data_1OTE
# 
_entry.id   1OTE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OTE         
RCSB  RCSB018651   
WWPDB D_1000018651 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2PHY 'Photoactive Yellow Protein, Dark State (Unbleached)'                                  unspecified 
PDB 1OTA 'E46Q Mutant of Photoactive Yellow Protein, P63 AT 295K'                               unspecified 
PDB 1OTB 'Wild Type Photoactive Yellow Protein, P63 AT 295K'                                    unspecified 
PDB 1OTD 'Strong Hydrogen Bonds in Photoactive Yellow Protein and their Role in its Photocycle' unspecified 
PDB 1OTI 'E46Q mutant of photoactive yellow protein, P65 at 295K'                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OTE 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anderson, S.' 1 
'Crosson, S.'  2 
'Moffat, K.'   3 
# 
_citation.id                        primary 
_citation.title                     'Short hydrogen bonds in photoactive yellow protein.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            60 
_citation.page_first                1008 
_citation.page_last                 1016 
_citation.year                      2004 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15159559 
_citation.pdbx_database_id_DOI      10.1107/S090744490400616X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Anderson, S.' 1 ? 
primary 'Crosson, S.'  2 ? 
primary 'Moffat, K.'   3 ? 
# 
_cell.entry_id           1OTE 
_cell.length_a           40.018 
_cell.length_b           40.018 
_cell.length_c           117.610 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OTE 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'photoactive yellow protein, PYP' 13887.591 1   ? E46Q ? ? 
2 non-polymer syn 
;4'-HYDROXYCINNAMIC ACID
;
164.158   1   ? ?    ? ? 
3 water       nat water                             18.015    138 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   VAL n 
1 5   ALA n 
1 6   PHE n 
1 7   GLY n 
1 8   SER n 
1 9   GLU n 
1 10  ASP n 
1 11  ILE n 
1 12  GLU n 
1 13  ASN n 
1 14  THR n 
1 15  LEU n 
1 16  ALA n 
1 17  LYS n 
1 18  MET n 
1 19  ASP n 
1 20  ASP n 
1 21  GLY n 
1 22  GLN n 
1 23  LEU n 
1 24  ASP n 
1 25  GLY n 
1 26  LEU n 
1 27  ALA n 
1 28  PHE n 
1 29  GLY n 
1 30  ALA n 
1 31  ILE n 
1 32  GLN n 
1 33  LEU n 
1 34  ASP n 
1 35  GLY n 
1 36  ASP n 
1 37  GLY n 
1 38  ASN n 
1 39  ILE n 
1 40  LEU n 
1 41  GLN n 
1 42  TYR n 
1 43  ASN n 
1 44  ALA n 
1 45  ALA n 
1 46  GLN n 
1 47  GLY n 
1 48  ASP n 
1 49  ILE n 
1 50  THR n 
1 51  GLY n 
1 52  ARG n 
1 53  ASP n 
1 54  PRO n 
1 55  LYS n 
1 56  GLN n 
1 57  VAL n 
1 58  ILE n 
1 59  GLY n 
1 60  LYS n 
1 61  ASN n 
1 62  PHE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  PRO n 
1 69  CYS n 
1 70  THR n 
1 71  ASP n 
1 72  SER n 
1 73  PRO n 
1 74  GLU n 
1 75  PHE n 
1 76  TYR n 
1 77  GLY n 
1 78  LYS n 
1 79  PHE n 
1 80  LYS n 
1 81  GLU n 
1 82  GLY n 
1 83  VAL n 
1 84  ALA n 
1 85  SER n 
1 86  GLY n 
1 87  ASN n 
1 88  LEU n 
1 89  ASN n 
1 90  THR n 
1 91  MET n 
1 92  PHE n 
1 93  GLU n 
1 94  TYR n 
1 95  THR n 
1 96  PHE n 
1 97  ASP n 
1 98  TYR n 
1 99  GLN n 
1 100 MET n 
1 101 THR n 
1 102 PRO n 
1 103 THR n 
1 104 LYS n 
1 105 VAL n 
1 106 LYS n 
1 107 VAL n 
1 108 HIS n 
1 109 MET n 
1 110 LYS n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 SER n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 TRP n 
1 120 VAL n 
1 121 PHE n 
1 122 VAL n 
1 123 LYS n 
1 124 ARG n 
1 125 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_ECTHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OTE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1OTE 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      46 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16113 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          46 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            46 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                    'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                    'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                    'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                    'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                    'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                    'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                    'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                    'C2 H5 N O2'     75.067  
HC4 non-polymer         . 
;4'-HYDROXYCINNAMIC ACID
;
'PARA-COUMARIC ACID' 'C9 H8 O3'       164.158 
HIS 'L-peptide linking' y HISTIDINE                 ?                    'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                     ?                    'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ?                    'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                    'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                    'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                    'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                    'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                    'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ?                    'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ?                    'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                    'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                    'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                    'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OTE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.96 
_exptl_crystal.density_percent_sol   37.15 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 2000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 110K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1OTE 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.40 
_reflns.d_resolution_low             100.00 
_reflns.number_all                   20725 
_reflns.number_obs                   20725 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              24.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.45 
_reflns_shell.percent_possible_all   94.3 
_reflns_shell.Rmerge_I_obs           0.13 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    13.2 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OTE 
_refine.ls_d_res_high                            1.40 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     20725 
_refine.ls_number_reflns_obs                     19844 
_refine.ls_number_reflns_R_free                  988 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.185 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PHY' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'derived from 0.95A 110K E46Q mutant ground state structure' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        949 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             138 
_refine_hist.number_atoms_total               1098 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_angle_d 2.44  ? ? ? 'X-RAY DIFFRACTION' ? 
s_bond_d  0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1OTE 
_struct.title                     'E46Q MUTANT OF PHOTOACTIVE YELLOW PROTEIN, P65 AT 110K' 
_struct.pdbx_descriptor           'PHOTOACTIVE YELLOW PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OTE 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'PYP, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 10 ? ALA A 16 ? ASP A 10 ALA A 16 1 ? 7  
HELX_P HELX_P2 2 GLN A 22 ? LEU A 26 ? GLN A 22 LEU A 26 5 ? 5  
HELX_P HELX_P3 3 ASN A 43 ? GLY A 51 ? ASN A 43 GLY A 51 1 ? 9  
HELX_P HELX_P4 4 ASP A 53 ? ILE A 58 ? ASP A 53 ILE A 58 1 ? 6  
HELX_P HELX_P5 5 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5  
HELX_P HELX_P6 6 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            69 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HC4 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             69 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HC4 
_struct_conn.ptnr2_auth_seq_id             169 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.787 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 39  ? TYR A 42  ? ILE A 39  TYR A 42  
A 2 GLY A 29  ? ASP A 34  ? GLY A 29  ASP A 34  
A 3 SER A 117 ? ARG A 124 ? SER A 117 ARG A 124 
A 4 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 
A 5 ASN A 89  ? PHE A 96  ? ASN A 89  PHE A 96  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 40  ? O LEU A 40  N GLN A 32  ? N GLN A 32  
A 2 3 N LEU A 33  ? N LEU A 33  O TYR A 118 ? O TYR A 118 
A 3 4 O PHE A 121 ? O PHE A 121 N HIS A 108 ? N HIS A 108 
A 4 5 O VAL A 107 ? O VAL A 107 N PHE A 92  ? N PHE A 92  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE HC4 A 169' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ILE A 31 ? ILE A 31 . ? 1_555 ? 
2  AC1 12 TYR A 42 ? TYR A 42 . ? 1_555 ? 
3  AC1 12 GLN A 46 ? GLN A 46 . ? 1_555 ? 
4  AC1 12 THR A 50 ? THR A 50 . ? 1_555 ? 
5  AC1 12 ARG A 52 ? ARG A 52 . ? 1_555 ? 
6  AC1 12 PHE A 62 ? PHE A 62 . ? 1_555 ? 
7  AC1 12 VAL A 66 ? VAL A 66 . ? 1_555 ? 
8  AC1 12 ALA A 67 ? ALA A 67 . ? 1_555 ? 
9  AC1 12 PRO A 68 ? PRO A 68 . ? 1_555 ? 
10 AC1 12 CYS A 69 ? CYS A 69 . ? 1_555 ? 
11 AC1 12 PHE A 96 ? PHE A 96 . ? 1_555 ? 
12 AC1 12 TYR A 98 ? TYR A 98 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OTE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OTE 
_atom_sites.fract_transf_matrix[1][1]   0.024989 
_atom_sites.fract_transf_matrix[1][2]   0.014427 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028855 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008503 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . VAL A 1 4   ? 5.466   42.862 11.331  1.00 37.78 ? 4    VAL A N     1 
ATOM   2    C CA    . VAL A 1 4   ? 4.419   43.880 11.468  1.00 35.69 ? 4    VAL A CA    1 
ATOM   3    C C     . VAL A 1 4   ? 3.061   43.253 11.230  1.00 28.24 ? 4    VAL A C     1 
ATOM   4    O O     . VAL A 1 4   ? 2.880   42.609 10.145  1.00 33.58 ? 4    VAL A O     1 
ATOM   5    C CB    . VAL A 1 4   ? 4.437   45.066 10.489  1.00 50.96 ? 4    VAL A CB    1 
ATOM   6    C CG1   . VAL A 1 4   ? 4.675   46.356 11.273  1.00 53.73 ? 4    VAL A CG1   1 
ATOM   7    C CG2   . VAL A 1 4   ? 5.497   44.829 9.447   1.00 67.81 ? 4    VAL A CG2   1 
ATOM   8    N N     . ALA A 1 5   ? 2.105   43.404 12.111  1.00 26.06 ? 5    ALA A N     1 
ATOM   9    C CA    . ALA A 1 5   ? 0.787   42.784 11.950  1.00 24.52 ? 5    ALA A CA    1 
ATOM   10   C C     . ALA A 1 5   ? -0.170  43.687 11.194  1.00 25.41 ? 5    ALA A C     1 
ATOM   11   O O     . ALA A 1 5   ? -0.207  44.928 11.301  1.00 24.77 ? 5    ALA A O     1 
ATOM   12   C CB    . ALA A 1 5   ? 0.219   42.415 13.305  1.00 24.44 ? 5    ALA A CB    1 
ATOM   13   N N     . PHE A 1 6   ? -1.023  43.049 10.370  1.00 22.85 ? 6    PHE A N     1 
ATOM   14   C CA    . PHE A 1 6   ? -2.125  43.755 9.726   1.00 23.03 ? 6    PHE A CA    1 
ATOM   15   C C     . PHE A 1 6   ? -2.924  44.539 10.777  1.00 22.69 ? 6    PHE A C     1 
ATOM   16   O O     . PHE A 1 6   ? -3.328  44.019 11.827  1.00 24.75 ? 6    PHE A O     1 
ATOM   17   C CB    . PHE A 1 6   ? -3.016  42.723 8.999   1.00 23.18 ? 6    PHE A CB    1 
ATOM   18   C CG    . PHE A 1 6   ? -4.226  43.285 8.325   1.00 21.67 ? 6    PHE A CG    1 
ATOM   19   C CD1   . PHE A 1 6   ? -5.448  43.507 8.965   1.00 24.34 ? 6    PHE A CD1   1 
ATOM   20   C CD2   . PHE A 1 6   ? -4.147  43.612 6.961   1.00 22.94 ? 6    PHE A CD2   1 
ATOM   21   C CE1   . PHE A 1 6   ? -6.560  44.035 8.348   1.00 25.53 ? 6    PHE A CE1   1 
ATOM   22   C CE2   . PHE A 1 6   ? -5.267  44.170 6.314   1.00 24.93 ? 6    PHE A CE2   1 
ATOM   23   C CZ    . PHE A 1 6   ? -6.465  44.376 7.001   1.00 27.28 ? 6    PHE A CZ    1 
ATOM   24   N N     . GLY A 1 7   ? -3.192  45.799 10.468  1.00 24.14 ? 7    GLY A N     1 
ATOM   25   C CA    . GLY A 1 7   ? -4.039  46.649 11.304  1.00 26.01 ? 7    GLY A CA    1 
ATOM   26   C C     . GLY A 1 7   ? -3.316  47.276 12.454  1.00 27.92 ? 7    GLY A C     1 
ATOM   27   O O     . GLY A 1 7   ? -3.908  47.958 13.296  1.00 29.81 ? 7    GLY A O     1 
ATOM   28   N N     . SER A 1 8   ? -1.985  47.121 12.532  1.00 26.55 ? 8    SER A N     1 
ATOM   29   C CA    . SER A 1 8   ? -1.245  47.828 13.607  1.00 28.28 ? 8    SER A CA    1 
ATOM   30   C C     . SER A 1 8   ? -1.419  49.330 13.570  1.00 30.43 ? 8    SER A C     1 
ATOM   31   O O     . SER A 1 8   ? -1.540  49.908 12.477  1.00 27.99 ? 8    SER A O     1 
ATOM   32   C CB    . SER A 1 8   ? 0.235   47.459 13.453  1.00 32.69 ? 8    SER A CB    1 
ATOM   33   O OG    . SER A 1 8   ? 0.483   46.061 13.615  1.00 29.14 ? 8    SER A OG    1 
ATOM   34   N N     . GLU A 1 9   ? -1.429  49.972 14.746  1.00 34.77 ? 9    GLU A N     1 
ATOM   35   C CA    . GLU A 1 9   ? -1.729  51.391 14.853  1.00 38.14 ? 9    GLU A CA    1 
ATOM   36   C C     . GLU A 1 9   ? -0.726  52.270 14.112  1.00 35.98 ? 9    GLU A C     1 
ATOM   37   O O     . GLU A 1 9   ? -1.161  53.362 13.703  1.00 38.93 ? 9    GLU A O     1 
ATOM   38   C CB    . GLU A 1 9   ? -1.807  51.894 16.301  1.00 46.13 ? 9    GLU A CB    1 
ATOM   39   C CG    . GLU A 1 9   ? -1.471  50.904 17.385  1.00 59.12 ? 9    GLU A CG    1 
ATOM   40   C CD    . GLU A 1 9   ? -2.218  51.096 18.686  1.00 70.60 ? 9    GLU A CD    1 
ATOM   41   O OE1   . GLU A 1 9   ? -2.662  50.136 19.383  1.00 87.19 ? 9    GLU A OE1   1 
ATOM   42   O OE2   . GLU A 1 9   ? -2.391  52.281 19.066  1.00 93.54 ? 9    GLU A OE2   1 
ATOM   43   N N     . ASP A 1 10  ? 0.482   51.748 14.019  1.00 37.82 ? 10   ASP A N     1 
ATOM   44   C CA    . ASP A 1 10  ? 1.553   52.520 13.372  1.00 34.49 ? 10   ASP A CA    1 
ATOM   45   C C     . ASP A 1 10  ? 2.200   51.756 12.230  1.00 31.63 ? 10   ASP A C     1 
ATOM   46   O O     . ASP A 1 10  ? 3.371   51.854 11.914  1.00 31.99 ? 10   ASP A O     1 
ATOM   47   C CB    . ASP A 1 10  ? 2.593   52.831 14.433  1.00 39.53 ? 10   ASP A CB    1 
ATOM   48   C CG    . ASP A 1 10  ? 3.284   51.632 15.035  1.00 40.67 ? 10   ASP A CG    1 
ATOM   49   O OD1   . ASP A 1 10  ? 2.732   50.533 14.953  1.00 38.66 ? 10   ASP A OD1   1 
ATOM   50   O OD2   . ASP A 1 10  ? 4.402   51.689 15.627  1.00 48.47 ? 10   ASP A OD2   1 
ATOM   51   N N     . ILE A 1 11  ? 1.373   50.977 11.547  1.00 28.77 ? 11   ILE A N     1 
ATOM   52   C CA    . ILE A 1 11  ? 1.839   50.123 10.453  1.00 26.11 ? 11   ILE A CA    1 
ATOM   53   C C     . ILE A 1 11  ? 2.583   50.924 9.406   1.00 28.35 ? 11   ILE A C     1 
ATOM   54   O O     . ILE A 1 11  ? 3.572   50.450 8.839   1.00 28.57 ? 11   ILE A O     1 
ATOM   55   C CB    . ILE A 1 11  ? 0.643   49.364 9.835   1.00 26.43 ? 11   ILE A CB    1 
ATOM   56   C CG1   . ILE A 1 11  ? 1.164   48.325 8.843   1.00 28.72 ? 11   ILE A CG1   1 
ATOM   57   C CG2   . ILE A 1 11  ? -0.371  50.311 9.208   1.00 30.82 ? 11   ILE A CG2   1 
ATOM   58   C CD1   . ILE A 1 11  ? 1.960   47.287 9.655   1.00 37.20 ? 11   ILE A CD1   1 
ATOM   59   N N     . GLU A 1 12  ? 2.140   52.132 9.130   1.00 29.02 ? 12   GLU A N     1 
ATOM   60   C CA    . GLU A 1 12  ? 2.786   52.882 8.064   1.00 32.90 ? 12   GLU A CA    1 
ATOM   61   C C     . GLU A 1 12  ? 4.176   53.292 8.510   1.00 32.04 ? 12   GLU A C     1 
ATOM   62   O O     . GLU A 1 12  ? 5.026   53.630 7.673   1.00 30.41 ? 12   GLU A O     1 
ATOM   63   C CB    . GLU A 1 12  ? 1.901   54.101 7.766   1.00 37.60 ? 12   GLU A CB    1 
ATOM   64   C CG    . GLU A 1 12  ? 1.953   55.217 8.784   1.00 40.55 ? 12   GLU A CG    1 
ATOM   65   C CD    . GLU A 1 12  ? 1.000   55.077 9.941   1.00 40.24 ? 12   GLU A CD    1 
ATOM   66   O OE1   . GLU A 1 12  ? 0.484   53.990 10.237  1.00 38.04 ? 12   GLU A OE1   1 
ATOM   67   O OE2   . GLU A 1 12  ? 0.723   56.096 10.603  1.00 48.80 ? 12   GLU A OE2   1 
ATOM   68   N N     . ASN A 1 13  ? 4.464   53.366 9.800   1.00 29.74 ? 13   ASN A N     1 
ATOM   69   C CA    . ASN A 1 13  ? 5.819   53.719 10.274  1.00 33.02 ? 13   ASN A CA    1 
ATOM   70   C C     . ASN A 1 13  ? 6.780   52.606 9.885   1.00 29.04 ? 13   ASN A C     1 
ATOM   71   O O     . ASN A 1 13  ? 7.874   52.759 9.428   1.00 34.63 ? 13   ASN A O     1 
ATOM   72   C CB    . ASN A 1 13  ? 5.877   53.852 11.790  1.00 37.06 ? 13   ASN A CB    1 
ATOM   73   C CG    . ASN A 1 13  ? 5.538   55.240 12.241  1.00 38.40 ? 13   ASN A CG    1 
ATOM   74   O OD1   . ASN A 1 13  ? 4.778   56.024 11.626  1.00 39.91 ? 13   ASN A OD1   1 
ATOM   75   N ND2   . ASN A 1 13  ? 6.072   55.678 13.356  1.00 45.27 ? 13   ASN A ND2   1 
ATOM   76   N N     . THR A 1 14  ? 6.341   51.373 10.147  1.00 28.48 ? 14   THR A N     1 
ATOM   77   C CA    . THR A 1 14  ? 7.169   50.211 9.831   1.00 30.05 ? 14   THR A CA    1 
ATOM   78   C C     . THR A 1 14  ? 7.360   50.075 8.323   1.00 31.92 ? 14   THR A C     1 
ATOM   79   O O     . THR A 1 14  ? 8.464   49.858 7.827   1.00 38.21 ? 14   THR A O     1 
ATOM   80   C CB    . THR A 1 14  ? 6.514   48.914 10.300  1.00 30.12 ? 14   THR A CB    1 
ATOM   81   O OG1   . THR A 1 14  ? 6.355   48.983 11.741  1.00 32.51 ? 14   THR A OG1   1 
ATOM   82   C CG2   . THR A 1 14  ? 7.374   47.716 9.931   1.00 34.30 ? 14   THR A CG2   1 
ATOM   83   N N     . LEU A 1 15  ? 6.258   50.222 7.565   1.00 31.31 ? 15   LEU A N     1 
ATOM   84   C CA    . LEU A 1 15  ? 6.422   50.063 6.113   1.00 37.87 ? 15   LEU A CA    1 
ATOM   85   C C     . LEU A 1 15  ? 7.187   51.196 5.436   1.00 35.44 ? 15   LEU A C     1 
ATOM   86   O O     . LEU A 1 15  ? 7.733   50.991 4.367   1.00 42.29 ? 15   LEU A O     1 
ATOM   87   C CB    . LEU A 1 15  ? 5.025   49.937 5.521   1.00 39.03 ? 15   LEU A CB    1 
ATOM   88   C CG    . LEU A 1 15  ? 4.684   48.417 5.412   1.00 41.24 ? 15   LEU A CG    1 
ATOM   89   C CD1   . LEU A 1 15  ? 4.623   47.769 6.767   1.00 35.57 ? 15   LEU A CD1   1 
ATOM   90   C CD2   . LEU A 1 15  ? 3.414   48.308 4.642   1.00 48.21 ? 15   LEU A CD2   1 
ATOM   91   N N     . ALA A 1 16  ? 7.295   52.362 6.076   1.00 33.67 ? 16   ALA A N     1 
ATOM   92   C CA    . ALA A 1 16  ? 8.071   53.438 5.481   1.00 33.61 ? 16   ALA A CA    1 
ATOM   93   C C     . ALA A 1 16  ? 9.571   53.114 5.416   1.00 35.83 ? 16   ALA A C     1 
ATOM   94   O O     . ALA A 1 16  ? 10.330  53.731 4.692   1.00 42.22 ? 16   ALA A O     1 
ATOM   95   C CB    . ALA A 1 16  ? 7.978   54.736 6.288   1.00 37.82 ? 16   ALA A CB    1 
ATOM   96   N N     . LYS A 1 17  ? 9.918   52.130 6.233   1.00 34.09 ? 17   LYS A N     1 
ATOM   97   C CA    . LYS A 1 17  ? 11.314  51.736 6.386   1.00 36.69 ? 17   LYS A CA    1 
ATOM   98   C C     . LYS A 1 17  ? 11.691  50.663 5.364   1.00 39.04 ? 17   LYS A C     1 
ATOM   99   O O     . LYS A 1 17  ? 12.857  50.395 5.156   1.00 41.64 ? 17   LYS A O     1 
ATOM   100  C CB    . LYS A 1 17  ? 11.541  51.168 7.762   1.00 35.73 ? 17   LYS A CB    1 
ATOM   101  C CG    . LYS A 1 17  ? 11.235  52.040 8.979   1.00 37.94 ? 17   LYS A CG    1 
ATOM   102  C CD    . LYS A 1 17  ? 11.548  51.215 10.239  1.00 35.15 ? 17   LYS A CD    1 
ATOM   103  C CE    . LYS A 1 17  ? 10.708  51.648 11.444  1.00 34.69 ? 17   LYS A CE    1 
ATOM   104  N NZ    . LYS A 1 17  ? 10.911  50.613 12.506  1.00 37.07 ? 17   LYS A NZ    1 
ATOM   105  N N     . MET A 1 18  ? 10.706  50.038 4.738   1.00 44.53 ? 18   MET A N     1 
ATOM   106  C CA    . MET A 1 18  ? 10.876  48.870 3.924   1.00 49.07 ? 18   MET A CA    1 
ATOM   107  C C     . MET A 1 18  ? 11.112  49.123 2.435   1.00 56.75 ? 18   MET A C     1 
ATOM   108  O O     . MET A 1 18  ? 10.417  49.931 1.823   1.00 67.09 ? 18   MET A O     1 
ATOM   109  C CB    . MET A 1 18  ? 9.578   48.049 4.021   1.00 48.75 ? 18   MET A CB    1 
ATOM   110  C CG    . MET A 1 18  ? 9.238   47.578 5.414   1.00 45.79 ? 18   MET A CG    1 
ATOM   111  S SD    . MET A 1 18  ? 7.978   46.291 5.388   1.00 42.64 ? 18   MET A SD    1 
ATOM   112  C CE    . MET A 1 18  ? 8.376   45.500 6.938   1.00 43.35 ? 18   MET A CE    1 
ATOM   113  N N     . ASP A 1 19  ? 12.057  48.382 1.856   1.00 63.54 ? 19   ASP A N     1 
ATOM   114  C CA    . ASP A 1 19  ? 12.317  48.445 0.426   1.00 65.34 ? 19   ASP A CA    1 
ATOM   115  C C     . ASP A 1 19  ? 11.575  47.304 -0.291  1.00 67.88 ? 19   ASP A C     1 
ATOM   116  O O     . ASP A 1 19  ? 10.675  46.707 0.325   1.00 59.64 ? 19   ASP A O     1 
ATOM   117  C CB    . ASP A 1 19  ? 13.810  48.362 0.168   1.00 67.96 ? 19   ASP A CB    1 
ATOM   118  C CG    . ASP A 1 19  ? 14.421  46.979 0.260   1.00 71.71 ? 19   ASP A CG    1 
ATOM   119  O OD1   . ASP A 1 19  ? 15.482  46.745 -0.358  1.00 76.50 ? 19   ASP A OD1   1 
ATOM   120  O OD2   . ASP A 1 19  ? 13.797  46.119 0.917   1.00 61.00 ? 19   ASP A OD2   1 
ATOM   121  N N     . ASP A 1 20  ? 12.030  47.124 -1.504  1.00 63.49 ? 20   ASP A N     1 
ATOM   122  C CA    . ASP A 1 20  ? 11.864  46.143 -2.530  1.00 61.08 ? 20   ASP A CA    1 
ATOM   123  C C     . ASP A 1 20  ? 12.459  44.814 -2.036  1.00 64.02 ? 20   ASP A C     1 
ATOM   124  O O     . ASP A 1 20  ? 13.595  44.479 -2.379  1.00 66.17 ? 20   ASP A O     1 
ATOM   125  C CB    . ASP A 1 20  ? 12.531  46.544 -3.851  1.00 59.09 ? 20   ASP A CB    1 
ATOM   126  C CG    . ASP A 1 20  ? 13.978  46.948 -3.627  1.00 60.93 ? 20   ASP A CG    1 
ATOM   127  O OD1   . ASP A 1 20  ? 14.221  47.647 -2.624  1.00 65.12 ? 20   ASP A OD1   1 
ATOM   128  O OD2   . ASP A 1 20  ? 14.826  46.541 -4.451  1.00 61.65 ? 20   ASP A OD2   1 
ATOM   129  N N     . GLY A 1 21  ? 11.661  44.104 -1.230  1.00 54.48 ? 21   GLY A N     1 
ATOM   130  C CA    . GLY A 1 21  ? 12.111  42.804 -0.719  1.00 53.49 ? 21   GLY A CA    1 
ATOM   131  C C     . GLY A 1 21  ? 11.480  42.600 0.657   1.00 53.43 ? 21   GLY A C     1 
ATOM   132  O O     . GLY A 1 21  ? 10.804  41.598 0.916   1.00 64.22 ? 21   GLY A O     1 
ATOM   133  N N     . GLN A 1 22  ? 11.713  43.607 1.492   1.00 53.74 ? 22   GLN A N     1 
ATOM   134  C CA    . GLN A 1 22  ? 11.097  43.558 2.828   1.00 49.71 ? 22   GLN A CA    1 
ATOM   135  C C     . GLN A 1 22  ? 9.578   43.550 2.667   1.00 42.10 ? 22   GLN A C     1 
ATOM   136  O O     . GLN A 1 22  ? 8.906   42.876 3.447   1.00 41.71 ? 22   GLN A O     1 
ATOM   137  C CB    . GLN A 1 22  ? 11.602  44.718 3.676   1.00 51.62 ? 22   GLN A CB    1 
ATOM   138  C CG    . GLN A 1 22  ? 13.074  45.046 3.399   1.00 66.10 ? 22   GLN A CG    1 
ATOM   139  C CD    . GLN A 1 22  ? 13.492  46.277 4.184   1.00 62.86 ? 22   GLN A CD    1 
ATOM   140  O OE1   . GLN A 1 22  ? 13.444  47.410 3.681   1.00 60.85 ? 22   GLN A OE1   1 
ATOM   141  N NE2   . GLN A 1 22  ? 13.864  46.015 5.428   1.00 77.88 ? 22   GLN A NE2   1 
ATOM   142  N N     . LEU A 1 23  ? 9.044   44.248 1.664   1.00 37.16 ? 23   LEU A N     1 
ATOM   143  C CA    . LEU A 1 23  ? 7.575   44.300 1.499   1.00 32.86 ? 23   LEU A CA    1 
ATOM   144  C C     . LEU A 1 23  ? 7.038   42.919 1.114   1.00 33.13 ? 23   LEU A C     1 
ATOM   145  O O     . LEU A 1 23  ? 5.980   42.495 1.604   1.00 30.56 ? 23   LEU A O     1 
ATOM   146  C CB    . LEU A 1 23  ? 7.183   45.385 0.507   1.00 34.07 ? 23   LEU A CB    1 
ATOM   147  C CG    . LEU A 1 23  ? 5.811   46.020 0.644   1.00 33.87 ? 23   LEU A CG    1 
ATOM   148  C CD1   . LEU A 1 23  ? 5.845   47.058 1.781   1.00 39.54 ? 23   LEU A CD1   1 
ATOM   149  C CD2   . LEU A 1 23  ? 5.349   46.682 -0.652  1.00 33.86 ? 23   LEU A CD2   1 
ATOM   150  N N     . ASP A 1 24  ? 7.846   42.188 0.334   1.00 29.90 ? 24   ASP A N     1 
ATOM   151  C CA    . ASP A 1 24  ? 7.468   40.812 -0.009  1.00 33.13 ? 24   ASP A CA    1 
ATOM   152  C C     . ASP A 1 24  ? 7.492   39.897 1.209   1.00 34.80 ? 24   ASP A C     1 
ATOM   153  O O     . ASP A 1 24  ? 6.874   38.823 1.171   1.00 39.63 ? 24   ASP A O     1 
ATOM   154  C CB    . ASP A 1 24  ? 8.317   40.232 -1.129  1.00 31.30 ? 24   ASP A CB    1 
ATOM   155  C CG    . ASP A 1 24  ? 8.053   40.921 -2.442  1.00 32.30 ? 24   ASP A CG    1 
ATOM   156  O OD1   . ASP A 1 24  ? 7.003   41.630 -2.659  1.00 31.18 ? 24   ASP A OD1   1 
ATOM   157  O OD2   . ASP A 1 24  ? 8.903   40.752 -3.338  1.00 38.46 ? 24   ASP A OD2   1 
ATOM   158  N N     . GLY A 1 25  ? 8.095   40.248 2.332   1.00 32.35 ? 25   GLY A N     1 
ATOM   159  C CA    . GLY A 1 25  ? 7.991   39.298 3.438   1.00 35.76 ? 25   GLY A CA    1 
ATOM   160  C C     . GLY A 1 25  ? 6.801   39.550 4.344   1.00 31.94 ? 25   GLY A C     1 
ATOM   161  O O     . GLY A 1 25  ? 6.685   38.834 5.346   1.00 40.45 ? 25   GLY A O     1 
ATOM   162  N N     . LEU A 1 26  ? 5.941   40.529 4.059   1.00 28.06 ? 26   LEU A N     1 
ATOM   163  C CA    . LEU A 1 26  ? 4.778   40.769 4.910   1.00 27.87 ? 26   LEU A CA    1 
ATOM   164  C C     . LEU A 1 26  ? 3.796   39.611 4.812   1.00 24.09 ? 26   LEU A C     1 
ATOM   165  O O     . LEU A 1 26  ? 3.671   38.933 3.777   1.00 27.92 ? 26   LEU A O     1 
ATOM   166  C CB    . LEU A 1 26  ? 4.038   42.066 4.576   1.00 24.80 ? 26   LEU A CB    1 
ATOM   167  C CG    . LEU A 1 26  ? 4.931   43.323 4.851   1.00 28.49 ? 26   LEU A CG    1 
ATOM   168  C CD1   . LEU A 1 26  ? 4.318   44.511 4.139   1.00 29.18 ? 26   LEU A CD1   1 
ATOM   169  C CD2   . LEU A 1 26  ? 5.123   43.511 6.352   1.00 31.72 ? 26   LEU A CD2   1 
ATOM   170  N N     . ALA A 1 27  ? 3.059   39.399 5.908   1.00 23.62 ? 27   ALA A N     1 
ATOM   171  C CA    . ALA A 1 27  ? 2.055   38.359 6.011   1.00 23.11 ? 27   ALA A CA    1 
ATOM   172  C C     . ALA A 1 27  ? 0.748   38.743 5.333   1.00 21.49 ? 27   ALA A C     1 
ATOM   173  O O     . ALA A 1 27  ? -0.122  37.883 5.174   1.00 24.26 ? 27   ALA A O     1 
ATOM   174  C CB    . ALA A 1 27  ? 1.746   38.052 7.482   1.00 25.20 ? 27   ALA A CB    1 
ATOM   175  N N     . PHE A 1 28  ? 0.641   39.976 4.908   1.00 24.18 ? 28   PHE A N     1 
ATOM   176  C CA    . PHE A 1 28  ? -0.570  40.496 4.270   1.00 22.21 ? 28   PHE A CA    1 
ATOM   177  C C     . PHE A 1 28  ? -0.218  41.213 2.986   1.00 22.09 ? 28   PHE A C     1 
ATOM   178  O O     . PHE A 1 28  ? 0.904   41.614 2.725   1.00 23.72 ? 28   PHE A O     1 
ATOM   179  C CB    . PHE A 1 28  ? -1.330  41.419 5.251   1.00 23.51 ? 28   PHE A CB    1 
ATOM   180  C CG    . PHE A 1 28  ? -0.427  42.528 5.844   1.00 23.37 ? 28   PHE A CG    1 
ATOM   181  C CD1   . PHE A 1 28  ? -0.305  43.724 5.170   1.00 24.05 ? 28   PHE A CD1   1 
ATOM   182  C CD2   . PHE A 1 28  ? 0.223   42.318 7.034   1.00 23.37 ? 28   PHE A CD2   1 
ATOM   183  C CE1   . PHE A 1 28  ? 0.511   44.739 5.639   1.00 26.70 ? 28   PHE A CE1   1 
ATOM   184  C CE2   . PHE A 1 28  ? 1.110   43.304 7.521   1.00 26.42 ? 28   PHE A CE2   1 
ATOM   185  C CZ    . PHE A 1 28  ? 1.222   44.495 6.821   1.00 26.89 ? 28   PHE A CZ    1 
ATOM   186  N N     . GLY A 1 29  ? -1.255  41.341 2.140   1.00 22.00 ? 29   GLY A N     1 
ATOM   187  C CA    . GLY A 1 29  ? -1.124  42.088 0.908   1.00 20.54 ? 29   GLY A CA    1 
ATOM   188  C C     . GLY A 1 29  ? -0.917  43.557 1.184   1.00 22.14 ? 29   GLY A C     1 
ATOM   189  O O     . GLY A 1 29  ? -1.563  44.137 2.068   1.00 21.11 ? 29   GLY A O     1 
ATOM   190  N N     . ALA A 1 30  ? -0.004  44.175 0.425   1.00 20.97 ? 30   ALA A N     1 
ATOM   191  C CA    . ALA A 1 30  ? 0.293   45.589 0.614   1.00 22.26 ? 30   ALA A CA    1 
ATOM   192  C C     . ALA A 1 30  ? 0.448   46.262 -0.756  1.00 21.71 ? 30   ALA A C     1 
ATOM   193  O O     . ALA A 1 30  ? 1.300   45.774 -1.545  1.00 23.39 ? 30   ALA A O     1 
ATOM   194  C CB    . ALA A 1 30  ? 1.532   45.847 1.465   1.00 23.79 ? 30   ALA A CB    1 
ATOM   195  N N     . ILE A 1 31  ? -0.320  47.261 -1.048  1.00 21.10 ? 31   ILE A N     1 
ATOM   196  C CA    . ILE A 1 31  ? -0.280  48.070 -2.267  1.00 20.88 ? 31   ILE A CA    1 
ATOM   197  C C     . ILE A 1 31  ? -0.019  49.494 -1.831  1.00 22.13 ? 31   ILE A C     1 
ATOM   198  O O     . ILE A 1 31  ? -0.654  49.985 -0.886  1.00 24.09 ? 31   ILE A O     1 
ATOM   199  C CB    . ILE A 1 31  ? -1.628  48.010 -3.019  1.00 21.90 ? 31   ILE A CB    1 
ATOM   200  C CG1   . ILE A 1 31  ? -2.002  46.542 -3.316  1.00 24.73 ? 31   ILE A CG1   1 
ATOM   201  C CG2   . ILE A 1 31  ? -1.530  48.870 -4.277  1.00 25.32 ? 31   ILE A CG2   1 
ATOM   202  C CD1   . ILE A 1 31  ? -3.428  46.366 -3.779  1.00 28.77 ? 31   ILE A CD1   1 
ATOM   203  N N     . GLN A 1 32  ? 0.839   50.171 -2.546  1.00 22.05 ? 32   GLN A N     1 
ATOM   204  C CA    . GLN A 1 32  ? 1.034   51.605 -2.327  1.00 21.91 ? 32   GLN A CA    1 
ATOM   205  C C     . GLN A 1 32  ? 0.496   52.330 -3.579  1.00 22.18 ? 32   GLN A C     1 
ATOM   206  O O     . GLN A 1 32  ? 0.879   51.948 -4.709  1.00 22.75 ? 32   GLN A O     1 
ATOM   207  C CB    . GLN A 1 32  ? 2.499   51.964 -2.055  1.00 25.03 ? 32   GLN A CB    1 
ATOM   208  C CG    . GLN A 1 32  ? 2.591   53.348 -1.389  1.00 27.32 ? 32   GLN A CG    1 
ATOM   209  C CD    . GLN A 1 32  ? 4.001   53.851 -1.257  1.00 32.83 ? 32   GLN A CD    1 
ATOM   210  O OE1   . GLN A 1 32  ? 4.893   53.484 -2.023  1.00 38.59 ? 32   GLN A OE1   1 
ATOM   211  N NE2   . GLN A 1 32  ? 4.122   54.728 -0.276  1.00 40.19 ? 32   GLN A NE2   1 
ATOM   212  N N     . LEU A 1 33  ? -0.333  53.344 -3.350  1.00 21.50 ? 33   LEU A N     1 
ATOM   213  C CA    . LEU A 1 33  ? -0.960  54.107 -4.427  1.00 21.10 ? 33   LEU A CA    1 
ATOM   214  C C     . LEU A 1 33  ? -0.584  55.592 -4.341  1.00 22.75 ? 33   LEU A C     1 
ATOM   215  O O     . LEU A 1 33  ? -0.434  56.061 -3.219  1.00 22.16 ? 33   LEU A O     1 
ATOM   216  C CB    . LEU A 1 33  ? -2.479  54.020 -4.361  1.00 21.65 ? 33   LEU A CB    1 
ATOM   217  C CG    . LEU A 1 33  ? -3.076  52.622 -4.418  1.00 20.88 ? 33   LEU A CG    1 
ATOM   218  C CD1   . LEU A 1 33  ? -4.624  52.658 -4.307  1.00 23.65 ? 33   LEU A CD1   1 
ATOM   219  C CD2   . LEU A 1 33  ? -2.682  51.924 -5.726  1.00 23.71 ? 33   LEU A CD2   1 
ATOM   220  N N     . ASP A 1 34  ? -0.532  56.299 -5.465  1.00 22.45 ? 34   ASP A N     1 
ATOM   221  C CA    . ASP A 1 34  ? -0.477  57.751 -5.374  1.00 23.31 ? 34   ASP A CA    1 
ATOM   222  C C     . ASP A 1 34  ? -1.921  58.256 -5.210  1.00 24.09 ? 34   ASP A C     1 
ATOM   223  O O     . ASP A 1 34  ? -2.873  57.474 -5.085  1.00 23.90 ? 34   ASP A O     1 
ATOM   224  C CB    . ASP A 1 34  ? 0.212   58.440 -6.547  1.00 24.43 ? 34   ASP A CB    1 
ATOM   225  C CG    . ASP A 1 34  ? -0.518  58.301 -7.877  1.00 27.12 ? 34   ASP A CG    1 
ATOM   226  O OD1   . ASP A 1 34  ? -1.683  57.907 -7.922  1.00 22.91 ? 34   ASP A OD1   1 
ATOM   227  O OD2   . ASP A 1 34  ? 0.125   58.591 -8.912  1.00 27.73 ? 34   ASP A OD2   1 
ATOM   228  N N     . GLY A 1 35  ? -2.109  59.579 -5.174  1.00 25.05 ? 35   GLY A N     1 
ATOM   229  C CA    . GLY A 1 35  ? -3.403  60.180 -4.857  1.00 26.31 ? 35   GLY A CA    1 
ATOM   230  C C     . GLY A 1 35  ? -4.450  59.879 -5.899  1.00 24.59 ? 35   GLY A C     1 
ATOM   231  O O     . GLY A 1 35  ? -5.655  60.050 -5.600  1.00 28.93 ? 35   GLY A O     1 
ATOM   232  N N     . ASP A 1 36  ? -4.010  59.542 -7.086  1.00 26.84 ? 36   ASP A N     1 
ATOM   233  C CA    . ASP A 1 36  ? -4.925  59.197 -8.205  1.00 26.71 ? 36   ASP A CA    1 
ATOM   234  C C     . ASP A 1 36  ? -5.242  57.715 -8.283  1.00 24.68 ? 36   ASP A C     1 
ATOM   235  O O     . ASP A 1 36  ? -6.052  57.275 -9.135  1.00 28.57 ? 36   ASP A O     1 
ATOM   236  C CB    . ASP A 1 36  ? -4.368  59.712 -9.548  1.00 27.60 ? 36   ASP A CB    1 
ATOM   237  C CG    . ASP A 1 36  ? -4.221  61.196 -9.640  1.00 37.70 ? 36   ASP A CG    1 
ATOM   238  O OD1   . ASP A 1 36  ? -5.052  61.870 -9.008  1.00 41.45 ? 36   ASP A OD1   1 
ATOM   239  O OD2   . ASP A 1 36  ? -3.273  61.666 -10.277 1.00 79.12 ? 36   ASP A OD2   1 
ATOM   240  N N     . GLY A 1 37  ? -4.552  56.915 -7.446  1.00 23.08 ? 37   GLY A N     1 
ATOM   241  C CA    . GLY A 1 37  ? -4.793  55.480 -7.489  1.00 22.59 ? 37   GLY A CA    1 
ATOM   242  C C     . GLY A 1 37  ? -3.852  54.748 -8.389  1.00 20.86 ? 37   GLY A C     1 
ATOM   243  O O     . GLY A 1 37  ? -4.040  53.550 -8.655  1.00 24.78 ? 37   GLY A O     1 
ATOM   244  N N     . ASN A 1 38  ? -2.768  55.382 -8.869  1.00 21.92 ? 38   ASN A N     1 
ATOM   245  C CA    . ASN A 1 38  ? -1.747  54.679 -9.639  1.00 22.83 ? 38   ASN A CA    1 
ATOM   246  C C     . ASN A 1 38  ? -0.907  53.806 -8.723  1.00 21.70 ? 38   ASN A C     1 
ATOM   247  O O     . ASN A 1 38  ? -0.597  54.265 -7.625  1.00 23.37 ? 38   ASN A O     1 
ATOM   248  C CB    . ASN A 1 38  ? -0.863  55.674 -10.391 1.00 24.08 ? 38   ASN A CB    1 
ATOM   249  C CG    . ASN A 1 38  ? -1.720  56.534 -11.324 1.00 24.65 ? 38   ASN A CG    1 
ATOM   250  O OD1   . ASN A 1 38  ? -2.483  56.007 -12.146 1.00 27.33 ? 38   ASN A OD1   1 
ATOM   251  N ND2   . ASN A 1 38  ? -1.610  57.863 -11.212 1.00 26.17 ? 38   ASN A ND2   1 
ATOM   252  N N     . ILE A 1 39  ? -0.565  52.621 -9.175  1.00 21.66 ? 39   ILE A N     1 
ATOM   253  C CA    . ILE A 1 39  ? 0.133   51.687 -8.305  1.00 22.73 ? 39   ILE A CA    1 
ATOM   254  C C     . ILE A 1 39  ? 1.617   51.954 -8.288  1.00 22.67 ? 39   ILE A C     1 
ATOM   255  O O     . ILE A 1 39  ? 2.335   51.876 -9.303  1.00 25.72 ? 39   ILE A O     1 
ATOM   256  C CB    . ILE A 1 39  ? -0.162  50.247 -8.768  1.00 21.58 ? 39   ILE A CB    1 
ATOM   257  C CG1   . ILE A 1 39  ? -1.661  49.952 -8.689  1.00 23.41 ? 39   ILE A CG1   1 
ATOM   258  C CG2   . ILE A 1 39  ? 0.666   49.251 -7.969  1.00 24.85 ? 39   ILE A CG2   1 
ATOM   259  C CD1   . ILE A 1 39  ? -2.117  48.667 -9.294  1.00 25.59 ? 39   ILE A CD1   1 
ATOM   260  N N     . LEU A 1 40  ? 2.085   52.267 -7.102  1.00 22.87 ? 40   LEU A N     1 
ATOM   261  C CA    . LEU A 1 40  ? 3.534   52.473 -6.882  1.00 23.57 ? 40   LEU A CA    1 
ATOM   262  C C     . LEU A 1 40  ? 4.303   51.224 -6.428  1.00 25.82 ? 40   LEU A C     1 
ATOM   263  O O     . LEU A 1 40  ? 5.451   50.988 -6.810  1.00 27.63 ? 40   LEU A O     1 
ATOM   264  C CB    . LEU A 1 40  ? 3.678   53.555 -5.825  1.00 25.26 ? 40   LEU A CB    1 
ATOM   265  C CG    . LEU A 1 40  ? 2.974   54.912 -6.021  1.00 27.12 ? 40   LEU A CG    1 
ATOM   266  C CD1   . LEU A 1 40  ? 3.215   55.821 -4.861  1.00 30.11 ? 40   LEU A CD1   1 
ATOM   267  C CD2   . LEU A 1 40  ? 3.374   55.580 -7.327  1.00 37.62 ? 40   LEU A CD2   1 
ATOM   268  N N     . GLN A 1 41  ? 3.653   50.453 -5.530  1.00 25.45 ? 41   GLN A N     1 
ATOM   269  C CA    . GLN A 1 41  ? 4.207   49.222 -5.011  1.00 23.85 ? 41   GLN A CA    1 
ATOM   270  C C     . GLN A 1 41  ? 3.116   48.166 -4.905  1.00 24.21 ? 41   GLN A C     1 
ATOM   271  O O     . GLN A 1 41  ? 1.938   48.572 -4.689  1.00 24.20 ? 41   GLN A O     1 
ATOM   272  C CB    . GLN A 1 41  ? 4.868   49.363 -3.599  1.00 26.39 ? 41   GLN A CB    1 
ATOM   273  C CG    . GLN A 1 41  ? 6.091   50.247 -3.460  1.00 34.29 ? 41   GLN A CG    1 
ATOM   274  C CD    . GLN A 1 41  ? 6.692   50.306 -2.053  1.00 35.23 ? 41   GLN A CD    1 
ATOM   275  O OE1   . GLN A 1 41  ? 7.230   49.293 -1.594  1.00 47.97 ? 41   GLN A OE1   1 
ATOM   276  N NE2   . GLN A 1 41  ? 6.641   51.391 -1.293  1.00 50.99 ? 41   GLN A NE2   1 
ATOM   277  N N     . TYR A 1 42  ? 3.474   46.920 -5.015  1.00 24.32 ? 42   TYR A N     1 
ATOM   278  C CA    . TYR A 1 42  ? 2.505   45.816 -4.945  1.00 22.39 ? 42   TYR A CA    1 
ATOM   279  C C     . TYR A 1 42  ? 3.266   44.562 -4.536  1.00 21.38 ? 42   TYR A C     1 
ATOM   280  O O     . TYR A 1 42  ? 4.165   44.099 -5.274  1.00 26.43 ? 42   TYR A O     1 
ATOM   281  C CB    . TYR A 1 42  ? 1.911   45.655 -6.311  1.00 23.12 ? 42   TYR A CB    1 
ATOM   282  C CG    . TYR A 1 42  ? 0.651   44.829 -6.498  1.00 23.32 ? 42   TYR A CG    1 
ATOM   283  C CD1   . TYR A 1 42  ? 0.697   43.439 -6.553  1.00 23.66 ? 42   TYR A CD1   1 
ATOM   284  C CD2   . TYR A 1 42  ? -0.630  45.394 -6.614  1.00 23.26 ? 42   TYR A CD2   1 
ATOM   285  C CE1   . TYR A 1 42  ? -0.437  42.678 -6.719  1.00 23.39 ? 42   TYR A CE1   1 
ATOM   286  C CE2   . TYR A 1 42  ? -1.780  44.683 -6.799  1.00 21.83 ? 42   TYR A CE2   1 
ATOM   287  C CZ    . TYR A 1 42  ? -1.670  43.303 -6.843  1.00 20.17 ? 42   TYR A CZ    1 
ATOM   288  O OH    . TYR A 1 42  ? -2.796  42.560 -7.055  1.00 21.47 ? 42   TYR A OH    1 
ATOM   289  N N     . ASN A 1 43  ? 3.014   44.019 -3.374  1.00 23.26 ? 43   ASN A N     1 
ATOM   290  C CA    . ASN A 1 43  ? 3.905   42.975 -2.831  1.00 23.51 ? 43   ASN A CA    1 
ATOM   291  C C     . ASN A 1 43  ? 3.434   41.588 -3.191  1.00 23.59 ? 43   ASN A C     1 
ATOM   292  O O     . ASN A 1 43  ? 2.399   41.341 -3.791  1.00 23.86 ? 43   ASN A O     1 
ATOM   293  C CB    . ASN A 1 43  ? 4.073   43.106 -1.332  1.00 23.97 ? 43   ASN A CB    1 
ATOM   294  C CG    . ASN A 1 43  ? 2.912   42.632 -0.520  1.00 22.85 ? 43   ASN A CG    1 
ATOM   295  O OD1   . ASN A 1 43  ? 1.784   42.389 -0.992  1.00 22.92 ? 43   ASN A OD1   1 
ATOM   296  N ND2   . ASN A 1 43  ? 3.098   42.474 0.811   1.00 23.36 ? 43   ASN A ND2   1 
ATOM   297  N N     . ALA A 1 44  ? 4.250   40.589 -2.808  1.00 26.41 ? 44   ALA A N     1 
ATOM   298  C CA    . ALA A 1 44  ? 4.062   39.213 -3.230  1.00 25.62 ? 44   ALA A CA    1 
ATOM   299  C C     . ALA A 1 44  ? 2.807   38.615 -2.634  1.00 24.55 ? 44   ALA A C     1 
ATOM   300  O O     . ALA A 1 44  ? 2.076   37.899 -3.347  1.00 23.88 ? 44   ALA A O     1 
ATOM   301  C CB    . ALA A 1 44  ? 5.287   38.348 -2.895  1.00 27.91 ? 44   ALA A CB    1 
ATOM   302  N N     . ALA A 1 45  ? 2.543   38.947 -1.375  1.00 25.11 ? 45   ALA A N     1 
ATOM   303  C CA    . ALA A 1 45  ? 1.340   38.406 -0.676  1.00 23.95 ? 45   ALA A CA    1 
ATOM   304  C C     . ALA A 1 45  ? 0.078   38.870 -1.399  1.00 23.76 ? 45   ALA A C     1 
ATOM   305  O O     . ALA A 1 45  ? -0.876  38.085 -1.486  1.00 24.11 ? 45   ALA A O     1 
ATOM   306  C CB    . ALA A 1 45  ? 1.361   38.839 0.767   1.00 25.88 ? 45   ALA A CB    1 
ATOM   307  N N     . GLN A 1 46  ? 0.066   40.104 -1.948  1.00 21.93 ? 46   GLN A N     1 
ATOM   308  C CA    . GLN A 1 46  ? -1.120  40.577 -2.634  1.00 21.38 ? 46   GLN A CA    1 
ATOM   309  C C     . GLN A 1 46  ? -1.282  39.784 -3.914  1.00 21.23 ? 46   GLN A C     1 
ATOM   310  O O     . GLN A 1 46  ? -2.409  39.355 -4.203  1.00 23.32 ? 46   GLN A O     1 
ATOM   311  C CB    . GLN A 1 46  ? -0.944  42.100 -2.948  1.00 23.82 ? 46   GLN A CB    1 
ATOM   312  C CG    . GLN A 1 46  ? -2.187  42.663 -3.587  1.00 22.78 ? 46   GLN A CG    1 
ATOM   313  C CD    . GLN A 1 46  ? -3.400  42.675 -2.631  1.00 24.79 ? 46   GLN A CD    1 
ATOM   314  O OE1   . GLN A 1 46  ? -3.314  42.387 -1.438  1.00 28.89 ? 46   GLN A OE1   1 
ATOM   315  N NE2   . GLN A 1 46  ? -4.551  42.975 -3.247  1.00 24.76 ? 46   GLN A NE2   1 
ATOM   316  N N     . GLY A 1 47  ? -0.229  39.539 -4.652  1.00 22.34 ? 47   GLY A N     1 
ATOM   317  C CA    . GLY A 1 47  ? -0.324  38.757 -5.885  1.00 23.71 ? 47   GLY A CA    1 
ATOM   318  C C     . GLY A 1 47  ? -0.805  37.348 -5.592  1.00 25.75 ? 47   GLY A C     1 
ATOM   319  O O     . GLY A 1 47  ? -1.481  36.786 -6.453  1.00 26.03 ? 47   GLY A O     1 
ATOM   320  N N     . ASP A 1 48  ? -0.440  36.778 -4.437  1.00 25.75 ? 48   ASP A N     1 
ATOM   321  C CA    . ASP A 1 48  ? -0.921  35.437 -4.134  1.00 28.26 ? 48   ASP A CA    1 
ATOM   322  C C     . ASP A 1 48  ? -2.429  35.404 -3.945  1.00 25.95 ? 48   ASP A C     1 
ATOM   323  O O     . ASP A 1 48  ? -3.084  34.385 -4.157  1.00 34.13 ? 48   ASP A O     1 
ATOM   324  C CB    . ASP A 1 48  ? -0.198  34.934 -2.889  1.00 29.83 ? 48   ASP A CB    1 
ATOM   325  C CG    . ASP A 1 48  ? 1.284   34.662 -3.154  1.00 32.00 ? 48   ASP A CG    1 
ATOM   326  O OD1   . ASP A 1 48  ? 1.820   34.585 -4.277  1.00 33.72 ? 48   ASP A OD1   1 
ATOM   327  O OD2   . ASP A 1 48  ? 1.989   34.452 -2.143  1.00 34.62 ? 48   ASP A OD2   1 
ATOM   328  N N     . ILE A 1 49  ? -3.026  36.530 -3.468  1.00 25.74 ? 49   ILE A N     1 
ATOM   329  C CA    . ILE A 1 49  ? -4.482  36.593 -3.315  1.00 26.65 ? 49   ILE A CA    1 
ATOM   330  C C     . ILE A 1 49  ? -5.169  36.835 -4.629  1.00 26.42 ? 49   ILE A C     1 
ATOM   331  O O     . ILE A 1 49  ? -6.214  36.238 -4.915  1.00 28.40 ? 49   ILE A O     1 
ATOM   332  C CB    . ILE A 1 49  ? -4.852  37.752 -2.360  1.00 25.15 ? 49   ILE A CB    1 
ATOM   333  C CG1   . ILE A 1 49  ? -4.257  37.472 -0.965  1.00 27.41 ? 49   ILE A CG1   1 
ATOM   334  C CG2   . ILE A 1 49  ? -6.354  37.977 -2.299  1.00 29.68 ? 49   ILE A CG2   1 
ATOM   335  C CD1   . ILE A 1 49  ? -4.337  38.582 0.035   1.00 27.58 ? 49   ILE A CD1   1 
ATOM   336  N N     . THR A 1 50  ? -4.575  37.683 -5.494  1.00 24.56 ? 50   THR A N     1 
ATOM   337  C CA    . THR A 1 50  ? -5.356  38.198 -6.635  1.00 24.06 ? 50   THR A CA    1 
ATOM   338  C C     . THR A 1 50  ? -4.972  37.562 -7.961  1.00 25.52 ? 50   THR A C     1 
ATOM   339  O O     . THR A 1 50  ? -5.672  37.710 -8.968  1.00 25.65 ? 50   THR A O     1 
ATOM   340  C CB    . THR A 1 50  ? -5.149  39.696 -6.743  1.00 22.87 ? 50   THR A CB    1 
ATOM   341  O OG1   . THR A 1 50  ? -3.733  39.887 -7.080  1.00 24.05 ? 50   THR A OG1   1 
ATOM   342  C CG2   . THR A 1 50  ? -5.487  40.435 -5.453  1.00 25.63 ? 50   THR A CG2   1 
ATOM   343  N N     . GLY A 1 51  ? -3.841  36.853 -8.027  1.00 25.03 ? 51   GLY A N     1 
ATOM   344  C CA    . GLY A 1 51  ? -3.484  36.331 -9.335  1.00 27.01 ? 51   GLY A CA    1 
ATOM   345  C C     . GLY A 1 51  ? -2.833  37.363 -10.234 1.00 26.33 ? 51   GLY A C     1 
ATOM   346  O O     . GLY A 1 51  ? -2.780  37.138 -11.456 1.00 33.71 ? 51   GLY A O     1 
ATOM   347  N N     . ARG A 1 52  ? -2.413  38.512 -9.715  1.00 26.89 ? 52   ARG A N     1 
ATOM   348  C CA    . ARG A 1 52  ? -1.706  39.489 -10.485 1.00 26.04 ? 52   ARG A CA    1 
ATOM   349  C C     . ARG A 1 52  ? -0.200  39.285 -10.310 1.00 26.89 ? 52   ARG A C     1 
ATOM   350  O O     . ARG A 1 52  ? 0.271   39.057 -9.197  1.00 28.75 ? 52   ARG A O     1 
ATOM   351  C CB    . ARG A 1 52  ? -2.061  40.929 -10.036 1.00 29.66 ? 52   ARG A CB    1 
ATOM   352  C CG    . ARG A 1 52  ? -3.322  41.470 -10.662 1.00 26.93 ? 52   ARG A CG    1 
ATOM   353  C CD    . ARG A 1 52  ? -4.568  40.586 -10.453 1.00 28.09 ? 52   ARG A CD    1 
ATOM   354  N NE    . ARG A 1 52  ? -5.720  41.259 -11.064 1.00 27.61 ? 52   ARG A NE    1 
ATOM   355  C CZ    . ARG A 1 52  ? -6.963  40.848 -10.998 1.00 25.89 ? 52   ARG A CZ    1 
ATOM   356  N NH1   . ARG A 1 52  ? -7.239  39.747 -10.296 1.00 26.21 ? 52   ARG A NH1   1 
ATOM   357  N NH2   . ARG A 1 52  ? -7.944  41.514 -11.578 1.00 29.16 ? 52   ARG A NH2   1 
ATOM   358  N N     . ASP A 1 53  ? 0.548   39.434 -11.388 1.00 29.45 ? 53   ASP A N     1 
ATOM   359  C CA    . ASP A 1 53  ? 1.974   39.519 -11.245 1.00 28.38 ? 53   ASP A CA    1 
ATOM   360  C C     . ASP A 1 53  ? 2.419   40.868 -10.668 1.00 28.04 ? 53   ASP A C     1 
ATOM   361  O O     . ASP A 1 53  ? 2.196   41.876 -11.322 1.00 29.92 ? 53   ASP A O     1 
ATOM   362  C CB    . ASP A 1 53  ? 2.621   39.333 -12.608 1.00 30.98 ? 53   ASP A CB    1 
ATOM   363  C CG    . ASP A 1 53  ? 4.123   39.485 -12.624 1.00 31.20 ? 53   ASP A CG    1 
ATOM   364  O OD1   . ASP A 1 53  ? 4.663   39.331 -13.754 1.00 44.17 ? 53   ASP A OD1   1 
ATOM   365  O OD2   . ASP A 1 53  ? 4.792   39.693 -11.599 1.00 39.00 ? 53   ASP A OD2   1 
ATOM   366  N N     . PRO A 1 54  ? 2.964   40.868 -9.452  1.00 27.78 ? 54   PRO A N     1 
ATOM   367  C CA    . PRO A 1 54  ? 3.297   42.145 -8.827  1.00 27.89 ? 54   PRO A CA    1 
ATOM   368  C C     . PRO A 1 54  ? 4.170   42.998 -9.716  1.00 29.81 ? 54   PRO A C     1 
ATOM   369  O O     . PRO A 1 54  ? 4.067   44.216 -9.641  1.00 36.35 ? 54   PRO A O     1 
ATOM   370  C CB    . PRO A 1 54  ? 4.038   41.714 -7.553  1.00 26.42 ? 54   PRO A CB    1 
ATOM   371  C CG    . PRO A 1 54  ? 3.411   40.400 -7.223  1.00 26.75 ? 54   PRO A CG    1 
ATOM   372  C CD    . PRO A 1 54  ? 3.172   39.727 -8.552  1.00 27.10 ? 54   PRO A CD    1 
ATOM   373  N N     . LYS A 1 55  ? 5.029   42.357 -10.532 1.00 32.45 ? 55   LYS A N     1 
ATOM   374  C CA    . LYS A 1 55  ? 5.930   43.177 -11.330 1.00 36.81 ? 55   LYS A CA    1 
ATOM   375  C C     . LYS A 1 55  ? 5.185   43.848 -12.502 1.00 34.41 ? 55   LYS A C     1 
ATOM   376  O O     . LYS A 1 55  ? 5.664   44.909 -13.000 1.00 45.33 ? 55   LYS A O     1 
ATOM   377  C CB    . LYS A 1 55  ? 7.133   42.340 -11.794 1.00 40.41 ? 55   LYS A CB    1 
ATOM   378  C CG    . LYS A 1 55  ? 7.703   41.305 -10.838 1.00 47.53 ? 55   LYS A CG    1 
ATOM   379  C CD    . LYS A 1 55  ? 9.068   41.690 -10.294 1.00 56.87 ? 55   LYS A CD    1 
ATOM   380  C CE    . LYS A 1 55  ? 9.798   40.588 -9.537  1.00 59.70 ? 55   LYS A CE    1 
ATOM   381  N NZ    . LYS A 1 55  ? 11.067  41.050 -8.899  1.00 60.08 ? 55   LYS A NZ    1 
ATOM   382  N N     . GLN A 1 56  ? 4.037   43.328 -12.906 1.00 31.78 ? 56   GLN A N     1 
ATOM   383  C CA    . GLN A 1 56  ? 3.311   43.808 -14.105 1.00 34.19 ? 56   GLN A CA    1 
ATOM   384  C C     . GLN A 1 56  ? 2.287   44.899 -13.781 1.00 30.41 ? 56   GLN A C     1 
ATOM   385  O O     . GLN A 1 56  ? 1.914   45.656 -14.638 1.00 34.72 ? 56   GLN A O     1 
ATOM   386  C CB    . GLN A 1 56  ? 2.570   42.641 -14.779 1.00 40.39 ? 56   GLN A CB    1 
ATOM   387  C CG    . GLN A 1 56  ? 1.671   42.957 -15.946 1.00 50.28 ? 56   GLN A CG    1 
ATOM   388  C CD    . GLN A 1 56  ? 0.766   41.842 -16.424 1.00 49.84 ? 56   GLN A CD    1 
ATOM   389  O OE1   . GLN A 1 56  ? 1.143   40.698 -16.733 1.00 61.79 ? 56   GLN A OE1   1 
ATOM   390  N NE2   . GLN A 1 56  ? -0.521  42.204 -16.543 1.00 60.06 ? 56   GLN A NE2   1 
ATOM   391  N N     . VAL A 1 57  ? 1.801   44.969 -12.550 1.00 31.21 ? 57   VAL A N     1 
ATOM   392  C CA    . VAL A 1 57  ? 0.711   45.919 -12.252 1.00 30.54 ? 57   VAL A CA    1 
ATOM   393  C C     . VAL A 1 57  ? 1.212   47.309 -11.911 1.00 26.89 ? 57   VAL A C     1 
ATOM   394  O O     . VAL A 1 57  ? 0.467   48.297 -11.884 1.00 28.69 ? 57   VAL A O     1 
ATOM   395  C CB    . VAL A 1 57  ? -0.206  45.419 -11.117 1.00 29.85 ? 57   VAL A CB    1 
ATOM   396  C CG1   . VAL A 1 57  ? -0.974  44.206 -11.629 1.00 34.85 ? 57   VAL A CG1   1 
ATOM   397  C CG2   . VAL A 1 57  ? 0.576   45.158 -9.848  1.00 27.78 ? 57   VAL A CG2   1 
ATOM   398  N N     . ILE A 1 58  ? 2.533   47.393 -11.585 1.00 27.06 ? 58   ILE A N     1 
ATOM   399  C CA    . ILE A 1 58  ? 3.089   48.673 -11.242 1.00 27.13 ? 58   ILE A CA    1 
ATOM   400  C C     . ILE A 1 58  ? 2.837   49.701 -12.342 1.00 25.95 ? 58   ILE A C     1 
ATOM   401  O O     . ILE A 1 58  ? 3.075   49.402 -13.525 1.00 29.00 ? 58   ILE A O     1 
ATOM   402  C CB    . ILE A 1 58  ? 4.622   48.575 -10.997 1.00 28.36 ? 58   ILE A CB    1 
ATOM   403  C CG1   . ILE A 1 58  ? 4.956   47.530 -9.937  1.00 29.00 ? 58   ILE A CG1   1 
ATOM   404  C CG2   . ILE A 1 58  ? 5.203   49.930 -10.673 1.00 29.01 ? 58   ILE A CG2   1 
ATOM   405  C CD1   . ILE A 1 58  ? 4.322   47.785 -8.587  1.00 28.94 ? 58   ILE A CD1   1 
ATOM   406  N N     . GLY A 1 59  ? 2.329   50.877 -11.975 1.00 24.63 ? 59   GLY A N     1 
ATOM   407  C CA    . GLY A 1 59  ? 2.025   51.944 -12.898 1.00 26.96 ? 59   GLY A CA    1 
ATOM   408  C C     . GLY A 1 59  ? 0.620   51.953 -13.422 1.00 25.62 ? 59   GLY A C     1 
ATOM   409  O O     . GLY A 1 59  ? 0.194   52.989 -13.912 1.00 26.56 ? 59   GLY A O     1 
ATOM   410  N N     . LYS A 1 60  ? -0.093  50.838 -13.268 1.00 25.15 ? 60   LYS A N     1 
ATOM   411  C CA    . LYS A 1 60  ? -1.476  50.816 -13.692 1.00 25.64 ? 60   LYS A CA    1 
ATOM   412  C C     . LYS A 1 60  ? -2.356  51.554 -12.673 1.00 22.64 ? 60   LYS A C     1 
ATOM   413  O O     . LYS A 1 60  ? -1.988  51.775 -11.526 1.00 24.05 ? 60   LYS A O     1 
ATOM   414  C CB    . LYS A 1 60  ? -1.956  49.360 -13.833 1.00 25.78 ? 60   LYS A CB    1 
ATOM   415  C CG    . LYS A 1 60  ? -1.228  48.563 -14.934 1.00 31.81 ? 60   LYS A CG    1 
ATOM   416  C CD    . LYS A 1 60  ? -1.875  47.228 -15.210 1.00 32.27 ? 60   LYS A CD    1 
ATOM   417  C CE    . LYS A 1 60  ? -1.164  46.502 -16.368 1.00 45.11 ? 60   LYS A CE    1 
ATOM   418  N NZ    . LYS A 1 60  ? -1.716  45.116 -16.564 1.00 47.20 ? 60   LYS A NZ    1 
ATOM   419  N N     . ASN A 1 61  ? -3.576  51.909 -13.091 1.00 24.63 ? 61   ASN A N     1 
ATOM   420  C CA    . ASN A 1 61  ? -4.464  52.552 -12.103 1.00 26.56 ? 61   ASN A CA    1 
ATOM   421  C C     . ASN A 1 61  ? -5.306  51.478 -11.414 1.00 23.24 ? 61   ASN A C     1 
ATOM   422  O O     . ASN A 1 61  ? -5.996  50.687 -12.076 1.00 24.76 ? 61   ASN A O     1 
ATOM   423  C CB    . ASN A 1 61  ? -5.291  53.656 -12.716 1.00 29.16 ? 61   ASN A CB    1 
ATOM   424  C CG    . ASN A 1 61  ? -6.090  54.391 -11.639 1.00 28.80 ? 61   ASN A CG    1 
ATOM   425  O OD1   . ASN A 1 61  ? -7.133  53.899 -11.254 1.00 27.48 ? 61   ASN A OD1   1 
ATOM   426  N ND2   . ASN A 1 61  ? -5.554  55.539 -11.218 1.00 30.02 ? 61   ASN A ND2   1 
ATOM   427  N N     . PHE A 1 62  ? -5.238  51.461 -10.105 1.00 23.76 ? 62   PHE A N     1 
ATOM   428  C CA    . PHE A 1 62  ? -5.939  50.393 -9.388  1.00 22.53 ? 62   PHE A CA    1 
ATOM   429  C C     . PHE A 1 62  ? -7.414  50.412 -9.604  1.00 22.58 ? 62   PHE A C     1 
ATOM   430  O O     . PHE A 1 62  ? -8.038  49.374 -9.779  1.00 23.01 ? 62   PHE A O     1 
ATOM   431  C CB    . PHE A 1 62  ? -5.515  50.546 -7.921  1.00 22.83 ? 62   PHE A CB    1 
ATOM   432  C CG    . PHE A 1 62  ? -6.103  49.514 -6.971  1.00 21.54 ? 62   PHE A CG    1 
ATOM   433  C CD1   . PHE A 1 62  ? -5.547  48.238 -6.895  1.00 22.31 ? 62   PHE A CD1   1 
ATOM   434  C CD2   . PHE A 1 62  ? -7.181  49.795 -6.138  1.00 23.31 ? 62   PHE A CD2   1 
ATOM   435  C CE1   . PHE A 1 62  ? -6.053  47.254 -6.039  1.00 22.85 ? 62   PHE A CE1   1 
ATOM   436  C CE2   . PHE A 1 62  ? -7.693  48.831 -5.324  1.00 22.94 ? 62   PHE A CE2   1 
ATOM   437  C CZ    . PHE A 1 62  ? -7.133  47.554 -5.227  1.00 22.05 ? 62   PHE A CZ    1 
ATOM   438  N N     . PHE A 1 63  ? -8.052  51.606 -9.594  1.00 21.86 ? 63   PHE A N     1 
ATOM   439  C CA    . PHE A 1 63  ? -9.509  51.696 -9.605  1.00 22.36 ? 63   PHE A CA    1 
ATOM   440  C C     . PHE A 1 63  ? -10.081 51.575 -11.010 1.00 22.81 ? 63   PHE A C     1 
ATOM   441  O O     . PHE A 1 63  ? -11.212 51.123 -11.149 1.00 23.74 ? 63   PHE A O     1 
ATOM   442  C CB    . PHE A 1 63  ? -9.937  53.012 -8.934  1.00 22.29 ? 63   PHE A CB    1 
ATOM   443  C CG    . PHE A 1 63  ? -9.490  53.068 -7.476  1.00 21.58 ? 63   PHE A CG    1 
ATOM   444  C CD1   . PHE A 1 63  ? -10.108 52.255 -6.549  1.00 23.06 ? 63   PHE A CD1   1 
ATOM   445  C CD2   . PHE A 1 63  ? -8.462  53.935 -7.075  1.00 23.14 ? 63   PHE A CD2   1 
ATOM   446  C CE1   . PHE A 1 63  ? -9.670  52.255 -5.230  1.00 23.84 ? 63   PHE A CE1   1 
ATOM   447  C CE2   . PHE A 1 63  ? -8.049  53.944 -5.732  1.00 24.67 ? 63   PHE A CE2   1 
ATOM   448  C CZ    . PHE A 1 63  ? -8.699  53.145 -4.820  1.00 23.38 ? 63   PHE A CZ    1 
ATOM   449  N N     . LYS A 1 64  ? -9.310  52.014 -12.004 1.00 22.48 ? 64   LYS A N     1 
ATOM   450  C CA    . LYS A 1 64  ? -9.818  51.991 -13.368 1.00 24.49 ? 64   LYS A CA    1 
ATOM   451  C C     . LYS A 1 64  ? -9.534  50.667 -14.067 1.00 26.13 ? 64   LYS A C     1 
ATOM   452  O O     . LYS A 1 64  ? -10.405 50.170 -14.760 1.00 28.77 ? 64   LYS A O     1 
ATOM   453  C CB    . LYS A 1 64  ? -9.194  53.168 -14.156 1.00 28.35 ? 64   LYS A CB    1 
ATOM   454  C CG    . LYS A 1 64  ? -9.584  53.182 -15.628 1.00 28.18 ? 64   LYS A CG    1 
ATOM   455  C CD    . LYS A 1 64  ? -8.962  54.333 -16.421 1.00 33.71 ? 64   LYS A CD    1 
ATOM   456  C CE    . LYS A 1 64  ? -9.272  54.231 -17.928 1.00 37.93 ? 64   LYS A CE    1 
ATOM   457  N NZ    . LYS A 1 64  ? -9.018  55.550 -18.578 1.00 57.43 ? 64   LYS A NZ    1 
ATOM   458  N N     . ASP A 1 65  ? -8.329  50.157 -13.897 1.00 24.98 ? 65   ASP A N     1 
ATOM   459  C CA    . ASP A 1 65  ? -7.840  49.047 -14.684 1.00 26.55 ? 65   ASP A CA    1 
ATOM   460  C C     . ASP A 1 65  ? -7.707  47.729 -13.928 1.00 24.83 ? 65   ASP A C     1 
ATOM   461  O O     . ASP A 1 65  ? -8.073  46.673 -14.506 1.00 28.41 ? 65   ASP A O     1 
ATOM   462  C CB    . ASP A 1 65  ? -6.420  49.391 -15.171 1.00 31.23 ? 65   ASP A CB    1 
ATOM   463  C CG    . ASP A 1 65  ? -6.147  50.709 -15.826 1.00 34.91 ? 65   ASP A CG    1 
ATOM   464  O OD1   . ASP A 1 65  ? -5.235  51.424 -15.342 1.00 54.54 ? 65   ASP A OD1   1 
ATOM   465  O OD2   . ASP A 1 65  ? -6.846  50.988 -16.808 1.00 46.22 ? 65   ASP A OD2   1 
ATOM   466  N N     . VAL A 1 66  ? -7.170  47.742 -12.749 1.00 23.55 ? 66   VAL A N     1 
ATOM   467  C CA    . VAL A 1 66  ? -6.817  46.454 -12.067 1.00 21.51 ? 66   VAL A CA    1 
ATOM   468  C C     . VAL A 1 66  ? -7.948  45.841 -11.277 1.00 21.86 ? 66   VAL A C     1 
ATOM   469  O O     . VAL A 1 66  ? -8.195  44.649 -11.273 1.00 23.57 ? 66   VAL A O     1 
ATOM   470  C CB    . VAL A 1 66  ? -5.610  46.699 -11.145 1.00 22.37 ? 66   VAL A CB    1 
ATOM   471  C CG1   . VAL A 1 66  ? -5.223  45.410 -10.408 1.00 26.52 ? 66   VAL A CG1   1 
ATOM   472  C CG2   . VAL A 1 66  ? -4.390  47.157 -11.982 1.00 26.96 ? 66   VAL A CG2   1 
ATOM   473  N N     . ALA A 1 67  ? -8.628  46.707 -10.529 1.00 22.32 ? 67   ALA A N     1 
ATOM   474  C CA    . ALA A 1 67  ? -9.598  46.289 -9.501  1.00 21.80 ? 67   ALA A CA    1 
ATOM   475  C C     . ALA A 1 67  ? -10.912 47.016 -9.676  1.00 19.85 ? 67   ALA A C     1 
ATOM   476  O O     . ALA A 1 67  ? -11.350 47.762 -8.797  1.00 20.74 ? 67   ALA A O     1 
ATOM   477  C CB    . ALA A 1 67  ? -8.951  46.536 -8.149  1.00 22.41 ? 67   ALA A CB    1 
ATOM   478  N N     . PRO A 1 68  ? -11.605 46.798 -10.807 1.00 21.04 ? 68   PRO A N     1 
ATOM   479  C CA    . PRO A 1 68  ? -12.804 47.633 -11.025 1.00 22.38 ? 68   PRO A CA    1 
ATOM   480  C C     . PRO A 1 68  ? -13.925 47.416 -10.038 1.00 22.41 ? 68   PRO A C     1 
ATOM   481  O O     . PRO A 1 68  ? -14.780 48.303 -9.772  1.00 23.39 ? 68   PRO A O     1 
ATOM   482  C CB    . PRO A 1 68  ? -13.268 47.147 -12.418 1.00 23.47 ? 68   PRO A CB    1 
ATOM   483  C CG    . PRO A 1 68  ? -12.629 45.802 -12.646 1.00 24.05 ? 68   PRO A CG    1 
ATOM   484  C CD    . PRO A 1 68  ? -11.294 45.904 -11.911 1.00 23.03 ? 68   PRO A CD    1 
ATOM   485  N N     . CYS A 1 69  ? -13.954 46.283 -9.330  1.00 23.69 ? 69   CYS A N     1 
ATOM   486  C CA    . CYS A 1 69  ? -14.982 46.057 -8.326  1.00 22.60 ? 69   CYS A CA    1 
ATOM   487  C C     . CYS A 1 69  ? -14.828 47.001 -7.118  1.00 22.31 ? 69   CYS A C     1 
ATOM   488  O O     . CYS A 1 69  ? -15.771 47.210 -6.357  1.00 23.93 ? 69   CYS A O     1 
ATOM   489  C CB    . CYS A 1 69  ? -15.046 44.613 -7.822  1.00 24.43 ? 69   CYS A CB    1 
ATOM   490  S SG    . CYS A 1 69  ? -13.674 44.111 -6.702  1.00 23.62 ? 69   CYS A SG    1 
ATOM   491  N N     . THR A 1 70  ? -13.616 47.558 -6.967  1.00 20.92 ? 70   THR A N     1 
ATOM   492  C CA    . THR A 1 70  ? -13.367 48.533 -5.892  1.00 20.61 ? 70   THR A CA    1 
ATOM   493  C C     . THR A 1 70  ? -13.772 49.940 -6.302  1.00 19.39 ? 70   THR A C     1 
ATOM   494  O O     . THR A 1 70  ? -13.704 50.848 -5.454  1.00 21.75 ? 70   THR A O     1 
ATOM   495  C CB    . THR A 1 70  ? -11.891 48.525 -5.436  1.00 21.68 ? 70   THR A CB    1 
ATOM   496  O OG1   . THR A 1 70  ? -11.073 49.148 -6.427  1.00 20.95 ? 70   THR A OG1   1 
ATOM   497  C CG2   . THR A 1 70  ? -11.440 47.091 -5.180  1.00 22.78 ? 70   THR A CG2   1 
ATOM   498  N N     . ASP A 1 71  ? -14.148 50.203 -7.547  1.00 20.79 ? 71   ASP A N     1 
ATOM   499  C CA    . ASP A 1 71  ? -14.605 51.511 -8.032  1.00 21.52 ? 71   ASP A CA    1 
ATOM   500  C C     . ASP A 1 71  ? -16.063 51.666 -7.574  1.00 20.92 ? 71   ASP A C     1 
ATOM   501  O O     . ASP A 1 71  ? -16.958 51.360 -8.315  1.00 23.13 ? 71   ASP A O     1 
ATOM   502  C CB    . ASP A 1 71  ? -14.454 51.582 -9.536  1.00 21.82 ? 71   ASP A CB    1 
ATOM   503  C CG    . ASP A 1 71  ? -14.867 52.903 -10.133 1.00 24.13 ? 71   ASP A CG    1 
ATOM   504  O OD1   . ASP A 1 71  ? -15.301 53.797 -9.336  1.00 23.54 ? 71   ASP A OD1   1 
ATOM   505  O OD2   . ASP A 1 71  ? -14.799 53.090 -11.389 1.00 24.45 ? 71   ASP A OD2   1 
ATOM   506  N N     . SER A 1 72  ? -16.208 52.111 -6.342  1.00 22.27 ? 72   SER A N     1 
ATOM   507  C CA    . SER A 1 72  ? -17.454 52.192 -5.613  1.00 22.31 ? 72   SER A CA    1 
ATOM   508  C C     . SER A 1 72  ? -17.326 53.194 -4.493  1.00 22.59 ? 72   SER A C     1 
ATOM   509  O O     . SER A 1 72  ? -16.207 53.431 -4.028  1.00 22.94 ? 72   SER A O     1 
ATOM   510  C CB    . SER A 1 72  ? -17.863 50.844 -5.018  1.00 25.81 ? 72   SER A CB    1 
ATOM   511  O OG    . SER A 1 72  ? -16.917 50.554 -3.975  1.00 26.76 ? 72   SER A OG    1 
ATOM   512  N N     . PRO A 1 73  ? -18.415 53.726 -3.981  1.00 24.18 ? 73   PRO A N     1 
ATOM   513  C CA    . PRO A 1 73  ? -18.354 54.588 -2.792  1.00 23.18 ? 73   PRO A CA    1 
ATOM   514  C C     . PRO A 1 73  ? -17.684 53.876 -1.606  1.00 23.33 ? 73   PRO A C     1 
ATOM   515  O O     . PRO A 1 73  ? -16.995 54.551 -0.843  1.00 26.78 ? 73   PRO A O     1 
ATOM   516  C CB    . PRO A 1 73  ? -19.824 54.892 -2.491  1.00 25.73 ? 73   PRO A CB    1 
ATOM   517  C CG    . PRO A 1 73  ? -20.453 54.873 -3.855  1.00 25.10 ? 73   PRO A CG    1 
ATOM   518  C CD    . PRO A 1 73  ? -19.815 53.654 -4.485  1.00 25.83 ? 73   PRO A CD    1 
ATOM   519  N N     . GLU A 1 74  ? -17.887 52.561 -1.489  1.00 24.38 ? 74   GLU A N     1 
ATOM   520  C CA    . GLU A 1 74  ? -17.464 51.764 -0.345  1.00 25.54 ? 74   GLU A CA    1 
ATOM   521  C C     . GLU A 1 74  ? -15.977 51.552 -0.284  1.00 25.63 ? 74   GLU A C     1 
ATOM   522  O O     . GLU A 1 74  ? -15.463 51.230 0.769   1.00 31.89 ? 74   GLU A O     1 
ATOM   523  C CB    . GLU A 1 74  ? -18.242 50.406 -0.390  1.00 28.13 ? 74   GLU A CB    1 
ATOM   524  C CG    . GLU A 1 74  ? -19.756 50.533 -0.202  1.00 30.86 ? 74   GLU A CG    1 
ATOM   525  C CD    . GLU A 1 74  ? -20.514 51.098 -1.365  1.00 30.69 ? 74   GLU A CD    1 
ATOM   526  O OE1   . GLU A 1 74  ? -21.587 51.715 -1.133  1.00 42.63 ? 74   GLU A OE1   1 
ATOM   527  O OE2   . GLU A 1 74  ? -20.001 50.923 -2.472  1.00 32.90 ? 74   GLU A OE2   1 
ATOM   528  N N     . PHE A 1 75  ? -15.291 51.750 -1.420  1.00 24.36 ? 75   PHE A N     1 
ATOM   529  C CA    . PHE A 1 75  ? -13.835 51.559 -1.450  1.00 21.84 ? 75   PHE A CA    1 
ATOM   530  C C     . PHE A 1 75  ? -13.166 52.786 -2.023  1.00 22.09 ? 75   PHE A C     1 
ATOM   531  O O     . PHE A 1 75  ? -12.579 53.599 -1.317  1.00 23.02 ? 75   PHE A O     1 
ATOM   532  C CB    . PHE A 1 75  ? -13.538 50.215 -2.173  1.00 21.66 ? 75   PHE A CB    1 
ATOM   533  C CG    . PHE A 1 75  ? -12.148 49.636 -2.034  1.00 21.32 ? 75   PHE A CG    1 
ATOM   534  C CD1   . PHE A 1 75  ? -10.976 50.393 -2.155  1.00 22.71 ? 75   PHE A CD1   1 
ATOM   535  C CD2   . PHE A 1 75  ? -12.010 48.272 -1.761  1.00 22.99 ? 75   PHE A CD2   1 
ATOM   536  C CE1   . PHE A 1 75  ? -9.718  49.858 -1.978  1.00 23.68 ? 75   PHE A CE1   1 
ATOM   537  C CE2   . PHE A 1 75  ? -10.753 47.735 -1.657  1.00 23.59 ? 75   PHE A CE2   1 
ATOM   538  C CZ    . PHE A 1 75  ? -9.616  48.493 -1.783  1.00 24.04 ? 75   PHE A CZ    1 
ATOM   539  N N     . TYR A 1 76  ? -13.236 52.919 -3.360  1.00 22.19 ? 76   TYR A N     1 
ATOM   540  C CA    . TYR A 1 76  ? -12.626 54.097 -3.992  1.00 22.02 ? 76   TYR A CA    1 
ATOM   541  C C     . TYR A 1 76  ? -13.188 55.369 -3.378  1.00 21.13 ? 76   TYR A C     1 
ATOM   542  O O     . TYR A 1 76  ? -12.391 56.337 -3.206  1.00 23.00 ? 76   TYR A O     1 
ATOM   543  C CB    . TYR A 1 76  ? -12.949 54.036 -5.475  1.00 22.57 ? 76   TYR A CB    1 
ATOM   544  C CG    . TYR A 1 76  ? -12.430 55.059 -6.413  1.00 21.56 ? 76   TYR A CG    1 
ATOM   545  C CD1   . TYR A 1 76  ? -11.192 55.665 -6.233  1.00 25.49 ? 76   TYR A CD1   1 
ATOM   546  C CD2   . TYR A 1 76  ? -13.180 55.383 -7.537  1.00 22.58 ? 76   TYR A CD2   1 
ATOM   547  C CE1   . TYR A 1 76  ? -10.783 56.598 -7.184  1.00 24.81 ? 76   TYR A CE1   1 
ATOM   548  C CE2   . TYR A 1 76  ? -12.764 56.298 -8.474  1.00 26.71 ? 76   TYR A CE2   1 
ATOM   549  C CZ    . TYR A 1 76  ? -11.566 56.920 -8.287  1.00 28.32 ? 76   TYR A CZ    1 
ATOM   550  O OH    . TYR A 1 76  ? -11.108 57.833 -9.212  1.00 31.11 ? 76   TYR A OH    1 
ATOM   551  N N     . GLY A 1 77  ? -14.471 55.468 -3.036  1.00 22.16 ? 77   GLY A N     1 
ATOM   552  C CA    . GLY A 1 77  ? -14.964 56.743 -2.484  1.00 23.56 ? 77   GLY A CA    1 
ATOM   553  C C     . GLY A 1 77  ? -14.262 57.020 -1.163  1.00 24.06 ? 77   GLY A C     1 
ATOM   554  O O     . GLY A 1 77  ? -13.951 58.147 -0.904  1.00 27.24 ? 77   GLY A O     1 
ATOM   555  N N     . LYS A 1 78  ? -14.044 55.964 -0.379  1.00 23.26 ? 78   LYS A N     1 
ATOM   556  C CA    . LYS A 1 78  ? -13.403 56.157 0.912   1.00 23.02 ? 78   LYS A CA    1 
ATOM   557  C C     . LYS A 1 78  ? -11.941 56.544 0.710   1.00 21.62 ? 78   LYS A C     1 
ATOM   558  O O     . LYS A 1 78  ? -11.351 57.346 1.457   1.00 25.29 ? 78   LYS A O     1 
ATOM   559  C CB    . LYS A 1 78  ? -13.501 54.895 1.758   1.00 26.35 ? 78   LYS A CB    1 
ATOM   560  C CG    . LYS A 1 78  ? -14.810 54.575 2.432   1.00 28.24 ? 78   LYS A CG    1 
ATOM   561  C CD    . LYS A 1 78  ? -14.667 53.314 3.383   1.00 31.86 ? 78   LYS A CD    1 
ATOM   562  C CE    . LYS A 1 78  ? -15.970 53.261 4.199   1.00 33.74 ? 78   LYS A CE    1 
ATOM   563  N NZ    . LYS A 1 78  ? -15.932 51.967 4.969   1.00 34.38 ? 78   LYS A NZ    1 
ATOM   564  N N     . PHE A 1 79  ? -11.271 55.966 -0.311  1.00 22.66 ? 79   PHE A N     1 
ATOM   565  C CA    . PHE A 1 79  ? -9.913  56.360 -0.617  1.00 22.67 ? 79   PHE A CA    1 
ATOM   566  C C     . PHE A 1 79  ? -9.789  57.819 -0.942  1.00 25.05 ? 79   PHE A C     1 
ATOM   567  O O     . PHE A 1 79  ? -8.958  58.545 -0.420  1.00 24.83 ? 79   PHE A O     1 
ATOM   568  C CB    . PHE A 1 79  ? -9.423  55.441 -1.774  1.00 22.16 ? 79   PHE A CB    1 
ATOM   569  C CG    . PHE A 1 79  ? -8.115  55.844 -2.337  1.00 20.51 ? 79   PHE A CG    1 
ATOM   570  C CD1   . PHE A 1 79  ? -6.948  55.300 -1.671  1.00 24.16 ? 79   PHE A CD1   1 
ATOM   571  C CD2   . PHE A 1 79  ? -7.934  56.694 -3.415  1.00 22.53 ? 79   PHE A CD2   1 
ATOM   572  C CE1   . PHE A 1 79  ? -5.685  55.638 -2.141  1.00 28.86 ? 79   PHE A CE1   1 
ATOM   573  C CE2   . PHE A 1 79  ? -6.643  56.984 -3.896  1.00 25.54 ? 79   PHE A CE2   1 
ATOM   574  C CZ    . PHE A 1 79  ? -5.536  56.471 -3.249  1.00 28.49 ? 79   PHE A CZ    1 
ATOM   575  N N     . LYS A 1 80  ? -10.596 58.292 -1.897  1.00 25.12 ? 80   LYS A N     1 
ATOM   576  C CA    . LYS A 1 80  ? -10.571 59.690 -2.290  1.00 29.84 ? 80   LYS A CA    1 
ATOM   577  C C     . LYS A 1 80  ? -10.919 60.602 -1.124  1.00 27.98 ? 80   LYS A C     1 
ATOM   578  O O     . LYS A 1 80  ? -10.294 61.684 -1.048  1.00 27.88 ? 80   LYS A O     1 
ATOM   579  C CB    . LYS A 1 80  ? -11.548 59.911 -3.457  1.00 35.42 ? 80   LYS A CB    1 
ATOM   580  C CG    . LYS A 1 80  ? -12.509 61.049 -3.164  1.00 45.10 ? 80   LYS A CG    1 
ATOM   581  C CD    . LYS A 1 80  ? -13.875 60.452 -2.768  1.00 52.12 ? 80   LYS A CD    1 
ATOM   582  C CE    . LYS A 1 80  ? -14.874 60.823 -3.858  1.00 54.45 ? 80   LYS A CE    1 
ATOM   583  N NZ    . LYS A 1 80  ? -15.966 61.693 -3.304  1.00 61.89 ? 80   LYS A NZ    1 
ATOM   584  N N     . GLU A 1 81  ? -11.871 60.207 -0.251  1.00 28.31 ? 81   GLU A N     1 
ATOM   585  C CA    . GLU A 1 81  ? -12.201 61.076 0.915   1.00 29.93 ? 81   GLU A CA    1 
ATOM   586  C C     . GLU A 1 81  ? -10.955 61.246 1.777   1.00 29.27 ? 81   GLU A C     1 
ATOM   587  O O     . GLU A 1 81  ? -10.614 62.282 2.323   1.00 31.40 ? 81   GLU A O     1 
ATOM   588  C CB    . GLU A 1 81  ? -13.249 60.459 1.813   1.00 36.95 ? 81   GLU A CB    1 
ATOM   589  C CG    . GLU A 1 81  ? -14.642 60.402 1.215   1.00 42.79 ? 81   GLU A CG    1 
ATOM   590  C CD    . GLU A 1 81  ? -15.567 59.405 1.903   1.00 44.66 ? 81   GLU A CD    1 
ATOM   591  O OE1   . GLU A 1 81  ? -15.120 58.654 2.827   1.00 41.19 ? 81   GLU A OE1   1 
ATOM   592  O OE2   . GLU A 1 81  ? -16.746 59.376 1.480   1.00 52.92 ? 81   GLU A OE2   1 
ATOM   593  N N     . GLY A 1 82  ? -10.226 60.115 1.967   1.00 26.57 ? 82   GLY A N     1 
ATOM   594  C CA    . GLY A 1 82  ? -8.988  60.191 2.753   1.00 26.27 ? 82   GLY A CA    1 
ATOM   595  C C     . GLY A 1 82  ? -7.854  60.929 2.075   1.00 25.97 ? 82   GLY A C     1 
ATOM   596  O O     . GLY A 1 82  ? -7.084  61.624 2.801   1.00 27.19 ? 82   GLY A O     1 
ATOM   597  N N     . VAL A 1 83  ? -7.727  60.816 0.721   1.00 26.02 ? 83   VAL A N     1 
ATOM   598  C CA    . VAL A 1 83  ? -6.592  61.635 0.229   1.00 27.60 ? 83   VAL A CA    1 
ATOM   599  C C     . VAL A 1 83  ? -7.003  63.096 0.331   1.00 30.10 ? 83   VAL A C     1 
ATOM   600  O O     . VAL A 1 83  ? -6.111  63.903 0.574   1.00 33.59 ? 83   VAL A O     1 
ATOM   601  C CB    . VAL A 1 83  ? -5.889  61.244 -1.045  1.00 39.87 ? 83   VAL A CB    1 
ATOM   602  C CG1   . VAL A 1 83  ? -6.159  59.825 -1.526  1.00 32.24 ? 83   VAL A CG1   1 
ATOM   603  C CG2   . VAL A 1 83  ? -5.981  62.293 -2.161  1.00 41.69 ? 83   VAL A CG2   1 
ATOM   604  N N     . ALA A 1 84  ? -8.282  63.397 0.238   1.00 31.13 ? 84   ALA A N     1 
ATOM   605  C CA    . ALA A 1 84  ? -8.614  64.825 0.363   1.00 32.74 ? 84   ALA A CA    1 
ATOM   606  C C     . ALA A 1 84  ? -8.475  65.307 1.806   1.00 34.10 ? 84   ALA A C     1 
ATOM   607  O O     . ALA A 1 84  ? -7.983  66.417 2.005   1.00 37.35 ? 84   ALA A O     1 
ATOM   608  C CB    . ALA A 1 84  ? -10.005 65.112 -0.124  1.00 34.36 ? 84   ALA A CB    1 
ATOM   609  N N     . SER A 1 85  ? -8.905  64.531 2.818   1.00 29.05 ? 85   SER A N     1 
ATOM   610  C CA    . SER A 1 85  ? -8.882  65.030 4.179   1.00 28.54 ? 85   SER A CA    1 
ATOM   611  C C     . SER A 1 85  ? -7.471  65.059 4.769   1.00 27.06 ? 85   SER A C     1 
ATOM   612  O O     . SER A 1 85  ? -7.190  65.784 5.737   1.00 32.18 ? 85   SER A O     1 
ATOM   613  C CB    . SER A 1 85  ? -9.713  64.107 5.026   1.00 31.20 ? 85   SER A CB    1 
ATOM   614  O OG    . SER A 1 85  ? -9.162  62.828 5.198   1.00 37.77 ? 85   SER A OG    1 
ATOM   615  N N     . GLY A 1 86  ? -6.646  64.219 4.141   1.00 28.02 ? 86   GLY A N     1 
ATOM   616  C CA    . GLY A 1 86  ? -5.299  64.059 4.688   1.00 30.71 ? 86   GLY A CA    1 
ATOM   617  C C     . GLY A 1 86  ? -5.278  63.077 5.846   1.00 29.95 ? 86   GLY A C     1 
ATOM   618  O O     . GLY A 1 86  ? -4.255  62.964 6.515   1.00 34.51 ? 86   GLY A O     1 
ATOM   619  N N     . ASN A 1 87  ? -6.378  62.380 6.159   1.00 31.56 ? 87   ASN A N     1 
ATOM   620  C CA    . ASN A 1 87  ? -6.282  61.456 7.308   1.00 34.61 ? 87   ASN A CA    1 
ATOM   621  C C     . ASN A 1 87  ? -6.891  60.117 6.943   1.00 36.95 ? 87   ASN A C     1 
ATOM   622  O O     . ASN A 1 87  ? -7.789  59.629 7.677   1.00 35.90 ? 87   ASN A O     1 
ATOM   623  C CB    . ASN A 1 87  ? -6.935  62.117 8.500   1.00 29.49 ? 87   ASN A CB    1 
ATOM   624  C CG    . ASN A 1 87  ? -6.717  61.384 9.820   1.00 32.17 ? 87   ASN A CG    1 
ATOM   625  O OD1   . ASN A 1 87  ? -7.364  61.724 10.814  1.00 32.44 ? 87   ASN A OD1   1 
ATOM   626  N ND2   . ASN A 1 87  ? -5.804  60.433 9.815   1.00 34.56 ? 87   ASN A ND2   1 
ATOM   627  N N     . LEU A 1 88  ? -6.429  59.453 5.883   1.00 27.93 ? 88   LEU A N     1 
ATOM   628  C CA    . LEU A 1 88  ? -6.983  58.144 5.433   1.00 26.66 ? 88   LEU A CA    1 
ATOM   629  C C     . LEU A 1 88  ? -6.678  57.101 6.488   1.00 31.01 ? 88   LEU A C     1 
ATOM   630  O O     . LEU A 1 88  ? -5.507  56.837 6.769   1.00 30.98 ? 88   LEU A O     1 
ATOM   631  C CB    . LEU A 1 88  ? -6.357  57.763 4.099   1.00 26.68 ? 88   LEU A CB    1 
ATOM   632  C CG    . LEU A 1 88  ? -6.821  56.441 3.456   1.00 24.64 ? 88   LEU A CG    1 
ATOM   633  C CD1   . LEU A 1 88  ? -8.291  56.512 3.125   1.00 30.03 ? 88   LEU A CD1   1 
ATOM   634  C CD2   . LEU A 1 88  ? -5.899  56.108 2.265   1.00 32.59 ? 88   LEU A CD2   1 
ATOM   635  N N     . ASN A 1 89  ? -7.680  56.456 7.071   1.00 32.65 ? 89   ASN A N     1 
ATOM   636  C CA    . ASN A 1 89  ? -7.342  55.377 8.033   1.00 36.15 ? 89   ASN A CA    1 
ATOM   637  C C     . ASN A 1 89  ? -8.636  54.622 8.277   1.00 35.07 ? 89   ASN A C     1 
ATOM   638  O O     . ASN A 1 89  ? -9.440  55.033 9.109   1.00 43.38 ? 89   ASN A O     1 
ATOM   639  C CB    . ASN A 1 89  ? -6.743  55.981 9.307   1.00 40.88 ? 89   ASN A CB    1 
ATOM   640  C CG    . ASN A 1 89  ? -6.369  54.889 10.304  1.00 39.68 ? 89   ASN A CG    1 
ATOM   641  O OD1   . ASN A 1 89  ? -6.355  53.689 9.997   1.00 40.83 ? 89   ASN A OD1   1 
ATOM   642  N ND2   . ASN A 1 89  ? -6.060  55.353 11.492  1.00 45.84 ? 89   ASN A ND2   1 
ATOM   643  N N     . THR A 1 90  ? -8.881  53.556 7.535   1.00 30.81 ? 90   THR A N     1 
ATOM   644  C CA    . THR A 1 90  ? -10.199 52.922 7.593   1.00 30.44 ? 90   THR A CA    1 
ATOM   645  C C     . THR A 1 90  ? -10.021 51.449 7.351   1.00 27.34 ? 90   THR A C     1 
ATOM   646  O O     . THR A 1 90  ? -9.154  51.060 6.538   1.00 27.96 ? 90   THR A O     1 
ATOM   647  C CB    . THR A 1 90  ? -11.195 53.568 6.601   1.00 32.81 ? 90   THR A CB    1 
ATOM   648  O OG1   . THR A 1 90  ? -12.492 52.880 6.613   1.00 37.75 ? 90   THR A OG1   1 
ATOM   649  C CG2   . THR A 1 90  ? -10.705 53.475 5.158   1.00 33.06 ? 90   THR A CG2   1 
ATOM   650  N N     . MET A 1 91  ? -10.794 50.612 7.956   1.00 29.96 ? 91   MET A N     1 
ATOM   651  C CA    . MET A 1 91  ? -10.758 49.172 7.794   1.00 30.22 ? 91   MET A CA    1 
ATOM   652  C C     . MET A 1 91  ? -12.170 48.688 7.468   1.00 28.87 ? 91   MET A C     1 
ATOM   653  O O     . MET A 1 91  ? -13.136 49.183 8.060   1.00 34.16 ? 91   MET A O     1 
ATOM   654  C CB    . MET A 1 91  ? -10.216 48.527 9.075   1.00 31.76 ? 91   MET A CB    1 
ATOM   655  C CG    . MET A 1 91  ? -8.745  48.753 9.333   1.00 37.50 ? 91   MET A CG    1 
ATOM   656  S SD    . MET A 1 91  ? -8.062  47.676 10.627  1.00 54.09 ? 91   MET A SD    1 
ATOM   657  C CE    . MET A 1 91  ? -9.281  46.374 10.502  1.00 31.90 ? 91   MET A CE    1 
ATOM   658  N N     . PHE A 1 92  ? -12.329 47.763 6.541   1.00 25.92 ? 92   PHE A N     1 
ATOM   659  C CA    . PHE A 1 92  ? -13.660 47.308 6.163   1.00 27.13 ? 92   PHE A CA    1 
ATOM   660  C C     . PHE A 1 92  ? -13.500 45.971 5.466   1.00 24.15 ? 92   PHE A C     1 
ATOM   661  O O     . PHE A 1 92  ? -12.397 45.643 4.967   1.00 27.43 ? 92   PHE A O     1 
ATOM   662  C CB    . PHE A 1 92  ? -14.397 48.306 5.238   1.00 25.40 ? 92   PHE A CB    1 
ATOM   663  C CG    . PHE A 1 92  ? -13.621 48.762 4.029   1.00 24.72 ? 92   PHE A CG    1 
ATOM   664  C CD1   . PHE A 1 92  ? -12.725 49.829 4.092   1.00 25.91 ? 92   PHE A CD1   1 
ATOM   665  C CD2   . PHE A 1 92  ? -13.745 48.109 2.817   1.00 24.97 ? 92   PHE A CD2   1 
ATOM   666  C CE1   . PHE A 1 92  ? -11.990 50.218 2.978   1.00 25.93 ? 92   PHE A CE1   1 
ATOM   667  C CE2   . PHE A 1 92  ? -13.000 48.499 1.702   1.00 22.97 ? 92   PHE A CE2   1 
ATOM   668  C CZ    . PHE A 1 92  ? -12.062 49.555 1.760   1.00 24.46 ? 92   PHE A CZ    1 
ATOM   669  N N     . GLU A 1 93  ? -14.548 45.182 5.340   1.00 27.78 ? 93   GLU A N     1 
ATOM   670  C CA    . GLU A 1 93  ? -14.570 43.980 4.559   1.00 25.55 ? 93   GLU A CA    1 
ATOM   671  C C     . GLU A 1 93  ? -15.025 44.271 3.127   1.00 23.77 ? 93   GLU A C     1 
ATOM   672  O O     . GLU A 1 93  ? -15.725 45.265 2.820   1.00 25.70 ? 93   GLU A O     1 
ATOM   673  C CB    . GLU A 1 93  ? -15.450 42.910 5.234   1.00 29.78 ? 93   GLU A CB    1 
ATOM   674  C CG    . GLU A 1 93  ? -14.628 42.261 6.373   1.00 38.03 ? 93   GLU A CG    1 
ATOM   675  C CD    . GLU A 1 93  ? -15.402 41.145 7.050   1.00 39.10 ? 93   GLU A CD    1 
ATOM   676  O OE1   . GLU A 1 93  ? -16.229 40.441 6.414   1.00 54.16 ? 93   GLU A OE1   1 
ATOM   677  O OE2   . GLU A 1 93  ? -15.251 40.975 8.273   1.00 56.56 ? 93   GLU A OE2   1 
ATOM   678  N N     . TYR A 1 94  ? -14.592 43.426 2.212   1.00 23.60 ? 94   TYR A N     1 
ATOM   679  C CA    . TYR A 1 94  ? -14.888 43.593 0.768   1.00 22.88 ? 94   TYR A CA    1 
ATOM   680  C C     . TYR A 1 94  ? -14.740 42.279 0.052   1.00 22.82 ? 94   TYR A C     1 
ATOM   681  O O     . TYR A 1 94  ? -14.135 41.384 0.645   1.00 24.83 ? 94   TYR A O     1 
ATOM   682  C CB    . TYR A 1 94  ? -13.935 44.652 0.191   1.00 21.73 ? 94   TYR A CB    1 
ATOM   683  C CG    . TYR A 1 94  ? -14.532 45.454 -0.954  1.00 22.28 ? 94   TYR A CG    1 
ATOM   684  C CD1   . TYR A 1 94  ? -15.369 46.523 -0.627  1.00 24.05 ? 94   TYR A CD1   1 
ATOM   685  C CD2   . TYR A 1 94  ? -14.351 45.193 -2.309  1.00 22.47 ? 94   TYR A CD2   1 
ATOM   686  C CE1   . TYR A 1 94  ? -15.973 47.294 -1.595  1.00 23.89 ? 94   TYR A CE1   1 
ATOM   687  C CE2   . TYR A 1 94  ? -14.918 45.956 -3.311  1.00 21.82 ? 94   TYR A CE2   1 
ATOM   688  C CZ    . TYR A 1 94  ? -15.736 47.007 -2.938  1.00 23.37 ? 94   TYR A CZ    1 
ATOM   689  O OH    . TYR A 1 94  ? -16.322 47.804 -3.880  1.00 24.23 ? 94   TYR A OH    1 
ATOM   690  N N     . THR A 1 95  ? -15.312 42.121 -1.102  1.00 23.50 ? 95   THR A N     1 
ATOM   691  C CA    . THR A 1 95  ? -15.120 40.948 -1.932  1.00 25.03 ? 95   THR A CA    1 
ATOM   692  C C     . THR A 1 95  ? -14.405 41.360 -3.210  1.00 23.94 ? 95   THR A C     1 
ATOM   693  O O     . THR A 1 95  ? -14.819 42.291 -3.901  1.00 24.59 ? 95   THR A O     1 
ATOM   694  C CB    . THR A 1 95  ? -16.503 40.288 -2.230  1.00 26.94 ? 95   THR A CB    1 
ATOM   695  O OG1   . THR A 1 95  ? -17.097 39.884 -1.001  1.00 29.96 ? 95   THR A OG1   1 
ATOM   696  C CG2   . THR A 1 95  ? -16.229 39.081 -3.098  1.00 29.47 ? 95   THR A CG2   1 
ATOM   697  N N     . PHE A 1 96  ? -13.315 40.696 -3.543  1.00 23.76 ? 96   PHE A N     1 
ATOM   698  C CA    . PHE A 1 96  ? -12.622 40.945 -4.792  1.00 22.78 ? 96   PHE A CA    1 
ATOM   699  C C     . PHE A 1 96  ? -13.001 39.862 -5.791  1.00 23.49 ? 96   PHE A C     1 
ATOM   700  O O     . PHE A 1 96  ? -12.861 38.676 -5.440  1.00 25.95 ? 96   PHE A O     1 
ATOM   701  C CB    . PHE A 1 96  ? -11.119 40.872 -4.554  1.00 23.60 ? 96   PHE A CB    1 
ATOM   702  C CG    . PHE A 1 96  ? -10.542 42.011 -3.743  1.00 20.56 ? 96   PHE A CG    1 
ATOM   703  C CD1   . PHE A 1 96  ? -11.251 43.176 -3.510  1.00 20.37 ? 96   PHE A CD1   1 
ATOM   704  C CD2   . PHE A 1 96  ? -9.257  41.910 -3.216  1.00 21.85 ? 96   PHE A CD2   1 
ATOM   705  C CE1   . PHE A 1 96  ? -10.660 44.210 -2.801  1.00 20.92 ? 96   PHE A CE1   1 
ATOM   706  C CE2   . PHE A 1 96  ? -8.687  42.934 -2.527  1.00 22.16 ? 96   PHE A CE2   1 
ATOM   707  C CZ    . PHE A 1 96  ? -9.361  44.104 -2.320  1.00 21.22 ? 96   PHE A CZ    1 
ATOM   708  N N     . ASP A 1 97  ? -13.410 40.224 -7.000  1.00 23.85 ? 97   ASP A N     1 
ATOM   709  C CA    . ASP A 1 97  ? -13.914 39.194 -7.905  1.00 23.68 ? 97   ASP A CA    1 
ATOM   710  C C     . ASP A 1 97  ? -13.642 39.436 -9.364  1.00 27.70 ? 97   ASP A C     1 
ATOM   711  O O     . ASP A 1 97  ? -14.252 38.776 -10.210 1.00 35.53 ? 97   ASP A O     1 
ATOM   712  C CB    . ASP A 1 97  ? -15.426 39.043 -7.643  1.00 27.42 ? 97   ASP A CB    1 
ATOM   713  C CG    . ASP A 1 97  ? -16.227 40.297 -7.886  1.00 25.73 ? 97   ASP A CG    1 
ATOM   714  O OD1   . ASP A 1 97  ? -15.621 41.335 -8.226  1.00 28.93 ? 97   ASP A OD1   1 
ATOM   715  O OD2   . ASP A 1 97  ? -17.431 40.389 -7.724  1.00 40.14 ? 97   ASP A OD2   1 
ATOM   716  N N     . TYR A 1 98  ? -12.795 40.388 -9.734  1.00 24.85 ? 98   TYR A N     1 
ATOM   717  C CA    . TYR A 1 98  ? -12.517 40.619 -11.153 1.00 26.25 ? 98   TYR A CA    1 
ATOM   718  C C     . TYR A 1 98  ? -11.282 39.810 -11.578 1.00 26.11 ? 98   TYR A C     1 
ATOM   719  O O     . TYR A 1 98  ? -10.183 40.013 -11.038 1.00 26.83 ? 98   TYR A O     1 
ATOM   720  C CB    . TYR A 1 98  ? -12.254 42.093 -11.431 1.00 24.59 ? 98   TYR A CB    1 
ATOM   721  C CG    . TYR A 1 98  ? -12.022 42.346 -12.877 1.00 24.18 ? 98   TYR A CG    1 
ATOM   722  C CD1   . TYR A 1 98  ? -13.016 42.134 -13.858 1.00 24.60 ? 98   TYR A CD1   1 
ATOM   723  C CD2   . TYR A 1 98  ? -10.779 42.815 -13.339 1.00 25.77 ? 98   TYR A CD2   1 
ATOM   724  C CE1   . TYR A 1 98  ? -12.752 42.386 -15.177 1.00 27.79 ? 98   TYR A CE1   1 
ATOM   725  C CE2   . TYR A 1 98  ? -10.551 43.075 -14.671 1.00 27.53 ? 98   TYR A CE2   1 
ATOM   726  C CZ    . TYR A 1 98  ? -11.531 42.847 -15.605 1.00 30.73 ? 98   TYR A CZ    1 
ATOM   727  O OH    . TYR A 1 98  ? -11.361 43.097 -16.973 1.00 34.62 ? 98   TYR A OH    1 
ATOM   728  N N     . GLN A 1 99  ? -11.472 38.886 -12.502 1.00 29.60 ? 99   GLN A N     1 
ATOM   729  C CA    . GLN A 1 99  ? -10.471 37.947 -12.975 1.00 31.85 ? 99   GLN A CA    1 
ATOM   730  C C     . GLN A 1 99  ? -9.727  37.286 -11.833 1.00 32.35 ? 99   GLN A C     1 
ATOM   731  O O     . GLN A 1 99  ? -8.499  37.100 -11.812 1.00 33.82 ? 99   GLN A O     1 
ATOM   732  C CB    . GLN A 1 99  ? -9.513  38.707 -13.906 1.00 33.40 ? 99   GLN A CB    1 
ATOM   733  C CG    . GLN A 1 99  ? -10.274 39.286 -15.090 1.00 37.85 ? 99   GLN A CG    1 
ATOM   734  C CD    . GLN A 1 99  ? -9.373  39.992 -16.086 1.00 43.10 ? 99   GLN A CD    1 
ATOM   735  O OE1   . GLN A 1 99  ? -9.786  40.301 -17.208 1.00 53.67 ? 99   GLN A OE1   1 
ATOM   736  N NE2   . GLN A 1 99  ? -8.136  40.275 -15.664 1.00 48.37 ? 99   GLN A NE2   1 
ATOM   737  N N     . MET A 1 100 ? -10.530 36.865 -10.853 1.00 34.16 ? 100  MET A N     1 
ATOM   738  C CA    . MET A 1 100 ? -10.083 36.041 -9.742  1.00 34.94 ? 100  MET A CA    1 
ATOM   739  C C     . MET A 1 100 ? -11.327 35.329 -9.200  1.00 34.31 ? 100  MET A C     1 
ATOM   740  O O     . MET A 1 100 ? -12.482 35.710 -9.367  1.00 37.21 ? 100  MET A O     1 
ATOM   741  C CB    . MET A 1 100 ? -9.358  36.875 -8.690  1.00 32.29 ? 100  MET A CB    1 
ATOM   742  C CG    . MET A 1 100 ? -10.184 38.046 -8.085  1.00 28.53 ? 100  MET A CG    1 
ATOM   743  S SD    . MET A 1 100 ? -9.161  39.021 -6.932  1.00 27.77 ? 100  MET A SD    1 
ATOM   744  C CE    . MET A 1 100 ? -9.164  37.991 -5.482  1.00 29.12 ? 100  MET A CE    1 
ATOM   745  N N     . THR A 1 101 ? -11.084 34.229 -8.489  1.00 36.26 ? 101  THR A N     1 
ATOM   746  C CA    . THR A 1 101 ? -12.134 33.575 -7.739  1.00 36.69 ? 101  THR A CA    1 
ATOM   747  C C     . THR A 1 101 ? -12.642 34.626 -6.723  1.00 31.65 ? 101  THR A C     1 
ATOM   748  O O     . THR A 1 101 ? -11.832 35.306 -6.085  1.00 30.81 ? 101  THR A O     1 
ATOM   749  C CB    . THR A 1 101 ? -11.565 32.323 -7.057  1.00 41.55 ? 101  THR A CB    1 
ATOM   750  O OG1   . THR A 1 101 ? -10.999 31.500 -8.098  1.00 48.74 ? 101  THR A OG1   1 
ATOM   751  C CG2   . THR A 1 101 ? -12.686 31.600 -6.348  1.00 48.27 ? 101  THR A CG2   1 
ATOM   752  N N     . PRO A 1 102 ? -13.971 34.781 -6.608  1.00 31.05 ? 102  PRO A N     1 
ATOM   753  C CA    . PRO A 1 102 ? -14.502 35.755 -5.646  1.00 30.18 ? 102  PRO A CA    1 
ATOM   754  C C     . PRO A 1 102 ? -13.946 35.420 -4.265  1.00 28.51 ? 102  PRO A C     1 
ATOM   755  O O     . PRO A 1 102 ? -14.032 34.316 -3.753  1.00 31.54 ? 102  PRO A O     1 
ATOM   756  C CB    . PRO A 1 102 ? -15.990 35.513 -5.758  1.00 33.64 ? 102  PRO A CB    1 
ATOM   757  C CG    . PRO A 1 102 ? -16.197 34.942 -7.122  1.00 39.93 ? 102  PRO A CG    1 
ATOM   758  C CD    . PRO A 1 102 ? -15.023 34.024 -7.343  1.00 38.79 ? 102  PRO A CD    1 
ATOM   759  N N     . THR A 1 103 ? -13.308 36.383 -3.627  1.00 26.00 ? 103  THR A N     1 
ATOM   760  C CA    . THR A 1 103 ? -12.531 36.198 -2.411  1.00 24.91 ? 103  THR A CA    1 
ATOM   761  C C     . THR A 1 103 ? -12.896 37.294 -1.419  1.00 23.73 ? 103  THR A C     1 
ATOM   762  O O     . THR A 1 103 ? -12.742 38.488 -1.681  1.00 25.77 ? 103  THR A O     1 
ATOM   763  C CB    . THR A 1 103 ? -11.027 36.269 -2.698  1.00 26.57 ? 103  THR A CB    1 
ATOM   764  O OG1   . THR A 1 103 ? -10.632 35.258 -3.644  1.00 28.11 ? 103  THR A OG1   1 
ATOM   765  C CG2   . THR A 1 103 ? -10.185 36.006 -1.440  1.00 29.35 ? 103  THR A CG2   1 
ATOM   766  N N     . LYS A 1 104 ? -13.370 36.833 -0.256  1.00 25.46 ? 104  LYS A N     1 
ATOM   767  C CA    . LYS A 1 104 ? -13.687 37.753 0.850   1.00 25.00 ? 104  LYS A CA    1 
ATOM   768  C C     . LYS A 1 104 ? -12.376 38.232 1.478   1.00 24.03 ? 104  LYS A C     1 
ATOM   769  O O     . LYS A 1 104 ? -11.502 37.410 1.797   1.00 25.57 ? 104  LYS A O     1 
ATOM   770  C CB    . LYS A 1 104 ? -14.520 37.182 2.005   1.00 30.25 ? 104  LYS A CB    1 
ATOM   771  C CG    . LYS A 1 104 ? -15.824 37.948 2.159   1.00 46.16 ? 104  LYS A CG    1 
ATOM   772  C CD    . LYS A 1 104 ? -15.663 39.119 3.176   1.00 48.68 ? 104  LYS A CD    1 
ATOM   773  C CE    . LYS A 1 104 ? -16.235 38.471 4.452   1.00 59.82 ? 104  LYS A CE    1 
ATOM   774  N NZ    . LYS A 1 104 ? -17.576 39.055 4.683   1.00 73.73 ? 104  LYS A NZ    1 
ATOM   775  N N     . VAL A 1 105 ? -12.214 39.533 1.704   1.00 23.89 ? 105  VAL A N     1 
ATOM   776  C CA    . VAL A 1 105 ? -11.005 40.100 2.322   1.00 22.78 ? 105  VAL A CA    1 
ATOM   777  C C     . VAL A 1 105 ? -11.394 41.118 3.356   1.00 22.15 ? 105  VAL A C     1 
ATOM   778  O O     . VAL A 1 105 ? -12.520 41.592 3.448   1.00 24.01 ? 105  VAL A O     1 
ATOM   779  C CB    . VAL A 1 105 ? -10.078 40.761 1.260   1.00 22.44 ? 105  VAL A CB    1 
ATOM   780  C CG1   . VAL A 1 105 ? -9.569  39.720 0.241   1.00 24.50 ? 105  VAL A CG1   1 
ATOM   781  C CG2   . VAL A 1 105 ? -10.828 41.908 0.576   1.00 22.92 ? 105  VAL A CG2   1 
ATOM   782  N N     . LYS A 1 106 ? -10.414 41.447 4.157   1.00 23.47 ? 106  LYS A N     1 
ATOM   783  C CA    . LYS A 1 106 ? -10.373 42.610 5.039   1.00 25.57 ? 106  LYS A CA    1 
ATOM   784  C C     . LYS A 1 106 ? -9.396  43.650 4.503   1.00 22.36 ? 106  LYS A C     1 
ATOM   785  O O     . LYS A 1 106 ? -8.279  43.210 4.107   1.00 23.31 ? 106  LYS A O     1 
ATOM   786  C CB    . LYS A 1 106 ? -9.992  42.215 6.487   1.00 26.21 ? 106  LYS A CB    1 
ATOM   787  C CG    . LYS A 1 106 ? -10.349 43.413 7.390   1.00 33.50 ? 106  LYS A CG    1 
ATOM   788  C CD    . LYS A 1 106 ? -11.524 42.953 8.213   1.00 46.96 ? 106  LYS A CD    1 
ATOM   789  C CE    . LYS A 1 106 ? -11.186 42.082 9.397   1.00 58.57 ? 106  LYS A CE    1 
ATOM   790  N NZ    . LYS A 1 106 ? -12.244 42.119 10.450  1.00 69.93 ? 106  LYS A NZ    1 
ATOM   791  N N     . VAL A 1 107 ? -9.814  44.898 4.417   1.00 21.03 ? 107  VAL A N     1 
ATOM   792  C CA    . VAL A 1 107 ? -9.008  45.969 3.813   1.00 21.03 ? 107  VAL A CA    1 
ATOM   793  C C     . VAL A 1 107 ? -8.700  47.000 4.881   1.00 21.77 ? 107  VAL A C     1 
ATOM   794  O O     . VAL A 1 107 ? -9.578  47.395 5.643   1.00 24.82 ? 107  VAL A O     1 
ATOM   795  C CB    . VAL A 1 107 ? -9.754  46.647 2.651   1.00 21.34 ? 107  VAL A CB    1 
ATOM   796  C CG1   . VAL A 1 107 ? -8.910  47.707 2.021   1.00 22.70 ? 107  VAL A CG1   1 
ATOM   797  C CG2   . VAL A 1 107 ? -10.219 45.597 1.611   1.00 23.43 ? 107  VAL A CG2   1 
ATOM   798  N N     . HIS A 1 108 ? -7.438  47.424 4.868   1.00 22.08 ? 108  HIS A N     1 
ATOM   799  C CA    . HIS A 1 108 ? -7.077  48.565 5.709   1.00 23.86 ? 108  HIS A CA    1 
ATOM   800  C C     . HIS A 1 108 ? -6.370  49.569 4.814   1.00 23.06 ? 108  HIS A C     1 
ATOM   801  O O     . HIS A 1 108 ? -5.315  49.237 4.245   1.00 24.29 ? 108  HIS A O     1 
ATOM   802  C CB    . HIS A 1 108 ? -6.158  48.100 6.825   1.00 22.43 ? 108  HIS A CB    1 
ATOM   803  C CG    . HIS A 1 108 ? -5.665  49.174 7.740   1.00 26.35 ? 108  HIS A CG    1 
ATOM   804  N ND1   . HIS A 1 108 ? -4.512  49.039 8.432   1.00 27.28 ? 108  HIS A ND1   1 
ATOM   805  C CD2   . HIS A 1 108 ? -6.156  50.356 8.091   1.00 27.17 ? 108  HIS A CD2   1 
ATOM   806  C CE1   . HIS A 1 108 ? -4.299  50.107 9.195   1.00 28.87 ? 108  HIS A CE1   1 
ATOM   807  N NE2   . HIS A 1 108 ? -5.304  50.928 8.990   1.00 28.25 ? 108  HIS A NE2   1 
ATOM   808  N N     . MET A 1 109 ? -6.974  50.756 4.717   1.00 25.31 ? 109  MET A N     1 
ATOM   809  C CA    . MET A 1 109 ? -6.372  51.827 3.920   1.00 22.87 ? 109  MET A CA    1 
ATOM   810  C C     . MET A 1 109 ? -5.754  52.794 4.936   1.00 24.98 ? 109  MET A C     1 
ATOM   811  O O     . MET A 1 109 ? -6.408  53.163 5.938   1.00 26.86 ? 109  MET A O     1 
ATOM   812  C CB    . MET A 1 109 ? -7.369  52.563 3.036   1.00 26.31 ? 109  MET A CB    1 
ATOM   813  C CG    . MET A 1 109 ? -7.709  51.685 1.833   1.00 32.51 ? 109  MET A CG    1 
ATOM   814  S SD    . MET A 1 109 ? -8.675  52.546 0.540   1.00 29.06 ? 109  MET A SD    1 
ATOM   815  C CE    . MET A 1 109 ? -10.117 52.914 1.392   1.00 33.70 ? 109  MET A CE    1 
ATOM   816  N N     . LYS A 1 110 ? -4.537  53.260 4.682   1.00 23.21 ? 110  LYS A N     1 
ATOM   817  C CA    . LYS A 1 110 ? -3.866  54.151 5.628   1.00 27.20 ? 110  LYS A CA    1 
ATOM   818  C C     . LYS A 1 110 ? -2.891  55.030 4.859   1.00 26.44 ? 110  LYS A C     1 
ATOM   819  O O     . LYS A 1 110 ? -2.117  54.560 4.024   1.00 28.99 ? 110  LYS A O     1 
ATOM   820  C CB    . LYS A 1 110 ? -3.095  53.344 6.684   1.00 26.47 ? 110  LYS A CB    1 
ATOM   821  C CG    . LYS A 1 110 ? -2.484  54.273 7.722   1.00 32.89 ? 110  LYS A CG    1 
ATOM   822  C CD    . LYS A 1 110 ? -3.363  54.534 8.897   1.00 37.05 ? 110  LYS A CD    1 
ATOM   823  C CE    . LYS A 1 110 ? -2.621  55.274 9.993   1.00 33.26 ? 110  LYS A CE    1 
ATOM   824  N NZ    . LYS A 1 110 ? -2.205  54.368 11.121  1.00 35.45 ? 110  LYS A NZ    1 
ATOM   825  N N     . LYS A 1 111 ? -2.989  56.320 5.178   1.00 27.96 ? 111  LYS A N     1 
ATOM   826  C CA    . LYS A 1 111 ? -2.041  57.223 4.558   1.00 29.55 ? 111  LYS A CA    1 
ATOM   827  C C     . LYS A 1 111 ? -0.601  56.812 4.877   1.00 29.27 ? 111  LYS A C     1 
ATOM   828  O O     . LYS A 1 111 ? -0.330  56.421 6.012   1.00 32.45 ? 111  LYS A O     1 
ATOM   829  C CB    . LYS A 1 111 ? -2.279  58.660 5.069   1.00 32.30 ? 111  LYS A CB    1 
ATOM   830  C CG    . LYS A 1 111 ? -1.087  59.581 4.880   1.00 44.81 ? 111  LYS A CG    1 
ATOM   831  C CD    . LYS A 1 111 ? -1.336  60.875 5.666   1.00 49.59 ? 111  LYS A CD    1 
ATOM   832  C CE    . LYS A 1 111 ? -1.505  62.055 4.702   1.00 53.69 ? 111  LYS A CE    1 
ATOM   833  N NZ    . LYS A 1 111 ? -1.495  63.233 5.625   1.00 62.52 ? 111  LYS A NZ    1 
ATOM   834  N N     . ALA A 1 112 ? 0.282   56.965 3.901   1.00 27.22 ? 112  ALA A N     1 
ATOM   835  C CA    . ALA A 1 112 ? 1.675   56.750 4.168   1.00 30.05 ? 112  ALA A CA    1 
ATOM   836  C C     . ALA A 1 112 ? 2.301   57.986 4.854   1.00 32.19 ? 112  ALA A C     1 
ATOM   837  O O     . ALA A 1 112 ? 1.770   59.104 4.772   1.00 36.34 ? 112  ALA A O     1 
ATOM   838  C CB    . ALA A 1 112 ? 2.422   56.441 2.867   1.00 30.96 ? 112  ALA A CB    1 
ATOM   839  N N     . LEU A 1 113 ? 3.478   57.789 5.395   1.00 31.83 ? 113  LEU A N     1 
ATOM   840  C CA    . LEU A 1 113 ? 4.261   58.893 5.964   1.00 36.99 ? 113  LEU A CA    1 
ATOM   841  C C     . LEU A 1 113 ? 4.721   59.906 4.932   1.00 40.41 ? 113  LEU A C     1 
ATOM   842  O O     . LEU A 1 113 ? 5.048   61.054 5.319   1.00 48.80 ? 113  LEU A O     1 
ATOM   843  C CB    . LEU A 1 113 ? 5.495   58.301 6.651   1.00 37.42 ? 113  LEU A CB    1 
ATOM   844  C CG    . LEU A 1 113 ? 5.168   57.437 7.855   1.00 40.81 ? 113  LEU A CG    1 
ATOM   845  C CD1   . LEU A 1 113 ? 6.399   57.338 8.755   1.00 44.69 ? 113  LEU A CD1   1 
ATOM   846  C CD2   . LEU A 1 113 ? 3.979   57.998 8.614   1.00 49.42 ? 113  LEU A CD2   1 
ATOM   847  N N     . SER A 1 114 ? 4.798   59.551 3.658   1.00 44.45 ? 114  SER A N     1 
ATOM   848  C CA    . SER A 1 114 ? 5.271   60.584 2.725   1.00 45.96 ? 114  SER A CA    1 
ATOM   849  C C     . SER A 1 114 ? 4.339   61.794 2.696   1.00 47.63 ? 114  SER A C     1 
ATOM   850  O O     . SER A 1 114 ? 4.786   62.925 2.505   1.00 51.26 ? 114  SER A O     1 
ATOM   851  C CB    . SER A 1 114 ? 5.402   60.030 1.302   1.00 50.20 ? 114  SER A CB    1 
ATOM   852  O OG    . SER A 1 114 ? 4.176   59.414 0.971   1.00 49.31 ? 114  SER A OG    1 
ATOM   853  N N     . GLY A 1 115 ? 3.057   61.541 2.878   1.00 47.87 ? 115  GLY A N     1 
ATOM   854  C CA    . GLY A 1 115 ? 1.946   62.457 2.736   1.00 51.86 ? 115  GLY A CA    1 
ATOM   855  C C     . GLY A 1 115 ? 1.381   62.554 1.324   1.00 52.95 ? 115  GLY A C     1 
ATOM   856  O O     . GLY A 1 115 ? 0.469   63.357 1.070   1.00 54.04 ? 115  GLY A O     1 
ATOM   857  N N     . ASP A 1 116 ? 1.899   61.789 0.364   1.00 51.86 ? 116  ASP A N     1 
ATOM   858  C CA    . ASP A 1 116 ? 1.545   61.877 -1.032  1.00 47.93 ? 116  ASP A CA    1 
ATOM   859  C C     . ASP A 1 116 ? 1.257   60.502 -1.660  1.00 40.53 ? 116  ASP A C     1 
ATOM   860  O O     . ASP A 1 116 ? 1.072   60.348 -2.857  1.00 43.59 ? 116  ASP A O     1 
ATOM   861  C CB    . ASP A 1 116 ? 2.692   62.490 -1.828  1.00 50.59 ? 116  ASP A CB    1 
ATOM   862  C CG    . ASP A 1 116 ? 4.050   61.945 -1.471  1.00 55.82 ? 116  ASP A CG    1 
ATOM   863  O OD1   . ASP A 1 116 ? 4.349   60.791 -1.808  1.00 53.37 ? 116  ASP A OD1   1 
ATOM   864  O OD2   . ASP A 1 116 ? 4.856   62.683 -0.865  1.00 62.81 ? 116  ASP A OD2   1 
ATOM   865  N N     . SER A 1 117 ? 1.295   59.514 -0.779  1.00 34.13 ? 117  SER A N     1 
ATOM   866  C CA    . SER A 1 117 ? 1.159   58.118 -1.161  1.00 32.69 ? 117  SER A CA    1 
ATOM   867  C C     . SER A 1 117 ? 0.395   57.466 -0.028  1.00 25.85 ? 117  SER A C     1 
ATOM   868  O O     . SER A 1 117 ? 0.360   57.945 1.111   1.00 32.84 ? 117  SER A O     1 
ATOM   869  C CB    . SER A 1 117 ? 2.499   57.500 -1.482  1.00 34.73 ? 117  SER A CB    1 
ATOM   870  O OG    . SER A 1 117 ? 3.155   57.105 -0.314  1.00 35.76 ? 117  SER A OG    1 
ATOM   871  N N     . TYR A 1 118 ? -0.360  56.423 -0.364  1.00 24.79 ? 118  TYR A N     1 
ATOM   872  C CA    . TYR A 1 118 ? -1.448  55.848 0.413   1.00 25.01 ? 118  TYR A CA    1 
ATOM   873  C C     . TYR A 1 118 ? -1.329  54.341 0.343   1.00 24.89 ? 118  TYR A C     1 
ATOM   874  O O     . TYR A 1 118 ? -1.163  53.740 -0.734  1.00 23.95 ? 118  TYR A O     1 
ATOM   875  C CB    . TYR A 1 118 ? -2.865  56.309 -0.128  1.00 24.84 ? 118  TYR A CB    1 
ATOM   876  C CG    . TYR A 1 118 ? -2.809  57.810 -0.253  1.00 24.01 ? 118  TYR A CG    1 
ATOM   877  C CD1   . TYR A 1 118 ? -2.376  58.452 -1.423  1.00 23.44 ? 118  TYR A CD1   1 
ATOM   878  C CD2   . TYR A 1 118 ? -3.053  58.606 0.818   1.00 25.96 ? 118  TYR A CD2   1 
ATOM   879  C CE1   . TYR A 1 118 ? -2.280  59.810 -1.502  1.00 24.03 ? 118  TYR A CE1   1 
ATOM   880  C CE2   . TYR A 1 118 ? -2.968  60.001 0.734   1.00 26.88 ? 118  TYR A CE2   1 
ATOM   881  C CZ    . TYR A 1 118 ? -2.585  60.615 -0.432  1.00 26.01 ? 118  TYR A CZ    1 
ATOM   882  O OH    . TYR A 1 118 ? -2.466  61.965 -0.499  1.00 28.47 ? 118  TYR A OH    1 
ATOM   883  N N     . TRP A 1 119 ? -1.521  53.652 1.463   1.00 25.00 ? 119  TRP A N     1 
ATOM   884  C CA    . TRP A 1 119 ? -1.456  52.203 1.469   1.00 25.30 ? 119  TRP A CA    1 
ATOM   885  C C     . TRP A 1 119 ? -2.857  51.583 1.435   1.00 23.34 ? 119  TRP A C     1 
ATOM   886  O O     . TRP A 1 119 ? -3.735  52.085 2.125   1.00 25.01 ? 119  TRP A O     1 
ATOM   887  C CB    . TRP A 1 119 ? -0.796  51.696 2.766   1.00 24.83 ? 119  TRP A CB    1 
ATOM   888  C CG    . TRP A 1 119 ? 0.637   52.036 2.915   1.00 25.59 ? 119  TRP A CG    1 
ATOM   889  C CD1   . TRP A 1 119 ? 1.152   53.014 3.714   1.00 27.48 ? 119  TRP A CD1   1 
ATOM   890  C CD2   . TRP A 1 119 ? 1.764   51.389 2.268   1.00 26.43 ? 119  TRP A CD2   1 
ATOM   891  N NE1   . TRP A 1 119 ? 2.523   53.030 3.584   1.00 29.79 ? 119  TRP A NE1   1 
ATOM   892  C CE2   . TRP A 1 119 ? 2.910   52.054 2.719   1.00 31.64 ? 119  TRP A CE2   1 
ATOM   893  C CE3   . TRP A 1 119 ? 1.884   50.332 1.339   1.00 25.24 ? 119  TRP A CE3   1 
ATOM   894  C CZ2   . TRP A 1 119 ? 4.182   51.675 2.275   1.00 34.36 ? 119  TRP A CZ2   1 
ATOM   895  C CZ3   . TRP A 1 119 ? 3.154   49.964 0.907   1.00 29.98 ? 119  TRP A CZ3   1 
ATOM   896  C CH2   . TRP A 1 119 ? 4.291   50.645 1.380   1.00 33.64 ? 119  TRP A CH2   1 
ATOM   897  N N     . VAL A 1 120 ? -2.932  50.472 0.668   1.00 22.26 ? 120  VAL A N     1 
ATOM   898  C CA    . VAL A 1 120 ? -4.036  49.579 0.752   1.00 20.76 ? 120  VAL A CA    1 
ATOM   899  C C     . VAL A 1 120 ? -3.487  48.228 1.208   1.00 20.94 ? 120  VAL A C     1 
ATOM   900  O O     . VAL A 1 120 ? -2.692  47.627 0.475   1.00 21.60 ? 120  VAL A O     1 
ATOM   901  C CB    . VAL A 1 120 ? -4.745  49.431 -0.619  1.00 21.25 ? 120  VAL A CB    1 
ATOM   902  C CG1   . VAL A 1 120 ? -5.913  48.487 -0.541  1.00 25.63 ? 120  VAL A CG1   1 
ATOM   903  C CG2   . VAL A 1 120 ? -5.152  50.844 -1.102  1.00 26.94 ? 120  VAL A CG2   1 
ATOM   904  N N     . PHE A 1 121 ? -3.917  47.781 2.376   1.00 20.74 ? 121  PHE A N     1 
ATOM   905  C CA    . PHE A 1 121 ? -3.543  46.490 2.936   1.00 22.07 ? 121  PHE A CA    1 
ATOM   906  C C     . PHE A 1 121 ? -4.702  45.517 2.867   1.00 20.26 ? 121  PHE A C     1 
ATOM   907  O O     . PHE A 1 121 ? -5.874  45.910 3.074   1.00 22.47 ? 121  PHE A O     1 
ATOM   908  C CB    . PHE A 1 121 ? -3.199  46.717 4.416   1.00 23.99 ? 121  PHE A CB    1 
ATOM   909  C CG    . PHE A 1 121 ? -2.074  47.707 4.649   1.00 24.26 ? 121  PHE A CG    1 
ATOM   910  C CD1   . PHE A 1 121 ? -0.846  47.506 4.006   1.00 25.70 ? 121  PHE A CD1   1 
ATOM   911  C CD2   . PHE A 1 121 ? -2.244  48.802 5.486   1.00 24.88 ? 121  PHE A CD2   1 
ATOM   912  C CE1   . PHE A 1 121 ? 0.166   48.409 4.173   1.00 26.20 ? 121  PHE A CE1   1 
ATOM   913  C CE2   . PHE A 1 121 ? -1.202  49.667 5.667   1.00 24.64 ? 121  PHE A CE2   1 
ATOM   914  C CZ    . PHE A 1 121 ? 0.031   49.465 5.041   1.00 25.87 ? 121  PHE A CZ    1 
ATOM   915  N N     . VAL A 1 122 ? -4.400  44.236 2.582   1.00 21.33 ? 122  VAL A N     1 
ATOM   916  C CA    . VAL A 1 122 ? -5.461  43.242 2.366   1.00 21.22 ? 122  VAL A CA    1 
ATOM   917  C C     . VAL A 1 122 ? -5.125  41.907 3.023   1.00 20.17 ? 122  VAL A C     1 
ATOM   918  O O     . VAL A 1 122 ? -3.981  41.462 2.952   1.00 23.08 ? 122  VAL A O     1 
ATOM   919  C CB    . VAL A 1 122 ? -5.643  43.002 0.821   1.00 21.63 ? 122  VAL A CB    1 
ATOM   920  C CG1   . VAL A 1 122 ? -6.651  41.915 0.569   1.00 24.53 ? 122  VAL A CG1   1 
ATOM   921  C CG2   . VAL A 1 122 ? -5.999  44.321 0.130   1.00 23.30 ? 122  VAL A CG2   1 
ATOM   922  N N     . LYS A 1 123 ? -6.117  41.293 3.667   1.00 22.19 ? 123  LYS A N     1 
ATOM   923  C CA    . LYS A 1 123 ? -5.857  39.906 4.074   1.00 22.65 ? 123  LYS A CA    1 
ATOM   924  C C     . LYS A 1 123 ? -7.110  39.117 3.815   1.00 23.16 ? 123  LYS A C     1 
ATOM   925  O O     . LYS A 1 123 ? -8.210  39.683 3.774   1.00 23.71 ? 123  LYS A O     1 
ATOM   926  C CB    . LYS A 1 123 ? -5.383  39.732 5.514   1.00 27.48 ? 123  LYS A CB    1 
ATOM   927  C CG    . LYS A 1 123 ? -6.389  40.170 6.551   1.00 25.93 ? 123  LYS A CG    1 
ATOM   928  C CD    . LYS A 1 123 ? -5.914  39.860 7.977   1.00 23.42 ? 123  LYS A CD    1 
ATOM   929  C CE    . LYS A 1 123 ? -7.033  40.092 8.998   1.00 24.99 ? 123  LYS A CE    1 
ATOM   930  N NZ    . LYS A 1 123 ? -6.564  39.527 10.303  1.00 24.94 ? 123  LYS A NZ    1 
ATOM   931  N N     . ARG A 1 124 ? -7.003  37.815 3.639   1.00 22.87 ? 124  ARG A N     1 
ATOM   932  C CA    . ARG A 1 124 ? -8.164  36.979 3.470   1.00 23.02 ? 124  ARG A CA    1 
ATOM   933  C C     . ARG A 1 124 ? -8.962  36.891 4.792   1.00 22.50 ? 124  ARG A C     1 
ATOM   934  O O     . ARG A 1 124 ? -8.368  37.000 5.877   1.00 25.25 ? 124  ARG A O     1 
ATOM   935  C CB    . ARG A 1 124 ? -7.783  35.553 3.100   1.00 23.93 ? 124  ARG A CB    1 
ATOM   936  C CG    . ARG A 1 124 ? -7.142  35.461 1.703   1.00 27.47 ? 124  ARG A CG    1 
ATOM   937  C CD    . ARG A 1 124 ? -6.652  34.002 1.503   1.00 31.76 ? 124  ARG A CD    1 
ATOM   938  N NE    . ARG A 1 124 ? -5.702  33.852 0.401   1.00 33.95 ? 124  ARG A NE    1 
ATOM   939  C CZ    . ARG A 1 124 ? -6.097  33.405 -0.790  1.00 37.24 ? 124  ARG A CZ    1 
ATOM   940  N NH1   . ARG A 1 124 ? -7.377  33.075 -0.967  1.00 39.81 ? 124  ARG A NH1   1 
ATOM   941  N NH2   . ARG A 1 124 ? -5.160  33.307 -1.722  1.00 46.39 ? 124  ARG A NH2   1 
ATOM   942  N N     . VAL A 1 125 ? -10.272 36.699 4.642   1.00 24.95 ? 125  VAL A N     1 
ATOM   943  C CA    . VAL A 1 125 ? -11.165 36.428 5.783   1.00 27.87 ? 125  VAL A CA    1 
ATOM   944  C C     . VAL A 1 125 ? -11.978 35.163 5.534   1.00 25.21 ? 125  VAL A C     1 
ATOM   945  O O     . VAL A 1 125 ? -12.161 34.783 4.351   1.00 26.81 ? 125  VAL A O     1 
ATOM   946  C CB    . VAL A 1 125 ? -12.101 37.572 6.115   1.00 28.21 ? 125  VAL A CB    1 
ATOM   947  C CG1   . VAL A 1 125 ? -11.388 38.875 6.409   1.00 29.44 ? 125  VAL A CG1   1 
ATOM   948  C CG2   . VAL A 1 125 ? -13.064 37.797 5.004   1.00 33.38 ? 125  VAL A CG2   1 
ATOM   949  O OXT   . VAL A 1 125 ? -12.413 34.642 6.597   1.00 29.57 ? 125  VAL A OXT   1 
HETATM 950  C C1    . HC4 B 2 .   ? -12.279 43.831 -7.784  1.00 23.92 ? 169  HC4 A C1    1 
HETATM 951  O O1    . HC4 B 2 .   ? -12.401 43.929 -9.018  1.00 26.29 ? 169  HC4 A O1    1 
HETATM 952  C C2    . HC4 B 2 .   ? -11.078 43.587 -7.148  1.00 23.84 ? 169  HC4 A C2    1 
HETATM 953  C C3    . HC4 B 2 .   ? -9.950  43.233 -7.829  1.00 22.76 ? 169  HC4 A C3    1 
HETATM 954  C "C1'" . HC4 B 2 .   ? -8.610  43.252 -7.322  1.00 21.05 ? 169  HC4 A "C1'" 1 
HETATM 955  C "C2'" . HC4 B 2 .   ? -7.553  42.932 -8.177  1.00 23.33 ? 169  HC4 A "C2'" 1 
HETATM 956  C "C3'" . HC4 B 2 .   ? -6.258  43.083 -7.750  1.00 21.65 ? 169  HC4 A "C3'" 1 
HETATM 957  C "C4'" . HC4 B 2 .   ? -5.956  43.609 -6.461  1.00 21.29 ? 169  HC4 A "C4'" 1 
HETATM 958  C "C5'" . HC4 B 2 .   ? -7.036  43.889 -5.618  1.00 20.81 ? 169  HC4 A "C5'" 1 
HETATM 959  C "C6'" . HC4 B 2 .   ? -8.336  43.706 -6.002  1.00 21.91 ? 169  HC4 A "C6'" 1 
HETATM 960  O "O4'" . HC4 B 2 .   ? -4.684  43.773 -6.020  1.00 21.99 ? 169  HC4 A "O4'" 1 
HETATM 961  O O     . HOH C 3 .   ? -9.022  37.065 8.617   1.00 28.60 ? 1001 HOH A O     1 
HETATM 962  O O     . HOH C 3 .   ? -13.631 51.110 -12.579 1.00 27.07 ? 1002 HOH A O     1 
HETATM 963  O O     . HOH C 3 .   ? -2.053  54.627 -14.481 1.00 28.08 ? 1003 HOH A O     1 
HETATM 964  O O     . HOH C 3 .   ? -1.175  36.225 0.674   1.00 27.57 ? 1004 HOH A O     1 
HETATM 965  O O     . HOH C 3 .   ? -4.306  36.782 4.077   1.00 32.29 ? 1005 HOH A O     1 
HETATM 966  O O     . HOH C 3 .   ? -1.957  37.589 3.022   1.00 29.92 ? 1006 HOH A O     1 
HETATM 967  O O     . HOH C 3 .   ? -10.435 56.966 6.547   1.00 34.51 ? 1007 HOH A O     1 
HETATM 968  O O     . HOH C 3 .   ? -3.599  63.351 1.522   1.00 35.60 ? 1008 HOH A O     1 
HETATM 969  O O     . HOH C 3 .   ? 4.142   40.635 8.439   1.00 29.49 ? 1009 HOH A O     1 
HETATM 970  O O     . HOH C 3 .   ? 6.369   46.473 -5.337  1.00 31.95 ? 1010 HOH A O     1 
HETATM 971  O O     . HOH C 3 .   ? 4.306   54.814 5.254   1.00 29.69 ? 1011 HOH A O     1 
HETATM 972  O O     . HOH C 3 .   ? 2.499   37.196 -6.021  1.00 27.73 ? 1012 HOH A O     1 
HETATM 973  O O     . HOH C 3 .   ? -11.131 60.856 5.810   1.00 35.76 ? 1013 HOH A O     1 
HETATM 974  O O     . HOH C 3 .   ? -13.745 34.072 0.167   1.00 32.46 ? 1014 HOH A O     1 
HETATM 975  O O     . HOH C 3 .   ? -15.942 42.634 -10.613 1.00 34.85 ? 1015 HOH A O     1 
HETATM 976  O O     . HOH C 3 .   ? -11.161 34.741 1.907   1.00 29.30 ? 1016 HOH A O     1 
HETATM 977  O O     . HOH C 3 .   ? -16.637 50.261 3.043   1.00 34.69 ? 1017 HOH A O     1 
HETATM 978  O O     . HOH C 3 .   ? -9.518  46.418 -16.721 1.00 31.96 ? 1018 HOH A O     1 
HETATM 979  O O     . HOH C 3 .   ? -10.266 60.213 8.349   1.00 39.33 ? 1019 HOH A O     1 
HETATM 980  O O     . HOH C 3 .   ? -2.821  34.148 0.247   1.00 45.96 ? 1020 HOH A O     1 
HETATM 981  O O     . HOH C 3 .   ? -11.411 47.988 -15.743 1.00 38.79 ? 1021 HOH A O     1 
HETATM 982  O O     . HOH C 3 .   ? -17.030 43.789 -4.836  1.00 38.32 ? 1022 HOH A O     1 
HETATM 983  O O     . HOH C 3 .   ? 4.289   53.687 -10.510 1.00 34.88 ? 1023 HOH A O     1 
HETATM 984  O O     . HOH C 3 .   ? -17.077 46.043 6.606   1.00 38.76 ? 1024 HOH A O     1 
HETATM 985  O O     . HOH C 3 .   ? -4.643  60.701 3.840   1.00 30.96 ? 1025 HOH A O     1 
HETATM 986  O O     . HOH C 3 .   ? -2.970  59.985 -12.650 1.00 37.27 ? 1026 HOH A O     1 
HETATM 987  O O     . HOH C 3 .   ? -13.181 42.660 -18.835 1.00 35.21 ? 1027 HOH A O     1 
HETATM 988  O O     . HOH C 3 .   ? 4.295   39.276 0.936   1.00 41.00 ? 1028 HOH A O     1 
HETATM 989  O O     . HOH C 3 .   ? -0.902  40.206 -13.676 1.00 37.23 ? 1029 HOH A O     1 
HETATM 990  O O     . HOH C 3 .   ? -0.169  61.668 -4.632  1.00 35.07 ? 1030 HOH A O     1 
HETATM 991  O O     . HOH C 3 .   ? 4.993   58.755 12.066  1.00 39.80 ? 1031 HOH A O     1 
HETATM 992  O O     . HOH C 3 .   ? -1.650  63.170 -2.798  1.00 36.30 ? 1032 HOH A O     1 
HETATM 993  O O     . HOH C 3 .   ? 7.621   48.803 -6.759  1.00 42.90 ? 1033 HOH A O     1 
HETATM 994  O O     . HOH C 3 .   ? -4.282  58.839 8.627   1.00 44.41 ? 1034 HOH A O     1 
HETATM 995  O O     . HOH C 3 .   ? -14.466 33.182 7.004   1.00 47.91 ? 1035 HOH A O     1 
HETATM 996  O O     . HOH C 3 .   ? -11.582 57.897 4.318   1.00 38.31 ? 1036 HOH A O     1 
HETATM 997  O O     . HOH C 3 .   ? -17.176 40.943 1.611   1.00 49.56 ? 1037 HOH A O     1 
HETATM 998  O O     . HOH C 3 .   ? 11.944  50.229 -2.871  1.00 53.63 ? 1038 HOH A O     1 
HETATM 999  O O     . HOH C 3 .   ? -12.494 64.080 2.910   1.00 36.63 ? 1039 HOH A O     1 
HETATM 1000 O O     . HOH C 3 .   ? -17.628 43.748 -1.708  1.00 34.29 ? 1040 HOH A O     1 
HETATM 1001 O O     . HOH C 3 .   ? -10.347 38.699 10.271  1.00 38.94 ? 1041 HOH A O     1 
HETATM 1002 O O     . HOH C 3 .   ? -3.251  51.917 11.675  1.00 37.92 ? 1042 HOH A O     1 
HETATM 1003 O O     . HOH C 3 .   ? 10.948  48.020 11.579  1.00 49.98 ? 1043 HOH A O     1 
HETATM 1004 O O     . HOH C 3 .   ? 1.276   44.729 16.044  1.00 36.31 ? 1044 HOH A O     1 
HETATM 1005 O O     . HOH C 3 .   ? -11.112 54.683 10.966  1.00 47.13 ? 1045 HOH A O     1 
HETATM 1006 O O     . HOH C 3 .   ? 6.631   44.612 -7.871  1.00 42.99 ? 1046 HOH A O     1 
HETATM 1007 O O     . HOH C 3 .   ? -6.744  61.004 13.840  1.00 38.60 ? 1047 HOH A O     1 
HETATM 1008 O O     . HOH C 3 .   ? -17.378 47.505 2.965   1.00 36.76 ? 1048 HOH A O     1 
HETATM 1009 O O     . HOH C 3 .   ? -4.743  43.586 -13.753 1.00 49.22 ? 1049 HOH A O     1 
HETATM 1010 O O     . HOH C 3 .   ? -6.216  43.592 12.606  1.00 36.06 ? 1050 HOH A O     1 
HETATM 1011 O O     . HOH C 3 .   ? 5.627   54.568 2.860   1.00 44.54 ? 1051 HOH A O     1 
HETATM 1012 O O     . HOH C 3 .   ? -9.141  57.309 -10.759 1.00 49.76 ? 1052 HOH A O     1 
HETATM 1013 O O     . HOH C 3 .   ? 6.438   42.064 -5.311  1.00 38.75 ? 1053 HOH A O     1 
HETATM 1014 O O     . HOH C 3 .   ? -15.756 63.832 -5.049  1.00 46.12 ? 1054 HOH A O     1 
HETATM 1015 O O     . HOH C 3 .   ? -19.388 48.221 -3.057  1.00 45.79 ? 1055 HOH A O     1 
HETATM 1016 O O     . HOH C 3 .   ? -5.219  50.130 13.737  1.00 50.86 ? 1056 HOH A O     1 
HETATM 1017 O O     . HOH C 3 .   ? 11.101  38.357 0.853   1.00 49.49 ? 1057 HOH A O     1 
HETATM 1018 O O     . HOH C 3 .   ? -1.172  48.142 17.052  1.00 44.99 ? 1058 HOH A O     1 
HETATM 1019 O O     . HOH C 3 .   ? -17.705 61.868 -5.082  1.00 43.93 ? 1059 HOH A O     1 
HETATM 1020 O O     . HOH C 3 .   ? -8.537  58.742 -9.080  1.00 41.94 ? 1060 HOH A O     1 
HETATM 1021 O O     . HOH C 3 .   ? 15.038  37.200 -6.294  1.00 55.55 ? 1061 HOH A O     1 
HETATM 1022 O O     . HOH C 3 .   ? 7.116   44.448 -3.171  1.00 34.93 ? 1062 HOH A O     1 
HETATM 1023 O O     . HOH C 3 .   ? -5.889  37.307 -12.638 1.00 38.51 ? 1063 HOH A O     1 
HETATM 1024 O O     . HOH C 3 .   ? -8.987  39.819 11.882  1.00 46.03 ? 1064 HOH A O     1 
HETATM 1025 O O     . HOH C 3 .   ? -12.558 39.980 -20.689 1.00 54.45 ? 1065 HOH A O     1 
HETATM 1026 O O     . HOH C 3 .   ? 5.650   36.961 -6.401  1.00 47.40 ? 1066 HOH A O     1 
HETATM 1027 O O     . HOH C 3 .   ? -14.873 32.975 1.958   1.00 51.00 ? 1067 HOH A O     1 
HETATM 1028 O O     . HOH C 3 .   ? -18.579 61.454 -2.119  1.00 49.84 ? 1068 HOH A O     1 
HETATM 1029 O O     . HOH C 3 .   ? 4.898   36.421 6.173   1.00 44.54 ? 1069 HOH A O     1 
HETATM 1030 O O     . HOH C 3 .   ? -17.186 57.054 3.434   1.00 35.75 ? 1070 HOH A O     1 
HETATM 1031 O O     . HOH C 3 .   ? -18.552 38.701 -5.801  1.00 50.88 ? 1071 HOH A O     1 
HETATM 1032 O O     . HOH C 3 .   ? -18.549 45.560 -5.819  1.00 54.45 ? 1072 HOH A O     1 
HETATM 1033 O O     . HOH C 3 .   ? -9.249  44.037 -17.955 1.00 46.25 ? 1073 HOH A O     1 
HETATM 1034 O O     . HOH C 3 .   ? -5.621  58.354 11.623  1.00 41.81 ? 1074 HOH A O     1 
HETATM 1035 O O     . HOH C 3 .   ? -9.349  63.367 -3.317  1.00 42.30 ? 1075 HOH A O     1 
HETATM 1036 O O     . HOH C 3 .   ? -6.861  44.250 -15.437 1.00 45.20 ? 1076 HOH A O     1 
HETATM 1037 O O     . HOH C 3 .   ? 7.935   51.152 13.322  1.00 38.53 ? 1077 HOH A O     1 
HETATM 1038 O O     . HOH C 3 .   ? 0.337   58.104 8.173   1.00 42.91 ? 1078 HOH A O     1 
HETATM 1039 O O     . HOH C 3 .   ? -19.679 51.677 3.070   1.00 51.69 ? 1079 HOH A O     1 
HETATM 1040 O O     . HOH C 3 .   ? -5.624  39.979 -14.089 1.00 43.54 ? 1080 HOH A O     1 
HETATM 1041 O O     . HOH C 3 .   ? -7.807  68.741 0.128   1.00 48.56 ? 1081 HOH A O     1 
HETATM 1042 O O     . HOH C 3 .   ? -11.552 66.782 3.308   1.00 49.42 ? 1082 HOH A O     1 
HETATM 1043 O O     . HOH C 3 .   ? 7.723   51.934 1.431   1.00 57.71 ? 1083 HOH A O     1 
HETATM 1044 O O     . HOH C 3 .   ? -12.427 51.843 10.056  1.00 50.11 ? 1084 HOH A O     1 
HETATM 1045 O O     . HOH C 3 .   ? -2.550  56.366 12.900  1.00 47.96 ? 1085 HOH A O     1 
HETATM 1046 O O     . HOH C 3 .   ? -0.377  61.644 -9.493  1.00 50.24 ? 1086 HOH A O     1 
HETATM 1047 O O     . HOH C 3 .   ? -3.563  65.805 -2.225  1.00 53.45 ? 1087 HOH A O     1 
HETATM 1048 O O     . HOH C 3 .   ? -7.231  51.663 11.768  1.00 58.28 ? 1088 HOH A O     1 
HETATM 1049 O O     . HOH C 3 .   ? -2.725  42.521 -14.676 1.00 51.66 ? 1089 HOH A O     1 
HETATM 1050 O O     . HOH C 3 .   ? 0.608   30.994 -2.086  1.00 50.82 ? 1090 HOH A O     1 
HETATM 1051 O O     . HOH C 3 .   ? -6.117  58.904 14.530  1.00 53.33 ? 1091 HOH A O     1 
HETATM 1052 O O     . HOH C 3 .   ? -13.765 37.772 -13.620 1.00 42.64 ? 1092 HOH A O     1 
HETATM 1053 O O     . HOH C 3 .   ? -4.437  70.198 -2.075  1.00 50.29 ? 1093 HOH A O     1 
HETATM 1054 O O     . HOH C 3 .   ? 8.281   46.174 -7.837  1.00 48.48 ? 1094 HOH A O     1 
HETATM 1055 O O     . HOH C 3 .   ? 3.261   52.985 18.527  1.00 56.87 ? 1095 HOH A O     1 
HETATM 1056 O O     . HOH C 3 .   ? -4.196  57.684 -13.949 1.00 50.54 ? 1096 HOH A O     1 
HETATM 1057 O O     . HOH C 3 .   ? 11.432  39.956 -3.157  1.00 48.81 ? 1097 HOH A O     1 
HETATM 1058 O O     . HOH C 3 .   ? 7.120   39.917 -6.764  1.00 49.06 ? 1098 HOH A O     1 
HETATM 1059 O O     . HOH C 3 .   ? -9.377  52.371 12.224  1.00 54.79 ? 1099 HOH A O     1 
HETATM 1060 O O     . HOH C 3 .   ? 7.314   53.746 -3.567  1.00 49.89 ? 1100 HOH A O     1 
HETATM 1061 O O     . HOH C 3 .   ? 5.179   51.288 -14.153 1.00 42.09 ? 1101 HOH A O     1 
HETATM 1062 O O     . HOH C 3 .   ? 10.519  52.357 0.197   1.00 49.98 ? 1102 HOH A O     1 
HETATM 1063 O O     . HOH C 3 .   ? -18.867 37.943 -0.959  1.00 45.59 ? 1103 HOH A O     1 
HETATM 1064 O O     . HOH C 3 .   ? 12.834  40.710 -11.478 1.00 50.93 ? 1104 HOH A O     1 
HETATM 1065 O O     . HOH C 3 .   ? -10.222 32.570 -3.035  1.00 50.61 ? 1105 HOH A O     1 
HETATM 1066 O O     . HOH C 3 .   ? -13.299 32.514 -2.035  1.00 49.90 ? 1106 HOH A O     1 
HETATM 1067 O O     . HOH C 3 .   ? 7.044   64.028 1.091   1.00 57.08 ? 1107 HOH A O     1 
HETATM 1068 O O     . HOH C 3 .   ? -2.610  37.947 -13.702 1.00 47.22 ? 1108 HOH A O     1 
HETATM 1069 O O     . HOH C 3 .   ? 4.348   34.659 -4.334  1.00 44.28 ? 1109 HOH A O     1 
HETATM 1070 O O     . HOH C 3 .   ? 6.954   39.884 -14.578 1.00 46.27 ? 1110 HOH A O     1 
HETATM 1071 O O     . HOH C 3 .   ? 2.173   66.772 0.869   1.00 52.25 ? 1111 HOH A O     1 
HETATM 1072 O O     . HOH C 3 .   ? -15.188 38.834 9.726   1.00 62.64 ? 1112 HOH A O     1 
HETATM 1073 O O     . HOH C 3 .   ? 3.419   62.029 7.570   1.00 55.84 ? 1113 HOH A O     1 
HETATM 1074 O O     . HOH C 3 .   ? -10.724 68.686 1.782   1.00 56.01 ? 1114 HOH A O     1 
HETATM 1075 O O     . HOH C 3 .   ? -8.289  56.556 -21.135 1.00 55.12 ? 1115 HOH A O     1 
HETATM 1076 O O     . HOH C 3 .   ? 10.095  43.752 10.775  1.00 53.58 ? 1116 HOH A O     1 
HETATM 1077 O O     . HOH C 3 .   ? 16.052  44.937 -3.354  1.00 51.49 ? 1117 HOH A O     1 
HETATM 1078 O O     . HOH C 3 .   ? 8.607   45.457 -9.991  1.00 53.42 ? 1118 HOH A O     1 
HETATM 1079 O O     . HOH C 3 .   ? 0.000   65.536 3.341   1.00 48.90 ? 1119 HOH A O     1 
HETATM 1080 O O     . HOH C 3 .   ? 6.082   56.762 3.363   1.00 46.11 ? 1120 HOH A O     1 
HETATM 1081 O O     . HOH C 3 .   ? -4.493  53.802 -15.993 1.00 45.95 ? 1121 HOH A O     1 
HETATM 1082 O O     . HOH C 3 .   ? -2.868  47.995 18.571  1.00 47.32 ? 1122 HOH A O     1 
HETATM 1083 O O     . HOH C 3 .   ? 18.454  46.452 1.945   1.00 54.40 ? 1123 HOH A O     1 
HETATM 1084 O O     . HOH C 3 .   ? -17.823 56.489 1.030   1.00 47.70 ? 1124 HOH A O     1 
HETATM 1085 O O     . HOH C 3 .   ? -21.903 50.121 -4.462  1.00 52.02 ? 1125 HOH A O     1 
HETATM 1086 O O     . HOH C 3 .   ? 15.494  43.581 -1.457  1.00 55.15 ? 1126 HOH A O     1 
HETATM 1087 O O     . HOH C 3 .   ? 6.999   55.743 0.350   1.00 58.30 ? 1127 HOH A O     1 
HETATM 1088 O O     . HOH C 3 .   ? 12.788  39.496 -7.978  1.00 52.41 ? 1128 HOH A O     1 
HETATM 1089 O O     . HOH C 3 .   ? -2.709  31.621 0.961   1.00 56.01 ? 1129 HOH A O     1 
HETATM 1090 O O     . HOH C 3 .   ? -18.986 40.562 -4.332  1.00 49.66 ? 1130 HOH A O     1 
HETATM 1091 O O     . HOH C 3 .   ? 11.473  54.080 1.581   1.00 48.32 ? 1131 HOH A O     1 
HETATM 1092 O O     . HOH C 3 .   ? 11.758  45.567 7.897   1.00 56.10 ? 1132 HOH A O     1 
HETATM 1093 O O     . HOH C 3 .   ? 8.392   37.092 -2.882  1.00 55.60 ? 1133 HOH A O     1 
HETATM 1094 O O     . HOH C 3 .   ? -5.197  56.078 -16.472 1.00 59.74 ? 1134 HOH A O     1 
HETATM 1095 O O     . HOH C 3 .   ? 15.085  38.294 -4.611  1.00 47.04 ? 1135 HOH A O     1 
HETATM 1096 O O     . HOH C 3 .   ? -3.693  65.778 7.728   1.00 54.06 ? 1136 HOH A O     1 
HETATM 1097 O O     . HOH C 3 .   ? 6.965   40.689 8.579   1.00 50.25 ? 1137 HOH A O     1 
HETATM 1098 O O     . HOH C 3 .   ? -2.565  47.045 8.048   1.00 36.18 ? 1138 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . VAL A 4   ? 0.3099 0.6990 0.4266 -0.1156 0.0011  -0.1438 4    VAL A N     
2    C CA    . VAL A 4   ? 0.3288 0.5573 0.4698 -0.1345 -0.0503 0.1303  4    VAL A CA    
3    C C     . VAL A 4   ? 0.3280 0.4889 0.2561 -0.1131 -0.0361 0.0779  4    VAL A C     
4    O O     . VAL A 4   ? 0.4430 0.6003 0.2324 -0.1075 -0.0143 0.0576  4    VAL A O     
5    C CB    . VAL A 4   ? 0.6689 0.7013 0.5662 -0.3485 -0.0651 0.2464  4    VAL A CB    
6    C CG1   . VAL A 4   ? 0.8450 0.5512 0.6452 -0.0657 0.1967  0.2163  4    VAL A CG1   
7    C CG2   . VAL A 4   ? 1.3800 0.7982 0.3981 -0.3370 0.1855  0.0573  4    VAL A CG2   
8    N N     . ALA A 5   ? 0.3429 0.3516 0.2958 -0.0727 -0.0175 0.0745  5    ALA A N     
9    C CA    . ALA A 5   ? 0.3187 0.3490 0.2640 -0.0380 -0.0159 0.0577  5    ALA A CA    
10   C C     . ALA A 5   ? 0.3768 0.3224 0.2661 -0.0284 -0.0522 0.0244  5    ALA A C     
11   O O     . ALA A 5   ? 0.3785 0.3163 0.2463 -0.0338 -0.0382 0.0418  5    ALA A O     
12   C CB    . ALA A 5   ? 0.3560 0.3002 0.2723 -0.0435 0.0171  0.0412  5    ALA A CB    
13   N N     . PHE A 6   ? 0.3277 0.3145 0.2261 -0.0378 -0.0155 0.0622  6    PHE A N     
14   C CA    . PHE A 6   ? 0.3787 0.3044 0.1918 -0.0024 -0.0387 0.0019  6    PHE A CA    
15   C C     . PHE A 6   ? 0.3867 0.2637 0.2117 -0.0298 -0.0021 0.0088  6    PHE A C     
16   O O     . PHE A 6   ? 0.4162 0.2798 0.2443 -0.0359 0.0125  0.0379  6    PHE A O     
17   C CB    . PHE A 6   ? 0.3648 0.3001 0.2158 -0.0050 -0.0262 -0.0111 6    PHE A CB    
18   C CG    . PHE A 6   ? 0.3605 0.2682 0.1945 -0.0247 -0.0290 -0.0098 6    PHE A CG    
19   C CD1   . PHE A 6   ? 0.3897 0.3339 0.2011 0.0329  -0.0280 -0.0218 6    PHE A CD1   
20   C CD2   . PHE A 6   ? 0.4292 0.2312 0.2114 -0.0313 -0.0178 0.0143  6    PHE A CD2   
21   C CE1   . PHE A 6   ? 0.3708 0.3285 0.2706 0.0176  -0.0320 0.0137  6    PHE A CE1   
22   C CE2   . PHE A 6   ? 0.4560 0.2742 0.2169 -0.0400 -0.0492 0.0377  6    PHE A CE2   
23   C CZ    . PHE A 6   ? 0.4276 0.3390 0.2700 -0.0055 -0.0735 0.0285  6    PHE A CZ    
24   N N     . GLY A 7   ? 0.4028 0.2546 0.2599 -0.0314 -0.0660 0.0075  7    GLY A N     
25   C CA    . GLY A 7   ? 0.4166 0.2658 0.3058 -0.0006 -0.0668 -0.0040 7    GLY A CA    
26   C C     . GLY A 7   ? 0.4645 0.2943 0.3021 0.0165  -0.0697 -0.0273 7    GLY A C     
27   O O     . GLY A 7   ? 0.5306 0.3285 0.2734 0.0119  -0.0169 -0.0054 7    GLY A O     
28   N N     . SER A 8   ? 0.4481 0.2762 0.2843 -0.0274 -0.0855 0.0221  8    SER A N     
29   C CA    . SER A 8   ? 0.4985 0.2768 0.2992 -0.0151 -0.0799 -0.0250 8    SER A CA    
30   C C     . SER A 8   ? 0.6507 0.2727 0.2329 -0.0205 0.0511  -0.0181 8    SER A C     
31   O O     . SER A 8   ? 0.5189 0.2799 0.2646 -0.0749 -0.0008 -0.0086 8    SER A O     
32   C CB    . SER A 8   ? 0.4669 0.3546 0.4205 -0.0447 -0.1265 -0.0043 8    SER A CB    
33   O OG    . SER A 8   ? 0.3867 0.3758 0.3447 -0.0179 -0.0605 0.0128  8    SER A OG    
34   N N     . GLU A 9   ? 0.6891 0.3582 0.2739 -0.0589 -0.0039 -0.0781 9    GLU A N     
35   C CA    . GLU A 9   ? 0.7304 0.3314 0.3873 -0.1703 0.0939  -0.1416 9    GLU A CA    
36   C C     . GLU A 9   ? 0.6701 0.4241 0.2727 -0.1422 0.0019  -0.0492 9    GLU A C     
37   O O     . GLU A 9   ? 0.7808 0.4040 0.2945 -0.1286 0.0064  -0.0531 9    GLU A O     
38   C CB    . GLU A 9   ? 0.9427 0.4105 0.3997 -0.1858 0.2220  -0.1544 9    GLU A CB    
39   C CG    . GLU A 9   ? 1.3068 0.5533 0.3863 -0.1926 0.0973  -0.1181 9    GLU A CG    
40   C CD    . GLU A 9   ? 1.6988 0.6251 0.3587 -0.2986 0.1921  -0.1607 9    GLU A CD    
41   O OE1   . GLU A 9   ? 1.9137 0.8577 0.5415 -0.3841 0.3013  -0.0099 9    GLU A OE1   
42   O OE2   . GLU A 9   ? 2.3054 0.7382 0.5104 -0.3642 0.3294  -0.3901 9    GLU A OE2   
43   N N     . ASP A 10  ? 0.6462 0.4440 0.3467 -0.1653 -0.0168 -0.1032 10   ASP A N     
44   C CA    . ASP A 10  ? 0.6165 0.3700 0.3241 -0.1382 -0.0715 -0.0664 10   ASP A CA    
45   C C     . ASP A 10  ? 0.5348 0.3704 0.2966 -0.0975 -0.1013 -0.0177 10   ASP A C     
46   O O     . ASP A 10  ? 0.5387 0.3653 0.3113 -0.0924 -0.1070 0.0349  10   ASP A O     
47   C CB    . ASP A 10  ? 0.7273 0.4509 0.3239 -0.2295 -0.1094 -0.0357 10   ASP A CB    
48   C CG    . ASP A 10  ? 0.6789 0.5451 0.3212 -0.2548 -0.1289 0.0581  10   ASP A CG    
49   O OD1   . ASP A 10  ? 0.5403 0.4859 0.4428 -0.1598 -0.0903 0.0481  10   ASP A OD1   
50   O OD2   . ASP A 10  ? 0.6906 0.6023 0.5488 -0.2445 -0.1985 -0.0149 10   ASP A OD2   
51   N N     . ILE A 11  ? 0.5458 0.3096 0.2377 -0.0837 -0.0925 0.0012  11   ILE A N     
52   C CA    . ILE A 11  ? 0.4427 0.2983 0.2511 -0.0376 -0.0857 0.0304  11   ILE A CA    
53   C C     . ILE A 11  ? 0.5003 0.3054 0.2716 -0.0533 -0.0698 0.0347  11   ILE A C     
54   O O     . ILE A 11  ? 0.4372 0.3234 0.3250 -0.0801 -0.0687 0.0390  11   ILE A O     
55   C CB    . ILE A 11  ? 0.4114 0.3327 0.2600 -0.0232 -0.0806 -0.0184 11   ILE A CB    
56   C CG1   . ILE A 11  ? 0.3897 0.3969 0.3046 -0.0453 -0.0491 -0.0592 11   ILE A CG1   
57   C CG2   . ILE A 11  ? 0.4313 0.4082 0.3317 0.0003  -0.0931 0.0330  11   ILE A CG2   
58   C CD1   . ILE A 11  ? 0.5140 0.3972 0.5021 0.0430  -0.1338 -0.0967 11   ILE A CD1   
59   N N     . GLU A 12  ? 0.5148 0.2925 0.2954 -0.0679 -0.0789 0.0420  12   GLU A N     
60   C CA    . GLU A 12  ? 0.5471 0.3615 0.3414 -0.0943 -0.0889 0.0972  12   GLU A CA    
61   C C     . GLU A 12  ? 0.5977 0.3209 0.2986 -0.1498 -0.0941 0.0730  12   GLU A C     
62   O O     . GLU A 12  ? 0.5224 0.3446 0.2885 -0.0663 -0.0926 0.0449  12   GLU A O     
63   C CB    . GLU A 12  ? 0.6949 0.4029 0.3308 -0.0363 -0.1156 0.1375  12   GLU A CB    
64   C CG    . GLU A 12  ? 0.7226 0.3527 0.4655 -0.0631 -0.0939 0.0989  12   GLU A CG    
65   C CD    . GLU A 12  ? 0.6655 0.3902 0.4731 -0.1233 -0.0991 -0.0321 12   GLU A CD    
66   O OE1   . GLU A 12  ? 0.6875 0.3496 0.4082 -0.0520 -0.0452 -0.0051 12   GLU A OE1   
67   O OE2   . GLU A 12  ? 0.6488 0.3625 0.8427 -0.1067 0.0563  -0.0774 12   GLU A OE2   
68   N N     . ASN A 13  ? 0.5523 0.2838 0.2939 -0.0346 -0.0723 0.0305  13   ASN A N     
69   C CA    . ASN A 13  ? 0.6093 0.3251 0.3201 -0.0896 -0.1034 -0.0190 13   ASN A CA    
70   C C     . ASN A 13  ? 0.4896 0.3396 0.2742 -0.1198 -0.0851 0.0464  13   ASN A C     
71   O O     . ASN A 13  ? 0.5078 0.4848 0.3233 -0.1684 -0.0620 0.0687  13   ASN A O     
72   C CB    . ASN A 13  ? 0.6707 0.4225 0.3149 -0.0394 -0.1068 -0.0191 13   ASN A CB    
73   C CG    . ASN A 13  ? 0.6532 0.4714 0.3343 0.0119  -0.1190 -0.0666 13   ASN A CG    
74   O OD1   . ASN A 13  ? 0.6033 0.4581 0.4549 -0.0429 -0.1300 0.0166  13   ASN A OD1   
75   N ND2   . ASN A 13  ? 0.6660 0.6721 0.3820 0.1493  -0.1392 -0.2230 13   ASN A ND2   
76   N N     . THR A 14  ? 0.4696 0.3195 0.2929 -0.0937 -0.0971 0.0562  14   THR A N     
77   C CA    . THR A 14  ? 0.4497 0.3555 0.3364 -0.0700 -0.0575 0.0857  14   THR A CA    
78   C C     . THR A 14  ? 0.4736 0.3883 0.3510 -0.1774 -0.0286 0.0001  14   THR A C     
79   O O     . THR A 14  ? 0.4841 0.5369 0.4309 -0.2294 0.0220  -0.0518 14   THR A O     
80   C CB    . THR A 14  ? 0.4456 0.3294 0.3694 -0.0497 -0.0966 0.1064  14   THR A CB    
81   O OG1   . THR A 14  ? 0.4725 0.3955 0.3673 -0.1045 -0.0863 0.1190  14   THR A OG1   
82   C CG2   . THR A 14  ? 0.4560 0.3685 0.4789 -0.0228 -0.1009 0.0829  14   THR A CG2   
83   N N     . LEU A 15  ? 0.5282 0.3476 0.3137 -0.1563 -0.0481 -0.0075 15   LEU A N     
84   C CA    . LEU A 15  ? 0.6566 0.4641 0.3180 -0.2921 -0.0249 -0.0356 15   LEU A CA    
85   C C     . LEU A 15  ? 0.5964 0.4483 0.3018 -0.2236 -0.1006 0.0508  15   LEU A C     
86   O O     . LEU A 15  ? 0.7343 0.5533 0.3192 -0.3630 -0.0337 -0.0077 15   LEU A O     
87   C CB    . LEU A 15  ? 0.6838 0.5170 0.2822 -0.3172 -0.0452 -0.0298 15   LEU A CB    
88   C CG    . LEU A 15  ? 0.6996 0.5217 0.3457 -0.3416 -0.0391 -0.0243 15   LEU A CG    
89   C CD1   . LEU A 15  ? 0.5557 0.4615 0.3342 -0.2270 0.0331  -0.0500 15   LEU A CD1   
90   C CD2   . LEU A 15  ? 0.8452 0.5786 0.4081 -0.3442 -0.1679 -0.0794 15   LEU A CD2   
91   N N     . ALA A 16  ? 0.4912 0.4477 0.3404 -0.2309 -0.1093 0.0425  16   ALA A N     
92   C CA    . ALA A 16  ? 0.5177 0.4448 0.3144 -0.2137 -0.0753 0.0387  16   ALA A CA    
93   C C     . ALA A 16  ? 0.5152 0.4995 0.3468 -0.2355 -0.0418 0.0477  16   ALA A C     
94   O O     . ALA A 16  ? 0.6281 0.6362 0.3397 -0.2294 0.0793  0.0427  16   ALA A O     
95   C CB    . ALA A 16  ? 0.7175 0.4093 0.3103 -0.1941 -0.0123 0.0702  16   ALA A CB    
96   N N     . LYS A 17  ? 0.4946 0.4308 0.3699 -0.1786 -0.0335 -0.0161 17   LYS A N     
97   C CA    . LYS A 17  ? 0.4945 0.5498 0.3496 -0.1533 0.0027  -0.0288 17   LYS A CA    
98   C C     . LYS A 17  ? 0.4667 0.6082 0.4086 -0.2280 0.1088  -0.0823 17   LYS A C     
99   O O     . LYS A 17  ? 0.4697 0.6887 0.4237 -0.1887 0.1193  -0.0218 17   LYS A O     
100  C CB    . LYS A 17  ? 0.4568 0.5353 0.3654 -0.1019 0.0275  -0.0072 17   LYS A CB    
101  C CG    . LYS A 17  ? 0.7193 0.3923 0.3298 -0.1125 -0.0251 0.0349  17   LYS A CG    
102  C CD    . LYS A 17  ? 0.5573 0.4149 0.3632 0.0017  0.0287  0.0517  17   LYS A CD    
103  C CE    . LYS A 17  ? 0.4794 0.5140 0.3247 -0.0602 -0.0229 0.0127  17   LYS A CE    
104  N NZ    . LYS A 17  ? 0.5860 0.5170 0.3054 -0.1471 -0.0637 0.0130  17   LYS A NZ    
105  N N     . MET A 18  ? 0.4975 0.6418 0.5528 -0.2515 0.1112  -0.1765 18   MET A N     
106  C CA    . MET A 18  ? 0.5511 0.6995 0.6140 -0.2933 0.2183  -0.2397 18   MET A CA    
107  C C     . MET A 18  ? 0.7754 0.7544 0.6263 -0.3548 0.2719  -0.2425 18   MET A C     
108  O O     . MET A 18  ? 1.3241 0.5095 0.7156 -0.2965 0.3658  -0.0885 18   MET A O     
109  C CB    . MET A 18  ? 0.5656 0.6860 0.6005 -0.3067 0.1597  -0.2228 18   MET A CB    
110  C CG    . MET A 18  ? 0.4175 0.6906 0.6317 -0.2068 0.1577  -0.1638 18   MET A CG    
111  S SD    . MET A 18  ? 0.4992 0.6366 0.4844 -0.2170 0.0396  -0.1105 18   MET A SD    
112  C CE    . MET A 18  ? 0.4872 0.6460 0.5140 -0.0720 0.0519  -0.1114 18   MET A CE    
113  N N     . ASP A 19  ? 0.7759 0.9235 0.7150 -0.3849 0.3716  -0.3055 19   ASP A N     
114  C CA    . ASP A 19  ? 0.7707 0.9954 0.7164 -0.3618 0.3558  -0.2651 19   ASP A CA    
115  C C     . ASP A 19  ? 0.8539 1.0410 0.6841 -0.3393 0.1996  -0.2401 19   ASP A C     
116  O O     . ASP A 19  ? 0.5102 1.1375 0.6182 -0.2958 0.0715  -0.3490 19   ASP A O     
117  C CB    . ASP A 19  ? 0.7892 1.0045 0.7885 -0.3452 0.4110  -0.3078 19   ASP A CB    
118  C CG    . ASP A 19  ? 0.8513 1.0150 0.8582 -0.3076 0.3367  -0.4165 19   ASP A CG    
119  O OD1   . ASP A 19  ? 0.8216 1.0296 1.0556 -0.2843 0.3954  -0.2640 19   ASP A OD1   
120  O OD2   . ASP A 19  ? 0.6444 0.9341 0.7391 -0.1850 0.2530  -0.4156 19   ASP A OD2   
121  N N     . ASP A 20  ? 0.7310 0.9934 0.6881 -0.2099 0.1716  -0.2202 20   ASP A N     
122  C CA    . ASP A 20  ? 0.6921 0.9555 0.6733 -0.1123 0.1224  -0.1965 20   ASP A CA    
123  C C     . ASP A 20  ? 0.7775 0.9951 0.6599 -0.1098 0.0505  -0.1635 20   ASP A C     
124  O O     . ASP A 20  ? 0.9280 0.9019 0.6843 -0.0232 0.2821  0.0869  20   ASP A O     
125  C CB    . ASP A 20  ? 0.6168 0.9690 0.6592 -0.0610 0.0930  -0.1754 20   ASP A CB    
126  C CG    . ASP A 20  ? 0.5845 0.9977 0.7328 -0.0149 0.0890  -0.1267 20   ASP A CG    
127  O OD1   . ASP A 20  ? 0.5929 1.1449 0.7363 -0.2189 0.1544  -0.1524 20   ASP A OD1   
128  O OD2   . ASP A 20  ? 0.5848 0.9219 0.8359 0.1771  0.0537  -0.0820 20   ASP A OD2   
129  N N     . GLY A 21  ? 0.5886 0.9633 0.5181 -0.0100 0.0080  -0.2095 21   GLY A N     
130  C CA    . GLY A 21  ? 0.3803 1.0781 0.5738 -0.0501 -0.1476 -0.0937 21   GLY A CA    
131  C C     . GLY A 21  ? 0.3840 1.0447 0.6014 -0.0617 -0.1153 -0.1158 21   GLY A C     
132  O O     . GLY A 21  ? 0.4001 1.2682 0.7719 -0.2555 0.0097  -0.2222 21   GLY A O     
133  N N     . GLN A 22  ? 0.3329 1.0503 0.6585 -0.0028 -0.0937 -0.1650 22   GLN A N     
134  C CA    . GLN A 22  ? 0.3325 0.9292 0.6271 0.0874  -0.1377 -0.1034 22   GLN A CA    
135  C C     . GLN A 22  ? 0.3285 0.7115 0.5597 0.0691  -0.1169 -0.0126 22   GLN A C     
136  O O     . GLN A 22  ? 0.3822 0.6489 0.5536 0.1530  -0.0964 0.0375  22   GLN A O     
137  C CB    . GLN A 22  ? 0.2763 1.0003 0.6848 0.1616  -0.2057 -0.1800 22   GLN A CB    
138  C CG    . GLN A 22  ? 0.4105 1.2824 0.8187 -0.0970 -0.1329 -0.1404 22   GLN A CG    
139  C CD    . GLN A 22  ? 0.3475 1.2750 0.7660 0.0078  -0.2921 -0.1102 22   GLN A CD    
140  O OE1   . GLN A 22  ? 0.5278 1.3095 0.4746 -0.2355 0.0903  -0.0899 22   GLN A OE1   
141  N NE2   . GLN A 22  ? 0.8026 1.3555 0.8009 0.1661  -0.3826 -0.0984 22   GLN A NE2   
142  N N     . LEU A 23  ? 0.3166 0.6652 0.4303 0.0221  -0.0612 -0.0505 23   LEU A N     
143  C CA    . LEU A 23  ? 0.3119 0.5781 0.3587 0.0337  -0.0414 -0.0241 23   LEU A CA    
144  C C     . LEU A 23  ? 0.3054 0.5639 0.3895 0.0379  -0.0223 -0.0085 23   LEU A C     
145  O O     . LEU A 23  ? 0.3070 0.5632 0.2908 0.0499  -0.0236 -0.0085 23   LEU A O     
146  C CB    . LEU A 23  ? 0.3651 0.5782 0.3512 -0.0152 -0.0507 -0.0049 23   LEU A CB    
147  C CG    . LEU A 23  ? 0.4429 0.5190 0.3251 0.0438  -0.0320 0.0350  23   LEU A CG    
148  C CD1   . LEU A 23  ? 0.7049 0.4057 0.3917 0.0073  0.0407  0.0453  23   LEU A CD1   
149  C CD2   . LEU A 23  ? 0.4335 0.4707 0.3825 -0.0235 0.0123  0.1347  23   LEU A CD2   
150  N N     . ASP A 24  ? 0.2722 0.5415 0.3225 0.0010  -0.0177 0.0164  24   ASP A N     
151  C CA    . ASP A 24  ? 0.3351 0.5562 0.3673 -0.0206 0.0142  -0.0140 24   ASP A CA    
152  C C     . ASP A 24  ? 0.4002 0.5146 0.4073 0.0089  0.0458  -0.0001 24   ASP A C     
153  O O     . ASP A 24  ? 0.4102 0.4511 0.6446 0.0590  -0.0008 0.0174  24   ASP A O     
154  C CB    . ASP A 24  ? 0.3026 0.4827 0.4041 0.0745  0.0073  0.0538  24   ASP A CB    
155  C CG    . ASP A 24  ? 0.3043 0.5586 0.3644 0.0815  -0.0029 0.0365  24   ASP A CG    
156  O OD1   . ASP A 24  ? 0.3500 0.3761 0.4586 0.0547  -0.0448 0.0175  24   ASP A OD1   
157  O OD2   . ASP A 24  ? 0.3444 0.7322 0.3848 0.0496  0.0324  -0.0052 24   ASP A OD2   
158  N N     . GLY A 25  ? 0.3038 0.5454 0.3799 0.0908  0.0577  0.0279  25   GLY A N     
159  C CA    . GLY A 25  ? 0.3164 0.5859 0.4565 0.1033  0.0306  0.0842  25   GLY A CA    
160  C C     . GLY A 25  ? 0.2898 0.5780 0.3456 0.0972  -0.0249 0.1257  25   GLY A C     
161  O O     . GLY A 25  ? 0.4599 0.6181 0.4589 0.1701  0.0497  0.2173  25   GLY A O     
162  N N     . LEU A 26  ? 0.2389 0.4814 0.3459 0.0403  -0.0618 0.0632  26   LEU A N     
163  C CA    . LEU A 26  ? 0.2838 0.3857 0.3896 0.0059  -0.0074 0.0543  26   LEU A CA    
164  C C     . LEU A 26  ? 0.3095 0.3352 0.2708 0.0280  -0.0204 0.0419  26   LEU A C     
165  O O     . LEU A 26  ? 0.3613 0.4178 0.2818 0.0415  -0.0318 0.0095  26   LEU A O     
166  C CB    . LEU A 26  ? 0.3464 0.3353 0.2607 -0.0028 -0.0313 -0.0126 26   LEU A CB    
167  C CG    . LEU A 26  ? 0.4127 0.3836 0.2861 -0.0571 -0.0580 0.0163  26   LEU A CG    
168  C CD1   . LEU A 26  ? 0.3476 0.3543 0.4068 -0.0222 -0.0194 0.0150  26   LEU A CD1   
169  C CD2   . LEU A 26  ? 0.4660 0.4476 0.2917 -0.1293 -0.0304 -0.0355 26   LEU A CD2   
170  N N     . ALA A 27  ? 0.2683 0.3558 0.2734 0.0209  -0.0337 0.0410  27   ALA A N     
171  C CA    . ALA A 27  ? 0.3037 0.3470 0.2274 0.0117  -0.0344 0.0367  27   ALA A CA    
172  C C     . ALA A 27  ? 0.2845 0.2843 0.2476 0.0131  -0.0211 0.0224  27   ALA A C     
173  O O     . ALA A 27  ? 0.3328 0.2926 0.2963 -0.0110 -0.0545 0.0304  27   ALA A O     
174  C CB    . ALA A 27  ? 0.3249 0.4001 0.2326 0.0333  -0.0150 0.0425  27   ALA A CB    
175  N N     . PHE A 28  ? 0.3337 0.2985 0.2865 -0.0065 -0.0838 0.0359  28   PHE A N     
176  C CA    . PHE A 28  ? 0.3145 0.3023 0.2269 0.0044  -0.0494 0.0298  28   PHE A CA    
177  C C     . PHE A 28  ? 0.3084 0.3107 0.2203 -0.0382 -0.0518 0.0065  28   PHE A C     
178  O O     . PHE A 28  ? 0.2981 0.3397 0.2634 -0.0103 -0.0096 0.0314  28   PHE A O     
179  C CB    . PHE A 28  ? 0.3495 0.3140 0.2296 -0.0113 -0.0392 -0.0004 28   PHE A CB    
180  C CG    . PHE A 28  ? 0.3527 0.3103 0.2248 -0.0070 -0.0645 0.0289  28   PHE A CG    
181  C CD1   . PHE A 28  ? 0.3801 0.2807 0.2528 0.0082  -0.0071 0.0095  28   PHE A CD1   
182  C CD2   . PHE A 28  ? 0.2958 0.3762 0.2160 0.0306  -0.0391 0.0010  28   PHE A CD2   
183  C CE1   . PHE A 28  ? 0.4545 0.3511 0.2087 -0.0588 -0.0044 0.0109  28   PHE A CE1   
184  C CE2   . PHE A 28  ? 0.3718 0.4370 0.1952 -0.0403 -0.0367 0.0083  28   PHE A CE2   
185  C CZ    . PHE A 28  ? 0.4216 0.3977 0.2023 -0.0187 0.0057  -0.0186 28   PHE A CZ    
186  N N     . GLY A 29  ? 0.3356 0.2413 0.2589 0.0215  -0.0834 0.0156  29   GLY A N     
187  C CA    . GLY A 29  ? 0.2757 0.2559 0.2488 0.0176  -0.0526 0.0065  29   GLY A CA    
188  C C     . GLY A 29  ? 0.3206 0.2648 0.2557 -0.0115 -0.0262 0.0099  29   GLY A C     
189  O O     . GLY A 29  ? 0.3118 0.2645 0.2256 0.0041  -0.0351 0.0111  29   GLY A O     
190  N N     . ALA A 30  ? 0.2915 0.2628 0.2425 0.0072  -0.0430 0.0294  30   ALA A N     
191  C CA    . ALA A 30  ? 0.3259 0.2845 0.2354 -0.0346 -0.0363 0.0363  30   ALA A CA    
192  C C     . ALA A 30  ? 0.3265 0.2669 0.2316 -0.0021 0.0016  0.0189  30   ALA A C     
193  O O     . ALA A 30  ? 0.3163 0.3219 0.2505 0.0097  0.0106  0.0305  30   ALA A O     
194  C CB    . ALA A 30  ? 0.3089 0.3241 0.2709 -0.0515 -0.0386 0.0260  30   ALA A CB    
195  N N     . ILE A 31  ? 0.3262 0.2625 0.2130 -0.0199 -0.0172 0.0187  31   ILE A N     
196  C CA    . ILE A 31  ? 0.2885 0.2723 0.2324 -0.0398 -0.0299 0.0287  31   ILE A CA    
197  C C     . ILE A 31  ? 0.3559 0.2568 0.2281 -0.0284 -0.0112 0.0293  31   ILE A C     
198  O O     . ILE A 31  ? 0.3468 0.3375 0.2311 -0.0390 -0.0188 -0.0101 31   ILE A O     
199  C CB    . ILE A 31  ? 0.2913 0.3284 0.2125 -0.0136 -0.0233 -0.0049 31   ILE A CB    
200  C CG1   . ILE A 31  ? 0.3424 0.3594 0.2378 -0.0541 -0.0592 -0.0439 31   ILE A CG1   
201  C CG2   . ILE A 31  ? 0.3009 0.4118 0.2494 0.0146  -0.0332 0.0475  31   ILE A CG2   
202  C CD1   . ILE A 31  ? 0.3633 0.3315 0.3984 -0.0385 -0.1370 0.0410  31   ILE A CD1   
203  N N     . GLN A 32  ? 0.2979 0.2682 0.2717 -0.0301 -0.0215 0.0415  32   GLN A N     
204  C CA    . GLN A 32  ? 0.2956 0.2767 0.2602 -0.0255 -0.0206 0.0198  32   GLN A CA    
205  C C     . GLN A 32  ? 0.3537 0.2556 0.2333 -0.0174 0.0154  0.0187  32   GLN A C     
206  O O     . GLN A 32  ? 0.3165 0.3058 0.2422 0.0099  -0.0128 -0.0095 32   GLN A O     
207  C CB    . GLN A 32  ? 0.2910 0.3345 0.3255 -0.0564 0.0111  -0.0137 32   GLN A CB    
208  C CG    . GLN A 32  ? 0.3731 0.3179 0.3472 -0.0602 -0.0426 0.0063  32   GLN A CG    
209  C CD    . GLN A 32  ? 0.3890 0.3908 0.4677 -0.0886 -0.0985 -0.0247 32   GLN A CD    
210  O OE1   . GLN A 32  ? 0.3776 0.5420 0.5467 -0.1512 -0.0329 -0.0380 32   GLN A OE1   
211  N NE2   . GLN A 32  ? 0.5249 0.4940 0.5082 -0.0509 -0.2084 -0.0818 32   GLN A NE2   
212  N N     . LEU A 33  ? 0.3011 0.2847 0.2310 -0.0112 -0.0186 0.0118  33   LEU A N     
213  C CA    . LEU A 33  ? 0.3132 0.2838 0.2047 -0.0159 0.0007  0.0147  33   LEU A CA    
214  C C     . LEU A 33  ? 0.3715 0.2925 0.2003 -0.0407 0.0278  0.0248  33   LEU A C     
215  O O     . LEU A 33  ? 0.3392 0.2993 0.2033 -0.0162 0.0072  0.0119  33   LEU A O     
216  C CB    . LEU A 33  ? 0.3131 0.2736 0.2358 -0.0001 -0.0128 0.0487  33   LEU A CB    
217  C CG    . LEU A 33  ? 0.2882 0.2610 0.2443 0.0143  0.0251  0.0146  33   LEU A CG    
218  C CD1   . LEU A 33  ? 0.2791 0.3838 0.2357 -0.0064 0.0061  0.0205  33   LEU A CD1   
219  C CD2   . LEU A 33  ? 0.3363 0.3416 0.2229 -0.0118 0.0261  -0.0061 33   LEU A CD2   
220  N N     . ASP A 34  ? 0.3517 0.2965 0.2047 -0.0276 0.0097  0.0320  34   ASP A N     
221  C CA    . ASP A 34  ? 0.3526 0.3038 0.2292 -0.0203 0.0036  0.0553  34   ASP A CA    
222  C C     . ASP A 34  ? 0.3551 0.3173 0.2428 -0.0144 0.0077  0.0214  34   ASP A C     
223  O O     . ASP A 34  ? 0.3595 0.3245 0.2241 -0.0090 0.0344  -0.0014 34   ASP A O     
224  C CB    . ASP A 34  ? 0.3550 0.3324 0.2407 -0.0319 0.0065  0.0658  34   ASP A CB    
225  C CG    . ASP A 34  ? 0.4520 0.3470 0.2316 -0.1654 -0.0131 0.0710  34   ASP A CG    
226  O OD1   . ASP A 34  ? 0.3665 0.2699 0.2339 -0.0317 0.0307  0.0126  34   ASP A OD1   
227  O OD2   . ASP A 34  ? 0.4095 0.3949 0.2494 -0.0824 0.0182  0.0674  34   ASP A OD2   
228  N N     . GLY A 35  ? 0.4024 0.3173 0.2321 0.0036  0.0038  0.0352  35   GLY A N     
229  C CA    . GLY A 35  ? 0.4149 0.3353 0.2493 -0.0014 0.0071  -0.0172 35   GLY A CA    
230  C C     . GLY A 35  ? 0.4113 0.2700 0.2532 0.0598  -0.0071 -0.0262 35   GLY A C     
231  O O     . GLY A 35  ? 0.4065 0.3717 0.3210 0.0852  -0.0054 0.0219  35   GLY A O     
232  N N     . ASP A 36  ? 0.4469 0.3420 0.2310 0.0382  -0.0097 -0.0129 36   ASP A N     
233  C CA    . ASP A 36  ? 0.4159 0.3548 0.2441 0.0569  -0.0175 -0.0255 36   ASP A CA    
234  C C     . ASP A 36  ? 0.3529 0.3634 0.2216 0.0633  0.0143  -0.0349 36   ASP A C     
235  O O     . ASP A 36  ? 0.4039 0.3549 0.3266 0.0675  -0.0628 -0.0385 36   ASP A O     
236  C CB    . ASP A 36  ? 0.4464 0.3538 0.2484 0.0806  -0.0319 0.0113  36   ASP A CB    
237  C CG    . ASP A 36  ? 0.5753 0.3477 0.5096 0.0874  0.1401  0.0272  36   ASP A CG    
238  O OD1   . ASP A 36  ? 0.6878 0.4104 0.4769 0.1369  0.1233  -0.0304 36   ASP A OD1   
239  O OD2   . ASP A 36  ? 1.3501 0.4674 1.1887 -0.0473 0.8851  0.0154  36   ASP A OD2   
240  N N     . GLY A 37  ? 0.3393 0.3367 0.2009 0.0146  0.0316  -0.0113 37   GLY A N     
241  C CA    . GLY A 37  ? 0.2630 0.3404 0.2550 -0.0090 0.0271  -0.0261 37   GLY A CA    
242  C C     . GLY A 37  ? 0.2578 0.3217 0.2132 -0.0314 0.0044  -0.0253 37   GLY A C     
243  O O     . GLY A 37  ? 0.2984 0.3336 0.3094 -0.0241 0.0076  -0.0641 37   GLY A O     
244  N N     . ASN A 38  ? 0.2769 0.3431 0.2130 -0.0056 0.0400  0.0073  38   ASN A N     
245  C CA    . ASN A 38  ? 0.3119 0.3428 0.2129 0.0370  0.0457  0.0211  38   ASN A CA    
246  C C     . ASN A 38  ? 0.3050 0.3067 0.2128 -0.0026 0.0113  -0.0007 38   ASN A C     
247  O O     . ASN A 38  ? 0.3291 0.3417 0.2173 0.0077  0.0102  -0.0053 38   ASN A O     
248  C CB    . ASN A 38  ? 0.3177 0.3887 0.2087 0.0292  0.0551  0.0381  38   ASN A CB    
249  C CG    . ASN A 38  ? 0.3529 0.3913 0.1924 0.0341  0.0397  0.0394  38   ASN A CG    
250  O OD1   . ASN A 38  ? 0.3902 0.4332 0.2149 0.0628  0.0132  -0.0045 38   ASN A OD1   
251  N ND2   . ASN A 38  ? 0.3570 0.3912 0.2462 0.0576  0.0600  0.0203  38   ASN A ND2   
252  N N     . ILE A 39  ? 0.2884 0.3019 0.2326 -0.0134 0.0170  0.0020  39   ILE A N     
253  C CA    . ILE A 39  ? 0.2786 0.3107 0.2743 0.0088  0.0047  -0.0192 39   ILE A CA    
254  C C     . ILE A 39  ? 0.2821 0.3121 0.2671 -0.0031 0.0200  0.0143  39   ILE A C     
255  O O     . ILE A 39  ? 0.3195 0.3777 0.2799 -0.0169 0.0486  0.0276  39   ILE A O     
256  C CB    . ILE A 39  ? 0.2898 0.3046 0.2254 -0.0019 0.0318  -0.0089 39   ILE A CB    
257  C CG1   . ILE A 39  ? 0.2934 0.3663 0.2299 -0.0240 0.0316  -0.0414 39   ILE A CG1   
258  C CG2   . ILE A 39  ? 0.3337 0.3230 0.2875 -0.0144 0.0000  0.0314  39   ILE A CG2   
259  C CD1   . ILE A 39  ? 0.3215 0.3402 0.3107 -0.0191 0.0158  -0.0415 39   ILE A CD1   
260  N N     . LEU A 40  ? 0.2832 0.3119 0.2738 -0.0355 0.0067  0.0293  40   LEU A N     
261  C CA    . LEU A 40  ? 0.2716 0.3240 0.2998 -0.0416 0.0235  0.0254  40   LEU A CA    
262  C C     . LEU A 40  ? 0.2987 0.3667 0.3155 0.0047  0.0271  0.0465  40   LEU A C     
263  O O     . LEU A 40  ? 0.2858 0.3705 0.3936 -0.0280 0.0195  0.0438  40   LEU A O     
264  C CB    . LEU A 40  ? 0.3133 0.3555 0.2909 -0.0308 -0.0204 0.0188  40   LEU A CB    
265  C CG    . LEU A 40  ? 0.4148 0.3065 0.3091 -0.0513 -0.0394 0.0226  40   LEU A CG    
266  C CD1   . LEU A 40  ? 0.3690 0.3567 0.4183 -0.0353 -0.1331 -0.0434 40   LEU A CD1   
267  C CD2   . LEU A 40  ? 0.6928 0.3061 0.4306 -0.0565 0.1187  0.0733  40   LEU A CD2   
268  N N     . GLN A 41  ? 0.2841 0.3450 0.3379 -0.0179 0.0036  0.0422  41   GLN A N     
269  C CA    . GLN A 41  ? 0.3069 0.3272 0.2719 -0.0150 0.0235  0.0045  41   GLN A CA    
270  C C     . GLN A 41  ? 0.3051 0.3302 0.2845 -0.0222 0.0351  -0.0145 41   GLN A C     
271  O O     . GLN A 41  ? 0.3057 0.3391 0.2747 -0.0015 0.0182  0.0209  41   GLN A O     
272  C CB    . GLN A 41  ? 0.2751 0.4085 0.3192 -0.0274 -0.0162 0.0351  41   GLN A CB    
273  C CG    . GLN A 41  ? 0.4421 0.3534 0.5074 -0.1228 -0.1318 0.0984  41   GLN A CG    
274  C CD    . GLN A 41  ? 0.3606 0.4596 0.5183 -0.0261 -0.1116 -0.0373 41   GLN A CD    
275  O OE1   . GLN A 41  ? 0.5852 0.6658 0.5715 0.1669  -0.2670 -0.0545 41   GLN A OE1   
276  N NE2   . GLN A 41  ? 0.8250 0.5456 0.5668 -0.0857 0.0299  -0.1152 41   GLN A NE2   
277  N N     . TYR A 42  ? 0.2803 0.3315 0.3121 -0.0176 0.0267  0.0109  42   TYR A N     
278  C CA    . TYR A 42  ? 0.2583 0.3192 0.2732 0.0029  -0.0020 0.0198  42   TYR A CA    
279  C C     . TYR A 42  ? 0.2558 0.3119 0.2446 0.0147  0.0084  -0.0172 42   TYR A C     
280  O O     . TYR A 42  ? 0.3116 0.3937 0.2989 0.0576  0.0491  0.0018  42   TYR A O     
281  C CB    . TYR A 42  ? 0.2919 0.3266 0.2599 0.0075  0.0130  0.0209  42   TYR A CB    
282  C CG    . TYR A 42  ? 0.3080 0.3274 0.2507 -0.0061 0.0214  -0.0416 42   TYR A CG    
283  C CD1   . TYR A 42  ? 0.3306 0.3368 0.2316 -0.0019 0.0083  -0.0125 42   TYR A CD1   
284  C CD2   . TYR A 42  ? 0.3179 0.3052 0.2605 -0.0249 -0.0370 -0.0056 42   TYR A CD2   
285  C CE1   . TYR A 42  ? 0.3177 0.3000 0.2709 0.0212  0.0096  -0.0343 42   TYR A CE1   
286  C CE2   . TYR A 42  ? 0.3148 0.2649 0.2497 -0.0127 0.0286  -0.0390 42   TYR A CE2   
287  C CZ    . TYR A 42  ? 0.3111 0.2663 0.1890 0.0031  0.0126  0.0004  42   TYR A CZ    
288  O OH    . TYR A 42  ? 0.3230 0.2533 0.2394 -0.0090 0.0077  -0.0158 42   TYR A OH    
289  N N     . ASN A 43  ? 0.3118 0.3085 0.2633 0.0311  0.0117  0.0070  43   ASN A N     
290  C CA    . ASN A 43  ? 0.2896 0.3380 0.2656 0.0376  -0.0122 0.0033  43   ASN A CA    
291  C C     . ASN A 43  ? 0.3246 0.3204 0.2514 0.0554  -0.0250 0.0050  43   ASN A C     
292  O O     . ASN A 43  ? 0.3107 0.3570 0.2390 0.0248  -0.0014 0.0015  43   ASN A O     
293  C CB    . ASN A 43  ? 0.2953 0.3582 0.2572 0.0010  0.0037  -0.0040 43   ASN A CB    
294  C CG    . ASN A 43  ? 0.2702 0.3356 0.2623 0.0171  -0.0214 0.0084  43   ASN A CG    
295  O OD1   . ASN A 43  ? 0.2534 0.3434 0.2739 0.0403  -0.0118 -0.0203 43   ASN A OD1   
296  N ND2   . ASN A 43  ? 0.2783 0.3576 0.2517 0.0027  -0.0199 0.0038  43   ASN A ND2   
297  N N     . ALA A 44  ? 0.3655 0.3368 0.3010 0.0931  -0.0286 -0.0328 44   ALA A N     
298  C CA    . ALA A 44  ? 0.3067 0.3243 0.3423 0.0728  0.0004  -0.0181 44   ALA A CA    
299  C C     . ALA A 44  ? 0.2712 0.3788 0.2829 0.0892  -0.0273 -0.0218 44   ALA A C     
300  O O     . ALA A 44  ? 0.3114 0.3201 0.2760 0.0670  -0.0274 -0.0007 44   ALA A O     
301  C CB    . ALA A 44  ? 0.2734 0.3394 0.4475 0.0646  -0.0243 -0.0242 44   ALA A CB    
302  N N     . ALA A 45  ? 0.3723 0.2870 0.2948 0.0415  -0.0019 -0.0070 45   ALA A N     
303  C CA    . ALA A 45  ? 0.3623 0.3307 0.2170 0.0255  -0.0474 0.0143  45   ALA A CA    
304  C C     . ALA A 45  ? 0.3619 0.3138 0.2270 0.0225  -0.0314 0.0209  45   ALA A C     
305  O O     . ALA A 45  ? 0.3440 0.3183 0.2538 0.0189  -0.0223 0.0145  45   ALA A O     
306  C CB    . ALA A 45  ? 0.3907 0.3524 0.2404 0.0669  -0.0474 -0.0275 45   ALA A CB    
307  N N     . GLN A 46  ? 0.2945 0.3265 0.2123 0.0219  -0.0284 0.0173  46   GLN A N     
308  C CA    . GLN A 46  ? 0.2841 0.3031 0.2251 0.0513  -0.0128 -0.0247 46   GLN A CA    
309  C C     . GLN A 46  ? 0.2706 0.3290 0.2072 0.0345  -0.0097 -0.0122 46   GLN A C     
310  O O     . GLN A 46  ? 0.2801 0.3032 0.3029 0.0244  -0.0502 -0.0067 46   GLN A O     
311  C CB    . GLN A 46  ? 0.2766 0.3119 0.3165 0.0342  -0.0190 0.0050  46   GLN A CB    
312  C CG    . GLN A 46  ? 0.2659 0.3223 0.2772 0.0394  -0.0132 -0.0046 46   GLN A CG    
313  C CD    . GLN A 46  ? 0.3092 0.4149 0.2179 0.1079  -0.0168 -0.0372 46   GLN A CD    
314  O OE1   . GLN A 46  ? 0.3651 0.4933 0.2393 0.1542  -0.0068 0.0104  46   GLN A OE1   
315  N NE2   . GLN A 46  ? 0.2728 0.4015 0.2666 0.0719  -0.0131 -0.0128 46   GLN A NE2   
316  N N     . GLY A 47  ? 0.2983 0.3000 0.2506 0.0475  0.0123  -0.0299 47   GLY A N     
317  C CA    . GLY A 47  ? 0.3501 0.3137 0.2369 0.0139  0.0280  -0.0279 47   GLY A CA    
318  C C     . GLY A 47  ? 0.4329 0.3355 0.2101 -0.0340 -0.0028 -0.0338 47   GLY A C     
319  O O     . GLY A 47  ? 0.3466 0.2977 0.3446 0.0483  -0.0801 -0.0447 47   GLY A O     
320  N N     . ASP A 48  ? 0.3904 0.3196 0.2683 0.0414  -0.0064 -0.0079 48   ASP A N     
321  C CA    . ASP A 48  ? 0.3727 0.3075 0.3934 0.0740  -0.0579 0.0295  48   ASP A CA    
322  C C     . ASP A 48  ? 0.3686 0.3023 0.3151 0.0470  -0.0766 -0.0183 48   ASP A C     
323  O O     . ASP A 48  ? 0.3986 0.3055 0.5927 0.0468  -0.1229 -0.0402 48   ASP A O     
324  C CB    . ASP A 48  ? 0.3748 0.3525 0.4063 0.0731  -0.0750 0.0481  48   ASP A CB    
325  C CG    . ASP A 48  ? 0.3721 0.4834 0.3605 0.0802  -0.0884 -0.0287 48   ASP A CG    
326  O OD1   . ASP A 48  ? 0.5164 0.3868 0.3780 0.1744  -0.0333 -0.0698 48   ASP A OD1   
327  O OD2   . ASP A 48  ? 0.4205 0.4941 0.4010 0.0814  -0.1304 0.0087  48   ASP A OD2   
328  N N     . ILE A 49  ? 0.3665 0.2940 0.3174 0.0558  -0.0514 0.0112  49   ILE A N     
329  C CA    . ILE A 49  ? 0.3726 0.3476 0.2922 0.0605  -0.0309 0.0748  49   ILE A CA    
330  C C     . ILE A 49  ? 0.3832 0.3006 0.3202 0.0234  -0.0671 0.0690  49   ILE A C     
331  O O     . ILE A 49  ? 0.3745 0.3504 0.3541 0.0118  -0.0417 0.0101  49   ILE A O     
332  C CB    . ILE A 49  ? 0.3297 0.3349 0.2910 0.0192  0.0043  0.0785  49   ILE A CB    
333  C CG1   . ILE A 49  ? 0.3976 0.2963 0.3476 0.0178  -0.0918 0.0447  49   ILE A CG1   
334  C CG2   . ILE A 49  ? 0.3317 0.4342 0.3617 0.0518  -0.0466 -0.0044 49   ILE A CG2   
335  C CD1   . ILE A 49  ? 0.3639 0.3815 0.3026 0.0040  0.0602  0.0255  49   ILE A CD1   
336  N N     . THR A 50  ? 0.3831 0.2759 0.2742 0.0571  -0.0440 0.0452  50   THR A N     
337  C CA    . THR A 50  ? 0.3972 0.2608 0.2561 0.0426  -0.0583 0.0110  50   THR A CA    
338  C C     . THR A 50  ? 0.3701 0.3005 0.2992 0.0522  -0.0679 -0.0452 50   THR A C     
339  O O     . THR A 50  ? 0.3686 0.3043 0.3015 0.0425  -0.0744 -0.0697 50   THR A O     
340  C CB    . THR A 50  ? 0.3586 0.2574 0.2531 0.0678  -0.0452 -0.0010 50   THR A CB    
341  O OG1   . THR A 50  ? 0.3725 0.2881 0.2530 0.0262  -0.0301 -0.0171 50   THR A OG1   
342  C CG2   . THR A 50  ? 0.3862 0.3091 0.2787 0.0645  -0.0332 -0.0428 50   THR A CG2   
343  N N     . GLY A 51  ? 0.3525 0.2775 0.3209 0.0353  -0.0488 -0.0210 51   GLY A N     
344  C CA    . GLY A 51  ? 0.3753 0.3118 0.3392 0.0509  -0.0481 -0.0492 51   GLY A CA    
345  C C     . GLY A 51  ? 0.3198 0.3636 0.3172 0.0300  -0.0275 -0.0680 51   GLY A C     
346  O O     . GLY A 51  ? 0.6004 0.3381 0.3424 0.0281  0.0527  -0.1054 51   GLY A O     
347  N N     . ARG A 52  ? 0.3179 0.3839 0.3199 -0.0073 -0.0567 -0.0494 52   ARG A N     
348  C CA    . ARG A 52  ? 0.3332 0.3432 0.3129 0.0572  -0.0132 -0.0401 52   ARG A CA    
349  C C     . ARG A 52  ? 0.3238 0.3950 0.3029 0.0239  -0.0148 -0.0722 52   ARG A C     
350  O O     . ARG A 52  ? 0.2999 0.4900 0.3023 0.0408  0.0153  -0.0049 52   ARG A O     
351  C CB    . ARG A 52  ? 0.3929 0.3578 0.3764 0.0686  -0.0624 -0.0674 52   ARG A CB    
352  C CG    . ARG A 52  ? 0.3864 0.3478 0.2889 0.0729  -0.0114 -0.0234 52   ARG A CG    
353  C CD    . ARG A 52  ? 0.3831 0.3548 0.3295 0.0671  -0.0358 0.0120  52   ARG A CD    
354  N NE    . ARG A 52  ? 0.3972 0.3695 0.2824 0.0710  -0.0480 -0.0403 52   ARG A NE    
355  C CZ    . ARG A 52  ? 0.3948 0.3583 0.2306 0.0857  -0.0724 -0.0377 52   ARG A CZ    
356  N NH1   . ARG A 52  ? 0.3862 0.3419 0.2676 0.0799  -0.0751 -0.0321 52   ARG A NH1   
357  N NH2   . ARG A 52  ? 0.4349 0.4240 0.2491 0.1220  -0.0828 0.0031  52   ARG A NH2   
358  N N     . ASP A 53  ? 0.3530 0.4542 0.3116 0.0933  0.0062  -0.0283 53   ASP A N     
359  C CA    . ASP A 53  ? 0.3532 0.4350 0.2902 0.0646  0.0183  -0.0388 53   ASP A CA    
360  C C     . ASP A 53  ? 0.3922 0.4261 0.2471 0.0709  0.0272  -0.0286 53   ASP A C     
361  O O     . ASP A 53  ? 0.4313 0.4338 0.2718 0.0652  0.0645  0.0059  53   ASP A O     
362  C CB    . ASP A 53  ? 0.4263 0.4336 0.3171 0.0941  0.0612  -0.0716 53   ASP A CB    
363  C CG    . ASP A 53  ? 0.4001 0.4345 0.3508 0.1832  0.0648  -0.0429 53   ASP A CG    
364  O OD1   . ASP A 53  ? 0.5681 0.6702 0.4399 0.0566  0.1980  -0.1204 53   ASP A OD1   
365  O OD2   . ASP A 53  ? 0.4749 0.5353 0.4716 0.0763  -0.0004 -0.1453 53   ASP A OD2   
366  N N     . PRO A 54  ? 0.3844 0.3974 0.2739 0.0764  0.0097  -0.0326 54   PRO A N     
367  C CA    . PRO A 54  ? 0.4027 0.3945 0.2624 0.0500  0.0163  -0.0158 54   PRO A CA    
368  C C     . PRO A 54  ? 0.3491 0.4596 0.3238 0.0497  0.0164  0.0193  54   PRO A C     
369  O O     . PRO A 54  ? 0.5160 0.4523 0.4130 -0.0520 0.1260  -0.0327 54   PRO A O     
370  C CB    . PRO A 54  ? 0.3031 0.3869 0.3137 0.0479  -0.0010 -0.0068 54   PRO A CB    
371  C CG    . PRO A 54  ? 0.3424 0.3958 0.2783 0.0319  0.0175  -0.0121 54   PRO A CG    
372  C CD    . PRO A 54  ? 0.3533 0.3908 0.2855 0.0667  -0.0018 -0.0244 54   PRO A CD    
373  N N     . LYS A 55  ? 0.4601 0.5237 0.2493 0.0179  0.0466  -0.0177 55   LYS A N     
374  C CA    . LYS A 55  ? 0.4893 0.6362 0.2732 -0.0570 0.0562  -0.0229 55   LYS A CA    
375  C C     . LYS A 55  ? 0.4746 0.5605 0.2725 -0.0569 0.1038  0.0079  55   LYS A C     
376  O O     . LYS A 55  ? 0.7694 0.6225 0.3306 -0.2203 0.0556  0.0233  55   LYS A O     
377  C CB    . LYS A 55  ? 0.4031 0.7344 0.3977 -0.0525 0.0483  0.0109  55   LYS A CB    
378  C CG    . LYS A 55  ? 0.4786 0.7806 0.5469 -0.0233 -0.0446 0.0496  55   LYS A CG    
379  C CD    . LYS A 55  ? 0.6285 0.9170 0.6152 -0.1610 -0.1859 0.1697  55   LYS A CD    
380  C CE    . LYS A 55  ? 0.6440 1.0107 0.6137 -0.1609 -0.2376 0.2109  55   LYS A CE    
381  N NZ    . LYS A 55  ? 0.7827 1.0548 0.4452 -0.2671 -0.2677 0.2390  55   LYS A NZ    
382  N N     . GLN A 56  ? 0.4455 0.4454 0.3166 0.0299  0.0707  -0.0164 56   GLN A N     
383  C CA    . GLN A 56  ? 0.5725 0.4470 0.2796 0.0507  0.0400  -0.0764 56   GLN A CA    
384  C C     . GLN A 56  ? 0.5154 0.4420 0.1982 0.0330  0.0097  -0.0411 56   GLN A C     
385  O O     . GLN A 56  ? 0.5025 0.5534 0.2632 0.0437  0.0364  0.0584  56   GLN A O     
386  C CB    . GLN A 56  ? 0.5905 0.5688 0.3753 0.0261  0.0582  -0.2042 56   GLN A CB    
387  C CG    . GLN A 56  ? 0.6813 0.7702 0.4590 -0.0104 -0.0493 -0.2131 56   GLN A CG    
388  C CD    . GLN A 56  ? 0.5983 0.7179 0.5774 0.0974  -0.0286 -0.3318 56   GLN A CD    
389  O OE1   . GLN A 56  ? 0.7315 0.7044 0.9117 0.0907  0.2019  -0.3191 56   GLN A OE1   
390  N NE2   . GLN A 56  ? 0.5218 0.8838 0.8764 0.0551  0.1327  -0.3630 56   GLN A NE2   
391  N N     . VAL A 57  ? 0.5423 0.4216 0.2221 0.0095  0.0571  -0.0110 57   VAL A N     
392  C CA    . VAL A 57  ? 0.4636 0.4517 0.2451 -0.0300 0.0601  -0.0344 57   VAL A CA    
393  C C     . VAL A 57  ? 0.3620 0.4159 0.2438 0.0234  0.0133  0.0087  57   VAL A C     
394  O O     . VAL A 57  ? 0.3143 0.4400 0.3358 0.0218  0.0672  0.0448  57   VAL A O     
395  C CB    . VAL A 57  ? 0.4980 0.4390 0.1973 -0.0520 0.0243  -0.0136 57   VAL A CB    
396  C CG1   . VAL A 57  ? 0.5088 0.4886 0.3269 -0.0912 -0.0179 -0.0248 57   VAL A CG1   
397  C CG2   . VAL A 57  ? 0.3908 0.4210 0.2439 0.0254  0.0265  -0.0359 57   VAL A CG2   
398  N N     . ILE A 58  ? 0.3345 0.3883 0.3055 0.0452  0.0572  -0.0009 58   ILE A N     
399  C CA    . ILE A 58  ? 0.3434 0.3823 0.3051 0.0294  0.0623  0.0129  58   ILE A CA    
400  C C     . ILE A 58  ? 0.3032 0.4169 0.2659 0.0318  0.0913  0.0189  58   ILE A C     
401  O O     . ILE A 58  ? 0.3400 0.4815 0.2803 0.0206  0.0557  -0.0167 58   ILE A O     
402  C CB    . ILE A 58  ? 0.3701 0.4337 0.2739 0.0181  0.0007  -0.0122 58   ILE A CB    
403  C CG1   . ILE A 58  ? 0.3241 0.4600 0.3176 -0.0037 0.0394  0.0390  58   ILE A CG1   
404  C CG2   . ILE A 58  ? 0.3355 0.4151 0.3518 0.0288  0.0791  -0.0244 58   ILE A CG2   
405  C CD1   . ILE A 58  ? 0.2751 0.4737 0.3507 0.0667  0.0696  0.0827  58   ILE A CD1   
406  N N     . GLY A 59  ? 0.2814 0.3572 0.2972 -0.0184 0.0139  0.0088  59   GLY A N     
407  C CA    . GLY A 59  ? 0.2847 0.4169 0.3228 -0.0248 0.0298  0.0665  59   GLY A CA    
408  C C     . GLY A 59  ? 0.2671 0.4096 0.2967 -0.0094 0.0534  0.0459  59   GLY A C     
409  O O     . GLY A 59  ? 0.3394 0.4107 0.2591 0.0075  0.0252  0.0302  59   GLY A O     
410  N N     . LYS A 60  ? 0.3171 0.3907 0.2478 -0.0254 0.0212  0.0051  60   LYS A N     
411  C CA    . LYS A 60  ? 0.3088 0.4178 0.2476 -0.0509 0.0503  -0.0515 60   LYS A CA    
412  C C     . LYS A 60  ? 0.3287 0.3387 0.1929 -0.0312 0.0464  0.0194  60   LYS A C     
413  O O     . LYS A 60  ? 0.3480 0.3509 0.2150 0.0052  0.0110  -0.0082 60   LYS A O     
414  C CB    . LYS A 60  ? 0.3050 0.3833 0.2912 0.0002  0.0304  -0.0393 60   LYS A CB    
415  C CG    . LYS A 60  ? 0.4283 0.4504 0.3299 0.0021  0.0779  -0.0925 60   LYS A CG    
416  C CD    . LYS A 60  ? 0.4231 0.4509 0.3521 0.0388  -0.0250 -0.1037 60   LYS A CD    
417  C CE    . LYS A 60  ? 0.6415 0.5367 0.5357 0.0225  0.1050  -0.2272 60   LYS A CE    
418  N NZ    . LYS A 60  ? 0.7068 0.5239 0.5627 0.0303  0.1124  -0.2171 60   LYS A NZ    
419  N N     . ASN A 61  ? 0.3181 0.3923 0.2255 -0.0346 0.0225  0.0017  61   ASN A N     
420  C CA    . ASN A 61  ? 0.3131 0.4006 0.2954 -0.0237 0.0449  -0.0114 61   ASN A CA    
421  C C     . ASN A 61  ? 0.2672 0.3537 0.2620 0.0065  0.0253  -0.0297 61   ASN A C     
422  O O     . ASN A 61  ? 0.3328 0.3489 0.2590 0.0023  0.0172  -0.0531 61   ASN A O     
423  C CB    . ASN A 61  ? 0.3834 0.3663 0.3582 -0.0215 0.0372  0.0104  61   ASN A CB    
424  C CG    . ASN A 61  ? 0.4177 0.3062 0.3704 -0.0169 0.0481  0.0182  61   ASN A CG    
425  O OD1   . ASN A 61  ? 0.3377 0.3163 0.3903 0.0286  0.0034  0.0008  61   ASN A OD1   
426  N ND2   . ASN A 61  ? 0.4727 0.3062 0.3618 -0.0337 0.0207  0.0487  61   ASN A ND2   
427  N N     . PHE A 62  ? 0.3133 0.3275 0.2620 -0.0198 0.0005  -0.0240 62   PHE A N     
428  C CA    . PHE A 62  ? 0.2894 0.3137 0.2531 0.0078  -0.0077 -0.0282 62   PHE A CA    
429  C C     . PHE A 62  ? 0.2873 0.3025 0.2682 0.0015  0.0247  -0.0520 62   PHE A C     
430  O O     . PHE A 62  ? 0.2857 0.3026 0.2859 0.0047  0.0038  -0.0424 62   PHE A O     
431  C CB    . PHE A 62  ? 0.3558 0.2729 0.2388 -0.0090 -0.0038 -0.0484 62   PHE A CB    
432  C CG    . PHE A 62  ? 0.2805 0.2796 0.2585 0.0054  -0.0201 -0.0332 62   PHE A CG    
433  C CD1   . PHE A 62  ? 0.3104 0.2816 0.2556 0.0144  -0.0337 -0.0304 62   PHE A CD1   
434  C CD2   . PHE A 62  ? 0.3036 0.3334 0.2487 0.0195  -0.0112 -0.0381 62   PHE A CD2   
435  C CE1   . PHE A 62  ? 0.2771 0.3247 0.2664 0.0300  -0.0203 0.0056  62   PHE A CE1   
436  C CE2   . PHE A 62  ? 0.2838 0.3067 0.2811 0.0013  -0.0048 -0.0487 62   PHE A CE2   
437  C CZ    . PHE A 62  ? 0.2720 0.3116 0.2541 0.0137  -0.0369 -0.0727 62   PHE A CZ    
438  N N     . PHE A 63  ? 0.2788 0.3141 0.2376 0.0067  0.0156  -0.0464 63   PHE A N     
439  C CA    . PHE A 63  ? 0.2762 0.3506 0.2228 0.0055  0.0187  -0.0260 63   PHE A CA    
440  C C     . PHE A 63  ? 0.2815 0.3574 0.2277 0.0153  0.0136  -0.0123 63   PHE A C     
441  O O     . PHE A 63  ? 0.2897 0.3710 0.2412 0.0075  -0.0070 -0.0115 63   PHE A O     
442  C CB    . PHE A 63  ? 0.3083 0.3212 0.2173 0.0426  0.0003  0.0051  63   PHE A CB    
443  C CG    . PHE A 63  ? 0.2888 0.3120 0.2190 0.0312  0.0043  -0.0115 63   PHE A CG    
444  C CD1   . PHE A 63  ? 0.3384 0.3265 0.2112 0.0391  0.0481  -0.0229 63   PHE A CD1   
445  C CD2   . PHE A 63  ? 0.2830 0.3142 0.2821 0.0437  0.0046  -0.0547 63   PHE A CD2   
446  C CE1   . PHE A 63  ? 0.3398 0.3337 0.2323 0.0061  0.0107  0.0218  63   PHE A CE1   
447  C CE2   . PHE A 63  ? 0.2878 0.3866 0.2631 -0.0252 0.0470  -0.0955 63   PHE A CE2   
448  C CZ    . PHE A 63  ? 0.3079 0.2978 0.2825 0.0502  0.0457  -0.0628 63   PHE A CZ    
449  N N     . LYS A 64  ? 0.3057 0.3207 0.2276 0.0399  0.0196  0.0054  64   LYS A N     
450  C CA    . LYS A 64  ? 0.3350 0.3650 0.2306 0.0447  0.0062  0.0076  64   LYS A CA    
451  C C     . LYS A 64  ? 0.3419 0.4052 0.2459 0.0622  0.0060  -0.0291 64   LYS A C     
452  O O     . LYS A 64  ? 0.3689 0.4336 0.2908 0.0800  -0.0460 -0.0494 64   LYS A O     
453  C CB    . LYS A 64  ? 0.4036 0.4367 0.2369 -0.0209 0.0005  0.0356  64   LYS A CB    
454  C CG    . LYS A 64  ? 0.3290 0.5053 0.2363 0.0811  0.0136  0.0519  64   LYS A CG    
455  C CD    . LYS A 64  ? 0.4163 0.6056 0.2591 0.0177  0.0157  0.1006  64   LYS A CD    
456  C CE    . LYS A 64  ? 0.3569 0.8109 0.2734 -0.0033 -0.0164 0.1528  64   LYS A CE    
457  N NZ    . LYS A 64  ? 0.8366 0.9443 0.4012 -0.1201 -0.0918 0.3036  64   LYS A NZ    
458  N N     . ASP A 65  ? 0.3189 0.3536 0.2768 0.0271  0.0205  -0.0263 65   ASP A N     
459  C CA    . ASP A 65  ? 0.4032 0.3706 0.2351 0.0834  0.0412  0.0041  65   ASP A CA    
460  C C     . ASP A 65  ? 0.3335 0.3514 0.2584 0.0310  -0.0079 0.0017  65   ASP A C     
461  O O     . ASP A 65  ? 0.3943 0.3722 0.3128 -0.0081 -0.0682 0.0023  65   ASP A O     
462  C CB    . ASP A 65  ? 0.4641 0.4192 0.3034 0.0807  0.1330  0.0746  65   ASP A CB    
463  C CG    . ASP A 65  ? 0.6359 0.3945 0.2961 0.0912  0.1901  0.0516  65   ASP A CG    
464  O OD1   . ASP A 65  ? 1.0031 0.3871 0.6821 -0.0686 0.0413  -0.0184 65   ASP A OD1   
465  O OD2   . ASP A 65  ? 0.8949 0.5780 0.2833 0.2263  0.1498  0.1282  65   ASP A OD2   
466  N N     . VAL A 66  ? 0.2966 0.3481 0.2502 0.0128  0.0086  0.0114  66   VAL A N     
467  C CA    . VAL A 66  ? 0.2474 0.3339 0.2359 0.0179  0.0067  -0.0093 66   VAL A CA    
468  C C     . VAL A 66  ? 0.2813 0.3025 0.2466 -0.0030 0.0271  -0.0476 66   VAL A C     
469  O O     . VAL A 66  ? 0.3151 0.3103 0.2702 -0.0140 -0.0237 -0.0331 66   VAL A O     
470  C CB    . VAL A 66  ? 0.2526 0.3169 0.2806 0.0281  -0.0084 -0.0474 66   VAL A CB    
471  C CG1   . VAL A 66  ? 0.2844 0.3664 0.3570 0.0530  -0.0547 -0.0032 66   VAL A CG1   
472  C CG2   . VAL A 66  ? 0.2621 0.4309 0.3314 -0.0054 0.0121  -0.0465 66   VAL A CG2   
473  N N     . ALA A 67  ? 0.2744 0.3601 0.2136 0.0410  0.0058  -0.0562 67   ALA A N     
474  C CA    . ALA A 67  ? 0.2939 0.3367 0.1978 0.0447  -0.0066 -0.0326 67   ALA A CA    
475  C C     . ALA A 67  ? 0.2598 0.2936 0.2008 0.0084  -0.0066 -0.0275 67   ALA A C     
476  O O     . ALA A 67  ? 0.2739 0.3119 0.2023 0.0104  -0.0232 -0.0464 67   ALA A O     
477  C CB    . ALA A 67  ? 0.2865 0.3484 0.2166 0.0376  -0.0205 -0.0412 67   ALA A CB    
478  N N     . PRO A 68  ? 0.2995 0.2907 0.2093 0.0178  -0.0215 -0.0380 68   PRO A N     
479  C CA    . PRO A 68  ? 0.3012 0.3256 0.2234 0.0345  -0.0306 -0.0358 68   PRO A CA    
480  C C     . PRO A 68  ? 0.2847 0.3310 0.2356 0.0189  -0.0340 -0.0522 68   PRO A C     
481  O O     . PRO A 68  ? 0.3227 0.3335 0.2326 0.0345  -0.0182 -0.0326 68   PRO A O     
482  C CB    . PRO A 68  ? 0.3348 0.3239 0.2331 0.0173  -0.0417 -0.0471 68   PRO A CB    
483  C CG    . PRO A 68  ? 0.3215 0.3189 0.2732 0.0158  -0.0660 -0.0597 68   PRO A CG    
484  C CD    . PRO A 68  ? 0.3001 0.3067 0.2682 -0.0037 -0.0315 -0.0842 68   PRO A CD    
485  N N     . CYS A 69  ? 0.2632 0.3989 0.2381 0.0577  -0.0381 0.0077  69   CYS A N     
486  C CA    . CYS A 69  ? 0.2722 0.2944 0.2921 0.0229  -0.0223 -0.0310 69   CYS A CA    
487  C C     . CYS A 69  ? 0.2767 0.3059 0.2650 0.0349  -0.0268 -0.0169 69   CYS A C     
488  O O     . CYS A 69  ? 0.2716 0.3806 0.2572 0.0330  -0.0238 -0.0123 69   CYS A O     
489  C CB    . CYS A 69  ? 0.3209 0.3020 0.3055 0.0397  -0.0713 -0.0066 69   CYS A CB    
490  S SG    . CYS A 69  ? 0.2902 0.3211 0.2863 0.0002  -0.0426 0.0169  69   CYS A SG    
491  N N     . THR A 70  ? 0.2910 0.2785 0.2255 0.0144  -0.0084 -0.0038 70   THR A N     
492  C CA    . THR A 70  ? 0.2820 0.2940 0.2071 0.0170  -0.0155 -0.0045 70   THR A CA    
493  C C     . THR A 70  ? 0.2649 0.2850 0.1867 -0.0065 0.0034  -0.0025 70   THR A C     
494  O O     . THR A 70  ? 0.3053 0.3112 0.2099 0.0372  0.0071  -0.0309 70   THR A O     
495  C CB    . THR A 70  ? 0.2757 0.3136 0.2344 0.0239  -0.0027 0.0136  70   THR A CB    
496  O OG1   . THR A 70  ? 0.2850 0.2943 0.2168 0.0070  -0.0033 -0.0356 70   THR A OG1   
497  C CG2   . THR A 70  ? 0.2979 0.3125 0.2553 0.0428  -0.0090 0.0137  70   THR A CG2   
498  N N     . ASP A 71  ? 0.2687 0.3121 0.2090 0.0335  -0.0273 -0.0070 71   ASP A N     
499  C CA    . ASP A 71  ? 0.2686 0.3454 0.2036 0.0514  -0.0059 0.0130  71   ASP A CA    
500  C C     . ASP A 71  ? 0.2632 0.3158 0.2157 0.0266  -0.0017 0.0169  71   ASP A C     
501  O O     . ASP A 71  ? 0.2781 0.3395 0.2612 0.0381  -0.0235 0.0100  71   ASP A O     
502  C CB    . ASP A 71  ? 0.2897 0.3321 0.2071 0.0414  0.0002  0.0097  71   ASP A CB    
503  C CG    . ASP A 71  ? 0.3070 0.3607 0.2490 0.0364  -0.0177 0.0461  71   ASP A CG    
504  O OD1   . ASP A 71  ? 0.2865 0.3058 0.3022 0.0226  0.0053  0.0514  71   ASP A OD1   
505  O OD2   . ASP A 71  ? 0.3207 0.3533 0.2550 -0.0013 -0.0215 0.0501  71   ASP A OD2   
506  N N     . SER A 72  ? 0.2837 0.2980 0.2644 0.0692  0.0110  -0.0288 72   SER A N     
507  C CA    . SER A 72  ? 0.2846 0.3131 0.2498 0.0348  0.0139  -0.0131 72   SER A CA    
508  C C     . SER A 72  ? 0.3006 0.3249 0.2330 0.0927  -0.0236 -0.0154 72   SER A C     
509  O O     . SER A 72  ? 0.2944 0.3395 0.2377 0.0567  -0.0125 -0.0069 72   SER A O     
510  C CB    . SER A 72  ? 0.3555 0.3176 0.3075 0.0558  0.0146  0.0358  72   SER A CB    
511  O OG    . SER A 72  ? 0.3748 0.3238 0.3180 0.0765  0.0015  0.0079  72   SER A OG    
512  N N     . PRO A 73  ? 0.2952 0.3458 0.2777 0.0738  -0.0136 -0.0359 73   PRO A N     
513  C CA    . PRO A 73  ? 0.2980 0.3412 0.2414 0.0971  -0.0034 -0.0158 73   PRO A CA    
514  C C     . PRO A 73  ? 0.2748 0.3478 0.2637 0.0493  -0.0161 0.0116  73   PRO A C     
515  O O     . PRO A 73  ? 0.3371 0.4333 0.2473 0.0456  -0.0185 -0.0463 73   PRO A O     
516  C CB    . PRO A 73  ? 0.2690 0.4379 0.2709 0.0780  -0.0181 -0.0489 73   PRO A CB    
517  C CG    . PRO A 73  ? 0.2951 0.3959 0.2626 0.0874  -0.0013 -0.0364 73   PRO A CG    
518  C CD    . PRO A 73  ? 0.3089 0.3829 0.2897 0.1124  -0.0471 -0.0372 73   PRO A CD    
519  N N     . GLU A 74  ? 0.3173 0.3745 0.2347 0.0282  0.0351  0.0488  74   GLU A N     
520  C CA    . GLU A 74  ? 0.2983 0.4109 0.2613 0.0170  0.0350  0.0848  74   GLU A CA    
521  C C     . GLU A 74  ? 0.2917 0.4631 0.2192 0.0008  0.0027  0.0125  74   GLU A C     
522  O O     . GLU A 74  ? 0.3708 0.5866 0.2543 0.1497  0.0309  0.0964  74   GLU A O     
523  C CB    . GLU A 74  ? 0.2859 0.4248 0.3581 0.0050  -0.0029 0.1185  74   GLU A CB    
524  C CG    . GLU A 74  ? 0.2942 0.5127 0.3658 -0.0131 -0.0105 -0.0122 74   GLU A CG    
525  C CD    . GLU A 74  ? 0.2689 0.5182 0.3788 0.0014  -0.0309 -0.0227 74   GLU A CD    
526  O OE1   . GLU A 74  ? 0.3362 0.7437 0.5399 0.1135  -0.0003 0.0017  74   GLU A OE1   
527  O OE2   . GLU A 74  ? 0.4095 0.4554 0.3852 -0.0033 0.0387  0.0615  74   GLU A OE2   
528  N N     . PHE A 75  ? 0.2974 0.3823 0.2458 0.0563  0.0257  0.0333  75   PHE A N     
529  C CA    . PHE A 75  ? 0.2902 0.3366 0.2029 0.0286  0.0066  0.0059  75   PHE A CA    
530  C C     . PHE A 75  ? 0.2963 0.3300 0.2130 0.0276  -0.0383 0.0253  75   PHE A C     
531  O O     . PHE A 75  ? 0.2885 0.3633 0.2228 0.0196  -0.0156 -0.0119 75   PHE A O     
532  C CB    . PHE A 75  ? 0.2625 0.3401 0.2204 0.0231  -0.0101 -0.0077 75   PHE A CB    
533  C CG    . PHE A 75  ? 0.2746 0.3222 0.2132 0.0285  -0.0256 0.0177  75   PHE A CG    
534  C CD1   . PHE A 75  ? 0.2597 0.3308 0.2725 0.0417  -0.0216 -0.0185 75   PHE A CD1   
535  C CD2   . PHE A 75  ? 0.3443 0.3238 0.2055 0.0391  -0.0467 0.0186  75   PHE A CD2   
536  C CE1   . PHE A 75  ? 0.2745 0.3371 0.2881 0.0602  -0.0237 -0.0012 75   PHE A CE1   
537  C CE2   . PHE A 75  ? 0.3521 0.3230 0.2211 0.0506  -0.0363 -0.0067 75   PHE A CE2   
538  C CZ    . PHE A 75  ? 0.3521 0.3280 0.2332 0.0534  -0.0262 -0.0065 75   PHE A CZ    
539  N N     . TYR A 76  ? 0.3228 0.3042 0.2163 0.0432  0.0018  0.0115  76   TYR A N     
540  C CA    . TYR A 76  ? 0.3219 0.3031 0.2115 0.0469  0.0256  -0.0016 76   TYR A CA    
541  C C     . TYR A 76  ? 0.2686 0.3030 0.2314 0.0481  0.0033  0.0012  76   TYR A C     
542  O O     . TYR A 76  ? 0.2938 0.3111 0.2691 0.0307  0.0015  -0.0101 76   TYR A O     
543  C CB    . TYR A 76  ? 0.3371 0.3004 0.2202 0.0139  0.0027  0.0071  76   TYR A CB    
544  C CG    . TYR A 76  ? 0.2951 0.2990 0.2252 0.0427  -0.0046 0.0140  76   TYR A CG    
545  C CD1   . TYR A 76  ? 0.3202 0.3954 0.2528 -0.0210 0.0092  0.0164  76   TYR A CD1   
546  C CD2   . TYR A 76  ? 0.3425 0.2897 0.2257 0.0689  -0.0179 -0.0024 76   TYR A CD2   
547  C CE1   . TYR A 76  ? 0.3276 0.3799 0.2351 -0.0073 0.0073  0.0017  76   TYR A CE1   
548  C CE2   . TYR A 76  ? 0.4249 0.3303 0.2596 -0.0074 -0.0765 0.0379  76   TYR A CE2   
549  C CZ    . TYR A 76  ? 0.3859 0.4011 0.2892 -0.0006 -0.0340 0.0419  76   TYR A CZ    
550  O OH    . TYR A 76  ? 0.4636 0.3820 0.3364 -0.0182 -0.0239 0.0620  76   TYR A OH    
551  N N     . GLY A 77  ? 0.2822 0.3396 0.2203 0.0521  0.0085  -0.0121 77   GLY A N     
552  C CA    . GLY A 77  ? 0.2737 0.3412 0.2804 0.0686  0.0103  -0.0140 77   GLY A CA    
553  C C     . GLY A 77  ? 0.3402 0.2929 0.2809 0.0507  -0.0010 -0.0282 77   GLY A C     
554  O O     . GLY A 77  ? 0.3853 0.3034 0.3462 0.0597  0.0451  -0.0764 77   GLY A O     
555  N N     . LYS A 78  ? 0.2869 0.3301 0.2668 0.0504  0.0204  -0.0173 78   LYS A N     
556  C CA    . LYS A 78  ? 0.2884 0.3590 0.2271 0.0209  0.0614  -0.0170 78   LYS A CA    
557  C C     . LYS A 78  ? 0.2839 0.3083 0.2292 0.0351  0.0537  -0.0249 78   LYS A C     
558  O O     . LYS A 78  ? 0.3376 0.3514 0.2719 -0.0075 0.0449  -0.0502 78   LYS A O     
559  C CB    . LYS A 78  ? 0.3145 0.4104 0.2763 -0.0251 0.0283  0.0330  78   LYS A CB    
560  C CG    . LYS A 78  ? 0.3073 0.3858 0.3798 0.0158  0.0640  0.0754  78   LYS A CG    
561  C CD    . LYS A 78  ? 0.3942 0.4745 0.3418 0.0243  0.0735  0.1229  78   LYS A CD    
562  C CE    . LYS A 78  ? 0.4394 0.4879 0.3546 0.0532  0.1045  0.1323  78   LYS A CE    
563  N NZ    . LYS A 78  ? 0.5246 0.4510 0.3307 0.0766  0.1551  0.1003  78   LYS A NZ    
564  N N     . PHE A 79  ? 0.2612 0.3945 0.2054 0.0237  0.0476  -0.0247 79   PHE A N     
565  C CA    . PHE A 79  ? 0.3065 0.3498 0.2051 -0.0075 0.0772  -0.0233 79   PHE A CA    
566  C C     . PHE A 79  ? 0.3258 0.3458 0.2801 0.0148  0.0559  -0.0304 79   PHE A C     
567  O O     . PHE A 79  ? 0.3439 0.3361 0.2636 -0.0018 0.0623  -0.0227 79   PHE A O     
568  C CB    . PHE A 79  ? 0.3072 0.3464 0.1884 -0.0143 0.0745  -0.0244 79   PHE A CB    
569  C CG    . PHE A 79  ? 0.2832 0.2923 0.2039 -0.0227 0.0483  -0.0434 79   PHE A CG    
570  C CD1   . PHE A 79  ? 0.3050 0.3627 0.2502 -0.0022 0.0059  -0.0926 79   PHE A CD1   
571  C CD2   . PHE A 79  ? 0.3372 0.2654 0.2535 -0.0697 0.0769  -0.0388 79   PHE A CD2   
572  C CE1   . PHE A 79  ? 0.2948 0.4631 0.3387 -0.0316 0.0033  -0.0944 79   PHE A CE1   
573  C CE2   . PHE A 79  ? 0.3618 0.3116 0.2971 -0.0687 0.1285  -0.0556 79   PHE A CE2   
574  C CZ    . PHE A 79  ? 0.3418 0.4131 0.3277 -0.0759 0.0736  -0.1410 79   PHE A CZ    
575  N N     . LYS A 80  ? 0.4002 0.2947 0.2596 -0.0018 0.0357  -0.0461 80   LYS A N     
576  C CA    . LYS A 80  ? 0.5612 0.3007 0.2717 0.0094  0.0576  -0.0277 80   LYS A CA    
577  C C     . LYS A 80  ? 0.4459 0.3057 0.3117 0.0611  0.0208  -0.0540 80   LYS A C     
578  O O     . LYS A 80  ? 0.4383 0.3075 0.3135 0.0634  -0.0302 -0.0378 80   LYS A O     
579  C CB    . LYS A 80  ? 0.7214 0.3261 0.2982 0.0577  -0.0210 -0.0327 80   LYS A CB    
580  C CG    . LYS A 80  ? 0.6530 0.4794 0.5812 0.1245  -0.0451 -0.0551 80   LYS A CG    
581  C CD    . LYS A 80  ? 0.6246 0.6077 0.7481 0.0941  -0.1116 0.0247  80   LYS A CD    
582  C CE    . LYS A 80  ? 0.6245 0.5559 0.8884 0.2361  -0.0988 0.1308  80   LYS A CE    
583  N NZ    . LYS A 80  ? 0.8077 0.5207 1.0232 0.2873  0.1552  0.3163  80   LYS A NZ    
584  N N     . GLU A 81  ? 0.3885 0.3537 0.3336 0.0677  0.0165  -0.0948 81   GLU A N     
585  C CA    . GLU A 81  ? 0.4210 0.3907 0.3256 0.1335  0.0062  -0.0887 81   GLU A CA    
586  C C     . GLU A 81  ? 0.4430 0.3554 0.3136 0.0471  0.0059  -0.0631 81   GLU A C     
587  O O     . GLU A 81  ? 0.4736 0.3711 0.3484 0.0002  0.0980  -0.1006 81   GLU A O     
588  C CB    . GLU A 81  ? 0.3876 0.5849 0.4315 0.0989  0.0639  -0.1124 81   GLU A CB    
589  C CG    . GLU A 81  ? 0.4207 0.6199 0.5853 0.1046  -0.0159 0.0480  81   GLU A CG    
590  C CD    . GLU A 81  ? 0.3778 0.6746 0.6444 0.1069  0.0920  0.0028  81   GLU A CD    
591  O OE1   . GLU A 81  ? 0.4361 0.5257 0.6034 0.0119  0.0518  -0.0472 81   GLU A OE1   
592  O OE2   . GLU A 81  ? 0.3825 0.9194 0.7087 0.0984  0.0910  0.0831  81   GLU A OE2   
593  N N     . GLY A 82  ? 0.3675 0.3753 0.2668 0.0435  0.0115  -0.0680 82   GLY A N     
594  C CA    . GLY A 82  ? 0.3631 0.3569 0.2781 0.0008  0.0281  -0.0706 82   GLY A CA    
595  C C     . GLY A 82  ? 0.4036 0.2999 0.2832 0.0014  0.0511  -0.0758 82   GLY A C     
596  O O     . GLY A 82  ? 0.4237 0.2908 0.3185 -0.0077 0.0408  -0.0952 82   GLY A O     
597  N N     . VAL A 83  ? 0.3990 0.3060 0.2838 0.0090  0.0450  -0.0741 83   VAL A N     
598  C CA    . VAL A 83  ? 0.4883 0.3091 0.2513 -0.0425 0.0427  -0.0581 83   VAL A CA    
599  C C     . VAL A 83  ? 0.5441 0.3199 0.2795 -0.0301 0.0663  -0.0534 83   VAL A C     
600  O O     . VAL A 83  ? 0.5973 0.3167 0.3623 -0.0809 0.1040  -0.0504 83   VAL A O     
601  C CB    . VAL A 83  ? 0.7749 0.3143 0.4257 -0.0676 0.2763  -0.0704 83   VAL A CB    
602  C CG1   . VAL A 83  ? 0.6311 0.3203 0.2736 0.0502  0.0255  -0.0696 83   VAL A CG1   
603  C CG2   . VAL A 83  ? 0.8223 0.3803 0.3815 -0.1947 0.3007  -0.0435 83   VAL A CG2   
604  N N     . ALA A 84  ? 0.5626 0.3272 0.2930 0.0115  0.0837  -0.0265 84   ALA A N     
605  C CA    . ALA A 84  ? 0.6383 0.3171 0.2885 0.0159  0.0091  0.0097  84   ALA A CA    
606  C C     . ALA A 84  ? 0.6844 0.3140 0.2974 -0.0268 0.0541  -0.0195 84   ALA A C     
607  O O     . ALA A 84  ? 0.7396 0.3151 0.3646 -0.0434 0.1362  -0.0643 84   ALA A O     
608  C CB    . ALA A 84  ? 0.5880 0.3067 0.4109 0.0090  0.0274  -0.0580 84   ALA A CB    
609  N N     . SER A 85  ? 0.5164 0.3087 0.2786 0.0260  0.0573  -0.0401 85   SER A N     
610  C CA    . SER A 85  ? 0.4979 0.2876 0.2987 -0.0171 0.0802  -0.0675 85   SER A CA    
611  C C     . SER A 85  ? 0.5012 0.2658 0.2613 -0.0432 0.0903  -0.0521 85   SER A C     
612  O O     . SER A 85  ? 0.5924 0.3487 0.2817 -0.0514 0.0517  -0.0937 85   SER A O     
613  C CB    . SER A 85  ? 0.4831 0.3787 0.3238 -0.0405 0.1037  -0.0532 85   SER A CB    
614  O OG    . SER A 85  ? 0.8253 0.2751 0.3347 -0.0610 0.1879  -0.0848 85   SER A OG    
615  N N     . GLY A 86  ? 0.5040 0.2974 0.2632 -0.0034 0.0618  -0.0393 86   GLY A N     
616  C CA    . GLY A 86  ? 0.5160 0.3501 0.3007 -0.0007 0.0411  -0.0347 86   GLY A CA    
617  C C     . GLY A 86  ? 0.5287 0.3358 0.2735 -0.0130 0.0160  -0.0604 86   GLY A C     
618  O O     . GLY A 86  ? 0.5416 0.4456 0.3242 0.0262  -0.0101 -0.0431 86   GLY A O     
619  N N     . ASN A 87  ? 0.5869 0.3278 0.2844 -0.0478 0.0393  -0.0709 87   ASN A N     
620  C CA    . ASN A 87  ? 0.7096 0.3387 0.2668 -0.0432 0.0461  -0.0696 87   ASN A CA    
621  C C     . ASN A 87  ? 0.7809 0.3454 0.2777 -0.0837 0.0954  -0.0778 87   ASN A C     
622  O O     . ASN A 87  ? 0.6921 0.3215 0.3503 -0.0048 0.0982  -0.0405 87   ASN A O     
623  C CB    . ASN A 87  ? 0.5549 0.3183 0.2471 0.0487  -0.0532 -0.0493 87   ASN A CB    
624  C CG    . ASN A 87  ? 0.5777 0.3964 0.2484 0.0734  -0.0090 -0.0220 87   ASN A CG    
625  O OD1   . ASN A 87  ? 0.5517 0.3912 0.2898 0.0038  0.0352  -0.0470 87   ASN A OD1   
626  N ND2   . ASN A 87  ? 0.6006 0.3982 0.3144 0.0948  0.0271  0.0380  87   ASN A ND2   
627  N N     . LEU A 88  ? 0.4700 0.3370 0.2544 0.0368  -0.0639 -0.0695 88   LEU A N     
628  C CA    . LEU A 88  ? 0.4814 0.3111 0.2204 0.0420  -0.0267 -0.0447 88   LEU A CA    
629  C C     . LEU A 88  ? 0.5857 0.3543 0.2384 0.0558  -0.0250 -0.0199 88   LEU A C     
630  O O     . LEU A 88  ? 0.6114 0.3247 0.2409 0.0853  -0.0723 -0.0389 88   LEU A O     
631  C CB    . LEU A 88  ? 0.4960 0.2630 0.2549 0.0531  0.0162  -0.0324 88   LEU A CB    
632  C CG    . LEU A 88  ? 0.4604 0.2692 0.2065 0.0282  0.0360  -0.0104 88   LEU A CG    
633  C CD1   . LEU A 88  ? 0.5258 0.3159 0.2992 0.0947  -0.1035 -0.0533 88   LEU A CD1   
634  C CD2   . LEU A 88  ? 0.6807 0.3207 0.2367 -0.0080 0.1546  -0.0157 88   LEU A CD2   
635  N N     . ASN A 89  ? 0.6425 0.4028 0.1951 0.0550  0.0187  -0.0041 89   ASN A N     
636  C CA    . ASN A 89  ? 0.8282 0.3209 0.2246 -0.0329 -0.0975 -0.0314 89   ASN A CA    
637  C C     . ASN A 89  ? 0.7903 0.3112 0.2311 0.0326  -0.0345 -0.0178 89   ASN A C     
638  O O     . ASN A 89  ? 0.9592 0.4462 0.2429 -0.0102 0.0567  -0.0803 89   ASN A O     
639  C CB    . ASN A 89  ? 0.9183 0.4308 0.2043 -0.0237 -0.0945 -0.0616 89   ASN A CB    
640  C CG    . ASN A 89  ? 0.8372 0.4680 0.2026 -0.0197 -0.0737 -0.0422 89   ASN A CG    
641  O OD1   . ASN A 89  ? 0.8439 0.4566 0.2510 0.0115  0.0095  -0.0179 89   ASN A OD1   
642  N ND2   . ASN A 89  ? 0.9274 0.6253 0.1891 -0.1663 -0.0932 -0.0165 89   ASN A ND2   
643  N N     . THR A 90  ? 0.6200 0.2888 0.2618 0.0326  -0.0179 -0.0102 90   THR A N     
644  C CA    . THR A 90  ? 0.5601 0.3413 0.2553 0.0889  0.0526  -0.0132 90   THR A CA    
645  C C     . THR A 90  ? 0.4416 0.3394 0.2579 0.0336  0.0426  -0.0490 90   THR A C     
646  O O     . THR A 90  ? 0.3712 0.3801 0.3109 0.0930  0.0174  -0.0314 90   THR A O     
647  C CB    . THR A 90  ? 0.5838 0.3986 0.2644 0.0769  0.0301  0.0211  90   THR A CB    
648  O OG1   . THR A 90  ? 0.5328 0.4800 0.4217 0.1083  0.0491  -0.0078 90   THR A OG1   
649  C CG2   . THR A 90  ? 0.5344 0.4579 0.2637 0.1424  0.0077  -0.0176 90   THR A CG2   
650  N N     . MET A 91  ? 0.4890 0.3771 0.2721 0.0093  0.0514  -0.0459 91   MET A N     
651  C CA    . MET A 91  ? 0.4980 0.3713 0.2790 -0.0338 0.0348  -0.0316 91   MET A CA    
652  C C     . MET A 91  ? 0.4552 0.4341 0.2078 -0.0244 0.1059  -0.0626 91   MET A C     
653  O O     . MET A 91  ? 0.5220 0.4862 0.2898 0.0365  0.1342  -0.0895 91   MET A O     
654  C CB    . MET A 91  ? 0.5097 0.4167 0.2804 -0.0086 0.0580  -0.0008 91   MET A CB    
655  C CG    . MET A 91  ? 0.5699 0.5639 0.2912 -0.1225 -0.0216 0.0301  91   MET A CG    
656  S SD    . MET A 91  ? 0.6761 0.8721 0.5068 -0.1312 -0.1459 0.2197  91   MET A SD    
657  C CE    . MET A 91  ? 0.3711 0.5886 0.2524 0.1438  0.0410  0.1477  91   MET A CE    
658  N N     . PHE A 92  ? 0.3977 0.3837 0.2034 0.0686  0.0052  -0.0343 92   PHE A N     
659  C CA    . PHE A 92  ? 0.4098 0.3539 0.2670 0.0531  -0.0130 0.0074  92   PHE A CA    
660  C C     . PHE A 92  ? 0.3598 0.3540 0.2037 0.0272  0.0243  0.0291  92   PHE A C     
661  O O     . PHE A 92  ? 0.3707 0.3928 0.2788 0.0455  0.0468  0.0390  92   PHE A O     
662  C CB    . PHE A 92  ? 0.3751 0.3893 0.2007 0.0801  0.0369  -0.0071 92   PHE A CB    
663  C CG    . PHE A 92  ? 0.3276 0.3933 0.2185 0.0578  0.0333  -0.0199 92   PHE A CG    
664  C CD1   . PHE A 92  ? 0.4013 0.3118 0.2712 0.0731  0.0203  0.0158  92   PHE A CD1   
665  C CD2   . PHE A 92  ? 0.3902 0.3533 0.2054 0.0905  0.0226  -0.0114 92   PHE A CD2   
666  C CE1   . PHE A 92  ? 0.4210 0.3252 0.2390 0.0203  -0.0032 0.0008  92   PHE A CE1   
667  C CE2   . PHE A 92  ? 0.3354 0.3373 0.1999 0.0677  -0.0164 0.0006  92   PHE A CE2   
668  C CZ    . PHE A 92  ? 0.3654 0.3028 0.2613 0.0760  -0.0165 -0.0201 92   PHE A CZ    
669  N N     . GLU A 93  ? 0.3681 0.4045 0.2831 0.0052  0.0173  -0.0046 93   GLU A N     
670  C CA    . GLU A 93  ? 0.3317 0.4018 0.2372 0.0006  0.0248  0.0125  93   GLU A CA    
671  C C     . GLU A 93  ? 0.2956 0.3667 0.2410 0.0359  0.0418  0.0228  93   GLU A C     
672  O O     . GLU A 93  ? 0.3538 0.3222 0.3005 0.0328  0.0189  0.0039  93   GLU A O     
673  C CB    . GLU A 93  ? 0.4499 0.4429 0.2387 -0.0558 0.0159  0.0443  93   GLU A CB    
674  C CG    . GLU A 93  ? 0.5433 0.5006 0.4012 -0.0520 -0.0571 0.1463  93   GLU A CG    
675  C CD    . GLU A 93  ? 0.4820 0.5578 0.4459 0.0025  -0.0058 0.2093  93   GLU A CD    
676  O OE1   . GLU A 93  ? 0.6242 0.8428 0.5910 -0.2750 -0.0671 0.3057  93   GLU A OE1   
677  O OE2   . GLU A 93  ? 1.0858 0.6156 0.4475 -0.1096 -0.0425 0.2214  93   GLU A OE2   
678  N N     . TYR A 94  ? 0.3211 0.3334 0.2422 0.0192  0.0313  0.0176  94   TYR A N     
679  C CA    . TYR A 94  ? 0.2859 0.3471 0.2365 0.0274  0.0314  0.0155  94   TYR A CA    
680  C C     . TYR A 94  ? 0.2536 0.3429 0.2704 0.0225  -0.0167 0.0050  94   TYR A C     
681  O O     . TYR A 94  ? 0.3107 0.3427 0.2902 0.0172  -0.0166 0.0453  94   TYR A O     
682  C CB    . TYR A 94  ? 0.2793 0.3339 0.2123 0.0222  -0.0094 0.0105  94   TYR A CB    
683  C CG    . TYR A 94  ? 0.2897 0.3165 0.2402 0.0167  -0.0394 0.0098  94   TYR A CG    
684  C CD1   . TYR A 94  ? 0.2750 0.3526 0.2862 0.0263  -0.0067 0.0283  94   TYR A CD1   
685  C CD2   . TYR A 94  ? 0.3005 0.3233 0.2300 -0.0074 -0.0372 0.0398  94   TYR A CD2   
686  C CE1   . TYR A 94  ? 0.2839 0.3389 0.2849 0.0406  0.0016  0.0261  94   TYR A CE1   
687  C CE2   . TYR A 94  ? 0.2598 0.3239 0.2453 0.0095  -0.0170 0.0433  94   TYR A CE2   
688  C CZ    . TYR A 94  ? 0.2711 0.3396 0.2774 0.0178  -0.0241 0.0135  94   TYR A CZ    
689  O OH    . TYR A 94  ? 0.3097 0.3390 0.2721 0.0545  -0.0061 0.0090  94   TYR A OH    
690  N N     . THR A 95  ? 0.3052 0.3277 0.2599 -0.0145 -0.0117 0.0236  95   THR A N     
691  C CA    . THR A 95  ? 0.3293 0.3445 0.2771 -0.0365 -0.0039 -0.0024 95   THR A CA    
692  C C     . THR A 95  ? 0.3119 0.3112 0.2864 0.0097  -0.0019 0.0227  95   THR A C     
693  O O     . THR A 95  ? 0.3607 0.2849 0.2888 0.0356  -0.0260 -0.0014 95   THR A O     
694  C CB    . THR A 95  ? 0.3163 0.3721 0.3352 -0.0362 0.0221  -0.0330 95   THR A CB    
695  O OG1   . THR A 95  ? 0.3949 0.3900 0.3535 -0.0788 0.0360  -0.0116 95   THR A OG1   
696  C CG2   . THR A 95  ? 0.3842 0.3569 0.3785 -0.0355 0.0040  -0.0473 95   THR A CG2   
697  N N     . PHE A 96  ? 0.3462 0.3211 0.2354 0.0409  -0.0171 0.0069  96   PHE A N     
698  C CA    . PHE A 96  ? 0.3006 0.3304 0.2346 -0.0071 -0.0323 -0.0222 96   PHE A CA    
699  C C     . PHE A 96  ? 0.3789 0.2712 0.2424 0.0143  -0.0395 -0.0102 96   PHE A C     
700  O O     . PHE A 96  ? 0.4254 0.2953 0.2652 -0.0084 -0.0533 0.0295  96   PHE A O     
701  C CB    . PHE A 96  ? 0.3083 0.2772 0.3110 0.0412  -0.0477 -0.0209 96   PHE A CB    
702  C CG    . PHE A 96  ? 0.2867 0.2694 0.2249 0.0238  -0.0228 0.0082  96   PHE A CG    
703  C CD1   . PHE A 96  ? 0.2662 0.2463 0.2616 -0.0028 0.0027  0.0089  96   PHE A CD1   
704  C CD2   . PHE A 96  ? 0.3009 0.3019 0.2274 0.0409  -0.0253 -0.0005 96   PHE A CD2   
705  C CE1   . PHE A 96  ? 0.3021 0.2710 0.2219 -0.0009 -0.0235 0.0134  96   PHE A CE1   
706  C CE2   . PHE A 96  ? 0.2897 0.3311 0.2211 0.0130  -0.0215 0.0033  96   PHE A CE2   
707  C CZ    . PHE A 96  ? 0.2929 0.2790 0.2343 -0.0157 -0.0208 0.0263  96   PHE A CZ    
708  N N     . ASP A 97  ? 0.3626 0.2917 0.2517 0.0191  -0.0675 -0.0087 97   ASP A N     
709  C CA    . ASP A 97  ? 0.3588 0.2846 0.2562 0.0369  -0.0477 -0.0241 97   ASP A CA    
710  C C     . ASP A 97  ? 0.4785 0.3293 0.2446 -0.0144 -0.0880 0.0026  97   ASP A C     
711  O O     . ASP A 97  ? 0.7597 0.3150 0.2752 -0.0900 -0.1298 0.0064  97   ASP A O     
712  C CB    . ASP A 97  ? 0.3463 0.3509 0.3446 0.0181  -0.1020 -0.0007 97   ASP A CB    
713  C CG    . ASP A 97  ? 0.3387 0.3353 0.3035 0.0256  -0.0493 -0.0252 97   ASP A CG    
714  O OD1   . ASP A 97  ? 0.4418 0.3404 0.3171 -0.0104 -0.0775 -0.0042 97   ASP A OD1   
715  O OD2   . ASP A 97  ? 0.3436 0.4543 0.7271 0.0436  -0.0397 0.0149  97   ASP A OD2   
716  N N     . TYR A 98  ? 0.3524 0.3518 0.2399 0.0505  -0.0273 -0.0228 98   TYR A N     
717  C CA    . TYR A 98  ? 0.4150 0.3257 0.2565 0.0480  -0.0081 -0.0381 98   TYR A CA    
718  C C     . TYR A 98  ? 0.4174 0.3544 0.2202 0.0597  -0.0173 -0.0414 98   TYR A C     
719  O O     . TYR A 98  ? 0.4205 0.3383 0.2605 0.0769  -0.0291 -0.0415 98   TYR A O     
720  C CB    . TYR A 98  ? 0.3438 0.3376 0.2530 0.0290  -0.0688 -0.0142 98   TYR A CB    
721  C CG    . TYR A 98  ? 0.3239 0.3391 0.2559 0.0540  -0.0580 -0.0238 98   TYR A CG    
722  C CD1   . TYR A 98  ? 0.3749 0.3164 0.2433 0.0315  -0.0689 -0.0276 98   TYR A CD1   
723  C CD2   . TYR A 98  ? 0.3356 0.3726 0.2709 0.0574  -0.0421 -0.0171 98   TYR A CD2   
724  C CE1   . TYR A 98  ? 0.3751 0.4266 0.2541 0.0544  -0.0443 -0.0008 98   TYR A CE1   
725  C CE2   . TYR A 98  ? 0.3360 0.4220 0.2880 0.0971  -0.0329 0.0282  98   TYR A CE2   
726  C CZ    . TYR A 98  ? 0.3815 0.5149 0.2712 0.0395  -0.0439 0.0223  98   TYR A CZ    
727  O OH    . TYR A 98  ? 0.4057 0.6218 0.2879 0.0763  -0.0187 0.0797  98   TYR A OH    
728  N N     . GLN A 99  ? 0.4902 0.3526 0.2820 0.0589  -0.0226 -0.0745 99   GLN A N     
729  C CA    . GLN A 99  ? 0.5511 0.4058 0.2534 0.1002  -0.0237 -0.0824 99   GLN A CA    
730  C C     . GLN A 99  ? 0.5723 0.3464 0.3104 0.0884  -0.0451 -0.0558 99   GLN A C     
731  O O     . GLN A 99  ? 0.5827 0.3687 0.3337 0.1272  -0.0575 -0.1126 99   GLN A O     
732  C CB    . GLN A 99  ? 0.5571 0.4229 0.2892 0.1587  0.0253  -0.0501 99   GLN A CB    
733  C CG    . GLN A 99  ? 0.6794 0.4285 0.3302 0.1586  -0.0166 -0.0103 99   GLN A CG    
734  C CD    . GLN A 99  ? 0.7964 0.4673 0.3741 0.2364  0.0958  0.0311  99   GLN A CD    
735  O OE1   . GLN A 99  ? 0.9515 0.7118 0.3760 0.2324  0.0742  0.0785  99   GLN A OE1   
736  N NE2   . GLN A 99  ? 0.8044 0.5215 0.5121 0.1191  0.0886  0.2452  99   GLN A NE2   
737  N N     . MET A 100 ? 0.6260 0.3765 0.2955 0.1313  -0.0241 -0.0432 100  MET A N     
738  C CA    . MET A 100 ? 0.6539 0.3564 0.3174 0.1038  -0.0567 -0.0329 100  MET A CA    
739  C C     . MET A 100 ? 0.6554 0.3173 0.3309 0.0961  -0.0781 -0.0443 100  MET A C     
740  O O     . MET A 100 ? 0.6475 0.3709 0.3953 0.0908  -0.0858 -0.0267 100  MET A O     
741  C CB    . MET A 100 ? 0.6204 0.3135 0.2930 0.0944  -0.0223 -0.0176 100  MET A CB    
742  C CG    . MET A 100 ? 0.4244 0.3953 0.2642 0.0785  -0.0290 -0.0264 100  MET A CG    
743  S SD    . MET A 100 ? 0.4059 0.3430 0.3064 0.0555  -0.0087 -0.0376 100  MET A SD    
744  C CE    . MET A 100 ? 0.3807 0.4261 0.2997 0.0702  -0.0423 -0.0087 100  MET A CE    
745  N N     . THR A 101 ? 0.7117 0.3194 0.3467 0.0951  -0.0725 -0.0326 101  THR A N     
746  C CA    . THR A 101 ? 0.7062 0.3535 0.3345 0.0882  -0.0844 -0.0226 101  THR A CA    
747  C C     . THR A 101 ? 0.5404 0.3268 0.3355 0.0843  -0.1524 -0.0310 101  THR A C     
748  O O     . THR A 101 ? 0.4888 0.3141 0.3676 0.0336  -0.0871 0.0022  101  THR A O     
749  C CB    . THR A 101 ? 0.7680 0.3312 0.4794 0.1275  0.0047  0.0210  101  THR A CB    
750  O OG1   . THR A 101 ? 0.7186 0.4682 0.6651 0.1630  0.1795  0.0043  101  THR A OG1   
751  C CG2   . THR A 101 ? 0.9322 0.4577 0.4442 0.1554  0.1773  0.0514  101  THR A CG2   
752  N N     . PRO A 102 ? 0.5257 0.3087 0.3455 -0.0250 -0.1157 -0.0013 102  PRO A N     
753  C CA    . PRO A 102 ? 0.4331 0.3379 0.3756 0.0065  -0.1272 -0.0026 102  PRO A CA    
754  C C     . PRO A 102 ? 0.4051 0.3396 0.3384 -0.0374 -0.0782 0.0192  102  PRO A C     
755  O O     . PRO A 102 ? 0.4994 0.3416 0.3574 -0.0669 -0.0690 0.0225  102  PRO A O     
756  C CB    . PRO A 102 ? 0.4471 0.3649 0.4662 -0.0342 -0.1613 0.0185  102  PRO A CB    
757  C CG    . PRO A 102 ? 0.5468 0.4708 0.4997 -0.0633 -0.2079 -0.0253 102  PRO A CG    
758  C CD    . PRO A 102 ? 0.6099 0.4121 0.4519 -0.0618 -0.1695 -0.0521 102  PRO A CD    
759  N N     . THR A 103 ? 0.3730 0.3246 0.2901 -0.0064 -0.0515 0.0042  103  THR A N     
760  C CA    . THR A 103 ? 0.3760 0.3009 0.2694 -0.0076 -0.0287 0.0238  103  THR A CA    
761  C C     . THR A 103 ? 0.3373 0.2806 0.2837 -0.0375 -0.0321 0.0182  103  THR A C     
762  O O     . THR A 103 ? 0.3467 0.2831 0.3495 -0.0107 -0.0329 0.0346  103  THR A O     
763  C CB    . THR A 103 ? 0.3643 0.2735 0.3717 0.0351  -0.0645 -0.0197 103  THR A CB    
764  O OG1   . THR A 103 ? 0.4057 0.2935 0.3689 0.0327  -0.0075 -0.0162 103  THR A OG1   
765  C CG2   . THR A 103 ? 0.4076 0.3173 0.3903 0.0576  -0.0898 0.0016  103  THR A CG2   
766  N N     . LYS A 104 ? 0.3831 0.3434 0.2410 -0.0290 -0.0662 0.0367  104  LYS A N     
767  C CA    . LYS A 104 ? 0.3357 0.3250 0.2890 -0.0018 -0.0214 0.0371  104  LYS A CA    
768  C C     . LYS A 104 ? 0.3769 0.3013 0.2348 -0.0076 -0.0445 0.0410  104  LYS A C     
769  O O     . LYS A 104 ? 0.3738 0.3127 0.2850 -0.0078 -0.0555 0.0482  104  LYS A O     
770  C CB    . LYS A 104 ? 0.4084 0.4026 0.3382 -0.0004 0.0273  0.0811  104  LYS A CB    
771  C CG    . LYS A 104 ? 0.4971 0.6612 0.5954 0.1056  0.1910  0.0270  104  LYS A CG    
772  C CD    . LYS A 104 ? 0.5100 0.7543 0.5852 0.1782  0.2075  -0.0317 104  LYS A CD    
773  C CE    . LYS A 104 ? 0.7744 0.8491 0.6494 -0.0090 0.3008  -0.0563 104  LYS A CE    
774  N NZ    . LYS A 104 ? 0.8926 0.9284 0.9805 0.0199  0.5973  -0.1239 104  LYS A NZ    
775  N N     . VAL A 105 ? 0.3444 0.3139 0.2494 -0.0038 -0.0339 0.0375  105  VAL A N     
776  C CA    . VAL A 105 ? 0.3216 0.3173 0.2265 -0.0126 0.0103  0.0150  105  VAL A CA    
777  C C     . VAL A 105 ? 0.3293 0.2970 0.2153 0.0212  0.0007  0.0428  105  VAL A C     
778  O O     . VAL A 105 ? 0.3183 0.3307 0.2634 0.0098  0.0265  0.0193  105  VAL A O     
779  C CB    . VAL A 105 ? 0.3581 0.2844 0.2100 0.0178  0.0148  0.0265  105  VAL A CB    
780  C CG1   . VAL A 105 ? 0.3812 0.3222 0.2275 0.0170  0.0120  -0.0149 105  VAL A CG1   
781  C CG2   . VAL A 105 ? 0.3082 0.3057 0.2568 -0.0032 -0.0322 0.0364  105  VAL A CG2   
782  N N     . LYS A 106 ? 0.3816 0.2957 0.2143 0.0100  -0.0237 0.0229  106  LYS A N     
783  C CA    . LYS A 106 ? 0.4600 0.2996 0.2119 -0.0265 0.0405  0.0178  106  LYS A CA    
784  C C     . LYS A 106 ? 0.3375 0.2707 0.2414 0.0380  -0.0102 0.0379  106  LYS A C     
785  O O     . LYS A 106 ? 0.3332 0.2683 0.2841 0.0487  -0.0277 0.0110  106  LYS A O     
786  C CB    . LYS A 106 ? 0.4412 0.3631 0.1917 0.0058  0.0524  0.0029  106  LYS A CB    
787  C CG    . LYS A 106 ? 0.6344 0.4180 0.2203 0.1504  0.0461  0.0048  106  LYS A CG    
788  C CD    . LYS A 106 ? 0.8573 0.5864 0.3405 0.0729  0.2612  -0.0880 106  LYS A CD    
789  C CE    . LYS A 106 ? 1.2128 0.7405 0.2722 -0.1999 0.1768  -0.0084 106  LYS A CE    
790  N NZ    . LYS A 106 ? 1.3219 0.9043 0.4309 -0.3164 0.3118  -0.0249 106  LYS A NZ    
791  N N     . VAL A 107 ? 0.3238 0.2654 0.2100 0.0234  0.0016  0.0156  107  VAL A N     
792  C CA    . VAL A 107 ? 0.3459 0.2628 0.1902 0.0211  0.0127  0.0129  107  VAL A CA    
793  C C     . VAL A 107 ? 0.3697 0.2557 0.2019 0.0183  0.0243  0.0108  107  VAL A C     
794  O O     . VAL A 107 ? 0.3347 0.3663 0.2422 0.0257  0.0036  -0.0679 107  VAL A O     
795  C CB    . VAL A 107 ? 0.2993 0.2976 0.2139 0.0200  0.0156  0.0279  107  VAL A CB    
796  C CG1   . VAL A 107 ? 0.3143 0.3386 0.2097 0.0164  0.0063  0.0674  107  VAL A CG1   
797  C CG2   . VAL A 107 ? 0.3463 0.3083 0.2355 0.0592  -0.0418 0.0107  107  VAL A CG2   
798  N N     . HIS A 108 ? 0.3631 0.2623 0.2136 0.0070  0.0051  0.0221  108  HIS A N     
799  C CA    . HIS A 108 ? 0.4097 0.2469 0.2501 0.0174  -0.0317 0.0253  108  HIS A CA    
800  C C     . HIS A 108 ? 0.3795 0.2517 0.2450 0.0139  -0.0295 0.0114  108  HIS A C     
801  O O     . HIS A 108 ? 0.4129 0.2895 0.2204 0.0411  -0.0195 0.0033  108  HIS A O     
802  C CB    . HIS A 108 ? 0.3799 0.2374 0.2348 0.0087  -0.0114 0.0079  108  HIS A CB    
803  C CG    . HIS A 108 ? 0.4708 0.2580 0.2723 0.0145  -0.0519 -0.0042 108  HIS A CG    
804  N ND1   . HIS A 108 ? 0.4998 0.3068 0.2300 -0.0084 -0.0704 0.0022  108  HIS A ND1   
805  C CD2   . HIS A 108 ? 0.5186 0.2847 0.2292 0.0171  -0.0235 -0.0424 108  HIS A CD2   
806  C CE1   . HIS A 108 ? 0.5280 0.3259 0.2430 0.0003  -0.0403 -0.0334 108  HIS A CE1   
807  N NE2   . HIS A 108 ? 0.5144 0.3556 0.2034 0.0093  -0.0335 -0.0375 108  HIS A NE2   
808  N N     . MET A 109 ? 0.4694 0.2395 0.2529 0.0356  0.0014  0.0110  109  MET A N     
809  C CA    . MET A 109 ? 0.3898 0.2308 0.2483 0.0363  -0.0051 -0.0105 109  MET A CA    
810  C C     . MET A 109 ? 0.4057 0.2822 0.2613 0.0303  0.0136  -0.0477 109  MET A C     
811  O O     . MET A 109 ? 0.4644 0.2940 0.2621 0.0064  0.0402  -0.0647 109  MET A O     
812  C CB    . MET A 109 ? 0.4698 0.2589 0.2711 0.0501  -0.0404 0.0156  109  MET A CB    
813  C CG    . MET A 109 ? 0.6684 0.2228 0.3441 0.0066  -0.1582 0.0143  109  MET A CG    
814  S SD    . MET A 109 ? 0.4110 0.3991 0.2941 0.0048  -0.0467 0.0379  109  MET A SD    
815  C CE    . MET A 109 ? 0.7346 0.3799 0.1660 0.1837  0.1233  0.0464  109  MET A CE    
816  N N     . LYS A 110 ? 0.3742 0.2890 0.2187 0.0414  -0.0433 -0.0197 110  LYS A N     
817  C CA    . LYS A 110 ? 0.5031 0.3004 0.2301 -0.0238 -0.0550 -0.0167 110  LYS A CA    
818  C C     . LYS A 110 ? 0.4999 0.2786 0.2260 -0.0161 -0.0593 -0.0422 110  LYS A C     
819  O O     . LYS A 110 ? 0.5710 0.3170 0.2134 -0.0447 -0.0143 -0.0506 110  LYS A O     
820  C CB    . LYS A 110 ? 0.4507 0.3673 0.1879 -0.0236 -0.0452 -0.0290 110  LYS A CB    
821  C CG    . LYS A 110 ? 0.5931 0.4599 0.1968 -0.0579 -0.0583 -0.0714 110  LYS A CG    
822  C CD    . LYS A 110 ? 0.6407 0.4988 0.2681 -0.0976 -0.0060 -0.1386 110  LYS A CD    
823  C CE    . LYS A 110 ? 0.6469 0.3482 0.2688 0.0436  -0.0535 -0.1492 110  LYS A CE    
824  N NZ    . LYS A 110 ? 0.5840 0.3872 0.3757 0.0533  -0.0654 -0.0889 110  LYS A NZ    
825  N N     . LYS A 111 ? 0.5196 0.2583 0.2843 0.0158  -0.0671 -0.0091 111  LYS A N     
826  C CA    . LYS A 111 ? 0.5537 0.2795 0.2896 -0.0172 -0.0785 0.0036  111  LYS A CA    
827  C C     . LYS A 111 ? 0.5450 0.3184 0.2488 -0.0367 -0.0693 0.0203  111  LYS A C     
828  O O     . LYS A 111 ? 0.5673 0.4293 0.2365 -0.0316 -0.0678 0.0378  111  LYS A O     
829  C CB    . LYS A 111 ? 0.5881 0.2779 0.3613 -0.0441 -0.0897 -0.0208 111  LYS A CB    
830  C CG    . LYS A 111 ? 0.7941 0.3393 0.5690 -0.1588 0.1460  -0.0426 111  LYS A CG    
831  C CD    . LYS A 111 ? 0.9136 0.3062 0.6644 -0.1931 0.0912  -0.0687 111  LYS A CD    
832  C CE    . LYS A 111 ? 0.9849 0.3547 0.7004 -0.1119 0.0072  -0.0531 111  LYS A CE    
833  N NZ    . LYS A 111 ? 0.9857 0.3350 1.0549 0.0258  0.1165  -0.1810 111  LYS A NZ    
834  N N     . ALA A 112 ? 0.5173 0.3039 0.2129 -0.1299 -0.1122 -0.0079 112  ALA A N     
835  C CA    . ALA A 112 ? 0.5034 0.3764 0.2621 -0.1599 -0.1182 0.0074  112  ALA A CA    
836  C C     . ALA A 112 ? 0.5347 0.3239 0.3645 -0.1323 -0.2218 0.0536  112  ALA A C     
837  O O     . ALA A 112 ? 0.5431 0.3411 0.4964 -0.1119 -0.2305 0.0564  112  ALA A O     
838  C CB    . ALA A 112 ? 0.4844 0.4373 0.2545 -0.1527 -0.0997 0.0823  112  ALA A CB    
839  N N     . LEU A 113 ? 0.4828 0.3762 0.3503 -0.0979 -0.1718 -0.0319 113  LEU A N     
840  C CA    . LEU A 113 ? 0.6346 0.3501 0.4207 -0.1366 -0.3198 0.0506  113  LEU A CA    
841  C C     . LEU A 113 ? 0.6493 0.4247 0.4614 -0.1888 -0.3480 0.1001  113  LEU A C     
842  O O     . LEU A 113 ? 0.9043 0.4318 0.5182 -0.2621 -0.2923 0.0875  113  LEU A O     
843  C CB    . LEU A 113 ? 0.6135 0.3862 0.4221 -0.1247 -0.3018 0.0534  113  LEU A CB    
844  C CG    . LEU A 113 ? 0.6143 0.4100 0.5263 -0.1669 -0.3430 0.1421  113  LEU A CG    
845  C CD1   . LEU A 113 ? 0.6400 0.5709 0.4872 -0.2220 -0.3443 0.1868  113  LEU A CD1   
846  C CD2   . LEU A 113 ? 0.6324 0.5823 0.6632 -0.2019 -0.1863 0.2421  113  LEU A CD2   
847  N N     . SER A 114 ? 0.7323 0.4604 0.4961 -0.2809 -0.1901 0.0715  114  SER A N     
848  C CA    . SER A 114 ? 0.7417 0.4443 0.5602 -0.2209 -0.0913 0.0708  114  SER A CA    
849  C C     . SER A 114 ? 0.8061 0.4908 0.5128 -0.1689 -0.1687 0.0635  114  SER A C     
850  O O     . SER A 114 ? 0.9391 0.4507 0.5578 -0.1117 0.2425  -0.0222 114  SER A O     
851  C CB    . SER A 114 ? 0.8530 0.4876 0.5668 -0.2360 -0.0261 0.0673  114  SER A CB    
852  O OG    . SER A 114 ? 0.7713 0.6043 0.4978 -0.0639 -0.2671 0.1230  114  SER A OG    
853  N N     . GLY A 115 ? 0.7763 0.5058 0.5367 -0.1499 -0.2270 -0.0122 115  GLY A N     
854  C CA    . GLY A 115 ? 0.8366 0.5344 0.5995 -0.1062 -0.2704 0.0044  115  GLY A CA    
855  C C     . GLY A 115 ? 0.8638 0.5249 0.6230 -0.1343 -0.3068 -0.0161 115  GLY A C     
856  O O     . GLY A 115 ? 0.9303 0.5264 0.5967 -0.1158 -0.2436 0.1241  115  GLY A O     
857  N N     . ASP A 116 ? 0.8851 0.4834 0.6019 -0.2274 -0.2289 0.0070  116  ASP A N     
858  C CA    . ASP A 116 ? 0.8057 0.4198 0.5955 -0.2047 -0.1983 0.0838  116  ASP A CA    
859  C C     . ASP A 116 ? 0.6499 0.4123 0.4777 -0.1345 -0.1733 0.0877  116  ASP A C     
860  O O     . ASP A 116 ? 0.7312 0.4897 0.4354 -0.2148 -0.1030 0.1329  116  ASP A O     
861  C CB    . ASP A 116 ? 0.7715 0.5083 0.6422 -0.2541 -0.1723 -0.0236 116  ASP A CB    
862  C CG    . ASP A 116 ? 0.7904 0.5959 0.7346 -0.2368 -0.2337 -0.0550 116  ASP A CG    
863  O OD1   . ASP A 116 ? 0.7551 0.5202 0.7526 -0.2578 -0.2993 0.0411  116  ASP A OD1   
864  O OD2   . ASP A 116 ? 0.8465 0.6938 0.8462 -0.1683 -0.3047 -0.2079 116  ASP A OD2   
865  N N     . SER A 117 ? 0.4775 0.4096 0.4097 -0.1500 -0.1414 0.0589  117  SER A N     
866  C CA    . SER A 117 ? 0.4875 0.4065 0.3481 -0.1470 -0.1213 0.0591  117  SER A CA    
867  C C     . SER A 117 ? 0.3912 0.2981 0.2930 -0.0377 -0.1494 0.0274  117  SER A C     
868  O O     . SER A 117 ? 0.6476 0.3290 0.2712 -0.1230 -0.1838 0.0355  117  SER A O     
869  C CB    . SER A 117 ? 0.5242 0.4482 0.3473 -0.1454 -0.0416 0.0482  117  SER A CB    
870  O OG    . SER A 117 ? 0.4744 0.5060 0.3785 -0.0695 -0.0977 -0.0429 117  SER A OG    
871  N N     . TYR A 118 ? 0.4126 0.2866 0.2426 -0.0474 -0.0760 0.0037  118  TYR A N     
872  C CA    . TYR A 118 ? 0.4243 0.2752 0.2506 -0.0334 -0.0485 -0.0074 118  TYR A CA    
873  C C     . TYR A 118 ? 0.4257 0.2727 0.2472 -0.0200 0.0043  0.0032  118  TYR A C     
874  O O     . TYR A 118 ? 0.4111 0.2775 0.2215 -0.0150 -0.0056 0.0234  118  TYR A O     
875  C CB    . TYR A 118 ? 0.4213 0.2578 0.2647 -0.0408 -0.0505 0.0186  118  TYR A CB    
876  C CG    . TYR A 118 ? 0.4212 0.2671 0.2239 -0.0320 0.0068  0.0143  118  TYR A CG    
877  C CD1   . TYR A 118 ? 0.3685 0.2690 0.2532 -0.0226 0.0118  0.0247  118  TYR A CD1   
878  C CD2   . TYR A 118 ? 0.4601 0.2777 0.2486 -0.0155 0.0038  0.0009  118  TYR A CD2   
879  C CE1   . TYR A 118 ? 0.3999 0.2625 0.2507 -0.0116 0.0055  0.0151  118  TYR A CE1   
880  C CE2   . TYR A 118 ? 0.4995 0.2828 0.2392 -0.0477 0.0021  -0.0071 118  TYR A CE2   
881  C CZ    . TYR A 118 ? 0.4653 0.2746 0.2483 -0.0359 -0.0058 0.0042  118  TYR A CZ    
882  O OH    . TYR A 118 ? 0.4938 0.2602 0.3277 -0.0287 0.0640  -0.0148 118  TYR A OH    
883  N N     . TRP A 119 ? 0.4331 0.2793 0.2373 -0.0219 -0.0051 -0.0053 119  TRP A N     
884  C CA    . TRP A 119 ? 0.4668 0.2686 0.2259 -0.0796 -0.0806 0.0019  119  TRP A CA    
885  C C     . TRP A 119 ? 0.4045 0.2738 0.2086 -0.0169 -0.0463 -0.0400 119  TRP A C     
886  O O     . TRP A 119 ? 0.4829 0.2684 0.1990 0.0432  -0.0329 -0.0113 119  TRP A O     
887  C CB    . TRP A 119 ? 0.3688 0.3574 0.2172 -0.0306 -0.0395 0.0149  119  TRP A CB    
888  C CG    . TRP A 119 ? 0.3890 0.3397 0.2436 -0.0814 -0.0179 -0.0008 119  TRP A CG    
889  C CD1   . TRP A 119 ? 0.4408 0.2903 0.3129 -0.0585 -0.0815 0.0130  119  TRP A CD1   
890  C CD2   . TRP A 119 ? 0.3713 0.3602 0.2726 -0.0787 0.0049  0.0272  119  TRP A CD2   
891  N NE1   . TRP A 119 ? 0.4368 0.3461 0.3491 -0.1202 -0.0747 0.0490  119  TRP A NE1   
892  C CE2   . TRP A 119 ? 0.3905 0.4332 0.3784 -0.0971 -0.0305 0.0176  119  TRP A CE2   
893  C CE3   . TRP A 119 ? 0.3532 0.3582 0.2477 -0.0132 -0.0211 0.0533  119  TRP A CE3   
894  C CZ2   . TRP A 119 ? 0.3727 0.4887 0.4442 -0.1081 -0.0277 0.0498  119  TRP A CZ2   
895  C CZ3   . TRP A 119 ? 0.3597 0.4501 0.3294 0.0038  -0.0114 0.0271  119  TRP A CZ3   
896  C CH2   . TRP A 119 ? 0.3457 0.4794 0.4529 -0.0032 -0.0399 0.0611  119  TRP A CH2   
897  N N     . VAL A 120 ? 0.3636 0.2563 0.2257 -0.0359 -0.0247 -0.0338 120  VAL A N     
898  C CA    . VAL A 120 ? 0.3434 0.2587 0.1866 -0.0161 0.0026  -0.0228 120  VAL A CA    
899  C C     . VAL A 120 ? 0.2873 0.2748 0.2336 -0.0174 -0.0055 -0.0016 120  VAL A C     
900  O O     . VAL A 120 ? 0.3226 0.2825 0.2157 0.0081  -0.0107 -0.0062 120  VAL A O     
901  C CB    . VAL A 120 ? 0.2837 0.3237 0.2000 -0.0014 -0.0008 -0.0027 120  VAL A CB    
902  C CG1   . VAL A 120 ? 0.2854 0.3842 0.3042 -0.0335 -0.0437 0.0242  120  VAL A CG1   
903  C CG2   . VAL A 120 ? 0.3532 0.3635 0.3070 0.0412  0.0207  0.0679  120  VAL A CG2   
904  N N     . PHE A 121 ? 0.2968 0.2693 0.2219 0.0077  -0.0143 0.0095  121  PHE A N     
905  C CA    . PHE A 121 ? 0.3559 0.2623 0.2203 -0.0122 -0.0732 -0.0102 121  PHE A CA    
906  C C     . PHE A 121 ? 0.3099 0.2588 0.2009 0.0040  -0.0330 -0.0056 121  PHE A C     
907  O O     . PHE A 121 ? 0.3445 0.2832 0.2260 0.0346  0.0055  0.0084  121  PHE A O     
908  C CB    . PHE A 121 ? 0.3905 0.3153 0.2058 -0.0408 -0.0682 0.0015  121  PHE A CB    
909  C CG    . PHE A 121 ? 0.3938 0.3335 0.1944 -0.0501 -0.0798 0.0203  121  PHE A CG    
910  C CD1   . PHE A 121 ? 0.3967 0.3580 0.2219 -0.0604 -0.0595 0.0412  121  PHE A CD1   
911  C CD2   . PHE A 121 ? 0.4503 0.3073 0.1878 -0.0694 -0.0689 0.0350  121  PHE A CD2   
912  C CE1   . PHE A 121 ? 0.4074 0.3278 0.2603 -0.0478 -0.0668 0.0313  121  PHE A CE1   
913  C CE2   . PHE A 121 ? 0.4206 0.3023 0.2134 -0.0526 -0.0781 0.0513  121  PHE A CE2   
914  C CZ    . PHE A 121 ? 0.4270 0.2778 0.2780 -0.0196 -0.0582 0.0526  121  PHE A CZ    
915  N N     . VAL A 122 ? 0.3277 0.2622 0.2205 -0.0030 0.0012  -0.0274 122  VAL A N     
916  C CA    . VAL A 122 ? 0.3191 0.2551 0.2322 0.0094  -0.0268 0.0005  122  VAL A CA    
917  C C     . VAL A 122 ? 0.2865 0.2711 0.2086 0.0156  -0.0143 -0.0002 122  VAL A C     
918  O O     . VAL A 122 ? 0.2778 0.3125 0.2865 0.0181  -0.0324 0.0087  122  VAL A O     
919  C CB    . VAL A 122 ? 0.3108 0.2795 0.2317 0.0003  -0.0569 0.0037  122  VAL A CB    
920  C CG1   . VAL A 122 ? 0.3708 0.3286 0.2325 -0.0606 -0.0061 -0.0056 122  VAL A CG1   
921  C CG2   . VAL A 122 ? 0.3645 0.2746 0.2460 0.0232  -0.0430 0.0006  122  VAL A CG2   
922  N N     . LYS A 123 ? 0.3233 0.2704 0.2495 -0.0045 0.0023  0.0119  123  LYS A N     
923  C CA    . LYS A 123 ? 0.3303 0.2768 0.2534 -0.0063 -0.0287 0.0167  123  LYS A CA    
924  C C     . LYS A 123 ? 0.3118 0.2801 0.2882 -0.0118 -0.0088 0.0551  123  LYS A C     
925  O O     . LYS A 123 ? 0.3334 0.3134 0.2540 0.0131  -0.0625 -0.0084 123  LYS A O     
926  C CB    . LYS A 123 ? 0.3816 0.4064 0.2562 0.0006  -0.0377 0.0396  123  LYS A CB    
927  C CG    . LYS A 123 ? 0.3830 0.3398 0.2625 -0.0317 -0.0141 0.0350  123  LYS A CG    
928  C CD    . LYS A 123 ? 0.3285 0.2970 0.2644 0.0238  -0.0176 0.0033  123  LYS A CD    
929  C CE    . LYS A 123 ? 0.3618 0.3339 0.2538 0.0442  -0.0146 -0.0032 123  LYS A CE    
930  N NZ    . LYS A 123 ? 0.3862 0.3059 0.2554 0.0185  -0.0153 0.0143  123  LYS A NZ    
931  N N     . ARG A 124 ? 0.3507 0.2805 0.2376 -0.0138 -0.0043 0.0290  124  ARG A N     
932  C CA    . ARG A 124 ? 0.3199 0.2855 0.2692 0.0042  0.0233  -0.0161 124  ARG A CA    
933  C C     . ARG A 124 ? 0.3407 0.2762 0.2381 0.0034  0.0032  0.0119  124  ARG A C     
934  O O     . ARG A 124 ? 0.3748 0.3301 0.2544 0.0051  -0.0227 0.0601  124  ARG A O     
935  C CB    . ARG A 124 ? 0.3412 0.2856 0.2825 0.0072  0.0210  -0.0082 124  ARG A CB    
936  C CG    . ARG A 124 ? 0.4066 0.3298 0.3075 0.0124  0.0471  -0.0635 124  ARG A CG    
937  C CD    . ARG A 124 ? 0.5318 0.3148 0.3602 0.0208  0.0498  -0.0795 124  ARG A CD    
938  N NE    . ARG A 124 ? 0.5491 0.3277 0.4131 0.0817  0.0873  -0.0512 124  ARG A NE    
939  C CZ    . ARG A 124 ? 0.6405 0.4576 0.3170 0.0016  0.1194  0.0453  124  ARG A CZ    
940  N NH1   . ARG A 124 ? 0.6461 0.4841 0.3823 0.0208  0.0745  -0.0883 124  ARG A NH1   
941  N NH2   . ARG A 124 ? 0.8287 0.4860 0.4480 -0.1496 0.2920  -0.0356 124  ARG A NH2   
942  N N     . VAL A 125 ? 0.3229 0.3501 0.2749 0.0104  0.0157  0.0194  125  VAL A N     
943  C CA    . VAL A 125 ? 0.3702 0.4010 0.2877 -0.0377 0.0440  -0.0297 125  VAL A CA    
944  C C     . VAL A 125 ? 0.3031 0.3633 0.2914 0.0065  -0.0700 0.0836  125  VAL A C     
945  O O     . VAL A 125 ? 0.3517 0.3621 0.3049 -0.0224 -0.0527 0.0334  125  VAL A O     
946  C CB    . VAL A 125 ? 0.3768 0.4038 0.2914 -0.0094 0.0718  0.0268  125  VAL A CB    
947  C CG1   . VAL A 125 ? 0.3862 0.3557 0.3767 0.0167  0.0724  0.0600  125  VAL A CG1   
948  C CG2   . VAL A 125 ? 0.4183 0.5462 0.3036 -0.0036 0.0527  0.0731  125  VAL A CG2   
949  O OXT   . VAL A 125 ? 0.4340 0.3918 0.2976 -0.0241 -0.0286 0.0616  125  VAL A OXT   
950  C C1    . HC4 B .   ? 0.3211 0.3053 0.2825 0.0434  -0.0494 -0.1003 169  HC4 A C1    
951  O O1    . HC4 B .   ? 0.3168 0.3902 0.2918 0.0751  -0.0468 -0.0632 169  HC4 A O1    
952  C C2    . HC4 B .   ? 0.2841 0.3117 0.3100 -0.0253 -0.0311 0.0313  169  HC4 A C2    
953  C C3    . HC4 B .   ? 0.2973 0.2836 0.2838 0.0203  -0.0584 0.0206  169  HC4 A C3    
954  C "C1'" . HC4 B .   ? 0.2991 0.2435 0.2571 0.0495  -0.0520 0.0020  169  HC4 A "C1'" 
955  C "C2'" . HC4 B .   ? 0.3002 0.2812 0.3051 0.0503  -0.0450 -0.0601 169  HC4 A "C2'" 
956  C "C3'" . HC4 B .   ? 0.3091 0.2706 0.2428 0.0005  -0.0326 -0.0177 169  HC4 A "C3'" 
957  C "C4'" . HC4 B .   ? 0.3019 0.2694 0.2376 0.0210  -0.0269 -0.0142 169  HC4 A "C4'" 
958  C "C5'" . HC4 B .   ? 0.2957 0.2762 0.2188 0.0226  -0.0272 0.0126  169  HC4 A "C5'" 
959  C "C6'" . HC4 B .   ? 0.3063 0.2711 0.2552 0.0274  -0.0454 0.0053  169  HC4 A "C6'" 
960  O "O4'" . HC4 B .   ? 0.3022 0.3038 0.2297 0.0090  -0.0267 -0.0212 169  HC4 A "O4'" 
961  O O     . HOH C .   ? 0.3843 0.4164 0.2860 0.0542  -0.0207 0.0332  1001 HOH A O     
962  O O     . HOH C .   ? 0.2900 0.5122 0.2265 0.0573  -0.0192 -0.0038 1002 HOH A O     
963  O O     . HOH C .   ? 0.3739 0.4413 0.2517 -0.0204 0.0096  -0.0303 1003 HOH A O     
964  O O     . HOH C .   ? 0.4195 0.3449 0.2831 -0.0195 -0.0179 0.0124  1004 HOH A O     
965  O O     . HOH C .   ? 0.3573 0.4106 0.4590 0.0258  0.0172  0.0447  1005 HOH A O     
966  O O     . HOH C .   ? 0.4119 0.4315 0.2934 -0.0257 0.0239  -0.0279 1006 HOH A O     
967  O O     . HOH C .   ? 0.4785 0.4417 0.3911 0.1116  0.0220  -0.0738 1007 HOH A O     
968  O O     . HOH C .   ? 0.5777 0.4603 0.3146 -0.1245 0.0459  -0.0729 1008 HOH A O     
969  O O     . HOH C .   ? 0.3919 0.4360 0.2925 -0.0442 -0.0604 0.0688  1009 HOH A O     
970  O O     . HOH C .   ? 0.3195 0.3752 0.5193 0.0411  0.0458  0.0205  1010 HOH A O     
971  O O     . HOH C .   ? 0.4336 0.4229 0.2715 -0.0688 -0.0584 0.0141  1011 HOH A O     
972  O O     . HOH C .   ? 0.3797 0.3666 0.3075 0.0602  -0.0161 0.0049  1012 HOH A O     
973  O O     . HOH C .   ? 0.4676 0.4239 0.4673 0.0487  0.0952  0.1057  1013 HOH A O     
974  O O     . HOH C .   ? 0.5050 0.3338 0.3945 -0.0180 -0.0387 0.0556  1014 HOH A O     
975  O O     . HOH C .   ? 0.5605 0.4581 0.3054 0.0642  -0.1008 0.0034  1015 HOH A O     
976  O O     . HOH C .   ? 0.4354 0.3489 0.3291 -0.0069 -0.0583 0.0433  1016 HOH A O     
977  O O     . HOH C .   ? 0.4801 0.5180 0.3200 0.1022  0.0312  0.1070  1017 HOH A O     
978  O O     . HOH C .   ? 0.4082 0.4502 0.3560 0.0190  -0.0576 -0.0647 1018 HOH A O     
979  O O     . HOH C .   ? 0.4869 0.5953 0.4120 -0.0172 0.1592  0.0637  1019 HOH A O     
980  O O     . HOH C .   ? 0.6028 0.5510 0.5924 -0.1223 -0.1548 0.1238  1020 HOH A O     
981  O O     . HOH C .   ? 0.4300 0.4798 0.5641 0.0289  -0.0094 -0.0521 1021 HOH A O     
982  O O     . HOH C .   ? 0.4011 0.5771 0.4779 0.0434  0.0486  0.0978  1022 HOH A O     
983  O O     . HOH C .   ? 0.5126 0.4594 0.3533 -0.0415 0.0641  0.0731  1023 HOH A O     
984  O O     . HOH C .   ? 0.4190 0.5533 0.5006 0.0645  0.1571  -0.0301 1024 HOH A O     
985  O O     . HOH C .   ? 0.4244 0.4377 0.3142 0.0097  -0.0259 -0.0553 1025 HOH A O     
986  O O     . HOH C .   ? 0.5747 0.5177 0.3237 0.0141  0.0356  0.1464  1026 HOH A O     
987  O O     . HOH C .   ? 0.4187 0.5058 0.4134 0.0141  -0.0815 0.0069  1027 HOH A O     
988  O O     . HOH C .   ? 0.3399 0.6543 0.5635 -0.0103 -0.0301 -0.1319 1028 HOH A O     
989  O O     . HOH C .   ? 0.5494 0.4929 0.3724 -0.0466 -0.0664 0.0524  1029 HOH A O     
990  O O     . HOH C .   ? 0.5316 0.4068 0.3942 -0.0304 0.0151  0.0352  1030 HOH A O     
991  O O     . HOH C .   ? 0.5181 0.5728 0.4213 -0.0371 -0.1260 -0.0346 1031 HOH A O     
992  O O     . HOH C .   ? 0.5560 0.4238 0.3996 -0.0217 0.0971  0.0071  1032 HOH A O     
993  O O     . HOH C .   ? 0.4345 0.6346 0.5609 0.0063  0.0071  -0.0634 1033 HOH A O     
994  O O     . HOH C .   ? 0.5376 0.6348 0.5151 -0.0504 -0.0846 -0.1668 1034 HOH A O     
995  O O     . HOH C .   ? 0.6256 0.5769 0.6177 -0.1473 -0.0358 0.2249  1035 HOH A O     
996  O O     . HOH C .   ? 0.5877 0.5478 0.3201 0.0410  0.1537  -0.0520 1036 HOH A O     
997  O O     . HOH C .   ? 0.4988 0.7529 0.6314 -0.1152 0.0851  -0.0480 1037 HOH A O     
998  O O     . HOH C .   ? 0.6868 0.6774 0.6734 -0.1981 -0.1661 0.0009  1038 HOH A O     
999  O O     . HOH C .   ? 0.6113 0.4122 0.3683 0.0769  0.0746  0.0351  1039 HOH A O     
1000 O O     . HOH C .   ? 0.3373 0.4535 0.5121 0.0590  -0.0409 0.0273  1040 HOH A O     
1001 O O     . HOH C .   ? 0.5878 0.5351 0.3565 0.0438  -0.0055 -0.0370 1041 HOH A O     
1002 O O     . HOH C .   ? 0.7347 0.4050 0.3012 -0.0420 -0.0166 -0.0877 1042 HOH A O     
1003 O O     . HOH C .   ? 0.6376 0.7128 0.5486 -0.0392 -0.1571 0.1710  1043 HOH A O     
1004 O O     . HOH C .   ? 0.4841 0.4166 0.4789 -0.0275 -0.1140 0.0185  1044 HOH A O     
1005 O O     . HOH C .   ? 0.4864 0.5963 0.7079 0.0959  0.2216  -0.0732 1045 HOH A O     
1006 O O     . HOH C .   ? 0.5578 0.6368 0.4388 -0.0985 0.1408  0.0250  1046 HOH A O     
1007 O O     . HOH C .   ? 0.4206 0.5973 0.4487 0.0136  -0.0171 0.1357  1047 HOH A O     
1008 O O     . HOH C .   ? 0.4098 0.4380 0.5489 0.0403  0.0549  -0.0141 1048 HOH A O     
1009 O O     . HOH C .   ? 0.6194 0.5410 0.7098 0.1863  -0.0482 -0.1438 1049 HOH A O     
1010 O O     . HOH C .   ? 0.3846 0.5993 0.3863 0.0093  -0.0058 0.0654  1050 HOH A O     
1011 O O     . HOH C .   ? 0.6986 0.6015 0.3921 -0.1433 0.0023  0.1127  1051 HOH A O     
1012 O O     . HOH C .   ? 0.6631 0.6188 0.6088 0.0090  0.0091  0.0291  1052 HOH A O     
1013 O O     . HOH C .   ? 0.3572 0.5866 0.5287 0.0436  -0.0237 -0.0905 1053 HOH A O     
1014 O O     . HOH C .   ? 0.6905 0.5689 0.4929 -0.0522 0.0031  -0.0449 1054 HOH A O     
1015 O O     . HOH C .   ? 0.4403 0.6772 0.6224 -0.0024 0.1473  0.0264  1055 HOH A O     
1016 O O     . HOH C .   ? 0.6721 0.5944 0.6661 0.0325  0.0596  -0.0675 1056 HOH A O     
1017 O O     . HOH C .   ? 0.5845 0.6129 0.6831 0.1067  -0.0093 0.0457  1057 HOH A O     
1018 O O     . HOH C .   ? 0.9398 0.5107 0.2589 -0.1798 0.0212  0.0389  1058 HOH A O     
1019 O O     . HOH C .   ? 0.7472 0.4815 0.4403 0.0600  -0.0692 -0.1553 1059 HOH A O     
1020 O O     . HOH C .   ? 0.3330 0.6749 0.5857 0.0130  0.0163  0.0831  1060 HOH A O     
1021 O O     . HOH C .   ? 0.7790 0.6689 0.6626 -0.0221 -0.0591 0.0122  1061 HOH A O     
1022 O O     . HOH C .   ? 0.4003 0.5353 0.3917 -0.0155 -0.0380 0.0987  1062 HOH A O     
1023 O O     . HOH C .   ? 0.5461 0.4423 0.4748 0.0294  -0.1401 0.0352  1063 HOH A O     
1024 O O     . HOH C .   ? 0.4886 0.6175 0.6429 0.1080  0.1294  -0.0313 1064 HOH A O     
1025 O O     . HOH C .   ? 0.6872 0.7279 0.6537 -0.1239 0.0812  0.1273  1065 HOH A O     
1026 O O     . HOH C .   ? 0.8637 0.5746 0.3628 -0.0626 -0.1748 -0.0132 1066 HOH A O     
1027 O O     . HOH C .   ? 0.7257 0.6880 0.5239 -0.1089 0.0924  0.1464  1067 HOH A O     
1028 O O     . HOH C .   ? 0.8338 0.4694 0.5906 -0.0961 0.0443  0.0059  1068 HOH A O     
1029 O O     . HOH C .   ? 0.4030 0.6618 0.6276 -0.0346 0.1238  -0.1241 1069 HOH A O     
1030 O O     . HOH C .   ? 0.3925 0.5311 0.4347 0.0751  0.0571  -0.0193 1070 HOH A O     
1031 O O     . HOH C .   ? 0.5382 0.7579 0.6371 -0.0224 0.0357  0.0976  1071 HOH A O     
1032 O O     . HOH C .   ? 0.6116 0.7218 0.7354 0.0336  -0.2207 0.1765  1072 HOH A O     
1033 O O     . HOH C .   ? 0.5827 0.6490 0.5254 -0.2137 0.0142  -0.1090 1073 HOH A O     
1034 O O     . HOH C .   ? 0.5942 0.5344 0.4599 -0.0361 -0.0730 0.0064  1074 HOH A O     
1035 O O     . HOH C .   ? 0.6731 0.4759 0.4582 0.0427  0.0684  0.0481  1075 HOH A O     
1036 O O     . HOH C .   ? 0.4881 0.6036 0.6257 0.0626  -0.0139 0.0910  1076 HOH A O     
1037 O O     . HOH C .   ? 0.4948 0.5523 0.4168 -0.0276 -0.1169 -0.0662 1077 HOH A O     
1038 O O     . HOH C .   ? 0.5683 0.5294 0.5328 0.0684  0.0362  -0.0350 1078 HOH A O     
1039 O O     . HOH C .   ? 0.9111 0.5984 0.4545 -0.3142 0.3782  -0.2249 1079 HOH A O     
1040 O O     . HOH C .   ? 0.6723 0.4391 0.5429 0.0562  0.0726  -0.0898 1080 HOH A O     
1041 O O     . HOH C .   ? 0.6829 0.5908 0.5714 -0.0919 -0.0881 0.1051  1081 HOH A O     
1042 O O     . HOH C .   ? 0.6694 0.5546 0.6538 0.0747  0.2149  -0.1065 1082 HOH A O     
1043 O O     . HOH C .   ? 0.6354 0.7678 0.7896 -0.0307 0.0740  -0.0009 1083 HOH A O     
1044 O O     . HOH C .   ? 0.8077 0.5456 0.5508 0.0637  0.2939  -0.0913 1084 HOH A O     
1045 O O     . HOH C .   ? 0.8584 0.3915 0.5724 0.0029  0.1142  -0.1868 1085 HOH A O     
1046 O O     . HOH C .   ? 0.5121 0.7272 0.6695 -0.0713 0.1388  0.1001  1086 HOH A O     
1047 O O     . HOH C .   ? 0.5997 0.7192 0.7121 0.0020  0.1079  0.0395  1087 HOH A O     
1048 O O     . HOH C .   ? 0.7947 0.7141 0.7054 0.0165  0.1330  -0.0869 1088 HOH A O     
1049 O O     . HOH C .   ? 0.5677 0.7641 0.6309 0.0644  0.1546  -0.0947 1089 HOH A O     
1050 O O     . HOH C .   ? 0.6856 0.6891 0.5563 0.0823  -0.0449 0.0509  1090 HOH A O     
1051 O O     . HOH C .   ? 0.5260 0.7784 0.7219 -0.1193 0.0086  -0.0474 1091 HOH A O     
1052 O O     . HOH C .   ? 0.6165 0.5232 0.4803 -0.0779 -0.1895 -0.0567 1092 HOH A O     
1053 O O     . HOH C .   ? 0.6378 0.6387 0.6342 -0.0123 0.0340  -0.0155 1093 HOH A O     
1054 O O     . HOH C .   ? 0.6576 0.5514 0.6330 -0.0565 0.1148  -0.0569 1094 HOH A O     
1055 O O     . HOH C .   ? 0.8038 0.7253 0.6317 -0.0852 -0.1987 -0.0010 1095 HOH A O     
1056 O O     . HOH C .   ? 0.7233 0.5889 0.6081 -0.0047 -0.1313 0.0387  1096 HOH A O     
1057 O O     . HOH C .   ? 0.5414 0.6518 0.6612 0.0267  0.1142  -0.1394 1097 HOH A O     
1058 O O     . HOH C .   ? 0.5575 0.6040 0.7026 0.0525  -0.0347 -0.0627 1098 HOH A O     
1059 O O     . HOH C .   ? 0.6724 0.6689 0.7405 0.0347  0.0174  0.0007  1099 HOH A O     
1060 O O     . HOH C .   ? 0.4598 0.7036 0.7323 -0.0046 0.0069  -0.0077 1100 HOH A O     
1061 O O     . HOH C .   ? 0.4141 0.6853 0.4999 -0.0895 0.0188  0.0807  1101 HOH A O     
1062 O O     . HOH C .   ? 0.7926 0.5820 0.5245 -0.0823 -0.0995 0.0372  1102 HOH A O     
1063 O O     . HOH C .   ? 0.4754 0.6484 0.6083 -0.1253 -0.0359 0.1001  1103 HOH A O     
1064 O O     . HOH C .   ? 0.7383 0.5229 0.6739 -0.0158 0.0195  -0.0326 1104 HOH A O     
1065 O O     . HOH C .   ? 0.7729 0.5135 0.6365 0.0029  -0.1450 0.0540  1105 HOH A O     
1066 O O     . HOH C .   ? 0.8830 0.5398 0.4731 -0.0998 -0.0861 0.0759  1106 HOH A O     
1067 O O     . HOH C .   ? 0.7512 0.7450 0.6727 -0.1388 -0.0457 0.0525  1107 HOH A O     
1068 O O     . HOH C .   ? 0.6535 0.6012 0.5396 -0.0447 -0.0124 -0.0792 1108 HOH A O     
1069 O O     . HOH C .   ? 0.6185 0.5494 0.5144 -0.0258 -0.1486 -0.0039 1109 HOH A O     
1070 O O     . HOH C .   ? 0.5626 0.6254 0.5699 0.0344  -0.0253 -0.0684 1110 HOH A O     
1071 O O     . HOH C .   ? 0.6701 0.7046 0.6107 -0.2249 0.0342  0.0713  1111 HOH A O     
1072 O O     . HOH C .   ? 0.9043 0.7748 0.7008 -0.0405 0.0836  -0.0475 1112 HOH A O     
1073 O O     . HOH C .   ? 0.7069 0.6895 0.7253 -0.0726 -0.0536 0.0136  1113 HOH A O     
1074 O O     . HOH C .   ? 0.7358 0.6981 0.6944 -0.0448 -0.0373 0.0221  1114 HOH A O     
1075 O O     . HOH C .   ? 0.8725 0.5464 0.6753 -0.0053 -0.0842 -0.1139 1115 HOH A O     
1076 O O     . HOH C .   ? 0.6927 0.6748 0.6683 -0.0822 0.0949  -0.0199 1116 HOH A O     
1077 O O     . HOH C .   ? 0.6906 0.6527 0.6131 -0.0046 0.0374  -0.0519 1117 HOH A O     
1078 O O     . HOH C .   ? 0.5393 0.6631 0.8273 0.1055  -0.1346 0.0610  1118 HOH A O     
1079 O O     . HOH C .   ? 0.6796 0.6239 0.5543 -0.0636 0.1177  -0.0417 1119 HOH A O     
1080 O O     . HOH C .   ? 0.4960 0.7910 0.4648 -0.1725 -0.1139 0.1708  1120 HOH A O     
1081 O O     . HOH C .   ? 0.6483 0.6507 0.4467 -0.0502 -0.1496 -0.0070 1121 HOH A O     
1082 O O     . HOH C .   ? 0.7051 0.5818 0.5110 0.0306  -0.0003 -0.0078 1122 HOH A O     
1083 O O     . HOH C .   ? 0.6662 0.7198 0.6811 -0.0041 -0.0549 0.0261  1123 HOH A O     
1084 O O     . HOH C .   ? 0.4787 0.6776 0.6561 0.1497  0.0358  -0.1365 1124 HOH A O     
1085 O O     . HOH C .   ? 0.6505 0.6926 0.6335 0.0279  -0.0351 -0.0011 1125 HOH A O     
1086 O O     . HOH C .   ? 0.4721 0.8086 0.8149 0.0155  -0.0135 -0.0243 1126 HOH A O     
1087 O O     . HOH C .   ? 0.6934 0.7599 0.7618 -0.1413 -0.2369 -0.0027 1127 HOH A O     
1088 O O     . HOH C .   ? 0.6495 0.6880 0.6539 -0.0122 -0.0454 -0.1982 1128 HOH A O     
1089 O O     . HOH C .   ? 0.8089 0.6769 0.6423 0.0114  0.1353  0.0579  1129 HOH A O     
1090 O O     . HOH C .   ? 0.5745 0.6202 0.6923 0.0865  -0.0777 0.0294  1130 HOH A O     
1091 O O     . HOH C .   ? 0.6422 0.6365 0.5574 -0.0370 0.0696  -0.1263 1131 HOH A O     
1092 O O     . HOH C .   ? 0.7692 0.6676 0.6947 0.0083  -0.0035 -0.0004 1132 HOH A O     
1093 O O     . HOH C .   ? 0.5206 0.7239 0.8681 0.0987  -0.0451 0.1242  1133 HOH A O     
1094 O O     . HOH C .   ? 0.7436 0.7049 0.8212 0.1084  0.0082  0.0375  1134 HOH A O     
1095 O O     . HOH C .   ? 0.5711 0.6336 0.5825 -0.0732 0.1079  -0.0439 1135 HOH A O     
1096 O O     . HOH C .   ? 0.6898 0.6749 0.6892 -0.0548 0.1253  -0.0052 1136 HOH A O     
1097 O O     . HOH C .   ? 0.6703 0.6417 0.5971 -0.0920 -0.0574 0.0223  1137 HOH A O     
1098 O O     . HOH C .   ? 0.5786 0.4591 0.3370 0.0572  -0.0072 0.0808  1138 HOH A O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HC4 1   169  169  HC4 HC4 A . 
C 3 HOH 1   1001 1001 HOH HOH A . 
C 3 HOH 2   1002 1002 HOH HOH A . 
C 3 HOH 3   1003 1003 HOH HOH A . 
C 3 HOH 4   1004 1004 HOH HOH A . 
C 3 HOH 5   1005 1005 HOH HOH A . 
C 3 HOH 6   1006 1006 HOH HOH A . 
C 3 HOH 7   1007 1007 HOH HOH A . 
C 3 HOH 8   1008 1008 HOH HOH A . 
C 3 HOH 9   1009 1009 HOH HOH A . 
C 3 HOH 10  1010 1010 HOH HOH A . 
C 3 HOH 11  1011 1011 HOH HOH A . 
C 3 HOH 12  1012 1012 HOH HOH A . 
C 3 HOH 13  1013 1013 HOH HOH A . 
C 3 HOH 14  1014 1014 HOH HOH A . 
C 3 HOH 15  1015 1015 HOH HOH A . 
C 3 HOH 16  1016 1016 HOH HOH A . 
C 3 HOH 17  1017 1017 HOH HOH A . 
C 3 HOH 18  1018 1018 HOH HOH A . 
C 3 HOH 19  1019 1019 HOH HOH A . 
C 3 HOH 20  1020 1020 HOH HOH A . 
C 3 HOH 21  1021 1021 HOH HOH A . 
C 3 HOH 22  1022 1022 HOH HOH A . 
C 3 HOH 23  1023 1023 HOH HOH A . 
C 3 HOH 24  1024 1024 HOH HOH A . 
C 3 HOH 25  1025 1025 HOH HOH A . 
C 3 HOH 26  1026 1026 HOH HOH A . 
C 3 HOH 27  1027 1027 HOH HOH A . 
C 3 HOH 28  1028 1028 HOH HOH A . 
C 3 HOH 29  1029 1029 HOH HOH A . 
C 3 HOH 30  1030 1030 HOH HOH A . 
C 3 HOH 31  1031 1031 HOH HOH A . 
C 3 HOH 32  1032 1032 HOH HOH A . 
C 3 HOH 33  1033 1033 HOH HOH A . 
C 3 HOH 34  1034 1034 HOH HOH A . 
C 3 HOH 35  1035 1035 HOH HOH A . 
C 3 HOH 36  1036 1036 HOH HOH A . 
C 3 HOH 37  1037 1037 HOH HOH A . 
C 3 HOH 38  1038 1038 HOH HOH A . 
C 3 HOH 39  1039 1039 HOH HOH A . 
C 3 HOH 40  1040 1040 HOH HOH A . 
C 3 HOH 41  1041 1041 HOH HOH A . 
C 3 HOH 42  1042 1042 HOH HOH A . 
C 3 HOH 43  1043 1043 HOH HOH A . 
C 3 HOH 44  1044 1044 HOH HOH A . 
C 3 HOH 45  1045 1045 HOH HOH A . 
C 3 HOH 46  1046 1046 HOH HOH A . 
C 3 HOH 47  1047 1047 HOH HOH A . 
C 3 HOH 48  1048 1048 HOH HOH A . 
C 3 HOH 49  1049 1049 HOH HOH A . 
C 3 HOH 50  1050 1050 HOH HOH A . 
C 3 HOH 51  1051 1051 HOH HOH A . 
C 3 HOH 52  1052 1052 HOH HOH A . 
C 3 HOH 53  1053 1053 HOH HOH A . 
C 3 HOH 54  1054 1054 HOH HOH A . 
C 3 HOH 55  1055 1055 HOH HOH A . 
C 3 HOH 56  1056 1056 HOH HOH A . 
C 3 HOH 57  1057 1057 HOH HOH A . 
C 3 HOH 58  1058 1058 HOH HOH A . 
C 3 HOH 59  1059 1059 HOH HOH A . 
C 3 HOH 60  1060 1060 HOH HOH A . 
C 3 HOH 61  1061 1061 HOH HOH A . 
C 3 HOH 62  1062 1062 HOH HOH A . 
C 3 HOH 63  1063 1063 HOH HOH A . 
C 3 HOH 64  1064 1064 HOH HOH A . 
C 3 HOH 65  1065 1065 HOH HOH A . 
C 3 HOH 66  1066 1066 HOH HOH A . 
C 3 HOH 67  1067 1067 HOH HOH A . 
C 3 HOH 68  1068 1068 HOH HOH A . 
C 3 HOH 69  1069 1069 HOH HOH A . 
C 3 HOH 70  1070 1070 HOH HOH A . 
C 3 HOH 71  1071 1071 HOH HOH A . 
C 3 HOH 72  1072 1072 HOH HOH A . 
C 3 HOH 73  1073 1073 HOH HOH A . 
C 3 HOH 74  1074 1074 HOH HOH A . 
C 3 HOH 75  1075 1075 HOH HOH A . 
C 3 HOH 76  1076 1076 HOH HOH A . 
C 3 HOH 77  1077 1077 HOH HOH A . 
C 3 HOH 78  1078 1078 HOH HOH A . 
C 3 HOH 79  1079 1079 HOH HOH A . 
C 3 HOH 80  1080 1080 HOH HOH A . 
C 3 HOH 81  1081 1081 HOH HOH A . 
C 3 HOH 82  1082 1082 HOH HOH A . 
C 3 HOH 83  1083 1083 HOH HOH A . 
C 3 HOH 84  1084 1084 HOH HOH A . 
C 3 HOH 85  1085 1085 HOH HOH A . 
C 3 HOH 86  1086 1086 HOH HOH A . 
C 3 HOH 87  1087 1087 HOH HOH A . 
C 3 HOH 88  1088 1088 HOH HOH A . 
C 3 HOH 89  1089 1089 HOH HOH A . 
C 3 HOH 90  1090 1090 HOH HOH A . 
C 3 HOH 91  1091 1091 HOH HOH A . 
C 3 HOH 92  1092 1092 HOH HOH A . 
C 3 HOH 93  1093 1093 HOH HOH A . 
C 3 HOH 94  1094 1094 HOH HOH A . 
C 3 HOH 95  1095 1095 HOH HOH A . 
C 3 HOH 96  1096 1096 HOH HOH A . 
C 3 HOH 97  1097 1097 HOH HOH A . 
C 3 HOH 98  1098 1098 HOH HOH A . 
C 3 HOH 99  1099 1099 HOH HOH A . 
C 3 HOH 100 1100 1100 HOH HOH A . 
C 3 HOH 101 1101 1101 HOH HOH A . 
C 3 HOH 102 1102 1102 HOH HOH A . 
C 3 HOH 103 1103 1103 HOH HOH A . 
C 3 HOH 104 1104 1104 HOH HOH A . 
C 3 HOH 105 1105 1105 HOH HOH A . 
C 3 HOH 106 1106 1106 HOH HOH A . 
C 3 HOH 107 1107 1107 HOH HOH A . 
C 3 HOH 108 1108 1108 HOH HOH A . 
C 3 HOH 109 1109 1109 HOH HOH A . 
C 3 HOH 110 1110 1110 HOH HOH A . 
C 3 HOH 111 1111 1111 HOH HOH A . 
C 3 HOH 112 1112 1112 HOH HOH A . 
C 3 HOH 113 1113 1113 HOH HOH A . 
C 3 HOH 114 1114 1114 HOH HOH A . 
C 3 HOH 115 1115 1115 HOH HOH A . 
C 3 HOH 116 1116 1116 HOH HOH A . 
C 3 HOH 117 1117 1117 HOH HOH A . 
C 3 HOH 118 1118 1118 HOH HOH A . 
C 3 HOH 119 1119 1119 HOH HOH A . 
C 3 HOH 120 1120 1120 HOH HOH A . 
C 3 HOH 121 1121 1121 HOH HOH A . 
C 3 HOH 122 1122 1122 HOH HOH A . 
C 3 HOH 123 1123 1123 HOH HOH A . 
C 3 HOH 124 1124 1124 HOH HOH A . 
C 3 HOH 125 1125 1125 HOH HOH A . 
C 3 HOH 126 1126 1126 HOH HOH A . 
C 3 HOH 127 1127 1127 HOH HOH A . 
C 3 HOH 128 1128 1128 HOH HOH A . 
C 3 HOH 129 1129 1129 HOH HOH A . 
C 3 HOH 130 1130 1130 HOH HOH A . 
C 3 HOH 131 1131 1131 HOH HOH A . 
C 3 HOH 132 1132 1132 HOH HOH A . 
C 3 HOH 133 1133 1133 HOH HOH A . 
C 3 HOH 134 1134 1134 HOH HOH A . 
C 3 HOH 135 1135 1135 HOH HOH A . 
C 3 HOH 136 1136 1136 HOH HOH A . 
C 3 HOH 137 1137 1137 HOH HOH A . 
C 3 HOH 138 1138 1138 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
5 'Structure model' 1 4 2019-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Experimental preparation'  
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow 
2 5 'Structure model' software           
3 5 'Structure model' struct_conn        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.temp'            
2 5 'Structure model' '_software.classification'            
3 5 'Structure model' '_software.name'                      
4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
DENZO     'data reduction' . ? 4 
CNS       phasing          . ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    1061 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1135 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.01 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 10  ? ? CG A ASP 10  ? ? OD2 A ASP 10  ? ? 123.71 118.30 5.41  0.90 N 
2 1 CB A ASP 48  ? ? CG A ASP 48  ? ? OD1 A ASP 48  ? ? 125.70 118.30 7.40  0.90 N 
3 1 CB A PHE 79  ? ? CG A PHE 79  ? ? CD2 A PHE 79  ? ? 125.37 120.80 4.57  0.70 N 
4 1 CB A PHE 79  ? ? CG A PHE 79  ? ? CD1 A PHE 79  ? ? 115.76 120.80 -5.04 0.70 N 
5 1 CB A TYR 94  ? ? CG A TYR 94  ? ? CD2 A TYR 94  ? ? 125.69 121.00 4.69  0.60 N 
6 1 CB A ASP 97  ? ? CG A ASP 97  ? ? OD2 A ASP 97  ? ? 124.50 118.30 6.20  0.90 N 
7 1 NE A ARG 124 ? ? CZ A ARG 124 ? ? NH2 A ARG 124 ? ? 116.36 120.30 -3.94 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 20 ? ? -65.49  81.12  
2 1 PHE A 75 ? ? -127.62 -76.87 
3 1 ASN A 89 ? ? -167.04 93.56  
4 1 ASP A 97 ? ? -147.31 11.77  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A GLU 2 ? A GLU 2 
3 1 Y 1 A HIS 3 ? A HIS 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;4'-HYDROXYCINNAMIC ACID
;
HC4 
3 water                     HOH 
#