.024   -58.828  -43.401  1.00 0.00 ? 333 PRO A CA   1  
ATOM 5012  C C    . PRO A 1 338 ? 42.014   -58.186  -44.358  1.00 0.00 ? 333 PRO A C    1  
ATOM 5013  O O    . PRO A 1 338 ? 41.008   -57.647  -43.939  1.00 0.00 ? 333 PRO A O    1  
ATOM 5014  C CB   . PRO A 1 338 ? 43.436   -60.215  -43.889  1.00 0.00 ? 333 PRO A CB   1  
ATOM 5015  C CG   . PRO A 1 338 ? 42.515   -61.164  -43.189  1.00 0.00 ? 333 PRO A CG   1  
ATOM 5016  C CD   . PRO A 1 338 ? 42.133   -60.528  -41.879  1.00 0.00 ? 333 PRO A CD   1  
ATOM 5017  H HA   . PRO A 1 338 ? 43.894   -58.202  -43.286  1.00 0.00 ? 333 PRO A HA   1  
ATOM 5018  H HB2  . PRO A 1 338 ? 43.311   -60.289  -44.960  1.00 0.00 ? 333 PRO A HB2  1  
ATOM 5019  H HB3  . PRO A 1 338 ? 44.458   -60.423  -43.613  1.00 0.00 ? 333 PRO A HB3  1  
ATOM 5020  H HG2  . PRO A 1 338 ? 41.633   -61.331  -43.792  1.00 0.00 ? 333 PRO A HG2  1  
ATOM 5021  H HG3  . PRO A 1 338 ? 43.020   -62.100  -43.005  1.00 0.00 ? 333 PRO A HG3  1  
ATOM 5022  H HD2  . PRO A 1 338 ? 41.086   -60.701  -41.667  1.00 0.00 ? 333 PRO A HD2  1  
ATOM 5023  H HD3  . PRO A 1 338 ? 42.750   -60.906  -41.079  1.00 0.00 ? 333 PRO A HD3  1  
ATOM 5024  N N    . GLU A 1 339 ? 42.274   -58.236  -45.639  1.00 0.00 ? 334 GLU A N    1  
ATOM 5025  C CA   . GLU A 1 339 ? 41.326   -57.626  -46.618  1.00 0.00 ? 334 GLU A CA   1  
ATOM 5026  C C    . GLU A 1 339 ? 40.697   -58.713  -47.497  1.00 0.00 ? 334 GLU A C    1  
ATOM 5027  O O    . GLU A 1 339 ? 39.544   -59.063  -47.335  1.00 0.00 ? 334 GLU A O    1  
ATOM 5028  C CB   . GLU A 1 339 ? 42.183   -56.675  -47.460  1.00 0.00 ? 334 GLU A CB   1  
ATOM 5029  C CG   . GLU A 1 339 ? 41.311   -55.994  -48.519  1.00 0.00 ? 334 GLU A CG   1  
ATOM 5030  C CD   . GLU A 1 339 ? 42.114   -55.824  -49.810  1.00 0.00 ? 334 GLU A CD   1  
ATOM 5031  O OE1  . GLU A 1 339 ? 43.284   -55.492  -49.718  1.00 0.00 ? 334 GLU A OE1  1  
ATOM 5032  O OE2  . GLU A 1 339 ? 41.544   -56.029  -50.870  1.00 0.00 ? 334 GLU A OE2  1  
ATOM 5033  H H    . GLU A 1 339 ? 43.091   -58.672  -45.957  1.00 0.00 ? 334 GLU A H    1  
ATOM 5034  H HA   . GLU A 1 339 ? 40.560   -57.070  -46.102  1.00 0.00 ? 334 GLU A HA   1  
ATOM 5035  H HB2  . GLU A 1 339 ? 42.621   -55.925  -46.818  1.00 0.00 ? 334 GLU A HB2  1  
ATOM 5036  H HB3  . GLU A 1 339 ? 42.968   -57.233  -47.947  1.00 0.00 ? 334 GLU A HB3  1  
ATOM 5037  H HG2  . GLU A 1 339 ? 40.439   -56.601  -48.715  1.00 0.00 ? 334 GLU A HG2  1  
ATOM 5038  H HG3  . GLU A 1 339 ? 41.001   -55.024  -48.161  1.00 0.00 ? 334 GLU A HG3  1  
ATOM 5039  N N    . SER A 1 340 ? 41.443   -59.246  -48.428  1.00 0.00 ? 335 SER A N    1  
ATOM 5040  C CA   . SER A 1 340 ? 40.886   -60.306  -49.320  1.00 0.00 ? 335 SER A CA   1  
ATOM 5041  C C    . SER A 1 340 ? 40.559   -61.564  -48.512  1.00 0.00 ? 335 SER A C    1  
ATOM 5042  O O    . SER A 1 340 ? 39.707   -62.347  -48.885  1.00 0.00 ? 335 SER A O    1  
ATOM 5043  C CB   . SER A 1 340 ? 41.993   -60.595  -50.334  1.00 0.00 ? 335 SER A CB   1  
ATOM 5044  O OG   . SER A 1 340 ? 43.232   -60.733  -49.650  1.00 0.00 ? 335 SER A OG   1  
ATOM 5045  H H    . SER A 1 340 ? 42.369   -58.947  -48.543  1.00 0.00 ? 335 SER A H    1  
ATOM 5046  H HA   . SER A 1 340 ? 40.007   -59.946  -49.829  1.00 0.00 ? 335 SER A HA   1  
ATOM 5047  H HB2  . SER A 1 340 ? 41.774   -61.510  -50.858  1.00 0.00 ? 335 SER A HB2  1  
ATOM 5048  H HB3  . SER A 1 340 ? 42.051   -59.780  -51.044  1.00 0.00 ? 335 SER A HB3  1  
ATOM 5049  H HG   . SER A 1 340 ? 43.822   -60.043  -49.963  1.00 0.00 ? 335 SER A HG   1  
ATOM 5050  N N    . LEU A 1 341 ? 41.228   -61.764  -47.409  1.00 0.00 ? 336 LEU A N    1  
ATOM 5051  C CA   . LEU A 1 341 ? 40.955   -62.973  -46.578  1.00 0.00 ? 336 LEU A CA   1  
ATOM 5052  C C    . LEU A 1 341 ? 39.611   -62.832  -45.857  1.00 0.00 ? 336 LEU A C    1  
ATOM 5053  O O    . LEU A 1 341 ? 39.041   -63.800  -45.397  1.00 0.00 ? 336 LEU A O    1  
ATOM 5054  C CB   . LEU A 1 341 ? 42.104   -63.028  -45.570  1.00 0.00 ? 336 LEU A CB   1  
ATOM 5055  C CG   . LEU A 1 341 ? 43.161   -64.024  -46.048  1.00 0.00 ? 336 LEU A CG   1  
ATOM 5056  C CD1  . LEU A 1 341 ? 44.120   -63.327  -47.015  1.00 0.00 ? 336 LEU A CD1  1  
ATOM 5057  C CD2  . LEU A 1 341 ? 43.946   -64.550  -44.844  1.00 0.00 ? 336 LEU A CD2  1  
ATOM 5058  H H    . LEU A 1 341 ? 41.909   -61.119  -47.126  1.00 0.00 ? 336 LEU A H    1  
ATOM 5059  H HA   . LEU A 1 341 ? 40.962   -63.861  -47.192  1.00 0.00 ? 336 LEU A HA   1  
ATOM 5060  H HB2  . LEU A 1 341 ? 42.548   -62.047  -45.481  1.00 0.00 ? 336 LEU A HB2  1  
ATOM 5061  H HB3  . LEU A 1 341 ? 41.725   -63.341  -44.608  1.00 0.00 ? 336 LEU A HB3  1  
ATOM 5062  H HG   . LEU A 1 341 ? 42.677   -64.848  -46.553  1.00 0.00 ? 336 LEU A HG   1  
ATOM 5063  H HD11 . LEU A 1 341 ? 44.373   -62.351  -46.629  1.00 0.00 ? 336 LEU A HD11 1  
ATOM 5064  H HD12 . LEU A 1 341 ? 43.645   -63.221  -47.979  1.00 0.00 ? 336 LEU A HD12 1  
ATOM 5065  H HD13 . LEU A 1 341 ? 45.019   -63.917  -47.119  1.00 0.00 ? 336 LEU A HD13 1  
ATOM 5066  H HD21 . LEU A 1 341 ? 43.298   -65.155  -44.228  1.00 0.00 ? 336 LEU A HD21 1  
ATOM 5067  H HD22 . LEU A 1 341 ? 44.318   -63.717  -44.266  1.00 0.00 ? 336 LEU A HD22 1  
ATOM 5068  H HD23 . LEU A 1 341 ? 44.777   -65.147  -45.189  1.00 0.00 ? 336 LEU A HD23 1  
ATOM 5069  N N    . VAL A 1 342 ? 39.101   -61.633  -45.756  1.00 0.00 ? 337 VAL A N    1  
ATOM 5070  C CA   . VAL A 1 342 ? 37.795   -61.429  -45.065  1.00 0.00 ? 337 VAL A CA   1  
ATOM 5071  C C    . VAL A 1 342 ? 36.647   -61.465  -46.080  1.00 0.00 ? 337 VAL A C    1  
ATOM 5072  O O    . VAL A 1 342 ? 35.703   -62.217  -45.936  1.00 0.00 ? 337 VAL A O    1  
ATOM 5073  C CB   . VAL A 1 342 ? 37.912   -60.044  -44.421  1.00 0.00 ? 337 VAL A CB   1  
ATOM 5074  C CG1  . VAL A 1 342 ? 36.551   -59.608  -43.862  1.00 0.00 ? 337 VAL A CG1  1  
ATOM 5075  C CG2  . VAL A 1 342 ? 38.937   -60.100  -43.283  1.00 0.00 ? 337 VAL A CG2  1  
ATOM 5076  H H    . VAL A 1 342 ? 39.577   -60.865  -46.134  1.00 0.00 ? 337 VAL A H    1  
ATOM 5077  H HA   . VAL A 1 342 ? 37.650   -62.178  -44.303  1.00 0.00 ? 337 VAL A HA   1  
ATOM 5078  H HB   . VAL A 1 342 ? 38.240   -59.332  -45.165  1.00 0.00 ? 337 VAL A HB   1  
ATOM 5079  H HG11 . VAL A 1 342 ? 35.847   -60.422  -43.949  1.00 0.00 ? 337 VAL A HG11 1  
ATOM 5080  H HG12 . VAL A 1 342 ? 36.189   -58.759  -44.422  1.00 0.00 ? 337 VAL A HG12 1  
ATOM 5081  H HG13 . VAL A 1 342 ? 36.658   -59.334  -42.824  1.00 0.00 ? 337 VAL A HG13 1  
ATOM 5082  H HG21 . VAL A 1 342 ? 39.401   -61.076  -43.261  1.00 0.00 ? 337 VAL A HG21 1  
ATOM 5083  H HG22 . VAL A 1 342 ? 38.442   -59.917  -42.341  1.00 0.00 ? 337 VAL A HG22 1  
ATOM 5084  H HG23 . VAL A 1 342 ? 39.693   -59.347  -43.444  1.00 0.00 ? 337 VAL A HG23 1  
ATOM 5085  N N    . ILE A 1 343 ? 36.723   -60.657  -47.104  1.00 0.00 ? 338 ILE A N    1  
ATOM 5086  C CA   . ILE A 1 343 ? 35.638   -60.641  -48.132  1.00 0.00 ? 338 ILE A CA   1  
ATOM 5087  C C    . ILE A 1 343 ? 35.406   -62.050  -48.688  1.00 0.00 ? 338 ILE A C    1  
ATOM 5088  O O    . ILE A 1 343 ? 34.310   -62.399  -49.082  1.00 0.00 ? 338 ILE A O    1  
ATOM 5089  C CB   . ILE A 1 343 ? 36.137   -59.699  -49.232  1.00 0.00 ? 338 ILE A CB   1  
ATOM 5090  C CG1  . ILE A 1 343 ? 37.493   -60.183  -49.758  1.00 0.00 ? 338 ILE A CG1  1  
ATOM 5091  C CG2  . ILE A 1 343 ? 36.290   -58.288  -48.660  1.00 0.00 ? 338 ILE A CG2  1  
ATOM 5092  C CD1  . ILE A 1 343 ? 37.295   -60.956  -51.064  1.00 0.00 ? 338 ILE A CD1  1  
ATOM 5093  H H    . ILE A 1 343 ? 37.494   -60.060  -47.198  1.00 0.00 ? 338 ILE A H    1  
ATOM 5094  H HA   . ILE A 1 343 ? 34.726   -60.254  -47.705  1.00 0.00 ? 338 ILE A HA   1  
ATOM 5095  H HB   . ILE A 1 343 ? 35.420   -59.681  -50.040  1.00 0.00 ? 338 ILE A HB   1  
ATOM 5096  H HG12 . ILE A 1 343 ? 38.132   -59.331  -49.939  1.00 0.00 ? 338 ILE A HG12 1  
ATOM 5097  H HG13 . ILE A 1 343 ? 37.955   -60.829  -49.028  1.00 0.00 ? 338 ILE A HG13 1  
ATOM 5098  H HG21 . ILE A 1 343 ? 35.455   -58.070  -48.010  1.00 0.00 ? 338 ILE A HG21 1  
ATOM 5099  H HG22 . ILE A 1 343 ? 36.312   -57.572  -49.469  1.00 0.00 ? 338 ILE A HG22 1  
ATOM 5100  H HG23 . ILE A 1 343 ? 37.210   -58.225  -48.098  1.00 0.00 ? 338 ILE A HG23 1  
ATOM 5101  H HD11 . ILE A 1 343 ? 37.738   -61.937  -50.973  1.00 0.00 ? 338 ILE A HD11 1  
ATOM 5102  H HD12 . ILE A 1 343 ? 37.770   -60.421  -51.874  1.00 0.00 ? 338 ILE A HD12 1  
ATOM 5103  H HD13 . ILE A 1 343 ? 36.239   -61.056  -51.269  1.00 0.00 ? 338 ILE A HD13 1  
ATOM 5104  N N    . GLN A 1 344 ? 36.428   -62.862  -48.720  1.00 0.00 ? 339 GLN A N    1  
ATOM 5105  C CA   . GLN A 1 344 ? 36.268   -64.250  -49.246  1.00 0.00 ? 339 GLN A CA   1  
ATOM 5106  C C    . GLN A 1 344 ? 35.877   -65.204  -48.113  1.00 0.00 ? 339 GLN A C    1  
ATOM 5107  O O    . GLN A 1 344 ? 34.823   -65.808  -48.135  1.00 0.00 ? 339 GLN A O    1  
ATOM 5108  C CB   . GLN A 1 344 ? 37.637   -64.624  -49.820  1.00 0.00 ? 339 GLN A CB   1  
ATOM 5109  C CG   . GLN A 1 344 ? 37.486   -65.024  -51.291  1.00 0.00 ? 339 GLN A CG   1  
ATOM 5110  C CD   . GLN A 1 344 ? 38.709   -65.831  -51.734  1.00 0.00 ? 339 GLN A CD   1  
ATOM 5111  O OE1  . GLN A 1 344 ? 39.678   -65.939  -51.008  1.00 0.00 ? 339 GLN A OE1  1  
ATOM 5112  N NE2  . GLN A 1 344 ? 38.706   -66.406  -52.906  1.00 0.00 ? 339 GLN A NE2  1  
ATOM 5113  H H    . GLN A 1 344 ? 37.302   -62.561  -48.395  1.00 0.00 ? 339 GLN A H    1  
ATOM 5114  H HA   . GLN A 1 344 ? 35.523   -64.270  -50.027  1.00 0.00 ? 339 GLN A HA   1  
ATOM 5115  H HB2  . GLN A 1 344 ? 38.302   -63.777  -49.745  1.00 0.00 ? 339 GLN A HB2  1  
ATOM 5116  H HB3  . GLN A 1 344 ? 38.047   -65.454  -49.265  1.00 0.00 ? 339 GLN A HB3  1  
ATOM 5117  H HG2  . GLN A 1 344 ? 36.596   -65.625  -51.410  1.00 0.00 ? 339 GLN A HG2  1  
ATOM 5118  H HG3  . GLN A 1 344 ? 37.404   -64.136  -51.899  1.00 0.00 ? 339 GLN A HG3  1  
ATOM 5119  H HE21 . GLN A 1 344 ? 37.925   -66.319  -53.492  1.00 0.00 ? 339 GLN A HE21 1  
ATOM 5120  H HE22 . GLN A 1 344 ? 39.484   -66.924  -53.199  1.00 0.00 ? 339 GLN A HE22 1  
ATOM 5121  N N    . ALA A 1 345 ? 36.729   -65.350  -47.129  1.00 0.00 ? 340 ALA A N    1  
ATOM 5122  C CA   . ALA A 1 345 ? 36.429   -66.272  -45.987  1.00 0.00 ? 340 ALA A CA   1  
ATOM 5123  C C    . ALA A 1 345 ? 34.993   -66.094  -45.479  1.00 0.00 ? 340 ALA A C    1  
ATOM 5124  O O    . ALA A 1 345 ? 34.416   -67.009  -44.926  1.00 0.00 ? 340 ALA A O    1  
ATOM 5125  C CB   . ALA A 1 345 ? 37.426   -65.888  -44.894  1.00 0.00 ? 340 ALA A CB   1  
ATOM 5126  H H    . ALA A 1 345 ? 37.575   -64.855  -47.143  1.00 0.00 ? 340 ALA A H    1  
ATOM 5127  H HA   . ALA A 1 345 ? 36.594   -67.296  -46.280  1.00 0.00 ? 340 ALA A HA   1  
ATOM 5128  H HB1  . ALA A 1 345 ? 38.432   -65.966  -45.280  1.00 0.00 ? 340 ALA A HB1  1  
ATOM 5129  H HB2  . ALA A 1 345 ? 37.312   -66.553  -44.051  1.00 0.00 ? 340 ALA A HB2  1  
ATOM 5130  H HB3  . ALA A 1 345 ? 37.240   -64.872  -44.578  1.00 0.00 ? 340 ALA A HB3  1  
ATOM 5131  N N    . TYR A 1 346 ? 34.411   -64.930  -45.657  1.00 0.00 ? 341 TYR A N    1  
ATOM 5132  C CA   . TYR A 1 346 ? 33.009   -64.713  -45.173  1.00 0.00 ? 341 TYR A CA   1  
ATOM 5133  C C    . TYR A 1 346 ? 32.125   -65.902  -45.561  1.00 0.00 ? 341 TYR A C    1  
ATOM 5134  O O    . TYR A 1 346 ? 31.371   -66.411  -44.755  1.00 0.00 ? 341 TYR A O    1  
ATOM 5135  C CB   . TYR A 1 346 ? 32.529   -63.428  -45.860  1.00 0.00 ? 341 TYR A CB   1  
ATOM 5136  C CG   . TYR A 1 346 ? 31.028   -63.286  -45.691  1.00 0.00 ? 341 TYR A CG   1  
ATOM 5137  C CD1  . TYR A 1 346 ? 30.415   -63.685  -44.495  1.00 0.00 ? 341 TYR A CD1  1  
ATOM 5138  C CD2  . TYR A 1 346 ? 30.251   -62.766  -46.734  1.00 0.00 ? 341 TYR A CD2  1  
ATOM 5139  C CE1  . TYR A 1 346 ? 29.030   -63.563  -44.343  1.00 0.00 ? 341 TYR A CE1  1  
ATOM 5140  C CE2  . TYR A 1 346 ? 28.864   -62.646  -46.581  1.00 0.00 ? 341 TYR A CE2  1  
ATOM 5141  C CZ   . TYR A 1 346 ? 28.254   -63.044  -45.385  1.00 0.00 ? 341 TYR A CZ   1  
ATOM 5142  O OH   . TYR A 1 346 ? 26.887   -62.926  -45.236  1.00 0.00 ? 341 TYR A OH   1  
ATOM 5143  H H    . TYR A 1 346 ? 34.893   -64.203  -46.102  1.00 0.00 ? 341 TYR A H    1  
ATOM 5144  H HA   . TYR A 1 346 ? 33.003   -64.583  -44.102  1.00 0.00 ? 341 TYR A HA   1  
ATOM 5145  H HB2  . TYR A 1 346 ? 33.023   -62.576  -45.415  1.00 0.00 ? 341 TYR A HB2  1  
ATOM 5146  H HB3  . TYR A 1 346 ? 32.768   -63.472  -46.912  1.00 0.00 ? 341 TYR A HB3  1  
ATOM 5147  H HD1  . TYR A 1 346 ? 31.012   -64.086  -43.690  1.00 0.00 ? 341 TYR A HD1  1  
ATOM 5148  H HD2  . TYR A 1 346 ? 30.720   -62.455  -47.655  1.00 0.00 ? 341 TYR A HD2  1  
ATOM 5149  H HE1  . TYR A 1 346 ? 28.560   -63.872  -43.421  1.00 0.00 ? 341 TYR A HE1  1  
ATOM 5150  H HE2  . TYR A 1 346 ? 28.266   -62.247  -47.385  1.00 0.00 ? 341 TYR A HE2  1  
ATOM 5151  H HH   . TYR A 1 346 ? 26.468   -63.509  -45.873  1.00 0.00 ? 341 TYR A HH   1  
ATOM 5152  N N    . PHE A 1 347 ? 32.228   -66.362  -46.779  1.00 0.00 ? 342 PHE A N    1  
ATOM 5153  C CA   . PHE A 1 347 ? 31.410   -67.537  -47.198  1.00 0.00 ? 342 PHE A CA   1  
ATOM 5154  C C    . PHE A 1 347 ? 31.991   -68.792  -46.545  1.00 0.00 ? 342 PHE A C    1  
ATOM 5155  O O    . PHE A 1 347 ? 32.446   -69.701  -47.210  1.00 0.00 ? 342 PHE A O    1  
ATOM 5156  C CB   . PHE A 1 347 ? 31.549   -67.604  -48.721  1.00 0.00 ? 342 PHE A CB   1  
ATOM 5157  C CG   . PHE A 1 347 ? 31.069   -66.308  -49.332  1.00 0.00 ? 342 PHE A CG   1  
ATOM 5158  C CD1  . PHE A 1 347 ? 29.717   -65.955  -49.254  1.00 0.00 ? 342 PHE A CD1  1  
ATOM 5159  C CD2  . PHE A 1 347 ? 31.978   -65.459  -49.975  1.00 0.00 ? 342 PHE A CD2  1  
ATOM 5160  C CE1  . PHE A 1 347 ? 29.273   -64.753  -49.820  1.00 0.00 ? 342 PHE A CE1  1  
ATOM 5161  C CE2  . PHE A 1 347 ? 31.535   -64.257  -50.541  1.00 0.00 ? 342 PHE A CE2  1  
ATOM 5162  C CZ   . PHE A 1 347 ? 30.182   -63.904  -50.463  1.00 0.00 ? 342 PHE A CZ   1  
ATOM 5163  H H    . PHE A 1 347 ? 32.854   -65.949  -47.409  1.00 0.00 ? 342 PHE A H    1  
ATOM 5164  H HA   . PHE A 1 347 ? 30.376   -67.402  -46.919  1.00 0.00 ? 342 PHE A HA   1  
ATOM 5165  H HB2  . PHE A 1 347 ? 32.585   -67.762  -48.981  1.00 0.00 ? 342 PHE A HB2  1  
ATOM 5166  H HB3  . PHE A 1 347 ? 30.954   -68.421  -49.101  1.00 0.00 ? 342 PHE A HB3  1  
ATOM 5167  H HD1  . PHE A 1 347 ? 29.015   -66.609  -48.759  1.00 0.00 ? 342 PHE A HD1  1  
ATOM 5168  H HD2  . PHE A 1 347 ? 33.022   -65.731  -50.035  1.00 0.00 ? 342 PHE A HD2  1  
ATOM 5169  H HE1  . PHE A 1 347 ? 28.230   -64.481  -49.760  1.00 0.00 ? 342 PHE A HE1  1  
ATOM 5170  H HE2  . PHE A 1 347 ? 32.236   -63.602  -51.036  1.00 0.00 ? 342 PHE A HE2  1  
ATOM 5171  H HZ   . PHE A 1 347 ? 29.840   -62.978  -50.899  1.00 0.00 ? 342 PHE A HZ   1  
ATOM 5172  N N    . ALA A 1 348 ? 31.998   -68.829  -45.239  1.00 0.00 ? 343 ALA A N    1  
ATOM 5173  C CA   . ALA A 1 348 ? 32.572   -70.000  -44.522  1.00 0.00 ? 343 ALA A CA   1  
ATOM 5174  C C    . ALA A 1 348 ? 31.566   -71.139  -44.436  1.00 0.00 ? 343 ALA A C    1  
ATOM 5175  O O    . ALA A 1 348 ? 31.736   -72.172  -45.055  1.00 0.00 ? 343 ALA A O    1  
ATOM 5176  C CB   . ALA A 1 348 ? 32.904   -69.479  -43.125  1.00 0.00 ? 343 ALA A CB   1  
ATOM 5177  H H    . ALA A 1 348 ? 31.640   -68.076  -44.728  1.00 0.00 ? 343 ALA A H    1  
ATOM 5178  H HA   . ALA A 1 348 ? 33.472   -70.333  -45.008  1.00 0.00 ? 343 ALA A HA   1  
ATOM 5179  H HB1  . ALA A 1 348 ? 33.089   -70.311  -42.463  1.00 0.00 ? 343 ALA A HB1  1  
ATOM 5180  H HB2  . ALA A 1 348 ? 32.074   -68.895  -42.748  1.00 0.00 ? 343 ALA A HB2  1  
ATOM 5181  H HB3  . ALA A 1 348 ? 33.784   -68.858  -43.180  1.00 0.00 ? 343 ALA A HB3  1  
ATOM 5182  N N    . CYS A 1 349 ? 30.528   -70.976  -43.663  1.00 0.00 ? 344 CYS A N    1  
ATOM 5183  C CA   . CYS A 1 349 ? 29.538   -72.076  -43.540  1.00 0.00 ? 344 CYS A CA   1  
ATOM 5184  C C    . CYS A 1 349 ? 28.121   -71.589  -43.844  1.00 0.00 ? 344 CYS A C    1  
ATOM 5185  O O    . CYS A 1 349 ? 27.507   -72.012  -44.804  1.00 0.00 ? 344 CYS A O    1  
ATOM 5186  C CB   . CYS A 1 349 ? 29.647   -72.545  -42.088  1.00 0.00 ? 344 CYS A CB   1  
ATOM 5187  S SG   . CYS A 1 349 ? 30.020   -74.316  -42.043  1.00 0.00 ? 344 CYS A SG   1  
ATOM 5188  H H    . CYS A 1 349 ? 30.410   -70.143  -43.159  1.00 0.00 ? 344 CYS A H    1  
ATOM 5189  H HA   . CYS A 1 349 ? 29.806   -72.874  -44.201  1.00 0.00 ? 344 CYS A HA   1  
ATOM 5190  H HB2  . CYS A 1 349 ? 30.437   -71.999  -41.593  1.00 0.00 ? 344 CYS A HB2  1  
ATOM 5191  H HB3  . CYS A 1 349 ? 28.712   -72.361  -41.580  1.00 0.00 ? 344 CYS A HB3  1  
ATOM 5192  H HG   . CYS A 1 349 ? 29.428   -74.728  -41.410  1.00 0.00 ? 344 CYS A HG   1  
ATOM 5193  N N    . GLU A 1 350 ? 27.589   -70.721  -43.029  1.00 0.00 ? 345 GLU A N    1  
ATOM 5194  C CA   . GLU A 1 350 ? 26.199   -70.234  -43.278  1.00 0.00 ? 345 GLU A CA   1  
ATOM 5195  C C    . GLU A 1 350 ? 26.205   -68.757  -43.668  1.00 0.00 ? 345 GLU A C    1  
ATOM 5196  O O    . GLU A 1 350 ? 25.260   -68.037  -43.411  1.00 0.00 ? 345 GLU A O    1  
ATOM 5197  C CB   . GLU A 1 350 ? 25.466   -70.434  -41.949  1.00 0.00 ? 345 GLU A CB   1  
ATOM 5198  C CG   . GLU A 1 350 ? 25.542   -71.906  -41.538  1.00 0.00 ? 345 GLU A CG   1  
ATOM 5199  C CD   . GLU A 1 350 ? 24.745   -72.119  -40.250  1.00 0.00 ? 345 GLU A CD   1  
ATOM 5200  O OE1  . GLU A 1 350 ? 23.547   -72.327  -40.345  1.00 0.00 ? 345 GLU A OE1  1  
ATOM 5201  O OE2  . GLU A 1 350 ? 25.347   -72.071  -39.190  1.00 0.00 ? 345 GLU A OE2  1  
ATOM 5202  H H    . GLU A 1 350 ? 28.097   -70.397  -42.250  1.00 0.00 ? 345 GLU A H    1  
ATOM 5203  H HA   . GLU A 1 350 ? 25.727   -70.824  -44.048  1.00 0.00 ? 345 GLU A HA   1  
ATOM 5204  H HB2  . GLU A 1 350 ? 25.930   -69.822  -41.188  1.00 0.00 ? 345 GLU A HB2  1  
ATOM 5205  H HB3  . GLU A 1 350 ? 24.432   -70.147  -42.062  1.00 0.00 ? 345 GLU A HB3  1  
ATOM 5206  H HG2  . GLU A 1 350 ? 25.128   -72.521  -42.325  1.00 0.00 ? 345 GLU A HG2  1  
ATOM 5207  H HG3  . GLU A 1 350 ? 26.573   -72.181  -41.371  1.00 0.00 ? 345 GLU A HG3  1  
ATOM 5208  N N    . LYS A 1 351 ? 27.273   -68.292  -44.265  1.00 0.00 ? 346 LYS A N    1  
ATOM 5209  C CA   . LYS A 1 351 ? 27.352   -66.855  -44.649  1.00 0.00 ? 346 LYS A CA   1  
ATOM 5210  C C    . LYS A 1 351 ? 27.144   -66.021  -43.396  1.00 0.00 ? 346 LYS A C    1  
ATOM 5211  O O    . LYS A 1 351 ? 26.640   -64.915  -43.439  1.00 0.00 ? 346 LYS A O    1  
ATOM 5212  C CB   . LYS A 1 351 ? 26.222   -66.622  -45.661  1.00 0.00 ? 346 LYS A CB   1  
ATOM 5213  C CG   . LYS A 1 351 ? 26.360   -67.607  -46.828  1.00 0.00 ? 346 LYS A CG   1  
ATOM 5214  C CD   . LYS A 1 351 ? 26.545   -66.833  -48.136  1.00 0.00 ? 346 LYS A CD   1  
ATOM 5215  C CE   . LYS A 1 351 ? 25.180   -66.593  -48.785  1.00 0.00 ? 346 LYS A CE   1  
ATOM 5216  N NZ   . LYS A 1 351 ? 25.460   -66.495  -50.244  1.00 0.00 ? 346 LYS A NZ   1  
ATOM 5217  H H    . LYS A 1 351 ? 28.028   -68.878  -44.436  1.00 0.00 ? 346 LYS A H    1  
ATOM 5218  H HA   . LYS A 1 351 ? 28.309   -66.635  -45.098  1.00 0.00 ? 346 LYS A HA   1  
ATOM 5219  H HB2  . LYS A 1 351 ? 25.269   -66.769  -45.176  1.00 0.00 ? 346 LYS A HB2  1  
ATOM 5220  H HB3  . LYS A 1 351 ? 26.281   -65.611  -46.036  1.00 0.00 ? 346 LYS A HB3  1  
ATOM 5221  H HG2  . LYS A 1 351 ? 27.216   -68.245  -46.663  1.00 0.00 ? 346 LYS A HG2  1  
ATOM 5222  H HG3  . LYS A 1 351 ? 25.468   -68.211  -46.894  1.00 0.00 ? 346 LYS A HG3  1  
ATOM 5223  H HD2  . LYS A 1 351 ? 27.018   -65.884  -47.928  1.00 0.00 ? 346 LYS A HD2  1  
ATOM 5224  H HD3  . LYS A 1 351 ? 27.165   -67.405  -48.808  1.00 0.00 ? 346 LYS A HD3  1  
ATOM 5225  H HE2  . LYS A 1 351 ? 24.517   -67.423  -48.582  1.00 0.00 ? 346 LYS A HE2  1  
ATOM 5226  H HE3  . LYS A 1 351 ? 24.750   -65.670  -48.428  1.00 0.00 ? 346 LYS A HE3  1  
ATOM 5227  H HZ1  . LYS A 1 351 ? 25.918   -67.369  -50.569  1.00 0.00 ? 346 LYS A HZ1  1  
ATOM 5228  H HZ2  . LYS A 1 351 ? 26.090   -65.685  -50.422  1.00 0.00 ? 346 LYS A HZ2  1  
ATOM 5229  H HZ3  . LYS A 1 351 ? 24.568   -66.360  -50.761  1.00 0.00 ? 346 LYS A HZ3  1  
ATOM 5230  N N    . ASN A 1 352 ? 27.519   -66.566  -42.271  1.00 0.00 ? 347 ASN A N    1  
ATOM 5231  C CA   . ASN A 1 352 ? 27.340   -65.835  -40.997  1.00 0.00 ? 347 ASN A CA   1  
ATOM 5232  C C    . ASN A 1 352 ? 28.566   -64.969  -40.710  1.00 0.00 ? 347 ASN A C    1  
ATOM 5233  O O    . ASN A 1 352 ? 29.413   -64.777  -41.560  1.00 0.00 ? 347 ASN A O    1  
ATOM 5234  C CB   . ASN A 1 352 ? 27.182   -66.922  -39.933  1.00 0.00 ? 347 ASN A CB   1  
ATOM 5235  C CG   . ASN A 1 352 ? 25.716   -67.355  -39.855  1.00 0.00 ? 347 ASN A CG   1  
ATOM 5236  O OD1  . ASN A 1 352 ? 24.836   -66.650  -40.309  1.00 0.00 ? 347 ASN A OD1  1  
ATOM 5237  N ND2  . ASN A 1 352 ? 25.414   -68.494  -39.294  1.00 0.00 ? 347 ASN A ND2  1  
ATOM 5238  H H    . ASN A 1 352 ? 27.912   -67.466  -42.268  1.00 0.00 ? 347 ASN A H    1  
ATOM 5239  H HA   . ASN A 1 352 ? 26.453   -65.236  -41.047  1.00 0.00 ? 347 ASN A HA   1  
ATOM 5240  H HB2  . ASN A 1 352 ? 27.796   -67.772  -40.193  1.00 0.00 ? 347 ASN A HB2  1  
ATOM 5241  H HB3  . ASN A 1 352 ? 27.492   -66.535  -38.974  1.00 0.00 ? 347 ASN A HB3  1  
ATOM 5242  H HD21 . ASN A 1 352 ? 26.123   -69.062  -38.927  1.00 0.00 ? 347 ASN A HD21 1  
ATOM 5243  H HD22 . ASN A 1 352 ? 24.478   -68.780  -39.239  1.00 0.00 ? 347 ASN A HD22 1  
ATOM 5244  N N    . GLU A 1 353 ? 28.668   -64.448  -39.520  1.00 0.00 ? 348 GLU A N    1  
ATOM 5245  C CA   . GLU A 1 353 ? 29.841   -63.596  -39.179  1.00 0.00 ? 348 GLU A CA   1  
ATOM 5246  C C    . GLU A 1 353 ? 30.768   -64.325  -38.202  1.00 0.00 ? 348 GLU A C    1  
ATOM 5247  O O    . GLU A 1 353 ? 31.661   -63.732  -37.630  1.00 0.00 ? 348 GLU A O    1  
ATOM 5248  C CB   . GLU A 1 353 ? 29.245   -62.349  -38.523  1.00 0.00 ? 348 GLU A CB   1  
ATOM 5249  C CG   . GLU A 1 353 ? 30.304   -61.245  -38.466  1.00 0.00 ? 348 GLU A CG   1  
ATOM 5250  C CD   . GLU A 1 353 ? 30.122   -60.429  -37.184  1.00 0.00 ? 348 GLU A CD   1  
ATOM 5251  O OE1  . GLU A 1 353 ? 30.107   -61.028  -36.121  1.00 0.00 ? 348 GLU A OE1  1  
ATOM 5252  O OE2  . GLU A 1 353 ? 30.002   -59.220  -37.288  1.00 0.00 ? 348 GLU A OE2  1  
ATOM 5253  H H    . GLU A 1 353 ? 27.973   -64.617  -38.849  1.00 0.00 ? 348 GLU A H    1  
ATOM 5254  H HA   . GLU A 1 353 ? 30.378   -63.320  -40.073  1.00 0.00 ? 348 GLU A HA   1  
ATOM 5255  H HB2  . GLU A 1 353 ? 28.399   -62.008  -39.102  1.00 0.00 ? 348 GLU A HB2  1  
ATOM 5256  H HB3  . GLU A 1 353 ? 28.923   -62.589  -37.521  1.00 0.00 ? 348 GLU A HB3  1  
ATOM 5257  H HG2  . GLU A 1 353 ? 31.288   -61.690  -38.474  1.00 0.00 ? 348 GLU A HG2  1  
ATOM 5258  H HG3  . GLU A 1 353 ? 30.194   -60.596  -39.321  1.00 0.00 ? 348 GLU A HG3  1  
ATOM 5259  N N    . ASN A 1 354 ? 30.575   -65.607  -38.009  1.00 0.00 ? 349 ASN A N    1  
ATOM 5260  C CA   . ASN A 1 354 ? 31.467   -66.349  -37.071  1.00 0.00 ? 349 ASN A CA   1  
ATOM 5261  C C    . ASN A 1 354 ? 32.125   -67.529  -37.782  1.00 0.00 ? 349 ASN A C    1  
ATOM 5262  O O    . ASN A 1 354 ? 33.321   -67.574  -37.922  1.00 0.00 ? 349 ASN A O    1  
ATOM 5263  C CB   . ASN A 1 354 ? 30.584   -66.840  -35.923  1.00 0.00 ? 349 ASN A CB   1  
ATOM 5264  C CG   . ASN A 1 354 ? 29.714   -65.691  -35.405  1.00 0.00 ? 349 ASN A CG   1  
ATOM 5265  O OD1  . ASN A 1 354 ? 28.787   -65.269  -36.067  1.00 0.00 ? 349 ASN A OD1  1  
ATOM 5266  N ND2  . ASN A 1 354 ? 29.975   -65.165  -34.240  1.00 0.00 ? 349 ASN A ND2  1  
ATOM 5267  H H    . ASN A 1 354 ? 29.860   -66.080  -38.485  1.00 0.00 ? 349 ASN A H    1  
ATOM 5268  H HA   . ASN A 1 354 ? 32.224   -65.685  -36.685  1.00 0.00 ? 349 ASN A HA   1  
ATOM 5269  H HB2  . ASN A 1 354 ? 29.953   -67.644  -36.271  1.00 0.00 ? 349 ASN A HB2  1  
ATOM 5270  H HB3  . ASN A 1 354 ? 31.218   -67.197  -35.120  1.00 0.00 ? 349 ASN A HB3  1  
ATOM 5271  H HD21 . ASN A 1 354 ? 30.723   -65.505  -33.705  1.00 0.00 ? 349 ASN A HD21 1  
ATOM 5272  H HD22 . ASN A 1 354 ? 29.425   -64.429  -33.900  1.00 0.00 ? 349 ASN A HD22 1  
ATOM 5273  N N    . LEU A 1 355 ? 31.368   -68.489  -38.243  1.00 0.00 ? 350 LEU A N    1  
ATOM 5274  C CA   . LEU A 1 355 ? 32.004   -69.650  -38.940  1.00 0.00 ? 350 LEU A CA   1  
ATOM 5275  C C    . LEU A 1 355 ? 33.260   -69.181  -39.684  1.00 0.00 ? 350 LEU A C    1  
ATOM 5276  O O    . LEU A 1 355 ? 34.328   -69.752  -39.557  1.00 0.00 ? 350 LEU A O    1  
ATOM 5277  C CB   . LEU A 1 355 ? 30.941   -70.151  -39.918  1.00 0.00 ? 350 LEU A CB   1  
ATOM 5278  C CG   . LEU A 1 355 ? 30.086   -71.227  -39.239  1.00 0.00 ? 350 LEU A CG   1  
ATOM 5279  C CD1  . LEU A 1 355 ? 30.959   -72.437  -38.904  1.00 0.00 ? 350 LEU A CD1  1  
ATOM 5280  C CD2  . LEU A 1 355 ? 29.480   -70.665  -37.949  1.00 0.00 ? 350 LEU A CD2  1  
ATOM 5281  H H    . LEU A 1 355 ? 30.394   -68.449  -38.138  1.00 0.00 ? 350 LEU A H    1  
ATOM 5282  H HA   . LEU A 1 355 ? 32.252   -70.425  -38.232  1.00 0.00 ? 350 LEU A HA   1  
ATOM 5283  H HB2  . LEU A 1 355 ? 30.312   -69.326  -40.219  1.00 0.00 ? 350 LEU A HB2  1  
ATOM 5284  H HB3  . LEU A 1 355 ? 31.423   -70.572  -40.787  1.00 0.00 ? 350 LEU A HB3  1  
ATOM 5285  H HG   . LEU A 1 355 ? 29.293   -71.529  -39.906  1.00 0.00 ? 350 LEU A HG   1  
ATOM 5286  H HD11 . LEU A 1 355 ? 31.361   -72.325  -37.908  1.00 0.00 ? 350 LEU A HD11 1  
ATOM 5287  H HD12 . LEU A 1 355 ? 31.769   -72.503  -39.614  1.00 0.00 ? 350 LEU A HD12 1  
ATOM 5288  H HD13 . LEU A 1 355 ? 30.362   -73.336  -38.953  1.00 0.00 ? 350 LEU A HD13 1  
ATOM 5289  H HD21 . LEU A 1 355 ? 30.272   -70.335  -37.293  1.00 0.00 ? 350 LEU A HD21 1  
ATOM 5290  H HD22 . LEU A 1 355 ? 28.901   -71.433  -37.458  1.00 0.00 ? 350 LEU A HD22 1  
ATOM 5291  H HD23 . LEU A 1 355 ? 28.840   -69.828  -38.187  1.00 0.00 ? 350 LEU A HD23 1  
ATOM 5292  N N    . ALA A 1 356 ? 33.134   -68.119  -40.430  1.00 0.00 ? 351 ALA A N    1  
ATOM 5293  C CA   . ALA A 1 356 ? 34.301   -67.570  -41.177  1.00 0.00 ? 351 ALA A CA   1  
ATOM 5294  C C    . ALA A 1 356 ? 35.246   -66.808  -40.235  1.00 0.00 ? 351 ALA A C    1  
ATOM 5295  O O    . ALA A 1 356 ? 36.445   -67.005  -40.259  1.00 0.00 ? 351 ALA A O    1  
ATOM 5296  C CB   . ALA A 1 356 ? 33.680   -66.622  -42.202  1.00 0.00 ? 351 ALA A CB   1  
ATOM 5297  H H    . ALA A 1 356 ? 32.265   -67.669  -40.489  1.00 0.00 ? 351 ALA A H    1  
ATOM 5298  H HA   . ALA A 1 356 ? 34.832   -68.360  -41.682  1.00 0.00 ? 351 ALA A HA   1  
ATOM 5299  H HB1  . ALA A 1 356 ? 33.251   -65.774  -41.690  1.00 0.00 ? 351 ALA A HB1  1  
ATOM 5300  H HB2  . ALA A 1 356 ? 32.903   -67.143  -42.748  1.00 0.00 ? 351 ALA A HB2  1  
ATOM 5301  H HB3  . ALA A 1 356 ? 34.440   -66.285  -42.888  1.00 0.00 ? 351 ALA A HB3  1  
ATOM 5302  N N    . ALA A 1 357 ? 34.720   -65.943  -39.405  1.00 0.00 ? 352 ALA A N    1  
ATOM 5303  C CA   . ALA A 1 357 ? 35.602   -65.180  -38.464  1.00 0.00 ? 352 ALA A CA   1  
ATOM 5304  C C    . ALA A 1 357 ? 35.967   -66.072  -37.278  1.00 0.00 ? 352 ALA A C    1  
ATOM 5305  O O    . ALA A 1 357 ? 37.123   -66.300  -36.987  1.00 0.00 ? 352 ALA A O    1  
ATOM 5306  C CB   . ALA A 1 357 ? 34.761   -63.988  -38.005  1.00 0.00 ? 352 ALA A CB   1  
ATOM 5307  H H    . ALA A 1 357 ? 33.750   -65.801  -39.394  1.00 0.00 ? 352 ALA A H    1  
ATOM 5308  H HA   . ALA A 1 357 ? 36.491   -64.838  -38.970  1.00 0.00 ? 352 ALA A HA   1  
ATOM 5309  H HB1  . ALA A 1 357 ? 34.488   -63.389  -38.862  1.00 0.00 ? 352 ALA A HB1  1  
ATOM 5310  H HB2  . ALA A 1 357 ? 35.336   -63.387  -37.315  1.00 0.00 ? 352 ALA A HB2  1  
ATOM 5311  H HB3  . ALA A 1 357 ? 33.868   -64.344  -37.515  1.00 0.00 ? 352 ALA A HB3  1  
ATOM 5312  N N    . ASN A 1 358 ? 34.970   -66.588  -36.611  1.00 0.00 ? 353 ASN A N    1  
ATOM 5313  C CA   . ASN A 1 358 ? 35.191   -67.498  -35.451  1.00 0.00 ? 353 ASN A CA   1  
ATOM 5314  C C    . ASN A 1 358 ? 36.364   -68.450  -35.725  1.00 0.00 ? 353 ASN A C    1  
ATOM 5315  O O    . ASN A 1 358 ? 37.268   -68.577  -34.922  1.00 0.00 ? 353 ASN A O    1  
ATOM 5316  C CB   . ASN A 1 358 ? 33.890   -68.291  -35.331  1.00 0.00 ? 353 ASN A CB   1  
ATOM 5317  C CG   . ASN A 1 358 ? 33.884   -69.067  -34.014  1.00 0.00 ? 353 ASN A CG   1  
ATOM 5318  O OD1  . ASN A 1 358 ? 33.165   -68.724  -33.096  1.00 0.00 ? 353 ASN A OD1  1  
ATOM 5319  N ND2  . ASN A 1 358 ? 34.661   -70.105  -33.882  1.00 0.00 ? 353 ASN A ND2  1  
ATOM 5320  H H    . ASN A 1 358 ? 34.057   -66.384  -36.891  1.00 0.00 ? 353 ASN A H    1  
ATOM 5321  H HA   . ASN A 1 358 ? 35.352   -66.932  -34.551  1.00 0.00 ? 353 ASN A HA   1  
ATOM 5322  H HB2  . ASN A 1 358 ? 33.053   -67.610  -35.354  1.00 0.00 ? 353 ASN A HB2  1  
ATOM 5323  H HB3  . ASN A 1 358 ? 33.813   -68.984  -36.155  1.00 0.00 ? 353 ASN A HB3  1  
ATOM 5324  H HD21 . ASN A 1 358 ? 35.240   -70.380  -34.623  1.00 0.00 ? 353 ASN A HD21 1  
ATOM 5325  H HD22 . ASN A 1 358 ? 34.666   -70.610  -33.043  1.00 0.00 ? 353 ASN A HD22 1  
ATOM 5326  N N    . PHE A 1 359 ? 36.360   -69.116  -36.858  1.00 0.00 ? 354 PHE A N    1  
ATOM 5327  C CA   . PHE A 1 359 ? 37.487   -70.048  -37.168  1.00 0.00 ? 354 PHE A CA   1  
ATOM 5328  C C    . PHE A 1 359 ? 38.767   -69.244  -37.432  1.00 0.00 ? 354 PHE A C    1  
ATOM 5329  O O    . PHE A 1 359 ? 39.856   -69.668  -37.099  1.00 0.00 ? 354 PHE A O    1  
ATOM 5330  C CB   . PHE A 1 359 ? 37.032   -70.837  -38.412  1.00 0.00 ? 354 PHE A CB   1  
ATOM 5331  C CG   . PHE A 1 359 ? 37.846   -70.451  -39.631  1.00 0.00 ? 354 PHE A CG   1  
ATOM 5332  C CD1  . PHE A 1 359 ? 39.141   -70.959  -39.799  1.00 0.00 ? 354 PHE A CD1  1  
ATOM 5333  C CD2  . PHE A 1 359 ? 37.303   -69.590  -40.593  1.00 0.00 ? 354 PHE A CD2  1  
ATOM 5334  C CE1  . PHE A 1 359 ? 39.892   -70.604  -40.926  1.00 0.00 ? 354 PHE A CE1  1  
ATOM 5335  C CE2  . PHE A 1 359 ? 38.055   -69.236  -41.720  1.00 0.00 ? 354 PHE A CE2  1  
ATOM 5336  C CZ   . PHE A 1 359 ? 39.349   -69.743  -41.886  1.00 0.00 ? 354 PHE A CZ   1  
ATOM 5337  H H    . PHE A 1 359 ? 35.625   -68.999  -37.499  1.00 0.00 ? 354 PHE A H    1  
ATOM 5338  H HA   . PHE A 1 359 ? 37.641   -70.726  -36.343  1.00 0.00 ? 354 PHE A HA   1  
ATOM 5339  H HB2  . PHE A 1 359 ? 37.157   -71.893  -38.225  1.00 0.00 ? 354 PHE A HB2  1  
ATOM 5340  H HB3  . PHE A 1 359 ? 35.991   -70.632  -38.599  1.00 0.00 ? 354 PHE A HB3  1  
ATOM 5341  H HD1  . PHE A 1 359 ? 39.561   -71.623  -39.058  1.00 0.00 ? 354 PHE A HD1  1  
ATOM 5342  H HD2  . PHE A 1 359 ? 36.304   -69.200  -40.467  1.00 0.00 ? 354 PHE A HD2  1  
ATOM 5343  H HE1  . PHE A 1 359 ? 40.890   -70.996  -41.055  1.00 0.00 ? 354 PHE A HE1  1  
ATOM 5344  H HE2  . PHE A 1 359 ? 37.636   -68.572  -42.462  1.00 0.00 ? 354 PHE A HE2  1  
ATOM 5345  H HZ   . PHE A 1 359 ? 39.928   -69.470  -42.756  1.00 0.00 ? 354 PHE A HZ   1  
ATOM 5346  N N    . LEU A 1 360 ? 38.640   -68.085  -38.023  1.00 0.00 ? 355 LEU A N    1  
ATOM 5347  C CA   . LEU A 1 360 ? 39.847   -67.252  -38.304  1.00 0.00 ? 355 LEU A CA   1  
ATOM 5348  C C    . LEU A 1 360 ? 40.523   -66.850  -36.990  1.00 0.00 ? 355 LEU A C    1  
ATOM 5349  O O    . LEU A 1 360 ? 41.727   -66.939  -36.848  1.00 0.00 ? 355 LEU A O    1  
ATOM 5350  C CB   . LEU A 1 360 ? 39.319   -66.015  -39.034  1.00 0.00 ? 355 LEU A CB   1  
ATOM 5351  C CG   . LEU A 1 360 ? 40.327   -65.582  -40.101  1.00 0.00 ? 355 LEU A CG   1  
ATOM 5352  C CD1  . LEU A 1 360 ? 39.582   -64.974  -41.294  1.00 0.00 ? 355 LEU A CD1  1  
ATOM 5353  C CD2  . LEU A 1 360 ? 41.282   -64.541  -39.508  1.00 0.00 ? 355 LEU A CD2  1  
ATOM 5354  H H    . LEU A 1 360 ? 37.751   -67.762  -38.279  1.00 0.00 ? 355 LEU A H    1  
ATOM 5355  H HA   . LEU A 1 360 ? 40.537   -67.788  -38.936  1.00 0.00 ? 355 LEU A HA   1  
ATOM 5356  H HB2  . LEU A 1 360 ? 38.376   -66.251  -39.503  1.00 0.00 ? 355 LEU A HB2  1  
ATOM 5357  H HB3  . LEU A 1 360 ? 39.180   -65.212  -38.326  1.00 0.00 ? 355 LEU A HB3  1  
ATOM 5358  H HG   . LEU A 1 360 ? 40.890   -66.443  -40.432  1.00 0.00 ? 355 LEU A HG   1  
ATOM 5359  H HD11 . LEU A 1 360 ? 40.023   -64.021  -41.548  1.00 0.00 ? 355 LEU A HD11 1  
ATOM 5360  H HD12 . LEU A 1 360 ? 38.542   -64.831  -41.037  1.00 0.00 ? 355 LEU A HD12 1  
ATOM 5361  H HD13 . LEU A 1 360 ? 39.654   -65.641  -42.140  1.00 0.00 ? 355 LEU A HD13 1  
ATOM 5362  H HD21 . LEU A 1 360 ? 41.251   -64.596  -38.430  1.00 0.00 ? 355 LEU A HD21 1  
ATOM 5363  H HD22 . LEU A 1 360 ? 40.983   -63.554  -39.827  1.00 0.00 ? 355 LEU A HD22 1  
ATOM 5364  H HD23 . LEU A 1 360 ? 42.287   -64.741  -39.850  1.00 0.00 ? 355 LEU A HD23 1  
ATOM 5365  N N    . LEU A 1 361 ? 39.755   -66.411  -36.029  1.00 0.00 ? 356 LEU A N    1  
ATOM 5366  C CA   . LEU A 1 361 ? 40.348   -66.004  -34.721  1.00 0.00 ? 356 LEU A CA   1  
ATOM 5367  C C    . LEU A 1 361 ? 41.008   -67.209  -34.045  1.00 0.00 ? 356 LEU A C    1  
ATOM 5368  O O    . LEU A 1 361 ? 42.120   -67.128  -33.561  1.00 0.00 ? 356 LEU A O    1  
ATOM 5369  C CB   . LEU A 1 361 ? 39.167   -65.504  -33.887  1.00 0.00 ? 356 LEU A CB   1  
ATOM 5370  C CG   . LEU A 1 361 ? 38.514   -64.305  -34.584  1.00 0.00 ? 356 LEU A CG   1  
ATOM 5371  C CD1  . LEU A 1 361 ? 37.011   -64.550  -34.730  1.00 0.00 ? 356 LEU A CD1  1  
ATOM 5372  C CD2  . LEU A 1 361 ? 38.744   -63.041  -33.750  1.00 0.00 ? 356 LEU A CD2  1  
ATOM 5373  H H    . LEU A 1 361 ? 38.786   -66.350  -36.168  1.00 0.00 ? 356 LEU A H    1  
ATOM 5374  H HA   . LEU A 1 361 ? 41.064   -65.210  -34.862  1.00 0.00 ? 356 LEU A HA   1  
ATOM 5375  H HB2  . LEU A 1 361 ? 38.442   -66.299  -33.780  1.00 0.00 ? 356 LEU A HB2  1  
ATOM 5376  H HB3  . LEU A 1 361 ? 39.518   -65.205  -32.911  1.00 0.00 ? 356 LEU A HB3  1  
ATOM 5377  H HG   . LEU A 1 361 ? 38.952   -64.175  -35.564  1.00 0.00 ? 356 LEU A HG   1  
ATOM 5378  H HD11 . LEU A 1 361 ? 36.651   -64.059  -35.623  1.00 0.00 ? 356 LEU A HD11 1  
ATOM 5379  H HD12 . LEU A 1 361 ? 36.496   -64.152  -33.868  1.00 0.00 ? 356 LEU A HD12 1  
ATOM 5380  H HD13 . LEU A 1 361 ? 36.824   -65.611  -34.803  1.00 0.00 ? 356 LEU A HD13 1  
ATOM 5381  H HD21 . LEU A 1 361 ? 38.257   -63.149  -32.792  1.00 0.00 ? 356 LEU A HD21 1  
ATOM 5382  H HD22 . LEU A 1 361 ? 38.333   -62.188  -34.269  1.00 0.00 ? 356 LEU A HD22 1  
ATOM 5383  H HD23 . LEU A 1 361 ? 39.804   -62.896  -33.602  1.00 0.00 ? 356 LEU A HD23 1  
ATOM 5384  N N    . SER A 1 362 ? 40.329   -68.324  -34.010  1.00 0.00 ? 357 SER A N    1  
ATOM 5385  C CA   . SER A 1 362 ? 40.915   -69.537  -33.367  1.00 0.00 ? 357 SER A CA   1  
ATOM 5386  C C    . SER A 1 362 ? 42.187   -69.968  -34.103  1.00 0.00 ? 357 SER A C    1  
ATOM 5387  O O    . SER A 1 362 ? 43.039   -70.634  -33.549  1.00 0.00 ? 357 SER A O    1  
ATOM 5388  C CB   . SER A 1 362 ? 39.836   -70.613  -33.489  1.00 0.00 ? 357 SER A CB   1  
ATOM 5389  O OG   . SER A 1 362 ? 39.812   -71.391  -32.299  1.00 0.00 ? 357 SER A OG   1  
ATOM 5390  H H    . SER A 1 362 ? 39.434   -68.364  -34.408  1.00 0.00 ? 357 SER A H    1  
ATOM 5391  H HA   . SER A 1 362 ? 41.128   -69.346  -32.327  1.00 0.00 ? 357 SER A HA   1  
ATOM 5392  H HB2  . SER A 1 362 ? 38.874   -70.147  -33.627  1.00 0.00 ? 357 SER A HB2  1  
ATOM 5393  H HB3  . SER A 1 362 ? 40.053   -71.244  -34.340  1.00 0.00 ? 357 SER A HB3  1  
ATOM 5394  H HG   . SER A 1 362 ? 39.130   -71.034  -31.725  1.00 0.00 ? 357 SER A HG   1  
ATOM 5395  N N    . GLN A 1 363 ? 42.321   -69.594  -35.349  1.00 0.00 ? 358 GLN A N    1  
ATOM 5396  C CA   . GLN A 1 363 ? 43.537   -69.983  -36.120  1.00 0.00 ? 358 GLN A CA   1  
ATOM 5397  C C    . GLN A 1 363 ? 44.677   -68.999  -35.845  1.00 0.00 ? 358 GLN A C    1  
ATOM 5398  O O    . GLN A 1 363 ? 45.840   -69.350  -35.903  1.00 0.00 ? 358 GLN A O    1  
ATOM 5399  C CB   . GLN A 1 363 ? 43.113   -69.917  -37.587  1.00 0.00 ? 358 GLN A CB   1  
ATOM 5400  C CG   . GLN A 1 363 ? 42.148   -71.065  -37.892  1.00 0.00 ? 358 GLN A CG   1  
ATOM 5401  C CD   . GLN A 1 363 ? 42.935   -72.269  -38.413  1.00 0.00 ? 358 GLN A CD   1  
ATOM 5402  O OE1  . GLN A 1 363 ? 43.976   -72.112  -39.020  1.00 0.00 ? 358 GLN A OE1  1  
ATOM 5403  N NE2  . GLN A 1 363 ? 42.478   -73.472  -38.201  1.00 0.00 ? 358 GLN A NE2  1  
ATOM 5404  H H    . GLN A 1 363 ? 41.621   -69.058  -35.777  1.00 0.00 ? 358 GLN A H    1  
ATOM 5405  H HA   . GLN A 1 363 ? 43.837   -70.988  -35.868  1.00 0.00 ? 358 GLN A HA   1  
ATOM 5406  H HB2  . GLN A 1 363 ? 42.623   -68.973  -37.778  1.00 0.00 ? 358 GLN A HB2  1  
ATOM 5407  H HB3  . GLN A 1 363 ? 43.985   -70.005  -38.218  1.00 0.00 ? 358 GLN A HB3  1  
ATOM 5408  H HG2  . GLN A 1 363 ? 41.621   -71.341  -36.990  1.00 0.00 ? 358 GLN A HG2  1  
ATOM 5409  H HG3  . GLN A 1 363 ? 41.438   -70.749  -38.642  1.00 0.00 ? 358 GLN A HG3  1  
ATOM 5410  H HE21 . GLN A 1 363 ? 41.638   -73.599  -37.712  1.00 0.00 ? 358 GLN A HE21 1  
ATOM 5411  H HE22 . GLN A 1 363 ? 42.974   -74.250  -38.531  1.00 0.00 ? 358 GLN A HE22 1  
ATOM 5412  N N    . ASN A 1 364 ? 44.354   -67.769  -35.546  1.00 0.00 ? 359 ASN A N    1  
ATOM 5413  C CA   . ASN A 1 364 ? 45.419   -66.762  -35.267  1.00 0.00 ? 359 ASN A CA   1  
ATOM 5414  C C    . ASN A 1 364 ? 46.082   -67.053  -33.918  1.00 0.00 ? 359 ASN A C    1  
ATOM 5415  O O    . ASN A 1 364 ? 47.291   -67.118  -33.812  1.00 0.00 ? 359 ASN A O    1  
ATOM 5416  C CB   . ASN A 1 364 ? 44.696   -65.415  -35.231  1.00 0.00 ? 359 ASN A CB   1  
ATOM 5417  C CG   . ASN A 1 364 ? 45.723   -64.287  -35.117  1.00 0.00 ? 359 ASN A CG   1  
ATOM 5418  O OD1  . ASN A 1 364 ? 46.821   -64.395  -35.625  1.00 0.00 ? 359 ASN A OD1  1  
ATOM 5419  N ND2  . ASN A 1 364 ? 45.410   -63.199  -34.467  1.00 0.00 ? 359 ASN A ND2  1  
ATOM 5420  H H    . ASN A 1 364 ? 43.410   -67.508  -35.505  1.00 0.00 ? 359 ASN A H    1  
ATOM 5421  H HA   . ASN A 1 364 ? 46.155   -66.764  -36.057  1.00 0.00 ? 359 ASN A HA   1  
ATOM 5422  H HB2  . ASN A 1 364 ? 44.122   -65.291  -36.138  1.00 0.00 ? 359 ASN A HB2  1  
ATOM 5423  H HB3  . ASN A 1 364 ? 44.034   -65.384  -34.379  1.00 0.00 ? 359 ASN A HB3  1  
ATOM 5424  H HD21 . ASN A 1 364 ? 44.524   -63.111  -34.058  1.00 0.00 ? 359 ASN A HD21 1  
ATOM 5425  H HD22 . ASN A 1 364 ? 46.061   -62.471  -34.388  1.00 0.00 ? 359 ASN A HD22 1  
ATOM 5426  N N    . PHE A 1 365 ? 45.297   -67.229  -32.885  1.00 0.00 ? 360 PHE A N    1  
ATOM 5427  C CA   . PHE A 1 365 ? 45.875   -67.518  -31.536  1.00 0.00 ? 360 PHE A CA   1  
ATOM 5428  C C    . PHE A 1 365 ? 46.939   -66.476  -31.174  1.00 0.00 ? 360 PHE A C    1  
ATOM 5429  O O    . PHE A 1 365 ? 47.038   -65.436  -31.796  1.00 0.00 ? 360 PHE A O    1  
ATOM 5430  C CB   . PHE A 1 365 ? 46.506   -68.908  -31.660  1.00 0.00 ? 360 PHE A CB   1  
ATOM 5431  C CG   . PHE A 1 365 ? 45.578   -69.941  -31.066  1.00 0.00 ? 360 PHE A CG   1  
ATOM 5432  C CD1  . PHE A 1 365 ? 45.153   -69.820  -29.738  1.00 0.00 ? 360 PHE A CD1  1  
ATOM 5433  C CD2  . PHE A 1 365 ? 45.142   -71.019  -31.846  1.00 0.00 ? 360 PHE A CD2  1  
ATOM 5434  C CE1  . PHE A 1 365 ? 44.292   -70.779  -29.189  1.00 0.00 ? 360 PHE A CE1  1  
ATOM 5435  C CE2  . PHE A 1 365 ? 44.282   -71.977  -31.297  1.00 0.00 ? 360 PHE A CE2  1  
ATOM 5436  C CZ   . PHE A 1 365 ? 43.857   -71.857  -29.968  1.00 0.00 ? 360 PHE A CZ   1  
ATOM 5437  H H    . PHE A 1 365 ? 44.325   -67.173  -32.997  1.00 0.00 ? 360 PHE A H    1  
ATOM 5438  H HA   . PHE A 1 365 ? 45.096   -67.533  -30.790  1.00 0.00 ? 360 PHE A HA   1  
ATOM 5439  H HB2  . PHE A 1 365 ? 46.677   -69.134  -32.702  1.00 0.00 ? 360 PHE A HB2  1  
ATOM 5440  H HB3  . PHE A 1 365 ? 47.447   -68.924  -31.130  1.00 0.00 ? 360 PHE A HB3  1  
ATOM 5441  H HD1  . PHE A 1 365 ? 45.489   -68.989  -29.137  1.00 0.00 ? 360 PHE A HD1  1  
ATOM 5442  H HD2  . PHE A 1 365 ? 45.470   -71.112  -32.871  1.00 0.00 ? 360 PHE A HD2  1  
ATOM 5443  H HE1  . PHE A 1 365 ? 43.965   -70.686  -28.164  1.00 0.00 ? 360 PHE A HE1  1  
ATOM 5444  H HE2  . PHE A 1 365 ? 43.946   -72.809  -31.898  1.00 0.00 ? 360 PHE A HE2  1  
ATOM 5445  H HZ   . PHE A 1 365 ? 43.193   -72.596  -29.545  1.00 0.00 ? 360 PHE A HZ   1  
ATOM 5446  N N    . ASP A 1 366 ? 47.733   -66.747  -30.173  1.00 0.00 ? 361 ASP A N    1  
ATOM 5447  C CA   . ASP A 1 366 ? 48.790   -65.774  -29.771  1.00 0.00 ? 361 ASP A CA   1  
ATOM 5448  C C    . ASP A 1 366 ? 50.140   -66.484  -29.638  1.00 0.00 ? 361 ASP A C    1  
ATOM 5449  O O    . ASP A 1 366 ? 51.076   -66.199  -30.359  1.00 0.00 ? 361 ASP A O    1  
ATOM 5450  C CB   . ASP A 1 366 ? 48.333   -65.231  -28.416  1.00 0.00 ? 361 ASP A CB   1  
ATOM 5451  C CG   . ASP A 1 366 ? 48.796   -63.781  -28.265  1.00 0.00 ? 361 ASP A CG   1  
ATOM 5452  O OD1  . ASP A 1 366 ? 49.975   -63.533  -28.458  1.00 0.00 ? 361 ASP A OD1  1  
ATOM 5453  O OD2  . ASP A 1 366 ? 47.964   -62.943  -27.957  1.00 0.00 ? 361 ASP A OD2  1  
ATOM 5454  H H    . ASP A 1 366 ? 47.635   -67.592  -29.686  1.00 0.00 ? 361 ASP A H    1  
ATOM 5455  H HA   . ASP A 1 366 ? 48.855   -64.971  -30.487  1.00 0.00 ? 361 ASP A HA   1  
ATOM 5456  H HB2  . ASP A 1 366 ? 47.255   -65.274  -28.357  1.00 0.00 ? 361 ASP A HB2  1  
ATOM 5457  H HB3  . ASP A 1 366 ? 48.761   -65.828  -27.626  1.00 0.00 ? 361 ASP A HB3  1  
ATOM 5458  N N    . ASP A 1 367 ? 50.246   -67.408  -28.720  1.00 0.00 ? 362 ASP A N    1  
ATOM 5459  C CA   . ASP A 1 367 ? 51.534   -68.139  -28.538  1.00 0.00 ? 362 ASP A CA   1  
ATOM 5460  C C    . ASP A 1 367 ? 51.316   -69.385  -27.675  1.00 0.00 ? 362 ASP A C    1  
ATOM 5461  O O    . ASP A 1 367 ? 50.589   -69.357  -26.702  1.00 0.00 ? 362 ASP A O    1  
ATOM 5462  C CB   . ASP A 1 367 ? 52.456   -67.148  -27.827  1.00 0.00 ? 362 ASP A CB   1  
ATOM 5463  C CG   . ASP A 1 367 ? 53.891   -67.339  -28.321  1.00 0.00 ? 362 ASP A CG   1  
ATOM 5464  O OD1  . ASP A 1 367 ? 54.168   -66.944  -29.442  1.00 0.00 ? 362 ASP A OD1  1  
ATOM 5465  O OD2  . ASP A 1 367 ? 54.688   -67.877  -27.571  1.00 0.00 ? 362 ASP A OD2  1  
ATOM 5466  H H    . ASP A 1 367 ? 49.478   -67.622  -28.150  1.00 0.00 ? 362 ASP A H    1  
ATOM 5467  H HA   . ASP A 1 367 ? 51.952   -68.411  -29.495  1.00 0.00 ? 362 ASP A HA   1  
ATOM 5468  H HB2  . ASP A 1 367 ? 52.132   -66.139  -28.040  1.00 0.00 ? 362 ASP A HB2  1  
ATOM 5469  H HB3  . ASP A 1 367 ? 52.418   -67.321  -26.762  1.00 0.00 ? 362 ASP A HB3  1  
ATOM 5470  N N    . GLU A 1 368 ? 51.942   -70.477  -28.026  1.00 0.00 ? 363 GLU A N    1  
ATOM 5471  C CA   . GLU A 1 368 ? 51.772   -71.726  -27.227  1.00 0.00 ? 363 GLU A CA   1  
ATOM 5472  C C    . GLU A 1 368 ? 53.037   -72.010  -26.414  1.00 0.00 ? 363 GLU A C    1  
ATOM 5473  O O    . GLU A 1 368 ? 53.617   -71.124  -25.819  1.00 0.00 ? 363 GLU A O    1  
ATOM 5474  C CB   . GLU A 1 368 ? 51.539   -72.828  -28.261  1.00 0.00 ? 363 GLU A CB   1  
ATOM 5475  C CG   . GLU A 1 368 ? 50.869   -74.027  -27.587  1.00 0.00 ? 363 GLU A CG   1  
ATOM 5476  C CD   . GLU A 1 368 ? 50.008   -74.773  -28.609  1.00 0.00 ? 363 GLU A CD   1  
ATOM 5477  O OE1  . GLU A 1 368 ? 50.541   -75.152  -29.638  1.00 0.00 ? 363 GLU A OE1  1  
ATOM 5478  O OE2  . GLU A 1 368 ? 48.831   -74.951  -28.344  1.00 0.00 ? 363 GLU A OE2  1  
ATOM 5479  H H    . GLU A 1 368 ? 52.523   -70.476  -28.814  1.00 0.00 ? 363 GLU A H    1  
ATOM 5480  H HA   . GLU A 1 368 ? 50.916   -71.644  -26.577  1.00 0.00 ? 363 GLU A HA   1  
ATOM 5481  H HB2  . GLU A 1 368 ? 50.901   -72.453  -29.048  1.00 0.00 ? 363 GLU A HB2  1  
ATOM 5482  H HB3  . GLU A 1 368 ? 52.485   -73.135  -28.679  1.00 0.00 ? 363 GLU A HB3  1  
ATOM 5483  H HG2  . GLU A 1 368 ? 51.628   -74.692  -27.201  1.00 0.00 ? 363 GLU A HG2  1  
ATOM 5484  H HG3  . GLU A 1 368 ? 50.245   -73.683  -26.776  1.00 0.00 ? 363 GLU A HG3  1  
ATOM 5485  N N    . SER A 1 6   ? -14.268  -73.588  -42.419  1.00 0.00 ? 1   SER A N    2  
ATOM 5486  C CA   . SER A 1 6   ? -14.153  -73.059  -41.030  1.00 0.00 ? 1   SER A CA   2  
ATOM 5487  C C    . SER A 1 6   ? -15.386  -72.220  -40.681  1.00 0.00 ? 1   SER A C    2  
ATOM 5488  O O    . SER A 1 6   ? -16.398  -72.278  -41.352  1.00 0.00 ? 1   SER A O    2  
ATOM 5489  C CB   . SER A 1 6   ? -12.897  -72.190  -41.040  1.00 0.00 ? 1   SER A CB   2  
ATOM 5490  O OG   . SER A 1 6   ? -12.186  -72.377  -39.823  1.00 0.00 ? 1   SER A OG   2  
ATOM 5491  H HA   . SER A 1 6   ? -14.036  -73.869  -40.326  1.00 0.00 ? 1   SER A HA   2  
ATOM 5492  H HB2  . SER A 1 6   ? -12.266  -72.475  -41.866  1.00 0.00 ? 1   SER A HB2  2  
ATOM 5493  H HB3  . SER A 1 6   ? -13.180  -71.151  -41.148  1.00 0.00 ? 1   SER A HB3  2  
ATOM 5494  H HG   . SER A 1 6   ? -11.838  -73.272  -39.817  1.00 0.00 ? 1   SER A HG   2  
ATOM 5495  N N    . ALA A 1 7   ? -15.307  -71.438  -39.635  1.00 0.00 ? 2   ALA A N    2  
ATOM 5496  C CA   . ALA A 1 7   ? -16.471  -70.588  -39.235  1.00 0.00 ? 2   ALA A CA   2  
ATOM 5497  C C    . ALA A 1 7   ? -17.738  -71.441  -39.103  1.00 0.00 ? 2   ALA A C    2  
ATOM 5498  O O    . ALA A 1 7   ? -17.685  -72.655  -39.131  1.00 0.00 ? 2   ALA A O    2  
ATOM 5499  C CB   . ALA A 1 7   ? -16.628  -69.568  -40.364  1.00 0.00 ? 2   ALA A CB   2  
ATOM 5500  H H    . ALA A 1 7   ? -14.480  -71.408  -39.110  1.00 0.00 ? 2   ALA A H    2  
ATOM 5501  H HA   . ALA A 1 7   ? -16.263  -70.080  -38.308  1.00 0.00 ? 2   ALA A HA   2  
ATOM 5502  H HB1  . ALA A 1 7   ? -15.657  -69.334  -40.775  1.00 0.00 ? 2   ALA A HB1  2  
ATOM 5503  H HB2  . ALA A 1 7   ? -17.080  -68.668  -39.975  1.00 0.00 ? 2   ALA A HB2  2  
ATOM 5504  H HB3  . ALA A 1 7   ? -17.256  -69.982  -41.139  1.00 0.00 ? 2   ALA A HB3  2  
ATOM 5505  N N    . VAL A 1 8   ? -18.875  -70.813  -38.958  1.00 0.00 ? 3   VAL A N    2  
ATOM 5506  C CA   . VAL A 1 8   ? -20.145  -71.584  -38.822  1.00 0.00 ? 3   VAL A CA   2  
ATOM 5507  C C    . VAL A 1 8   ? -21.345  -70.637  -38.941  1.00 0.00 ? 3   VAL A C    2  
ATOM 5508  O O    . VAL A 1 8   ? -21.539  -69.759  -38.124  1.00 0.00 ? 3   VAL A O    2  
ATOM 5509  C CB   . VAL A 1 8   ? -20.076  -72.217  -37.428  1.00 0.00 ? 3   VAL A CB   2  
ATOM 5510  C CG1  . VAL A 1 8   ? -19.942  -71.123  -36.366  1.00 0.00 ? 3   VAL A CG1  2  
ATOM 5511  C CG2  . VAL A 1 8   ? -21.348  -73.031  -37.168  1.00 0.00 ? 3   VAL A CG2  2  
ATOM 5512  H H    . VAL A 1 8   ? -18.895  -69.834  -38.937  1.00 0.00 ? 3   VAL A H    2  
ATOM 5513  H HA   . VAL A 1 8   ? -20.199  -72.355  -39.575  1.00 0.00 ? 3   VAL A HA   2  
ATOM 5514  H HB   . VAL A 1 8   ? -19.216  -72.870  -37.376  1.00 0.00 ? 3   VAL A HB   2  
ATOM 5515  H HG11 . VAL A 1 8   ? -19.598  -71.560  -35.440  1.00 0.00 ? 3   VAL A HG11 2  
ATOM 5516  H HG12 . VAL A 1 8   ? -20.902  -70.654  -36.207  1.00 0.00 ? 3   VAL A HG12 2  
ATOM 5517  H HG13 . VAL A 1 8   ? -19.231  -70.382  -36.699  1.00 0.00 ? 3   VAL A HG13 2  
ATOM 5518  H HG21 . VAL A 1 8   ? -21.146  -74.078  -37.340  1.00 0.00 ? 3   VAL A HG21 2  
ATOM 5519  H HG22 . VAL A 1 8   ? -22.131  -72.702  -37.836  1.00 0.00 ? 3   VAL A HG22 2  
ATOM 5520  H HG23 . VAL A 1 8   ? -21.664  -72.889  -36.145  1.00 0.00 ? 3   VAL A HG23 2  
ATOM 5521  N N    . THR A 1 9   ? -22.145  -70.806  -39.961  1.00 0.00 ? 4   THR A N    2  
ATOM 5522  C CA   . THR A 1 9   ? -23.331  -69.914  -40.144  1.00 0.00 ? 4   THR A CA   2  
ATOM 5523  C C    . THR A 1 9   ? -24.345  -70.142  -39.024  1.00 0.00 ? 4   THR A C    2  
ATOM 5524  O O    . THR A 1 9   ? -24.860  -71.229  -38.850  1.00 0.00 ? 4   THR A O    2  
ATOM 5525  C CB   . THR A 1 9   ? -23.924  -70.317  -41.495  1.00 0.00 ? 4   THR A CB   2  
ATOM 5526  O OG1  . THR A 1 9   ? -22.950  -70.134  -42.513  1.00 0.00 ? 4   THR A OG1  2  
ATOM 5527  C CG2  . THR A 1 9   ? -25.154  -69.454  -41.802  1.00 0.00 ? 4   THR A CG2  2  
ATOM 5528  H H    . THR A 1 9   ? -21.963  -71.517  -40.611  1.00 0.00 ? 4   THR A H    2  
ATOM 5529  H HA   . THR A 1 9   ? -23.029  -68.881  -40.169  1.00 0.00 ? 4   THR A HA   2  
ATOM 5530  H HB   . THR A 1 9   ? -24.215  -71.353  -41.461  1.00 0.00 ? 4   THR A HB   2  
ATOM 5531  H HG1  . THR A 1 9   ? -22.873  -70.956  -43.001  1.00 0.00 ? 4   THR A HG1  2  
ATOM 5532  H HG21 . THR A 1 9   ? -24.879  -68.667  -42.489  1.00 0.00 ? 4   THR A HG21 2  
ATOM 5533  H HG22 . THR A 1 9   ? -25.527  -69.017  -40.888  1.00 0.00 ? 4   THR A HG22 2  
ATOM 5534  H HG23 . THR A 1 9   ? -25.923  -70.068  -42.247  1.00 0.00 ? 4   THR A HG23 2  
ATOM 5535  N N    . ILE A 1 10  ? -24.635  -69.122  -38.262  1.00 0.00 ? 5   ILE A N    2  
ATOM 5536  C CA   . ILE A 1 10  ? -25.615  -69.276  -37.152  1.00 0.00 ? 5   ILE A CA   2  
ATOM 5537  C C    . ILE A 1 10  ? -26.954  -68.654  -37.537  1.00 0.00 ? 5   ILE A C    2  
ATOM 5538  O O    . ILE A 1 10  ? -27.038  -67.491  -37.880  1.00 0.00 ? 5   ILE A O    2  
ATOM 5539  C CB   . ILE A 1 10  ? -25.003  -68.536  -35.958  1.00 0.00 ? 5   ILE A CB   2  
ATOM 5540  C CG1  . ILE A 1 10  ? -23.564  -69.015  -35.716  1.00 0.00 ? 5   ILE A CG1  2  
ATOM 5541  C CG2  . ILE A 1 10  ? -25.843  -68.811  -34.710  1.00 0.00 ? 5   ILE A CG2  2  
ATOM 5542  C CD1  . ILE A 1 10  ? -23.466  -70.527  -35.942  1.00 0.00 ? 5   ILE A CD1  2  
ATOM 5543  H H    . ILE A 1 10  ? -24.207  -68.255  -38.420  1.00 0.00 ? 5   ILE A H    2  
ATOM 5544  H HA   . ILE A 1 10  ? -25.746  -70.318  -36.911  1.00 0.00 ? 5   ILE A HA   2  
ATOM 5545  H HB   . ILE A 1 10  ? -25.001  -67.474  -36.160  1.00 0.00 ? 5   ILE A HB   2  
ATOM 5546  H HG12 . ILE A 1 10  ? -22.898  -68.507  -36.398  1.00 0.00 ? 5   ILE A HG12 2  
ATOM 5547  H HG13 . ILE A 1 10  ? -23.277  -68.788  -34.700  1.00 0.00 ? 5   ILE A HG13 2  
ATOM 5548  H HG21 . ILE A 1 10  ? -26.012  -69.874  -34.617  1.00 0.00 ? 5   ILE A HG21 2  
ATOM 5549  H HG22 . ILE A 1 10  ? -26.792  -68.302  -34.795  1.00 0.00 ? 5   ILE A HG22 2  
ATOM 5550  H HG23 . ILE A 1 10  ? -25.318  -68.452  -33.837  1.00 0.00 ? 5   ILE A HG23 2  
ATOM 5551  H HD11 . ILE A 1 10  ? -23.141  -70.715  -36.957  1.00 0.00 ? 5   ILE A HD11 2  
ATOM 5552  H HD12 . ILE A 1 10  ? -24.435  -70.978  -35.783  1.00 0.00 ? 5   ILE A HD12 2  
ATOM 5553  H HD13 . ILE A 1 10  ? -22.755  -70.950  -35.250  1.00 0.00 ? 5   ILE A HD13 2  
ATOM 5554  N N    . THR A 1 11  ? -28.002  -69.425  -37.476  1.00 0.00 ? 6   THR A N    2  
ATOM 5555  C CA   . THR A 1 11  ? -29.345  -68.893  -37.829  1.00 0.00 ? 6   THR A CA   2  
ATOM 5556  C C    . THR A 1 11  ? -29.889  -68.061  -36.666  1.00 0.00 ? 6   THR A C    2  
ATOM 5557  O O    . THR A 1 11  ? -29.864  -68.487  -35.527  1.00 0.00 ? 6   THR A O    2  
ATOM 5558  C CB   . THR A 1 11  ? -30.205  -70.138  -38.055  1.00 0.00 ? 6   THR A CB   2  
ATOM 5559  O OG1  . THR A 1 11  ? -29.688  -70.875  -39.155  1.00 0.00 ? 6   THR A OG1  2  
ATOM 5560  C CG2  . THR A 1 11  ? -31.643  -69.722  -38.350  1.00 0.00 ? 6   THR A CG2  2  
ATOM 5561  H H    . THR A 1 11  ? -27.905  -70.358  -37.192  1.00 0.00 ? 6   THR A H    2  
ATOM 5562  H HA   . THR A 1 11  ? -29.297  -68.304  -38.731  1.00 0.00 ? 6   THR A HA   2  
ATOM 5563  H HB   . THR A 1 11  ? -30.187  -70.753  -37.169  1.00 0.00 ? 6   THR A HB   2  
ATOM 5564  H HG1  . THR A 1 11  ? -28.754  -71.031  -38.995  1.00 0.00 ? 6   THR A HG1  2  
ATOM 5565  H HG21 . THR A 1 11  ? -32.130  -70.496  -38.923  1.00 0.00 ? 6   THR A HG21 2  
ATOM 5566  H HG22 . THR A 1 11  ? -31.641  -68.802  -38.914  1.00 0.00 ? 6   THR A HG22 2  
ATOM 5567  H HG23 . THR A 1 11  ? -32.171  -69.575  -37.420  1.00 0.00 ? 6   THR A HG23 2  
ATOM 5568  N N    . LEU A 1 12  ? -30.383  -66.882  -36.937  1.00 0.00 ? 7   LEU A N    2  
ATOM 5569  C CA   . LEU A 1 12  ? -30.926  -66.041  -35.832  1.00 0.00 ? 7   LEU A CA   2  
ATOM 5570  C C    . LEU A 1 12  ? -32.389  -65.686  -36.107  1.00 0.00 ? 7   LEU A C    2  
ATOM 5571  O O    . LEU A 1 12  ? -32.691  -64.870  -36.957  1.00 0.00 ? 7   LEU A O    2  
ATOM 5572  C CB   . LEU A 1 12  ? -30.061  -64.780  -35.806  1.00 0.00 ? 7   LEU A CB   2  
ATOM 5573  C CG   . LEU A 1 12  ? -29.147  -64.801  -34.573  1.00 0.00 ? 7   LEU A CG   2  
ATOM 5574  C CD1  . LEU A 1 12  ? -29.996  -64.839  -33.297  1.00 0.00 ? 7   LEU A CD1  2  
ATOM 5575  C CD2  . LEU A 1 12  ? -28.243  -66.036  -34.624  1.00 0.00 ? 7   LEU A CD2  2  
ATOM 5576  H H    . LEU A 1 12  ? -30.400  -66.554  -37.861  1.00 0.00 ? 7   LEU A H    2  
ATOM 5577  H HA   . LEU A 1 12  ? -30.834  -66.559  -34.894  1.00 0.00 ? 7   LEU A HA   2  
ATOM 5578  H HB2  . LEU A 1 12  ? -29.459  -64.737  -36.702  1.00 0.00 ? 7   LEU A HB2  2  
ATOM 5579  H HB3  . LEU A 1 12  ? -30.699  -63.912  -35.758  1.00 0.00 ? 7   LEU A HB3  2  
ATOM 5580  H HG   . LEU A 1 12  ? -28.537  -63.909  -34.567  1.00 0.00 ? 7   LEU A HG   2  
ATOM 5581  H HD11 . LEU A 1 12  ? -31.014  -65.098  -33.547  1.00 0.00 ? 7   LEU A HD11 2  
ATOM 5582  H HD12 . LEU A 1 12  ? -29.979  -63.867  -32.825  1.00 0.00 ? 7   LEU A HD12 2  
ATOM 5583  H HD13 . LEU A 1 12  ? -29.593  -65.575  -32.617  1.00 0.00 ? 7   LEU A HD13 2  
ATOM 5584  H HD21 . LEU A 1 12  ? -28.757  -66.877  -34.183  1.00 0.00 ? 7   LEU A HD21 2  
ATOM 5585  H HD22 . LEU A 1 12  ? -27.335  -65.840  -34.073  1.00 0.00 ? 7   LEU A HD22 2  
ATOM 5586  H HD23 . LEU A 1 12  ? -27.999  -66.262  -35.652  1.00 0.00 ? 7   LEU A HD23 2  
ATOM 5587  N N    . LYS A 1 13  ? -33.298  -66.292  -35.391  1.00 0.00 ? 8   LYS A N    2  
ATOM 5588  C CA   . LYS A 1 13  ? -34.744  -65.991  -35.602  1.00 0.00 ? 8   LYS A CA   2  
ATOM 5589  C C    . LYS A 1 13  ? -35.206  -64.937  -34.597  1.00 0.00 ? 8   LYS A C    2  
ATOM 5590  O O    . LYS A 1 13  ? -34.908  -65.017  -33.423  1.00 0.00 ? 8   LYS A O    2  
ATOM 5591  C CB   . LYS A 1 13  ? -35.472  -67.316  -35.353  1.00 0.00 ? 8   LYS A CB   2  
ATOM 5592  C CG   . LYS A 1 13  ? -36.673  -67.444  -36.299  1.00 0.00 ? 8   LYS A CG   2  
ATOM 5593  C CD   . LYS A 1 13  ? -37.428  -66.111  -36.372  1.00 0.00 ? 8   LYS A CD   2  
ATOM 5594  C CE   . LYS A 1 13  ? -38.775  -66.320  -37.068  1.00 0.00 ? 8   LYS A CE   2  
ATOM 5595  N NZ   . LYS A 1 13  ? -39.765  -66.441  -35.961  1.00 0.00 ? 8   LYS A NZ   2  
ATOM 5596  H H    . LYS A 1 13  ? -33.029  -66.943  -34.712  1.00 0.00 ? 8   LYS A H    2  
ATOM 5597  H HA   . LYS A 1 13  ? -34.919  -65.655  -36.611  1.00 0.00 ? 8   LYS A HA   2  
ATOM 5598  H HB2  . LYS A 1 13  ? -34.791  -68.137  -35.525  1.00 0.00 ? 8   LYS A HB2  2  
ATOM 5599  H HB3  . LYS A 1 13  ? -35.819  -67.347  -34.332  1.00 0.00 ? 8   LYS A HB3  2  
ATOM 5600  H HG2  . LYS A 1 13  ? -36.325  -67.716  -37.284  1.00 0.00 ? 8   LYS A HG2  2  
ATOM 5601  H HG3  . LYS A 1 13  ? -37.338  -68.211  -35.930  1.00 0.00 ? 8   LYS A HG3  2  
ATOM 5602  H HD2  . LYS A 1 13  ? -37.591  -65.735  -35.373  1.00 0.00 ? 8   LYS A HD2  2  
ATOM 5603  H HD3  . LYS A 1 13  ? -36.843  -65.399  -36.934  1.00 0.00 ? 8   LYS A HD3  2  
ATOM 5604  H HE2  . LYS A 1 13  ? -39.006  -65.468  -37.693  1.00 0.00 ? 8   LYS A HE2  2  
ATOM 5605  H HE3  . LYS A 1 13  ? -38.760  -67.225  -37.653  1.00 0.00 ? 8   LYS A HE3  2  
ATOM 5606  H HZ1  . LYS A 1 13  ? -40.700  -66.664  -36.355  1.00 0.00 ? 8   LYS A HZ1  2  
ATOM 5607  H HZ2  . LYS A 1 13  ? -39.812  -65.542  -35.439  1.00 0.00 ? 8   LYS A HZ2  2  
ATOM 5608  H HZ3  . LYS A 1 13  ? -39.473  -67.203  -35.316  1.00 0.00 ? 8   LYS A HZ3  2  
ATOM 5609  N N    . THR A 1 14  ? -35.930  -63.948  -35.045  1.00 0.00 ? 9   THR A N    2  
ATOM 5610  C CA   . THR A 1 14  ? -36.406  -62.890  -34.110  1.00 0.00 ? 9   THR A CA   2  
ATOM 5611  C C    . THR A 1 14  ? -37.896  -63.066  -33.819  1.00 0.00 ? 9   THR A C    2  
ATOM 5612  O O    . THR A 1 14  ? -38.682  -63.340  -34.709  1.00 0.00 ? 9   THR A O    2  
ATOM 5613  C CB   . THR A 1 14  ? -36.149  -61.574  -34.842  1.00 0.00 ? 9   THR A CB   2  
ATOM 5614  O OG1  . THR A 1 14  ? -36.875  -61.564  -36.064  1.00 0.00 ? 9   THR A OG1  2  
ATOM 5615  C CG2  . THR A 1 14  ? -34.654  -61.441  -35.130  1.00 0.00 ? 9   THR A CG2  2  
ATOM 5616  H H    . THR A 1 14  ? -36.158  -63.899  -35.996  1.00 0.00 ? 9   THR A H    2  
ATOM 5617  H HA   . THR A 1 14  ? -35.840  -62.915  -33.194  1.00 0.00 ? 9   THR A HA   2  
ATOM 5618  H HB   . THR A 1 14  ? -36.469  -60.749  -34.225  1.00 0.00 ? 9   THR A HB   2  
ATOM 5619  H HG1  . THR A 1 14  ? -37.727  -61.154  -35.900  1.00 0.00 ? 9   THR A HG1  2  
ATOM 5620  H HG21 . THR A 1 14  ? -34.475  -60.546  -35.707  1.00 0.00 ? 9   THR A HG21 2  
ATOM 5621  H HG22 . THR A 1 14  ? -34.317  -62.303  -35.687  1.00 0.00 ? 9   THR A HG22 2  
ATOM 5622  H HG23 . THR A 1 14  ? -34.113  -61.383  -34.197  1.00 0.00 ? 9   THR A HG23 2  
ATOM 5623  N N    . LEU A 1 15  ? -38.285  -62.910  -32.574  1.00 0.00 ? 10  LEU A N    2  
ATOM 5624  C CA   . LEU A 1 15  ? -39.726  -63.065  -32.193  1.00 0.00 ? 10  LEU A CA   2  
ATOM 5625  C C    . LEU A 1 15  ? -40.638  -62.329  -33.182  1.00 0.00 ? 10  LEU A C    2  
ATOM 5626  O O    . LEU A 1 15  ? -41.778  -62.700  -33.383  1.00 0.00 ? 10  LEU A O    2  
ATOM 5627  C CB   . LEU A 1 15  ? -39.835  -62.440  -30.801  1.00 0.00 ? 10  LEU A CB   2  
ATOM 5628  C CG   . LEU A 1 15  ? -40.822  -63.245  -29.953  1.00 0.00 ? 10  LEU A CG   2  
ATOM 5629  C CD1  . LEU A 1 15  ? -40.760  -62.764  -28.502  1.00 0.00 ? 10  LEU A CD1  2  
ATOM 5630  C CD2  . LEU A 1 15  ? -42.239  -63.045  -30.495  1.00 0.00 ? 10  LEU A CD2  2  
ATOM 5631  H H    . LEU A 1 15  ? -37.623  -62.690  -31.886  1.00 0.00 ? 10  LEU A H    2  
ATOM 5632  H HA   . LEU A 1 15  ? -39.991  -64.109  -32.145  1.00 0.00 ? 10  LEU A HA   2  
ATOM 5633  H HB2  . LEU A 1 15  ? -38.863  -62.446  -30.328  1.00 0.00 ? 10  LEU A HB2  2  
ATOM 5634  H HB3  . LEU A 1 15  ? -40.186  -61.423  -30.890  1.00 0.00 ? 10  LEU A HB3  2  
ATOM 5635  H HG   . LEU A 1 15  ? -40.562  -64.293  -29.996  1.00 0.00 ? 10  LEU A HG   2  
ATOM 5636  H HD11 . LEU A 1 15  ? -41.541  -63.243  -27.930  1.00 0.00 ? 10  LEU A HD11 2  
ATOM 5637  H HD12 . LEU A 1 15  ? -40.897  -61.693  -28.471  1.00 0.00 ? 10  LEU A HD12 2  
ATOM 5638  H HD13 . LEU A 1 15  ? -39.798  -63.016  -28.080  1.00 0.00 ? 10  LEU A HD13 2  
ATOM 5639  H HD21 . LEU A 1 15  ? -42.378  -62.009  -30.765  1.00 0.00 ? 10  LEU A HD21 2  
ATOM 5640  H HD22 . LEU A 1 15  ? -42.956  -63.320  -29.737  1.00 0.00 ? 10  LEU A HD22 2  
ATOM 5641  H HD23 . LEU A 1 15  ? -42.381  -63.666  -31.368  1.00 0.00 ? 10  LEU A HD23 2  
ATOM 5642  N N    . GLN A 1 16  ? -40.138  -61.298  -33.808  1.00 0.00 ? 11  GLN A N    2  
ATOM 5643  C CA   . GLN A 1 16  ? -40.967  -60.544  -34.796  1.00 0.00 ? 11  GLN A CA   2  
ATOM 5644  C C    . GLN A 1 16  ? -41.258  -61.414  -36.028  1.00 0.00 ? 11  GLN A C    2  
ATOM 5645  O O    . GLN A 1 16  ? -41.965  -61.003  -36.926  1.00 0.00 ? 11  GLN A O    2  
ATOM 5646  C CB   . GLN A 1 16  ? -40.118  -59.332  -35.187  1.00 0.00 ? 11  GLN A CB   2  
ATOM 5647  C CG   . GLN A 1 16  ? -40.592  -58.097  -34.411  1.00 0.00 ? 11  GLN A CG   2  
ATOM 5648  C CD   . GLN A 1 16  ? -39.444  -57.555  -33.557  1.00 0.00 ? 11  GLN A CD   2  
ATOM 5649  O OE1  . GLN A 1 16  ? -38.607  -56.818  -34.040  1.00 0.00 ? 11  GLN A OE1  2  
ATOM 5650  N NE2  . GLN A 1 16  ? -39.369  -57.890  -32.298  1.00 0.00 ? 11  GLN A NE2  2  
ATOM 5651  H H    . GLN A 1 16  ? -39.214  -61.022  -33.635  1.00 0.00 ? 11  GLN A H    2  
ATOM 5652  H HA   . GLN A 1 16  ? -41.888  -60.216  -34.341  1.00 0.00 ? 11  GLN A HA   2  
ATOM 5653  H HB2  . GLN A 1 16  ? -39.081  -59.530  -34.955  1.00 0.00 ? 11  GLN A HB2  2  
ATOM 5654  H HB3  . GLN A 1 16  ? -40.220  -59.149  -36.246  1.00 0.00 ? 11  GLN A HB3  2  
ATOM 5655  H HG2  . GLN A 1 16  ? -40.912  -57.337  -35.109  1.00 0.00 ? 11  GLN A HG2  2  
ATOM 5656  H HG3  . GLN A 1 16  ? -41.418  -58.368  -33.771  1.00 0.00 ? 11  GLN A HG3  2  
ATOM 5657  H HE21 . GLN A 1 16  ? -40.044  -58.484  -31.908  1.00 0.00 ? 11  GLN A HE21 2  
ATOM 5658  H HE22 . GLN A 1 16  ? -38.639  -57.547  -31.742  1.00 0.00 ? 11  GLN A HE22 2  
ATOM 5659  N N    . GLN A 1 17  ? -40.699  -62.606  -36.080  1.00 0.00 ? 12  GLN A N    2  
ATOM 5660  C CA   . GLN A 1 17  ? -40.910  -63.522  -37.248  1.00 0.00 ? 12  GLN A CA   2  
ATOM 5661  C C    . GLN A 1 17  ? -39.960  -63.133  -38.378  1.00 0.00 ? 12  GLN A C    2  
ATOM 5662  O O    . GLN A 1 17  ? -40.255  -63.306  -39.544  1.00 0.00 ? 12  GLN A O    2  
ATOM 5663  C CB   . GLN A 1 17  ? -42.374  -63.367  -37.680  1.00 0.00 ? 12  GLN A CB   2  
ATOM 5664  C CG   . GLN A 1 17  ? -42.908  -64.716  -38.164  1.00 0.00 ? 12  GLN A CG   2  
ATOM 5665  C CD   . GLN A 1 17  ? -43.597  -65.439  -37.005  1.00 0.00 ? 12  GLN A CD   2  
ATOM 5666  O OE1  . GLN A 1 17  ? -44.647  -66.026  -37.178  1.00 0.00 ? 12  GLN A OE1  2  
ATOM 5667  N NE2  . GLN A 1 17  ? -43.048  -65.422  -35.821  1.00 0.00 ? 12  GLN A NE2  2  
ATOM 5668  H H    . GLN A 1 17  ? -40.120  -62.899  -35.349  1.00 0.00 ? 12  GLN A H    2  
ATOM 5669  H HA   . GLN A 1 17  ? -40.722  -64.543  -36.951  1.00 0.00 ? 12  GLN A HA   2  
ATOM 5670  H HB2  . GLN A 1 17  ? -42.962  -63.027  -36.840  1.00 0.00 ? 12  GLN A HB2  2  
ATOM 5671  H HB3  . GLN A 1 17  ? -42.440  -62.647  -38.481  1.00 0.00 ? 12  GLN A HB3  2  
ATOM 5672  H HG2  . GLN A 1 17  ? -43.618  -64.556  -38.963  1.00 0.00 ? 12  GLN A HG2  2  
ATOM 5673  H HG3  . GLN A 1 17  ? -42.089  -65.319  -38.526  1.00 0.00 ? 12  GLN A HG3  2  
ATOM 5674  H HE21 . GLN A 1 17  ? -42.201  -64.949  -35.680  1.00 0.00 ? 12  GLN A HE21 2  
ATOM 5675  H HE22 . GLN A 1 17  ? -43.482  -65.883  -35.073  1.00 0.00 ? 12  GLN A HE22 2  
ATOM 5676  N N    . GLN A 1 18  ? -38.811  -62.619  -38.030  1.00 0.00 ? 13  GLN A N    2  
ATOM 5677  C CA   . GLN A 1 18  ? -37.817  -62.226  -39.068  1.00 0.00 ? 13  GLN A CA   2  
ATOM 5678  C C    . GLN A 1 18  ? -36.543  -63.049  -38.876  1.00 0.00 ? 13  GLN A C    2  
ATOM 5679  O O    . GLN A 1 18  ? -35.736  -62.763  -38.013  1.00 0.00 ? 13  GLN A O    2  
ATOM 5680  C CB   . GLN A 1 18  ? -37.544  -60.741  -38.821  1.00 0.00 ? 13  GLN A CB   2  
ATOM 5681  C CG   . GLN A 1 18  ? -38.273  -59.903  -39.873  1.00 0.00 ? 13  GLN A CG   2  
ATOM 5682  C CD   . GLN A 1 18  ? -39.752  -59.790  -39.500  1.00 0.00 ? 13  GLN A CD   2  
ATOM 5683  O OE1  . GLN A 1 18  ? -40.101  -59.118  -38.550  1.00 0.00 ? 13  GLN A OE1  2  
ATOM 5684  N NE2  . GLN A 1 18  ? -40.642  -60.424  -40.213  1.00 0.00 ? 13  GLN A NE2  2  
ATOM 5685  H H    . GLN A 1 18  ? -38.597  -62.502  -37.080  1.00 0.00 ? 13  GLN A H    2  
ATOM 5686  H HA   . GLN A 1 18  ? -38.221  -62.374  -40.058  1.00 0.00 ? 13  GLN A HA   2  
ATOM 5687  H HB2  . GLN A 1 18  ? -37.896  -60.470  -37.836  1.00 0.00 ? 13  GLN A HB2  2  
ATOM 5688  H HB3  . GLN A 1 18  ? -36.483  -60.554  -38.887  1.00 0.00 ? 13  GLN A HB3  2  
ATOM 5689  H HG2  . GLN A 1 18  ? -37.834  -58.916  -39.914  1.00 0.00 ? 13  GLN A HG2  2  
ATOM 5690  H HG3  . GLN A 1 18  ? -38.183  -60.378  -40.838  1.00 0.00 ? 13  GLN A HG3  2  
ATOM 5691  H HE21 . GLN A 1 18  ? -40.361  -60.966  -40.979  1.00 0.00 ? 13  GLN A HE21 2  
ATOM 5692  H HE22 . GLN A 1 18  ? -41.593  -60.358  -39.982  1.00 0.00 ? 13  GLN A HE22 2  
ATOM 5693  N N    . THR A 1 19  ? -36.365  -64.083  -39.655  1.00 0.00 ? 14  THR A N    2  
ATOM 5694  C CA   . THR A 1 19  ? -35.153  -64.930  -39.488  1.00 0.00 ? 14  THR A CA   2  
ATOM 5695  C C    . THR A 1 19  ? -34.106  -64.633  -40.551  1.00 0.00 ? 14  THR A C    2  
ATOM 5696  O O    . THR A 1 19  ? -34.390  -64.113  -41.611  1.00 0.00 ? 14  THR A O    2  
ATOM 5697  C CB   . THR A 1 19  ? -35.631  -66.369  -39.649  1.00 0.00 ? 14  THR A CB   2  
ATOM 5698  O OG1  . THR A 1 19  ? -36.881  -66.534  -38.997  1.00 0.00 ? 14  THR A OG1  2  
ATOM 5699  C CG2  . THR A 1 19  ? -34.592  -67.310  -39.041  1.00 0.00 ? 14  THR A CG2  2  
ATOM 5700  H H    . THR A 1 19  ? -37.031  -64.309  -40.334  1.00 0.00 ? 14  THR A H    2  
ATOM 5701  H HA   . THR A 1 19  ? -34.736  -64.796  -38.503  1.00 0.00 ? 14  THR A HA   2  
ATOM 5702  H HB   . THR A 1 19  ? -35.738  -66.594  -40.697  1.00 0.00 ? 14  THR A HB   2  
ATOM 5703  H HG1  . THR A 1 19  ? -37.529  -66.787  -39.659  1.00 0.00 ? 14  THR A HG1  2  
ATOM 5704  H HG21 . THR A 1 19  ? -34.545  -67.153  -37.973  1.00 0.00 ? 14  THR A HG21 2  
ATOM 5705  H HG22 . THR A 1 19  ? -33.621  -67.106  -39.478  1.00 0.00 ? 14  THR A HG22 2  
ATOM 5706  H HG23 . THR A 1 19  ? -34.870  -68.334  -39.243  1.00 0.00 ? 14  THR A HG23 2  
ATOM 5707  N N    . PHE A 1 20  ? -32.895  -64.996  -40.261  1.00 0.00 ? 15  PHE A N    2  
ATOM 5708  C CA   . PHE A 1 20  ? -31.781  -64.794  -41.221  1.00 0.00 ? 15  PHE A CA   2  
ATOM 5709  C C    . PHE A 1 20  ? -30.639  -65.742  -40.836  1.00 0.00 ? 15  PHE A C    2  
ATOM 5710  O O    . PHE A 1 20  ? -30.870  -66.779  -40.243  1.00 0.00 ? 15  PHE A O    2  
ATOM 5711  C CB   . PHE A 1 20  ? -31.376  -63.314  -41.103  1.00 0.00 ? 15  PHE A CB   2  
ATOM 5712  C CG   . PHE A 1 20  ? -31.464  -62.846  -39.669  1.00 0.00 ? 15  PHE A CG   2  
ATOM 5713  C CD1  . PHE A 1 20  ? -32.688  -62.411  -39.142  1.00 0.00 ? 15  PHE A CD1  2  
ATOM 5714  C CD2  . PHE A 1 20  ? -30.318  -62.839  -38.870  1.00 0.00 ? 15  PHE A CD2  2  
ATOM 5715  C CE1  . PHE A 1 20  ? -32.763  -61.973  -37.817  1.00 0.00 ? 15  PHE A CE1  2  
ATOM 5716  C CE2  . PHE A 1 20  ? -30.393  -62.400  -37.545  1.00 0.00 ? 15  PHE A CE2  2  
ATOM 5717  C CZ   . PHE A 1 20  ? -31.616  -61.967  -37.018  1.00 0.00 ? 15  PHE A CZ   2  
ATOM 5718  H H    . PHE A 1 20  ? -32.717  -65.428  -39.401  1.00 0.00 ? 15  PHE A H    2  
ATOM 5719  H HA   . PHE A 1 20  ? -32.116  -65.006  -42.225  1.00 0.00 ? 15  PHE A HA   2  
ATOM 5720  H HB2  . PHE A 1 20  ? -30.365  -63.189  -41.455  1.00 0.00 ? 15  PHE A HB2  2  
ATOM 5721  H HB3  . PHE A 1 20  ? -32.039  -62.717  -41.712  1.00 0.00 ? 15  PHE A HB3  2  
ATOM 5722  H HD1  . PHE A 1 20  ? -33.576  -62.414  -39.757  1.00 0.00 ? 15  PHE A HD1  2  
ATOM 5723  H HD2  . PHE A 1 20  ? -29.374  -63.174  -39.275  1.00 0.00 ? 15  PHE A HD2  2  
ATOM 5724  H HE1  . PHE A 1 20  ? -33.706  -61.639  -37.412  1.00 0.00 ? 15  PHE A HE1  2  
ATOM 5725  H HE2  . PHE A 1 20  ? -29.507  -62.395  -36.930  1.00 0.00 ? 15  PHE A HE2  2  
ATOM 5726  H HZ   . PHE A 1 20  ? -31.674  -61.630  -35.994  1.00 0.00 ? 15  PHE A HZ   2  
ATOM 5727  N N    . LYS A 1 21  ? -29.421  -65.420  -41.164  1.00 0.00 ? 16  LYS A N    2  
ATOM 5728  C CA   . LYS A 1 21  ? -28.299  -66.338  -40.810  1.00 0.00 ? 16  LYS A CA   2  
ATOM 5729  C C    . LYS A 1 21  ? -26.970  -65.584  -40.729  1.00 0.00 ? 16  LYS A C    2  
ATOM 5730  O O    . LYS A 1 21  ? -26.456  -65.098  -41.717  1.00 0.00 ? 16  LYS A O    2  
ATOM 5731  C CB   . LYS A 1 21  ? -28.260  -67.365  -41.944  1.00 0.00 ? 16  LYS A CB   2  
ATOM 5732  C CG   . LYS A 1 21  ? -28.766  -68.717  -41.434  1.00 0.00 ? 16  LYS A CG   2  
ATOM 5733  C CD   . LYS A 1 21  ? -29.281  -69.548  -42.612  1.00 0.00 ? 16  LYS A CD   2  
ATOM 5734  C CE   . LYS A 1 21  ? -28.940  -71.023  -42.385  1.00 0.00 ? 16  LYS A CE   2  
ATOM 5735  N NZ   . LYS A 1 21  ? -29.016  -71.647  -43.736  1.00 0.00 ? 16  LYS A NZ   2  
ATOM 5736  H H    . LYS A 1 21  ? -29.246  -64.591  -41.640  1.00 0.00 ? 16  LYS A H    2  
ATOM 5737  H HA   . LYS A 1 21  ? -28.504  -66.835  -39.875  1.00 0.00 ? 16  LYS A HA   2  
ATOM 5738  H HB2  . LYS A 1 21  ? -28.887  -67.029  -42.757  1.00 0.00 ? 16  LYS A HB2  2  
ATOM 5739  H HB3  . LYS A 1 21  ? -27.245  -67.474  -42.296  1.00 0.00 ? 16  LYS A HB3  2  
ATOM 5740  H HG2  . LYS A 1 21  ? -27.957  -69.243  -40.948  1.00 0.00 ? 16  LYS A HG2  2  
ATOM 5741  H HG3  . LYS A 1 21  ? -29.568  -68.558  -40.730  1.00 0.00 ? 16  LYS A HG3  2  
ATOM 5742  H HD2  . LYS A 1 21  ? -30.353  -69.434  -42.690  1.00 0.00 ? 16  LYS A HD2  2  
ATOM 5743  H HD3  . LYS A 1 21  ? -28.815  -69.209  -43.525  1.00 0.00 ? 16  LYS A HD3  2  
ATOM 5744  H HE2  . LYS A 1 21  ? -27.942  -71.118  -41.979  1.00 0.00 ? 16  LYS A HE2  2  
ATOM 5745  H HE3  . LYS A 1 21  ? -29.662  -71.480  -41.726  1.00 0.00 ? 16  LYS A HE3  2  
ATOM 5746  H HZ1  . LYS A 1 21  ? -29.987  -71.574  -44.098  1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 5747  H HZ2  . LYS A 1 21  ? -28.744  -72.649  -43.669  1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 5748  H HZ3  . LYS A 1 21  ? -28.369  -71.154  -44.383  1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 5749  N N    . ILE A 1 22  ? -26.403  -65.510  -39.558  1.00 0.00 ? 17  ILE A N    2  
ATOM 5750  C CA   . ILE A 1 22  ? -25.092  -64.818  -39.392  1.00 0.00 ? 17  ILE A CA   2  
ATOM 5751  C C    . ILE A 1 22  ? -23.979  -65.864  -39.494  1.00 0.00 ? 17  ILE A C    2  
ATOM 5752  O O    . ILE A 1 22  ? -24.248  -67.030  -39.707  1.00 0.00 ? 17  ILE A O    2  
ATOM 5753  C CB   . ILE A 1 22  ? -25.152  -64.190  -37.997  1.00 0.00 ? 17  ILE A CB   2  
ATOM 5754  C CG1  . ILE A 1 22  ? -26.407  -63.319  -37.885  1.00 0.00 ? 17  ILE A CG1  2  
ATOM 5755  C CG2  . ILE A 1 22  ? -23.922  -63.312  -37.769  1.00 0.00 ? 17  ILE A CG2  2  
ATOM 5756  C CD1  . ILE A 1 22  ? -26.889  -63.314  -36.439  1.00 0.00 ? 17  ILE A CD1  2  
ATOM 5757  H H    . ILE A 1 22  ? -26.832  -65.928  -38.782  1.00 0.00 ? 17  ILE A H    2  
ATOM 5758  H HA   . ILE A 1 22  ? -24.964  -64.054  -40.138  1.00 0.00 ? 17  ILE A HA   2  
ATOM 5759  H HB   . ILE A 1 22  ? -25.184  -64.970  -37.250  1.00 0.00 ? 17  ILE A HB   2  
ATOM 5760  H HG12 . ILE A 1 22  ? -26.172  -62.310  -38.191  1.00 0.00 ? 17  ILE A HG12 2  
ATOM 5761  H HG13 . ILE A 1 22  ? -27.184  -63.715  -38.520  1.00 0.00 ? 17  ILE A HG13 2  
ATOM 5762  H HG21 . ILE A 1 22  ? -24.186  -62.484  -37.128  1.00 0.00 ? 17  ILE A HG21 2  
ATOM 5763  H HG22 . ILE A 1 22  ? -23.569  -62.933  -38.717  1.00 0.00 ? 17  ILE A HG22 2  
ATOM 5764  H HG23 . ILE A 1 22  ? -23.143  -63.896  -37.301  1.00 0.00 ? 17  ILE A HG23 2  
ATOM 5765  H HD11 . ILE A 1 22  ? -27.329  -62.354  -36.213  1.00 0.00 ? 17  ILE A HD11 2  
ATOM 5766  H HD12 . ILE A 1 22  ? -26.049  -63.491  -35.783  1.00 0.00 ? 17  ILE A HD12 2  
ATOM 5767  H HD13 . ILE A 1 22  ? -27.628  -64.094  -36.304  1.00 0.00 ? 17  ILE A HD13 2  
ATOM 5768  N N    . ARG A 1 23  ? -22.739  -65.480  -39.357  1.00 0.00 ? 18  ARG A N    2  
ATOM 5769  C CA   . ARG A 1 23  ? -21.649  -66.496  -39.461  1.00 0.00 ? 18  ARG A CA   2  
ATOM 5770  C C    . ARG A 1 23  ? -20.377  -66.022  -38.761  1.00 0.00 ? 18  ARG A C    2  
ATOM 5771  O O    . ARG A 1 23  ? -19.302  -66.047  -39.328  1.00 0.00 ? 18  ARG A O    2  
ATOM 5772  C CB   . ARG A 1 23  ? -21.401  -66.674  -40.957  1.00 0.00 ? 18  ARG A CB   2  
ATOM 5773  C CG   . ARG A 1 23  ? -20.979  -68.121  -41.227  1.00 0.00 ? 18  ARG A CG   2  
ATOM 5774  C CD   . ARG A 1 23  ? -19.495  -68.166  -41.601  1.00 0.00 ? 18  ARG A CD   2  
ATOM 5775  N NE   . ARG A 1 23  ? -19.363  -69.349  -42.497  1.00 0.00 ? 18  ARG A NE   2  
ATOM 5776  C CZ   . ARG A 1 23  ? -19.786  -69.285  -43.729  1.00 0.00 ? 18  ARG A CZ   2  
ATOM 5777  N NH1  . ARG A 1 23  ? -19.405  -68.302  -44.498  1.00 0.00 ? 18  ARG A NH1  2  
ATOM 5778  N NH2  . ARG A 1 23  ? -20.592  -70.201  -44.192  1.00 0.00 ? 18  ARG A NH2  2  
ATOM 5779  H H    . ARG A 1 23  ? -22.526  -64.540  -39.191  1.00 0.00 ? 18  ARG A H    2  
ATOM 5780  H HA   . ARG A 1 23  ? -21.976  -67.432  -39.037  1.00 0.00 ? 18  ARG A HA   2  
ATOM 5781  H HB2  . ARG A 1 23  ? -22.308  -66.452  -41.502  1.00 0.00 ? 18  ARG A HB2  2  
ATOM 5782  H HB3  . ARG A 1 23  ? -20.616  -66.004  -41.275  1.00 0.00 ? 18  ARG A HB3  2  
ATOM 5783  H HG2  . ARG A 1 23  ? -21.145  -68.716  -40.338  1.00 0.00 ? 18  ARG A HG2  2  
ATOM 5784  H HG3  . ARG A 1 23  ? -21.565  -68.519  -42.040  1.00 0.00 ? 18  ARG A HG3  2  
ATOM 5785  H HD2  . ARG A 1 23  ? -19.212  -67.262  -42.123  1.00 0.00 ? 18  ARG A HD2  2  
ATOM 5786  H HD3  . ARG A 1 23  ? -18.889  -68.300  -40.719  1.00 0.00 ? 18  ARG A HD3  2  
ATOM 5787  H HE   . ARG A 1 23  ? -18.958  -70.176  -42.160  1.00 0.00 ? 18  ARG A HE   2  
ATOM 5788  H HH11 . ARG A 1 23  ? -18.788  -67.599  -44.143  1.00 0.00 ? 18  ARG A HH11 2  
ATOM 5789  H HH12 . ARG A 1 23  ? -19.729  -68.251  -45.443  1.00 0.00 ? 18  ARG A HH12 2  
ATOM 5790  H HH21 . ARG A 1 23  ? -20.885  -70.953  -43.603  1.00 0.00 ? 18  ARG A HH21 2  
ATOM 5791  H HH22 . ARG A 1 23  ? -20.916  -70.151  -45.137  1.00 0.00 ? 18  ARG A HH22 2  
ATOM 5792  N N    . MET A 1 24  ? -20.487  -65.608  -37.532  1.00 0.00 ? 19  MET A N    2  
ATOM 5793  C CA   . MET A 1 24  ? -19.278  -65.154  -36.789  1.00 0.00 ? 19  MET A CA   2  
ATOM 5794  C C    . MET A 1 24  ? -18.294  -66.322  -36.651  1.00 0.00 ? 19  MET A C    2  
ATOM 5795  O O    . MET A 1 24  ? -18.309  -67.251  -37.435  1.00 0.00 ? 19  MET A O    2  
ATOM 5796  C CB   . MET A 1 24  ? -19.797  -64.693  -35.417  1.00 0.00 ? 19  MET A CB   2  
ATOM 5797  C CG   . MET A 1 24  ? -20.188  -65.900  -34.543  1.00 0.00 ? 19  MET A CG   2  
ATOM 5798  S SD   . MET A 1 24  ? -21.952  -66.269  -34.739  1.00 0.00 ? 19  MET A SD   2  
ATOM 5799  C CE   . MET A 1 24  ? -22.577  -64.629  -34.308  1.00 0.00 ? 19  MET A CE   2  
ATOM 5800  H H    . MET A 1 24  ? -21.362  -65.608  -37.095  1.00 0.00 ? 19  MET A H    2  
ATOM 5801  H HA   . MET A 1 24  ? -18.811  -64.328  -37.303  1.00 0.00 ? 19  MET A HA   2  
ATOM 5802  H HB2  . MET A 1 24  ? -19.024  -64.128  -34.917  1.00 0.00 ? 19  MET A HB2  2  
ATOM 5803  H HB3  . MET A 1 24  ? -20.661  -64.061  -35.561  1.00 0.00 ? 19  MET A HB3  2  
ATOM 5804  H HG2  . MET A 1 24  ? -19.611  -66.763  -34.834  1.00 0.00 ? 19  MET A HG2  2  
ATOM 5805  H HG3  . MET A 1 24  ? -19.986  -65.669  -33.508  1.00 0.00 ? 19  MET A HG3  2  
ATOM 5806  H HE1  . MET A 1 24  ? -23.398  -64.730  -33.614  1.00 0.00 ? 19  MET A HE1  2  
ATOM 5807  H HE2  . MET A 1 24  ? -22.921  -64.126  -35.202  1.00 0.00 ? 19  MET A HE2  2  
ATOM 5808  H HE3  . MET A 1 24  ? -21.781  -64.053  -33.854  1.00 0.00 ? 19  MET A HE3  2  
ATOM 5809  N N    . GLU A 1 25  ? -17.454  -66.293  -35.654  1.00 0.00 ? 20  GLU A N    2  
ATOM 5810  C CA   . GLU A 1 25  ? -16.490  -67.414  -35.466  1.00 0.00 ? 20  GLU A CA   2  
ATOM 5811  C C    . GLU A 1 25  ? -17.117  -68.483  -34.565  1.00 0.00 ? 20  GLU A C    2  
ATOM 5812  O O    . GLU A 1 25  ? -18.137  -68.246  -33.949  1.00 0.00 ? 20  GLU A O    2  
ATOM 5813  C CB   . GLU A 1 25  ? -15.274  -66.788  -34.788  1.00 0.00 ? 20  GLU A CB   2  
ATOM 5814  C CG   . GLU A 1 25  ? -14.390  -66.114  -35.839  1.00 0.00 ? 20  GLU A CG   2  
ATOM 5815  C CD   . GLU A 1 25  ? -13.047  -65.737  -35.211  1.00 0.00 ? 20  GLU A CD   2  
ATOM 5816  O OE1  . GLU A 1 25  ? -12.543  -66.519  -34.422  1.00 0.00 ? 20  GLU A OE1  2  
ATOM 5817  O OE2  . GLU A 1 25  ? -12.545  -64.671  -35.530  1.00 0.00 ? 20  GLU A OE2  2  
ATOM 5818  H H    . GLU A 1 25  ? -17.465  -65.543  -35.024  1.00 0.00 ? 20  GLU A H    2  
ATOM 5819  H HA   . GLU A 1 25  ? -16.209  -67.836  -36.418  1.00 0.00 ? 20  GLU A HA   2  
ATOM 5820  H HB2  . GLU A 1 25  ? -15.603  -66.055  -34.067  1.00 0.00 ? 20  GLU A HB2  2  
ATOM 5821  H HB3  . GLU A 1 25  ? -14.709  -67.559  -34.286  1.00 0.00 ? 20  GLU A HB3  2  
ATOM 5822  H HG2  . GLU A 1 25  ? -14.226  -66.796  -36.661  1.00 0.00 ? 20  GLU A HG2  2  
ATOM 5823  H HG3  . GLU A 1 25  ? -14.879  -65.223  -36.202  1.00 0.00 ? 20  GLU A HG3  2  
ATOM 5824  N N    . PRO A 1 26  ? -16.489  -69.630  -34.515  1.00 0.00 ? 21  PRO A N    2  
ATOM 5825  C CA   . PRO A 1 26  ? -17.003  -70.736  -33.677  1.00 0.00 ? 21  PRO A CA   2  
ATOM 5826  C C    . PRO A 1 26  ? -16.527  -70.592  -32.224  1.00 0.00 ? 21  PRO A C    2  
ATOM 5827  O O    . PRO A 1 26  ? -16.401  -71.567  -31.508  1.00 0.00 ? 21  PRO A O    2  
ATOM 5828  C CB   . PRO A 1 26  ? -16.391  -71.973  -34.318  1.00 0.00 ? 21  PRO A CB   2  
ATOM 5829  C CG   . PRO A 1 26  ? -15.148  -71.500  -35.015  1.00 0.00 ? 21  PRO A CG   2  
ATOM 5830  C CD   . PRO A 1 26  ? -15.265  -70.007  -35.227  1.00 0.00 ? 21  PRO A CD   2  
ATOM 5831  H HA   . PRO A 1 26  ? -18.078  -70.787  -33.726  1.00 0.00 ? 21  PRO A HA   2  
ATOM 5832  H HB2  . PRO A 1 26  ? -16.144  -72.700  -33.557  1.00 0.00 ? 21  PRO A HB2  2  
ATOM 5833  H HB3  . PRO A 1 26  ? -17.076  -72.398  -35.035  1.00 0.00 ? 21  PRO A HB3  2  
ATOM 5834  H HG2  . PRO A 1 26  ? -14.284  -71.717  -34.404  1.00 0.00 ? 21  PRO A HG2  2  
ATOM 5835  H HG3  . PRO A 1 26  ? -15.055  -71.993  -35.970  1.00 0.00 ? 21  PRO A HG3  2  
ATOM 5836  H HD2  . PRO A 1 26  ? -14.408  -69.499  -34.806  1.00 0.00 ? 21  PRO A HD2  2  
ATOM 5837  H HD3  . PRO A 1 26  ? -15.362  -69.781  -36.277  1.00 0.00 ? 21  PRO A HD3  2  
ATOM 5838  N N    . ASP A 1 27  ? -16.263  -69.391  -31.783  1.00 0.00 ? 22  ASP A N    2  
ATOM 5839  C CA   . ASP A 1 27  ? -15.796  -69.193  -30.378  1.00 0.00 ? 22  ASP A CA   2  
ATOM 5840  C C    . ASP A 1 27  ? -15.796  -67.703  -30.017  1.00 0.00 ? 22  ASP A C    2  
ATOM 5841  O O    . ASP A 1 27  ? -15.088  -67.273  -29.128  1.00 0.00 ? 22  ASP A O    2  
ATOM 5842  C CB   . ASP A 1 27  ? -14.372  -69.754  -30.347  1.00 0.00 ? 22  ASP A CB   2  
ATOM 5843  C CG   . ASP A 1 27  ? -13.492  -68.986  -31.337  1.00 0.00 ? 22  ASP A CG   2  
ATOM 5844  O OD1  . ASP A 1 27  ? -13.102  -67.876  -31.015  1.00 0.00 ? 22  ASP A OD1  2  
ATOM 5845  O OD2  . ASP A 1 27  ? -13.225  -69.521  -32.401  1.00 0.00 ? 22  ASP A OD2  2  
ATOM 5846  H H    . ASP A 1 27  ? -16.370  -68.620  -32.373  1.00 0.00 ? 22  ASP A H    2  
ATOM 5847  H HA   . ASP A 1 27  ? -16.423  -69.745  -29.695  1.00 0.00 ? 22  ASP A HA   2  
ATOM 5848  H HB2  . ASP A 1 27  ? -13.967  -69.650  -29.350  1.00 0.00 ? 22  ASP A HB2  2  
ATOM 5849  H HB3  . ASP A 1 27  ? -14.390  -70.798  -30.620  1.00 0.00 ? 22  ASP A HB3  2  
ATOM 5850  N N    . GLU A 1 28  ? -16.586  -66.914  -30.697  1.00 0.00 ? 23  GLU A N    2  
ATOM 5851  C CA   . GLU A 1 28  ? -16.632  -65.458  -30.392  1.00 0.00 ? 23  GLU A CA   2  
ATOM 5852  C C    . GLU A 1 28  ? -17.581  -65.203  -29.223  1.00 0.00 ? 23  GLU A C    2  
ATOM 5853  O O    . GLU A 1 28  ? -18.694  -65.692  -29.200  1.00 0.00 ? 23  GLU A O    2  
ATOM 5854  C CB   . GLU A 1 28  ? -17.170  -64.799  -31.667  1.00 0.00 ? 23  GLU A CB   2  
ATOM 5855  C CG   . GLU A 1 28  ? -17.346  -63.292  -31.439  1.00 0.00 ? 23  GLU A CG   2  
ATOM 5856  C CD   . GLU A 1 28  ? -16.317  -62.523  -32.270  1.00 0.00 ? 23  GLU A CD   2  
ATOM 5857  O OE1  . GLU A 1 28  ? -16.506  -62.428  -33.472  1.00 0.00 ? 23  GLU A OE1  2  
ATOM 5858  O OE2  . GLU A 1 28  ? -15.356  -62.042  -31.691  1.00 0.00 ? 23  GLU A OE2  2  
ATOM 5859  H H    . GLU A 1 28  ? -17.149  -67.277  -31.405  1.00 0.00 ? 23  GLU A H    2  
ATOM 5860  H HA   . GLU A 1 28  ? -15.646  -65.085  -30.169  1.00 0.00 ? 23  GLU A HA   2  
ATOM 5861  H HB2  . GLU A 1 28  ? -16.473  -64.963  -32.477  1.00 0.00 ? 23  GLU A HB2  2  
ATOM 5862  H HB3  . GLU A 1 28  ? -18.125  -65.234  -31.922  1.00 0.00 ? 23  GLU A HB3  2  
ATOM 5863  H HG2  . GLU A 1 28  ? -18.342  -62.999  -31.737  1.00 0.00 ? 23  GLU A HG2  2  
ATOM 5864  H HG3  . GLU A 1 28  ? -17.203  -63.064  -30.392  1.00 0.00 ? 23  GLU A HG3  2  
ATOM 5865  N N    . THR A 1 29  ? -17.152  -64.432  -28.260  1.00 0.00 ? 24  THR A N    2  
ATOM 5866  C CA   . THR A 1 29  ? -18.033  -64.125  -27.091  1.00 0.00 ? 24  THR A CA   2  
ATOM 5867  C C    . THR A 1 29  ? -19.417  -63.707  -27.590  1.00 0.00 ? 24  THR A C    2  
ATOM 5868  O O    . THR A 1 29  ? -19.538  -62.859  -28.453  1.00 0.00 ? 24  THR A O    2  
ATOM 5869  C CB   . THR A 1 29  ? -17.348  -62.961  -26.373  1.00 0.00 ? 24  THR A CB   2  
ATOM 5870  O OG1  . THR A 1 29  ? -17.234  -61.860  -27.263  1.00 0.00 ? 24  THR A OG1  2  
ATOM 5871  C CG2  . THR A 1 29  ? -15.956  -63.390  -25.908  1.00 0.00 ? 24  THR A CG2  2  
ATOM 5872  H H    . THR A 1 29  ? -16.254  -64.046  -28.311  1.00 0.00 ? 24  THR A H    2  
ATOM 5873  H HA   . THR A 1 29  ? -18.105  -64.974  -26.432  1.00 0.00 ? 24  THR A HA   2  
ATOM 5874  H HB   . THR A 1 29  ? -17.936  -62.671  -25.515  1.00 0.00 ? 24  THR A HB   2  
ATOM 5875  H HG1  . THR A 1 29  ? -17.831  -61.171  -26.961  1.00 0.00 ? 24  THR A HG1  2  
ATOM 5876  H HG21 . THR A 1 29  ? -15.633  -62.752  -25.099  1.00 0.00 ? 24  THR A HG21 2  
ATOM 5877  H HG22 . THR A 1 29  ? -15.261  -63.308  -26.731  1.00 0.00 ? 24  THR A HG22 2  
ATOM 5878  H HG23 . THR A 1 29  ? -15.990  -64.414  -25.567  1.00 0.00 ? 24  THR A HG23 2  
ATOM 5879  N N    . VAL A 1 30  ? -20.464  -64.293  -27.066  1.00 0.00 ? 25  VAL A N    2  
ATOM 5880  C CA   . VAL A 1 30  ? -21.831  -63.916  -27.533  1.00 0.00 ? 25  VAL A CA   2  
ATOM 5881  C C    . VAL A 1 30  ? -22.017  -62.397  -27.441  1.00 0.00 ? 25  VAL A C    2  
ATOM 5882  O O    . VAL A 1 30  ? -22.882  -61.835  -28.080  1.00 0.00 ? 25  VAL A O    2  
ATOM 5883  C CB   . VAL A 1 30  ? -22.807  -64.649  -26.610  1.00 0.00 ? 25  VAL A CB   2  
ATOM 5884  C CG1  . VAL A 1 30  ? -24.239  -64.193  -26.911  1.00 0.00 ? 25  VAL A CG1  2  
ATOM 5885  C CG2  . VAL A 1 30  ? -22.701  -66.157  -26.854  1.00 0.00 ? 25  VAL A CG2  2  
ATOM 5886  H H    . VAL A 1 30  ? -20.351  -64.979  -26.375  1.00 0.00 ? 25  VAL A H    2  
ATOM 5887  H HA   . VAL A 1 30  ? -21.976  -64.245  -28.550  1.00 0.00 ? 25  VAL A HA   2  
ATOM 5888  H HB   . VAL A 1 30  ? -22.565  -64.431  -25.580  1.00 0.00 ? 25  VAL A HB   2  
ATOM 5889  H HG11 . VAL A 1 30  ? -24.396  -64.187  -27.980  1.00 0.00 ? 25  VAL A HG11 2  
ATOM 5890  H HG12 . VAL A 1 30  ? -24.391  -63.198  -26.521  1.00 0.00 ? 25  VAL A HG12 2  
ATOM 5891  H HG13 . VAL A 1 30  ? -24.939  -64.872  -26.449  1.00 0.00 ? 25  VAL A HG13 2  
ATOM 5892  H HG21 . VAL A 1 30  ? -21.765  -66.378  -27.347  1.00 0.00 ? 25  VAL A HG21 2  
ATOM 5893  H HG22 . VAL A 1 30  ? -23.521  -66.481  -27.479  1.00 0.00 ? 25  VAL A HG22 2  
ATOM 5894  H HG23 . VAL A 1 30  ? -22.741  -66.678  -25.910  1.00 0.00 ? 25  VAL A HG23 2  
ATOM 5895  N N    . LYS A 1 31  ? -21.195  -61.723  -26.673  1.00 0.00 ? 26  LYS A N    2  
ATOM 5896  C CA   . LYS A 1 31  ? -21.321  -60.237  -26.581  1.00 0.00 ? 26  LYS A CA   2  
ATOM 5897  C C    . LYS A 1 31  ? -21.203  -59.654  -27.990  1.00 0.00 ? 26  LYS A C    2  
ATOM 5898  O O    . LYS A 1 31  ? -21.872  -58.702  -28.346  1.00 0.00 ? 26  LYS A O    2  
ATOM 5899  C CB   . LYS A 1 31  ? -20.153  -59.781  -25.701  1.00 0.00 ? 26  LYS A CB   2  
ATOM 5900  C CG   . LYS A 1 31  ? -20.691  -59.222  -24.380  1.00 0.00 ? 26  LYS A CG   2  
ATOM 5901  C CD   . LYS A 1 31  ? -20.790  -57.697  -24.469  1.00 0.00 ? 26  LYS A CD   2  
ATOM 5902  C CE   . LYS A 1 31  ? -20.488  -57.085  -23.099  1.00 0.00 ? 26  LYS A CE   2  
ATOM 5903  N NZ   . LYS A 1 31  ? -21.297  -55.836  -23.049  1.00 0.00 ? 26  LYS A NZ   2  
ATOM 5904  H H    . LYS A 1 31  ? -20.489  -62.188  -26.178  1.00 0.00 ? 26  LYS A H    2  
ATOM 5905  H HA   . LYS A 1 31  ? -22.263  -59.962  -26.131  1.00 0.00 ? 26  LYS A HA   2  
ATOM 5906  H HB2  . LYS A 1 31  ? -19.504  -60.621  -25.498  1.00 0.00 ? 26  LYS A HB2  2  
ATOM 5907  H HB3  . LYS A 1 31  ? -19.595  -59.011  -26.213  1.00 0.00 ? 26  LYS A HB3  2  
ATOM 5908  H HG2  . LYS A 1 31  ? -21.670  -59.637  -24.186  1.00 0.00 ? 26  LYS A HG2  2  
ATOM 5909  H HG3  . LYS A 1 31  ? -20.022  -59.490  -23.576  1.00 0.00 ? 26  LYS A HG3  2  
ATOM 5910  H HD2  . LYS A 1 31  ? -20.076  -57.332  -25.193  1.00 0.00 ? 26  LYS A HD2  2  
ATOM 5911  H HD3  . LYS A 1 31  ? -21.788  -57.418  -24.774  1.00 0.00 ? 26  LYS A HD3  2  
ATOM 5912  H HE2  . LYS A 1 31  ? -20.788  -57.763  -22.312  1.00 0.00 ? 26  LYS A HE2  2  
ATOM 5913  H HE3  . LYS A 1 31  ? -19.439  -56.849  -23.015  1.00 0.00 ? 26  LYS A HE3  2  
ATOM 5914  H HZ1  . LYS A 1 31  ? -21.012  -55.205  -23.824  1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 5915  H HZ2  . LYS A 1 31  ? -21.141  -55.359  -22.137  1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 5916  H HZ3  . LYS A 1 31  ? -22.305  -56.071  -23.150  1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 5917  N N    . VAL A 1 32  ? -20.376  -60.256  -28.804  1.00 0.00 ? 27  VAL A N    2  
ATOM 5918  C CA   . VAL A 1 32  ? -20.225  -59.783  -30.206  1.00 0.00 ? 27  VAL A CA   2  
ATOM 5919  C C    . VAL A 1 32  ? -21.394  -60.328  -31.020  1.00 0.00 ? 27  VAL A C    2  
ATOM 5920  O O    . VAL A 1 32  ? -21.896  -59.684  -31.920  1.00 0.00 ? 27  VAL A O    2  
ATOM 5921  C CB   . VAL A 1 32  ? -18.899  -60.369  -30.692  1.00 0.00 ? 27  VAL A CB   2  
ATOM 5922  C CG1  . VAL A 1 32  ? -18.665  -59.966  -32.149  1.00 0.00 ? 27  VAL A CG1  2  
ATOM 5923  C CG2  . VAL A 1 32  ? -17.756  -59.831  -29.828  1.00 0.00 ? 27  VAL A CG2  2  
ATOM 5924  H H    . VAL A 1 32  ? -19.875  -61.040  -28.497  1.00 0.00 ? 27  VAL A H    2  
ATOM 5925  H HA   . VAL A 1 32  ? -20.199  -58.705  -30.245  1.00 0.00 ? 27  VAL A HA   2  
ATOM 5926  H HB   . VAL A 1 32  ? -18.932  -61.447  -30.618  1.00 0.00 ? 27  VAL A HB   2  
ATOM 5927  H HG11 . VAL A 1 32  ? -18.914  -58.923  -32.279  1.00 0.00 ? 27  VAL A HG11 2  
ATOM 5928  H HG12 . VAL A 1 32  ? -19.289  -60.568  -32.794  1.00 0.00 ? 27  VAL A HG12 2  
ATOM 5929  H HG13 . VAL A 1 32  ? -17.627  -60.123  -32.404  1.00 0.00 ? 27  VAL A HG13 2  
ATOM 5930  H HG21 . VAL A 1 32  ? -17.964  -58.807  -29.553  1.00 0.00 ? 27  VAL A HG21 2  
ATOM 5931  H HG22 . VAL A 1 32  ? -16.832  -59.873  -30.385  1.00 0.00 ? 27  VAL A HG22 2  
ATOM 5932  H HG23 . VAL A 1 32  ? -17.666  -60.432  -28.935  1.00 0.00 ? 27  VAL A HG23 2  
ATOM 5933  N N    . LEU A 1 33  ? -21.846  -61.508  -30.682  1.00 0.00 ? 28  LEU A N    2  
ATOM 5934  C CA   . LEU A 1 33  ? -23.006  -62.100  -31.403  1.00 0.00 ? 28  LEU A CA   2  
ATOM 5935  C C    . LEU A 1 33  ? -24.219  -61.193  -31.196  1.00 0.00 ? 28  LEU A C    2  
ATOM 5936  O O    . LEU A 1 33  ? -24.975  -60.927  -32.110  1.00 0.00 ? 28  LEU A O    2  
ATOM 5937  C CB   . LEU A 1 33  ? -23.223  -63.467  -30.749  1.00 0.00 ? 28  LEU A CB   2  
ATOM 5938  C CG   . LEU A 1 33  ? -24.511  -64.095  -31.280  1.00 0.00 ? 28  LEU A CG   2  
ATOM 5939  C CD1  . LEU A 1 33  ? -24.366  -65.617  -31.293  1.00 0.00 ? 28  LEU A CD1  2  
ATOM 5940  C CD2  . LEU A 1 33  ? -25.677  -63.697  -30.372  1.00 0.00 ? 28  LEU A CD2  2  
ATOM 5941  H H    . LEU A 1 33  ? -21.433  -61.994  -29.938  1.00 0.00 ? 28  LEU A H    2  
ATOM 5942  H HA   . LEU A 1 33  ? -22.786  -62.215  -32.453  1.00 0.00 ? 28  LEU A HA   2  
ATOM 5943  H HB2  . LEU A 1 33  ? -22.386  -64.112  -30.977  1.00 0.00 ? 28  LEU A HB2  2  
ATOM 5944  H HB3  . LEU A 1 33  ? -23.301  -63.344  -29.680  1.00 0.00 ? 28  LEU A HB3  2  
ATOM 5945  H HG   . LEU A 1 33  ? -24.696  -63.742  -32.285  1.00 0.00 ? 28  LEU A HG   2  
ATOM 5946  H HD11 . LEU A 1 33  ? -24.160  -65.967  -30.293  1.00 0.00 ? 28  LEU A HD11 2  
ATOM 5947  H HD12 . LEU A 1 33  ? -23.553  -65.896  -31.947  1.00 0.00 ? 28  LEU A HD12 2  
ATOM 5948  H HD13 . LEU A 1 33  ? -25.283  -66.063  -31.649  1.00 0.00 ? 28  LEU A HD13 2  
ATOM 5949  H HD21 . LEU A 1 33  ? -25.945  -64.532  -29.743  1.00 0.00 ? 28  LEU A HD21 2  
ATOM 5950  H HD22 . LEU A 1 33  ? -26.525  -63.415  -30.977  1.00 0.00 ? 28  LEU A HD22 2  
ATOM 5951  H HD23 . LEU A 1 33  ? -25.383  -62.861  -29.753  1.00 0.00 ? 28  LEU A HD23 2  
ATOM 5952  N N    . LYS A 1 34  ? -24.386  -60.689  -29.999  1.00 0.00 ? 29  LYS A N    2  
ATOM 5953  C CA   . LYS A 1 34  ? -25.523  -59.766  -29.729  1.00 0.00 ? 29  LYS A CA   2  
ATOM 5954  C C    . LYS A 1 34  ? -25.365  -58.543  -30.627  1.00 0.00 ? 29  LYS A C    2  
ATOM 5955  O O    . LYS A 1 34  ? -26.291  -58.117  -31.292  1.00 0.00 ? 29  LYS A O    2  
ATOM 5956  C CB   . LYS A 1 34  ? -25.388  -59.381  -28.254  1.00 0.00 ? 29  LYS A CB   2  
ATOM 5957  C CG   . LYS A 1 34  ? -26.773  -59.336  -27.608  1.00 0.00 ? 29  LYS A CG   2  
ATOM 5958  C CD   . LYS A 1 34  ? -26.669  -59.767  -26.143  1.00 0.00 ? 29  LYS A CD   2  
ATOM 5959  C CE   . LYS A 1 34  ? -25.867  -58.725  -25.359  1.00 0.00 ? 29  LYS A CE   2  
ATOM 5960  N NZ   . LYS A 1 34  ? -26.548  -58.631  -24.038  1.00 0.00 ? 29  LYS A NZ   2  
ATOM 5961  H H    . LYS A 1 34  ? -23.748  -60.900  -29.288  1.00 0.00 ? 29  LYS A H    2  
ATOM 5962  H HA   . LYS A 1 34  ? -26.467  -60.257  -29.908  1.00 0.00 ? 29  LYS A HA   2  
ATOM 5963  H HB2  . LYS A 1 34  ? -24.776  -60.112  -27.746  1.00 0.00 ? 29  LYS A HB2  2  
ATOM 5964  H HB3  . LYS A 1 34  ? -24.925  -58.408  -28.177  1.00 0.00 ? 29  LYS A HB3  2  
ATOM 5965  H HG2  . LYS A 1 34  ? -27.162  -58.329  -27.661  1.00 0.00 ? 29  LYS A HG2  2  
ATOM 5966  H HG3  . LYS A 1 34  ? -27.437  -60.007  -28.132  1.00 0.00 ? 29  LYS A HG3  2  
ATOM 5967  H HD2  . LYS A 1 34  ? -27.660  -59.851  -25.722  1.00 0.00 ? 29  LYS A HD2  2  
ATOM 5968  H HD3  . LYS A 1 34  ? -26.169  -60.722  -26.083  1.00 0.00 ? 29  LYS A HD3  2  
ATOM 5969  H HE2  . LYS A 1 34  ? -24.845  -59.055  -25.235  1.00 0.00 ? 29  LYS A HE2  2  
ATOM 5970  H HE3  . LYS A 1 34  ? -25.898  -57.770  -25.860  1.00 0.00 ? 29  LYS A HE3  2  
ATOM 5971  H HZ1  . LYS A 1 34  ? -27.542  -58.359  -24.178  1.00 0.00 ? 29  LYS A HZ1  2  
ATOM 5972  H HZ2  . LYS A 1 34  ? -26.071  -57.914  -23.453  1.00 0.00 ? 29  LYS A HZ2  2  
ATOM 5973  H HZ3  . LYS A 1 34  ? -26.508  -59.553  -23.559  1.00 0.00 ? 29  LYS A HZ3  2  
ATOM 5974  N N    . GLU A 1 35  ? -24.176  -58.002  -30.679  1.00 0.00 ? 30  GLU A N    2  
ATOM 5975  C CA   . GLU A 1 35  ? -23.931  -56.833  -31.567  1.00 0.00 ? 30  GLU A CA   2  
ATOM 5976  C C    . GLU A 1 35  ? -24.096  -57.289  -33.018  1.00 0.00 ? 30  GLU A C    2  
ATOM 5977  O O    . GLU A 1 35  ? -24.515  -56.538  -33.877  1.00 0.00 ? 30  GLU A O    2  
ATOM 5978  C CB   . GLU A 1 35  ? -22.487  -56.411  -31.293  1.00 0.00 ? 30  GLU A CB   2  
ATOM 5979  C CG   . GLU A 1 35  ? -22.418  -55.646  -29.970  1.00 0.00 ? 30  GLU A CG   2  
ATOM 5980  C CD   . GLU A 1 35  ? -22.692  -54.162  -30.222  1.00 0.00 ? 30  GLU A CD   2  
ATOM 5981  O OE1  . GLU A 1 35  ? -21.754  -53.454  -30.547  1.00 0.00 ? 30  GLU A OE1  2  
ATOM 5982  O OE2  . GLU A 1 35  ? -23.836  -53.760  -30.085  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 5983  H H    . GLU A 1 35  ? -23.440  -58.384  -30.156  1.00 0.00 ? 30  GLU A H    2  
ATOM 5984  H HA   . GLU A 1 35  ? -24.612  -56.028  -31.335  1.00 0.00 ? 30  GLU A HA   2  
ATOM 5985  H HB2  . GLU A 1 35  ? -21.860  -57.289  -31.236  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 5986  H HB3  . GLU A 1 35  ? -22.141  -55.773  -32.093  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 5987  H HG2  . GLU A 1 35  ? -23.158  -56.040  -29.288  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 5988  H HG3  . GLU A 1 35  ? -21.435  -55.760  -29.539  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 5989  N N    . LYS A 1 36  ? -23.785  -58.535  -33.285  1.00 0.00 ? 31  LYS A N    2  
ATOM 5990  C CA   . LYS A 1 36  ? -23.937  -59.072  -34.667  1.00 0.00 ? 31  LYS A CA   2  
ATOM 5991  C C    . LYS A 1 36  ? -25.406  -58.995  -35.075  1.00 0.00 ? 31  LYS A C    2  
ATOM 5992  O O    . LYS A 1 36  ? -25.733  -58.730  -36.214  1.00 0.00 ? 31  LYS A O    2  
ATOM 5993  C CB   . LYS A 1 36  ? -23.478  -60.530  -34.584  1.00 0.00 ? 31  LYS A CB   2  
ATOM 5994  C CG   . LYS A 1 36  ? -22.621  -60.868  -35.805  1.00 0.00 ? 31  LYS A CG   2  
ATOM 5995  C CD   . LYS A 1 36  ? -21.165  -60.490  -35.528  1.00 0.00 ? 31  LYS A CD   2  
ATOM 5996  C CE   . LYS A 1 36  ? -20.516  -59.969  -36.812  1.00 0.00 ? 31  LYS A CE   2  
ATOM 5997  N NZ   . LYS A 1 36  ? -19.705  -58.795  -36.385  1.00 0.00 ? 31  LYS A NZ   2  
ATOM 5998  H H    . LYS A 1 36  ? -23.465  -59.120  -32.568  1.00 0.00 ? 31  LYS A H    2  
ATOM 5999  H HA   . LYS A 1 36  ? -23.319  -58.527  -35.361  1.00 0.00 ? 31  LYS A HA   2  
ATOM 6000  H HB2  . LYS A 1 36  ? -22.897  -60.672  -33.685  1.00 0.00 ? 31  LYS A HB2  2  
ATOM 6001  H HB3  . LYS A 1 36  ? -24.341  -61.179  -34.561  1.00 0.00 ? 31  LYS A HB3  2  
ATOM 6002  H HG2  . LYS A 1 36  ? -22.685  -61.928  -36.007  1.00 0.00 ? 31  LYS A HG2  2  
ATOM 6003  H HG3  . LYS A 1 36  ? -22.978  -60.315  -36.661  1.00 0.00 ? 31  LYS A HG3  2  
ATOM 6004  H HD2  . LYS A 1 36  ? -21.131  -59.723  -34.769  1.00 0.00 ? 31  LYS A HD2  2  
ATOM 6005  H HD3  . LYS A 1 36  ? -20.628  -61.361  -35.183  1.00 0.00 ? 31  LYS A HD3  2  
ATOM 6006  H HE2  . LYS A 1 36  ? -19.881  -60.730  -37.247  1.00 0.00 ? 31  LYS A HE2  2  
ATOM 6007  H HE3  . LYS A 1 36  ? -21.272  -59.659  -37.517  1.00 0.00 ? 31  LYS A HE3  2  
ATOM 6008  H HZ1  . LYS A 1 36  ? -19.030  -59.087  -35.651  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM 6009  H HZ2  . LYS A 1 36  ? -20.335  -58.059  -36.004  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM 6010  H HZ3  . LYS A 1 36  ? -19.184  -58.417  -37.201  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM 6011  N N    . ILE A 1 37  ? -26.293  -59.212  -34.141  1.00 0.00 ? 32  ILE A N    2  
ATOM 6012  C CA   . ILE A 1 37  ? -27.746  -59.137  -34.457  1.00 0.00 ? 32  ILE A CA   2  
ATOM 6013  C C    . ILE A 1 37  ? -28.121  -57.684  -34.758  1.00 0.00 ? 32  ILE A C    2  
ATOM 6014  O O    . ILE A 1 37  ? -28.955  -57.408  -35.598  1.00 0.00 ? 32  ILE A O    2  
ATOM 6015  C CB   . ILE A 1 37  ? -28.453  -59.648  -33.196  1.00 0.00 ? 32  ILE A CB   2  
ATOM 6016  C CG1  . ILE A 1 37  ? -28.281  -61.168  -33.104  1.00 0.00 ? 32  ILE A CG1  2  
ATOM 6017  C CG2  . ILE A 1 37  ? -29.946  -59.311  -33.258  1.00 0.00 ? 32  ILE A CG2  2  
ATOM 6018  C CD1  . ILE A 1 37  ? -28.094  -61.577  -31.643  1.00 0.00 ? 32  ILE A CD1  2  
ATOM 6019  H H    . ILE A 1 37  ? -26.001  -59.413  -33.227  1.00 0.00 ? 32  ILE A H    2  
ATOM 6020  H HA   . ILE A 1 37  ? -27.983  -59.771  -35.296  1.00 0.00 ? 32  ILE A HA   2  
ATOM 6021  H HB   . ILE A 1 37  ? -28.016  -59.182  -32.325  1.00 0.00 ? 32  ILE A HB   2  
ATOM 6022  H HG12 . ILE A 1 37  ? -29.158  -61.654  -33.506  1.00 0.00 ? 32  ILE A HG12 2  
ATOM 6023  H HG13 . ILE A 1 37  ? -27.412  -61.466  -33.673  1.00 0.00 ? 32  ILE A HG13 2  
ATOM 6024  H HG21 . ILE A 1 37  ? -30.363  -59.693  -34.178  1.00 0.00 ? 32  ILE A HG21 2  
ATOM 6025  H HG22 . ILE A 1 37  ? -30.072  -58.239  -33.223  1.00 0.00 ? 32  ILE A HG22 2  
ATOM 6026  H HG23 . ILE A 1 37  ? -30.453  -59.761  -32.417  1.00 0.00 ? 32  ILE A HG23 2  
ATOM 6027  H HD11 . ILE A 1 37  ? -28.387  -62.609  -31.518  1.00 0.00 ? 32  ILE A HD11 2  
ATOM 6028  H HD12 . ILE A 1 37  ? -28.706  -60.950  -31.012  1.00 0.00 ? 32  ILE A HD12 2  
ATOM 6029  H HD13 . ILE A 1 37  ? -27.056  -61.462  -31.367  1.00 0.00 ? 32  ILE A HD13 2  
ATOM 6030  N N    . GLU A 1 38  ? -27.496  -56.752  -34.085  1.00 0.00 ? 33  GLU A N    2  
ATOM 6031  C CA   . GLU A 1 38  ? -27.801  -55.314  -34.344  1.00 0.00 ? 33  GLU A CA   2  
ATOM 6032  C C    . GLU A 1 38  ? -27.418  -54.964  -35.783  1.00 0.00 ? 33  GLU A C    2  
ATOM 6033  O O    . GLU A 1 38  ? -28.143  -54.286  -36.484  1.00 0.00 ? 33  GLU A O    2  
ATOM 6034  C CB   . GLU A 1 38  ? -26.936  -54.534  -33.352  1.00 0.00 ? 33  GLU A CB   2  
ATOM 6035  C CG   . GLU A 1 38  ? -27.765  -54.179  -32.114  1.00 0.00 ? 33  GLU A CG   2  
ATOM 6036  C CD   . GLU A 1 38  ? -27.317  -55.041  -30.932  1.00 0.00 ? 33  GLU A CD   2  
ATOM 6037  O OE1  . GLU A 1 38  ? -27.844  -56.132  -30.786  1.00 0.00 ? 33  GLU A OE1  2  
ATOM 6038  O OE2  . GLU A 1 38  ? -26.452  -54.597  -30.195  1.00 0.00 ? 33  GLU A OE2  2  
ATOM 6039  H H    . GLU A 1 38  ? -26.819  -56.998  -33.421  1.00 0.00 ? 33  GLU A H    2  
ATOM 6040  H HA   . GLU A 1 38  ? -28.846  -55.111  -34.168  1.00 0.00 ? 33  GLU A HA   2  
ATOM 6041  H HB2  . GLU A 1 38  ? -26.090  -55.140  -33.060  1.00 0.00 ? 33  GLU A HB2  2  
ATOM 6042  H HB3  . GLU A 1 38  ? -26.584  -53.627  -33.819  1.00 0.00 ? 33  GLU A HB3  2  
ATOM 6043  H HG2  . GLU A 1 38  ? -27.623  -53.136  -31.874  1.00 0.00 ? 33  GLU A HG2  2  
ATOM 6044  H HG3  . GLU A 1 38  ? -28.810  -54.363  -32.314  1.00 0.00 ? 33  GLU A HG3  2  
ATOM 6045  N N    . ALA A 1 39  ? -26.285  -55.435  -36.231  1.00 0.00 ? 34  ALA A N    2  
ATOM 6046  C CA   . ALA A 1 39  ? -25.852  -55.147  -37.628  1.00 0.00 ? 34  ALA A CA   2  
ATOM 6047  C C    . ALA A 1 39  ? -26.508  -56.146  -38.584  1.00 0.00 ? 34  ALA A C    2  
ATOM 6048  O O    . ALA A 1 39  ? -26.739  -55.856  -39.742  1.00 0.00 ? 34  ALA A O    2  
ATOM 6049  C CB   . ALA A 1 39  ? -24.333  -55.326  -37.619  1.00 0.00 ? 34  ALA A CB   2  
ATOM 6050  H H    . ALA A 1 39  ? -25.721  -55.987  -35.649  1.00 0.00 ? 34  ALA A H    2  
ATOM 6051  H HA   . ALA A 1 39  ? -26.105  -54.136  -37.902  1.00 0.00 ? 34  ALA A HA   2  
ATOM 6052  H HB1  . ALA A 1 39  ? -24.094  -56.376  -37.541  1.00 0.00 ? 34  ALA A HB1  2  
ATOM 6053  H HB2  . ALA A 1 39  ? -23.914  -54.797  -36.776  1.00 0.00 ? 34  ALA A HB2  2  
ATOM 6054  H HB3  . ALA A 1 39  ? -23.919  -54.930  -38.534  1.00 0.00 ? 34  ALA A HB3  2  
ATOM 6055  N N    . GLU A 1 40  ? -26.817  -57.321  -38.100  1.00 0.00 ? 35  GLU A N    2  
ATOM 6056  C CA   . GLU A 1 40  ? -27.469  -58.345  -38.967  1.00 0.00 ? 35  GLU A CA   2  
ATOM 6057  C C    . GLU A 1 40  ? -28.917  -57.936  -39.248  1.00 0.00 ? 35  GLU A C    2  
ATOM 6058  O O    . GLU A 1 40  ? -29.317  -57.759  -40.383  1.00 0.00 ? 35  GLU A O    2  
ATOM 6059  C CB   . GLU A 1 40  ? -27.426  -59.639  -38.153  1.00 0.00 ? 35  GLU A CB   2  
ATOM 6060  C CG   . GLU A 1 40  ? -28.148  -60.749  -38.917  1.00 0.00 ? 35  GLU A CG   2  
ATOM 6061  C CD   . GLU A 1 40  ? -27.387  -61.063  -40.206  1.00 0.00 ? 35  GLU A CD   2  
ATOM 6062  O OE1  . GLU A 1 40  ? -26.168  -61.053  -40.169  1.00 0.00 ? 35  GLU A OE1  2  
ATOM 6063  O OE2  . GLU A 1 40  ? -28.037  -61.309  -41.209  1.00 0.00 ? 35  GLU A OE2  2  
ATOM 6064  H H    . GLU A 1 40  ? -26.627  -57.526  -37.162  1.00 0.00 ? 35  GLU A H    2  
ATOM 6065  H HA   . GLU A 1 40  ? -26.922  -58.471  -39.885  1.00 0.00 ? 35  GLU A HA   2  
ATOM 6066  H HB2  . GLU A 1 40  ? -26.397  -59.925  -37.987  1.00 0.00 ? 35  GLU A HB2  2  
ATOM 6067  H HB3  . GLU A 1 40  ? -27.914  -59.482  -37.204  1.00 0.00 ? 35  GLU A HB3  2  
ATOM 6068  H HG2  . GLU A 1 40  ? -28.196  -61.635  -38.301  1.00 0.00 ? 35  GLU A HG2  2  
ATOM 6069  H HG3  . GLU A 1 40  ? -29.148  -60.423  -39.161  1.00 0.00 ? 35  GLU A HG3  2  
ATOM 6070  N N    . LYS A 1 41  ? -29.701  -57.780  -38.216  1.00 0.00 ? 36  LYS A N    2  
ATOM 6071  C CA   . LYS A 1 41  ? -31.125  -57.376  -38.403  1.00 0.00 ? 36  LYS A CA   2  
ATOM 6072  C C    . LYS A 1 41  ? -31.225  -55.851  -38.477  1.00 0.00 ? 36  LYS A C    2  
ATOM 6073  O O    . LYS A 1 41  ? -31.962  -55.302  -39.272  1.00 0.00 ? 36  LYS A O    2  
ATOM 6074  C CB   . LYS A 1 41  ? -31.843  -57.904  -37.159  1.00 0.00 ? 36  LYS A CB   2  
ATOM 6075  C CG   . LYS A 1 41  ? -33.314  -57.472  -37.179  1.00 0.00 ? 36  LYS A CG   2  
ATOM 6076  C CD   . LYS A 1 41  ? -34.182  -58.630  -37.682  1.00 0.00 ? 36  LYS A CD   2  
ATOM 6077  C CE   . LYS A 1 41  ? -34.693  -58.320  -39.093  1.00 0.00 ? 36  LYS A CE   2  
ATOM 6078  N NZ   . LYS A 1 41  ? -33.954  -59.257  -39.985  1.00 0.00 ? 36  LYS A NZ   2  
ATOM 6079  H H    . LYS A 1 41  ? -29.351  -57.925  -37.312  1.00 0.00 ? 36  LYS A H    2  
ATOM 6080  H HA   . LYS A 1 41  ? -31.536  -57.828  -39.291  1.00 0.00 ? 36  LYS A HA   2  
ATOM 6081  H HB2  . LYS A 1 41  ? -31.785  -58.982  -37.142  1.00 0.00 ? 36  LYS A HB2  2  
ATOM 6082  H HB3  . LYS A 1 41  ? -31.368  -57.506  -36.275  1.00 0.00 ? 36  LYS A HB3  2  
ATOM 6083  H HG2  . LYS A 1 41  ? -33.619  -57.199  -36.179  1.00 0.00 ? 36  LYS A HG2  2  
ATOM 6084  H HG3  . LYS A 1 41  ? -33.433  -56.623  -37.834  1.00 0.00 ? 36  LYS A HG3  2  
ATOM 6085  H HD2  . LYS A 1 41  ? -33.595  -59.537  -37.702  1.00 0.00 ? 36  LYS A HD2  2  
ATOM 6086  H HD3  . LYS A 1 41  ? -35.023  -58.762  -37.019  1.00 0.00 ? 36  LYS A HD3  2  
ATOM 6087  H HE2  . LYS A 1 41  ? -35.758  -58.502  -39.153  1.00 0.00 ? 36  LYS A HE2  2  
ATOM 6088  H HE3  . LYS A 1 41  ? -34.469  -57.300  -39.361  1.00 0.00 ? 36  LYS A HE3  2  
ATOM 6089  H HZ1  . LYS A 1 41  ? -34.116  -60.235  -39.673  1.00 0.00 ? 36  LYS A HZ1  2  
ATOM 6090  H HZ2  . LYS A 1 41  ? -32.936  -59.043  -39.945  1.00 0.00 ? 36  LYS A HZ2  2  
ATOM 6091  H HZ3  . LYS A 1 41  ? -34.293  -59.147  -40.961  1.00 0.00 ? 36  LYS A HZ3  2  
ATOM 6092  N N    . GLY A 1 42  ? -30.487  -55.168  -37.647  1.00 0.00 ? 37  GLY A N    2  
ATOM 6093  C CA   . GLY A 1 42  ? -30.532  -53.677  -37.655  1.00 0.00 ? 37  GLY A CA   2  
ATOM 6094  C C    . GLY A 1 42  ? -30.613  -53.159  -36.217  1.00 0.00 ? 37  GLY A C    2  
ATOM 6095  O O    . GLY A 1 42  ? -30.448  -53.903  -35.270  1.00 0.00 ? 37  GLY A O    2  
ATOM 6096  H H    . GLY A 1 42  ? -29.903  -55.639  -37.016  1.00 0.00 ? 37  GLY A H    2  
ATOM 6097  H HA2  . GLY A 1 42  ? -29.639  -53.293  -38.128  1.00 0.00 ? 37  GLY A HA2  2  
ATOM 6098  H HA3  . GLY A 1 42  ? -31.401  -53.345  -38.203  1.00 0.00 ? 37  GLY A HA3  2  
ATOM 6099  N N    . ARG A 1 43  ? -30.866  -51.888  -36.048  1.00 0.00 ? 38  ARG A N    2  
ATOM 6100  C CA   . ARG A 1 43  ? -30.959  -51.319  -34.671  1.00 0.00 ? 38  ARG A CA   2  
ATOM 6101  C C    . ARG A 1 43  ? -32.222  -50.461  -34.529  1.00 0.00 ? 38  ARG A C    2  
ATOM 6102  O O    . ARG A 1 43  ? -32.393  -49.754  -33.555  1.00 0.00 ? 38  ARG A O    2  
ATOM 6103  C CB   . ARG A 1 43  ? -29.706  -50.457  -34.516  1.00 0.00 ? 38  ARG A CB   2  
ATOM 6104  C CG   . ARG A 1 43  ? -28.470  -51.358  -34.458  1.00 0.00 ? 38  ARG A CG   2  
ATOM 6105  C CD   . ARG A 1 43  ? -27.235  -50.514  -34.135  1.00 0.00 ? 38  ARG A CD   2  
ATOM 6106  N NE   . ARG A 1 43  ? -26.794  -49.960  -35.445  1.00 0.00 ? 38  ARG A NE   2  
ATOM 6107  C CZ   . ARG A 1 43  ? -25.614  -50.257  -35.915  1.00 0.00 ? 38  ARG A CZ   2  
ATOM 6108  N NH1  . ARG A 1 43  ? -25.365  -51.466  -36.337  1.00 0.00 ? 38  ARG A NH1  2  
ATOM 6109  N NH2  . ARG A 1 43  ? -24.682  -49.344  -35.963  1.00 0.00 ? 38  ARG A NH2  2  
ATOM 6110  H H    . ARG A 1 43  ? -30.996  -51.308  -36.827  1.00 0.00 ? 38  ARG A H    2  
ATOM 6111  H HA   . ARG A 1 43  ? -30.956  -52.107  -33.934  1.00 0.00 ? 38  ARG A HA   2  
ATOM 6112  H HB2  . ARG A 1 43  ? -29.624  -49.786  -35.360  1.00 0.00 ? 38  ARG A HB2  2  
ATOM 6113  H HB3  . ARG A 1 43  ? -29.774  -49.883  -33.604  1.00 0.00 ? 38  ARG A HB3  2  
ATOM 6114  H HG2  . ARG A 1 43  ? -28.607  -52.106  -33.690  1.00 0.00 ? 38  ARG A HG2  2  
ATOM 6115  H HG3  . ARG A 1 43  ? -28.333  -51.843  -35.413  1.00 0.00 ? 38  ARG A HG3  2  
ATOM 6116  H HD2  . ARG A 1 43  ? -27.494  -49.716  -33.453  1.00 0.00 ? 38  ARG A HD2  2  
ATOM 6117  H HD3  . ARG A 1 43  ? -26.456  -51.132  -33.715  1.00 0.00 ? 38  ARG A HD3  2  
ATOM 6118  H HE   . ARG A 1 43  ? -27.391  -49.372  -35.954  1.00 0.00 ? 38  ARG A HE   2  
ATOM 6119  H HH11 . ARG A 1 43  ? -26.079  -52.165  -36.299  1.00 0.00 ? 38  ARG A HH11 2  
ATOM 6120  H HH12 . ARG A 1 43  ? -24.460  -51.694  -36.696  1.00 0.00 ? 38  ARG A HH12 2  
ATOM 6121  H HH21 . ARG A 1 43  ? -24.873  -48.417  -35.640  1.00 0.00 ? 38  ARG A HH21 2  
ATOM 6122  H HH22 . ARG A 1 43  ? -23.778  -49.572  -36.323  1.00 0.00 ? 38  ARG A HH22 2  
ATOM 6123  N N    . ASP A 1 44  ? -33.110  -50.517  -35.489  1.00 0.00 ? 39  ASP A N    2  
ATOM 6124  C CA   . ASP A 1 44  ? -34.359  -49.705  -35.397  1.00 0.00 ? 39  ASP A CA   2  
ATOM 6125  C C    . ASP A 1 44  ? -35.233  -50.220  -34.251  1.00 0.00 ? 39  ASP A C    2  
ATOM 6126  O O    . ASP A 1 44  ? -35.930  -49.467  -33.600  1.00 0.00 ? 39  ASP A O    2  
ATOM 6127  C CB   . ASP A 1 44  ? -35.065  -49.901  -36.740  1.00 0.00 ? 39  ASP A CB   2  
ATOM 6128  C CG   . ASP A 1 44  ? -36.260  -48.950  -36.833  1.00 0.00 ? 39  ASP A CG   2  
ATOM 6129  O OD1  . ASP A 1 44  ? -36.078  -47.774  -36.567  1.00 0.00 ? 39  ASP A OD1  2  
ATOM 6130  O OD2  . ASP A 1 44  ? -37.338  -49.415  -37.168  1.00 0.00 ? 39  ASP A OD2  2  
ATOM 6131  H H    . ASP A 1 44  ? -32.958  -51.094  -36.265  1.00 0.00 ? 39  ASP A H    2  
ATOM 6132  H HA   . ASP A 1 44  ? -34.123  -48.662  -35.253  1.00 0.00 ? 39  ASP A HA   2  
ATOM 6133  H HB2  . ASP A 1 44  ? -34.374  -49.692  -37.544  1.00 0.00 ? 39  ASP A HB2  2  
ATOM 6134  H HB3  . ASP A 1 44  ? -35.412  -50.920  -36.819  1.00 0.00 ? 39  ASP A HB3  2  
ATOM 6135  N N    . ALA A 1 45  ? -35.195  -51.501  -34.000  1.00 0.00 ? 40  ALA A N    2  
ATOM 6136  C CA   . ALA A 1 45  ? -36.016  -52.074  -32.894  1.00 0.00 ? 40  ALA A CA   2  
ATOM 6137  C C    . ALA A 1 45  ? -35.299  -53.279  -32.279  1.00 0.00 ? 40  ALA A C    2  
ATOM 6138  O O    . ALA A 1 45  ? -35.913  -54.137  -31.676  1.00 0.00 ? 40  ALA A O    2  
ATOM 6139  C CB   . ALA A 1 45  ? -37.324  -52.507  -33.555  1.00 0.00 ? 40  ALA A CB   2  
ATOM 6140  H H    . ALA A 1 45  ? -34.622  -52.087  -34.537  1.00 0.00 ? 40  ALA A H    2  
ATOM 6141  H HA   . ALA A 1 45  ? -36.210  -51.327  -32.143  1.00 0.00 ? 40  ALA A HA   2  
ATOM 6142  H HB1  . ALA A 1 45  ? -37.940  -51.638  -33.738  1.00 0.00 ? 40  ALA A HB1  2  
ATOM 6143  H HB2  . ALA A 1 45  ? -37.849  -53.188  -32.902  1.00 0.00 ? 40  ALA A HB2  2  
ATOM 6144  H HB3  . ALA A 1 45  ? -37.109  -52.999  -34.491  1.00 0.00 ? 40  ALA A HB3  2  
ATOM 6145  N N    . PHE A 1 46  ? -34.004  -53.347  -32.431  1.00 0.00 ? 41  PHE A N    2  
ATOM 6146  C CA   . PHE A 1 46  ? -33.242  -54.493  -31.861  1.00 0.00 ? 41  PHE A CA   2  
ATOM 6147  C C    . PHE A 1 46  ? -32.204  -53.983  -30.856  1.00 0.00 ? 41  PHE A C    2  
ATOM 6148  O O    . PHE A 1 46  ? -31.032  -53.893  -31.167  1.00 0.00 ? 41  PHE A O    2  
ATOM 6149  C CB   . PHE A 1 46  ? -32.557  -55.137  -33.065  1.00 0.00 ? 41  PHE A CB   2  
ATOM 6150  C CG   . PHE A 1 46  ? -33.418  -56.259  -33.594  1.00 0.00 ? 41  PHE A CG   2  
ATOM 6151  C CD1  . PHE A 1 46  ? -34.704  -55.987  -34.077  1.00 0.00 ? 41  PHE A CD1  2  
ATOM 6152  C CD2  . PHE A 1 46  ? -32.931  -57.570  -33.601  1.00 0.00 ? 41  PHE A CD2  2  
ATOM 6153  C CE1  . PHE A 1 46  ? -35.502  -57.029  -34.568  1.00 0.00 ? 41  PHE A CE1  2  
ATOM 6154  C CE2  . PHE A 1 46  ? -33.728  -58.610  -34.090  1.00 0.00 ? 41  PHE A CE2  2  
ATOM 6155  C CZ   . PHE A 1 46  ? -35.013  -58.340  -34.574  1.00 0.00 ? 41  PHE A CZ   2  
ATOM 6156  H H    . PHE A 1 46  ? -33.531  -52.644  -32.922  1.00 0.00 ? 41  PHE A H    2  
ATOM 6157  H HA   . PHE A 1 46  ? -33.910  -55.198  -31.393  1.00 0.00 ? 41  PHE A HA   2  
ATOM 6158  H HB2  . PHE A 1 46  ? -32.418  -54.395  -33.837  1.00 0.00 ? 41  PHE A HB2  2  
ATOM 6159  H HB3  . PHE A 1 46  ? -31.597  -55.531  -32.767  1.00 0.00 ? 41  PHE A HB3  2  
ATOM 6160  H HD1  . PHE A 1 46  ? -35.080  -54.976  -34.073  1.00 0.00 ? 41  PHE A HD1  2  
ATOM 6161  H HD2  . PHE A 1 46  ? -31.942  -57.780  -33.226  1.00 0.00 ? 41  PHE A HD2  2  
ATOM 6162  H HE1  . PHE A 1 46  ? -36.494  -56.820  -34.941  1.00 0.00 ? 41  PHE A HE1  2  
ATOM 6163  H HE2  . PHE A 1 46  ? -33.349  -59.620  -34.094  1.00 0.00 ? 41  PHE A HE2  2  
ATOM 6164  H HZ   . PHE A 1 46  ? -35.627  -59.143  -34.954  1.00 0.00 ? 41  PHE A HZ   2  
ATOM 6165  N N    . PRO A 1 47  ? -32.671  -53.657  -29.678  1.00 0.00 ? 42  PRO A N    2  
ATOM 6166  C CA   . PRO A 1 47  ? -31.768  -53.143  -28.621  1.00 0.00 ? 42  PRO A CA   2  
ATOM 6167  C C    . PRO A 1 47  ? -30.919  -54.278  -28.040  1.00 0.00 ? 42  PRO A C    2  
ATOM 6168  O O    . PRO A 1 47  ? -30.801  -55.337  -28.623  1.00 0.00 ? 42  PRO A O    2  
ATOM 6169  C CB   . PRO A 1 47  ? -32.726  -52.587  -27.570  1.00 0.00 ? 42  PRO A CB   2  
ATOM 6170  C CG   . PRO A 1 47  ? -34.004  -53.338  -27.771  1.00 0.00 ? 42  PRO A CG   2  
ATOM 6171  C CD   . PRO A 1 47  ? -34.066  -53.735  -29.223  1.00 0.00 ? 42  PRO A CD   2  
ATOM 6172  H HA   . PRO A 1 47  ? -31.142  -52.354  -29.007  1.00 0.00 ? 42  PRO A HA   2  
ATOM 6173  H HB2  . PRO A 1 47  ? -32.336  -52.764  -26.577  1.00 0.00 ? 42  PRO A HB2  2  
ATOM 6174  H HB3  . PRO A 1 47  ? -32.889  -51.533  -27.730  1.00 0.00 ? 42  PRO A HB3  2  
ATOM 6175  H HG2  . PRO A 1 47  ? -34.014  -54.219  -27.145  1.00 0.00 ? 42  PRO A HG2  2  
ATOM 6176  H HG3  . PRO A 1 47  ? -34.845  -52.705  -27.532  1.00 0.00 ? 42  PRO A HG3  2  
ATOM 6177  H HD2  . PRO A 1 47  ? -34.444  -54.744  -29.322  1.00 0.00 ? 42  PRO A HD2  2  
ATOM 6178  H HD3  . PRO A 1 47  ? -34.678  -53.044  -29.781  1.00 0.00 ? 42  PRO A HD3  2  
ATOM 6179  N N    . VAL A 1 48  ? -30.326  -54.061  -26.896  1.00 0.00 ? 43  VAL A N    2  
ATOM 6180  C CA   . VAL A 1 48  ? -29.481  -55.121  -26.273  1.00 0.00 ? 43  VAL A CA   2  
ATOM 6181  C C    . VAL A 1 48  ? -30.078  -55.556  -24.929  1.00 0.00 ? 43  VAL A C    2  
ATOM 6182  O O    . VAL A 1 48  ? -30.020  -56.712  -24.559  1.00 0.00 ? 43  VAL A O    2  
ATOM 6183  C CB   . VAL A 1 48  ? -28.110  -54.470  -26.074  1.00 0.00 ? 43  VAL A CB   2  
ATOM 6184  C CG1  . VAL A 1 48  ? -27.165  -55.460  -25.391  1.00 0.00 ? 43  VAL A CG1  2  
ATOM 6185  C CG2  . VAL A 1 48  ? -27.531  -54.077  -27.437  1.00 0.00 ? 43  VAL A CG2  2  
ATOM 6186  H H    . VAL A 1 48  ? -30.435  -53.198  -26.446  1.00 0.00 ? 43  VAL A H    2  
ATOM 6187  H HA   . VAL A 1 48  ? -29.392  -55.967  -26.934  1.00 0.00 ? 43  VAL A HA   2  
ATOM 6188  H HB   . VAL A 1 48  ? -28.216  -53.589  -25.458  1.00 0.00 ? 43  VAL A HB   2  
ATOM 6189  H HG11 . VAL A 1 48  ? -27.214  -55.325  -24.321  1.00 0.00 ? 43  VAL A HG11 2  
ATOM 6190  H HG12 . VAL A 1 48  ? -26.154  -55.286  -25.730  1.00 0.00 ? 43  VAL A HG12 2  
ATOM 6191  H HG13 . VAL A 1 48  ? -27.459  -56.469  -25.640  1.00 0.00 ? 43  VAL A HG13 2  
ATOM 6192  H HG21 . VAL A 1 48  ? -26.645  -53.478  -27.292  1.00 0.00 ? 43  VAL A HG21 2  
ATOM 6193  H HG22 . VAL A 1 48  ? -28.264  -53.508  -27.989  1.00 0.00 ? 43  VAL A HG22 2  
ATOM 6194  H HG23 . VAL A 1 48  ? -27.275  -54.969  -27.991  1.00 0.00 ? 43  VAL A HG23 2  
ATOM 6195  N N    . ALA A 1 49  ? -30.642  -54.636  -24.192  1.00 0.00 ? 44  ALA A N    2  
ATOM 6196  C CA   . ALA A 1 49  ? -31.236  -54.989  -22.866  1.00 0.00 ? 44  ALA A CA   2  
ATOM 6197  C C    . ALA A 1 49  ? -32.148  -56.220  -22.977  1.00 0.00 ? 44  ALA A C    2  
ATOM 6198  O O    . ALA A 1 49  ? -32.239  -57.015  -22.061  1.00 0.00 ? 44  ALA A O    2  
ATOM 6199  C CB   . ALA A 1 49  ? -32.046  -53.759  -22.457  1.00 0.00 ? 44  ALA A CB   2  
ATOM 6200  H H    . ALA A 1 49  ? -30.669  -53.709  -24.508  1.00 0.00 ? 44  ALA A H    2  
ATOM 6201  H HA   . ALA A 1 49  ? -30.456  -55.167  -22.143  1.00 0.00 ? 44  ALA A HA   2  
ATOM 6202  H HB1  . ALA A 1 49  ? -32.774  -54.039  -21.710  1.00 0.00 ? 44  ALA A HB1  2  
ATOM 6203  H HB2  . ALA A 1 49  ? -32.554  -53.358  -23.321  1.00 0.00 ? 44  ALA A HB2  2  
ATOM 6204  H HB3  . ALA A 1 49  ? -31.383  -53.010  -22.049  1.00 0.00 ? 44  ALA A HB3  2  
ATOM 6205  N N    . GLY A 1 50  ? -32.824  -56.387  -24.086  1.00 0.00 ? 45  GLY A N    2  
ATOM 6206  C CA   . GLY A 1 50  ? -33.724  -57.568  -24.239  1.00 0.00 ? 45  GLY A CA   2  
ATOM 6207  C C    . GLY A 1 50  ? -33.139  -58.543  -25.261  1.00 0.00 ? 45  GLY A C    2  
ATOM 6208  O O    . GLY A 1 50  ? -33.856  -59.303  -25.881  1.00 0.00 ? 45  GLY A O    2  
ATOM 6209  H H    . GLY A 1 50  ? -32.742  -55.737  -24.816  1.00 0.00 ? 45  GLY A H    2  
ATOM 6210  H HA2  . GLY A 1 50  ? -33.826  -58.068  -23.286  1.00 0.00 ? 45  GLY A HA2  2  
ATOM 6211  H HA3  . GLY A 1 50  ? -34.695  -57.241  -24.578  1.00 0.00 ? 45  GLY A HA3  2  
ATOM 6212  N N    . GLN A 1 51  ? -31.845  -58.533  -25.441  1.00 0.00 ? 46  GLN A N    2  
ATOM 6213  C CA   . GLN A 1 51  ? -31.227  -59.468  -26.425  1.00 0.00 ? 46  GLN A CA   2  
ATOM 6214  C C    . GLN A 1 51  ? -30.861  -60.790  -25.745  1.00 0.00 ? 46  GLN A C    2  
ATOM 6215  O O    . GLN A 1 51  ? -29.818  -60.914  -25.132  1.00 0.00 ? 46  GLN A O    2  
ATOM 6216  C CB   . GLN A 1 51  ? -29.968  -58.758  -26.927  1.00 0.00 ? 46  GLN A CB   2  
ATOM 6217  C CG   . GLN A 1 51  ? -30.257  -58.091  -28.274  1.00 0.00 ? 46  GLN A CG   2  
ATOM 6218  C CD   . GLN A 1 51  ? -29.935  -59.064  -29.408  1.00 0.00 ? 46  GLN A CD   2  
ATOM 6219  O OE1  . GLN A 1 51  ? -28.909  -58.949  -30.049  1.00 0.00 ? 46  GLN A OE1  2  
ATOM 6220  N NE2  . GLN A 1 51  ? -30.773  -60.024  -29.686  1.00 0.00 ? 46  GLN A NE2  2  
ATOM 6221  H H    . GLN A 1 51  ? -31.282  -57.915  -24.930  1.00 0.00 ? 46  GLN A H    2  
ATOM 6222  H HA   . GLN A 1 51  ? -31.898  -59.644  -27.247  1.00 0.00 ? 46  GLN A HA   2  
ATOM 6223  H HB2  . GLN A 1 51  ? -29.667  -58.010  -26.211  1.00 0.00 ? 46  GLN A HB2  2  
ATOM 6224  H HB3  . GLN A 1 51  ? -29.175  -59.479  -27.049  1.00 0.00 ? 46  GLN A HB3  2  
ATOM 6225  H HG2  . GLN A 1 51  ? -31.300  -57.813  -28.322  1.00 0.00 ? 46  GLN A HG2  2  
ATOM 6226  H HG3  . GLN A 1 51  ? -29.644  -57.209  -28.377  1.00 0.00 ? 46  GLN A HG3  2  
ATOM 6227  H HE21 . GLN A 1 51  ? -31.601  -60.117  -29.170  1.00 0.00 ? 46  GLN A HE21 2  
ATOM 6228  H HE22 . GLN A 1 51  ? -30.575  -60.652  -30.412  1.00 0.00 ? 46  GLN A HE22 2  
ATOM 6229  N N    . LYS A 1 52  ? -31.708  -61.779  -25.851  1.00 0.00 ? 47  LYS A N    2  
ATOM 6230  C CA   . LYS A 1 52  ? -31.410  -63.093  -25.214  1.00 0.00 ? 47  LYS A CA   2  
ATOM 6231  C C    . LYS A 1 52  ? -31.338  -64.170  -26.305  1.00 0.00 ? 47  LYS A C    2  
ATOM 6232  O O    . LYS A 1 52  ? -32.241  -64.308  -27.107  1.00 0.00 ? 47  LYS A O    2  
ATOM 6233  C CB   . LYS A 1 52  ? -32.588  -63.343  -24.266  1.00 0.00 ? 47  LYS A CB   2  
ATOM 6234  C CG   . LYS A 1 52  ? -32.863  -62.085  -23.433  1.00 0.00 ? 47  LYS A CG   2  
ATOM 6235  C CD   . LYS A 1 52  ? -33.359  -62.490  -22.042  1.00 0.00 ? 47  LYS A CD   2  
ATOM 6236  C CE   . LYS A 1 52  ? -32.192  -62.457  -21.052  1.00 0.00 ? 47  LYS A CE   2  
ATOM 6237  N NZ   . LYS A 1 52  ? -32.825  -62.252  -19.720  1.00 0.00 ? 47  LYS A NZ   2  
ATOM 6238  H H    . LYS A 1 52  ? -32.546  -61.660  -26.345  1.00 0.00 ? 47  LYS A H    2  
ATOM 6239  H HA   . LYS A 1 52  ? -30.485  -63.048  -24.660  1.00 0.00 ? 47  LYS A HA   2  
ATOM 6240  H HB2  . LYS A 1 52  ? -33.468  -63.590  -24.842  1.00 0.00 ? 47  LYS A HB2  2  
ATOM 6241  H HB3  . LYS A 1 52  ? -32.351  -64.158  -23.605  1.00 0.00 ? 47  LYS A HB3  2  
ATOM 6242  H HG2  . LYS A 1 52  ? -31.953  -61.511  -23.339  1.00 0.00 ? 47  LYS A HG2  2  
ATOM 6243  H HG3  . LYS A 1 52  ? -33.617  -61.488  -23.922  1.00 0.00 ? 47  LYS A HG3  2  
ATOM 6244  H HD2  . LYS A 1 52  ? -34.125  -61.799  -21.719  1.00 0.00 ? 47  LYS A HD2  2  
ATOM 6245  H HD3  . LYS A 1 52  ? -33.767  -63.488  -22.081  1.00 0.00 ? 47  LYS A HD3  2  
ATOM 6246  H HE2  . LYS A 1 52  ? -31.654  -63.395  -21.077  1.00 0.00 ? 47  LYS A HE2  2  
ATOM 6247  H HE3  . LYS A 1 52  ? -31.530  -61.636  -21.278  1.00 0.00 ? 47  LYS A HE3  2  
ATOM 6248  H HZ1  . LYS A 1 52  ? -32.101  -62.318  -18.978  1.00 0.00 ? 47  LYS A HZ1  2  
ATOM 6249  H HZ2  . LYS A 1 52  ? -33.549  -62.983  -19.565  1.00 0.00 ? 47  LYS A HZ2  2  
ATOM 6250  H HZ3  . LYS A 1 52  ? -33.267  -61.312  -19.687  1.00 0.00 ? 47  LYS A HZ3  2  
ATOM 6251  N N    . LEU A 1 53  ? -30.259  -64.914  -26.366  1.00 0.00 ? 48  LEU A N    2  
ATOM 6252  C CA   . LEU A 1 53  ? -30.131  -65.953  -27.439  1.00 0.00 ? 48  LEU A CA   2  
ATOM 6253  C C    . LEU A 1 53  ? -30.970  -67.194  -27.114  1.00 0.00 ? 48  LEU A C    2  
ATOM 6254  O O    . LEU A 1 53  ? -30.522  -68.091  -26.434  1.00 0.00 ? 48  LEU A O    2  
ATOM 6255  C CB   . LEU A 1 53  ? -28.643  -66.306  -27.463  1.00 0.00 ? 48  LEU A CB   2  
ATOM 6256  C CG   . LEU A 1 53  ? -27.888  -65.355  -28.399  1.00 0.00 ? 48  LEU A CG   2  
ATOM 6257  C CD1  . LEU A 1 53  ? -28.433  -65.488  -29.824  1.00 0.00 ? 48  LEU A CD1  2  
ATOM 6258  C CD2  . LEU A 1 53  ? -28.064  -63.910  -27.920  1.00 0.00 ? 48  LEU A CD2  2  
ATOM 6259  H H    . LEU A 1 53  ? -29.527  -64.775  -25.725  1.00 0.00 ? 48  LEU A H    2  
ATOM 6260  H HA   . LEU A 1 53  ? -30.425  -65.545  -28.393  1.00 0.00 ? 48  LEU A HA   2  
ATOM 6261  H HB2  . LEU A 1 53  ? -28.241  -66.216  -26.464  1.00 0.00 ? 48  LEU A HB2  2  
ATOM 6262  H HB3  . LEU A 1 53  ? -28.520  -67.321  -27.810  1.00 0.00 ? 48  LEU A HB3  2  
ATOM 6263  H HG   . LEU A 1 53  ? -26.839  -65.610  -28.394  1.00 0.00 ? 48  LEU A HG   2  
ATOM 6264  H HD11 . LEU A 1 53  ? -29.256  -64.803  -29.960  1.00 0.00 ? 48  LEU A HD11 2  
ATOM 6265  H HD12 . LEU A 1 53  ? -28.775  -66.500  -29.985  1.00 0.00 ? 48  LEU A HD12 2  
ATOM 6266  H HD13 . LEU A 1 53  ? -27.651  -65.256  -30.532  1.00 0.00 ? 48  LEU A HD13 2  
ATOM 6267  H HD21 . LEU A 1 53  ? -27.703  -63.821  -26.905  1.00 0.00 ? 48  LEU A HD21 2  
ATOM 6268  H HD22 . LEU A 1 53  ? -29.110  -63.643  -27.955  1.00 0.00 ? 48  LEU A HD22 2  
ATOM 6269  H HD23 . LEU A 1 53  ? -27.502  -63.247  -28.561  1.00 0.00 ? 48  LEU A HD23 2  
ATOM 6270  N N    . ILE A 1 54  ? -32.176  -67.267  -27.610  1.00 0.00 ? 49  ILE A N    2  
ATOM 6271  C CA   . ILE A 1 54  ? -33.015  -68.474  -27.318  1.00 0.00 ? 49  ILE A CA   2  
ATOM 6272  C C    . ILE A 1 54  ? -32.657  -69.612  -28.280  1.00 0.00 ? 49  ILE A C    2  
ATOM 6273  O O    . ILE A 1 54  ? -32.920  -69.535  -29.463  1.00 0.00 ? 49  ILE A O    2  
ATOM 6274  C CB   . ILE A 1 54  ? -34.495  -68.088  -27.527  1.00 0.00 ? 49  ILE A CB   2  
ATOM 6275  C CG1  . ILE A 1 54  ? -34.738  -66.581  -27.349  1.00 0.00 ? 49  ILE A CG1  2  
ATOM 6276  C CG2  . ILE A 1 54  ? -35.345  -68.846  -26.507  1.00 0.00 ? 49  ILE A CG2  2  
ATOM 6277  C CD1  . ILE A 1 54  ? -34.250  -66.131  -25.977  1.00 0.00 ? 49  ILE A CD1  2  
ATOM 6278  H H    . ILE A 1 54  ? -32.518  -66.547  -28.175  1.00 0.00 ? 49  ILE A H    2  
ATOM 6279  H HA   . ILE A 1 54  ? -32.860  -68.787  -26.294  1.00 0.00 ? 49  ILE A HA   2  
ATOM 6280  H HB   . ILE A 1 54  ? -34.796  -68.385  -28.522  1.00 0.00 ? 49  ILE A HB   2  
ATOM 6281  H HG12 . ILE A 1 54  ? -34.216  -66.036  -28.115  1.00 0.00 ? 49  ILE A HG12 2  
ATOM 6282  H HG13 . ILE A 1 54  ? -35.796  -66.382  -27.430  1.00 0.00 ? 49  ILE A HG13 2  
ATOM 6283  H HG21 . ILE A 1 54  ? -35.616  -69.810  -26.910  1.00 0.00 ? 49  ILE A HG21 2  
ATOM 6284  H HG22 . ILE A 1 54  ? -36.239  -68.280  -26.292  1.00 0.00 ? 49  ILE A HG22 2  
ATOM 6285  H HG23 . ILE A 1 54  ? -34.776  -68.982  -25.598  1.00 0.00 ? 49  ILE A HG23 2  
ATOM 6286  H HD11 . ILE A 1 54  ? -33.364  -66.685  -25.708  1.00 0.00 ? 49  ILE A HD11 2  
ATOM 6287  H HD12 . ILE A 1 54  ? -35.023  -66.312  -25.245  1.00 0.00 ? 49  ILE A HD12 2  
ATOM 6288  H HD13 . ILE A 1 54  ? -34.021  -65.077  -26.005  1.00 0.00 ? 49  ILE A HD13 2  
ATOM 6289  N N    . TYR A 1 55  ? -32.073  -70.671  -27.786  1.00 0.00 ? 50  TYR A N    2  
ATOM 6290  C CA   . TYR A 1 55  ? -31.720  -71.812  -28.681  1.00 0.00 ? 50  TYR A CA   2  
ATOM 6291  C C    . TYR A 1 55  ? -32.468  -73.079  -28.235  1.00 0.00 ? 50  TYR A C    2  
ATOM 6292  O O    . TYR A 1 55  ? -32.554  -74.045  -28.967  1.00 0.00 ? 50  TYR A O    2  
ATOM 6293  C CB   . TYR A 1 55  ? -30.199  -71.971  -28.537  1.00 0.00 ? 50  TYR A CB   2  
ATOM 6294  C CG   . TYR A 1 55  ? -29.771  -73.353  -28.981  1.00 0.00 ? 50  TYR A CG   2  
ATOM 6295  C CD1  . TYR A 1 55  ? -30.185  -73.860  -30.222  1.00 0.00 ? 50  TYR A CD1  2  
ATOM 6296  C CD2  . TYR A 1 55  ? -28.967  -74.132  -28.142  1.00 0.00 ? 50  TYR A CD2  2  
ATOM 6297  C CE1  . TYR A 1 55  ? -29.795  -75.143  -30.617  1.00 0.00 ? 50  TYR A CE1  2  
ATOM 6298  C CE2  . TYR A 1 55  ? -28.576  -75.414  -28.539  1.00 0.00 ? 50  TYR A CE2  2  
ATOM 6299  C CZ   . TYR A 1 55  ? -28.991  -75.921  -29.776  1.00 0.00 ? 50  TYR A CZ   2  
ATOM 6300  O OH   . TYR A 1 55  ? -28.607  -77.188  -30.167  1.00 0.00 ? 50  TYR A OH   2  
ATOM 6301  H H    . TYR A 1 55  ? -31.875  -70.722  -26.829  1.00 0.00 ? 50  TYR A H    2  
ATOM 6302  H HA   . TYR A 1 55  ? -31.969  -71.574  -29.703  1.00 0.00 ? 50  TYR A HA   2  
ATOM 6303  H HB2  . TYR A 1 55  ? -29.703  -71.231  -29.148  1.00 0.00 ? 50  TYR A HB2  2  
ATOM 6304  H HB3  . TYR A 1 55  ? -29.921  -71.826  -27.504  1.00 0.00 ? 50  TYR A HB3  2  
ATOM 6305  H HD1  . TYR A 1 55  ? -30.804  -73.262  -30.874  1.00 0.00 ? 50  TYR A HD1  2  
ATOM 6306  H HD2  . TYR A 1 55  ? -28.641  -73.740  -27.190  1.00 0.00 ? 50  TYR A HD2  2  
ATOM 6307  H HE1  . TYR A 1 55  ? -30.114  -75.532  -31.572  1.00 0.00 ? 50  TYR A HE1  2  
ATOM 6308  H HE2  . TYR A 1 55  ? -27.957  -76.013  -27.890  1.00 0.00 ? 50  TYR A HE2  2  
ATOM 6309  H HH   . TYR A 1 55  ? -27.804  -77.107  -30.687  1.00 0.00 ? 50  TYR A HH   2  
ATOM 6310  N N    . ALA A 1 56  ? -33.013  -73.084  -27.044  1.00 0.00 ? 51  ALA A N    2  
ATOM 6311  C CA   . ALA A 1 56  ? -33.753  -74.291  -26.570  1.00 0.00 ? 51  ALA A CA   2  
ATOM 6312  C C    . ALA A 1 56  ? -34.563  -73.966  -25.310  1.00 0.00 ? 51  ALA A C    2  
ATOM 6313  O O    . ALA A 1 56  ? -34.686  -74.780  -24.416  1.00 0.00 ? 51  ALA A O    2  
ATOM 6314  C CB   . ALA A 1 56  ? -32.667  -75.321  -26.258  1.00 0.00 ? 51  ALA A CB   2  
ATOM 6315  H H    . ALA A 1 56  ? -32.940  -72.298  -26.466  1.00 0.00 ? 51  ALA A H    2  
ATOM 6316  H HA   . ALA A 1 56  ? -34.400  -74.665  -27.348  1.00 0.00 ? 51  ALA A HA   2  
ATOM 6317  H HB1  . ALA A 1 56  ? -32.035  -74.949  -25.465  1.00 0.00 ? 51  ALA A HB1  2  
ATOM 6318  H HB2  . ALA A 1 56  ? -32.070  -75.494  -27.142  1.00 0.00 ? 51  ALA A HB2  2  
ATOM 6319  H HB3  . ALA A 1 56  ? -33.127  -76.247  -25.948  1.00 0.00 ? 51  ALA A HB3  2  
ATOM 6320  N N    . GLY A 1 57  ? -35.116  -72.784  -25.232  1.00 0.00 ? 52  GLY A N    2  
ATOM 6321  C CA   . GLY A 1 57  ? -35.917  -72.413  -24.029  1.00 0.00 ? 52  GLY A CA   2  
ATOM 6322  C C    . GLY A 1 57  ? -35.089  -71.491  -23.136  1.00 0.00 ? 52  GLY A C    2  
ATOM 6323  O O    . GLY A 1 57  ? -35.540  -70.440  -22.722  1.00 0.00 ? 52  GLY A O    2  
ATOM 6324  H H    . GLY A 1 57  ? -35.005  -72.140  -25.964  1.00 0.00 ? 52  GLY A H    2  
ATOM 6325  H HA2  . GLY A 1 57  ? -36.819  -71.904  -24.340  1.00 0.00 ? 52  GLY A HA2  2  
ATOM 6326  H HA3  . GLY A 1 57  ? -36.176  -73.304  -23.479  1.00 0.00 ? 52  GLY A HA3  2  
ATOM 6327  N N    . LYS A 1 58  ? -33.875  -71.872  -22.847  1.00 0.00 ? 53  LYS A N    2  
ATOM 6328  C CA   . LYS A 1 58  ? -33.002  -71.017  -21.993  1.00 0.00 ? 53  LYS A CA   2  
ATOM 6329  C C    . LYS A 1 58  ? -32.170  -70.105  -22.890  1.00 0.00 ? 53  LYS A C    2  
ATOM 6330  O O    . LYS A 1 58  ? -31.437  -70.567  -23.743  1.00 0.00 ? 53  LYS A O    2  
ATOM 6331  C CB   . LYS A 1 58  ? -32.105  -71.995  -21.233  1.00 0.00 ? 53  LYS A CB   2  
ATOM 6332  C CG   . LYS A 1 58  ? -31.541  -71.311  -19.986  1.00 0.00 ? 53  LYS A CG   2  
ATOM 6333  C CD   . LYS A 1 58  ? -30.196  -70.662  -20.321  1.00 0.00 ? 53  LYS A CD   2  
ATOM 6334  C CE   . LYS A 1 58  ? -29.073  -71.686  -20.131  1.00 0.00 ? 53  LYS A CE   2  
ATOM 6335  N NZ   . LYS A 1 58  ? -28.675  -71.558  -18.701  1.00 0.00 ? 53  LYS A NZ   2  
ATOM 6336  H H    . LYS A 1 58  ? -33.531  -72.717  -23.203  1.00 0.00 ? 53  LYS A H    2  
ATOM 6337  H HA   . LYS A 1 58  ? -33.595  -70.437  -21.302  1.00 0.00 ? 53  LYS A HA   2  
ATOM 6338  H HB2  . LYS A 1 58  ? -32.683  -72.860  -20.940  1.00 0.00 ? 53  LYS A HB2  2  
ATOM 6339  H HB3  . LYS A 1 58  ? -31.290  -72.305  -21.870  1.00 0.00 ? 53  LYS A HB3  2  
ATOM 6340  H HG2  . LYS A 1 58  ? -32.233  -70.553  -19.648  1.00 0.00 ? 53  LYS A HG2  2  
ATOM 6341  H HG3  . LYS A 1 58  ? -31.400  -72.044  -19.206  1.00 0.00 ? 53  LYS A HG3  2  
ATOM 6342  H HD2  . LYS A 1 58  ? -30.206  -70.323  -21.347  1.00 0.00 ? 53  LYS A HD2  2  
ATOM 6343  H HD3  . LYS A 1 58  ? -30.028  -69.822  -19.665  1.00 0.00 ? 53  LYS A HD3  2  
ATOM 6344  H HE2  . LYS A 1 58  ? -29.437  -72.683  -20.336  1.00 0.00 ? 53  LYS A HE2  2  
ATOM 6345  H HE3  . LYS A 1 58  ? -28.237  -71.450  -20.770  1.00 0.00 ? 53  LYS A HE3  2  
ATOM 6346  H HZ1  . LYS A 1 58  ? -29.452  -71.886  -18.094  1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 6347  H HZ2  . LYS A 1 58  ? -28.463  -70.562  -18.488  1.00 0.00 ? 53  LYS A HZ2  2  
ATOM 6348  H HZ3  . LYS A 1 58  ? -27.831  -72.139  -18.523  1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 6349  N N    . ILE A 1 59  ? -32.285  -68.816  -22.725  1.00 0.00 ? 54  ILE A N    2  
ATOM 6350  C CA   . ILE A 1 59  ? -31.501  -67.896  -23.598  1.00 0.00 ? 54  ILE A CA   2  
ATOM 6351  C C    . ILE A 1 59  ? -30.010  -67.965  -23.250  1.00 0.00 ? 54  ILE A C    2  
ATOM 6352  O O    . ILE A 1 59  ? -29.634  -68.012  -22.096  1.00 0.00 ? 54  ILE A O    2  
ATOM 6353  C CB   . ILE A 1 59  ? -32.044  -66.476  -23.347  1.00 0.00 ? 54  ILE A CB   2  
ATOM 6354  C CG1  . ILE A 1 59  ? -31.453  -65.900  -22.059  1.00 0.00 ? 54  ILE A CG1  2  
ATOM 6355  C CG2  . ILE A 1 59  ? -33.566  -66.474  -23.235  1.00 0.00 ? 54  ILE A CG2  2  
ATOM 6356  C CD1  . ILE A 1 59  ? -30.220  -65.077  -22.414  1.00 0.00 ? 54  ILE A CD1  2  
ATOM 6357  H H    . ILE A 1 59  ? -32.889  -68.458  -22.042  1.00 0.00 ? 54  ILE A H    2  
ATOM 6358  H HA   . ILE A 1 59  ? -31.651  -68.160  -24.632  1.00 0.00 ? 54  ILE A HA   2  
ATOM 6359  H HB   . ILE A 1 59  ? -31.756  -65.847  -24.176  1.00 0.00 ? 54  ILE A HB   2  
ATOM 6360  H HG12 . ILE A 1 59  ? -32.185  -65.267  -21.576  1.00 0.00 ? 54  ILE A HG12 2  
ATOM 6361  H HG13 . ILE A 1 59  ? -31.174  -66.702  -21.394  1.00 0.00 ? 54  ILE A HG13 2  
ATOM 6362  H HG21 . ILE A 1 59  ? -33.852  -66.580  -22.200  1.00 0.00 ? 54  ILE A HG21 2  
ATOM 6363  H HG22 . ILE A 1 59  ? -33.972  -67.293  -23.810  1.00 0.00 ? 54  ILE A HG22 2  
ATOM 6364  H HG23 . ILE A 1 59  ? -33.947  -65.535  -23.620  1.00 0.00 ? 54  ILE A HG23 2  
ATOM 6365  H HD11 . ILE A 1 59  ? -30.510  -64.051  -22.583  1.00 0.00 ? 54  ILE A HD11 2  
ATOM 6366  H HD12 . ILE A 1 59  ? -29.774  -65.478  -23.313  1.00 0.00 ? 54  ILE A HD12 2  
ATOM 6367  H HD13 . ILE A 1 59  ? -29.508  -65.124  -21.604  1.00 0.00 ? 54  ILE A HD13 2  
ATOM 6368  N N    . LEU A 1 60  ? -29.159  -67.945  -24.239  1.00 0.00 ? 55  LEU A N    2  
ATOM 6369  C CA   . LEU A 1 60  ? -27.699  -67.978  -23.957  1.00 0.00 ? 55  LEU A CA   2  
ATOM 6370  C C    . LEU A 1 60  ? -27.252  -66.571  -23.560  1.00 0.00 ? 55  LEU A C    2  
ATOM 6371  O O    . LEU A 1 60  ? -27.705  -65.585  -24.125  1.00 0.00 ? 55  LEU A O    2  
ATOM 6372  C CB   . LEU A 1 60  ? -27.023  -68.418  -25.262  1.00 0.00 ? 55  LEU A CB   2  
ATOM 6373  C CG   . LEU A 1 60  ? -27.682  -69.696  -25.793  1.00 0.00 ? 55  LEU A CG   2  
ATOM 6374  C CD1  . LEU A 1 60  ? -27.044  -70.077  -27.130  1.00 0.00 ? 55  LEU A CD1  2  
ATOM 6375  C CD2  . LEU A 1 60  ? -27.481  -70.838  -24.789  1.00 0.00 ? 55  LEU A CD2  2  
ATOM 6376  H H    . LEU A 1 60  ? -29.478  -67.889  -25.159  1.00 0.00 ? 55  LEU A H    2  
ATOM 6377  H HA   . LEU A 1 60  ? -27.482  -68.681  -23.168  1.00 0.00 ? 55  LEU A HA   2  
ATOM 6378  H HB2  . LEU A 1 60  ? -27.117  -67.634  -25.998  1.00 0.00 ? 55  LEU A HB2  2  
ATOM 6379  H HB3  . LEU A 1 60  ? -25.977  -68.609  -25.075  1.00 0.00 ? 55  LEU A HB3  2  
ATOM 6380  H HG   . LEU A 1 60  ? -28.739  -69.522  -25.936  1.00 0.00 ? 55  LEU A HG   2  
ATOM 6381  H HD11 . LEU A 1 60  ? -26.238  -70.775  -26.958  1.00 0.00 ? 55  LEU A HD11 2  
ATOM 6382  H HD12 . LEU A 1 60  ? -26.658  -69.191  -27.611  1.00 0.00 ? 55  LEU A HD12 2  
ATOM 6383  H HD13 . LEU A 1 60  ? -27.788  -70.536  -27.765  1.00 0.00 ? 55  LEU A HD13 2  
ATOM 6384  H HD21 . LEU A 1 60  ? -27.028  -70.452  -23.887  1.00 0.00 ? 55  LEU A HD21 2  
ATOM 6385  H HD22 . LEU A 1 60  ? -26.838  -71.590  -25.221  1.00 0.00 ? 55  LEU A HD22 2  
ATOM 6386  H HD23 . LEU A 1 60  ? -28.438  -71.278  -24.550  1.00 0.00 ? 55  LEU A HD23 2  
ATOM 6387  N N    . SER A 1 61  ? -26.389  -66.472  -22.582  1.00 0.00 ? 56  SER A N    2  
ATOM 6388  C CA   . SER A 1 61  ? -25.919  -65.136  -22.117  1.00 0.00 ? 56  SER A CA   2  
ATOM 6389  C C    . SER A 1 61  ? -25.026  -64.477  -23.166  1.00 0.00 ? 56  SER A C    2  
ATOM 6390  O O    . SER A 1 61  ? -24.834  -64.992  -24.250  1.00 0.00 ? 56  SER A O    2  
ATOM 6391  C CB   . SER A 1 61  ? -25.123  -65.418  -20.843  1.00 0.00 ? 56  SER A CB   2  
ATOM 6392  O OG   . SER A 1 61  ? -24.847  -64.191  -20.180  1.00 0.00 ? 56  SER A OG   2  
ATOM 6393  H H    . SER A 1 61  ? -26.059  -67.282  -22.142  1.00 0.00 ? 56  SER A H    2  
ATOM 6394  H HA   . SER A 1 61  ? -26.758  -64.503  -21.888  1.00 0.00 ? 56  SER A HA   2  
ATOM 6395  H HB2  . SER A 1 61  ? -25.698  -66.053  -20.190  1.00 0.00 ? 56  SER A HB2  2  
ATOM 6396  H HB3  . SER A 1 61  ? -24.197  -65.916  -21.102  1.00 0.00 ? 56  SER A HB3  2  
ATOM 6397  H HG   . SER A 1 61  ? -25.683  -63.749  -20.014  1.00 0.00 ? 56  SER A HG   2  
ATOM 6398  N N    . ASP A 1 62  ? -24.480  -63.338  -22.843  1.00 0.00 ? 57  ASP A N    2  
ATOM 6399  C CA   . ASP A 1 62  ? -23.594  -62.627  -23.808  1.00 0.00 ? 57  ASP A CA   2  
ATOM 6400  C C    . ASP A 1 62  ? -22.154  -62.587  -23.283  1.00 0.00 ? 57  ASP A C    2  
ATOM 6401  O O    . ASP A 1 62  ? -21.339  -61.812  -23.744  1.00 0.00 ? 57  ASP A O    2  
ATOM 6402  C CB   . ASP A 1 62  ? -24.172  -61.214  -23.916  1.00 0.00 ? 57  ASP A CB   2  
ATOM 6403  C CG   . ASP A 1 62  ? -24.190  -60.556  -22.534  1.00 0.00 ? 57  ASP A CG   2  
ATOM 6404  O OD1  . ASP A 1 62  ? -23.154  -60.061  -22.122  1.00 0.00 ? 57  ASP A OD1  2  
ATOM 6405  O OD2  . ASP A 1 62  ? -25.240  -60.559  -21.912  1.00 0.00 ? 57  ASP A OD2  2  
ATOM 6406  H H    . ASP A 1 62  ? -24.653  -62.950  -21.961  1.00 0.00 ? 57  ASP A H    2  
ATOM 6407  H HA   . ASP A 1 62  ? -23.627  -63.109  -24.769  1.00 0.00 ? 57  ASP A HA   2  
ATOM 6408  H HB2  . ASP A 1 62  ? -23.563  -60.626  -24.587  1.00 0.00 ? 57  ASP A HB2  2  
ATOM 6409  H HB3  . ASP A 1 62  ? -25.181  -61.267  -24.299  1.00 0.00 ? 57  ASP A HB3  2  
ATOM 6410  N N    . ASP A 1 63  ? -21.834  -63.421  -22.328  1.00 0.00 ? 58  ASP A N    2  
ATOM 6411  C CA   . ASP A 1 63  ? -20.446  -63.435  -21.780  1.00 0.00 ? 58  ASP A CA   2  
ATOM 6412  C C    . ASP A 1 63  ? -19.743  -64.750  -22.143  1.00 0.00 ? 58  ASP A C    2  
ATOM 6413  O O    . ASP A 1 63  ? -18.654  -65.028  -21.682  1.00 0.00 ? 58  ASP A O    2  
ATOM 6414  C CB   . ASP A 1 63  ? -20.616  -63.319  -20.265  1.00 0.00 ? 58  ASP A CB   2  
ATOM 6415  C CG   . ASP A 1 63  ? -19.270  -62.973  -19.624  1.00 0.00 ? 58  ASP A CG   2  
ATOM 6416  O OD1  . ASP A 1 63  ? -18.782  -61.883  -19.870  1.00 0.00 ? 58  ASP A OD1  2  
ATOM 6417  O OD2  . ASP A 1 63  ? -18.751  -63.805  -18.898  1.00 0.00 ? 58  ASP A OD2  2  
ATOM 6418  H H    . ASP A 1 63  ? -22.504  -64.041  -21.974  1.00 0.00 ? 58  ASP A H    2  
ATOM 6419  H HA   . ASP A 1 63  ? -19.885  -62.593  -22.153  1.00 0.00 ? 58  ASP A HA   2  
ATOM 6420  H HB2  . ASP A 1 63  ? -21.332  -62.541  -20.042  1.00 0.00 ? 58  ASP A HB2  2  
ATOM 6421  H HB3  . ASP A 1 63  ? -20.970  -64.259  -19.869  1.00 0.00 ? 58  ASP A HB3  2  
ATOM 6422  N N    . VAL A 1 64  ? -20.359  -65.559  -22.966  1.00 0.00 ? 59  VAL A N    2  
ATOM 6423  C CA   . VAL A 1 64  ? -19.730  -66.853  -23.360  1.00 0.00 ? 59  VAL A CA   2  
ATOM 6424  C C    . VAL A 1 64  ? -19.536  -66.883  -24.882  1.00 0.00 ? 59  VAL A C    2  
ATOM 6425  O O    . VAL A 1 64  ? -20.357  -66.370  -25.609  1.00 0.00 ? 59  VAL A O    2  
ATOM 6426  C CB   . VAL A 1 64  ? -20.732  -67.927  -22.920  1.00 0.00 ? 59  VAL A CB   2  
ATOM 6427  C CG1  . VAL A 1 64  ? -20.085  -69.309  -23.021  1.00 0.00 ? 59  VAL A CG1  2  
ATOM 6428  C CG2  . VAL A 1 64  ? -21.161  -67.674  -21.470  1.00 0.00 ? 59  VAL A CG2  2  
ATOM 6429  H H    . VAL A 1 64  ? -21.237  -65.318  -23.328  1.00 0.00 ? 59  VAL A H    2  
ATOM 6430  H HA   . VAL A 1 64  ? -18.789  -66.990  -22.850  1.00 0.00 ? 59  VAL A HA   2  
ATOM 6431  H HB   . VAL A 1 64  ? -21.599  -67.890  -23.564  1.00 0.00 ? 59  VAL A HB   2  
ATOM 6432  H HG11 . VAL A 1 64  ? -19.830  -69.513  -24.051  1.00 0.00 ? 59  VAL A HG11 2  
ATOM 6433  H HG12 . VAL A 1 64  ? -20.778  -70.057  -22.667  1.00 0.00 ? 59  VAL A HG12 2  
ATOM 6434  H HG13 . VAL A 1 64  ? -19.190  -69.332  -22.418  1.00 0.00 ? 59  VAL A HG13 2  
ATOM 6435  H HG21 . VAL A 1 64  ? -22.007  -66.999  -21.457  1.00 0.00 ? 59  VAL A HG21 2  
ATOM 6436  H HG22 . VAL A 1 64  ? -20.341  -67.234  -20.923  1.00 0.00 ? 59  VAL A HG22 2  
ATOM 6437  H HG23 . VAL A 1 64  ? -21.441  -68.610  -21.009  1.00 0.00 ? 59  VAL A HG23 2  
ATOM 6438  N N    . PRO A 1 65  ? -18.455  -67.477  -25.321  1.00 0.00 ? 60  PRO A N    2  
ATOM 6439  C CA   . PRO A 1 65  ? -18.176  -67.551  -26.780  1.00 0.00 ? 60  PRO A CA   2  
ATOM 6440  C C    . PRO A 1 65  ? -19.170  -68.486  -27.474  1.00 0.00 ? 60  PRO A C    2  
ATOM 6441  O O    . PRO A 1 65  ? -19.546  -69.511  -26.942  1.00 0.00 ? 60  PRO A O    2  
ATOM 6442  C CB   . PRO A 1 65  ? -16.756  -68.107  -26.846  1.00 0.00 ? 60  PRO A CB   2  
ATOM 6443  C CG   . PRO A 1 65  ? -16.574  -68.847  -25.560  1.00 0.00 ? 60  PRO A CG   2  
ATOM 6444  C CD   . PRO A 1 65  ? -17.403  -68.129  -24.528  1.00 0.00 ? 60  PRO A CD   2  
ATOM 6445  H HA   . PRO A 1 65  ? -18.209  -66.571  -27.223  1.00 0.00 ? 60  PRO A HA   2  
ATOM 6446  H HB2  . PRO A 1 65  ? -16.654  -68.778  -27.688  1.00 0.00 ? 60  PRO A HB2  2  
ATOM 6447  H HB3  . PRO A 1 65  ? -16.039  -67.304  -26.914  1.00 0.00 ? 60  PRO A HB3  2  
ATOM 6448  H HG2  . PRO A 1 65  ? -16.916  -69.867  -25.671  1.00 0.00 ? 60  PRO A HG2  2  
ATOM 6449  H HG3  . PRO A 1 65  ? -15.536  -68.832  -25.267  1.00 0.00 ? 60  PRO A HG3  2  
ATOM 6450  H HD2  . PRO A 1 65  ? -17.830  -68.835  -23.829  1.00 0.00 ? 60  PRO A HD2  2  
ATOM 6451  H HD3  . PRO A 1 65  ? -16.813  -67.389  -24.013  1.00 0.00 ? 60  PRO A HD3  2  
ATOM 6452  N N    . ILE A 1 66  ? -19.598  -68.136  -28.663  1.00 0.00 ? 61  ILE A N    2  
ATOM 6453  C CA   . ILE A 1 66  ? -20.569  -69.003  -29.397  1.00 0.00 ? 61  ILE A CA   2  
ATOM 6454  C C    . ILE A 1 66  ? -20.044  -70.441  -29.451  1.00 0.00 ? 61  ILE A C    2  
ATOM 6455  O O    . ILE A 1 66  ? -18.878  -70.687  -29.213  1.00 0.00 ? 61  ILE A O    2  
ATOM 6456  C CB   . ILE A 1 66  ? -20.677  -68.392  -30.801  1.00 0.00 ? 61  ILE A CB   2  
ATOM 6457  C CG1  . ILE A 1 66  ? -21.700  -69.174  -31.628  1.00 0.00 ? 61  ILE A CG1  2  
ATOM 6458  C CG2  . ILE A 1 66  ? -19.319  -68.438  -31.501  1.00 0.00 ? 61  ILE A CG2  2  
ATOM 6459  C CD1  . ILE A 1 66  ? -23.077  -69.058  -30.977  1.00 0.00 ? 61  ILE A CD1  2  
ATOM 6460  H H    . ILE A 1 66  ? -19.280  -67.303  -29.071  1.00 0.00 ? 61  ILE A H    2  
ATOM 6461  H HA   . ILE A 1 66  ? -21.532  -68.976  -28.910  1.00 0.00 ? 61  ILE A HA   2  
ATOM 6462  H HB   . ILE A 1 66  ? -20.997  -67.363  -30.716  1.00 0.00 ? 61  ILE A HB   2  
ATOM 6463  H HG12 . ILE A 1 66  ? -21.739  -68.765  -32.628  1.00 0.00 ? 61  ILE A HG12 2  
ATOM 6464  H HG13 . ILE A 1 66  ? -21.410  -70.212  -31.674  1.00 0.00 ? 61  ILE A HG13 2  
ATOM 6465  H HG21 . ILE A 1 66  ? -19.197  -67.547  -32.103  1.00 0.00 ? 61  ILE A HG21 2  
ATOM 6466  H HG22 . ILE A 1 66  ? -19.270  -69.312  -32.137  1.00 0.00 ? 61  ILE A HG22 2  
ATOM 6467  H HG23 . ILE A 1 66  ? -18.534  -68.486  -30.763  1.00 0.00 ? 61  ILE A HG23 2  
ATOM 6468  H HD11 . ILE A 1 66  ? -23.317  -68.016  -30.826  1.00 0.00 ? 61  ILE A HD11 2  
ATOM 6469  H HD12 . ILE A 1 66  ? -23.068  -69.568  -30.025  1.00 0.00 ? 61  ILE A HD12 2  
ATOM 6470  H HD13 . ILE A 1 66  ? -23.818  -69.508  -31.621  1.00 0.00 ? 61  ILE A HD13 2  
ATOM 6471  N N    . ARG A 1 67  ? -20.903  -71.390  -29.736  1.00 0.00 ? 62  ARG A N    2  
ATOM 6472  C CA   . ARG A 1 67  ? -20.481  -72.832  -29.786  1.00 0.00 ? 62  ARG A CA   2  
ATOM 6473  C C    . ARG A 1 67  ? -20.354  -73.401  -28.367  1.00 0.00 ? 62  ARG A C    2  
ATOM 6474  O O    . ARG A 1 67  ? -20.656  -74.554  -28.127  1.00 0.00 ? 62  ARG A O    2  
ATOM 6475  C CB   . ARG A 1 67  ? -19.129  -72.867  -30.507  1.00 0.00 ? 62  ARG A CB   2  
ATOM 6476  C CG   . ARG A 1 67  ? -18.982  -74.197  -31.249  1.00 0.00 ? 62  ARG A CG   2  
ATOM 6477  C CD   . ARG A 1 67  ? -17.873  -74.076  -32.294  1.00 0.00 ? 62  ARG A CD   2  
ATOM 6478  N NE   . ARG A 1 67  ? -18.050  -75.259  -33.181  1.00 0.00 ? 62  ARG A NE   2  
ATOM 6479  C CZ   . ARG A 1 67  ? -17.018  -75.984  -33.517  1.00 0.00 ? 62  ARG A CZ   2  
ATOM 6480  N NH1  . ARG A 1 67  ? -16.205  -76.427  -32.598  1.00 0.00 ? 62  ARG A NH1  2  
ATOM 6481  N NH2  . ARG A 1 67  ? -16.799  -76.265  -34.773  1.00 0.00 ? 62  ARG A NH2  2  
ATOM 6482  H H    . ARG A 1 67  ? -21.840  -71.157  -29.903  1.00 0.00 ? 62  ARG A H    2  
ATOM 6483  H HA   . ARG A 1 67  ? -21.205  -73.404  -30.346  1.00 0.00 ? 62  ARG A HA   2  
ATOM 6484  H HB2  . ARG A 1 67  ? -19.075  -72.052  -31.213  1.00 0.00 ? 62  ARG A HB2  2  
ATOM 6485  H HB3  . ARG A 1 67  ? -18.333  -72.772  -29.784  1.00 0.00 ? 62  ARG A HB3  2  
ATOM 6486  H HG2  . ARG A 1 67  ? -18.731  -74.976  -30.544  1.00 0.00 ? 62  ARG A HG2  2  
ATOM 6487  H HG3  . ARG A 1 67  ? -19.912  -74.440  -31.740  1.00 0.00 ? 62  ARG A HG3  2  
ATOM 6488  H HD2  . ARG A 1 67  ? -17.989  -73.160  -32.856  1.00 0.00 ? 62  ARG A HD2  2  
ATOM 6489  H HD3  . ARG A 1 67  ? -16.904  -74.110  -31.821  1.00 0.00 ? 62  ARG A HD3  2  
ATOM 6490  H HE   . ARG A 1 67  ? -18.942  -75.494  -33.513  1.00 0.00 ? 62  ARG A HE   2  
ATOM 6491  H HH11 . ARG A 1 67  ? -16.372  -76.212  -31.636  1.00 0.00 ? 62  ARG A HH11 2  
ATOM 6492  H HH12 . ARG A 1 67  ? -15.414  -76.982  -32.856  1.00 0.00 ? 62  ARG A HH12 2  
ATOM 6493  H HH21 . ARG A 1 67  ? -17.422  -75.926  -35.477  1.00 0.00 ? 62  ARG A HH21 2  
ATOM 6494  H HH22 . ARG A 1 67  ? -16.008  -76.821  -35.030  1.00 0.00 ? 62  ARG A HH22 2  
ATOM 6495  N N    . ASP A 1 68  ? -19.918  -72.606  -27.421  1.00 0.00 ? 63  ASP A N    2  
ATOM 6496  C CA   . ASP A 1 68  ? -19.784  -73.109  -26.019  1.00 0.00 ? 63  ASP A CA   2  
ATOM 6497  C C    . ASP A 1 68  ? -21.123  -73.669  -25.527  1.00 0.00 ? 63  ASP A C    2  
ATOM 6498  O O    . ASP A 1 68  ? -21.172  -74.493  -24.635  1.00 0.00 ? 63  ASP A O    2  
ATOM 6499  C CB   . ASP A 1 68  ? -19.380  -71.886  -25.194  1.00 0.00 ? 63  ASP A CB   2  
ATOM 6500  C CG   . ASP A 1 68  ? -18.644  -72.343  -23.934  1.00 0.00 ? 63  ASP A CG   2  
ATOM 6501  O OD1  . ASP A 1 68  ? -19.261  -73.010  -23.120  1.00 0.00 ? 63  ASP A OD1  2  
ATOM 6502  O OD2  . ASP A 1 68  ? -17.475  -72.019  -23.804  1.00 0.00 ? 63  ASP A OD2  2  
ATOM 6503  H H    . ASP A 1 68  ? -19.683  -71.682  -27.629  1.00 0.00 ? 63  ASP A H    2  
ATOM 6504  H HA   . ASP A 1 68  ? -19.015  -73.863  -25.961  1.00 0.00 ? 63  ASP A HA   2  
ATOM 6505  H HB2  . ASP A 1 68  ? -18.731  -71.253  -25.783  1.00 0.00 ? 63  ASP A HB2  2  
ATOM 6506  H HB3  . ASP A 1 68  ? -20.263  -71.333  -24.912  1.00 0.00 ? 63  ASP A HB3  2  
ATOM 6507  N N    . TYR A 1 69  ? -22.207  -73.239  -26.117  1.00 0.00 ? 64  TYR A N    2  
ATOM 6508  C CA   . TYR A 1 69  ? -23.543  -73.752  -25.707  1.00 0.00 ? 64  TYR A CA   2  
ATOM 6509  C C    . TYR A 1 69  ? -23.881  -74.993  -26.533  1.00 0.00 ? 64  TYR A C    2  
ATOM 6510  O O    . TYR A 1 69  ? -24.886  -75.641  -26.316  1.00 0.00 ? 64  TYR A O    2  
ATOM 6511  C CB   . TYR A 1 69  ? -24.520  -72.619  -26.017  1.00 0.00 ? 64  TYR A CB   2  
ATOM 6512  C CG   . TYR A 1 69  ? -24.281  -71.474  -25.063  1.00 0.00 ? 64  TYR A CG   2  
ATOM 6513  C CD1  . TYR A 1 69  ? -24.727  -71.561  -23.739  1.00 0.00 ? 64  TYR A CD1  2  
ATOM 6514  C CD2  . TYR A 1 69  ? -23.615  -70.325  -25.504  1.00 0.00 ? 64  TYR A CD2  2  
ATOM 6515  C CE1  . TYR A 1 69  ? -24.506  -70.498  -22.856  1.00 0.00 ? 64  TYR A CE1  2  
ATOM 6516  C CE2  . TYR A 1 69  ? -23.395  -69.264  -24.621  1.00 0.00 ? 64  TYR A CE2  2  
ATOM 6517  C CZ   . TYR A 1 69  ? -23.840  -69.349  -23.297  1.00 0.00 ? 64  TYR A CZ   2  
ATOM 6518  O OH   . TYR A 1 69  ? -23.623  -68.300  -22.428  1.00 0.00 ? 64  TYR A OH   2  
ATOM 6519  H H    . TYR A 1 69  ? -22.142  -72.591  -26.842  1.00 0.00 ? 64  TYR A H    2  
ATOM 6520  H HA   . TYR A 1 69  ? -23.557  -73.980  -24.653  1.00 0.00 ? 64  TYR A HA   2  
ATOM 6521  H HB2  . TYR A 1 69  ? -24.368  -72.280  -27.032  1.00 0.00 ? 64  TYR A HB2  2  
ATOM 6522  H HB3  . TYR A 1 69  ? -25.532  -72.975  -25.904  1.00 0.00 ? 64  TYR A HB3  2  
ATOM 6523  H HD1  . TYR A 1 69  ? -25.241  -72.448  -23.399  1.00 0.00 ? 64  TYR A HD1  2  
ATOM 6524  H HD2  . TYR A 1 69  ? -23.270  -70.259  -26.525  1.00 0.00 ? 64  TYR A HD2  2  
ATOM 6525  H HE1  . TYR A 1 69  ? -24.849  -70.565  -21.834  1.00 0.00 ? 64  TYR A HE1  2  
ATOM 6526  H HE2  . TYR A 1 69  ? -22.881  -68.379  -24.963  1.00 0.00 ? 64  TYR A HE2  2  
ATOM 6527  H HH   . TYR A 1 69  ? -24.376  -68.243  -21.836  1.00 0.00 ? 64  TYR A HH   2  
ATOM 6528  N N    . ARG A 1 70  ? -23.035  -75.328  -27.477  1.00 0.00 ? 65  ARG A N    2  
ATOM 6529  C CA   . ARG A 1 70  ? -23.274  -76.529  -28.328  1.00 0.00 ? 65  ARG A CA   2  
ATOM 6530  C C    . ARG A 1 70  ? -24.491  -76.320  -29.232  1.00 0.00 ? 65  ARG A C    2  
ATOM 6531  O O    . ARG A 1 70  ? -25.257  -77.232  -29.476  1.00 0.00 ? 65  ARG A O    2  
ATOM 6532  C CB   . ARG A 1 70  ? -23.514  -77.667  -27.338  1.00 0.00 ? 65  ARG A CB   2  
ATOM 6533  C CG   . ARG A 1 70  ? -22.867  -78.952  -27.859  1.00 0.00 ? 65  ARG A CG   2  
ATOM 6534  C CD   . ARG A 1 70  ? -22.446  -79.827  -26.675  1.00 0.00 ? 65  ARG A CD   2  
ATOM 6535  N NE   . ARG A 1 70  ? -23.696  -80.507  -26.235  1.00 0.00 ? 65  ARG A NE   2  
ATOM 6536  C CZ   . ARG A 1 70  ? -23.956  -80.636  -24.962  1.00 0.00 ? 65  ARG A CZ   2  
ATOM 6537  N NH1  . ARG A 1 70  ? -24.397  -79.615  -24.278  1.00 0.00 ? 65  ARG A NH1  2  
ATOM 6538  N NH2  . ARG A 1 70  ? -23.775  -81.786  -24.373  1.00 0.00 ? 65  ARG A NH2  2  
ATOM 6539  H H    . ARG A 1 70  ? -22.233  -74.787  -27.623  1.00 0.00 ? 65  ARG A H    2  
ATOM 6540  H HA   . ARG A 1 70  ? -22.401  -76.743  -28.923  1.00 0.00 ? 65  ARG A HA   2  
ATOM 6541  H HB2  . ARG A 1 70  ? -23.077  -77.400  -26.385  1.00 0.00 ? 65  ARG A HB2  2  
ATOM 6542  H HB3  . ARG A 1 70  ? -24.575  -77.820  -27.217  1.00 0.00 ? 65  ARG A HB3  2  
ATOM 6543  H HG2  . ARG A 1 70  ? -23.576  -79.490  -28.471  1.00 0.00 ? 65  ARG A HG2  2  
ATOM 6544  H HG3  . ARG A 1 70  ? -21.997  -78.705  -28.448  1.00 0.00 ? 65  ARG A HG3  2  
ATOM 6545  H HD2  . ARG A 1 70  ? -21.710  -80.555  -26.990  1.00 0.00 ? 65  ARG A HD2  2  
ATOM 6546  H HD3  . ARG A 1 70  ? -22.055  -79.217  -25.876  1.00 0.00 ? 65  ARG A HD3  2  
ATOM 6547  H HE   . ARG A 1 70  ? -24.324  -80.857  -26.901  1.00 0.00 ? 65  ARG A HE   2  
ATOM 6548  H HH11 . ARG A 1 70  ? -24.536  -78.734  -24.729  1.00 0.00 ? 65  ARG A HH11 2  
ATOM 6549  H HH12 . ARG A 1 70  ? -24.595  -79.715  -23.303  1.00 0.00 ? 65  ARG A HH12 2  
ATOM 6550  H HH21 . ARG A 1 70  ? -23.439  -82.569  -24.897  1.00 0.00 ? 65  ARG A HH21 2  
ATOM 6551  H HH22 . ARG A 1 70  ? -23.974  -81.885  -23.398  1.00 0.00 ? 65  ARG A HH22 2  
ATOM 6552  N N    . ILE A 1 71  ? -24.668  -75.128  -29.744  1.00 0.00 ? 66  ILE A N    2  
ATOM 6553  C CA   . ILE A 1 71  ? -25.821  -74.867  -30.643  1.00 0.00 ? 66  ILE A CA   2  
ATOM 6554  C C    . ILE A 1 71  ? -25.720  -75.766  -31.874  1.00 0.00 ? 66  ILE A C    2  
ATOM 6555  O O    . ILE A 1 71  ? -24.711  -76.403  -32.109  1.00 0.00 ? 66  ILE A O    2  
ATOM 6556  C CB   . ILE A 1 71  ? -25.702  -73.392  -31.039  1.00 0.00 ? 66  ILE A CB   2  
ATOM 6557  C CG1  . ILE A 1 71  ? -25.797  -72.517  -29.785  1.00 0.00 ? 66  ILE A CG1  2  
ATOM 6558  C CG2  . ILE A 1 71  ? -26.836  -73.023  -32.000  1.00 0.00 ? 66  ILE A CG2  2  
ATOM 6559  C CD1  . ILE A 1 71  ? -25.584  -71.051  -30.167  1.00 0.00 ? 66  ILE A CD1  2  
ATOM 6560  H H    . ILE A 1 71  ? -24.039  -74.412  -29.547  1.00 0.00 ? 66  ILE A H    2  
ATOM 6561  H HA   . ILE A 1 71  ? -26.749  -75.038  -30.125  1.00 0.00 ? 66  ILE A HA   2  
ATOM 6562  H HB   . ILE A 1 71  ? -24.751  -73.226  -31.524  1.00 0.00 ? 66  ILE A HB   2  
ATOM 6563  H HG12 . ILE A 1 71  ? -26.773  -72.636  -29.337  1.00 0.00 ? 66  ILE A HG12 2  
ATOM 6564  H HG13 . ILE A 1 71  ? -25.038  -72.816  -29.078  1.00 0.00 ? 66  ILE A HG13 2  
ATOM 6565  H HG21 . ILE A 1 71  ? -26.929  -71.948  -32.052  1.00 0.00 ? 66  ILE A HG21 2  
ATOM 6566  H HG22 . ILE A 1 71  ? -27.763  -73.447  -31.643  1.00 0.00 ? 66  ILE A HG22 2  
ATOM 6567  H HG23 . ILE A 1 71  ? -26.616  -73.413  -32.983  1.00 0.00 ? 66  ILE A HG23 2  
ATOM 6568  H HD11 . ILE A 1 71  ? -25.008  -70.559  -29.398  1.00 0.00 ? 66  ILE A HD11 2  
ATOM 6569  H HD12 . ILE A 1 71  ? -26.542  -70.564  -30.268  1.00 0.00 ? 66  ILE A HD12 2  
ATOM 6570  H HD13 . ILE A 1 71  ? -25.053  -70.998  -31.106  1.00 0.00 ? 66  ILE A HD13 2  
ATOM 6571  N N    . ASP A 1 72  ? -26.755  -75.823  -32.654  1.00 0.00 ? 67  ASP A N    2  
ATOM 6572  C CA   . ASP A 1 72  ? -26.726  -76.685  -33.871  1.00 0.00 ? 67  ASP A CA   2  
ATOM 6573  C C    . ASP A 1 72  ? -27.303  -75.932  -35.071  1.00 0.00 ? 67  ASP A C    2  
ATOM 6574  O O    . ASP A 1 72  ? -28.481  -75.637  -35.121  1.00 0.00 ? 67  ASP A O    2  
ATOM 6575  C CB   . ASP A 1 72  ? -27.602  -77.889  -33.523  1.00 0.00 ? 67  ASP A CB   2  
ATOM 6576  C CG   . ASP A 1 72  ? -26.715  -79.073  -33.132  1.00 0.00 ? 67  ASP A CG   2  
ATOM 6577  O OD1  . ASP A 1 72  ? -25.730  -78.849  -32.448  1.00 0.00 ? 67  ASP A OD1  2  
ATOM 6578  O OD2  . ASP A 1 72  ? -27.036  -80.183  -33.524  1.00 0.00 ? 67  ASP A OD2  2  
ATOM 6579  H H    . ASP A 1 72  ? -27.553  -75.302  -32.437  1.00 0.00 ? 67  ASP A H    2  
ATOM 6580  H HA   . ASP A 1 72  ? -25.719  -77.010  -34.078  1.00 0.00 ? 67  ASP A HA   2  
ATOM 6581  H HB2  . ASP A 1 72  ? -28.250  -77.635  -32.696  1.00 0.00 ? 67  ASP A HB2  2  
ATOM 6582  H HB3  . ASP A 1 72  ? -28.201  -78.158  -34.379  1.00 0.00 ? 67  ASP A HB3  2  
ATOM 6583  N N    . GLU A 1 73  ? -26.483  -75.624  -36.042  1.00 0.00 ? 68  GLU A N    2  
ATOM 6584  C CA   . GLU A 1 73  ? -26.989  -74.896  -37.245  1.00 0.00 ? 68  GLU A CA   2  
ATOM 6585  C C    . GLU A 1 73  ? -28.163  -75.663  -37.860  1.00 0.00 ? 68  GLU A C    2  
ATOM 6586  O O    . GLU A 1 73  ? -29.013  -75.095  -38.518  1.00 0.00 ? 68  GLU A O    2  
ATOM 6587  C CB   . GLU A 1 73  ? -25.810  -74.853  -38.219  1.00 0.00 ? 68  GLU A CB   2  
ATOM 6588  C CG   . GLU A 1 73  ? -24.608  -74.177  -37.551  1.00 0.00 ? 68  GLU A CG   2  
ATOM 6589  C CD   . GLU A 1 73  ? -23.461  -75.182  -37.423  1.00 0.00 ? 68  GLU A CD   2  
ATOM 6590  O OE1  . GLU A 1 73  ? -22.994  -75.652  -38.448  1.00 0.00 ? 68  GLU A OE1  2  
ATOM 6591  O OE2  . GLU A 1 73  ? -23.069  -75.465  -36.303  1.00 0.00 ? 68  GLU A OE2  2  
ATOM 6592  H H    . GLU A 1 73  ? -25.538  -75.877  -35.983  1.00 0.00 ? 68  GLU A H    2  
ATOM 6593  H HA   . GLU A 1 73  ? -27.289  -73.894  -36.981  1.00 0.00 ? 68  GLU A HA   2  
ATOM 6594  H HB2  . GLU A 1 73  ? -25.547  -75.860  -38.507  1.00 0.00 ? 68  GLU A HB2  2  
ATOM 6595  H HB3  . GLU A 1 73  ? -26.092  -74.291  -39.097  1.00 0.00 ? 68  GLU A HB3  2  
ATOM 6596  H HG2  . GLU A 1 73  ? -24.287  -73.339  -38.152  1.00 0.00 ? 68  GLU A HG2  2  
ATOM 6597  H HG3  . GLU A 1 73  ? -24.889  -73.828  -36.568  1.00 0.00 ? 68  GLU A HG3  2  
ATOM 6598  N N    . LYS A 1 74  ? -28.218  -76.951  -37.640  1.00 0.00 ? 69  LYS A N    2  
ATOM 6599  C CA   . LYS A 1 74  ? -29.340  -77.757  -38.200  1.00 0.00 ? 69  LYS A CA   2  
ATOM 6600  C C    . LYS A 1 74  ? -30.661  -77.298  -37.581  1.00 0.00 ? 69  LYS A C    2  
ATOM 6601  O O    . LYS A 1 74  ? -31.721  -77.478  -38.148  1.00 0.00 ? 69  LYS A O    2  
ATOM 6602  C CB   . LYS A 1 74  ? -29.031  -79.202  -37.807  1.00 0.00 ? 69  LYS A CB   2  
ATOM 6603  C CG   . LYS A 1 74  ? -27.815  -79.696  -38.594  1.00 0.00 ? 69  LYS A CG   2  
ATOM 6604  C CD   . LYS A 1 74  ? -27.834  -81.224  -38.662  1.00 0.00 ? 69  LYS A CD   2  
ATOM 6605  C CE   . LYS A 1 74  ? -27.020  -81.691  -39.870  1.00 0.00 ? 69  LYS A CE   2  
ATOM 6606  N NZ   . LYS A 1 74  ? -26.336  -82.932  -39.413  1.00 0.00 ? 69  LYS A NZ   2  
ATOM 6607  H H    . LYS A 1 74  ? -27.527  -77.384  -37.099  1.00 0.00 ? 69  LYS A H    2  
ATOM 6608  H HA   . LYS A 1 74  ? -29.373  -77.664  -39.275  1.00 0.00 ? 69  LYS A HA   2  
ATOM 6609  H HB2  . LYS A 1 74  ? -28.819  -79.249  -36.748  1.00 0.00 ? 69  LYS A HB2  2  
ATOM 6610  H HB3  . LYS A 1 74  ? -29.882  -79.827  -38.032  1.00 0.00 ? 69  LYS A HB3  2  
ATOM 6611  H HG2  . LYS A 1 74  ? -27.847  -79.290  -39.595  1.00 0.00 ? 69  LYS A HG2  2  
ATOM 6612  H HG3  . LYS A 1 74  ? -26.911  -79.370  -38.102  1.00 0.00 ? 69  LYS A HG3  2  
ATOM 6613  H HD2  . LYS A 1 74  ? -27.404  -81.629  -37.757  1.00 0.00 ? 69  LYS A HD2  2  
ATOM 6614  H HD3  . LYS A 1 74  ? -28.853  -81.567  -38.762  1.00 0.00 ? 69  LYS A HD3  2  
ATOM 6615  H HE2  . LYS A 1 74  ? -27.675  -81.904  -40.704  1.00 0.00 ? 69  LYS A HE2  2  
ATOM 6616  H HE3  . LYS A 1 74  ? -26.289  -80.946  -40.143  1.00 0.00 ? 69  LYS A HE3  2  
ATOM 6617  H HZ1  . LYS A 1 74  ? -25.775  -83.327  -40.194  1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 6618  H HZ2  . LYS A 1 74  ? -27.048  -83.628  -39.110  1.00 0.00 ? 69  LYS A HZ2  2  
ATOM 6619  H HZ3  . LYS A 1 74  ? -25.707  -82.709  -38.617  1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 6620  N N    . ASN A 1 75  ? -30.601  -76.694  -36.423  1.00 0.00 ? 70  ASN A N    2  
ATOM 6621  C CA   . ASN A 1 75  ? -31.842  -76.208  -35.766  1.00 0.00 ? 70  ASN A CA   2  
ATOM 6622  C C    . ASN A 1 75  ? -31.862  -74.679  -35.808  1.00 0.00 ? 70  ASN A C    2  
ATOM 6623  O O    . ASN A 1 75  ? -30.830  -74.038  -35.835  1.00 0.00 ? 70  ASN A O    2  
ATOM 6624  C CB   . ASN A 1 75  ? -31.751  -76.725  -34.324  1.00 0.00 ? 70  ASN A CB   2  
ATOM 6625  C CG   . ASN A 1 75  ? -32.706  -75.938  -33.422  1.00 0.00 ? 70  ASN A CG   2  
ATOM 6626  O OD1  . ASN A 1 75  ? -33.792  -76.391  -33.121  1.00 0.00 ? 70  ASN A OD1  2  
ATOM 6627  N ND2  . ASN A 1 75  ? -32.339  -74.768  -32.976  1.00 0.00 ? 70  ASN A ND2  2  
ATOM 6628  H H    . ASN A 1 75  ? -29.735  -76.549  -35.987  1.00 0.00 ? 70  ASN A H    2  
ATOM 6629  H HA   . ASN A 1 75  ? -32.714  -76.614  -36.254  1.00 0.00 ? 70  ASN A HA   2  
ATOM 6630  H HB2  . ASN A 1 75  ? -32.018  -77.772  -34.302  1.00 0.00 ? 70  ASN A HB2  2  
ATOM 6631  H HB3  . ASN A 1 75  ? -30.740  -76.606  -33.964  1.00 0.00 ? 70  ASN A HB3  2  
ATOM 6632  H HD21 . ASN A 1 75  ? -31.462  -74.404  -33.220  1.00 0.00 ? 70  ASN A HD21 2  
ATOM 6633  H HD22 . ASN A 1 75  ? -32.940  -74.253  -32.398  1.00 0.00 ? 70  ASN A HD22 2  
ATOM 6634  N N    . PHE A 1 76  ? -33.024  -74.092  -35.816  1.00 0.00 ? 71  PHE A N    2  
ATOM 6635  C CA   . PHE A 1 76  ? -33.101  -72.605  -35.859  1.00 0.00 ? 71  PHE A CA   2  
ATOM 6636  C C    . PHE A 1 76  ? -33.158  -72.043  -34.437  1.00 0.00 ? 71  PHE A C    2  
ATOM 6637  O O    . PHE A 1 76  ? -33.906  -72.511  -33.601  1.00 0.00 ? 71  PHE A O    2  
ATOM 6638  C CB   . PHE A 1 76  ? -34.384  -72.286  -36.635  1.00 0.00 ? 71  PHE A CB   2  
ATOM 6639  C CG   . PHE A 1 76  ? -35.591  -72.782  -35.873  1.00 0.00 ? 71  PHE A CG   2  
ATOM 6640  C CD1  . PHE A 1 76  ? -36.218  -71.949  -34.940  1.00 0.00 ? 71  PHE A CD1  2  
ATOM 6641  C CD2  . PHE A 1 76  ? -36.086  -74.071  -36.104  1.00 0.00 ? 71  PHE A CD2  2  
ATOM 6642  C CE1  . PHE A 1 76  ? -37.339  -72.404  -34.236  1.00 0.00 ? 71  PHE A CE1  2  
ATOM 6643  C CE2  . PHE A 1 76  ? -37.208  -74.527  -35.401  1.00 0.00 ? 71  PHE A CE2  2  
ATOM 6644  C CZ   . PHE A 1 76  ? -37.834  -73.693  -34.467  1.00 0.00 ? 71  PHE A CZ   2  
ATOM 6645  H H    . PHE A 1 76  ? -33.841  -74.627  -35.794  1.00 0.00 ? 71  PHE A H    2  
ATOM 6646  H HA   . PHE A 1 76  ? -32.248  -72.204  -36.383  1.00 0.00 ? 71  PHE A HA   2  
ATOM 6647  H HB2  . PHE A 1 76  ? -34.462  -71.218  -36.772  1.00 0.00 ? 71  PHE A HB2  2  
ATOM 6648  H HB3  . PHE A 1 76  ? -34.347  -72.769  -37.600  1.00 0.00 ? 71  PHE A HB3  2  
ATOM 6649  H HD1  . PHE A 1 76  ? -35.836  -70.954  -34.762  1.00 0.00 ? 71  PHE A HD1  2  
ATOM 6650  H HD2  . PHE A 1 76  ? -35.600  -74.715  -36.823  1.00 0.00 ? 71  PHE A HD2  2  
ATOM 6651  H HE1  . PHE A 1 76  ? -37.821  -71.761  -33.516  1.00 0.00 ? 71  PHE A HE1  2  
ATOM 6652  H HE2  . PHE A 1 76  ? -37.589  -75.521  -35.580  1.00 0.00 ? 71  PHE A HE2  2  
ATOM 6653  H HZ   . PHE A 1 76  ? -38.699  -74.044  -33.924  1.00 0.00 ? 71  PHE A HZ   2  
ATOM 6654  N N    . VAL A 1 77  ? -32.363  -71.047  -34.159  1.00 0.00 ? 72  VAL A N    2  
ATOM 6655  C CA   . VAL A 1 77  ? -32.355  -70.453  -32.792  1.00 0.00 ? 72  VAL A CA   2  
ATOM 6656  C C    . VAL A 1 77  ? -33.201  -69.179  -32.768  1.00 0.00 ? 72  VAL A C    2  
ATOM 6657  O O    . VAL A 1 77  ? -33.156  -68.375  -33.677  1.00 0.00 ? 72  VAL A O    2  
ATOM 6658  C CB   . VAL A 1 77  ? -30.883  -70.127  -32.518  1.00 0.00 ? 72  VAL A CB   2  
ATOM 6659  C CG1  . VAL A 1 77  ? -30.754  -69.370  -31.192  1.00 0.00 ? 72  VAL A CG1  2  
ATOM 6660  C CG2  . VAL A 1 77  ? -30.078  -71.428  -32.442  1.00 0.00 ? 72  VAL A CG2  2  
ATOM 6661  H H    . VAL A 1 77  ? -31.765  -70.692  -34.849  1.00 0.00 ? 72  VAL A H    2  
ATOM 6662  H HA   . VAL A 1 77  ? -32.718  -71.164  -32.068  1.00 0.00 ? 72  VAL A HA   2  
ATOM 6663  H HB   . VAL A 1 77  ? -30.499  -69.512  -33.319  1.00 0.00 ? 72  VAL A HB   2  
ATOM 6664  H HG11 . VAL A 1 77  ? -31.468  -68.558  -31.167  1.00 0.00 ? 72  VAL A HG11 2  
ATOM 6665  H HG12 . VAL A 1 77  ? -29.754  -68.972  -31.101  1.00 0.00 ? 72  VAL A HG12 2  
ATOM 6666  H HG13 . VAL A 1 77  ? -30.948  -70.045  -30.372  1.00 0.00 ? 72  VAL A HG13 2  
ATOM 6667  H HG21 . VAL A 1 77  ? -29.170  -71.323  -33.017  1.00 0.00 ? 72  VAL A HG21 2  
ATOM 6668  H HG22 . VAL A 1 77  ? -30.666  -72.241  -32.843  1.00 0.00 ? 72  VAL A HG22 2  
ATOM 6669  H HG23 . VAL A 1 77  ? -29.829  -71.639  -31.412  1.00 0.00 ? 72  VAL A HG23 2  
ATOM 6670  N N    . VAL A 1 78  ? -33.963  -68.987  -31.727  1.00 0.00 ? 73  VAL A N    2  
ATOM 6671  C CA   . VAL A 1 78  ? -34.803  -67.762  -31.632  1.00 0.00 ? 73  VAL A CA   2  
ATOM 6672  C C    . VAL A 1 78  ? -34.113  -66.739  -30.728  1.00 0.00 ? 73  VAL A C    2  
ATOM 6673  O O    . VAL A 1 78  ? -33.360  -67.092  -29.844  1.00 0.00 ? 73  VAL A O    2  
ATOM 6674  C CB   . VAL A 1 78  ? -36.125  -68.229  -31.017  1.00 0.00 ? 73  VAL A CB   2  
ATOM 6675  C CG1  . VAL A 1 78  ? -37.044  -67.026  -30.795  1.00 0.00 ? 73  VAL A CG1  2  
ATOM 6676  C CG2  . VAL A 1 78  ? -36.805  -69.218  -31.966  1.00 0.00 ? 73  VAL A CG2  2  
ATOM 6677  H H    . VAL A 1 78  ? -33.976  -69.646  -31.002  1.00 0.00 ? 73  VAL A H    2  
ATOM 6678  H HA   . VAL A 1 78  ? -34.976  -67.345  -32.610  1.00 0.00 ? 73  VAL A HA   2  
ATOM 6679  H HB   . VAL A 1 78  ? -35.930  -68.712  -30.071  1.00 0.00 ? 73  VAL A HB   2  
ATOM 6680  H HG11 . VAL A 1 78  ? -36.725  -66.487  -29.915  1.00 0.00 ? 73  VAL A HG11 2  
ATOM 6681  H HG12 . VAL A 1 78  ? -38.059  -67.368  -30.660  1.00 0.00 ? 73  VAL A HG12 2  
ATOM 6682  H HG13 . VAL A 1 78  ? -36.995  -66.373  -31.654  1.00 0.00 ? 73  VAL A HG13 2  
ATOM 6683  H HG21 . VAL A 1 78  ? -37.615  -69.712  -31.450  1.00 0.00 ? 73  VAL A HG21 2  
ATOM 6684  H HG22 . VAL A 1 78  ? -36.087  -69.954  -32.296  1.00 0.00 ? 73  VAL A HG22 2  
ATOM 6685  H HG23 . VAL A 1 78  ? -37.194  -68.686  -32.822  1.00 0.00 ? 73  VAL A HG23 2  
ATOM 6686  N N    . VAL A 1 79  ? -34.360  -65.478  -30.946  1.00 0.00 ? 74  VAL A N    2  
ATOM 6687  C CA   . VAL A 1 79  ? -33.717  -64.433  -30.100  1.00 0.00 ? 74  VAL A CA   2  
ATOM 6688  C C    . VAL A 1 79  ? -34.739  -63.359  -29.716  1.00 0.00 ? 74  VAL A C    2  
ATOM 6689  O O    . VAL A 1 79  ? -35.635  -63.034  -30.476  1.00 0.00 ? 74  VAL A O    2  
ATOM 6690  C CB   . VAL A 1 79  ? -32.601  -63.840  -30.969  1.00 0.00 ? 74  VAL A CB   2  
ATOM 6691  C CG1  . VAL A 1 79  ? -33.191  -63.255  -32.256  1.00 0.00 ? 74  VAL A CG1  2  
ATOM 6692  C CG2  . VAL A 1 79  ? -31.881  -62.734  -30.190  1.00 0.00 ? 74  VAL A CG2  2  
ATOM 6693  H H    . VAL A 1 79  ? -34.968  -65.218  -31.666  1.00 0.00 ? 74  VAL A H    2  
ATOM 6694  H HA   . VAL A 1 79  ? -33.291  -64.877  -29.216  1.00 0.00 ? 74  VAL A HA   2  
ATOM 6695  H HB   . VAL A 1 79  ? -31.895  -64.618  -31.222  1.00 0.00 ? 74  VAL A HB   2  
ATOM 6696  H HG11 . VAL A 1 79  ? -32.808  -62.257  -32.409  1.00 0.00 ? 74  VAL A HG11 2  
ATOM 6697  H HG12 . VAL A 1 79  ? -34.266  -63.219  -32.175  1.00 0.00 ? 74  VAL A HG12 2  
ATOM 6698  H HG13 . VAL A 1 79  ? -32.915  -63.879  -33.094  1.00 0.00 ? 74  VAL A HG13 2  
ATOM 6699  H HG21 . VAL A 1 79  ? -30.823  -62.776  -30.400  1.00 0.00 ? 74  VAL A HG21 2  
ATOM 6700  H HG22 . VAL A 1 79  ? -32.044  -62.874  -29.131  1.00 0.00 ? 74  VAL A HG22 2  
ATOM 6701  H HG23 . VAL A 1 79  ? -32.269  -61.771  -30.490  1.00 0.00 ? 74  VAL A HG23 2  
ATOM 6702  N N    . MET A 1 80  ? -34.608  -62.805  -28.539  1.00 0.00 ? 75  MET A N    2  
ATOM 6703  C CA   . MET A 1 80  ? -35.559  -61.749  -28.099  1.00 0.00 ? 75  MET A CA   2  
ATOM 6704  C C    . MET A 1 80  ? -34.869  -60.388  -28.165  1.00 0.00 ? 75  MET A C    2  
ATOM 6705  O O    . MET A 1 80  ? -33.659  -60.298  -28.133  1.00 0.00 ? 75  MET A O    2  
ATOM 6706  C CB   . MET A 1 80  ? -35.912  -62.104  -26.654  1.00 0.00 ? 75  MET A CB   2  
ATOM 6707  C CG   . MET A 1 80  ? -37.092  -61.246  -26.193  1.00 0.00 ? 75  MET A CG   2  
ATOM 6708  S SD   . MET A 1 80  ? -37.360  -61.492  -24.420  1.00 0.00 ? 75  MET A SD   2  
ATOM 6709  C CE   . MET A 1 80  ? -38.585  -62.816  -24.558  1.00 0.00 ? 75  MET A CE   2  
ATOM 6710  H H    . MET A 1 80  ? -33.878  -63.081  -27.946  1.00 0.00 ? 75  MET A H    2  
ATOM 6711  H HA   . MET A 1 80  ? -36.446  -61.757  -28.712  1.00 0.00 ? 75  MET A HA   2  
ATOM 6712  H HB2  . MET A 1 80  ? -36.180  -63.149  -26.595  1.00 0.00 ? 75  MET A HB2  2  
ATOM 6713  H HB3  . MET A 1 80  ? -35.061  -61.914  -26.018  1.00 0.00 ? 75  MET A HB3  2  
ATOM 6714  H HG2  . MET A 1 80  ? -36.876  -60.205  -26.383  1.00 0.00 ? 75  MET A HG2  2  
ATOM 6715  H HG3  . MET A 1 80  ? -37.980  -61.535  -26.734  1.00 0.00 ? 75  MET A HG3  2  
ATOM 6716  H HE1  . MET A 1 80  ? -39.462  -62.555  -23.983  1.00 0.00 ? 75  MET A HE1  2  
ATOM 6717  H HE2  . MET A 1 80  ? -38.168  -63.734  -24.177  1.00 0.00 ? 75  MET A HE2  2  
ATOM 6718  H HE3  . MET A 1 80  ? -38.854  -62.949  -25.597  1.00 0.00 ? 75  MET A HE3  2  
ATOM 6719  N N    . VAL A 1 81  ? -35.627  -59.331  -28.260  1.00 0.00 ? 76  VAL A N    2  
ATOM 6720  C CA   . VAL A 1 81  ? -35.012  -57.973  -28.332  1.00 0.00 ? 76  VAL A CA   2  
ATOM 6721  C C    . VAL A 1 81  ? -35.944  -56.944  -27.690  1.00 0.00 ? 76  VAL A C    2  
ATOM 6722  O O    . VAL A 1 81  ? -36.350  -55.983  -28.313  1.00 0.00 ? 76  VAL A O    2  
ATOM 6723  C CB   . VAL A 1 81  ? -34.839  -57.694  -29.828  1.00 0.00 ? 76  VAL A CB   2  
ATOM 6724  C CG1  . VAL A 1 81  ? -33.861  -58.710  -30.418  1.00 0.00 ? 76  VAL A CG1  2  
ATOM 6725  C CG2  . VAL A 1 81  ? -36.192  -57.818  -30.535  1.00 0.00 ? 76  VAL A CG2  2  
ATOM 6726  H H    . VAL A 1 81  ? -36.601  -59.429  -28.285  1.00 0.00 ? 76  VAL A H    2  
ATOM 6727  H HA   . VAL A 1 81  ? -34.051  -57.968  -27.842  1.00 0.00 ? 76  VAL A HA   2  
ATOM 6728  H HB   . VAL A 1 81  ? -34.447  -56.697  -29.968  1.00 0.00 ? 76  VAL A HB   2  
ATOM 6729  H HG11 . VAL A 1 81  ? -33.014  -58.819  -29.757  1.00 0.00 ? 76  VAL A HG11 2  
ATOM 6730  H HG12 . VAL A 1 81  ? -33.522  -58.363  -31.382  1.00 0.00 ? 76  VAL A HG12 2  
ATOM 6731  H HG13 . VAL A 1 81  ? -34.356  -59.663  -30.531  1.00 0.00 ? 76  VAL A HG13 2  
ATOM 6732  H HG21 . VAL A 1 81  ? -36.660  -58.751  -30.259  1.00 0.00 ? 76  VAL A HG21 2  
ATOM 6733  H HG22 . VAL A 1 81  ? -36.043  -57.793  -31.605  1.00 0.00 ? 76  VAL A HG22 2  
ATOM 6734  H HG23 . VAL A 1 81  ? -36.828  -56.996  -30.242  1.00 0.00 ? 76  VAL A HG23 2  
ATOM 6735  N N    . THR A 1 82  ? -36.287  -57.144  -26.446  1.00 0.00 ? 77  THR A N    2  
ATOM 6736  C CA   . THR A 1 82  ? -37.199  -56.182  -25.759  1.00 0.00 ? 77  THR A CA   2  
ATOM 6737  C C    . THR A 1 82  ? -36.393  -55.163  -24.948  1.00 0.00 ? 77  THR A C    2  
ATOM 6738  O O    . THR A 1 82  ? -35.181  -55.106  -25.028  1.00 0.00 ? 77  THR A O    2  
ATOM 6739  C CB   . THR A 1 82  ? -38.059  -57.042  -24.831  1.00 0.00 ? 77  THR A CB   2  
ATOM 6740  O OG1  . THR A 1 82  ? -37.217  -57.840  -24.011  1.00 0.00 ? 77  THR A OG1  2  
ATOM 6741  C CG2  . THR A 1 82  ? -38.969  -57.946  -25.665  1.00 0.00 ? 77  THR A CG2  2  
ATOM 6742  H H    . THR A 1 82  ? -35.947  -57.930  -25.964  1.00 0.00 ? 77  THR A H    2  
ATOM 6743  H HA   . THR A 1 82  ? -37.825  -55.679  -26.478  1.00 0.00 ? 77  THR A HA   2  
ATOM 6744  H HB   . THR A 1 82  ? -38.667  -56.403  -24.210  1.00 0.00 ? 77  THR A HB   2  
ATOM 6745  H HG1  . THR A 1 82  ? -37.717  -58.093  -23.231  1.00 0.00 ? 77  THR A HG1  2  
ATOM 6746  H HG21 . THR A 1 82  ? -39.878  -58.144  -25.117  1.00 0.00 ? 77  THR A HG21 2  
ATOM 6747  H HG22 . THR A 1 82  ? -38.461  -58.877  -25.869  1.00 0.00 ? 77  THR A HG22 2  
ATOM 6748  H HG23 . THR A 1 82  ? -39.209  -57.454  -26.596  1.00 0.00 ? 77  THR A HG23 2  
ATOM 6749  N N    . LYS A 1 83  ? -37.066  -54.361  -24.163  1.00 0.00 ? 78  LYS A N    2  
ATOM 6750  C CA   . LYS A 1 83  ? -36.360  -53.336  -23.334  1.00 0.00 ? 78  LYS A CA   2  
ATOM 6751  C C    . LYS A 1 83  ? -35.562  -52.382  -24.227  1.00 0.00 ? 78  LYS A C    2  
ATOM 6752  O O    . LYS A 1 83  ? -34.536  -52.737  -24.773  1.00 0.00 ? 78  LYS A O    2  
ATOM 6753  C CB   . LYS A 1 83  ? -35.424  -54.130  -22.420  1.00 0.00 ? 78  LYS A CB   2  
ATOM 6754  C CG   . LYS A 1 83  ? -35.331  -53.436  -21.059  1.00 0.00 ? 78  LYS A CG   2  
ATOM 6755  C CD   . LYS A 1 83  ? -36.457  -53.938  -20.153  1.00 0.00 ? 78  LYS A CD   2  
ATOM 6756  C CE   . LYS A 1 83  ? -36.008  -55.214  -19.434  1.00 0.00 ? 78  LYS A CE   2  
ATOM 6757  N NZ   . LYS A 1 83  ? -36.257  -54.949  -17.989  1.00 0.00 ? 78  LYS A NZ   2  
ATOM 6758  H H    . LYS A 1 83  ? -38.043  -54.433  -24.117  1.00 0.00 ? 78  LYS A H    2  
ATOM 6759  H HA   . LYS A 1 83  ? -37.071  -52.784  -22.738  1.00 0.00 ? 78  LYS A HA   2  
ATOM 6760  H HB2  . LYS A 1 83  ? -35.810  -55.130  -22.290  1.00 0.00 ? 78  LYS A HB2  2  
ATOM 6761  H HB3  . LYS A 1 83  ? -34.442  -54.178  -22.865  1.00 0.00 ? 78  LYS A HB3  2  
ATOM 6762  H HG2  . LYS A 1 83  ? -34.376  -53.659  -20.606  1.00 0.00 ? 78  LYS A HG2  2  
ATOM 6763  H HG3  . LYS A 1 83  ? -35.427  -52.369  -21.192  1.00 0.00 ? 78  LYS A HG3  2  
ATOM 6764  H HD2  . LYS A 1 83  ? -36.698  -53.178  -19.424  1.00 0.00 ? 78  LYS A HD2  2  
ATOM 6765  H HD3  . LYS A 1 83  ? -37.331  -54.154  -20.750  1.00 0.00 ? 78  LYS A HD3  2  
ATOM 6766  H HE2  . LYS A 1 83  ? -36.593  -56.059  -19.770  1.00 0.00 ? 78  LYS A HE2  2  
ATOM 6767  H HE3  . LYS A 1 83  ? -34.957  -55.391  -19.601  1.00 0.00 ? 78  LYS A HE3  2  
ATOM 6768  H HZ1  . LYS A 1 83  ? -35.986  -55.783  -17.431  1.00 0.00 ? 78  LYS A HZ1  2  
ATOM 6769  H HZ2  . LYS A 1 83  ? -37.268  -54.747  -17.844  1.00 0.00 ? 78  LYS A HZ2  2  
ATOM 6770  H HZ3  . LYS A 1 83  ? -35.693  -54.131  -17.684  1.00 0.00 ? 78  LYS A HZ3  2  
ATOM 6771  N N    . THR A 1 84  ? -36.027  -51.169  -24.375  1.00 0.00 ? 79  THR A N    2  
ATOM 6772  C CA   . THR A 1 84  ? -35.299  -50.185  -25.228  1.00 0.00 ? 79  THR A CA   2  
ATOM 6773  C C    . THR A 1 84  ? -34.214  -49.477  -24.411  1.00 0.00 ? 79  THR A C    2  
ATOM 6774  O O    . THR A 1 84  ? -34.163  -48.264  -24.348  1.00 0.00 ? 79  THR A O    2  
ATOM 6775  C CB   . THR A 1 84  ? -36.368  -49.188  -25.679  1.00 0.00 ? 79  THR A CB   2  
ATOM 6776  O OG1  . THR A 1 84  ? -37.533  -49.894  -26.082  1.00 0.00 ? 79  THR A OG1  2  
ATOM 6777  C CG2  . THR A 1 84  ? -35.838  -48.363  -26.852  1.00 0.00 ? 79  THR A CG2  2  
ATOM 6778  H H    . THR A 1 84  ? -36.855  -50.905  -23.922  1.00 0.00 ? 79  THR A H    2  
ATOM 6779  H HA   . THR A 1 84  ? -34.867  -50.676  -26.086  1.00 0.00 ? 79  THR A HA   2  
ATOM 6780  H HB   . THR A 1 84  ? -36.612  -48.527  -24.862  1.00 0.00 ? 79  THR A HB   2  
ATOM 6781  H HG1  . THR A 1 84  ? -38.298  -49.418  -25.750  1.00 0.00 ? 79  THR A HG1  2  
ATOM 6782  H HG21 . THR A 1 84  ? -34.802  -48.111  -26.676  1.00 0.00 ? 79  THR A HG21 2  
ATOM 6783  H HG22 . THR A 1 84  ? -36.418  -47.457  -26.946  1.00 0.00 ? 79  THR A HG22 2  
ATOM 6784  H HG23 . THR A 1 84  ? -35.918  -48.938  -27.763  1.00 0.00 ? 79  THR A HG23 2  
ATOM 6785  N N    . LYS A 1 85  ? -33.345  -50.227  -23.783  1.00 0.00 ? 80  LYS A N    2  
ATOM 6786  C CA   . LYS A 1 85  ? -32.258  -49.604  -22.966  1.00 0.00 ? 80  LYS A CA   2  
ATOM 6787  C C    . LYS A 1 85  ? -32.849  -48.610  -21.960  1.00 0.00 ? 80  LYS A C    2  
ATOM 6788  O O    . LYS A 1 85  ? -34.031  -48.630  -21.675  1.00 0.00 ? 80  LYS A O    2  
ATOM 6789  C CB   . LYS A 1 85  ? -31.362  -48.881  -23.975  1.00 0.00 ? 80  LYS A CB   2  
ATOM 6790  C CG   . LYS A 1 85  ? -29.893  -49.133  -23.628  1.00 0.00 ? 80  LYS A CG   2  
ATOM 6791  C CD   . LYS A 1 85  ? -29.009  -48.666  -24.785  1.00 0.00 ? 80  LYS A CD   2  
ATOM 6792  C CE   . LYS A 1 85  ? -28.716  -47.172  -24.634  1.00 0.00 ? 80  LYS A CE   2  
ATOM 6793  N NZ   . LYS A 1 85  ? -27.821  -46.839  -25.777  1.00 0.00 ? 80  LYS A NZ   2  
ATOM 6794  H H    . LYS A 1 85  ? -33.406  -51.203  -23.849  1.00 0.00 ? 80  LYS A H    2  
ATOM 6795  H HA   . LYS A 1 85  ? -31.693  -50.366  -22.452  1.00 0.00 ? 80  LYS A HA   2  
ATOM 6796  H HB2  . LYS A 1 85  ? -31.567  -49.254  -24.968  1.00 0.00 ? 80  LYS A HB2  2  
ATOM 6797  H HB3  . LYS A 1 85  ? -31.562  -47.821  -23.939  1.00 0.00 ? 80  LYS A HB3  2  
ATOM 6798  H HG2  . LYS A 1 85  ? -29.636  -48.585  -22.733  1.00 0.00 ? 80  LYS A HG2  2  
ATOM 6799  H HG3  . LYS A 1 85  ? -29.738  -50.188  -23.462  1.00 0.00 ? 80  LYS A HG3  2  
ATOM 6800  H HD2  . LYS A 1 85  ? -28.080  -49.219  -24.774  1.00 0.00 ? 80  LYS A HD2  2  
ATOM 6801  H HD3  . LYS A 1 85  ? -29.519  -48.838  -25.721  1.00 0.00 ? 80  LYS A HD3  2  
ATOM 6802  H HE2  . LYS A 1 85  ? -29.634  -46.602  -24.693  1.00 0.00 ? 80  LYS A HE2  2  
ATOM 6803  H HE3  . LYS A 1 85  ? -28.211  -46.979  -23.701  1.00 0.00 ? 80  LYS A HE3  2  
ATOM 6804  H HZ1  . LYS A 1 85  ? -26.976  -47.442  -25.744  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM 6805  H HZ2  . LYS A 1 85  ? -27.538  -45.839  -25.715  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM 6806  H HZ3  . LYS A 1 85  ? -28.325  -47.002  -26.672  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM 6807  N N    . ALA A 1 86  ? -32.035  -47.742  -21.421  1.00 0.00 ? 81  ALA A N    2  
ATOM 6808  C CA   . ALA A 1 86  ? -32.547  -46.746  -20.435  1.00 0.00 ? 81  ALA A CA   2  
ATOM 6809  C C    . ALA A 1 86  ? -31.745  -45.445  -20.532  1.00 0.00 ? 81  ALA A C    2  
ATOM 6810  O O    . ALA A 1 86  ? -31.259  -44.929  -19.545  1.00 0.00 ? 81  ALA A O    2  
ATOM 6811  C CB   . ALA A 1 86  ? -32.342  -47.401  -19.068  1.00 0.00 ? 81  ALA A CB   2  
ATOM 6812  H H    . ALA A 1 86  ? -31.086  -47.744  -21.666  1.00 0.00 ? 81  ALA A H    2  
ATOM 6813  H HA   . ALA A 1 86  ? -33.596  -46.557  -20.600  1.00 0.00 ? 81  ALA A HA   2  
ATOM 6814  H HB1  . ALA A 1 86  ? -32.781  -48.387  -19.072  1.00 0.00 ? 81  ALA A HB1  2  
ATOM 6815  H HB2  . ALA A 1 86  ? -32.815  -46.799  -18.306  1.00 0.00 ? 81  ALA A HB2  2  
ATOM 6816  H HB3  . ALA A 1 86  ? -31.285  -47.478  -18.861  1.00 0.00 ? 81  ALA A HB3  2  
ATOM 6817  N N    . GLY A 1 87  ? -31.606  -44.911  -21.716  1.00 0.00 ? 82  GLY A N    2  
ATOM 6818  C CA   . GLY A 1 87  ? -30.837  -43.643  -21.879  1.00 0.00 ? 82  GLY A CA   2  
ATOM 6819  C C    . GLY A 1 87  ? -31.639  -42.665  -22.738  1.00 0.00 ? 82  GLY A C    2  
ATOM 6820  O O    . GLY A 1 87  ? -31.260  -42.344  -23.848  1.00 0.00 ? 82  GLY A O    2  
ATOM 6821  H H    . GLY A 1 87  ? -32.007  -45.344  -22.498  1.00 0.00 ? 82  GLY A H    2  
ATOM 6822  H HA2  . GLY A 1 87  ? -30.655  -43.206  -20.907  1.00 0.00 ? 82  GLY A HA2  2  
ATOM 6823  H HA3  . GLY A 1 87  ? -29.895  -43.853  -22.363  1.00 0.00 ? 82  GLY A HA3  2  
ATOM 6824  N N    . GLN A 1 88  ? -32.745  -42.188  -22.233  1.00 0.00 ? 83  GLN A N    2  
ATOM 6825  C CA   . GLN A 1 88  ? -33.575  -41.229  -23.019  1.00 0.00 ? 83  GLN A CA   2  
ATOM 6826  C C    . GLN A 1 88  ? -33.703  -39.902  -22.266  1.00 0.00 ? 83  GLN A C    2  
ATOM 6827  O O    . GLN A 1 88  ? -33.393  -38.849  -22.788  1.00 0.00 ? 83  GLN A O    2  
ATOM 6828  C CB   . GLN A 1 88  ? -34.941  -41.904  -23.153  1.00 0.00 ? 83  GLN A CB   2  
ATOM 6829  C CG   . GLN A 1 88  ? -34.792  -43.207  -23.942  1.00 0.00 ? 83  GLN A CG   2  
ATOM 6830  C CD   . GLN A 1 88  ? -36.036  -43.426  -24.805  1.00 0.00 ? 83  GLN A CD   2  
ATOM 6831  O OE1  . GLN A 1 88  ? -37.115  -42.989  -24.459  1.00 0.00 ? 83  GLN A OE1  2  
ATOM 6832  N NE2  . GLN A 1 88  ? -35.930  -44.090  -25.924  1.00 0.00 ? 83  GLN A NE2  2  
ATOM 6833  H H    . GLN A 1 88  ? -33.031  -42.461  -21.336  1.00 0.00 ? 83  GLN A H    2  
ATOM 6834  H HA   . GLN A 1 88  ? -33.145  -41.069  -23.995  1.00 0.00 ? 83  GLN A HA   2  
ATOM 6835  H HB2  . GLN A 1 88  ? -35.333  -42.120  -22.169  1.00 0.00 ? 83  GLN A HB2  2  
ATOM 6836  H HB3  . GLN A 1 88  ? -35.619  -41.245  -23.674  1.00 0.00 ? 83  GLN A HB3  2  
ATOM 6837  H HG2  . GLN A 1 88  ? -33.919  -43.147  -24.575  1.00 0.00 ? 83  GLN A HG2  2  
ATOM 6838  H HG3  . GLN A 1 88  ? -34.683  -44.033  -23.255  1.00 0.00 ? 83  GLN A HG3  2  
ATOM 6839  H HE21 . GLN A 1 88  ? -35.059  -44.443  -26.203  1.00 0.00 ? 83  GLN A HE21 2  
ATOM 6840  H HE22 . GLN A 1 88  ? -36.720  -44.236  -26.484  1.00 0.00 ? 83  GLN A HE22 2  
ATOM 6841  N N    . GLY A 1 89  ? -34.158  -39.947  -21.042  1.00 0.00 ? 84  GLY A N    2  
ATOM 6842  C CA   . GLY A 1 89  ? -34.306  -38.691  -20.252  1.00 0.00 ? 84  GLY A CA   2  
ATOM 6843  C C    . GLY A 1 89  ? -35.404  -37.823  -20.869  1.00 0.00 ? 84  GLY A C    2  
ATOM 6844  O O    . GLY A 1 89  ? -36.578  -38.115  -20.753  1.00 0.00 ? 84  GLY A O    2  
ATOM 6845  H H    . GLY A 1 89  ? -34.401  -40.807  -20.642  1.00 0.00 ? 84  GLY A H    2  
ATOM 6846  H HA2  . GLY A 1 89  ? -34.571  -38.937  -19.233  1.00 0.00 ? 84  GLY A HA2  2  
ATOM 6847  H HA3  . GLY A 1 89  ? -33.374  -38.147  -20.261  1.00 0.00 ? 84  GLY A HA3  2  
ATOM 6848  N N    . THR A 1 90  ? -35.030  -36.756  -21.524  1.00 0.00 ? 85  THR A N    2  
ATOM 6849  C CA   . THR A 1 90  ? -36.050  -35.865  -22.149  1.00 0.00 ? 85  THR A CA   2  
ATOM 6850  C C    . THR A 1 90  ? -36.169  -36.160  -23.647  1.00 0.00 ? 85  THR A C    2  
ATOM 6851  O O    . THR A 1 90  ? -35.496  -35.560  -24.463  1.00 0.00 ? 85  THR A O    2  
ATOM 6852  C CB   . THR A 1 90  ? -35.528  -34.446  -21.923  1.00 0.00 ? 85  THR A CB   2  
ATOM 6853  O OG1  . THR A 1 90  ? -35.213  -34.272  -20.548  1.00 0.00 ? 85  THR A OG1  2  
ATOM 6854  C CG2  . THR A 1 90  ? -36.599  -33.435  -22.335  1.00 0.00 ? 85  THR A CG2  2  
ATOM 6855  H H    . THR A 1 90  ? -34.078  -36.539  -21.603  1.00 0.00 ? 85  THR A H    2  
ATOM 6856  H HA   . THR A 1 90  ? -37.006  -35.987  -21.664  1.00 0.00 ? 85  THR A HA   2  
ATOM 6857  H HB   . THR A 1 90  ? -34.642  -34.288  -22.519  1.00 0.00 ? 85  THR A HB   2  
ATOM 6858  H HG1  . THR A 1 90  ? -34.280  -34.462  -20.431  1.00 0.00 ? 85  THR A HG1  2  
ATOM 6859  H HG21 . THR A 1 90  ? -37.545  -33.714  -21.895  1.00 0.00 ? 85  THR A HG21 2  
ATOM 6860  H HG22 . THR A 1 90  ? -36.691  -33.427  -23.411  1.00 0.00 ? 85  THR A HG22 2  
ATOM 6861  H HG23 . THR A 1 90  ? -36.318  -32.451  -21.990  1.00 0.00 ? 85  THR A HG23 2  
ATOM 6862  N N    . SER A 1 91  ? -37.021  -37.080  -24.014  1.00 0.00 ? 86  SER A N    2  
ATOM 6863  C CA   . SER A 1 91  ? -37.188  -37.414  -25.458  1.00 0.00 ? 86  SER A CA   2  
ATOM 6864  C C    . SER A 1 91  ? -38.208  -36.471  -26.102  1.00 0.00 ? 86  SER A C    2  
ATOM 6865  O O    . SER A 1 91  ? -38.425  -35.368  -25.638  1.00 0.00 ? 86  SER A O    2  
ATOM 6866  C CB   . SER A 1 91  ? -37.700  -38.854  -25.474  1.00 0.00 ? 86  SER A CB   2  
ATOM 6867  O OG   . SER A 1 91  ? -39.064  -38.871  -25.072  1.00 0.00 ? 86  SER A OG   2  
ATOM 6868  H H    . SER A 1 91  ? -37.554  -37.550  -23.338  1.00 0.00 ? 86  SER A H    2  
ATOM 6869  H HA   . SER A 1 91  ? -36.241  -37.354  -25.971  1.00 0.00 ? 86  SER A HA   2  
ATOM 6870  H HB2  . SER A 1 91  ? -37.619  -39.256  -26.470  1.00 0.00 ? 86  SER A HB2  2  
ATOM 6871  H HB3  . SER A 1 91  ? -37.106  -39.454  -24.797  1.00 0.00 ? 86  SER A HB3  2  
ATOM 6872  H HG   . SER A 1 91  ? -39.092  -38.802  -24.115  1.00 0.00 ? 86  SER A HG   2  
ATOM 6873  N N    . ALA A 1 92  ? -38.836  -36.895  -27.167  1.00 0.00 ? 87  ALA A N    2  
ATOM 6874  C CA   . ALA A 1 92  ? -39.843  -36.022  -27.839  1.00 0.00 ? 87  ALA A CA   2  
ATOM 6875  C C    . ALA A 1 92  ? -40.989  -35.694  -26.872  1.00 0.00 ? 87  ALA A C    2  
ATOM 6876  O O    . ALA A 1 92  ? -41.374  -36.523  -26.071  1.00 0.00 ? 87  ALA A O    2  
ATOM 6877  C CB   . ALA A 1 92  ? -40.358  -36.844  -29.021  1.00 0.00 ? 87  ALA A CB   2  
ATOM 6878  H H    . ALA A 1 92  ? -38.646  -37.788  -27.523  1.00 0.00 ? 87  ALA A H    2  
ATOM 6879  H HA   . ALA A 1 92  ? -39.376  -35.117  -28.194  1.00 0.00 ? 87  ALA A HA   2  
ATOM 6880  H HB1  . ALA A 1 92  ? -41.207  -36.344  -29.464  1.00 0.00 ? 87  ALA A HB1  2  
ATOM 6881  H HB2  . ALA A 1 92  ? -40.657  -37.823  -28.676  1.00 0.00 ? 87  ALA A HB2  2  
ATOM 6882  H HB3  . ALA A 1 92  ? -39.575  -36.945  -29.758  1.00 0.00 ? 87  ALA A HB3  2  
ATOM 6883  N N    . PRO A 1 93  ? -41.498  -34.491  -26.976  1.00 0.00 ? 88  PRO A N    2  
ATOM 6884  C CA   . PRO A 1 93  ? -42.610  -34.062  -26.092  1.00 0.00 ? 88  PRO A CA   2  
ATOM 6885  C C    . PRO A 1 93  ? -43.921  -34.735  -26.517  1.00 0.00 ? 88  PRO A C    2  
ATOM 6886  O O    . PRO A 1 93  ? -44.082  -35.104  -27.663  1.00 0.00 ? 88  PRO A O    2  
ATOM 6887  C CB   . PRO A 1 93  ? -42.679  -32.554  -26.308  1.00 0.00 ? 88  PRO A CB   2  
ATOM 6888  C CG   . PRO A 1 93  ? -42.092  -32.327  -27.665  1.00 0.00 ? 88  PRO A CG   2  
ATOM 6889  C CD   . PRO A 1 93  ? -41.096  -33.431  -27.910  1.00 0.00 ? 88  PRO A CD   2  
ATOM 6890  H HA   . PRO A 1 93  ? -42.383  -34.279  -25.061  1.00 0.00 ? 88  PRO A HA   2  
ATOM 6891  H HB2  . PRO A 1 93  ? -43.707  -32.219  -26.279  1.00 0.00 ? 88  PRO A HB2  2  
ATOM 6892  H HB3  . PRO A 1 93  ? -42.093  -32.040  -25.563  1.00 0.00 ? 88  PRO A HB3  2  
ATOM 6893  H HG2  . PRO A 1 93  ? -42.873  -32.358  -28.413  1.00 0.00 ? 88  PRO A HG2  2  
ATOM 6894  H HG3  . PRO A 1 93  ? -41.590  -31.372  -27.695  1.00 0.00 ? 88  PRO A HG3  2  
ATOM 6895  H HD2  . PRO A 1 93  ? -41.161  -33.777  -28.933  1.00 0.00 ? 88  PRO A HD2  2  
ATOM 6896  H HD3  . PRO A 1 93  ? -40.096  -33.096  -27.684  1.00 0.00 ? 88  PRO A HD3  2  
ATOM 6897  N N    . PRO A 1 94  ? -44.819  -34.872  -25.574  1.00 0.00 ? 89  PRO A N    2  
ATOM 6898  C CA   . PRO A 1 94  ? -46.128  -35.507  -25.862  1.00 0.00 ? 89  PRO A CA   2  
ATOM 6899  C C    . PRO A 1 94  ? -47.008  -34.562  -26.686  1.00 0.00 ? 89  PRO A C    2  
ATOM 6900  O O    . PRO A 1 94  ? -46.565  -33.525  -27.139  1.00 0.00 ? 89  PRO A O    2  
ATOM 6901  C CB   . PRO A 1 94  ? -46.728  -35.740  -24.478  1.00 0.00 ? 89  PRO A CB   2  
ATOM 6902  C CG   . PRO A 1 94  ? -46.072  -34.726  -23.596  1.00 0.00 ? 89  PRO A CG   2  
ATOM 6903  C CD   . PRO A 1 94  ? -44.705  -34.456  -24.170  1.00 0.00 ? 89  PRO A CD   2  
ATOM 6904  H HA   . PRO A 1 94  ? -45.994  -36.447  -26.371  1.00 0.00 ? 89  PRO A HA   2  
ATOM 6905  H HB2  . PRO A 1 94  ? -47.798  -35.586  -24.503  1.00 0.00 ? 89  PRO A HB2  2  
ATOM 6906  H HB3  . PRO A 1 94  ? -46.497  -36.735  -24.131  1.00 0.00 ? 89  PRO A HB3  2  
ATOM 6907  H HG2  . PRO A 1 94  ? -46.657  -33.816  -23.585  1.00 0.00 ? 89  PRO A HG2  2  
ATOM 6908  H HG3  . PRO A 1 94  ? -45.975  -35.115  -22.594  1.00 0.00 ? 89  PRO A HG3  2  
ATOM 6909  H HD2  . PRO A 1 94  ? -44.468  -33.403  -24.101  1.00 0.00 ? 89  PRO A HD2  2  
ATOM 6910  H HD3  . PRO A 1 94  ? -43.958  -35.048  -23.665  1.00 0.00 ? 89  PRO A HD3  2  
ATOM 6911  N N    . GLU A 1 95  ? -48.250  -34.914  -26.884  1.00 0.00 ? 90  GLU A N    2  
ATOM 6912  C CA   . GLU A 1 95  ? -49.159  -34.038  -27.678  1.00 0.00 ? 90  GLU A CA   2  
ATOM 6913  C C    . GLU A 1 95  ? -50.042  -33.207  -26.743  1.00 0.00 ? 90  GLU A C    2  
ATOM 6914  O O    . GLU A 1 95  ? -49.837  -33.175  -25.546  1.00 0.00 ? 90  GLU A O    2  
ATOM 6915  C CB   . GLU A 1 95  ? -50.012  -34.998  -28.507  1.00 0.00 ? 90  GLU A CB   2  
ATOM 6916  C CG   . GLU A 1 95  ? -49.125  -35.722  -29.522  1.00 0.00 ? 90  GLU A CG   2  
ATOM 6917  C CD   . GLU A 1 95  ? -49.930  -36.828  -30.207  1.00 0.00 ? 90  GLU A CD   2  
ATOM 6918  O OE1  . GLU A 1 95  ? -49.995  -37.914  -29.657  1.00 0.00 ? 90  GLU A OE1  2  
ATOM 6919  O OE2  . GLU A 1 95  ? -50.468  -36.569  -31.272  1.00 0.00 ? 90  GLU A OE2  2  
ATOM 6920  H H    . GLU A 1 95  ? -48.586  -35.756  -26.509  1.00 0.00 ? 90  GLU A H    2  
ATOM 6921  H HA   . GLU A 1 95  ? -48.589  -33.395  -28.329  1.00 0.00 ? 90  GLU A HA   2  
ATOM 6922  H HB2  . GLU A 1 95  ? -50.477  -35.722  -27.853  1.00 0.00 ? 90  GLU A HB2  2  
ATOM 6923  H HB3  . GLU A 1 95  ? -50.775  -34.443  -29.030  1.00 0.00 ? 90  GLU A HB3  2  
ATOM 6924  H HG2  . GLU A 1 95  ? -48.776  -35.017  -30.263  1.00 0.00 ? 90  GLU A HG2  2  
ATOM 6925  H HG3  . GLU A 1 95  ? -48.278  -36.159  -29.014  1.00 0.00 ? 90  GLU A HG3  2  
ATOM 6926  N N    . ALA A 1 96  ? -51.026  -32.534  -27.283  1.00 0.00 ? 91  ALA A N    2  
ATOM 6927  C CA   . ALA A 1 96  ? -51.929  -31.701  -26.431  1.00 0.00 ? 91  ALA A CA   2  
ATOM 6928  C C    . ALA A 1 96  ? -51.111  -30.728  -25.576  1.00 0.00 ? 91  ALA A C    2  
ATOM 6929  O O    . ALA A 1 96  ? -51.338  -30.589  -24.390  1.00 0.00 ? 91  ALA A O    2  
ATOM 6930  C CB   . ALA A 1 96  ? -52.675  -32.699  -25.544  1.00 0.00 ? 91  ALA A CB   2  
ATOM 6931  H H    . ALA A 1 96  ? -51.171  -32.576  -28.252  1.00 0.00 ? 91  ALA A H    2  
ATOM 6932  H HA   . ALA A 1 96  ? -52.631  -31.161  -27.046  1.00 0.00 ? 91  ALA A HA   2  
ATOM 6933  H HB1  . ALA A 1 96  ? -51.998  -33.100  -24.805  1.00 0.00 ? 91  ALA A HB1  2  
ATOM 6934  H HB2  . ALA A 1 96  ? -53.061  -33.504  -26.152  1.00 0.00 ? 91  ALA A HB2  2  
ATOM 6935  H HB3  . ALA A 1 96  ? -53.494  -32.199  -25.048  1.00 0.00 ? 91  ALA A HB3  2  
ATOM 6936  N N    . SER A 1 97  ? -50.162  -30.055  -26.171  1.00 0.00 ? 92  SER A N    2  
ATOM 6937  C CA   . SER A 1 97  ? -49.329  -29.091  -25.394  1.00 0.00 ? 92  SER A CA   2  
ATOM 6938  C C    . SER A 1 97  ? -48.708  -28.049  -26.333  1.00 0.00 ? 92  SER A C    2  
ATOM 6939  O O    . SER A 1 97  ? -47.573  -28.188  -26.745  1.00 0.00 ? 92  SER A O    2  
ATOM 6940  C CB   . SER A 1 97  ? -48.240  -29.944  -24.744  1.00 0.00 ? 92  SER A CB   2  
ATOM 6941  O OG   . SER A 1 97  ? -47.835  -29.339  -23.524  1.00 0.00 ? 92  SER A OG   2  
ATOM 6942  H H    . SER A 1 97  ? -49.997  -30.183  -27.128  1.00 0.00 ? 92  SER A H    2  
ATOM 6943  H HA   . SER A 1 97  ? -49.921  -28.608  -24.633  1.00 0.00 ? 92  SER A HA   2  
ATOM 6944  H HB2  . SER A 1 97  ? -48.626  -30.929  -24.540  1.00 0.00 ? 92  SER A HB2  2  
ATOM 6945  H HB3  . SER A 1 97  ? -47.397  -30.023  -25.417  1.00 0.00 ? 92  SER A HB3  2  
ATOM 6946  H HG   . SER A 1 97  ? -48.242  -29.823  -22.802  1.00 0.00 ? 92  SER A HG   2  
ATOM 6947  N N    . PRO A 1 98  ? -49.476  -27.034  -26.640  1.00 0.00 ? 93  PRO A N    2  
ATOM 6948  C CA   . PRO A 1 98  ? -48.988  -25.960  -27.540  1.00 0.00 ? 93  PRO A CA   2  
ATOM 6949  C C    . PRO A 1 98  ? -47.964  -25.080  -26.817  1.00 0.00 ? 93  PRO A C    2  
ATOM 6950  O O    . PRO A 1 98  ? -48.128  -24.742  -25.661  1.00 0.00 ? 93  PRO A O    2  
ATOM 6951  C CB   . PRO A 1 98  ? -50.250  -25.167  -27.868  1.00 0.00 ? 93  PRO A CB   2  
ATOM 6952  C CG   . PRO A 1 98  ? -51.180  -25.423  -26.725  1.00 0.00 ? 93  PRO A CG   2  
ATOM 6953  C CD   . PRO A 1 98  ? -50.852  -26.792  -26.186  1.00 0.00 ? 93  PRO A CD   2  
ATOM 6954  H HA   . PRO A 1 98  ? -48.568  -26.376  -28.440  1.00 0.00 ? 93  PRO A HA   2  
ATOM 6955  H HB2  . PRO A 1 98  ? -50.021  -24.112  -27.941  1.00 0.00 ? 93  PRO A HB2  2  
ATOM 6956  H HB3  . PRO A 1 98  ? -50.689  -25.522  -28.788  1.00 0.00 ? 93  PRO A HB3  2  
ATOM 6957  H HG2  . PRO A 1 98  ? -51.033  -24.677  -25.957  1.00 0.00 ? 93  PRO A HG2  2  
ATOM 6958  H HG3  . PRO A 1 98  ? -52.202  -25.404  -27.069  1.00 0.00 ? 93  PRO A HG3  2  
ATOM 6959  H HD2  . PRO A 1 98  ? -50.904  -26.795  -25.106  1.00 0.00 ? 93  PRO A HD2  2  
ATOM 6960  H HD3  . PRO A 1 98  ? -51.516  -27.533  -26.602  1.00 0.00 ? 93  PRO A HD3  2  
ATOM 6961  N N    . THR A 1 99  ? -46.907  -24.709  -27.490  1.00 0.00 ? 94  THR A N    2  
ATOM 6962  C CA   . THR A 1 99  ? -45.870  -23.853  -26.845  1.00 0.00 ? 94  THR A CA   2  
ATOM 6963  C C    . THR A 1 99  ? -46.207  -22.372  -27.044  1.00 0.00 ? 94  THR A C    2  
ATOM 6964  O O    . THR A 1 99  ? -46.529  -21.668  -26.107  1.00 0.00 ? 94  THR A O    2  
ATOM 6965  C CB   . THR A 1 99  ? -44.564  -24.207  -27.558  1.00 0.00 ? 94  THR A CB   2  
ATOM 6966  O OG1  . THR A 1 99  ? -44.753  -24.112  -28.963  1.00 0.00 ? 94  THR A OG1  2  
ATOM 6967  C CG2  . THR A 1 99  ? -44.150  -25.632  -27.191  1.00 0.00 ? 94  THR A CG2  2  
ATOM 6968  H H    . THR A 1 99  ? -46.796  -24.994  -28.421  1.00 0.00 ? 94  THR A H    2  
ATOM 6969  H HA   . THR A 1 99  ? -45.791  -24.084  -25.794  1.00 0.00 ? 94  THR A HA   2  
ATOM 6970  H HB   . THR A 1 99  ? -43.789  -23.521  -27.252  1.00 0.00 ? 94  THR A HB   2  
ATOM 6971  H HG1  . THR A 1 99  ? -43.888  -24.116  -29.380  1.00 0.00 ? 94  THR A HG1  2  
ATOM 6972  H HG21 . THR A 1 99  ? -45.032  -26.239  -27.052  1.00 0.00 ? 94  THR A HG21 2  
ATOM 6973  H HG22 . THR A 1 99  ? -43.576  -25.616  -26.276  1.00 0.00 ? 94  THR A HG22 2  
ATOM 6974  H HG23 . THR A 1 99  ? -43.548  -26.048  -27.986  1.00 0.00 ? 94  THR A HG23 2  
ATOM 6975  N N    . ALA A 1 100 ? -46.136  -21.896  -28.259  1.00 0.00 ? 95  ALA A N    2  
ATOM 6976  C CA   . ALA A 1 100 ? -46.452  -20.462  -28.521  1.00 0.00 ? 95  ALA A CA   2  
ATOM 6977  C C    . ALA A 1 100 ? -47.491  -20.347  -29.640  1.00 0.00 ? 95  ALA A C    2  
ATOM 6978  O O    . ALA A 1 100 ? -48.513  -19.708  -29.486  1.00 0.00 ? 95  ALA A O    2  
ATOM 6979  C CB   . ALA A 1 100 ? -45.126  -19.836  -28.953  1.00 0.00 ? 95  ALA A CB   2  
ATOM 6980  H H    . ALA A 1 100 ? -45.874  -22.483  -28.999  1.00 0.00 ? 95  ALA A H    2  
ATOM 6981  H HA   . ALA A 1 100 ? -46.810  -19.984  -27.623  1.00 0.00 ? 95  ALA A HA   2  
ATOM 6982  H HB1  . ALA A 1 100 ? -44.329  -20.214  -28.329  1.00 0.00 ? 95  ALA A HB1  2  
ATOM 6983  H HB2  . ALA A 1 100 ? -45.184  -18.763  -28.852  1.00 0.00 ? 95  ALA A HB2  2  
ATOM 6984  H HB3  . ALA A 1 100 ? -44.927  -20.090  -29.984  1.00 0.00 ? 95  ALA A HB3  2  
ATOM 6985  N N    . ALA A 1 101 ? -47.235  -20.962  -30.763  1.00 0.00 ? 96  ALA A N    2  
ATOM 6986  C CA   . ALA A 1 101 ? -48.207  -20.892  -31.893  1.00 0.00 ? 96  ALA A CA   2  
ATOM 6987  C C    . ALA A 1 101 ? -49.216  -22.045  -31.792  1.00 0.00 ? 96  ALA A C    2  
ATOM 6988  O O    . ALA A 1 101 ? -48.830  -23.196  -31.740  1.00 0.00 ? 96  ALA A O    2  
ATOM 6989  C CB   . ALA A 1 101 ? -47.356  -21.035  -33.155  1.00 0.00 ? 96  ALA A CB   2  
ATOM 6990  H H    . ALA A 1 101 ? -46.405  -21.472  -30.863  1.00 0.00 ? 96  ALA A H    2  
ATOM 6991  H HA   . ALA A 1 101 ? -48.712  -19.940  -31.896  1.00 0.00 ? 96  ALA A HA   2  
ATOM 6992  H HB1  . ALA A 1 101 ? -46.597  -21.787  -32.995  1.00 0.00 ? 96  ALA A HB1  2  
ATOM 6993  H HB2  . ALA A 1 101 ? -46.883  -20.090  -33.380  1.00 0.00 ? 96  ALA A HB2  2  
ATOM 6994  H HB3  . ALA A 1 101 ? -47.985  -21.329  -33.982  1.00 0.00 ? 96  ALA A HB3  2  
ATOM 6995  N N    . PRO A 1 102 ? -50.481  -21.702  -31.764  1.00 0.00 ? 97  PRO A N    2  
ATOM 6996  C CA   . PRO A 1 102 ? -51.540  -22.736  -31.666  1.00 0.00 ? 97  PRO A CA   2  
ATOM 6997  C C    . PRO A 1 102 ? -51.672  -23.494  -32.990  1.00 0.00 ? 97  PRO A C    2  
ATOM 6998  O O    . PRO A 1 102 ? -52.471  -23.145  -33.838  1.00 0.00 ? 97  PRO A O    2  
ATOM 6999  C CB   . PRO A 1 102 ? -52.804  -21.932  -31.372  1.00 0.00 ? 97  PRO A CB   2  
ATOM 7000  C CG   . PRO A 1 102 ? -52.529  -20.567  -31.917  1.00 0.00 ? 97  PRO A CG   2  
ATOM 7001  C CD   . PRO A 1 102 ? -51.042  -20.345  -31.821  1.00 0.00 ? 97  PRO A CD   2  
ATOM 7002  H HA   . PRO A 1 102 ? -51.337  -23.416  -30.855  1.00 0.00 ? 97  PRO A HA   2  
ATOM 7003  H HB2  . PRO A 1 102 ? -53.654  -22.375  -31.871  1.00 0.00 ? 97  PRO A HB2  2  
ATOM 7004  H HB3  . PRO A 1 102 ? -52.976  -21.877  -30.309  1.00 0.00 ? 97  PRO A HB3  2  
ATOM 7005  H HG2  . PRO A 1 102 ? -52.848  -20.512  -32.949  1.00 0.00 ? 97  PRO A HG2  2  
ATOM 7006  H HG3  . PRO A 1 102 ? -53.046  -19.824  -31.330  1.00 0.00 ? 97  PRO A HG3  2  
ATOM 7007  H HD2  . PRO A 1 102 ? -50.682  -19.819  -32.696  1.00 0.00 ? 97  PRO A HD2  2  
ATOM 7008  H HD3  . PRO A 1 102 ? -50.796  -19.803  -30.922  1.00 0.00 ? 97  PRO A HD3  2  
ATOM 7009  N N    . GLU A 1 103 ? -50.895  -24.527  -33.173  1.00 0.00 ? 98  GLU A N    2  
ATOM 7010  C CA   . GLU A 1 103 ? -50.975  -25.308  -34.442  1.00 0.00 ? 98  GLU A CA   2  
ATOM 7011  C C    . GLU A 1 103 ? -52.361  -25.944  -34.582  1.00 0.00 ? 98  GLU A C    2  
ATOM 7012  O O    . GLU A 1 103 ? -53.274  -25.632  -33.843  1.00 0.00 ? 98  GLU A O    2  
ATOM 7013  C CB   . GLU A 1 103 ? -49.900  -26.388  -34.316  1.00 0.00 ? 98  GLU A CB   2  
ATOM 7014  C CG   . GLU A 1 103 ? -48.516  -25.750  -34.454  1.00 0.00 ? 98  GLU A CG   2  
ATOM 7015  C CD   . GLU A 1 103 ? -48.306  -25.293  -35.898  1.00 0.00 ? 98  GLU A CD   2  
ATOM 7016  O OE1  . GLU A 1 103 ? -48.723  -24.192  -36.217  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 7017  O OE2  . GLU A 1 103 ? -47.732  -26.052  -36.661  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 7018  H H    . GLU A 1 103 ? -50.259  -24.790  -32.475  1.00 0.00 ? 98  GLU A H    2  
ATOM 7019  H HA   . GLU A 1 103 ? -50.764  -24.675  -35.289  1.00 0.00 ? 98  GLU A HA   2  
ATOM 7020  H HB2  . GLU A 1 103 ? -49.982  -26.867  -33.351  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 7021  H HB3  . GLU A 1 103 ? -50.034  -27.123  -35.095  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 7022  H HG2  . GLU A 1 103 ? -48.445  -24.899  -33.792  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 7023  H HG3  . GLU A 1 103 ? -47.758  -26.474  -34.194  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 7024  N N    . SER A 1 104 ? -52.523  -26.833  -35.525  1.00 0.00 ? 99  SER A N    2  
ATOM 7025  C CA   . SER A 1 104 ? -53.849  -27.491  -35.714  1.00 0.00 ? 99  SER A CA   2  
ATOM 7026  C C    . SER A 1 104 ? -54.055  -28.580  -34.658  1.00 0.00 ? 99  SER A C    2  
ATOM 7027  O O    . SER A 1 104 ? -53.116  -29.210  -34.212  1.00 0.00 ? 99  SER A O    2  
ATOM 7028  C CB   . SER A 1 104 ? -53.792  -28.105  -37.112  1.00 0.00 ? 99  SER A CB   2  
ATOM 7029  O OG   . SER A 1 104 ? -53.432  -27.101  -38.051  1.00 0.00 ? 99  SER A OG   2  
ATOM 7030  H H    . SER A 1 104 ? -51.772  -27.069  -36.109  1.00 0.00 ? 99  SER A H    2  
ATOM 7031  H HA   . SER A 1 104 ? -54.642  -26.761  -35.664  1.00 0.00 ? 99  SER A HA   2  
ATOM 7032  H HB2  . SER A 1 104 ? -53.056  -28.890  -37.132  1.00 0.00 ? 99  SER A HB2  2  
ATOM 7033  H HB3  . SER A 1 104 ? -54.761  -28.517  -37.362  1.00 0.00 ? 99  SER A HB3  2  
ATOM 7034  H HG   . SER A 1 104 ? -54.147  -26.462  -38.092  1.00 0.00 ? 99  SER A HG   2  
ATOM 7035  N N    . SER A 1 105 ? -55.277  -28.804  -34.255  1.00 0.00 ? 100 SER A N    2  
ATOM 7036  C CA   . SER A 1 105 ? -55.547  -29.853  -33.229  1.00 0.00 ? 100 SER A CA   2  
ATOM 7037  C C    . SER A 1 105 ? -56.505  -30.907  -33.791  1.00 0.00 ? 100 SER A C    2  
ATOM 7038  O O    . SER A 1 105 ? -57.361  -31.416  -33.095  1.00 0.00 ? 100 SER A O    2  
ATOM 7039  C CB   . SER A 1 105 ? -56.196  -29.107  -32.063  1.00 0.00 ? 100 SER A CB   2  
ATOM 7040  O OG   . SER A 1 105 ? -57.433  -28.553  -32.491  1.00 0.00 ? 100 SER A OG   2  
ATOM 7041  H H    . SER A 1 105 ? -56.019  -28.284  -34.629  1.00 0.00 ? 100 SER A H    2  
ATOM 7042  H HA   . SER A 1 105 ? -54.626  -30.312  -32.906  1.00 0.00 ? 100 SER A HA   2  
ATOM 7043  H HB2  . SER A 1 105 ? -56.376  -29.792  -31.251  1.00 0.00 ? 100 SER A HB2  2  
ATOM 7044  H HB3  . SER A 1 105 ? -55.533  -28.320  -31.727  1.00 0.00 ? 100 SER A HB3  2  
ATOM 7045  H HG   . SER A 1 105 ? -57.249  -27.718  -32.928  1.00 0.00 ? 100 SER A HG   2  
ATOM 7046  N N    . THR A 1 106 ? -56.365  -31.237  -35.050  1.00 0.00 ? 101 THR A N    2  
ATOM 7047  C CA   . THR A 1 106 ? -57.265  -32.259  -35.669  1.00 0.00 ? 101 THR A CA   2  
ATOM 7048  C C    . THR A 1 106 ? -58.734  -31.889  -35.437  1.00 0.00 ? 101 THR A C    2  
ATOM 7049  O O    . THR A 1 106 ? -59.508  -32.674  -34.925  1.00 0.00 ? 101 THR A O    2  
ATOM 7050  C CB   . THR A 1 106 ? -56.923  -33.573  -34.963  1.00 0.00 ? 101 THR A CB   2  
ATOM 7051  O OG1  . THR A 1 106 ? -55.512  -33.729  -34.913  1.00 0.00 ? 101 THR A OG1  2  
ATOM 7052  C CG2  . THR A 1 106 ? -57.541  -34.742  -35.732  1.00 0.00 ? 101 THR A CG2  2  
ATOM 7053  H H    . THR A 1 106 ? -55.668  -30.811  -35.590  1.00 0.00 ? 101 THR A H    2  
ATOM 7054  H HA   . THR A 1 106 ? -57.062  -32.345  -36.724  1.00 0.00 ? 101 THR A HA   2  
ATOM 7055  H HB   . THR A 1 106 ? -57.321  -33.558  -33.960  1.00 0.00 ? 101 THR A HB   2  
ATOM 7056  H HG1  . THR A 1 106 ? -55.185  -33.756  -35.816  1.00 0.00 ? 101 THR A HG1  2  
ATOM 7057  H HG21 . THR A 1 106 ? -56.870  -35.050  -36.521  1.00 0.00 ? 101 THR A HG21 2  
ATOM 7058  H HG22 . THR A 1 106 ? -58.483  -34.433  -36.161  1.00 0.00 ? 101 THR A HG22 2  
ATOM 7059  H HG23 . THR A 1 106 ? -57.707  -35.570  -35.058  1.00 0.00 ? 101 THR A HG23 2  
ATOM 7060  N N    . SER A 1 107 ? -59.121  -30.699  -35.813  1.00 0.00 ? 102 SER A N    2  
ATOM 7061  C CA   . SER A 1 107 ? -60.539  -30.277  -35.617  1.00 0.00 ? 102 SER A CA   2  
ATOM 7062  C C    . SER A 1 107 ? -61.151  -29.846  -36.952  1.00 0.00 ? 102 SER A C    2  
ATOM 7063  O O    . SER A 1 107 ? -60.652  -28.958  -37.616  1.00 0.00 ? 102 SER A O    2  
ATOM 7064  C CB   . SER A 1 107 ? -60.470  -29.095  -34.652  1.00 0.00 ? 102 SER A CB   2  
ATOM 7065  O OG   . SER A 1 107 ? -61.785  -28.615  -34.403  1.00 0.00 ? 102 SER A OG   2  
ATOM 7066  H H    . SER A 1 107 ? -58.480  -30.083  -36.225  1.00 0.00 ? 102 SER A H    2  
ATOM 7067  H HA   . SER A 1 107 ? -61.113  -31.078  -35.179  1.00 0.00 ? 102 SER A HA   2  
ATOM 7068  H HB2  . SER A 1 107 ? -60.027  -29.412  -33.722  1.00 0.00 ? 102 SER A HB2  2  
ATOM 7069  H HB3  . SER A 1 107 ? -59.865  -28.310  -35.088  1.00 0.00 ? 102 SER A HB3  2  
ATOM 7070  H HG   . SER A 1 107 ? -61.888  -27.779  -34.864  1.00 0.00 ? 102 SER A HG   2  
ATOM 7071  N N    . PHE A 1 108 ? -62.228  -30.469  -37.350  1.00 0.00 ? 103 PHE A N    2  
ATOM 7072  C CA   . PHE A 1 108 ? -62.874  -30.097  -38.642  1.00 0.00 ? 103 PHE A CA   2  
ATOM 7073  C C    . PHE A 1 108 ? -64.308  -29.611  -38.396  1.00 0.00 ? 103 PHE A C    2  
ATOM 7074  O O    . PHE A 1 108 ? -65.254  -30.347  -38.596  1.00 0.00 ? 103 PHE A O    2  
ATOM 7075  C CB   . PHE A 1 108 ? -62.874  -31.386  -39.469  1.00 0.00 ? 103 PHE A CB   2  
ATOM 7076  C CG   . PHE A 1 108 ? -61.916  -31.244  -40.628  1.00 0.00 ? 103 PHE A CG   2  
ATOM 7077  C CD1  . PHE A 1 108 ? -62.095  -30.216  -41.561  1.00 0.00 ? 103 PHE A CD1  2  
ATOM 7078  C CD2  . PHE A 1 108 ? -60.849  -32.139  -40.768  1.00 0.00 ? 103 PHE A CD2  2  
ATOM 7079  C CE1  . PHE A 1 108 ? -61.207  -30.083  -42.635  1.00 0.00 ? 103 PHE A CE1  2  
ATOM 7080  C CE2  . PHE A 1 108 ? -59.960  -32.006  -41.842  1.00 0.00 ? 103 PHE A CE2  2  
ATOM 7081  C CZ   . PHE A 1 108 ? -60.140  -30.978  -42.776  1.00 0.00 ? 103 PHE A CZ   2  
ATOM 7082  H H    . PHE A 1 108 ? -62.612  -31.181  -36.798  1.00 0.00 ? 103 PHE A H    2  
ATOM 7083  H HA   . PHE A 1 108 ? -62.299  -29.336  -39.145  1.00 0.00 ? 103 PHE A HA   2  
ATOM 7084  H HB2  . PHE A 1 108 ? -62.566  -32.213  -38.847  1.00 0.00 ? 103 PHE A HB2  2  
ATOM 7085  H HB3  . PHE A 1 108 ? -63.868  -31.572  -39.847  1.00 0.00 ? 103 PHE A HB3  2  
ATOM 7086  H HD1  . PHE A 1 108 ? -62.918  -29.526  -41.452  1.00 0.00 ? 103 PHE A HD1  2  
ATOM 7087  H HD2  . PHE A 1 108 ? -60.710  -32.932  -40.048  1.00 0.00 ? 103 PHE A HD2  2  
ATOM 7088  H HE1  . PHE A 1 108 ? -61.345  -29.290  -43.355  1.00 0.00 ? 103 PHE A HE1  2  
ATOM 7089  H HE2  . PHE A 1 108 ? -59.137  -32.697  -41.951  1.00 0.00 ? 103 PHE A HE2  2  
ATOM 7090  H HZ   . PHE A 1 108 ? -59.455  -30.875  -43.604  1.00 0.00 ? 103 PHE A HZ   2  
ATOM 7091  N N    . PRO A 1 109 ? -64.422  -28.378  -37.970  1.00 0.00 ? 104 PRO A N    2  
ATOM 7092  C CA   . PRO A 1 109 ? -65.757  -27.791  -37.696  1.00 0.00 ? 104 PRO A CA   2  
ATOM 7093  C C    . PRO A 1 109 ? -66.488  -27.491  -39.010  1.00 0.00 ? 104 PRO A C    2  
ATOM 7094  O O    . PRO A 1 109 ? -65.904  -27.568  -40.073  1.00 0.00 ? 104 PRO A O    2  
ATOM 7095  C CB   . PRO A 1 109 ? -65.435  -26.501  -36.946  1.00 0.00 ? 104 PRO A CB   2  
ATOM 7096  C CG   . PRO A 1 109 ? -64.047  -26.140  -37.373  1.00 0.00 ? 104 PRO A CG   2  
ATOM 7097  C CD   . PRO A 1 109 ? -63.335  -27.426  -37.704  1.00 0.00 ? 104 PRO A CD   2  
ATOM 7098  H HA   . PRO A 1 109 ? -66.343  -28.446  -37.072  1.00 0.00 ? 104 PRO A HA   2  
ATOM 7099  H HB2  . PRO A 1 109 ? -66.132  -25.722  -37.226  1.00 0.00 ? 104 PRO A HB2  2  
ATOM 7100  H HB3  . PRO A 1 109 ? -65.462  -26.667  -35.881  1.00 0.00 ? 104 PRO A HB3  2  
ATOM 7101  H HG2  . PRO A 1 109 ? -64.086  -25.501  -38.244  1.00 0.00 ? 104 PRO A HG2  2  
ATOM 7102  H HG3  . PRO A 1 109 ? -63.533  -25.637  -36.568  1.00 0.00 ? 104 PRO A HG3  2  
ATOM 7103  H HD2  . PRO A 1 109 ? -62.716  -27.299  -38.581  1.00 0.00 ? 104 PRO A HD2  2  
ATOM 7104  H HD3  . PRO A 1 109 ? -62.745  -27.760  -36.865  1.00 0.00 ? 104 PRO A HD3  2  
ATOM 7105  N N    . PRO A 1 110 ? -67.749  -27.158  -38.894  1.00 0.00 ? 105 PRO A N    2  
ATOM 7106  C CA   . PRO A 1 110 ? -68.564  -26.844  -40.094  1.00 0.00 ? 105 PRO A CA   2  
ATOM 7107  C C    . PRO A 1 110 ? -68.170  -25.479  -40.665  1.00 0.00 ? 105 PRO A C    2  
ATOM 7108  O O    . PRO A 1 110 ? -68.177  -25.272  -41.863  1.00 0.00 ? 105 PRO A O    2  
ATOM 7109  C CB   . PRO A 1 110 ? -69.994  -26.818  -39.561  1.00 0.00 ? 105 PRO A CB   2  
ATOM 7110  C CG   . PRO A 1 110 ? -69.860  -26.501  -38.105  1.00 0.00 ? 105 PRO A CG   2  
ATOM 7111  C CD   . PRO A 1 110 ? -68.527  -27.042  -37.654  1.00 0.00 ? 105 PRO A CD   2  
ATOM 7112  H HA   . PRO A 1 110 ? -68.460  -27.616  -40.839  1.00 0.00 ? 105 PRO A HA   2  
ATOM 7113  H HB2  . PRO A 1 110 ? -70.566  -26.050  -40.064  1.00 0.00 ? 105 PRO A HB2  2  
ATOM 7114  H HB3  . PRO A 1 110 ? -70.461  -27.782  -39.688  1.00 0.00 ? 105 PRO A HB3  2  
ATOM 7115  H HG2  . PRO A 1 110 ? -69.895  -25.431  -37.957  1.00 0.00 ? 105 PRO A HG2  2  
ATOM 7116  H HG3  . PRO A 1 110 ? -70.652  -26.978  -37.549  1.00 0.00 ? 105 PRO A HG3  2  
ATOM 7117  H HD2  . PRO A 1 110 ? -68.053  -26.353  -36.968  1.00 0.00 ? 105 PRO A HD2  2  
ATOM 7118  H HD3  . PRO A 1 110 ? -68.646  -28.012  -37.198  1.00 0.00 ? 105 PRO A HD3  2  
ATOM 7119  N N    . ALA A 1 111 ? -67.828  -24.547  -39.816  1.00 0.00 ? 106 ALA A N    2  
ATOM 7120  C CA   . ALA A 1 111 ? -67.433  -23.194  -40.309  1.00 0.00 ? 106 ALA A CA   2  
ATOM 7121  C C    . ALA A 1 111 ? -66.073  -23.263  -41.013  1.00 0.00 ? 106 ALA A C    2  
ATOM 7122  O O    . ALA A 1 111 ? -65.324  -24.199  -40.817  1.00 0.00 ? 106 ALA A O    2  
ATOM 7123  C CB   . ALA A 1 111 ? -67.343  -22.324  -39.055  1.00 0.00 ? 106 ALA A CB   2  
ATOM 7124  H H    . ALA A 1 111 ? -67.830  -24.737  -38.855  1.00 0.00 ? 106 ALA A H    2  
ATOM 7125  H HA   . ALA A 1 111 ? -68.184  -22.802  -40.976  1.00 0.00 ? 106 ALA A HA   2  
ATOM 7126  H HB1  . ALA A 1 111 ? -66.483  -22.620  -38.472  1.00 0.00 ? 106 ALA A HB1  2  
ATOM 7127  H HB2  . ALA A 1 111 ? -68.238  -22.450  -38.464  1.00 0.00 ? 106 ALA A HB2  2  
ATOM 7128  H HB3  . ALA A 1 111 ? -67.244  -21.287  -39.342  1.00 0.00 ? 106 ALA A HB3  2  
ATOM 7129  N N    . PRO A 1 112 ? -65.797  -22.264  -41.813  1.00 0.00 ? 107 PRO A N    2  
ATOM 7130  C CA   . PRO A 1 112 ? -64.510  -22.218  -42.549  1.00 0.00 ? 107 PRO A CA   2  
ATOM 7131  C C    . PRO A 1 112 ? -63.350  -21.905  -41.594  1.00 0.00 ? 107 PRO A C    2  
ATOM 7132  O O    . PRO A 1 112 ? -62.628  -22.790  -41.178  1.00 0.00 ? 107 PRO A O    2  
ATOM 7133  C CB   . PRO A 1 112 ? -64.718  -21.098  -43.567  1.00 0.00 ? 107 PRO A CB   2  
ATOM 7134  C CG   . PRO A 1 112 ? -65.784  -20.225  -42.981  1.00 0.00 ? 107 PRO A CG   2  
ATOM 7135  C CD   . PRO A 1 112 ? -66.643  -21.098  -42.103  1.00 0.00 ? 107 PRO A CD   2  
ATOM 7136  H HA   . PRO A 1 112 ? -64.336  -23.150  -43.061  1.00 0.00 ? 107 PRO A HA   2  
ATOM 7137  H HB2  . PRO A 1 112 ? -63.802  -20.538  -43.699  1.00 0.00 ? 107 PRO A HB2  2  
ATOM 7138  H HB3  . PRO A 1 112 ? -65.051  -21.503  -44.510  1.00 0.00 ? 107 PRO A HB3  2  
ATOM 7139  H HG2  . PRO A 1 112 ? -65.336  -19.435  -42.396  1.00 0.00 ? 107 PRO A HG2  2  
ATOM 7140  H HG3  . PRO A 1 112 ? -66.387  -19.802  -43.770  1.00 0.00 ? 107 PRO A HG3  2  
ATOM 7141  H HD2  . PRO A 1 112 ? -66.901  -20.577  -41.190  1.00 0.00 ? 107 PRO A HD2  2  
ATOM 7142  H HD3  . PRO A 1 112 ? -67.533  -21.407  -42.629  1.00 0.00 ? 107 PRO A HD3  2  
ATOM 7143  N N    . THR A 1 113 ? -63.164  -20.660  -41.243  1.00 0.00 ? 108 THR A N    2  
ATOM 7144  C CA   . THR A 1 113 ? -62.050  -20.305  -40.315  1.00 0.00 ? 108 THR A CA   2  
ATOM 7145  C C    . THR A 1 113 ? -62.596  -20.044  -38.909  1.00 0.00 ? 108 THR A C    2  
ATOM 7146  O O    . THR A 1 113 ? -63.468  -19.219  -38.715  1.00 0.00 ? 108 THR A O    2  
ATOM 7147  C CB   . THR A 1 113 ? -61.439  -19.030  -40.899  1.00 0.00 ? 108 THR A CB   2  
ATOM 7148  O OG1  . THR A 1 113 ? -61.254  -19.193  -42.298  1.00 0.00 ? 108 THR A OG1  2  
ATOM 7149  C CG2  . THR A 1 113 ? -60.089  -18.758  -40.232  1.00 0.00 ? 108 THR A CG2  2  
ATOM 7150  H H    . THR A 1 113 ? -63.754  -19.960  -41.586  1.00 0.00 ? 108 THR A H    2  
ATOM 7151  H HA   . THR A 1 113 ? -61.312  -21.091  -40.294  1.00 0.00 ? 108 THR A HA   2  
ATOM 7152  H HB   . THR A 1 113 ? -62.100  -18.197  -40.716  1.00 0.00 ? 108 THR A HB   2  
ATOM 7153  H HG1  . THR A 1 113 ? -61.482  -18.364  -42.726  1.00 0.00 ? 108 THR A HG1  2  
ATOM 7154  H HG21 . THR A 1 113 ? -60.092  -19.168  -39.233  1.00 0.00 ? 108 THR A HG21 2  
ATOM 7155  H HG22 . THR A 1 113 ? -59.920  -17.692  -40.183  1.00 0.00 ? 108 THR A HG22 2  
ATOM 7156  H HG23 . THR A 1 113 ? -59.302  -19.221  -40.809  1.00 0.00 ? 108 THR A HG23 2  
ATOM 7157  N N    . SER A 1 114 ? -62.091  -20.743  -37.928  1.00 0.00 ? 109 SER A N    2  
ATOM 7158  C CA   . SER A 1 114 ? -62.580  -20.538  -36.533  1.00 0.00 ? 109 SER A CA   2  
ATOM 7159  C C    . SER A 1 114 ? -61.694  -19.525  -35.804  1.00 0.00 ? 109 SER A C    2  
ATOM 7160  O O    . SER A 1 114 ? -60.617  -19.190  -36.256  1.00 0.00 ? 109 SER A O    2  
ATOM 7161  C CB   . SER A 1 114 ? -62.479  -21.913  -35.873  1.00 0.00 ? 109 SER A CB   2  
ATOM 7162  O OG   . SER A 1 114 ? -63.616  -22.122  -35.047  1.00 0.00 ? 109 SER A OG   2  
ATOM 7163  H H    . SER A 1 114 ? -61.390  -21.403  -38.108  1.00 0.00 ? 109 SER A H    2  
ATOM 7164  H HA   . SER A 1 114 ? -63.607  -20.207  -36.539  1.00 0.00 ? 109 SER A HA   2  
ATOM 7165  H HB2  . SER A 1 114 ? -62.446  -22.677  -36.632  1.00 0.00 ? 109 SER A HB2  2  
ATOM 7166  H HB3  . SER A 1 114 ? -61.576  -21.960  -35.279  1.00 0.00 ? 109 SER A HB3  2  
ATOM 7167  H HG   . SER A 1 114 ? -63.390  -21.848  -34.155  1.00 0.00 ? 109 SER A HG   2  
ATOM 7168  N N    . GLY A 1 115 ? -62.141  -19.034  -34.679  1.00 0.00 ? 110 GLY A N    2  
ATOM 7169  C CA   . GLY A 1 115 ? -61.328  -18.042  -33.919  1.00 0.00 ? 110 GLY A CA   2  
ATOM 7170  C C    . GLY A 1 115 ? -62.255  -17.132  -33.111  1.00 0.00 ? 110 GLY A C    2  
ATOM 7171  O O    . GLY A 1 115 ? -63.425  -17.417  -32.941  1.00 0.00 ? 110 GLY A O    2  
ATOM 7172  H H    . GLY A 1 115 ? -63.013  -19.318  -34.333  1.00 0.00 ? 110 GLY A H    2  
ATOM 7173  H HA2  . GLY A 1 115 ? -60.659  -18.564  -33.249  1.00 0.00 ? 110 GLY A HA2  2  
ATOM 7174  H HA3  . GLY A 1 115 ? -60.753  -17.443  -34.608  1.00 0.00 ? 110 GLY A HA3  2  
ATOM 7175  N N    . MET A 1 116 ? -61.743  -16.040  -32.611  1.00 0.00 ? 111 MET A N    2  
ATOM 7176  C CA   . MET A 1 116 ? -62.595  -15.111  -31.812  1.00 0.00 ? 111 MET A CA   2  
ATOM 7177  C C    . MET A 1 116 ? -63.431  -14.227  -32.743  1.00 0.00 ? 111 MET A C    2  
ATOM 7178  O O    . MET A 1 116 ? -62.956  -13.757  -33.759  1.00 0.00 ? 111 MET A O    2  
ATOM 7179  C CB   . MET A 1 116 ? -61.611  -14.262  -31.004  1.00 0.00 ? 111 MET A CB   2  
ATOM 7180  C CG   . MET A 1 116 ? -62.099  -14.152  -29.558  1.00 0.00 ? 111 MET A CG   2  
ATOM 7181  S SD   . MET A 1 116 ? -61.630  -12.541  -28.880  1.00 0.00 ? 111 MET A SD   2  
ATOM 7182  C CE   . MET A 1 116 ? -63.028  -12.357  -27.746  1.00 0.00 ? 111 MET A CE   2  
ATOM 7183  H H    . MET A 1 116 ? -60.797  -15.830  -32.760  1.00 0.00 ? 111 MET A H    2  
ATOM 7184  H HA   . MET A 1 116 ? -63.236  -15.667  -31.146  1.00 0.00 ? 111 MET A HA   2  
ATOM 7185  H HB2  . MET A 1 116 ? -60.636  -14.727  -31.022  1.00 0.00 ? 111 MET A HB2  2  
ATOM 7186  H HB3  . MET A 1 116 ? -61.547  -13.275  -31.437  1.00 0.00 ? 111 MET A HB3  2  
ATOM 7187  H HG2  . MET A 1 116 ? -63.174  -14.254  -29.532  1.00 0.00 ? 111 MET A HG2  2  
ATOM 7188  H HG3  . MET A 1 116 ? -61.649  -14.936  -28.966  1.00 0.00 ? 111 MET A HG3  2  
ATOM 7189  H HE1  . MET A 1 116 ? -63.356  -13.335  -27.420  1.00 0.00 ? 111 MET A HE1  2  
ATOM 7190  H HE2  . MET A 1 116 ? -63.839  -11.858  -28.249  1.00 0.00 ? 111 MET A HE2  2  
ATOM 7191  H HE3  . MET A 1 116 ? -62.722  -11.771  -26.890  1.00 0.00 ? 111 MET A HE3  2  
ATOM 7192  N N    . SER A 1 117 ? -64.671  -13.999  -32.403  1.00 0.00 ? 112 SER A N    2  
ATOM 7193  C CA   . SER A 1 117 ? -65.541  -13.147  -33.267  1.00 0.00 ? 112 SER A CA   2  
ATOM 7194  C C    . SER A 1 117 ? -65.001  -11.715  -33.315  1.00 0.00 ? 112 SER A C    2  
ATOM 7195  O O    . SER A 1 117 ? -64.895  -11.118  -34.369  1.00 0.00 ? 112 SER A O    2  
ATOM 7196  C CB   . SER A 1 117 ? -66.916  -13.179  -32.600  1.00 0.00 ? 112 SER A CB   2  
ATOM 7197  O OG   . SER A 1 117 ? -67.707  -14.195  -33.202  1.00 0.00 ? 112 SER A OG   2  
ATOM 7198  H H    . SER A 1 117 ? -65.031  -14.390  -31.579  1.00 0.00 ? 112 SER A H    2  
ATOM 7199  H HA   . SER A 1 117 ? -65.604  -13.560  -34.261  1.00 0.00 ? 112 SER A HA   2  
ATOM 7200  H HB2  . SER A 1 117 ? -66.804  -13.392  -31.550  1.00 0.00 ? 112 SER A HB2  2  
ATOM 7201  H HB3  . SER A 1 117 ? -67.395  -12.216  -32.720  1.00 0.00 ? 112 SER A HB3  2  
ATOM 7202  H HG   . SER A 1 117 ? -68.120  -14.703  -32.500  1.00 0.00 ? 112 SER A HG   2  
ATOM 7203  N N    . HIS A 1 118 ? -64.661  -11.161  -32.182  1.00 0.00 ? 113 HIS A N    2  
ATOM 7204  C CA   . HIS A 1 118 ? -64.129  -9.766   -32.161  1.00 0.00 ? 113 HIS A CA   2  
ATOM 7205  C C    . HIS A 1 118 ? -62.651  -9.768   -31.751  1.00 0.00 ? 113 HIS A C    2  
ATOM 7206  O O    . HIS A 1 118 ? -62.337  -9.719   -30.578  1.00 0.00 ? 113 HIS A O    2  
ATOM 7207  C CB   . HIS A 1 118 ? -64.976  -9.037   -31.117  1.00 0.00 ? 113 HIS A CB   2  
ATOM 7208  C CG   . HIS A 1 118 ? -65.313  -7.658   -31.615  1.00 0.00 ? 113 HIS A CG   2  
ATOM 7209  N ND1  . HIS A 1 118 ? -64.353  -6.808   -32.143  1.00 0.00 ? 113 HIS A ND1  2  
ATOM 7210  C CD2  . HIS A 1 118 ? -66.498  -6.967   -31.674  1.00 0.00 ? 113 HIS A CD2  2  
ATOM 7211  C CE1  . HIS A 1 118 ? -64.972  -5.665   -32.493  1.00 0.00 ? 113 HIS A CE1  2  
ATOM 7212  N NE2  . HIS A 1 118 ? -66.280  -5.710   -32.229  1.00 0.00 ? 113 HIS A NE2  2  
ATOM 7213  H H    . HIS A 1 118 ? -64.755  -11.661  -31.345  1.00 0.00 ? 113 HIS A H    2  
ATOM 7214  H HA   . HIS A 1 118 ? -64.253  -9.301   -33.127  1.00 0.00 ? 113 HIS A HA   2  
ATOM 7215  H HB2  . HIS A 1 118 ? -65.889  -9.589   -30.944  1.00 0.00 ? 113 HIS A HB2  2  
ATOM 7216  H HB3  . HIS A 1 118 ? -64.422  -8.959   -30.193  1.00 0.00 ? 113 HIS A HB3  2  
ATOM 7217  H HD1  . HIS A 1 118 ? -63.398  -7.004   -32.243  1.00 0.00 ? 113 HIS A HD1  2  
ATOM 7218  H HD2  . HIS A 1 118 ? -67.454  -7.343   -31.341  1.00 0.00 ? 113 HIS A HD2  2  
ATOM 7219  H HE1  . HIS A 1 118 ? -64.471  -4.816   -32.934  1.00 0.00 ? 113 HIS A HE1  2  
ATOM 7220  N N    . PRO A 1 119 ? -61.788  -9.824   -32.735  1.00 0.00 ? 114 PRO A N    2  
ATOM 7221  C CA   . PRO A 1 119 ? -60.330  -9.832   -32.462  1.00 0.00 ? 114 PRO A CA   2  
ATOM 7222  C C    . PRO A 1 119 ? -59.860  -8.443   -32.011  1.00 0.00 ? 114 PRO A C    2  
ATOM 7223  O O    . PRO A 1 119 ? -60.425  -7.442   -32.405  1.00 0.00 ? 114 PRO A O    2  
ATOM 7224  C CB   . PRO A 1 119 ? -59.715  -10.202  -33.809  1.00 0.00 ? 114 PRO A CB   2  
ATOM 7225  C CG   . PRO A 1 119 ? -60.727  -9.783   -34.827  1.00 0.00 ? 114 PRO A CG   2  
ATOM 7226  C CD   . PRO A 1 119 ? -62.081  -9.885   -34.173  1.00 0.00 ? 114 PRO A CD   2  
ATOM 7227  H HA   . PRO A 1 119 ? -60.084  -10.579  -31.725  1.00 0.00 ? 114 PRO A HA   2  
ATOM 7228  H HB2  . PRO A 1 119 ? -58.786  -9.667   -33.956  1.00 0.00 ? 114 PRO A HB2  2  
ATOM 7229  H HB3  . PRO A 1 119 ? -59.550  -11.267  -33.869  1.00 0.00 ? 114 PRO A HB3  2  
ATOM 7230  H HG2  . PRO A 1 119 ? -60.539  -8.764   -35.135  1.00 0.00 ? 114 PRO A HG2  2  
ATOM 7231  H HG3  . PRO A 1 119 ? -60.687  -10.441  -35.681  1.00 0.00 ? 114 PRO A HG3  2  
ATOM 7232  H HD2  . PRO A 1 119 ? -62.708  -9.055   -34.471  1.00 0.00 ? 114 PRO A HD2  2  
ATOM 7233  H HD3  . PRO A 1 119 ? -62.551  -10.825  -34.417  1.00 0.00 ? 114 PRO A HD3  2  
ATOM 7234  N N    . PRO A 1 120 ? -58.837  -8.427   -31.193  1.00 0.00 ? 115 PRO A N    2  
ATOM 7235  C CA   . PRO A 1 120 ? -58.291  -7.143   -30.687  1.00 0.00 ? 115 PRO A CA   2  
ATOM 7236  C C    . PRO A 1 120 ? -57.515  -6.417   -31.792  1.00 0.00 ? 115 PRO A C    2  
ATOM 7237  O O    . PRO A 1 120 ? -57.287  -6.969   -32.851  1.00 0.00 ? 115 PRO A O    2  
ATOM 7238  C CB   . PRO A 1 120 ? -57.358  -7.570   -29.557  1.00 0.00 ? 115 PRO A CB   2  
ATOM 7239  C CG   . PRO A 1 120 ? -56.964  -8.974   -29.887  1.00 0.00 ? 115 PRO A CG   2  
ATOM 7240  C CD   . PRO A 1 120 ? -58.099  -9.584   -30.669  1.00 0.00 ? 115 PRO A CD   2  
ATOM 7241  H HA   . PRO A 1 120 ? -59.080  -6.519   -30.299  1.00 0.00 ? 115 PRO A HA   2  
ATOM 7242  H HB2  . PRO A 1 120 ? -56.487  -6.929   -29.529  1.00 0.00 ? 115 PRO A HB2  2  
ATOM 7243  H HB3  . PRO A 1 120 ? -57.875  -7.544   -28.611  1.00 0.00 ? 115 PRO A HB3  2  
ATOM 7244  H HG2  . PRO A 1 120 ? -56.061  -8.972   -30.483  1.00 0.00 ? 115 PRO A HG2  2  
ATOM 7245  H HG3  . PRO A 1 120 ? -56.806  -9.536   -28.979  1.00 0.00 ? 115 PRO A HG3  2  
ATOM 7246  H HD2  . PRO A 1 120 ? -57.715  -10.191  -31.478  1.00 0.00 ? 115 PRO A HD2  2  
ATOM 7247  H HD3  . PRO A 1 120 ? -58.734  -10.168  -30.023  1.00 0.00 ? 115 PRO A HD3  2  
ATOM 7248  N N    . PRO A 1 121 ? -57.132  -5.197   -31.510  1.00 0.00 ? 116 PRO A N    2  
ATOM 7249  C CA   . PRO A 1 121 ? -56.372  -4.394   -32.500  1.00 0.00 ? 116 PRO A CA   2  
ATOM 7250  C C    . PRO A 1 121 ? -54.941  -4.923   -32.630  1.00 0.00 ? 116 PRO A C    2  
ATOM 7251  O O    . PRO A 1 121 ? -54.560  -5.875   -31.977  1.00 0.00 ? 116 PRO A O    2  
ATOM 7252  C CB   . PRO A 1 121 ? -56.381  -2.988   -31.905  1.00 0.00 ? 116 PRO A CB   2  
ATOM 7253  C CG   . PRO A 1 121 ? -56.567  -3.190   -30.435  1.00 0.00 ? 116 PRO A CG   2  
ATOM 7254  C CD   . PRO A 1 121 ? -57.364  -4.457   -30.262  1.00 0.00 ? 116 PRO A CD   2  
ATOM 7255  H HA   . PRO A 1 121 ? -56.870  -4.395   -33.456  1.00 0.00 ? 116 PRO A HA   2  
ATOM 7256  H HB2  . PRO A 1 121 ? -55.441  -2.491   -32.104  1.00 0.00 ? 116 PRO A HB2  2  
ATOM 7257  H HB3  . PRO A 1 121 ? -57.203  -2.415   -32.305  1.00 0.00 ? 116 PRO A HB3  2  
ATOM 7258  H HG2  . PRO A 1 121 ? -55.604  -3.288   -29.953  1.00 0.00 ? 116 PRO A HG2  2  
ATOM 7259  H HG3  . PRO A 1 121 ? -57.109  -2.359   -30.013  1.00 0.00 ? 116 PRO A HG3  2  
ATOM 7260  H HD2  . PRO A 1 121 ? -57.001  -5.018   -29.411  1.00 0.00 ? 116 PRO A HD2  2  
ATOM 7261  H HD3  . PRO A 1 121 ? -58.413  -4.234   -30.152  1.00 0.00 ? 116 PRO A HD3  2  
ATOM 7262  N N    . ALA A 1 122 ? -54.148  -4.316   -33.472  1.00 0.00 ? 117 ALA A N    2  
ATOM 7263  C CA   . ALA A 1 122 ? -52.743  -4.785   -33.647  1.00 0.00 ? 117 ALA A CA   2  
ATOM 7264  C C    . ALA A 1 122 ? -51.770  -3.816   -32.970  1.00 0.00 ? 117 ALA A C    2  
ATOM 7265  O O    . ALA A 1 122 ? -51.684  -2.658   -33.327  1.00 0.00 ? 117 ALA A O    2  
ATOM 7266  C CB   . ALA A 1 122 ? -52.517  -4.802   -35.159  1.00 0.00 ? 117 ALA A CB   2  
ATOM 7267  H H    . ALA A 1 122 ? -54.477  -3.552   -33.989  1.00 0.00 ? 117 ALA A H    2  
ATOM 7268  H HA   . ALA A 1 122 ? -52.625  -5.780   -33.246  1.00 0.00 ? 117 ALA A HA   2  
ATOM 7269  H HB1  . ALA A 1 122 ? -53.462  -4.945   -35.662  1.00 0.00 ? 117 ALA A HB1  2  
ATOM 7270  H HB2  . ALA A 1 122 ? -51.848  -5.610   -35.414  1.00 0.00 ? 117 ALA A HB2  2  
ATOM 7271  H HB3  . ALA A 1 122 ? -52.083  -3.863   -35.469  1.00 0.00 ? 117 ALA A HB3  2  
ATOM 7272  N N    . ALA A 1 123 ? -51.034  -4.284   -31.994  1.00 0.00 ? 118 ALA A N    2  
ATOM 7273  C CA   . ALA A 1 123 ? -50.060  -3.397   -31.287  1.00 0.00 ? 118 ALA A CA   2  
ATOM 7274  C C    . ALA A 1 123 ? -50.756  -2.130   -30.780  1.00 0.00 ? 118 ALA A C    2  
ATOM 7275  O O    . ALA A 1 123 ? -51.946  -1.950   -30.957  1.00 0.00 ? 118 ALA A O    2  
ATOM 7276  C CB   . ALA A 1 123 ? -49.004  -3.046   -32.337  1.00 0.00 ? 118 ALA A CB   2  
ATOM 7277  H H    . ALA A 1 123 ? -51.121  -5.223   -31.726  1.00 0.00 ? 118 ALA A H    2  
ATOM 7278  H HA   . ALA A 1 123 ? -49.600  -3.926   -30.467  1.00 0.00 ? 118 ALA A HA   2  
ATOM 7279  H HB1  . ALA A 1 123 ? -48.040  -2.946   -31.859  1.00 0.00 ? 118 ALA A HB1  2  
ATOM 7280  H HB2  . ALA A 1 123 ? -49.267  -2.114   -32.815  1.00 0.00 ? 118 ALA A HB2  2  
ATOM 7281  H HB3  . ALA A 1 123 ? -48.958  -3.831   -33.078  1.00 0.00 ? 118 ALA A HB3  2  
ATOM 7282  N N    . ARG A 1 124 ? -50.021  -1.252   -30.150  1.00 0.00 ? 119 ARG A N    2  
ATOM 7283  C CA   . ARG A 1 124 ? -50.635  0.005    -29.629  1.00 0.00 ? 119 ARG A CA   2  
ATOM 7284  C C    . ARG A 1 124 ? -49.542  0.983    -29.184  1.00 0.00 ? 119 ARG A C    2  
ATOM 7285  O O    . ARG A 1 124 ? -48.365  0.699    -29.283  1.00 0.00 ? 119 ARG A O    2  
ATOM 7286  C CB   . ARG A 1 124 ? -51.488  -0.431   -28.433  1.00 0.00 ? 119 ARG A CB   2  
ATOM 7287  C CG   . ARG A 1 124 ? -50.609  -1.138   -27.395  1.00 0.00 ? 119 ARG A CG   2  
ATOM 7288  C CD   . ARG A 1 124 ? -50.871  -2.646   -27.439  1.00 0.00 ? 119 ARG A CD   2  
ATOM 7289  N NE   . ARG A 1 124 ? -52.249  -2.813   -26.900  1.00 0.00 ? 119 ARG A NE   2  
ATOM 7290  C CZ   . ARG A 1 124 ? -52.430  -3.360   -25.729  1.00 0.00 ? 119 ARG A CZ   2  
ATOM 7291  N NH1  . ARG A 1 124 ? -51.910  -2.812   -24.665  1.00 0.00 ? 119 ARG A NH1  2  
ATOM 7292  N NH2  . ARG A 1 124 ? -53.131  -4.456   -25.622  1.00 0.00 ? 119 ARG A NH2  2  
ATOM 7293  H H    . ARG A 1 124 ? -49.065  -1.419   -30.019  1.00 0.00 ? 119 ARG A H    2  
ATOM 7294  H HA   . ARG A 1 124 ? -51.261  0.458    -30.381  1.00 0.00 ? 119 ARG A HA   2  
ATOM 7295  H HB2  . ARG A 1 124 ? -51.947  0.438    -27.984  1.00 0.00 ? 119 ARG A HB2  2  
ATOM 7296  H HB3  . ARG A 1 124 ? -52.258  -1.108   -28.771  1.00 0.00 ? 119 ARG A HB3  2  
ATOM 7297  H HG2  . ARG A 1 124 ? -49.568  -0.947   -27.615  1.00 0.00 ? 119 ARG A HG2  2  
ATOM 7298  H HG3  . ARG A 1 124 ? -50.843  -0.763   -26.411  1.00 0.00 ? 119 ARG A HG3  2  
ATOM 7299  H HD2  . ARG A 1 124 ? -50.816  -3.007   -28.456  1.00 0.00 ? 119 ARG A HD2  2  
ATOM 7300  H HD3  . ARG A 1 124 ? -50.164  -3.169   -26.814  1.00 0.00 ? 119 ARG A HD3  2  
ATOM 7301  H HE   . ARG A 1 124 ? -53.021  -2.512   -27.424  1.00 0.00 ? 119 ARG A HE   2  
ATOM 7302  H HH11 . ARG A 1 124 ? -51.373  -1.972   -24.747  1.00 0.00 ? 119 ARG A HH11 2  
ATOM 7303  H HH12 . ARG A 1 124 ? -52.049  -3.231   -23.768  1.00 0.00 ? 119 ARG A HH12 2  
ATOM 7304  H HH21 . ARG A 1 124 ? -53.529  -4.877   -26.437  1.00 0.00 ? 119 ARG A HH21 2  
ATOM 7305  H HH22 . ARG A 1 124 ? -53.269  -4.876   -24.725  1.00 0.00 ? 119 ARG A HH22 2  
ATOM 7306  N N    . GLU A 1 125 ? -49.926  2.135    -28.694  1.00 0.00 ? 120 GLU A N    2  
ATOM 7307  C CA   . GLU A 1 125 ? -48.915  3.140    -28.239  1.00 0.00 ? 120 GLU A CA   2  
ATOM 7308  C C    . GLU A 1 125 ? -47.882  3.400    -29.341  1.00 0.00 ? 120 GLU A C    2  
ATOM 7309  O O    . GLU A 1 125 ? -47.987  2.883    -30.436  1.00 0.00 ? 120 GLU A O    2  
ATOM 7310  C CB   . GLU A 1 125 ? -48.247  2.511    -27.014  1.00 0.00 ? 120 GLU A CB   2  
ATOM 7311  C CG   . GLU A 1 125 ? -48.860  3.095    -25.739  1.00 0.00 ? 120 GLU A CG   2  
ATOM 7312  C CD   . GLU A 1 125 ? -47.837  3.028    -24.604  1.00 0.00 ? 120 GLU A CD   2  
ATOM 7313  O OE1  . GLU A 1 125 ? -46.675  3.293    -24.864  1.00 0.00 ? 120 GLU A OE1  2  
ATOM 7314  O OE2  . GLU A 1 125 ? -48.233  2.713    -23.494  1.00 0.00 ? 120 GLU A OE2  2  
ATOM 7315  H H    . GLU A 1 125 ? -50.881  2.340    -28.624  1.00 0.00 ? 120 GLU A H    2  
ATOM 7316  H HA   . GLU A 1 125 ? -49.403  4.060    -27.958  1.00 0.00 ? 120 GLU A HA   2  
ATOM 7317  H HB2  . GLU A 1 125 ? -48.399  1.442    -27.030  1.00 0.00 ? 120 GLU A HB2  2  
ATOM 7318  H HB3  . GLU A 1 125 ? -47.189  2.724    -27.032  1.00 0.00 ? 120 GLU A HB3  2  
ATOM 7319  H HG2  . GLU A 1 125 ? -49.140  4.124    -25.914  1.00 0.00 ? 120 GLU A HG2  2  
ATOM 7320  H HG3  . GLU A 1 125 ? -49.735  2.524    -25.467  1.00 0.00 ? 120 GLU A HG3  2  
ATOM 7321  N N    . ASP A 1 126 ? -46.887  4.198    -29.058  1.00 0.00 ? 121 ASP A N    2  
ATOM 7322  C CA   . ASP A 1 126 ? -45.848  4.492    -30.088  1.00 0.00 ? 121 ASP A CA   2  
ATOM 7323  C C    . ASP A 1 126 ? -44.532  4.896    -29.417  1.00 0.00 ? 121 ASP A C    2  
ATOM 7324  O O    . ASP A 1 126 ? -43.500  4.295    -29.644  1.00 0.00 ? 121 ASP A O    2  
ATOM 7325  C CB   . ASP A 1 126 ? -46.414  5.659    -30.899  1.00 0.00 ? 121 ASP A CB   2  
ATOM 7326  C CG   . ASP A 1 126 ? -47.432  5.132    -31.911  1.00 0.00 ? 121 ASP A CG   2  
ATOM 7327  O OD1  . ASP A 1 126 ? -47.072  4.261    -32.686  1.00 0.00 ? 121 ASP A OD1  2  
ATOM 7328  O OD2  . ASP A 1 126 ? -48.555  5.609    -31.895  1.00 0.00 ? 121 ASP A OD2  2  
ATOM 7329  H H    . ASP A 1 126 ? -46.822  4.604    -28.169  1.00 0.00 ? 121 ASP A H    2  
ATOM 7330  H HA   . ASP A 1 126 ? -45.699  3.638    -30.728  1.00 0.00 ? 121 ASP A HA   2  
ATOM 7331  H HB2  . ASP A 1 126 ? -46.896  6.359    -30.232  1.00 0.00 ? 121 ASP A HB2  2  
ATOM 7332  H HB3  . ASP A 1 126 ? -45.611  6.155    -31.424  1.00 0.00 ? 121 ASP A HB3  2  
ATOM 7333  N N    . LYS A 1 127 ? -44.561  5.910    -28.595  1.00 0.00 ? 122 LYS A N    2  
ATOM 7334  C CA   . LYS A 1 127 ? -43.312  6.356    -27.911  1.00 0.00 ? 122 LYS A CA   2  
ATOM 7335  C C    . LYS A 1 127 ? -42.989  5.430    -26.734  1.00 0.00 ? 122 LYS A C    2  
ATOM 7336  O O    . LYS A 1 127 ? -43.853  5.074    -25.957  1.00 0.00 ? 122 LYS A O    2  
ATOM 7337  C CB   . LYS A 1 127 ? -43.614  7.770    -27.413  1.00 0.00 ? 122 LYS A CB   2  
ATOM 7338  C CG   . LYS A 1 127 ? -42.359  8.640    -27.543  1.00 0.00 ? 122 LYS A CG   2  
ATOM 7339  C CD   . LYS A 1 127 ? -42.687  9.911    -28.334  1.00 0.00 ? 122 LYS A CD   2  
ATOM 7340  C CE   . LYS A 1 127 ? -42.757  11.107   -27.381  1.00 0.00 ? 122 LYS A CE   2  
ATOM 7341  N NZ   . LYS A 1 127 ? -43.524  12.145   -28.123  1.00 0.00 ? 122 LYS A NZ   2  
ATOM 7342  H H    . LYS A 1 127 ? -45.405  6.381    -28.429  1.00 0.00 ? 122 LYS A H    2  
ATOM 7343  H HA   . LYS A 1 127 ? -42.489  6.380    -28.608  1.00 0.00 ? 122 LYS A HA   2  
ATOM 7344  H HB2  . LYS A 1 127 ? -44.414  8.195    -28.004  1.00 0.00 ? 122 LYS A HB2  2  
ATOM 7345  H HB3  . LYS A 1 127 ? -43.916  7.730    -26.377  1.00 0.00 ? 122 LYS A HB3  2  
ATOM 7346  H HG2  . LYS A 1 127 ? -42.007  8.910    -26.557  1.00 0.00 ? 122 LYS A HG2  2  
ATOM 7347  H HG3  . LYS A 1 127 ? -41.589  8.088    -28.060  1.00 0.00 ? 122 LYS A HG3  2  
ATOM 7348  H HD2  . LYS A 1 127 ? -41.917  10.083   -29.072  1.00 0.00 ? 122 LYS A HD2  2  
ATOM 7349  H HD3  . LYS A 1 127 ? -43.639  9.793    -28.830  1.00 0.00 ? 122 LYS A HD3  2  
ATOM 7350  H HE2  . LYS A 1 127 ? -43.273  10.831   -26.471  1.00 0.00 ? 122 LYS A HE2  2  
ATOM 7351  H HE3  . LYS A 1 127 ? -41.766  11.469   -27.158  1.00 0.00 ? 122 LYS A HE3  2  
ATOM 7352  H HZ1  . LYS A 1 127 ? -43.094  12.293   -29.058  1.00 0.00 ? 122 LYS A HZ1  2  
ATOM 7353  H HZ2  . LYS A 1 127 ? -43.507  13.037   -27.587  1.00 0.00 ? 122 LYS A HZ2  2  
ATOM 7354  H HZ3  . LYS A 1 127 ? -44.508  11.831   -28.243  1.00 0.00 ? 122 LYS A HZ3  2  
ATOM 7355  N N    . SER A 1 128 ? -41.749  5.041    -26.599  1.00 0.00 ? 123 SER A N    2  
ATOM 7356  C CA   . SER A 1 128 ? -41.364  4.140    -25.473  1.00 0.00 ? 123 SER A CA   2  
ATOM 7357  C C    . SER A 1 128 ? -39.837  4.073    -25.349  1.00 0.00 ? 123 SER A C    2  
ATOM 7358  O O    . SER A 1 128 ? -39.211  3.184    -25.892  1.00 0.00 ? 123 SER A O    2  
ATOM 7359  C CB   . SER A 1 128 ? -41.936  2.772    -25.847  1.00 0.00 ? 123 SER A CB   2  
ATOM 7360  O OG   . SER A 1 128 ? -41.228  2.255    -26.967  1.00 0.00 ? 123 SER A OG   2  
ATOM 7361  H H    . SER A 1 128 ? -41.070  5.342    -27.238  1.00 0.00 ? 123 SER A H    2  
ATOM 7362  H HA   . SER A 1 128 ? -41.803  4.483    -24.550  1.00 0.00 ? 123 SER A HA   2  
ATOM 7363  H HB2  . SER A 1 128 ? -41.828  2.095    -25.017  1.00 0.00 ? 123 SER A HB2  2  
ATOM 7364  H HB3  . SER A 1 128 ? -42.985  2.876    -26.089  1.00 0.00 ? 123 SER A HB3  2  
ATOM 7365  H HG   . SER A 1 128 ? -41.507  2.742    -27.745  1.00 0.00 ? 123 SER A HG   2  
ATOM 7366  N N    . PRO A 1 129 ? -39.284  5.022    -24.636  1.00 0.00 ? 124 PRO A N    2  
ATOM 7367  C CA   . PRO A 1 129 ? -37.813  5.067    -24.444  1.00 0.00 ? 124 PRO A CA   2  
ATOM 7368  C C    . PRO A 1 129 ? -37.364  3.962    -23.483  1.00 0.00 ? 124 PRO A C    2  
ATOM 7369  O O    . PRO A 1 129 ? -36.448  3.215    -23.767  1.00 0.00 ? 124 PRO A O    2  
ATOM 7370  C CB   . PRO A 1 129 ? -37.572  6.447    -23.838  1.00 0.00 ? 124 PRO A CB   2  
ATOM 7371  C CG   . PRO A 1 129 ? -38.863  6.813    -23.179  1.00 0.00 ? 124 PRO A CG   2  
ATOM 7372  C CD   . PRO A 1 129 ? -39.963  6.128    -23.949  1.00 0.00 ? 124 PRO A CD   2  
ATOM 7373  H HA   . PRO A 1 129 ? -37.302  4.983    -25.389  1.00 0.00 ? 124 PRO A HA   2  
ATOM 7374  H HB2  . PRO A 1 129 ? -36.773  6.402    -23.110  1.00 0.00 ? 124 PRO A HB2  2  
ATOM 7375  H HB3  . PRO A 1 129 ? -37.337  7.162    -24.611  1.00 0.00 ? 124 PRO A HB3  2  
ATOM 7376  H HG2  . PRO A 1 129 ? -38.861  6.472    -22.152  1.00 0.00 ? 124 PRO A HG2  2  
ATOM 7377  H HG3  . PRO A 1 129 ? -39.006  7.881    -23.214  1.00 0.00 ? 124 PRO A HG3  2  
ATOM 7378  H HD2  . PRO A 1 129 ? -40.719  5.752    -23.272  1.00 0.00 ? 124 PRO A HD2  2  
ATOM 7379  H HD3  . PRO A 1 129 ? -40.398  6.803    -24.670  1.00 0.00 ? 124 PRO A HD3  2  
ATOM 7380  N N    . SER A 1 130 ? -38.003  3.854    -22.347  1.00 0.00 ? 125 SER A N    2  
ATOM 7381  C CA   . SER A 1 130 ? -37.621  2.799    -21.357  1.00 0.00 ? 125 SER A CA   2  
ATOM 7382  C C    . SER A 1 130 ? -36.113  2.837    -21.086  1.00 0.00 ? 125 SER A C    2  
ATOM 7383  O O    . SER A 1 130 ? -35.415  3.729    -21.529  1.00 0.00 ? 125 SER A O    2  
ATOM 7384  C CB   . SER A 1 130 ? -38.025  1.473    -22.008  1.00 0.00 ? 125 SER A CB   2  
ATOM 7385  O OG   . SER A 1 130 ? -36.962  0.998    -22.825  1.00 0.00 ? 125 SER A OG   2  
ATOM 7386  H H    . SER A 1 130 ? -38.738  4.470    -22.142  1.00 0.00 ? 125 SER A H    2  
ATOM 7387  H HA   . SER A 1 130 ? -38.169  2.936    -20.438  1.00 0.00 ? 125 SER A HA   2  
ATOM 7388  H HB2  . SER A 1 130 ? -38.236  0.745    -21.244  1.00 0.00 ? 125 SER A HB2  2  
ATOM 7389  H HB3  . SER A 1 130 ? -38.913  1.626    -22.609  1.00 0.00 ? 125 SER A HB3  2  
ATOM 7390  H HG   . SER A 1 130 ? -36.517  0.292    -22.351  1.00 0.00 ? 125 SER A HG   2  
ATOM 7391  N N    . GLU A 1 131 ? -35.607  1.875    -20.361  1.00 0.00 ? 126 GLU A N    2  
ATOM 7392  C CA   . GLU A 1 131 ? -34.145  1.854    -20.059  1.00 0.00 ? 126 GLU A CA   2  
ATOM 7393  C C    . GLU A 1 131 ? -33.485  0.637    -20.713  1.00 0.00 ? 126 GLU A C    2  
ATOM 7394  O O    . GLU A 1 131 ? -32.323  0.667    -21.070  1.00 0.00 ? 126 GLU A O    2  
ATOM 7395  C CB   . GLU A 1 131 ? -34.057  1.759    -18.536  1.00 0.00 ? 126 GLU A CB   2  
ATOM 7396  C CG   . GLU A 1 131 ? -32.612  1.992    -18.092  1.00 0.00 ? 126 GLU A CG   2  
ATOM 7397  C CD   . GLU A 1 131 ? -32.601  2.725    -16.749  1.00 0.00 ? 126 GLU A CD   2  
ATOM 7398  O OE1  . GLU A 1 131 ? -32.894  2.091    -15.748  1.00 0.00 ? 126 GLU A OE1  2  
ATOM 7399  O OE2  . GLU A 1 131 ? -32.301  3.907    -16.744  1.00 0.00 ? 126 GLU A OE2  2  
ATOM 7400  H H    . GLU A 1 131 ? -36.188  1.167    -20.013  1.00 0.00 ? 126 GLU A H    2  
ATOM 7401  H HA   . GLU A 1 131 ? -33.678  2.764    -20.399  1.00 0.00 ? 126 GLU A HA   2  
ATOM 7402  H HB2  . GLU A 1 131 ? -34.697  2.508    -18.091  1.00 0.00 ? 126 GLU A HB2  2  
ATOM 7403  H HB3  . GLU A 1 131 ? -34.376  0.778    -18.217  1.00 0.00 ? 126 GLU A HB3  2  
ATOM 7404  H HG2  . GLU A 1 131 ? -32.110  1.040    -17.988  1.00 0.00 ? 126 GLU A HG2  2  
ATOM 7405  H HG3  . GLU A 1 131 ? -32.100  2.590    -18.830  1.00 0.00 ? 126 GLU A HG3  2  
ATOM 7406  N N    . GLU A 1 132 ? -34.218  -0.431   -20.871  1.00 0.00 ? 127 GLU A N    2  
ATOM 7407  C CA   . GLU A 1 132 ? -33.636  -1.653   -21.501  1.00 0.00 ? 127 GLU A CA   2  
ATOM 7408  C C    . GLU A 1 132 ? -34.689  -2.351   -22.366  1.00 0.00 ? 127 GLU A C    2  
ATOM 7409  O O    . GLU A 1 132 ? -35.760  -1.825   -22.602  1.00 0.00 ? 127 GLU A O    2  
ATOM 7410  C CB   . GLU A 1 132 ? -33.223  -2.547   -20.329  1.00 0.00 ? 127 GLU A CB   2  
ATOM 7411  C CG   . GLU A 1 132 ? -31.696  -2.603   -20.240  1.00 0.00 ? 127 GLU A CG   2  
ATOM 7412  C CD   . GLU A 1 132 ? -31.274  -2.749   -18.776  1.00 0.00 ? 127 GLU A CD   2  
ATOM 7413  O OE1  . GLU A 1 132 ? -31.709  -1.942   -17.972  1.00 0.00 ? 127 GLU A OE1  2  
ATOM 7414  O OE2  . GLU A 1 132 ? -30.524  -3.666   -18.486  1.00 0.00 ? 127 GLU A OE2  2  
ATOM 7415  H H    . GLU A 1 132 ? -35.151  -0.431   -20.575  1.00 0.00 ? 127 GLU A H    2  
ATOM 7416  H HA   . GLU A 1 132 ? -32.772  -1.396   -22.093  1.00 0.00 ? 127 GLU A HA   2  
ATOM 7417  H HB2  . GLU A 1 132 ? -33.624  -2.144   -19.410  1.00 0.00 ? 127 GLU A HB2  2  
ATOM 7418  H HB3  . GLU A 1 132 ? -33.608  -3.544   -20.483  1.00 0.00 ? 127 GLU A HB3  2  
ATOM 7419  H HG2  . GLU A 1 132 ? -31.333  -3.448   -20.806  1.00 0.00 ? 127 GLU A HG2  2  
ATOM 7420  H HG3  . GLU A 1 132 ? -31.278  -1.693   -20.643  1.00 0.00 ? 127 GLU A HG3  2  
ATOM 7421  N N    . SER A 1 133 ? -34.393  -3.532   -22.841  1.00 0.00 ? 128 SER A N    2  
ATOM 7422  C CA   . SER A 1 133 ? -35.376  -4.265   -23.691  1.00 0.00 ? 128 SER A CA   2  
ATOM 7423  C C    . SER A 1 133 ? -34.994  -5.745   -23.787  1.00 0.00 ? 128 SER A C    2  
ATOM 7424  O O    . SER A 1 133 ? -33.952  -6.093   -24.309  1.00 0.00 ? 128 SER A O    2  
ATOM 7425  C CB   . SER A 1 133 ? -35.290  -3.597   -25.063  1.00 0.00 ? 128 SER A CB   2  
ATOM 7426  O OG   . SER A 1 133 ? -36.447  -2.799   -25.270  1.00 0.00 ? 128 SER A OG   2  
ATOM 7427  H H    . SER A 1 133 ? -33.524  -3.937   -22.638  1.00 0.00 ? 128 SER A H    2  
ATOM 7428  H HA   . SER A 1 133 ? -36.372  -4.158   -23.292  1.00 0.00 ? 128 SER A HA   2  
ATOM 7429  H HB2  . SER A 1 133 ? -34.414  -2.970   -25.107  1.00 0.00 ? 128 SER A HB2  2  
ATOM 7430  H HB3  . SER A 1 133 ? -35.222  -4.358   -25.830  1.00 0.00 ? 128 SER A HB3  2  
ATOM 7431  H HG   . SER A 1 133 ? -36.219  -1.888   -25.071  1.00 0.00 ? 128 SER A HG   2  
ATOM 7432  N N    . ALA A 1 134 ? -35.831  -6.615   -23.290  1.00 0.00 ? 129 ALA A N    2  
ATOM 7433  C CA   . ALA A 1 134 ? -35.521  -8.074   -23.352  1.00 0.00 ? 129 ALA A CA   2  
ATOM 7434  C C    . ALA A 1 134 ? -36.821  -8.886   -23.403  1.00 0.00 ? 129 ALA A C    2  
ATOM 7435  O O    . ALA A 1 134 ? -37.126  -9.625   -22.487  1.00 0.00 ? 129 ALA A O    2  
ATOM 7436  C CB   . ALA A 1 134 ? -34.749  -8.370   -22.066  1.00 0.00 ? 129 ALA A CB   2  
ATOM 7437  H H    . ALA A 1 134 ? -36.665  -6.310   -22.876  1.00 0.00 ? 129 ALA A H    2  
ATOM 7438  H HA   . ALA A 1 134 ? -34.906  -8.292   -24.211  1.00 0.00 ? 129 ALA A HA   2  
ATOM 7439  H HB1  . ALA A 1 134 ? -33.731  -8.023   -22.169  1.00 0.00 ? 129 ALA A HB1  2  
ATOM 7440  H HB2  . ALA A 1 134 ? -34.749  -9.435   -21.883  1.00 0.00 ? 129 ALA A HB2  2  
ATOM 7441  H HB3  . ALA A 1 134 ? -35.220  -7.863   -21.237  1.00 0.00 ? 129 ALA A HB3  2  
ATOM 7442  N N    . PRO A 1 135 ? -37.549  -8.721   -24.479  1.00 0.00 ? 130 PRO A N    2  
ATOM 7443  C CA   . PRO A 1 135 ? -38.830  -9.450   -24.648  1.00 0.00 ? 130 PRO A CA   2  
ATOM 7444  C C    . PRO A 1 135 ? -38.571  -10.929  -24.946  1.00 0.00 ? 130 PRO A C    2  
ATOM 7445  O O    . PRO A 1 135 ? -37.874  -11.270  -25.882  1.00 0.00 ? 130 PRO A O    2  
ATOM 7446  C CB   . PRO A 1 135 ? -39.480  -8.761   -25.845  1.00 0.00 ? 130 PRO A CB   2  
ATOM 7447  C CG   . PRO A 1 135 ? -38.344  -8.170   -26.616  1.00 0.00 ? 130 PRO A CG   2  
ATOM 7448  C CD   . PRO A 1 135 ? -37.253  -7.852   -25.626  1.00 0.00 ? 130 PRO A CD   2  
ATOM 7449  H HA   . PRO A 1 135 ? -39.451  -9.338   -23.774  1.00 0.00 ? 130 PRO A HA   2  
ATOM 7450  H HB2  . PRO A 1 135 ? -40.012  -9.483   -26.449  1.00 0.00 ? 130 PRO A HB2  2  
ATOM 7451  H HB3  . PRO A 1 135 ? -40.147  -7.980   -25.513  1.00 0.00 ? 130 PRO A HB3  2  
ATOM 7452  H HG2  . PRO A 1 135 ? -37.986  -8.882   -27.348  1.00 0.00 ? 130 PRO A HG2  2  
ATOM 7453  H HG3  . PRO A 1 135 ? -38.663  -7.264   -27.107  1.00 0.00 ? 130 PRO A HG3  2  
ATOM 7454  H HD2  . PRO A 1 135 ? -36.284  -8.088   -26.044  1.00 0.00 ? 130 PRO A HD2  2  
ATOM 7455  H HD3  . PRO A 1 135 ? -37.299  -6.816   -25.329  1.00 0.00 ? 130 PRO A HD3  2  
ATOM 7456  N N    . THR A 1 136 ? -39.128  -11.808  -24.157  1.00 0.00 ? 131 THR A N    2  
ATOM 7457  C CA   . THR A 1 136 ? -38.916  -13.267  -24.393  1.00 0.00 ? 131 THR A CA   2  
ATOM 7458  C C    . THR A 1 136 ? -40.219  -14.033  -24.144  1.00 0.00 ? 131 THR A C    2  
ATOM 7459  O O    . THR A 1 136 ? -40.684  -14.775  -24.987  1.00 0.00 ? 131 THR A O    2  
ATOM 7460  C CB   . THR A 1 136 ? -37.843  -13.689  -23.384  1.00 0.00 ? 131 THR A CB   2  
ATOM 7461  O OG1  . THR A 1 136 ? -37.042  -12.566  -23.040  1.00 0.00 ? 131 THR A OG1  2  
ATOM 7462  C CG2  . THR A 1 136 ? -36.960  -14.775  -24.000  1.00 0.00 ? 131 THR A CG2  2  
ATOM 7463  H H    . THR A 1 136 ? -39.687  -11.510  -23.410  1.00 0.00 ? 131 THR A H    2  
ATOM 7464  H HA   . THR A 1 136 ? -38.565  -13.438  -25.398  1.00 0.00 ? 131 THR A HA   2  
ATOM 7465  H HB   . THR A 1 136 ? -38.317  -14.079  -22.496  1.00 0.00 ? 131 THR A HB   2  
ATOM 7466  H HG1  . THR A 1 136 ? -37.050  -12.477  -22.084  1.00 0.00 ? 131 THR A HG1  2  
ATOM 7467  H HG21 . THR A 1 136 ? -36.068  -14.324  -24.409  1.00 0.00 ? 131 THR A HG21 2  
ATOM 7468  H HG22 . THR A 1 136 ? -37.503  -15.277  -24.787  1.00 0.00 ? 131 THR A HG22 2  
ATOM 7469  H HG23 . THR A 1 136 ? -36.685  -15.490  -23.239  1.00 0.00 ? 131 THR A HG23 2  
ATOM 7470  N N    . THR A 1 137 ? -40.812  -13.856  -22.991  1.00 0.00 ? 132 THR A N    2  
ATOM 7471  C CA   . THR A 1 137 ? -42.089  -14.568  -22.678  1.00 0.00 ? 132 THR A CA   2  
ATOM 7472  C C    . THR A 1 137 ? -41.940  -16.074  -22.919  1.00 0.00 ? 132 THR A C    2  
ATOM 7473  O O    . THR A 1 137 ? -42.834  -16.721  -23.427  1.00 0.00 ? 132 THR A O    2  
ATOM 7474  C CB   . THR A 1 137 ? -43.124  -13.972  -23.635  1.00 0.00 ? 132 THR A CB   2  
ATOM 7475  O OG1  . THR A 1 137 ? -42.988  -12.559  -23.657  1.00 0.00 ? 132 THR A OG1  2  
ATOM 7476  C CG2  . THR A 1 137 ? -44.531  -14.344  -23.164  1.00 0.00 ? 132 THR A CG2  2  
ATOM 7477  H H    . THR A 1 137 ? -40.417  -13.250  -22.329  1.00 0.00 ? 132 THR A H    2  
ATOM 7478  H HA   . THR A 1 137 ? -42.382  -14.379  -21.658  1.00 0.00 ? 132 THR A HA   2  
ATOM 7479  H HB   . THR A 1 137 ? -42.966  -14.365  -24.627  1.00 0.00 ? 132 THR A HB   2  
ATOM 7480  H HG1  . THR A 1 137 ? -43.112  -12.235  -22.761  1.00 0.00 ? 132 THR A HG1  2  
ATOM 7481  H HG21 . THR A 1 137 ? -45.255  -13.714  -23.659  1.00 0.00 ? 132 THR A HG21 2  
ATOM 7482  H HG22 . THR A 1 137 ? -44.603  -14.204  -22.096  1.00 0.00 ? 132 THR A HG22 2  
ATOM 7483  H HG23 . THR A 1 137 ? -44.730  -15.378  -23.405  1.00 0.00 ? 132 THR A HG23 2  
ATOM 7484  N N    . SER A 1 138 ? -40.818  -16.635  -22.555  1.00 0.00 ? 133 SER A N    2  
ATOM 7485  C CA   . SER A 1 138 ? -40.613  -18.099  -22.760  1.00 0.00 ? 133 SER A CA   2  
ATOM 7486  C C    . SER A 1 138 ? -41.387  -18.893  -21.699  1.00 0.00 ? 133 SER A C    2  
ATOM 7487  O O    . SER A 1 138 ? -41.087  -18.804  -20.525  1.00 0.00 ? 133 SER A O    2  
ATOM 7488  C CB   . SER A 1 138 ? -39.109  -18.315  -22.598  1.00 0.00 ? 133 SER A CB   2  
ATOM 7489  O OG   . SER A 1 138 ? -38.841  -19.708  -22.504  1.00 0.00 ? 133 SER A OG   2  
ATOM 7490  H H    . SER A 1 138 ? -40.111  -16.094  -22.144  1.00 0.00 ? 133 SER A H    2  
ATOM 7491  H HA   . SER A 1 138 ? -40.921  -18.387  -23.752  1.00 0.00 ? 133 SER A HA   2  
ATOM 7492  H HB2  . SER A 1 138 ? -38.591  -17.912  -23.452  1.00 0.00 ? 133 SER A HB2  2  
ATOM 7493  H HB3  . SER A 1 138 ? -38.769  -17.811  -21.702  1.00 0.00 ? 133 SER A HB3  2  
ATOM 7494  H HG   . SER A 1 138 ? -37.916  -19.818  -22.274  1.00 0.00 ? 133 SER A HG   2  
ATOM 7495  N N    . PRO A 1 139 ? -42.364  -19.648  -22.142  1.00 0.00 ? 134 PRO A N    2  
ATOM 7496  C CA   . PRO A 1 139 ? -43.178  -20.458  -21.201  1.00 0.00 ? 134 PRO A CA   2  
ATOM 7497  C C    . PRO A 1 139 ? -42.354  -21.624  -20.648  1.00 0.00 ? 134 PRO A C    2  
ATOM 7498  O O    . PRO A 1 139 ? -42.147  -22.620  -21.312  1.00 0.00 ? 134 PRO A O    2  
ATOM 7499  C CB   . PRO A 1 139 ? -44.331  -20.964  -22.065  1.00 0.00 ? 134 PRO A CB   2  
ATOM 7500  C CG   . PRO A 1 139 ? -43.801  -20.945  -23.463  1.00 0.00 ? 134 PRO A CG   2  
ATOM 7501  C CD   . PRO A 1 139 ? -42.799  -19.823  -23.535  1.00 0.00 ? 134 PRO A CD   2  
ATOM 7502  H HA   . PRO A 1 139 ? -43.558  -19.844  -20.400  1.00 0.00 ? 134 PRO A HA   2  
ATOM 7503  H HB2  . PRO A 1 139 ? -44.602  -21.970  -21.776  1.00 0.00 ? 134 PRO A HB2  2  
ATOM 7504  H HB3  . PRO A 1 139 ? -45.181  -20.305  -21.984  1.00 0.00 ? 134 PRO A HB3  2  
ATOM 7505  H HG2  . PRO A 1 139 ? -43.322  -21.888  -23.688  1.00 0.00 ? 134 PRO A HG2  2  
ATOM 7506  H HG3  . PRO A 1 139 ? -44.603  -20.761  -24.160  1.00 0.00 ? 134 PRO A HG3  2  
ATOM 7507  H HD2  . PRO A 1 139 ? -41.964  -20.102  -24.165  1.00 0.00 ? 134 PRO A HD2  2  
ATOM 7508  H HD3  . PRO A 1 139 ? -43.264  -18.920  -23.895  1.00 0.00 ? 134 PRO A HD3  2  
ATOM 7509  N N    . GLU A 1 140 ? -41.883  -21.504  -19.435  1.00 0.00 ? 135 GLU A N    2  
ATOM 7510  C CA   . GLU A 1 140 ? -41.070  -22.602  -18.834  1.00 0.00 ? 135 GLU A CA   2  
ATOM 7511  C C    . GLU A 1 140 ? -41.556  -22.904  -17.413  1.00 0.00 ? 135 GLU A C    2  
ATOM 7512  O O    . GLU A 1 140 ? -40.780  -22.950  -16.479  1.00 0.00 ? 135 GLU A O    2  
ATOM 7513  C CB   . GLU A 1 140 ? -39.635  -22.068  -18.809  1.00 0.00 ? 135 GLU A CB   2  
ATOM 7514  C CG   . GLU A 1 140 ? -39.580  -20.759  -18.012  1.00 0.00 ? 135 GLU A CG   2  
ATOM 7515  C CD   . GLU A 1 140 ? -38.569  -20.893  -16.871  1.00 0.00 ? 135 GLU A CD   2  
ATOM 7516  O OE1  . GLU A 1 140 ? -37.428  -21.221  -17.153  1.00 0.00 ? 135 GLU A OE1  2  
ATOM 7517  O OE2  . GLU A 1 140 ? -38.952  -20.665  -15.736  1.00 0.00 ? 135 GLU A OE2  2  
ATOM 7518  H H    . GLU A 1 140 ? -42.063  -20.690  -18.919  1.00 0.00 ? 135 GLU A H    2  
ATOM 7519  H HA   . GLU A 1 140 ? -41.122  -23.487  -19.447  1.00 0.00 ? 135 GLU A HA   2  
ATOM 7520  H HB2  . GLU A 1 140 ? -38.988  -22.800  -18.347  1.00 0.00 ? 135 GLU A HB2  2  
ATOM 7521  H HB3  . GLU A 1 140 ? -39.304  -21.884  -19.820  1.00 0.00 ? 135 GLU A HB3  2  
ATOM 7522  H HG2  . GLU A 1 140 ? -39.280  -19.953  -18.666  1.00 0.00 ? 135 GLU A HG2  2  
ATOM 7523  H HG3  . GLU A 1 140 ? -40.556  -20.544  -17.602  1.00 0.00 ? 135 GLU A HG3  2  
ATOM 7524  N N    . SER A 1 141 ? -42.835  -23.111  -17.245  1.00 0.00 ? 136 SER A N    2  
ATOM 7525  C CA   . SER A 1 141 ? -43.372  -23.410  -15.886  1.00 0.00 ? 136 SER A CA   2  
ATOM 7526  C C    . SER A 1 141 ? -44.511  -24.429  -15.979  1.00 0.00 ? 136 SER A C    2  
ATOM 7527  O O    . SER A 1 141 ? -45.295  -24.415  -16.908  1.00 0.00 ? 136 SER A O    2  
ATOM 7528  C CB   . SER A 1 141 ? -43.891  -22.072  -15.361  1.00 0.00 ? 136 SER A CB   2  
ATOM 7529  O OG   . SER A 1 141 ? -44.642  -22.293  -14.174  1.00 0.00 ? 136 SER A OG   2  
ATOM 7530  H H    . SER A 1 141 ? -43.443  -23.069  -18.013  1.00 0.00 ? 136 SER A H    2  
ATOM 7531  H HA   . SER A 1 141 ? -42.588  -23.779  -15.243  1.00 0.00 ? 136 SER A HA   2  
ATOM 7532  H HB2  . SER A 1 141 ? -43.061  -21.423  -15.141  1.00 0.00 ? 136 SER A HB2  2  
ATOM 7533  H HB3  . SER A 1 141 ? -44.517  -21.610  -16.114  1.00 0.00 ? 136 SER A HB3  2  
ATOM 7534  H HG   . SER A 1 141 ? -44.871  -21.437  -13.805  1.00 0.00 ? 136 SER A HG   2  
ATOM 7535  N N    . VAL A 1 142 ? -44.608  -25.313  -15.021  1.00 0.00 ? 137 VAL A N    2  
ATOM 7536  C CA   . VAL A 1 142 ? -45.696  -26.334  -15.051  1.00 0.00 ? 137 VAL A CA   2  
ATOM 7537  C C    . VAL A 1 142 ? -46.768  -25.988  -14.013  1.00 0.00 ? 137 VAL A C    2  
ATOM 7538  O O    . VAL A 1 142 ? -46.630  -26.285  -12.842  1.00 0.00 ? 137 VAL A O    2  
ATOM 7539  C CB   . VAL A 1 142 ? -45.011  -27.656  -14.700  1.00 0.00 ? 137 VAL A CB   2  
ATOM 7540  C CG1  . VAL A 1 142 ? -46.039  -28.790  -14.726  1.00 0.00 ? 137 VAL A CG1  2  
ATOM 7541  C CG2  . VAL A 1 142 ? -43.910  -27.948  -15.722  1.00 0.00 ? 137 VAL A CG2  2  
ATOM 7542  H H    . VAL A 1 142 ? -43.964  -25.305  -14.282  1.00 0.00 ? 137 VAL A H    2  
ATOM 7543  H HA   . VAL A 1 142 ? -46.130  -26.393  -16.036  1.00 0.00 ? 137 VAL A HA   2  
ATOM 7544  H HB   . VAL A 1 142 ? -44.579  -27.586  -13.712  1.00 0.00 ? 137 VAL A HB   2  
ATOM 7545  H HG11 . VAL A 1 142 ? -46.966  -28.447  -14.291  1.00 0.00 ? 137 VAL A HG11 2  
ATOM 7546  H HG12 . VAL A 1 142 ? -45.664  -29.629  -14.160  1.00 0.00 ? 137 VAL A HG12 2  
ATOM 7547  H HG13 . VAL A 1 142 ? -46.213  -29.094  -15.748  1.00 0.00 ? 137 VAL A HG13 2  
ATOM 7548  H HG21 . VAL A 1 142 ? -43.645  -28.995  -15.678  1.00 0.00 ? 137 VAL A HG21 2  
ATOM 7549  H HG22 . VAL A 1 142 ? -43.041  -27.348  -15.496  1.00 0.00 ? 137 VAL A HG22 2  
ATOM 7550  H HG23 . VAL A 1 142 ? -44.265  -27.709  -16.713  1.00 0.00 ? 137 VAL A HG23 2  
ATOM 7551  N N    . SER A 1 143 ? -47.836  -25.363  -14.436  1.00 0.00 ? 138 SER A N    2  
ATOM 7552  C CA   . SER A 1 143 ? -48.925  -24.993  -13.481  1.00 0.00 ? 138 SER A CA   2  
ATOM 7553  C C    . SER A 1 143 ? -48.358  -24.199  -12.299  1.00 0.00 ? 138 SER A C    2  
ATOM 7554  O O    . SER A 1 143 ? -48.645  -24.486  -11.153  1.00 0.00 ? 138 SER A O    2  
ATOM 7555  C CB   . SER A 1 143 ? -49.508  -26.323  -13.003  1.00 0.00 ? 138 SER A CB   2  
ATOM 7556  O OG   . SER A 1 143 ? -50.872  -26.138  -12.649  1.00 0.00 ? 138 SER A OG   2  
ATOM 7557  H H    . SER A 1 143 ? -47.922  -25.135  -15.385  1.00 0.00 ? 138 SER A H    2  
ATOM 7558  H HA   . SER A 1 143 ? -49.687  -24.420  -13.986  1.00 0.00 ? 138 SER A HA   2  
ATOM 7559  H HB2  . SER A 1 143 ? -49.443  -27.052  -13.793  1.00 0.00 ? 138 SER A HB2  2  
ATOM 7560  H HB3  . SER A 1 143 ? -48.947  -26.673  -12.146  1.00 0.00 ? 138 SER A HB3  2  
ATOM 7561  H HG   . SER A 1 143 ? -51.216  -26.979  -12.342  1.00 0.00 ? 138 SER A HG   2  
ATOM 7562  N N    . GLY A 1 144 ? -47.558  -23.203  -12.571  1.00 0.00 ? 139 GLY A N    2  
ATOM 7563  C CA   . GLY A 1 144 ? -46.974  -22.388  -11.466  1.00 0.00 ? 139 GLY A CA   2  
ATOM 7564  C C    . GLY A 1 144 ? -45.875  -23.186  -10.762  1.00 0.00 ? 139 GLY A C    2  
ATOM 7565  O O    . GLY A 1 144 ? -45.481  -24.246  -11.207  1.00 0.00 ? 139 GLY A O    2  
ATOM 7566  H H    . GLY A 1 144 ? -47.342  -22.989  -13.503  1.00 0.00 ? 139 GLY A H    2  
ATOM 7567  H HA2  . GLY A 1 144 ? -46.556  -21.479  -11.874  1.00 0.00 ? 139 GLY A HA2  2  
ATOM 7568  H HA3  . GLY A 1 144 ? -47.747  -22.141  -10.754  1.00 0.00 ? 139 GLY A HA3  2  
ATOM 7569  N N    . SER A 1 145 ? -45.376  -22.681  -9.664   1.00 0.00 ? 140 SER A N    2  
ATOM 7570  C CA   . SER A 1 145 ? -44.300  -23.406  -8.926   1.00 0.00 ? 140 SER A CA   2  
ATOM 7571  C C    . SER A 1 145 ? -44.371  -23.079  -7.431   1.00 0.00 ? 140 SER A C    2  
ATOM 7572  O O    . SER A 1 145 ? -44.828  -22.023  -7.039   1.00 0.00 ? 140 SER A O    2  
ATOM 7573  C CB   . SER A 1 145 ? -42.993  -22.889  -9.526   1.00 0.00 ? 140 SER A CB   2  
ATOM 7574  O OG   . SER A 1 145 ? -43.084  -21.482  -9.710   1.00 0.00 ? 140 SER A OG   2  
ATOM 7575  H H    . SER A 1 145 ? -45.709  -21.824  -9.324   1.00 0.00 ? 140 SER A H    2  
ATOM 7576  H HA   . SER A 1 145 ? -44.383  -24.469  -9.084   1.00 0.00 ? 140 SER A HA   2  
ATOM 7577  H HB2  . SER A 1 145 ? -42.177  -23.106  -8.858   1.00 0.00 ? 140 SER A HB2  2  
ATOM 7578  H HB3  . SER A 1 145 ? -42.817  -23.376  -10.476  1.00 0.00 ? 140 SER A HB3  2  
ATOM 7579  H HG   . SER A 1 145 ? -42.506  -21.061  -9.070   1.00 0.00 ? 140 SER A HG   2  
ATOM 7580  N N    . VAL A 1 146 ? -43.922  -23.977  -6.596   1.00 0.00 ? 141 VAL A N    2  
ATOM 7581  C CA   . VAL A 1 146 ? -43.963  -23.720  -5.126   1.00 0.00 ? 141 VAL A CA   2  
ATOM 7582  C C    . VAL A 1 146 ? -42.631  -24.118  -4.477   1.00 0.00 ? 141 VAL A C    2  
ATOM 7583  O O    . VAL A 1 146 ? -42.489  -25.215  -3.974   1.00 0.00 ? 141 VAL A O    2  
ATOM 7584  C CB   . VAL A 1 146 ? -45.102  -24.596  -4.598   1.00 0.00 ? 141 VAL A CB   2  
ATOM 7585  C CG1  . VAL A 1 146 ? -46.427  -24.124  -5.200   1.00 0.00 ? 141 VAL A CG1  2  
ATOM 7586  C CG2  . VAL A 1 146 ? -44.857  -26.060  -4.987   1.00 0.00 ? 141 VAL A CG2  2  
ATOM 7587  H H    . VAL A 1 146 ? -43.558  -24.822  -6.934   1.00 0.00 ? 141 VAL A H    2  
ATOM 7588  H HA   . VAL A 1 146 ? -44.179  -22.681  -4.933   1.00 0.00 ? 141 VAL A HA   2  
ATOM 7589  H HB   . VAL A 1 146 ? -45.149  -24.512  -3.521   1.00 0.00 ? 141 VAL A HB   2  
ATOM 7590  H HG11 . VAL A 1 146 ? -46.635  -24.688  -6.098   1.00 0.00 ? 141 VAL A HG11 2  
ATOM 7591  H HG12 . VAL A 1 146 ? -46.359  -23.074  -5.441   1.00 0.00 ? 141 VAL A HG12 2  
ATOM 7592  H HG13 . VAL A 1 146 ? -47.222  -24.279  -4.486   1.00 0.00 ? 141 VAL A HG13 2  
ATOM 7593  H HG21 . VAL A 1 146 ? -43.887  -26.151  -5.455   1.00 0.00 ? 141 VAL A HG21 2  
ATOM 7594  H HG22 . VAL A 1 146 ? -45.621  -26.384  -5.678   1.00 0.00 ? 141 VAL A HG22 2  
ATOM 7595  H HG23 . VAL A 1 146 ? -44.888  -26.677  -4.101   1.00 0.00 ? 141 VAL A HG23 2  
ATOM 7596  N N    . PRO A 1 147 ? -41.691  -23.206  -4.508   1.00 0.00 ? 142 PRO A N    2  
ATOM 7597  C CA   . PRO A 1 147 ? -40.360  -23.472  -3.911   1.00 0.00 ? 142 PRO A CA   2  
ATOM 7598  C C    . PRO A 1 147 ? -40.440  -23.470  -2.379   1.00 0.00 ? 142 PRO A C    2  
ATOM 7599  O O    . PRO A 1 147 ? -40.459  -24.511  -1.752   1.00 0.00 ? 142 PRO A O    2  
ATOM 7600  C CB   . PRO A 1 147 ? -39.498  -22.322  -4.429   1.00 0.00 ? 142 PRO A CB   2  
ATOM 7601  C CG   . PRO A 1 147 ? -40.459  -21.219  -4.745   1.00 0.00 ? 142 PRO A CG   2  
ATOM 7602  C CD   . PRO A 1 147 ? -41.778  -21.860  -5.092   1.00 0.00 ? 142 PRO A CD   2  
ATOM 7603  H HA   . PRO A 1 147 ? -39.969  -24.412  -4.267   1.00 0.00 ? 142 PRO A HA   2  
ATOM 7604  H HB2  . PRO A 1 147 ? -38.798  -22.007  -3.667   1.00 0.00 ? 142 PRO A HB2  2  
ATOM 7605  H HB3  . PRO A 1 147 ? -38.972  -22.620  -5.323   1.00 0.00 ? 142 PRO A HB3  2  
ATOM 7606  H HG2  . PRO A 1 147 ? -40.573  -20.571  -3.888   1.00 0.00 ? 142 PRO A HG2  2  
ATOM 7607  H HG3  . PRO A 1 147 ? -40.101  -20.651  -5.590   1.00 0.00 ? 142 PRO A HG3  2  
ATOM 7608  H HD2  . PRO A 1 147 ? -42.595  -21.305  -4.650   1.00 0.00 ? 142 PRO A HD2  2  
ATOM 7609  H HD3  . PRO A 1 147 ? -41.898  -21.927  -6.162   1.00 0.00 ? 142 PRO A HD3  2  
ATOM 7610  N N    . SER A 1 148 ? -40.486  -22.314  -1.771   1.00 0.00 ? 143 SER A N    2  
ATOM 7611  C CA   . SER A 1 148 ? -40.564  -22.255  -0.281   1.00 0.00 ? 143 SER A CA   2  
ATOM 7612  C C    . SER A 1 148 ? -41.974  -22.625  0.190    1.00 0.00 ? 143 SER A C    2  
ATOM 7613  O O    . SER A 1 148 ? -42.884  -21.820  0.145    1.00 0.00 ? 143 SER A O    2  
ATOM 7614  C CB   . SER A 1 148 ? -40.243  -20.804  0.076    1.00 0.00 ? 143 SER A CB   2  
ATOM 7615  O OG   . SER A 1 148 ? -40.374  -20.625  1.480    1.00 0.00 ? 143 SER A OG   2  
ATOM 7616  H H    . SER A 1 148 ? -40.469  -21.486  -2.291   1.00 0.00 ? 143 SER A H    2  
ATOM 7617  H HA   . SER A 1 148 ? -39.834  -22.913  0.161    1.00 0.00 ? 143 SER A HA   2  
ATOM 7618  H HB2  . SER A 1 148 ? -39.233  -20.574  -0.218   1.00 0.00 ? 143 SER A HB2  2  
ATOM 7619  H HB3  . SER A 1 148 ? -40.926  -20.147  -0.447   1.00 0.00 ? 143 SER A HB3  2  
ATOM 7620  H HG   . SER A 1 148 ? -39.729  -21.189  1.913    1.00 0.00 ? 143 SER A HG   2  
ATOM 7621  N N    . SER A 1 149 ? -42.160  -23.839  0.640    1.00 0.00 ? 144 SER A N    2  
ATOM 7622  C CA   . SER A 1 149 ? -43.511  -24.270  1.115    1.00 0.00 ? 144 SER A CA   2  
ATOM 7623  C C    . SER A 1 149 ? -44.567  -23.995  0.041    1.00 0.00 ? 144 SER A C    2  
ATOM 7624  O O    . SER A 1 149 ? -44.249  -23.664  -1.085   1.00 0.00 ? 144 SER A O    2  
ATOM 7625  C CB   . SER A 1 149 ? -43.784  -23.429  2.363    1.00 0.00 ? 144 SER A CB   2  
ATOM 7626  O OG   . SER A 1 149 ? -44.468  -24.223  3.324    1.00 0.00 ? 144 SER A OG   2  
ATOM 7627  H H    . SER A 1 149 ? -41.411  -24.470  0.665    1.00 0.00 ? 144 SER A H    2  
ATOM 7628  H HA   . SER A 1 149 ? -43.501  -25.317  1.373    1.00 0.00 ? 144 SER A HA   2  
ATOM 7629  H HB2  . SER A 1 149 ? -42.852  -23.090  2.783    1.00 0.00 ? 144 SER A HB2  2  
ATOM 7630  H HB3  . SER A 1 149 ? -44.388  -22.572  2.093    1.00 0.00 ? 144 SER A HB3  2  
ATOM 7631  H HG   . SER A 1 149 ? -44.345  -23.818  4.185    1.00 0.00 ? 144 SER A HG   2  
ATOM 7632  N N    . GLY A 1 150 ? -45.821  -24.130  0.380    1.00 0.00 ? 145 GLY A N    2  
ATOM 7633  C CA   . GLY A 1 150 ? -46.898  -23.877  -0.620   1.00 0.00 ? 145 GLY A CA   2  
ATOM 7634  C C    . GLY A 1 150 ? -48.039  -24.873  -0.407   1.00 0.00 ? 145 GLY A C    2  
ATOM 7635  O O    . GLY A 1 150 ? -48.541  -25.030  0.688    1.00 0.00 ? 145 GLY A O    2  
ATOM 7636  H H    . GLY A 1 150 ? -46.055  -24.397  1.294    1.00 0.00 ? 145 GLY A H    2  
ATOM 7637  H HA2  . GLY A 1 150 ? -47.270  -22.869  -0.499   1.00 0.00 ? 145 GLY A HA2  2  
ATOM 7638  H HA3  . GLY A 1 150 ? -46.500  -23.997  -1.616   1.00 0.00 ? 145 GLY A HA3  2  
ATOM 7639  N N    . SER A 1 151 ? -48.451  -25.547  -1.448   1.00 0.00 ? 146 SER A N    2  
ATOM 7640  C CA   . SER A 1 151 ? -49.561  -26.534  -1.309   1.00 0.00 ? 146 SER A CA   2  
ATOM 7641  C C    . SER A 1 151 ? -48.996  -27.935  -1.056   1.00 0.00 ? 146 SER A C    2  
ATOM 7642  O O    . SER A 1 151 ? -48.160  -28.419  -1.794   1.00 0.00 ? 146 SER A O    2  
ATOM 7643  C CB   . SER A 1 151 ? -50.299  -26.488  -2.646   1.00 0.00 ? 146 SER A CB   2  
ATOM 7644  O OG   . SER A 1 151 ? -51.343  -27.453  -2.639   1.00 0.00 ? 146 SER A OG   2  
ATOM 7645  H H    . SER A 1 151 ? -48.031  -25.403  -2.321   1.00 0.00 ? 146 SER A H    2  
ATOM 7646  H HA   . SER A 1 151 ? -50.226  -26.245  -0.510   1.00 0.00 ? 146 SER A HA   2  
ATOM 7647  H HB2  . SER A 1 151 ? -50.723  -25.509  -2.792   1.00 0.00 ? 146 SER A HB2  2  
ATOM 7648  H HB3  . SER A 1 151 ? -49.604  -26.700  -3.447   1.00 0.00 ? 146 SER A HB3  2  
ATOM 7649  H HG   . SER A 1 151 ? -51.314  -27.928  -3.472   1.00 0.00 ? 146 SER A HG   2  
ATOM 7650  N N    . SER A 1 152 ? -49.447  -28.588  -0.019   1.00 0.00 ? 147 SER A N    2  
ATOM 7651  C CA   . SER A 1 152 ? -48.939  -29.957  0.284    1.00 0.00 ? 147 SER A CA   2  
ATOM 7652  C C    . SER A 1 152 ? -49.982  -30.743  1.084    1.00 0.00 ? 147 SER A C    2  
ATOM 7653  O O    . SER A 1 152 ? -50.651  -30.205  1.945    1.00 0.00 ? 147 SER A O    2  
ATOM 7654  C CB   . SER A 1 152 ? -47.678  -29.736  1.118    1.00 0.00 ? 147 SER A CB   2  
ATOM 7655  O OG   . SER A 1 152 ? -48.034  -29.129  2.354    1.00 0.00 ? 147 SER A OG   2  
ATOM 7656  H H    . SER A 1 152 ? -50.122  -28.177  0.562    1.00 0.00 ? 147 SER A H    2  
ATOM 7657  H HA   . SER A 1 152 ? -48.691  -30.478  -0.627   1.00 0.00 ? 147 SER A HA   2  
ATOM 7658  H HB2  . SER A 1 152 ? -47.201  -30.682  1.312    1.00 0.00 ? 147 SER A HB2  2  
ATOM 7659  H HB3  . SER A 1 152 ? -46.996  -29.096  0.574    1.00 0.00 ? 147 SER A HB3  2  
ATOM 7660  H HG   . SER A 1 152 ? -48.021  -29.808  3.032    1.00 0.00 ? 147 SER A HG   2  
ATOM 7661  N N    . GLY A 1 153 ? -50.124  -32.012  0.806    1.00 0.00 ? 148 GLY A N    2  
ATOM 7662  C CA   . GLY A 1 153 ? -51.122  -32.834  1.549    1.00 0.00 ? 148 GLY A CA   2  
ATOM 7663  C C    . GLY A 1 153 ? -51.743  -33.862  0.602    1.00 0.00 ? 148 GLY A C    2  
ATOM 7664  O O    . GLY A 1 153 ? -52.479  -33.521  -0.303   1.00 0.00 ? 148 GLY A O    2  
ATOM 7665  H H    . GLY A 1 153 ? -49.573  -32.424  0.108    1.00 0.00 ? 148 GLY A H    2  
ATOM 7666  H HA2  . GLY A 1 153 ? -50.632  -33.344  2.365    1.00 0.00 ? 148 GLY A HA2  2  
ATOM 7667  H HA3  . GLY A 1 153 ? -51.899  -32.193  1.938    1.00 0.00 ? 148 GLY A HA3  2  
ATOM 7668  N N    . ARG A 1 154 ? -51.451  -35.119  0.803    1.00 0.00 ? 149 ARG A N    2  
ATOM 7669  C CA   . ARG A 1 154 ? -52.024  -36.172  -0.085   1.00 0.00 ? 149 ARG A CA   2  
ATOM 7670  C C    . ARG A 1 154 ? -53.466  -36.483  0.324    1.00 0.00 ? 149 ARG A C    2  
ATOM 7671  O O    . ARG A 1 154 ? -53.738  -36.832  1.457    1.00 0.00 ? 149 ARG A O    2  
ATOM 7672  C CB   . ARG A 1 154 ? -51.132  -37.398  0.123    1.00 0.00 ? 149 ARG A CB   2  
ATOM 7673  C CG   . ARG A 1 154 ? -50.069  -37.453  -0.979   1.00 0.00 ? 149 ARG A CG   2  
ATOM 7674  C CD   . ARG A 1 154 ? -50.082  -38.835  -1.638   1.00 0.00 ? 149 ARG A CD   2  
ATOM 7675  N NE   . ARG A 1 154 ? -49.394  -38.646  -2.945   1.00 0.00 ? 149 ARG A NE   2  
ATOM 7676  C CZ   . ARG A 1 154 ? -48.900  -39.675  -3.577   1.00 0.00 ? 149 ARG A CZ   2  
ATOM 7677  N NH1  . ARG A 1 154 ? -49.690  -40.630  -3.987   1.00 0.00 ? 149 ARG A NH1  2  
ATOM 7678  N NH2  . ARG A 1 154 ? -47.616  -39.750  -3.798   1.00 0.00 ? 149 ARG A NH2  2  
ATOM 7679  H H    . ARG A 1 154 ? -50.855  -35.371  1.539    1.00 0.00 ? 149 ARG A H    2  
ATOM 7680  H HA   . ARG A 1 154 ? -51.984  -35.858  -1.116   1.00 0.00 ? 149 ARG A HA   2  
ATOM 7681  H HB2  . ARG A 1 154 ? -50.648  -37.330  1.087    1.00 0.00 ? 149 ARG A HB2  2  
ATOM 7682  H HB3  . ARG A 1 154 ? -51.735  -38.292  0.085    1.00 0.00 ? 149 ARG A HB3  2  
ATOM 7683  H HG2  . ARG A 1 154 ? -50.279  -36.698  -1.723   1.00 0.00 ? 149 ARG A HG2  2  
ATOM 7684  H HG3  . ARG A 1 154 ? -49.095  -37.272  -0.549   1.00 0.00 ? 149 ARG A HG3  2  
ATOM 7685  H HD2  . ARG A 1 154 ? -49.544  -39.547  -1.026   1.00 0.00 ? 149 ARG A HD2  2  
ATOM 7686  H HD3  . ARG A 1 154 ? -51.097  -39.166  -1.798   1.00 0.00 ? 149 ARG A HD3  2  
ATOM 7687  H HE   . ARG A 1 154 ? -49.313  -37.749  -3.331   1.00 0.00 ? 149 ARG A HE   2  
ATOM 7688  H HH11 . ARG A 1 154 ? -50.674  -40.573  -3.816   1.00 0.00 ? 149 ARG A HH11 2  
ATOM 7689  H HH12 . ARG A 1 154 ? -49.311  -41.419  -4.471   1.00 0.00 ? 149 ARG A HH12 2  
ATOM 7690  H HH21 . ARG A 1 154 ? -47.011  -39.019  -3.484   1.00 0.00 ? 149 ARG A HH21 2  
ATOM 7691  H HH22 . ARG A 1 154 ? -47.238  -40.539  -4.283   1.00 0.00 ? 149 ARG A HH22 2  
ATOM 7692  N N    . GLU A 1 155 ? -54.391  -36.357  -0.590   1.00 0.00 ? 150 GLU A N    2  
ATOM 7693  C CA   . GLU A 1 155 ? -55.816  -36.643  -0.257   1.00 0.00 ? 150 GLU A CA   2  
ATOM 7694  C C    . GLU A 1 155 ? -56.121  -38.130  -0.466   1.00 0.00 ? 150 GLU A C    2  
ATOM 7695  O O    . GLU A 1 155 ? -56.858  -38.503  -1.357   1.00 0.00 ? 150 GLU A O    2  
ATOM 7696  C CB   . GLU A 1 155 ? -56.628  -35.785  -1.228   1.00 0.00 ? 150 GLU A CB   2  
ATOM 7697  C CG   . GLU A 1 155 ? -56.519  -34.314  -0.822   1.00 0.00 ? 150 GLU A CG   2  
ATOM 7698  C CD   . GLU A 1 155 ? -57.277  -34.087  0.487    1.00 0.00 ? 150 GLU A CD   2  
ATOM 7699  O OE1  . GLU A 1 155 ? -58.473  -34.329  0.505    1.00 0.00 ? 150 GLU A OE1  2  
ATOM 7700  O OE2  . GLU A 1 155 ? -56.650  -33.676  1.448    1.00 0.00 ? 150 GLU A OE2  2  
ATOM 7701  H H    . GLU A 1 155 ? -54.147  -36.074  -1.496   1.00 0.00 ? 150 GLU A H    2  
ATOM 7702  H HA   . GLU A 1 155 ? -56.032  -36.353  0.759    1.00 0.00 ? 150 GLU A HA   2  
ATOM 7703  H HB2  . GLU A 1 155 ? -56.243  -35.913  -2.230   1.00 0.00 ? 150 GLU A HB2  2  
ATOM 7704  H HB3  . GLU A 1 155 ? -57.664  -36.089  -1.198   1.00 0.00 ? 150 GLU A HB3  2  
ATOM 7705  H HG2  . GLU A 1 155 ? -55.479  -34.055  -0.686   1.00 0.00 ? 150 GLU A HG2  2  
ATOM 7706  H HG3  . GLU A 1 155 ? -56.947  -33.694  -1.596   1.00 0.00 ? 150 GLU A HG3  2  
ATOM 7707  N N    . GLU A 1 156 ? -55.557  -38.979  0.351    1.00 0.00 ? 151 GLU A N    2  
ATOM 7708  C CA   . GLU A 1 156 ? -55.811  -40.442  0.204    1.00 0.00 ? 151 GLU A CA   2  
ATOM 7709  C C    . GLU A 1 156 ? -57.110  -40.827  0.919    1.00 0.00 ? 151 GLU A C    2  
ATOM 7710  O O    . GLU A 1 156 ? -57.878  -41.636  0.437    1.00 0.00 ? 151 GLU A O    2  
ATOM 7711  C CB   . GLU A 1 156 ? -54.611  -41.122  0.868    1.00 0.00 ? 151 GLU A CB   2  
ATOM 7712  C CG   . GLU A 1 156 ? -53.711  -41.738  -0.206   1.00 0.00 ? 151 GLU A CG   2  
ATOM 7713  C CD   . GLU A 1 156 ? -54.307  -43.069  -0.668   1.00 0.00 ? 151 GLU A CD   2  
ATOM 7714  O OE1  . GLU A 1 156 ? -54.672  -43.860  0.186    1.00 0.00 ? 151 GLU A OE1  2  
ATOM 7715  O OE2  . GLU A 1 156 ? -54.387  -43.275  -1.868   1.00 0.00 ? 151 GLU A OE2  2  
ATOM 7716  H H    . GLU A 1 156 ? -54.967  -38.654  1.063    1.00 0.00 ? 151 GLU A H    2  
ATOM 7717  H HA   . GLU A 1 156 ? -55.860  -40.713  -0.838   1.00 0.00 ? 151 GLU A HA   2  
ATOM 7718  H HB2  . GLU A 1 156 ? -54.050  -40.391  1.432    1.00 0.00 ? 151 GLU A HB2  2  
ATOM 7719  H HB3  . GLU A 1 156 ? -54.958  -41.899  1.532    1.00 0.00 ? 151 GLU A HB3  2  
ATOM 7720  H HG2  . GLU A 1 156 ? -53.641  -41.062  -1.047   1.00 0.00 ? 151 GLU A HG2  2  
ATOM 7721  H HG3  . GLU A 1 156 ? -52.727  -41.908  0.203    1.00 0.00 ? 151 GLU A HG3  2  
ATOM 7722  N N    . ASP A 1 157 ? -57.359  -40.251  2.065    1.00 0.00 ? 152 ASP A N    2  
ATOM 7723  C CA   . ASP A 1 157 ? -58.607  -40.582  2.813    1.00 0.00 ? 152 ASP A CA   2  
ATOM 7724  C C    . ASP A 1 157 ? -59.744  -39.646  2.390    1.00 0.00 ? 152 ASP A C    2  
ATOM 7725  O O    . ASP A 1 157 ? -60.401  -39.041  3.214    1.00 0.00 ? 152 ASP A O    2  
ATOM 7726  C CB   . ASP A 1 157 ? -58.257  -40.373  4.290    1.00 0.00 ? 152 ASP A CB   2  
ATOM 7727  C CG   . ASP A 1 157 ? -57.835  -38.920  4.523    1.00 0.00 ? 152 ASP A CG   2  
ATOM 7728  O OD1  . ASP A 1 157 ? -56.659  -38.633  4.372    1.00 0.00 ? 152 ASP A OD1  2  
ATOM 7729  O OD2  . ASP A 1 157 ? -58.696  -38.119  4.849    1.00 0.00 ? 152 ASP A OD2  2  
ATOM 7730  H H    . ASP A 1 157 ? -56.724  -39.602  2.433    1.00 0.00 ? 152 ASP A H    2  
ATOM 7731  H HA   . ASP A 1 157 ? -58.885  -41.610  2.644    1.00 0.00 ? 152 ASP A HA   2  
ATOM 7732  H HB2  . ASP A 1 157 ? -59.121  -40.599  4.899    1.00 0.00 ? 152 ASP A HB2  2  
ATOM 7733  H HB3  . ASP A 1 157 ? -57.444  -41.029  4.562    1.00 0.00 ? 152 ASP A HB3  2  
ATOM 7734  N N    . ALA A 1 158 ? -59.978  -39.523  1.110    1.00 0.00 ? 153 ALA A N    2  
ATOM 7735  C CA   . ALA A 1 158 ? -61.072  -38.627  0.632    1.00 0.00 ? 153 ALA A CA   2  
ATOM 7736  C C    . ALA A 1 158 ? -61.854  -39.304  -0.498   1.00 0.00 ? 153 ALA A C    2  
ATOM 7737  O O    . ALA A 1 158 ? -61.947  -38.790  -1.596   1.00 0.00 ? 153 ALA A O    2  
ATOM 7738  C CB   . ALA A 1 158 ? -60.360  -37.375  0.119    1.00 0.00 ? 153 ALA A CB   2  
ATOM 7739  H H    . ALA A 1 158 ? -59.436  -40.021  0.464    1.00 0.00 ? 153 ALA A H    2  
ATOM 7740  H HA   . ALA A 1 158 ? -61.731  -38.369  1.446    1.00 0.00 ? 153 ALA A HA   2  
ATOM 7741  H HB1  . ALA A 1 158 ? -60.944  -36.928  -0.672   1.00 0.00 ? 153 ALA A HB1  2  
ATOM 7742  H HB2  . ALA A 1 158 ? -59.386  -37.644  -0.261   1.00 0.00 ? 153 ALA A HB2  2  
ATOM 7743  H HB3  . ALA A 1 158 ? -60.248  -36.668  0.928    1.00 0.00 ? 153 ALA A HB3  2  
ATOM 7744  N N    . ALA A 1 159 ? -62.416  -40.454  -0.235   1.00 0.00 ? 154 ALA A N    2  
ATOM 7745  C CA   . ALA A 1 159 ? -63.193  -41.167  -1.291   1.00 0.00 ? 154 ALA A CA   2  
ATOM 7746  C C    . ALA A 1 159 ? -64.695  -41.044  -1.019   1.00 0.00 ? 154 ALA A C    2  
ATOM 7747  O O    . ALA A 1 159 ? -65.416  -42.023  -1.013   1.00 0.00 ? 154 ALA A O    2  
ATOM 7748  C CB   . ALA A 1 159 ? -62.748  -42.626  -1.192   1.00 0.00 ? 154 ALA A CB   2  
ATOM 7749  H H    . ALA A 1 159 ? -62.327  -40.849  0.657    1.00 0.00 ? 154 ALA A H    2  
ATOM 7750  H HA   . ALA A 1 159 ? -62.952  -40.774  -2.266   1.00 0.00 ? 154 ALA A HA   2  
ATOM 7751  H HB1  . ALA A 1 159 ? -63.582  -43.274  -1.419   1.00 0.00 ? 154 ALA A HB1  2  
ATOM 7752  H HB2  . ALA A 1 159 ? -62.397  -42.829  -0.191   1.00 0.00 ? 154 ALA A HB2  2  
ATOM 7753  H HB3  . ALA A 1 159 ? -61.949  -42.808  -1.897   1.00 0.00 ? 154 ALA A HB3  2  
ATOM 7754  N N    . SER A 1 160 ? -65.170  -39.848  -0.794   1.00 0.00 ? 155 SER A N    2  
ATOM 7755  C CA   . SER A 1 160 ? -66.626  -39.660  -0.521   1.00 0.00 ? 155 SER A CA   2  
ATOM 7756  C C    . SER A 1 160 ? -67.314  -39.028  -1.735   1.00 0.00 ? 155 SER A C    2  
ATOM 7757  O O    . SER A 1 160 ? -67.332  -37.823  -1.894   1.00 0.00 ? 155 SER A O    2  
ATOM 7758  C CB   . SER A 1 160 ? -66.684  -38.719  0.682    1.00 0.00 ? 155 SER A CB   2  
ATOM 7759  O OG   . SER A 1 160 ? -66.275  -37.417  0.283    1.00 0.00 ? 155 SER A OG   2  
ATOM 7760  H H    . SER A 1 160 ? -64.570  -39.073  -0.803   1.00 0.00 ? 155 SER A H    2  
ATOM 7761  H HA   . SER A 1 160 ? -67.087  -40.603  -0.274   1.00 0.00 ? 155 SER A HA   2  
ATOM 7762  H HB2  . SER A 1 160 ? -67.692  -38.674  1.058    1.00 0.00 ? 155 SER A HB2  2  
ATOM 7763  H HB3  . SER A 1 160 ? -66.029  -39.091  1.460    1.00 0.00 ? 155 SER A HB3  2  
ATOM 7764  H HG   . SER A 1 160 ? -65.333  -37.337  0.452    1.00 0.00 ? 155 SER A HG   2  
ATOM 7765  N N    . THR A 1 161 ? -67.880  -39.834  -2.593   1.00 0.00 ? 156 THR A N    2  
ATOM 7766  C CA   . THR A 1 161 ? -68.566  -39.281  -3.798   1.00 0.00 ? 156 THR A CA   2  
ATOM 7767  C C    . THR A 1 161 ? -70.054  -39.642  -3.779   1.00 0.00 ? 156 THR A C    2  
ATOM 7768  O O    . THR A 1 161 ? -70.886  -38.906  -4.271   1.00 0.00 ? 156 THR A O    2  
ATOM 7769  C CB   . THR A 1 161 ? -67.869  -39.941  -4.988   1.00 0.00 ? 156 THR A CB   2  
ATOM 7770  O OG1  . THR A 1 161 ? -66.462  -39.903  -4.791   1.00 0.00 ? 156 THR A OG1  2  
ATOM 7771  C CG2  . THR A 1 161 ? -68.228  -39.192  -6.272   1.00 0.00 ? 156 THR A CG2  2  
ATOM 7772  H H    . THR A 1 161 ? -67.853  -40.803  -2.447   1.00 0.00 ? 156 THR A H    2  
ATOM 7773  H HA   . THR A 1 161 ? -68.440  -38.213  -3.844   1.00 0.00 ? 156 THR A HA   2  
ATOM 7774  H HB   . THR A 1 161 ? -68.193  -40.967  -5.073   1.00 0.00 ? 156 THR A HB   2  
ATOM 7775  H HG1  . THR A 1 161 ? -66.179  -38.988  -4.851   1.00 0.00 ? 156 THR A HG1  2  
ATOM 7776  H HG21 . THR A 1 161 ? -67.428  -39.304  -6.990   1.00 0.00 ? 156 THR A HG21 2  
ATOM 7777  H HG22 . THR A 1 161 ? -68.368  -38.145  -6.051   1.00 0.00 ? 156 THR A HG22 2  
ATOM 7778  H HG23 . THR A 1 161 ? -69.140  -39.599  -6.683   1.00 0.00 ? 156 THR A HG23 2  
ATOM 7779  N N    . LEU A 1 162 ? -70.393  -40.770  -3.216   1.00 0.00 ? 157 LEU A N    2  
ATOM 7780  C CA   . LEU A 1 162 ? -71.827  -41.180  -3.167   1.00 0.00 ? 157 LEU A CA   2  
ATOM 7781  C C    . LEU A 1 162 ? -72.481  -40.674  -1.876   1.00 0.00 ? 157 LEU A C    2  
ATOM 7782  O O    . LEU A 1 162 ? -73.146  -39.656  -1.866   1.00 0.00 ? 157 LEU A O    2  
ATOM 7783  C CB   . LEU A 1 162 ? -71.805  -42.710  -3.204   1.00 0.00 ? 157 LEU A CB   2  
ATOM 7784  C CG   . LEU A 1 162 ? -71.704  -43.185  -4.654   1.00 0.00 ? 157 LEU A CG   2  
ATOM 7785  C CD1  . LEU A 1 162 ? -71.127  -44.601  -4.690   1.00 0.00 ? 157 LEU A CD1  2  
ATOM 7786  C CD2  . LEU A 1 162 ? -73.098  -43.187  -5.287   1.00 0.00 ? 157 LEU A CD2  2  
ATOM 7787  H H    . LEU A 1 162 ? -69.705  -41.348  -2.827   1.00 0.00 ? 157 LEU A H    2  
ATOM 7788  H HA   . LEU A 1 162 ? -72.355  -40.801  -4.026   1.00 0.00 ? 157 LEU A HA   2  
ATOM 7789  H HB2  . LEU A 1 162 ? -70.953  -43.070  -2.646   1.00 0.00 ? 157 LEU A HB2  2  
ATOM 7790  H HB3  . LEU A 1 162 ? -72.713  -43.094  -2.764   1.00 0.00 ? 157 LEU A HB3  2  
ATOM 7791  H HG   . LEU A 1 162 ? -71.057  -42.519  -5.207   1.00 0.00 ? 157 LEU A HG   2  
ATOM 7792  H HD11 . LEU A 1 162 ? -70.600  -44.752  -5.620   1.00 0.00 ? 157 LEU A HD11 2  
ATOM 7793  H HD12 . LEU A 1 162 ? -71.930  -45.319  -4.610   1.00 0.00 ? 157 LEU A HD12 2  
ATOM 7794  H HD13 . LEU A 1 162 ? -70.444  -44.732  -3.863   1.00 0.00 ? 157 LEU A HD13 2  
ATOM 7795  H HD21 . LEU A 1 162 ? -73.569  -44.144  -5.116   1.00 0.00 ? 157 LEU A HD21 2  
ATOM 7796  H HD22 . LEU A 1 162 ? -73.011  -43.013  -6.349   1.00 0.00 ? 157 LEU A HD22 2  
ATOM 7797  H HD23 . LEU A 1 162 ? -73.696  -42.406  -4.842   1.00 0.00 ? 157 LEU A HD23 2  
ATOM 7798  N N    . VAL A 1 163 ? -72.296  -41.374  -0.787   1.00 0.00 ? 158 VAL A N    2  
ATOM 7799  C CA   . VAL A 1 163 ? -72.904  -40.937  0.508    1.00 0.00 ? 158 VAL A CA   2  
ATOM 7800  C C    . VAL A 1 163 ? -74.407  -40.684  0.336    1.00 0.00 ? 158 VAL A C    2  
ATOM 7801  O O    . VAL A 1 163 ? -74.909  -39.626  0.663    1.00 0.00 ? 158 VAL A O    2  
ATOM 7802  C CB   . VAL A 1 163 ? -72.177  -39.640  0.874    1.00 0.00 ? 158 VAL A CB   2  
ATOM 7803  C CG1  . VAL A 1 163 ? -72.714  -39.108  2.204    1.00 0.00 ? 158 VAL A CG1  2  
ATOM 7804  C CG2  . VAL A 1 163 ? -70.678  -39.916  1.008    1.00 0.00 ? 158 VAL A CG2  2  
ATOM 7805  H H    . VAL A 1 163 ? -71.755  -42.190  -0.821   1.00 0.00 ? 158 VAL A H    2  
ATOM 7806  H HA   . VAL A 1 163 ? -72.734  -41.680  1.271    1.00 0.00 ? 158 VAL A HA   2  
ATOM 7807  H HB   . VAL A 1 163 ? -72.343  -38.905  0.100    1.00 0.00 ? 158 VAL A HB   2  
ATOM 7808  H HG11 . VAL A 1 163 ? -73.030  -39.936  2.822    1.00 0.00 ? 158 VAL A HG11 2  
ATOM 7809  H HG12 . VAL A 1 163 ? -73.556  -38.457  2.018    1.00 0.00 ? 158 VAL A HG12 2  
ATOM 7810  H HG13 . VAL A 1 163 ? -71.937  -38.556  2.712    1.00 0.00 ? 158 VAL A HG13 2  
ATOM 7811  H HG21 . VAL A 1 163 ? -70.507  -40.586  1.838    1.00 0.00 ? 158 VAL A HG21 2  
ATOM 7812  H HG22 . VAL A 1 163 ? -70.155  -38.987  1.182    1.00 0.00 ? 158 VAL A HG22 2  
ATOM 7813  H HG23 . VAL A 1 163 ? -70.312  -40.369  0.098    1.00 0.00 ? 158 VAL A HG23 2  
ATOM 7814  N N    . THR A 1 164 ? -75.128  -41.648  -0.175   1.00 0.00 ? 159 THR A N    2  
ATOM 7815  C CA   . THR A 1 164 ? -76.599  -41.463  -0.366   1.00 0.00 ? 159 THR A CA   2  
ATOM 7816  C C    . THR A 1 164 ? -77.247  -42.776  -0.818   1.00 0.00 ? 159 THR A C    2  
ATOM 7817  O O    . THR A 1 164 ? -78.342  -43.110  -0.408   1.00 0.00 ? 159 THR A O    2  
ATOM 7818  C CB   . THR A 1 164 ? -76.732  -40.394  -1.456   1.00 0.00 ? 159 THR A CB   2  
ATOM 7819  O OG1  . THR A 1 164 ? -78.108  -40.162  -1.722   1.00 0.00 ? 159 THR A OG1  2  
ATOM 7820  C CG2  . THR A 1 164 ? -76.036  -40.867  -2.734   1.00 0.00 ? 159 THR A CG2  2  
ATOM 7821  H H    . THR A 1 164 ? -74.704  -42.493  -0.431   1.00 0.00 ? 159 THR A H    2  
ATOM 7822  H HA   . THR A 1 164 ? -77.055  -41.114  0.547    1.00 0.00 ? 159 THR A HA   2  
ATOM 7823  H HB   . THR A 1 164 ? -76.271  -39.478  -1.119   1.00 0.00 ? 159 THR A HB   2  
ATOM 7824  H HG1  . THR A 1 164 ? -78.368  -39.361  -1.262   1.00 0.00 ? 159 THR A HG1  2  
ATOM 7825  H HG21 . THR A 1 164 ? -75.054  -41.245  -2.491   1.00 0.00 ? 159 THR A HG21 2  
ATOM 7826  H HG22 . THR A 1 164 ? -75.943  -40.039  -3.421   1.00 0.00 ? 159 THR A HG22 2  
ATOM 7827  H HG23 . THR A 1 164 ? -76.620  -41.651  -3.193   1.00 0.00 ? 159 THR A HG23 2  
ATOM 7828  N N    . GLY A 1 165 ? -76.582  -43.518  -1.662   1.00 0.00 ? 160 GLY A N    2  
ATOM 7829  C CA   . GLY A 1 165 ? -77.160  -44.806  -2.143   1.00 0.00 ? 160 GLY A CA   2  
ATOM 7830  C C    . GLY A 1 165 ? -76.926  -45.898  -1.097   1.00 0.00 ? 160 GLY A C    2  
ATOM 7831  O O    . GLY A 1 165 ? -77.792  -46.708  -0.827   1.00 0.00 ? 160 GLY A O    2  
ATOM 7832  H H    . GLY A 1 165 ? -75.703  -43.228  -1.981   1.00 0.00 ? 160 GLY A H    2  
ATOM 7833  H HA2  . GLY A 1 165 ? -78.222  -44.685  -2.306   1.00 0.00 ? 160 GLY A HA2  2  
ATOM 7834  H HA3  . GLY A 1 165 ? -76.684  -45.092  -3.068   1.00 0.00 ? 160 GLY A HA3  2  
ATOM 7835  N N    . SER A 1 166 ? -75.761  -45.927  -0.507   1.00 0.00 ? 161 SER A N    2  
ATOM 7836  C CA   . SER A 1 166 ? -75.469  -46.968  0.522    1.00 0.00 ? 161 SER A CA   2  
ATOM 7837  C C    . SER A 1 166 ? -74.432  -46.453  1.524    1.00 0.00 ? 161 SER A C    2  
ATOM 7838  O O    . SER A 1 166 ? -74.548  -46.670  2.715    1.00 0.00 ? 161 SER A O    2  
ATOM 7839  C CB   . SER A 1 166 ? -74.910  -48.154  -0.262   1.00 0.00 ? 161 SER A CB   2  
ATOM 7840  O OG   . SER A 1 166 ? -74.010  -47.680  -1.254   1.00 0.00 ? 161 SER A OG   2  
ATOM 7841  H H    . SER A 1 166 ? -75.078  -45.264  -0.741   1.00 0.00 ? 161 SER A H    2  
ATOM 7842  H HA   . SER A 1 166 ? -76.374  -47.258  1.032    1.00 0.00 ? 161 SER A HA   2  
ATOM 7843  H HB2  . SER A 1 166 ? -74.385  -48.814  0.408    1.00 0.00 ? 161 SER A HB2  2  
ATOM 7844  H HB3  . SER A 1 166 ? -75.726  -48.692  -0.727   1.00 0.00 ? 161 SER A HB3  2  
ATOM 7845  H HG   . SER A 1 166 ? -74.459  -47.713  -2.102   1.00 0.00 ? 161 SER A HG   2  
ATOM 7846  N N    . GLU A 1 167 ? -73.418  -45.774  1.052    1.00 0.00 ? 162 GLU A N    2  
ATOM 7847  C CA   . GLU A 1 167 ? -72.371  -45.244  1.979    1.00 0.00 ? 162 GLU A CA   2  
ATOM 7848  C C    . GLU A 1 167 ? -73.019  -44.444  3.114    1.00 0.00 ? 162 GLU A C    2  
ATOM 7849  O O    . GLU A 1 167 ? -72.483  -44.344  4.202    1.00 0.00 ? 162 GLU A O    2  
ATOM 7850  C CB   . GLU A 1 167 ? -71.490  -44.336  1.115    1.00 0.00 ? 162 GLU A CB   2  
ATOM 7851  C CG   . GLU A 1 167 ? -70.025  -44.753  1.260    1.00 0.00 ? 162 GLU A CG   2  
ATOM 7852  C CD   . GLU A 1 167 ? -69.824  -46.140  0.647    1.00 0.00 ? 162 GLU A CD   2  
ATOM 7853  O OE1  . GLU A 1 167 ? -69.547  -46.207  -0.540   1.00 0.00 ? 162 GLU A OE1  2  
ATOM 7854  O OE2  . GLU A 1 167 ? -69.951  -47.111  1.373    1.00 0.00 ? 162 GLU A OE2  2  
ATOM 7855  H H    . GLU A 1 167 ? -73.345  -45.613  0.088    1.00 0.00 ? 162 GLU A H    2  
ATOM 7856  H HA   . GLU A 1 167 ? -71.782  -46.054  2.380    1.00 0.00 ? 162 GLU A HA   2  
ATOM 7857  H HB2  . GLU A 1 167 ? -71.788  -44.424  0.080    1.00 0.00 ? 162 GLU A HB2  2  
ATOM 7858  H HB3  . GLU A 1 167 ? -71.604  -43.312  1.436    1.00 0.00 ? 162 GLU A HB3  2  
ATOM 7859  H HG2  . GLU A 1 167 ? -69.395  -44.038  0.750    1.00 0.00 ? 162 GLU A HG2  2  
ATOM 7860  H HG3  . GLU A 1 167 ? -69.761  -44.783  2.307    1.00 0.00 ? 162 GLU A HG3  2  
ATOM 7861  N N    . TYR A 1 168 ? -74.179  -43.891  2.875    1.00 0.00 ? 163 TYR A N    2  
ATOM 7862  C CA   . TYR A 1 168 ? -74.869  -43.117  3.940    1.00 0.00 ? 163 TYR A CA   2  
ATOM 7863  C C    . TYR A 1 168 ? -75.499  -44.096  4.922    1.00 0.00 ? 163 TYR A C    2  
ATOM 7864  O O    . TYR A 1 168 ? -75.522  -43.861  6.113    1.00 0.00 ? 163 TYR A O    2  
ATOM 7865  C CB   . TYR A 1 168 ? -75.929  -42.278  3.206    1.00 0.00 ? 163 TYR A CB   2  
ATOM 7866  C CG   . TYR A 1 168 ? -77.298  -42.473  3.827    1.00 0.00 ? 163 TYR A CG   2  
ATOM 7867  C CD1  . TYR A 1 168 ? -77.502  -42.201  5.187    1.00 0.00 ? 163 TYR A CD1  2  
ATOM 7868  C CD2  . TYR A 1 168 ? -78.360  -42.930  3.038    1.00 0.00 ? 163 TYR A CD2  2  
ATOM 7869  C CE1  . TYR A 1 168 ? -78.767  -42.390  5.754    1.00 0.00 ? 163 TYR A CE1  2  
ATOM 7870  C CE2  . TYR A 1 168 ? -79.625  -43.117  3.606    1.00 0.00 ? 163 TYR A CE2  2  
ATOM 7871  C CZ   . TYR A 1 168 ? -79.828  -42.847  4.964    1.00 0.00 ? 163 TYR A CZ   2  
ATOM 7872  O OH   . TYR A 1 168 ? -81.076  -43.032  5.525    1.00 0.00 ? 163 TYR A OH   2  
ATOM 7873  H H    . TYR A 1 168 ? -74.604  -44.001  2.001    1.00 0.00 ? 163 TYR A H    2  
ATOM 7874  H HA   . TYR A 1 168 ? -74.174  -42.468  4.450    1.00 0.00 ? 163 TYR A HA   2  
ATOM 7875  H HB2  . TYR A 1 168 ? -75.659  -41.235  3.268    1.00 0.00 ? 163 TYR A HB2  2  
ATOM 7876  H HB3  . TYR A 1 168 ? -75.963  -42.576  2.169    1.00 0.00 ? 163 TYR A HB3  2  
ATOM 7877  H HD1  . TYR A 1 168 ? -76.680  -41.850  5.801    1.00 0.00 ? 163 TYR A HD1  2  
ATOM 7878  H HD2  . TYR A 1 168 ? -78.204  -43.139  1.990    1.00 0.00 ? 163 TYR A HD2  2  
ATOM 7879  H HE1  . TYR A 1 168 ? -78.925  -42.181  6.799    1.00 0.00 ? 163 TYR A HE1  2  
ATOM 7880  H HE2  . TYR A 1 168 ? -80.445  -43.469  2.997    1.00 0.00 ? 163 TYR A HE2  2  
ATOM 7881  H HH   . TYR A 1 168 ? -81.382  -43.910  5.285    1.00 0.00 ? 163 TYR A HH   2  
ATOM 7882  N N    . GLU A 1 169 ? -76.011  -45.191  4.432    1.00 0.00 ? 164 GLU A N    2  
ATOM 7883  C CA   . GLU A 1 169 ? -76.635  -46.177  5.348    1.00 0.00 ? 164 GLU A CA   2  
ATOM 7884  C C    . GLU A 1 169 ? -75.542  -46.894  6.135    1.00 0.00 ? 164 GLU A C    2  
ATOM 7885  O O    . GLU A 1 169 ? -75.638  -47.062  7.335    1.00 0.00 ? 164 GLU A O    2  
ATOM 7886  C CB   . GLU A 1 169 ? -77.391  -47.161  4.459    1.00 0.00 ? 164 GLU A CB   2  
ATOM 7887  C CG   . GLU A 1 169 ? -78.378  -46.404  3.562    1.00 0.00 ? 164 GLU A CG   2  
ATOM 7888  C CD   . GLU A 1 169 ? -79.811  -46.689  4.020    1.00 0.00 ? 164 GLU A CD   2  
ATOM 7889  O OE1  . GLU A 1 169 ? -80.278  -47.791  3.785    1.00 0.00 ? 164 GLU A OE1  2  
ATOM 7890  O OE2  . GLU A 1 169 ? -80.415  -45.800  4.596    1.00 0.00 ? 164 GLU A OE2  2  
ATOM 7891  H H    . GLU A 1 169 ? -75.983  -45.362  3.466    1.00 0.00 ? 164 GLU A H    2  
ATOM 7892  H HA   . GLU A 1 169 ? -77.316  -45.680  6.014    1.00 0.00 ? 164 GLU A HA   2  
ATOM 7893  H HB2  . GLU A 1 169 ? -76.687  -47.702  3.847    1.00 0.00 ? 164 GLU A HB2  2  
ATOM 7894  H HB3  . GLU A 1 169 ? -77.933  -47.853  5.084    1.00 0.00 ? 164 GLU A HB3  2  
ATOM 7895  H HG2  . GLU A 1 169 ? -78.184  -45.343  3.626    1.00 0.00 ? 164 GLU A HG2  2  
ATOM 7896  H HG3  . GLU A 1 169 ? -78.258  -46.731  2.541    1.00 0.00 ? 164 GLU A HG3  2  
ATOM 7897  N N    . THR A 1 170 ? -74.488  -47.296  5.470    1.00 0.00 ? 165 THR A N    2  
ATOM 7898  C CA   . THR A 1 170 ? -73.373  -47.977  6.190    1.00 0.00 ? 165 THR A CA   2  
ATOM 7899  C C    . THR A 1 170 ? -72.910  -47.074  7.333    1.00 0.00 ? 165 THR A C    2  
ATOM 7900  O O    . THR A 1 170 ? -72.496  -47.530  8.382    1.00 0.00 ? 165 THR A O    2  
ATOM 7901  C CB   . THR A 1 170 ? -72.264  -48.149  5.150    1.00 0.00 ? 165 THR A CB   2  
ATOM 7902  O OG1  . THR A 1 170 ? -72.836  -48.562  3.916    1.00 0.00 ? 165 THR A OG1  2  
ATOM 7903  C CG2  . THR A 1 170 ? -71.269  -49.206  5.631    1.00 0.00 ? 165 THR A CG2  2  
ATOM 7904  H H    . THR A 1 170 ? -74.424  -47.131  4.505    1.00 0.00 ? 165 THR A H    2  
ATOM 7905  H HA   . THR A 1 170 ? -73.691  -48.937  6.566    1.00 0.00 ? 165 THR A HA   2  
ATOM 7906  H HB   . THR A 1 170 ? -71.749  -47.212  5.012    1.00 0.00 ? 165 THR A HB   2  
ATOM 7907  H HG1  . THR A 1 170 ? -72.153  -48.517  3.243    1.00 0.00 ? 165 THR A HG1  2  
ATOM 7908  H HG21 . THR A 1 170 ? -70.809  -49.683  4.778    1.00 0.00 ? 165 THR A HG21 2  
ATOM 7909  H HG22 . THR A 1 170 ? -71.787  -49.947  6.222    1.00 0.00 ? 165 THR A HG22 2  
ATOM 7910  H HG23 . THR A 1 170 ? -70.506  -48.734  6.233    1.00 0.00 ? 165 THR A HG23 2  
ATOM 7911  N N    . MET A 1 171 ? -73.016  -45.787  7.137    1.00 0.00 ? 166 MET A N    2  
ATOM 7912  C CA   . MET A 1 171 ? -72.628  -44.830  8.197    1.00 0.00 ? 166 MET A CA   2  
ATOM 7913  C C    . MET A 1 171 ? -73.843  -44.579  9.087    1.00 0.00 ? 166 MET A C    2  
ATOM 7914  O O    . MET A 1 171 ? -73.724  -44.392  10.282   1.00 0.00 ? 166 MET A O    2  
ATOM 7915  C CB   . MET A 1 171 ? -72.212  -43.557  7.453    1.00 0.00 ? 166 MET A CB   2  
ATOM 7916  C CG   . MET A 1 171 ? -70.770  -43.192  7.823    1.00 0.00 ? 166 MET A CG   2  
ATOM 7917  S SD   . MET A 1 171 ? -70.759  -41.779  8.959    1.00 0.00 ? 166 MET A SD   2  
ATOM 7918  C CE   . MET A 1 171 ? -72.016  -42.389  10.110   1.00 0.00 ? 166 MET A CE   2  
ATOM 7919  H H    . MET A 1 171 ? -73.377  -45.451  6.296    1.00 0.00 ? 166 MET A H    2  
ATOM 7920  H HA   . MET A 1 171 ? -71.803  -45.216  8.775    1.00 0.00 ? 166 MET A HA   2  
ATOM 7921  H HB2  . MET A 1 171 ? -72.277  -43.726  6.388    1.00 0.00 ? 166 MET A HB2  2  
ATOM 7922  H HB3  . MET A 1 171 ? -72.870  -42.746  7.727    1.00 0.00 ? 166 MET A HB3  2  
ATOM 7923  H HG2  . MET A 1 171 ? -70.295  -44.037  8.299    1.00 0.00 ? 166 MET A HG2  2  
ATOM 7924  H HG3  . MET A 1 171 ? -70.225  -42.935  6.927    1.00 0.00 ? 166 MET A HG3  2  
ATOM 7925  H HE1  . MET A 1 171 ? -72.046  -41.752  10.980   1.00 0.00 ? 166 MET A HE1  2  
ATOM 7926  H HE2  . MET A 1 171 ? -71.773  -43.397  10.415   1.00 0.00 ? 166 MET A HE2  2  
ATOM 7927  H HE3  . MET A 1 171 ? -72.983  -42.385  9.619    1.00 0.00 ? 166 MET A HE3  2  
ATOM 7928  N N    . LEU A 1 172 ? -75.023  -44.599  8.515    1.00 0.00 ? 167 LEU A N    2  
ATOM 7929  C CA   . LEU A 1 172 ? -76.247  -44.384  9.338    1.00 0.00 ? 167 LEU A CA   2  
ATOM 7930  C C    . LEU A 1 172 ? -76.210  -45.344  10.523   1.00 0.00 ? 167 LEU A C    2  
ATOM 7931  O O    . LEU A 1 172 ? -76.634  -45.025  11.614   1.00 0.00 ? 167 LEU A O    2  
ATOM 7932  C CB   . LEU A 1 172 ? -77.432  -44.686  8.419    1.00 0.00 ? 167 LEU A CB   2  
ATOM 7933  C CG   . LEU A 1 172 ? -78.711  -44.091  9.022    1.00 0.00 ? 167 LEU A CG   2  
ATOM 7934  C CD1  . LEU A 1 172 ? -78.538  -42.581  9.232    1.00 0.00 ? 167 LEU A CD1  2  
ATOM 7935  C CD2  . LEU A 1 172 ? -79.885  -44.341  8.073    1.00 0.00 ? 167 LEU A CD2  2  
ATOM 7936  H H    . LEU A 1 172 ? -75.100  -44.772  7.556    1.00 0.00 ? 167 LEU A H    2  
ATOM 7937  H HA   . LEU A 1 172 ? -76.292  -43.366  9.677    1.00 0.00 ? 167 LEU A HA   2  
ATOM 7938  H HB2  . LEU A 1 172 ? -77.254  -44.250  7.447    1.00 0.00 ? 167 LEU A HB2  2  
ATOM 7939  H HB3  . LEU A 1 172 ? -77.548  -45.755  8.319    1.00 0.00 ? 167 LEU A HB3  2  
ATOM 7940  H HG   . LEU A 1 172 ? -78.909  -44.564  9.973    1.00 0.00 ? 167 LEU A HG   2  
ATOM 7941  H HD11 . LEU A 1 172 ? -79.499  -42.093  9.161    1.00 0.00 ? 167 LEU A HD11 2  
ATOM 7942  H HD12 . LEU A 1 172 ? -77.876  -42.184  8.478    1.00 0.00 ? 167 LEU A HD12 2  
ATOM 7943  H HD13 . LEU A 1 172 ? -78.116  -42.401  10.209   1.00 0.00 ? 167 LEU A HD13 2  
ATOM 7944  H HD21 . LEU A 1 172 ? -79.516  -44.462  7.066    1.00 0.00 ? 167 LEU A HD21 2  
ATOM 7945  H HD22 . LEU A 1 172 ? -80.563  -43.501  8.110    1.00 0.00 ? 167 LEU A HD22 2  
ATOM 7946  H HD23 . LEU A 1 172 ? -80.407  -45.238  8.375    1.00 0.00 ? 167 LEU A HD23 2  
ATOM 7947  N N    . THR A 1 173 ? -75.656  -46.507  10.313   1.00 0.00 ? 168 THR A N    2  
ATOM 7948  C CA   . THR A 1 173 ? -75.531  -47.490  11.419   1.00 0.00 ? 168 THR A CA   2  
ATOM 7949  C C    . THR A 1 173 ? -74.240  -47.194  12.184   1.00 0.00 ? 168 THR A C    2  
ATOM 7950  O O    . THR A 1 173 ? -74.147  -47.402  13.377   1.00 0.00 ? 168 THR A O    2  
ATOM 7951  C CB   . THR A 1 173 ? -75.451  -48.854  10.735   1.00 0.00 ? 168 THR A CB   2  
ATOM 7952  O OG1  . THR A 1 173 ? -76.386  -48.903  9.666    1.00 0.00 ? 168 THR A OG1  2  
ATOM 7953  C CG2  . THR A 1 173 ? -75.771  -49.956  11.747   1.00 0.00 ? 168 THR A CG2  2  
ATOM 7954  H H    . THR A 1 173 ? -75.294  -46.721  9.429    1.00 0.00 ? 168 THR A H    2  
ATOM 7955  H HA   . THR A 1 173 ? -76.387  -47.445  12.074   1.00 0.00 ? 168 THR A HA   2  
ATOM 7956  H HB   . THR A 1 173 ? -74.454  -49.004  10.350   1.00 0.00 ? 168 THR A HB   2  
ATOM 7957  H HG1  . THR A 1 173 ? -75.953  -48.567  8.878    1.00 0.00 ? 168 THR A HG1  2  
ATOM 7958  H HG21 . THR A 1 173 ? -76.436  -49.567  12.504   1.00 0.00 ? 168 THR A HG21 2  
ATOM 7959  H HG22 . THR A 1 173 ? -74.857  -50.295  12.211   1.00 0.00 ? 168 THR A HG22 2  
ATOM 7960  H HG23 . THR A 1 173 ? -76.246  -50.783  11.240   1.00 0.00 ? 168 THR A HG23 2  
ATOM 7961  N N    . GLU A 1 174 ? -73.244  -46.692  11.493   1.00 0.00 ? 169 GLU A N    2  
ATOM 7962  C CA   . GLU A 1 174 ? -71.954  -46.359  12.164   1.00 0.00 ? 169 GLU A CA   2  
ATOM 7963  C C    . GLU A 1 174 ? -72.209  -45.411  13.336   1.00 0.00 ? 169 GLU A C    2  
ATOM 7964  O O    . GLU A 1 174 ? -71.576  -45.505  14.370   1.00 0.00 ? 169 GLU A O    2  
ATOM 7965  C CB   . GLU A 1 174 ? -71.102  -45.687  11.088   1.00 0.00 ? 169 GLU A CB   2  
ATOM 7966  C CG   . GLU A 1 174 ? -69.755  -45.269  11.684   1.00 0.00 ? 169 GLU A CG   2  
ATOM 7967  C CD   . GLU A 1 174 ? -68.924  -46.516  11.993   1.00 0.00 ? 169 GLU A CD   2  
ATOM 7968  O OE1  . GLU A 1 174 ? -68.849  -47.381  11.137   1.00 0.00 ? 169 GLU A OE1  2  
ATOM 7969  O OE2  . GLU A 1 174 ? -68.377  -46.584  13.081   1.00 0.00 ? 169 GLU A OE2  2  
ATOM 7970  H H    . GLU A 1 174 ? -73.351  -46.527  10.532   1.00 0.00 ? 169 GLU A H    2  
ATOM 7971  H HA   . GLU A 1 174 ? -71.470  -47.248  12.504   1.00 0.00 ? 169 GLU A HA   2  
ATOM 7972  H HB2  . GLU A 1 174 ? -70.937  -46.381  10.277   1.00 0.00 ? 169 GLU A HB2  2  
ATOM 7973  H HB3  . GLU A 1 174 ? -71.614  -44.819  10.717   1.00 0.00 ? 169 GLU A HB3  2  
ATOM 7974  H HG2  . GLU A 1 174 ? -69.226  -44.648  10.976   1.00 0.00 ? 169 GLU A HG2  2  
ATOM 7975  H HG3  . GLU A 1 174 ? -69.922  -44.715  12.595   1.00 0.00 ? 169 GLU A HG3  2  
ATOM 7976  N N    . ILE A 1 175 ? -73.142  -44.507  13.190   1.00 0.00 ? 170 ILE A N    2  
ATOM 7977  C CA   . ILE A 1 175 ? -73.441  -43.568  14.316   1.00 0.00 ? 170 ILE A CA   2  
ATOM 7978  C C    . ILE A 1 175 ? -74.676  -44.052  15.089   1.00 0.00 ? 170 ILE A C    2  
ATOM 7979  O O    . ILE A 1 175 ? -74.653  -44.153  16.299   1.00 0.00 ? 170 ILE A O    2  
ATOM 7980  C CB   . ILE A 1 175 ? -73.688  -42.200  13.664   1.00 0.00 ? 170 ILE A CB   2  
ATOM 7981  C CG1  . ILE A 1 175 ? -72.348  -41.466  13.527   1.00 0.00 ? 170 ILE A CG1  2  
ATOM 7982  C CG2  . ILE A 1 175 ? -74.637  -41.369  14.536   1.00 0.00 ? 170 ILE A CG2  2  
ATOM 7983  C CD1  . ILE A 1 175 ? -72.567  -40.089  12.893   1.00 0.00 ? 170 ILE A CD1  2  
ATOM 7984  H H    . ILE A 1 175 ? -73.650  -44.455  12.346   1.00 0.00 ? 170 ILE A H    2  
ATOM 7985  H HA   . ILE A 1 175 ? -72.591  -43.508  14.978   1.00 0.00 ? 170 ILE A HA   2  
ATOM 7986  H HB   . ILE A 1 175 ? -74.125  -42.339  12.688   1.00 0.00 ? 170 ILE A HB   2  
ATOM 7987  H HG12 . ILE A 1 175 ? -71.906  -41.345  14.505   1.00 0.00 ? 170 ILE A HG12 2  
ATOM 7988  H HG13 . ILE A 1 175 ? -71.684  -42.045  12.903   1.00 0.00 ? 170 ILE A HG13 2  
ATOM 7989  H HG21 . ILE A 1 175 ? -74.702  -40.365  14.144   1.00 0.00 ? 170 ILE A HG21 2  
ATOM 7990  H HG22 . ILE A 1 175 ? -74.261  -41.338  15.548   1.00 0.00 ? 170 ILE A HG22 2  
ATOM 7991  H HG23 . ILE A 1 175 ? -75.618  -41.823  14.532   1.00 0.00 ? 170 ILE A HG23 2  
ATOM 7992  H HD11 . ILE A 1 175 ? -72.124  -40.071  11.908   1.00 0.00 ? 170 ILE A HD11 2  
ATOM 7993  H HD12 . ILE A 1 175 ? -72.102  -39.334  13.508   1.00 0.00 ? 170 ILE A HD12 2  
ATOM 7994  H HD13 . ILE A 1 175 ? -73.626  -39.890  12.815   1.00 0.00 ? 170 ILE A HD13 2  
ATOM 7995  N N    . MET A 1 176 ? -75.748  -44.356  14.398   1.00 0.00 ? 171 MET A N    2  
ATOM 7996  C CA   . MET A 1 176 ? -76.993  -44.844  15.081   1.00 0.00 ? 171 MET A CA   2  
ATOM 7997  C C    . MET A 1 176 ? -76.642  -45.701  16.303   1.00 0.00 ? 171 MET A C    2  
ATOM 7998  O O    . MET A 1 176 ? -77.188  -45.527  17.373   1.00 0.00 ? 171 MET A O    2  
ATOM 7999  C CB   . MET A 1 176 ? -77.727  -45.679  14.027   1.00 0.00 ? 171 MET A CB   2  
ATOM 8000  C CG   . MET A 1 176 ? -78.948  -46.361  14.658   1.00 0.00 ? 171 MET A CG   2  
ATOM 8001  S SD   . MET A 1 176 ? -78.737  -48.160  14.608   1.00 0.00 ? 171 MET A SD   2  
ATOM 8002  C CE   . MET A 1 176 ? -79.051  -48.375  12.838   1.00 0.00 ? 171 MET A CE   2  
ATOM 8003  H H    . MET A 1 176 ? -75.735  -44.269  13.422   1.00 0.00 ? 171 MET A H    2  
ATOM 8004  H HA   . MET A 1 176 ? -77.607  -44.008  15.376   1.00 0.00 ? 171 MET A HA   2  
ATOM 8005  H HB2  . MET A 1 176 ? -78.055  -45.032  13.226   1.00 0.00 ? 171 MET A HB2  2  
ATOM 8006  H HB3  . MET A 1 176 ? -77.058  -46.428  13.633   1.00 0.00 ? 171 MET A HB3  2  
ATOM 8007  H HG2  . MET A 1 176 ? -79.050  -46.042  15.685   1.00 0.00 ? 171 MET A HG2  2  
ATOM 8008  H HG3  . MET A 1 176 ? -79.836  -46.088  14.108   1.00 0.00 ? 171 MET A HG3  2  
ATOM 8009  H HE1  . MET A 1 176 ? -80.115  -48.475  12.672   1.00 0.00 ? 171 MET A HE1  2  
ATOM 8010  H HE2  . MET A 1 176 ? -78.550  -49.264  12.488   1.00 0.00 ? 171 MET A HE2  2  
ATOM 8011  H HE3  . MET A 1 176 ? -78.675  -47.516  12.300   1.00 0.00 ? 171 MET A HE3  2  
ATOM 8012  N N    . SER A 1 177 ? -75.739  -46.631  16.134   1.00 0.00 ? 172 SER A N    2  
ATOM 8013  C CA   . SER A 1 177 ? -75.330  -47.529  17.262   1.00 0.00 ? 172 SER A CA   2  
ATOM 8014  C C    . SER A 1 177 ? -75.219  -46.756  18.584   1.00 0.00 ? 172 SER A C    2  
ATOM 8015  O O    . SER A 1 177 ? -75.456  -47.297  19.647   1.00 0.00 ? 172 SER A O    2  
ATOM 8016  C CB   . SER A 1 177 ? -73.963  -48.074  16.847   1.00 0.00 ? 172 SER A CB   2  
ATOM 8017  O OG   . SER A 1 177 ? -74.064  -49.474  16.624   1.00 0.00 ? 172 SER A OG   2  
ATOM 8018  H H    . SER A 1 177 ? -75.324  -46.741  15.253   1.00 0.00 ? 172 SER A H    2  
ATOM 8019  H HA   . SER A 1 177 ? -76.029  -48.343  17.363   1.00 0.00 ? 172 SER A HA   2  
ATOM 8020  H HB2  . SER A 1 177 ? -73.641  -47.592  15.938   1.00 0.00 ? 172 SER A HB2  2  
ATOM 8021  H HB3  . SER A 1 177 ? -73.243  -47.875  17.631   1.00 0.00 ? 172 SER A HB3  2  
ATOM 8022  H HG   . SER A 1 177 ? -73.184  -49.850  16.697   1.00 0.00 ? 172 SER A HG   2  
ATOM 8023  N N    . MET A 1 178 ? -74.865  -45.497  18.530   1.00 0.00 ? 173 MET A N    2  
ATOM 8024  C CA   . MET A 1 178 ? -74.746  -44.701  19.790   1.00 0.00 ? 173 MET A CA   2  
ATOM 8025  C C    . MET A 1 178 ? -76.075  -44.711  20.552   1.00 0.00 ? 173 MET A C    2  
ATOM 8026  O O    . MET A 1 178 ? -76.118  -44.482  21.745   1.00 0.00 ? 173 MET A O    2  
ATOM 8027  C CB   . MET A 1 178 ? -74.396  -43.279  19.342   1.00 0.00 ? 173 MET A CB   2  
ATOM 8028  C CG   . MET A 1 178 ? -72.967  -42.940  19.775   1.00 0.00 ? 173 MET A CG   2  
ATOM 8029  S SD   . MET A 1 178 ? -71.812  -43.402  18.460   1.00 0.00 ? 173 MET A SD   2  
ATOM 8030  C CE   . MET A 1 178 ? -72.392  -42.216  17.223   1.00 0.00 ? 173 MET A CE   2  
ATOM 8031  H H    . MET A 1 178 ? -74.678  -45.078  17.664   1.00 0.00 ? 173 MET A H    2  
ATOM 8032  H HA   . MET A 1 178 ? -73.958  -45.096  20.409   1.00 0.00 ? 173 MET A HA   2  
ATOM 8033  H HB2  . MET A 1 178 ? -74.472  -43.210  18.267   1.00 0.00 ? 173 MET A HB2  2  
ATOM 8034  H HB3  . MET A 1 178 ? -75.081  -42.579  19.796   1.00 0.00 ? 173 MET A HB3  2  
ATOM 8035  H HG2  . MET A 1 178 ? -72.891  -41.880  19.965   1.00 0.00 ? 173 MET A HG2  2  
ATOM 8036  H HG3  . MET A 1 178 ? -72.725  -43.486  20.675   1.00 0.00 ? 173 MET A HG3  2  
ATOM 8037  H HE1  . MET A 1 178 ? -73.182  -42.665  16.639   1.00 0.00 ? 173 MET A HE1  2  
ATOM 8038  H HE2  . MET A 1 178 ? -71.577  -41.944  16.573   1.00 0.00 ? 173 MET A HE2  2  
ATOM 8039  H HE3  . MET A 1 178 ? -72.764  -41.330  17.721   1.00 0.00 ? 173 MET A HE3  2  
ATOM 8040  N N    . GLY A 1 179 ? -77.156  -44.975  19.871   1.00 0.00 ? 174 GLY A N    2  
ATOM 8041  C CA   . GLY A 1 179 ? -78.483  -45.002  20.551   1.00 0.00 ? 174 GLY A CA   2  
ATOM 8042  C C    . GLY A 1 179 ? -79.430  -44.008  19.873   1.00 0.00 ? 174 GLY A C    2  
ATOM 8043  O O    . GLY A 1 179 ? -80.403  -43.571  20.455   1.00 0.00 ? 174 GLY A O    2  
ATOM 8044  H H    . GLY A 1 179 ? -77.096  -45.156  18.910   1.00 0.00 ? 174 GLY A H    2  
ATOM 8045  H HA2  . GLY A 1 179 ? -78.898  -45.998  20.487   1.00 0.00 ? 174 GLY A HA2  2  
ATOM 8046  H HA3  . GLY A 1 179 ? -78.362  -44.727  21.587   1.00 0.00 ? 174 GLY A HA3  2  
ATOM 8047  N N    . TYR A 1 180 ? -79.154  -43.648  18.647   1.00 0.00 ? 175 TYR A N    2  
ATOM 8048  C CA   . TYR A 1 180 ? -80.039  -42.681  17.933   1.00 0.00 ? 175 TYR A CA   2  
ATOM 8049  C C    . TYR A 1 180 ? -81.077  -43.430  17.093   1.00 0.00 ? 175 TYR A C    2  
ATOM 8050  O O    . TYR A 1 180 ? -81.344  -44.595  17.313   1.00 0.00 ? 175 TYR A O    2  
ATOM 8051  C CB   . TYR A 1 180 ? -79.102  -41.873  17.033   1.00 0.00 ? 175 TYR A CB   2  
ATOM 8052  C CG   . TYR A 1 180 ? -78.057  -41.183  17.877   1.00 0.00 ? 175 TYR A CG   2  
ATOM 8053  C CD1  . TYR A 1 180 ? -78.443  -40.425  18.989   1.00 0.00 ? 175 TYR A CD1  2  
ATOM 8054  C CD2  . TYR A 1 180 ? -76.701  -41.303  17.549   1.00 0.00 ? 175 TYR A CD2  2  
ATOM 8055  C CE1  . TYR A 1 180 ? -77.475  -39.788  19.773   1.00 0.00 ? 175 TYR A CE1  2  
ATOM 8056  C CE2  . TYR A 1 180 ? -75.732  -40.666  18.333   1.00 0.00 ? 175 TYR A CE2  2  
ATOM 8057  C CZ   . TYR A 1 180 ? -76.119  -39.908  19.445   1.00 0.00 ? 175 TYR A CZ   2  
ATOM 8058  O OH   . TYR A 1 180 ? -75.163  -39.280  20.217   1.00 0.00 ? 175 TYR A OH   2  
ATOM 8059  H H    . TYR A 1 180 ? -78.364  -44.010  18.195   1.00 0.00 ? 175 TYR A H    2  
ATOM 8060  H HA   . TYR A 1 180 ? -80.527  -42.026  18.638   1.00 0.00 ? 175 TYR A HA   2  
ATOM 8061  H HB2  . TYR A 1 180 ? -78.618  -42.536  16.331   1.00 0.00 ? 175 TYR A HB2  2  
ATOM 8062  H HB3  . TYR A 1 180 ? -79.672  -41.131  16.493   1.00 0.00 ? 175 TYR A HB3  2  
ATOM 8063  H HD1  . TYR A 1 180 ? -79.489  -40.332  19.242   1.00 0.00 ? 175 TYR A HD1  2  
ATOM 8064  H HD2  . TYR A 1 180 ? -76.403  -41.888  16.691   1.00 0.00 ? 175 TYR A HD2  2  
ATOM 8065  H HE1  . TYR A 1 180 ? -77.774  -39.204  20.630   1.00 0.00 ? 175 TYR A HE1  2  
ATOM 8066  H HE2  . TYR A 1 180 ? -74.687  -40.758  18.080   1.00 0.00 ? 175 TYR A HE2  2  
ATOM 8067  H HH   . TYR A 1 180 ? -74.571  -39.953  20.561   1.00 0.00 ? 175 TYR A HH   2  
ATOM 8068  N N    . GLU A 1 181 ? -81.662  -42.767  16.132   1.00 0.00 ? 176 GLU A N    2  
ATOM 8069  C CA   . GLU A 1 181 ? -82.685  -43.434  15.273   1.00 0.00 ? 176 GLU A CA   2  
ATOM 8070  C C    . GLU A 1 181 ? -82.129  -43.626  13.854   1.00 0.00 ? 176 GLU A C    2  
ATOM 8071  O O    . GLU A 1 181 ? -80.958  -43.900  13.675   1.00 0.00 ? 176 GLU A O    2  
ATOM 8072  C CB   . GLU A 1 181 ? -83.882  -42.476  15.275   1.00 0.00 ? 176 GLU A CB   2  
ATOM 8073  C CG   . GLU A 1 181 ? -84.345  -42.230  16.715   1.00 0.00 ? 176 GLU A CG   2  
ATOM 8074  C CD   . GLU A 1 181 ? -85.869  -42.347  16.792   1.00 0.00 ? 176 GLU A CD   2  
ATOM 8075  O OE1  . GLU A 1 181 ? -86.347  -43.446  17.021   1.00 0.00 ? 176 GLU A OE1  2  
ATOM 8076  O OE2  . GLU A 1 181 ? -86.531  -41.337  16.621   1.00 0.00 ? 176 GLU A OE2  2  
ATOM 8077  H H    . GLU A 1 181 ? -81.430  -41.828  15.975   1.00 0.00 ? 176 GLU A H    2  
ATOM 8078  H HA   . GLU A 1 181 ? -82.971  -44.383  15.697   1.00 0.00 ? 176 GLU A HA   2  
ATOM 8079  H HB2  . GLU A 1 181 ? -83.592  -41.538  14.824   1.00 0.00 ? 176 GLU A HB2  2  
ATOM 8080  H HB3  . GLU A 1 181 ? -84.692  -42.912  14.709   1.00 0.00 ? 176 GLU A HB3  2  
ATOM 8081  H HG2  . GLU A 1 181 ? -83.893  -42.962  17.369   1.00 0.00 ? 176 GLU A HG2  2  
ATOM 8082  H HG3  . GLU A 1 181 ? -84.047  -41.239  17.024   1.00 0.00 ? 176 GLU A HG3  2  
ATOM 8083  N N    . ARG A 1 182 ? -82.952  -43.488  12.846   1.00 0.00 ? 177 ARG A N    2  
ATOM 8084  C CA   . ARG A 1 182 ? -82.457  -43.664  11.449   1.00 0.00 ? 177 ARG A CA   2  
ATOM 8085  C C    . ARG A 1 182 ? -82.713  -42.391  10.637   1.00 0.00 ? 177 ARG A C    2  
ATOM 8086  O O    . ARG A 1 182 ? -81.866  -41.937  9.893    1.00 0.00 ? 177 ARG A O    2  
ATOM 8087  C CB   . ARG A 1 182 ? -83.268  -44.831  10.886   1.00 0.00 ? 177 ARG A CB   2  
ATOM 8088  C CG   . ARG A 1 182 ? -82.518  -46.141  11.137   1.00 0.00 ? 177 ARG A CG   2  
ATOM 8089  C CD   . ARG A 1 182 ? -83.521  -47.293  11.235   1.00 0.00 ? 177 ARG A CD   2  
ATOM 8090  N NE   . ARG A 1 182 ? -82.979  -48.187  12.297   1.00 0.00 ? 177 ARG A NE   2  
ATOM 8091  C CZ   . ARG A 1 182 ? -83.699  -49.179  12.744   1.00 0.00 ? 177 ARG A CZ   2  
ATOM 8092  N NH1  . ARG A 1 182 ? -83.691  -50.325  12.120   1.00 0.00 ? 177 ARG A NH1  2  
ATOM 8093  N NH2  . ARG A 1 182 ? -84.427  -49.026  13.816   1.00 0.00 ? 177 ARG A NH2  2  
ATOM 8094  H H    . ARG A 1 182 ? -83.892  -43.269  13.005   1.00 0.00 ? 177 ARG A H    2  
ATOM 8095  H HA   . ARG A 1 182 ? -81.406  -43.909  11.449   1.00 0.00 ? 177 ARG A HA   2  
ATOM 8096  H HB2  . ARG A 1 182 ? -84.232  -44.868  11.373   1.00 0.00 ? 177 ARG A HB2  2  
ATOM 8097  H HB3  . ARG A 1 182 ? -83.405  -44.696  9.824    1.00 0.00 ? 177 ARG A HB3  2  
ATOM 8098  H HG2  . ARG A 1 182 ? -81.834  -46.326  10.322   1.00 0.00 ? 177 ARG A HG2  2  
ATOM 8099  H HG3  . ARG A 1 182 ? -81.966  -46.068  12.062   1.00 0.00 ? 177 ARG A HG3  2  
ATOM 8100  H HD2  . ARG A 1 182 ? -84.495  -46.919  11.516   1.00 0.00 ? 177 ARG A HD2  2  
ATOM 8101  H HD3  . ARG A 1 182 ? -83.576  -47.824  10.298   1.00 0.00 ? 177 ARG A HD3  2  
ATOM 8102  H HE   . ARG A 1 182 ? -82.082  -48.031  12.660   1.00 0.00 ? 177 ARG A HE   2  
ATOM 8103  H HH11 . ARG A 1 182 ? -83.133  -50.443  11.298   1.00 0.00 ? 177 ARG A HH11 2  
ATOM 8104  H HH12 . ARG A 1 182 ? -84.243  -51.086  12.463   1.00 0.00 ? 177 ARG A HH12 2  
ATOM 8105  H HH21 . ARG A 1 182 ? -84.433  -48.147  14.294   1.00 0.00 ? 177 ARG A HH21 2  
ATOM 8106  H HH22 . ARG A 1 182 ? -84.979  -49.786  14.159   1.00 0.00 ? 177 ARG A HH22 2  
ATOM 8107  N N    . GLU A 1 183 ? -83.876  -41.813  10.778   1.00 0.00 ? 178 GLU A N    2  
ATOM 8108  C CA   . GLU A 1 183 ? -84.192  -40.567  10.019   1.00 0.00 ? 178 GLU A CA   2  
ATOM 8109  C C    . GLU A 1 183 ? -83.526  -39.361  10.686   1.00 0.00 ? 178 GLU A C    2  
ATOM 8110  O O    . GLU A 1 183 ? -83.153  -38.406  10.033   1.00 0.00 ? 178 GLU A O    2  
ATOM 8111  C CB   . GLU A 1 183 ? -85.715  -40.441  10.073   1.00 0.00 ? 178 GLU A CB   2  
ATOM 8112  C CG   . GLU A 1 183 ? -86.350  -41.525  9.201    1.00 0.00 ? 178 GLU A CG   2  
ATOM 8113  C CD   . GLU A 1 183 ? -87.841  -41.233  9.027    1.00 0.00 ? 178 GLU A CD   2  
ATOM 8114  O OE1  . GLU A 1 183 ? -88.452  -40.783  9.982    1.00 0.00 ? 178 GLU A OE1  2  
ATOM 8115  O OE2  . GLU A 1 183 ? -88.348  -41.464  7.941    1.00 0.00 ? 178 GLU A OE2  2  
ATOM 8116  H H    . GLU A 1 183 ? -84.542  -42.197  11.385   1.00 0.00 ? 178 GLU A H    2  
ATOM 8117  H HA   . GLU A 1 183 ? -83.864  -40.658  8.994    1.00 0.00 ? 178 GLU A HA   2  
ATOM 8118  H HB2  . GLU A 1 183 ? -86.049  -40.558  11.094   1.00 0.00 ? 178 GLU A HB2  2  
ATOM 8119  H HB3  . GLU A 1 183 ? -86.009  -39.469  9.707    1.00 0.00 ? 178 GLU A HB3  2  
ATOM 8120  H HG2  . GLU A 1 183 ? -85.869  -41.536  8.233    1.00 0.00 ? 178 GLU A HG2  2  
ATOM 8121  H HG3  . GLU A 1 183 ? -86.227  -42.487  9.675    1.00 0.00 ? 178 GLU A HG3  2  
ATOM 8122  N N    . ARG A 1 184 ? -83.374  -39.396  11.982   1.00 0.00 ? 179 ARG A N    2  
ATOM 8123  C CA   . ARG A 1 184 ? -82.727  -38.252  12.686   1.00 0.00 ? 179 ARG A CA   2  
ATOM 8124  C C    . ARG A 1 184 ? -81.216  -38.313  12.495   1.00 0.00 ? 179 ARG A C    2  
ATOM 8125  O O    . ARG A 1 184 ? -80.549  -37.299  12.426   1.00 0.00 ? 179 ARG A O    2  
ATOM 8126  C CB   . ARG A 1 184 ? -83.093  -38.424  14.159   1.00 0.00 ? 179 ARG A CB   2  
ATOM 8127  C CG   . ARG A 1 184 ? -84.375  -37.647  14.463   1.00 0.00 ? 179 ARG A CG   2  
ATOM 8128  C CD   . ARG A 1 184 ? -84.437  -37.323  15.958   1.00 0.00 ? 179 ARG A CD   2  
ATOM 8129  N NE   . ARG A 1 184 ? -85.866  -37.510  16.333   1.00 0.00 ? 179 ARG A NE   2  
ATOM 8130  C CZ   . ARG A 1 184 ? -86.484  -36.591  17.024   1.00 0.00 ? 179 ARG A CZ   2  
ATOM 8131  N NH1  . ARG A 1 184 ? -86.909  -35.508  16.435   1.00 0.00 ? 179 ARG A NH1  2  
ATOM 8132  N NH2  . ARG A 1 184 ? -86.676  -36.757  18.304   1.00 0.00 ? 179 ARG A NH2  2  
ATOM 8133  H H    . ARG A 1 184 ? -83.680  -40.176  12.491   1.00 0.00 ? 179 ARG A H    2  
ATOM 8134  H HA   . ARG A 1 184 ? -83.107  -37.317  12.315   1.00 0.00 ? 179 ARG A HA   2  
ATOM 8135  H HB2  . ARG A 1 184 ? -83.246  -39.472  14.371   1.00 0.00 ? 179 ARG A HB2  2  
ATOM 8136  H HB3  . ARG A 1 184 ? -82.291  -38.046  14.775   1.00 0.00 ? 179 ARG A HB3  2  
ATOM 8137  H HG2  . ARG A 1 184 ? -84.383  -36.728  13.894   1.00 0.00 ? 179 ARG A HG2  2  
ATOM 8138  H HG3  . ARG A 1 184 ? -85.232  -38.246  14.191   1.00 0.00 ? 179 ARG A HG3  2  
ATOM 8139  H HD2  . ARG A 1 184 ? -83.807  -38.004  16.515   1.00 0.00 ? 179 ARG A HD2  2  
ATOM 8140  H HD3  . ARG A 1 184 ? -84.139  -36.302  16.134   1.00 0.00 ? 179 ARG A HD3  2  
ATOM 8141  H HE   . ARG A 1 184 ? -86.342  -38.322  16.061   1.00 0.00 ? 179 ARG A HE   2  
ATOM 8142  H HH11 . ARG A 1 184 ? -86.762  -35.381  15.454   1.00 0.00 ? 179 ARG A HH11 2  
ATOM 8143  H HH12 . ARG A 1 184 ? -87.383  -34.804  16.964   1.00 0.00 ? 179 ARG A HH12 2  
ATOM 8144  H HH21 . ARG A 1 184 ? -86.350  -37.588  18.755   1.00 0.00 ? 179 ARG A HH21 2  
ATOM 8145  H HH22 . ARG A 1 184 ? -87.149  -36.053  18.834   1.00 0.00 ? 179 ARG A HH22 2  
ATOM 8146  N N    . VAL A 1 185 ? -80.669  -39.492  12.396   1.00 0.00 ? 180 VAL A N    2  
ATOM 8147  C CA   . VAL A 1 185 ? -79.200  -39.604  12.196   1.00 0.00 ? 180 VAL A CA   2  
ATOM 8148  C C    . VAL A 1 185 ? -78.848  -39.123  10.787   1.00 0.00 ? 180 VAL A C    2  
ATOM 8149  O O    . VAL A 1 185 ? -78.024  -38.251  10.618   1.00 0.00 ? 180 VAL A O    2  
ATOM 8150  C CB   . VAL A 1 185 ? -78.860  -41.086  12.375   1.00 0.00 ? 180 VAL A CB   2  
ATOM 8151  C CG1  . VAL A 1 185 ? -77.340  -41.255  12.444   1.00 0.00 ? 180 VAL A CG1  2  
ATOM 8152  C CG2  . VAL A 1 185 ? -79.480  -41.605  13.676   1.00 0.00 ? 180 VAL A CG2  2  
ATOM 8153  H H    . VAL A 1 185 ? -81.224  -40.298  12.444   1.00 0.00 ? 180 VAL A H    2  
ATOM 8154  H HA   . VAL A 1 185 ? -78.678  -39.014  12.932   1.00 0.00 ? 180 VAL A HA   2  
ATOM 8155  H HB   . VAL A 1 185 ? -79.245  -41.645  11.539   1.00 0.00 ? 180 VAL A HB   2  
ATOM 8156  H HG11 . VAL A 1 185 ? -76.893  -40.342  12.807   1.00 0.00 ? 180 VAL A HG11 2  
ATOM 8157  H HG12 . VAL A 1 185 ? -76.956  -41.477  11.460   1.00 0.00 ? 180 VAL A HG12 2  
ATOM 8158  H HG13 . VAL A 1 185 ? -77.098  -42.066  13.116   1.00 0.00 ? 180 VAL A HG13 2  
ATOM 8159  H HG21 . VAL A 1 185 ? -79.299  -40.895  14.469   1.00 0.00 ? 180 VAL A HG21 2  
ATOM 8160  H HG22 . VAL A 1 185 ? -79.034  -42.554  13.934   1.00 0.00 ? 180 VAL A HG22 2  
ATOM 8161  H HG23 . VAL A 1 185 ? -80.543  -41.732  13.543   1.00 0.00 ? 180 VAL A HG23 2  
ATOM 8162  N N    . VAL A 1 186 ? -79.476  -39.667  9.771    1.00 0.00 ? 181 VAL A N    2  
ATOM 8163  C CA   . VAL A 1 186 ? -79.167  -39.211  8.381    1.00 0.00 ? 181 VAL A CA   2  
ATOM 8164  C C    . VAL A 1 186 ? -79.307  -37.686  8.290    1.00 0.00 ? 181 VAL A C    2  
ATOM 8165  O O    . VAL A 1 186 ? -78.483  -37.013  7.700    1.00 0.00 ? 181 VAL A O    2  
ATOM 8166  C CB   . VAL A 1 186 ? -80.178  -39.918  7.469    1.00 0.00 ? 181 VAL A CB   2  
ATOM 8167  C CG1  . VAL A 1 186 ? -81.587  -39.373  7.710    1.00 0.00 ? 181 VAL A CG1  2  
ATOM 8168  C CG2  . VAL A 1 186 ? -79.782  -39.683  6.008    1.00 0.00 ? 181 VAL A CG2  2  
ATOM 8169  H H    . VAL A 1 186 ? -80.151  -40.362  9.924    1.00 0.00 ? 181 VAL A H    2  
ATOM 8170  H HA   . VAL A 1 186 ? -78.166  -39.506  8.110    1.00 0.00 ? 181 VAL A HA   2  
ATOM 8171  H HB   . VAL A 1 186 ? -80.169  -40.977  7.678    1.00 0.00 ? 181 VAL A HB   2  
ATOM 8172  H HG11 . VAL A 1 186 ? -81.829  -39.460  8.758    1.00 0.00 ? 181 VAL A HG11 2  
ATOM 8173  H HG12 . VAL A 1 186 ? -82.297  -39.940  7.128    1.00 0.00 ? 181 VAL A HG12 2  
ATOM 8174  H HG13 . VAL A 1 186 ? -81.627  -38.335  7.415    1.00 0.00 ? 181 VAL A HG13 2  
ATOM 8175  H HG21 . VAL A 1 186 ? -78.730  -39.902  5.879    1.00 0.00 ? 181 VAL A HG21 2  
ATOM 8176  H HG22 . VAL A 1 186 ? -79.970  -38.653  5.745    1.00 0.00 ? 181 VAL A HG22 2  
ATOM 8177  H HG23 . VAL A 1 186 ? -80.365  -40.329  5.368    1.00 0.00 ? 181 VAL A HG23 2  
ATOM 8178  N N    . ALA A 1 187 ? -80.328  -37.131  8.898    1.00 0.00 ? 182 ALA A N    2  
ATOM 8179  C CA   . ALA A 1 187 ? -80.488  -35.649  8.867    1.00 0.00 ? 182 ALA A CA   2  
ATOM 8180  C C    . ALA A 1 187 ? -79.265  -35.025  9.534    1.00 0.00 ? 182 ALA A C    2  
ATOM 8181  O O    . ALA A 1 187 ? -78.638  -34.116  9.009    1.00 0.00 ? 182 ALA A O    2  
ATOM 8182  C CB   . ALA A 1 187 ? -81.756  -35.360  9.674    1.00 0.00 ? 182 ALA A CB   2  
ATOM 8183  H H    . ALA A 1 187 ? -80.969  -37.686  9.391    1.00 0.00 ? 182 ALA A H    2  
ATOM 8184  H HA   . ALA A 1 187 ? -80.595  -35.295  7.853    1.00 0.00 ? 182 ALA A HA   2  
ATOM 8185  H HB1  . ALA A 1 187 ? -82.395  -36.230  9.664    1.00 0.00 ? 182 ALA A HB1  2  
ATOM 8186  H HB2  . ALA A 1 187 ? -82.280  -34.524  9.235    1.00 0.00 ? 182 ALA A HB2  2  
ATOM 8187  H HB3  . ALA A 1 187 ? -81.488  -35.122  10.693   1.00 0.00 ? 182 ALA A HB3  2  
ATOM 8188  N N    . ALA A 1 188 ? -78.892  -35.552  10.672   1.00 0.00 ? 183 ALA A N    2  
ATOM 8189  C CA   . ALA A 1 188 ? -77.682  -35.039  11.363   1.00 0.00 ? 183 ALA A CA   2  
ATOM 8190  C C    . ALA A 1 188 ? -76.481  -35.322  10.467   1.00 0.00 ? 183 ALA A C    2  
ATOM 8191  O O    . ALA A 1 188 ? -75.499  -34.609  10.469   1.00 0.00 ? 183 ALA A O    2  
ATOM 8192  C CB   . ALA A 1 188 ? -77.592  -35.836  12.662   1.00 0.00 ? 183 ALA A CB   2  
ATOM 8193  H H    . ALA A 1 188 ? -79.388  -36.311  11.049   1.00 0.00 ? 183 ALA A H    2  
ATOM 8194  H HA   . ALA A 1 188 ? -77.775  -33.986  11.570   1.00 0.00 ? 183 ALA A HA   2  
ATOM 8195  H HB1  . ALA A 1 188 ? -76.852  -35.387  13.306   1.00 0.00 ? 183 ALA A HB1  2  
ATOM 8196  H HB2  . ALA A 1 188 ? -77.309  -36.854  12.441   1.00 0.00 ? 183 ALA A HB2  2  
ATOM 8197  H HB3  . ALA A 1 188 ? -78.553  -35.827  13.154   1.00 0.00 ? 183 ALA A HB3  2  
ATOM 8198  N N    . LEU A 1 189 ? -76.586  -36.360  9.678    1.00 0.00 ? 184 LEU A N    2  
ATOM 8199  C CA   . LEU A 1 189 ? -75.495  -36.719  8.738    1.00 0.00 ? 184 LEU A CA   2  
ATOM 8200  C C    . LEU A 1 189 ? -75.753  -36.056  7.384    1.00 0.00 ? 184 LEU A C    2  
ATOM 8201  O O    . LEU A 1 189 ? -75.101  -36.347  6.404    1.00 0.00 ? 184 LEU A O    2  
ATOM 8202  C CB   . LEU A 1 189 ? -75.564  -38.239  8.621    1.00 0.00 ? 184 LEU A CB   2  
ATOM 8203  C CG   . LEU A 1 189 ? -74.734  -38.870  9.741    1.00 0.00 ? 184 LEU A CG   2  
ATOM 8204  C CD1  . LEU A 1 189 ? -75.664  -39.396  10.837   1.00 0.00 ? 184 LEU A CD1  2  
ATOM 8205  C CD2  . LEU A 1 189 ? -73.910  -40.026  9.173    1.00 0.00 ? 184 LEU A CD2  2  
ATOM 8206  H H    . LEU A 1 189 ? -77.403  -36.896  9.691    1.00 0.00 ? 184 LEU A H    2  
ATOM 8207  H HA   . LEU A 1 189 ? -74.540  -36.421  9.132    1.00 0.00 ? 184 LEU A HA   2  
ATOM 8208  H HB2  . LEU A 1 189 ? -76.592  -38.559  8.707    1.00 0.00 ? 184 LEU A HB2  2  
ATOM 8209  H HB3  . LEU A 1 189 ? -75.171  -38.546  7.664    1.00 0.00 ? 184 LEU A HB3  2  
ATOM 8210  H HG   . LEU A 1 189 ? -74.071  -38.127  10.161   1.00 0.00 ? 184 LEU A HG   2  
ATOM 8211  H HD11 . LEU A 1 189 ? -76.519  -39.878  10.384   1.00 0.00 ? 184 LEU A HD11 2  
ATOM 8212  H HD12 . LEU A 1 189 ? -76.002  -38.571  11.449   1.00 0.00 ? 184 LEU A HD12 2  
ATOM 8213  H HD13 . LEU A 1 189 ? -75.133  -40.107  11.451   1.00 0.00 ? 184 LEU A HD13 2  
ATOM 8214  H HD21 . LEU A 1 189 ? -73.633  -39.803  8.153    1.00 0.00 ? 184 LEU A HD21 2  
ATOM 8215  H HD22 . LEU A 1 189 ? -74.496  -40.932  9.198    1.00 0.00 ? 184 LEU A HD22 2  
ATOM 8216  H HD23 . LEU A 1 189 ? -73.018  -40.155  9.767    1.00 0.00 ? 184 LEU A HD23 2  
ATOM 8217  N N    . ARG A 1 190 ? -76.681  -35.137  7.337    1.00 0.00 ? 185 ARG A N    2  
ATOM 8218  C CA   . ARG A 1 190 ? -76.964  -34.420  6.075    1.00 0.00 ? 185 ARG A CA   2  
ATOM 8219  C C    . ARG A 1 190 ? -76.237  -33.091  6.155    1.00 0.00 ? 185 ARG A C    2  
ATOM 8220  O O    . ARG A 1 190 ? -75.775  -32.553  5.167    1.00 0.00 ? 185 ARG A O    2  
ATOM 8221  C CB   . ARG A 1 190 ? -78.480  -34.219  6.052    1.00 0.00 ? 185 ARG A CB   2  
ATOM 8222  C CG   . ARG A 1 190 ? -78.907  -33.692  4.680    1.00 0.00 ? 185 ARG A CG   2  
ATOM 8223  C CD   . ARG A 1 190 ? -80.390  -33.310  4.715    1.00 0.00 ? 185 ARG A CD   2  
ATOM 8224  N NE   . ARG A 1 190 ? -80.419  -31.850  4.423    1.00 0.00 ? 185 ARG A NE   2  
ATOM 8225  C CZ   . ARG A 1 190 ? -81.510  -31.298  3.968    1.00 0.00 ? 185 ARG A CZ   2  
ATOM 8226  N NH1  . ARG A 1 190 ? -82.611  -31.355  4.667    1.00 0.00 ? 185 ARG A NH1  2  
ATOM 8227  N NH2  . ARG A 1 190 ? -81.502  -30.689  2.813    1.00 0.00 ? 185 ARG A NH2  2  
ATOM 8228  H H    . ARG A 1 190 ? -77.169  -34.890  8.144    1.00 0.00 ? 185 ARG A H    2  
ATOM 8229  H HA   . ARG A 1 190 ? -76.638  -34.992  5.221    1.00 0.00 ? 185 ARG A HA   2  
ATOM 8230  H HB2  . ARG A 1 190 ? -78.971  -35.162  6.245    1.00 0.00 ? 185 ARG A HB2  2  
ATOM 8231  H HB3  . ARG A 1 190 ? -78.761  -33.505  6.812    1.00 0.00 ? 185 ARG A HB3  2  
ATOM 8232  H HG2  . ARG A 1 190 ? -78.315  -32.824  4.429    1.00 0.00 ? 185 ARG A HG2  2  
ATOM 8233  H HG3  . ARG A 1 190 ? -78.753  -34.460  3.937    1.00 0.00 ? 185 ARG A HG3  2  
ATOM 8234  H HD2  . ARG A 1 190 ? -80.936  -33.858  3.959    1.00 0.00 ? 185 ARG A HD2  2  
ATOM 8235  H HD3  . ARG A 1 190 ? -80.806  -33.499  5.692    1.00 0.00 ? 185 ARG A HD3  2  
ATOM 8236  H HE   . ARG A 1 190 ? -79.619  -31.304  4.572    1.00 0.00 ? 185 ARG A HE   2  
ATOM 8237  H HH11 . ARG A 1 190 ? -82.617  -31.821  5.552    1.00 0.00 ? 185 ARG A HH11 2  
ATOM 8238  H HH12 . ARG A 1 190 ? -83.447  -30.932  4.319    1.00 0.00 ? 185 ARG A HH12 2  
ATOM 8239  H HH21 . ARG A 1 190 ? -80.658  -30.646  2.277    1.00 0.00 ? 185 ARG A HH21 2  
ATOM 8240  H HH22 . ARG A 1 190 ? -82.338  -30.266  2.465    1.00 0.00 ? 185 ARG A HH22 2  
ATOM 8241  N N    . ALA A 1 191 ? -76.107  -32.574  7.351    1.00 0.00 ? 186 ALA A N    2  
ATOM 8242  C CA   . ALA A 1 191 ? -75.379  -31.296  7.522    1.00 0.00 ? 186 ALA A CA   2  
ATOM 8243  C C    . ALA A 1 191 ? -74.007  -31.552  8.165    1.00 0.00 ? 186 ALA A C    2  
ATOM 8244  O O    . ALA A 1 191 ? -73.140  -30.701  8.148    1.00 0.00 ? 186 ALA A O    2  
ATOM 8245  C CB   . ALA A 1 191 ? -76.255  -30.431  8.426    1.00 0.00 ? 186 ALA A CB   2  
ATOM 8246  H H    . ALA A 1 191 ? -76.473  -33.041  8.133    1.00 0.00 ? 186 ALA A H    2  
ATOM 8247  H HA   . ALA A 1 191 ? -75.261  -30.826  6.568    1.00 0.00 ? 186 ALA A HA   2  
ATOM 8248  H HB1  . ALA A 1 191 ? -75.967  -30.582  9.455    1.00 0.00 ? 186 ALA A HB1  2  
ATOM 8249  H HB2  . ALA A 1 191 ? -77.290  -30.706  8.296    1.00 0.00 ? 186 ALA A HB2  2  
ATOM 8250  H HB3  . ALA A 1 191 ? -76.124  -29.391  8.166    1.00 0.00 ? 186 ALA A HB3  2  
ATOM 8251  N N    . SER A 1 192 ? -73.797  -32.724  8.722    1.00 0.00 ? 187 SER A N    2  
ATOM 8252  C CA   . SER A 1 192 ? -72.471  -33.027  9.348    1.00 0.00 ? 187 SER A CA   2  
ATOM 8253  C C    . SER A 1 192 ? -71.575  -33.750  8.350    1.00 0.00 ? 187 SER A C    2  
ATOM 8254  O O    . SER A 1 192 ? -70.758  -34.569  8.714    1.00 0.00 ? 187 SER A O    2  
ATOM 8255  C CB   . SER A 1 192 ? -72.757  -33.945  10.529   1.00 0.00 ? 187 SER A CB   2  
ATOM 8256  O OG   . SER A 1 192 ? -73.223  -35.195  10.048   1.00 0.00 ? 187 SER A OG   2  
ATOM 8257  H H    . SER A 1 192 ? -74.502  -33.403  8.719    1.00 0.00 ? 187 SER A H    2  
ATOM 8258  H HA   . SER A 1 192 ? -72.000  -32.119  9.690    1.00 0.00 ? 187 SER A HA   2  
ATOM 8259  H HB2  . SER A 1 192 ? -71.846  -34.104  11.081   1.00 0.00 ? 187 SER A HB2  2  
ATOM 8260  H HB3  . SER A 1 192 ? -73.498  -33.491  11.172   1.00 0.00 ? 187 SER A HB3  2  
ATOM 8261  H HG   . SER A 1 192 ? -72.458  -35.732  9.828    1.00 0.00 ? 187 SER A HG   2  
ATOM 8262  N N    . TYR A 1 193 ? -71.725  -33.456  7.094    1.00 0.00 ? 188 TYR A N    2  
ATOM 8263  C CA   . TYR A 1 193 ? -70.881  -34.129  6.050    1.00 0.00 ? 188 TYR A CA   2  
ATOM 8264  C C    . TYR A 1 193 ? -71.154  -35.636  6.043    1.00 0.00 ? 188 TYR A C    2  
ATOM 8265  O O    . TYR A 1 193 ? -70.344  -36.416  5.582    1.00 0.00 ? 188 TYR A O    2  
ATOM 8266  C CB   . TYR A 1 193 ? -69.406  -33.882  6.434    1.00 0.00 ? 188 TYR A CB   2  
ATOM 8267  C CG   . TYR A 1 193 ? -69.247  -32.602  7.227    1.00 0.00 ? 188 TYR A CG   2  
ATOM 8268  C CD1  . TYR A 1 193 ? -69.530  -31.368  6.631    1.00 0.00 ? 188 TYR A CD1  2  
ATOM 8269  C CD2  . TYR A 1 193 ? -68.808  -32.653  8.561    1.00 0.00 ? 188 TYR A CD2  2  
ATOM 8270  C CE1  . TYR A 1 193 ? -69.378  -30.185  7.364    1.00 0.00 ? 188 TYR A CE1  2  
ATOM 8271  C CE2  . TYR A 1 193 ? -68.657  -31.469  9.291    1.00 0.00 ? 188 TYR A CE2  2  
ATOM 8272  C CZ   . TYR A 1 193 ? -68.942  -30.236  8.694    1.00 0.00 ? 188 TYR A CZ   2  
ATOM 8273  O OH   . TYR A 1 193 ? -68.792  -29.069  9.415    1.00 0.00 ? 188 TYR A OH   2  
ATOM 8274  H H    . TYR A 1 193 ? -72.400  -32.796  6.831    1.00 0.00 ? 188 TYR A H    2  
ATOM 8275  H HA   . TYR A 1 193 ? -71.082  -33.707  5.078    1.00 0.00 ? 188 TYR A HA   2  
ATOM 8276  H HB2  . TYR A 1 193 ? -69.052  -34.710  7.028    1.00 0.00 ? 188 TYR A HB2  2  
ATOM 8277  H HB3  . TYR A 1 193 ? -68.814  -33.816  5.532    1.00 0.00 ? 188 TYR A HB3  2  
ATOM 8278  H HD1  . TYR A 1 193 ? -69.867  -31.328  5.606    1.00 0.00 ? 188 TYR A HD1  2  
ATOM 8279  H HD2  . TYR A 1 193 ? -68.589  -33.607  9.029    1.00 0.00 ? 188 TYR A HD2  2  
ATOM 8280  H HE1  . TYR A 1 193 ? -69.598  -29.233  6.904    1.00 0.00 ? 188 TYR A HE1  2  
ATOM 8281  H HE2  . TYR A 1 193 ? -68.319  -31.508  10.316   1.00 0.00 ? 188 TYR A HE2  2  
ATOM 8282  H HH   . TYR A 1 193 ? -67.910  -28.728  9.248    1.00 0.00 ? 188 TYR A HH   2  
ATOM 8283  N N    . ASN A 1 194 ? -72.281  -36.057  6.559    1.00 0.00 ? 189 ASN A N    2  
ATOM 8284  C CA   . ASN A 1 194 ? -72.593  -37.522  6.591    1.00 0.00 ? 189 ASN A CA   2  
ATOM 8285  C C    . ASN A 1 194 ? -71.439  -38.281  7.253    1.00 0.00 ? 189 ASN A C    2  
ATOM 8286  O O    . ASN A 1 194 ? -71.159  -39.417  6.923    1.00 0.00 ? 189 ASN A O    2  
ATOM 8287  C CB   . ASN A 1 194 ? -72.742  -37.959  5.126    1.00 0.00 ? 189 ASN A CB   2  
ATOM 8288  C CG   . ASN A 1 194 ? -73.512  -36.902  4.328    1.00 0.00 ? 189 ASN A CG   2  
ATOM 8289  O OD1  . ASN A 1 194 ? -72.988  -35.847  4.031    1.00 0.00 ? 189 ASN A OD1  2  
ATOM 8290  N ND2  . ASN A 1 194 ? -74.742  -37.143  3.966    1.00 0.00 ? 189 ASN A ND2  2  
ATOM 8291  H H    . ASN A 1 194 ? -72.918  -35.414  6.934    1.00 0.00 ? 189 ASN A H    2  
ATOM 8292  H HA   . ASN A 1 194 ? -73.513  -37.699  7.125    1.00 0.00 ? 189 ASN A HA   2  
ATOM 8293  H HB2  . ASN A 1 194 ? -71.763  -38.093  4.692    1.00 0.00 ? 189 ASN A HB2  2  
ATOM 8294  H HB3  . ASN A 1 194 ? -73.281  -38.895  5.088    1.00 0.00 ? 189 ASN A HB3  2  
ATOM 8295  H HD21 . ASN A 1 194 ? -75.165  -37.994  4.204    1.00 0.00 ? 189 ASN A HD21 2  
ATOM 8296  H HD22 . ASN A 1 194 ? -75.243  -36.473  3.455    1.00 0.00 ? 189 ASN A HD22 2  
ATOM 8297  N N    . ASN A 1 195 ? -70.759  -37.651  8.173    1.00 0.00 ? 190 ASN A N    2  
ATOM 8298  C CA   . ASN A 1 195 ? -69.609  -38.322  8.847    1.00 0.00 ? 190 ASN A CA   2  
ATOM 8299  C C    . ASN A 1 195 ? -69.852  -38.433  10.362   1.00 0.00 ? 190 ASN A C    2  
ATOM 8300  O O    . ASN A 1 195 ? -70.803  -37.879  10.878   1.00 0.00 ? 190 ASN A O    2  
ATOM 8301  C CB   . ASN A 1 195 ? -68.404  -37.426  8.523    1.00 0.00 ? 190 ASN A CB   2  
ATOM 8302  C CG   . ASN A 1 195 ? -68.154  -36.418  9.646    1.00 0.00 ? 190 ASN A CG   2  
ATOM 8303  O OD1  . ASN A 1 195 ? -67.029  -36.220  10.058   1.00 0.00 ? 190 ASN A OD1  2  
ATOM 8304  N ND2  . ASN A 1 195 ? -69.162  -35.769  10.157   1.00 0.00 ? 190 ASN A ND2  2  
ATOM 8305  H H    . ASN A 1 195 ? -70.997  -36.732  8.411    1.00 0.00 ? 190 ASN A H    2  
ATOM 8306  H HA   . ASN A 1 195 ? -69.456  -39.303  8.425    1.00 0.00 ? 190 ASN A HA   2  
ATOM 8307  H HB2  . ASN A 1 195 ? -67.527  -38.040  8.393    1.00 0.00 ? 190 ASN A HB2  2  
ATOM 8308  H HB3  . ASN A 1 195 ? -68.602  -36.889  7.607    1.00 0.00 ? 190 ASN A HB3  2  
ATOM 8309  H HD21 . ASN A 1 195 ? -70.068  -35.929  9.823    1.00 0.00 ? 190 ASN A HD21 2  
ATOM 8310  H HD22 . ASN A 1 195 ? -69.016  -35.119  10.869   1.00 0.00 ? 190 ASN A HD22 2  
ATOM 8311  N N    . PRO A 1 196 ? -68.981  -39.156  11.022   1.00 0.00 ? 191 PRO A N    2  
ATOM 8312  C CA   . PRO A 1 196 ? -69.103  -39.352  12.485   1.00 0.00 ? 191 PRO A CA   2  
ATOM 8313  C C    . PRO A 1 196 ? -68.491  -38.179  13.266   1.00 0.00 ? 191 PRO A C    2  
ATOM 8314  O O    . PRO A 1 196 ? -67.702  -38.377  14.170   1.00 0.00 ? 191 PRO A O    2  
ATOM 8315  C CB   . PRO A 1 196 ? -68.307  -40.628  12.735   1.00 0.00 ? 191 PRO A CB   2  
ATOM 8316  C CG   . PRO A 1 196 ? -67.314  -40.713  11.613   1.00 0.00 ? 191 PRO A CG   2  
ATOM 8317  C CD   . PRO A 1 196 ? -67.817  -39.860  10.472   1.00 0.00 ? 191 PRO A CD   2  
ATOM 8318  H HA   . PRO A 1 196 ? -70.133  -39.502  12.765   1.00 0.00 ? 191 PRO A HA   2  
ATOM 8319  H HB2  . PRO A 1 196 ? -67.796  -40.567  13.686   1.00 0.00 ? 191 PRO A HB2  2  
ATOM 8320  H HB3  . PRO A 1 196 ? -68.960  -41.486  12.714   1.00 0.00 ? 191 PRO A HB3  2  
ATOM 8321  H HG2  . PRO A 1 196 ? -66.353  -40.349  11.948   1.00 0.00 ? 191 PRO A HG2  2  
ATOM 8322  H HG3  . PRO A 1 196 ? -67.222  -41.737  11.284   1.00 0.00 ? 191 PRO A HG3  2  
ATOM 8323  H HD2  . PRO A 1 196 ? -67.056  -39.155  10.166   1.00 0.00 ? 191 PRO A HD2  2  
ATOM 8324  H HD3  . PRO A 1 196 ? -68.117  -40.478  9.641    1.00 0.00 ? 191 PRO A HD3  2  
ATOM 8325  N N    . HIS A 1 197 ? -68.853  -36.964  12.944   1.00 0.00 ? 192 HIS A N    2  
ATOM 8326  C CA   . HIS A 1 197 ? -68.293  -35.798  13.694   1.00 0.00 ? 192 HIS A CA   2  
ATOM 8327  C C    . HIS A 1 197 ? -69.392  -34.764  13.961   1.00 0.00 ? 192 HIS A C    2  
ATOM 8328  O O    . HIS A 1 197 ? -69.996  -34.740  15.021   1.00 0.00 ? 192 HIS A O    2  
ATOM 8329  C CB   . HIS A 1 197 ? -67.195  -35.217  12.800   1.00 0.00 ? 192 HIS A CB   2  
ATOM 8330  C CG   . HIS A 1 197 ? -66.009  -36.142  12.800   1.00 0.00 ? 192 HIS A CG   2  
ATOM 8331  N ND1  . HIS A 1 197 ? -64.835  -35.837  13.470   1.00 0.00 ? 192 HIS A ND1  2  
ATOM 8332  C CD2  . HIS A 1 197 ? -65.802  -37.369  12.219   1.00 0.00 ? 192 HIS A CD2  2  
ATOM 8333  C CE1  . HIS A 1 197 ? -63.981  -36.860  13.278   1.00 0.00 ? 192 HIS A CE1  2  
ATOM 8334  N NE2  . HIS A 1 197 ? -64.520  -37.820  12.523   1.00 0.00 ? 192 HIS A NE2  2  
ATOM 8335  H H    . HIS A 1 197 ? -69.499  -36.820  12.221   1.00 0.00 ? 192 HIS A H    2  
ATOM 8336  H HA   . HIS A 1 197 ? -67.866  -36.128  14.621   1.00 0.00 ? 192 HIS A HA   2  
ATOM 8337  H HB2  . HIS A 1 197 ? -67.565  -35.106  11.796   1.00 0.00 ? 192 HIS A HB2  2  
ATOM 8338  H HB3  . HIS A 1 197 ? -66.895  -34.252  13.181   1.00 0.00 ? 192 HIS A HB3  2  
ATOM 8339  H HD1  . HIS A 1 197 ? -64.658  -35.025  13.989   1.00 0.00 ? 192 HIS A HD1  2  
ATOM 8340  H HD2  . HIS A 1 197 ? -66.523  -37.902  11.618   1.00 0.00 ? 192 HIS A HD2  2  
ATOM 8341  H HE1  . HIS A 1 197 ? -62.982  -36.899  13.686   1.00 0.00 ? 192 HIS A HE1  2  
ATOM 8342  N N    . ARG A 1 198 ? -69.665  -33.908  13.015   1.00 0.00 ? 193 ARG A N    2  
ATOM 8343  C CA   . ARG A 1 198 ? -70.726  -32.891  13.233   1.00 0.00 ? 193 ARG A CA   2  
ATOM 8344  C C    . ARG A 1 198 ? -72.072  -33.576  13.492   1.00 0.00 ? 193 ARG A C    2  
ATOM 8345  O O    . ARG A 1 198 ? -72.979  -32.966  14.005   1.00 0.00 ? 193 ARG A O    2  
ATOM 8346  C CB   . ARG A 1 198 ? -70.773  -32.061  11.947   1.00 0.00 ? 193 ARG A CB   2  
ATOM 8347  C CG   . ARG A 1 198 ? -70.186  -30.669  12.211   1.00 0.00 ? 193 ARG A CG   2  
ATOM 8348  C CD   . ARG A 1 198 ? -71.122  -29.599  11.643   1.00 0.00 ? 193 ARG A CD   2  
ATOM 8349  N NE   . ARG A 1 198 ? -70.531  -28.301  12.073   1.00 0.00 ? 193 ARG A NE   2  
ATOM 8350  C CZ   . ARG A 1 198 ? -70.589  -27.939  13.327   1.00 0.00 ? 193 ARG A CZ   2  
ATOM 8351  N NH1  . ARG A 1 198 ? -71.629  -27.286  13.770   1.00 0.00 ? 193 ARG A NH1  2  
ATOM 8352  N NH2  . ARG A 1 198 ? -69.608  -28.230  14.136   1.00 0.00 ? 193 ARG A NH2  2  
ATOM 8353  H H    . ARG A 1 198 ? -69.176  -33.934  12.169   1.00 0.00 ? 193 ARG A H    2  
ATOM 8354  H HA   . ARG A 1 198 ? -70.467  -32.259  14.068   1.00 0.00 ? 193 ARG A HA   2  
ATOM 8355  H HB2  . ARG A 1 198 ? -70.199  -32.555  11.178   1.00 0.00 ? 193 ARG A HB2  2  
ATOM 8356  H HB3  . ARG A 1 198 ? -71.798  -31.960  11.623   1.00 0.00 ? 193 ARG A HB3  2  
ATOM 8357  H HG2  . ARG A 1 198 ? -70.074  -30.520  13.276   1.00 0.00 ? 193 ARG A HG2  2  
ATOM 8358  H HG3  . ARG A 1 198 ? -69.222  -30.589  11.735   1.00 0.00 ? 193 ARG A HG3  2  
ATOM 8359  H HD2  . ARG A 1 198 ? -71.152  -29.663  10.564   1.00 0.00 ? 193 ARG A HD2  2  
ATOM 8360  H HD3  . ARG A 1 198 ? -72.113  -29.708  12.055   1.00 0.00 ? 193 ARG A HD3  2  
ATOM 8361  H HE   . ARG A 1 198 ? -70.097  -27.718  11.415   1.00 0.00 ? 193 ARG A HE   2  
ATOM 8362  H HH11 . ARG A 1 198 ? -72.381  -27.063  13.150   1.00 0.00 ? 193 ARG A HH11 2  
ATOM 8363  H HH12 . ARG A 1 198 ? -71.673  -27.009  14.730   1.00 0.00 ? 193 ARG A HH12 2  
ATOM 8364  H HH21 . ARG A 1 198 ? -68.812  -28.730  13.797   1.00 0.00 ? 193 ARG A HH21 2  
ATOM 8365  H HH22 . ARG A 1 198 ? -69.653  -27.952  15.096   1.00 0.00 ? 193 ARG A HH22 2  
ATOM 8366  N N    . ALA A 1 199 ? -72.211  -34.840  13.157   1.00 0.00 ? 194 ALA A N    2  
ATOM 8367  C CA   . ALA A 1 199 ? -73.505  -35.531  13.414   1.00 0.00 ? 194 ALA A CA   2  
ATOM 8368  C C    . ALA A 1 199 ? -73.747  -35.578  14.918   1.00 0.00 ? 194 ALA A C    2  
ATOM 8369  O O    . ALA A 1 199 ? -74.644  -34.934  15.419   1.00 0.00 ? 194 ALA A O    2  
ATOM 8370  C CB   . ALA A 1 199 ? -73.356  -36.941  12.840   1.00 0.00 ? 194 ALA A CB   2  
ATOM 8371  H H    . ALA A 1 199 ? -71.471  -35.329  12.754   1.00 0.00 ? 194 ALA A H    2  
ATOM 8372  H HA   . ALA A 1 199 ? -74.312  -35.012  12.919   1.00 0.00 ? 194 ALA A HA   2  
ATOM 8373  H HB1  . ALA A 1 199 ? -72.630  -36.931  12.040   1.00 0.00 ? 194 ALA A HB1  2  
ATOM 8374  H HB2  . ALA A 1 199 ? -74.311  -37.277  12.456   1.00 0.00 ? 194 ALA A HB2  2  
ATOM 8375  H HB3  . ALA A 1 199 ? -73.026  -37.613  13.618   1.00 0.00 ? 194 ALA A HB3  2  
ATOM 8376  N N    . VAL A 1 200 ? -72.941  -36.312  15.652   1.00 0.00 ? 195 VAL A N    2  
ATOM 8377  C CA   . VAL A 1 200 ? -73.134  -36.360  17.134   1.00 0.00 ? 195 VAL A CA   2  
ATOM 8378  C C    . VAL A 1 200 ? -73.348  -34.933  17.646   1.00 0.00 ? 195 VAL A C    2  
ATOM 8379  O O    . VAL A 1 200 ? -74.175  -34.684  18.509   1.00 0.00 ? 195 VAL A O    2  
ATOM 8380  C CB   . VAL A 1 200 ? -71.860  -36.991  17.713   1.00 0.00 ? 195 VAL A CB   2  
ATOM 8381  C CG1  . VAL A 1 200 ? -71.797  -38.465  17.303   1.00 0.00 ? 195 VAL A CG1  2  
ATOM 8382  C CG2  . VAL A 1 200 ? -70.618  -36.269  17.185   1.00 0.00 ? 195 VAL A CG2  2  
ATOM 8383  H H    . VAL A 1 200 ? -72.209  -36.809  15.233   1.00 0.00 ? 195 VAL A H    2  
ATOM 8384  H HA   . VAL A 1 200 ? -73.990  -36.973  17.376   1.00 0.00 ? 195 VAL A HA   2  
ATOM 8385  H HB   . VAL A 1 200 ? -71.887  -36.923  18.792   1.00 0.00 ? 195 VAL A HB   2  
ATOM 8386  H HG11 . VAL A 1 200 ? -70.765  -38.762  17.187   1.00 0.00 ? 195 VAL A HG11 2  
ATOM 8387  H HG12 . VAL A 1 200 ? -72.318  -38.602  16.366   1.00 0.00 ? 195 VAL A HG12 2  
ATOM 8388  H HG13 . VAL A 1 200 ? -72.262  -39.071  18.066   1.00 0.00 ? 195 VAL A HG13 2  
ATOM 8389  H HG21 . VAL A 1 200 ? -70.490  -36.495  16.138   1.00 0.00 ? 195 VAL A HG21 2  
ATOM 8390  H HG22 . VAL A 1 200 ? -69.749  -36.603  17.733   1.00 0.00 ? 195 VAL A HG22 2  
ATOM 8391  H HG23 . VAL A 1 200 ? -70.735  -35.205  17.315   1.00 0.00 ? 195 VAL A HG23 2  
ATOM 8392  N N    . GLU A 1 201 ? -72.656  -33.983  17.064   1.00 0.00 ? 196 GLU A N    2  
ATOM 8393  C CA   . GLU A 1 201 ? -72.868  -32.565  17.464   1.00 0.00 ? 196 GLU A CA   2  
ATOM 8394  C C    . GLU A 1 201 ? -74.238  -32.136  16.938   1.00 0.00 ? 196 GLU A C    2  
ATOM 8395  O O    . GLU A 1 201 ? -75.075  -31.646  17.667   1.00 0.00 ? 196 GLU A O    2  
ATOM 8396  C CB   . GLU A 1 201 ? -71.749  -31.776  16.781   1.00 0.00 ? 196 GLU A CB   2  
ATOM 8397  C CG   . GLU A 1 201 ? -70.397  -32.206  17.354   1.00 0.00 ? 196 GLU A CG   2  
ATOM 8398  C CD   . GLU A 1 201 ? -70.091  -31.389  18.610   1.00 0.00 ? 196 GLU A CD   2  
ATOM 8399  O OE1  . GLU A 1 201 ? -71.016  -31.125  19.361   1.00 0.00 ? 196 GLU A OE1  2  
ATOM 8400  O OE2  . GLU A 1 201 ? -68.938  -31.040  18.800   1.00 0.00 ? 196 GLU A OE2  2  
ATOM 8401  H H    . GLU A 1 201 ? -72.038  -34.201  16.336   1.00 0.00 ? 196 GLU A H    2  
ATOM 8402  H HA   . GLU A 1 201 ? -72.813  -32.454  18.537   1.00 0.00 ? 196 GLU A HA   2  
ATOM 8403  H HB2  . GLU A 1 201 ? -71.769  -31.971  15.719   1.00 0.00 ? 196 GLU A HB2  2  
ATOM 8404  H HB3  . GLU A 1 201 ? -71.892  -30.721  16.957   1.00 0.00 ? 196 GLU A HB3  2  
ATOM 8405  H HG2  . GLU A 1 201 ? -70.431  -33.256  17.606   1.00 0.00 ? 196 GLU A HG2  2  
ATOM 8406  H HG3  . GLU A 1 201 ? -69.624  -32.037  16.620   1.00 0.00 ? 196 GLU A HG3  2  
ATOM 8407  N N    . TYR A 1 202 ? -74.479  -32.371  15.675   1.00 0.00 ? 197 TYR A N    2  
ATOM 8408  C CA   . TYR A 1 202 ? -75.795  -32.040  15.065   1.00 0.00 ? 197 TYR A CA   2  
ATOM 8409  C C    . TYR A 1 202 ? -76.736  -33.240  15.283   1.00 0.00 ? 197 TYR A C    2  
ATOM 8410  O O    . TYR A 1 202 ? -77.529  -33.608  14.441   1.00 0.00 ? 197 TYR A O    2  
ATOM 8411  C CB   . TYR A 1 202 ? -75.460  -31.793  13.578   1.00 0.00 ? 197 TYR A CB   2  
ATOM 8412  C CG   . TYR A 1 202 ? -76.698  -31.762  12.705   1.00 0.00 ? 197 TYR A CG   2  
ATOM 8413  C CD1  . TYR A 1 202 ? -77.955  -31.510  13.263   1.00 0.00 ? 197 TYR A CD1  2  
ATOM 8414  C CD2  . TYR A 1 202 ? -76.580  -31.986  11.324   1.00 0.00 ? 197 TYR A CD2  2  
ATOM 8415  C CE1  . TYR A 1 202 ? -79.091  -31.481  12.454   1.00 0.00 ? 197 TYR A CE1  2  
ATOM 8416  C CE2  . TYR A 1 202 ? -77.721  -31.955  10.513   1.00 0.00 ? 197 TYR A CE2  2  
ATOM 8417  C CZ   . TYR A 1 202 ? -78.977  -31.703  11.078   1.00 0.00 ? 197 TYR A CZ   2  
ATOM 8418  O OH   . TYR A 1 202 ? -80.100  -31.673  10.277   1.00 0.00 ? 197 TYR A OH   2  
ATOM 8419  H H    . TYR A 1 202 ? -73.794  -32.802  15.124   1.00 0.00 ? 197 TYR A H    2  
ATOM 8420  H HA   . TYR A 1 202 ? -76.207  -31.148  15.512   1.00 0.00 ? 197 TYR A HA   2  
ATOM 8421  H HB2  . TYR A 1 202 ? -74.952  -30.844  13.490   1.00 0.00 ? 197 TYR A HB2  2  
ATOM 8422  H HB3  . TYR A 1 202 ? -74.805  -32.576  13.229   1.00 0.00 ? 197 TYR A HB3  2  
ATOM 8423  H HD1  . TYR A 1 202 ? -78.047  -31.342  14.324   1.00 0.00 ? 197 TYR A HD1  2  
ATOM 8424  H HD2  . TYR A 1 202 ? -75.606  -32.181  10.880   1.00 0.00 ? 197 TYR A HD2  2  
ATOM 8425  H HE1  . TYR A 1 202 ? -80.057  -31.289  12.892   1.00 0.00 ? 197 TYR A HE1  2  
ATOM 8426  H HE2  . TYR A 1 202 ? -77.634  -32.132  9.455    1.00 0.00 ? 197 TYR A HE2  2  
ATOM 8427  H HH   . TYR A 1 202 ? -80.561  -32.509  10.381   1.00 0.00 ? 197 TYR A HH   2  
ATOM 8428  N N    . LEU A 1 203 ? -76.634  -33.852  16.433   1.00 0.00 ? 198 LEU A N    2  
ATOM 8429  C CA   . LEU A 1 203 ? -77.493  -35.022  16.762   1.00 0.00 ? 198 LEU A CA   2  
ATOM 8430  C C    . LEU A 1 203 ? -78.191  -34.770  18.100   1.00 0.00 ? 198 LEU A C    2  
ATOM 8431  O O    . LEU A 1 203 ? -79.343  -35.110  18.284   1.00 0.00 ? 198 LEU A O    2  
ATOM 8432  C CB   . LEU A 1 203 ? -76.533  -36.211  16.894   1.00 0.00 ? 198 LEU A CB   2  
ATOM 8433  C CG   . LEU A 1 203 ? -76.451  -36.989  15.573   1.00 0.00 ? 198 LEU A CG   2  
ATOM 8434  C CD1  . LEU A 1 203 ? -75.477  -38.160  15.733   1.00 0.00 ? 198 LEU A CD1  2  
ATOM 8435  C CD2  . LEU A 1 203 ? -77.836  -37.535  15.216   1.00 0.00 ? 198 LEU A CD2  2  
ATOM 8436  H H    . LEU A 1 203 ? -75.985  -33.537  17.088   1.00 0.00 ? 198 LEU A H    2  
ATOM 8437  H HA   . LEU A 1 203 ? -78.212  -35.202  15.981   1.00 0.00 ? 198 LEU A HA   2  
ATOM 8438  H HB2  . LEU A 1 203 ? -75.554  -35.849  17.158   1.00 0.00 ? 198 LEU A HB2  2  
ATOM 8439  H HB3  . LEU A 1 203 ? -76.889  -36.870  17.671   1.00 0.00 ? 198 LEU A HB3  2  
ATOM 8440  H HG   . LEU A 1 203 ? -76.097  -36.336  14.785   1.00 0.00 ? 198 LEU A HG   2  
ATOM 8441  H HD11 . LEU A 1 203 ? -75.304  -38.345  16.783   1.00 0.00 ? 198 LEU A HD11 2  
ATOM 8442  H HD12 . LEU A 1 203 ? -74.542  -37.919  15.252   1.00 0.00 ? 198 LEU A HD12 2  
ATOM 8443  H HD13 . LEU A 1 203 ? -75.897  -39.044  15.277   1.00 0.00 ? 198 LEU A HD13 2  
ATOM 8444  H HD21 . LEU A 1 203 ? -78.468  -36.728  14.879   1.00 0.00 ? 198 LEU A HD21 2  
ATOM 8445  H HD22 . LEU A 1 203 ? -78.277  -37.995  16.088   1.00 0.00 ? 198 LEU A HD22 2  
ATOM 8446  H HD23 . LEU A 1 203 ? -77.741  -38.270  14.432   1.00 0.00 ? 198 LEU A HD23 2  
ATOM 8447  N N    . LEU A 1 204 ? -77.493  -34.179  19.042   1.00 0.00 ? 199 LEU A N    2  
ATOM 8448  C CA   . LEU A 1 204 ? -78.119  -33.914  20.373   1.00 0.00 ? 199 LEU A CA   2  
ATOM 8449  C C    . LEU A 1 204 ? -78.395  -32.419  20.572   1.00 0.00 ? 199 LEU A C    2  
ATOM 8450  O O    . LEU A 1 204 ? -79.502  -32.026  20.884   1.00 0.00 ? 199 LEU A O    2  
ATOM 8451  C CB   . LEU A 1 204 ? -77.091  -34.394  21.400   1.00 0.00 ? 199 LEU A CB   2  
ATOM 8452  C CG   . LEU A 1 204 ? -77.271  -35.892  21.665   1.00 0.00 ? 199 LEU A CG   2  
ATOM 8453  C CD1  . LEU A 1 204 ? -78.684  -36.160  22.191   1.00 0.00 ? 199 LEU A CD1  2  
ATOM 8454  C CD2  . LEU A 1 204 ? -77.050  -36.670  20.366   1.00 0.00 ? 199 LEU A CD2  2  
ATOM 8455  H H    . LEU A 1 204 ? -76.562  -33.920  18.876   1.00 0.00 ? 199 LEU A H    2  
ATOM 8456  H HA   . LEU A 1 204 ? -79.030  -34.479  20.477   1.00 0.00 ? 199 LEU A HA   2  
ATOM 8457  H HB2  . LEU A 1 204 ? -76.096  -34.213  21.021   1.00 0.00 ? 199 LEU A HB2  2  
ATOM 8458  H HB3  . LEU A 1 204 ? -77.227  -33.849  22.322   1.00 0.00 ? 199 LEU A HB3  2  
ATOM 8459  H HG   . LEU A 1 204 ? -76.549  -36.212  22.403   1.00 0.00 ? 199 LEU A HG   2  
ATOM 8460  H HD11 . LEU A 1 204 ? -79.315  -36.488  21.378   1.00 0.00 ? 199 LEU A HD11 2  
ATOM 8461  H HD12 . LEU A 1 204 ? -79.088  -35.253  22.616   1.00 0.00 ? 199 LEU A HD12 2  
ATOM 8462  H HD13 . LEU A 1 204 ? -78.646  -36.928  22.950   1.00 0.00 ? 199 LEU A HD13 2  
ATOM 8463  H HD21 . LEU A 1 204 ? -76.596  -37.623  20.591   1.00 0.00 ? 199 LEU A HD21 2  
ATOM 8464  H HD22 . LEU A 1 204 ? -76.399  -36.106  19.715   1.00 0.00 ? 199 LEU A HD22 2  
ATOM 8465  H HD23 . LEU A 1 204 ? -78.000  -36.830  19.876   1.00 0.00 ? 199 LEU A HD23 2  
ATOM 8466  N N    . THR A 1 205 ? -77.401  -31.583  20.413   1.00 0.00 ? 200 THR A N    2  
ATOM 8467  C CA   . THR A 1 205 ? -77.629  -30.120  20.618   1.00 0.00 ? 200 THR A CA   2  
ATOM 8468  C C    . THR A 1 205 ? -76.558  -29.291  19.910   1.00 0.00 ? 200 THR A C    2  
ATOM 8469  O O    . THR A 1 205 ? -76.082  -28.299  20.428   1.00 0.00 ? 200 THR A O    2  
ATOM 8470  C CB   . THR A 1 205 ? -77.552  -29.923  22.130   1.00 0.00 ? 200 THR A CB   2  
ATOM 8471  O OG1  . THR A 1 205 ? -77.779  -28.555  22.440   1.00 0.00 ? 200 THR A OG1  2  
ATOM 8472  C CG2  . THR A 1 205 ? -76.173  -30.344  22.641   1.00 0.00 ? 200 THR A CG2  2  
ATOM 8473  H H    . THR A 1 205 ? -76.511  -31.915  20.174   1.00 0.00 ? 200 THR A H    2  
ATOM 8474  H HA   . THR A 1 205 ? -78.607  -29.843  20.264   1.00 0.00 ? 200 THR A HA   2  
ATOM 8475  H HB   . THR A 1 205 ? -78.305  -30.529  22.602   1.00 0.00 ? 200 THR A HB   2  
ATOM 8476  H HG1  . THR A 1 205 ? -78.702  -28.456  22.684   1.00 0.00 ? 200 THR A HG1  2  
ATOM 8477  H HG21 . THR A 1 205 ? -75.415  -29.721  22.188   1.00 0.00 ? 200 THR A HG21 2  
ATOM 8478  H HG22 . THR A 1 205 ? -75.992  -31.377  22.380   1.00 0.00 ? 200 THR A HG22 2  
ATOM 8479  H HG23 . THR A 1 205 ? -76.137  -30.233  23.714   1.00 0.00 ? 200 THR A HG23 2  
ATOM 8480  N N    . GLY A 1 206 ? -76.189  -29.684  18.729   1.00 0.00 ? 201 GLY A N    2  
ATOM 8481  C CA   . GLY A 1 206 ? -75.159  -28.916  17.970   1.00 0.00 ? 201 GLY A CA   2  
ATOM 8482  C C    . GLY A 1 206 ? -75.854  -28.050  16.917   1.00 0.00 ? 201 GLY A C    2  
ATOM 8483  O O    . GLY A 1 206 ? -75.333  -27.038  16.490   1.00 0.00 ? 201 GLY A O    2  
ATOM 8484  H H    . GLY A 1 206 ? -76.596  -30.482  18.335   1.00 0.00 ? 201 GLY A H    2  
ATOM 8485  H HA2  . GLY A 1 206 ? -74.607  -28.284  18.652   1.00 0.00 ? 201 GLY A HA2  2  
ATOM 8486  H HA3  . GLY A 1 206 ? -74.482  -29.598  17.481   1.00 0.00 ? 201 GLY A HA3  2  
ATOM 8487  N N    . ILE A 1 207 ? -77.030  -28.441  16.500   1.00 0.00 ? 202 ILE A N    2  
ATOM 8488  C CA   . ILE A 1 207 ? -77.765  -27.642  15.479   1.00 0.00 ? 202 ILE A CA   2  
ATOM 8489  C C    . ILE A 1 207 ? -79.244  -27.475  15.898   1.00 0.00 ? 202 ILE A C    2  
ATOM 8490  O O    . ILE A 1 207 ? -79.668  -26.370  16.176   1.00 0.00 ? 202 ILE A O    2  
ATOM 8491  C CB   . ILE A 1 207 ? -77.593  -28.424  14.167   1.00 0.00 ? 202 ILE A CB   2  
ATOM 8492  C CG1  . ILE A 1 207 ? -76.271  -28.005  13.513   1.00 0.00 ? 202 ILE A CG1  2  
ATOM 8493  C CG2  . ILE A 1 207 ? -78.748  -28.133  13.198   1.00 0.00 ? 202 ILE A CG2  2  
ATOM 8494  C CD1  . ILE A 1 207 ? -76.081  -28.754  12.189   1.00 0.00 ? 202 ILE A CD1  2  
ATOM 8495  H H    . ILE A 1 207 ? -77.428  -29.256  16.862   1.00 0.00 ? 202 ILE A H    2  
ATOM 8496  H HA   . ILE A 1 207 ? -77.302  -26.674  15.379   1.00 0.00 ? 202 ILE A HA   2  
ATOM 8497  H HB   . ILE A 1 207 ? -77.561  -29.477  14.386   1.00 0.00 ? 202 ILE A HB   2  
ATOM 8498  H HG12 . ILE A 1 207 ? -76.286  -26.941  13.324   1.00 0.00 ? 202 ILE A HG12 2  
ATOM 8499  H HG13 . ILE A 1 207 ? -75.452  -28.239  14.176   1.00 0.00 ? 202 ILE A HG13 2  
ATOM 8500  H HG21 . ILE A 1 207 ? -78.637  -28.748  12.315   1.00 0.00 ? 202 ILE A HG21 2  
ATOM 8501  H HG22 . ILE A 1 207 ? -78.729  -27.091  12.916   1.00 0.00 ? 202 ILE A HG22 2  
ATOM 8502  H HG23 . ILE A 1 207 ? -79.689  -28.360  13.675   1.00 0.00 ? 202 ILE A HG23 2  
ATOM 8503  H HD11 . ILE A 1 207 ? -75.998  -28.041  11.382   1.00 0.00 ? 202 ILE A HD11 2  
ATOM 8504  H HD12 . ILE A 1 207 ? -76.930  -29.398  12.014   1.00 0.00 ? 202 ILE A HD12 2  
ATOM 8505  H HD13 . ILE A 1 207 ? -75.181  -29.348  12.238   1.00 0.00 ? 202 ILE A HD13 2  
ATOM 8506  N N    . PRO A 1 208 ? -79.992  -28.562  15.946   1.00 0.00 ? 203 PRO A N    2  
ATOM 8507  C CA   . PRO A 1 208 ? -81.418  -28.469  16.353   1.00 0.00 ? 203 PRO A CA   2  
ATOM 8508  C C    . PRO A 1 208 ? -81.526  -28.276  17.869   1.00 0.00 ? 203 PRO A C    2  
ATOM 8509  O O    . PRO A 1 208 ? -82.191  -27.377  18.345   1.00 0.00 ? 203 PRO A O    2  
ATOM 8510  C CB   . PRO A 1 208 ? -82.001  -29.818  15.947   1.00 0.00 ? 203 PRO A CB   2  
ATOM 8511  C CG   . PRO A 1 208 ? -80.839  -30.757  15.941   1.00 0.00 ? 203 PRO A CG   2  
ATOM 8512  C CD   . PRO A 1 208 ? -79.608  -29.946  15.630   1.00 0.00 ? 203 PRO A CD   2  
ATOM 8513  H HA   . PRO A 1 208 ? -81.917  -27.673  15.826   1.00 0.00 ? 203 PRO A HA   2  
ATOM 8514  H HB2  . PRO A 1 208 ? -82.743  -30.137  16.667   1.00 0.00 ? 203 PRO A HB2  2  
ATOM 8515  H HB3  . PRO A 1 208 ? -82.434  -29.759  14.960   1.00 0.00 ? 203 PRO A HB3  2  
ATOM 8516  H HG2  . PRO A 1 208 ? -80.740  -31.225  16.910   1.00 0.00 ? 203 PRO A HG2  2  
ATOM 8517  H HG3  . PRO A 1 208 ? -80.979  -31.510  15.181   1.00 0.00 ? 203 PRO A HG3  2  
ATOM 8518  H HD2  . PRO A 1 208 ? -78.781  -30.268  16.245   1.00 0.00 ? 203 PRO A HD2  2  
ATOM 8519  H HD3  . PRO A 1 208 ? -79.363  -30.033  14.587   1.00 0.00 ? 203 PRO A HD3  2  
ATOM 8520  N N    . GLY A 1 209 ? -80.874  -29.118  18.628   1.00 0.00 ? 204 GLY A N    2  
ATOM 8521  C CA   . GLY A 1 209 ? -80.932  -28.992  20.114   1.00 0.00 ? 204 GLY A CA   2  
ATOM 8522  C C    . GLY A 1 209 ? -80.198  -27.722  20.557   1.00 0.00 ? 204 GLY A C    2  
ATOM 8523  O O    . GLY A 1 209 ? -80.294  -27.308  21.696   1.00 0.00 ? 204 GLY A O    2  
ATOM 8524  H H    . GLY A 1 209 ? -80.344  -29.834  18.220   1.00 0.00 ? 204 GLY A H    2  
ATOM 8525  H HA2  . GLY A 1 209 ? -81.965  -28.941  20.428   1.00 0.00 ? 204 GLY A HA2  2  
ATOM 8526  H HA3  . GLY A 1 209 ? -80.462  -29.854  20.567   1.00 0.00 ? 204 GLY A HA3  2  
ATOM 8527  N N    . SER A 1 210 ? -79.466  -27.098  19.669   1.00 0.00 ? 205 SER A N    2  
ATOM 8528  C CA   . SER A 1 210 ? -78.728  -25.857  20.042   1.00 0.00 ? 205 SER A CA   2  
ATOM 8529  C C    . SER A 1 210 ? -79.445  -24.625  19.471   1.00 0.00 ? 205 SER A C    2  
ATOM 8530  O O    . SER A 1 210 ? -79.298  -24.312  18.307   1.00 0.00 ? 205 SER A O    2  
ATOM 8531  C CB   . SER A 1 210 ? -77.346  -26.014  19.406   1.00 0.00 ? 205 SER A CB   2  
ATOM 8532  O OG   . SER A 1 210 ? -76.348  -25.829  20.401   1.00 0.00 ? 205 SER A OG   2  
ATOM 8533  H H    . SER A 1 210 ? -79.399  -27.447  18.757   1.00 0.00 ? 205 SER A H    2  
ATOM 8534  H HA   . SER A 1 210 ? -78.634  -25.780  21.113   1.00 0.00 ? 205 SER A HA   2  
ATOM 8535  H HB2  . SER A 1 210 ? -77.250  -27.002  18.986   1.00 0.00 ? 205 SER A HB2  2  
ATOM 8536  H HB3  . SER A 1 210 ? -77.226  -25.280  18.620   1.00 0.00 ? 205 SER A HB3  2  
ATOM 8537  H HG   . SER A 1 210 ? -76.243  -26.659  20.874   1.00 0.00 ? 205 SER A HG   2  
ATOM 8538  N N    . PRO A 1 211 ? -80.202  -23.966  20.312   1.00 0.00 ? 206 PRO A N    2  
ATOM 8539  C CA   . PRO A 1 211 ? -80.948  -22.759  19.875   1.00 0.00 ? 206 PRO A CA   2  
ATOM 8540  C C    . PRO A 1 211 ? -79.991  -21.584  19.653   1.00 0.00 ? 206 PRO A C    2  
ATOM 8541  O O    . PRO A 1 211 ? -79.017  -21.422  20.361   1.00 0.00 ? 206 PRO A O    2  
ATOM 8542  C CB   . PRO A 1 211 ? -81.893  -22.478  21.040   1.00 0.00 ? 206 PRO A CB   2  
ATOM 8543  C CG   . PRO A 1 211 ? -81.233  -23.096  22.231   1.00 0.00 ? 206 PRO A CG   2  
ATOM 8544  C CD   . PRO A 1 211 ? -80.436  -24.272  21.731   1.00 0.00 ? 206 PRO A CD   2  
ATOM 8545  H HA   . PRO A 1 211 ? -81.515  -22.964  18.981   1.00 0.00 ? 206 PRO A HA   2  
ATOM 8546  H HB2  . PRO A 1 211 ? -82.007  -21.411  21.181   1.00 0.00 ? 206 PRO A HB2  2  
ATOM 8547  H HB3  . PRO A 1 211 ? -82.852  -22.940  20.868   1.00 0.00 ? 206 PRO A HB3  2  
ATOM 8548  H HG2  . PRO A 1 211 ? -80.578  -22.376  22.703   1.00 0.00 ? 206 PRO A HG2  2  
ATOM 8549  H HG3  . PRO A 1 211 ? -81.979  -23.434  22.933   1.00 0.00 ? 206 PRO A HG3  2  
ATOM 8550  H HD2  . PRO A 1 211 ? -79.498  -24.348  22.265   1.00 0.00 ? 206 PRO A HD2  2  
ATOM 8551  H HD3  . PRO A 1 211 ? -81.004  -25.184  21.825   1.00 0.00 ? 206 PRO A HD3  2  
ATOM 8552  N N    . GLU A 1 212 ? -80.266  -20.763  18.675   1.00 0.00 ? 207 GLU A N    2  
ATOM 8553  C CA   . GLU A 1 212 ? -79.377  -19.595  18.404   1.00 0.00 ? 207 GLU A CA   2  
ATOM 8554  C C    . GLU A 1 212 ? -80.220  -18.370  18.026   1.00 0.00 ? 207 GLU A C    2  
ATOM 8555  O O    . GLU A 1 212 ? -80.545  -18.177  16.872   1.00 0.00 ? 207 GLU A O    2  
ATOM 8556  C CB   . GLU A 1 212 ? -78.500  -20.029  17.226   1.00 0.00 ? 207 GLU A CB   2  
ATOM 8557  C CG   . GLU A 1 212 ? -77.057  -20.213  17.701   1.00 0.00 ? 207 GLU A CG   2  
ATOM 8558  C CD   . GLU A 1 212 ? -76.284  -18.908  17.504   1.00 0.00 ? 207 GLU A CD   2  
ATOM 8559  O OE1  . GLU A 1 212 ? -76.713  -17.901  18.043   1.00 0.00 ? 207 GLU A OE1  2  
ATOM 8560  O OE2  . GLU A 1 212 ? -75.275  -18.938  16.819   1.00 0.00 ? 207 GLU A OE2  2  
ATOM 8561  H H    . GLU A 1 212 ? -81.058  -20.913  18.119   1.00 0.00 ? 207 GLU A H    2  
ATOM 8562  H HA   . GLU A 1 212 ? -78.763  -19.381  19.264   1.00 0.00 ? 207 GLU A HA   2  
ATOM 8563  H HB2  . GLU A 1 212 ? -78.870  -20.962  16.826   1.00 0.00 ? 207 GLU A HB2  2  
ATOM 8564  H HB3  . GLU A 1 212 ? -78.529  -19.271  16.457   1.00 0.00 ? 207 GLU A HB3  2  
ATOM 8565  H HG2  . GLU A 1 212 ? -77.055  -20.479  18.749   1.00 0.00 ? 207 GLU A HG2  2  
ATOM 8566  H HG3  . GLU A 1 212 ? -76.587  -20.998  17.129   1.00 0.00 ? 207 GLU A HG3  2  
ATOM 8567  N N    . PRO A 1 213 ? -80.549  -17.578  19.017   1.00 0.00 ? 208 PRO A N    2  
ATOM 8568  C CA   . PRO A 1 213 ? -81.365  -16.362  18.776   1.00 0.00 ? 208 PRO A CA   2  
ATOM 8569  C C    . PRO A 1 213 ? -80.536  -15.293  18.058   1.00 0.00 ? 208 PRO A C    2  
ATOM 8570  O O    . PRO A 1 213 ? -79.615  -14.730  18.616   1.00 0.00 ? 208 PRO A O    2  
ATOM 8571  C CB   . PRO A 1 213 ? -81.747  -15.901  20.181   1.00 0.00 ? 208 PRO A CB   2  
ATOM 8572  C CG   . PRO A 1 213 ? -80.684  -16.459  21.073   1.00 0.00 ? 208 PRO A CG   2  
ATOM 8573  C CD   . PRO A 1 213 ? -80.199  -17.735  20.435   1.00 0.00 ? 208 PRO A CD   2  
ATOM 8574  H HA   . PRO A 1 213 ? -82.251  -16.602  18.212   1.00 0.00 ? 208 PRO A HA   2  
ATOM 8575  H HB2  . PRO A 1 213 ? -81.755  -14.821  20.231   1.00 0.00 ? 208 PRO A HB2  2  
ATOM 8576  H HB3  . PRO A 1 213 ? -82.709  -16.300  20.460   1.00 0.00 ? 208 PRO A HB3  2  
ATOM 8577  H HG2  . PRO A 1 213 ? -79.869  -15.753  21.160   1.00 0.00 ? 208 PRO A HG2  2  
ATOM 8578  H HG3  . PRO A 1 213 ? -81.094  -16.673  22.047   1.00 0.00 ? 208 PRO A HG3  2  
ATOM 8579  H HD2  . PRO A 1 213 ? -79.129  -17.834  20.557   1.00 0.00 ? 208 PRO A HD2  2  
ATOM 8580  H HD3  . PRO A 1 213 ? -80.711  -18.587  20.853   1.00 0.00 ? 208 PRO A HD3  2  
ATOM 8581  N N    . GLU A 1 214 ? -80.859  -15.011  16.825   1.00 0.00 ? 209 GLU A N    2  
ATOM 8582  C CA   . GLU A 1 214 ? -80.093  -13.978  16.068   1.00 0.00 ? 209 GLU A CA   2  
ATOM 8583  C C    . GLU A 1 214 ? -81.042  -13.152  15.196   1.00 0.00 ? 209 GLU A C    2  
ATOM 8584  O O    . GLU A 1 214 ? -81.001  -11.937  15.197   1.00 0.00 ? 209 GLU A O    2  
ATOM 8585  C CB   . GLU A 1 214 ? -79.116  -14.768  15.197   1.00 0.00 ? 209 GLU A CB   2  
ATOM 8586  C CG   . GLU A 1 214 ? -77.905  -13.893  14.868   1.00 0.00 ? 209 GLU A CG   2  
ATOM 8587  C CD   . GLU A 1 214 ? -78.255  -12.950  13.716   1.00 0.00 ? 209 GLU A CD   2  
ATOM 8588  O OE1  . GLU A 1 214 ? -78.967  -13.377  12.822   1.00 0.00 ? 209 GLU A OE1  2  
ATOM 8589  O OE2  . GLU A 1 214 ? -77.805  -11.816  13.747   1.00 0.00 ? 209 GLU A OE2  2  
ATOM 8590  H H    . GLU A 1 214 ? -81.607  -15.477  16.396   1.00 0.00 ? 209 GLU A H    2  
ATOM 8591  H HA   . GLU A 1 214 ? -79.551  -13.339  16.746   1.00 0.00 ? 209 GLU A HA   2  
ATOM 8592  H HB2  . GLU A 1 214 ? -78.791  -15.649  15.731   1.00 0.00 ? 209 GLU A HB2  2  
ATOM 8593  H HB3  . GLU A 1 214 ? -79.605  -15.061  14.281   1.00 0.00 ? 209 GLU A HB3  2  
ATOM 8594  H HG2  . GLU A 1 214 ? -77.632  -13.314  15.739   1.00 0.00 ? 209 GLU A HG2  2  
ATOM 8595  H HG3  . GLU A 1 214 ? -77.075  -14.520  14.578   1.00 0.00 ? 209 GLU A HG3  2  
ATOM 8596  N N    . HIS A 1 215 ? -81.895  -13.803  14.451   1.00 0.00 ? 210 HIS A N    2  
ATOM 8597  C CA   . HIS A 1 215 ? -82.848  -13.057  13.578   1.00 0.00 ? 210 HIS A CA   2  
ATOM 8598  C C    . HIS A 1 215 ? -83.997  -12.490  14.416   1.00 0.00 ? 210 HIS A C    2  
ATOM 8599  O O    . HIS A 1 215 ? -84.094  -11.297  14.626   1.00 0.00 ? 210 HIS A O    2  
ATOM 8600  C CB   . HIS A 1 215 ? -83.370  -14.094  12.583   1.00 0.00 ? 210 HIS A CB   2  
ATOM 8601  C CG   . HIS A 1 215 ? -82.352  -14.303  11.496   1.00 0.00 ? 210 HIS A CG   2  
ATOM 8602  N ND1  . HIS A 1 215 ? -81.187  -15.026  11.702   1.00 0.00 ? 210 HIS A ND1  2  
ATOM 8603  C CD2  . HIS A 1 215 ? -82.309  -13.890  10.187   1.00 0.00 ? 210 HIS A CD2  2  
ATOM 8604  C CE1  . HIS A 1 215 ? -80.500  -15.026  10.546   1.00 0.00 ? 210 HIS A CE1  2  
ATOM 8605  N NE2  . HIS A 1 215 ? -81.139  -14.348  9.589    1.00 0.00 ? 210 HIS A NE2  2  
ATOM 8606  H H    . HIS A 1 215 ? -81.910  -14.783  14.467   1.00 0.00 ? 210 HIS A H    2  
ATOM 8607  H HA   . HIS A 1 215 ? -82.338  -12.265  13.053   1.00 0.00 ? 210 HIS A HA   2  
ATOM 8608  H HB2  . HIS A 1 215 ? -83.545  -15.028  13.096   1.00 0.00 ? 210 HIS A HB2  2  
ATOM 8609  H HB3  . HIS A 1 215 ? -84.293  -13.743  12.148   1.00 0.00 ? 210 HIS A HB3  2  
ATOM 8610  H HD1  . HIS A 1 215 ? -80.915  -15.458  12.539   1.00 0.00 ? 210 HIS A HD1  2  
ATOM 8611  H HD2  . HIS A 1 215 ? -83.069  -13.300  9.696    1.00 0.00 ? 210 HIS A HD2  2  
ATOM 8612  H HE1  . HIS A 1 215 ? -79.547  -15.515  10.408   1.00 0.00 ? 210 HIS A HE1  2  
ATOM 8613  N N    . GLY A 1 216 ? -84.867  -13.338  14.895   1.00 0.00 ? 211 GLY A N    2  
ATOM 8614  C CA   . GLY A 1 216 ? -86.010  -12.852  15.721   1.00 0.00 ? 211 GLY A CA   2  
ATOM 8615  C C    . GLY A 1 216 ? -87.034  -12.159  14.821   1.00 0.00 ? 211 GLY A C    2  
ATOM 8616  O O    . GLY A 1 216 ? -87.664  -11.195  15.210   1.00 0.00 ? 211 GLY A O    2  
ATOM 8617  H H    . GLY A 1 216 ? -84.768  -14.296  14.713   1.00 0.00 ? 211 GLY A H    2  
ATOM 8618  H HA2  . GLY A 1 216 ? -86.475  -13.691  16.219   1.00 0.00 ? 211 GLY A HA2  2  
ATOM 8619  H HA3  . GLY A 1 216 ? -85.650  -12.150  16.457   1.00 0.00 ? 211 GLY A HA3  2  
ATOM 8620  N N    . SER A 1 217 ? -87.206  -12.643  13.620   1.00 0.00 ? 212 SER A N    2  
ATOM 8621  C CA   . SER A 1 217 ? -88.191  -12.013  12.693   1.00 0.00 ? 212 SER A CA   2  
ATOM 8622  C C    . SER A 1 217 ? -88.622  -13.015  11.619   1.00 0.00 ? 212 SER A C    2  
ATOM 8623  O O    . SER A 1 217 ? -88.597  -12.724  10.439   1.00 0.00 ? 212 SER A O    2  
ATOM 8624  C CB   . SER A 1 217 ? -87.446  -10.838  12.062   1.00 0.00 ? 212 SER A CB   2  
ATOM 8625  O OG   . SER A 1 217 ? -87.137  -9.883   13.069   1.00 0.00 ? 212 SER A OG   2  
ATOM 8626  H H    . SER A 1 217 ? -86.687  -13.421  13.327   1.00 0.00 ? 212 SER A H    2  
ATOM 8627  H HA   . SER A 1 217 ? -89.048  -11.654  13.241   1.00 0.00 ? 212 SER A HA   2  
ATOM 8628  H HB2  . SER A 1 217 ? -86.532  -11.187  11.613   1.00 0.00 ? 212 SER A HB2  2  
ATOM 8629  H HB3  . SER A 1 217 ? -88.068  -10.385  11.301   1.00 0.00 ? 212 SER A HB3  2  
ATOM 8630  H HG   . SER A 1 217 ? -86.210  -9.983   13.299   1.00 0.00 ? 212 SER A HG   2  
ATOM 8631  N N    . VAL A 1 218 ? -89.019  -14.193  12.020   1.00 0.00 ? 213 VAL A N    2  
ATOM 8632  C CA   . VAL A 1 218 ? -89.454  -15.216  11.024   1.00 0.00 ? 213 VAL A CA   2  
ATOM 8633  C C    . VAL A 1 218 ? -90.846  -14.868  10.488   1.00 0.00 ? 213 VAL A C    2  
ATOM 8634  O O    . VAL A 1 218 ? -91.197  -15.216  9.378    1.00 0.00 ? 213 VAL A O    2  
ATOM 8635  C CB   . VAL A 1 218 ? -89.488  -16.538  11.797   1.00 0.00 ? 213 VAL A CB   2  
ATOM 8636  C CG1  . VAL A 1 218 ? -89.914  -17.671  10.860   1.00 0.00 ? 213 VAL A CG1  2  
ATOM 8637  C CG2  . VAL A 1 218 ? -88.095  -16.840  12.356   1.00 0.00 ? 213 VAL A CG2  2  
ATOM 8638  H H    . VAL A 1 218 ? -89.032  -14.405  12.977   1.00 0.00 ? 213 VAL A H    2  
ATOM 8639  H HA   . VAL A 1 218 ? -88.744  -15.280  10.215   1.00 0.00 ? 213 VAL A HA   2  
ATOM 8640  H HB   . VAL A 1 218 ? -90.195  -16.459  12.610   1.00 0.00 ? 213 VAL A HB   2  
ATOM 8641  H HG11 . VAL A 1 218 ? -90.658  -17.308  10.168   1.00 0.00 ? 213 VAL A HG11 2  
ATOM 8642  H HG12 . VAL A 1 218 ? -90.330  -18.481  11.442   1.00 0.00 ? 213 VAL A HG12 2  
ATOM 8643  H HG13 . VAL A 1 218 ? -89.054  -18.027  10.312   1.00 0.00 ? 213 VAL A HG13 2  
ATOM 8644  H HG21 . VAL A 1 218 ? -87.568  -17.494  11.676   1.00 0.00 ? 213 VAL A HG21 2  
ATOM 8645  H HG22 . VAL A 1 218 ? -88.190  -17.323  13.318   1.00 0.00 ? 213 VAL A HG22 2  
ATOM 8646  H HG23 . VAL A 1 218 ? -87.543  -15.919  12.469   1.00 0.00 ? 213 VAL A HG23 2  
ATOM 8647  N N    . GLN A 1 219 ? -91.640  -14.181  11.271   1.00 0.00 ? 214 GLN A N    2  
ATOM 8648  C CA   . GLN A 1 219 ? -93.017  -13.801  10.823   1.00 0.00 ? 214 GLN A CA   2  
ATOM 8649  C C    . GLN A 1 219 ? -93.859  -15.057  10.563   1.00 0.00 ? 214 GLN A C    2  
ATOM 8650  O O    . GLN A 1 219 ? -94.687  -15.434  11.368   1.00 0.00 ? 214 GLN A O    2  
ATOM 8651  C CB   . GLN A 1 219 ? -92.827  -12.994  9.532    1.00 0.00 ? 214 GLN A CB   2  
ATOM 8652  C CG   . GLN A 1 219 ? -93.392  -11.584  9.720    1.00 0.00 ? 214 GLN A CG   2  
ATOM 8653  C CD   . GLN A 1 219 ? -92.713  -10.626  8.740    1.00 0.00 ? 214 GLN A CD   2  
ATOM 8654  O OE1  . GLN A 1 219 ? -93.115  -10.519  7.599    1.00 0.00 ? 214 GLN A OE1  2  
ATOM 8655  N NE2  . GLN A 1 219 ? -91.692  -9.918   9.141    1.00 0.00 ? 214 GLN A NE2  2  
ATOM 8656  H H    . GLN A 1 219 ? -91.329  -13.913  12.161   1.00 0.00 ? 214 GLN A H    2  
ATOM 8657  H HA   . GLN A 1 219 ? -93.492  -13.186  11.571   1.00 0.00 ? 214 GLN A HA   2  
ATOM 8658  H HB2  . GLN A 1 219 ? -91.774  -12.930  9.297    1.00 0.00 ? 214 GLN A HB2  2  
ATOM 8659  H HB3  . GLN A 1 219 ? -93.347  -13.481  8.721    1.00 0.00 ? 214 GLN A HB3  2  
ATOM 8660  H HG2  . GLN A 1 219 ? -94.457  -11.596  9.533    1.00 0.00 ? 214 GLN A HG2  2  
ATOM 8661  H HG3  . GLN A 1 219 ? -93.207  -11.254  10.731   1.00 0.00 ? 214 GLN A HG3  2  
ATOM 8662  H HE21 . GLN A 1 219 ? -91.367  -10.004  10.062   1.00 0.00 ? 214 GLN A HE21 2  
ATOM 8663  H HE22 . GLN A 1 219 ? -91.249  -9.302   8.521    1.00 0.00 ? 214 GLN A HE22 2  
ATOM 8664  N N    . GLU A 1 220 ? -93.655  -15.706  9.447    1.00 0.00 ? 215 GLU A N    2  
ATOM 8665  C CA   . GLU A 1 220 ? -94.444  -16.935  9.141    1.00 0.00 ? 215 GLU A CA   2  
ATOM 8666  C C    . GLU A 1 220 ? -93.557  -17.973  8.449    1.00 0.00 ? 215 GLU A C    2  
ATOM 8667  O O    . GLU A 1 220 ? -93.348  -19.059  8.952    1.00 0.00 ? 215 GLU A O    2  
ATOM 8668  C CB   . GLU A 1 220 ? -95.556  -16.467  8.200    1.00 0.00 ? 215 GLU A CB   2  
ATOM 8669  C CG   . GLU A 1 220 ? -96.851  -16.279  8.993    1.00 0.00 ? 215 GLU A CG   2  
ATOM 8670  C CD   . GLU A 1 220 ? -97.638  -17.591  9.004    1.00 0.00 ? 215 GLU A CD   2  
ATOM 8671  O OE1  . GLU A 1 220 ? -97.191  -18.521  9.655    1.00 0.00 ? 215 GLU A OE1  2  
ATOM 8672  O OE2  . GLU A 1 220 ? -98.674  -17.644  8.362    1.00 0.00 ? 215 GLU A OE2  2  
ATOM 8673  H H    . GLU A 1 220 ? -92.982  -15.386  8.811    1.00 0.00 ? 215 GLU A H    2  
ATOM 8674  H HA   . GLU A 1 220 ? -94.870  -17.344  10.043   1.00 0.00 ? 215 GLU A HA   2  
ATOM 8675  H HB2  . GLU A 1 220 ? -95.271  -15.529  7.746    1.00 0.00 ? 215 GLU A HB2  2  
ATOM 8676  H HB3  . GLU A 1 220 ? -95.711  -17.208  7.430    1.00 0.00 ? 215 GLU A HB3  2  
ATOM 8677  H HG2  . GLU A 1 220 ? -96.614  -15.991  10.007   1.00 0.00 ? 215 GLU A HG2  2  
ATOM 8678  H HG3  . GLU A 1 220 ? -97.448  -15.508  8.529    1.00 0.00 ? 215 GLU A HG3  2  
ATOM 8679  N N    . SER A 1 221 ? -93.033  -17.645  7.298    1.00 0.00 ? 216 SER A N    2  
ATOM 8680  C CA   . SER A 1 221 ? -92.159  -18.609  6.570    1.00 0.00 ? 216 SER A CA   2  
ATOM 8681  C C    . SER A 1 221 ? -91.072  -17.857  5.798    1.00 0.00 ? 216 SER A C    2  
ATOM 8682  O O    . SER A 1 221 ? -91.122  -16.652  5.652    1.00 0.00 ? 216 SER A O    2  
ATOM 8683  C CB   . SER A 1 221 ? -93.092  -19.343  5.608    1.00 0.00 ? 216 SER A CB   2  
ATOM 8684  O OG   . SER A 1 221 ? -93.799  -18.391  4.823    1.00 0.00 ? 216 SER A OG   2  
ATOM 8685  H H    . SER A 1 221 ? -93.215  -16.763  6.912    1.00 0.00 ? 216 SER A H    2  
ATOM 8686  H HA   . SER A 1 221 ? -91.715  -19.310  7.260    1.00 0.00 ? 216 SER A HA   2  
ATOM 8687  H HB2  . SER A 1 221 ? -92.515  -19.979  4.958    1.00 0.00 ? 216 SER A HB2  2  
ATOM 8688  H HB3  . SER A 1 221 ? -93.789  -19.947  6.174    1.00 0.00 ? 216 SER A HB3  2  
ATOM 8689  H HG   . SER A 1 221 ? -93.155  -17.807  4.415    1.00 0.00 ? 216 SER A HG   2  
ATOM 8690  N N    . GLN A 1 222 ? -90.089  -18.561  5.302    1.00 0.00 ? 217 GLN A N    2  
ATOM 8691  C CA   . GLN A 1 222 ? -88.998  -17.889  4.538    1.00 0.00 ? 217 GLN A CA   2  
ATOM 8692  C C    . GLN A 1 222 ? -89.060  -18.290  3.061    1.00 0.00 ? 217 GLN A C    2  
ATOM 8693  O O    . GLN A 1 222 ? -88.609  -17.567  2.194    1.00 0.00 ? 217 GLN A O    2  
ATOM 8694  C CB   . GLN A 1 222 ? -87.701  -18.391  5.176    1.00 0.00 ? 217 GLN A CB   2  
ATOM 8695  C CG   . GLN A 1 222 ? -87.186  -17.353  6.174    1.00 0.00 ? 217 GLN A CG   2  
ATOM 8696  C CD   . GLN A 1 222 ? -86.264  -18.032  7.188    1.00 0.00 ? 217 GLN A CD   2  
ATOM 8697  O OE1  . GLN A 1 222 ? -86.631  -18.218  8.331    1.00 0.00 ? 217 GLN A OE1  2  
ATOM 8698  N NE2  . GLN A 1 222 ? -85.073  -18.414  6.815    1.00 0.00 ? 217 GLN A NE2  2  
ATOM 8699  H H    . GLN A 1 222 ? -90.069  -19.532  5.431    1.00 0.00 ? 217 GLN A H    2  
ATOM 8700  H HA   . GLN A 1 222 ? -89.069  -16.818  4.642    1.00 0.00 ? 217 GLN A HA   2  
ATOM 8701  H HB2  . GLN A 1 222 ? -87.891  -19.323  5.689    1.00 0.00 ? 217 GLN A HB2  2  
ATOM 8702  H HB3  . GLN A 1 222 ? -86.959  -18.548  4.408    1.00 0.00 ? 217 GLN A HB3  2  
ATOM 8703  H HG2  . GLN A 1 222 ? -86.639  -16.586  5.646    1.00 0.00 ? 217 GLN A HG2  2  
ATOM 8704  H HG3  . GLN A 1 222 ? -88.021  -16.907  6.693    1.00 0.00 ? 217 GLN A HG3  2  
ATOM 8705  H HE21 . GLN A 1 222 ? -84.777  -18.264  5.893    1.00 0.00 ? 217 GLN A HE21 2  
ATOM 8706  H HE22 . GLN A 1 222 ? -84.475  -18.850  7.457    1.00 0.00 ? 217 GLN A HE22 2  
ATOM 8707  N N    . VAL A 1 223 ? -89.617  -19.435  2.769    1.00 0.00 ? 218 VAL A N    2  
ATOM 8708  C CA   . VAL A 1 223 ? -89.711  -19.882  1.349    1.00 0.00 ? 218 VAL A CA   2  
ATOM 8709  C C    . VAL A 1 223 ? -91.180  -20.008  0.931    1.00 0.00 ? 218 VAL A C    2  
ATOM 8710  O O    . VAL A 1 223 ? -92.031  -20.366  1.721    1.00 0.00 ? 218 VAL A O    2  
ATOM 8711  C CB   . VAL A 1 223 ? -89.015  -21.247  1.314    1.00 0.00 ? 218 VAL A CB   2  
ATOM 8712  C CG1  . VAL A 1 223 ? -89.720  -22.217  2.269    1.00 0.00 ? 218 VAL A CG1  2  
ATOM 8713  C CG2  . VAL A 1 223 ? -89.061  -21.806  -0.111   1.00 0.00 ? 218 VAL A CG2  2  
ATOM 8714  H H    . VAL A 1 223 ? -89.975  -20.002  3.483    1.00 0.00 ? 218 VAL A H    2  
ATOM 8715  H HA   . VAL A 1 223 ? -89.194  -19.190  0.703    1.00 0.00 ? 218 VAL A HA   2  
ATOM 8716  H HB   . VAL A 1 223 ? -87.985  -21.130  1.621    1.00 0.00 ? 218 VAL A HB   2  
ATOM 8717  H HG11 . VAL A 1 223 ? -90.580  -21.733  2.707    1.00 0.00 ? 218 VAL A HG11 2  
ATOM 8718  H HG12 . VAL A 1 223 ? -89.036  -22.510  3.052    1.00 0.00 ? 218 VAL A HG12 2  
ATOM 8719  H HG13 . VAL A 1 223 ? -90.039  -23.094  1.724    1.00 0.00 ? 218 VAL A HG13 2  
ATOM 8720  H HG21 . VAL A 1 223 ? -88.698  -22.823  -0.110   1.00 0.00 ? 218 VAL A HG21 2  
ATOM 8721  H HG22 . VAL A 1 223 ? -88.438  -21.203  -0.754   1.00 0.00 ? 218 VAL A HG22 2  
ATOM 8722  H HG23 . VAL A 1 223 ? -90.078  -21.787  -0.472   1.00 0.00 ? 218 VAL A HG23 2  
ATOM 8723  N N    . SER A 1 224 ? -91.481  -19.714  -0.305   1.00 0.00 ? 219 SER A N    2  
ATOM 8724  C CA   . SER A 1 224 ? -92.893  -19.814  -0.776   1.00 0.00 ? 219 SER A CA   2  
ATOM 8725  C C    . SER A 1 224 ? -92.931  -20.177  -2.263   1.00 0.00 ? 219 SER A C    2  
ATOM 8726  O O    . SER A 1 224 ? -93.302  -19.375  -3.099   1.00 0.00 ? 219 SER A O    2  
ATOM 8727  C CB   . SER A 1 224 ? -93.485  -18.424  -0.547   1.00 0.00 ? 219 SER A CB   2  
ATOM 8728  O OG   . SER A 1 224 ? -93.305  -18.055  0.814    1.00 0.00 ? 219 SER A OG   2  
ATOM 8729  H H    . SER A 1 224 ? -90.778  -19.426  -0.923   1.00 0.00 ? 219 SER A H    2  
ATOM 8730  H HA   . SER A 1 224 ? -93.433  -20.544  -0.195   1.00 0.00 ? 219 SER A HA   2  
ATOM 8731  H HB2  . SER A 1 224 ? -92.983  -17.708  -1.177   1.00 0.00 ? 219 SER A HB2  2  
ATOM 8732  H HB3  . SER A 1 224 ? -94.539  -18.438  -0.791   1.00 0.00 ? 219 SER A HB3  2  
ATOM 8733  H HG   . SER A 1 224 ? -94.173  -17.949  1.210    1.00 0.00 ? 219 SER A HG   2  
ATOM 8734  N N    . GLU A 1 225 ? -92.552  -21.381  -2.599   1.00 0.00 ? 220 GLU A N    2  
ATOM 8735  C CA   . GLU A 1 225 ? -92.567  -21.797  -4.033   1.00 0.00 ? 220 GLU A CA   2  
ATOM 8736  C C    . GLU A 1 225 ? -94.006  -21.834  -4.555   1.00 0.00 ? 220 GLU A C    2  
ATOM 8737  O O    . GLU A 1 225 ? -94.313  -21.281  -5.593   1.00 0.00 ? 220 GLU A O    2  
ATOM 8738  C CB   . GLU A 1 225 ? -91.956  -23.199  -4.047   1.00 0.00 ? 220 GLU A CB   2  
ATOM 8739  C CG   . GLU A 1 225 ? -90.437  -23.093  -4.193   1.00 0.00 ? 220 GLU A CG   2  
ATOM 8740  C CD   . GLU A 1 225 ? -90.092  -22.590  -5.596   1.00 0.00 ? 220 GLU A CD   2  
ATOM 8741  O OE1  . GLU A 1 225 ? -90.762  -22.997  -6.531   1.00 0.00 ? 220 GLU A OE1  2  
ATOM 8742  O OE2  . GLU A 1 225 ? -89.165  -21.806  -5.711   1.00 0.00 ? 220 GLU A OE2  2  
ATOM 8743  H H    . GLU A 1 225 ? -92.258  -22.011  -1.909   1.00 0.00 ? 220 GLU A H    2  
ATOM 8744  H HA   . GLU A 1 225 ? -91.967  -21.127  -4.627   1.00 0.00 ? 220 GLU A HA   2  
ATOM 8745  H HB2  . GLU A 1 225 ? -92.196  -23.706  -3.124   1.00 0.00 ? 220 GLU A HB2  2  
ATOM 8746  H HB3  . GLU A 1 225 ? -92.357  -23.758  -4.879   1.00 0.00 ? 220 GLU A HB3  2  
ATOM 8747  H HG2  . GLU A 1 225 ? -90.053  -22.402  -3.457   1.00 0.00 ? 220 GLU A HG2  2  
ATOM 8748  H HG3  . GLU A 1 225 ? -89.992  -24.065  -4.042   1.00 0.00 ? 220 GLU A HG3  2  
ATOM 8749  N N    . GLN A 1 226 ? -94.888  -22.482  -3.842   1.00 0.00 ? 221 GLN A N    2  
ATOM 8750  C CA   . GLN A 1 226 ? -96.308  -22.557  -4.295   1.00 0.00 ? 221 GLN A CA   2  
ATOM 8751  C C    . GLN A 1 226 ? -97.231  -22.833  -3.099   1.00 0.00 ? 221 GLN A C    2  
ATOM 8752  O O    . GLN A 1 226 ? -96.964  -23.718  -2.309   1.00 0.00 ? 221 GLN A O    2  
ATOM 8753  C CB   . GLN A 1 226 ? -96.349  -23.721  -5.288   1.00 0.00 ? 221 GLN A CB   2  
ATOM 8754  C CG   . GLN A 1 226 ? -95.896  -25.010  -4.596   1.00 0.00 ? 221 GLN A CG   2  
ATOM 8755  C CD   . GLN A 1 226 ? -95.470  -26.034  -5.649   1.00 0.00 ? 221 GLN A CD   2  
ATOM 8756  O OE1  . GLN A 1 226 ? -96.255  -26.418  -6.492   1.00 0.00 ? 221 GLN A OE1  2  
ATOM 8757  N NE2  . GLN A 1 226 ? -94.249  -26.495  -5.636   1.00 0.00 ? 221 GLN A NE2  2  
ATOM 8758  H H    . GLN A 1 226 ? -94.617  -22.920  -3.009   1.00 0.00 ? 221 GLN A H    2  
ATOM 8759  H HA   . GLN A 1 226 ? -96.591  -21.642  -4.790   1.00 0.00 ? 221 GLN A HA   2  
ATOM 8760  H HB2  . GLN A 1 226 ? -97.357  -23.845  -5.655   1.00 0.00 ? 221 GLN A HB2  2  
ATOM 8761  H HB3  . GLN A 1 226 ? -95.689  -23.510  -6.116   1.00 0.00 ? 221 GLN A HB3  2  
ATOM 8762  H HG2  . GLN A 1 226 ? -95.061  -24.795  -3.944   1.00 0.00 ? 221 GLN A HG2  2  
ATOM 8763  H HG3  . GLN A 1 226 ? -96.712  -25.412  -4.015   1.00 0.00 ? 221 GLN A HG3  2  
ATOM 8764  H HE21 . GLN A 1 226 ? -93.615  -26.185  -4.956   1.00 0.00 ? 221 GLN A HE21 2  
ATOM 8765  H HE22 . GLN A 1 226 ? -93.966  -27.152  -6.307   1.00 0.00 ? 221 GLN A HE22 2  
ATOM 8766  N N    . PRO A 1 227 ? -98.289  -22.067  -2.999   1.00 0.00 ? 222 PRO A N    2  
ATOM 8767  C CA   . PRO A 1 227 ? -99.248  -22.246  -1.881   1.00 0.00 ? 222 PRO A CA   2  
ATOM 8768  C C    . PRO A 1 227 ? -100.093 -23.504  -2.097   1.00 0.00 ? 222 PRO A C    2  
ATOM 8769  O O    . PRO A 1 227 ? -100.246 -24.320  -1.210   1.00 0.00 ? 222 PRO A O    2  
ATOM 8770  C CB   . PRO A 1 227 ? -100.116 -20.992  -1.946   1.00 0.00 ? 222 PRO A CB   2  
ATOM 8771  C CG   . PRO A 1 227 ? -100.029 -20.531  -3.366   1.00 0.00 ? 222 PRO A CG   2  
ATOM 8772  C CD   . PRO A 1 227 ? -98.692  -20.977  -3.900   1.00 0.00 ? 222 PRO A CD   2  
ATOM 8773  H HA   . PRO A 1 227 ? -98.731  -22.289  -0.937   1.00 0.00 ? 222 PRO A HA   2  
ATOM 8774  H HB2  . PRO A 1 227 ? -101.138 -21.231  -1.688   1.00 0.00 ? 222 PRO A HB2  2  
ATOM 8775  H HB3  . PRO A 1 227 ? -99.728  -20.231  -1.287   1.00 0.00 ? 222 PRO A HB3  2  
ATOM 8776  H HG2  . PRO A 1 227 ? -100.827 -20.975  -3.946   1.00 0.00 ? 222 PRO A HG2  2  
ATOM 8777  H HG3  . PRO A 1 227 ? -100.095 -19.455  -3.409   1.00 0.00 ? 222 PRO A HG3  2  
ATOM 8778  H HD2  . PRO A 1 227 ? -98.793  -21.338  -4.915   1.00 0.00 ? 222 PRO A HD2  2  
ATOM 8779  H HD3  . PRO A 1 227 ? -97.976  -20.172  -3.852   1.00 0.00 ? 222 PRO A HD3  2  
ATOM 8780  N N    . ALA A 1 228 ? -100.643 -23.666  -3.274   1.00 0.00 ? 223 ALA A N    2  
ATOM 8781  C CA   . ALA A 1 228 ? -101.482 -24.871  -3.559   1.00 0.00 ? 223 ALA A CA   2  
ATOM 8782  C C    . ALA A 1 228 ? -102.576 -25.027  -2.496   1.00 0.00 ? 223 ALA A C    2  
ATOM 8783  O O    . ALA A 1 228 ? -102.701 -24.218  -1.598   1.00 0.00 ? 223 ALA A O    2  
ATOM 8784  C CB   . ALA A 1 228 ? -100.515 -26.055  -3.511   1.00 0.00 ? 223 ALA A CB   2  
ATOM 8785  H H    . ALA A 1 228 ? -100.504 -22.993  -3.972   1.00 0.00 ? 223 ALA A H    2  
ATOM 8786  H HA   . ALA A 1 228 ? -101.922 -24.797  -4.541   1.00 0.00 ? 223 ALA A HA   2  
ATOM 8787  H HB1  . ALA A 1 228 ? -101.065 -26.961  -3.304   1.00 0.00 ? 223 ALA A HB1  2  
ATOM 8788  H HB2  . ALA A 1 228 ? -99.784  -25.893  -2.732   1.00 0.00 ? 223 ALA A HB2  2  
ATOM 8789  H HB3  . ALA A 1 228 ? -100.013 -26.148  -4.462   1.00 0.00 ? 223 ALA A HB3  2  
ATOM 8790  N N    . THR A 1 229 ? -103.366 -26.063  -2.594   1.00 0.00 ? 224 THR A N    2  
ATOM 8791  C CA   . THR A 1 229 ? -104.451 -26.274  -1.593   1.00 0.00 ? 224 THR A CA   2  
ATOM 8792  C C    . THR A 1 229 ? -104.086 -27.426  -0.653   1.00 0.00 ? 224 THR A C    2  
ATOM 8793  O O    . THR A 1 229 ? -104.581 -28.529  -0.785   1.00 0.00 ? 224 THR A O    2  
ATOM 8794  C CB   . THR A 1 229 ? -105.690 -26.627  -2.419   1.00 0.00 ? 224 THR A CB   2  
ATOM 8795  O OG1  . THR A 1 229 ? -105.846 -25.678  -3.464   1.00 0.00 ? 224 THR A OG1  2  
ATOM 8796  C CG2  . THR A 1 229 ? -106.930 -26.611  -1.522   1.00 0.00 ? 224 THR A CG2  2  
ATOM 8797  H H    . THR A 1 229 ? -103.245 -26.702  -3.328   1.00 0.00 ? 224 THR A H    2  
ATOM 8798  H HA   . THR A 1 229 ? -104.628 -25.371  -1.032   1.00 0.00 ? 224 THR A HA   2  
ATOM 8799  H HB   . THR A 1 229 ? -105.571 -27.612  -2.843   1.00 0.00 ? 224 THR A HB   2  
ATOM 8800  H HG1  . THR A 1 229 ? -105.283 -25.945  -4.195   1.00 0.00 ? 224 THR A HG1  2  
ATOM 8801  H HG21 . THR A 1 229 ? -107.699 -26.009  -1.983   1.00 0.00 ? 224 THR A HG21 2  
ATOM 8802  H HG22 . THR A 1 229 ? -106.675 -26.193  -0.559   1.00 0.00 ? 224 THR A HG22 2  
ATOM 8803  H HG23 . THR A 1 229 ? -107.293 -27.620  -1.392   1.00 0.00 ? 224 THR A HG23 2  
ATOM 8804  N N    . GLU A 1 230 ? -103.223 -27.179  0.296    1.00 0.00 ? 225 GLU A N    2  
ATOM 8805  C CA   . GLU A 1 230 ? -102.824 -28.258  1.245    1.00 0.00 ? 225 GLU A CA   2  
ATOM 8806  C C    . GLU A 1 230 ? -102.676 -27.690  2.660    1.00 0.00 ? 225 GLU A C    2  
ATOM 8807  O O    . GLU A 1 230 ? -101.723 -27.000  2.965    1.00 0.00 ? 225 GLU A O    2  
ATOM 8808  C CB   . GLU A 1 230 ? -101.477 -28.764  0.726    1.00 0.00 ? 225 GLU A CB   2  
ATOM 8809  C CG   . GLU A 1 230 ? -101.700 -29.615  -0.526   1.00 0.00 ? 225 GLU A CG   2  
ATOM 8810  C CD   . GLU A 1 230 ? -100.352 -30.099  -1.062   1.00 0.00 ? 225 GLU A CD   2  
ATOM 8811  O OE1  . GLU A 1 230 ? -99.664  -30.797  -0.336   1.00 0.00 ? 225 GLU A OE1  2  
ATOM 8812  O OE2  . GLU A 1 230 ? -100.029 -29.762  -2.189   1.00 0.00 ? 225 GLU A OE2  2  
ATOM 8813  H H    . GLU A 1 230 ? -102.836 -26.282  0.383    1.00 0.00 ? 225 GLU A H    2  
ATOM 8814  H HA   . GLU A 1 230 ? -103.547 -29.057  1.234    1.00 0.00 ? 225 GLU A HA   2  
ATOM 8815  H HB2  . GLU A 1 230 ? -100.846 -27.922  0.482    1.00 0.00 ? 225 GLU A HB2  2  
ATOM 8816  H HB3  . GLU A 1 230 ? -101.001 -29.364  1.486    1.00 0.00 ? 225 GLU A HB3  2  
ATOM 8817  H HG2  . GLU A 1 230 ? -102.316 -30.468  -0.276   1.00 0.00 ? 225 GLU A HG2  2  
ATOM 8818  H HG3  . GLU A 1 230 ? -102.194 -29.023  -1.281   1.00 0.00 ? 225 GLU A HG3  2  
ATOM 8819  N N    . ALA A 1 231 ? -103.613 -27.976  3.524    1.00 0.00 ? 226 ALA A N    2  
ATOM 8820  C CA   . ALA A 1 231 ? -103.530 -27.454  4.919    1.00 0.00 ? 226 ALA A CA   2  
ATOM 8821  C C    . ALA A 1 231 ? -103.241 -28.598  5.895    1.00 0.00 ? 226 ALA A C    2  
ATOM 8822  O O    . ALA A 1 231 ? -103.153 -29.748  5.509    1.00 0.00 ? 226 ALA A O    2  
ATOM 8823  C CB   . ALA A 1 231 ? -104.905 -26.846  5.198    1.00 0.00 ? 226 ALA A CB   2  
ATOM 8824  H H    . ALA A 1 231 ? -104.372 -28.535  3.255    1.00 0.00 ? 226 ALA A H    2  
ATOM 8825  H HA   . ALA A 1 231 ? -102.769 -26.694  4.993    1.00 0.00 ? 226 ALA A HA   2  
ATOM 8826  H HB1  . ALA A 1 231 ? -105.644 -27.325  4.572    1.00 0.00 ? 226 ALA A HB1  2  
ATOM 8827  H HB2  . ALA A 1 231 ? -104.881 -25.788  4.982    1.00 0.00 ? 226 ALA A HB2  2  
ATOM 8828  H HB3  . ALA A 1 231 ? -105.161 -26.996  6.236    1.00 0.00 ? 226 ALA A HB3  2  
ATOM 8829  N N    . ALA A 1 232 ? -103.093 -28.291  7.156    1.00 0.00 ? 227 ALA A N    2  
ATOM 8830  C CA   . ALA A 1 232 ? -102.809 -29.358  8.159    1.00 0.00 ? 227 ALA A CA   2  
ATOM 8831  C C    . ALA A 1 232 ? -104.115 -29.858  8.783    1.00 0.00 ? 227 ALA A C    2  
ATOM 8832  O O    . ALA A 1 232 ? -104.214 -30.991  9.212    1.00 0.00 ? 227 ALA A O    2  
ATOM 8833  C CB   . ALA A 1 232 ? -101.934 -28.683  9.216    1.00 0.00 ? 227 ALA A CB   2  
ATOM 8834  H H    . ALA A 1 232 ? -103.168 -27.357  7.443    1.00 0.00 ? 227 ALA A H    2  
ATOM 8835  H HA   . ALA A 1 232 ? -102.272 -30.173  7.702    1.00 0.00 ? 227 ALA A HA   2  
ATOM 8836  H HB1  . ALA A 1 232 ? -102.467 -27.848  9.645    1.00 0.00 ? 227 ALA A HB1  2  
ATOM 8837  H HB2  . ALA A 1 232 ? -101.022 -28.331  8.756    1.00 0.00 ? 227 ALA A HB2  2  
ATOM 8838  H HB3  . ALA A 1 232 ? -101.693 -29.394  9.992    1.00 0.00 ? 227 ALA A HB3  2  
ATOM 8839  N N    . GLY A 1 233 ? -105.117 -29.020  8.835    1.00 0.00 ? 228 GLY A N    2  
ATOM 8840  C CA   . GLY A 1 233 ? -106.417 -29.445  9.430    1.00 0.00 ? 228 GLY A CA   2  
ATOM 8841  C C    . GLY A 1 233 ? -107.144 -28.223  9.995    1.00 0.00 ? 228 GLY A C    2  
ATOM 8842  O O    . GLY A 1 233 ? -106.908 -27.811  11.114   1.00 0.00 ? 228 GLY A O    2  
ATOM 8843  H H    . GLY A 1 233 ? -105.014 -28.112  8.483    1.00 0.00 ? 228 GLY A H    2  
ATOM 8844  H HA2  . GLY A 1 233 ? -107.026 -29.908  8.668    1.00 0.00 ? 228 GLY A HA2  2  
ATOM 8845  H HA3  . GLY A 1 233 ? -106.236 -30.151  10.226   1.00 0.00 ? 228 GLY A HA3  2  
ATOM 8846  N N    . GLU A 1 234 ? -108.026 -27.641  9.228    1.00 0.00 ? 229 GLU A N    2  
ATOM 8847  C CA   . GLU A 1 234 ? -108.772 -26.444  9.717    1.00 0.00 ? 229 GLU A CA   2  
ATOM 8848  C C    . GLU A 1 234 ? -109.994 -26.879  10.531   1.00 0.00 ? 229 GLU A C    2  
ATOM 8849  O O    . GLU A 1 234 ? -111.111 -26.855  10.053   1.00 0.00 ? 229 GLU A O    2  
ATOM 8850  C CB   . GLU A 1 234 ? -109.204 -25.704  8.450    1.00 0.00 ? 229 GLU A CB   2  
ATOM 8851  C CG   . GLU A 1 234 ? -109.778 -24.334  8.825    1.00 0.00 ? 229 GLU A CG   2  
ATOM 8852  C CD   . GLU A 1 234 ? -109.119 -23.250  7.969    1.00 0.00 ? 229 GLU A CD   2  
ATOM 8853  O OE1  . GLU A 1 234 ? -107.967 -22.938  8.226    1.00 0.00 ? 229 GLU A OE1  2  
ATOM 8854  O OE2  . GLU A 1 234 ? -109.776 -22.750  7.071    1.00 0.00 ? 229 GLU A OE2  2  
ATOM 8855  H H    . GLU A 1 234 ? -108.199 -27.991  8.329    1.00 0.00 ? 229 GLU A H    2  
ATOM 8856  H HA   . GLU A 1 234 ? -108.127 -25.815  10.310   1.00 0.00 ? 229 GLU A HA   2  
ATOM 8857  H HB2  . GLU A 1 234 ? -108.349 -25.574  7.802    1.00 0.00 ? 229 GLU A HB2  2  
ATOM 8858  H HB3  . GLU A 1 234 ? -109.959 -26.280  7.938    1.00 0.00 ? 229 GLU A HB3  2  
ATOM 8859  H HG2  . GLU A 1 234 ? -110.844 -24.331  8.651    1.00 0.00 ? 229 GLU A HG2  2  
ATOM 8860  H HG3  . GLU A 1 234 ? -109.583 -24.133  9.868    1.00 0.00 ? 229 GLU A HG3  2  
ATOM 8861  N N    . ASN A 1 235 ? -109.788 -27.278  11.759   1.00 0.00 ? 230 ASN A N    2  
ATOM 8862  C CA   . ASN A 1 235 ? -110.934 -27.716  12.607   1.00 0.00 ? 230 ASN A CA   2  
ATOM 8863  C C    . ASN A 1 235 ? -111.313 -26.608  13.601   1.00 0.00 ? 230 ASN A C    2  
ATOM 8864  O O    . ASN A 1 235 ? -110.468 -26.112  14.319   1.00 0.00 ? 230 ASN A O    2  
ATOM 8865  C CB   . ASN A 1 235 ? -110.421 -28.950  13.352   1.00 0.00 ? 230 ASN A CB   2  
ATOM 8866  C CG   . ASN A 1 235 ? -111.588 -29.894  13.644   1.00 0.00 ? 230 ASN A CG   2  
ATOM 8867  O OD1  . ASN A 1 235 ? -111.570 -31.042  13.248   1.00 0.00 ? 230 ASN A OD1  2  
ATOM 8868  N ND2  . ASN A 1 235 ? -112.610 -29.455  14.327   1.00 0.00 ? 230 ASN A ND2  2  
ATOM 8869  H H    . ASN A 1 235 ? -108.878 -27.289  12.122   1.00 0.00 ? 230 ASN A H    2  
ATOM 8870  H HA   . ASN A 1 235 ? -111.778 -27.982  11.991   1.00 0.00 ? 230 ASN A HA   2  
ATOM 8871  H HB2  . ASN A 1 235 ? -109.689 -29.459  12.742   1.00 0.00 ? 230 ASN A HB2  2  
ATOM 8872  H HB3  . ASN A 1 235 ? -109.966 -28.645  14.282   1.00 0.00 ? 230 ASN A HB3  2  
ATOM 8873  H HD21 . ASN A 1 235 ? -112.625 -28.529  14.647   1.00 0.00 ? 230 ASN A HD21 2  
ATOM 8874  H HD22 . ASN A 1 235 ? -113.363 -30.052  14.519   1.00 0.00 ? 230 ASN A HD22 2  
ATOM 8875  N N    . PRO A 1 236 ? -112.575 -26.252  13.612   1.00 0.00 ? 231 PRO A N    2  
ATOM 8876  C CA   . PRO A 1 236 ? -113.053 -25.189  14.532   1.00 0.00 ? 231 PRO A CA   2  
ATOM 8877  C C    . PRO A 1 236 ? -113.131 -25.717  15.969   1.00 0.00 ? 231 PRO A C    2  
ATOM 8878  O O    . PRO A 1 236 ? -114.188 -25.760  16.567   1.00 0.00 ? 231 PRO A O    2  
ATOM 8879  C CB   . PRO A 1 236 ? -114.444 -24.856  14.002   1.00 0.00 ? 231 PRO A CB   2  
ATOM 8880  C CG   . PRO A 1 236 ? -114.896 -26.090  13.287   1.00 0.00 ? 231 PRO A CG   2  
ATOM 8881  C CD   . PRO A 1 236 ? -113.662 -26.792  12.783   1.00 0.00 ? 231 PRO A CD   2  
ATOM 8882  H HA   . PRO A 1 236 ? -112.417 -24.321  14.476   1.00 0.00 ? 231 PRO A HA   2  
ATOM 8883  H HB2  . PRO A 1 236 ? -115.112 -24.627  14.821   1.00 0.00 ? 231 PRO A HB2  2  
ATOM 8884  H HB3  . PRO A 1 236 ? -114.395 -24.028  13.312   1.00 0.00 ? 231 PRO A HB3  2  
ATOM 8885  H HG2  . PRO A 1 236 ? -115.435 -26.732  13.970   1.00 0.00 ? 231 PRO A HG2  2  
ATOM 8886  H HG3  . PRO A 1 236 ? -115.527 -25.823  12.454   1.00 0.00 ? 231 PRO A HG3  2  
ATOM 8887  H HD2  . PRO A 1 236 ? -113.753 -27.861  12.922   1.00 0.00 ? 231 PRO A HD2  2  
ATOM 8888  H HD3  . PRO A 1 236 ? -113.489 -26.556  11.744   1.00 0.00 ? 231 PRO A HD3  2  
ATOM 8889  N N    . LEU A 1 237 ? -112.018 -26.116  16.527   1.00 0.00 ? 232 LEU A N    2  
ATOM 8890  C CA   . LEU A 1 237 ? -112.023 -26.639  17.926   1.00 0.00 ? 232 LEU A CA   2  
ATOM 8891  C C    . LEU A 1 237 ? -110.589 -26.904  18.393   1.00 0.00 ? 232 LEU A C    2  
ATOM 8892  O O    . LEU A 1 237 ? -110.245 -26.669  19.535   1.00 0.00 ? 232 LEU A O    2  
ATOM 8893  C CB   . LEU A 1 237 ? -112.821 -27.946  17.864   1.00 0.00 ? 232 LEU A CB   2  
ATOM 8894  C CG   . LEU A 1 237 ? -114.161 -27.763  18.581   1.00 0.00 ? 232 LEU A CG   2  
ATOM 8895  C CD1  . LEU A 1 237 ? -115.247 -28.557  17.852   1.00 0.00 ? 232 LEU A CD1  2  
ATOM 8896  C CD2  . LEU A 1 237 ? -114.043 -28.269  20.021   1.00 0.00 ? 232 LEU A CD2  2  
ATOM 8897  H H    . LEU A 1 237 ? -111.177 -26.070  16.027   1.00 0.00 ? 232 LEU A H    2  
ATOM 8898  H HA   . LEU A 1 237 ? -112.510 -25.941  18.587   1.00 0.00 ? 232 LEU A HA   2  
ATOM 8899  H HB2  . LEU A 1 237 ? -112.997 -28.211  16.831   1.00 0.00 ? 232 LEU A HB2  2  
ATOM 8900  H HB3  . LEU A 1 237 ? -112.261 -28.734  18.346   1.00 0.00 ? 232 LEU A HB3  2  
ATOM 8901  H HG   . LEU A 1 237 ? -114.426 -26.716  18.587   1.00 0.00 ? 232 LEU A HG   2  
ATOM 8902  H HD11 . LEU A 1 237 ? -114.974 -28.670  16.813   1.00 0.00 ? 232 LEU A HD11 2  
ATOM 8903  H HD12 . LEU A 1 237 ? -116.187 -28.030  17.922   1.00 0.00 ? 232 LEU A HD12 2  
ATOM 8904  H HD13 . LEU A 1 237 ? -115.347 -29.532  18.306   1.00 0.00 ? 232 LEU A HD13 2  
ATOM 8905  H HD21 . LEU A 1 237 ? -113.061 -28.034  20.405   1.00 0.00 ? 232 LEU A HD21 2  
ATOM 8906  H HD22 . LEU A 1 237 ? -114.190 -29.339  20.040   1.00 0.00 ? 232 LEU A HD22 2  
ATOM 8907  H HD23 . LEU A 1 237 ? -114.793 -27.791  20.633   1.00 0.00 ? 232 LEU A HD23 2  
ATOM 8908  N N    . GLU A 1 238 ? -109.751 -27.390  17.517   1.00 0.00 ? 233 GLU A N    2  
ATOM 8909  C CA   . GLU A 1 238 ? -108.339 -27.670  17.905   1.00 0.00 ? 233 GLU A CA   2  
ATOM 8910  C C    . GLU A 1 238 ? -107.489 -26.403  17.764   1.00 0.00 ? 233 GLU A C    2  
ATOM 8911  O O    . GLU A 1 238 ? -106.723 -26.058  18.642   1.00 0.00 ? 233 GLU A O    2  
ATOM 8912  C CB   . GLU A 1 238 ? -107.866 -28.744  16.925   1.00 0.00 ? 233 GLU A CB   2  
ATOM 8913  C CG   . GLU A 1 238 ? -106.526 -29.316  17.397   1.00 0.00 ? 233 GLU A CG   2  
ATOM 8914  C CD   . GLU A 1 238 ? -106.748 -30.700  18.012   1.00 0.00 ? 233 GLU A CD   2  
ATOM 8915  O OE1  . GLU A 1 238 ? -107.009 -31.625  17.261   1.00 0.00 ? 233 GLU A OE1  2  
ATOM 8916  O OE2  . GLU A 1 238 ? -106.653 -30.810  19.223   1.00 0.00 ? 233 GLU A OE2  2  
ATOM 8917  H H    . GLU A 1 238 ? -110.051 -27.571  16.602   1.00 0.00 ? 233 GLU A H    2  
ATOM 8918  H HA   . GLU A 1 238 ? -108.292 -28.046  18.915   1.00 0.00 ? 233 GLU A HA   2  
ATOM 8919  H HB2  . GLU A 1 238 ? -108.601 -29.535  16.877   1.00 0.00 ? 233 GLU A HB2  2  
ATOM 8920  H HB3  . GLU A 1 238 ? -107.743 -28.307  15.945   1.00 0.00 ? 233 GLU A HB3  2  
ATOM 8921  H HG2  . GLU A 1 238 ? -105.855 -29.400  16.554   1.00 0.00 ? 233 GLU A HG2  2  
ATOM 8922  H HG3  . GLU A 1 238 ? -106.094 -28.661  18.138   1.00 0.00 ? 233 GLU A HG3  2  
ATOM 8923  N N    . PHE A 1 239 ? -107.616 -25.712  16.661   1.00 0.00 ? 234 PHE A N    2  
ATOM 8924  C CA   . PHE A 1 239 ? -106.812 -24.469  16.456   1.00 0.00 ? 234 PHE A CA   2  
ATOM 8925  C C    . PHE A 1 239 ? -107.038 -23.480  17.609   1.00 0.00 ? 234 PHE A C    2  
ATOM 8926  O O    . PHE A 1 239 ? -106.216 -22.625  17.872   1.00 0.00 ? 234 PHE A O    2  
ATOM 8927  C CB   . PHE A 1 239 ? -107.300 -23.890  15.119   1.00 0.00 ? 234 PHE A CB   2  
ATOM 8928  C CG   . PHE A 1 239 ? -108.580 -23.104  15.314   1.00 0.00 ? 234 PHE A CG   2  
ATOM 8929  C CD1  . PHE A 1 239 ? -109.719 -23.730  15.835   1.00 0.00 ? 234 PHE A CD1  2  
ATOM 8930  C CD2  . PHE A 1 239 ? -108.624 -21.748  14.969   1.00 0.00 ? 234 PHE A CD2  2  
ATOM 8931  C CE1  . PHE A 1 239 ? -110.900 -22.999  16.012   1.00 0.00 ? 234 PHE A CE1  2  
ATOM 8932  C CE2  . PHE A 1 239 ? -109.805 -21.018  15.145   1.00 0.00 ? 234 PHE A CE2  2  
ATOM 8933  C CZ   . PHE A 1 239 ? -110.943 -21.644  15.667   1.00 0.00 ? 234 PHE A CZ   2  
ATOM 8934  H H    . PHE A 1 239 ? -108.236 -26.014  15.965   1.00 0.00 ? 234 PHE A H    2  
ATOM 8935  H HA   . PHE A 1 239 ? -105.764 -24.716  16.382   1.00 0.00 ? 234 PHE A HA   2  
ATOM 8936  H HB2  . PHE A 1 239 ? -106.541 -23.238  14.714   1.00 0.00 ? 234 PHE A HB2  2  
ATOM 8937  H HB3  . PHE A 1 239 ? -107.481 -24.699  14.426   1.00 0.00 ? 234 PHE A HB3  2  
ATOM 8938  H HD1  . PHE A 1 239 ? -109.687 -24.775  16.102   1.00 0.00 ? 234 PHE A HD1  2  
ATOM 8939  H HD2  . PHE A 1 239 ? -107.746 -21.265  14.566   1.00 0.00 ? 234 PHE A HD2  2  
ATOM 8940  H HE1  . PHE A 1 239 ? -111.778 -23.482  16.415   1.00 0.00 ? 234 PHE A HE1  2  
ATOM 8941  H HE2  . PHE A 1 239 ? -109.838 -19.972  14.879   1.00 0.00 ? 234 PHE A HE2  2  
ATOM 8942  H HZ   . PHE A 1 239 ? -111.855 -21.080  15.803   1.00 0.00 ? 234 PHE A HZ   2  
ATOM 8943  N N    . LEU A 1 240 ? -108.142 -23.594  18.299   1.00 0.00 ? 235 LEU A N    2  
ATOM 8944  C CA   . LEU A 1 240 ? -108.413 -22.664  19.433   1.00 0.00 ? 235 LEU A CA   2  
ATOM 8945  C C    . LEU A 1 240 ? -107.931 -23.285  20.744   1.00 0.00 ? 235 LEU A C    2  
ATOM 8946  O O    . LEU A 1 240 ? -107.293 -22.638  21.551   1.00 0.00 ? 235 LEU A O    2  
ATOM 8947  C CB   . LEU A 1 240 ? -109.933 -22.485  19.448   1.00 0.00 ? 235 LEU A CB   2  
ATOM 8948  C CG   . LEU A 1 240 ? -110.272 -21.021  19.732   1.00 0.00 ? 235 LEU A CG   2  
ATOM 8949  C CD1  . LEU A 1 240 ? -110.416 -20.264  18.410   1.00 0.00 ? 235 LEU A CD1  2  
ATOM 8950  C CD2  . LEU A 1 240 ? -111.589 -20.943  20.509   1.00 0.00 ? 235 LEU A CD2  2  
ATOM 8951  H H    . LEU A 1 240 ? -108.789 -24.292  18.075   1.00 0.00 ? 235 LEU A H    2  
ATOM 8952  H HA   . LEU A 1 240 ? -107.931 -21.714  19.265   1.00 0.00 ? 235 LEU A HA   2  
ATOM 8953  H HB2  . LEU A 1 240 ? -110.338 -22.770  18.488   1.00 0.00 ? 235 LEU A HB2  2  
ATOM 8954  H HB3  . LEU A 1 240 ? -110.361 -23.108  20.219   1.00 0.00 ? 235 LEU A HB3  2  
ATOM 8955  H HG   . LEU A 1 240 ? -109.480 -20.575  20.317   1.00 0.00 ? 235 LEU A HG   2  
ATOM 8956  H HD11 . LEU A 1 240 ? -110.454 -19.203  18.606   1.00 0.00 ? 235 LEU A HD11 2  
ATOM 8957  H HD12 . LEU A 1 240 ? -111.325 -20.573  17.916   1.00 0.00 ? 235 LEU A HD12 2  
ATOM 8958  H HD13 . LEU A 1 240 ? -109.569 -20.484  17.777   1.00 0.00 ? 235 LEU A HD13 2  
ATOM 8959  H HD21 . LEU A 1 240 ? -111.755 -21.873  21.031   1.00 0.00 ? 235 LEU A HD21 2  
ATOM 8960  H HD22 . LEU A 1 240 ? -112.403 -20.766  19.821   1.00 0.00 ? 235 LEU A HD22 2  
ATOM 8961  H HD23 . LEU A 1 240 ? -111.539 -20.134  21.222   1.00 0.00 ? 235 LEU A HD23 2  
ATOM 8962  N N    . ARG A 1 241 ? -108.227 -24.540  20.959   1.00 0.00 ? 236 ARG A N    2  
ATOM 8963  C CA   . ARG A 1 241 ? -107.784 -25.214  22.217   1.00 0.00 ? 236 ARG A CA   2  
ATOM 8964  C C    . ARG A 1 241 ? -106.271 -25.052  22.404   1.00 0.00 ? 236 ARG A C    2  
ATOM 8965  O O    . ARG A 1 241 ? -105.761 -25.138  23.504   1.00 0.00 ? 236 ARG A O    2  
ATOM 8966  C CB   . ARG A 1 241 ? -108.145 -26.688  22.026   1.00 0.00 ? 236 ARG A CB   2  
ATOM 8967  C CG   . ARG A 1 241 ? -107.924 -27.445  23.339   1.00 0.00 ? 236 ARG A CG   2  
ATOM 8968  C CD   . ARG A 1 241 ? -106.587 -28.188  23.282   1.00 0.00 ? 236 ARG A CD   2  
ATOM 8969  N NE   . ARG A 1 241 ? -106.168 -28.335  24.703   1.00 0.00 ? 236 ARG A NE   2  
ATOM 8970  C CZ   . ARG A 1 241 ? -105.492 -29.386  25.078   1.00 0.00 ? 236 ARG A CZ   2  
ATOM 8971  N NH1  . ARG A 1 241 ? -104.218 -29.472  24.809   1.00 0.00 ? 236 ARG A NH1  2  
ATOM 8972  N NH2  . ARG A 1 241 ? -106.089 -30.351  25.722   1.00 0.00 ? 236 ARG A NH2  2  
ATOM 8973  H H    . ARG A 1 241 ? -108.740 -25.041  20.290   1.00 0.00 ? 236 ARG A H    2  
ATOM 8974  H HA   . ARG A 1 241 ? -108.314 -24.813  23.067   1.00 0.00 ? 236 ARG A HA   2  
ATOM 8975  H HB2  . ARG A 1 241 ? -109.182 -26.769  21.734   1.00 0.00 ? 236 ARG A HB2  2  
ATOM 8976  H HB3  . ARG A 1 241 ? -107.520 -27.116  21.257   1.00 0.00 ? 236 ARG A HB3  2  
ATOM 8977  H HG2  . ARG A 1 241 ? -107.913 -26.744  24.162   1.00 0.00 ? 236 ARG A HG2  2  
ATOM 8978  H HG3  . ARG A 1 241 ? -108.723 -28.157  23.483   1.00 0.00 ? 236 ARG A HG3  2  
ATOM 8979  H HD2  . ARG A 1 241 ? -106.718 -29.158  22.823   1.00 0.00 ? 236 ARG A HD2  2  
ATOM 8980  H HD3  . ARG A 1 241 ? -105.857 -27.608  22.740   1.00 0.00 ? 236 ARG A HD3  2  
ATOM 8981  H HE   . ARG A 1 241 ? -106.401 -27.643  25.357   1.00 0.00 ? 236 ARG A HE   2  
ATOM 8982  H HH11 . ARG A 1 241 ? -103.760 -28.733  24.315   1.00 0.00 ? 236 ARG A HH11 2  
ATOM 8983  H HH12 . ARG A 1 241 ? -103.699 -30.278  25.096   1.00 0.00 ? 236 ARG A HH12 2  
ATOM 8984  H HH21 . ARG A 1 241 ? -107.065 -30.285  25.929   1.00 0.00 ? 236 ARG A HH21 2  
ATOM 8985  H HH22 . ARG A 1 241 ? -105.571 -31.156  26.010   1.00 0.00 ? 236 ARG A HH22 2  
ATOM 8986  N N    . ASP A 1 242 ? -105.551 -24.817  21.338   1.00 0.00 ? 237 ASP A N    2  
ATOM 8987  C CA   . ASP A 1 242 ? -104.073 -24.649  21.455   1.00 0.00 ? 237 ASP A CA   2  
ATOM 8988  C C    . ASP A 1 242 ? -103.706 -23.161  21.498   1.00 0.00 ? 237 ASP A C    2  
ATOM 8989  O O    . ASP A 1 242 ? -102.663 -22.787  21.997   1.00 0.00 ? 237 ASP A O    2  
ATOM 8990  C CB   . ASP A 1 242 ? -103.499 -25.304  20.198   1.00 0.00 ? 237 ASP A CB   2  
ATOM 8991  C CG   . ASP A 1 242 ? -103.301 -26.800  20.447   1.00 0.00 ? 237 ASP A CG   2  
ATOM 8992  O OD1  . ASP A 1 242 ? -102.929 -27.152  21.554   1.00 0.00 ? 237 ASP A OD1  2  
ATOM 8993  O OD2  . ASP A 1 242 ? -103.523 -27.568  19.525   1.00 0.00 ? 237 ASP A OD2  2  
ATOM 8994  H H    . ASP A 1 242 ? -105.981 -24.752  20.461   1.00 0.00 ? 237 ASP A H    2  
ATOM 8995  H HA   . ASP A 1 242 ? -103.704 -25.154  22.333   1.00 0.00 ? 237 ASP A HA   2  
ATOM 8996  H HB2  . ASP A 1 242 ? -104.184 -25.163  19.374   1.00 0.00 ? 237 ASP A HB2  2  
ATOM 8997  H HB3  . ASP A 1 242 ? -102.549 -24.852  19.958   1.00 0.00 ? 237 ASP A HB3  2  
ATOM 8998  N N    . GLN A 1 243 ? -104.553 -22.311  20.977   1.00 0.00 ? 238 GLN A N    2  
ATOM 8999  C CA   . GLN A 1 243 ? -104.245 -20.848  20.990   1.00 0.00 ? 238 GLN A CA   2  
ATOM 9000  C C    . GLN A 1 243 ? -104.282 -20.311  22.428   1.00 0.00 ? 238 GLN A C    2  
ATOM 9001  O O    . GLN A 1 243 ? -104.769 -20.973  23.323   1.00 0.00 ? 238 GLN A O    2  
ATOM 9002  C CB   . GLN A 1 243 ? -105.340 -20.197  20.139   1.00 0.00 ? 238 GLN A CB   2  
ATOM 9003  C CG   . GLN A 1 243 ? -104.732 -19.651  18.844   1.00 0.00 ? 238 GLN A CG   2  
ATOM 9004  C CD   . GLN A 1 243 ? -104.213 -20.808  17.988   1.00 0.00 ? 238 GLN A CD   2  
ATOM 9005  O OE1  . GLN A 1 243 ? -103.923 -21.873  18.495   1.00 0.00 ? 238 GLN A OE1  2  
ATOM 9006  N NE2  . GLN A 1 243 ? -104.083 -20.642  16.700   1.00 0.00 ? 238 GLN A NE2  2  
ATOM 9007  H H    . GLN A 1 243 ? -105.389 -22.633  20.576   1.00 0.00 ? 238 GLN A H    2  
ATOM 9008  H HA   . GLN A 1 243 ? -103.278 -20.666  20.547   1.00 0.00 ? 238 GLN A HA   2  
ATOM 9009  H HB2  . GLN A 1 243 ? -106.095 -20.932  19.901   1.00 0.00 ? 238 GLN A HB2  2  
ATOM 9010  H HB3  . GLN A 1 243 ? -105.790 -19.386  20.692   1.00 0.00 ? 238 GLN A HB3  2  
ATOM 9011  H HG2  . GLN A 1 243 ? -105.487 -19.107  18.294   1.00 0.00 ? 238 GLN A HG2  2  
ATOM 9012  H HG3  . GLN A 1 243 ? -103.914 -18.988  19.080   1.00 0.00 ? 238 GLN A HG3  2  
ATOM 9013  H HE21 . GLN A 1 243 ? -104.317 -19.783  16.291   1.00 0.00 ? 238 GLN A HE21 2  
ATOM 9014  H HE22 . GLN A 1 243 ? -103.752 -21.377  16.143   1.00 0.00 ? 238 GLN A HE22 2  
ATOM 9015  N N    . PRO A 1 244 ? -103.759 -19.122  22.603   1.00 0.00 ? 239 PRO A N    2  
ATOM 9016  C CA   . PRO A 1 244 ? -103.728 -18.498  23.950   1.00 0.00 ? 239 PRO A CA   2  
ATOM 9017  C C    . PRO A 1 244 ? -105.134 -18.067  24.377   1.00 0.00 ? 239 PRO A C    2  
ATOM 9018  O O    . PRO A 1 244 ? -105.470 -18.096  25.545   1.00 0.00 ? 239 PRO A O    2  
ATOM 9019  C CB   . PRO A 1 244 ? -102.817 -17.287  23.765   1.00 0.00 ? 239 PRO A CB   2  
ATOM 9020  C CG   . PRO A 1 244 ? -102.897 -16.961  22.308   1.00 0.00 ? 239 PRO A CG   2  
ATOM 9021  C CD   . PRO A 1 244 ? -103.157 -18.255  21.581   1.00 0.00 ? 239 PRO A CD   2  
ATOM 9022  H HA   . PRO A 1 244 ? -103.300 -19.174  24.672   1.00 0.00 ? 239 PRO A HA   2  
ATOM 9023  H HB2  . PRO A 1 244 ? -103.172 -16.457  24.359   1.00 0.00 ? 239 PRO A HB2  2  
ATOM 9024  H HB3  . PRO A 1 244 ? -101.802 -17.536  24.032   1.00 0.00 ? 239 PRO A HB3  2  
ATOM 9025  H HG2  . PRO A 1 244 ? -103.705 -16.265  22.131   1.00 0.00 ? 239 PRO A HG2  2  
ATOM 9026  H HG3  . PRO A 1 244 ? -101.963 -16.538  21.972   1.00 0.00 ? 239 PRO A HG3  2  
ATOM 9027  H HD2  . PRO A 1 244 ? -103.846 -18.094  20.764   1.00 0.00 ? 239 PRO A HD2  2  
ATOM 9028  H HD3  . PRO A 1 244 ? -102.234 -18.684  21.225   1.00 0.00 ? 239 PRO A HD3  2  
ATOM 9029  N N    . GLN A 1 245 ? -105.959 -17.674  23.443   1.00 0.00 ? 240 GLN A N    2  
ATOM 9030  C CA   . GLN A 1 245 ? -107.346 -17.248  23.802   1.00 0.00 ? 240 GLN A CA   2  
ATOM 9031  C C    . GLN A 1 245 ? -108.047 -18.363  24.581   1.00 0.00 ? 240 GLN A C    2  
ATOM 9032  O O    . GLN A 1 245 ? -108.570 -18.150  25.659   1.00 0.00 ? 240 GLN A O    2  
ATOM 9033  C CB   . GLN A 1 245 ? -108.049 -17.002  22.466   1.00 0.00 ? 240 GLN A CB   2  
ATOM 9034  C CG   . GLN A 1 245 ? -107.367 -15.843  21.733   1.00 0.00 ? 240 GLN A CG   2  
ATOM 9035  C CD   . GLN A 1 245 ? -106.555 -16.388  20.556   1.00 0.00 ? 240 GLN A CD   2  
ATOM 9036  O OE1  . GLN A 1 245 ? -105.362 -16.173  20.474   1.00 0.00 ? 240 GLN A OE1  2  
ATOM 9037  N NE2  . GLN A 1 245 ? -107.155 -17.089  19.633   1.00 0.00 ? 240 GLN A NE2  2  
ATOM 9038  H H    . GLN A 1 245 ? -105.669 -17.662  22.507   1.00 0.00 ? 240 GLN A H    2  
ATOM 9039  H HA   . GLN A 1 245 ? -107.323 -16.339  24.382   1.00 0.00 ? 240 GLN A HA   2  
ATOM 9040  H HB2  . GLN A 1 245 ? -107.995 -17.896  21.861   1.00 0.00 ? 240 GLN A HB2  2  
ATOM 9041  H HB3  . GLN A 1 245 ? -109.084 -16.751  22.646   1.00 0.00 ? 240 GLN A HB3  2  
ATOM 9042  H HG2  . GLN A 1 245 ? -108.119 -15.159  21.366   1.00 0.00 ? 240 GLN A HG2  2  
ATOM 9043  H HG3  . GLN A 1 245 ? -106.708 -15.323  22.412   1.00 0.00 ? 240 GLN A HG3  2  
ATOM 9044  H HE21 . GLN A 1 245 ? -108.118 -17.263  19.699   1.00 0.00 ? 240 GLN A HE21 2  
ATOM 9045  H HE22 . GLN A 1 245 ? -106.644 -17.442  18.876   1.00 0.00 ? 240 GLN A HE22 2  
ATOM 9046  N N    . PHE A 1 246 ? -108.050 -19.554  24.046   1.00 0.00 ? 241 PHE A N    2  
ATOM 9047  C CA   . PHE A 1 246 ? -108.706 -20.688  24.757   1.00 0.00 ? 241 PHE A CA   2  
ATOM 9048  C C    . PHE A 1 246 ? -107.977 -20.962  26.074   1.00 0.00 ? 241 PHE A C    2  
ATOM 9049  O O    . PHE A 1 246 ? -108.590 -21.214  27.092   1.00 0.00 ? 241 PHE A O    2  
ATOM 9050  C CB   . PHE A 1 246 ? -108.576 -21.881  23.812   1.00 0.00 ? 241 PHE A CB   2  
ATOM 9051  C CG   . PHE A 1 246 ? -109.496 -22.987  24.267   1.00 0.00 ? 241 PHE A CG   2  
ATOM 9052  C CD1  . PHE A 1 246 ? -109.246 -23.653  25.472   1.00 0.00 ? 241 PHE A CD1  2  
ATOM 9053  C CD2  . PHE A 1 246 ? -110.599 -23.346  23.484   1.00 0.00 ? 241 PHE A CD2  2  
ATOM 9054  C CE1  . PHE A 1 246 ? -110.100 -24.679  25.895   1.00 0.00 ? 241 PHE A CE1  2  
ATOM 9055  C CE2  . PHE A 1 246 ? -111.453 -24.371  23.907   1.00 0.00 ? 241 PHE A CE2  2  
ATOM 9056  C CZ   . PHE A 1 246 ? -111.204 -25.038  25.112   1.00 0.00 ? 241 PHE A CZ   2  
ATOM 9057  H H    . PHE A 1 246 ? -107.615 -19.704  23.180   1.00 0.00 ? 241 PHE A H    2  
ATOM 9058  H HA   . PHE A 1 246 ? -109.747 -20.470  24.938   1.00 0.00 ? 241 PHE A HA   2  
ATOM 9059  H HB2  . PHE A 1 246 ? -108.844 -21.578  22.810   1.00 0.00 ? 241 PHE A HB2  2  
ATOM 9060  H HB3  . PHE A 1 246 ? -107.556 -22.237  23.819   1.00 0.00 ? 241 PHE A HB3  2  
ATOM 9061  H HD1  . PHE A 1 246 ? -108.394 -23.377  26.076   1.00 0.00 ? 241 PHE A HD1  2  
ATOM 9062  H HD2  . PHE A 1 246 ? -110.792 -22.831  22.555   1.00 0.00 ? 241 PHE A HD2  2  
ATOM 9063  H HE1  . PHE A 1 246 ? -109.908 -25.192  26.825   1.00 0.00 ? 241 PHE A HE1  2  
ATOM 9064  H HE2  . PHE A 1 246 ? -112.304 -24.648  23.303   1.00 0.00 ? 241 PHE A HE2  2  
ATOM 9065  H HZ   . PHE A 1 246 ? -111.862 -25.829  25.438   1.00 0.00 ? 241 PHE A HZ   2  
ATOM 9066  N N    . GLN A 1 247 ? -106.670 -20.911  26.061   1.00 0.00 ? 242 GLN A N    2  
ATOM 9067  C CA   . GLN A 1 247 ? -105.898 -21.165  27.315   1.00 0.00 ? 242 GLN A CA   2  
ATOM 9068  C C    . GLN A 1 247 ? -106.353 -20.201  28.411   1.00 0.00 ? 242 GLN A C    2  
ATOM 9069  O O    . GLN A 1 247 ? -106.446 -20.561  29.568   1.00 0.00 ? 242 GLN A O    2  
ATOM 9070  C CB   . GLN A 1 247 ? -104.437 -20.909  26.945   1.00 0.00 ? 242 GLN A CB   2  
ATOM 9071  C CG   . GLN A 1 247 ? -103.746 -22.242  26.653   1.00 0.00 ? 242 GLN A CG   2  
ATOM 9072  C CD   . GLN A 1 247 ? -104.214 -22.773  25.296   1.00 0.00 ? 242 GLN A CD   2  
ATOM 9073  O OE1  . GLN A 1 247 ? -103.450 -22.812  24.352   1.00 0.00 ? 242 GLN A OE1  2  
ATOM 9074  N NE2  . GLN A 1 247 ? -105.445 -23.187  25.157   1.00 0.00 ? 242 GLN A NE2  2  
ATOM 9075  H H    . GLN A 1 247 ? -106.196 -20.703  25.228   1.00 0.00 ? 242 GLN A H    2  
ATOM 9076  H HA   . GLN A 1 247 ? -106.025 -22.187  27.635   1.00 0.00 ? 242 GLN A HA   2  
ATOM 9077  H HB2  . GLN A 1 247 ? -104.393 -20.279  26.068   1.00 0.00 ? 242 GLN A HB2  2  
ATOM 9078  H HB3  . GLN A 1 247 ? -103.937 -20.419  27.767   1.00 0.00 ? 242 GLN A HB3  2  
ATOM 9079  H HG2  . GLN A 1 247 ? -102.676 -22.096  26.634   1.00 0.00 ? 242 GLN A HG2  2  
ATOM 9080  H HG3  . GLN A 1 247 ? -104.000 -22.956  27.422   1.00 0.00 ? 242 GLN A HG3  2  
ATOM 9081  H HE21 . GLN A 1 247 ? -106.062 -23.158  25.917   1.00 0.00 ? 242 GLN A HE21 2  
ATOM 9082  H HE22 . GLN A 1 247 ? -105.753 -23.525  24.290   1.00 0.00 ? 242 GLN A HE22 2  
ATOM 9083  N N    . ASN A 1 248 ? -106.649 -18.983  28.050   1.00 0.00 ? 243 ASN A N    2  
ATOM 9084  C CA   . ASN A 1 248 ? -107.113 -17.997  29.068   1.00 0.00 ? 243 ASN A CA   2  
ATOM 9085  C C    . ASN A 1 248 ? -108.478 -18.427  29.606   1.00 0.00 ? 243 ASN A C    2  
ATOM 9086  O O    . ASN A 1 248 ? -108.807 -18.195  30.750   1.00 0.00 ? 243 ASN A O    2  
ATOM 9087  C CB   . ASN A 1 248 ? -107.221 -16.667  28.320   1.00 0.00 ? 243 ASN A CB   2  
ATOM 9088  C CG   . ASN A 1 248 ? -105.942 -15.855  28.532   1.00 0.00 ? 243 ASN A CG   2  
ATOM 9089  O OD1  . ASN A 1 248 ? -104.873 -16.412  28.680   1.00 0.00 ? 243 ASN A OD1  2  
ATOM 9090  N ND2  . ASN A 1 248 ? -106.007 -14.552  28.555   1.00 0.00 ? 243 ASN A ND2  2  
ATOM 9091  H H    . ASN A 1 248 ? -106.576 -18.720  27.109   1.00 0.00 ? 243 ASN A H    2  
ATOM 9092  H HA   . ASN A 1 248 ? -106.397 -17.915  29.871   1.00 0.00 ? 243 ASN A HA   2  
ATOM 9093  H HB2  . ASN A 1 248 ? -107.357 -16.858  27.265   1.00 0.00 ? 243 ASN A HB2  2  
ATOM 9094  H HB3  . ASN A 1 248 ? -108.066 -16.110  28.697   1.00 0.00 ? 243 ASN A HB3  2  
ATOM 9095  H HD21 . ASN A 1 248 ? -106.870 -14.102  28.436   1.00 0.00 ? 243 ASN A HD21 2  
ATOM 9096  H HD22 . ASN A 1 248 ? -105.194 -14.023  28.691   1.00 0.00 ? 243 ASN A HD22 2  
ATOM 9097  N N    . MET A 1 249 ? -109.267 -19.063  28.783   1.00 0.00 ? 244 MET A N    2  
ATOM 9098  C CA   . MET A 1 249 ? -110.612 -19.527  29.232   1.00 0.00 ? 244 MET A CA   2  
ATOM 9099  C C    . MET A 1 249 ? -110.474 -20.808  30.058   1.00 0.00 ? 244 MET A C    2  
ATOM 9100  O O    . MET A 1 249 ? -111.349 -21.164  30.822   1.00 0.00 ? 244 MET A O    2  
ATOM 9101  C CB   . MET A 1 249 ? -111.389 -19.799  27.941   1.00 0.00 ? 244 MET A CB   2  
ATOM 9102  C CG   . MET A 1 249 ? -112.700 -19.018  27.964   1.00 0.00 ? 244 MET A CG   2  
ATOM 9103  S SD   . MET A 1 249 ? -113.604 -19.308  26.424   1.00 0.00 ? 244 MET A SD   2  
ATOM 9104  C CE   . MET A 1 249 ? -113.245 -17.713  25.651   1.00 0.00 ? 244 MET A CE   2  
ATOM 9105  H H    . MET A 1 249 ? -108.972 -19.244  27.870   1.00 0.00 ? 244 MET A H    2  
ATOM 9106  H HA   . MET A 1 249 ? -111.104 -18.758  29.806   1.00 0.00 ? 244 MET A HA   2  
ATOM 9107  H HB2  . MET A 1 249 ? -110.799 -19.485  27.091   1.00 0.00 ? 244 MET A HB2  2  
ATOM 9108  H HB3  . MET A 1 249 ? -111.602 -20.854  27.861   1.00 0.00 ? 244 MET A HB3  2  
ATOM 9109  H HG2  . MET A 1 249 ? -113.297 -19.345  28.801   1.00 0.00 ? 244 MET A HG2  2  
ATOM 9110  H HG3  . MET A 1 249 ? -112.485 -17.965  28.063   1.00 0.00 ? 244 MET A HG3  2  
ATOM 9111  H HE1  . MET A 1 249 ? -112.265 -17.376  25.961   1.00 0.00 ? 244 MET A HE1  2  
ATOM 9112  H HE2  . MET A 1 249 ? -113.984 -16.990  25.956   1.00 0.00 ? 244 MET A HE2  2  
ATOM 9113  H HE3  . MET A 1 249 ? -113.271 -17.821  24.576   1.00 0.00 ? 244 MET A HE3  2  
ATOM 9114  N N    . ARG A 1 250 ? -109.374 -21.498  29.914   1.00 0.00 ? 245 ARG A N    2  
ATOM 9115  C CA   . ARG A 1 250 ? -109.163 -22.751  30.693   1.00 0.00 ? 245 ARG A CA   2  
ATOM 9116  C C    . ARG A 1 250 ? -108.192 -22.488  31.849   1.00 0.00 ? 245 ARG A C    2  
ATOM 9117  O O    . ARG A 1 250 ? -108.004 -23.318  32.715   1.00 0.00 ? 245 ARG A O    2  
ATOM 9118  C CB   . ARG A 1 250 ? -108.557 -23.738  29.695   1.00 0.00 ? 245 ARG A CB   2  
ATOM 9119  C CG   . ARG A 1 250 ? -108.682 -25.162  30.242   1.00 0.00 ? 245 ARG A CG   2  
ATOM 9120  C CD   . ARG A 1 250 ? -108.524 -26.165  29.095   1.00 0.00 ? 245 ARG A CD   2  
ATOM 9121  N NE   . ARG A 1 250 ? -107.619 -27.226  29.624   1.00 0.00 ? 245 ARG A NE   2  
ATOM 9122  C CZ   . ARG A 1 250 ? -106.366 -26.955  29.884   1.00 0.00 ? 245 ARG A CZ   2  
ATOM 9123  N NH1  . ARG A 1 250 ? -105.696 -26.142  29.112   1.00 0.00 ? 245 ARG A NH1  2  
ATOM 9124  N NH2  . ARG A 1 250 ? -105.783 -27.501  30.916   1.00 0.00 ? 245 ARG A NH2  2  
ATOM 9125  H H    . ARG A 1 250 ? -108.682 -21.187  29.297   1.00 0.00 ? 245 ARG A H    2  
ATOM 9126  H HA   . ARG A 1 250 ? -110.102 -23.129  31.064   1.00 0.00 ? 245 ARG A HA   2  
ATOM 9127  H HB2  . ARG A 1 250 ? -109.082 -23.666  28.754   1.00 0.00 ? 245 ARG A HB2  2  
ATOM 9128  H HB3  . ARG A 1 250 ? -107.514 -23.503  29.544   1.00 0.00 ? 245 ARG A HB3  2  
ATOM 9129  H HG2  . ARG A 1 250 ? -107.911 -25.332  30.980   1.00 0.00 ? 245 ARG A HG2  2  
ATOM 9130  H HG3  . ARG A 1 250 ? -109.652 -25.289  30.697   1.00 0.00 ? 245 ARG A HG3  2  
ATOM 9131  H HD2  . ARG A 1 250 ? -109.486 -26.585  28.832   1.00 0.00 ? 245 ARG A HD2  2  
ATOM 9132  H HD3  . ARG A 1 250 ? -108.075 -25.689  28.237   1.00 0.00 ? 245 ARG A HD3  2  
ATOM 9133  H HE   . ARG A 1 250 ? -107.965 -28.130  29.778   1.00 0.00 ? 245 ARG A HE   2  
ATOM 9134  H HH11 . ARG A 1 250 ? -106.139 -25.724  28.320   1.00 0.00 ? 245 ARG A HH11 2  
ATOM 9135  H HH12 . ARG A 1 250 ? -104.738 -25.937  29.314   1.00 0.00 ? 245 ARG A HH12 2  
ATOM 9136  H HH21 . ARG A 1 250 ? -106.295 -28.125  31.507   1.00 0.00 ? 245 ARG A HH21 2  
ATOM 9137  H HH22 . ARG A 1 250 ? -104.825 -27.295  31.116   1.00 0.00 ? 245 ARG A HH22 2  
ATOM 9138  N N    . GLN A 1 251 ? -107.578 -21.332  31.868   1.00 0.00 ? 246 GLN A N    2  
ATOM 9139  C CA   . GLN A 1 251 ? -106.625 -21.005  32.965   1.00 0.00 ? 246 GLN A CA   2  
ATOM 9140  C C    . GLN A 1 251 ? -107.241 -19.949  33.884   1.00 0.00 ? 246 GLN A C    2  
ATOM 9141  O O    . GLN A 1 251 ? -107.086 -19.997  35.089   1.00 0.00 ? 246 GLN A O    2  
ATOM 9142  C CB   . GLN A 1 251 ? -105.384 -20.447  32.265   1.00 0.00 ? 246 GLN A CB   2  
ATOM 9143  C CG   . GLN A 1 251 ? -104.596 -21.593  31.627   1.00 0.00 ? 246 GLN A CG   2  
ATOM 9144  C CD   . GLN A 1 251 ? -103.485 -22.042  32.579   1.00 0.00 ? 246 GLN A CD   2  
ATOM 9145  O OE1  . GLN A 1 251 ? -103.711 -22.851  33.456   1.00 0.00 ? 246 GLN A OE1  2  
ATOM 9146  N NE2  . GLN A 1 251 ? -102.285 -21.546  32.442   1.00 0.00 ? 246 GLN A NE2  2  
ATOM 9147  H H    . GLN A 1 251 ? -107.748 -20.676  31.162   1.00 0.00 ? 246 GLN A H    2  
ATOM 9148  H HA   . GLN A 1 251 ? -106.370 -21.892  33.523   1.00 0.00 ? 246 GLN A HA   2  
ATOM 9149  H HB2  . GLN A 1 251 ? -105.687 -19.747  31.500   1.00 0.00 ? 246 GLN A HB2  2  
ATOM 9150  H HB3  . GLN A 1 251 ? -104.761 -19.943  32.988   1.00 0.00 ? 246 GLN A HB3  2  
ATOM 9151  H HG2  . GLN A 1 251 ? -105.261 -22.422  31.432   1.00 0.00 ? 246 GLN A HG2  2  
ATOM 9152  H HG3  . GLN A 1 251 ? -104.158 -21.256  30.700   1.00 0.00 ? 246 GLN A HG3  2  
ATOM 9153  H HE21 . GLN A 1 251 ? -102.102 -20.893  31.734   1.00 0.00 ? 246 GLN A HE21 2  
ATOM 9154  H HE22 . GLN A 1 251 ? -101.567 -21.828  33.046   1.00 0.00 ? 246 GLN A HE22 2  
ATOM 9155  N N    . VAL A 1 252 ? -107.944 -18.997  33.325   1.00 0.00 ? 247 VAL A N    2  
ATOM 9156  C CA   . VAL A 1 252 ? -108.571 -17.943  34.175   1.00 0.00 ? 247 VAL A CA   2  
ATOM 9157  C C    . VAL A 1 252 ? -109.838 -18.495  34.839   1.00 0.00 ? 247 VAL A C    2  
ATOM 9158  O O    . VAL A 1 252 ? -110.213 -18.081  35.919   1.00 0.00 ? 247 VAL A O    2  
ATOM 9159  C CB   . VAL A 1 252 ? -108.887 -16.784  33.216   1.00 0.00 ? 247 VAL A CB   2  
ATOM 9160  C CG1  . VAL A 1 252 ? -110.289 -16.945  32.618   1.00 0.00 ? 247 VAL A CG1  2  
ATOM 9161  C CG2  . VAL A 1 252 ? -108.812 -15.461  33.982   1.00 0.00 ? 247 VAL A CG2  2  
ATOM 9162  H H    . VAL A 1 252 ? -108.060 -18.978  32.348   1.00 0.00 ? 247 VAL A H    2  
ATOM 9163  H HA   . VAL A 1 252 ? -107.873 -17.613  34.929   1.00 0.00 ? 247 VAL A HA   2  
ATOM 9164  H HB   . VAL A 1 252 ? -108.159 -16.776  32.417   1.00 0.00 ? 247 VAL A HB   2  
ATOM 9165  H HG11 . VAL A 1 252 ? -111.029 -16.739  33.377   1.00 0.00 ? 247 VAL A HG11 2  
ATOM 9166  H HG12 . VAL A 1 252 ? -110.412 -17.956  32.261   1.00 0.00 ? 247 VAL A HG12 2  
ATOM 9167  H HG13 . VAL A 1 252 ? -110.412 -16.255  31.797   1.00 0.00 ? 247 VAL A HG13 2  
ATOM 9168  H HG21 . VAL A 1 252 ? -109.543 -14.773  33.584   1.00 0.00 ? 247 VAL A HG21 2  
ATOM 9169  H HG22 . VAL A 1 252 ? -107.824 -15.039  33.875   1.00 0.00 ? 247 VAL A HG22 2  
ATOM 9170  H HG23 . VAL A 1 252 ? -109.017 -15.639  35.027   1.00 0.00 ? 247 VAL A HG23 2  
ATOM 9171  N N    . ILE A 1 253 ? -110.491 -19.433  34.205   1.00 0.00 ? 248 ILE A N    2  
ATOM 9172  C CA   . ILE A 1 253 ? -111.726 -20.019  34.806   1.00 0.00 ? 248 ILE A CA   2  
ATOM 9173  C C    . ILE A 1 253 ? -111.348 -20.880  36.018   1.00 0.00 ? 248 ILE A C    2  
ATOM 9174  O O    . ILE A 1 253 ? -112.134 -21.069  36.926   1.00 0.00 ? 248 ILE A O    2  
ATOM 9175  C CB   . ILE A 1 253 ? -112.349 -20.868  33.687   1.00 0.00 ? 248 ILE A CB   2  
ATOM 9176  C CG1  . ILE A 1 253 ? -113.395 -20.036  32.941   1.00 0.00 ? 248 ILE A CG1  2  
ATOM 9177  C CG2  . ILE A 1 253 ? -113.029 -22.113  34.271   1.00 0.00 ? 248 ILE A CG2  2  
ATOM 9178  C CD1  . ILE A 1 253 ? -112.720 -18.844  32.262   1.00 0.00 ? 248 ILE A CD1  2  
ATOM 9179  H H    . ILE A 1 253 ? -110.165 -19.758  33.338   1.00 0.00 ? 248 ILE A H    2  
ATOM 9180  H HA   . ILE A 1 253 ? -112.408 -19.237  35.099   1.00 0.00 ? 248 ILE A HA   2  
ATOM 9181  H HB   . ILE A 1 253 ? -111.576 -21.174  32.999   1.00 0.00 ? 248 ILE A HB   2  
ATOM 9182  H HG12 . ILE A 1 253 ? -113.875 -20.650  32.194   1.00 0.00 ? 248 ILE A HG12 2  
ATOM 9183  H HG13 . ILE A 1 253 ? -114.135 -19.677  33.641   1.00 0.00 ? 248 ILE A HG13 2  
ATOM 9184  H HG21 . ILE A 1 253 ? -113.573 -22.625  33.491   1.00 0.00 ? 248 ILE A HG21 2  
ATOM 9185  H HG22 . ILE A 1 253 ? -113.713 -21.816  35.052   1.00 0.00 ? 248 ILE A HG22 2  
ATOM 9186  H HG23 . ILE A 1 253 ? -112.279 -22.774  34.680   1.00 0.00 ? 248 ILE A HG23 2  
ATOM 9187  H HD11 . ILE A 1 253 ? -112.423 -18.125  33.011   1.00 0.00 ? 248 ILE A HD11 2  
ATOM 9188  H HD12 . ILE A 1 253 ? -113.412 -18.382  31.573   1.00 0.00 ? 248 ILE A HD12 2  
ATOM 9189  H HD13 . ILE A 1 253 ? -111.848 -19.184  31.723   1.00 0.00 ? 248 ILE A HD13 2  
ATOM 9190  N N    . GLN A 1 254 ? -110.149 -21.400  36.036   1.00 0.00 ? 249 GLN A N    2  
ATOM 9191  C CA   . GLN A 1 254 ? -109.717 -22.248  37.188   1.00 0.00 ? 249 GLN A CA   2  
ATOM 9192  C C    . GLN A 1 254 ? -109.857 -21.473  38.502   1.00 0.00 ? 249 GLN A C    2  
ATOM 9193  O O    . GLN A 1 254 ? -109.958 -22.052  39.566   1.00 0.00 ? 249 GLN A O    2  
ATOM 9194  C CB   . GLN A 1 254 ? -108.248 -22.575  36.914   1.00 0.00 ? 249 GLN A CB   2  
ATOM 9195  C CG   . GLN A 1 254 ? -108.136 -23.416  35.640   1.00 0.00 ? 249 GLN A CG   2  
ATOM 9196  C CD   . GLN A 1 254 ? -108.833 -24.762  35.850   1.00 0.00 ? 249 GLN A CD   2  
ATOM 9197  O OE1  . GLN A 1 254 ? -108.365 -25.590  36.605   1.00 0.00 ? 249 GLN A OE1  2  
ATOM 9198  N NE2  . GLN A 1 254 ? -109.941 -25.016  35.208   1.00 0.00 ? 249 GLN A NE2  2  
ATOM 9199  H H    . GLN A 1 254 ? -109.532 -21.233  35.291   1.00 0.00 ? 249 GLN A H    2  
ATOM 9200  H HA   . GLN A 1 254 ? -110.296 -23.158  37.223   1.00 0.00 ? 249 GLN A HA   2  
ATOM 9201  H HB2  . GLN A 1 254 ? -107.693 -21.657  36.790   1.00 0.00 ? 249 GLN A HB2  2  
ATOM 9202  H HB3  . GLN A 1 254 ? -107.842 -23.131  37.746   1.00 0.00 ? 249 GLN A HB3  2  
ATOM 9203  H HG2  . GLN A 1 254 ? -108.605 -22.891  34.820   1.00 0.00 ? 249 GLN A HG2  2  
ATOM 9204  H HG3  . GLN A 1 254 ? -107.095 -23.584  35.410   1.00 0.00 ? 249 GLN A HG3  2  
ATOM 9205  H HE21 . GLN A 1 254 ? -110.318 -24.347  34.599   1.00 0.00 ? 249 GLN A HE21 2  
ATOM 9206  H HE22 . GLN A 1 254 ? -110.395 -25.875  35.335   1.00 0.00 ? 249 GLN A HE22 2  
ATOM 9207  N N    . GLN A 1 255 ? -109.861 -20.168  38.436   1.00 0.00 ? 250 GLN A N    2  
ATOM 9208  C CA   . GLN A 1 255 ? -109.992 -19.356  39.681   1.00 0.00 ? 250 GLN A CA   2  
ATOM 9209  C C    . GLN A 1 255 ? -111.357 -18.659  39.732   1.00 0.00 ? 250 GLN A C    2  
ATOM 9210  O O    . GLN A 1 255 ? -111.764 -18.159  40.763   1.00 0.00 ? 250 GLN A O    2  
ATOM 9211  C CB   . GLN A 1 255 ? -108.867 -18.324  39.599   1.00 0.00 ? 250 GLN A CB   2  
ATOM 9212  C CG   . GLN A 1 255 ? -107.519 -19.020  39.803   1.00 0.00 ? 250 GLN A CG   2  
ATOM 9213  C CD   . GLN A 1 255 ? -106.386 -18.018  39.572   1.00 0.00 ? 250 GLN A CD   2  
ATOM 9214  O OE1  . GLN A 1 255 ? -105.524 -17.855  40.413   1.00 0.00 ? 250 GLN A OE1  2  
ATOM 9215  N NE2  . GLN A 1 255 ? -106.350 -17.336  38.460   1.00 0.00 ? 250 GLN A NE2  2  
ATOM 9216  H H    . GLN A 1 255 ? -109.777 -19.721  37.568   1.00 0.00 ? 250 GLN A H    2  
ATOM 9217  H HA   . GLN A 1 255 ? -109.855 -19.978  40.551   1.00 0.00 ? 250 GLN A HA   2  
ATOM 9218  H HB2  . GLN A 1 255 ? -108.884 -17.849  38.628   1.00 0.00 ? 250 GLN A HB2  2  
ATOM 9219  H HB3  . GLN A 1 255 ? -109.005 -17.579  40.367   1.00 0.00 ? 250 GLN A HB3  2  
ATOM 9220  H HG2  . GLN A 1 255 ? -107.462 -19.403  40.811   1.00 0.00 ? 250 GLN A HG2  2  
ATOM 9221  H HG3  . GLN A 1 255 ? -107.425 -19.835  39.101   1.00 0.00 ? 250 GLN A HG3  2  
ATOM 9222  H HE21 . GLN A 1 255 ? -107.045 -17.468  37.782   1.00 0.00 ? 250 GLN A HE21 2  
ATOM 9223  H HE22 . GLN A 1 255 ? -105.628 -16.693  38.304   1.00 0.00 ? 250 GLN A HE22 2  
ATOM 9224  N N    . ASN A 1 256 ? -112.067 -18.619  38.634   1.00 0.00 ? 251 ASN A N    2  
ATOM 9225  C CA   . ASN A 1 256 ? -113.400 -17.950  38.634   1.00 0.00 ? 251 ASN A CA   2  
ATOM 9226  C C    . ASN A 1 256 ? -114.302 -18.568  37.557   1.00 0.00 ? 251 ASN A C    2  
ATOM 9227  O O    . ASN A 1 256 ? -114.037 -18.430  36.380   1.00 0.00 ? 251 ASN A O    2  
ATOM 9228  C CB   . ASN A 1 256 ? -113.106 -16.483  38.311   1.00 0.00 ? 251 ASN A CB   2  
ATOM 9229  C CG   . ASN A 1 256 ? -113.795 -15.582  39.337   1.00 0.00 ? 251 ASN A CG   2  
ATOM 9230  O OD1  . ASN A 1 256 ? -113.293 -15.388  40.426   1.00 0.00 ? 251 ASN A OD1  2  
ATOM 9231  N ND2  . ASN A 1 256 ? -114.934 -15.021  39.035   1.00 0.00 ? 251 ASN A ND2  2  
ATOM 9232  H H    . ASN A 1 256 ? -111.725 -19.026  37.810   1.00 0.00 ? 251 ASN A H    2  
ATOM 9233  H HA   . ASN A 1 256 ? -113.859 -18.028  39.606   1.00 0.00 ? 251 ASN A HA   2  
ATOM 9234  H HB2  . ASN A 1 256 ? -112.039 -16.314  38.343   1.00 0.00 ? 251 ASN A HB2  2  
ATOM 9235  H HB3  . ASN A 1 256 ? -113.477 -16.249  37.324   1.00 0.00 ? 251 ASN A HB3  2  
ATOM 9236  H HD21 . ASN A 1 256 ? -115.339 -15.178  38.156   1.00 0.00 ? 251 ASN A HD21 2  
ATOM 9237  H HD22 . ASN A 1 256 ? -115.383 -14.442  39.685   1.00 0.00 ? 251 ASN A HD22 2  
ATOM 9238  N N    . PRO A 1 257 ? -115.346 -19.231  37.993   1.00 0.00 ? 252 PRO A N    2  
ATOM 9239  C CA   . PRO A 1 257 ? -116.288 -19.869  37.038   1.00 0.00 ? 252 PRO A CA   2  
ATOM 9240  C C    . PRO A 1 257 ? -117.121 -18.807  36.309   1.00 0.00 ? 252 PRO A C    2  
ATOM 9241  O O    . PRO A 1 257 ? -117.833 -19.105  35.370   1.00 0.00 ? 252 PRO A O    2  
ATOM 9242  C CB   . PRO A 1 257 ? -117.173 -20.736  37.931   1.00 0.00 ? 252 PRO A CB   2  
ATOM 9243  C CG   . PRO A 1 257 ? -117.104 -20.096  39.280   1.00 0.00 ? 252 PRO A CG   2  
ATOM 9244  C CD   . PRO A 1 257 ? -115.748 -19.449  39.389   1.00 0.00 ? 252 PRO A CD   2  
ATOM 9245  H HA   . PRO A 1 257 ? -115.756 -20.487  36.334   1.00 0.00 ? 252 PRO A HA   2  
ATOM 9246  H HB2  . PRO A 1 257 ? -118.190 -20.736  37.563   1.00 0.00 ? 252 PRO A HB2  2  
ATOM 9247  H HB3  . PRO A 1 257 ? -116.788 -21.742  37.980   1.00 0.00 ? 252 PRO A HB3  2  
ATOM 9248  H HG2  . PRO A 1 257 ? -117.881 -19.350  39.374   1.00 0.00 ? 252 PRO A HG2  2  
ATOM 9249  H HG3  . PRO A 1 257 ? -117.213 -20.843  40.050   1.00 0.00 ? 252 PRO A HG3  2  
ATOM 9250  H HD2  . PRO A 1 257 ? -115.820 -18.508  39.918   1.00 0.00 ? 252 PRO A HD2  2  
ATOM 9251  H HD3  . PRO A 1 257 ? -115.050 -20.110  39.879   1.00 0.00 ? 252 PRO A HD3  2  
ATOM 9252  N N    . ALA A 1 258 ? -117.037 -17.572  36.730   1.00 0.00 ? 253 ALA A N    2  
ATOM 9253  C CA   . ALA A 1 258 ? -117.823 -16.496  36.057   1.00 0.00 ? 253 ALA A CA   2  
ATOM 9254  C C    . ALA A 1 258 ? -117.092 -16.007  34.801   1.00 0.00 ? 253 ALA A C    2  
ATOM 9255  O O    . ALA A 1 258 ? -117.666 -15.345  33.956   1.00 0.00 ? 253 ALA A O    2  
ATOM 9256  C CB   . ALA A 1 258 ? -117.922 -15.373  37.090   1.00 0.00 ? 253 ALA A CB   2  
ATOM 9257  H H    . ALA A 1 258 ? -116.456 -17.350  37.488   1.00 0.00 ? 253 ALA A H    2  
ATOM 9258  H HA   . ALA A 1 258 ? -118.809 -16.852  35.805   1.00 0.00 ? 253 ALA A HA   2  
ATOM 9259  H HB1  . ALA A 1 258 ? -118.730 -14.708  36.822   1.00 0.00 ? 253 ALA A HB1  2  
ATOM 9260  H HB2  . ALA A 1 258 ? -116.994 -14.821  37.112   1.00 0.00 ? 253 ALA A HB2  2  
ATOM 9261  H HB3  . ALA A 1 258 ? -118.112 -15.796  38.065   1.00 0.00 ? 253 ALA A HB3  2  
ATOM 9262  N N    . LEU A 1 259 ? -115.832 -16.329  34.670   1.00 0.00 ? 254 LEU A N    2  
ATOM 9263  C CA   . LEU A 1 259 ? -115.068 -15.883  33.469   1.00 0.00 ? 254 LEU A CA   2  
ATOM 9264  C C    . LEU A 1 259 ? -115.441 -16.733  32.251   1.00 0.00 ? 254 LEU A C    2  
ATOM 9265  O O    . LEU A 1 259 ? -115.342 -16.291  31.124   1.00 0.00 ? 254 LEU A O    2  
ATOM 9266  C CB   . LEU A 1 259 ? -113.597 -16.084  33.838   1.00 0.00 ? 254 LEU A CB   2  
ATOM 9267  C CG   . LEU A 1 259 ? -113.151 -14.964  34.779   1.00 0.00 ? 254 LEU A CG   2  
ATOM 9268  C CD1  . LEU A 1 259 ? -111.908 -15.409  35.553   1.00 0.00 ? 254 LEU A CD1  2  
ATOM 9269  C CD2  . LEU A 1 259 ? -112.820 -13.714  33.961   1.00 0.00 ? 254 LEU A CD2  2  
ATOM 9270  H H    . LEU A 1 259 ? -115.388 -16.864  35.361   1.00 0.00 ? 254 LEU A H    2  
ATOM 9271  H HA   . LEU A 1 259 ? -115.256 -14.840  33.271   1.00 0.00 ? 254 LEU A HA   2  
ATOM 9272  H HB2  . LEU A 1 259 ? -113.477 -17.039  34.330   1.00 0.00 ? 254 LEU A HB2  2  
ATOM 9273  H HB3  . LEU A 1 259 ? -112.995 -16.062  32.942   1.00 0.00 ? 254 LEU A HB3  2  
ATOM 9274  H HG   . LEU A 1 259 ? -113.947 -14.741  35.475   1.00 0.00 ? 254 LEU A HG   2  
ATOM 9275  H HD11 . LEU A 1 259 ? -111.883 -16.487  35.606   1.00 0.00 ? 254 LEU A HD11 2  
ATOM 9276  H HD12 . LEU A 1 259 ? -111.942 -15.001  36.553   1.00 0.00 ? 254 LEU A HD12 2  
ATOM 9277  H HD13 . LEU A 1 259 ? -111.023 -15.052  35.049   1.00 0.00 ? 254 LEU A HD13 2  
ATOM 9278  H HD21 . LEU A 1 259 ? -111.846 -13.828  33.507   1.00 0.00 ? 254 LEU A HD21 2  
ATOM 9279  H HD22 . LEU A 1 259 ? -112.816 -12.850  34.609   1.00 0.00 ? 254 LEU A HD22 2  
ATOM 9280  H HD23 . LEU A 1 259 ? -113.564 -13.581  33.189   1.00 0.00 ? 254 LEU A HD23 2  
ATOM 9281  N N    . LEU A 1 260 ? -115.873 -17.950  32.463   1.00 0.00 ? 255 LEU A N    2  
ATOM 9282  C CA   . LEU A 1 260 ? -116.252 -18.819  31.306   1.00 0.00 ? 255 LEU A CA   2  
ATOM 9283  C C    . LEU A 1 260 ? -117.282 -18.107  30.417   1.00 0.00 ? 255 LEU A C    2  
ATOM 9284  O O    . LEU A 1 260 ? -117.065 -17.954  29.231   1.00 0.00 ? 255 LEU A O    2  
ATOM 9285  C CB   . LEU A 1 260 ? -116.853 -20.084  31.925   1.00 0.00 ? 255 LEU A CB   2  
ATOM 9286  C CG   . LEU A 1 260 ? -116.199 -21.318  31.297   1.00 0.00 ? 255 LEU A CG   2  
ATOM 9287  C CD1  . LEU A 1 260 ? -116.034 -22.404  32.361   1.00 0.00 ? 255 LEU A CD1  2  
ATOM 9288  C CD2  . LEU A 1 260 ? -117.085 -21.841  30.163   1.00 0.00 ? 255 LEU A CD2  2  
ATOM 9289  H H    . LEU A 1 260 ? -115.949 -18.290  33.379   1.00 0.00 ? 255 LEU A H    2  
ATOM 9290  H HA   . LEU A 1 260 ? -115.376 -19.073  30.730   1.00 0.00 ? 255 LEU A HA   2  
ATOM 9291  H HB2  . LEU A 1 260 ? -116.675 -20.084  32.991   1.00 0.00 ? 255 LEU A HB2  2  
ATOM 9292  H HB3  . LEU A 1 260 ? -117.915 -20.109  31.737   1.00 0.00 ? 255 LEU A HB3  2  
ATOM 9293  H HG   . LEU A 1 260 ? -115.230 -21.050  30.903   1.00 0.00 ? 255 LEU A HG   2  
ATOM 9294  H HD11 . LEU A 1 260 ? -116.995 -22.847  32.577   1.00 0.00 ? 255 LEU A HD11 2  
ATOM 9295  H HD12 . LEU A 1 260 ? -115.629 -21.966  33.263   1.00 0.00 ? 255 LEU A HD12 2  
ATOM 9296  H HD13 . LEU A 1 260 ? -115.360 -23.165  31.997   1.00 0.00 ? 255 LEU A HD13 2  
ATOM 9297  H HD21 . LEU A 1 260 ? -118.105 -21.916  30.508   1.00 0.00 ? 255 LEU A HD21 2  
ATOM 9298  H HD22 . LEU A 1 260 ? -116.736 -22.816  29.856   1.00 0.00 ? 255 LEU A HD22 2  
ATOM 9299  H HD23 . LEU A 1 260 ? -117.036 -21.160  29.325   1.00 0.00 ? 255 LEU A HD23 2  
ATOM 9300  N N    . PRO A 1 261 ? -118.372 -17.685  31.014   1.00 0.00 ? 256 PRO A N    2  
ATOM 9301  C CA   . PRO A 1 261 ? -119.424 -16.977  30.245   1.00 0.00 ? 256 PRO A CA   2  
ATOM 9302  C C    . PRO A 1 261 ? -118.926 -15.592  29.821   1.00 0.00 ? 256 PRO A C    2  
ATOM 9303  O O    . PRO A 1 261 ? -119.133 -15.165  28.703   1.00 0.00 ? 256 PRO A O    2  
ATOM 9304  C CB   . PRO A 1 261 ? -120.584 -16.868  31.232   1.00 0.00 ? 256 PRO A CB   2  
ATOM 9305  C CG   . PRO A 1 261 ? -119.947 -16.944  32.580   1.00 0.00 ? 256 PRO A CG   2  
ATOM 9306  C CD   . PRO A 1 261 ? -118.730 -17.818  32.434   1.00 0.00 ? 256 PRO A CD   2  
ATOM 9307  H HA   . PRO A 1 261 ? -119.722 -17.555  29.385   1.00 0.00 ? 256 PRO A HA   2  
ATOM 9308  H HB2  . PRO A 1 261 ? -121.096 -15.924  31.106   1.00 0.00 ? 256 PRO A HB2  2  
ATOM 9309  H HB3  . PRO A 1 261 ? -121.269 -17.691  31.100   1.00 0.00 ? 256 PRO A HB3  2  
ATOM 9310  H HG2  . PRO A 1 261 ? -119.659 -15.955  32.909   1.00 0.00 ? 256 PRO A HG2  2  
ATOM 9311  H HG3  . PRO A 1 261 ? -120.630 -17.387  33.289   1.00 0.00 ? 256 PRO A HG3  2  
ATOM 9312  H HD2  . PRO A 1 261 ? -117.933 -17.460  33.068   1.00 0.00 ? 256 PRO A HD2  2  
ATOM 9313  H HD3  . PRO A 1 261 ? -118.969 -18.843  32.665   1.00 0.00 ? 256 PRO A HD3  2  
ATOM 9314  N N    . ALA A 1 262 ? -118.264 -14.891  30.706   1.00 0.00 ? 257 ALA A N    2  
ATOM 9315  C CA   . ALA A 1 262 ? -117.746 -13.535  30.350   1.00 0.00 ? 257 ALA A CA   2  
ATOM 9316  C C    . ALA A 1 262 ? -116.852 -13.622  29.108   1.00 0.00 ? 257 ALA A C    2  
ATOM 9317  O O    . ALA A 1 262 ? -116.960 -12.826  28.196   1.00 0.00 ? 257 ALA A O    2  
ATOM 9318  C CB   . ALA A 1 262 ? -116.932 -13.088  31.565   1.00 0.00 ? 257 ALA A CB   2  
ATOM 9319  H H    . ALA A 1 262 ? -118.105 -15.257  31.601   1.00 0.00 ? 257 ALA A H    2  
ATOM 9320  H HA   . ALA A 1 262 ? -118.563 -12.852  30.180   1.00 0.00 ? 257 ALA A HA   2  
ATOM 9321  H HB1  . ALA A 1 262 ? -117.360 -13.512  32.461   1.00 0.00 ? 257 ALA A HB1  2  
ATOM 9322  H HB2  . ALA A 1 262 ? -116.950 -12.010  31.633   1.00 0.00 ? 257 ALA A HB2  2  
ATOM 9323  H HB3  . ALA A 1 262 ? -115.912 -13.425  31.459   1.00 0.00 ? 257 ALA A HB3  2  
ATOM 9324  N N    . LEU A 1 263 ? -115.974 -14.589  29.068   1.00 0.00 ? 258 LEU A N    2  
ATOM 9325  C CA   . LEU A 1 263 ? -115.074 -14.740  27.888   1.00 0.00 ? 258 LEU A CA   2  
ATOM 9326  C C    . LEU A 1 263 ? -115.829 -15.398  26.737   1.00 0.00 ? 258 LEU A C    2  
ATOM 9327  O O    . LEU A 1 263 ? -115.737 -14.972  25.603   1.00 0.00 ? 258 LEU A O    2  
ATOM 9328  C CB   . LEU A 1 263 ? -113.923 -15.626  28.368   1.00 0.00 ? 258 LEU A CB   2  
ATOM 9329  C CG   . LEU A 1 263 ? -113.178 -14.932  29.514   1.00 0.00 ? 258 LEU A CG   2  
ATOM 9330  C CD1  . LEU A 1 263 ? -111.845 -15.639  29.754   1.00 0.00 ? 258 LEU A CD1  2  
ATOM 9331  C CD2  . LEU A 1 263 ? -112.916 -13.466  29.151   1.00 0.00 ? 258 LEU A CD2  2  
ATOM 9332  H H    . LEU A 1 263 ? -115.910 -15.220  29.814   1.00 0.00 ? 258 LEU A H    2  
ATOM 9333  H HA   . LEU A 1 263 ? -114.696 -13.779  27.579   1.00 0.00 ? 258 LEU A HA   2  
ATOM 9334  H HB2  . LEU A 1 263 ? -114.319 -16.570  28.715   1.00 0.00 ? 258 LEU A HB2  2  
ATOM 9335  H HB3  . LEU A 1 263 ? -113.239 -15.802  27.551   1.00 0.00 ? 258 LEU A HB3  2  
ATOM 9336  H HG   . LEU A 1 263 ? -113.775 -14.980  30.412   1.00 0.00 ? 258 LEU A HG   2  
ATOM 9337  H HD11 . LEU A 1 263 ? -112.026 -16.605  30.203   1.00 0.00 ? 258 LEU A HD11 2  
ATOM 9338  H HD12 . LEU A 1 263 ? -111.235 -15.043  30.417   1.00 0.00 ? 258 LEU A HD12 2  
ATOM 9339  H HD13 . LEU A 1 263 ? -111.332 -15.770  28.813   1.00 0.00 ? 258 LEU A HD13 2  
ATOM 9340  H HD21 . LEU A 1 263 ? -113.858 -12.937  29.098   1.00 0.00 ? 258 LEU A HD21 2  
ATOM 9341  H HD22 . LEU A 1 263 ? -112.422 -13.416  28.192   1.00 0.00 ? 258 LEU A HD22 2  
ATOM 9342  H HD23 . LEU A 1 263 ? -112.290 -13.013  29.905   1.00 0.00 ? 258 LEU A HD23 2  
ATOM 9343  N N    . LEU A 1 264 ? -116.588 -16.423  27.021   1.00 0.00 ? 259 LEU A N    2  
ATOM 9344  C CA   . LEU A 1 264 ? -117.370 -17.100  25.943   1.00 0.00 ? 259 LEU A CA   2  
ATOM 9345  C C    . LEU A 1 264 ? -118.135 -16.057  25.118   1.00 0.00 ? 259 LEU A C    2  
ATOM 9346  O O    . LEU A 1 264 ? -118.477 -16.284  23.974   1.00 0.00 ? 259 LEU A O    2  
ATOM 9347  C CB   . LEU A 1 264 ? -118.349 -18.010  26.682   1.00 0.00 ? 259 LEU A CB   2  
ATOM 9348  C CG   . LEU A 1 264 ? -119.266 -18.715  25.677   1.00 0.00 ? 259 LEU A CG   2  
ATOM 9349  C CD1  . LEU A 1 264 ? -118.430 -19.581  24.731   1.00 0.00 ? 259 LEU A CD1  2  
ATOM 9350  C CD2  . LEU A 1 264 ? -120.261 -19.600  26.430   1.00 0.00 ? 259 LEU A CD2  2  
ATOM 9351  H H    . LEU A 1 264 ? -116.654 -16.740  27.946   1.00 0.00 ? 259 LEU A H    2  
ATOM 9352  H HA   . LEU A 1 264 ? -116.721 -17.686  25.313   1.00 0.00 ? 259 LEU A HA   2  
ATOM 9353  H HB2  . LEU A 1 264 ? -117.796 -18.747  27.247   1.00 0.00 ? 259 LEU A HB2  2  
ATOM 9354  H HB3  . LEU A 1 264 ? -118.946 -17.414  27.355   1.00 0.00 ? 259 LEU A HB3  2  
ATOM 9355  H HG   . LEU A 1 264 ? -119.804 -17.974  25.103   1.00 0.00 ? 259 LEU A HG   2  
ATOM 9356  H HD11 . LEU A 1 264 ? -117.747 -18.955  24.178   1.00 0.00 ? 259 LEU A HD11 2  
ATOM 9357  H HD12 . LEU A 1 264 ? -119.084 -20.096  24.042   1.00 0.00 ? 259 LEU A HD12 2  
ATOM 9358  H HD13 . LEU A 1 264 ? -117.871 -20.305  25.306   1.00 0.00 ? 259 LEU A HD13 2  
ATOM 9359  H HD21 . LEU A 1 264 ? -119.772 -20.046  27.283   1.00 0.00 ? 259 LEU A HD21 2  
ATOM 9360  H HD22 . LEU A 1 264 ? -120.620 -20.378  25.773   1.00 0.00 ? 259 LEU A HD22 2  
ATOM 9361  H HD23 . LEU A 1 264 ? -121.094 -19.000  26.766   1.00 0.00 ? 259 LEU A HD23 2  
ATOM 9362  N N    . GLN A 1 265 ? -118.394 -14.911  25.693   1.00 0.00 ? 260 GLN A N    2  
ATOM 9363  C CA   . GLN A 1 265 ? -119.124 -13.846  24.948   1.00 0.00 ? 260 GLN A CA   2  
ATOM 9364  C C    . GLN A 1 265 ? -118.128 -12.802  24.439   1.00 0.00 ? 260 GLN A C    2  
ATOM 9365  O O    . GLN A 1 265 ? -118.410 -12.050  23.527   1.00 0.00 ? 260 GLN A O    2  
ATOM 9366  C CB   . GLN A 1 265 ? -120.077 -13.226  25.971   1.00 0.00 ? 260 GLN A CB   2  
ATOM 9367  C CG   . GLN A 1 265 ? -121.428 -13.944  25.913   1.00 0.00 ? 260 GLN A CG   2  
ATOM 9368  C CD   . GLN A 1 265 ? -121.998 -14.077  27.327   1.00 0.00 ? 260 GLN A CD   2  
ATOM 9369  O OE1  . GLN A 1 265 ? -121.864 -13.180  28.135   1.00 0.00 ? 260 GLN A OE1  2  
ATOM 9370  N NE2  . GLN A 1 265 ? -122.633 -15.167  27.661   1.00 0.00 ? 260 GLN A NE2  2  
ATOM 9371  H H    . GLN A 1 265 ? -118.098 -14.746  26.617   1.00 0.00 ? 260 GLN A H    2  
ATOM 9372  H HA   . GLN A 1 265 ? -119.682 -14.270  24.129   1.00 0.00 ? 260 GLN A HA   2  
ATOM 9373  H HB2  . GLN A 1 265 ? -119.657 -13.327  26.962   1.00 0.00 ? 260 GLN A HB2  2  
ATOM 9374  H HB3  . GLN A 1 265 ? -120.218 -12.180  25.744   1.00 0.00 ? 260 GLN A HB3  2  
ATOM 9375  H HG2  . GLN A 1 265 ? -122.112 -13.374  25.300   1.00 0.00 ? 260 GLN A HG2  2  
ATOM 9376  H HG3  . GLN A 1 265 ? -121.296 -14.927  25.486   1.00 0.00 ? 260 GLN A HG3  2  
ATOM 9377  H HE21 . GLN A 1 265 ? -122.740 -15.891  27.009   1.00 0.00 ? 260 GLN A HE21 2  
ATOM 9378  H HE22 . GLN A 1 265 ? -123.001 -15.262  28.564   1.00 0.00 ? 260 GLN A HE22 2  
ATOM 9379  N N    . GLN A 1 266 ? -116.960 -12.758  25.024   1.00 0.00 ? 261 GLN A N    2  
ATOM 9380  C CA   . GLN A 1 266 ? -115.934 -11.770  24.581   1.00 0.00 ? 261 GLN A CA   2  
ATOM 9381  C C    . GLN A 1 266 ? -114.816 -12.481  23.811   1.00 0.00 ? 261 GLN A C    2  
ATOM 9382  O O    . GLN A 1 266 ? -114.709 -12.363  22.605   1.00 0.00 ? 261 GLN A O    2  
ATOM 9383  C CB   . GLN A 1 266 ? -115.396 -11.155  25.876   1.00 0.00 ? 261 GLN A CB   2  
ATOM 9384  C CG   . GLN A 1 266 ? -114.291 -10.145  25.550   1.00 0.00 ? 261 GLN A CG   2  
ATOM 9385  C CD   . GLN A 1 266 ? -114.807 -8.724   25.788   1.00 0.00 ? 261 GLN A CD   2  
ATOM 9386  O OE1  . GLN A 1 266 ? -115.401 -8.127   24.912   1.00 0.00 ? 261 GLN A OE1  2  
ATOM 9387  N NE2  . GLN A 1 266 ? -114.605 -8.155   26.945   1.00 0.00 ? 261 GLN A NE2  2  
ATOM 9388  H H    . GLN A 1 266 ? -116.758 -13.378  25.756   1.00 0.00 ? 261 GLN A H    2  
ATOM 9389  H HA   . GLN A 1 266 ? -116.386 -11.005  23.970   1.00 0.00 ? 261 GLN A HA   2  
ATOM 9390  H HB2  . GLN A 1 266 ? -116.201 -10.655  26.396   1.00 0.00 ? 261 GLN A HB2  2  
ATOM 9391  H HB3  . GLN A 1 266 ? -114.994 -11.935  26.504   1.00 0.00 ? 261 GLN A HB3  2  
ATOM 9392  H HG2  . GLN A 1 266 ? -113.438 -10.330  26.187   1.00 0.00 ? 261 GLN A HG2  2  
ATOM 9393  H HG3  . GLN A 1 266 ? -113.997 -10.251  24.517   1.00 0.00 ? 261 GLN A HG3  2  
ATOM 9394  H HE21 . GLN A 1 266 ? -114.127 -8.636   27.651   1.00 0.00 ? 261 GLN A HE21 2  
ATOM 9395  H HE22 . GLN A 1 266 ? -114.932 -7.245   27.106   1.00 0.00 ? 261 GLN A HE22 2  
ATOM 9396  N N    . LEU A 1 267 ? -113.983 -13.219  24.497   1.00 0.00 ? 262 LEU A N    2  
ATOM 9397  C CA   . LEU A 1 267 ? -112.872 -13.938  23.805   1.00 0.00 ? 262 LEU A CA   2  
ATOM 9398  C C    . LEU A 1 267 ? -113.434 -15.096  22.976   1.00 0.00 ? 262 LEU A C    2  
ATOM 9399  O O    . LEU A 1 267 ? -113.115 -15.254  21.814   1.00 0.00 ? 262 LEU A O    2  
ATOM 9400  C CB   . LEU A 1 267 ? -111.972 -14.466  24.929   1.00 0.00 ? 262 LEU A CB   2  
ATOM 9401  C CG   . LEU A 1 267 ? -110.597 -13.793  24.857   1.00 0.00 ? 262 LEU A CG   2  
ATOM 9402  C CD1  . LEU A 1 267 ? -109.946 -14.092  23.505   1.00 0.00 ? 262 LEU A CD1  2  
ATOM 9403  C CD2  . LEU A 1 267 ? -110.757 -12.279  25.023   1.00 0.00 ? 262 LEU A CD2  2  
ATOM 9404  H H    . LEU A 1 267 ? -114.089 -13.300  25.468   1.00 0.00 ? 262 LEU A H    2  
ATOM 9405  H HA   . LEU A 1 267 ? -112.318 -13.259  23.176   1.00 0.00 ? 262 LEU A HA   2  
ATOM 9406  H HB2  . LEU A 1 267 ? -112.427 -14.252  25.885   1.00 0.00 ? 262 LEU A HB2  2  
ATOM 9407  H HB3  . LEU A 1 267 ? -111.852 -15.534  24.821   1.00 0.00 ? 262 LEU A HB3  2  
ATOM 9408  H HG   . LEU A 1 267 ? -109.969 -14.178  25.649   1.00 0.00 ? 262 LEU A HG   2  
ATOM 9409  H HD11 . LEU A 1 267 ? -110.350 -15.011  23.105   1.00 0.00 ? 262 LEU A HD11 2  
ATOM 9410  H HD12 . LEU A 1 267 ? -108.878 -14.196  23.634   1.00 0.00 ? 262 LEU A HD12 2  
ATOM 9411  H HD13 . LEU A 1 267 ? -110.148 -13.282  22.820   1.00 0.00 ? 262 LEU A HD13 2  
ATOM 9412  H HD21 . LEU A 1 267 ? -109.877 -11.874  25.499   1.00 0.00 ? 262 LEU A HD21 2  
ATOM 9413  H HD22 . LEU A 1 267 ? -111.624 -12.074  25.634   1.00 0.00 ? 262 LEU A HD22 2  
ATOM 9414  H HD23 . LEU A 1 267 ? -110.885 -11.823  24.052   1.00 0.00 ? 262 LEU A HD23 2  
ATOM 9415  N N    . GLY A 1 268 ? -114.271 -15.906  23.568   1.00 0.00 ? 263 GLY A N    2  
ATOM 9416  C CA   . GLY A 1 268 ? -114.860 -17.056  22.821   1.00 0.00 ? 263 GLY A CA   2  
ATOM 9417  C C    . GLY A 1 268 ? -115.662 -16.542  21.621   1.00 0.00 ? 263 GLY A C    2  
ATOM 9418  O O    . GLY A 1 268 ? -115.930 -17.273  20.687   1.00 0.00 ? 263 GLY A O    2  
ATOM 9419  H H    . GLY A 1 268 ? -114.513 -15.756  24.506   1.00 0.00 ? 263 GLY A H    2  
ATOM 9420  H HA2  . GLY A 1 268 ? -114.066 -17.702  22.473   1.00 0.00 ? 263 GLY A HA2  2  
ATOM 9421  H HA3  . GLY A 1 268 ? -115.514 -17.612  23.474   1.00 0.00 ? 263 GLY A HA3  2  
ATOM 9422  N N    . GLN A 1 269 ? -116.045 -15.292  21.637   1.00 0.00 ? 264 GLN A N    2  
ATOM 9423  C CA   . GLN A 1 269 ? -116.826 -14.735  20.495   1.00 0.00 ? 264 GLN A CA   2  
ATOM 9424  C C    . GLN A 1 269 ? -115.925 -13.868  19.611   1.00 0.00 ? 264 GLN A C    2  
ATOM 9425  O O    . GLN A 1 269 ? -116.395 -13.061  18.833   1.00 0.00 ? 264 GLN A O    2  
ATOM 9426  C CB   . GLN A 1 269 ? -117.925 -13.886  21.140   1.00 0.00 ? 264 GLN A CB   2  
ATOM 9427  C CG   . GLN A 1 269 ? -119.288 -14.539  20.895   1.00 0.00 ? 264 GLN A CG   2  
ATOM 9428  C CD   . GLN A 1 269 ? -120.386 -13.478  20.984   1.00 0.00 ? 264 GLN A CD   2  
ATOM 9429  O OE1  . GLN A 1 269 ? -120.462 -12.745  21.950   1.00 0.00 ? 264 GLN A OE1  2  
ATOM 9430  N NE2  . GLN A 1 269 ? -121.247 -13.363  20.010   1.00 0.00 ? 264 GLN A NE2  2  
ATOM 9431  H H    . GLN A 1 269 ? -115.816 -14.720  22.396   1.00 0.00 ? 264 GLN A H    2  
ATOM 9432  H HA   . GLN A 1 269 ? -117.266 -15.531  19.916   1.00 0.00 ? 264 GLN A HA   2  
ATOM 9433  H HB2  . GLN A 1 269 ? -117.747 -13.815  22.203   1.00 0.00 ? 264 GLN A HB2  2  
ATOM 9434  H HB3  . GLN A 1 269 ? -117.919 -12.897  20.707   1.00 0.00 ? 264 GLN A HB3  2  
ATOM 9435  H HG2  . GLN A 1 269 ? -119.300 -14.988  19.912   1.00 0.00 ? 264 GLN A HG2  2  
ATOM 9436  H HG3  . GLN A 1 269 ? -119.463 -15.299  21.640   1.00 0.00 ? 264 GLN A HG3  2  
ATOM 9437  H HE21 . GLN A 1 269 ? -121.186 -13.954  19.230   1.00 0.00 ? 264 GLN A HE21 2  
ATOM 9438  H HE22 . GLN A 1 269 ? -121.955 -12.687  20.058   1.00 0.00 ? 264 GLN A HE22 2  
ATOM 9439  N N    . GLU A 1 270 ? -114.634 -14.035  19.720   1.00 0.00 ? 265 GLU A N    2  
ATOM 9440  C CA   . GLU A 1 270 ? -113.703 -13.228  18.880   1.00 0.00 ? 265 GLU A CA   2  
ATOM 9441  C C    . GLU A 1 270 ? -113.407 -13.970  17.575   1.00 0.00 ? 265 GLU A C    2  
ATOM 9442  O O    . GLU A 1 270 ? -112.959 -13.388  16.606   1.00 0.00 ? 265 GLU A O    2  
ATOM 9443  C CB   . GLU A 1 270 ? -112.432 -13.086  19.718   1.00 0.00 ? 265 GLU A CB   2  
ATOM 9444  C CG   . GLU A 1 270 ? -111.628 -11.880  19.226   1.00 0.00 ? 265 GLU A CG   2  
ATOM 9445  C CD   . GLU A 1 270 ? -112.004 -10.645  20.046   1.00 0.00 ? 265 GLU A CD   2  
ATOM 9446  O OE1  . GLU A 1 270 ? -111.585 -10.567  21.189   1.00 0.00 ? 265 GLU A OE1  2  
ATOM 9447  O OE2  . GLU A 1 270 ? -112.706 -9.799   19.517   1.00 0.00 ? 265 GLU A OE2  2  
ATOM 9448  H H    . GLU A 1 270 ? -114.276 -14.696  20.348   1.00 0.00 ? 265 GLU A H    2  
ATOM 9449  H HA   . GLU A 1 270 ? -114.123 -12.255  18.677   1.00 0.00 ? 265 GLU A HA   2  
ATOM 9450  H HB2  . GLU A 1 270 ? -112.699 -12.942  20.755   1.00 0.00 ? 265 GLU A HB2  2  
ATOM 9451  H HB3  . GLU A 1 270 ? -111.834 -13.979  19.619   1.00 0.00 ? 265 GLU A HB3  2  
ATOM 9452  H HG2  . GLU A 1 270 ? -110.572 -12.081  19.340   1.00 0.00 ? 265 GLU A HG2  2  
ATOM 9453  H HG3  . GLU A 1 270 ? -111.850 -11.700  18.184   1.00 0.00 ? 265 GLU A HG3  2  
ATOM 9454  N N    . ASN A 1 271 ? -113.657 -15.252  17.545   1.00 0.00 ? 266 ASN A N    2  
ATOM 9455  C CA   . ASN A 1 271 ? -113.395 -16.037  16.305   1.00 0.00 ? 266 ASN A CA   2  
ATOM 9456  C C    . ASN A 1 271 ? -114.677 -16.752  15.853   1.00 0.00 ? 266 ASN A C    2  
ATOM 9457  O O    . ASN A 1 271 ? -115.177 -17.616  16.546   1.00 0.00 ? 266 ASN A O    2  
ATOM 9458  C CB   . ASN A 1 271 ? -112.321 -17.057  16.697   1.00 0.00 ? 266 ASN A CB   2  
ATOM 9459  C CG   . ASN A 1 271 ? -112.810 -17.898  17.879   1.00 0.00 ? 266 ASN A CG   2  
ATOM 9460  O OD1  . ASN A 1 271 ? -113.388 -18.950  17.693   1.00 0.00 ? 266 ASN A OD1  2  
ATOM 9461  N ND2  . ASN A 1 271 ? -112.602 -17.475  19.095   1.00 0.00 ? 266 ASN A ND2  2  
ATOM 9462  H H    . ASN A 1 271 ? -114.020 -15.699  18.339   1.00 0.00 ? 266 ASN A H    2  
ATOM 9463  H HA   . ASN A 1 271 ? -113.023 -15.393  15.525   1.00 0.00 ? 266 ASN A HA   2  
ATOM 9464  H HB2  . ASN A 1 271 ? -112.117 -17.703  15.855   1.00 0.00 ? 266 ASN A HB2  2  
ATOM 9465  H HB3  . ASN A 1 271 ? -111.418 -16.536  16.978   1.00 0.00 ? 266 ASN A HB3  2  
ATOM 9466  H HD21 . ASN A 1 271 ? -112.136 -16.626  19.246   1.00 0.00 ? 266 ASN A HD21 2  
ATOM 9467  H HD22 . ASN A 1 271 ? -112.911 -18.006  19.859   1.00 0.00 ? 266 ASN A HD22 2  
ATOM 9468  N N    . PRO A 1 272 ? -115.171 -16.372  14.699   1.00 0.00 ? 267 PRO A N    2  
ATOM 9469  C CA   . PRO A 1 272 ? -116.405 -17.000  14.165   1.00 0.00 ? 267 PRO A CA   2  
ATOM 9470  C C    . PRO A 1 272 ? -116.126 -18.446  13.742   1.00 0.00 ? 267 PRO A C    2  
ATOM 9471  O O    . PRO A 1 272 ? -117.034 -19.225  13.525   1.00 0.00 ? 267 PRO A O    2  
ATOM 9472  C CB   . PRO A 1 272 ? -116.758 -16.132  12.960   1.00 0.00 ? 267 PRO A CB   2  
ATOM 9473  C CG   . PRO A 1 272 ? -115.465 -15.510  12.542   1.00 0.00 ? 267 PRO A CG   2  
ATOM 9474  C CD   . PRO A 1 272 ? -114.641 -15.345  13.792   1.00 0.00 ? 267 PRO A CD   2  
ATOM 9475  H HA   . PRO A 1 272 ? -117.199 -16.962  14.894   1.00 0.00 ? 267 PRO A HA   2  
ATOM 9476  H HB2  . PRO A 1 272 ? -117.161 -16.743  12.163   1.00 0.00 ? 267 PRO A HB2  2  
ATOM 9477  H HB3  . PRO A 1 272 ? -117.463 -15.365  13.241   1.00 0.00 ? 267 PRO A HB3  2  
ATOM 9478  H HG2  . PRO A 1 272 ? -114.955 -16.156  11.841   1.00 0.00 ? 267 PRO A HG2  2  
ATOM 9479  H HG3  . PRO A 1 272 ? -115.645 -14.545  12.095   1.00 0.00 ? 267 PRO A HG3  2  
ATOM 9480  H HD2  . PRO A 1 272 ? -113.595 -15.523  13.580   1.00 0.00 ? 267 PRO A HD2  2  
ATOM 9481  H HD3  . PRO A 1 272 ? -114.784 -14.364  14.216   1.00 0.00 ? 267 PRO A HD3  2  
ATOM 9482  N N    . GLN A 1 273 ? -114.875 -18.810  13.627   1.00 0.00 ? 268 GLN A N    2  
ATOM 9483  C CA   . GLN A 1 273 ? -114.534 -20.204  13.223   1.00 0.00 ? 268 GLN A CA   2  
ATOM 9484  C C    . GLN A 1 273 ? -115.066 -21.199  14.258   1.00 0.00 ? 268 GLN A C    2  
ATOM 9485  O O    . GLN A 1 273 ? -115.576 -22.248  13.915   1.00 0.00 ? 268 GLN A O    2  
ATOM 9486  C CB   . GLN A 1 273 ? -113.006 -20.243  13.179   1.00 0.00 ? 268 GLN A CB   2  
ATOM 9487  C CG   . GLN A 1 273 ? -112.500 -19.329  12.059   1.00 0.00 ? 268 GLN A CG   2  
ATOM 9488  C CD   . GLN A 1 273 ? -111.418 -20.052  11.254   1.00 0.00 ? 268 GLN A CD   2  
ATOM 9489  O OE1  . GLN A 1 273 ? -110.635 -20.802  11.802   1.00 0.00 ? 268 GLN A OE1  2  
ATOM 9490  N NE2  . GLN A 1 273 ? -111.342 -19.858  9.965    1.00 0.00 ? 268 GLN A NE2  2  
ATOM 9491  H H    . GLN A 1 273 ? -114.159 -18.166  13.809   1.00 0.00 ? 268 GLN A H    2  
ATOM 9492  H HA   . GLN A 1 273 ? -114.937 -20.423  12.246   1.00 0.00 ? 268 GLN A HA   2  
ATOM 9493  H HB2  . GLN A 1 273 ? -112.612 -19.905  14.127   1.00 0.00 ? 268 GLN A HB2  2  
ATOM 9494  H HB3  . GLN A 1 273 ? -112.677 -21.255  12.993   1.00 0.00 ? 268 GLN A HB3  2  
ATOM 9495  H HG2  . GLN A 1 273 ? -113.321 -19.068  11.407   1.00 0.00 ? 268 GLN A HG2  2  
ATOM 9496  H HG3  . GLN A 1 273 ? -112.083 -18.430  12.489   1.00 0.00 ? 268 GLN A HG3  2  
ATOM 9497  H HE21 . GLN A 1 273 ? -111.973 -19.253  9.523    1.00 0.00 ? 268 GLN A HE21 2  
ATOM 9498  H HE22 . GLN A 1 273 ? -110.653 -20.316  9.441    1.00 0.00 ? 268 GLN A HE22 2  
ATOM 9499  N N    . LEU A 1 274 ? -114.955 -20.878  15.521   1.00 0.00 ? 269 LEU A N    2  
ATOM 9500  C CA   . LEU A 1 274 ? -115.459 -21.810  16.571   1.00 0.00 ? 269 LEU A CA   2  
ATOM 9501  C C    . LEU A 1 274 ? -116.898 -21.456  16.942   1.00 0.00 ? 269 LEU A C    2  
ATOM 9502  O O    . LEU A 1 274 ? -117.704 -22.318  17.213   1.00 0.00 ? 269 LEU A O    2  
ATOM 9503  C CB   . LEU A 1 274 ? -114.537 -21.609  17.774   1.00 0.00 ? 269 LEU A CB   2  
ATOM 9504  C CG   . LEU A 1 274 ? -114.773 -22.735  18.790   1.00 0.00 ? 269 LEU A CG   2  
ATOM 9505  C CD1  . LEU A 1 274 ? -113.602 -23.718  18.747   1.00 0.00 ? 269 LEU A CD1  2  
ATOM 9506  C CD2  . LEU A 1 274 ? -114.885 -22.142  20.196   1.00 0.00 ? 269 LEU A CD2  2  
ATOM 9507  H H    . LEU A 1 274 ? -114.544 -20.026  15.778   1.00 0.00 ? 269 LEU A H    2  
ATOM 9508  H HA   . LEU A 1 274 ? -115.400 -22.831  16.228   1.00 0.00 ? 269 LEU A HA   2  
ATOM 9509  H HB2  . LEU A 1 274 ? -113.507 -21.626  17.445   1.00 0.00 ? 269 LEU A HB2  2  
ATOM 9510  H HB3  . LEU A 1 274 ? -114.751 -20.657  18.237   1.00 0.00 ? 269 LEU A HB3  2  
ATOM 9511  H HG   . LEU A 1 274 ? -115.688 -23.259  18.545   1.00 0.00 ? 269 LEU A HG   2  
ATOM 9512  H HD11 . LEU A 1 274 ? -113.281 -23.853  17.725   1.00 0.00 ? 269 LEU A HD11 2  
ATOM 9513  H HD12 . LEU A 1 274 ? -113.915 -24.668  19.154   1.00 0.00 ? 269 LEU A HD12 2  
ATOM 9514  H HD13 . LEU A 1 274 ? -112.783 -23.328  19.333   1.00 0.00 ? 269 LEU A HD13 2  
ATOM 9515  H HD21 . LEU A 1 274 ? -113.904 -22.085  20.642   1.00 0.00 ? 269 LEU A HD21 2  
ATOM 9516  H HD22 . LEU A 1 274 ? -115.519 -22.773  20.802   1.00 0.00 ? 269 LEU A HD22 2  
ATOM 9517  H HD23 . LEU A 1 274 ? -115.312 -21.153  20.137   1.00 0.00 ? 269 LEU A HD23 2  
ATOM 9518  N N    . LEU A 1 275 ? -117.226 -20.192  16.961   1.00 0.00 ? 270 LEU A N    2  
ATOM 9519  C CA   . LEU A 1 275 ? -118.619 -19.784  17.323   1.00 0.00 ? 270 LEU A CA   2  
ATOM 9520  C C    . LEU A 1 275 ? -119.645 -20.589  16.516   1.00 0.00 ? 270 LEU A C    2  
ATOM 9521  O O    . LEU A 1 275 ? -120.673 -20.999  17.026   1.00 0.00 ? 270 LEU A O    2  
ATOM 9522  C CB   . LEU A 1 275 ? -118.705 -18.297  16.965   1.00 0.00 ? 270 LEU A CB   2  
ATOM 9523  C CG   . LEU A 1 275 ? -119.356 -17.527  18.118   1.00 0.00 ? 270 LEU A CG   2  
ATOM 9524  C CD1  . LEU A 1 275 ? -120.762 -18.075  18.375   1.00 0.00 ? 270 LEU A CD1  2  
ATOM 9525  C CD2  . LEU A 1 275 ? -118.505 -17.688  19.381   1.00 0.00 ? 270 LEU A CD2  2  
ATOM 9526  H H    . LEU A 1 275 ? -116.556 -19.510  16.741   1.00 0.00 ? 270 LEU A H    2  
ATOM 9527  H HA   . LEU A 1 275 ? -118.785 -19.915  18.378   1.00 0.00 ? 270 LEU A HA   2  
ATOM 9528  H HB2  . LEU A 1 275 ? -117.711 -17.910  16.790   1.00 0.00 ? 270 LEU A HB2  2  
ATOM 9529  H HB3  . LEU A 1 275 ? -119.301 -18.174  16.073   1.00 0.00 ? 270 LEU A HB3  2  
ATOM 9530  H HG   . LEU A 1 275 ? -119.421 -16.480  17.859   1.00 0.00 ? 270 LEU A HG   2  
ATOM 9531  H HD11 . LEU A 1 275 ? -121.439 -17.256  18.568   1.00 0.00 ? 270 LEU A HD11 2  
ATOM 9532  H HD12 . LEU A 1 275 ? -120.742 -18.735  19.230   1.00 0.00 ? 270 LEU A HD12 2  
ATOM 9533  H HD13 . LEU A 1 275 ? -121.099 -18.623  17.506   1.00 0.00 ? 270 LEU A HD13 2  
ATOM 9534  H HD21 . LEU A 1 275 ? -118.707 -16.874  20.060   1.00 0.00 ? 270 LEU A HD21 2  
ATOM 9535  H HD22 . LEU A 1 275 ? -117.458 -17.683  19.112   1.00 0.00 ? 270 LEU A HD22 2  
ATOM 9536  H HD23 . LEU A 1 275 ? -118.747 -18.626  19.861   1.00 0.00 ? 270 LEU A HD23 2  
ATOM 9537  N N    . GLN A 1 276 ? -119.366 -20.812  15.262   1.00 0.00 ? 271 GLN A N    2  
ATOM 9538  C CA   . GLN A 1 276 ? -120.314 -21.583  14.401   1.00 0.00 ? 271 GLN A CA   2  
ATOM 9539  C C    . GLN A 1 276 ? -120.448 -23.027  14.896   1.00 0.00 ? 271 GLN A C    2  
ATOM 9540  O O    . GLN A 1 276 ? -121.459 -23.670  14.691   1.00 0.00 ? 271 GLN A O    2  
ATOM 9541  C CB   . GLN A 1 276 ? -119.696 -21.551  12.999   1.00 0.00 ? 271 GLN A CB   2  
ATOM 9542  C CG   . GLN A 1 276 ? -118.334 -22.253  13.015   1.00 0.00 ? 271 GLN A CG   2  
ATOM 9543  C CD   . GLN A 1 276 ? -117.526 -21.833  11.785   1.00 0.00 ? 271 GLN A CD   2  
ATOM 9544  O OE1  . GLN A 1 276 ? -117.788 -20.804  11.193   1.00 0.00 ? 271 GLN A OE1  2  
ATOM 9545  N NE2  . GLN A 1 276 ? -116.547 -22.591  11.372   1.00 0.00 ? 271 GLN A NE2  2  
ATOM 9546  H H    . GLN A 1 276 ? -118.530 -20.470  14.886   1.00 0.00 ? 271 GLN A H    2  
ATOM 9547  H HA   . GLN A 1 276 ? -121.279 -21.103  14.385   1.00 0.00 ? 271 GLN A HA   2  
ATOM 9548  H HB2  . GLN A 1 276 ? -120.353 -22.056  12.306   1.00 0.00 ? 271 GLN A HB2  2  
ATOM 9549  H HB3  . GLN A 1 276 ? -119.566 -20.526  12.688   1.00 0.00 ? 271 GLN A HB3  2  
ATOM 9550  H HG2  . GLN A 1 276 ? -117.797 -21.977  13.911   1.00 0.00 ? 271 GLN A HG2  2  
ATOM 9551  H HG3  . GLN A 1 276 ? -118.480 -23.322  12.998   1.00 0.00 ? 271 GLN A HG3  2  
ATOM 9552  H HE21 . GLN A 1 276 ? -116.334 -23.421  11.849   1.00 0.00 ? 271 GLN A HE21 2  
ATOM 9553  H HE22 . GLN A 1 276 ? -116.024 -22.331  10.585   1.00 0.00 ? 271 GLN A HE22 2  
ATOM 9554  N N    . GLN A 1 277 ? -119.437 -23.541  15.542   1.00 0.00 ? 272 GLN A N    2  
ATOM 9555  C CA   . GLN A 1 277 ? -119.509 -24.945  16.045   1.00 0.00 ? 272 GLN A CA   2  
ATOM 9556  C C    . GLN A 1 277 ? -119.823 -24.951  17.541   1.00 0.00 ? 272 GLN A C    2  
ATOM 9557  O O    . GLN A 1 277 ? -120.760 -25.582  17.984   1.00 0.00 ? 272 GLN A O    2  
ATOM 9558  C CB   . GLN A 1 277 ? -118.120 -25.531  15.784   1.00 0.00 ? 272 GLN A CB   2  
ATOM 9559  C CG   . GLN A 1 277 ? -118.141 -26.353  14.491   1.00 0.00 ? 272 GLN A CG   2  
ATOM 9560  C CD   . GLN A 1 277 ? -117.560 -27.744  14.757   1.00 0.00 ? 272 GLN A CD   2  
ATOM 9561  O OE1  . GLN A 1 277 ? -116.791 -27.927  15.680   1.00 0.00 ? 272 GLN A OE1  2  
ATOM 9562  N NE2  . GLN A 1 277 ? -117.898 -28.738  13.983   1.00 0.00 ? 272 GLN A NE2  2  
ATOM 9563  H H    . GLN A 1 277 ? -118.631 -23.006  15.695   1.00 0.00 ? 272 GLN A H    2  
ATOM 9564  H HA   . GLN A 1 277 ? -120.254 -25.503  15.500   1.00 0.00 ? 272 GLN A HA   2  
ATOM 9565  H HB2  . GLN A 1 277 ? -117.404 -24.727  15.689   1.00 0.00 ? 272 GLN A HB2  2  
ATOM 9566  H HB3  . GLN A 1 277 ? -117.838 -26.167  16.610   1.00 0.00 ? 272 GLN A HB3  2  
ATOM 9567  H HG2  . GLN A 1 277 ? -119.158 -26.449  14.140   1.00 0.00 ? 272 GLN A HG2  2  
ATOM 9568  H HG3  . GLN A 1 277 ? -117.546 -25.856  13.740   1.00 0.00 ? 272 GLN A HG3  2  
ATOM 9569  H HE21 . GLN A 1 277 ? -118.519 -28.591  13.239   1.00 0.00 ? 272 GLN A HE21 2  
ATOM 9570  H HE22 . GLN A 1 277 ? -117.531 -29.632  14.146   1.00 0.00 ? 272 GLN A HE22 2  
ATOM 9571  N N    . ILE A 1 278 ? -119.039 -24.247  18.315   1.00 0.00 ? 273 ILE A N    2  
ATOM 9572  C CA   . ILE A 1 278 ? -119.262 -24.186  19.794   1.00 0.00 ? 273 ILE A CA   2  
ATOM 9573  C C    . ILE A 1 278 ? -120.757 -24.059  20.119   1.00 0.00 ? 273 ILE A C    2  
ATOM 9574  O O    . ILE A 1 278 ? -121.235 -24.598  21.098   1.00 0.00 ? 273 ILE A O    2  
ATOM 9575  C CB   . ILE A 1 278 ? -118.493 -22.936  20.239   1.00 0.00 ? 273 ILE A CB   2  
ATOM 9576  C CG1  . ILE A 1 278 ? -118.227 -22.996  21.744   1.00 0.00 ? 273 ILE A CG1  2  
ATOM 9577  C CG2  . ILE A 1 278 ? -119.304 -21.677  19.923   1.00 0.00 ? 273 ILE A CG2  2  
ATOM 9578  C CD1  . ILE A 1 278 ? -117.386 -21.784  22.154   1.00 0.00 ? 273 ILE A CD1  2  
ATOM 9579  H H    . ILE A 1 278 ? -118.293 -23.755  17.922   1.00 0.00 ? 273 ILE A H    2  
ATOM 9580  H HA   . ILE A 1 278 ? -118.847 -25.059  20.271   1.00 0.00 ? 273 ILE A HA   2  
ATOM 9581  H HB   . ILE A 1 278 ? -117.552 -22.891  19.711   1.00 0.00 ? 273 ILE A HB   2  
ATOM 9582  H HG12 . ILE A 1 278 ? -119.166 -22.983  22.278   1.00 0.00 ? 273 ILE A HG12 2  
ATOM 9583  H HG13 . ILE A 1 278 ? -117.689 -23.902  21.980   1.00 0.00 ? 273 ILE A HG13 2  
ATOM 9584  H HG21 . ILE A 1 278 ? -120.198 -21.663  20.529   1.00 0.00 ? 273 ILE A HG21 2  
ATOM 9585  H HG22 . ILE A 1 278 ? -119.577 -21.678  18.878   1.00 0.00 ? 273 ILE A HG22 2  
ATOM 9586  H HG23 . ILE A 1 278 ? -118.708 -20.803  20.140   1.00 0.00 ? 273 ILE A HG23 2  
ATOM 9587  H HD11 . ILE A 1 278 ? -117.898 -21.237  22.931   1.00 0.00 ? 273 ILE A HD11 2  
ATOM 9588  H HD12 . ILE A 1 278 ? -117.239 -21.140  21.297   1.00 0.00 ? 273 ILE A HD12 2  
ATOM 9589  H HD13 . ILE A 1 278 ? -116.427 -22.118  22.521   1.00 0.00 ? 273 ILE A HD13 2  
ATOM 9590  N N    . SER A 1 279 ? -121.498 -23.353  19.302   1.00 0.00 ? 274 SER A N    2  
ATOM 9591  C CA   . SER A 1 279 ? -122.960 -23.200  19.566   1.00 0.00 ? 274 SER A CA   2  
ATOM 9592  C C    . SER A 1 279 ? -123.618 -24.578  19.680   1.00 0.00 ? 274 SER A C    2  
ATOM 9593  O O    . SER A 1 279 ? -124.381 -24.840  20.589   1.00 0.00 ? 274 SER A O    2  
ATOM 9594  C CB   . SER A 1 279 ? -123.508 -22.439  18.360   1.00 0.00 ? 274 SER A CB   2  
ATOM 9595  O OG   . SER A 1 279 ? -123.531 -21.048  18.654   1.00 0.00 ? 274 SER A OG   2  
ATOM 9596  H H    . SER A 1 279 ? -121.093 -22.930  18.516   1.00 0.00 ? 274 SER A H    2  
ATOM 9597  H HA   . SER A 1 279 ? -123.121 -22.632  20.468   1.00 0.00 ? 274 SER A HA   2  
ATOM 9598  H HB2  . SER A 1 279 ? -122.875 -22.610  17.505   1.00 0.00 ? 274 SER A HB2  2  
ATOM 9599  H HB3  . SER A 1 279 ? -124.509 -22.788  18.140   1.00 0.00 ? 274 SER A HB3  2  
ATOM 9600  H HG   . SER A 1 279 ? -122.661 -20.690  18.465   1.00 0.00 ? 274 SER A HG   2  
ATOM 9601  N N    . ARG A 1 280 ? -123.319 -25.462  18.767   1.00 0.00 ? 275 ARG A N    2  
ATOM 9602  C CA   . ARG A 1 280 ? -123.914 -26.828  18.821   1.00 0.00 ? 275 ARG A CA   2  
ATOM 9603  C C    . ARG A 1 280 ? -122.864 -27.844  19.292   1.00 0.00 ? 275 ARG A C    2  
ATOM 9604  O O    . ARG A 1 280 ? -123.149 -29.015  19.449   1.00 0.00 ? 275 ARG A O    2  
ATOM 9605  C CB   . ARG A 1 280 ? -124.350 -27.130  17.384   1.00 0.00 ? 275 ARG A CB   2  
ATOM 9606  C CG   . ARG A 1 280 ? -125.880 -27.119  17.295   1.00 0.00 ? 275 ARG A CG   2  
ATOM 9607  C CD   . ARG A 1 280 ? -126.321 -26.251  16.113   1.00 0.00 ? 275 ARG A CD   2  
ATOM 9608  N NE   . ARG A 1 280 ? -126.316 -27.167  14.940   1.00 0.00 ? 275 ARG A NE   2  
ATOM 9609  C CZ   . ARG A 1 280 ? -127.439 -27.650  14.485   1.00 0.00 ? 275 ARG A CZ   2  
ATOM 9610  N NH1  . ARG A 1 280 ? -127.942 -28.736  15.006   1.00 0.00 ? 275 ARG A NH1  2  
ATOM 9611  N NH2  . ARG A 1 280 ? -128.060 -27.047  13.508   1.00 0.00 ? 275 ARG A NH2  2  
ATOM 9612  H H    . ARG A 1 280 ? -122.695 -25.229  18.048   1.00 0.00 ? 275 ARG A H    2  
ATOM 9613  H HA   . ARG A 1 280 ? -124.770 -26.840  19.477   1.00 0.00 ? 275 ARG A HA   2  
ATOM 9614  H HB2  . ARG A 1 280 ? -123.944 -26.379  16.721   1.00 0.00 ? 275 ARG A HB2  2  
ATOM 9615  H HB3  . ARG A 1 280 ? -123.983 -28.102  17.093   1.00 0.00 ? 275 ARG A HB3  2  
ATOM 9616  H HG2  . ARG A 1 280 ? -126.238 -28.128  17.153   1.00 0.00 ? 275 ARG A HG2  2  
ATOM 9617  H HG3  . ARG A 1 280 ? -126.293 -26.716  18.208   1.00 0.00 ? 275 ARG A HG3  2  
ATOM 9618  H HD2  . ARG A 1 280 ? -127.315 -25.861  16.285   1.00 0.00 ? 275 ARG A HD2  2  
ATOM 9619  H HD3  . ARG A 1 280 ? -125.620 -25.445  15.956   1.00 0.00 ? 275 ARG A HD3  2  
ATOM 9620  H HE   . ARG A 1 280 ? -125.469 -27.408  14.510   1.00 0.00 ? 275 ARG A HE   2  
ATOM 9621  H HH11 . ARG A 1 280 ? -127.466 -29.198  15.754   1.00 0.00 ? 275 ARG A HH11 2  
ATOM 9622  H HH12 . ARG A 1 280 ? -128.802 -29.106  14.656   1.00 0.00 ? 275 ARG A HH12 2  
ATOM 9623  H HH21 . ARG A 1 280 ? -127.676 -26.215  13.109   1.00 0.00 ? 275 ARG A HH21 2  
ATOM 9624  H HH22 . ARG A 1 280 ? -128.921 -27.418  13.159   1.00 0.00 ? 275 ARG A HH22 2  
ATOM 9625  N N    . HIS A 1 281 ? -121.653 -27.402  19.519   1.00 0.00 ? 276 HIS A N    2  
ATOM 9626  C CA   . HIS A 1 281 ? -120.586 -28.337  19.980   1.00 0.00 ? 276 HIS A CA   2  
ATOM 9627  C C    . HIS A 1 281 ? -120.159 -27.992  21.411   1.00 0.00 ? 276 HIS A C    2  
ATOM 9628  O O    . HIS A 1 281 ? -119.160 -28.482  21.901   1.00 0.00 ? 276 HIS A O    2  
ATOM 9629  C CB   . HIS A 1 281 ? -119.425 -28.119  19.008   1.00 0.00 ? 276 HIS A CB   2  
ATOM 9630  C CG   . HIS A 1 281 ? -119.809 -28.631  17.647   1.00 0.00 ? 276 HIS A CG   2  
ATOM 9631  N ND1  . HIS A 1 281 ? -119.154 -29.696  17.046   1.00 0.00 ? 276 HIS A ND1  2  
ATOM 9632  C CD2  . HIS A 1 281 ? -120.777 -28.237  16.757   1.00 0.00 ? 276 HIS A CD2  2  
ATOM 9633  C CE1  . HIS A 1 281 ? -119.732 -29.903  15.849   1.00 0.00 ? 276 HIS A CE1  2  
ATOM 9634  N NE2  . HIS A 1 281 ? -120.727 -29.041  15.622   1.00 0.00 ? 276 HIS A NE2  2  
ATOM 9635  H H    . HIS A 1 281 ? -121.443 -26.455  19.388   1.00 0.00 ? 276 HIS A H    2  
ATOM 9636  H HA   . HIS A 1 281 ? -120.928 -29.358  19.923   1.00 0.00 ? 276 HIS A HA   2  
ATOM 9637  H HB2  . HIS A 1 281 ? -119.200 -27.063  18.946   1.00 0.00 ? 276 HIS A HB2  2  
ATOM 9638  H HB3  . HIS A 1 281 ? -118.555 -28.652  19.361   1.00 0.00 ? 276 HIS A HB3  2  
ATOM 9639  H HD1  . HIS A 1 281 ? -118.407 -30.205  17.425   1.00 0.00 ? 276 HIS A HD1  2  
ATOM 9640  H HD2  . HIS A 1 281 ? -121.472 -27.425  16.914   1.00 0.00 ? 276 HIS A HD2  2  
ATOM 9641  H HE1  . HIS A 1 281 ? -119.428 -30.673  15.155   1.00 0.00 ? 276 HIS A HE1  2  
ATOM 9642  N N    . GLN A 1 282 ? -120.905 -27.152  22.086   1.00 0.00 ? 277 GLN A N    2  
ATOM 9643  C CA   . GLN A 1 282 ? -120.538 -26.777  23.486   1.00 0.00 ? 277 GLN A CA   2  
ATOM 9644  C C    . GLN A 1 282 ? -120.311 -28.033  24.336   1.00 0.00 ? 277 GLN A C    2  
ATOM 9645  O O    . GLN A 1 282 ? -119.582 -28.012  25.308   1.00 0.00 ? 277 GLN A O    2  
ATOM 9646  C CB   . GLN A 1 282 ? -121.737 -25.984  24.013   1.00 0.00 ? 277 GLN A CB   2  
ATOM 9647  C CG   . GLN A 1 282 ? -121.378 -24.498  24.087   1.00 0.00 ? 277 GLN A CG   2  
ATOM 9648  C CD   . GLN A 1 282 ? -122.659 -23.662  24.059   1.00 0.00 ? 277 GLN A CD   2  
ATOM 9649  O OE1  . GLN A 1 282 ? -123.140 -23.232  25.089   1.00 0.00 ? 277 GLN A OE1  2  
ATOM 9650  N NE2  . GLN A 1 282 ? -123.236 -23.411  22.916   1.00 0.00 ? 277 GLN A NE2  2  
ATOM 9651  H H    . GLN A 1 282 ? -121.706 -26.766  21.672   1.00 0.00 ? 277 GLN A H    2  
ATOM 9652  H HA   . GLN A 1 282 ? -119.655 -26.157  23.490   1.00 0.00 ? 277 GLN A HA   2  
ATOM 9653  H HB2  . GLN A 1 282 ? -122.578 -26.120  23.348   1.00 0.00 ? 277 GLN A HB2  2  
ATOM 9654  H HB3  . GLN A 1 282 ? -121.997 -26.338  24.999   1.00 0.00 ? 277 GLN A HB3  2  
ATOM 9655  H HG2  . GLN A 1 282 ? -120.840 -24.303  25.003   1.00 0.00 ? 277 GLN A HG2  2  
ATOM 9656  H HG3  . GLN A 1 282 ? -120.760 -24.234  23.243   1.00 0.00 ? 277 GLN A HG3  2  
ATOM 9657  H HE21 . GLN A 1 282 ? -122.848 -23.758  22.085   1.00 0.00 ? 277 GLN A HE21 2  
ATOM 9658  H HE22 . GLN A 1 282 ? -124.057 -22.877  22.888   1.00 0.00 ? 277 GLN A HE22 2  
ATOM 9659  N N    . GLU A 1 283 ? -120.930 -29.126  23.973   1.00 0.00 ? 278 GLU A N    2  
ATOM 9660  C CA   . GLU A 1 283 ? -120.749 -30.384  24.758   1.00 0.00 ? 278 GLU A CA   2  
ATOM 9661  C C    . GLU A 1 283 ? -119.275 -30.799  24.755   1.00 0.00 ? 278 GLU A C    2  
ATOM 9662  O O    . GLU A 1 283 ? -118.721 -31.160  25.775   1.00 0.00 ? 278 GLU A O    2  
ATOM 9663  C CB   . GLU A 1 283 ? -121.602 -31.429  24.037   1.00 0.00 ? 278 GLU A CB   2  
ATOM 9664  C CG   . GLU A 1 283 ? -122.267 -32.345  25.067   1.00 0.00 ? 278 GLU A CG   2  
ATOM 9665  C CD   . GLU A 1 283 ? -122.490 -33.728  24.451   1.00 0.00 ? 278 GLU A CD   2  
ATOM 9666  O OE1  . GLU A 1 283 ? -123.276 -33.822  23.523   1.00 0.00 ? 278 GLU A OE1  2  
ATOM 9667  O OE2  . GLU A 1 283 ? -121.870 -34.670  24.919   1.00 0.00 ? 278 GLU A OE2  2  
ATOM 9668  H H    . GLU A 1 283 ? -121.512 -29.120  23.185   1.00 0.00 ? 278 GLU A H    2  
ATOM 9669  H HA   . GLU A 1 283 ? -121.102 -30.252  25.768   1.00 0.00 ? 278 GLU A HA   2  
ATOM 9670  H HB2  . GLU A 1 283 ? -122.361 -30.931  23.452   1.00 0.00 ? 278 GLU A HB2  2  
ATOM 9671  H HB3  . GLU A 1 283 ? -120.974 -32.018  23.386   1.00 0.00 ? 278 GLU A HB3  2  
ATOM 9672  H HG2  . GLU A 1 283 ? -121.629 -32.434  25.934   1.00 0.00 ? 278 GLU A HG2  2  
ATOM 9673  H HG3  . GLU A 1 283 ? -123.218 -31.927  25.360   1.00 0.00 ? 278 GLU A HG3  2  
ATOM 9674  N N    . GLN A 1 284 ? -118.638 -30.748  23.616   1.00 0.00 ? 279 GLN A N    2  
ATOM 9675  C CA   . GLN A 1 284 ? -117.199 -31.137  23.546   1.00 0.00 ? 279 GLN A CA   2  
ATOM 9676  C C    . GLN A 1 284 ? -116.317 -29.972  24.002   1.00 0.00 ? 279 GLN A C    2  
ATOM 9677  O O    . GLN A 1 284 ? -115.309 -30.163  24.654   1.00 0.00 ? 279 GLN A O    2  
ATOM 9678  C CB   . GLN A 1 284 ? -116.946 -31.460  22.072   1.00 0.00 ? 279 GLN A CB   2  
ATOM 9679  C CG   . GLN A 1 284 ? -117.552 -32.825  21.735   1.00 0.00 ? 279 GLN A CG   2  
ATOM 9680  C CD   . GLN A 1 284 ? -116.588 -33.609  20.843   1.00 0.00 ? 279 GLN A CD   2  
ATOM 9681  O OE1  . GLN A 1 284 ? -115.697 -34.276  21.330   1.00 0.00 ? 279 GLN A OE1  2  
ATOM 9682  N NE2  . GLN A 1 284 ? -116.730 -33.558  19.547   1.00 0.00 ? 279 GLN A NE2  2  
ATOM 9683  H H    . GLN A 1 284 ? -119.105 -30.452  22.807   1.00 0.00 ? 279 GLN A H    2  
ATOM 9684  H HA   . GLN A 1 284 ? -117.015 -32.010  24.152   1.00 0.00 ? 279 GLN A HA   2  
ATOM 9685  H HB2  . GLN A 1 284 ? -117.403 -30.700  21.454   1.00 0.00 ? 279 GLN A HB2  2  
ATOM 9686  H HB3  . GLN A 1 284 ? -115.883 -31.484  21.887   1.00 0.00 ? 279 GLN A HB3  2  
ATOM 9687  H HG2  . GLN A 1 284 ? -117.728 -33.377  22.648   1.00 0.00 ? 279 GLN A HG2  2  
ATOM 9688  H HG3  . GLN A 1 284 ? -118.488 -32.685  21.215   1.00 0.00 ? 279 GLN A HG3  2  
ATOM 9689  H HE21 . GLN A 1 284 ? -117.449 -33.021  19.153   1.00 0.00 ? 279 GLN A HE21 2  
ATOM 9690  H HE22 . GLN A 1 284 ? -116.118 -34.057  18.966   1.00 0.00 ? 279 GLN A HE22 2  
ATOM 9691  N N    . PHE A 1 285 ? -116.693 -28.766  23.667   1.00 0.00 ? 280 PHE A N    2  
ATOM 9692  C CA   . PHE A 1 285 ? -115.879 -27.586  24.085   1.00 0.00 ? 280 PHE A CA   2  
ATOM 9693  C C    . PHE A 1 285 ? -115.839 -27.494  25.613   1.00 0.00 ? 280 PHE A C    2  
ATOM 9694  O O    . PHE A 1 285 ? -114.787 -27.375  26.210   1.00 0.00 ? 280 PHE A O    2  
ATOM 9695  C CB   . PHE A 1 285 ? -116.599 -26.373  23.487   1.00 0.00 ? 280 PHE A CB   2  
ATOM 9696  C CG   . PHE A 1 285 ? -115.864 -25.106  23.860   1.00 0.00 ? 280 PHE A CG   2  
ATOM 9697  C CD1  . PHE A 1 285 ? -115.993 -24.575  25.149   1.00 0.00 ? 280 PHE A CD1  2  
ATOM 9698  C CD2  . PHE A 1 285 ? -115.055 -24.462  22.916   1.00 0.00 ? 280 PHE A CD2  2  
ATOM 9699  C CE1  . PHE A 1 285 ? -115.314 -23.401  25.495   1.00 0.00 ? 280 PHE A CE1  2  
ATOM 9700  C CE2  . PHE A 1 285 ? -114.375 -23.287  23.262   1.00 0.00 ? 280 PHE A CE2  2  
ATOM 9701  C CZ   . PHE A 1 285 ? -114.505 -22.757  24.551   1.00 0.00 ? 280 PHE A CZ   2  
ATOM 9702  H H    . PHE A 1 285 ? -117.512 -28.637  23.143   1.00 0.00 ? 280 PHE A H    2  
ATOM 9703  H HA   . PHE A 1 285 ? -114.880 -27.657  23.685   1.00 0.00 ? 280 PHE A HA   2  
ATOM 9704  H HB2  . PHE A 1 285 ? -116.628 -26.466  22.410   1.00 0.00 ? 280 PHE A HB2  2  
ATOM 9705  H HB3  . PHE A 1 285 ? -117.608 -26.328  23.870   1.00 0.00 ? 280 PHE A HB3  2  
ATOM 9706  H HD1  . PHE A 1 285 ? -116.616 -25.073  25.878   1.00 0.00 ? 280 PHE A HD1  2  
ATOM 9707  H HD2  . PHE A 1 285 ? -114.955 -24.871  21.922   1.00 0.00 ? 280 PHE A HD2  2  
ATOM 9708  H HE1  . PHE A 1 285 ? -115.414 -22.992  26.489   1.00 0.00 ? 280 PHE A HE1  2  
ATOM 9709  H HE2  . PHE A 1 285 ? -113.751 -22.790  22.534   1.00 0.00 ? 280 PHE A HE2  2  
ATOM 9710  H HZ   . PHE A 1 285 ? -113.981 -21.851  24.818   1.00 0.00 ? 280 PHE A HZ   2  
ATOM 9711  N N    . ILE A 1 286 ? -116.979 -27.549  26.249   1.00 0.00 ? 281 ILE A N    2  
ATOM 9712  C CA   . ILE A 1 286 ? -117.011 -27.465  27.739   1.00 0.00 ? 281 ILE A CA   2  
ATOM 9713  C C    . ILE A 1 286 ? -116.400 -28.729  28.352   1.00 0.00 ? 281 ILE A C    2  
ATOM 9714  O O    . ILE A 1 286 ? -115.696 -28.671  29.342   1.00 0.00 ? 281 ILE A O    2  
ATOM 9715  C CB   . ILE A 1 286 ? -118.494 -27.351  28.099   1.00 0.00 ? 281 ILE A CB   2  
ATOM 9716  C CG1  . ILE A 1 286 ? -119.067 -26.072  27.483   1.00 0.00 ? 281 ILE A CG1  2  
ATOM 9717  C CG2  . ILE A 1 286 ? -118.652 -27.297  29.621   1.00 0.00 ? 281 ILE A CG2  2  
ATOM 9718  C CD1  . ILE A 1 286 ? -120.577 -26.017  27.724   1.00 0.00 ? 281 ILE A CD1  2  
ATOM 9719  H H    . ILE A 1 286 ? -117.815 -27.646  25.746   1.00 0.00 ? 281 ILE A H    2  
ATOM 9720  H HA   . ILE A 1 286 ? -116.482 -26.589  28.078   1.00 0.00 ? 281 ILE A HA   2  
ATOM 9721  H HB   . ILE A 1 286 ? -119.026 -28.209  27.713   1.00 0.00 ? 281 ILE A HB   2  
ATOM 9722  H HG12 . ILE A 1 286 ? -118.598 -25.212  27.939   1.00 0.00 ? 281 ILE A HG12 2  
ATOM 9723  H HG13 . ILE A 1 286 ? -118.874 -26.066  26.421   1.00 0.00 ? 281 ILE A HG13 2  
ATOM 9724  H HG21 . ILE A 1 286 ? -119.556 -26.762  29.871   1.00 0.00 ? 281 ILE A HG21 2  
ATOM 9725  H HG22 . ILE A 1 286 ? -117.803 -26.790  30.053   1.00 0.00 ? 281 ILE A HG22 2  
ATOM 9726  H HG23 . ILE A 1 286 ? -118.709 -28.302  30.013   1.00 0.00 ? 281 ILE A HG23 2  
ATOM 9727  H HD11 . ILE A 1 286 ? -121.056 -25.518  26.895   1.00 0.00 ? 281 ILE A HD11 2  
ATOM 9728  H HD12 . ILE A 1 286 ? -120.776 -25.473  28.636   1.00 0.00 ? 281 ILE A HD12 2  
ATOM 9729  H HD13 . ILE A 1 286 ? -120.964 -27.021  27.812   1.00 0.00 ? 281 ILE A HD13 2  
ATOM 9730  N N    . GLN A 1 287 ? -116.661 -29.870  27.770   1.00 0.00 ? 282 GLN A N    2  
ATOM 9731  C CA   . GLN A 1 287 ? -116.091 -31.137  28.319   1.00 0.00 ? 282 GLN A CA   2  
ATOM 9732  C C    . GLN A 1 287 ? -114.561 -31.067  28.332   1.00 0.00 ? 282 GLN A C    2  
ATOM 9733  O O    . GLN A 1 287 ? -113.906 -31.772  29.074   1.00 0.00 ? 282 GLN A O    2  
ATOM 9734  C CB   . GLN A 1 287 ? -116.568 -32.235  27.368   1.00 0.00 ? 282 GLN A CB   2  
ATOM 9735  C CG   . GLN A 1 287 ? -117.913 -32.781  27.850   1.00 0.00 ? 282 GLN A CG   2  
ATOM 9736  C CD   . GLN A 1 287 ? -117.709 -33.577  29.140   1.00 0.00 ? 282 GLN A CD   2  
ATOM 9737  O OE1  . GLN A 1 287 ? -116.789 -34.364  29.243   1.00 0.00 ? 282 GLN A OE1  2  
ATOM 9738  N NE2  . GLN A 1 287 ? -118.536 -33.405  30.136   1.00 0.00 ? 282 GLN A NE2  2  
ATOM 9739  H H    . GLN A 1 287 ? -117.230 -29.893  26.972   1.00 0.00 ? 282 GLN A H    2  
ATOM 9740  H HA   . GLN A 1 287 ? -116.469 -31.320  29.312   1.00 0.00 ? 282 GLN A HA   2  
ATOM 9741  H HB2  . GLN A 1 287 ? -116.679 -31.827  26.373   1.00 0.00 ? 282 GLN A HB2  2  
ATOM 9742  H HB3  . GLN A 1 287 ? -115.843 -33.035  27.350   1.00 0.00 ? 282 GLN A HB3  2  
ATOM 9743  H HG2  . GLN A 1 287 ? -118.589 -31.959  28.036   1.00 0.00 ? 282 GLN A HG2  2  
ATOM 9744  H HG3  . GLN A 1 287 ? -118.332 -33.428  27.093   1.00 0.00 ? 282 GLN A HG3  2  
ATOM 9745  H HE21 . GLN A 1 287 ? -119.278 -32.771  30.052   1.00 0.00 ? 282 GLN A HE21 2  
ATOM 9746  H HE22 . GLN A 1 287 ? -118.413 -33.910  30.967   1.00 0.00 ? 282 GLN A HE22 2  
ATOM 9747  N N    . MET A 1 288 ? -113.989 -30.220  27.518   1.00 0.00 ? 283 MET A N    2  
ATOM 9748  C CA   . MET A 1 288 ? -112.503 -30.102  27.483   1.00 0.00 ? 283 MET A CA   2  
ATOM 9749  C C    . MET A 1 288 ? -112.040 -28.976  28.412   1.00 0.00 ? 283 MET A C    2  
ATOM 9750  O O    . MET A 1 288 ? -110.928 -28.981  28.902   1.00 0.00 ? 283 MET A O    2  
ATOM 9751  C CB   . MET A 1 288 ? -112.167 -29.772  26.028   1.00 0.00 ? 283 MET A CB   2  
ATOM 9752  C CG   . MET A 1 288 ? -111.906 -31.069  25.257   1.00 0.00 ? 283 MET A CG   2  
ATOM 9753  S SD   . MET A 1 288 ? -112.560 -30.919  23.575   1.00 0.00 ? 283 MET A SD   2  
ATOM 9754  C CE   . MET A 1 288 ? -111.430 -29.624  23.007   1.00 0.00 ? 283 MET A CE   2  
ATOM 9755  H H    . MET A 1 288 ? -114.537 -29.660  26.929   1.00 0.00 ? 283 MET A H    2  
ATOM 9756  H HA   . MET A 1 288 ? -112.044 -31.036  27.764   1.00 0.00 ? 283 MET A HA   2  
ATOM 9757  H HB2  . MET A 1 288 ? -112.997 -29.245  25.579   1.00 0.00 ? 283 MET A HB2  2  
ATOM 9758  H HB3  . MET A 1 288 ? -111.285 -29.151  25.993   1.00 0.00 ? 283 MET A HB3  2  
ATOM 9759  H HG2  . MET A 1 288 ? -110.843 -31.253  25.214   1.00 0.00 ? 283 MET A HG2  2  
ATOM 9760  H HG3  . MET A 1 288 ? -112.393 -31.891  25.760   1.00 0.00 ? 283 MET A HG3  2  
ATOM 9761  H HE1  . MET A 1 288 ? -111.446 -29.583  21.927   1.00 0.00 ? 283 MET A HE1  2  
ATOM 9762  H HE2  . MET A 1 288 ? -110.430 -29.846  23.342   1.00 0.00 ? 283 MET A HE2  2  
ATOM 9763  H HE3  . MET A 1 288 ? -111.742 -28.672  23.414   1.00 0.00 ? 283 MET A HE3  2  
ATOM 9764  N N    . LEU A 1 289 ? -112.887 -28.011  28.658   1.00 0.00 ? 284 LEU A N    2  
ATOM 9765  C CA   . LEU A 1 289 ? -112.500 -26.885  29.556   1.00 0.00 ? 284 LEU A CA   2  
ATOM 9766  C C    . LEU A 1 289 ? -112.537 -27.339  31.018   1.00 0.00 ? 284 LEU A C    2  
ATOM 9767  O O    . LEU A 1 289 ? -111.690 -26.979  31.812   1.00 0.00 ? 284 LEU A O    2  
ATOM 9768  C CB   . LEU A 1 289 ? -113.548 -25.799  29.305   1.00 0.00 ? 284 LEU A CB   2  
ATOM 9769  C CG   . LEU A 1 289 ? -112.888 -24.421  29.385   1.00 0.00 ? 284 LEU A CG   2  
ATOM 9770  C CD1  . LEU A 1 289 ? -111.881 -24.267  28.243   1.00 0.00 ? 284 LEU A CD1  2  
ATOM 9771  C CD2  . LEU A 1 289 ? -113.962 -23.337  29.267   1.00 0.00 ? 284 LEU A CD2  2  
ATOM 9772  H H    . LEU A 1 289 ? -113.779 -28.028  28.252   1.00 0.00 ? 284 LEU A H    2  
ATOM 9773  H HA   . LEU A 1 289 ? -111.519 -26.517  29.299   1.00 0.00 ? 284 LEU A HA   2  
ATOM 9774  H HB2  . LEU A 1 289 ? -113.979 -25.936  28.324   1.00 0.00 ? 284 LEU A HB2  2  
ATOM 9775  H HB3  . LEU A 1 289 ? -114.324 -25.868  30.052   1.00 0.00 ? 284 LEU A HB3  2  
ATOM 9776  H HG   . LEU A 1 289 ? -112.376 -24.322  30.332   1.00 0.00 ? 284 LEU A HG   2  
ATOM 9777  H HD11 . LEU A 1 289 ? -111.781 -23.223  27.990   1.00 0.00 ? 284 LEU A HD11 2  
ATOM 9778  H HD12 . LEU A 1 289 ? -112.229 -24.815  27.380   1.00 0.00 ? 284 LEU A HD12 2  
ATOM 9779  H HD13 . LEU A 1 289 ? -110.923 -24.656  28.554   1.00 0.00 ? 284 LEU A HD13 2  
ATOM 9780  H HD21 . LEU A 1 289 ? -113.616 -22.434  29.748   1.00 0.00 ? 284 LEU A HD21 2  
ATOM 9781  H HD22 . LEU A 1 289 ? -114.869 -23.674  29.745   1.00 0.00 ? 284 LEU A HD22 2  
ATOM 9782  H HD23 . LEU A 1 289 ? -114.158 -23.136  28.224   1.00 0.00 ? 284 LEU A HD23 2  
ATOM 9783  N N    . ASN A 1 290 ? -113.514 -28.129  31.378   1.00 0.00 ? 285 ASN A N    2  
ATOM 9784  C CA   . ASN A 1 290 ? -113.610 -28.609  32.787   1.00 0.00 ? 285 ASN A CA   2  
ATOM 9785  C C    . ASN A 1 290 ? -112.752 -29.863  32.979   1.00 0.00 ? 285 ASN A C    2  
ATOM 9786  O O    . ASN A 1 290 ? -112.225 -30.107  34.047   1.00 0.00 ? 285 ASN A O    2  
ATOM 9787  C CB   . ASN A 1 290 ? -115.089 -28.935  32.995   1.00 0.00 ? 285 ASN A CB   2  
ATOM 9788  C CG   . ASN A 1 290 ? -115.822 -27.690  33.498   1.00 0.00 ? 285 ASN A CG   2  
ATOM 9789  O OD1  . ASN A 1 290 ? -115.998 -27.513  34.687   1.00 0.00 ? 285 ASN A OD1  2  
ATOM 9790  N ND2  . ASN A 1 290 ? -116.261 -26.814  32.636   1.00 0.00 ? 285 ASN A ND2  2  
ATOM 9791  H H    . ASN A 1 290 ? -114.186 -28.407  30.720   1.00 0.00 ? 285 ASN A H    2  
ATOM 9792  H HA   . ASN A 1 290 ? -113.303 -27.834  33.471   1.00 0.00 ? 285 ASN A HA   2  
ATOM 9793  H HB2  . ASN A 1 290 ? -115.522 -29.256  32.059   1.00 0.00 ? 285 ASN A HB2  2  
ATOM 9794  H HB3  . ASN A 1 290 ? -115.184 -29.725  33.725   1.00 0.00 ? 285 ASN A HB3  2  
ATOM 9795  H HD21 . ASN A 1 290 ? -116.119 -26.956  31.677   1.00 0.00 ? 285 ASN A HD21 2  
ATOM 9796  H HD22 . ASN A 1 290 ? -116.731 -26.013  32.948   1.00 0.00 ? 285 ASN A HD22 2  
ATOM 9797  N N    . GLU A 1 291 ? -112.611 -30.660  31.953   1.00 0.00 ? 286 GLU A N    2  
ATOM 9798  C CA   . GLU A 1 291 ? -111.789 -31.899  32.076   1.00 0.00 ? 286 GLU A CA   2  
ATOM 9799  C C    . GLU A 1 291 ? -110.980 -32.129  30.791   1.00 0.00 ? 286 GLU A C    2  
ATOM 9800  O O    . GLU A 1 291 ? -111.546 -32.378  29.745   1.00 0.00 ? 286 GLU A O    2  
ATOM 9801  C CB   . GLU A 1 291 ? -112.803 -33.026  32.276   1.00 0.00 ? 286 GLU A CB   2  
ATOM 9802  C CG   . GLU A 1 291 ? -113.297 -33.017  33.724   1.00 0.00 ? 286 GLU A CG   2  
ATOM 9803  C CD   . GLU A 1 291 ? -114.325 -34.134  33.920   1.00 0.00 ? 286 GLU A CD   2  
ATOM 9804  O OE1  . GLU A 1 291 ? -114.025 -35.258  33.554   1.00 0.00 ? 286 GLU A OE1  2  
ATOM 9805  O OE2  . GLU A 1 291 ? -115.393 -33.845  34.433   1.00 0.00 ? 286 GLU A OE2  2  
ATOM 9806  H H    . GLU A 1 291 ? -113.046 -30.443  31.102   1.00 0.00 ? 286 GLU A H    2  
ATOM 9807  H HA   . GLU A 1 291 ? -111.137 -31.836  32.931   1.00 0.00 ? 286 GLU A HA   2  
ATOM 9808  H HB2  . GLU A 1 291 ? -113.640 -32.880  31.608   1.00 0.00 ? 286 GLU A HB2  2  
ATOM 9809  H HB3  . GLU A 1 291 ? -112.334 -33.975  32.064   1.00 0.00 ? 286 GLU A HB3  2  
ATOM 9810  H HG2  . GLU A 1 291 ? -112.461 -33.175  34.390   1.00 0.00 ? 286 GLU A HG2  2  
ATOM 9811  H HG3  . GLU A 1 291 ? -113.757 -32.065  33.942   1.00 0.00 ? 286 GLU A HG3  2  
ATOM 9812  N N    . PRO A 1 292 ? -109.677 -32.038  30.907   1.00 0.00 ? 287 PRO A N    2  
ATOM 9813  C CA   . PRO A 1 292 ? -108.799 -32.242  29.729   1.00 0.00 ? 287 PRO A CA   2  
ATOM 9814  C C    . PRO A 1 292 ? -108.752 -33.729  29.349   1.00 0.00 ? 287 PRO A C    2  
ATOM 9815  O O    . PRO A 1 292 ? -108.521 -34.571  30.194   1.00 0.00 ? 287 PRO A O    2  
ATOM 9816  C CB   . PRO A 1 292 ? -107.432 -31.763  30.212   1.00 0.00 ? 287 PRO A CB   2  
ATOM 9817  C CG   . PRO A 1 292 ? -107.472 -31.914  31.699   1.00 0.00 ? 287 PRO A CG   2  
ATOM 9818  C CD   . PRO A 1 292 ? -108.907 -31.741  32.123   1.00 0.00 ? 287 PRO A CD   2  
ATOM 9819  H HA   . PRO A 1 292 ? -109.129 -31.640  28.899   1.00 0.00 ? 287 PRO A HA   2  
ATOM 9820  H HB2  . PRO A 1 292 ? -106.649 -32.378  29.789   1.00 0.00 ? 287 PRO A HB2  2  
ATOM 9821  H HB3  . PRO A 1 292 ? -107.282 -30.727  29.951   1.00 0.00 ? 287 PRO A HB3  2  
ATOM 9822  H HG2  . PRO A 1 292 ? -107.118 -32.898  31.978   1.00 0.00 ? 287 PRO A HG2  2  
ATOM 9823  H HG3  . PRO A 1 292 ? -106.861 -31.156  32.164   1.00 0.00 ? 287 PRO A HG3  2  
ATOM 9824  H HD2  . PRO A 1 292 ? -109.154 -32.439  32.912   1.00 0.00 ? 287 PRO A HD2  2  
ATOM 9825  H HD3  . PRO A 1 292 ? -109.089 -30.727  32.441   1.00 0.00 ? 287 PRO A HD3  2  
ATOM 9826  N N    . PRO A 1 293 ? -108.972 -34.009  28.087   1.00 0.00 ? 288 PRO A N    2  
ATOM 9827  C CA   . PRO A 1 293 ? -108.949 -35.414  27.612   1.00 0.00 ? 288 PRO A CA   2  
ATOM 9828  C C    . PRO A 1 293 ? -107.512 -35.940  27.567   1.00 0.00 ? 288 PRO A C    2  
ATOM 9829  O O    . PRO A 1 293 ? -107.265 -37.116  27.746   1.00 0.00 ? 288 PRO A O    2  
ATOM 9830  C CB   . PRO A 1 293 ? -109.541 -35.330  26.208   1.00 0.00 ? 288 PRO A CB   2  
ATOM 9831  C CG   . PRO A 1 293 ? -109.283 -33.926  25.761   1.00 0.00 ? 288 PRO A CG   2  
ATOM 9832  C CD   . PRO A 1 293 ? -109.257 -33.064  26.998   1.00 0.00 ? 288 PRO A CD   2  
ATOM 9833  H HA   . PRO A 1 293 ? -109.566 -36.039  28.238   1.00 0.00 ? 288 PRO A HA   2  
ATOM 9834  H HB2  . PRO A 1 293 ? -109.048 -36.033  25.551   1.00 0.00 ? 288 PRO A HB2  2  
ATOM 9835  H HB3  . PRO A 1 293 ? -110.603 -35.519  26.236   1.00 0.00 ? 288 PRO A HB3  2  
ATOM 9836  H HG2  . PRO A 1 293 ? -108.331 -33.873  25.251   1.00 0.00 ? 288 PRO A HG2  2  
ATOM 9837  H HG3  . PRO A 1 293 ? -110.074 -33.596  25.106   1.00 0.00 ? 288 PRO A HG3  2  
ATOM 9838  H HD2  . PRO A 1 293 ? -108.475 -32.320  26.922   1.00 0.00 ? 288 PRO A HD2  2  
ATOM 9839  H HD3  . PRO A 1 293 ? -110.216 -32.596  27.154   1.00 0.00 ? 288 PRO A HD3  2  
ATOM 9840  N N    . GLY A 1 294 ? -106.562 -35.074  27.330   1.00 0.00 ? 289 GLY A N    2  
ATOM 9841  C CA   . GLY A 1 294 ? -105.140 -35.520  27.273   1.00 0.00 ? 289 GLY A CA   2  
ATOM 9842  C C    . GLY A 1 294 ? -104.695 -35.990  28.659   1.00 0.00 ? 289 GLY A C    2  
ATOM 9843  O O    . GLY A 1 294 ? -104.652 -35.222  29.601   1.00 0.00 ? 289 GLY A O    2  
ATOM 9844  H H    . GLY A 1 294 ? -106.785 -34.130  27.190   1.00 0.00 ? 289 GLY A H    2  
ATOM 9845  H HA2  . GLY A 1 294 ? -105.046 -36.333  26.568   1.00 0.00 ? 289 GLY A HA2  2  
ATOM 9846  H HA3  . GLY A 1 294 ? -104.517 -34.696  26.959   1.00 0.00 ? 289 GLY A HA3  2  
ATOM 9847  N N    . GLU A 1 295 ? -104.363 -37.246  28.791   1.00 0.00 ? 290 GLU A N    2  
ATOM 9848  C CA   . GLU A 1 295 ? -103.920 -37.768  30.117   1.00 0.00 ? 290 GLU A CA   2  
ATOM 9849  C C    . GLU A 1 295 ? -102.413 -38.037  30.103   1.00 0.00 ? 290 GLU A C    2  
ATOM 9850  O O    . GLU A 1 295 ? -101.860 -38.470  29.110   1.00 0.00 ? 290 GLU A O    2  
ATOM 9851  C CB   . GLU A 1 295 ? -104.696 -39.071  30.311   1.00 0.00 ? 290 GLU A CB   2  
ATOM 9852  C CG   . GLU A 1 295 ? -106.193 -38.767  30.402   1.00 0.00 ? 290 GLU A CG   2  
ATOM 9853  C CD   . GLU A 1 295 ? -106.850 -39.725  31.398   1.00 0.00 ? 290 GLU A CD   2  
ATOM 9854  O OE1  . GLU A 1 295 ? -106.551 -40.907  31.338   1.00 0.00 ? 290 GLU A OE1  2  
ATOM 9855  O OE2  . GLU A 1 295 ? -107.640 -39.261  32.204   1.00 0.00 ? 290 GLU A OE2  2  
ATOM 9856  H H    . GLU A 1 295 ? -104.405 -37.847  28.018   1.00 0.00 ? 290 GLU A H    2  
ATOM 9857  H HA   . GLU A 1 295 ? -104.171 -37.070  30.900   1.00 0.00 ? 290 GLU A HA   2  
ATOM 9858  H HB2  . GLU A 1 295 ? -104.511 -39.727  29.472   1.00 0.00 ? 290 GLU A HB2  2  
ATOM 9859  H HB3  . GLU A 1 295 ? -104.371 -39.551  31.222   1.00 0.00 ? 290 GLU A HB3  2  
ATOM 9860  H HG2  . GLU A 1 295 ? -106.334 -37.749  30.735   1.00 0.00 ? 290 GLU A HG2  2  
ATOM 9861  H HG3  . GLU A 1 295 ? -106.646 -38.895  29.431   1.00 0.00 ? 290 GLU A HG3  2  
ATOM 9862  N N    . LEU A 1 296 ? -101.746 -37.785  31.197   1.00 0.00 ? 291 LEU A N    2  
ATOM 9863  C CA   . LEU A 1 296 ? -100.275 -38.025  31.251   1.00 0.00 ? 291 LEU A CA   2  
ATOM 9864  C C    . LEU A 1 296 ? -99.788  -38.005  32.702   1.00 0.00 ? 291 LEU A C    2  
ATOM 9865  O O    . LEU A 1 296 ? -98.974  -38.813  33.104   1.00 0.00 ? 291 LEU A O    2  
ATOM 9866  C CB   . LEU A 1 296 ? -99.657  -36.869  30.463   1.00 0.00 ? 291 LEU A CB   2  
ATOM 9867  C CG   . LEU A 1 296 ? -98.157  -37.112  30.287   1.00 0.00 ? 291 LEU A CG   2  
ATOM 9868  C CD1  . LEU A 1 296 ? -97.921  -37.986  29.054   1.00 0.00 ? 291 LEU A CD1  2  
ATOM 9869  C CD2  . LEU A 1 296 ? -97.443  -35.771  30.104   1.00 0.00 ? 291 LEU A CD2  2  
ATOM 9870  H H    . LEU A 1 296 ? -102.214 -37.436  31.985   1.00 0.00 ? 291 LEU A H    2  
ATOM 9871  H HA   . LEU A 1 296 ? -100.028 -38.964  30.782   1.00 0.00 ? 291 LEU A HA   2  
ATOM 9872  H HB2  . LEU A 1 296 ? -100.128 -36.803  29.492   1.00 0.00 ? 291 LEU A HB2  2  
ATOM 9873  H HB3  . LEU A 1 296 ? -99.809  -35.945  31.000   1.00 0.00 ? 291 LEU A HB3  2  
ATOM 9874  H HG   . LEU A 1 296 ? -97.769  -37.613  31.162   1.00 0.00 ? 291 LEU A HG   2  
ATOM 9875  H HD11 . LEU A 1 296 ? -98.589  -38.834  29.080   1.00 0.00 ? 291 LEU A HD11 2  
ATOM 9876  H HD12 . LEU A 1 296 ? -96.899  -38.333  29.048   1.00 0.00 ? 291 LEU A HD12 2  
ATOM 9877  H HD13 . LEU A 1 296 ? -98.110  -37.407  28.162   1.00 0.00 ? 291 LEU A HD13 2  
ATOM 9878  H HD21 . LEU A 1 296 ? -97.884  -35.239  29.274   1.00 0.00 ? 291 LEU A HD21 2  
ATOM 9879  H HD22 . LEU A 1 296 ? -96.396  -35.945  29.905   1.00 0.00 ? 291 LEU A HD22 2  
ATOM 9880  H HD23 . LEU A 1 296 ? -97.545  -35.183  31.004   1.00 0.00 ? 291 LEU A HD23 2  
ATOM 9881  N N    . ALA A 1 297 ? -100.282 -37.088  33.490   1.00 0.00 ? 292 ALA A N    2  
ATOM 9882  C CA   . ALA A 1 297 ? -99.849  -37.014  34.916   1.00 0.00 ? 292 ALA A CA   2  
ATOM 9883  C C    . ALA A 1 297 ? -100.868 -36.219  35.738   1.00 0.00 ? 292 ALA A C    2  
ATOM 9884  O O    . ALA A 1 297 ? -100.516 -35.507  36.658   1.00 0.00 ? 292 ALA A O    2  
ATOM 9885  C CB   . ALA A 1 297 ? -98.504  -36.289  34.884   1.00 0.00 ? 292 ALA A CB   2  
ATOM 9886  H H    . ALA A 1 297 ? -100.937 -36.447  33.144   1.00 0.00 ? 292 ALA A H    2  
ATOM 9887  H HA   . ALA A 1 297 ? -99.725  -38.004  35.324   1.00 0.00 ? 292 ALA A HA   2  
ATOM 9888  H HB1  . ALA A 1 297 ? -98.194  -36.060  35.893   1.00 0.00 ? 292 ALA A HB1  2  
ATOM 9889  H HB2  . ALA A 1 297 ? -98.602  -35.373  34.320   1.00 0.00 ? 292 ALA A HB2  2  
ATOM 9890  H HB3  . ALA A 1 297 ? -97.765  -36.922  34.415   1.00 0.00 ? 292 ALA A HB3  2  
ATOM 9891  N N    . ASP A 1 298 ? -102.127 -36.337  35.412   1.00 0.00 ? 293 ASP A N    2  
ATOM 9892  C CA   . ASP A 1 298 ? -103.170 -35.590  36.175   1.00 0.00 ? 293 ASP A CA   2  
ATOM 9893  C C    . ASP A 1 298 ? -103.291 -36.154  37.593   1.00 0.00 ? 293 ASP A C    2  
ATOM 9894  O O    . ASP A 1 298 ? -103.641 -35.453  38.523   1.00 0.00 ? 293 ASP A O    2  
ATOM 9895  C CB   . ASP A 1 298 ? -104.468 -35.811  35.398   1.00 0.00 ? 293 ASP A CB   2  
ATOM 9896  C CG   . ASP A 1 298 ? -104.679 -34.657  34.416   1.00 0.00 ? 293 ASP A CG   2  
ATOM 9897  O OD1  . ASP A 1 298 ? -104.609 -33.518  34.847   1.00 0.00 ? 293 ASP A OD1  2  
ATOM 9898  O OD2  . ASP A 1 298 ? -104.908 -34.932  33.249   1.00 0.00 ? 293 ASP A OD2  2  
ATOM 9899  H H    . ASP A 1 298 ? -102.388 -36.918  34.667   1.00 0.00 ? 293 ASP A H    2  
ATOM 9900  H HA   . ASP A 1 298 ? -102.933 -34.538  36.206   1.00 0.00 ? 293 ASP A HA   2  
ATOM 9901  H HB2  . ASP A 1 298 ? -104.407 -36.742  34.853   1.00 0.00 ? 293 ASP A HB2  2  
ATOM 9902  H HB3  . ASP A 1 298 ? -105.298 -35.850  36.087   1.00 0.00 ? 293 ASP A HB3  2  
ATOM 9903  N N    . ILE A 1 299 ? -103.004 -37.417  37.764   1.00 0.00 ? 294 ILE A N    2  
ATOM 9904  C CA   . ILE A 1 299 ? -103.101 -38.031  39.122   1.00 0.00 ? 294 ILE A CA   2  
ATOM 9905  C C    . ILE A 1 299 ? -101.762 -38.661  39.516   1.00 0.00 ? 294 ILE A C    2  
ATOM 9906  O O    . ILE A 1 299 ? -100.756 -38.465  38.861   1.00 0.00 ? 294 ILE A O    2  
ATOM 9907  C CB   . ILE A 1 299 ? -104.186 -39.104  38.999   1.00 0.00 ? 294 ILE A CB   2  
ATOM 9908  C CG1  . ILE A 1 299 ? -103.808 -40.098  37.896   1.00 0.00 ? 294 ILE A CG1  2  
ATOM 9909  C CG2  . ILE A 1 299 ? -105.520 -38.442  38.650   1.00 0.00 ? 294 ILE A CG2  2  
ATOM 9910  C CD1  . ILE A 1 299 ? -104.644 -41.371  38.048   1.00 0.00 ? 294 ILE A CD1  2  
ATOM 9911  H H    . ILE A 1 299 ? -102.724 -37.963  37.000   1.00 0.00 ? 294 ILE A H    2  
ATOM 9912  H HA   . ILE A 1 299 ? -103.397 -37.291  39.848   1.00 0.00 ? 294 ILE A HA   2  
ATOM 9913  H HB   . ILE A 1 299 ? -104.281 -39.627  39.940   1.00 0.00 ? 294 ILE A HB   2  
ATOM 9914  H HG12 . ILE A 1 299 ? -104.000 -39.653  36.930   1.00 0.00 ? 294 ILE A HG12 2  
ATOM 9915  H HG13 . ILE A 1 299 ? -102.761 -40.346  37.978   1.00 0.00 ? 294 ILE A HG13 2  
ATOM 9916  H HG21 . ILE A 1 299 ? -105.628 -38.394  37.576   1.00 0.00 ? 294 ILE A HG21 2  
ATOM 9917  H HG22 . ILE A 1 299 ? -105.545 -37.443  39.059   1.00 0.00 ? 294 ILE A HG22 2  
ATOM 9918  H HG23 . ILE A 1 299 ? -106.330 -39.023  39.067   1.00 0.00 ? 294 ILE A HG23 2  
ATOM 9919  H HD11 . ILE A 1 299 ? -105.631 -41.113  38.403   1.00 0.00 ? 294 ILE A HD11 2  
ATOM 9920  H HD12 . ILE A 1 299 ? -104.167 -42.032  38.756   1.00 0.00 ? 294 ILE A HD12 2  
ATOM 9921  H HD13 . ILE A 1 299 ? -104.724 -41.865  37.090   1.00 0.00 ? 294 ILE A HD13 2  
ATOM 9922  N N    . SER A 1 300 ? -101.742 -39.417  40.582   1.00 0.00 ? 295 SER A N    2  
ATOM 9923  C CA   . SER A 1 300 ? -100.469 -40.060  41.022   1.00 0.00 ? 295 SER A CA   2  
ATOM 9924  C C    . SER A 1 300 ? -100.287 -41.410  40.321   1.00 0.00 ? 295 SER A C    2  
ATOM 9925  O O    . SER A 1 300 ? -100.972 -42.370  40.617   1.00 0.00 ? 295 SER A O    2  
ATOM 9926  C CB   . SER A 1 300 ? -100.626 -40.254  42.529   1.00 0.00 ? 295 SER A CB   2  
ATOM 9927  O OG   . SER A 1 300 ? -99.395  -39.950  43.172   1.00 0.00 ? 295 SER A OG   2  
ATOM 9928  H H    . SER A 1 300 ? -102.565 -39.560  41.094   1.00 0.00 ? 295 SER A H    2  
ATOM 9929  H HA   . SER A 1 300 ? -99.630  -39.413  40.819   1.00 0.00 ? 295 SER A HA   2  
ATOM 9930  H HB2  . SER A 1 300 ? -101.392 -39.595  42.902   1.00 0.00 ? 295 SER A HB2  2  
ATOM 9931  H HB3  . SER A 1 300 ? -100.907 -41.280  42.732   1.00 0.00 ? 295 SER A HB3  2  
ATOM 9932  H HG   . SER A 1 300 ? -99.335  -38.997  43.263   1.00 0.00 ? 295 SER A HG   2  
ATOM 9933  N N    . ASP A 1 301 ? -99.367  -41.489  39.397   1.00 0.00 ? 296 ASP A N    2  
ATOM 9934  C CA   . ASP A 1 301 ? -99.137  -42.776  38.676   1.00 0.00 ? 296 ASP A CA   2  
ATOM 9935  C C    . ASP A 1 301 ? -97.770  -43.354  39.052   1.00 0.00 ? 296 ASP A C    2  
ATOM 9936  O O    . ASP A 1 301 ? -96.740  -42.829  38.679   1.00 0.00 ? 296 ASP A O    2  
ATOM 9937  C CB   . ASP A 1 301 ? -99.174  -42.411  37.192   1.00 0.00 ? 296 ASP A CB   2  
ATOM 9938  C CG   . ASP A 1 301 ? -99.221  -43.689  36.353   1.00 0.00 ? 296 ASP A CG   2  
ATOM 9939  O OD1  . ASP A 1 301 ? -99.911  -44.612  36.752   1.00 0.00 ? 296 ASP A OD1  2  
ATOM 9940  O OD2  . ASP A 1 301 ? -98.565  -43.723  35.324   1.00 0.00 ? 296 ASP A OD2  2  
ATOM 9941  H H    . ASP A 1 301 ? -98.826  -40.702  39.177   1.00 0.00 ? 296 ASP A H    2  
ATOM 9942  H HA   . ASP A 1 301 ? -99.921  -43.481  38.903   1.00 0.00 ? 296 ASP A HA   2  
ATOM 9943  H HB2  . ASP A 1 301 ? -100.052 -41.814  36.990   1.00 0.00 ? 296 ASP A HB2  2  
ATOM 9944  H HB3  . ASP A 1 301 ? -98.289  -41.847  36.937   1.00 0.00 ? 296 ASP A HB3  2  
ATOM 9945  N N    . VAL A 1 302 ? -97.755  -44.433  39.789   1.00 0.00 ? 297 VAL A N    2  
ATOM 9946  C CA   . VAL A 1 302 ? -96.455  -45.047  40.190   1.00 0.00 ? 297 VAL A CA   2  
ATOM 9947  C C    . VAL A 1 302 ? -96.375  -46.494  39.693   1.00 0.00 ? 297 VAL A C    2  
ATOM 9948  O O    . VAL A 1 302 ? -95.812  -47.353  40.343   1.00 0.00 ? 297 VAL A O    2  
ATOM 9949  C CB   . VAL A 1 302 ? -96.445  -45.000  41.720   1.00 0.00 ? 297 VAL A CB   2  
ATOM 9950  C CG1  . VAL A 1 302 ? -96.482  -43.544  42.185   1.00 0.00 ? 297 VAL A CG1  2  
ATOM 9951  C CG2  . VAL A 1 302 ? -97.670  -45.739  42.269   1.00 0.00 ? 297 VAL A CG2  2  
ATOM 9952  H H    . VAL A 1 302 ? -98.598  -44.840  40.078   1.00 0.00 ? 297 VAL A H    2  
ATOM 9953  H HA   . VAL A 1 302 ? -95.631  -44.470  39.800   1.00 0.00 ? 297 VAL A HA   2  
ATOM 9954  H HB   . VAL A 1 302 ? -95.544  -45.471  42.088   1.00 0.00 ? 297 VAL A HB   2  
ATOM 9955  H HG11 . VAL A 1 302 ? -95.639  -43.012  41.770   1.00 0.00 ? 297 VAL A HG11 2  
ATOM 9956  H HG12 . VAL A 1 302 ? -96.436  -43.508  43.263   1.00 0.00 ? 297 VAL A HG12 2  
ATOM 9957  H HG13 . VAL A 1 302 ? -97.399  -43.082  41.849   1.00 0.00 ? 297 VAL A HG13 2  
ATOM 9958  H HG21 . VAL A 1 302 ? -97.471  -46.067  43.278   1.00 0.00 ? 297 VAL A HG21 2  
ATOM 9959  H HG22 . VAL A 1 302 ? -97.884  -46.596  41.648   1.00 0.00 ? 297 VAL A HG22 2  
ATOM 9960  H HG23 . VAL A 1 302 ? -98.521  -45.074  42.268   1.00 0.00 ? 297 VAL A HG23 2  
ATOM 9961  N N    . GLU A 1 303 ? -96.932  -46.767  38.543   1.00 0.00 ? 298 GLU A N    2  
ATOM 9962  C CA   . GLU A 1 303 ? -96.889  -48.157  38.002   1.00 0.00 ? 298 GLU A CA   2  
ATOM 9963  C C    . GLU A 1 303 ? -97.181  -48.147  36.498   1.00 0.00 ? 298 GLU A C    2  
ATOM 9964  O O    . GLU A 1 303 ? -98.307  -47.973  36.076   1.00 0.00 ? 298 GLU A O    2  
ATOM 9965  C CB   . GLU A 1 303 ? -97.985  -48.914  38.758   1.00 0.00 ? 298 GLU A CB   2  
ATOM 9966  C CG   . GLU A 1 303 ? -97.348  -49.975  39.658   1.00 0.00 ? 298 GLU A CG   2  
ATOM 9967  C CD   . GLU A 1 303 ? -98.280  -51.183  39.764   1.00 0.00 ? 298 GLU A CD   2  
ATOM 9968  O OE1  . GLU A 1 303 ? -98.453  -51.862  38.766   1.00 0.00 ? 298 GLU A OE1  2  
ATOM 9969  O OE2  . GLU A 1 303 ? -98.805  -51.408  40.842   1.00 0.00 ? 298 GLU A OE2  2  
ATOM 9970  H H    . GLU A 1 303 ? -97.380  -46.058  38.036   1.00 0.00 ? 298 GLU A H    2  
ATOM 9971  H HA   . GLU A 1 303 ? -95.928  -48.607  38.195   1.00 0.00 ? 298 GLU A HA   2  
ATOM 9972  H HB2  . GLU A 1 303 ? -98.549  -48.220  39.363   1.00 0.00 ? 298 GLU A HB2  2  
ATOM 9973  H HB3  . GLU A 1 303 ? -98.645  -49.395  38.051   1.00 0.00 ? 298 GLU A HB3  2  
ATOM 9974  H HG2  . GLU A 1 303 ? -96.402  -50.284  39.235   1.00 0.00 ? 298 GLU A HG2  2  
ATOM 9975  H HG3  . GLU A 1 303 ? -97.184  -49.562  40.642   1.00 0.00 ? 298 GLU A HG3  2  
ATOM 9976  N N    . GLY A 1 304 ? -96.172  -48.331  35.689   1.00 0.00 ? 299 GLY A N    2  
ATOM 9977  C CA   . GLY A 1 304 ? -96.386  -48.332  34.213   1.00 0.00 ? 299 GLY A CA   2  
ATOM 9978  C C    . GLY A 1 304 ? -95.192  -47.671  33.523   1.00 0.00 ? 299 GLY A C    2  
ATOM 9979  O O    . GLY A 1 304 ? -94.335  -48.336  32.973   1.00 0.00 ? 299 GLY A O    2  
ATOM 9980  H H    . GLY A 1 304 ? -95.272  -48.469  36.052   1.00 0.00 ? 299 GLY A H    2  
ATOM 9981  H HA2  . GLY A 1 304 ? -96.487  -49.350  33.865   1.00 0.00 ? 299 GLY A HA2  2  
ATOM 9982  H HA3  . GLY A 1 304 ? -97.283  -47.780  33.979   1.00 0.00 ? 299 GLY A HA3  2  
ATOM 9983  N N    . GLU A 1 305 ? -95.128  -46.367  33.549   1.00 0.00 ? 300 GLU A N    2  
ATOM 9984  C CA   . GLU A 1 305 ? -93.988  -45.660  32.895   1.00 0.00 ? 300 GLU A CA   2  
ATOM 9985  C C    . GLU A 1 305 ? -92.917  -45.313  33.934   1.00 0.00 ? 300 GLU A C    2  
ATOM 9986  O O    . GLU A 1 305 ? -93.202  -44.726  34.959   1.00 0.00 ? 300 GLU A O    2  
ATOM 9987  C CB   . GLU A 1 305 ? -94.596  -44.387  32.306   1.00 0.00 ? 300 GLU A CB   2  
ATOM 9988  C CG   . GLU A 1 305 ? -95.427  -44.742  31.071   1.00 0.00 ? 300 GLU A CG   2  
ATOM 9989  C CD   . GLU A 1 305 ? -94.533  -44.725  29.831   1.00 0.00 ? 300 GLU A CD   2  
ATOM 9990  O OE1  . GLU A 1 305 ? -93.673  -45.585  29.733   1.00 0.00 ? 300 GLU A OE1  2  
ATOM 9991  O OE2  . GLU A 1 305 ? -94.723  -43.852  28.999   1.00 0.00 ? 300 GLU A OE2  2  
ATOM 9992  H H    . GLU A 1 305 ? -95.829  -45.851  33.999   1.00 0.00 ? 300 GLU A H    2  
ATOM 9993  H HA   . GLU A 1 305 ? -93.568  -46.267  32.109   1.00 0.00 ? 300 GLU A HA   2  
ATOM 9994  H HB2  . GLU A 1 305 ? -95.229  -43.916  33.044   1.00 0.00 ? 300 GLU A HB2  2  
ATOM 9995  H HB3  . GLU A 1 305 ? -93.806  -43.708  32.023   1.00 0.00 ? 300 GLU A HB3  2  
ATOM 9996  H HG2  . GLU A 1 305 ? -95.854  -45.727  31.196   1.00 0.00 ? 300 GLU A HG2  2  
ATOM 9997  H HG3  . GLU A 1 305 ? -96.220  -44.019  30.951   1.00 0.00 ? 300 GLU A HG3  2  
ATOM 9998  N N    . VAL A 1 306 ? -91.686  -45.671  33.674   1.00 0.00 ? 301 VAL A N    2  
ATOM 9999  C CA   . VAL A 1 306 ? -90.588  -45.364  34.643   1.00 0.00 ? 301 VAL A CA   2  
ATOM 10000 C C    . VAL A 1 306 ? -90.955  -45.871  36.042   1.00 0.00 ? 301 VAL A C    2  
ATOM 10001 O O    . VAL A 1 306 ? -91.145  -45.098  36.962   1.00 0.00 ? 301 VAL A O    2  
ATOM 10002 C CB   . VAL A 1 306 ? -90.461  -43.838  34.637   1.00 0.00 ? 301 VAL A CB   2  
ATOM 10003 C CG1  . VAL A 1 306 ? -89.344  -43.413  35.591   1.00 0.00 ? 301 VAL A CG1  2  
ATOM 10004 C CG2  . VAL A 1 306 ? -90.128  -43.359  33.221   1.00 0.00 ? 301 VAL A CG2  2  
ATOM 10005 H H    . VAL A 1 306 ? -91.482  -46.142  32.839   1.00 0.00 ? 301 VAL A H    2  
ATOM 10006 H HA   . VAL A 1 306 ? -89.663  -45.810  34.313   1.00 0.00 ? 301 VAL A HA   2  
ATOM 10007 H HB   . VAL A 1 306 ? -91.395  -43.399  34.957   1.00 0.00 ? 301 VAL A HB   2  
ATOM 10008 H HG11 . VAL A 1 306 ? -88.975  -42.440  35.303   1.00 0.00 ? 301 VAL A HG11 2  
ATOM 10009 H HG12 . VAL A 1 306 ? -88.539  -44.131  35.546   1.00 0.00 ? 301 VAL A HG12 2  
ATOM 10010 H HG13 . VAL A 1 306 ? -89.730  -43.368  36.599   1.00 0.00 ? 301 VAL A HG13 2  
ATOM 10011 H HG21 . VAL A 1 306 ? -91.006  -43.440  32.598   1.00 0.00 ? 301 VAL A HG21 2  
ATOM 10012 H HG22 . VAL A 1 306 ? -89.338  -43.970  32.811   1.00 0.00 ? 301 VAL A HG22 2  
ATOM 10013 H HG23 . VAL A 1 306 ? -89.806  -42.329  33.256   1.00 0.00 ? 301 VAL A HG23 2  
ATOM 10014 N N    . GLY A 1 307 ? -91.056  -47.162  36.208   1.00 0.00 ? 302 GLY A N    2  
ATOM 10015 C CA   . GLY A 1 307 ? -91.409  -47.720  37.545   1.00 0.00 ? 302 GLY A CA   2  
ATOM 10016 C C    . GLY A 1 307 ? -90.377  -48.774  37.948   1.00 0.00 ? 302 GLY A C    2  
ATOM 10017 O O    . GLY A 1 307 ? -89.231  -48.720  37.545   1.00 0.00 ? 302 GLY A O    2  
ATOM 10018 H H    . GLY A 1 307 ? -90.898  -47.766  35.452   1.00 0.00 ? 302 GLY A H    2  
ATOM 10019 H HA2  . GLY A 1 307 ? -91.417  -46.924  38.275   1.00 0.00 ? 302 GLY A HA2  2  
ATOM 10020 H HA3  . GLY A 1 307 ? -92.386  -48.177  37.498   1.00 0.00 ? 302 GLY A HA3  2  
ATOM 10021 N N    . ALA A 1 308 ? -90.775  -49.734  38.740   1.00 0.00 ? 303 ALA A N    2  
ATOM 10022 C CA   . ALA A 1 308 ? -89.817  -50.794  39.171   1.00 0.00 ? 303 ALA A CA   2  
ATOM 10023 C C    . ALA A 1 308 ? -90.578  -51.995  39.739   1.00 0.00 ? 303 ALA A C    2  
ATOM 10024 O O    . ALA A 1 308 ? -91.642  -51.854  40.309   1.00 0.00 ? 303 ALA A O    2  
ATOM 10025 C CB   . ALA A 1 308 ? -88.964  -50.139  40.257   1.00 0.00 ? 303 ALA A CB   2  
ATOM 10026 H H    . ALA A 1 308 ? -91.703  -49.757  39.052   1.00 0.00 ? 303 ALA A H    2  
ATOM 10027 H HA   . ALA A 1 308 ? -89.194  -51.098  38.345   1.00 0.00 ? 303 ALA A HA   2  
ATOM 10028 H HB1  . ALA A 1 308 ? -89.348  -50.410  41.229   1.00 0.00 ? 303 ALA A HB1  2  
ATOM 10029 H HB2  . ALA A 1 308 ? -88.997  -49.066  40.143   1.00 0.00 ? 303 ALA A HB2  2  
ATOM 10030 H HB3  . ALA A 1 308 ? -87.943  -50.479  40.167   1.00 0.00 ? 303 ALA A HB3  2  
ATOM 10031 N N    . ILE A 1 309 ? -90.039  -53.175  39.587   1.00 0.00 ? 304 ILE A N    2  
ATOM 10032 C CA   . ILE A 1 309 ? -90.729  -54.387  40.117   1.00 0.00 ? 304 ILE A CA   2  
ATOM 10033 C C    . ILE A 1 309 ? -89.699  -55.441  40.541   1.00 0.00 ? 304 ILE A C    2  
ATOM 10034 O O    . ILE A 1 309 ? -89.986  -56.621  40.587   1.00 0.00 ? 304 ILE A O    2  
ATOM 10035 C CB   . ILE A 1 309 ? -91.585  -54.895  38.953   1.00 0.00 ? 304 ILE A CB   2  
ATOM 10036 C CG1  . ILE A 1 309 ? -92.384  -56.124  39.401   1.00 0.00 ? 304 ILE A CG1  2  
ATOM 10037 C CG2  . ILE A 1 309 ? -90.683  -55.273  37.775   1.00 0.00 ? 304 ILE A CG2  2  
ATOM 10038 C CD1  . ILE A 1 309 ? -93.814  -56.030  38.863   1.00 0.00 ? 304 ILE A CD1  2  
ATOM 10039 H H    . ILE A 1 309 ? -89.180  -53.265  39.124   1.00 0.00 ? 304 ILE A H    2  
ATOM 10040 H HA   . ILE A 1 309 ? -91.362  -54.125  40.951   1.00 0.00 ? 304 ILE A HA   2  
ATOM 10041 H HB   . ILE A 1 309 ? -92.266  -54.115  38.645   1.00 0.00 ? 304 ILE A HB   2  
ATOM 10042 H HG12 . ILE A 1 309 ? -91.913  -57.019  39.018   1.00 0.00 ? 304 ILE A HG12 2  
ATOM 10043 H HG13 . ILE A 1 309 ? -92.409  -56.164  40.479   1.00 0.00 ? 304 ILE A HG13 2  
ATOM 10044 H HG21 . ILE A 1 309 ? -91.181  -55.030  36.848   1.00 0.00 ? 304 ILE A HG21 2  
ATOM 10045 H HG22 . ILE A 1 309 ? -90.475  -56.332  37.805   1.00 0.00 ? 304 ILE A HG22 2  
ATOM 10046 H HG23 . ILE A 1 309 ? -89.756  -54.722  37.840   1.00 0.00 ? 304 ILE A HG23 2  
ATOM 10047 H HD11 . ILE A 1 309 ? -94.172  -55.017  38.971   1.00 0.00 ? 304 ILE A HD11 2  
ATOM 10048 H HD12 . ILE A 1 309 ? -94.453  -56.698  39.421   1.00 0.00 ? 304 ILE A HD12 2  
ATOM 10049 H HD13 . ILE A 1 309 ? -93.825  -56.307  37.820   1.00 0.00 ? 304 ILE A HD13 2  
ATOM 10050 N N    . GLY A 1 310 ? -88.500  -55.021  40.850   1.00 0.00 ? 305 GLY A N    2  
ATOM 10051 C CA   . GLY A 1 310 ? -87.450  -55.994  41.271   1.00 0.00 ? 305 GLY A CA   2  
ATOM 10052 C C    . GLY A 1 310 ? -87.165  -56.968  40.126   1.00 0.00 ? 305 GLY A C    2  
ATOM 10053 O O    . GLY A 1 310 ? -86.527  -56.623  39.150   1.00 0.00 ? 305 GLY A O    2  
ATOM 10054 H H    . GLY A 1 310 ? -88.289  -54.065  40.807   1.00 0.00 ? 305 GLY A H    2  
ATOM 10055 H HA2  . GLY A 1 310 ? -86.546  -55.460  41.525   1.00 0.00 ? 305 GLY A HA2  2  
ATOM 10056 H HA3  . GLY A 1 310 ? -87.796  -56.547  42.131   1.00 0.00 ? 305 GLY A HA3  2  
ATOM 10057 N N    . GLU A 1 311 ? -87.634  -58.182  40.238   1.00 0.00 ? 306 GLU A N    2  
ATOM 10058 C CA   . GLU A 1 311 ? -87.393  -59.182  39.157   1.00 0.00 ? 306 GLU A CA   2  
ATOM 10059 C C    . GLU A 1 311 ? -88.504  -60.235  39.157   1.00 0.00 ? 306 GLU A C    2  
ATOM 10060 O O    . GLU A 1 311 ? -89.392  -60.213  39.986   1.00 0.00 ? 306 GLU A O    2  
ATOM 10061 C CB   . GLU A 1 311 ? -86.045  -59.822  39.500   1.00 0.00 ? 306 GLU A CB   2  
ATOM 10062 C CG   . GLU A 1 311 ? -85.015  -59.456  38.429   1.00 0.00 ? 306 GLU A CG   2  
ATOM 10063 C CD   . GLU A 1 311 ? -85.086  -60.470  37.286   1.00 0.00 ? 306 GLU A CD   2  
ATOM 10064 O OE1  . GLU A 1 311 ? -85.149  -61.654  37.573   1.00 0.00 ? 306 GLU A OE1  2  
ATOM 10065 O OE2  . GLU A 1 311 ? -85.076  -60.046  36.142   1.00 0.00 ? 306 GLU A OE2  2  
ATOM 10066 H H    . GLU A 1 311 ? -88.147  -58.436  41.034   1.00 0.00 ? 306 GLU A H    2  
ATOM 10067 H HA   . GLU A 1 311 ? -87.337  -58.693  38.197   1.00 0.00 ? 306 GLU A HA   2  
ATOM 10068 H HB2  . GLU A 1 311 ? -85.709  -59.460  40.461   1.00 0.00 ? 306 GLU A HB2  2  
ATOM 10069 H HB3  . GLU A 1 311 ? -86.154  -60.895  39.538   1.00 0.00 ? 306 GLU A HB3  2  
ATOM 10070 H HG2  . GLU A 1 311 ? -85.227  -58.468  38.048   1.00 0.00 ? 306 GLU A HG2  2  
ATOM 10071 H HG3  . GLU A 1 311 ? -84.025  -59.472  38.860   1.00 0.00 ? 306 GLU A HG3  2  
ATOM 10072 N N    . GLU A 1 312 ? -88.460  -61.158  38.233   1.00 0.00 ? 307 GLU A N    2  
ATOM 10073 C CA   . GLU A 1 312 ? -89.514  -62.213  38.179   1.00 0.00 ? 307 GLU A CA   2  
ATOM 10074 C C    . GLU A 1 312 ? -88.946  -63.497  37.570   1.00 0.00 ? 307 GLU A C    2  
ATOM 10075 O O    . GLU A 1 312 ? -89.174  -64.582  38.067   1.00 0.00 ? 307 GLU A O    2  
ATOM 10076 C CB   . GLU A 1 312 ? -90.610  -61.633  37.285   1.00 0.00 ? 307 GLU A CB   2  
ATOM 10077 C CG   . GLU A 1 312 ? -91.625  -60.880  38.146   1.00 0.00 ? 307 GLU A CG   2  
ATOM 10078 C CD   . GLU A 1 312 ? -93.015  -60.997  37.518   1.00 0.00 ? 307 GLU A CD   2  
ATOM 10079 O OE1  . GLU A 1 312 ? -93.574  -62.080  37.564   1.00 0.00 ? 307 GLU A OE1  2  
ATOM 10080 O OE2  . GLU A 1 312 ? -93.496  -60.001  37.003   1.00 0.00 ? 307 GLU A OE2  2  
ATOM 10081 H H    . GLU A 1 312 ? -87.735  -61.156  37.574   1.00 0.00 ? 307 GLU A H    2  
ATOM 10082 H HA   . GLU A 1 312 ? -89.906  -62.404  39.165   1.00 0.00 ? 307 GLU A HA   2  
ATOM 10083 H HB2  . GLU A 1 312 ? -90.168  -60.954  36.569   1.00 0.00 ? 307 GLU A HB2  2  
ATOM 10084 H HB3  . GLU A 1 312 ? -91.109  -62.434  36.761   1.00 0.00 ? 307 GLU A HB3  2  
ATOM 10085 H HG2  . GLU A 1 312 ? -91.640  -61.306  39.139   1.00 0.00 ? 307 GLU A HG2  2  
ATOM 10086 H HG3  . GLU A 1 312 ? -91.345  -59.839  38.206   1.00 0.00 ? 307 GLU A HG3  2  
ATOM 10087 N N    . ALA A 1 313 ? -88.205  -63.380  36.497   1.00 0.00 ? 308 ALA A N    2  
ATOM 10088 C CA   . ALA A 1 313 ? -87.616  -64.592  35.846   1.00 0.00 ? 308 ALA A CA   2  
ATOM 10089 C C    . ALA A 1 313 ? -88.728  -65.556  35.406   1.00 0.00 ? 308 ALA A C    2  
ATOM 10090 O O    . ALA A 1 313 ? -89.371  -66.173  36.231   1.00 0.00 ? 308 ALA A O    2  
ATOM 10091 C CB   . ALA A 1 313 ? -86.738  -65.241  36.919   1.00 0.00 ? 308 ALA A CB   2  
ATOM 10092 H H    . ALA A 1 313 ? -88.036  -62.493  36.117   1.00 0.00 ? 308 ALA A H    2  
ATOM 10093 H HA   . ALA A 1 313 ? -87.010  -64.304  35.003   1.00 0.00 ? 308 ALA A HA   2  
ATOM 10094 H HB1  . ALA A 1 313 ? -85.969  -65.833  36.444   1.00 0.00 ? 308 ALA A HB1  2  
ATOM 10095 H HB2  . ALA A 1 313 ? -87.345  -65.877  37.545   1.00 0.00 ? 308 ALA A HB2  2  
ATOM 10096 H HB3  . ALA A 1 313 ? -86.279  -64.472  37.522   1.00 0.00 ? 308 ALA A HB3  2  
ATOM 10097 N N    . PRO A 1 314 ? -88.920  -65.659  34.113   1.00 0.00 ? 309 PRO A N    2  
ATOM 10098 C CA   . PRO A 1 314 ? -89.967  -66.562  33.574   1.00 0.00 ? 309 PRO A CA   2  
ATOM 10099 C C    . PRO A 1 314 ? -89.553  -68.026  33.751   1.00 0.00 ? 309 PRO A C    2  
ATOM 10100 O O    . PRO A 1 314 ? -88.512  -68.322  34.305   1.00 0.00 ? 309 PRO A O    2  
ATOM 10101 C CB   . PRO A 1 314 ? -90.038  -66.190  32.095   1.00 0.00 ? 309 PRO A CB   2  
ATOM 10102 C CG   . PRO A 1 314 ? -88.698  -65.606  31.780   1.00 0.00 ? 309 PRO A CG   2  
ATOM 10103 C CD   . PRO A 1 314 ? -88.194  -64.959  33.043   1.00 0.00 ? 309 PRO A CD   2  
ATOM 10104 H HA   . PRO A 1 314 ? -90.916  -66.373  34.049   1.00 0.00 ? 309 PRO A HA   2  
ATOM 10105 H HB2  . PRO A 1 314 ? -90.219  -67.071  31.495   1.00 0.00 ? 309 PRO A HB2  2  
ATOM 10106 H HB3  . PRO A 1 314 ? -90.810  -65.454  31.928   1.00 0.00 ? 309 PRO A HB3  2  
ATOM 10107 H HG2  . PRO A 1 314 ? -88.021  -66.389  31.466   1.00 0.00 ? 309 PRO A HG2  2  
ATOM 10108 H HG3  . PRO A 1 314 ? -88.792  -64.863  31.003   1.00 0.00 ? 309 PRO A HG3  2  
ATOM 10109 H HD2  . PRO A 1 314 ? -87.127  -65.108  33.143   1.00 0.00 ? 309 PRO A HD2  2  
ATOM 10110 H HD3  . PRO A 1 314 ? -88.436  -63.908  33.055   1.00 0.00 ? 309 PRO A HD3  2  
ATOM 10111 N N    . GLN A 1 315 ? -90.361  -68.941  33.288   1.00 0.00 ? 310 GLN A N    2  
ATOM 10112 C CA   . GLN A 1 315 ? -90.016  -70.386  33.430   1.00 0.00 ? 310 GLN A CA   2  
ATOM 10113 C C    . GLN A 1 315 ? -90.130  -71.095  32.078   1.00 0.00 ? 310 GLN A C    2  
ATOM 10114 O O    . GLN A 1 315 ? -90.636  -72.196  31.985   1.00 0.00 ? 310 GLN A O    2  
ATOM 10115 C CB   . GLN A 1 315 ? -91.044  -70.941  34.417   1.00 0.00 ? 310 GLN A CB   2  
ATOM 10116 C CG   . GLN A 1 315 ? -90.805  -70.331  35.800   1.00 0.00 ? 310 GLN A CG   2  
ATOM 10117 C CD   . GLN A 1 315 ? -91.654  -69.067  35.959   1.00 0.00 ? 310 GLN A CD   2  
ATOM 10118 O OE1  . GLN A 1 315 ? -92.289  -68.623  35.022   1.00 0.00 ? 310 GLN A OE1  2  
ATOM 10119 N NE2  . GLN A 1 315 ? -91.693  -68.464  37.116   1.00 0.00 ? 310 GLN A NE2  2  
ATOM 10120 H H    . GLN A 1 315 ? -91.196  -68.679  32.846   1.00 0.00 ? 310 GLN A H    2  
ATOM 10121 H HA   . GLN A 1 315 ? -89.022  -70.498  33.833   1.00 0.00 ? 310 GLN A HA   2  
ATOM 10122 H HB2  . GLN A 1 315 ? -92.039  -70.690  34.078   1.00 0.00 ? 310 GLN A HB2  2  
ATOM 10123 H HB3  . GLN A 1 315 ? -90.943  -72.014  34.476   1.00 0.00 ? 310 GLN A HB3  2  
ATOM 10124 H HG2  . GLN A 1 315 ? -91.078  -71.048  36.560   1.00 0.00 ? 310 GLN A HG2  2  
ATOM 10125 H HG3  . GLN A 1 315 ? -89.761  -70.076  35.904   1.00 0.00 ? 310 GLN A HG3  2  
ATOM 10126 H HE21 . GLN A 1 315 ? -91.181  -68.821  37.872   1.00 0.00 ? 310 GLN A HE21 2  
ATOM 10127 H HE22 . GLN A 1 315 ? -92.233  -67.654  37.228   1.00 0.00 ? 310 GLN A HE22 2  
ATOM 10128 N N    . MET A 1 316 ? -89.663  -70.471  31.030   1.00 0.00 ? 311 MET A N    2  
ATOM 10129 C CA   . MET A 1 316 ? -89.741  -71.106  29.682   1.00 0.00 ? 311 MET A CA   2  
ATOM 10130 C C    . MET A 1 316 ? -88.600  -70.602  28.794   1.00 0.00 ? 311 MET A C    2  
ATOM 10131 O O    . MET A 1 316 ? -87.849  -69.724  29.172   1.00 0.00 ? 311 MET A O    2  
ATOM 10132 C CB   . MET A 1 316 ? -91.097  -70.677  29.115   1.00 0.00 ? 311 MET A CB   2  
ATOM 10133 C CG   . MET A 1 316 ? -91.182  -69.149  29.073   1.00 0.00 ? 311 MET A CG   2  
ATOM 10134 S SD   . MET A 1 316 ? -92.540  -68.650  27.985   1.00 0.00 ? 311 MET A SD   2  
ATOM 10135 C CE   . MET A 1 316 ? -93.629  -67.989  29.270   1.00 0.00 ? 311 MET A CE   2  
ATOM 10136 H H    . MET A 1 316 ? -89.258  -69.583  31.130   1.00 0.00 ? 311 MET A H    2  
ATOM 10137 H HA   . MET A 1 316 ? -89.703  -72.180  29.770   1.00 0.00 ? 311 MET A HA   2  
ATOM 10138 H HB2  . MET A 1 316 ? -91.209  -71.072  28.115   1.00 0.00 ? 311 MET A HB2  2  
ATOM 10139 H HB3  . MET A 1 316 ? -91.887  -71.061  29.743   1.00 0.00 ? 311 MET A HB3  2  
ATOM 10140 H HG2  . MET A 1 316 ? -91.360  -68.771  30.068   1.00 0.00 ? 311 MET A HG2  2  
ATOM 10141 H HG3  . MET A 1 316 ? -90.253  -68.747  28.696   1.00 0.00 ? 311 MET A HG3  2  
ATOM 10142 H HE1  . MET A 1 316 ? -94.432  -67.430  28.809   1.00 0.00 ? 311 MET A HE1  2  
ATOM 10143 H HE2  . MET A 1 316 ? -93.067  -67.336  29.919   1.00 0.00 ? 311 MET A HE2  2  
ATOM 10144 H HE3  . MET A 1 316 ? -94.037  -68.805  29.850   1.00 0.00 ? 311 MET A HE3  2  
ATOM 10145 N N    . ASN A 1 317 ? -88.464  -71.152  27.616   1.00 0.00 ? 312 ASN A N    2  
ATOM 10146 C CA   . ASN A 1 317 ? -87.370  -70.705  26.704   1.00 0.00 ? 312 ASN A CA   2  
ATOM 10147 C C    . ASN A 1 317 ? -87.742  -70.993  25.247   1.00 0.00 ? 312 ASN A C    2  
ATOM 10148 O O    . ASN A 1 317 ? -86.963  -71.547  24.496   1.00 0.00 ? 312 ASN A O    2  
ATOM 10149 C CB   . ASN A 1 317 ? -86.150  -71.527  27.120   1.00 0.00 ? 312 ASN A CB   2  
ATOM 10150 C CG   . ASN A 1 317 ? -84.902  -70.643  27.086   1.00 0.00 ? 312 ASN A CG   2  
ATOM 10151 O OD1  . ASN A 1 317 ? -84.578  -69.992  28.060   1.00 0.00 ? 312 ASN A OD1  2  
ATOM 10152 N ND2  . ASN A 1 317 ? -84.181  -70.592  25.999   1.00 0.00 ? 312 ASN A ND2  2  
ATOM 10153 H H    . ASN A 1 317 ? -89.080  -71.858  27.331   1.00 0.00 ? 312 ASN A H    2  
ATOM 10154 H HA   . ASN A 1 317 ? -87.171  -69.654  26.842   1.00 0.00 ? 312 ASN A HA   2  
ATOM 10155 H HB2  . ASN A 1 317 ? -86.296  -71.907  28.121   1.00 0.00 ? 312 ASN A HB2  2  
ATOM 10156 H HB3  . ASN A 1 317 ? -86.022  -72.353  26.436   1.00 0.00 ? 312 ASN A HB3  2  
ATOM 10157 H HD21 . ASN A 1 317 ? -84.442  -71.117  25.214   1.00 0.00 ? 312 ASN A HD21 2  
ATOM 10158 H HD22 . ASN A 1 317 ? -83.380  -70.028  25.968   1.00 0.00 ? 312 ASN A HD22 2  
ATOM 10159 N N    . TYR A 1 318 ? -88.927  -70.619  24.842   1.00 0.00 ? 313 TYR A N    2  
ATOM 10160 C CA   . TYR A 1 318 ? -89.350  -70.869  23.433   1.00 0.00 ? 313 TYR A CA   2  
ATOM 10161 C C    . TYR A 1 318 ? -89.554  -69.541  22.700   1.00 0.00 ? 313 TYR A C    2  
ATOM 10162 O O    . TYR A 1 318 ? -88.802  -69.189  21.812   1.00 0.00 ? 313 TYR A O    2  
ATOM 10163 C CB   . TYR A 1 318 ? -90.673  -71.628  23.544   1.00 0.00 ? 313 TYR A CB   2  
ATOM 10164 C CG   . TYR A 1 318 ? -90.400  -73.065  23.918   1.00 0.00 ? 313 TYR A CG   2  
ATOM 10165 C CD1  . TYR A 1 318 ? -90.204  -74.023  22.917   1.00 0.00 ? 313 TYR A CD1  2  
ATOM 10166 C CD2  . TYR A 1 318 ? -90.343  -73.438  25.266   1.00 0.00 ? 313 TYR A CD2  2  
ATOM 10167 C CE1  . TYR A 1 318 ? -89.952  -75.356  23.263   1.00 0.00 ? 313 TYR A CE1  2  
ATOM 10168 C CE2  . TYR A 1 318 ? -90.090  -74.771  25.612   1.00 0.00 ? 313 TYR A CE2  2  
ATOM 10169 C CZ   . TYR A 1 318 ? -89.894  -75.730  24.611   1.00 0.00 ? 313 TYR A CZ   2  
ATOM 10170 O OH   . TYR A 1 318 ? -89.645  -77.043  24.952   1.00 0.00 ? 313 TYR A OH   2  
ATOM 10171 H H    . TYR A 1 318 ? -89.538  -70.173  25.464   1.00 0.00 ? 313 TYR A H    2  
ATOM 10172 H HA   . TYR A 1 318 ? -88.620  -71.475  22.921   1.00 0.00 ? 313 TYR A HA   2  
ATOM 10173 H HB2  . TYR A 1 318 ? -91.288  -71.168  24.304   1.00 0.00 ? 313 TYR A HB2  2  
ATOM 10174 H HB3  . TYR A 1 318 ? -91.188  -71.595  22.596   1.00 0.00 ? 313 TYR A HB3  2  
ATOM 10175 H HD1  . TYR A 1 318 ? -90.248  -73.734  21.877   1.00 0.00 ? 313 TYR A HD1  2  
ATOM 10176 H HD2  . TYR A 1 318 ? -90.494  -72.699  26.038   1.00 0.00 ? 313 TYR A HD2  2  
ATOM 10177 H HE1  . TYR A 1 318 ? -89.800  -76.095  22.491   1.00 0.00 ? 313 TYR A HE1  2  
ATOM 10178 H HE2  . TYR A 1 318 ? -90.046  -75.060  26.652   1.00 0.00 ? 313 TYR A HE2  2  
ATOM 10179 H HH   . TYR A 1 318 ? -90.334  -77.587  24.562   1.00 0.00 ? 313 TYR A HH   2  
ATOM 10180 N N    . ILE A 1 319 ? -90.566  -68.801  23.066   1.00 0.00 ? 314 ILE A N    2  
ATOM 10181 C CA   . ILE A 1 319 ? -90.821  -67.493  22.393   1.00 0.00 ? 314 ILE A CA   2  
ATOM 10182 C C    . ILE A 1 319 ? -89.744  -66.477  22.793   1.00 0.00 ? 314 ILE A C    2  
ATOM 10183 O O    . ILE A 1 319 ? -89.171  -66.557  23.863   1.00 0.00 ? 314 ILE A O    2  
ATOM 10184 C CB   . ILE A 1 319 ? -92.205  -67.055  22.890   1.00 0.00 ? 314 ILE A CB   2  
ATOM 10185 C CG1  . ILE A 1 319 ? -92.649  -65.799  22.130   1.00 0.00 ? 314 ILE A CG1  2  
ATOM 10186 C CG2  . ILE A 1 319 ? -92.148  -66.752  24.391   1.00 0.00 ? 314 ILE A CG2  2  
ATOM 10187 C CD1  . ILE A 1 319 ? -93.792  -66.154  21.176   1.00 0.00 ? 314 ILE A CD1  2  
ATOM 10188 H H    . ILE A 1 319 ? -91.159  -69.105  23.785   1.00 0.00 ? 314 ILE A H    2  
ATOM 10189 H HA   . ILE A 1 319 ? -90.838  -67.620  21.322   1.00 0.00 ? 314 ILE A HA   2  
ATOM 10190 H HB   . ILE A 1 319 ? -92.914  -67.851  22.714   1.00 0.00 ? 314 ILE A HB   2  
ATOM 10191 H HG12 . ILE A 1 319 ? -92.988  -65.052  22.834   1.00 0.00 ? 314 ILE A HG12 2  
ATOM 10192 H HG13 . ILE A 1 319 ? -91.820  -65.407  21.563   1.00 0.00 ? 314 ILE A HG13 2  
ATOM 10193 H HG21 . ILE A 1 319 ? -93.151  -66.727  24.790   1.00 0.00 ? 314 ILE A HG21 2  
ATOM 10194 H HG22 . ILE A 1 319 ? -91.675  -65.794  24.547   1.00 0.00 ? 314 ILE A HG22 2  
ATOM 10195 H HG23 . ILE A 1 319 ? -91.580  -67.521  24.892   1.00 0.00 ? 314 ILE A HG23 2  
ATOM 10196 H HD11 . ILE A 1 319 ? -94.657  -66.456  21.747   1.00 0.00 ? 314 ILE A HD11 2  
ATOM 10197 H HD12 . ILE A 1 319 ? -93.484  -66.965  20.532   1.00 0.00 ? 314 ILE A HD12 2  
ATOM 10198 H HD13 . ILE A 1 319 ? -94.040  -65.291  20.575   1.00 0.00 ? 314 ILE A HD13 2  
ATOM 10199 N N    . GLN A 1 320 ? -89.464  -65.523  21.944   1.00 0.00 ? 315 GLN A N    2  
ATOM 10200 C CA   . GLN A 1 320 ? -88.425  -64.505  22.278   1.00 0.00 ? 315 GLN A CA   2  
ATOM 10201 C C    . GLN A 1 320 ? -88.946  -63.098  21.975   1.00 0.00 ? 315 GLN A C    2  
ATOM 10202 O O    . GLN A 1 320 ? -88.190  -62.148  21.917   1.00 0.00 ? 315 GLN A O    2  
ATOM 10203 C CB   . GLN A 1 320 ? -87.242  -64.842  21.372   1.00 0.00 ? 315 GLN A CB   2  
ATOM 10204 C CG   . GLN A 1 320 ? -85.994  -64.105  21.862   1.00 0.00 ? 315 GLN A CG   2  
ATOM 10205 C CD   . GLN A 1 320 ? -85.126  -63.717  20.664   1.00 0.00 ? 315 GLN A CD   2  
ATOM 10206 O OE1  . GLN A 1 320 ? -85.607  -63.131  19.714   1.00 0.00 ? 315 GLN A OE1  2  
ATOM 10207 N NE2  . GLN A 1 320 ? -83.857  -64.021  20.667   1.00 0.00 ? 315 GLN A NE2  2  
ATOM 10208 H H    . GLN A 1 320 ? -89.938  -65.474  21.086   1.00 0.00 ? 315 GLN A H    2  
ATOM 10209 H HA   . GLN A 1 320 ? -88.134  -64.587  23.313   1.00 0.00 ? 315 GLN A HA   2  
ATOM 10210 H HB2  . GLN A 1 320 ? -87.065  -65.908  21.395   1.00 0.00 ? 315 GLN A HB2  2  
ATOM 10211 H HB3  . GLN A 1 320 ? -87.466  -64.536  20.362   1.00 0.00 ? 315 GLN A HB3  2  
ATOM 10212 H HG2  . GLN A 1 320 ? -86.290  -63.214  22.397   1.00 0.00 ? 315 GLN A HG2  2  
ATOM 10213 H HG3  . GLN A 1 320 ? -85.430  -64.749  22.519   1.00 0.00 ? 315 GLN A HG3  2  
ATOM 10214 H HE21 . GLN A 1 320 ? -83.468  -64.493  21.433   1.00 0.00 ? 315 GLN A HE21 2  
ATOM 10215 H HE22 . GLN A 1 320 ? -83.292  -63.776  19.904   1.00 0.00 ? 315 GLN A HE22 2  
ATOM 10216 N N    . VAL A 1 321 ? -90.233  -62.962  21.778   1.00 0.00 ? 316 VAL A N    2  
ATOM 10217 C CA   . VAL A 1 321 ? -90.823  -61.624  21.471   1.00 0.00 ? 316 VAL A CA   2  
ATOM 10218 C C    . VAL A 1 321 ? -90.171  -61.029  20.218   1.00 0.00 ? 316 VAL A C    2  
ATOM 10219 O O    . VAL A 1 321 ? -89.088  -61.412  19.822   1.00 0.00 ? 316 VAL A O    2  
ATOM 10220 C CB   . VAL A 1 321 ? -90.545  -60.758  22.706   1.00 0.00 ? 316 VAL A CB   2  
ATOM 10221 C CG1  . VAL A 1 321 ? -90.959  -59.311  22.429   1.00 0.00 ? 316 VAL A CG1  2  
ATOM 10222 C CG2  . VAL A 1 321 ? -91.355  -61.293  23.888   1.00 0.00 ? 316 VAL A CG2  2  
ATOM 10223 H H    . VAL A 1 321 ? -90.816  -63.746  21.828   1.00 0.00 ? 316 VAL A H    2  
ATOM 10224 H HA   . VAL A 1 321 ? -91.888  -61.715  21.325   1.00 0.00 ? 316 VAL A HA   2  
ATOM 10225 H HB   . VAL A 1 321 ? -89.493  -60.791  22.944   1.00 0.00 ? 316 VAL A HB   2  
ATOM 10226 H HG11 . VAL A 1 321 ? -91.997  -59.284  22.133   1.00 0.00 ? 316 VAL A HG11 2  
ATOM 10227 H HG12 . VAL A 1 321 ? -90.348  -58.907  21.636   1.00 0.00 ? 316 VAL A HG12 2  
ATOM 10228 H HG13 . VAL A 1 321 ? -90.825  -58.721  23.324   1.00 0.00 ? 316 VAL A HG13 2  
ATOM 10229 H HG21 . VAL A 1 321 ? -92.408  -61.142  23.700   1.00 0.00 ? 316 VAL A HG21 2  
ATOM 10230 H HG22 . VAL A 1 321 ? -91.071  -60.767  24.787   1.00 0.00 ? 316 VAL A HG22 2  
ATOM 10231 H HG23 . VAL A 1 321 ? -91.159  -62.348  24.011   1.00 0.00 ? 316 VAL A HG23 2  
ATOM 10232 N N    . THR A 1 322 ? -90.833  -60.099  19.589   1.00 0.00 ? 317 THR A N    2  
ATOM 10233 C CA   . THR A 1 322 ? -90.271  -59.475  18.358   1.00 0.00 ? 317 THR A CA   2  
ATOM 10234 C C    . THR A 1 322 ? -90.803  -58.044  18.216   1.00 0.00 ? 317 THR A C    2  
ATOM 10235 O O    . THR A 1 322 ? -91.574  -57.592  19.038   1.00 0.00 ? 317 THR A O    2  
ATOM 10236 C CB   . THR A 1 322 ? -90.762  -60.356  17.200   1.00 0.00 ? 317 THR A CB   2  
ATOM 10237 O OG1  . THR A 1 322 ? -91.691  -61.317  17.686   1.00 0.00 ? 317 THR A OG1  2  
ATOM 10238 C CG2  . THR A 1 322 ? -89.572  -61.077  16.564   1.00 0.00 ? 317 THR A CG2  2  
ATOM 10239 H H    . THR A 1 322 ? -91.706  -59.812  19.924   1.00 0.00 ? 317 THR A H    2  
ATOM 10240 H HA   . THR A 1 322 ? -89.192  -59.475  18.393   1.00 0.00 ? 317 THR A HA   2  
ATOM 10241 H HB   . THR A 1 322 ? -91.241  -59.739  16.457   1.00 0.00 ? 317 THR A HB   2  
ATOM 10242 H HG1  . THR A 1 322 ? -92.420  -61.366  17.063   1.00 0.00 ? 317 THR A HG1  2  
ATOM 10243 H HG21 . THR A 1 322 ? -89.802  -61.312  15.535   1.00 0.00 ? 317 THR A HG21 2  
ATOM 10244 H HG22 . THR A 1 322 ? -89.373  -61.990  17.106   1.00 0.00 ? 317 THR A HG22 2  
ATOM 10245 H HG23 . THR A 1 322 ? -88.702  -60.439  16.602   1.00 0.00 ? 317 THR A HG23 2  
ATOM 10246 N N    . PRO A 1 323 ? -90.376  -57.374  17.174   1.00 0.00 ? 318 PRO A N    2  
ATOM 10247 C CA   . PRO A 1 323 ? -90.829  -55.980  16.939   1.00 0.00 ? 318 PRO A CA   2  
ATOM 10248 C C    . PRO A 1 323 ? -92.278  -55.944  16.430   1.00 0.00 ? 318 PRO A C    2  
ATOM 10249 O O    . PRO A 1 323 ? -92.794  -54.897  16.089   1.00 0.00 ? 318 PRO A O    2  
ATOM 10250 C CB   . PRO A 1 323 ? -89.867  -55.467  15.873   1.00 0.00 ? 318 PRO A CB   2  
ATOM 10251 C CG   . PRO A 1 323 ? -89.384  -56.689  15.158   1.00 0.00 ? 318 PRO A CG   2  
ATOM 10252 C CD   . PRO A 1 323 ? -89.444  -57.835  16.135   1.00 0.00 ? 318 PRO A CD   2  
ATOM 10253 H HA   . PRO A 1 323 ? -90.727  -55.392  17.837   1.00 0.00 ? 318 PRO A HA   2  
ATOM 10254 H HB2  . PRO A 1 323 ? -90.383  -54.808  15.190   1.00 0.00 ? 318 PRO A HB2  2  
ATOM 10255 H HB3  . PRO A 1 323 ? -89.035  -54.958  16.334   1.00 0.00 ? 318 PRO A HB3  2  
ATOM 10256 H HG2  . PRO A 1 323 ? -90.022  -56.892  14.309   1.00 0.00 ? 318 PRO A HG2  2  
ATOM 10257 H HG3  . PRO A 1 323 ? -88.366  -56.546  14.830   1.00 0.00 ? 318 PRO A HG3  2  
ATOM 10258 H HD2  . PRO A 1 323 ? -89.821  -58.722  15.647   1.00 0.00 ? 318 PRO A HD2  2  
ATOM 10259 H HD3  . PRO A 1 323 ? -88.472  -58.019  16.563   1.00 0.00 ? 318 PRO A HD3  2  
ATOM 10260 N N    . GLN A 1 324 ? -92.941  -57.071  16.382   1.00 0.00 ? 319 GLN A N    2  
ATOM 10261 C CA   . GLN A 1 324 ? -94.353  -57.090  15.903   1.00 0.00 ? 319 GLN A CA   2  
ATOM 10262 C C    . GLN A 1 324 ? -95.302  -57.116  17.102   1.00 0.00 ? 319 GLN A C    2  
ATOM 10263 O O    . GLN A 1 324 ? -96.214  -56.318  17.202   1.00 0.00 ? 319 GLN A O    2  
ATOM 10264 C CB   . GLN A 1 324 ? -94.479  -58.378  15.088   1.00 0.00 ? 319 GLN A CB   2  
ATOM 10265 C CG   . GLN A 1 324 ? -93.531  -58.319  13.887   1.00 0.00 ? 319 GLN A CG   2  
ATOM 10266 C CD   . GLN A 1 324 ? -92.940  -59.707  13.634   1.00 0.00 ? 319 GLN A CD   2  
ATOM 10267 O OE1  . GLN A 1 324 ? -92.206  -60.226  14.451   1.00 0.00 ? 319 GLN A OE1  2  
ATOM 10268 N NE2  . GLN A 1 324 ? -93.232  -60.335  12.527   1.00 0.00 ? 319 GLN A NE2  2  
ATOM 10269 H H    . GLN A 1 324 ? -92.516  -57.902  16.664   1.00 0.00 ? 319 GLN A H    2  
ATOM 10270 H HA   . GLN A 1 324 ? -94.553  -56.234  15.278   1.00 0.00 ? 319 GLN A HA   2  
ATOM 10271 H HB2  . GLN A 1 324 ? -94.222  -59.223  15.710   1.00 0.00 ? 319 GLN A HB2  2  
ATOM 10272 H HB3  . GLN A 1 324 ? -95.494  -58.484  14.737   1.00 0.00 ? 319 GLN A HB3  2  
ATOM 10273 H HG2  . GLN A 1 324 ? -94.077  -57.994  13.014   1.00 0.00 ? 319 GLN A HG2  2  
ATOM 10274 H HG3  . GLN A 1 324 ? -92.732  -57.622  14.092   1.00 0.00 ? 319 GLN A HG3  2  
ATOM 10275 H HE21 . GLN A 1 324 ? -93.824  -59.916  11.868   1.00 0.00 ? 319 GLN A HE21 2  
ATOM 10276 H HE22 . GLN A 1 324 ? -92.858  -61.224  12.356   1.00 0.00 ? 319 GLN A HE22 2  
ATOM 10277 N N    . GLU A 1 325 ? -95.087  -58.023  18.018   1.00 0.00 ? 320 GLU A N    2  
ATOM 10278 C CA   . GLU A 1 325 ? -95.968  -58.096  19.219   1.00 0.00 ? 320 GLU A CA   2  
ATOM 10279 C C    . GLU A 1 325 ? -95.475  -57.120  20.291   1.00 0.00 ? 320 GLU A C    2  
ATOM 10280 O O    . GLU A 1 325 ? -96.209  -56.745  21.183   1.00 0.00 ? 320 GLU A O    2  
ATOM 10281 C CB   . GLU A 1 325 ? -95.863  -59.543  19.712   1.00 0.00 ? 320 GLU A CB   2  
ATOM 10282 C CG   . GLU A 1 325 ? -94.404  -59.884  20.035   1.00 0.00 ? 320 GLU A CG   2  
ATOM 10283 C CD   . GLU A 1 325 ? -93.963  -61.088  19.199   1.00 0.00 ? 320 GLU A CD   2  
ATOM 10284 O OE1  . GLU A 1 325 ? -94.145  -61.044  17.994   1.00 0.00 ? 320 GLU A OE1  2  
ATOM 10285 O OE2  . GLU A 1 325 ? -93.453  -62.032  19.779   1.00 0.00 ? 320 GLU A OE2  2  
ATOM 10286 H H    . GLU A 1 325 ? -94.341  -58.651  17.920   1.00 0.00 ? 320 GLU A H    2  
ATOM 10287 H HA   . GLU A 1 325 ? -96.989  -57.873  18.949   1.00 0.00 ? 320 GLU A HA   2  
ATOM 10288 H HB2  . GLU A 1 325 ? -96.465  -59.662  20.602   1.00 0.00 ? 320 GLU A HB2  2  
ATOM 10289 H HB3  . GLU A 1 325 ? -96.226  -60.210  18.944   1.00 0.00 ? 320 GLU A HB3  2  
ATOM 10290 H HG2  . GLU A 1 325 ? -93.775  -59.036  19.806   1.00 0.00 ? 320 GLU A HG2  2  
ATOM 10291 H HG3  . GLU A 1 325 ? -94.315  -60.125  21.084   1.00 0.00 ? 320 GLU A HG3  2  
ATOM 10292 N N    . LYS A 1 326 ? -94.236  -56.702  20.205   1.00 0.00 ? 321 LYS A N    2  
ATOM 10293 C CA   . LYS A 1 326 ? -93.693  -55.745  21.216   1.00 0.00 ? 321 LYS A CA   2  
ATOM 10294 C C    . LYS A 1 326 ? -94.619  -54.533  21.350   1.00 0.00 ? 321 LYS A C    2  
ATOM 10295 O O    . LYS A 1 326 ? -94.684  -53.901  22.385   1.00 0.00 ? 321 LYS A O    2  
ATOM 10296 C CB   . LYS A 1 326 ? -92.332  -55.313  20.667   1.00 0.00 ? 321 LYS A CB   2  
ATOM 10297 C CG   . LYS A 1 326 ? -91.226  -56.138  21.329   1.00 0.00 ? 321 LYS A CG   2  
ATOM 10298 C CD   . LYS A 1 326 ? -91.053  -55.693  22.783   1.00 0.00 ? 321 LYS A CD   2  
ATOM 10299 C CE   . LYS A 1 326 ? -90.338  -54.339  22.827   1.00 0.00 ? 321 LYS A CE   2  
ATOM 10300 N NZ   . LYS A 1 326 ? -88.957  -54.610  22.333   1.00 0.00 ? 321 LYS A NZ   2  
ATOM 10301 H H    . LYS A 1 326 ? -93.664  -57.016  19.475   1.00 0.00 ? 321 LYS A H    2  
ATOM 10302 H HA   . LYS A 1 326 ? -93.569  -56.232  22.170   1.00 0.00 ? 321 LYS A HA   2  
ATOM 10303 H HB2  . LYS A 1 326 ? -92.309  -55.472  19.598   1.00 0.00 ? 321 LYS A HB2  2  
ATOM 10304 H HB3  . LYS A 1 326 ? -92.174  -54.267  20.879   1.00 0.00 ? 321 LYS A HB3  2  
ATOM 10305 H HG2  . LYS A 1 326 ? -91.493  -57.183  21.301   1.00 0.00 ? 321 LYS A HG2  2  
ATOM 10306 H HG3  . LYS A 1 326 ? -90.299  -55.989  20.797   1.00 0.00 ? 321 LYS A HG3  2  
ATOM 10307 H HD2  . LYS A 1 326 ? -92.024  -55.603  23.249   1.00 0.00 ? 321 LYS A HD2  2  
ATOM 10308 H HD3  . LYS A 1 326 ? -90.465  -56.426  23.315   1.00 0.00 ? 321 LYS A HD3  2  
ATOM 10309 H HE2  . LYS A 1 326 ? -90.838  -53.630  22.183   1.00 0.00 ? 321 LYS A HE2  2  
ATOM 10310 H HE3  . LYS A 1 326 ? -90.300  -53.967  23.839   1.00 0.00 ? 321 LYS A HE3  2  
ATOM 10311 H HZ1  . LYS A 1 326 ? -88.626  -55.523  22.703   1.00 0.00 ? 321 LYS A HZ1  2  
ATOM 10312 H HZ2  . LYS A 1 326 ? -88.321  -53.853  22.656   1.00 0.00 ? 321 LYS A HZ2  2  
ATOM 10313 H HZ3  . LYS A 1 326 ? -88.961  -54.640  21.294   1.00 0.00 ? 321 LYS A HZ3  2  
ATOM 10314 N N    . GLU A 1 327 ? -95.336  -54.208  20.308   1.00 0.00 ? 322 GLU A N    2  
ATOM 10315 C CA   . GLU A 1 327 ? -96.261  -53.037  20.374   1.00 0.00 ? 322 GLU A CA   2  
ATOM 10316 C C    . GLU A 1 327 ? -97.353  -53.284  21.419   1.00 0.00 ? 322 GLU A C    2  
ATOM 10317 O O    . GLU A 1 327 ? -97.695  -52.411  22.195   1.00 0.00 ? 322 GLU A O    2  
ATOM 10318 C CB   . GLU A 1 327 ? -96.871  -52.929  18.976   1.00 0.00 ? 322 GLU A CB   2  
ATOM 10319 C CG   . GLU A 1 327 ? -95.862  -52.281  18.026   1.00 0.00 ? 322 GLU A CG   2  
ATOM 10320 C CD   . GLU A 1 327 ? -96.035  -52.864  16.622   1.00 0.00 ? 322 GLU A CD   2  
ATOM 10321 O OE1  . GLU A 1 327 ? -97.170  -53.021  16.204   1.00 0.00 ? 322 GLU A OE1  2  
ATOM 10322 O OE2  . GLU A 1 327 ? -95.029  -53.142  15.990   1.00 0.00 ? 322 GLU A OE2  2  
ATOM 10323 H H    . GLU A 1 327 ? -95.266  -54.734  19.481   1.00 0.00 ? 322 GLU A H    2  
ATOM 10324 H HA   . GLU A 1 327 ? -95.713  -52.138  20.607   1.00 0.00 ? 322 GLU A HA   2  
ATOM 10325 H HB2  . GLU A 1 327 ? -97.123  -53.916  18.617   1.00 0.00 ? 322 GLU A HB2  2  
ATOM 10326 H HB3  . GLU A 1 327 ? -97.763  -52.322  19.018   1.00 0.00 ? 322 GLU A HB3  2  
ATOM 10327 H HG2  . GLU A 1 327 ? -96.029  -51.214  17.998   1.00 0.00 ? 322 GLU A HG2  2  
ATOM 10328 H HG3  . GLU A 1 327 ? -94.859  -52.479  18.375   1.00 0.00 ? 322 GLU A HG3  2  
ATOM 10329 N N    . ALA A 1 328 ? -97.904  -54.468  21.444   1.00 0.00 ? 323 ALA A N    2  
ATOM 10330 C CA   . ALA A 1 328 ? -98.976  -54.776  22.436   1.00 0.00 ? 323 ALA A CA   2  
ATOM 10331 C C    . ALA A 1 328 ? -98.385  -54.895  23.844   1.00 0.00 ? 323 ALA A C    2  
ATOM 10332 O O    . ALA A 1 328 ? -99.066  -54.690  24.830   1.00 0.00 ? 323 ALA A O    2  
ATOM 10333 C CB   . ALA A 1 328 ? -99.560  -56.117  21.986   1.00 0.00 ? 323 ALA A CB   2  
ATOM 10334 H H    . ALA A 1 328 ? -97.612  -55.156  20.809   1.00 0.00 ? 323 ALA A H    2  
ATOM 10335 H HA   . ALA A 1 328 ? -99.741  -54.016  22.411   1.00 0.00 ? 323 ALA A HA   2  
ATOM 10336 H HB1  . ALA A 1 328 ? -99.845  -56.054  20.946   1.00 0.00 ? 323 ALA A HB1  2  
ATOM 10337 H HB2  . ALA A 1 328 ? -100.428 -56.350  22.584   1.00 0.00 ? 323 ALA A HB2  2  
ATOM 10338 H HB3  . ALA A 1 328 ? -98.818  -56.892  22.110   1.00 0.00 ? 323 ALA A HB3  2  
ATOM 10339 N N    . ILE A 1 329 ? -97.125  -55.225  23.948   1.00 0.00 ? 324 ILE A N    2  
ATOM 10340 C CA   . ILE A 1 329 ? -96.499  -55.357  25.298   1.00 0.00 ? 324 ILE A CA   2  
ATOM 10341 C C    . ILE A 1 329 ? -96.025  -53.998  25.793   1.00 0.00 ? 324 ILE A C    2  
ATOM 10342 O O    . ILE A 1 329 ? -96.338  -53.585  26.891   1.00 0.00 ? 324 ILE A O    2  
ATOM 10343 C CB   . ILE A 1 329 ? -95.297  -56.284  25.112   1.00 0.00 ? 324 ILE A CB   2  
ATOM 10344 C CG1  . ILE A 1 329 ? -95.709  -57.530  24.317   1.00 0.00 ? 324 ILE A CG1  2  
ATOM 10345 C CG2  . ILE A 1 329 ? -94.771  -56.711  26.484   1.00 0.00 ? 324 ILE A CG2  2  
ATOM 10346 C CD1  . ILE A 1 329 ? -96.882  -58.226  25.016   1.00 0.00 ? 324 ILE A CD1  2  
ATOM 10347 H H    . ILE A 1 329 ? -96.592  -55.387  23.142   1.00 0.00 ? 324 ILE A H    2  
ATOM 10348 H HA   . ILE A 1 329 ? -97.195  -55.792  25.997   1.00 0.00 ? 324 ILE A HA   2  
ATOM 10349 H HB   . ILE A 1 329 ? -94.519  -55.749  24.583   1.00 0.00 ? 324 ILE A HB   2  
ATOM 10350 H HG12 . ILE A 1 329 ? -96.006  -57.239  23.321   1.00 0.00 ? 324 ILE A HG12 2  
ATOM 10351 H HG13 . ILE A 1 329 ? -94.874  -58.211  24.259   1.00 0.00 ? 324 ILE A HG13 2  
ATOM 10352 H HG21 . ILE A 1 329 ? -95.576  -56.682  27.203   1.00 0.00 ? 324 ILE A HG21 2  
ATOM 10353 H HG22 . ILE A 1 329 ? -93.986  -56.037  26.795   1.00 0.00 ? 324 ILE A HG22 2  
ATOM 10354 H HG23 . ILE A 1 329 ? -94.379  -57.716  26.422   1.00 0.00 ? 324 ILE A HG23 2  
ATOM 10355 H HD11 . ILE A 1 329 ? -97.237  -59.039  24.401   1.00 0.00 ? 324 ILE A HD11 2  
ATOM 10356 H HD12 . ILE A 1 329 ? -97.683  -57.516  25.172   1.00 0.00 ? 324 ILE A HD12 2  
ATOM 10357 H HD13 . ILE A 1 329 ? -96.554  -58.612  25.970   1.00 0.00 ? 324 ILE A HD13 2  
ATOM 10358 N N    . GLU A 1 330 ? -95.262  -53.300  24.995   1.00 0.00 ? 325 GLU A N    2  
ATOM 10359 C CA   . GLU A 1 330 ? -94.759  -51.969  25.431   1.00 0.00 ? 325 GLU A CA   2  
ATOM 10360 C C    . GLU A 1 330 ? -95.931  -51.095  25.896   1.00 0.00 ? 325 GLU A C    2  
ATOM 10361 O O    . GLU A 1 330 ? -95.832  -50.367  26.866   1.00 0.00 ? 325 GLU A O    2  
ATOM 10362 C CB   . GLU A 1 330 ? -94.070  -51.367  24.200   1.00 0.00 ? 325 GLU A CB   2  
ATOM 10363 C CG   . GLU A 1 330 ? -95.105  -51.042  23.120   1.00 0.00 ? 325 GLU A CG   2  
ATOM 10364 C CD   . GLU A 1 330 ? -94.396  -50.478  21.887   1.00 0.00 ? 325 GLU A CD   2  
ATOM 10365 O OE1  . GLU A 1 330 ? -93.317  -50.956  21.578   1.00 0.00 ? 325 GLU A OE1  2  
ATOM 10366 O OE2  . GLU A 1 330 ? -94.943  -49.576  21.274   1.00 0.00 ? 325 GLU A OE2  2  
ATOM 10367 H H    . GLU A 1 330 ? -95.015  -53.655  24.117   1.00 0.00 ? 325 GLU A H    2  
ATOM 10368 H HA   . GLU A 1 330 ? -94.044  -52.096  26.226   1.00 0.00 ? 325 GLU A HA   2  
ATOM 10369 H HB2  . GLU A 1 330 ? -93.554  -50.462  24.486   1.00 0.00 ? 325 GLU A HB2  2  
ATOM 10370 H HB3  . GLU A 1 330 ? -93.357  -52.076  23.808   1.00 0.00 ? 325 GLU A HB3  2  
ATOM 10371 H HG2  . GLU A 1 330 ? -95.638  -51.942  22.850   1.00 0.00 ? 325 GLU A HG2  2  
ATOM 10372 H HG3  . GLU A 1 330 ? -95.802  -50.309  23.496   1.00 0.00 ? 325 GLU A HG3  2  
ATOM 10373 N N    . ARG A 1 331 ? -97.045  -51.179  25.218   1.00 0.00 ? 326 ARG A N    2  
ATOM 10374 C CA   . ARG A 1 331 ? -98.230  -50.371  25.625   1.00 0.00 ? 326 ARG A CA   2  
ATOM 10375 C C    . ARG A 1 331 ? -98.800  -50.921  26.934   1.00 0.00 ? 326 ARG A C    2  
ATOM 10376 O O    . ARG A 1 331 ? -99.125  -50.180  27.841   1.00 0.00 ? 326 ARG A O    2  
ATOM 10377 C CB   . ARG A 1 331 ? -99.240  -50.532  24.485   1.00 0.00 ? 326 ARG A CB   2  
ATOM 10378 C CG   . ARG A 1 331 ? -99.621  -49.154  23.938   1.00 0.00 ? 326 ARG A CG   2  
ATOM 10379 C CD   . ARG A 1 331 ? -101.095 -49.157  23.523   1.00 0.00 ? 326 ARG A CD   2  
ATOM 10380 N NE   . ARG A 1 331 ? -101.123 -48.462  22.206   1.00 0.00 ? 326 ARG A NE   2  
ATOM 10381 C CZ   . ARG A 1 331 ? -101.992 -48.817  21.300   1.00 0.00 ? 326 ARG A CZ   2  
ATOM 10382 N NH1  . ARG A 1 331 ? -103.188 -48.294  21.302   1.00 0.00 ? 326 ARG A NH1  2  
ATOM 10383 N NH2  . ARG A 1 331 ? -101.665 -49.694  20.391   1.00 0.00 ? 326 ARG A NH2  2  
ATOM 10384 H H    . ARG A 1 331 ? -97.104  -51.783  24.448   1.00 0.00 ? 326 ARG A H    2  
ATOM 10385 H HA   . ARG A 1 331 ? -97.958  -49.333  25.738   1.00 0.00 ? 326 ARG A HA   2  
ATOM 10386 H HB2  . ARG A 1 331 ? -98.801  -51.124  23.695   1.00 0.00 ? 326 ARG A HB2  2  
ATOM 10387 H HB3  . ARG A 1 331 ? -100.125 -51.027  24.855   1.00 0.00 ? 326 ARG A HB3  2  
ATOM 10388 H HG2  . ARG A 1 331 ? -99.463  -48.407  24.703   1.00 0.00 ? 326 ARG A HG2  2  
ATOM 10389 H HG3  . ARG A 1 331 ? -99.008  -48.925  23.080   1.00 0.00 ? 326 ARG A HG3  2  
ATOM 10390 H HD2  . ARG A 1 331 ? -101.455 -50.172  23.423   1.00 0.00 ? 326 ARG A HD2  2  
ATOM 10391 H HD3  . ARG A 1 331 ? -101.689 -48.613  24.241   1.00 0.00 ? 326 ARG A HD3  2  
ATOM 10392 H HE   . ARG A 1 331 ? -100.490 -47.737  22.021   1.00 0.00 ? 326 ARG A HE   2  
ATOM 10393 H HH11 . ARG A 1 331 ? -103.438 -47.622  21.998   1.00 0.00 ? 326 ARG A HH11 2  
ATOM 10394 H HH12 . ARG A 1 331 ? -103.853 -48.566  20.607   1.00 0.00 ? 326 ARG A HH12 2  
ATOM 10395 H HH21 . ARG A 1 331 ? -100.749 -50.095  20.390   1.00 0.00 ? 326 ARG A HH21 2  
ATOM 10396 H HH22 . ARG A 1 331 ? -102.331 -49.966  19.696   1.00 0.00 ? 326 ARG A HH22 2  
ATOM 10397 N N    . LEU A 1 332 ? -98.917  -52.219  27.039   1.00 0.00 ? 327 LEU A N    2  
ATOM 10398 C CA   . LEU A 1 332 ? -99.460  -52.824  28.292   1.00 0.00 ? 327 LEU A CA   2  
ATOM 10399 C C    . LEU A 1 332 ? -98.543  -52.486  29.464   1.00 0.00 ? 327 LEU A C    2  
ATOM 10400 O O    . LEU A 1 332 ? -98.984  -52.000  30.487   1.00 0.00 ? 327 LEU A O    2  
ATOM 10401 C CB   . LEU A 1 332 ? -99.483  -54.330  28.029   1.00 0.00 ? 327 LEU A CB   2  
ATOM 10402 C CG   . LEU A 1 332 ? -100.880 -54.748  27.557   1.00 0.00 ? 327 LEU A CG   2  
ATOM 10403 C CD1  . LEU A 1 332 ? -101.354 -53.808  26.444   1.00 0.00 ? 327 LEU A CD1  2  
ATOM 10404 C CD2  . LEU A 1 332 ? -100.827 -56.180  27.022   1.00 0.00 ? 327 LEU A CD2  2  
ATOM 10405 H H    . LEU A 1 332 ? -98.643  -52.796  26.295   1.00 0.00 ? 327 LEU A H    2  
ATOM 10406 H HA   . LEU A 1 332 ? -100.459 -52.468  28.480   1.00 0.00 ? 327 LEU A HA   2  
ATOM 10407 H HB2  . LEU A 1 332 ? -98.756  -54.573  27.267   1.00 0.00 ? 327 LEU A HB2  2  
ATOM 10408 H HB3  . LEU A 1 332 ? -99.240  -54.857  28.939   1.00 0.00 ? 327 LEU A HB3  2  
ATOM 10409 H HG   . LEU A 1 332 ? -101.569 -54.697  28.387   1.00 0.00 ? 327 LEU A HG   2  
ATOM 10410 H HD11 . LEU A 1 332 ? -100.498 -53.413  25.918   1.00 0.00 ? 327 LEU A HD11 2  
ATOM 10411 H HD12 . LEU A 1 332 ? -101.916 -52.994  26.877   1.00 0.00 ? 327 LEU A HD12 2  
ATOM 10412 H HD13 . LEU A 1 332 ? -101.981 -54.353  25.755   1.00 0.00 ? 327 LEU A HD13 2  
ATOM 10413 H HD21 . LEU A 1 332 ? -99.939  -56.306  26.420   1.00 0.00 ? 327 LEU A HD21 2  
ATOM 10414 H HD22 . LEU A 1 332 ? -101.702 -56.371  26.418   1.00 0.00 ? 327 LEU A HD22 2  
ATOM 10415 H HD23 . LEU A 1 332 ? -100.802 -56.872  27.850   1.00 0.00 ? 327 LEU A HD23 2  
ATOM 10416 N N    . LYS A 1 333 ? -97.266  -52.716  29.315   1.00 0.00 ? 328 LYS A N    2  
ATOM 10417 C CA   . LYS A 1 333 ? -96.318  -52.380  30.414   1.00 0.00 ? 328 LYS A CA   2  
ATOM 10418 C C    . LYS A 1 333 ? -96.457  -50.895  30.761   1.00 0.00 ? 328 LYS A C    2  
ATOM 10419 O O    . LYS A 1 333 ? -96.123  -50.466  31.848   1.00 0.00 ? 328 LYS A O    2  
ATOM 10420 C CB   . LYS A 1 333 ? -94.926  -52.675  29.851   1.00 0.00 ? 328 LYS A CB   2  
ATOM 10421 C CG   . LYS A 1 333 ? -94.408  -53.998  30.423   1.00 0.00 ? 328 LYS A CG   2  
ATOM 10422 C CD   . LYS A 1 333 ? -93.747  -54.817  29.310   1.00 0.00 ? 328 LYS A CD   2  
ATOM 10423 C CE   . LYS A 1 333 ? -92.522  -54.068  28.775   1.00 0.00 ? 328 LYS A CE   2  
ATOM 10424 N NZ   . LYS A 1 333 ? -91.538  -54.083  29.894   1.00 0.00 ? 328 LYS A NZ   2  
ATOM 10425 H H    . LYS A 1 333 ? -96.931  -53.091  28.475   1.00 0.00 ? 328 LYS A H    2  
ATOM 10426 H HA   . LYS A 1 333 ? -96.509  -52.994  31.281   1.00 0.00 ? 328 LYS A HA   2  
ATOM 10427 H HB2  . LYS A 1 333 ? -94.982  -52.743  28.774   1.00 0.00 ? 328 LYS A HB2  2  
ATOM 10428 H HB3  . LYS A 1 333 ? -94.251  -51.878  30.126   1.00 0.00 ? 328 LYS A HB3  2  
ATOM 10429 H HG2  . LYS A 1 333 ? -93.685  -53.795  31.199   1.00 0.00 ? 328 LYS A HG2  2  
ATOM 10430 H HG3  . LYS A 1 333 ? -95.232  -54.559  30.837   1.00 0.00 ? 328 LYS A HG3  2  
ATOM 10431 H HD2  . LYS A 1 333 ? -93.440  -55.775  29.703   1.00 0.00 ? 328 LYS A HD2  2  
ATOM 10432 H HD3  . LYS A 1 333 ? -94.453  -54.967  28.507   1.00 0.00 ? 328 LYS A HD3  2  
ATOM 10433 H HE2  . LYS A 1 333 ? -92.120  -54.579  27.911   1.00 0.00 ? 328 LYS A HE2  2  
ATOM 10434 H HE3  . LYS A 1 333 ? -92.782  -53.052  28.525   1.00 0.00 ? 328 LYS A HE3  2  
ATOM 10435 H HZ1  . LYS A 1 333 ? -91.845  -53.422  30.635   1.00 0.00 ? 328 LYS A HZ1  2  
ATOM 10436 H HZ2  . LYS A 1 333 ? -90.604  -53.795  29.536   1.00 0.00 ? 328 LYS A HZ2  2  
ATOM 10437 H HZ3  . LYS A 1 333 ? -91.478  -55.042  30.291   1.00 0.00 ? 328 LYS A HZ3  2  
ATOM 10438 N N    . ALA A 1 334 ? -96.965  -50.112  29.842   1.00 0.00 ? 329 ALA A N    2  
ATOM 10439 C CA   . ALA A 1 334 ? -97.146  -48.658  30.114   1.00 0.00 ? 329 ALA A CA   2  
ATOM 10440 C C    . ALA A 1 334 ? -98.496  -48.429  30.797   1.00 0.00 ? 329 ALA A C    2  
ATOM 10441 O O    . ALA A 1 334 ? -98.657  -47.523  31.591   1.00 0.00 ? 329 ALA A O    2  
ATOM 10442 C CB   . ALA A 1 334 ? -97.117  -47.990  28.739   1.00 0.00 ? 329 ALA A CB   2  
ATOM 10443 H H    . ALA A 1 334 ? -97.237  -50.485  28.972   1.00 0.00 ? 329 ALA A H    2  
ATOM 10444 H HA   . ALA A 1 334 ? -96.341  -48.283  30.726   1.00 0.00 ? 329 ALA A HA   2  
ATOM 10445 H HB1  . ALA A 1 334 ? -98.076  -48.114  28.258   1.00 0.00 ? 329 ALA A HB1  2  
ATOM 10446 H HB2  . ALA A 1 334 ? -96.349  -48.446  28.133   1.00 0.00 ? 329 ALA A HB2  2  
ATOM 10447 H HB3  . ALA A 1 334 ? -96.906  -46.937  28.854   1.00 0.00 ? 329 ALA A HB3  2  
ATOM 10448 N N    . LEU A 1 335 ? -99.464  -49.253  30.495   1.00 0.00 ? 330 LEU A N    2  
ATOM 10449 C CA   . LEU A 1 335 ? -100.808 -49.099  31.126   1.00 0.00 ? 330 LEU A CA   2  
ATOM 10450 C C    . LEU A 1 335 ? -100.750 -49.518  32.599   1.00 0.00 ? 330 LEU A C    2  
ATOM 10451 O O    . LEU A 1 335 ? -101.614 -49.179  33.384   1.00 0.00 ? 330 LEU A O    2  
ATOM 10452 C CB   . LEU A 1 335 ? -101.727 -50.038  30.342   1.00 0.00 ? 330 LEU A CB   2  
ATOM 10453 C CG   . LEU A 1 335 ? -101.835 -49.561  28.892   1.00 0.00 ? 330 LEU A CG   2  
ATOM 10454 C CD1  . LEU A 1 335 ? -102.111 -50.758  27.975   1.00 0.00 ? 330 LEU A CD1  2  
ATOM 10455 C CD2  . LEU A 1 335 ? -102.982 -48.554  28.774   1.00 0.00 ? 330 LEU A CD2  2  
ATOM 10456 H H    . LEU A 1 335 ? -99.306  -49.978  29.855   1.00 0.00 ? 330 LEU A H    2  
ATOM 10457 H HA   . LEU A 1 335 ? -101.154 -48.082  31.036   1.00 0.00 ? 330 LEU A HA   2  
ATOM 10458 H HB2  . LEU A 1 335 ? -101.320 -51.039  30.362   1.00 0.00 ? 330 LEU A HB2  2  
ATOM 10459 H HB3  . LEU A 1 335 ? -102.708 -50.040  30.792   1.00 0.00 ? 330 LEU A HB3  2  
ATOM 10460 H HG   . LEU A 1 335 ? -100.909 -49.090  28.599   1.00 0.00 ? 330 LEU A HG   2  
ATOM 10461 H HD11 . LEU A 1 335 ? -101.221 -50.991  27.409   1.00 0.00 ? 330 LEU A HD11 2  
ATOM 10462 H HD12 . LEU A 1 335 ? -102.915 -50.517  27.296   1.00 0.00 ? 330 LEU A HD12 2  
ATOM 10463 H HD13 . LEU A 1 335 ? -102.390 -51.615  28.573   1.00 0.00 ? 330 LEU A HD13 2  
ATOM 10464 H HD21 . LEU A 1 335 ? -103.077 -48.234  27.747   1.00 0.00 ? 330 LEU A HD21 2  
ATOM 10465 H HD22 . LEU A 1 335 ? -102.774 -47.698  29.400   1.00 0.00 ? 330 LEU A HD22 2  
ATOM 10466 H HD23 . LEU A 1 335 ? -103.903 -49.018  29.093   1.00 0.00 ? 330 LEU A HD23 2  
ATOM 10467 N N    . GLY A 1 336 ? -99.738  -50.255  32.978   1.00 0.00 ? 331 GLY A N    2  
ATOM 10468 C CA   . GLY A 1 336 ? -99.623  -50.699  34.396   1.00 0.00 ? 331 GLY A CA   2  
ATOM 10469 C C    . GLY A 1 336 ? -99.765  -52.222  34.471   1.00 0.00 ? 331 GLY A C    2  
ATOM 10470 O O    . GLY A 1 336 ? -100.113 -52.770  35.498   1.00 0.00 ? 331 GLY A O    2  
ATOM 10471 H H    . GLY A 1 336 ? -99.054  -50.517  32.328   1.00 0.00 ? 331 GLY A H    2  
ATOM 10472 H HA2  . GLY A 1 336 ? -98.659  -50.406  34.787   1.00 0.00 ? 331 GLY A HA2  2  
ATOM 10473 H HA3  . GLY A 1 336 ? -100.405 -50.240  34.982   1.00 0.00 ? 331 GLY A HA3  2  
ATOM 10474 N N    . PHE A 1 337 ? -99.499  -52.909  33.391   1.00 0.00 ? 332 PHE A N    2  
ATOM 10475 C CA   . PHE A 1 337 ? -99.619  -54.396  33.401   1.00 0.00 ? 332 PHE A CA   2  
ATOM 10476 C C    . PHE A 1 337 ? -98.237  -55.042  33.560   1.00 0.00 ? 332 PHE A C    2  
ATOM 10477 O O    . PHE A 1 337 ? -97.226  -54.389  33.389   1.00 0.00 ? 332 PHE A O    2  
ATOM 10478 C CB   . PHE A 1 337 ? -100.223 -54.752  32.041   1.00 0.00 ? 332 PHE A CB   2  
ATOM 10479 C CG   . PHE A 1 337 ? -101.730 -54.693  32.128   1.00 0.00 ? 332 PHE A CG   2  
ATOM 10480 C CD1  . PHE A 1 337 ? -102.392 -53.469  31.974   1.00 0.00 ? 332 PHE A CD1  2  
ATOM 10481 C CD2  . PHE A 1 337 ? -102.463 -55.862  32.363   1.00 0.00 ? 332 PHE A CD2  2  
ATOM 10482 C CE1  . PHE A 1 337 ? -103.789 -53.414  32.054   1.00 0.00 ? 332 PHE A CE1  2  
ATOM 10483 C CE2  . PHE A 1 337 ? -103.860 -55.807  32.443   1.00 0.00 ? 332 PHE A CE2  2  
ATOM 10484 C CZ   . PHE A 1 337 ? -104.523 -54.583  32.289   1.00 0.00 ? 332 PHE A CZ   2  
ATOM 10485 H H    . PHE A 1 337 ? -99.220  -52.447  32.572   1.00 0.00 ? 332 PHE A H    2  
ATOM 10486 H HA   . PHE A 1 337 ? -100.279 -54.716  34.192   1.00 0.00 ? 332 PHE A HA   2  
ATOM 10487 H HB2  . PHE A 1 337 ? -99.877  -54.048  31.299   1.00 0.00 ? 332 PHE A HB2  2  
ATOM 10488 H HB3  . PHE A 1 337 ? -99.919  -55.749  31.762   1.00 0.00 ? 332 PHE A HB3  2  
ATOM 10489 H HD1  . PHE A 1 337 ? -101.826 -52.567  31.793   1.00 0.00 ? 332 PHE A HD1  2  
ATOM 10490 H HD2  . PHE A 1 337 ? -101.952 -56.805  32.482   1.00 0.00 ? 332 PHE A HD2  2  
ATOM 10491 H HE1  . PHE A 1 337 ? -104.300 -52.471  31.936   1.00 0.00 ? 332 PHE A HE1  2  
ATOM 10492 H HE2  . PHE A 1 337 ? -104.426 -56.708  32.624   1.00 0.00 ? 332 PHE A HE2  2  
ATOM 10493 H HZ   . PHE A 1 337 ? -105.600 -54.541  32.351   1.00 0.00 ? 332 PHE A HZ   2  
ATOM 10494 N N    . PRO A 1 338 ? -98.238  -56.312  33.883   1.00 0.00 ? 333 PRO A N    2  
ATOM 10495 C CA   . PRO A 1 338 ? -96.964  -57.051  34.066   1.00 0.00 ? 333 PRO A CA   2  
ATOM 10496 C C    . PRO A 1 338 ? -96.292  -57.302  32.712   1.00 0.00 ? 333 PRO A C    2  
ATOM 10497 O O    . PRO A 1 338 ? -96.631  -56.690  31.718   1.00 0.00 ? 333 PRO A O    2  
ATOM 10498 C CB   . PRO A 1 338 ? -97.401  -58.366  34.708   1.00 0.00 ? 333 PRO A CB   2  
ATOM 10499 C CG   . PRO A 1 338 ? -98.826  -58.546  34.293   1.00 0.00 ? 333 PRO A CG   2  
ATOM 10500 C CD   . PRO A 1 338 ? -99.410  -57.169  34.108   1.00 0.00 ? 333 PRO A CD   2  
ATOM 10501 H HA   . PRO A 1 338 ? -96.303  -56.517  34.728   1.00 0.00 ? 333 PRO A HA   2  
ATOM 10502 H HB2  . PRO A 1 338 ? -96.793  -59.182  34.342   1.00 0.00 ? 333 PRO A HB2  2  
ATOM 10503 H HB3  . PRO A 1 338 ? -97.335  -58.299  35.783   1.00 0.00 ? 333 PRO A HB3  2  
ATOM 10504 H HG2  . PRO A 1 338 ? -98.871  -59.097  33.364   1.00 0.00 ? 333 PRO A HG2  2  
ATOM 10505 H HG3  . PRO A 1 338 ? -99.371  -59.071  35.061   1.00 0.00 ? 333 PRO A HG3  2  
ATOM 10506 H HD2  . PRO A 1 338 ? -100.068 -57.151  33.249   1.00 0.00 ? 333 PRO A HD2  2  
ATOM 10507 H HD3  . PRO A 1 338 ? -99.935  -56.857  34.996   1.00 0.00 ? 333 PRO A HD3  2  
ATOM 10508 N N    . GLU A 1 339 ? -95.340  -58.198  32.667   1.00 0.00 ? 334 GLU A N    2  
ATOM 10509 C CA   . GLU A 1 339 ? -94.645  -58.489  31.378   1.00 0.00 ? 334 GLU A CA   2  
ATOM 10510 C C    . GLU A 1 339 ? -94.819  -59.964  31.004   1.00 0.00 ? 334 GLU A C    2  
ATOM 10511 O O    . GLU A 1 339 ? -95.277  -60.290  29.926   1.00 0.00 ? 334 GLU A O    2  
ATOM 10512 C CB   . GLU A 1 339 ? -93.172  -58.171  31.641   1.00 0.00 ? 334 GLU A CB   2  
ATOM 10513 C CG   . GLU A 1 339 ? -92.385  -58.267  30.332   1.00 0.00 ? 334 GLU A CG   2  
ATOM 10514 C CD   . GLU A 1 339 ? -91.009  -57.623  30.515   1.00 0.00 ? 334 GLU A CD   2  
ATOM 10515 O OE1  . GLU A 1 339 ? -90.195  -58.200  31.216   1.00 0.00 ? 334 GLU A OE1  2  
ATOM 10516 O OE2  . GLU A 1 339 ? -90.794  -56.563  29.951   1.00 0.00 ? 334 GLU A OE2  2  
ATOM 10517 H H    . GLU A 1 339 ? -95.082  -58.679  33.480   1.00 0.00 ? 334 GLU A H    2  
ATOM 10518 H HA   . GLU A 1 339 ? -95.025  -57.853  30.593   1.00 0.00 ? 334 GLU A HA   2  
ATOM 10519 H HB2  . GLU A 1 339 ? -93.086  -57.171  32.041   1.00 0.00 ? 334 GLU A HB2  2  
ATOM 10520 H HB3  . GLU A 1 339 ? -92.773  -58.878  32.352   1.00 0.00 ? 334 GLU A HB3  2  
ATOM 10521 H HG2  . GLU A 1 339 ? -92.264  -59.306  30.061   1.00 0.00 ? 334 GLU A HG2  2  
ATOM 10522 H HG3  . GLU A 1 339 ? -92.921  -57.751  29.550   1.00 0.00 ? 334 GLU A HG3  2  
ATOM 10523 N N    . SER A 1 340 ? -94.455  -60.856  31.886   1.00 0.00 ? 335 SER A N    2  
ATOM 10524 C CA   . SER A 1 340 ? -94.598  -62.312  31.582   1.00 0.00 ? 335 SER A CA   2  
ATOM 10525 C C    . SER A 1 340 ? -96.071  -62.663  31.355   1.00 0.00 ? 335 SER A C    2  
ATOM 10526 O O    . SER A 1 340 ? -96.406  -63.435  30.477   1.00 0.00 ? 335 SER A O    2  
ATOM 10527 C CB   . SER A 1 340 ? -94.059  -63.032  32.817   1.00 0.00 ? 335 SER A CB   2  
ATOM 10528 O OG   . SER A 1 340 ? -94.930  -62.796  33.915   1.00 0.00 ? 335 SER A OG   2  
ATOM 10529 H H    . SER A 1 340 ? -94.087  -60.570  32.748   1.00 0.00 ? 335 SER A H    2  
ATOM 10530 H HA   . SER A 1 340 ? -94.010  -62.575  30.717   1.00 0.00 ? 335 SER A HA   2  
ATOM 10531 H HB2  . SER A 1 340 ? -94.009  -64.091  32.626   1.00 0.00 ? 335 SER A HB2  2  
ATOM 10532 H HB3  . SER A 1 340 ? -93.068  -62.662  33.044   1.00 0.00 ? 335 SER A HB3  2  
ATOM 10533 H HG   . SER A 1 340 ? -94.455  -63.006  34.722   1.00 0.00 ? 335 SER A HG   2  
ATOM 10534 N N    . LEU A 1 341 ? -96.952  -62.101  32.138   1.00 0.00 ? 336 LEU A N    2  
ATOM 10535 C CA   . LEU A 1 341 ? -98.405  -62.400  31.968   1.00 0.00 ? 336 LEU A CA   2  
ATOM 10536 C C    . LEU A 1 341 ? -98.946  -61.688  30.725   1.00 0.00 ? 336 LEU A C    2  
ATOM 10537 O O    . LEU A 1 341 ? -99.924  -62.104  30.135   1.00 0.00 ? 336 LEU A O    2  
ATOM 10538 C CB   . LEU A 1 341 ? -99.074  -61.856  33.232   1.00 0.00 ? 336 LEU A CB   2  
ATOM 10539 C CG   . LEU A 1 341 ? -99.243  -62.986  34.250   1.00 0.00 ? 336 LEU A CG   2  
ATOM 10540 C CD1  . LEU A 1 341 ? -97.867  -63.469  34.713   1.00 0.00 ? 336 LEU A CD1  2  
ATOM 10541 C CD2  . LEU A 1 341 ? -100.032 -62.470  35.455   1.00 0.00 ? 336 LEU A CD2  2  
ATOM 10542 H H    . LEU A 1 341 ? -96.658  -61.480  32.837   1.00 0.00 ? 336 LEU A H    2  
ATOM 10543 H HA   . LEU A 1 341 ? -98.565  -63.464  31.894   1.00 0.00 ? 336 LEU A HA   2  
ATOM 10544 H HB2  . LEU A 1 341 ? -98.458  -61.077  33.657   1.00 0.00 ? 336 LEU A HB2  2  
ATOM 10545 H HB3  . LEU A 1 341 ? -100.043 -61.452  32.981   1.00 0.00 ? 336 LEU A HB3  2  
ATOM 10546 H HG   . LEU A 1 341 ? -99.777  -63.806  33.792   1.00 0.00 ? 336 LEU A HG   2  
ATOM 10547 H HD11 . LEU A 1 341 ? -97.952  -63.905  35.697   1.00 0.00 ? 336 LEU A HD11 2  
ATOM 10548 H HD12 . LEU A 1 341 ? -97.185  -62.632  34.748   1.00 0.00 ? 336 LEU A HD12 2  
ATOM 10549 H HD13 . LEU A 1 341 ? -97.494  -64.210  34.022   1.00 0.00 ? 336 LEU A HD13 2  
ATOM 10550 H HD21 . LEU A 1 341 ? -100.628 -63.272  35.866   1.00 0.00 ? 336 LEU A HD21 2  
ATOM 10551 H HD22 . LEU A 1 341 ? -100.680 -61.664  35.144   1.00 0.00 ? 336 LEU A HD22 2  
ATOM 10552 H HD23 . LEU A 1 341 ? -99.346  -62.110  36.208   1.00 0.00 ? 336 LEU A HD23 2  
ATOM 10553 N N    . VAL A 1 342 ? -98.314  -60.617  30.324   1.00 0.00 ? 337 VAL A N    2  
ATOM 10554 C CA   . VAL A 1 342 ? -98.786  -59.873  29.120   1.00 0.00 ? 337 VAL A CA   2  
ATOM 10555 C C    . VAL A 1 342 ? -98.287  -60.559  27.844   1.00 0.00 ? 337 VAL A C    2  
ATOM 10556 O O    . VAL A 1 342 ? -99.061  -60.907  26.973   1.00 0.00 ? 337 VAL A O    2  
ATOM 10557 C CB   . VAL A 1 342 ? -98.178  -58.475  29.264   1.00 0.00 ? 337 VAL A CB   2  
ATOM 10558 C CG1  . VAL A 1 342 ? -98.438  -57.661  27.994   1.00 0.00 ? 337 VAL A CG1  2  
ATOM 10559 C CG2  . VAL A 1 342 ? -98.819  -57.766  30.460   1.00 0.00 ? 337 VAL A CG2  2  
ATOM 10560 H H    . VAL A 1 342 ? -97.528  -60.300  30.816   1.00 0.00 ? 337 VAL A H    2  
ATOM 10561 H HA   . VAL A 1 342 ? -99.863  -59.807  29.117   1.00 0.00 ? 337 VAL A HA   2  
ATOM 10562 H HB   . VAL A 1 342 ? -97.113  -58.562  29.424   1.00 0.00 ? 337 VAL A HB   2  
ATOM 10563 H HG11 . VAL A 1 342 ? -98.703  -56.649  28.262   1.00 0.00 ? 337 VAL A HG11 2  
ATOM 10564 H HG12 . VAL A 1 342 ? -99.249  -58.109  27.438   1.00 0.00 ? 337 VAL A HG12 2  
ATOM 10565 H HG13 . VAL A 1 342 ? -97.547  -57.649  27.385   1.00 0.00 ? 337 VAL A HG13 2  
ATOM 10566 H HG21 . VAL A 1 342 ? -98.549  -56.721  30.447   1.00 0.00 ? 337 VAL A HG21 2  
ATOM 10567 H HG22 . VAL A 1 342 ? -98.468  -58.217  31.377   1.00 0.00 ? 337 VAL A HG22 2  
ATOM 10568 H HG23 . VAL A 1 342 ? -99.894  -57.861  30.402   1.00 0.00 ? 337 VAL A HG23 2  
ATOM 10569 N N    . ILE A 1 343 ? -96.999  -60.756  27.726   1.00 0.00 ? 338 ILE A N    2  
ATOM 10570 C CA   . ILE A 1 343 ? -96.451  -61.421  26.504   1.00 0.00 ? 338 ILE A CA   2  
ATOM 10571 C C    . ILE A 1 343 ? -97.117  -62.785  26.297   1.00 0.00 ? 338 ILE A C    2  
ATOM 10572 O O    . ILE A 1 343 ? -97.271  -63.249  25.184   1.00 0.00 ? 338 ILE A O    2  
ATOM 10573 C CB   . ILE A 1 343 ? -94.952  -61.590  26.774   1.00 0.00 ? 338 ILE A CB   2  
ATOM 10574 C CG1  . ILE A 1 343 ? -94.744  -62.425  28.043   1.00 0.00 ? 338 ILE A CG1  2  
ATOM 10575 C CG2  . ILE A 1 343 ? -94.309  -60.214  26.962   1.00 0.00 ? 338 ILE A CG2  2  
ATOM 10576 C CD1  . ILE A 1 343 ? -94.611  -63.903  27.669   1.00 0.00 ? 338 ILE A CD1  2  
ATOM 10577 H H    . ILE A 1 343 ? -96.394  -60.468  28.441   1.00 0.00 ? 338 ILE A H    2  
ATOM 10578 H HA   . ILE A 1 343 ? -96.599  -60.795  25.638   1.00 0.00 ? 338 ILE A HA   2  
ATOM 10579 H HB   . ILE A 1 343 ? -94.491  -62.088  25.933   1.00 0.00 ? 338 ILE A HB   2  
ATOM 10580 H HG12 . ILE A 1 343 ? -93.844  -62.098  28.543   1.00 0.00 ? 338 ILE A HG12 2  
ATOM 10581 H HG13 . ILE A 1 343 ? -95.589  -62.297  28.702   1.00 0.00 ? 338 ILE A HG13 2  
ATOM 10582 H HG21 . ILE A 1 343 ? -95.051  -59.515  27.319   1.00 0.00 ? 338 ILE A HG21 2  
ATOM 10583 H HG22 . ILE A 1 343 ? -93.915  -59.869  26.017   1.00 0.00 ? 338 ILE A HG22 2  
ATOM 10584 H HG23 . ILE A 1 343 ? -93.507  -60.287  27.681   1.00 0.00 ? 338 ILE A HG23 2  
ATOM 10585 H HD11 . ILE A 1 343 ? -95.009  -64.062  26.677   1.00 0.00 ? 338 ILE A HD11 2  
ATOM 10586 H HD12 . ILE A 1 343 ? -95.161  -64.504  28.378   1.00 0.00 ? 338 ILE A HD12 2  
ATOM 10587 H HD13 . ILE A 1 343 ? -93.569  -64.187  27.688   1.00 0.00 ? 338 ILE A HD13 2  
ATOM 10588 N N    . GLN A 1 344 ? -97.514  -63.425  27.362   1.00 0.00 ? 339 GLN A N    2  
ATOM 10589 C CA   . GLN A 1 344 ? -98.173  -64.757  27.237   1.00 0.00 ? 339 GLN A CA   2  
ATOM 10590 C C    . GLN A 1 344 ? -99.656  -64.584  26.896   1.00 0.00 ? 339 GLN A C    2  
ATOM 10591 O O    . GLN A 1 344 ? -100.117 -65.008  25.854   1.00 0.00 ? 339 GLN A O    2  
ATOM 10592 C CB   . GLN A 1 344 ? -98.013  -65.410  28.610   1.00 0.00 ? 339 GLN A CB   2  
ATOM 10593 C CG   . GLN A 1 344 ? -98.502  -66.858  28.546   1.00 0.00 ? 339 GLN A CG   2  
ATOM 10594 C CD   . GLN A 1 344 ? -97.737  -67.702  29.567   1.00 0.00 ? 339 GLN A CD   2  
ATOM 10595 O OE1  . GLN A 1 344 ? -96.656  -68.180  29.289   1.00 0.00 ? 339 GLN A OE1  2  
ATOM 10596 N NE2  . GLN A 1 344 ? -98.257  -67.906  30.747   1.00 0.00 ? 339 GLN A NE2  2  
ATOM 10597 H H    . GLN A 1 344 ? -97.380  -63.028  28.248   1.00 0.00 ? 339 GLN A H    2  
ATOM 10598 H HA   . GLN A 1 344 ? -97.680  -65.352  26.485   1.00 0.00 ? 339 GLN A HA   2  
ATOM 10599 H HB2  . GLN A 1 344 ? -96.971  -65.393  28.897   1.00 0.00 ? 339 GLN A HB2  2  
ATOM 10600 H HB3  . GLN A 1 344 ? -98.596  -64.867  29.337   1.00 0.00 ? 339 GLN A HB3  2  
ATOM 10601 H HG2  . GLN A 1 344 ? -99.559  -66.891  28.770   1.00 0.00 ? 339 GLN A HG2  2  
ATOM 10602 H HG3  . GLN A 1 344 ? -98.332  -67.253  27.556   1.00 0.00 ? 339 GLN A HG3  2  
ATOM 10603 H HE21 . GLN A 1 344 ? -99.130  -67.521  30.971   1.00 0.00 ? 339 GLN A HE21 2  
ATOM 10604 H HE22 . GLN A 1 344 ? -97.774  -68.445  31.408   1.00 0.00 ? 339 GLN A HE22 2  
ATOM 10605 N N    . ALA A 1 345 ? -100.404 -63.970  27.775   1.00 0.00 ? 340 ALA A N    2  
ATOM 10606 C CA   . ALA A 1 345 ? -101.864 -63.768  27.522   1.00 0.00 ? 340 ALA A CA   2  
ATOM 10607 C C    . ALA A 1 345 ? -102.109 -63.187  26.126   1.00 0.00 ? 340 ALA A C    2  
ATOM 10608 O O    . ALA A 1 345 ? -103.160 -63.382  25.548   1.00 0.00 ? 340 ALA A O    2  
ATOM 10609 C CB   . ALA A 1 345 ? -102.319 -62.778  28.595   1.00 0.00 ? 340 ALA A CB   2  
ATOM 10610 H H    . ALA A 1 345 ? -100.005 -63.645  28.609   1.00 0.00 ? 340 ALA A H    2  
ATOM 10611 H HA   . ALA A 1 345 ? -102.397 -64.698  27.637   1.00 0.00 ? 340 ALA A HA   2  
ATOM 10612 H HB1  . ALA A 1 345 ? -101.728 -61.877  28.527   1.00 0.00 ? 340 ALA A HB1  2  
ATOM 10613 H HB2  . ALA A 1 345 ? -102.189 -63.221  29.572   1.00 0.00 ? 340 ALA A HB2  2  
ATOM 10614 H HB3  . ALA A 1 345 ? -103.361 -62.537  28.445   1.00 0.00 ? 340 ALA A HB3  2  
ATOM 10615 N N    . TYR A 1 346 ? -101.153 -62.475  25.579   1.00 0.00 ? 341 TYR A N    2  
ATOM 10616 C CA   . TYR A 1 346 ? -101.344 -61.880  24.218   1.00 0.00 ? 341 TYR A CA   2  
ATOM 10617 C C    . TYR A 1 346 ? -101.908 -62.925  23.252   1.00 0.00 ? 341 TYR A C    2  
ATOM 10618 O O    . TYR A 1 346 ? -102.795 -62.641  22.471   1.00 0.00 ? 341 TYR A O    2  
ATOM 10619 C CB   . TYR A 1 346 ? -99.951  -61.419  23.772   1.00 0.00 ? 341 TYR A CB   2  
ATOM 10620 C CG   . TYR A 1 346 ? -100.004 -60.922  22.340   1.00 0.00 ? 341 TYR A CG   2  
ATOM 10621 C CD1  . TYR A 1 346 ? -101.177 -60.340  21.835   1.00 0.00 ? 341 TYR A CD1  2  
ATOM 10622 C CD2  . TYR A 1 346 ? -98.879  -61.046  21.516   1.00 0.00 ? 341 TYR A CD2  2  
ATOM 10623 C CE1  . TYR A 1 346 ? -101.222 -59.886  20.513   1.00 0.00 ? 341 TYR A CE1  2  
ATOM 10624 C CE2  . TYR A 1 346 ? -98.925  -60.591  20.193   1.00 0.00 ? 341 TYR A CE2  2  
ATOM 10625 C CZ   . TYR A 1 346 ? -100.096 -60.011  19.691   1.00 0.00 ? 341 TYR A CZ   2  
ATOM 10626 O OH   . TYR A 1 346 ? -100.140 -59.564  18.387   1.00 0.00 ? 341 TYR A OH   2  
ATOM 10627 H H    . TYR A 1 346 ? -100.314 -62.328  26.064   1.00 0.00 ? 341 TYR A H    2  
ATOM 10628 H HA   . TYR A 1 346 ? -102.010 -61.033  24.274   1.00 0.00 ? 341 TYR A HA   2  
ATOM 10629 H HB2  . TYR A 1 346 ? -99.614  -60.621  24.416   1.00 0.00 ? 341 TYR A HB2  2  
ATOM 10630 H HB3  . TYR A 1 346 ? -99.261  -62.248  23.837   1.00 0.00 ? 341 TYR A HB3  2  
ATOM 10631 H HD1  . TYR A 1 346 ? -102.046 -60.242  22.468   1.00 0.00 ? 341 TYR A HD1  2  
ATOM 10632 H HD2  . TYR A 1 346 ? -97.974  -61.493  21.902   1.00 0.00 ? 341 TYR A HD2  2  
ATOM 10633 H HE1  . TYR A 1 346 ? -102.126 -59.441  20.126   1.00 0.00 ? 341 TYR A HE1  2  
ATOM 10634 H HE2  . TYR A 1 346 ? -98.057  -60.688  19.558   1.00 0.00 ? 341 TYR A HE2  2  
ATOM 10635 H HH   . TYR A 1 346 ? -100.572 -58.707  18.381   1.00 0.00 ? 341 TYR A HH   2  
ATOM 10636 N N    . PHE A 1 347 ? -101.419 -64.135  23.311   1.00 0.00 ? 342 PHE A N    2  
ATOM 10637 C CA   . PHE A 1 347 ? -101.955 -65.194  22.409   1.00 0.00 ? 342 PHE A CA   2  
ATOM 10638 C C    . PHE A 1 347 ? -103.343 -65.603  22.904   1.00 0.00 ? 342 PHE A C    2  
ATOM 10639 O O    . PHE A 1 347 ? -103.571 -66.733  23.292   1.00 0.00 ? 342 PHE A O    2  
ATOM 10640 C CB   . PHE A 1 347 ? -100.972 -66.360  22.525   1.00 0.00 ? 342 PHE A CB   2  
ATOM 10641 C CG   . PHE A 1 347 ? -99.720  -66.045  21.742   1.00 0.00 ? 342 PHE A CG   2  
ATOM 10642 C CD1  . PHE A 1 347 ? -98.711  -65.264  22.318   1.00 0.00 ? 342 PHE A CD1  2  
ATOM 10643 C CD2  . PHE A 1 347 ? -99.568  -66.534  20.438   1.00 0.00 ? 342 PHE A CD2  2  
ATOM 10644 C CE1  . PHE A 1 347 ? -97.551  -64.973  21.592   1.00 0.00 ? 342 PHE A CE1  2  
ATOM 10645 C CE2  . PHE A 1 347 ? -98.407  -66.242  19.712   1.00 0.00 ? 342 PHE A CE2  2  
ATOM 10646 C CZ   . PHE A 1 347 ? -97.398  -65.462  20.290   1.00 0.00 ? 342 PHE A CZ   2  
ATOM 10647 H H    . PHE A 1 347 ? -100.715 -64.349  23.958   1.00 0.00 ? 342 PHE A H    2  
ATOM 10648 H HA   . PHE A 1 347 ? -102.001 -64.841  21.390   1.00 0.00 ? 342 PHE A HA   2  
ATOM 10649 H HB2  . PHE A 1 347 ? -100.718 -66.514  23.564   1.00 0.00 ? 342 PHE A HB2  2  
ATOM 10650 H HB3  . PHE A 1 347 ? -101.427 -67.256  22.129   1.00 0.00 ? 342 PHE A HB3  2  
ATOM 10651 H HD1  . PHE A 1 347 ? -98.829  -64.887  23.324   1.00 0.00 ? 342 PHE A HD1  2  
ATOM 10652 H HD2  . PHE A 1 347 ? -100.346 -67.136  19.993   1.00 0.00 ? 342 PHE A HD2  2  
ATOM 10653 H HE1  . PHE A 1 347 ? -96.772  -64.371  22.038   1.00 0.00 ? 342 PHE A HE1  2  
ATOM 10654 H HE2  . PHE A 1 347 ? -98.290  -66.619  18.707   1.00 0.00 ? 342 PHE A HE2  2  
ATOM 10655 H HZ   . PHE A 1 347 ? -96.503  -65.236  19.730   1.00 0.00 ? 342 PHE A HZ   2  
ATOM 10656 N N    . ALA A 1 348 ? -104.266 -64.679  22.913   1.00 0.00 ? 343 ALA A N    2  
ATOM 10657 C CA   . ALA A 1 348 ? -105.637 -64.987  23.404   1.00 0.00 ? 343 ALA A CA   2  
ATOM 10658 C C    . ALA A 1 348 ? -106.472 -65.650  22.316   1.00 0.00 ? 343 ALA A C    2  
ATOM 10659 O O    . ALA A 1 348 ? -106.786 -66.822  22.393   1.00 0.00 ? 343 ALA A O    2  
ATOM 10660 C CB   . ALA A 1 348 ? -106.235 -63.631  23.774   1.00 0.00 ? 343 ALA A CB   2  
ATOM 10661 H H    . ALA A 1 348 ? -104.052 -63.773  22.609   1.00 0.00 ? 343 ALA A H    2  
ATOM 10662 H HA   . ALA A 1 348 ? -105.591 -65.616  24.278   1.00 0.00 ? 343 ALA A HA   2  
ATOM 10663 H HB1  . ALA A 1 348 ? -107.311 -63.711  23.824   1.00 0.00 ? 343 ALA A HB1  2  
ATOM 10664 H HB2  . ALA A 1 348 ? -105.963 -62.895  23.027   1.00 0.00 ? 343 ALA A HB2  2  
ATOM 10665 H HB3  . ALA A 1 348 ? -105.852 -63.328  24.734   1.00 0.00 ? 343 ALA A HB3  2  
ATOM 10666 N N    . CYS A 1 349 ? -106.853 -64.909  21.314   1.00 0.00 ? 344 CYS A N    2  
ATOM 10667 C CA   . CYS A 1 349 ? -107.688 -65.507  20.243   1.00 0.00 ? 344 CYS A CA   2  
ATOM 10668 C C    . CYS A 1 349 ? -107.016 -65.369  18.875   1.00 0.00 ? 344 CYS A C    2  
ATOM 10669 O O    . CYS A 1 349 ? -106.666 -66.350  18.249   1.00 0.00 ? 344 CYS A O    2  
ATOM 10670 C CB   . CYS A 1 349 ? -108.997 -64.719  20.284   1.00 0.00 ? 344 CYS A CB   2  
ATOM 10671 S SG   . CYS A 1 349 ? -110.397 -65.863  20.405   1.00 0.00 ? 344 CYS A SG   2  
ATOM 10672 H H    . CYS A 1 349 ? -106.604 -63.962  21.275   1.00 0.00 ? 344 CYS A H    2  
ATOM 10673 H HA   . CYS A 1 349 ? -107.876 -66.540  20.465   1.00 0.00 ? 344 CYS A HA   2  
ATOM 10674 H HB2  . CYS A 1 349 ? -108.993 -64.063  21.143   1.00 0.00 ? 344 CYS A HB2  2  
ATOM 10675 H HB3  . CYS A 1 349 ? -109.091 -64.132  19.383   1.00 0.00 ? 344 CYS A HB3  2  
ATOM 10676 H HG   . CYS A 1 349 ? -110.046 -66.753  20.489   1.00 0.00 ? 344 CYS A HG   2  
ATOM 10677 N N    . GLU A 1 350 ? -106.847 -64.165  18.398   1.00 0.00 ? 345 GLU A N    2  
ATOM 10678 C CA   . GLU A 1 350 ? -106.210 -63.986  17.058   1.00 0.00 ? 345 GLU A CA   2  
ATOM 10679 C C    . GLU A 1 350 ? -104.924 -63.170  17.179   1.00 0.00 ? 345 GLU A C    2  
ATOM 10680 O O    . GLU A 1 350 ? -104.544 -62.458  16.270   1.00 0.00 ? 345 GLU A O    2  
ATOM 10681 C CB   . GLU A 1 350 ? -107.248 -63.231  16.225   1.00 0.00 ? 345 GLU A CB   2  
ATOM 10682 C CG   . GLU A 1 350 ? -108.559 -64.021  16.202   1.00 0.00 ? 345 GLU A CG   2  
ATOM 10683 C CD   . GLU A 1 350 ? -108.356 -65.325  15.429   1.00 0.00 ? 345 GLU A CD   2  
ATOM 10684 O OE1  . GLU A 1 350 ? -108.056 -65.251  14.248   1.00 0.00 ? 345 GLU A OE1  2  
ATOM 10685 O OE2  . GLU A 1 350 ? -108.504 -66.376  16.030   1.00 0.00 ? 345 GLU A OE2  2  
ATOM 10686 H H    . GLU A 1 350 ? -107.146 -63.381  18.914   1.00 0.00 ? 345 GLU A H    2  
ATOM 10687 H HA   . GLU A 1 350 ? -106.006 -64.944  16.609   1.00 0.00 ? 345 GLU A HA   2  
ATOM 10688 H HB2  . GLU A 1 350 ? -107.420 -62.258  16.662   1.00 0.00 ? 345 GLU A HB2  2  
ATOM 10689 H HB3  . GLU A 1 350 ? -106.883 -63.114  15.216   1.00 0.00 ? 345 GLU A HB3  2  
ATOM 10690 H HG2  . GLU A 1 350 ? -108.861 -64.245  17.216   1.00 0.00 ? 345 GLU A HG2  2  
ATOM 10691 H HG3  . GLU A 1 350 ? -109.325 -63.433  15.719   1.00 0.00 ? 345 GLU A HG3  2  
ATOM 10692 N N    . LYS A 1 351 ? -104.259 -63.250  18.303   1.00 0.00 ? 346 LYS A N    2  
ATOM 10693 C CA   . LYS A 1 351 ? -103.009 -62.465  18.495   1.00 0.00 ? 346 LYS A CA   2  
ATOM 10694 C C    . LYS A 1 351 ? -103.355 -60.985  18.425   1.00 0.00 ? 346 LYS A C    2  
ATOM 10695 O O    . LYS A 1 351 ? -102.539 -60.155  18.075   1.00 0.00 ? 346 LYS A O    2  
ATOM 10696 C CB   . LYS A 1 351 ? -102.079 -62.866  17.345   1.00 0.00 ? 346 LYS A CB   2  
ATOM 10697 C CG   . LYS A 1 351 ? -100.623 -62.799  17.815   1.00 0.00 ? 346 LYS A CG   2  
ATOM 10698 C CD   . LYS A 1 351 ? -99.768  -62.107  16.750   1.00 0.00 ? 346 LYS A CD   2  
ATOM 10699 C CE   . LYS A 1 351 ? -99.047  -63.162  15.907   1.00 0.00 ? 346 LYS A CE   2  
ATOM 10700 N NZ   . LYS A 1 351 ? -97.967  -62.418  15.202   1.00 0.00 ? 346 LYS A NZ   2  
ATOM 10701 H H    . LYS A 1 351 ? -104.594 -63.807  19.026   1.00 0.00 ? 346 LYS A H    2  
ATOM 10702 H HA   . LYS A 1 351 ? -102.554 -62.704  19.444   1.00 0.00 ? 346 LYS A HA   2  
ATOM 10703 H HB2  . LYS A 1 351 ? -102.311 -63.874  17.031   1.00 0.00 ? 346 LYS A HB2  2  
ATOM 10704 H HB3  . LYS A 1 351 ? -102.220 -62.189  16.516   1.00 0.00 ? 346 LYS A HB3  2  
ATOM 10705 H HG2  . LYS A 1 351 ? -100.568 -62.242  18.739   1.00 0.00 ? 346 LYS A HG2  2  
ATOM 10706 H HG3  . LYS A 1 351 ? -100.252 -63.800  17.978   1.00 0.00 ? 346 LYS A HG3  2  
ATOM 10707 H HD2  . LYS A 1 351 ? -100.402 -61.508  16.112   1.00 0.00 ? 346 LYS A HD2  2  
ATOM 10708 H HD3  . LYS A 1 351 ? -99.039  -61.473  17.230   1.00 0.00 ? 346 LYS A HD3  2  
ATOM 10709 H HE2  . LYS A 1 351 ? -98.626  -63.927  16.546   1.00 0.00 ? 346 LYS A HE2  2  
ATOM 10710 H HE3  . LYS A 1 351 ? -99.724  -63.599  15.190   1.00 0.00 ? 346 LYS A HE3  2  
ATOM 10711 H HZ1  . LYS A 1 351 ? -97.331  -63.092  14.731   1.00 0.00 ? 346 LYS A HZ1  2  
ATOM 10712 H HZ2  . LYS A 1 351 ? -97.428  -61.855  15.892   1.00 0.00 ? 346 LYS A HZ2  2  
ATOM 10713 H HZ3  . LYS A 1 351 ? -98.387  -61.787  14.491   1.00 0.00 ? 346 LYS A HZ3  2  
ATOM 10714 N N    . ASN A 1 352 ? -104.576 -60.656  18.753   1.00 0.00 ? 347 ASN A N    2  
ATOM 10715 C CA   . ASN A 1 352 ? -105.002 -59.239  18.705   1.00 0.00 ? 347 ASN A CA   2  
ATOM 10716 C C    . ASN A 1 352 ? -104.626 -58.541  20.011   1.00 0.00 ? 347 ASN A C    2  
ATOM 10717 O O    . ASN A 1 352 ? -104.183 -59.167  20.954   1.00 0.00 ? 347 ASN A O    2  
ATOM 10718 C CB   . ASN A 1 352 ? -106.522 -59.282  18.529   1.00 0.00 ? 347 ASN A CB   2  
ATOM 10719 C CG   . ASN A 1 352 ? -106.912 -58.536  17.250   1.00 0.00 ? 347 ASN A CG   2  
ATOM 10720 O OD1  . ASN A 1 352 ? -107.259 -57.373  17.294   1.00 0.00 ? 347 ASN A OD1  2  
ATOM 10721 N ND2  . ASN A 1 352 ? -106.870 -59.163  16.107   1.00 0.00 ? 347 ASN A ND2  2  
ATOM 10722 H H    . ASN A 1 352 ? -105.214 -61.348  19.026   1.00 0.00 ? 347 ASN A H    2  
ATOM 10723 H HA   . ASN A 1 352 ? -104.545 -58.751  17.866   1.00 0.00 ? 347 ASN A HA   2  
ATOM 10724 H HB2  . ASN A 1 352 ? -106.848 -60.310  18.459   1.00 0.00 ? 347 ASN A HB2  2  
ATOM 10725 H HB3  . ASN A 1 352 ? -106.997 -58.810  19.376   1.00 0.00 ? 347 ASN A HB3  2  
ATOM 10726 H HD21 . ASN A 1 352 ? -106.590 -60.101  16.072   1.00 0.00 ? 347 ASN A HD21 2  
ATOM 10727 H HD22 . ASN A 1 352 ? -107.118 -58.694  15.282   1.00 0.00 ? 347 ASN A HD22 2  
ATOM 10728 N N    . GLU A 1 353 ? -104.800 -57.251  20.076   1.00 0.00 ? 348 GLU A N    2  
ATOM 10729 C CA   . GLU A 1 353 ? -104.451 -56.519  21.325   1.00 0.00 ? 348 GLU A CA   2  
ATOM 10730 C C    . GLU A 1 353 ? -105.684 -56.367  22.219   1.00 0.00 ? 348 GLU A C    2  
ATOM 10731 O O    . GLU A 1 353 ? -105.662 -55.635  23.190   1.00 0.00 ? 348 GLU A O    2  
ATOM 10732 C CB   . GLU A 1 353 ? -103.957 -55.149  20.857   1.00 0.00 ? 348 GLU A CB   2  
ATOM 10733 C CG   . GLU A 1 353 ? -102.429 -55.154  20.779   1.00 0.00 ? 348 GLU A CG   2  
ATOM 10734 C CD   . GLU A 1 353 ? -101.967 -54.135  19.736   1.00 0.00 ? 348 GLU A CD   2  
ATOM 10735 O OE1  . GLU A 1 353 ? -102.213 -52.957  19.937   1.00 0.00 ? 348 GLU A OE1  2  
ATOM 10736 O OE2  . GLU A 1 353 ? -101.376 -54.550  18.753   1.00 0.00 ? 348 GLU A OE2  2  
ATOM 10737 H H    . GLU A 1 353 ? -105.159 -56.764  19.305   1.00 0.00 ? 348 GLU A H    2  
ATOM 10738 H HA   . GLU A 1 353 ? -103.664 -57.033  21.854   1.00 0.00 ? 348 GLU A HA   2  
ATOM 10739 H HB2  . GLU A 1 353 ? -104.367 -54.933  19.881   1.00 0.00 ? 348 GLU A HB2  2  
ATOM 10740 H HB3  . GLU A 1 353 ? -104.277 -54.393  21.558   1.00 0.00 ? 348 GLU A HB3  2  
ATOM 10741 H HG2  . GLU A 1 353 ? -102.019 -54.893  21.745   1.00 0.00 ? 348 GLU A HG2  2  
ATOM 10742 H HG3  . GLU A 1 353 ? -102.085 -56.137  20.496   1.00 0.00 ? 348 GLU A HG3  2  
ATOM 10743 N N    . ASN A 1 354 ? -106.758 -57.055  21.916   1.00 0.00 ? 349 ASN A N    2  
ATOM 10744 C CA   . ASN A 1 354 ? -107.970 -56.935  22.777   1.00 0.00 ? 349 ASN A CA   2  
ATOM 10745 C C    . ASN A 1 354 ? -108.400 -58.311  23.282   1.00 0.00 ? 349 ASN A C    2  
ATOM 10746 O O    . ASN A 1 354 ? -108.590 -58.507  24.455   1.00 0.00 ? 349 ASN A O    2  
ATOM 10747 C CB   . ASN A 1 354 ? -109.070 -56.312  21.918   1.00 0.00 ? 349 ASN A CB   2  
ATOM 10748 C CG   . ASN A 1 354 ? -108.505 -55.146  21.101   1.00 0.00 ? 349 ASN A CG   2  
ATOM 10749 O OD1  . ASN A 1 354 ? -107.882 -55.352  20.079   1.00 0.00 ? 349 ASN A OD1  2  
ATOM 10750 N ND2  . ASN A 1 354 ? -108.700 -53.923  21.511   1.00 0.00 ? 349 ASN A ND2  2  
ATOM 10751 H H    . ASN A 1 354 ? -106.762 -57.656  21.141   1.00 0.00 ? 349 ASN A H    2  
ATOM 10752 H HA   . ASN A 1 354 ? -107.758 -56.288  23.614   1.00 0.00 ? 349 ASN A HA   2  
ATOM 10753 H HB2  . ASN A 1 354 ? -109.475 -57.059  21.252   1.00 0.00 ? 349 ASN A HB2  2  
ATOM 10754 H HB3  . ASN A 1 354 ? -109.855 -55.944  22.570   1.00 0.00 ? 349 ASN A HB3  2  
ATOM 10755 H HD21 . ASN A 1 354 ? -109.203 -53.757  22.336   1.00 0.00 ? 349 ASN A HD21 2  
ATOM 10756 H HD22 . ASN A 1 354 ? -108.343 -53.170  20.995   1.00 0.00 ? 349 ASN A HD22 2  
ATOM 10757 N N    . LEU A 1 355 ? -108.552 -59.280  22.424   1.00 0.00 ? 350 LEU A N    2  
ATOM 10758 C CA   . LEU A 1 355 ? -108.965 -60.621  22.928   1.00 0.00 ? 350 LEU A CA   2  
ATOM 10759 C C    . LEU A 1 355 ? -108.193 -60.927  24.216   1.00 0.00 ? 350 LEU A C    2  
ATOM 10760 O O    . LEU A 1 355 ? -108.761 -61.255  25.243   1.00 0.00 ? 350 LEU A O    2  
ATOM 10761 C CB   . LEU A 1 355 ? -108.590 -61.596  21.811   1.00 0.00 ? 350 LEU A CB   2  
ATOM 10762 C CG   . LEU A 1 355 ? -109.755 -61.718  20.823   1.00 0.00 ? 350 LEU A CG   2  
ATOM 10763 C CD1  . LEU A 1 355 ? -110.958 -62.347  21.527   1.00 0.00 ? 350 LEU A CD1  2  
ATOM 10764 C CD2  . LEU A 1 355 ? -110.141 -60.330  20.302   1.00 0.00 ? 350 LEU A CD2  2  
ATOM 10765 H H    . LEU A 1 355 ? -108.389 -59.136  21.466   1.00 0.00 ? 350 LEU A H    2  
ATOM 10766 H HA   . LEU A 1 355 ? -110.028 -60.647  23.107   1.00 0.00 ? 350 LEU A HA   2  
ATOM 10767 H HB2  . LEU A 1 355 ? -107.715 -61.230  21.294   1.00 0.00 ? 350 LEU A HB2  2  
ATOM 10768 H HB3  . LEU A 1 355 ? -108.378 -62.565  22.236   1.00 0.00 ? 350 LEU A HB3  2  
ATOM 10769 H HG   . LEU A 1 355 ? -109.458 -62.342  19.994   1.00 0.00 ? 350 LEU A HG   2  
ATOM 10770 H HD11 . LEU A 1 355 ? -111.618 -62.785  20.793   1.00 0.00 ? 350 LEU A HD11 2  
ATOM 10771 H HD12 . LEU A 1 355 ? -111.489 -61.587  22.081   1.00 0.00 ? 350 LEU A HD12 2  
ATOM 10772 H HD13 . LEU A 1 355 ? -110.616 -63.114  22.207   1.00 0.00 ? 350 LEU A HD13 2  
ATOM 10773 H HD21 . LEU A 1 355 ? -110.467 -59.714  21.127   1.00 0.00 ? 350 LEU A HD21 2  
ATOM 10774 H HD22 . LEU A 1 355 ? -110.942 -60.424  19.584   1.00 0.00 ? 350 LEU A HD22 2  
ATOM 10775 H HD23 . LEU A 1 355 ? -109.284 -59.873  19.829   1.00 0.00 ? 350 LEU A HD23 2  
ATOM 10776 N N    . ALA A 1 356 ? -106.899 -60.779  24.162   1.00 0.00 ? 351 ALA A N    2  
ATOM 10777 C CA   . ALA A 1 356 ? -106.050 -61.030  25.360   1.00 0.00 ? 351 ALA A CA   2  
ATOM 10778 C C    . ALA A 1 356 ? -106.118 -59.858  26.349   1.00 0.00 ? 351 ALA A C    2  
ATOM 10779 O O    . ALA A 1 356 ? -106.277 -60.054  27.537   1.00 0.00 ? 351 ALA A O    2  
ATOM 10780 C CB   . ALA A 1 356 ? -104.641 -61.167  24.790   1.00 0.00 ? 351 ALA A CB   2  
ATOM 10781 H H    . ALA A 1 356 ? -106.482 -60.486  23.325   1.00 0.00 ? 351 ALA A H    2  
ATOM 10782 H HA   . ALA A 1 356 ? -106.341 -61.947  25.844   1.00 0.00 ? 351 ALA A HA   2  
ATOM 10783 H HB1  . ALA A 1 356 ? -104.628 -61.955  24.047   1.00 0.00 ? 351 ALA A HB1  2  
ATOM 10784 H HB2  . ALA A 1 356 ? -103.953 -61.406  25.585   1.00 0.00 ? 351 ALA A HB2  2  
ATOM 10785 H HB3  . ALA A 1 356 ? -104.352 -60.235  24.328   1.00 0.00 ? 351 ALA A HB3  2  
ATOM 10786 N N    . ALA A 1 357 ? -105.991 -58.646  25.875   1.00 0.00 ? 352 ALA A N    2  
ATOM 10787 C CA   . ALA A 1 357 ? -106.041 -57.471  26.803   1.00 0.00 ? 352 ALA A CA   2  
ATOM 10788 C C    . ALA A 1 357 ? -107.489 -57.169  27.192   1.00 0.00 ? 352 ALA A C    2  
ATOM 10789 O O    . ALA A 1 357 ? -107.832 -57.108  28.356   1.00 0.00 ? 352 ALA A O    2  
ATOM 10790 C CB   . ALA A 1 357 ? -105.443 -56.309  26.009   1.00 0.00 ? 352 ALA A CB   2  
ATOM 10791 H H    . ALA A 1 357 ? -105.861 -58.507  24.912   1.00 0.00 ? 352 ALA A H    2  
ATOM 10792 H HA   . ALA A 1 357 ? -105.446 -57.662  27.683   1.00 0.00 ? 352 ALA A HA   2  
ATOM 10793 H HB1  . ALA A 1 357 ? -105.093 -55.549  26.692   1.00 0.00 ? 352 ALA A HB1  2  
ATOM 10794 H HB2  . ALA A 1 357 ? -106.197 -55.891  25.360   1.00 0.00 ? 352 ALA A HB2  2  
ATOM 10795 H HB3  . ALA A 1 357 ? -104.615 -56.668  25.415   1.00 0.00 ? 352 ALA A HB3  2  
ATOM 10796 N N    . ASN A 1 358 ? -108.337 -56.993  26.216   1.00 0.00 ? 353 ASN A N    2  
ATOM 10797 C CA   . ASN A 1 358 ? -109.780 -56.711  26.488   1.00 0.00 ? 353 ASN A CA   2  
ATOM 10798 C C    . ASN A 1 358 ? -110.307 -57.651  27.579   1.00 0.00 ? 353 ASN A C    2  
ATOM 10799 O O    . ASN A 1 358 ? -110.921 -57.216  28.535   1.00 0.00 ? 353 ASN A O    2  
ATOM 10800 C CB   . ASN A 1 358 ? -110.504 -56.977  25.167   1.00 0.00 ? 353 ASN A CB   2  
ATOM 10801 C CG   . ASN A 1 358 ? -111.834 -56.222  25.152   1.00 0.00 ? 353 ASN A CG   2  
ATOM 10802 O OD1  . ASN A 1 358 ? -112.415 -55.970  26.188   1.00 0.00 ? 353 ASN A OD1  2  
ATOM 10803 N ND2  . ASN A 1 358 ? -112.344 -55.848  24.010   1.00 0.00 ? 353 ASN A ND2  2  
ATOM 10804 H H    . ASN A 1 358 ? -108.023 -57.059  25.293   1.00 0.00 ? 353 ASN A H    2  
ATOM 10805 H HA   . ASN A 1 358 ? -109.913 -55.681  26.768   1.00 0.00 ? 353 ASN A HA   2  
ATOM 10806 H HB2  . ASN A 1 358 ? -109.888 -56.641  24.348   1.00 0.00 ? 353 ASN A HB2  2  
ATOM 10807 H HB3  . ASN A 1 358 ? -110.692 -58.036  25.067   1.00 0.00 ? 353 ASN A HB3  2  
ATOM 10808 H HD21 . ASN A 1 358 ? -111.876 -56.051  23.174   1.00 0.00 ? 353 ASN A HD21 2  
ATOM 10809 H HD22 . ASN A 1 358 ? -113.196 -55.364  23.989   1.00 0.00 ? 353 ASN A HD22 2  
ATOM 10810 N N    . PHE A 1 359 ? -110.065 -58.938  27.454   1.00 0.00 ? 354 PHE A N    2  
ATOM 10811 C CA   . PHE A 1 359 ? -110.553 -59.880  28.506   1.00 0.00 ? 354 PHE A CA   2  
ATOM 10812 C C    . PHE A 1 359 ? -109.771 -59.648  29.807   1.00 0.00 ? 354 PHE A C    2  
ATOM 10813 O O    . PHE A 1 359 ? -110.270 -59.875  30.891   1.00 0.00 ? 354 PHE A O    2  
ATOM 10814 C CB   . PHE A 1 359 ? -110.320 -61.290  27.932   1.00 0.00 ? 354 PHE A CB   2  
ATOM 10815 C CG   . PHE A 1 359 ? -109.262 -62.031  28.722   1.00 0.00 ? 354 PHE A CG   2  
ATOM 10816 C CD1  . PHE A 1 359 ? -109.583 -62.597  29.963   1.00 0.00 ? 354 PHE A CD1  2  
ATOM 10817 C CD2  . PHE A 1 359 ? -107.964 -62.153  28.212   1.00 0.00 ? 354 PHE A CD2  2  
ATOM 10818 C CE1  . PHE A 1 359 ? -108.606 -63.283  30.693   1.00 0.00 ? 354 PHE A CE1  2  
ATOM 10819 C CE2  . PHE A 1 359 ? -106.987 -62.840  28.943   1.00 0.00 ? 354 PHE A CE2  2  
ATOM 10820 C CZ   . PHE A 1 359 ? -107.308 -63.405  30.183   1.00 0.00 ? 354 PHE A CZ   2  
ATOM 10821 H H    . PHE A 1 359 ? -109.561 -59.276  26.681   1.00 0.00 ? 354 PHE A H    2  
ATOM 10822 H HA   . PHE A 1 359 ? -111.607 -59.725  28.678   1.00 0.00 ? 354 PHE A HA   2  
ATOM 10823 H HB2  . PHE A 1 359 ? -111.244 -61.846  27.972   1.00 0.00 ? 354 PHE A HB2  2  
ATOM 10824 H HB3  . PHE A 1 359 ? -110.003 -61.206  26.905   1.00 0.00 ? 354 PHE A HB3  2  
ATOM 10825 H HD1  . PHE A 1 359 ? -110.584 -62.503  30.356   1.00 0.00 ? 354 PHE A HD1  2  
ATOM 10826 H HD2  . PHE A 1 359 ? -107.717 -61.718  27.256   1.00 0.00 ? 354 PHE A HD2  2  
ATOM 10827 H HE1  . PHE A 1 359 ? -108.853 -63.718  31.650   1.00 0.00 ? 354 PHE A HE1  2  
ATOM 10828 H HE2  . PHE A 1 359 ? -105.985 -62.934  28.549   1.00 0.00 ? 354 PHE A HE2  2  
ATOM 10829 H HZ   . PHE A 1 359 ? -106.554 -63.934  30.746   1.00 0.00 ? 354 PHE A HZ   2  
ATOM 10830 N N    . LEU A 1 360 ? -108.549 -59.190  29.703   1.00 0.00 ? 355 LEU A N    2  
ATOM 10831 C CA   . LEU A 1 360 ? -107.736 -58.936  30.930   1.00 0.00 ? 355 LEU A CA   2  
ATOM 10832 C C    . LEU A 1 360 ? -108.283 -57.716  31.677   1.00 0.00 ? 355 LEU A C    2  
ATOM 10833 O O    . LEU A 1 360 ? -108.556 -57.770  32.860   1.00 0.00 ? 355 LEU A O    2  
ATOM 10834 C CB   . LEU A 1 360 ? -106.320 -58.655  30.420   1.00 0.00 ? 355 LEU A CB   2  
ATOM 10835 C CG   . LEU A 1 360 ? -105.302 -59.398  31.287   1.00 0.00 ? 355 LEU A CG   2  
ATOM 10836 C CD1  . LEU A 1 360 ? -105.340 -60.890  30.955   1.00 0.00 ? 355 LEU A CD1  2  
ATOM 10837 C CD2  . LEU A 1 360 ? -103.901 -58.850  31.008   1.00 0.00 ? 355 LEU A CD2  2  
ATOM 10838 H H    . LEU A 1 360 ? -108.169 -59.010  28.818   1.00 0.00 ? 355 LEU A H    2  
ATOM 10839 H HA   . LEU A 1 360 ? -107.735 -59.803  31.570   1.00 0.00 ? 355 LEU A HA   2  
ATOM 10840 H HB2  . LEU A 1 360 ? -106.233 -58.990  29.398   1.00 0.00 ? 355 LEU A HB2  2  
ATOM 10841 H HB3  . LEU A 1 360 ? -106.123 -57.595  30.468   1.00 0.00 ? 355 LEU A HB3  2  
ATOM 10842 H HG   . LEU A 1 360 ? -105.546 -59.255  32.330   1.00 0.00 ? 355 LEU A HG   2  
ATOM 10843 H HD11 . LEU A 1 360 ? -106.360 -61.243  30.999   1.00 0.00 ? 355 LEU A HD11 2  
ATOM 10844 H HD12 . LEU A 1 360 ? -104.741 -61.434  31.670   1.00 0.00 ? 355 LEU A HD12 2  
ATOM 10845 H HD13 . LEU A 1 360 ? -104.947 -61.048  29.962   1.00 0.00 ? 355 LEU A HD13 2  
ATOM 10846 H HD21 . LEU A 1 360 ? -103.247 -59.099  31.831   1.00 0.00 ? 355 LEU A HD21 2  
ATOM 10847 H HD22 . LEU A 1 360 ? -103.949 -57.777  30.898   1.00 0.00 ? 355 LEU A HD22 2  
ATOM 10848 H HD23 . LEU A 1 360 ? -103.518 -59.288  30.098   1.00 0.00 ? 355 LEU A HD23 2  
ATOM 10849 N N    . LEU A 1 361 ? -108.441 -56.616  30.990   1.00 0.00 ? 356 LEU A N    2  
ATOM 10850 C CA   . LEU A 1 361 ? -108.968 -55.384  31.650   1.00 0.00 ? 356 LEU A CA   2  
ATOM 10851 C C    . LEU A 1 361 ? -110.361 -55.645  32.231   1.00 0.00 ? 356 LEU A C    2  
ATOM 10852 O O    . LEU A 1 361 ? -110.772 -55.014  33.186   1.00 0.00 ? 356 LEU A O    2  
ATOM 10853 C CB   . LEU A 1 361 ? -109.041 -54.336  30.537   1.00 0.00 ? 356 LEU A CB   2  
ATOM 10854 C CG   . LEU A 1 361 ? -107.647 -54.126  29.932   1.00 0.00 ? 356 LEU A CG   2  
ATOM 10855 C CD1  . LEU A 1 361 ? -107.723 -54.246  28.409   1.00 0.00 ? 356 LEU A CD1  2  
ATOM 10856 C CD2  . LEU A 1 361 ? -107.133 -52.733  30.305   1.00 0.00 ? 356 LEU A CD2  2  
ATOM 10857 H H    . LEU A 1 361 ? -108.212 -56.599  30.037   1.00 0.00 ? 356 LEU A H    2  
ATOM 10858 H HA   . LEU A 1 361 ? -108.293 -55.053  32.423   1.00 0.00 ? 356 LEU A HA   2  
ATOM 10859 H HB2  . LEU A 1 361 ? -109.721 -54.676  29.769   1.00 0.00 ? 356 LEU A HB2  2  
ATOM 10860 H HB3  . LEU A 1 361 ? -109.399 -53.403  30.945   1.00 0.00 ? 356 LEU A HB3  2  
ATOM 10861 H HG   . LEU A 1 361 ? -106.971 -54.876  30.317   1.00 0.00 ? 356 LEU A HG   2  
ATOM 10862 H HD11 . LEU A 1 361 ? -108.530 -54.912  28.140   1.00 0.00 ? 356 LEU A HD11 2  
ATOM 10863 H HD12 . LEU A 1 361 ? -106.791 -54.641  28.032   1.00 0.00 ? 356 LEU A HD12 2  
ATOM 10864 H HD13 . LEU A 1 361 ? -107.902 -53.272  27.979   1.00 0.00 ? 356 LEU A HD13 2  
ATOM 10865 H HD21 . LEU A 1 361 ? -107.810 -51.984  29.922   1.00 0.00 ? 356 LEU A HD21 2  
ATOM 10866 H HD22 . LEU A 1 361 ? -106.152 -52.585  29.878   1.00 0.00 ? 356 LEU A HD22 2  
ATOM 10867 H HD23 . LEU A 1 361 ? -107.073 -52.647  31.380   1.00 0.00 ? 356 LEU A HD23 2  
ATOM 10868 N N    . SER A 1 362 ? -111.089 -56.567  31.661   1.00 0.00 ? 357 SER A N    2  
ATOM 10869 C CA   . SER A 1 362 ? -112.457 -56.867  32.178   1.00 0.00 ? 357 SER A CA   2  
ATOM 10870 C C    . SER A 1 362 ? -112.376 -57.784  33.402   1.00 0.00 ? 357 SER A C    2  
ATOM 10871 O O    . SER A 1 362 ? -112.892 -57.472  34.457   1.00 0.00 ? 357 SER A O    2  
ATOM 10872 C CB   . SER A 1 362 ? -113.169 -57.575  31.026   1.00 0.00 ? 357 SER A CB   2  
ATOM 10873 O OG   . SER A 1 362 ? -114.369 -58.168  31.508   1.00 0.00 ? 357 SER A OG   2  
ATOM 10874 H H    . SER A 1 362 ? -110.738 -57.062  30.892   1.00 0.00 ? 357 SER A H    2  
ATOM 10875 H HA   . SER A 1 362 ? -112.975 -55.954  32.425   1.00 0.00 ? 357 SER A HA   2  
ATOM 10876 H HB2  . SER A 1 362 ? -113.411 -56.862  30.256   1.00 0.00 ? 357 SER A HB2  2  
ATOM 10877 H HB3  . SER A 1 362 ? -112.519 -58.337  30.616   1.00 0.00 ? 357 SER A HB3  2  
ATOM 10878 H HG   . SER A 1 362 ? -114.713 -58.742  30.821   1.00 0.00 ? 357 SER A HG   2  
ATOM 10879 N N    . GLN A 1 363 ? -111.733 -58.913  33.268   1.00 0.00 ? 358 GLN A N    2  
ATOM 10880 C CA   . GLN A 1 363 ? -111.621 -59.852  34.424   1.00 0.00 ? 358 GLN A CA   2  
ATOM 10881 C C    . GLN A 1 363 ? -110.796 -59.217  35.547   1.00 0.00 ? 358 GLN A C    2  
ATOM 10882 O O    . GLN A 1 363 ? -111.077 -59.402  36.715   1.00 0.00 ? 358 GLN A O    2  
ATOM 10883 C CB   . GLN A 1 363 ? -110.909 -61.086  33.867   1.00 0.00 ? 358 GLN A CB   2  
ATOM 10884 C CG   . GLN A 1 363 ? -111.799 -61.760  32.821   1.00 0.00 ? 358 GLN A CG   2  
ATOM 10885 C CD   . GLN A 1 363 ? -112.991 -62.423  33.515   1.00 0.00 ? 358 GLN A CD   2  
ATOM 10886 O OE1  . GLN A 1 363 ? -112.837 -63.417  34.195   1.00 0.00 ? 358 GLN A OE1  2  
ATOM 10887 N NE2  . GLN A 1 363 ? -114.182 -61.910  33.369   1.00 0.00 ? 358 GLN A NE2  2  
ATOM 10888 H H    . GLN A 1 363 ? -111.327 -59.145  32.407   1.00 0.00 ? 358 GLN A H    2  
ATOM 10889 H HA   . GLN A 1 363 ? -112.600 -60.124  34.784   1.00 0.00 ? 358 GLN A HA   2  
ATOM 10890 H HB2  . GLN A 1 363 ? -109.976 -60.788  33.411   1.00 0.00 ? 358 GLN A HB2  2  
ATOM 10891 H HB3  . GLN A 1 363 ? -110.712 -61.780  34.670   1.00 0.00 ? 358 GLN A HB3  2  
ATOM 10892 H HG2  . GLN A 1 363 ? -112.155 -61.019  32.121   1.00 0.00 ? 358 GLN A HG2  2  
ATOM 10893 H HG3  . GLN A 1 363 ? -111.229 -62.510  32.294   1.00 0.00 ? 358 GLN A HG3  2  
ATOM 10894 H HE21 . GLN A 1 363 ? -114.307 -61.108  32.820   1.00 0.00 ? 358 GLN A HE21 2  
ATOM 10895 H HE22 . GLN A 1 363 ? -114.952 -62.327  33.810   1.00 0.00 ? 358 GLN A HE22 2  
ATOM 10896 N N    . ASN A 1 364 ? -109.780 -58.472  35.203   1.00 0.00 ? 359 ASN A N    2  
ATOM 10897 C CA   . ASN A 1 364 ? -108.937 -57.827  36.252   1.00 0.00 ? 359 ASN A CA   2  
ATOM 10898 C C    . ASN A 1 364 ? -108.897 -56.311  36.044   1.00 0.00 ? 359 ASN A C    2  
ATOM 10899 O O    . ASN A 1 364 ? -108.121 -55.803  35.258   1.00 0.00 ? 359 ASN A O    2  
ATOM 10900 C CB   . ASN A 1 364 ? -107.544 -58.431  36.069   1.00 0.00 ? 359 ASN A CB   2  
ATOM 10901 C CG   . ASN A 1 364 ? -107.310 -59.509  37.129   1.00 0.00 ? 359 ASN A CG   2  
ATOM 10902 O OD1  . ASN A 1 364 ? -106.859 -59.218  38.219   1.00 0.00 ? 359 ASN A OD1  2  
ATOM 10903 N ND2  . ASN A 1 364 ? -107.601 -60.751  36.854   1.00 0.00 ? 359 ASN A ND2  2  
ATOM 10904 H H    . ASN A 1 364 ? -109.570 -58.337  34.255   1.00 0.00 ? 359 ASN A H    2  
ATOM 10905 H HA   . ASN A 1 364 ? -109.314 -58.062  37.235   1.00 0.00 ? 359 ASN A HA   2  
ATOM 10906 H HB2  . ASN A 1 364 ? -107.469 -58.870  35.085   1.00 0.00 ? 359 ASN A HB2  2  
ATOM 10907 H HB3  . ASN A 1 364 ? -106.799 -57.657  36.176   1.00 0.00 ? 359 ASN A HB3  2  
ATOM 10908 H HD21 . ASN A 1 364 ? -107.965 -60.986  35.975   1.00 0.00 ? 359 ASN A HD21 2  
ATOM 10909 H HD22 . ASN A 1 364 ? -107.456 -61.449  37.526   1.00 0.00 ? 359 ASN A HD22 2  
ATOM 10910 N N    . PHE A 1 365 ? -109.727 -55.586  36.746   1.00 0.00 ? 360 PHE A N    2  
ATOM 10911 C CA   . PHE A 1 365 ? -109.738 -54.102  36.594   1.00 0.00 ? 360 PHE A CA   2  
ATOM 10912 C C    . PHE A 1 365 ? -109.389 -53.434  37.928   1.00 0.00 ? 360 PHE A C    2  
ATOM 10913 O O    . PHE A 1 365 ? -110.176 -52.696  38.489   1.00 0.00 ? 360 PHE A O    2  
ATOM 10914 C CB   . PHE A 1 365 ? -111.170 -53.757  36.173   1.00 0.00 ? 360 PHE A CB   2  
ATOM 10915 C CG   . PHE A 1 365 ? -111.315 -52.259  36.025   1.00 0.00 ? 360 PHE A CG   2  
ATOM 10916 C CD1  . PHE A 1 365 ? -110.347 -51.523  35.329   1.00 0.00 ? 360 PHE A CD1  2  
ATOM 10917 C CD2  . PHE A 1 365 ? -112.420 -51.606  36.585   1.00 0.00 ? 360 PHE A CD2  2  
ATOM 10918 C CE1  . PHE A 1 365 ? -110.485 -50.136  35.194   1.00 0.00 ? 360 PHE A CE1  2  
ATOM 10919 C CE2  . PHE A 1 365 ? -112.558 -50.220  36.450   1.00 0.00 ? 360 PHE A CE2  2  
ATOM 10920 C CZ   . PHE A 1 365 ? -111.590 -49.485  35.754   1.00 0.00 ? 360 PHE A CZ   2  
ATOM 10921 H H    . PHE A 1 365 ? -110.342 -56.018  37.374   1.00 0.00 ? 360 PHE A H    2  
ATOM 10922 H HA   . PHE A 1 365 ? -109.045 -53.797  35.826   1.00 0.00 ? 360 PHE A HA   2  
ATOM 10923 H HB2  . PHE A 1 365 ? -111.391 -54.234  35.229   1.00 0.00 ? 360 PHE A HB2  2  
ATOM 10924 H HB3  . PHE A 1 365 ? -111.860 -54.111  36.924   1.00 0.00 ? 360 PHE A HB3  2  
ATOM 10925 H HD1  . PHE A 1 365 ? -109.494 -52.026  34.896   1.00 0.00 ? 360 PHE A HD1  2  
ATOM 10926 H HD2  . PHE A 1 365 ? -113.167 -52.173  37.122   1.00 0.00 ? 360 PHE A HD2  2  
ATOM 10927 H HE1  . PHE A 1 365 ? -109.738 -49.569  34.658   1.00 0.00 ? 360 PHE A HE1  2  
ATOM 10928 H HE2  . PHE A 1 365 ? -113.410 -49.717  36.882   1.00 0.00 ? 360 PHE A HE2  2  
ATOM 10929 H HZ   . PHE A 1 365 ? -111.696 -48.415  35.650   1.00 0.00 ? 360 PHE A HZ   2  
ATOM 10930 N N    . ASP A 1 366 ? -108.213 -53.687  38.436   1.00 0.00 ? 361 ASP A N    2  
ATOM 10931 C CA   . ASP A 1 366 ? -107.808 -53.068  39.732   1.00 0.00 ? 361 ASP A CA   2  
ATOM 10932 C C    . ASP A 1 366 ? -106.285 -52.919  39.793   1.00 0.00 ? 361 ASP A C    2  
ATOM 10933 O O    . ASP A 1 366 ? -105.557 -53.893  39.796   1.00 0.00 ? 361 ASP A O    2  
ATOM 10934 C CB   . ASP A 1 366 ? -108.295 -54.042  40.806   1.00 0.00 ? 361 ASP A CB   2  
ATOM 10935 C CG   . ASP A 1 366 ? -109.637 -53.563  41.362   1.00 0.00 ? 361 ASP A CG   2  
ATOM 10936 O OD1  . ASP A 1 366 ? -110.651 -53.879  40.762   1.00 0.00 ? 361 ASP A OD1  2  
ATOM 10937 O OD2  . ASP A 1 366 ? -109.628 -52.888  42.378   1.00 0.00 ? 361 ASP A OD2  2  
ATOM 10938 H H    . ASP A 1 366 ? -107.595 -54.284  37.966   1.00 0.00 ? 361 ASP A H    2  
ATOM 10939 H HA   . ASP A 1 366 ? -108.286 -52.110  39.859   1.00 0.00 ? 361 ASP A HA   2  
ATOM 10940 H HB2  . ASP A 1 366 ? -108.414 -55.025  40.373   1.00 0.00 ? 361 ASP A HB2  2  
ATOM 10941 H HB3  . ASP A 1 366 ? -107.571 -54.087  41.606   1.00 0.00 ? 361 ASP A HB3  2  
ATOM 10942 N N    . ASP A 1 367 ? -105.799 -51.707  39.840   1.00 0.00 ? 362 ASP A N    2  
ATOM 10943 C CA   . ASP A 1 367 ? -104.323 -51.494  39.900   1.00 0.00 ? 362 ASP A CA   2  
ATOM 10944 C C    . ASP A 1 367 ? -103.747 -52.128  41.169   1.00 0.00 ? 362 ASP A C    2  
ATOM 10945 O O    . ASP A 1 367 ? -104.365 -52.973  41.788   1.00 0.00 ? 362 ASP A O    2  
ATOM 10946 C CB   . ASP A 1 367 ? -104.140 -49.976  39.928   1.00 0.00 ? 362 ASP A CB   2  
ATOM 10947 C CG   . ASP A 1 367 ? -102.916 -49.593  39.096   1.00 0.00 ? 362 ASP A CG   2  
ATOM 10948 O OD1  . ASP A 1 367 ? -101.834 -50.053  39.422   1.00 0.00 ? 362 ASP A OD1  2  
ATOM 10949 O OD2  . ASP A 1 367 ? -103.080 -48.846  38.145   1.00 0.00 ? 362 ASP A OD2  2  
ATOM 10950 H H    . ASP A 1 367 ? -106.406 -50.937  39.836   1.00 0.00 ? 362 ASP A H    2  
ATOM 10951 H HA   . ASP A 1 367 ? -103.847 -51.906  39.024   1.00 0.00 ? 362 ASP A HA   2  
ATOM 10952 H HB2  . ASP A 1 367 ? -105.019 -49.501  39.517   1.00 0.00 ? 362 ASP A HB2  2  
ATOM 10953 H HB3  . ASP A 1 367 ? -103.997 -49.649  40.947   1.00 0.00 ? 362 ASP A HB3  2  
ATOM 10954 N N    . GLU A 1 368 ? -102.565 -51.727  41.561   1.00 0.00 ? 363 GLU A N    2  
ATOM 10955 C CA   . GLU A 1 368 ? -101.939 -52.303  42.791   1.00 0.00 ? 363 GLU A CA   2  
ATOM 10956 C C    . GLU A 1 368 ? -101.901 -53.833  42.705   1.00 0.00 ? 363 GLU A C    2  
ATOM 10957 O O    . GLU A 1 368 ? -102.791 -54.513  43.174   1.00 0.00 ? 363 GLU A O    2  
ATOM 10958 C CB   . GLU A 1 368 ? -102.836 -51.854  43.946   1.00 0.00 ? 363 GLU A CB   2  
ATOM 10959 C CG   . GLU A 1 368 ? -101.973 -51.534  45.168   1.00 0.00 ? 363 GLU A CG   2  
ATOM 10960 C CD   . GLU A 1 368 ? -102.749 -51.870  46.443   1.00 0.00 ? 363 GLU A CD   2  
ATOM 10961 O OE1  . GLU A 1 368 ? -103.222 -52.989  46.548   1.00 0.00 ? 363 GLU A OE1  2  
ATOM 10962 O OE2  . GLU A 1 368 ? -102.857 -51.001  47.293   1.00 0.00 ? 363 GLU A OE2  2  
ATOM 10963 H H    . GLU A 1 368 ? -102.086 -51.046  41.044   1.00 0.00 ? 363 GLU A H    2  
ATOM 10964 H HA   . GLU A 1 368 ? -100.944 -51.910  42.925   1.00 0.00 ? 363 GLU A HA   2  
ATOM 10965 H HB2  . GLU A 1 368 ? -103.387 -50.972  43.652   1.00 0.00 ? 363 GLU A HB2  2  
ATOM 10966 H HB3  . GLU A 1 368 ? -103.528 -52.645  44.194   1.00 0.00 ? 363 GLU A HB3  2  
ATOM 10967 H HG2  . GLU A 1 368 ? -101.067 -52.122  45.132   1.00 0.00 ? 363 GLU A HG2  2  
ATOM 10968 H HG3  . GLU A 1 368 ? -101.722 -50.485  45.168   1.00 0.00 ? 363 GLU A HG3  2  
ATOM 10969 N N    . SER A 1 6   ? -17.493  23.392   -5.377   1.00 0.00 ? 1   SER A N    3  
ATOM 10970 C CA   . SER A 1 6   ? -18.475  24.356   -4.801   1.00 0.00 ? 1   SER A CA   3  
ATOM 10971 C C    . SER A 1 6   ? -17.970  24.882   -3.454   1.00 0.00 ? 1   SER A C    3  
ATOM 10972 O O    . SER A 1 6   ? -18.530  24.593   -2.414   1.00 0.00 ? 1   SER A O    3  
ATOM 10973 C CB   . SER A 1 6   ? -19.761  23.549   -4.618   1.00 0.00 ? 1   SER A CB   3  
ATOM 10974 O OG   . SER A 1 6   ? -20.672  23.876   -5.660   1.00 0.00 ? 1   SER A OG   3  
ATOM 10975 H HA   . SER A 1 6   ? -18.646  25.173   -5.484   1.00 0.00 ? 1   SER A HA   3  
ATOM 10976 H HB2  . SER A 1 6   ? -19.537  22.497   -4.660   1.00 0.00 ? 1   SER A HB2  3  
ATOM 10977 H HB3  . SER A 1 6   ? -20.199  23.784   -3.657   1.00 0.00 ? 1   SER A HB3  3  
ATOM 10978 H HG   . SER A 1 6   ? -20.213  23.779   -6.498   1.00 0.00 ? 1   SER A HG   3  
ATOM 10979 N N    . ALA A 1 7   ? -16.913  25.653   -3.466   1.00 0.00 ? 2   ALA A N    3  
ATOM 10980 C CA   . ALA A 1 7   ? -16.360  26.203   -2.190   1.00 0.00 ? 2   ALA A CA   3  
ATOM 10981 C C    . ALA A 1 7   ? -16.032  25.066   -1.217   1.00 0.00 ? 2   ALA A C    3  
ATOM 10982 O O    . ALA A 1 7   ? -16.364  23.921   -1.451   1.00 0.00 ? 2   ALA A O    3  
ATOM 10983 C CB   . ALA A 1 7   ? -17.467  27.095   -1.621   1.00 0.00 ? 2   ALA A CB   3  
ATOM 10984 H H    . ALA A 1 7   ? -16.479  25.870   -4.318   1.00 0.00 ? 2   ALA A H    3  
ATOM 10985 H HA   . ALA A 1 7   ? -15.479  26.793   -2.387   1.00 0.00 ? 2   ALA A HA   3  
ATOM 10986 H HB1  . ALA A 1 7   ? -18.077  26.521   -0.940   1.00 0.00 ? 2   ALA A HB1  3  
ATOM 10987 H HB2  . ALA A 1 7   ? -18.080  27.467   -2.428   1.00 0.00 ? 2   ALA A HB2  3  
ATOM 10988 H HB3  . ALA A 1 7   ? -17.023  27.926   -1.094   1.00 0.00 ? 2   ALA A HB3  3  
ATOM 10989 N N    . VAL A 1 8   ? -15.383  25.376   -0.125   1.00 0.00 ? 3   VAL A N    3  
ATOM 10990 C CA   . VAL A 1 8   ? -15.032  24.323   0.868    1.00 0.00 ? 3   VAL A CA   3  
ATOM 10991 C C    . VAL A 1 8   ? -14.402  24.978   2.098    1.00 0.00 ? 3   VAL A C    3  
ATOM 10992 O O    . VAL A 1 8   ? -13.510  25.796   1.990    1.00 0.00 ? 3   VAL A O    3  
ATOM 10993 C CB   . VAL A 1 8   ? -14.027  23.407   0.157    1.00 0.00 ? 3   VAL A CB   3  
ATOM 10994 C CG1  . VAL A 1 8   ? -12.804  24.217   -0.283   1.00 0.00 ? 3   VAL A CG1  3  
ATOM 10995 C CG2  . VAL A 1 8   ? -13.586  22.291   1.112    1.00 0.00 ? 3   VAL A CG2  3  
ATOM 10996 H H    . VAL A 1 8   ? -15.127  26.306   0.047    1.00 0.00 ? 3   VAL A H    3  
ATOM 10997 H HA   . VAL A 1 8   ? -15.910  23.763   1.148    1.00 0.00 ? 3   VAL A HA   3  
ATOM 10998 H HB   . VAL A 1 8   ? -14.497  22.971   -0.712   1.00 0.00 ? 3   VAL A HB   3  
ATOM 10999 H HG11 . VAL A 1 8   ? -12.299  24.608   0.586    1.00 0.00 ? 3   VAL A HG11 3  
ATOM 11000 H HG12 . VAL A 1 8   ? -13.122  25.034   -0.914   1.00 0.00 ? 3   VAL A HG12 3  
ATOM 11001 H HG13 . VAL A 1 8   ? -12.130  23.579   -0.835   1.00 0.00 ? 3   VAL A HG13 3  
ATOM 11002 H HG21 . VAL A 1 8   ? -14.124  21.384   0.877    1.00 0.00 ? 3   VAL A HG21 3  
ATOM 11003 H HG22 . VAL A 1 8   ? -13.799  22.580   2.131    1.00 0.00 ? 3   VAL A HG22 3  
ATOM 11004 H HG23 . VAL A 1 8   ? -12.526  22.119   1.001    1.00 0.00 ? 3   VAL A HG23 3  
ATOM 11005 N N    . THR A 1 9   ? -14.866  24.630   3.264    1.00 0.00 ? 4   THR A N    3  
ATOM 11006 C CA   . THR A 1 9   ? -14.302  25.234   4.504    1.00 0.00 ? 4   THR A CA   3  
ATOM 11007 C C    . THR A 1 9   ? -12.969  24.567   4.852    1.00 0.00 ? 4   THR A C    3  
ATOM 11008 O O    . THR A 1 9   ? -12.859  23.357   4.882    1.00 0.00 ? 4   THR A O    3  
ATOM 11009 C CB   . THR A 1 9   ? -15.347  24.953   5.580    1.00 0.00 ? 4   THR A CB   3  
ATOM 11010 O OG1  . THR A 1 9   ? -16.569  25.584   5.227    1.00 0.00 ? 4   THR A OG1  3  
ATOM 11011 C CG2  . THR A 1 9   ? -14.861  25.494   6.928    1.00 0.00 ? 4   THR A CG2  3  
ATOM 11012 H H    . THR A 1 9   ? -15.591  23.973   3.326    1.00 0.00 ? 4   THR A H    3  
ATOM 11013 H HA   . THR A 1 9   ? -14.172  26.296   4.383    1.00 0.00 ? 4   THR A HA   3  
ATOM 11014 H HB   . THR A 1 9   ? -15.502  23.891   5.654    1.00 0.00 ? 4   THR A HB   3  
ATOM 11015 H HG1  . THR A 1 9   ? -17.274  25.168   5.728    1.00 0.00 ? 4   THR A HG1  3  
ATOM 11016 H HG21 . THR A 1 9   ? -14.009  24.920   7.260    1.00 0.00 ? 4   THR A HG21 3  
ATOM 11017 H HG22 . THR A 1 9   ? -15.655  25.414   7.655    1.00 0.00 ? 4   THR A HG22 3  
ATOM 11018 H HG23 . THR A 1 9   ? -14.576  26.530   6.818    1.00 0.00 ? 4   THR A HG23 3  
ATOM 11019 N N    . ILE A 1 10  ? -11.957  25.349   5.114    1.00 0.00 ? 5   ILE A N    3  
ATOM 11020 C CA   . ILE A 1 10  ? -10.629  24.765   5.460    1.00 0.00 ? 5   ILE A CA   3  
ATOM 11021 C C    . ILE A 1 10  ? -10.338  24.990   6.944    1.00 0.00 ? 5   ILE A C    3  
ATOM 11022 O O    . ILE A 1 10  ? -10.479  26.083   7.453    1.00 0.00 ? 5   ILE A O    3  
ATOM 11023 C CB   . ILE A 1 10  ? -9.624   25.517   4.568    1.00 0.00 ? 5   ILE A CB   3  
ATOM 11024 C CG1  . ILE A 1 10  ? -9.508   24.820   3.203    1.00 0.00 ? 5   ILE A CG1  3  
ATOM 11025 C CG2  . ILE A 1 10  ? -8.241   25.534   5.230    1.00 0.00 ? 5   ILE A CG2  3  
ATOM 11026 C CD1  . ILE A 1 10  ? -10.875  24.288   2.754    1.00 0.00 ? 5   ILE A CD1  3  
ATOM 11027 H H    . ILE A 1 10  ? -12.069  26.322   5.082    1.00 0.00 ? 5   ILE A H    3  
ATOM 11028 H HA   . ILE A 1 10  ? -10.610  23.712   5.229    1.00 0.00 ? 5   ILE A HA   3  
ATOM 11029 H HB   . ILE A 1 10  ? -9.962   26.535   4.425    1.00 0.00 ? 5   ILE A HB   3  
ATOM 11030 H HG12 . ILE A 1 10  ? -9.144   25.526   2.471    1.00 0.00 ? 5   ILE A HG12 3  
ATOM 11031 H HG13 . ILE A 1 10  ? -8.814   23.997   3.280    1.00 0.00 ? 5   ILE A HG13 3  
ATOM 11032 H HG21 . ILE A 1 10  ? -8.051   24.577   5.692    1.00 0.00 ? 5   ILE A HG21 3  
ATOM 11033 H HG22 . ILE A 1 10  ? -8.212   26.309   5.982    1.00 0.00 ? 5   ILE A HG22 3  
ATOM 11034 H HG23 . ILE A 1 10  ? -7.486   25.729   4.482    1.00 0.00 ? 5   ILE A HG23 3  
ATOM 11035 H HD11 . ILE A 1 10  ? -10.807  23.941   1.734    1.00 0.00 ? 5   ILE A HD11 3  
ATOM 11036 H HD12 . ILE A 1 10  ? -11.611  25.077   2.822    1.00 0.00 ? 5   ILE A HD12 3  
ATOM 11037 H HD13 . ILE A 1 10  ? -11.167  23.467   3.394    1.00 0.00 ? 5   ILE A HD13 3  
ATOM 11038 N N    . THR A 1 11  ? -9.933   23.963   7.640    1.00 0.00 ? 6   THR A N    3  
ATOM 11039 C CA   . THR A 1 11  ? -9.635   24.118   9.089    1.00 0.00 ? 6   THR A CA   3  
ATOM 11040 C C    . THR A 1 11  ? -8.274   24.791   9.264    1.00 0.00 ? 6   THR A C    3  
ATOM 11041 O O    . THR A 1 11  ? -7.246   24.233   8.930    1.00 0.00 ? 6   THR A O    3  
ATOM 11042 C CB   . THR A 1 11  ? -9.611   22.695   9.650    1.00 0.00 ? 6   THR A CB   3  
ATOM 11043 O OG1  . THR A 1 11  ? -10.379  21.838   8.815    1.00 0.00 ? 6   THR A OG1  3  
ATOM 11044 C CG2  . THR A 1 11  ? -10.202  22.694   11.058   1.00 0.00 ? 6   THR A CG2  3  
ATOM 11045 H H    . THR A 1 11  ? -9.824   23.090   7.210    1.00 0.00 ? 6   THR A H    3  
ATOM 11046 H HA   . THR A 1 11  ? -10.407  24.695   9.574    1.00 0.00 ? 6   THR A HA   3  
ATOM 11047 H HB   . THR A 1 11  ? -8.594   22.341   9.690    1.00 0.00 ? 6   THR A HB   3  
ATOM 11048 H HG1  . THR A 1 11  ? -9.874   21.035   8.670    1.00 0.00 ? 6   THR A HG1  3  
ATOM 11049 H HG21 . THR A 1 11  ? -9.439   22.971   11.770   1.00 0.00 ? 6   THR A HG21 3  
ATOM 11050 H HG22 . THR A 1 11  ? -10.573  21.708   11.292   1.00 0.00 ? 6   THR A HG22 3  
ATOM 11051 H HG23 . THR A 1 11  ? -11.014  23.405   11.106   1.00 0.00 ? 6   THR A HG23 3  
ATOM 11052 N N    . LEU A 1 12  ? -8.261   25.989   9.779    1.00 0.00 ? 7   LEU A N    3  
ATOM 11053 C CA   . LEU A 1 12  ? -6.971   26.707   9.971    1.00 0.00 ? 7   LEU A CA   3  
ATOM 11054 C C    . LEU A 1 12  ? -6.611   26.755   11.457   1.00 0.00 ? 7   LEU A C    3  
ATOM 11055 O O    . LEU A 1 12  ? -7.284   27.387   12.247   1.00 0.00 ? 7   LEU A O    3  
ATOM 11056 C CB   . LEU A 1 12  ? -7.221   28.111   9.438    1.00 0.00 ? 7   LEU A CB   3  
ATOM 11057 C CG   . LEU A 1 12  ? -5.940   28.663   8.797    1.00 0.00 ? 7   LEU A CG   3  
ATOM 11058 C CD1  . LEU A 1 12  ? -4.806   28.667   9.825    1.00 0.00 ? 7   LEU A CD1  3  
ATOM 11059 C CD2  . LEU A 1 12  ? -5.544   27.789   7.601    1.00 0.00 ? 7   LEU A CD2  3  
ATOM 11060 H H    . LEU A 1 12  ? -9.104   26.419   10.038   1.00 0.00 ? 7   LEU A H    3  
ATOM 11061 H HA   . LEU A 1 12  ? -6.190   26.239   9.402    1.00 0.00 ? 7   LEU A HA   3  
ATOM 11062 H HB2  . LEU A 1 12  ? -8.010   28.079   8.700    1.00 0.00 ? 7   LEU A HB2  3  
ATOM 11063 H HB3  . LEU A 1 12  ? -7.518   28.746   10.252   1.00 0.00 ? 7   LEU A HB3  3  
ATOM 11064 H HG   . LEU A 1 12  ? -6.115   29.673   8.459    1.00 0.00 ? 7   LEU A HG   3  
ATOM 11065 H HD11 . LEU A 1 12  ? -4.227   27.762   9.724    1.00 0.00 ? 7   LEU A HD11 3  
ATOM 11066 H HD12 . LEU A 1 12  ? -5.222   28.721   10.820   1.00 0.00 ? 7   LEU A HD12 3  
ATOM 11067 H HD13 . LEU A 1 12  ? -4.170   29.523   9.653    1.00 0.00 ? 7   LEU A HD13 3  
ATOM 11068 H HD21 . LEU A 1 12  ? -6.207   26.938   7.538    1.00 0.00 ? 7   LEU A HD21 3  
ATOM 11069 H HD22 . LEU A 1 12  ? -4.528   27.444   7.725    1.00 0.00 ? 7   LEU A HD22 3  
ATOM 11070 H HD23 . LEU A 1 12  ? -5.617   28.369   6.692    1.00 0.00 ? 7   LEU A HD23 3  
ATOM 11071 N N    . LYS A 1 13  ? -5.556   26.091   11.844   1.00 0.00 ? 8   LYS A N    3  
ATOM 11072 C CA   . LYS A 1 13  ? -5.155   26.098   13.280   1.00 0.00 ? 8   LYS A CA   3  
ATOM 11073 C C    . LYS A 1 13  ? -3.824   26.833   13.456   1.00 0.00 ? 8   LYS A C    3  
ATOM 11074 O O    . LYS A 1 13  ? -2.846   26.520   12.811   1.00 0.00 ? 8   LYS A O    3  
ATOM 11075 C CB   . LYS A 1 13  ? -5.003   24.623   13.656   1.00 0.00 ? 8   LYS A CB   3  
ATOM 11076 C CG   . LYS A 1 13  ? -5.504   24.396   15.086   1.00 0.00 ? 8   LYS A CG   3  
ATOM 11077 C CD   . LYS A 1 13  ? -4.833   25.393   16.037   1.00 0.00 ? 8   LYS A CD   3  
ATOM 11078 C CE   . LYS A 1 13  ? -5.308   25.138   17.470   1.00 0.00 ? 8   LYS A CE   3  
ATOM 11079 N NZ   . LYS A 1 13  ? -4.159   24.475   18.145   1.00 0.00 ? 8   LYS A NZ   3  
ATOM 11080 H H    . LYS A 1 13  ? -5.028   25.587   11.190   1.00 0.00 ? 8   LYS A H    3  
ATOM 11081 H HA   . LYS A 1 13  ? -5.922   26.556   13.884   1.00 0.00 ? 8   LYS A HA   3  
ATOM 11082 H HB2  . LYS A 1 13  ? -5.581   24.018   12.972   1.00 0.00 ? 8   LYS A HB2  3  
ATOM 11083 H HB3  . LYS A 1 13  ? -3.964   24.341   13.593   1.00 0.00 ? 8   LYS A HB3  3  
ATOM 11084 H HG2  . LYS A 1 13  ? -6.574   24.533   15.116   1.00 0.00 ? 8   LYS A HG2  3  
ATOM 11085 H HG3  . LYS A 1 13  ? -5.263   23.390   15.395   1.00 0.00 ? 8   LYS A HG3  3  
ATOM 11086 H HD2  . LYS A 1 13  ? -3.760   25.273   15.985   1.00 0.00 ? 8   LYS A HD2  3  
ATOM 11087 H HD3  . LYS A 1 13  ? -5.097   26.399   15.746   1.00 0.00 ? 8   LYS A HD3  3  
ATOM 11088 H HE2  . LYS A 1 13  ? -5.545   26.075   17.956   1.00 0.00 ? 8   LYS A HE2  3  
ATOM 11089 H HE3  . LYS A 1 13  ? -6.167   24.485   17.472   1.00 0.00 ? 8   LYS A HE3  3  
ATOM 11090 H HZ1  . LYS A 1 13  ? -3.304   25.053   18.023   1.00 0.00 ? 8   LYS A HZ1  3  
ATOM 11091 H HZ2  . LYS A 1 13  ? -4.006   23.535   17.724   1.00 0.00 ? 8   LYS A HZ2  3  
ATOM 11092 H HZ3  . LYS A 1 13  ? -4.364   24.372   19.159   1.00 0.00 ? 8   LYS A HZ3  3  
ATOM 11093 N N    . THR A 1 14  ? -3.779   27.807   14.324   1.00 0.00 ? 9   THR A N    3  
ATOM 11094 C CA   . THR A 1 14  ? -2.507   28.557   14.538   1.00 0.00 ? 9   THR A CA   3  
ATOM 11095 C C    . THR A 1 14  ? -1.781   28.029   15.778   1.00 0.00 ? 9   THR A C    3  
ATOM 11096 O O    . THR A 1 14  ? -2.393   27.758   16.796   1.00 0.00 ? 9   THR A O    3  
ATOM 11097 C CB   . THR A 1 14  ? -2.933   30.011   14.738   1.00 0.00 ? 9   THR A CB   3  
ATOM 11098 O OG1  . THR A 1 14  ? -3.849   30.090   15.820   1.00 0.00 ? 9   THR A OG1  3  
ATOM 11099 C CG2  . THR A 1 14  ? -3.598   30.523   13.461   1.00 0.00 ? 9   THR A CG2  3  
ATOM 11100 H H    . THR A 1 14  ? -4.580   28.046   14.836   1.00 0.00 ? 9   THR A H    3  
ATOM 11101 H HA   . THR A 1 14  ? -1.873   28.476   13.669   1.00 0.00 ? 9   THR A HA   3  
ATOM 11102 H HB   . THR A 1 14  ? -2.065   30.615   14.954   1.00 0.00 ? 9   THR A HB   3  
ATOM 11103 H HG1  . THR A 1 14  ? -3.561   30.798   16.402   1.00 0.00 ? 9   THR A HG1  3  
ATOM 11104 H HG21 . THR A 1 14  ? -3.920   31.544   13.606   1.00 0.00 ? 9   THR A HG21 3  
ATOM 11105 H HG22 . THR A 1 14  ? -4.453   29.906   13.229   1.00 0.00 ? 9   THR A HG22 3  
ATOM 11106 H HG23 . THR A 1 14  ? -2.891   30.480   12.645   1.00 0.00 ? 9   THR A HG23 3  
ATOM 11107 N N    . LEU A 1 15  ? -0.480   27.880   15.691   1.00 0.00 ? 10  LEU A N    3  
ATOM 11108 C CA   . LEU A 1 15  ? 0.316    27.362   16.852   1.00 0.00 ? 10  LEU A CA   3  
ATOM 11109 C C    . LEU A 1 15  ? -0.096   28.058   18.154   1.00 0.00 ? 10  LEU A C    3  
ATOM 11110 O O    . LEU A 1 15  ? 0.011    27.499   19.228   1.00 0.00 ? 10  LEU A O    3  
ATOM 11111 C CB   . LEU A 1 15  ? 1.773    27.688   16.510   1.00 0.00 ? 10  LEU A CB   3  
ATOM 11112 C CG   . LEU A 1 15  ? 2.648    26.464   16.782   1.00 0.00 ? 10  LEU A CG   3  
ATOM 11113 C CD1  . LEU A 1 15  ? 4.071    26.735   16.291   1.00 0.00 ? 10  LEU A CD1  3  
ATOM 11114 C CD2  . LEU A 1 15  ? 2.673    26.180   18.285   1.00 0.00 ? 10  LEU A CD2  3  
ATOM 11115 H H    . LEU A 1 15  ? -0.023   28.107   14.854   1.00 0.00 ? 10  LEU A H    3  
ATOM 11116 H HA   . LEU A 1 15  ? 0.192    26.295   16.944   1.00 0.00 ? 10  LEU A HA   3  
ATOM 11117 H HB2  . LEU A 1 15  ? 1.846    27.959   15.467   1.00 0.00 ? 10  LEU A HB2  3  
ATOM 11118 H HB3  . LEU A 1 15  ? 2.111    28.512   17.120   1.00 0.00 ? 10  LEU A HB3  3  
ATOM 11119 H HG   . LEU A 1 15  ? 2.244    25.609   16.258   1.00 0.00 ? 10  LEU A HG   3  
ATOM 11120 H HD11 . LEU A 1 15  ? 4.767