data_1OTI
# 
_entry.id   1OTI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1OTI         pdb_00001oti 10.2210/pdb1oti/pdb 
RCSB  RCSB018652   ?            ?                   
WWPDB D_1000018652 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2PHY 'Photoactive Yellow Protein, Dark State (Unbleached)'                                  unspecified 
PDB 1OTA 'E46Q Mutant of Photoactive Yellow Protein, P63 AT 295K'                               unspecified 
PDB 1OTB 'Wild Type Photoactive Yellow Protein, P63 AT 295K'                                    unspecified 
PDB 1OTD 'Strong Hydrogen Bonds in Photoactive Yellow Protein and their Role in its Photocycle' unspecified 
PDB 1OTE 'E46Q mutant of photoactive yellow protein, P65 at 110K'                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OTI 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anderson, S.' 1 
'Crosson, S.'  2 
'Moffat, K.'   3 
# 
_citation.id                        primary 
_citation.title                     'Short hydrogen bonds in photoactive yellow protein.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            60 
_citation.page_first                1008 
_citation.page_last                 1016 
_citation.year                      2004 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15159559 
_citation.pdbx_database_id_DOI      10.1107/S090744490400616X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Anderson, S.' 1 ? 
primary 'Crosson, S.'  2 ? 
primary 'Moffat, K.'   3 ? 
# 
_cell.entry_id           1OTI 
_cell.length_a           40.987 
_cell.length_b           40.987 
_cell.length_c           117.277 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OTI 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Photoactive yellow protein' 13887.591 1   ? E46Q ? ? 
2 non-polymer syn 
;4'-HYDROXYCINNAMIC ACID
;
164.158   1   ? ?    ? ? 
3 water       nat water                        18.015    117 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PYP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   VAL n 
1 5   ALA n 
1 6   PHE n 
1 7   GLY n 
1 8   SER n 
1 9   GLU n 
1 10  ASP n 
1 11  ILE n 
1 12  GLU n 
1 13  ASN n 
1 14  THR n 
1 15  LEU n 
1 16  ALA n 
1 17  LYS n 
1 18  MET n 
1 19  ASP n 
1 20  ASP n 
1 21  GLY n 
1 22  GLN n 
1 23  LEU n 
1 24  ASP n 
1 25  GLY n 
1 26  LEU n 
1 27  ALA n 
1 28  PHE n 
1 29  GLY n 
1 30  ALA n 
1 31  ILE n 
1 32  GLN n 
1 33  LEU n 
1 34  ASP n 
1 35  GLY n 
1 36  ASP n 
1 37  GLY n 
1 38  ASN n 
1 39  ILE n 
1 40  LEU n 
1 41  GLN n 
1 42  TYR n 
1 43  ASN n 
1 44  ALA n 
1 45  ALA n 
1 46  GLN n 
1 47  GLY n 
1 48  ASP n 
1 49  ILE n 
1 50  THR n 
1 51  GLY n 
1 52  ARG n 
1 53  ASP n 
1 54  PRO n 
1 55  LYS n 
1 56  GLN n 
1 57  VAL n 
1 58  ILE n 
1 59  GLY n 
1 60  LYS n 
1 61  ASN n 
1 62  PHE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  PRO n 
1 69  CYS n 
1 70  THR n 
1 71  ASP n 
1 72  SER n 
1 73  PRO n 
1 74  GLU n 
1 75  PHE n 
1 76  TYR n 
1 77  GLY n 
1 78  LYS n 
1 79  PHE n 
1 80  LYS n 
1 81  GLU n 
1 82  GLY n 
1 83  VAL n 
1 84  ALA n 
1 85  SER n 
1 86  GLY n 
1 87  ASN n 
1 88  LEU n 
1 89  ASN n 
1 90  THR n 
1 91  MET n 
1 92  PHE n 
1 93  GLU n 
1 94  TYR n 
1 95  THR n 
1 96  PHE n 
1 97  ASP n 
1 98  TYR n 
1 99  GLN n 
1 100 MET n 
1 101 THR n 
1 102 PRO n 
1 103 THR n 
1 104 LYS n 
1 105 VAL n 
1 106 LYS n 
1 107 VAL n 
1 108 HIS n 
1 109 MET n 
1 110 LYS n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 SER n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 TRP n 
1 120 VAL n 
1 121 PHE n 
1 122 VAL n 
1 123 LYS n 
1 124 ARG n 
1 125 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 PYP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_ECTHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OTI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1OTI 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      46 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16113 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          46 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            46 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                    'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                    'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                    'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                    'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                    'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                    'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                    'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                    'C2 H5 N O2'     75.067  
HC4 non-polymer         . 
;4'-HYDROXYCINNAMIC ACID
;
'PARA-COUMARIC ACID' 'C9 H8 O3'       164.158 
HIS 'L-peptide linking' y HISTIDINE                 ?                    'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                     ?                    'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ?                    'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                    'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                    'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                    'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                    'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                    'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ?                    'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ?                    'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                    'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                    'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                    'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OTI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.05 
_exptl_crystal.density_percent_sol   39.91 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 2000, MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-05-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1OTI 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            1.40 
_reflns.d_resolution_low             100.00 
_reflns.number_all                   21402 
_reflns.number_obs                   21402 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              23.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.40 
_reflns_shell.d_res_low              1.45 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.568 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OTI 
_refine.ls_d_res_high                            1.40 
_refine.ls_d_res_low                             20.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     21402 
_refine.ls_number_reflns_obs                     20328 
_refine.ls_number_reflns_R_free                  1074 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.133 
_refine.ls_R_factor_obs                          0.133 
_refine.ls_R_factor_R_work                       0.131 
_refine.ls_R_factor_R_free                       0.161 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PHY' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'derived from 0.95A 110K E46Q mutant ground state structure' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        976 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               1104 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d  0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d 2.55  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1OTI 
_struct.title                     'E46Q MUTANT OF PHOTOACTIVE YELLOW PROTEIN, P65 AT 295K' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OTI 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'PYP, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 10 ? LYS A 17 ? ASP A 10 LYS A 17 1 ? 8  
HELX_P HELX_P2 2 ASP A 19 ? ASP A 24 ? ASP A 19 ASP A 24 1 ? 6  
HELX_P HELX_P3 3 ASN A 43 ? GLY A 51 ? ASN A 43 GLY A 51 1 ? 9  
HELX_P HELX_P4 4 ASP A 53 ? ILE A 58 ? ASP A 53 ILE A 58 1 ? 6  
HELX_P HELX_P5 5 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5  
HELX_P HELX_P6 6 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            69 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HC4 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             69 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HC4 
_struct_conn.ptnr2_auth_seq_id             169 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.744 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 39  ? TYR A 42  ? ILE A 39  TYR A 42  
A 2 GLY A 29  ? LEU A 33  ? GLY A 29  LEU A 33  
A 3 TYR A 118 ? ARG A 124 ? TYR A 118 ARG A 124 
A 4 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 
A 5 ASN A 89  ? PHE A 96  ? ASN A 89  PHE A 96  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 40  ? O LEU A 40  N GLN A 32  ? N GLN A 32  
A 2 3 N LEU A 33  ? N LEU A 33  O TYR A 118 ? O TYR A 118 
A 3 4 O TRP A 119 ? O TRP A 119 N LYS A 110 ? N LYS A 110 
A 4 5 O VAL A 107 ? O VAL A 107 N PHE A 92  ? N PHE A 92  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    HC4 
_struct_site.pdbx_auth_seq_id     169 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE HC4 A 169' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 TYR A 42 ? TYR A 42 . ? 1_555 ? 
2 AC1 8 GLN A 46 ? GLN A 46 . ? 1_555 ? 
3 AC1 8 THR A 50 ? THR A 50 . ? 1_555 ? 
4 AC1 8 ALA A 67 ? ALA A 67 . ? 1_555 ? 
5 AC1 8 PRO A 68 ? PRO A 68 . ? 1_555 ? 
6 AC1 8 CYS A 69 ? CYS A 69 . ? 1_555 ? 
7 AC1 8 PHE A 96 ? PHE A 96 . ? 1_555 ? 
8 AC1 8 TYR A 98 ? TYR A 98 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OTI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OTI 
_atom_sites.fract_transf_matrix[1][1]   0.024398 
_atom_sites.fract_transf_matrix[1][2]   0.014086 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028172 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008527 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? 10.236  37.037 6.742   1.00 45.32 ? 1    MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? 9.038   37.849 6.689   1.00 45.95 ? 1    MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? 9.127   39.102 7.537   1.00 39.92 ? 1    MET A C     1 
ATOM   4    O O     . MET A 1 1   ? 9.484   38.992 8.715   1.00 51.47 ? 1    MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? 7.884   36.991 7.224   1.00 51.81 ? 1    MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? 6.641   37.836 7.435   1.00 54.75 ? 1    MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? 5.212   36.784 7.719   1.00 53.28 ? 1    MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? 5.139   35.868 6.173   1.00 65.75 ? 1    MET A CE    1 
ATOM   9    N N     . GLU A 1 2   ? 8.817   40.299 7.071   1.00 36.56 ? 2    GLU A N     1 
ATOM   10   C CA    . GLU A 1 2   ? 8.932   41.474 7.950   1.00 36.79 ? 2    GLU A CA    1 
ATOM   11   C C     . GLU A 1 2   ? 7.991   41.383 9.140   1.00 36.19 ? 2    GLU A C     1 
ATOM   12   O O     . GLU A 1 2   ? 6.871   40.925 8.913   1.00 44.34 ? 2    GLU A O     1 
ATOM   13   C CB    . GLU A 1 2   ? 8.621   42.739 7.156   1.00 41.42 ? 2    GLU A CB    1 
ATOM   14   C CG    . GLU A 1 2   ? 9.452   42.914 5.899   1.00 40.93 ? 2    GLU A CG    1 
ATOM   15   C CD    . GLU A 1 2   ? 10.915  43.015 6.282   1.00 43.36 ? 2    GLU A CD    1 
ATOM   16   O OE1   . GLU A 1 2   ? 11.242  43.952 7.033   1.00 48.46 ? 2    GLU A OE1   1 
ATOM   17   O OE2   . GLU A 1 2   ? 11.707  42.141 5.870   1.00 57.13 ? 2    GLU A OE2   1 
ATOM   18   N N     . HIS A 1 3   ? 8.352   41.799 10.363  1.00 36.22 ? 3    HIS A N     1 
ATOM   19   C CA    . HIS A 1 3   ? 7.360   41.696 11.436  1.00 34.43 ? 3    HIS A CA    1 
ATOM   20   C C     . HIS A 1 3   ? 6.574   42.976 11.694  1.00 29.05 ? 3    HIS A C     1 
ATOM   21   O O     . HIS A 1 3   ? 6.964   43.771 12.556  1.00 39.23 ? 3    HIS A O     1 
ATOM   22   C CB    . HIS A 1 3   ? 7.994   41.280 12.768  1.00 47.23 ? 3    HIS A CB    1 
ATOM   23   C CG    . HIS A 1 3   ? 8.245   39.811 12.628  1.00 54.33 ? 3    HIS A CG    1 
ATOM   24   N ND1   . HIS A 1 3   ? 9.226   39.353 11.782  1.00 61.73 ? 3    HIS A ND1   1 
ATOM   25   C CD2   . HIS A 1 3   ? 7.690   38.727 13.186  1.00 59.40 ? 3    HIS A CD2   1 
ATOM   26   C CE1   . HIS A 1 3   ? 9.279   38.029 11.822  1.00 60.75 ? 3    HIS A CE1   1 
ATOM   27   N NE2   . HIS A 1 3   ? 8.340   37.625 12.675  1.00 57.80 ? 3    HIS A NE2   1 
ATOM   28   N N     . VAL A 1 4   ? 5.508   43.202 10.981  1.00 26.65 ? 4    VAL A N     1 
ATOM   29   C CA    . VAL A 1 4   ? 4.631   44.378 11.052  1.00 24.91 ? 4    VAL A CA    1 
ATOM   30   C C     . VAL A 1 4   ? 3.214   43.813 11.051  1.00 19.32 ? 4    VAL A C     1 
ATOM   31   O O     . VAL A 1 4   ? 2.957   43.082 10.084  1.00 23.23 ? 4    VAL A O     1 
ATOM   32   C CB    . VAL A 1 4   ? 4.808   45.337 9.865   1.00 32.74 ? 4    VAL A CB    1 
ATOM   33   C CG1   . VAL A 1 4   ? 3.898   46.511 10.098  1.00 37.32 ? 4    VAL A CG1   1 
ATOM   34   C CG2   . VAL A 1 4   ? 6.276   45.688 9.751   1.00 47.23 ? 4    VAL A CG2   1 
ATOM   35   N N     . ALA A 1 5   ? 2.310   44.114 11.953  1.00 18.37 ? 5    ALA A N     1 
ATOM   36   C CA    . ALA A 1 5   ? 0.976   43.552 11.902  1.00 15.90 ? 5    ALA A CA    1 
ATOM   37   C C     . ALA A 1 5   ? 0.000   44.496 11.175  1.00 14.63 ? 5    ALA A C     1 
ATOM   38   O O     . ALA A 1 5   ? 0.038   45.721 11.310  1.00 17.84 ? 5    ALA A O     1 
ATOM   39   C CB    . ALA A 1 5   ? 0.411   43.277 13.273  1.00 18.48 ? 5    ALA A CB    1 
ATOM   40   N N     . PHE A 1 6   ? -0.879  43.889 10.418  1.00 14.99 ? 6    PHE A N     1 
ATOM   41   C CA    . PHE A 1 6   ? -1.973  44.615 9.744   1.00 14.40 ? 6    PHE A CA    1 
ATOM   42   C C     . PHE A 1 6   ? -2.716  45.420 10.809  1.00 15.58 ? 6    PHE A C     1 
ATOM   43   O O     . PHE A 1 6   ? -3.071  44.833 11.855  1.00 17.90 ? 6    PHE A O     1 
ATOM   44   C CB    . PHE A 1 6   ? -2.875  43.625 9.056   1.00 16.09 ? 6    PHE A CB    1 
ATOM   45   C CG    . PHE A 1 6   ? -4.068  44.211 8.331   1.00 15.45 ? 6    PHE A CG    1 
ATOM   46   C CD1   . PHE A 1 6   ? -5.256  44.471 8.998   1.00 18.54 ? 6    PHE A CD1   1 
ATOM   47   C CD2   . PHE A 1 6   ? -3.974  44.490 6.985   1.00 16.62 ? 6    PHE A CD2   1 
ATOM   48   C CE1   . PHE A 1 6   ? -6.321  45.015 8.278   1.00 20.08 ? 6    PHE A CE1   1 
ATOM   49   C CE2   . PHE A 1 6   ? -5.047  45.019 6.296   1.00 18.91 ? 6    PHE A CE2   1 
ATOM   50   C CZ    . PHE A 1 6   ? -6.243  45.259 6.941   1.00 21.45 ? 6    PHE A CZ    1 
ATOM   51   N N     . GLY A 1 7   ? -2.988  46.674 10.521  1.00 16.44 ? 7    GLY A N     1 
ATOM   52   C CA    . GLY A 1 7   ? -3.808  47.503 11.417  1.00 19.31 ? 7    GLY A CA    1 
ATOM   53   C C     . GLY A 1 7   ? -3.036  48.125 12.556  1.00 18.75 ? 7    GLY A C     1 
ATOM   54   O O     . GLY A 1 7   ? -3.604  48.743 13.471  1.00 24.46 ? 7    GLY A O     1 
ATOM   55   N N     . SER A 1 8   ? -1.714  47.985 12.591  1.00 17.55 ? 8    SER A N     1 
ATOM   56   C CA    . SER A 1 8   ? -0.937  48.589 13.657  1.00 19.49 ? 8    SER A CA    1 
ATOM   57   C C     . SER A 1 8   ? -1.035  50.099 13.665  1.00 19.92 ? 8    SER A C     1 
ATOM   58   O O     . SER A 1 8   ? -1.036  50.720 12.593  1.00 20.93 ? 8    SER A O     1 
ATOM   59   C CB    . SER A 1 8   ? 0.547   48.214 13.439  1.00 25.77 ? 8    SER A CB    1 
ATOM   60   O OG    . SER A 1 8   ? 0.687   46.850 13.793  1.00 29.71 ? 8    SER A OG    1 
ATOM   61   N N     . GLU A 1 9   ? -1.075  50.713 14.840  1.00 20.77 ? 9    GLU A N     1 
ATOM   62   C CA    . GLU A 1 9   ? -1.233  52.149 14.992  1.00 21.69 ? 9    GLU A CA    1 
ATOM   63   C C     . GLU A 1 9   ? -0.169  52.962 14.302  1.00 21.69 ? 9    GLU A C     1 
ATOM   64   O O     . GLU A 1 9   ? -0.455  54.088 13.875  1.00 26.80 ? 9    GLU A O     1 
ATOM   65   C CB    . GLU A 1 9   ? -1.280  52.541 16.489  1.00 36.67 ? 9    GLU A CB    1 
ATOM   66   C CG    . GLU A 1 9   ? -2.578  52.007 17.105  1.00 45.84 ? 9    GLU A CG    1 
ATOM   67   C CD    . GLU A 1 9   ? -3.814  52.348 16.270  1.00 58.64 ? 9    GLU A CD    1 
ATOM   68   O OE1   . GLU A 1 9   ? -4.861  51.664 16.442  1.00 64.83 ? 9    GLU A OE1   1 
ATOM   69   O OE2   . GLU A 1 9   ? -3.739  53.304 15.446  1.00 74.68 ? 9    GLU A OE2   1 
ATOM   70   N N     . ASP A 1 10  ? 1.040   52.421 14.219  1.00 23.17 ? 10   ASP A N     1 
ATOM   71   C CA    . ASP A 1 10  ? 2.118   53.223 13.646  1.00 25.91 ? 10   ASP A CA    1 
ATOM   72   C C     . ASP A 1 10  ? 2.657   52.597 12.388  1.00 20.59 ? 10   ASP A C     1 
ATOM   73   O O     . ASP A 1 10  ? 3.802   52.793 12.036  1.00 22.93 ? 10   ASP A O     1 
ATOM   74   C CB    . ASP A 1 10  ? 3.263   53.344 14.648  1.00 32.88 ? 10   ASP A CB    1 
ATOM   75   C CG    . ASP A 1 10  ? 3.585   52.054 15.371  1.00 40.38 ? 10   ASP A CG    1 
ATOM   76   O OD1   . ASP A 1 10  ? 3.133   50.993 14.937  1.00 41.36 ? 10   ASP A OD1   1 
ATOM   77   O OD2   . ASP A 1 10  ? 4.331   52.196 16.362  1.00 55.18 ? 10   ASP A OD2   1 
ATOM   78   N N     . ILE A 1 11  ? 1.816   51.904 11.668  1.00 19.26 ? 11   ILE A N     1 
ATOM   79   C CA    . ILE A 1 11  ? 2.250   51.147 10.515  1.00 18.84 ? 11   ILE A CA    1 
ATOM   80   C C     . ILE A 1 11  ? 2.897   52.047 9.497   1.00 19.89 ? 11   ILE A C     1 
ATOM   81   O O     . ILE A 1 11  ? 3.826   51.609 8.821   1.00 19.83 ? 11   ILE A O     1 
ATOM   82   C CB    . ILE A 1 11  ? 1.008   50.405 9.933   1.00 19.24 ? 11   ILE A CB    1 
ATOM   83   C CG1   . ILE A 1 11  ? 1.393   49.444 8.788   1.00 23.74 ? 11   ILE A CG1   1 
ATOM   84   C CG2   . ILE A 1 11  ? -0.078  51.352 9.476   1.00 20.70 ? 11   ILE A CG2   1 
ATOM   85   C CD1   . ILE A 1 11  ? 0.439   48.346 8.455   1.00 29.12 ? 11   ILE A CD1   1 
ATOM   86   N N     . GLU A 1 12  ? 2.400   53.283 9.328   1.00 18.91 ? 12   GLU A N     1 
ATOM   87   C CA    . GLU A 1 12  ? 3.007   54.119 8.301   1.00 20.58 ? 12   GLU A CA    1 
ATOM   88   C C     . GLU A 1 12  ? 4.426   54.524 8.713   1.00 20.96 ? 12   GLU A C     1 
ATOM   89   O O     . GLU A 1 12  ? 5.233   54.850 7.815   1.00 22.23 ? 12   GLU A O     1 
ATOM   90   C CB    . GLU A 1 12  ? 2.096   55.320 8.032   1.00 25.74 ? 12   GLU A CB    1 
ATOM   91   C CG    . GLU A 1 12  ? 2.175   56.396 9.139   1.00 26.29 ? 12   GLU A CG    1 
ATOM   92   C CD    . GLU A 1 12  ? 1.241   56.112 10.296  1.00 24.43 ? 12   GLU A CD    1 
ATOM   93   O OE1   . GLU A 1 12  ? 0.779   54.985 10.533  1.00 23.26 ? 12   GLU A OE1   1 
ATOM   94   O OE2   . GLU A 1 12  ? 0.944   57.098 11.013  1.00 36.15 ? 12   GLU A OE2   1 
ATOM   95   N N     . ASN A 1 13  ? 4.769   54.557 10.008  1.00 20.29 ? 13   ASN A N     1 
ATOM   96   C CA    . ASN A 1 13  ? 6.142   54.880 10.382  1.00 21.18 ? 13   ASN A CA    1 
ATOM   97   C C     . ASN A 1 13  ? 7.074   53.723 9.996   1.00 21.00 ? 13   ASN A C     1 
ATOM   98   O O     . ASN A 1 13  ? 8.180   53.844 9.480   1.00 23.89 ? 13   ASN A O     1 
ATOM   99   C CB    . ASN A 1 13  ? 6.234   55.057 11.878  1.00 25.93 ? 13   ASN A CB    1 
ATOM   100  C CG    . ASN A 1 13  ? 5.698   56.339 12.443  1.00 29.65 ? 13   ASN A CG    1 
ATOM   101  O OD1   . ASN A 1 13  ? 4.530   56.667 12.252  1.00 43.82 ? 13   ASN A OD1   1 
ATOM   102  N ND2   . ASN A 1 13  ? 6.604   57.006 13.141  1.00 36.39 ? 13   ASN A ND2   1 
ATOM   103  N N     . THR A 1 14  ? 6.596   52.490 10.234  1.00 19.85 ? 14   THR A N     1 
ATOM   104  C CA    . THR A 1 14  ? 7.406   51.342 9.902   1.00 21.03 ? 14   THR A CA    1 
ATOM   105  C C     . THR A 1 14  ? 7.644   51.216 8.420   1.00 20.36 ? 14   THR A C     1 
ATOM   106  O O     . THR A 1 14  ? 8.753   50.912 7.962   1.00 23.12 ? 14   THR A O     1 
ATOM   107  C CB    . THR A 1 14  ? 6.704   50.046 10.376  1.00 27.60 ? 14   THR A CB    1 
ATOM   108  O OG1   . THR A 1 14  ? 6.488   50.233 11.770  1.00 29.40 ? 14   THR A OG1   1 
ATOM   109  C CG2   . THR A 1 14  ? 7.604   48.853 10.185  1.00 34.28 ? 14   THR A CG2   1 
ATOM   110  N N     . LEU A 1 15  ? 6.574   51.389 7.652   1.00 19.84 ? 15   LEU A N     1 
ATOM   111  C CA    . LEU A 1 15  ? 6.750   51.208 6.207   1.00 21.69 ? 15   LEU A CA    1 
ATOM   112  C C     . LEU A 1 15  ? 7.508   52.362 5.583   1.00 21.13 ? 15   LEU A C     1 
ATOM   113  O O     . LEU A 1 15  ? 8.075   52.207 4.498   1.00 25.74 ? 15   LEU A O     1 
ATOM   114  C CB    . LEU A 1 15  ? 5.364   51.015 5.632   1.00 24.28 ? 15   LEU A CB    1 
ATOM   115  C CG    . LEU A 1 15  ? 4.882   49.534 5.603   1.00 27.17 ? 15   LEU A CG    1 
ATOM   116  C CD1   . LEU A 1 15  ? 4.873   48.865 6.939   1.00 29.70 ? 15   LEU A CD1   1 
ATOM   117  C CD2   . LEU A 1 15  ? 3.526   49.575 4.940   1.00 34.22 ? 15   LEU A CD2   1 
ATOM   118  N N     . ALA A 1 16  ? 7.616   53.534 6.238   1.00 20.97 ? 16   ALA A N     1 
ATOM   119  C CA    . ALA A 1 16  ? 8.383   54.628 5.618   1.00 21.40 ? 16   ALA A CA    1 
ATOM   120  C C     . ALA A 1 16  ? 9.852   54.249 5.544   1.00 22.32 ? 16   ALA A C     1 
ATOM   121  O O     . ALA A 1 16  ? 10.632  54.779 4.756   1.00 30.60 ? 16   ALA A O     1 
ATOM   122  C CB    . ALA A 1 16  ? 8.219   55.836 6.518   1.00 22.79 ? 16   ALA A CB    1 
ATOM   123  N N     . LYS A 1 17  ? 10.253  53.350 6.434   1.00 22.57 ? 17   LYS A N     1 
ATOM   124  C CA    . LYS A 1 17  ? 11.640  52.934 6.478   1.00 25.19 ? 17   LYS A CA    1 
ATOM   125  C C     . LYS A 1 17  ? 11.988  51.809 5.523   1.00 29.48 ? 17   LYS A C     1 
ATOM   126  O O     . LYS A 1 17  ? 13.160  51.444 5.455   1.00 38.84 ? 17   LYS A O     1 
ATOM   127  C CB    . LYS A 1 17  ? 11.997  52.399 7.870   1.00 25.69 ? 17   LYS A CB    1 
ATOM   128  C CG    . LYS A 1 17  ? 11.570  53.322 9.009   1.00 27.84 ? 17   LYS A CG    1 
ATOM   129  C CD    . LYS A 1 17  ? 12.118  52.731 10.318  1.00 32.06 ? 17   LYS A CD    1 
ATOM   130  C CE    . LYS A 1 17  ? 11.080  52.557 11.405  1.00 39.55 ? 17   LYS A CE    1 
ATOM   131  N NZ    . LYS A 1 17  ? 11.466  51.580 12.477  1.00 44.03 ? 17   LYS A NZ    1 
ATOM   132  N N     . MET A 1 18  ? 11.044  51.227 4.807   1.00 34.06 ? 18   MET A N     1 
ATOM   133  C CA    . MET A 1 18  ? 11.246  50.076 3.953   1.00 36.13 ? 18   MET A CA    1 
ATOM   134  C C     . MET A 1 18  ? 11.364  50.332 2.447   1.00 42.87 ? 18   MET A C     1 
ATOM   135  O O     . MET A 1 18  ? 10.644  51.118 1.824   1.00 45.83 ? 18   MET A O     1 
ATOM   136  C CB    . MET A 1 18  ? 10.030  49.150 4.099   1.00 33.20 ? 18   MET A CB    1 
ATOM   137  C CG    . MET A 1 18  ? 9.799   48.682 5.549   1.00 32.47 ? 18   MET A CG    1 
ATOM   138  S SD    . MET A 1 18  ? 8.501   47.425 5.495   1.00 40.60 ? 18   MET A SD    1 
ATOM   139  C CE    . MET A 1 18  ? 8.665   46.607 7.075   1.00 86.20 ? 18   MET A CE    1 
ATOM   140  N N     . ASP A 1 19  ? 12.299  49.589 1.849   1.00 50.55 ? 19   ASP A N     1 
ATOM   141  C CA    . ASP A 1 19  ? 12.462  49.604 0.403   1.00 50.86 ? 19   ASP A CA    1 
ATOM   142  C C     . ASP A 1 19  ? 11.516  48.593 -0.203  1.00 45.53 ? 19   ASP A C     1 
ATOM   143  O O     . ASP A 1 19  ? 10.706  47.906 0.395   1.00 35.15 ? 19   ASP A O     1 
ATOM   144  C CB    . ASP A 1 19  ? 13.911  49.316 0.052   1.00 55.17 ? 19   ASP A CB    1 
ATOM   145  C CG    . ASP A 1 19  ? 14.409  47.956 0.489   1.00 55.98 ? 19   ASP A CG    1 
ATOM   146  O OD1   . ASP A 1 19  ? 15.648  47.815 0.688   1.00 64.04 ? 19   ASP A OD1   1 
ATOM   147  O OD2   . ASP A 1 19  ? 13.625  46.994 0.622   1.00 56.99 ? 19   ASP A OD2   1 
ATOM   148  N N     . ASP A 1 20  ? 11.609  48.435 -1.503  1.00 49.65 ? 20   ASP A N     1 
ATOM   149  C CA    . ASP A 1 20  ? 10.682  47.582 -2.230  1.00 54.39 ? 20   ASP A CA    1 
ATOM   150  C C     . ASP A 1 20  ? 10.825  46.119 -1.831  1.00 50.43 ? 20   ASP A C     1 
ATOM   151  O O     . ASP A 1 20  ? 9.863   45.362 -1.674  1.00 46.77 ? 20   ASP A O     1 
ATOM   152  C CB    . ASP A 1 20  ? 10.912  47.719 -3.730  1.00 55.86 ? 20   ASP A CB    1 
ATOM   153  C CG    . ASP A 1 20  ? 12.288  48.160 -4.163  1.00 55.31 ? 20   ASP A CG    1 
ATOM   154  O OD1   . ASP A 1 20  ? 13.230  48.425 -3.381  1.00 57.85 ? 20   ASP A OD1   1 
ATOM   155  O OD2   . ASP A 1 20  ? 12.448  48.249 -5.411  1.00 63.22 ? 20   ASP A OD2   1 
ATOM   156  N N     . GLY A 1 21  ? 12.100  45.768 -1.721  1.00 50.18 ? 21   GLY A N     1 
ATOM   157  C CA    . GLY A 1 21  ? 12.372  44.383 -1.374  1.00 48.40 ? 21   GLY A CA    1 
ATOM   158  C C     . GLY A 1 21  ? 11.718  44.065 -0.050  1.00 40.48 ? 21   GLY A C     1 
ATOM   159  O O     . GLY A 1 21  ? 11.086  43.041 0.079   1.00 39.62 ? 21   GLY A O     1 
ATOM   160  N N     . GLN A 1 22  ? 11.842  44.929 0.939   1.00 38.13 ? 22   GLN A N     1 
ATOM   161  C CA    . GLN A 1 22  ? 11.251  44.632 2.239   1.00 35.62 ? 22   GLN A CA    1 
ATOM   162  C C     . GLN A 1 22  ? 9.729   44.663 2.180   1.00 28.19 ? 22   GLN A C     1 
ATOM   163  O O     . GLN A 1 22  ? 9.080   43.903 2.897   1.00 29.49 ? 22   GLN A O     1 
ATOM   164  C CB    . GLN A 1 22  ? 11.703  45.618 3.324   1.00 35.37 ? 22   GLN A CB    1 
ATOM   165  C CG    . GLN A 1 22  ? 13.077  45.295 3.887   1.00 39.03 ? 22   GLN A CG    1 
ATOM   166  C CD    . GLN A 1 22  ? 13.480  46.216 5.013   1.00 44.33 ? 22   GLN A CD    1 
ATOM   167  O OE1   . GLN A 1 22  ? 13.682  45.724 6.131   1.00 55.79 ? 22   GLN A OE1   1 
ATOM   168  N NE2   . GLN A 1 22  ? 13.599  47.508 4.665   1.00 39.78 ? 22   GLN A NE2   1 
ATOM   169  N N     . LEU A 1 23  ? 9.139   45.535 1.357   1.00 24.28 ? 23   LEU A N     1 
ATOM   170  C CA    . LEU A 1 23  ? 7.694   45.537 1.299   1.00 21.03 ? 23   LEU A CA    1 
ATOM   171  C C     . LEU A 1 23  ? 7.146   44.178 0.905   1.00 19.57 ? 23   LEU A C     1 
ATOM   172  O O     . LEU A 1 23  ? 6.056   43.740 1.268   1.00 19.30 ? 23   LEU A O     1 
ATOM   173  C CB    . LEU A 1 23  ? 7.216   46.510 0.217   1.00 24.90 ? 23   LEU A CB    1 
ATOM   174  C CG    . LEU A 1 23  ? 5.936   47.261 0.429   1.00 30.12 ? 23   LEU A CG    1 
ATOM   175  C CD1   . LEU A 1 23  ? 5.955   48.042 1.750   1.00 37.59 ? 23   LEU A CD1   1 
ATOM   176  C CD2   . LEU A 1 23  ? 5.778   48.226 -0.749  1.00 37.19 ? 23   LEU A CD2   1 
ATOM   177  N N     . ASP A 1 24  ? 7.943   43.461 0.094   1.00 19.42 ? 24   ASP A N     1 
ATOM   178  C CA    . ASP A 1 24  ? 7.525   42.130 -0.364  1.00 20.27 ? 24   ASP A CA    1 
ATOM   179  C C     . ASP A 1 24  ? 7.596   41.091 0.762   1.00 20.67 ? 24   ASP A C     1 
ATOM   180  O O     . ASP A 1 24  ? 7.185   39.985 0.604   1.00 26.24 ? 24   ASP A O     1 
ATOM   181  C CB    . ASP A 1 24  ? 8.414   41.661 -1.515  1.00 21.28 ? 24   ASP A CB    1 
ATOM   182  C CG    . ASP A 1 24  ? 8.040   42.308 -2.837  1.00 21.40 ? 24   ASP A CG    1 
ATOM   183  O OD1   . ASP A 1 24  ? 6.936   42.842 -2.967  1.00 21.41 ? 24   ASP A OD1   1 
ATOM   184  O OD2   . ASP A 1 24  ? 8.940   42.239 -3.730  1.00 32.97 ? 24   ASP A OD2   1 
ATOM   185  N N     . GLY A 1 25  ? 8.186   41.402 1.928   1.00 21.58 ? 25   GLY A N     1 
ATOM   186  C CA    . GLY A 1 25  ? 8.226   40.457 3.044   1.00 23.28 ? 25   GLY A CA    1 
ATOM   187  C C     . GLY A 1 25  ? 7.068   40.665 4.011   1.00 21.72 ? 25   GLY A C     1 
ATOM   188  O O     . GLY A 1 25  ? 7.005   40.001 5.019   1.00 25.58 ? 25   GLY A O     1 
ATOM   189  N N     . LEU A 1 26  ? 6.111   41.560 3.706   1.00 19.03 ? 26   LEU A N     1 
ATOM   190  C CA    . LEU A 1 26  ? 5.004   41.789 4.594   1.00 16.95 ? 26   LEU A CA    1 
ATOM   191  C C     . LEU A 1 26  ? 4.004   40.627 4.512   1.00 17.08 ? 26   LEU A C     1 
ATOM   192  O O     . LEU A 1 26  ? 3.868   39.993 3.462   1.00 20.64 ? 26   LEU A O     1 
ATOM   193  C CB    . LEU A 1 26  ? 4.244   43.076 4.253   1.00 17.48 ? 26   LEU A CB    1 
ATOM   194  C CG    . LEU A 1 26  ? 4.997   44.405 4.490   1.00 19.40 ? 26   LEU A CG    1 
ATOM   195  C CD1   . LEU A 1 26  ? 4.140   45.526 3.944   1.00 22.61 ? 26   LEU A CD1   1 
ATOM   196  C CD2   . LEU A 1 26  ? 5.305   44.490 5.971   1.00 22.91 ? 26   LEU A CD2   1 
ATOM   197  N N     . ALA A 1 27  ? 3.263   40.398 5.610   1.00 16.63 ? 27   ALA A N     1 
ATOM   198  C CA    . ALA A 1 27  ? 2.290   39.329 5.675   1.00 17.70 ? 27   ALA A CA    1 
ATOM   199  C C     . ALA A 1 27  ? 0.958   39.682 5.038   1.00 16.10 ? 27   ALA A C     1 
ATOM   200  O O     . ALA A 1 27  ? 0.094   38.812 4.918   1.00 17.94 ? 27   ALA A O     1 
ATOM   201  C CB    . ALA A 1 27  ? 2.014   38.930 7.129   1.00 21.23 ? 27   ALA A CB    1 
ATOM   202  N N     . PHE A 1 28  ? 0.802   40.919 4.628   1.00 15.10 ? 28   PHE A N     1 
ATOM   203  C CA    . PHE A 1 28  ? -0.449  41.380 3.995   1.00 14.96 ? 28   PHE A CA    1 
ATOM   204  C C     . PHE A 1 28  ? -0.111  42.176 2.769   1.00 14.04 ? 28   PHE A C     1 
ATOM   205  O O     . PHE A 1 28  ? 1.010   42.594 2.527   1.00 14.22 ? 28   PHE A O     1 
ATOM   206  C CB    . PHE A 1 28  ? -1.182  42.233 5.038   1.00 16.50 ? 28   PHE A CB    1 
ATOM   207  C CG    . PHE A 1 28  ? -0.343  43.330 5.661   1.00 15.39 ? 28   PHE A CG    1 
ATOM   208  C CD1   . PHE A 1 28  ? -0.251  44.580 5.070   1.00 16.66 ? 28   PHE A CD1   1 
ATOM   209  C CD2   . PHE A 1 28  ? 0.354   43.040 6.844   1.00 18.54 ? 28   PHE A CD2   1 
ATOM   210  C CE1   . PHE A 1 28  ? 0.520   45.543 5.658   1.00 19.56 ? 28   PHE A CE1   1 
ATOM   211  C CE2   . PHE A 1 28  ? 1.082   44.043 7.459   1.00 20.47 ? 28   PHE A CE2   1 
ATOM   212  C CZ    . PHE A 1 28  ? 1.129   45.301 6.861   1.00 21.64 ? 28   PHE A CZ    1 
ATOM   213  N N     . GLY A 1 29  ? -1.130  42.432 1.923   1.00 12.90 ? 29   GLY A N     1 
ATOM   214  C CA    . GLY A 1 29  ? -0.977  43.214 0.718   1.00 11.99 ? 29   GLY A CA    1 
ATOM   215  C C     . GLY A 1 29  ? -0.792  44.674 1.028   1.00 11.72 ? 29   GLY A C     1 
ATOM   216  O O     . GLY A 1 29  ? -1.450  45.226 1.946   1.00 13.13 ? 29   GLY A O     1 
ATOM   217  N N     . ALA A 1 30  ? 0.052   45.340 0.239   1.00 12.59 ? 30   ALA A N     1 
ATOM   218  C CA    . ALA A 1 30  ? 0.283   46.768 0.439   1.00 12.96 ? 30   ALA A CA    1 
ATOM   219  C C     . ALA A 1 30  ? 0.431   47.412 -0.951  1.00 12.16 ? 30   ALA A C     1 
ATOM   220  O O     . ALA A 1 30  ? 1.210   46.897 -1.764  1.00 15.26 ? 30   ALA A O     1 
ATOM   221  C CB    . ALA A 1 30  ? 1.536   46.991 1.276   1.00 15.72 ? 30   ALA A CB    1 
ATOM   222  N N     . ILE A 1 31  ? -0.329  48.448 -1.147  1.00 11.28 ? 31   ILE A N     1 
ATOM   223  C CA    . ILE A 1 31  ? -0.277  49.222 -2.360  1.00 11.74 ? 31   ILE A CA    1 
ATOM   224  C C     . ILE A 1 31  ? -0.057  50.640 -1.940  1.00 12.16 ? 31   ILE A C     1 
ATOM   225  O O     . ILE A 1 31  ? -0.684  51.148 -1.015  1.00 14.76 ? 31   ILE A O     1 
ATOM   226  C CB    . ILE A 1 31  ? -1.647  49.157 -3.100  1.00 13.26 ? 31   ILE A CB    1 
ATOM   227  C CG1   . ILE A 1 31  ? -2.054  47.702 -3.352  1.00 15.69 ? 31   ILE A CG1   1 
ATOM   228  C CG2   . ILE A 1 31  ? -1.550  49.986 -4.406  1.00 17.47 ? 31   ILE A CG2   1 
ATOM   229  C CD1   . ILE A 1 31  ? -3.538  47.621 -3.812  1.00 21.98 ? 31   ILE A CD1   1 
ATOM   230  N N     . GLN A 1 32  ? 0.874   51.375 -2.554  1.00 12.90 ? 32   GLN A N     1 
ATOM   231  C CA    . GLN A 1 32  ? 1.052   52.796 -2.314  1.00 12.71 ? 32   GLN A CA    1 
ATOM   232  C C     . GLN A 1 32  ? 0.525   53.533 -3.524  1.00 11.82 ? 32   GLN A C     1 
ATOM   233  O O     . GLN A 1 32  ? 0.886   53.195 -4.662  1.00 14.03 ? 32   GLN A O     1 
ATOM   234  C CB    . GLN A 1 32  ? 2.546   53.092 -2.142  1.00 15.26 ? 32   GLN A CB    1 
ATOM   235  C CG    . GLN A 1 32  ? 2.731   54.499 -1.541  1.00 20.10 ? 32   GLN A CG    1 
ATOM   236  C CD    . GLN A 1 32  ? 4.237   54.773 -1.336  1.00 29.63 ? 32   GLN A CD    1 
ATOM   237  O OE1   . GLN A 1 32  ? 5.088   54.123 -1.978  1.00 39.69 ? 32   GLN A OE1   1 
ATOM   238  N NE2   . GLN A 1 32  ? 4.488   55.704 -0.444  1.00 37.56 ? 32   GLN A NE2   1 
ATOM   239  N N     . LEU A 1 33  ? -0.350  54.516 -3.265  1.00 12.96 ? 33   LEU A N     1 
ATOM   240  C CA    . LEU A 1 33  ? -0.945  55.331 -4.341  1.00 12.10 ? 33   LEU A CA    1 
ATOM   241  C C     . LEU A 1 33  ? -0.561  56.773 -4.229  1.00 12.26 ? 33   LEU A C     1 
ATOM   242  O O     . LEU A 1 33  ? -0.382  57.241 -3.080  1.00 14.96 ? 33   LEU A O     1 
ATOM   243  C CB    . LEU A 1 33  ? -2.472  55.252 -4.174  1.00 13.83 ? 33   LEU A CB    1 
ATOM   244  C CG    . LEU A 1 33  ? -3.116  53.869 -4.262  1.00 12.83 ? 33   LEU A CG    1 
ATOM   245  C CD1   . LEU A 1 33  ? -4.628  53.965 -4.008  1.00 16.55 ? 33   LEU A CD1   1 
ATOM   246  C CD2   . LEU A 1 33  ? -2.829  53.217 -5.583  1.00 16.82 ? 33   LEU A CD2   1 
ATOM   247  N N     . ASP A 1 34  ? -0.525  57.504 -5.316  1.00 13.22 ? 34   ASP A N     1 
ATOM   248  C CA    . ASP A 1 34  ? -0.483  58.982 -5.203  1.00 14.10 ? 34   ASP A CA    1 
ATOM   249  C C     . ASP A 1 34  ? -1.905  59.464 -5.018  1.00 13.76 ? 34   ASP A C     1 
ATOM   250  O O     . ASP A 1 34  ? -2.882  58.704 -4.907  1.00 13.95 ? 34   ASP A O     1 
ATOM   251  C CB    . ASP A 1 34  ? 0.222   59.574 -6.385  1.00 14.80 ? 34   ASP A CB    1 
ATOM   252  C CG    . ASP A 1 34  ? -0.508  59.466 -7.683  1.00 14.44 ? 34   ASP A CG    1 
ATOM   253  O OD1   . ASP A 1 34  ? -1.693  59.155 -7.744  1.00 14.51 ? 34   ASP A OD1   1 
ATOM   254  O OD2   . ASP A 1 34  ? 0.143   59.778 -8.701  1.00 20.12 ? 34   ASP A OD2   1 
ATOM   255  N N     . GLY A 1 35  ? -2.102  60.779 -4.942  1.00 15.29 ? 35   GLY A N     1 
ATOM   256  C CA    . GLY A 1 35  ? -3.427  61.307 -4.632  1.00 16.66 ? 35   GLY A CA    1 
ATOM   257  C C     . GLY A 1 35  ? -4.398  61.136 -5.759  1.00 16.21 ? 35   GLY A C     1 
ATOM   258  O O     . GLY A 1 35  ? -5.565  61.384 -5.538  1.00 19.19 ? 35   GLY A O     1 
ATOM   259  N N     . ASP A 1 36  ? -4.013  60.790 -6.998  1.00 15.32 ? 36   ASP A N     1 
ATOM   260  C CA    . ASP A 1 36  ? -4.911  60.534 -8.079  1.00 16.34 ? 36   ASP A CA    1 
ATOM   261  C C     . ASP A 1 36  ? -5.209  59.018 -8.179  1.00 14.94 ? 36   ASP A C     1 
ATOM   262  O O     . ASP A 1 36  ? -5.971  58.633 -9.043  1.00 18.46 ? 36   ASP A O     1 
ATOM   263  C CB    . ASP A 1 36  ? -4.316  60.999 -9.394  1.00 18.84 ? 36   ASP A CB    1 
ATOM   264  C CG    . ASP A 1 36  ? -4.480  62.484 -9.574  1.00 23.05 ? 36   ASP A CG    1 
ATOM   265  O OD1   . ASP A 1 36  ? -5.248  63.140 -8.877  1.00 28.44 ? 36   ASP A OD1   1 
ATOM   266  O OD2   . ASP A 1 36  ? -3.753  62.921 -10.463 1.00 39.00 ? 36   ASP A OD2   1 
ATOM   267  N N     . GLY A 1 37  ? -4.612  58.218 -7.333  1.00 13.31 ? 37   GLY A N     1 
ATOM   268  C CA    . GLY A 1 37  ? -4.830  56.757 -7.384  1.00 14.92 ? 37   GLY A CA    1 
ATOM   269  C C     . GLY A 1 37  ? -3.842  56.014 -8.320  1.00 14.44 ? 37   GLY A C     1 
ATOM   270  O O     . GLY A 1 37  ? -4.037  54.815 -8.599  1.00 15.59 ? 37   GLY A O     1 
ATOM   271  N N     . ASN A 1 38  ? -2.763  56.679 -8.778  1.00 13.05 ? 38   ASN A N     1 
ATOM   272  C CA    . ASN A 1 38  ? -1.763  55.962 -9.552  1.00 13.42 ? 38   ASN A CA    1 
ATOM   273  C C     . ASN A 1 38  ? -0.934  55.077 -8.631  1.00 13.00 ? 38   ASN A C     1 
ATOM   274  O O     . ASN A 1 38  ? -0.600  55.462 -7.514  1.00 13.68 ? 38   ASN A O     1 
ATOM   275  C CB    . ASN A 1 38  ? -0.848  56.951 -10.319 1.00 14.09 ? 38   ASN A CB    1 
ATOM   276  C CG    . ASN A 1 38  ? -1.686  57.824 -11.213 1.00 16.23 ? 38   ASN A CG    1 
ATOM   277  O OD1   . ASN A 1 38  ? -2.472  57.321 -12.050 1.00 18.95 ? 38   ASN A OD1   1 
ATOM   278  N ND2   . ASN A 1 38  ? -1.513  59.126 -11.073 1.00 19.18 ? 38   ASN A ND2   1 
ATOM   279  N N     . ILE A 1 39  ? -0.627  53.862 -9.117  1.00 12.51 ? 39   ILE A N     1 
ATOM   280  C CA    . ILE A 1 39  ? 0.087   52.890 -8.274  1.00 12.48 ? 39   ILE A CA    1 
ATOM   281  C C     . ILE A 1 39  ? 1.565   53.106 -8.289  1.00 13.37 ? 39   ILE A C     1 
ATOM   282  O O     . ILE A 1 39  ? 2.204   53.036 -9.367  1.00 16.88 ? 39   ILE A O     1 
ATOM   283  C CB    . ILE A 1 39  ? -0.270  51.448 -8.766  1.00 13.18 ? 39   ILE A CB    1 
ATOM   284  C CG1   . ILE A 1 39  ? -1.774  51.178 -8.647  1.00 14.06 ? 39   ILE A CG1   1 
ATOM   285  C CG2   . ILE A 1 39  ? 0.572   50.440 -7.994  1.00 15.27 ? 39   ILE A CG2   1 
ATOM   286  C CD1   . ILE A 1 39  ? -2.179  49.939 -9.400  1.00 16.93 ? 39   ILE A CD1   1 
ATOM   287  N N     . LEU A 1 40  ? 2.114   53.391 -7.117  1.00 14.38 ? 40   LEU A N     1 
ATOM   288  C CA    . LEU A 1 40  ? 3.536   53.656 -6.921  1.00 15.81 ? 40   LEU A CA    1 
ATOM   289  C C     . LEU A 1 40  ? 4.294   52.402 -6.487  1.00 16.91 ? 40   LEU A C     1 
ATOM   290  O O     . LEU A 1 40  ? 5.455   52.196 -6.911  1.00 19.67 ? 40   LEU A O     1 
ATOM   291  C CB    . LEU A 1 40  ? 3.721   54.738 -5.869  1.00 17.52 ? 40   LEU A CB    1 
ATOM   292  C CG    . LEU A 1 40  ? 2.905   56.027 -6.083  1.00 19.28 ? 40   LEU A CG    1 
ATOM   293  C CD1   . LEU A 1 40  ? 3.212   57.007 -4.962  1.00 21.10 ? 40   LEU A CD1   1 
ATOM   294  C CD2   . LEU A 1 40  ? 3.110   56.622 -7.475  1.00 27.52 ? 40   LEU A CD2   1 
ATOM   295  N N     . GLN A 1 41  ? 3.656   51.572 -5.657  1.00 16.54 ? 41   GLN A N     1 
ATOM   296  C CA    . GLN A 1 41  ? 4.268   50.334 -5.186  1.00 16.16 ? 41   GLN A CA    1 
ATOM   297  C C     . GLN A 1 41  ? 3.148   49.334 -5.014  1.00 13.58 ? 41   GLN A C     1 
ATOM   298  O O     . GLN A 1 41  ? 1.993   49.719 -4.759  1.00 14.76 ? 41   GLN A O     1 
ATOM   299  C CB    . GLN A 1 41  ? 4.921   50.499 -3.776  1.00 19.81 ? 41   GLN A CB    1 
ATOM   300  C CG    . GLN A 1 41  ? 6.067   51.473 -3.721  1.00 25.47 ? 41   GLN A CG    1 
ATOM   301  C CD    . GLN A 1 41  ? 6.860   51.482 -2.433  1.00 31.18 ? 41   GLN A CD    1 
ATOM   302  O OE1   . GLN A 1 41  ? 6.588   52.284 -1.512  1.00 42.18 ? 41   GLN A OE1   1 
ATOM   303  N NE2   . GLN A 1 41  ? 7.855   50.603 -2.400  1.00 39.48 ? 41   GLN A NE2   1 
ATOM   304  N N     . TYR A 1 42  ? 3.485   48.084 -5.157  1.00 15.59 ? 42   TYR A N     1 
ATOM   305  C CA    . TYR A 1 42  ? 2.477   47.008 -5.128  1.00 14.23 ? 42   TYR A CA    1 
ATOM   306  C C     . TYR A 1 42  ? 3.218   45.749 -4.714  1.00 14.20 ? 42   TYR A C     1 
ATOM   307  O O     . TYR A 1 42  ? 4.113   45.322 -5.489  1.00 18.43 ? 42   TYR A O     1 
ATOM   308  C CB    . TYR A 1 42  ? 1.857   46.918 -6.516  1.00 15.25 ? 42   TYR A CB    1 
ATOM   309  C CG    . TYR A 1 42  ? 0.636   46.030 -6.677  1.00 14.58 ? 42   TYR A CG    1 
ATOM   310  C CD1   . TYR A 1 42  ? 0.751   44.652 -6.833  1.00 17.09 ? 42   TYR A CD1   1 
ATOM   311  C CD2   . TYR A 1 42  ? -0.644  46.535 -6.743  1.00 14.31 ? 42   TYR A CD2   1 
ATOM   312  C CE1   . TYR A 1 42  ? -0.355  43.842 -7.009  1.00 16.12 ? 42   TYR A CE1   1 
ATOM   313  C CE2   . TYR A 1 42  ? -1.788  45.776 -6.914  1.00 13.14 ? 42   TYR A CE2   1 
ATOM   314  C CZ    . TYR A 1 42  ? -1.622  44.411 -7.042  1.00 14.98 ? 42   TYR A CZ    1 
ATOM   315  O OH    . TYR A 1 42  ? -2.724  43.623 -7.215  1.00 16.41 ? 42   TYR A OH    1 
ATOM   316  N N     . ASN A 1 43  ? 2.965   45.199 -3.552  1.00 14.24 ? 43   ASN A N     1 
ATOM   317  C CA    . ASN A 1 43  ? 3.871   44.134 -3.075  1.00 14.23 ? 43   ASN A CA    1 
ATOM   318  C C     . ASN A 1 43  ? 3.446   42.750 -3.484  1.00 14.87 ? 43   ASN A C     1 
ATOM   319  O O     . ASN A 1 43  ? 2.389   42.494 -4.058  1.00 16.34 ? 43   ASN A O     1 
ATOM   320  C CB    . ASN A 1 43  ? 4.107   44.223 -1.570  1.00 15.16 ? 43   ASN A CB    1 
ATOM   321  C CG    . ASN A 1 43  ? 2.966   43.758 -0.708  1.00 13.52 ? 43   ASN A CG    1 
ATOM   322  O OD1   . ASN A 1 43  ? 1.828   43.565 -1.224  1.00 15.21 ? 43   ASN A OD1   1 
ATOM   323  N ND2   . ASN A 1 43  ? 3.182   43.577 0.598   1.00 16.78 ? 43   ASN A ND2   1 
ATOM   324  N N     . ALA A 1 44  ? 4.363   41.817 -3.163  1.00 17.46 ? 44   ALA A N     1 
ATOM   325  C CA    . ALA A 1 44  ? 4.173   40.442 -3.600  1.00 17.52 ? 44   ALA A CA    1 
ATOM   326  C C     . ALA A 1 44  ? 2.944   39.850 -2.925  1.00 16.74 ? 44   ALA A C     1 
ATOM   327  O O     . ALA A 1 44  ? 2.197   39.066 -3.539  1.00 18.30 ? 44   ALA A O     1 
ATOM   328  C CB    . ALA A 1 44  ? 5.388   39.595 -3.260  1.00 20.38 ? 44   ALA A CB    1 
ATOM   329  N N     . ALA A 1 45  ? 2.658   40.142 -1.669  1.00 16.56 ? 45   ALA A N     1 
ATOM   330  C CA    . ALA A 1 45  ? 1.517   39.542 -0.992  1.00 16.57 ? 45   ALA A CA    1 
ATOM   331  C C     . ALA A 1 45  ? 0.236   40.002 -1.658  1.00 16.43 ? 45   ALA A C     1 
ATOM   332  O O     . ALA A 1 45  ? -0.715  39.234 -1.712  1.00 17.34 ? 45   ALA A O     1 
ATOM   333  C CB    . ALA A 1 45  ? 1.450   39.909 0.484   1.00 19.30 ? 45   ALA A CB    1 
ATOM   334  N N     . GLN A 1 46  ? 0.165   41.238 -2.132  1.00 14.22 ? 46   GLN A N     1 
ATOM   335  C CA    . GLN A 1 46  ? -1.036  41.702 -2.808  1.00 12.92 ? 46   GLN A CA    1 
ATOM   336  C C     . GLN A 1 46  ? -1.222  40.891 -4.082  1.00 13.45 ? 46   GLN A C     1 
ATOM   337  O O     . GLN A 1 46  ? -2.329  40.469 -4.448  1.00 15.61 ? 46   GLN A O     1 
ATOM   338  C CB    . GLN A 1 46  ? -0.881  43.189 -3.119  1.00 13.52 ? 46   GLN A CB    1 
ATOM   339  C CG    . GLN A 1 46  ? -2.163  43.763 -3.771  1.00 13.63 ? 46   GLN A CG    1 
ATOM   340  C CD    . GLN A 1 46  ? -3.337  43.739 -2.832  1.00 13.99 ? 46   GLN A CD    1 
ATOM   341  O OE1   . GLN A 1 46  ? -3.245  43.546 -1.640  1.00 19.70 ? 46   GLN A OE1   1 
ATOM   342  N NE2   . GLN A 1 46  ? -4.555  43.996 -3.369  1.00 16.63 ? 46   GLN A NE2   1 
ATOM   343  N N     . GLY A 1 47  ? -0.178  40.674 -4.883  1.00 14.75 ? 47   GLY A N     1 
ATOM   344  C CA    . GLY A 1 47  ? -0.294  39.898 -6.118  1.00 17.64 ? 47   GLY A CA    1 
ATOM   345  C C     . GLY A 1 47  ? -0.728  38.477 -5.859  1.00 15.63 ? 47   GLY A C     1 
ATOM   346  O O     . GLY A 1 47  ? -1.431  37.900 -6.699  1.00 20.35 ? 47   GLY A O     1 
ATOM   347  N N     . ASP A 1 48  ? -0.358  37.930 -4.701  1.00 17.49 ? 48   ASP A N     1 
ATOM   348  C CA    . ASP A 1 48  ? -0.838  36.577 -4.333  1.00 19.10 ? 48   ASP A CA    1 
ATOM   349  C C     . ASP A 1 48  ? -2.343  36.564 -4.097  1.00 20.11 ? 48   ASP A C     1 
ATOM   350  O O     . ASP A 1 48  ? -3.063  35.566 -4.288  1.00 30.26 ? 48   ASP A O     1 
ATOM   351  C CB    . ASP A 1 48  ? -0.107  36.101 -3.086  1.00 24.24 ? 48   ASP A CB    1 
ATOM   352  C CG    . ASP A 1 48  ? 1.326   35.678 -3.318  1.00 27.64 ? 48   ASP A CG    1 
ATOM   353  O OD1   . ASP A 1 48  ? 1.750   35.569 -4.487  1.00 37.39 ? 48   ASP A OD1   1 
ATOM   354  O OD2   . ASP A 1 48  ? 2.004   35.429 -2.289  1.00 34.94 ? 48   ASP A OD2   1 
ATOM   355  N N     . ILE A 1 49  ? -2.900  37.690 -3.625  1.00 18.08 ? 49   ILE A N     1 
ATOM   356  C CA    . ILE A 1 49  ? -4.352  37.722 -3.411  1.00 18.21 ? 49   ILE A CA    1 
ATOM   357  C C     . ILE A 1 49  ? -5.099  37.865 -4.724  1.00 19.54 ? 49   ILE A C     1 
ATOM   358  O O     . ILE A 1 49  ? -6.156  37.265 -4.971  1.00 22.26 ? 49   ILE A O     1 
ATOM   359  C CB    . ILE A 1 49  ? -4.693  38.856 -2.392  1.00 19.37 ? 49   ILE A CB    1 
ATOM   360  C CG1   . ILE A 1 49  ? -4.123  38.599 -0.997  1.00 24.50 ? 49   ILE A CG1   1 
ATOM   361  C CG2   . ILE A 1 49  ? -6.190  39.094 -2.345  1.00 25.67 ? 49   ILE A CG2   1 
ATOM   362  C CD1   . ILE A 1 49  ? -4.218  39.753 -0.016  1.00 27.02 ? 49   ILE A CD1   1 
ATOM   363  N N     . THR A 1 50  ? -4.585  38.755 -5.597  1.00 16.89 ? 50   THR A N     1 
ATOM   364  C CA    . THR A 1 50  ? -5.336  39.191 -6.733  1.00 16.62 ? 50   THR A CA    1 
ATOM   365  C C     . THR A 1 50  ? -4.930  38.619 -8.083  1.00 18.17 ? 50   THR A C     1 
ATOM   366  O O     . THR A 1 50  ? -5.628  38.777 -9.100  1.00 19.07 ? 50   THR A O     1 
ATOM   367  C CB    . THR A 1 50  ? -5.203  40.739 -6.887  1.00 17.06 ? 50   THR A CB    1 
ATOM   368  O OG1   . THR A 1 50  ? -3.836  40.961 -7.232  1.00 18.39 ? 50   THR A OG1   1 
ATOM   369  C CG2   . THR A 1 50  ? -5.575  41.419 -5.598  1.00 20.54 ? 50   THR A CG2   1 
ATOM   370  N N     . GLY A 1 51  ? -3.823  37.930 -8.120  1.00 18.64 ? 51   GLY A N     1 
ATOM   371  C CA    . GLY A 1 51  ? -3.359  37.385 -9.405  1.00 20.88 ? 51   GLY A CA    1 
ATOM   372  C C     . GLY A 1 51  ? -2.772  38.419 -10.344 1.00 19.13 ? 51   GLY A C     1 
ATOM   373  O O     . GLY A 1 51  ? -2.547  38.058 -11.511 1.00 23.90 ? 51   GLY A O     1 
ATOM   374  N N     . ARG A 1 52  ? -2.498  39.647 -9.888  1.00 16.69 ? 52   ARG A N     1 
ATOM   375  C CA    . ARG A 1 52  ? -1.838  40.631 -10.698 1.00 19.04 ? 52   ARG A CA    1 
ATOM   376  C C     . ARG A 1 52  ? -0.336  40.576 -10.506 1.00 19.62 ? 52   ARG A C     1 
ATOM   377  O O     . ARG A 1 52  ? 0.150   40.415 -9.369  1.00 22.31 ? 52   ARG A O     1 
ATOM   378  C CB    . ARG A 1 52  ? -2.370  42.039 -10.302 1.00 20.41 ? 52   ARG A CB    1 
ATOM   379  C CG    . ARG A 1 52  ? -3.633  42.404 -11.091 1.00 21.97 ? 52   ARG A CG    1 
ATOM   380  C CD    . ARG A 1 52  ? -4.803  41.513 -10.725 1.00 21.89 ? 52   ARG A CD    1 
ATOM   381  N NE    . ARG A 1 52  ? -5.991  42.127 -11.396 1.00 21.39 ? 52   ARG A NE    1 
ATOM   382  C CZ    . ARG A 1 52  ? -7.206  41.656 -11.262 1.00 22.06 ? 52   ARG A CZ    1 
ATOM   383  N NH1   . ARG A 1 52  ? -7.372  40.587 -10.506 1.00 26.03 ? 52   ARG A NH1   1 
ATOM   384  N NH2   . ARG A 1 52  ? -8.196  42.251 -11.876 1.00 28.59 ? 52   ARG A NH2   1 
ATOM   385  N N     . ASP A 1 53  ? 0.431   40.722 -11.574 1.00 21.35 ? 53   ASP A N     1 
ATOM   386  C CA    . ASP A 1 53  ? 1.895   40.787 -11.462 1.00 19.61 ? 53   ASP A CA    1 
ATOM   387  C C     . ASP A 1 53  ? 2.286   42.186 -11.050 1.00 21.49 ? 53   ASP A C     1 
ATOM   388  O O     . ASP A 1 53  ? 1.928   43.137 -11.735 1.00 19.88 ? 53   ASP A O     1 
ATOM   389  C CB    . ASP A 1 53  ? 2.453   40.467 -12.833 1.00 25.27 ? 53   ASP A CB    1 
ATOM   390  C CG    . ASP A 1 53  ? 3.934   40.640 -12.974 1.00 29.49 ? 53   ASP A CG    1 
ATOM   391  O OD1   . ASP A 1 53  ? 4.396   40.510 -14.120 1.00 37.17 ? 53   ASP A OD1   1 
ATOM   392  O OD2   . ASP A 1 53  ? 4.631   40.893 -11.984 1.00 32.31 ? 53   ASP A OD2   1 
ATOM   393  N N     . PRO A 1 54  ? 2.919   42.384 -9.912  1.00 20.61 ? 54   PRO A N     1 
ATOM   394  C CA    . PRO A 1 54  ? 3.247   43.734 -9.471  1.00 22.61 ? 54   PRO A CA    1 
ATOM   395  C C     . PRO A 1 54  ? 3.942   44.563 -10.528 1.00 26.32 ? 54   PRO A C     1 
ATOM   396  O O     . PRO A 1 54  ? 3.571   45.748 -10.730 1.00 30.50 ? 54   PRO A O     1 
ATOM   397  C CB    . PRO A 1 54  ? 4.193   43.446 -8.308  1.00 27.39 ? 54   PRO A CB    1 
ATOM   398  C CG    . PRO A 1 54  ? 3.657   42.149 -7.741  1.00 26.65 ? 54   PRO A CG    1 
ATOM   399  C CD    . PRO A 1 54  ? 3.301   41.322 -8.944  1.00 24.28 ? 54   PRO A CD    1 
ATOM   400  N N     . LYS A 1 55  ? 4.885   43.923 -11.190 1.00 27.39 ? 55   LYS A N     1 
ATOM   401  C CA    . LYS A 1 55  ? 5.645   44.710 -12.192 1.00 35.77 ? 55   LYS A CA    1 
ATOM   402  C C     . LYS A 1 55  ? 4.722   45.265 -13.243 1.00 35.75 ? 55   LYS A C     1 
ATOM   403  O O     . LYS A 1 55  ? 4.932   46.368 -13.779 1.00 43.47 ? 55   LYS A O     1 
ATOM   404  C CB    . LYS A 1 55  ? 6.809   43.867 -12.738 1.00 41.12 ? 55   LYS A CB    1 
ATOM   405  C CG    . LYS A 1 55  ? 7.993   43.876 -11.779 1.00 48.08 ? 55   LYS A CG    1 
ATOM   406  C CD    . LYS A 1 55  ? 7.814   42.995 -10.557 1.00 51.30 ? 55   LYS A CD    1 
ATOM   407  C CE    . LYS A 1 55  ? 8.958   43.222 -9.564  1.00 55.81 ? 55   LYS A CE    1 
ATOM   408  N NZ    . LYS A 1 55  ? 8.525   44.162 -8.489  1.00 75.54 ? 55   LYS A NZ    1 
ATOM   409  N N     . GLN A 1 56  ? 3.618   44.614 -13.570 1.00 31.49 ? 56   GLN A N     1 
ATOM   410  C CA    . GLN A 1 56  ? 2.782   45.147 -14.622 1.00 30.21 ? 56   GLN A CA    1 
ATOM   411  C C     . GLN A 1 56  ? 1.745   46.181 -14.222 1.00 27.48 ? 56   GLN A C     1 
ATOM   412  O O     . GLN A 1 56  ? 1.181   46.913 -15.044 1.00 34.11 ? 56   GLN A O     1 
ATOM   413  C CB    . GLN A 1 56  ? 2.035   43.985 -15.263 1.00 38.55 ? 56   GLN A CB    1 
ATOM   414  C CG    . GLN A 1 56  ? 3.027   42.862 -15.593 1.00 47.19 ? 56   GLN A CG    1 
ATOM   415  C CD    . GLN A 1 56  ? 2.392   42.050 -16.702 1.00 55.35 ? 56   GLN A CD    1 
ATOM   416  O OE1   . GLN A 1 56  ? 1.728   42.620 -17.563 1.00 68.59 ? 56   GLN A OE1   1 
ATOM   417  N NE2   . GLN A 1 56  ? 2.619   40.758 -16.615 1.00 62.16 ? 56   GLN A NE2   1 
ATOM   418  N N     . VAL A 1 57  ? 1.449   46.237 -12.933 1.00 22.43 ? 57   VAL A N     1 
ATOM   419  C CA    . VAL A 1 57  ? 0.409   47.225 -12.563 1.00 20.49 ? 57   VAL A CA    1 
ATOM   420  C C     . VAL A 1 57  ? 1.006   48.543 -12.093 1.00 17.69 ? 57   VAL A C     1 
ATOM   421  O O     . VAL A 1 57  ? 0.305   49.551 -11.970 1.00 18.19 ? 57   VAL A O     1 
ATOM   422  C CB    . VAL A 1 57  ? -0.576  46.677 -11.514 1.00 19.66 ? 57   VAL A CB    1 
ATOM   423  C CG1   . VAL A 1 57  ? -1.410  45.520 -12.015 1.00 24.06 ? 57   VAL A CG1   1 
ATOM   424  C CG2   . VAL A 1 57  ? 0.165   46.258 -10.219 1.00 24.28 ? 57   VAL A CG2   1 
ATOM   425  N N     . ILE A 1 58  ? 2.298   48.562 -11.773 1.00 19.79 ? 58   ILE A N     1 
ATOM   426  C CA    . ILE A 1 58  ? 2.899   49.802 -11.282 1.00 19.52 ? 58   ILE A CA    1 
ATOM   427  C C     . ILE A 1 58  ? 2.816   50.834 -12.397 1.00 18.56 ? 58   ILE A C     1 
ATOM   428  O O     . ILE A 1 58  ? 3.196   50.583 -13.534 1.00 26.46 ? 58   ILE A O     1 
ATOM   429  C CB    . ILE A 1 58  ? 4.321   49.531 -10.803 1.00 24.61 ? 58   ILE A CB    1 
ATOM   430  C CG1   . ILE A 1 58  ? 4.370   48.768 -9.466  1.00 31.44 ? 58   ILE A CG1   1 
ATOM   431  C CG2   . ILE A 1 58  ? 5.103   50.827 -10.650 1.00 29.25 ? 58   ILE A CG2   1 
ATOM   432  C CD1   . ILE A 1 58  ? 5.730   48.191 -9.161  1.00 45.01 ? 58   ILE A CD1   1 
ATOM   433  N N     . GLY A 1 59  ? 2.279   52.000 -12.035 1.00 17.17 ? 59   GLY A N     1 
ATOM   434  C CA    . GLY A 1 59  ? 2.090   53.132 -12.925 1.00 18.93 ? 59   GLY A CA    1 
ATOM   435  C C     . GLY A 1 59  ? 0.669   53.259 -13.443 1.00 17.64 ? 59   GLY A C     1 
ATOM   436  O O     . GLY A 1 59  ? 0.367   54.316 -13.975 1.00 21.89 ? 59   GLY A O     1 
ATOM   437  N N     . LYS A 1 60  ? -0.141  52.216 -13.337 1.00 16.31 ? 60   LYS A N     1 
ATOM   438  C CA    . LYS A 1 60  ? -1.536  52.298 -13.746 1.00 16.62 ? 60   LYS A CA    1 
ATOM   439  C C     . LYS A 1 60  ? -2.363  52.965 -12.668 1.00 14.31 ? 60   LYS A C     1 
ATOM   440  O O     . LYS A 1 60  ? -1.939  53.091 -11.533 1.00 15.90 ? 60   LYS A O     1 
ATOM   441  C CB    . LYS A 1 60  ? -2.066  50.875 -14.020 1.00 16.93 ? 60   LYS A CB    1 
ATOM   442  C CG    . LYS A 1 60  ? -1.322  50.260 -15.218 1.00 22.21 ? 60   LYS A CG    1 
ATOM   443  C CD    . LYS A 1 60  ? -1.898  48.960 -15.669 1.00 28.58 ? 60   LYS A CD    1 
ATOM   444  C CE    . LYS A 1 60  ? -1.067  48.289 -16.754 1.00 34.04 ? 60   LYS A CE    1 
ATOM   445  N NZ    . LYS A 1 60  ? -0.861  48.977 -18.023 1.00 55.04 ? 60   LYS A NZ    1 
ATOM   446  N N     . ASN A 1 61  ? -3.571  53.321 -13.111 1.00 14.47 ? 61   ASN A N     1 
ATOM   447  C CA    . ASN A 1 61  ? -4.451  53.943 -12.125 1.00 15.65 ? 61   ASN A CA    1 
ATOM   448  C C     . ASN A 1 61  ? -5.300  52.867 -11.474 1.00 14.43 ? 61   ASN A C     1 
ATOM   449  O O     . ASN A 1 61  ? -5.977  52.081 -12.155 1.00 15.52 ? 61   ASN A O     1 
ATOM   450  C CB    . ASN A 1 61  ? -5.310  55.016 -12.789 1.00 17.15 ? 61   ASN A CB    1 
ATOM   451  C CG    . ASN A 1 61  ? -6.092  55.768 -11.718 1.00 15.40 ? 61   ASN A CG    1 
ATOM   452  O OD1   . ASN A 1 61  ? -7.164  55.305 -11.284 1.00 16.99 ? 61   ASN A OD1   1 
ATOM   453  N ND2   . ASN A 1 61  ? -5.513  56.883 -11.274 1.00 18.48 ? 61   ASN A ND2   1 
ATOM   454  N N     . PHE A 1 62  ? -5.296  52.789 -10.150 1.00 13.17 ? 62   PHE A N     1 
ATOM   455  C CA    . PHE A 1 62  ? -5.996  51.754 -9.463  1.00 12.99 ? 62   PHE A CA    1 
ATOM   456  C C     . PHE A 1 62  ? -7.485  51.826 -9.650  1.00 12.39 ? 62   PHE A C     1 
ATOM   457  O O     . PHE A 1 62  ? -8.098  50.800 -9.869  1.00 14.40 ? 62   PHE A O     1 
ATOM   458  C CB    . PHE A 1 62  ? -5.611  51.929 -7.966  1.00 13.75 ? 62   PHE A CB    1 
ATOM   459  C CG    . PHE A 1 62  ? -6.177  50.832 -7.075  1.00 12.68 ? 62   PHE A CG    1 
ATOM   460  C CD1   . PHE A 1 62  ? -5.627  49.562 -7.040  1.00 14.25 ? 62   PHE A CD1   1 
ATOM   461  C CD2   . PHE A 1 62  ? -7.217  51.059 -6.225  1.00 14.20 ? 62   PHE A CD2   1 
ATOM   462  C CE1   . PHE A 1 62  ? -6.092  48.544 -6.232  1.00 15.05 ? 62   PHE A CE1   1 
ATOM   463  C CE2   . PHE A 1 62  ? -7.717  50.064 -5.392  1.00 16.17 ? 62   PHE A CE2   1 
ATOM   464  C CZ    . PHE A 1 62  ? -7.124  48.803 -5.348  1.00 16.08 ? 62   PHE A CZ    1 
ATOM   465  N N     . PHE A 1 63  ? -8.096  53.009 -9.599  1.00 12.55 ? 63   PHE A N     1 
ATOM   466  C CA    . PHE A 1 63  ? -9.559  53.088 -9.658  1.00 13.90 ? 63   PHE A CA    1 
ATOM   467  C C     . PHE A 1 63  ? -10.102 53.030 -11.058 1.00 13.86 ? 63   PHE A C     1 
ATOM   468  O O     . PHE A 1 63  ? -11.252 52.591 -11.215 1.00 17.89 ? 63   PHE A O     1 
ATOM   469  C CB    . PHE A 1 63  ? -9.995  54.424 -9.003  1.00 14.87 ? 63   PHE A CB    1 
ATOM   470  C CG    . PHE A 1 63  ? -9.538  54.435 -7.534  1.00 14.18 ? 63   PHE A CG    1 
ATOM   471  C CD1   . PHE A 1 63  ? -10.160 53.586 -6.612  1.00 16.21 ? 63   PHE A CD1   1 
ATOM   472  C CD2   . PHE A 1 63  ? -8.473  55.227 -7.115  1.00 17.66 ? 63   PHE A CD2   1 
ATOM   473  C CE1   . PHE A 1 63  ? -9.708  53.536 -5.298  1.00 16.12 ? 63   PHE A CE1   1 
ATOM   474  C CE2   . PHE A 1 63  ? -8.083  55.203 -5.778  1.00 17.32 ? 63   PHE A CE2   1 
ATOM   475  C CZ    . PHE A 1 63  ? -8.711  54.387 -4.880  1.00 17.34 ? 63   PHE A CZ    1 
ATOM   476  N N     . LYS A 1 64  ? -9.303  53.450 -12.035 1.00 15.68 ? 64   LYS A N     1 
ATOM   477  C CA    . LYS A 1 64  ? -9.812  53.485 -13.408 1.00 17.46 ? 64   LYS A CA    1 
ATOM   478  C C     . LYS A 1 64  ? -9.537  52.178 -14.142 1.00 17.35 ? 64   LYS A C     1 
ATOM   479  O O     . LYS A 1 64  ? -10.438 51.686 -14.839 1.00 23.68 ? 64   LYS A O     1 
ATOM   480  C CB    . LYS A 1 64  ? -9.195  54.624 -14.219 1.00 18.75 ? 64   LYS A CB    1 
ATOM   481  C CG    . LYS A 1 64  ? -9.714  54.614 -15.671 1.00 23.89 ? 64   LYS A CG    1 
ATOM   482  C CD    . LYS A 1 64  ? -9.197  55.772 -16.482 1.00 30.85 ? 64   LYS A CD    1 
ATOM   483  C CE    . LYS A 1 64  ? -9.405  55.785 -17.950 1.00 41.47 ? 64   LYS A CE    1 
ATOM   484  N NZ    . LYS A 1 64  ? -9.660  54.745 -18.982 1.00 47.68 ? 64   LYS A NZ    1 
ATOM   485  N N     . ASP A 1 65  ? -8.329  51.649 -13.972 1.00 15.62 ? 65   ASP A N     1 
ATOM   486  C CA    . ASP A 1 65  ? -7.814  50.575 -14.795 1.00 20.84 ? 65   ASP A CA    1 
ATOM   487  C C     . ASP A 1 65  ? -7.737  49.225 -14.098 1.00 18.69 ? 65   ASP A C     1 
ATOM   488  O O     . ASP A 1 65  ? -8.132  48.153 -14.616 1.00 23.76 ? 65   ASP A O     1 
ATOM   489  C CB    . ASP A 1 65  ? -6.356  50.896 -15.248 1.00 25.88 ? 65   ASP A CB    1 
ATOM   490  C CG    . ASP A 1 65  ? -6.056  52.214 -15.910 1.00 30.54 ? 65   ASP A CG    1 
ATOM   491  O OD1   . ASP A 1 65  ? -6.844  52.542 -16.814 1.00 31.22 ? 65   ASP A OD1   1 
ATOM   492  O OD2   . ASP A 1 65  ? -5.060  52.992 -15.655 1.00 41.56 ? 65   ASP A OD2   1 
ATOM   493  N N     . VAL A 1 66  ? -7.186  49.216 -12.892 1.00 15.27 ? 66   VAL A N     1 
ATOM   494  C CA    . VAL A 1 66  ? -6.862  47.916 -12.287 1.00 14.36 ? 66   VAL A CA    1 
ATOM   495  C C     . VAL A 1 66  ? -8.014  47.343 -11.500 1.00 14.21 ? 66   VAL A C     1 
ATOM   496  O O     . VAL A 1 66  ? -8.261  46.139 -11.513 1.00 15.40 ? 66   VAL A O     1 
ATOM   497  C CB    . VAL A 1 66  ? -5.616  48.091 -11.359 1.00 16.41 ? 66   VAL A CB    1 
ATOM   498  C CG1   . VAL A 1 66  ? -5.272  46.818 -10.624 1.00 17.50 ? 66   VAL A CG1   1 
ATOM   499  C CG2   . VAL A 1 66  ? -4.458  48.624 -12.202 1.00 18.74 ? 66   VAL A CG2   1 
ATOM   500  N N     . ALA A 1 67  ? -8.706  48.205 -10.730 1.00 13.56 ? 67   ALA A N     1 
ATOM   501  C CA    . ALA A 1 67  ? -9.693  47.742 -9.736  1.00 12.90 ? 67   ALA A CA    1 
ATOM   502  C C     . ALA A 1 67  ? -10.988 48.511 -9.895  1.00 12.56 ? 67   ALA A C     1 
ATOM   503  O O     . ALA A 1 67  ? -11.389 49.235 -8.987  1.00 13.01 ? 67   ALA A O     1 
ATOM   504  C CB    . ALA A 1 67  ? -9.101  47.870 -8.342  1.00 13.94 ? 67   ALA A CB    1 
ATOM   505  N N     . PRO A 1 68  ? -11.719 48.349 -10.984 1.00 14.49 ? 68   PRO A N     1 
ATOM   506  C CA    . PRO A 1 68  ? -12.950 49.134 -11.185 1.00 13.12 ? 68   PRO A CA    1 
ATOM   507  C C     . PRO A 1 68  ? -13.981 48.852 -10.126 1.00 12.88 ? 68   PRO A C     1 
ATOM   508  O O     . PRO A 1 68  ? -14.826 49.733 -9.888  1.00 14.45 ? 68   PRO A O     1 
ATOM   509  C CB    . PRO A 1 68  ? -13.356 48.737 -12.633 1.00 16.91 ? 68   PRO A CB    1 
ATOM   510  C CG    . PRO A 1 68  ? -12.772 47.334 -12.784 1.00 17.71 ? 68   PRO A CG    1 
ATOM   511  C CD    . PRO A 1 68  ? -11.412 47.441 -12.118 1.00 15.71 ? 68   PRO A CD    1 
ATOM   512  N N     . CYS A 1 69  ? -13.944 47.687 -9.505  1.00 13.52 ? 69   CYS A N     1 
ATOM   513  C CA    . CYS A 1 69  ? -14.952 47.411 -8.469  1.00 13.31 ? 69   CYS A CA    1 
ATOM   514  C C     . CYS A 1 69  ? -14.775 48.321 -7.292  1.00 13.10 ? 69   CYS A C     1 
ATOM   515  O O     . CYS A 1 69  ? -15.745 48.346 -6.504  1.00 15.53 ? 69   CYS A O     1 
ATOM   516  C CB    . CYS A 1 69  ? -14.948 45.913 -8.100  1.00 14.19 ? 69   CYS A CB    1 
ATOM   517  S SG    . CYS A 1 69  ? -13.570 45.436 -7.017  1.00 15.45 ? 69   CYS A SG    1 
ATOM   518  N N     . THR A 1 70  ? -13.647 48.945 -7.102  1.00 12.18 ? 70   THR A N     1 
ATOM   519  C CA    . THR A 1 70  ? -13.416 49.880 -6.000  1.00 12.17 ? 70   THR A CA    1 
ATOM   520  C C     . THR A 1 70  ? -13.819 51.303 -6.372  1.00 12.25 ? 70   THR A C     1 
ATOM   521  O O     . THR A 1 70  ? -13.741 52.176 -5.476  1.00 13.43 ? 70   THR A O     1 
ATOM   522  C CB    . THR A 1 70  ? -11.932 49.900 -5.604  1.00 12.03 ? 70   THR A CB    1 
ATOM   523  O OG1   . THR A 1 70  ? -11.143 50.500 -6.624  1.00 13.03 ? 70   THR A OG1   1 
ATOM   524  C CG2   . THR A 1 70  ? -11.457 48.450 -5.277  1.00 14.29 ? 70   THR A CG2   1 
ATOM   525  N N     . ASP A 1 71  ? -14.250 51.547 -7.613  1.00 12.34 ? 71   ASP A N     1 
ATOM   526  C CA    . ASP A 1 71  ? -14.741 52.864 -8.007  1.00 12.70 ? 71   ASP A CA    1 
ATOM   527  C C     . ASP A 1 71  ? -16.180 52.955 -7.538  1.00 13.19 ? 71   ASP A C     1 
ATOM   528  O O     . ASP A 1 71  ? -17.100 52.633 -8.281  1.00 15.33 ? 71   ASP A O     1 
ATOM   529  C CB    . ASP A 1 71  ? -14.582 52.990 -9.519  1.00 14.57 ? 71   ASP A CB    1 
ATOM   530  C CG    . ASP A 1 71  ? -15.034 54.346 -10.025 1.00 15.00 ? 71   ASP A CG    1 
ATOM   531  O OD1   . ASP A 1 71  ? -15.549 55.170 -9.260  1.00 17.42 ? 71   ASP A OD1   1 
ATOM   532  O OD2   . ASP A 1 71  ? -14.908 54.572 -11.267 1.00 20.18 ? 71   ASP A OD2   1 
ATOM   533  N N     . SER A 1 72  ? -16.364 53.360 -6.300  1.00 13.73 ? 72   SER A N     1 
ATOM   534  C CA    . SER A 1 72  ? -17.636 53.378 -5.597  1.00 14.25 ? 72   SER A CA    1 
ATOM   535  C C     . SER A 1 72  ? -17.511 54.361 -4.442  1.00 13.60 ? 72   SER A C     1 
ATOM   536  O O     . SER A 1 72  ? -16.379 54.629 -4.012  1.00 14.74 ? 72   SER A O     1 
ATOM   537  C CB    . SER A 1 72  ? -17.947 51.978 -5.052  1.00 16.97 ? 72   SER A CB    1 
ATOM   538  O OG    . SER A 1 72  ? -17.038 51.765 -3.939  1.00 22.82 ? 72   SER A OG    1 
ATOM   539  N N     . PRO A 1 73  ? -18.594 54.902 -3.958  1.00 14.70 ? 73   PRO A N     1 
ATOM   540  C CA    . PRO A 1 73  ? -18.481 55.809 -2.817  1.00 15.65 ? 73   PRO A CA    1 
ATOM   541  C C     . PRO A 1 73  ? -17.834 55.134 -1.616  1.00 15.92 ? 73   PRO A C     1 
ATOM   542  O O     . PRO A 1 73  ? -17.184 55.855 -0.846  1.00 19.63 ? 73   PRO A O     1 
ATOM   543  C CB    . PRO A 1 73  ? -19.941 56.130 -2.416  1.00 20.16 ? 73   PRO A CB    1 
ATOM   544  C CG    . PRO A 1 73  ? -20.675 55.910 -3.704  1.00 21.79 ? 73   PRO A CG    1 
ATOM   545  C CD    . PRO A 1 73  ? -19.992 54.813 -4.454  1.00 18.62 ? 73   PRO A CD    1 
ATOM   546  N N     . GLU A 1 74  ? -18.030 53.822 -1.453  1.00 17.31 ? 74   GLU A N     1 
ATOM   547  C CA    . GLU A 1 74  ? -17.568 53.062 -0.324  1.00 20.88 ? 74   GLU A CA    1 
ATOM   548  C C     . GLU A 1 74  ? -16.064 52.868 -0.247  1.00 18.26 ? 74   GLU A C     1 
ATOM   549  O O     . GLU A 1 74  ? -15.500 52.536 0.791   1.00 27.64 ? 74   GLU A O     1 
ATOM   550  C CB    . GLU A 1 74  ? -18.191 51.637 -0.282  1.00 27.44 ? 74   GLU A CB    1 
ATOM   551  C CG    . GLU A 1 74  ? -19.673 51.726 0.024   1.00 34.07 ? 74   GLU A CG    1 
ATOM   552  C CD    . GLU A 1 74  ? -20.551 52.117 -1.142  1.00 35.34 ? 74   GLU A CD    1 
ATOM   553  O OE1   . GLU A 1 74  ? -21.710 52.501 -0.847  1.00 51.93 ? 74   GLU A OE1   1 
ATOM   554  O OE2   . GLU A 1 74  ? -20.133 52.060 -2.308  1.00 33.51 ? 74   GLU A OE2   1 
ATOM   555  N N     . PHE A 1 75  ? -15.365 53.080 -1.363  1.00 16.07 ? 75   PHE A N     1 
ATOM   556  C CA    . PHE A 1 75  ? -13.912 52.797 -1.418  1.00 12.86 ? 75   PHE A CA    1 
ATOM   557  C C     . PHE A 1 75  ? -13.281 54.029 -2.009  1.00 12.54 ? 75   PHE A C     1 
ATOM   558  O O     . PHE A 1 75  ? -12.718 54.830 -1.316  1.00 13.53 ? 75   PHE A O     1 
ATOM   559  C CB    . PHE A 1 75  ? -13.700 51.486 -2.168  1.00 12.65 ? 75   PHE A CB    1 
ATOM   560  C CG    . PHE A 1 75  ? -12.327 50.887 -2.048  1.00 12.57 ? 75   PHE A CG    1 
ATOM   561  C CD1   . PHE A 1 75  ? -11.157 51.602 -2.139  1.00 14.75 ? 75   PHE A CD1   1 
ATOM   562  C CD2   . PHE A 1 75  ? -12.153 49.545 -1.826  1.00 14.19 ? 75   PHE A CD2   1 
ATOM   563  C CE1   . PHE A 1 75  ? -9.869  51.107 -1.974  1.00 16.37 ? 75   PHE A CE1   1 
ATOM   564  C CE2   . PHE A 1 75  ? -10.917 48.979 -1.702  1.00 16.52 ? 75   PHE A CE2   1 
ATOM   565  C CZ    . PHE A 1 75  ? -9.780  49.742 -1.809  1.00 15.44 ? 75   PHE A CZ    1 
ATOM   566  N N     . TYR A 1 76  ? -13.351 54.238 -3.323  1.00 12.44 ? 76   TYR A N     1 
ATOM   567  C CA    . TYR A 1 76  ? -12.784 55.428 -3.984  1.00 12.38 ? 76   TYR A CA    1 
ATOM   568  C C     . TYR A 1 76  ? -13.329 56.688 -3.334  1.00 12.88 ? 76   TYR A C     1 
ATOM   569  O O     . TYR A 1 76  ? -12.575 57.638 -3.136  1.00 14.24 ? 76   TYR A O     1 
ATOM   570  C CB    . TYR A 1 76  ? -13.098 55.325 -5.469  1.00 13.89 ? 76   TYR A CB    1 
ATOM   571  C CG    . TYR A 1 76  ? -12.533 56.414 -6.336  1.00 15.59 ? 76   TYR A CG    1 
ATOM   572  C CD1   . TYR A 1 76  ? -11.326 57.052 -6.129  1.00 16.84 ? 76   TYR A CD1   1 
ATOM   573  C CD2   . TYR A 1 76  ? -13.254 56.726 -7.503  1.00 19.62 ? 76   TYR A CD2   1 
ATOM   574  C CE1   . TYR A 1 76  ? -10.892 58.017 -7.030  1.00 21.58 ? 76   TYR A CE1   1 
ATOM   575  C CE2   . TYR A 1 76  ? -12.817 57.685 -8.378  1.00 23.80 ? 76   TYR A CE2   1 
ATOM   576  C CZ    . TYR A 1 76  ? -11.648 58.334 -8.139  1.00 25.46 ? 76   TYR A CZ    1 
ATOM   577  O OH    . TYR A 1 76  ? -11.176 59.292 -9.023  1.00 30.23 ? 76   TYR A OH    1 
ATOM   578  N N     . GLY A 1 77  ? -14.624 56.772 -3.013  1.00 13.44 ? 77   GLY A N     1 
ATOM   579  C CA    . GLY A 1 77  ? -15.128 57.995 -2.392  1.00 16.06 ? 77   GLY A CA    1 
ATOM   580  C C     . GLY A 1 77  ? -14.430 58.247 -1.068  1.00 15.36 ? 77   GLY A C     1 
ATOM   581  O O     . GLY A 1 77  ? -14.108 59.413 -0.803  1.00 19.04 ? 77   GLY A O     1 
ATOM   582  N N     . LYS A 1 78  ? -14.204 57.287 -0.209  1.00 15.13 ? 78   LYS A N     1 
ATOM   583  C CA    . LYS A 1 78  ? -13.522 57.470 1.059   1.00 15.30 ? 78   LYS A CA    1 
ATOM   584  C C     . LYS A 1 78  ? -12.082 57.854 0.818   1.00 13.90 ? 78   LYS A C     1 
ATOM   585  O O     . LYS A 1 78  ? -11.512 58.702 1.546   1.00 16.45 ? 78   LYS A O     1 
ATOM   586  C CB    . LYS A 1 78  ? -13.535 56.168 1.853   1.00 19.48 ? 78   LYS A CB    1 
ATOM   587  C CG    . LYS A 1 78  ? -14.881 55.655 2.296   1.00 28.04 ? 78   LYS A CG    1 
ATOM   588  C CD    . LYS A 1 78  ? -14.781 54.663 3.438   1.00 30.18 ? 78   LYS A CD    1 
ATOM   589  C CE    . LYS A 1 78  ? -16.196 54.435 3.932   1.00 37.87 ? 78   LYS A CE    1 
ATOM   590  N NZ    . LYS A 1 78  ? -16.199 53.375 4.990   1.00 37.73 ? 78   LYS A NZ    1 
ATOM   591  N N     . PHE A 1 79  ? -11.454 57.301 -0.222  1.00 12.84 ? 79   PHE A N     1 
ATOM   592  C CA    . PHE A 1 79  ? -10.078 57.670 -0.548  1.00 12.34 ? 79   PHE A CA    1 
ATOM   593  C C     . PHE A 1 79  ? -10.024 59.136 -0.889  1.00 13.45 ? 79   PHE A C     1 
ATOM   594  O O     . PHE A 1 79  ? -9.185  59.885 -0.351  1.00 15.78 ? 79   PHE A O     1 
ATOM   595  C CB    . PHE A 1 79  ? -9.615  56.819 -1.737  1.00 13.15 ? 79   PHE A CB    1 
ATOM   596  C CG    . PHE A 1 79  ? -8.247  57.194 -2.272  1.00 14.26 ? 79   PHE A CG    1 
ATOM   597  C CD1   . PHE A 1 79  ? -7.104  56.738 -1.648  1.00 18.51 ? 79   PHE A CD1   1 
ATOM   598  C CD2   . PHE A 1 79  ? -8.070  57.991 -3.387  1.00 16.31 ? 79   PHE A CD2   1 
ATOM   599  C CE1   . PHE A 1 79  ? -5.849  57.017 -2.037  1.00 22.70 ? 79   PHE A CE1   1 
ATOM   600  C CE2   . PHE A 1 79  ? -6.792  58.265 -3.812  1.00 20.62 ? 79   PHE A CE2   1 
ATOM   601  C CZ    . PHE A 1 79  ? -5.668  57.800 -3.164  1.00 22.06 ? 79   PHE A CZ    1 
ATOM   602  N N     . LYS A 1 80  ? -10.860 59.570 -1.791  1.00 13.91 ? 80   LYS A N     1 
ATOM   603  C CA    . LYS A 1 80  ? -10.761 60.969 -2.216  1.00 18.17 ? 80   LYS A CA    1 
ATOM   604  C C     . LYS A 1 80  ? -11.125 61.885 -1.055  1.00 18.80 ? 80   LYS A C     1 
ATOM   605  O O     . LYS A 1 80  ? -10.528 62.971 -0.983  1.00 19.43 ? 80   LYS A O     1 
ATOM   606  C CB    . LYS A 1 80  ? -11.595 61.149 -3.453  1.00 24.44 ? 80   LYS A CB    1 
ATOM   607  C CG    . LYS A 1 80  ? -13.067 61.138 -3.117  1.00 31.31 ? 80   LYS A CG    1 
ATOM   608  C CD    . LYS A 1 80  ? -13.565 62.590 -3.211  1.00 38.90 ? 80   LYS A CD    1 
ATOM   609  C CE    . LYS A 1 80  ? -15.093 62.528 -3.168  1.00 44.26 ? 80   LYS A CE    1 
ATOM   610  N NZ    . LYS A 1 80  ? -15.568 63.607 -2.245  1.00 53.73 ? 80   LYS A NZ    1 
ATOM   611  N N     . GLU A 1 81  ? -12.055 61.554 -0.166  1.00 16.64 ? 81   GLU A N     1 
ATOM   612  C CA    . GLU A 1 81  ? -12.358 62.380 1.005   1.00 18.85 ? 81   GLU A CA    1 
ATOM   613  C C     . GLU A 1 81  ? -11.099 62.520 1.882   1.00 16.69 ? 81   GLU A C     1 
ATOM   614  O O     . GLU A 1 81  ? -10.814 63.607 2.378   1.00 19.76 ? 81   GLU A O     1 
ATOM   615  C CB    . GLU A 1 81  ? -13.459 61.748 1.875   1.00 22.88 ? 81   GLU A CB    1 
ATOM   616  C CG    . GLU A 1 81  ? -14.856 61.700 1.269   1.00 32.91 ? 81   GLU A CG    1 
ATOM   617  C CD    . GLU A 1 81  ? -15.776 60.684 1.902   1.00 37.14 ? 81   GLU A CD    1 
ATOM   618  O OE1   . GLU A 1 81  ? -15.406 60.109 2.961   1.00 44.00 ? 81   GLU A OE1   1 
ATOM   619  O OE2   . GLU A 1 81  ? -16.886 60.415 1.364   1.00 51.92 ? 81   GLU A OE2   1 
ATOM   620  N N     . GLY A 1 82  ? -10.394 61.417 2.079   1.00 15.62 ? 82   GLY A N     1 
ATOM   621  C CA    . GLY A 1 82  ? -9.184  61.438 2.892   1.00 17.28 ? 82   GLY A CA    1 
ATOM   622  C C     . GLY A 1 82  ? -8.070  62.186 2.247   1.00 16.10 ? 82   GLY A C     1 
ATOM   623  O O     . GLY A 1 82  ? -7.300  62.853 2.980   1.00 20.27 ? 82   GLY A O     1 
ATOM   624  N N     . VAL A 1 83  ? -7.893  62.104 0.952   1.00 17.01 ? 83   VAL A N     1 
ATOM   625  C CA    . VAL A 1 83  ? -6.846  62.917 0.285   1.00 17.79 ? 83   VAL A CA    1 
ATOM   626  C C     . VAL A 1 83  ? -7.172  64.382 0.475   1.00 19.02 ? 83   VAL A C     1 
ATOM   627  O O     . VAL A 1 83  ? -6.248  65.151 0.794   1.00 24.38 ? 83   VAL A O     1 
ATOM   628  C CB    . VAL A 1 83  ? -6.753  62.525 -1.202  1.00 18.20 ? 83   VAL A CB    1 
ATOM   629  C CG1   . VAL A 1 83  ? -5.806  63.428 -1.962  1.00 25.07 ? 83   VAL A CG1   1 
ATOM   630  C CG2   . VAL A 1 83  ? -6.277  61.055 -1.268  1.00 21.66 ? 83   VAL A CG2   1 
ATOM   631  N N     . ALA A 1 84  ? -8.445  64.745 0.315   1.00 18.89 ? 84   ALA A N     1 
ATOM   632  C CA    . ALA A 1 84  ? -8.827  66.165 0.391   1.00 20.56 ? 84   ALA A CA    1 
ATOM   633  C C     . ALA A 1 84  ? -8.713  66.663 1.832   1.00 20.28 ? 84   ALA A C     1 
ATOM   634  O O     . ALA A 1 84  ? -8.283  67.789 2.083   1.00 27.87 ? 84   ALA A O     1 
ATOM   635  C CB    . ALA A 1 84  ? -10.232 66.350 -0.124  1.00 26.55 ? 84   ALA A CB    1 
ATOM   636  N N     . SER A 1 85  ? -9.111  65.860 2.816   1.00 19.04 ? 85   SER A N     1 
ATOM   637  C CA    . SER A 1 85  ? -9.123  66.369 4.176   1.00 20.64 ? 85   SER A CA    1 
ATOM   638  C C     . SER A 1 85  ? -7.767  66.279 4.814   1.00 18.63 ? 85   SER A C     1 
ATOM   639  O O     . SER A 1 85  ? -7.478  66.946 5.816   1.00 23.90 ? 85   SER A O     1 
ATOM   640  C CB    . SER A 1 85  ? -10.140 65.544 4.982   1.00 22.83 ? 85   SER A CB    1 
ATOM   641  O OG    . SER A 1 85  ? -9.566  64.240 5.184   1.00 22.38 ? 85   SER A OG    1 
ATOM   642  N N     . GLY A 1 86  ? -6.901  65.434 4.310   1.00 19.80 ? 86   GLY A N     1 
ATOM   643  C CA    . GLY A 1 86  ? -5.575  65.240 4.918   1.00 20.59 ? 86   GLY A CA    1 
ATOM   644  C C     . GLY A 1 86  ? -5.616  64.212 6.040   1.00 19.37 ? 86   GLY A C     1 
ATOM   645  O O     . GLY A 1 86  ? -4.570  64.032 6.645   1.00 27.05 ? 86   GLY A O     1 
ATOM   646  N N     . ASN A 1 87  ? -6.733  63.536 6.271   1.00 20.02 ? 87   ASN A N     1 
ATOM   647  C CA    . ASN A 1 87  ? -6.839  62.584 7.371   1.00 20.01 ? 87   ASN A CA    1 
ATOM   648  C C     . ASN A 1 87  ? -7.460  61.347 6.811   1.00 25.40 ? 87   ASN A C     1 
ATOM   649  O O     . ASN A 1 87  ? -8.644  61.023 6.915   1.00 52.31 ? 87   ASN A O     1 
ATOM   650  C CB    . ASN A 1 87  ? -7.725  63.111 8.495   1.00 26.60 ? 87   ASN A CB    1 
ATOM   651  C CG    . ASN A 1 87  ? -7.511  62.488 9.839   1.00 31.73 ? 87   ASN A CG    1 
ATOM   652  O OD1   . ASN A 1 87  ? -7.879  62.954 10.936  1.00 32.51 ? 87   ASN A OD1   1 
ATOM   653  N ND2   . ASN A 1 87  ? -6.824  61.391 9.813   1.00 45.00 ? 87   ASN A ND2   1 
ATOM   654  N N     . LEU A 1 88  ? -6.685  60.527 6.161   1.00 19.34 ? 88   LEU A N     1 
ATOM   655  C CA    . LEU A 1 88  ? -7.160  59.229 5.703   1.00 16.36 ? 88   LEU A CA    1 
ATOM   656  C C     . LEU A 1 88  ? -6.660  58.150 6.671   1.00 16.77 ? 88   LEU A C     1 
ATOM   657  O O     . LEU A 1 88  ? -5.477  57.923 6.892   1.00 17.71 ? 88   LEU A O     1 
ATOM   658  C CB    . LEU A 1 88  ? -6.549  58.982 4.318   1.00 16.17 ? 88   LEU A CB    1 
ATOM   659  C CG    . LEU A 1 88  ? -6.940  57.611 3.721   1.00 15.18 ? 88   LEU A CG    1 
ATOM   660  C CD1   . LEU A 1 88  ? -8.441  57.535 3.448   1.00 19.41 ? 88   LEU A CD1   1 
ATOM   661  C CD2   . LEU A 1 88  ? -6.178  57.350 2.438   1.00 19.32 ? 88   LEU A CD2   1 
ATOM   662  N N     . ASN A 1 89  ? -7.615  57.445 7.276   1.00 16.77 ? 89   ASN A N     1 
ATOM   663  C CA    . ASN A 1 89  ? -7.324  56.340 8.165   1.00 17.45 ? 89   ASN A CA    1 
ATOM   664  C C     . ASN A 1 89  ? -8.638  55.599 8.389   1.00 18.74 ? 89   ASN A C     1 
ATOM   665  O O     . ASN A 1 89  ? -9.416  56.008 9.272   1.00 24.08 ? 89   ASN A O     1 
ATOM   666  C CB    . ASN A 1 89  ? -6.738  56.820 9.498   1.00 22.03 ? 89   ASN A CB    1 
ATOM   667  C CG    . ASN A 1 89  ? -6.331  55.665 10.402  1.00 20.49 ? 89   ASN A CG    1 
ATOM   668  O OD1   . ASN A 1 89  ? -6.183  54.499 10.007  1.00 24.10 ? 89   ASN A OD1   1 
ATOM   669  N ND2   . ASN A 1 89  ? -6.121  55.946 11.692  1.00 26.11 ? 89   ASN A ND2   1 
ATOM   670  N N     . THR A 1 90  ? -8.891  54.558 7.606   1.00 17.06 ? 90   THR A N     1 
ATOM   671  C CA    . THR A 1 90  ? -10.219 53.914 7.703   1.00 17.04 ? 90   THR A CA    1 
ATOM   672  C C     . THR A 1 90  ? -10.045 52.454 7.360   1.00 15.18 ? 90   THR A C     1 
ATOM   673  O O     . THR A 1 90  ? -9.166  52.065 6.575   1.00 16.39 ? 90   THR A O     1 
ATOM   674  C CB    . THR A 1 90  ? -11.290 54.594 6.817   1.00 21.47 ? 90   THR A CB    1 
ATOM   675  O OG1   . THR A 1 90  ? -12.551 53.919 6.957   1.00 30.23 ? 90   THR A OG1   1 
ATOM   676  C CG2   . THR A 1 90  ? -10.904 54.523 5.335   1.00 23.40 ? 90   THR A CG2   1 
ATOM   677  N N     . MET A 1 91  ? -10.870 51.657 7.968   1.00 17.42 ? 91   MET A N     1 
ATOM   678  C CA    . MET A 1 91  ? -10.802 50.188 7.745   1.00 17.05 ? 91   MET A CA    1 
ATOM   679  C C     . MET A 1 91  ? -12.178 49.679 7.467   1.00 18.33 ? 91   MET A C     1 
ATOM   680  O O     . MET A 1 91  ? -13.155 50.130 8.101   1.00 22.13 ? 91   MET A O     1 
ATOM   681  C CB    . MET A 1 91  ? -10.177 49.586 9.018   1.00 23.63 ? 91   MET A CB    1 
ATOM   682  C CG    . MET A 1 91  ? -9.732  48.145 8.815   1.00 32.46 ? 91   MET A CG    1 
ATOM   683  S SD    . MET A 1 91  ? -9.042  47.520 10.351  1.00 37.35 ? 91   MET A SD    1 
ATOM   684  C CE    . MET A 1 91  ? -7.476  48.339 10.509  1.00 37.77 ? 91   MET A CE    1 
ATOM   685  N N     . PHE A 1 92  ? -12.338 48.771 6.534   1.00 14.60 ? 92   PHE A N     1 
ATOM   686  C CA    . PHE A 1 92  ? -13.659 48.278 6.105   1.00 15.19 ? 92   PHE A CA    1 
ATOM   687  C C     . PHE A 1 92  ? -13.486 46.942 5.376   1.00 14.31 ? 92   PHE A C     1 
ATOM   688  O O     . PHE A 1 92  ? -12.418 46.648 4.957   1.00 18.04 ? 92   PHE A O     1 
ATOM   689  C CB    . PHE A 1 92  ? -14.424 49.288 5.248   1.00 16.37 ? 92   PHE A CB    1 
ATOM   690  C CG    . PHE A 1 92  ? -13.667 49.758 4.044   1.00 16.12 ? 92   PHE A CG    1 
ATOM   691  C CD1   . PHE A 1 92  ? -12.787 50.834 4.129   1.00 18.12 ? 92   PHE A CD1   1 
ATOM   692  C CD2   . PHE A 1 92  ? -13.809 49.125 2.803   1.00 17.39 ? 92   PHE A CD2   1 
ATOM   693  C CE1   . PHE A 1 92  ? -12.077 51.248 3.005   1.00 21.32 ? 92   PHE A CE1   1 
ATOM   694  C CE2   . PHE A 1 92  ? -13.093 49.520 1.699   1.00 17.04 ? 92   PHE A CE2   1 
ATOM   695  C CZ    . PHE A 1 92  ? -12.212 50.581 1.775   1.00 19.85 ? 92   PHE A CZ    1 
ATOM   696  N N     . GLU A 1 93  ? -14.543 46.180 5.229   1.00 15.33 ? 93   GLU A N     1 
ATOM   697  C CA    . GLU A 1 93  ? -14.499 44.973 4.400   1.00 16.40 ? 93   GLU A CA    1 
ATOM   698  C C     . GLU A 1 93  ? -14.987 45.255 2.996   1.00 14.85 ? 93   GLU A C     1 
ATOM   699  O O     . GLU A 1 93  ? -15.807 46.155 2.730   1.00 18.29 ? 93   GLU A O     1 
ATOM   700  C CB    . GLU A 1 93  ? -15.313 43.874 5.069   1.00 22.59 ? 93   GLU A CB    1 
ATOM   701  C CG    . GLU A 1 93  ? -14.611 43.336 6.319   1.00 30.28 ? 93   GLU A CG    1 
ATOM   702  C CD    . GLU A 1 93  ? -15.342 42.164 6.948   1.00 47.06 ? 93   GLU A CD    1 
ATOM   703  O OE1   . GLU A 1 93  ? -16.432 41.784 6.456   1.00 66.70 ? 93   GLU A OE1   1 
ATOM   704  O OE2   . GLU A 1 93  ? -14.790 41.613 7.925   1.00 74.66 ? 93   GLU A OE2   1 
ATOM   705  N N     . TYR A 1 94  ? -14.517 44.444 2.057   1.00 14.15 ? 94   TYR A N     1 
ATOM   706  C CA    . TYR A 1 94  ? -14.836 44.691 0.668   1.00 14.95 ? 94   TYR A CA    1 
ATOM   707  C C     . TYR A 1 94  ? -14.742 43.374 -0.071  1.00 12.98 ? 94   TYR A C     1 
ATOM   708  O O     . TYR A 1 94  ? -14.153 42.429 0.429   1.00 18.12 ? 94   TYR A O     1 
ATOM   709  C CB    . TYR A 1 94  ? -13.899 45.747 0.041   1.00 14.27 ? 94   TYR A CB    1 
ATOM   710  C CG    . TYR A 1 94  ? -14.572 46.569 -1.047  1.00 13.85 ? 94   TYR A CG    1 
ATOM   711  C CD1   . TYR A 1 94  ? -15.445 47.603 -0.696  1.00 14.56 ? 94   TYR A CD1   1 
ATOM   712  C CD2   . TYR A 1 94  ? -14.290 46.374 -2.394  1.00 13.90 ? 94   TYR A CD2   1 
ATOM   713  C CE1   . TYR A 1 94  ? -16.057 48.368 -1.660  1.00 15.55 ? 94   TYR A CE1   1 
ATOM   714  C CE2   . TYR A 1 94  ? -14.907 47.155 -3.371  1.00 15.22 ? 94   TYR A CE2   1 
ATOM   715  C CZ    . TYR A 1 94  ? -15.796 48.146 -2.981  1.00 15.14 ? 94   TYR A CZ    1 
ATOM   716  O OH    . TYR A 1 94  ? -16.379 48.934 -3.974  1.00 17.53 ? 94   TYR A OH    1 
ATOM   717  N N     . THR A 1 95  ? -15.288 43.268 -1.290  1.00 15.33 ? 95   THR A N     1 
ATOM   718  C CA    . THR A 1 95  ? -15.167 42.097 -2.149  1.00 15.07 ? 95   THR A CA    1 
ATOM   719  C C     . THR A 1 95  ? -14.479 42.526 -3.430  1.00 14.32 ? 95   THR A C     1 
ATOM   720  O O     . THR A 1 95  ? -14.925 43.481 -4.091  1.00 17.05 ? 95   THR A O     1 
ATOM   721  C CB    . THR A 1 95  ? -16.524 41.440 -2.436  1.00 18.31 ? 95   THR A CB    1 
ATOM   722  O OG1   . THR A 1 95  ? -17.088 40.973 -1.224  1.00 24.13 ? 95   THR A OG1   1 
ATOM   723  C CG2   . THR A 1 95  ? -16.303 40.264 -3.400  1.00 22.92 ? 95   THR A CG2   1 
ATOM   724  N N     . PHE A 1 96  ? -13.415 41.856 -3.778  1.00 13.22 ? 96   PHE A N     1 
ATOM   725  C CA    . PHE A 1 96  ? -12.734 42.074 -5.052  1.00 14.24 ? 96   PHE A CA    1 
ATOM   726  C C     . PHE A 1 96  ? -13.161 41.015 -6.043  1.00 14.88 ? 96   PHE A C     1 
ATOM   727  O O     . PHE A 1 96  ? -13.001 39.833 -5.753  1.00 18.04 ? 96   PHE A O     1 
ATOM   728  C CB    . PHE A 1 96  ? -11.229 41.956 -4.879  1.00 15.34 ? 96   PHE A CB    1 
ATOM   729  C CG    . PHE A 1 96  ? -10.594 43.068 -4.031  1.00 14.10 ? 96   PHE A CG    1 
ATOM   730  C CD1   . PHE A 1 96  ? -11.248 44.254 -3.771  1.00 14.76 ? 96   PHE A CD1   1 
ATOM   731  C CD2   . PHE A 1 96  ? -9.309  42.890 -3.552  1.00 15.48 ? 96   PHE A CD2   1 
ATOM   732  C CE1   . PHE A 1 96  ? -10.580 45.214 -3.036  1.00 15.65 ? 96   PHE A CE1   1 
ATOM   733  C CE2   . PHE A 1 96  ? -8.628  43.849 -2.824  1.00 16.90 ? 96   PHE A CE2   1 
ATOM   734  C CZ    . PHE A 1 96  ? -9.291  45.068 -2.584  1.00 16.66 ? 96   PHE A CZ    1 
ATOM   735  N N     . ASP A 1 97  ? -13.710 41.441 -7.182  1.00 16.34 ? 97   ASP A N     1 
ATOM   736  C CA    . ASP A 1 97  ? -14.318 40.443 -8.084  1.00 17.52 ? 97   ASP A CA    1 
ATOM   737  C C     . ASP A 1 97  ? -14.122 40.749 -9.556  1.00 18.46 ? 97   ASP A C     1 
ATOM   738  O O     . ASP A 1 97  ? -14.859 40.194 -10.410 1.00 24.71 ? 97   ASP A O     1 
ATOM   739  C CB    . ASP A 1 97  ? -15.827 40.352 -7.774  1.00 20.20 ? 97   ASP A CB    1 
ATOM   740  C CG    . ASP A 1 97  ? -16.584 41.630 -8.040  1.00 21.99 ? 97   ASP A CG    1 
ATOM   741  O OD1   . ASP A 1 97  ? -15.965 42.670 -8.308  1.00 21.25 ? 97   ASP A OD1   1 
ATOM   742  O OD2   . ASP A 1 97  ? -17.821 41.579 -7.964  1.00 37.56 ? 97   ASP A OD2   1 
ATOM   743  N N     . TYR A 1 98  ? -13.157 41.605 -9.885  1.00 16.66 ? 98   TYR A N     1 
ATOM   744  C CA    . TYR A 1 98  ? -12.896 41.917 -11.317 1.00 17.42 ? 98   TYR A CA    1 
ATOM   745  C C     . TYR A 1 98  ? -11.822 40.983 -11.861 1.00 17.93 ? 98   TYR A C     1 
ATOM   746  O O     . TYR A 1 98  ? -10.705 40.999 -11.358 1.00 18.89 ? 98   TYR A O     1 
ATOM   747  C CB    . TYR A 1 98  ? -12.453 43.366 -11.419 1.00 18.20 ? 98   TYR A CB    1 
ATOM   748  C CG    . TYR A 1 98  ? -12.185 43.783 -12.865 1.00 17.77 ? 98   TYR A CG    1 
ATOM   749  C CD1   . TYR A 1 98  ? -13.228 43.695 -13.813 1.00 18.83 ? 98   TYR A CD1   1 
ATOM   750  C CD2   . TYR A 1 98  ? -10.948 44.267 -13.267 1.00 19.58 ? 98   TYR A CD2   1 
ATOM   751  C CE1   . TYR A 1 98  ? -12.951 44.088 -15.103 1.00 19.81 ? 98   TYR A CE1   1 
ATOM   752  C CE2   . TYR A 1 98  ? -10.665 44.663 -14.559 1.00 23.00 ? 98   TYR A CE2   1 
ATOM   753  C CZ    . TYR A 1 98  ? -11.712 44.568 -15.471 1.00 21.06 ? 98   TYR A CZ    1 
ATOM   754  O OH    . TYR A 1 98  ? -11.560 44.918 -16.783 1.00 30.17 ? 98   TYR A OH    1 
ATOM   755  N N     . GLN A 1 99  ? -12.158 40.171 -12.865 1.00 21.39 ? 99   GLN A N     1 
ATOM   756  C CA    . GLN A 1 99  ? -11.253 39.213 -13.463 1.00 22.32 ? 99   GLN A CA    1 
ATOM   757  C C     . GLN A 1 99  ? -10.548 38.320 -12.452 1.00 22.26 ? 99   GLN A C     1 
ATOM   758  O O     . GLN A 1 99  ? -9.363  38.025 -12.552 1.00 26.52 ? 99   GLN A O     1 
ATOM   759  C CB    . GLN A 1 99  ? -10.186 39.935 -14.298 1.00 26.74 ? 99   GLN A CB    1 
ATOM   760  C CG    . GLN A 1 99  ? -10.844 40.786 -15.384 1.00 32.19 ? 99   GLN A CG    1 
ATOM   761  C CD    . GLN A 1 99  ? -9.867  41.499 -16.273 1.00 38.49 ? 99   GLN A CD    1 
ATOM   762  O OE1   . GLN A 1 99  ? -10.084 41.526 -17.496 1.00 53.26 ? 99   GLN A OE1   1 
ATOM   763  N NE2   . GLN A 1 99  ? -8.840  42.112 -15.721 1.00 52.43 ? 99   GLN A NE2   1 
ATOM   764  N N     . MET A 1 100 ? -11.362 37.938 -11.467 1.00 22.39 ? 100  MET A N     1 
ATOM   765  C CA    . MET A 1 100 ? -10.849 37.047 -10.434 1.00 24.60 ? 100  MET A CA    1 
ATOM   766  C C     . MET A 1 100 ? -12.014 36.427 -9.693  1.00 25.20 ? 100  MET A C     1 
ATOM   767  O O     . MET A 1 100 ? -13.137 36.943 -9.763  1.00 27.95 ? 100  MET A O     1 
ATOM   768  C CB    . MET A 1 100 ? -9.943  37.794 -9.427  1.00 23.84 ? 100  MET A CB    1 
ATOM   769  C CG    . MET A 1 100 ? -10.741 38.876 -8.697  1.00 20.97 ? 100  MET A CG    1 
ATOM   770  S SD    . MET A 1 100 ? -9.724  40.019 -7.750  1.00 28.95 ? 100  MET A SD    1 
ATOM   771  C CE    . MET A 1 100 ? -9.365  38.890 -6.377  1.00 32.61 ? 100  MET A CE    1 
ATOM   772  N N     . THR A 1 101 ? -11.691 35.327 -9.019  1.00 28.67 ? 101  THR A N     1 
ATOM   773  C CA    . THR A 1 101 ? -12.726 34.718 -8.188  1.00 30.76 ? 101  THR A CA    1 
ATOM   774  C C     . THR A 1 101 ? -13.072 35.738 -7.110  1.00 23.16 ? 101  THR A C     1 
ATOM   775  O O     . THR A 1 101 ? -12.163 36.348 -6.517  1.00 22.87 ? 101  THR A O     1 
ATOM   776  C CB    . THR A 1 101 ? -12.239 33.384 -7.629  1.00 32.56 ? 101  THR A CB    1 
ATOM   777  O OG1   . THR A 1 101 ? -11.285 33.449 -6.561  1.00 57.72 ? 101  THR A OG1   1 
ATOM   778  C CG2   . THR A 1 101 ? -11.357 32.630 -8.648  1.00 41.54 ? 101  THR A CG2   1 
ATOM   779  N N     . PRO A 1 102 ? -14.354 35.948 -6.842  1.00 22.59 ? 102  PRO A N     1 
ATOM   780  C CA    . PRO A 1 102 ? -14.708 36.963 -5.809  1.00 20.18 ? 102  PRO A CA    1 
ATOM   781  C C     . PRO A 1 102 ? -14.057 36.587 -4.489  1.00 20.34 ? 102  PRO A C     1 
ATOM   782  O O     . PRO A 1 102 ? -14.130 35.430 -4.024  1.00 24.46 ? 102  PRO A O     1 
ATOM   783  C CB    . PRO A 1 102 ? -16.244 36.926 -5.769  1.00 26.09 ? 102  PRO A CB    1 
ATOM   784  C CG    . PRO A 1 102 ? -16.655 36.321 -7.091  1.00 31.99 ? 102  PRO A CG    1 
ATOM   785  C CD    . PRO A 1 102 ? -15.551 35.311 -7.414  1.00 30.00 ? 102  PRO A CD    1 
ATOM   786  N N     . THR A 1 103 ? -13.392 37.572 -3.907  1.00 19.38 ? 103  THR A N     1 
ATOM   787  C CA    . THR A 1 103 ? -12.560 37.358 -2.735  1.00 18.58 ? 103  THR A CA    1 
ATOM   788  C C     . THR A 1 103 ? -12.864 38.430 -1.709  1.00 16.49 ? 103  THR A C     1 
ATOM   789  O O     . THR A 1 103 ? -12.732 39.626 -2.038  1.00 17.07 ? 103  THR A O     1 
ATOM   790  C CB    . THR A 1 103 ? -11.079 37.453 -3.136  1.00 19.93 ? 103  THR A CB    1 
ATOM   791  O OG1   . THR A 1 103 ? -10.803 36.415 -4.124  1.00 23.15 ? 103  THR A OG1   1 
ATOM   792  C CG2   . THR A 1 103 ? -10.197 37.257 -1.926  1.00 22.11 ? 103  THR A CG2   1 
ATOM   793  N N     . LYS A 1 104 ? -13.294 38.041 -0.519  1.00 16.45 ? 104  LYS A N     1 
ATOM   794  C CA    . LYS A 1 104 ? -13.583 38.998 0.558   1.00 16.72 ? 104  LYS A CA    1 
ATOM   795  C C     . LYS A 1 104 ? -12.272 39.394 1.234   1.00 14.75 ? 104  LYS A C     1 
ATOM   796  O O     . LYS A 1 104 ? -11.437 38.524 1.525   1.00 17.15 ? 104  LYS A O     1 
ATOM   797  C CB    . LYS A 1 104 ? -14.553 38.408 1.599   1.00 20.96 ? 104  LYS A CB    1 
ATOM   798  C CG    . LYS A 1 104 ? -15.887 37.921 1.122   1.00 34.56 ? 104  LYS A CG    1 
ATOM   799  C CD    . LYS A 1 104 ? -16.868 37.766 2.304   1.00 41.69 ? 104  LYS A CD    1 
ATOM   800  C CE    . LYS A 1 104 ? -16.276 38.570 3.485   1.00 53.58 ? 104  LYS A CE    1 
ATOM   801  N NZ    . LYS A 1 104 ? -16.356 37.834 4.777   1.00 70.36 ? 104  LYS A NZ    1 
ATOM   802  N N     . VAL A 1 105 ? -12.151 40.690 1.498   1.00 13.94 ? 105  VAL A N     1 
ATOM   803  C CA    . VAL A 1 105 ? -10.944 41.224 2.106   1.00 13.73 ? 105  VAL A CA    1 
ATOM   804  C C     . VAL A 1 105 ? -11.284 42.219 3.177   1.00 13.40 ? 105  VAL A C     1 
ATOM   805  O O     . VAL A 1 105 ? -12.397 42.745 3.171   1.00 16.26 ? 105  VAL A O     1 
ATOM   806  C CB    . VAL A 1 105 ? -10.047 41.843 1.045   1.00 14.54 ? 105  VAL A CB    1 
ATOM   807  C CG1   . VAL A 1 105 ? -9.542  40.801 0.046   1.00 15.86 ? 105  VAL A CG1   1 
ATOM   808  C CG2   . VAL A 1 105 ? -10.741 42.980 0.286   1.00 16.54 ? 105  VAL A CG2   1 
ATOM   809  N N     . LYS A 1 106 ? -10.310 42.499 4.043   1.00 13.87 ? 106  LYS A N     1 
ATOM   810  C CA    . LYS A 1 106 ? -10.322 43.653 4.925   1.00 14.51 ? 106  LYS A CA    1 
ATOM   811  C C     . LYS A 1 106 ? -9.348  44.661 4.329   1.00 12.26 ? 106  LYS A C     1 
ATOM   812  O O     . LYS A 1 106 ? -8.244  44.271 3.923   1.00 15.40 ? 106  LYS A O     1 
ATOM   813  C CB    . LYS A 1 106 ? -9.869  43.243 6.357   1.00 18.39 ? 106  LYS A CB    1 
ATOM   814  C CG    . LYS A 1 106 ? -10.156 44.377 7.377   1.00 26.76 ? 106  LYS A CG    1 
ATOM   815  C CD    . LYS A 1 106 ? -10.077 43.879 8.820   1.00 36.08 ? 106  LYS A CD    1 
ATOM   816  C CE    . LYS A 1 106 ? -10.290 42.367 8.818   1.00 42.70 ? 106  LYS A CE    1 
ATOM   817  N NZ    . LYS A 1 106 ? -10.309 41.826 10.194  1.00 63.54 ? 106  LYS A NZ    1 
ATOM   818  N N     . VAL A 1 107 ? -9.734  45.912 4.273   1.00 13.09 ? 107  VAL A N     1 
ATOM   819  C CA    . VAL A 1 107 ? -8.926  46.980 3.690   1.00 12.03 ? 107  VAL A CA    1 
ATOM   820  C C     . VAL A 1 107 ? -8.704  48.016 4.763   1.00 11.41 ? 107  VAL A C     1 
ATOM   821  O O     . VAL A 1 107 ? -9.632  48.402 5.477   1.00 14.40 ? 107  VAL A O     1 
ATOM   822  C CB    . VAL A 1 107 ? -9.709  47.644 2.509   1.00 13.22 ? 107  VAL A CB    1 
ATOM   823  C CG1   . VAL A 1 107 ? -8.878  48.799 1.927   1.00 16.63 ? 107  VAL A CG1   1 
ATOM   824  C CG2   . VAL A 1 107 ? -10.032 46.561 1.476   1.00 19.02 ? 107  VAL A CG2   1 
ATOM   825  N N     . HIS A 1 108 ? -7.436  48.455 4.860   1.00 11.99 ? 108  HIS A N     1 
ATOM   826  C CA    . HIS A 1 108 ? -7.097  49.605 5.685   1.00 13.35 ? 108  HIS A CA    1 
ATOM   827  C C     . HIS A 1 108 ? -6.458  50.654 4.804   1.00 12.43 ? 108  HIS A C     1 
ATOM   828  O O     . HIS A 1 108 ? -5.459  50.298 4.165   1.00 14.56 ? 108  HIS A O     1 
ATOM   829  C CB    . HIS A 1 108 ? -6.134  49.115 6.764   1.00 15.03 ? 108  HIS A CB    1 
ATOM   830  C CG    . HIS A 1 108 ? -5.733  50.208 7.729   1.00 15.49 ? 108  HIS A CG    1 
ATOM   831  N ND1   . HIS A 1 108 ? -4.575  50.052 8.454   1.00 17.89 ? 108  HIS A ND1   1 
ATOM   832  C CD2   . HIS A 1 108 ? -6.291  51.412 8.041   1.00 16.45 ? 108  HIS A CD2   1 
ATOM   833  C CE1   . HIS A 1 108 ? -4.438  51.120 9.187   1.00 19.45 ? 108  HIS A CE1   1 
ATOM   834  N NE2   . HIS A 1 108 ? -5.466  51.972 9.000   1.00 17.97 ? 108  HIS A NE2   1 
ATOM   835  N N     . MET A 1 109 ? -7.027  51.840 4.699   1.00 12.54 ? 109  MET A N     1 
ATOM   836  C CA    . MET A 1 109 ? -6.393  52.918 3.939   1.00 13.06 ? 109  MET A CA    1 
ATOM   837  C C     . MET A 1 109 ? -5.820  53.888 4.937   1.00 13.69 ? 109  MET A C     1 
ATOM   838  O O     . MET A 1 109 ? -6.501  54.251 5.906   1.00 16.20 ? 109  MET A O     1 
ATOM   839  C CB    . MET A 1 109 ? -7.442  53.643 3.056   1.00 18.33 ? 109  MET A CB    1 
ATOM   840  C CG    . MET A 1 109 ? -7.890  52.724 1.902   1.00 21.29 ? 109  MET A CG    1 
ATOM   841  S SD    . MET A 1 109 ? -8.738  53.688 0.622   1.00 24.48 ? 109  MET A SD    1 
ATOM   842  C CE    . MET A 1 109 ? -10.139 54.122 1.626   1.00 24.75 ? 109  MET A CE    1 
ATOM   843  N N     . LYS A 1 110 ? -4.584  54.322 4.703   1.00 13.83 ? 110  LYS A N     1 
ATOM   844  C CA    . LYS A 1 110 ? -3.966  55.268 5.646   1.00 14.44 ? 110  LYS A CA    1 
ATOM   845  C C     . LYS A 1 110 ? -3.017  56.174 4.899   1.00 13.91 ? 110  LYS A C     1 
ATOM   846  O O     . LYS A 1 110 ? -2.281  55.696 4.048   1.00 16.08 ? 110  LYS A O     1 
ATOM   847  C CB    . LYS A 1 110 ? -3.308  54.495 6.790   1.00 16.62 ? 110  LYS A CB    1 
ATOM   848  C CG    . LYS A 1 110 ? -3.052  55.457 7.971   1.00 20.25 ? 110  LYS A CG    1 
ATOM   849  C CD    . LYS A 1 110 ? -2.343  54.751 9.109   1.00 20.17 ? 110  LYS A CD    1 
ATOM   850  C CE    . LYS A 1 110 ? -2.371  55.734 10.290  1.00 23.23 ? 110  LYS A CE    1 
ATOM   851  N NZ    . LYS A 1 110 ? -1.749  55.031 11.426  1.00 23.03 ? 110  LYS A NZ    1 
ATOM   852  N N     . LYS A 1 111 ? -3.030  57.459 5.242   1.00 14.67 ? 111  LYS A N     1 
ATOM   853  C CA    . LYS A 1 111 ? -2.027  58.340 4.656   1.00 15.75 ? 111  LYS A CA    1 
ATOM   854  C C     . LYS A 1 111 ? -0.634  57.912 5.024   1.00 15.28 ? 111  LYS A C     1 
ATOM   855  O O     . LYS A 1 111 ? -0.346  57.468 6.157   1.00 18.56 ? 111  LYS A O     1 
ATOM   856  C CB    . LYS A 1 111 ? -2.349  59.733 5.200   1.00 20.43 ? 111  LYS A CB    1 
ATOM   857  C CG    . LYS A 1 111 ? -1.655  60.948 4.663   1.00 35.67 ? 111  LYS A CG    1 
ATOM   858  C CD    . LYS A 1 111 ? -2.036  62.183 5.524   1.00 40.83 ? 111  LYS A CD    1 
ATOM   859  C CE    . LYS A 1 111 ? -2.501  63.342 4.656   1.00 52.20 ? 111  LYS A CE    1 
ATOM   860  N NZ    . LYS A 1 111 ? -2.700  62.948 3.238   1.00 63.22 ? 111  LYS A NZ    1 
ATOM   861  N N     . ALA A 1 112 ? 0.303   58.085 4.090   1.00 15.70 ? 112  ALA A N     1 
ATOM   862  C CA    . ALA A 1 112 ? 1.710   57.775 4.398   1.00 17.70 ? 112  ALA A CA    1 
ATOM   863  C C     . ALA A 1 112 ? 2.268   58.809 5.341   1.00 19.82 ? 112  ALA A C     1 
ATOM   864  O O     . ALA A 1 112 ? 1.743   59.904 5.476   1.00 22.86 ? 112  ALA A O     1 
ATOM   865  C CB    . ALA A 1 112 ? 2.528   57.742 3.104   1.00 20.08 ? 112  ALA A CB    1 
ATOM   866  N N     . LEU A 1 113 ? 3.367   58.484 5.959   1.00 21.63 ? 113  LEU A N     1 
ATOM   867  C CA    . LEU A 1 113 ? 3.963   59.306 7.031   1.00 21.66 ? 113  LEU A CA    1 
ATOM   868  C C     . LEU A 1 113 ? 4.230   60.689 6.492   1.00 22.87 ? 113  LEU A C     1 
ATOM   869  O O     . LEU A 1 113 ? 4.033   61.649 7.259   1.00 28.17 ? 113  LEU A O     1 
ATOM   870  C CB    . LEU A 1 113 ? 5.235   58.644 7.542   1.00 24.09 ? 113  LEU A CB    1 
ATOM   871  C CG    . LEU A 1 113 ? 6.024   59.433 8.615   1.00 28.87 ? 113  LEU A CG    1 
ATOM   872  C CD1   . LEU A 1 113 ? 5.249   59.492 9.919   1.00 39.09 ? 113  LEU A CD1   1 
ATOM   873  C CD2   . LEU A 1 113 ? 7.388   58.822 8.764   1.00 39.91 ? 113  LEU A CD2   1 
ATOM   874  N N     . SER A 1 114 ? 4.699   60.840 5.251   1.00 22.71 ? 114  SER A N     1 
ATOM   875  C CA    . SER A 1 114 ? 4.999   62.174 4.747   1.00 28.74 ? 114  SER A CA    1 
ATOM   876  C C     . SER A 1 114 ? 3.749   62.908 4.307   1.00 29.71 ? 114  SER A C     1 
ATOM   877  O O     . SER A 1 114 ? 3.783   64.124 4.044   1.00 38.94 ? 114  SER A O     1 
ATOM   878  C CB    . SER A 1 114 ? 5.936   62.036 3.525   1.00 35.63 ? 114  SER A CB    1 
ATOM   879  O OG    . SER A 1 114 ? 5.323   61.096 2.637   1.00 46.77 ? 114  SER A OG    1 
ATOM   880  N N     . GLY A 1 115 ? 2.620   62.264 4.141   1.00 26.08 ? 115  GLY A N     1 
ATOM   881  C CA    . GLY A 1 115 ? 1.392   62.958 3.817   1.00 27.51 ? 115  GLY A CA    1 
ATOM   882  C C     . GLY A 1 115 ? 1.171   63.203 2.347   1.00 29.90 ? 115  GLY A C     1 
ATOM   883  O O     . GLY A 1 115 ? 0.177   63.856 2.004   1.00 37.22 ? 115  GLY A O     1 
ATOM   884  N N     . ASP A 1 116 ? 1.986   62.723 1.433   1.00 28.20 ? 116  ASP A N     1 
ATOM   885  C CA    . ASP A 1 116 ? 1.737   63.037 0.014   1.00 30.89 ? 116  ASP A CA    1 
ATOM   886  C C     . ASP A 1 116 ? 1.562   61.749 -0.771  1.00 24.50 ? 116  ASP A C     1 
ATOM   887  O O     . ASP A 1 116 ? 1.643   61.718 -2.006  1.00 28.41 ? 116  ASP A O     1 
ATOM   888  C CB    . ASP A 1 116 ? 2.854   63.821 -0.627  1.00 41.21 ? 116  ASP A CB    1 
ATOM   889  C CG    . ASP A 1 116 ? 4.219   63.339 -0.218  1.00 46.21 ? 116  ASP A CG    1 
ATOM   890  O OD1   . ASP A 1 116 ? 4.255   62.256 0.386   1.00 39.65 ? 116  ASP A OD1   1 
ATOM   891  O OD2   . ASP A 1 116 ? 5.215   64.053 -0.504  1.00 59.04 ? 116  ASP A OD2   1 
ATOM   892  N N     . SER A 1 117 ? 1.369   60.681 -0.057  1.00 19.23 ? 117  SER A N     1 
ATOM   893  C CA    . SER A 1 117 ? 1.049   59.398 -0.747  1.00 17.51 ? 117  SER A CA    1 
ATOM   894  C C     . SER A 1 117 ? 0.266   58.624 0.275   1.00 15.10 ? 117  SER A C     1 
ATOM   895  O O     . SER A 1 117 ? 0.064   59.066 1.398   1.00 16.00 ? 117  SER A O     1 
ATOM   896  C CB    . SER A 1 117 ? 2.243   58.605 -1.235  1.00 20.71 ? 117  SER A CB    1 
ATOM   897  O OG    . SER A 1 117 ? 3.003   58.185 -0.069  1.00 25.29 ? 117  SER A OG    1 
ATOM   898  N N     . TYR A 1 118 ? -0.418  57.540 -0.203  1.00 14.18 ? 118  TYR A N     1 
ATOM   899  C CA    . TYR A 1 118 ? -1.511  56.910 0.553   1.00 13.60 ? 118  TYR A CA    1 
ATOM   900  C C     . TYR A 1 118 ? -1.351  55.397 0.435   1.00 13.16 ? 118  TYR A C     1 
ATOM   901  O O     . TYR A 1 118 ? -1.035  54.900 -0.653  1.00 18.89 ? 118  TYR A O     1 
ATOM   902  C CB    . TYR A 1 118 ? -2.938  57.343 0.037   1.00 14.44 ? 118  TYR A CB    1 
ATOM   903  C CG    . TYR A 1 118 ? -2.906  58.856 -0.054  1.00 14.57 ? 118  TYR A CG    1 
ATOM   904  C CD1   . TYR A 1 118 ? -2.474  59.519 -1.208  1.00 15.28 ? 118  TYR A CD1   1 
ATOM   905  C CD2   . TYR A 1 118 ? -3.187  59.651 1.051   1.00 16.09 ? 118  TYR A CD2   1 
ATOM   906  C CE1   . TYR A 1 118 ? -2.372  60.888 -1.266  1.00 17.16 ? 118  TYR A CE1   1 
ATOM   907  C CE2   . TYR A 1 118 ? -3.085  61.009 0.996   1.00 17.38 ? 118  TYR A CE2   1 
ATOM   908  C CZ    . TYR A 1 118 ? -2.713  61.652 -0.166  1.00 18.09 ? 118  TYR A CZ    1 
ATOM   909  O OH    . TYR A 1 118 ? -2.620  63.022 -0.169  1.00 23.41 ? 118  TYR A OH    1 
ATOM   910  N N     . TRP A 1 119 ? -1.529  54.712 1.533   1.00 13.12 ? 119  TRP A N     1 
ATOM   911  C CA    . TRP A 1 119 ? -1.439  53.260 1.497   1.00 13.08 ? 119  TRP A CA    1 
ATOM   912  C C     . TRP A 1 119 ? -2.810  52.608 1.471   1.00 12.52 ? 119  TRP A C     1 
ATOM   913  O O     . TRP A 1 119 ? -3.748  53.075 2.138   1.00 14.50 ? 119  TRP A O     1 
ATOM   914  C CB    . TRP A 1 119 ? -0.778  52.771 2.773   1.00 14.58 ? 119  TRP A CB    1 
ATOM   915  C CG    . TRP A 1 119 ? 0.659   53.149 2.926   1.00 15.86 ? 119  TRP A CG    1 
ATOM   916  C CD1   . TRP A 1 119 ? 1.189   54.150 3.704   1.00 18.42 ? 119  TRP A CD1   1 
ATOM   917  C CD2   . TRP A 1 119 ? 1.760   52.512 2.276   1.00 17.99 ? 119  TRP A CD2   1 
ATOM   918  N NE1   . TRP A 1 119 ? 2.575   54.158 3.574   1.00 21.88 ? 119  TRP A NE1   1 
ATOM   919  C CE2   . TRP A 1 119 ? 2.928   53.148 2.695   1.00 21.16 ? 119  TRP A CE2   1 
ATOM   920  C CE3   . TRP A 1 119 ? 1.805   51.443 1.393   1.00 17.77 ? 119  TRP A CE3   1 
ATOM   921  C CZ2   . TRP A 1 119 ? 4.178   52.731 2.217   1.00 24.32 ? 119  TRP A CZ2   1 
ATOM   922  C CZ3   . TRP A 1 119 ? 3.043   51.023 0.923   1.00 21.81 ? 119  TRP A CZ3   1 
ATOM   923  C CH2   . TRP A 1 119 ? 4.217   51.678 1.346   1.00 22.68 ? 119  TRP A CH2   1 
ATOM   924  N N     . VAL A 1 120 ? -2.873  51.496 0.747   1.00 12.56 ? 120  VAL A N     1 
ATOM   925  C CA    . VAL A 1 120 ? -4.019  50.579 0.809   1.00 11.78 ? 120  VAL A CA    1 
ATOM   926  C C     . VAL A 1 120 ? -3.454  49.242 1.271   1.00 11.55 ? 120  VAL A C     1 
ATOM   927  O O     . VAL A 1 120 ? -2.587  48.683 0.588   1.00 13.88 ? 120  VAL A O     1 
ATOM   928  C CB    . VAL A 1 120 ? -4.720  50.455 -0.557  1.00 12.41 ? 120  VAL A CB    1 
ATOM   929  C CG1   . VAL A 1 120 ? -5.891  49.474 -0.461  1.00 15.39 ? 120  VAL A CG1   1 
ATOM   930  C CG2   . VAL A 1 120 ? -5.176  51.803 -1.054  1.00 17.39 ? 120  VAL A CG2   1 
ATOM   931  N N     . PHE A 1 121 ? -3.899  48.764 2.428   1.00 10.99 ? 121  PHE A N     1 
ATOM   932  C CA    . PHE A 1 121 ? -3.432  47.500 2.966   1.00 11.95 ? 121  PHE A CA    1 
ATOM   933  C C     . PHE A 1 121 ? -4.596  46.521 2.877   1.00 12.47 ? 121  PHE A C     1 
ATOM   934  O O     . PHE A 1 121 ? -5.746  46.879 3.164   1.00 13.82 ? 121  PHE A O     1 
ATOM   935  C CB    . PHE A 1 121 ? -3.077  47.688 4.458   1.00 14.74 ? 121  PHE A CB    1 
ATOM   936  C CG    . PHE A 1 121 ? -1.968  48.688 4.645   1.00 13.60 ? 121  PHE A CG    1 
ATOM   937  C CD1   . PHE A 1 121 ? -0.723  48.476 4.040   1.00 15.18 ? 121  PHE A CD1   1 
ATOM   938  C CD2   . PHE A 1 121 ? -2.216  49.796 5.414   1.00 15.02 ? 121  PHE A CD2   1 
ATOM   939  C CE1   . PHE A 1 121 ? 0.275   49.424 4.266   1.00 18.43 ? 121  PHE A CE1   1 
ATOM   940  C CE2   . PHE A 1 121 ? -1.198  50.698 5.671   1.00 18.19 ? 121  PHE A CE2   1 
ATOM   941  C CZ    . PHE A 1 121 ? 0.053   50.510 5.091   1.00 18.71 ? 121  PHE A CZ    1 
ATOM   942  N N     . VAL A 1 122 ? -4.292  45.292 2.492   1.00 12.07 ? 122  VAL A N     1 
ATOM   943  C CA    . VAL A 1 122 ? -5.339  44.300 2.254   1.00 12.56 ? 122  VAL A CA    1 
ATOM   944  C C     . VAL A 1 122 ? -4.996  42.980 2.898   1.00 11.65 ? 122  VAL A C     1 
ATOM   945  O O     . VAL A 1 122 ? -3.886  42.518 2.779   1.00 15.49 ? 122  VAL A O     1 
ATOM   946  C CB    . VAL A 1 122 ? -5.498  44.094 0.714   1.00 14.92 ? 122  VAL A CB    1 
ATOM   947  C CG1   . VAL A 1 122 ? -6.543  43.052 0.405   1.00 16.95 ? 122  VAL A CG1   1 
ATOM   948  C CG2   . VAL A 1 122 ? -5.866  45.432 0.043   1.00 17.61 ? 122  VAL A CG2   1 
ATOM   949  N N     . LYS A 1 123 ? -5.965  42.332 3.525   1.00 12.01 ? 123  LYS A N     1 
ATOM   950  C CA    . LYS A 1 123 ? -5.756  40.950 3.891   1.00 13.21 ? 123  LYS A CA    1 
ATOM   951  C C     . LYS A 1 123 ? -7.029  40.172 3.615   1.00 12.44 ? 123  LYS A C     1 
ATOM   952  O O     . LYS A 1 123 ? -8.145  40.709 3.628   1.00 14.58 ? 123  LYS A O     1 
ATOM   953  C CB    . LYS A 1 123 ? -5.359  40.823 5.311   1.00 19.48 ? 123  LYS A CB    1 
ATOM   954  C CG    . LYS A 1 123 ? -6.357  41.114 6.383   1.00 22.82 ? 123  LYS A CG    1 
ATOM   955  C CD    . LYS A 1 123 ? -5.859  40.640 7.737   1.00 21.25 ? 123  LYS A CD    1 
ATOM   956  C CE    . LYS A 1 123 ? -6.943  40.941 8.787   1.00 24.99 ? 123  LYS A CE    1 
ATOM   957  N NZ    . LYS A 1 123 ? -6.410  40.406 10.080  1.00 22.01 ? 123  LYS A NZ    1 
ATOM   958  N N     . ARG A 1 124 ? -6.912  38.891 3.401   1.00 13.71 ? 124  ARG A N     1 
ATOM   959  C CA    . ARG A 1 124 ? -8.082  38.050 3.282   1.00 15.01 ? 124  ARG A CA    1 
ATOM   960  C C     . ARG A 1 124 ? -8.866  37.914 4.571   1.00 14.92 ? 124  ARG A C     1 
ATOM   961  O O     . ARG A 1 124 ? -8.246  37.951 5.631   1.00 17.78 ? 124  ARG A O     1 
ATOM   962  C CB    . ARG A 1 124 ? -7.648  36.621 2.859   1.00 17.04 ? 124  ARG A CB    1 
ATOM   963  C CG    . ARG A 1 124 ? -7.008  36.583 1.471   1.00 21.50 ? 124  ARG A CG    1 
ATOM   964  C CD    . ARG A 1 124 ? -6.507  35.128 1.280   1.00 26.60 ? 124  ARG A CD    1 
ATOM   965  N NE    . ARG A 1 124 ? -5.805  34.959 0.038   1.00 27.85 ? 124  ARG A NE    1 
ATOM   966  C CZ    . ARG A 1 124 ? -6.206  34.477 -1.109  1.00 33.28 ? 124  ARG A CZ    1 
ATOM   967  N NH1   . ARG A 1 124 ? -7.433  34.008 -1.248  1.00 42.76 ? 124  ARG A NH1   1 
ATOM   968  N NH2   . ARG A 1 124 ? -5.358  34.440 -2.135  1.00 45.32 ? 124  ARG A NH2   1 
ATOM   969  N N     . VAL A 1 125 ? -10.157 37.710 4.442   1.00 16.42 ? 125  VAL A N     1 
ATOM   970  C CA    . VAL A 1 125 ? -11.007 37.406 5.572   1.00 16.69 ? 125  VAL A CA    1 
ATOM   971  C C     . VAL A 1 125 ? -11.839 36.170 5.257   1.00 19.00 ? 125  VAL A C     1 
ATOM   972  O O     . VAL A 1 125 ? -12.018 35.731 4.109   1.00 24.71 ? 125  VAL A O     1 
ATOM   973  C CB    . VAL A 1 125 ? -11.943 38.549 5.951   1.00 20.77 ? 125  VAL A CB    1 
ATOM   974  C CG1   . VAL A 1 125 ? -11.119 39.745 6.401   1.00 25.92 ? 125  VAL A CG1   1 
ATOM   975  C CG2   . VAL A 1 125 ? -12.891 38.908 4.825   1.00 26.61 ? 125  VAL A CG2   1 
ATOM   976  O OXT   . VAL A 1 125 ? -12.374 35.657 6.329   1.00 24.12 ? 125  VAL A OXT   1 
HETATM 977  C C1    . HC4 B 2 .   ? -12.213 45.248 -8.097  1.00 14.62 ? 169  HC4 A C1    1 
HETATM 978  O O1    . HC4 B 2 .   ? -12.311 45.443 -9.347  1.00 16.31 ? 169  HC4 A O1    1 
HETATM 979  C C2    . HC4 B 2 .   ? -10.968 44.901 -7.393  1.00 14.32 ? 169  HC4 A C2    1 
HETATM 980  C C3    . HC4 B 2 .   ? -9.879  44.642 -8.180  1.00 13.64 ? 169  HC4 A C3    1 
HETATM 981  C "C1'" . HC4 B 2 .   ? -8.564  44.526 -7.605  1.00 13.50 ? 169  HC4 A "C1'" 1 
HETATM 982  C "C2'" . HC4 B 2 .   ? -7.507  44.248 -8.421  1.00 15.44 ? 169  HC4 A "C2'" 1 
HETATM 983  C "C3'" . HC4 B 2 .   ? -6.160  44.312 -7.996  1.00 15.49 ? 169  HC4 A "C3'" 1 
HETATM 984  C "C4'" . HC4 B 2 .   ? -5.917  44.670 -6.669  1.00 14.62 ? 169  HC4 A "C4'" 1 
HETATM 985  C "C5'" . HC4 B 2 .   ? -7.013  44.963 -5.818  1.00 14.60 ? 169  HC4 A "C5'" 1 
HETATM 986  C "C6'" . HC4 B 2 .   ? -8.304  44.896 -6.261  1.00 13.60 ? 169  HC4 A "C6'" 1 
HETATM 987  O "O4'" . HC4 B 2 .   ? -4.701  44.736 -6.200  1.00 18.31 ? 169  HC4 A "O4'" 1 
HETATM 988  O O     . HOH C 3 .   ? 4.446   55.793 5.249   1.00 19.61 ? 1001 HOH A O     1 
HETATM 989  O O     . HOH C 3 .   ? 4.187   41.561 8.170   1.00 23.10 ? 1002 HOH A O     1 
HETATM 990  O O     . HOH C 3 .   ? -13.637 52.675 -12.669 1.00 21.32 ? 1003 HOH A O     1 
HETATM 991  O O     . HOH C 3 .   ? -3.025  52.542 11.756  1.00 23.88 ? 1004 HOH A O     1 
HETATM 992  O O     . HOH C 3 .   ? -8.750  37.856 8.372   1.00 28.27 ? 1005 HOH A O     1 
HETATM 993  O O     . HOH C 3 .   ? -10.959 36.037 8.756   1.00 26.20 ? 1006 HOH A O     1 
HETATM 994  O O     . HOH C 3 .   ? -6.985  44.315 -13.069 1.00 26.04 ? 1007 HOH A O     1 
HETATM 995  O O     . HOH C 3 .   ? 14.067  52.176 13.370  1.00 30.39 ? 1008 HOH A O     1 
HETATM 996  O O     . HOH C 3 .   ? -4.342  37.654 3.590   1.00 26.42 ? 1009 HOH A O     1 
HETATM 997  O O     . HOH C 3 .   ? -11.027 35.839 1.642   1.00 24.88 ? 1010 HOH A O     1 
HETATM 998  O O     . HOH C 3 .   ? -2.570  61.439 -12.426 1.00 25.23 ? 1011 HOH A O     1 
HETATM 999  O O     . HOH C 3 .   ? -14.845 40.274 -13.975 1.00 33.83 ? 1012 HOH A O     1 
HETATM 1000 O O     . HOH C 3 .   ? -13.383 35.135 -0.142  1.00 33.38 ? 1013 HOH A O     1 
HETATM 1001 O O     . HOH C 3 .   ? -17.777 44.908 -2.038  1.00 34.10 ? 1014 HOH A O     1 
HETATM 1002 O O     . HOH C 3 .   ? -3.875  64.530 1.718   1.00 30.98 ? 1015 HOH A O     1 
HETATM 1003 O O     . HOH C 3 .   ? 0.053   62.496 -4.260  1.00 33.04 ? 1016 HOH A O     1 
HETATM 1004 O O     . HOH C 3 .   ? 11.461  42.171 9.946   1.00 52.70 ? 1017 HOH A O     1 
HETATM 1005 O O     . HOH C 3 .   ? 6.383   47.658 -5.448  1.00 30.94 ? 1018 HOH A O     1 
HETATM 1006 O O     . HOH C 3 .   ? -10.410 58.158 6.680   1.00 24.85 ? 1019 HOH A O     1 
HETATM 1007 O O     . HOH C 3 .   ? -16.960 47.129 6.445   1.00 40.60 ? 1020 HOH A O     1 
HETATM 1008 O O     . HOH C 3 .   ? -11.601 49.523 -16.121 1.00 37.15 ? 1021 HOH A O     1 
HETATM 1009 O O     . HOH C 3 .   ? 4.449   40.475 0.605   1.00 35.44 ? 1022 HOH A O     1 
HETATM 1010 O O     . HOH C 3 .   ? 6.858   37.184 10.718  1.00 44.01 ? 1023 HOH A O     1 
HETATM 1011 O O     . HOH C 3 .   ? -1.093  37.174 0.438   1.00 27.45 ? 1024 HOH A O     1 
HETATM 1012 O O     . HOH C 3 .   ? -16.443 51.508 3.099   1.00 34.15 ? 1025 HOH A O     1 
HETATM 1013 O O     . HOH C 3 .   ? -18.557 43.972 1.586   1.00 51.78 ? 1026 HOH A O     1 
HETATM 1014 O O     . HOH C 3 .   ? -4.863  61.989 4.016   1.00 28.99 ? 1027 HOH A O     1 
HETATM 1015 O O     . HOH C 3 .   ? 7.145   45.770 -3.183  1.00 33.18 ? 1028 HOH A O     1 
HETATM 1016 O O     . HOH C 3 .   ? -19.923 53.737 2.217   1.00 48.66 ? 1029 HOH A O     1 
HETATM 1017 O O     . HOH C 3 .   ? -4.360  60.245 8.686   1.00 48.27 ? 1030 HOH A O     1 
HETATM 1018 O O     . HOH C 3 .   ? -16.981 44.407 -5.602  1.00 38.55 ? 1031 HOH A O     1 
HETATM 1019 O O     . HOH C 3 .   ? -8.466  70.113 4.215   1.00 54.41 ? 1032 HOH A O     1 
HETATM 1020 O O     . HOH C 3 .   ? -0.821  41.221 -14.011 1.00 42.40 ? 1033 HOH A O     1 
HETATM 1021 O O     . HOH C 3 .   ? 1.939   56.555 -13.795 1.00 35.94 ? 1034 HOH A O     1 
HETATM 1022 O O     . HOH C 3 .   ? -2.007  57.220 13.329  1.00 45.04 ? 1035 HOH A O     1 
HETATM 1023 O O     . HOH C 3 .   ? -2.762  47.974 8.142   1.00 22.99 ? 1036 HOH A O     1 
HETATM 1024 O O     . HOH C 3 .   ? -1.893  56.022 -14.445 1.00 27.02 ? 1037 HOH A O     1 
HETATM 1025 O O     . HOH C 3 .   ? 6.095   55.966 2.870   1.00 38.65 ? 1038 HOH A O     1 
HETATM 1026 O O     . HOH C 3 .   ? 4.416   54.665 -10.447 1.00 30.94 ? 1039 HOH A O     1 
HETATM 1027 O O     . HOH C 3 .   ? -1.802  38.263 2.871   1.00 35.42 ? 1040 HOH A O     1 
HETATM 1028 O O     . HOH C 3 .   ? -10.079 47.772 -16.581 1.00 36.22 ? 1041 HOH A O     1 
HETATM 1029 O O     . HOH C 3 .   ? 6.618   46.008 -7.654  1.00 49.43 ? 1042 HOH A O     1 
HETATM 1030 O O     . HOH C 3 .   ? 1.232   45.764 16.385  1.00 40.20 ? 1043 HOH A O     1 
HETATM 1031 O O     . HOH C 3 .   ? -13.381 52.561 9.797   1.00 51.57 ? 1044 HOH A O     1 
HETATM 1032 O O     . HOH C 3 .   ? -9.494  64.292 -3.411  1.00 40.10 ? 1045 HOH A O     1 
HETATM 1033 O O     . HOH C 3 .   ? -15.152 37.384 -11.145 1.00 44.11 ? 1046 HOH A O     1 
HETATM 1034 O O     . HOH C 3 .   ? 12.097  57.057 5.111   1.00 49.47 ? 1047 HOH A O     1 
HETATM 1035 O O     . HOH C 3 .   ? -11.822 59.310 4.342   1.00 33.35 ? 1048 HOH A O     1 
HETATM 1036 O O     . HOH C 3 .   ? -10.052 61.575 8.637   1.00 47.91 ? 1049 HOH A O     1 
HETATM 1037 O O     . HOH C 3 .   ? -4.376  66.114 12.261  1.00 61.58 ? 1050 HOH A O     1 
HETATM 1038 O O     . HOH C 3 .   ? 8.255   52.204 13.359  1.00 39.87 ? 1051 HOH A O     1 
HETATM 1039 O O     . HOH C 3 .   ? -6.092  44.691 12.624  1.00 34.76 ? 1052 HOH A O     1 
HETATM 1040 O O     . HOH C 3 .   ? -17.508 58.187 3.348   1.00 42.00 ? 1053 HOH A O     1 
HETATM 1041 O O     . HOH C 3 .   ? -7.725  35.411 -4.673  1.00 46.04 ? 1054 HOH A O     1 
HETATM 1042 O O     . HOH C 3 .   ? 3.072   45.528 14.414  1.00 45.35 ? 1055 HOH A O     1 
HETATM 1043 O O     . HOH C 3 .   ? -12.027 55.776 10.319  1.00 36.97 ? 1056 HOH A O     1 
HETATM 1044 O O     . HOH C 3 .   ? -9.569  39.446 10.227  1.00 41.55 ? 1057 HOH A O     1 
HETATM 1045 O O     . HOH C 3 .   ? -19.234 42.541 -5.172  1.00 44.10 ? 1058 HOH A O     1 
HETATM 1046 O O     . HOH C 3 .   ? -7.765  42.145 11.740  1.00 55.12 ? 1059 HOH A O     1 
HETATM 1047 O O     . HOH C 3 .   ? -9.299  33.920 0.653   1.00 43.31 ? 1060 HOH A O     1 
HETATM 1048 O O     . HOH C 3 .   ? 5.416   38.416 -6.559  1.00 55.63 ? 1061 HOH A O     1 
HETATM 1049 O O     . HOH C 3 .   ? -13.887 37.399 -13.057 1.00 54.96 ? 1062 HOH A O     1 
HETATM 1050 O O     . HOH C 3 .   ? -10.580 57.285 11.277  1.00 38.16 ? 1063 HOH A O     1 
HETATM 1051 O O     . HOH C 3 .   ? -1.503  64.284 -2.399  1.00 47.24 ? 1064 HOH A O     1 
HETATM 1052 O O     . HOH C 3 .   ? -8.687  57.580 12.799  1.00 53.38 ? 1065 HOH A O     1 
HETATM 1053 O O     . HOH C 3 .   ? -4.825  69.314 2.616   1.00 55.86 ? 1066 HOH A O     1 
HETATM 1054 O O     . HOH C 3 .   ? -0.540  58.844 8.748   1.00 45.51 ? 1067 HOH A O     1 
HETATM 1055 O O     . HOH C 3 .   ? 6.807   55.148 -3.163  1.00 54.84 ? 1068 HOH A O     1 
HETATM 1056 O O     . HOH C 3 .   ? -14.716 53.068 6.991   1.00 38.23 ? 1069 HOH A O     1 
HETATM 1057 O O     . HOH C 3 .   ? -7.392  59.780 11.637  1.00 48.63 ? 1070 HOH A O     1 
HETATM 1058 O O     . HOH C 3 .   ? -2.703  32.999 -4.006  1.00 53.43 ? 1071 HOH A O     1 
HETATM 1059 O O     . HOH C 3 .   ? 6.319   43.195 -5.560  1.00 37.21 ? 1072 HOH A O     1 
HETATM 1060 O O     . HOH C 3 .   ? 8.601   58.255 4.002   1.00 50.01 ? 1073 HOH A O     1 
HETATM 1061 O O     . HOH C 3 .   ? 7.971   52.313 1.717   1.00 48.11 ? 1074 HOH A O     1 
HETATM 1062 O O     . HOH C 3 .   ? -6.122  43.880 -17.234 1.00 62.31 ? 1075 HOH A O     1 
HETATM 1063 O O     . HOH C 3 .   ? 3.782   49.339 13.033  1.00 50.16 ? 1076 HOH A O     1 
HETATM 1064 O O     . HOH C 3 .   ? -19.868 49.213 -4.229  1.00 56.01 ? 1077 HOH A O     1 
HETATM 1065 O O     . HOH C 3 .   ? -6.190  47.593 14.409  1.00 50.43 ? 1078 HOH A O     1 
HETATM 1066 O O     . HOH C 3 .   ? -3.516  65.280 -11.184 1.00 56.03 ? 1079 HOH A O     1 
HETATM 1067 O O     . HOH C 3 .   ? 1.730   63.755 7.434   1.00 50.55 ? 1080 HOH A O     1 
HETATM 1068 O O     . HOH C 3 .   ? 11.583  50.238 -7.493  1.00 63.45 ? 1081 HOH A O     1 
HETATM 1069 O O     . HOH C 3 .   ? 0.396   46.660 -19.012 1.00 58.53 ? 1082 HOH A O     1 
HETATM 1070 O O     . HOH C 3 .   ? 14.157  45.471 9.044   1.00 60.61 ? 1083 HOH A O     1 
HETATM 1071 O O     . HOH C 3 .   ? -15.856 37.977 7.219   1.00 57.65 ? 1084 HOH A O     1 
HETATM 1072 O O     . HOH C 3 .   ? -20.976 44.395 -5.090  1.00 55.44 ? 1085 HOH A O     1 
HETATM 1073 O O     . HOH C 3 .   ? 19.780  44.748 2.544   1.00 49.51 ? 1086 HOH A O     1 
HETATM 1074 O O     . HOH C 3 .   ? -14.976 46.727 9.548   1.00 43.26 ? 1087 HOH A O     1 
HETATM 1075 O O     . HOH C 3 .   ? -23.108 54.378 -1.927  1.00 57.65 ? 1088 HOH A O     1 
HETATM 1076 O O     . HOH C 3 .   ? -4.606  58.743 12.104  1.00 52.14 ? 1089 HOH A O     1 
HETATM 1077 O O     . HOH C 3 .   ? 6.400   58.182 3.367   1.00 41.79 ? 1090 HOH A O     1 
HETATM 1078 O O     . HOH C 3 .   ? 4.999   60.031 0.421   1.00 44.94 ? 1091 HOH A O     1 
HETATM 1079 O O     . HOH C 3 .   ? -3.909  58.698 -13.833 1.00 41.32 ? 1092 HOH A O     1 
HETATM 1080 O O     . HOH C 3 .   ? -18.293 56.483 1.587   1.00 51.07 ? 1093 HOH A O     1 
HETATM 1081 O O     . HOH C 3 .   ? -17.936 58.618 -0.087  1.00 48.92 ? 1094 HOH A O     1 
HETATM 1082 O O     . HOH C 3 .   ? -18.426 46.973 -6.799  1.00 57.78 ? 1095 HOH A O     1 
HETATM 1083 O O     . HOH C 3 .   ? 2.452   66.392 3.694   1.00 55.64 ? 1096 HOH A O     1 
HETATM 1084 O O     . HOH C 3 .   ? 11.026  39.207 0.266   1.00 52.55 ? 1097 HOH A O     1 
HETATM 1085 O O     . HOH C 3 .   ? 4.696   66.225 4.162   1.00 53.28 ? 1098 HOH A O     1 
HETATM 1086 O O     . HOH C 3 .   ? -12.808 65.777 2.605   1.00 41.28 ? 1099 HOH A O     1 
HETATM 1087 O O     . HOH C 3 .   ? -8.436  43.191 -18.962 1.00 59.11 ? 1100 HOH A O     1 
HETATM 1088 O O     . HOH C 3 .   ? -0.837  48.794 17.131  1.00 39.78 ? 1101 HOH A O     1 
HETATM 1089 O O     . HOH C 3 .   ? 7.094   40.771 -6.810  1.00 48.64 ? 1102 HOH A O     1 
HETATM 1090 O O     . HOH C 3 .   ? -9.469  53.397 12.219  1.00 59.38 ? 1103 HOH A O     1 
HETATM 1091 O O     . HOH C 3 .   ? -4.022  49.540 16.183  1.00 45.03 ? 1104 HOH A O     1 
HETATM 1092 O O     . HOH C 3 .   ? 2.994   61.135 -4.380  1.00 56.07 ? 1105 HOH A O     1 
HETATM 1093 O O     . HOH C 3 .   ? -4.095  57.204 -15.562 1.00 53.18 ? 1106 HOH A O     1 
HETATM 1094 O O     . HOH C 3 .   ? 5.175   52.320 -13.705 1.00 57.52 ? 1107 HOH A O     1 
HETATM 1095 O O     . HOH C 3 .   ? -5.050  46.891 -16.763 1.00 50.31 ? 1108 HOH A O     1 
HETATM 1096 O O     . HOH C 3 .   ? -17.534 48.540 2.813   1.00 44.65 ? 1109 HOH A O     1 
HETATM 1097 O O     . HOH C 3 .   ? 6.358   59.200 -2.409  1.00 56.45 ? 1110 HOH A O     1 
HETATM 1098 O O     . HOH C 3 .   ? 8.414   60.816 2.074   1.00 53.62 ? 1111 HOH A O     1 
HETATM 1099 O O     . HOH C 3 .   ? -10.657 33.543 -2.793  1.00 63.30 ? 1112 HOH A O     1 
HETATM 1100 O O     . HOH C 3 .   ? -13.787 34.193 2.951   1.00 51.09 ? 1113 HOH A O     1 
HETATM 1101 O O     . HOH C 3 .   ? 18.197  48.112 -1.832  1.00 60.24 ? 1114 HOH A O     1 
HETATM 1102 O O     . HOH C 3 .   ? -5.669  41.278 -14.899 1.00 61.27 ? 1115 HOH A O     1 
HETATM 1103 O O     . HOH C 3 .   ? 10.996  48.696 8.712   1.00 57.56 ? 1116 HOH A O     1 
HETATM 1104 O O     . HOH C 3 .   ? 9.043   60.414 4.636   1.00 61.92 ? 1117 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6605 0.3762 0.6853 0.0736  -0.1227 0.1153  1    MET A N     
2    C CA    . MET A 1   ? 0.6455 0.4950 0.6053 0.1138  -0.0040 0.0460  1    MET A CA    
3    C C     . MET A 1   ? 0.5764 0.5037 0.4367 0.0989  -0.0569 0.1031  1    MET A C     
4    O O     . MET A 1   ? 0.8076 0.7403 0.4076 0.0832  -0.0436 0.1659  1    MET A O     
5    C CB    . MET A 1   ? 0.7542 0.4641 0.7503 0.0782  0.1075  -0.0156 1    MET A CB    
6    C CG    . MET A 1   ? 0.7830 0.4870 0.8104 0.0459  0.2541  -0.1684 1    MET A CG    
7    S SD    . MET A 1   ? 0.6167 0.5659 0.8417 0.0092  -0.2569 0.0137  1    MET A SD    
8    C CE    . MET A 1   ? 1.4245 0.5282 0.5456 -0.6630 -0.3125 0.1065  1    MET A CE    
9    N N     . GLU A 2   ? 0.4207 0.4830 0.4854 0.0907  -0.0109 0.0885  2    GLU A N     
10   C CA    . GLU A 2   ? 0.4160 0.5046 0.4773 0.0506  -0.0124 0.0795  2    GLU A CA    
11   C C     . GLU A 2   ? 0.3129 0.5550 0.5073 0.0001  -0.0307 0.0138  2    GLU A C     
12   O O     . GLU A 2   ? 0.3171 0.6465 0.7211 -0.0111 -0.0275 -0.1341 2    GLU A O     
13   C CB    . GLU A 2   ? 0.6286 0.4719 0.4731 0.0112  -0.1563 0.0446  2    GLU A CB    
14   C CG    . GLU A 2   ? 0.6830 0.4577 0.4145 0.0549  -0.1898 0.0981  2    GLU A CG    
15   C CD    . GLU A 2   ? 0.6286 0.4826 0.5361 0.1154  -0.1119 0.0248  2    GLU A CD    
16   O OE1   . GLU A 2   ? 0.5627 0.5280 0.7506 -0.0863 -0.0154 -0.0297 2    GLU A OE1   
17   O OE2   . GLU A 2   ? 0.7892 0.4655 0.9159 0.1966  -0.0052 0.0666  2    GLU A OE2   
18   N N     . HIS A 3   ? 0.3323 0.5455 0.4985 0.0364  -0.0194 0.0021  3    HIS A N     
19   C CA    . HIS A 3   ? 0.2888 0.5326 0.4869 0.0332  -0.0496 0.0631  3    HIS A CA    
20   C C     . HIS A 3   ? 0.3274 0.4850 0.2913 -0.0059 -0.0613 0.0330  3    HIS A C     
21   O O     . HIS A 3   ? 0.3764 0.6566 0.4575 -0.0546 -0.1323 -0.0911 3    HIS A O     
22   C CB    . HIS A 3   ? 0.5908 0.6248 0.5790 0.0661  -0.0855 0.2596  3    HIS A CB    
23   C CG    . HIS A 3   ? 0.7670 0.6351 0.6620 0.1207  0.1532  0.3101  3    HIS A CG    
24   N ND1   . HIS A 3   ? 0.9879 0.6587 0.6987 0.0430  0.3306  0.2771  3    HIS A ND1   
25   C CD2   . HIS A 3   ? 0.8561 0.6180 0.7827 0.0777  0.3307  0.2169  3    HIS A CD2   
26   C CE1   . HIS A 3   ? 0.9188 0.6601 0.7295 0.0869  0.3807  0.3011  3    HIS A CE1   
27   N NE2   . HIS A 3   ? 0.7847 0.6385 0.7730 0.1428  0.3449  0.3134  3    HIS A NE2   
28   N N     . VAL A 4   ? 0.2398 0.4379 0.3348 -0.0112 -0.0284 -0.0527 4    VAL A N     
29   C CA    . VAL A 4   ? 0.2405 0.3315 0.3746 -0.0835 -0.0003 0.0499  4    VAL A CA    
30   C C     . VAL A 4   ? 0.2214 0.2748 0.2379 -0.0511 -0.0502 0.0586  4    VAL A C     
31   O O     . VAL A 4   ? 0.2776 0.3610 0.2439 -0.0402 -0.0499 0.0196  4    VAL A O     
32   C CB    . VAL A 4   ? 0.3903 0.4213 0.4322 -0.1652 0.0361  0.0978  4    VAL A CB    
33   C CG1   . VAL A 4   ? 0.4999 0.3038 0.6144 -0.1479 -0.2191 0.0864  4    VAL A CG1   
34   C CG2   . VAL A 4   ? 0.4489 0.7247 0.6210 -0.2869 0.1264  0.1143  4    VAL A CG2   
35   N N     . ALA A 5   ? 0.2273 0.2315 0.2390 -0.0611 -0.0506 0.0556  5    ALA A N     
36   C CA    . ALA A 5   ? 0.2250 0.1862 0.1931 -0.0469 -0.0410 0.0808  5    ALA A CA    
37   C C     . ALA A 5   ? 0.2372 0.1522 0.1664 -0.0359 -0.0497 0.0414  5    ALA A C     
38   O O     . ALA A 5   ? 0.2443 0.1508 0.2829 -0.0326 -0.0513 0.0099  5    ALA A O     
39   C CB    . ALA A 5   ? 0.2790 0.2290 0.1942 0.0044  -0.0129 0.0987  5    ALA A CB    
40   N N     . PHE A 6   ? 0.2196 0.1570 0.1931 -0.0283 -0.0466 0.0256  6    PHE A N     
41   C CA    . PHE A 6   ? 0.2319 0.1438 0.1715 -0.0209 -0.0485 0.0035  6    PHE A CA    
42   C C     . PHE A 6   ? 0.2751 0.1364 0.1803 -0.0114 -0.0152 0.0237  6    PHE A C     
43   O O     . PHE A 6   ? 0.2989 0.1983 0.1830 -0.0305 -0.0084 0.0382  6    PHE A O     
44   C CB    . PHE A 6   ? 0.2397 0.1795 0.1922 -0.0432 -0.0590 0.0062  6    PHE A CB    
45   C CG    . PHE A 6   ? 0.2230 0.1624 0.2015 -0.0768 -0.0466 0.0433  6    PHE A CG    
46   C CD1   . PHE A 6   ? 0.2075 0.2529 0.2440 -0.0711 -0.0370 0.0594  6    PHE A CD1   
47   C CD2   . PHE A 6   ? 0.2862 0.1402 0.2049 -0.0669 -0.0401 0.0628  6    PHE A CD2   
48   C CE1   . PHE A 6   ? 0.2585 0.2650 0.2395 -0.0111 -0.0494 0.0089  6    PHE A CE1   
49   C CE2   . PHE A 6   ? 0.3353 0.1771 0.2062 -0.0241 -0.0508 0.0529  6    PHE A CE2   
50   C CZ    . PHE A 6   ? 0.2946 0.2701 0.2502 -0.0413 -0.0708 0.0414  6    PHE A CZ    
51   N N     . GLY A 7   ? 0.2286 0.1376 0.2584 -0.0125 -0.0247 0.0286  7    GLY A N     
52   C CA    . GLY A 7   ? 0.2256 0.1813 0.3266 0.0247  -0.0413 -0.0005 7    GLY A CA    
53   C C     . GLY A 7   ? 0.2798 0.1924 0.2404 -0.0053 -0.0118 0.0253  7    GLY A C     
54   O O     . GLY A 7   ? 0.3530 0.2462 0.3302 0.0351  0.0113  -0.0241 7    GLY A O     
55   N N     . SER A 8   ? 0.2768 0.1723 0.2177 -0.0346 -0.0353 0.0143  8    SER A N     
56   C CA    . SER A 8   ? 0.3513 0.1694 0.2200 -0.0501 -0.0485 0.0000  8    SER A CA    
57   C C     . SER A 8   ? 0.3409 0.1684 0.2475 -0.0360 0.0026  -0.0093 8    SER A C     
58   O O     . SER A 8   ? 0.3638 0.1612 0.2704 -0.0439 -0.0225 0.0047  8    SER A O     
59   C CB    . SER A 8   ? 0.3353 0.2052 0.4386 -0.0032 -0.1557 -0.0272 8    SER A CB    
60   O OG    . SER A 8   ? 0.4812 0.2138 0.4339 0.0143  -0.2309 -0.0270 8    SER A OG    
61   N N     . GLU A 9   ? 0.3327 0.1899 0.2664 -0.0493 0.0018  -0.0294 9    GLU A N     
62   C CA    . GLU A 9   ? 0.3485 0.1832 0.2926 -0.0772 -0.0082 -0.0458 9    GLU A CA    
63   C C     . GLU A 9   ? 0.3674 0.2239 0.2329 -0.0852 -0.0246 -0.0074 9    GLU A C     
64   O O     . GLU A 9   ? 0.4717 0.2214 0.3251 -0.0875 -0.0371 0.0082  9    GLU A O     
65   C CB    . GLU A 9   ? 0.6934 0.3454 0.3544 -0.1923 0.2225  -0.1494 9    GLU A CB    
66   C CG    . GLU A 9   ? 0.6129 0.5857 0.5433 -0.1347 0.2745  -0.1245 9    GLU A CG    
67   C CD    . GLU A 9   ? 0.6952 0.7370 0.7957 -0.1567 0.1600  0.0613  9    GLU A CD    
68   O OE1   . GLU A 9   ? 0.6011 0.6396 1.2224 -0.0712 0.1433  0.0194  9    GLU A OE1   
69   O OE2   . GLU A 9   ? 0.9859 0.9894 0.8622 -0.1804 0.1157  0.2447  9    GLU A OE2   
70   N N     . ASP A 10  ? 0.3621 0.2396 0.2785 -0.1042 0.0092  -0.0556 10   ASP A N     
71   C CA    . ASP A 10  ? 0.3727 0.3568 0.2551 -0.1771 -0.0294 -0.0564 10   ASP A CA    
72   C C     . ASP A 10  ? 0.2837 0.2299 0.2688 -0.1012 -0.0413 -0.0014 10   ASP A C     
73   O O     . ASP A 10  ? 0.2791 0.3271 0.2650 -0.1016 -0.0640 0.0216  10   ASP A O     
74   C CB    . ASP A 10  ? 0.3752 0.5349 0.3392 -0.1260 -0.0666 -0.1304 10   ASP A CB    
75   C CG    . ASP A 10  ? 0.4338 0.6838 0.4166 -0.0877 -0.1398 -0.0053 10   ASP A CG    
76   O OD1   . ASP A 10  ? 0.5744 0.5960 0.4012 -0.1323 -0.2022 0.1518  10   ASP A OD1   
77   O OD2   . ASP A 10  ? 0.6052 0.9110 0.5805 -0.1493 -0.3123 0.0243  10   ASP A OD2   
78   N N     . ILE A 11  ? 0.3012 0.2104 0.2202 -0.0756 -0.0904 0.0238  11   ILE A N     
79   C CA    . ILE A 11  ? 0.2543 0.2200 0.2416 -0.0770 -0.0672 0.0234  11   ILE A CA    
80   C C     . ILE A 11  ? 0.2224 0.2371 0.2961 -0.0217 -0.0380 0.0649  11   ILE A C     
81   O O     . ILE A 11  ? 0.2110 0.2284 0.3141 -0.0554 -0.0437 0.0339  11   ILE A O     
82   C CB    . ILE A 11  ? 0.2257 0.2644 0.2409 -0.0528 -0.0534 -0.0308 11   ILE A CB    
83   C CG1   . ILE A 11  ? 0.3602 0.3161 0.2259 -0.0705 -0.0301 -0.0551 11   ILE A CG1   
84   C CG2   . ILE A 11  ? 0.2408 0.2917 0.2541 -0.0647 -0.0485 0.0603  11   ILE A CG2   
85   C CD1   . ILE A 11  ? 0.4410 0.2474 0.4181 -0.0404 -0.1421 -0.0600 11   ILE A CD1   
86   N N     . GLU A 12  ? 0.2757 0.2122 0.2307 -0.0456 -0.0423 0.0309  12   GLU A N     
87   C CA    . GLU A 12  ? 0.2605 0.2478 0.2737 -0.0493 -0.0690 0.0756  12   GLU A CA    
88   C C     . GLU A 12  ? 0.2757 0.2387 0.2821 -0.0724 -0.0662 0.0410  12   GLU A C     
89   O O     . GLU A 12  ? 0.2797 0.2967 0.2684 -0.0939 -0.0721 0.0399  12   GLU A O     
90   C CB    . GLU A 12  ? 0.3176 0.2976 0.3627 -0.0022 -0.0447 0.1306  12   GLU A CB    
91   C CG    . GLU A 12  ? 0.3114 0.2130 0.4745 -0.0205 -0.0341 0.1162  12   GLU A CG    
92   C CD    . GLU A 12  ? 0.2861 0.2373 0.4047 -0.0416 -0.0684 0.0447  12   GLU A CD    
93   O OE1   . GLU A 12  ? 0.3162 0.2452 0.3222 -0.0394 -0.0473 0.0528  12   GLU A OE1   
94   O OE2   . GLU A 12  ? 0.6698 0.2814 0.4223 -0.1198 0.0042  -0.0218 12   GLU A OE2   
95   N N     . ASN A 13  ? 0.2428 0.2546 0.2736 -0.0379 -0.0365 0.0052  13   ASN A N     
96   C CA    . ASN A 13  ? 0.2690 0.2407 0.2952 -0.0481 -0.0943 0.0681  13   ASN A CA    
97   C C     . ASN A 13  ? 0.2185 0.2545 0.3249 -0.0709 -0.0980 0.0346  13   ASN A C     
98   O O     . ASN A 13  ? 0.2507 0.2897 0.3674 -0.0858 -0.0548 0.0372  13   ASN A O     
99   C CB    . ASN A 13  ? 0.4182 0.2730 0.2940 -0.0577 -0.1056 0.0206  13   ASN A CB    
100  C CG    . ASN A 13  ? 0.4155 0.3193 0.3917 -0.0095 -0.1227 -0.0213 13   ASN A CG    
101  O OD1   . ASN A 13  ? 0.4875 0.5605 0.6169 0.1314  -0.2049 0.0060  13   ASN A OD1   
102  N ND2   . ASN A 13  ? 0.6256 0.3565 0.4006 -0.0029 -0.2475 -0.0691 13   ASN A ND2   
103  N N     . THR A 14  ? 0.2593 0.2402 0.2548 -0.0724 -0.0815 0.0170  14   THR A N     
104  C CA    . THR A 14  ? 0.2164 0.2528 0.3299 -0.0570 -0.1044 0.0313  14   THR A CA    
105  C C     . THR A 14  ? 0.2191 0.2150 0.3395 -0.0286 -0.0852 -0.0017 14   THR A C     
106  O O     . THR A 14  ? 0.2215 0.2692 0.3877 -0.0203 -0.0782 -0.0103 14   THR A O     
107  C CB    . THR A 14  ? 0.3705 0.2522 0.4258 -0.0693 -0.0803 0.0907  14   THR A CB    
108  O OG1   . THR A 14  ? 0.4054 0.2912 0.4204 -0.0519 -0.0827 0.1279  14   THR A OG1   
109  C CG2   . THR A 14  ? 0.4158 0.2576 0.6289 -0.0638 0.0139  0.0881  14   THR A CG2   
110  N N     . LEU A 15  ? 0.2138 0.2351 0.3048 -0.0545 -0.0700 -0.0123 15   LEU A N     
111  C CA    . LEU A 15  ? 0.2514 0.2612 0.3116 -0.1010 -0.0647 -0.0272 15   LEU A CA    
112  C C     . LEU A 15  ? 0.2257 0.2525 0.3248 -0.0691 -0.0442 -0.0139 15   LEU A C     
113  O O     . LEU A 15  ? 0.3441 0.2945 0.3395 -0.0565 0.0077  -0.0086 15   LEU A O     
114  C CB    . LEU A 15  ? 0.2761 0.3336 0.3129 -0.1296 -0.0866 -0.0221 15   LEU A CB    
115  C CG    . LEU A 15  ? 0.2540 0.3544 0.4241 -0.1589 -0.0539 -0.0065 15   LEU A CG    
116  C CD1   . LEU A 15  ? 0.3545 0.3237 0.4501 -0.0896 -0.0182 0.0169  15   LEU A CD1   
117  C CD2   . LEU A 15  ? 0.3208 0.4349 0.5446 -0.1724 -0.1582 -0.0483 15   LEU A CD2   
118  N N     . ALA A 16  ? 0.2326 0.2609 0.3033 -0.1012 -0.0647 -0.0030 16   ALA A N     
119  C CA    . ALA A 16  ? 0.2486 0.2412 0.3233 -0.0664 -0.0550 0.0184  16   ALA A CA    
120  C C     . ALA A 16  ? 0.2433 0.3385 0.2663 -0.0706 -0.0081 0.0293  16   ALA A C     
121  O O     . ALA A 16  ? 0.3652 0.3885 0.4088 -0.1206 0.0924  0.0472  16   ALA A O     
122  C CB    . ALA A 16  ? 0.2981 0.2445 0.3233 -0.0840 -0.0257 0.0098  16   ALA A CB    
123  N N     . LYS A 17  ? 0.2315 0.2701 0.3559 -0.0567 -0.0475 0.0158  17   LYS A N     
124  C CA    . LYS A 17  ? 0.2375 0.3899 0.3296 -0.0314 -0.0492 -0.0403 17   LYS A CA    
125  C C     . LYS A 17  ? 0.2392 0.4555 0.4255 -0.0453 -0.0257 -0.1184 17   LYS A C     
126  O O     . LYS A 17  ? 0.2326 0.5402 0.7029 -0.0544 0.0787  -0.1742 17   LYS A O     
127  C CB    . LYS A 17  ? 0.2116 0.4068 0.3576 -0.0244 -0.0289 0.0174  17   LYS A CB    
128  C CG    . LYS A 17  ? 0.3247 0.4154 0.3177 0.0137  -0.0557 0.0237  17   LYS A CG    
129  C CD    . LYS A 17  ? 0.3988 0.4582 0.3611 0.0565  -0.1032 0.0341  17   LYS A CD    
130  C CE    . LYS A 17  ? 0.6195 0.5132 0.3702 -0.0994 -0.0288 0.0965  17   LYS A CE    
131  N NZ    . LYS A 17  ? 0.7345 0.4600 0.4785 -0.1534 -0.1281 0.1167  17   LYS A NZ    
132  N N     . MET A 18  ? 0.3679 0.4973 0.4291 -0.0925 -0.0902 -0.1149 18   MET A N     
133  C CA    . MET A 18  ? 0.4009 0.5274 0.4445 -0.1274 -0.0222 -0.1437 18   MET A CA    
134  C C     . MET A 18  ? 0.5399 0.6320 0.4571 -0.1496 0.0582  -0.1285 18   MET A C     
135  O O     . MET A 18  ? 0.5799 0.7175 0.4440 -0.1675 0.0815  -0.0137 18   MET A O     
136  C CB    . MET A 18  ? 0.3275 0.5152 0.4189 -0.0720 0.0628  -0.2327 18   MET A CB    
137  C CG    . MET A 18  ? 0.3114 0.5114 0.4108 -0.1180 -0.0363 -0.1964 18   MET A CG    
138  S SD    . MET A 18  ? 0.2982 0.4072 0.8374 -0.0627 -0.0463 -0.0413 18   MET A SD    
139  C CE    . MET A 18  ? 1.5214 0.3125 1.4415 -0.2274 -0.4860 0.4597  18   MET A CE    
140  N N     . ASP A 19  ? 0.5788 0.7575 0.5845 -0.1435 0.1868  -0.1262 19   ASP A N     
141  C CA    . ASP A 19  ? 0.5428 0.7942 0.5953 -0.2046 0.2365  -0.1109 19   ASP A CA    
142  C C     . ASP A 19  ? 0.4762 0.6959 0.5580 -0.0929 0.0576  0.0225  19   ASP A C     
143  O O     . ASP A 19  ? 0.4392 0.4117 0.4845 0.0324  0.0238  0.0103  19   ASP A O     
144  C CB    . ASP A 19  ? 0.5240 0.8689 0.7034 -0.2470 0.2395  -0.1526 19   ASP A CB    
145  C CG    . ASP A 19  ? 0.4900 0.8572 0.7796 -0.2047 0.3348  -0.1763 19   ASP A CG    
146  O OD1   . ASP A 19  ? 0.4789 0.9380 1.0164 -0.1565 0.3843  -0.1677 19   ASP A OD1   
147  O OD2   . ASP A 19  ? 0.5833 0.8717 0.7105 -0.2620 0.2516  -0.1558 19   ASP A OD2   
148  N N     . ASP A 20  ? 0.5519 0.7221 0.6125 -0.1864 0.2098  -0.0931 20   ASP A N     
149  C CA    . ASP A 20  ? 0.7008 0.7030 0.6626 -0.1598 0.0813  -0.1087 20   ASP A CA    
150  C C     . ASP A 20  ? 0.4855 0.7382 0.6924 -0.2058 0.0382  -0.0356 20   ASP A C     
151  O O     . ASP A 20  ? 0.4670 0.7451 0.5649 -0.1959 0.1977  -0.1963 20   ASP A O     
152  C CB    . ASP A 20  ? 0.8094 0.6532 0.6597 -0.0769 0.0703  -0.0861 20   ASP A CB    
153  C CG    . ASP A 20  ? 0.8186 0.5748 0.7083 0.0405  0.1806  -0.0309 20   ASP A CG    
154  O OD1   . ASP A 20  ? 0.6624 0.6096 0.9261 0.1099  0.0905  0.2260  20   ASP A OD1   
155  O OD2   . ASP A 20  ? 1.1682 0.5063 0.7276 0.1002  0.3188  -0.0960 20   ASP A OD2   
156  N N     . GLY A 21  ? 0.4711 0.7280 0.7077 -0.2189 0.0341  -0.1698 21   GLY A N     
157  C CA    . GLY A 21  ? 0.4242 0.6980 0.7166 -0.2031 0.0131  -0.2397 21   GLY A CA    
158  C C     . GLY A 21  ? 0.2623 0.5266 0.7490 -0.0236 0.0269  -0.2135 21   GLY A C     
159  O O     . GLY A 21  ? 0.2638 0.5218 0.7199 -0.0201 -0.0236 -0.1907 21   GLY A O     
160  N N     . GLN A 22  ? 0.1981 0.5330 0.7176 -0.0203 -0.0270 -0.1906 22   GLN A N     
161  C CA    . GLN A 22  ? 0.2388 0.4452 0.6693 0.0109  -0.0962 -0.1314 22   GLN A CA    
162  C C     . GLN A 22  ? 0.2362 0.3637 0.4711 0.0340  -0.0683 -0.1035 22   GLN A C     
163  O O     . GLN A 22  ? 0.2484 0.3861 0.4858 0.0656  -0.1157 -0.0054 22   GLN A O     
164  C CB    . GLN A 22  ? 0.1791 0.4530 0.7117 0.0494  -0.0818 -0.1717 22   GLN A CB    
165  C CG    . GLN A 22  ? 0.2607 0.4753 0.7468 0.0709  -0.1710 -0.1301 22   GLN A CG    
166  C CD    . GLN A 22  ? 0.4481 0.5153 0.7210 -0.0152 -0.2248 -0.0929 22   GLN A CD    
167  O OE1   . GLN A 22  ? 0.8206 0.6994 0.5996 -0.1805 0.0106  -0.0566 22   GLN A OE1   
168  N NE2   . GLN A 22  ? 0.2733 0.4785 0.7597 0.0532  -0.0925 -0.1410 22   GLN A NE2   
169  N N     . LEU A 23  ? 0.2126 0.3154 0.3946 -0.0100 0.0069  -0.0944 23   LEU A N     
170  C CA    . LEU A 23  ? 0.2194 0.2301 0.3494 -0.0085 -0.0106 -0.0183 23   LEU A CA    
171  C C     . LEU A 23  ? 0.1868 0.1938 0.3628 0.0284  -0.0007 0.0088  23   LEU A C     
172  O O     . LEU A 23  ? 0.1572 0.2389 0.3373 0.0160  -0.0499 0.0096  23   LEU A O     
173  C CB    . LEU A 23  ? 0.3572 0.2016 0.3872 0.0051  -0.0173 0.0151  23   LEU A CB    
174  C CG    . LEU A 23  ? 0.5125 0.3199 0.3120 0.1572  0.0026  0.0075  23   LEU A CG    
175  C CD1   . LEU A 23  ? 0.7094 0.4401 0.2786 0.1818  0.0025  -0.0059 23   LEU A CD1   
176  C CD2   . LEU A 23  ? 0.6052 0.5260 0.2819 0.2722  -0.0007 0.0586  23   LEU A CD2   
177  N N     . ASP A 24  ? 0.2059 0.2113 0.3208 0.0444  -0.0212 0.0046  24   ASP A N     
178  C CA    . ASP A 24  ? 0.2508 0.2352 0.2842 0.0047  -0.0106 -0.0103 24   ASP A CA    
179  C C     . ASP A 24  ? 0.2102 0.2393 0.3359 -0.0165 -0.0333 0.0208  24   ASP A C     
180  O O     . ASP A 24  ? 0.3187 0.2253 0.4531 -0.0129 -0.0545 0.0247  24   ASP A O     
181  C CB    . ASP A 24  ? 0.2183 0.2799 0.3103 0.0424  -0.0206 -0.0242 24   ASP A CB    
182  C CG    . ASP A 24  ? 0.1506 0.3701 0.2924 0.0467  -0.0030 -0.0138 24   ASP A CG    
183  O OD1   . ASP A 24  ? 0.1556 0.2925 0.3654 0.0307  -0.0075 0.0029  24   ASP A OD1   
184  O OD2   . ASP A 24  ? 0.2424 0.6285 0.3819 0.1244  0.0820  0.0737  24   ASP A OD2   
185  N N     . GLY A 25  ? 0.1767 0.3144 0.3287 0.0565  -0.0407 0.0206  25   GLY A N     
186  C CA    . GLY A 25  ? 0.2165 0.3066 0.3614 0.1191  -0.0347 0.0340  25   GLY A CA    
187  C C     . GLY A 25  ? 0.2003 0.2900 0.3350 0.0695  -0.0430 0.0448  25   GLY A C     
188  O O     . GLY A 25  ? 0.3141 0.3080 0.3500 0.0895  -0.0386 0.0617  25   GLY A O     
189  N N     . LEU A 26  ? 0.1485 0.2355 0.3390 0.0341  -0.0433 0.0061  26   LEU A N     
190  C CA    . LEU A 26  ? 0.1620 0.1939 0.2883 0.0102  -0.0444 0.0440  26   LEU A CA    
191  C C     . LEU A 26  ? 0.2098 0.1579 0.2811 0.0017  -0.0315 0.0000  26   LEU A C     
192  O O     . LEU A 26  ? 0.2543 0.2303 0.2995 0.0238  -0.0519 -0.0226 26   LEU A O     
193  C CB    . LEU A 26  ? 0.1797 0.1559 0.3285 0.0080  -0.0492 0.0057  26   LEU A CB    
194  C CG    . LEU A 26  ? 0.2415 0.1838 0.3119 -0.0204 -0.0533 -0.0281 26   LEU A CG    
195  C CD1   . LEU A 26  ? 0.3622 0.1575 0.3394 -0.0220 -0.0578 0.0203  26   LEU A CD1   
196  C CD2   . LEU A 26  ? 0.3177 0.2396 0.3133 -0.0643 -0.0710 0.0083  26   LEU A CD2   
197  N N     . ALA A 27  ? 0.1963 0.1625 0.2732 0.0007  -0.0665 0.0485  27   ALA A N     
198  C CA    . ALA A 27  ? 0.1783 0.1694 0.3249 0.0180  -0.0570 0.0703  27   ALA A CA    
199  C C     . ALA A 27  ? 0.2015 0.1309 0.2795 0.0234  -0.0816 0.0193  27   ALA A C     
200  O O     . ALA A 27  ? 0.2351 0.1727 0.2740 -0.0237 -0.0742 0.0136  27   ALA A O     
201  C CB    . ALA A 27  ? 0.2815 0.2065 0.3186 -0.0357 -0.1017 0.1102  27   ALA A CB    
202  N N     . PHE A 28  ? 0.1787 0.1674 0.2276 0.0077  -0.0571 0.0665  28   PHE A N     
203  C CA    . PHE A 28  ? 0.1626 0.1936 0.2123 0.0324  -0.0193 0.0855  28   PHE A CA    
204  C C     . PHE A 28  ? 0.1432 0.1744 0.2160 0.0052  -0.0314 0.0740  28   PHE A C     
205  O O     . PHE A 28  ? 0.1694 0.1535 0.2172 -0.0080 -0.0107 0.0328  28   PHE A O     
206  C CB    . PHE A 28  ? 0.1523 0.2237 0.2511 -0.0120 0.0007  0.0423  28   PHE A CB    
207  C CG    . PHE A 28  ? 0.1430 0.2173 0.2246 0.0150  -0.0130 0.0597  28   PHE A CG    
208  C CD1   . PHE A 28  ? 0.2618 0.1734 0.1978 0.0220  0.0156  0.0062  28   PHE A CD1   
209  C CD2   . PHE A 28  ? 0.1806 0.2817 0.2421 0.0281  -0.0421 0.0470  28   PHE A CD2   
210  C CE1   . PHE A 28  ? 0.3304 0.1754 0.2374 0.0392  -0.0647 0.0049  28   PHE A CE1   
211  C CE2   . PHE A 28  ? 0.2958 0.2934 0.1885 -0.0038 -0.0381 0.0425  28   PHE A CE2   
212  C CZ    . PHE A 28  ? 0.3884 0.2352 0.1985 0.0567  -0.0468 -0.0155 28   PHE A CZ    
213  N N     . GLY A 29  ? 0.1941 0.1017 0.1945 0.0112  -0.0597 0.0352  29   GLY A N     
214  C CA    . GLY A 29  ? 0.1611 0.1108 0.1836 0.0023  -0.0164 0.0278  29   GLY A CA    
215  C C     . GLY A 29  ? 0.1230 0.1086 0.2137 0.0105  -0.0159 0.0313  29   GLY A C     
216  O O     . GLY A 29  ? 0.1544 0.1237 0.2206 0.0156  -0.0043 0.0172  29   GLY A O     
217  N N     . ALA A 30  ? 0.1519 0.1218 0.2047 -0.0143 -0.0153 0.0206  30   ALA A N     
218  C CA    . ALA A 30  ? 0.1607 0.1269 0.2048 -0.0329 -0.0365 0.0387  30   ALA A CA    
219  C C     . ALA A 30  ? 0.0965 0.1583 0.2074 0.0108  0.0010  0.0454  30   ALA A C     
220  O O     . ALA A 30  ? 0.1501 0.1675 0.2622 0.0412  0.0346  0.0221  30   ALA A O     
221  C CB    . ALA A 30  ? 0.1822 0.1955 0.2197 -0.0368 -0.0526 -0.0020 30   ALA A CB    
222  N N     . ILE A 31  ? 0.1319 0.1254 0.1712 0.0088  -0.0072 0.0073  31   ILE A N     
223  C CA    . ILE A 31  ? 0.1612 0.1067 0.1781 -0.0185 -0.0236 0.0084  31   ILE A CA    
224  C C     . ILE A 31  ? 0.1504 0.1193 0.1925 -0.0178 -0.0055 -0.0089 31   ILE A C     
225  O O     . ILE A 31  ? 0.2204 0.1392 0.2011 -0.0182 0.0268  -0.0229 31   ILE A O     
226  C CB    . ILE A 31  ? 0.1829 0.1286 0.1925 -0.0231 -0.0478 0.0106  31   ILE A CB    
227  C CG1   . ILE A 31  ? 0.1970 0.1385 0.2605 -0.0377 -0.0527 -0.0209 31   ILE A CG1   
228  C CG2   . ILE A 31  ? 0.2391 0.2076 0.2170 -0.0215 -0.0501 0.0554  31   ILE A CG2   
229  C CD1   . ILE A 31  ? 0.2154 0.2094 0.4105 -0.0523 -0.0982 -0.0348 31   ILE A CD1   
230  N N     . GLN A 32  ? 0.1525 0.1238 0.2138 -0.0269 -0.0093 0.0083  32   GLN A N     
231  C CA    . GLN A 32  ? 0.1611 0.1165 0.2053 -0.0283 -0.0417 0.0156  32   GLN A CA    
232  C C     . GLN A 32  ? 0.1401 0.1314 0.1777 -0.0156 -0.0069 0.0045  32   GLN A C     
233  O O     . GLN A 32  ? 0.1850 0.1626 0.1853 0.0066  0.0120  0.0099  32   GLN A O     
234  C CB    . GLN A 32  ? 0.1470 0.1655 0.2673 -0.0286 -0.0424 0.0061  32   GLN A CB    
235  C CG    . GLN A 32  ? 0.2230 0.1707 0.3702 -0.0708 -0.1155 0.0134  32   GLN A CG    
236  C CD    . GLN A 32  ? 0.2253 0.2832 0.6174 -0.0752 -0.1553 -0.0706 32   GLN A CD    
237  O OE1   . GLN A 32  ? 0.2393 0.3632 0.9057 -0.0915 -0.0288 -0.1196 32   GLN A OE1   
238  N NE2   . GLN A 32  ? 0.3840 0.4236 0.6195 -0.1724 -0.1968 -0.1167 32   GLN A NE2   
239  N N     . LEU A 33  ? 0.1850 0.1138 0.1938 -0.0029 -0.0052 0.0174  33   LEU A N     
240  C CA    . LEU A 33  ? 0.1600 0.1205 0.1792 -0.0209 0.0041  0.0395  33   LEU A CA    
241  C C     . LEU A 33  ? 0.1638 0.1348 0.1671 -0.0342 0.0207  0.0250  33   LEU A C     
242  O O     . LEU A 33  ? 0.2429 0.1593 0.1661 -0.0335 -0.0015 0.0173  33   LEU A O     
243  C CB    . LEU A 33  ? 0.1616 0.1599 0.2041 -0.0446 -0.0133 0.0184  33   LEU A CB    
244  C CG    . LEU A 33  ? 0.1574 0.1371 0.1930 -0.0251 0.0041  -0.0004 33   LEU A CG    
245  C CD1   . LEU A 33  ? 0.1528 0.2224 0.2538 -0.0499 0.0101  0.0553  33   LEU A CD1   
246  C CD2   . LEU A 33  ? 0.2443 0.2147 0.1802 -0.0227 -0.0261 -0.0212 33   LEU A CD2   
247  N N     . ASP A 34  ? 0.2119 0.1241 0.1663 -0.0286 0.0137  0.0319  34   ASP A N     
248  C CA    . ASP A 34  ? 0.1921 0.1380 0.2055 -0.0076 0.0280  0.0507  34   ASP A CA    
249  C C     . ASP A 34  ? 0.1962 0.1397 0.1870 -0.0082 0.0050  0.0263  34   ASP A C     
250  O O     . ASP A 34  ? 0.1872 0.1534 0.1893 -0.0130 0.0268  -0.0061 34   ASP A O     
251  C CB    . ASP A 34  ? 0.2182 0.1531 0.1911 -0.0336 0.0090  0.0567  34   ASP A CB    
252  C CG    . ASP A 34  ? 0.2169 0.1401 0.1918 -0.0190 0.0176  0.0472  34   ASP A CG    
253  O OD1   . ASP A 34  ? 0.2055 0.1572 0.1886 -0.0043 0.0190  0.0046  34   ASP A OD1   
254  O OD2   . ASP A 34  ? 0.2778 0.2999 0.1868 -0.0809 0.0455  0.0547  34   ASP A OD2   
255  N N     . GLY A 35  ? 0.2319 0.1356 0.2136 0.0012  0.0121  0.0148  35   GLY A N     
256  C CA    . GLY A 35  ? 0.2534 0.1757 0.2041 0.0245  0.0171  -0.0324 35   GLY A CA    
257  C C     . GLY A 35  ? 0.2404 0.1746 0.2010 0.0466  0.0212  -0.0206 35   GLY A C     
258  O O     . GLY A 35  ? 0.2578 0.2602 0.2110 0.0854  0.0113  -0.0041 35   GLY A O     
259  N N     . ASP A 36  ? 0.2366 0.1564 0.1891 0.0183  0.0184  0.0029  36   ASP A N     
260  C CA    . ASP A 36  ? 0.2460 0.1728 0.2022 0.0333  -0.0001 0.0090  36   ASP A CA    
261  C C     . ASP A 36  ? 0.1838 0.1750 0.2089 0.0471  0.0046  -0.0227 36   ASP A C     
262  O O     . ASP A 36  ? 0.2435 0.2267 0.2311 0.0386  -0.0237 -0.0332 36   ASP A O     
263  C CB    . ASP A 36  ? 0.3222 0.1999 0.1939 0.0555  -0.0096 0.0239  36   ASP A CB    
264  C CG    . ASP A 36  ? 0.3869 0.2048 0.2841 0.0628  0.0650  0.0573  36   ASP A CG    
265  O OD1   . ASP A 36  ? 0.4997 0.2420 0.3387 0.1257  0.0816  0.0225  36   ASP A OD1   
266  O OD2   . ASP A 36  ? 0.7744 0.2817 0.4257 -0.0292 0.2790  0.0553  36   ASP A OD2   
267  N N     . GLY A 37  ? 0.1679 0.1587 0.1792 0.0174  0.0426  0.0095  37   GLY A N     
268  C CA    . GLY A 37  ? 0.1831 0.1646 0.2191 0.0027  0.0471  -0.0019 37   GLY A CA    
269  C C     . GLY A 37  ? 0.1985 0.1417 0.2083 -0.0005 0.0492  0.0161  37   GLY A C     
270  O O     . GLY A 37  ? 0.2292 0.1566 0.2067 -0.0243 0.0190  -0.0136 37   GLY A O     
271  N N     . ASN A 38  ? 0.1632 0.1662 0.1664 -0.0043 0.0257  0.0031  38   ASN A N     
272  C CA    . ASN A 38  ? 0.1797 0.1474 0.1828 0.0246  0.0257  0.0197  38   ASN A CA    
273  C C     . ASN A 38  ? 0.2248 0.1235 0.1456 0.0138  0.0213  0.0037  38   ASN A C     
274  O O     . ASN A 38  ? 0.1878 0.1679 0.1640 -0.0023 0.0156  -0.0149 38   ASN A O     
275  C CB    . ASN A 38  ? 0.1961 0.1792 0.1601 0.0154  0.0374  0.0251  38   ASN A CB    
276  C CG    . ASN A 38  ? 0.2425 0.2003 0.1739 0.0375  0.0301  0.0400  38   ASN A CG    
277  O OD1   . ASN A 38  ? 0.2973 0.2482 0.1744 0.0497  -0.0053 0.0330  38   ASN A OD1   
278  N ND2   . ASN A 38  ? 0.3055 0.1937 0.2295 0.0427  0.0758  0.0371  38   ASN A ND2   
279  N N     . ILE A 39  ? 0.1807 0.1161 0.1784 0.0174  0.0342  0.0125  39   ILE A N     
280  C CA    . ILE A 39  ? 0.1330 0.1252 0.2161 0.0125  0.0044  -0.0009 39   ILE A CA    
281  C C     . ILE A 39  ? 0.1490 0.1583 0.2007 -0.0121 0.0329  0.0009  39   ILE A C     
282  O O     . ILE A 39  ? 0.1765 0.2204 0.2446 -0.0159 0.0635  -0.0177 39   ILE A O     
283  C CB    . ILE A 39  ? 0.1537 0.1192 0.2280 0.0152  0.0074  0.0048  39   ILE A CB    
284  C CG1   . ILE A 39  ? 0.1589 0.1546 0.2209 -0.0149 0.0155  -0.0255 39   ILE A CG1   
285  C CG2   . ILE A 39  ? 0.2055 0.1412 0.2335 0.0368  -0.0034 0.0125  39   ILE A CG2   
286  C CD1   . ILE A 39  ? 0.2216 0.2030 0.2187 -0.0315 0.0209  -0.0686 39   ILE A CD1   
287  N N     . LEU A 40  ? 0.1491 0.1662 0.2310 -0.0225 -0.0003 0.0170  40   LEU A N     
288  C CA    . LEU A 40  ? 0.1600 0.1698 0.2708 -0.0221 -0.0110 0.0342  40   LEU A CA    
289  C C     . LEU A 40  ? 0.1680 0.1923 0.2822 0.0000  0.0068  0.0470  40   LEU A C     
290  O O     . LEU A 40  ? 0.1525 0.2320 0.3628 -0.0111 0.0241  0.0249  40   LEU A O     
291  C CB    . LEU A 40  ? 0.1739 0.1825 0.3091 -0.0352 -0.0321 0.0136  40   LEU A CB    
292  C CG    . LEU A 40  ? 0.2761 0.1877 0.2687 -0.0004 0.0052  0.0246  40   LEU A CG    
293  C CD1   . LEU A 40  ? 0.2307 0.2160 0.3551 -0.0361 0.0289  -0.0332 40   LEU A CD1   
294  C CD2   . LEU A 40  ? 0.4943 0.2325 0.3187 0.0256  0.0575  0.0823  40   LEU A CD2   
295  N N     . GLN A 41  ? 0.1849 0.1540 0.2897 -0.0263 -0.0007 0.0327  41   GLN A N     
296  C CA    . GLN A 41  ? 0.1766 0.1371 0.3003 -0.0209 -0.0246 0.0080  41   GLN A CA    
297  C C     . GLN A 41  ? 0.1596 0.1426 0.2136 -0.0059 0.0039  0.0138  41   GLN A C     
298  O O     . GLN A 41  ? 0.1751 0.1400 0.2456 -0.0026 0.0315  0.0029  41   GLN A O     
299  C CB    . GLN A 41  ? 0.2265 0.1726 0.3537 -0.0351 -0.0799 0.0055  41   GLN A CB    
300  C CG    . GLN A 41  ? 0.2619 0.2707 0.4352 -0.1157 -0.1040 0.0349  41   GLN A CG    
301  C CD    . GLN A 41  ? 0.2653 0.4018 0.5176 -0.0421 -0.1775 -0.0037 41   GLN A CD    
302  O OE1   . GLN A 41  ? 0.4852 0.7210 0.3965 0.0120  -0.0886 -0.0439 41   GLN A OE1   
303  N NE2   . GLN A 41  ? 0.2869 0.4619 0.7513 -0.0073 -0.1334 0.1489  41   GLN A NE2   
304  N N     . TYR A 42  ? 0.1622 0.1383 0.2918 -0.0087 -0.0054 0.0152  42   TYR A N     
305  C CA    . TYR A 42  ? 0.1726 0.1190 0.2491 0.0034  -0.0179 0.0109  42   TYR A CA    
306  C C     . TYR A 42  ? 0.1434 0.1460 0.2500 0.0295  0.0193  0.0272  42   TYR A C     
307  O O     . TYR A 42  ? 0.1835 0.2371 0.2798 0.0576  0.0373  0.0203  42   TYR A O     
308  C CB    . TYR A 42  ? 0.1230 0.2140 0.2425 -0.0054 -0.0025 0.0157  42   TYR A CB    
309  C CG    . TYR A 42  ? 0.1256 0.1735 0.2550 0.0026  0.0077  0.0088  42   TYR A CG    
310  C CD1   . TYR A 42  ? 0.1573 0.1682 0.3240 0.0207  0.0143  0.0399  42   TYR A CD1   
311  C CD2   . TYR A 42  ? 0.1251 0.1703 0.2485 0.0030  0.0059  -0.0034 42   TYR A CD2   
312  C CE1   . TYR A 42  ? 0.1807 0.1584 0.2733 0.0126  0.0234  0.0264  42   TYR A CE1   
313  C CE2   . TYR A 42  ? 0.1274 0.1652 0.2068 -0.0007 0.0235  -0.0161 42   TYR A CE2   
314  C CZ    . TYR A 42  ? 0.1658 0.1650 0.2382 0.0082  -0.0092 -0.0227 42   TYR A CZ    
315  O OH    . TYR A 42  ? 0.1969 0.1940 0.2325 -0.0257 -0.0050 -0.0196 42   TYR A OH    
316  N N     . ASN A 43  ? 0.1392 0.1550 0.2470 0.0087  -0.0090 0.0223  43   ASN A N     
317  C CA    . ASN A 43  ? 0.1459 0.1536 0.2412 0.0275  0.0023  0.0122  43   ASN A CA    
318  C C     . ASN A 43  ? 0.1715 0.1566 0.2368 0.0222  -0.0133 0.0239  43   ASN A C     
319  O O     . ASN A 43  ? 0.1820 0.1624 0.2766 0.0323  -0.0304 -0.0099 43   ASN A O     
320  C CB    . ASN A 43  ? 0.1348 0.1928 0.2483 -0.0059 -0.0140 0.0130  43   ASN A CB    
321  C CG    . ASN A 43  ? 0.1065 0.1663 0.2410 0.0280  -0.0087 0.0123  43   ASN A CG    
322  O OD1   . ASN A 43  ? 0.1258 0.1714 0.2807 0.0084  -0.0280 -0.0086 43   ASN A OD1   
323  N ND2   . ASN A 43  ? 0.1914 0.1967 0.2496 0.0183  -0.0336 0.0490  43   ASN A ND2   
324  N N     . ALA A 44  ? 0.2087 0.1695 0.2853 0.0478  -0.0391 0.0155  44   ALA A N     
325  C CA    . ALA A 44  ? 0.1597 0.1855 0.3204 0.0574  -0.0014 -0.0437 44   ALA A CA    
326  C C     . ALA A 44  ? 0.1519 0.1898 0.2943 0.0483  -0.0229 -0.0481 44   ALA A C     
327  O O     . ALA A 44  ? 0.1904 0.1622 0.3427 0.0379  -0.0543 -0.0319 44   ALA A O     
328  C CB    . ALA A 44  ? 0.1585 0.2320 0.3838 0.0733  -0.0224 -0.0395 44   ALA A CB    
329  N N     . ALA A 45  ? 0.1869 0.1674 0.2749 0.0660  -0.0254 0.0050  45   ALA A N     
330  C CA    . ALA A 45  ? 0.2072 0.1668 0.2555 0.0357  -0.0463 0.0128  45   ALA A CA    
331  C C     . ALA A 45  ? 0.1974 0.1709 0.2559 0.0043  -0.0432 0.0439  45   ALA A C     
332  O O     . ALA A 45  ? 0.1997 0.1605 0.2986 0.0090  -0.0357 0.0245  45   ALA A O     
333  C CB    . ALA A 45  ? 0.2556 0.2292 0.2484 0.0155  -0.0394 0.0144  45   ALA A CB    
334  N N     . GLN A 46  ? 0.1598 0.1591 0.2215 0.0236  -0.0296 0.0160  46   GLN A N     
335  C CA    . GLN A 46  ? 0.1454 0.1273 0.2182 0.0361  -0.0074 -0.0151 46   GLN A CA    
336  C C     . GLN A 46  ? 0.1508 0.1465 0.2136 0.0164  -0.0210 -0.0027 46   GLN A C     
337  O O     . GLN A 46  ? 0.1653 0.1714 0.2564 -0.0002 -0.0329 -0.0250 46   GLN A O     
338  C CB    . GLN A 46  ? 0.1480 0.1312 0.2346 0.0309  -0.0213 0.0006  46   GLN A CB    
339  C CG    . GLN A 46  ? 0.1324 0.1825 0.2030 0.0435  0.0018  0.0153  46   GLN A CG    
340  C CD    . GLN A 46  ? 0.1536 0.2052 0.1728 0.0370  -0.0032 0.0009  46   GLN A CD    
341  O OE1   . GLN A 46  ? 0.2657 0.3192 0.1636 0.0977  0.0088  0.0066  46   GLN A OE1   
342  N NE2   . GLN A 46  ? 0.1297 0.2373 0.2649 0.0268  -0.0155 0.0059  46   GLN A NE2   
343  N N     . GLY A 47  ? 0.1897 0.1472 0.2235 0.0239  0.0140  -0.0186 47   GLY A N     
344  C CA    . GLY A 47  ? 0.2745 0.1571 0.2386 0.0238  0.0023  -0.0306 47   GLY A CA    
345  C C     . GLY A 47  ? 0.1675 0.1641 0.2622 0.0254  -0.0111 -0.0390 47   GLY A C     
346  O O     . GLY A 47  ? 0.2175 0.2144 0.3414 0.0267  -0.0591 -0.0898 47   GLY A O     
347  N N     . ASP A 48  ? 0.2097 0.1457 0.3090 0.0373  -0.0294 -0.0041 48   ASP A N     
348  C CA    . ASP A 48  ? 0.2116 0.1409 0.3733 0.0511  -0.0278 -0.0031 48   ASP A CA    
349  C C     . ASP A 48  ? 0.2226 0.1603 0.3813 0.0231  -0.0108 -0.0121 48   ASP A C     
350  O O     . ASP A 48  ? 0.2735 0.2049 0.6712 -0.0317 -0.0161 -0.0569 48   ASP A O     
351  C CB    . ASP A 48  ? 0.2942 0.1711 0.4556 0.1003  -0.0713 0.0622  48   ASP A CB    
352  C CG    . ASP A 48  ? 0.2818 0.2726 0.4958 0.0979  -0.0654 0.0829  48   ASP A CG    
353  O OD1   . ASP A 48  ? 0.3701 0.5100 0.5405 0.1417  -0.0100 -0.0114 48   ASP A OD1   
354  O OD2   . ASP A 48  ? 0.3240 0.4233 0.5803 0.1063  -0.1640 0.0354  48   ASP A OD2   
355  N N     . ILE A 49  ? 0.2129 0.1794 0.2948 0.0505  0.0165  0.0132  49   ILE A N     
356  C CA    . ILE A 49  ? 0.2213 0.1752 0.2953 0.0227  0.0114  0.0409  49   ILE A CA    
357  C C     . ILE A 49  ? 0.2264 0.1972 0.3187 -0.0247 -0.0182 0.0367  49   ILE A C     
358  O O     . ILE A 49  ? 0.2460 0.2039 0.3957 -0.0407 -0.0193 0.0042  49   ILE A O     
359  C CB    . ILE A 49  ? 0.2325 0.2055 0.2978 0.0665  0.0365  0.0329  49   ILE A CB    
360  C CG1   . ILE A 49  ? 0.3958 0.2345 0.3005 0.0194  -0.0030 0.0234  49   ILE A CG1   
361  C CG2   . ILE A 49  ? 0.2280 0.2436 0.5038 0.0385  0.0630  0.0104  49   ILE A CG2   
362  C CD1   . ILE A 49  ? 0.4721 0.2793 0.2752 0.0515  0.0685  0.0154  49   ILE A CD1   
363  N N     . THR A 50  ? 0.1843 0.1745 0.2828 0.0303  -0.0163 0.0267  50   THR A N     
364  C CA    . THR A 50  ? 0.2122 0.1411 0.2783 0.0082  -0.0531 -0.0155 50   THR A CA    
365  C C     . THR A 50  ? 0.2437 0.1463 0.3005 0.0159  -0.0514 -0.0343 50   THR A C     
366  O O     . THR A 50  ? 0.2509 0.1897 0.2838 0.0175  -0.0399 -0.0538 50   THR A O     
367  C CB    . THR A 50  ? 0.2574 0.1421 0.2488 0.0348  0.0052  -0.0094 50   THR A CB    
368  O OG1   . THR A 50  ? 0.2435 0.1718 0.2835 -0.0208 -0.0290 -0.0023 50   THR A OG1   
369  C CG2   . THR A 50  ? 0.3328 0.1931 0.2546 0.0647  -0.0266 -0.0448 50   THR A CG2   
370  N N     . GLY A 51  ? 0.2425 0.1312 0.3345 0.0160  -0.0112 -0.0140 51   GLY A N     
371  C CA    . GLY A 51  ? 0.3011 0.1430 0.3492 0.0181  -0.0345 -0.0576 51   GLY A CA    
372  C C     . GLY A 51  ? 0.2434 0.1541 0.3295 0.0629  0.0152  -0.0663 51   GLY A C     
373  O O     . GLY A 51  ? 0.3395 0.2363 0.3321 0.0290  -0.0033 -0.1055 51   GLY A O     
374  N N     . ARG A 52  ? 0.2241 0.1642 0.2460 0.0133  -0.0328 -0.0314 52   ARG A N     
375  C CA    . ARG A 52  ? 0.2338 0.1949 0.2947 0.0306  0.0105  -0.0161 52   ARG A CA    
376  C C     . ARG A 52  ? 0.2370 0.2030 0.3055 0.0281  0.0284  -0.0502 52   ARG A C     
377  O O     . ARG A 52  ? 0.2187 0.3038 0.3251 -0.0136 0.0021  -0.0127 52   ARG A O     
378  C CB    . ARG A 52  ? 0.2296 0.1692 0.3766 0.0195  0.0031  -0.0056 52   ARG A CB    
379  C CG    . ARG A 52  ? 0.2378 0.2240 0.3730 0.0490  0.0038  -0.0382 52   ARG A CG    
380  C CD    . ARG A 52  ? 0.2485 0.2297 0.3535 0.0175  -0.0571 -0.0364 52   ARG A CD    
381  N NE    . ARG A 52  ? 0.2609 0.2719 0.2800 0.0401  -0.0462 -0.0771 52   ARG A NE    
382  C CZ    . ARG A 52  ? 0.2417 0.2582 0.3384 0.0721  -0.0483 -0.0728 52   ARG A CZ    
383  N NH1   . ARG A 52  ? 0.2625 0.3240 0.4024 0.0134  -0.0624 -0.0139 52   ARG A NH1   
384  N NH2   . ARG A 52  ? 0.2656 0.4980 0.3226 0.1413  -0.0281 -0.0056 52   ARG A NH2   
385  N N     . ASP A 53  ? 0.2619 0.2188 0.3306 0.0079  0.0568  -0.0352 53   ASP A N     
386  C CA    . ASP A 53  ? 0.2560 0.1827 0.3062 0.0329  0.0433  -0.0239 53   ASP A CA    
387  C C     . ASP A 53  ? 0.2619 0.1906 0.3640 0.0421  -0.0077 -0.0307 53   ASP A C     
388  O O     . ASP A 53  ? 0.2548 0.1790 0.3215 0.0188  0.0524  -0.0207 53   ASP A O     
389  C CB    . ASP A 53  ? 0.3663 0.2244 0.3694 0.0322  0.1482  -0.0330 53   ASP A CB    
390  C CG    . ASP A 53  ? 0.3544 0.3418 0.4243 0.0657  0.1467  -0.0625 53   ASP A CG    
391  O OD1   . ASP A 53  ? 0.4048 0.5391 0.4683 -0.0603 0.2053  -0.1435 53   ASP A OD1   
392  O OD2   . ASP A 53  ? 0.3646 0.4192 0.4437 0.0621  0.1189  -0.0368 53   ASP A OD2   
393  N N     . PRO A 54  ? 0.2038 0.2293 0.3500 0.0584  0.0239  -0.0643 54   PRO A N     
394  C CA    . PRO A 54  ? 0.1790 0.2568 0.4234 0.0297  0.0326  -0.0922 54   PRO A CA    
395  C C     . PRO A 54  ? 0.1888 0.2658 0.5455 0.0266  0.0836  -0.0539 54   PRO A C     
396  O O     . PRO A 54  ? 0.2468 0.2393 0.6727 0.0026  0.1072  -0.0503 54   PRO A O     
397  C CB    . PRO A 54  ? 0.2227 0.3262 0.4917 0.0558  -0.0385 -0.1246 54   PRO A CB    
398  C CG    . PRO A 54  ? 0.2943 0.3152 0.4032 0.0698  -0.0817 -0.1113 54   PRO A CG    
399  C CD    . PRO A 54  ? 0.3387 0.2717 0.3121 0.0755  -0.0030 -0.0722 54   PRO A CD    
400  N N     . LYS A 55  ? 0.2230 0.2948 0.5230 0.0323  0.1098  -0.0358 55   LYS A N     
401  C CA    . LYS A 55  ? 0.4124 0.3453 0.6014 0.0505  0.2242  0.0046  55   LYS A CA    
402  C C     . LYS A 55  ? 0.4558 0.3350 0.5677 0.0546  0.2408  0.0303  55   LYS A C     
403  O O     . LYS A 55  ? 0.3779 0.4730 0.8006 -0.0012 0.2514  0.1966  55   LYS A O     
404  C CB    . LYS A 55  ? 0.3240 0.5715 0.6668 0.0563  0.2391  -0.0215 55   LYS A CB    
405  C CG    . LYS A 55  ? 0.4265 0.6721 0.7284 0.0893  0.1506  0.0139  55   LYS A CG    
406  C CD    . LYS A 55  ? 0.5412 0.7280 0.6798 0.0372  0.1497  -0.0081 55   LYS A CD    
407  C CE    . LYS A 55  ? 0.6487 0.7379 0.7338 -0.0063 0.0689  0.0187  55   LYS A CE    
408  N NZ    . LYS A 55  ? 1.2524 0.7000 0.9178 -0.4548 0.2887  -0.2050 55   LYS A NZ    
409  N N     . GLN A 56  ? 0.4912 0.2148 0.4906 0.0952  0.2011  0.0212  56   GLN A N     
410  C CA    . GLN A 56  ? 0.5711 0.1834 0.3933 0.1003  0.2173  -0.0120 56   GLN A CA    
411  C C     . GLN A 56  ? 0.5302 0.1922 0.3219 0.0935  0.1970  0.0284  56   GLN A C     
412  O O     . GLN A 56  ? 0.6506 0.3102 0.3351 0.1804  0.1775  0.0486  56   GLN A O     
413  C CB    . GLN A 56  ? 0.7124 0.2523 0.5001 0.0811  0.1358  -0.0804 56   GLN A CB    
414  C CG    . GLN A 56  ? 0.7989 0.3025 0.6915 0.0800  0.2088  -0.2387 56   GLN A CG    
415  C CD    . GLN A 56  ? 0.9584 0.4185 0.7262 0.0401  0.1574  -0.2785 56   GLN A CD    
416  O OE1   . GLN A 56  ? 1.0910 0.6552 0.8600 -0.1030 -0.0144 -0.1271 56   GLN A OE1   
417  N NE2   . GLN A 56  ? 1.0510 0.3979 0.9130 0.0283  0.2211  -0.3890 56   GLN A NE2   
418  N N     . VAL A 57  ? 0.3554 0.2046 0.2924 0.0174  0.1114  -0.0455 57   VAL A N     
419  C CA    . VAL A 57  ? 0.2929 0.2096 0.2759 0.0018  0.0901  -0.0316 57   VAL A CA    
420  C C     . VAL A 57  ? 0.2275 0.1903 0.2545 0.0336  0.0695  -0.0074 57   VAL A C     
421  O O     . VAL A 57  ? 0.2092 0.1836 0.2985 0.0130  0.0555  0.0179  57   VAL A O     
422  C CB    . VAL A 57  ? 0.2716 0.2224 0.2531 0.0005  0.0553  0.0121  57   VAL A CB    
423  C CG1   . VAL A 57  ? 0.3425 0.2189 0.3529 -0.0231 0.1080  -0.0447 57   VAL A CG1   
424  C CG2   . VAL A 57  ? 0.3623 0.2643 0.2961 0.1400  0.0323  0.0208  57   VAL A CG2   
425  N N     . ILE A 58  ? 0.2371 0.2174 0.2975 0.0437  0.0554  -0.0231 58   ILE A N     
426  C CA    . ILE A 58  ? 0.2341 0.2067 0.3008 0.0547  0.0193  -0.0016 58   ILE A CA    
427  C C     . ILE A 58  ? 0.1782 0.2436 0.2834 0.0503  0.0908  0.0108  58   ILE A C     
428  O O     . ILE A 58  ? 0.3693 0.3097 0.3262 0.0108  0.1906  -0.0150 58   ILE A O     
429  C CB    . ILE A 58  ? 0.2344 0.2546 0.4459 0.0437  -0.0133 0.0136  58   ILE A CB    
430  C CG1   . ILE A 58  ? 0.3735 0.2888 0.5322 0.0381  -0.1424 0.0919  58   ILE A CG1   
431  C CG2   . ILE A 58  ? 0.2343 0.3336 0.5434 -0.0344 0.1098  -0.0164 58   ILE A CG2   
432  C CD1   . ILE A 58  ? 0.4601 0.4118 0.8383 0.1007  -0.2981 0.0774  58   ILE A CD1   
433  N N     . GLY A 59  ? 0.1917 0.1900 0.2706 0.0021  0.0791  0.0208  59   GLY A N     
434  C CA    . GLY A 59  ? 0.1728 0.2235 0.3230 -0.0228 0.1059  0.0682  59   GLY A CA    
435  C C     . GLY A 59  ? 0.2031 0.2222 0.2451 -0.0062 0.0800  0.0402  59   GLY A C     
436  O O     . GLY A 59  ? 0.2807 0.2435 0.3077 -0.0197 0.0251  0.0708  59   GLY A O     
437  N N     . LYS A 60  ? 0.1752 0.2139 0.2305 -0.0009 0.0804  -0.0017 60   LYS A N     
438  C CA    . LYS A 60  ? 0.1855 0.2244 0.2215 0.0206  0.0628  -0.0183 60   LYS A CA    
439  C C     . LYS A 60  ? 0.1675 0.1972 0.1791 0.0103  0.0364  0.0005  60   LYS A C     
440  O O     . LYS A 60  ? 0.2054 0.1994 0.1993 -0.0038 0.0071  -0.0125 60   LYS A O     
441  C CB    . LYS A 60  ? 0.2006 0.2289 0.2137 0.0252  0.0084  -0.0276 60   LYS A CB    
442  C CG    . LYS A 60  ? 0.2488 0.2902 0.3049 -0.0106 0.0675  -0.0962 60   LYS A CG    
443  C CD    . LYS A 60  ? 0.3136 0.3455 0.4267 -0.0202 0.0292  -0.1859 60   LYS A CD    
444  C CE    . LYS A 60  ? 0.5123 0.3802 0.4007 0.0156  0.0895  -0.1756 60   LYS A CE    
445  N NZ    . LYS A 60  ? 0.9638 0.7499 0.3777 -0.0129 0.0998  -0.0958 60   LYS A NZ    
446  N N     . ASN A 61  ? 0.1711 0.1761 0.2027 0.0212  0.0353  0.0083  61   ASN A N     
447  C CA    . ASN A 61  ? 0.1813 0.1960 0.2174 0.0252  0.0541  0.0237  61   ASN A CA    
448  C C     . ASN A 61  ? 0.1910 0.1836 0.1737 0.0044  0.0336  -0.0141 61   ASN A C     
449  O O     . ASN A 61  ? 0.1928 0.1992 0.1975 0.0157  0.0120  -0.0428 61   ASN A O     
450  C CB    . ASN A 61  ? 0.2258 0.2007 0.2250 0.0571  0.0307  0.0090  61   ASN A CB    
451  C CG    . ASN A 61  ? 0.2117 0.1511 0.2222 0.0133  0.0352  0.0044  61   ASN A CG    
452  O OD1   . ASN A 61  ? 0.2041 0.1996 0.2417 -0.0109 0.0225  0.0104  61   ASN A OD1   
453  N ND2   . ASN A 61  ? 0.2507 0.1647 0.2868 -0.0152 0.0004  0.0020  61   ASN A ND2   
454  N N     . PHE A 62  ? 0.1712 0.1499 0.1792 0.0042  0.0125  0.0059  62   PHE A N     
455  C CA    . PHE A 62  ? 0.1765 0.1350 0.1820 0.0253  0.0157  0.0050  62   PHE A CA    
456  C C     . PHE A 62  ? 0.1663 0.1250 0.1794 0.0118  0.0189  -0.0213 62   PHE A C     
457  O O     . PHE A 62  ? 0.1904 0.1285 0.2283 0.0097  0.0098  -0.0105 62   PHE A O     
458  C CB    . PHE A 62  ? 0.1960 0.1572 0.1693 -0.0194 0.0124  -0.0090 62   PHE A CB    
459  C CG    . PHE A 62  ? 0.1456 0.1534 0.1826 0.0025  -0.0014 0.0063  62   PHE A CG    
460  C CD1   . PHE A 62  ? 0.1884 0.1699 0.1833 0.0191  -0.0079 0.0159  62   PHE A CD1   
461  C CD2   . PHE A 62  ? 0.1570 0.1820 0.2006 -0.0130 0.0091  0.0009  62   PHE A CD2   
462  C CE1   . PHE A 62  ? 0.1840 0.1809 0.2069 -0.0033 -0.0216 0.0289  62   PHE A CE1   
463  C CE2   . PHE A 62  ? 0.2024 0.2080 0.2038 -0.0107 0.0233  0.0229  62   PHE A CE2   
464  C CZ    . PHE A 62  ? 0.1936 0.2138 0.2034 -0.0127 -0.0113 0.0403  62   PHE A CZ    
465  N N     . PHE A 63  ? 0.1620 0.1406 0.1741 0.0207  0.0059  -0.0054 63   PHE A N     
466  C CA    . PHE A 63  ? 0.1603 0.1793 0.1885 0.0227  0.0018  -0.0373 63   PHE A CA    
467  C C     . PHE A 63  ? 0.1694 0.1602 0.1969 0.0318  -0.0111 -0.0187 63   PHE A C     
468  O O     . PHE A 63  ? 0.1966 0.2546 0.2287 -0.0255 -0.0377 0.0063  63   PHE A O     
469  C CB    . PHE A 63  ? 0.1935 0.1810 0.1906 0.0446  0.0186  -0.0236 63   PHE A CB    
470  C CG    . PHE A 63  ? 0.1982 0.1492 0.1913 0.0284  0.0206  -0.0300 63   PHE A CG    
471  C CD1   . PHE A 63  ? 0.2268 0.1851 0.2042 0.0269  0.0306  -0.0087 63   PHE A CD1   
472  C CD2   . PHE A 63  ? 0.2045 0.2195 0.2471 0.0009  0.0158  -0.0648 63   PHE A CD2   
473  C CE1   . PHE A 63  ? 0.1988 0.2085 0.2052 0.0161  0.0300  0.0012  63   PHE A CE1   
474  C CE2   . PHE A 63  ? 0.1698 0.2339 0.2543 0.0007  0.0238  -0.0599 63   PHE A CE2   
475  C CZ    . PHE A 63  ? 0.1811 0.2268 0.2508 0.0360  0.0377  -0.0493 63   PHE A CZ    
476  N N     . LYS A 64  ? 0.1721 0.2226 0.2010 0.0314  -0.0072 -0.0052 64   LYS A N     
477  C CA    . LYS A 64  ? 0.2316 0.2334 0.1985 0.0698  -0.0065 0.0098  64   LYS A CA    
478  C C     . LYS A 64  ? 0.2478 0.2428 0.1685 0.0749  -0.0383 0.0118  64   LYS A C     
479  O O     . LYS A 64  ? 0.2961 0.3426 0.2612 0.0759  -0.0929 -0.0537 64   LYS A O     
480  C CB    . LYS A 64  ? 0.2201 0.2576 0.2347 0.0594  -0.0103 0.0345  64   LYS A CB    
481  C CG    . LYS A 64  ? 0.2948 0.4080 0.2049 0.1002  0.0177  0.0483  64   LYS A CG    
482  C CD    . LYS A 64  ? 0.3777 0.5145 0.2800 0.0935  0.0501  0.1417  64   LYS A CD    
483  C CE    . LYS A 64  ? 0.6410 0.6451 0.2896 -0.0724 -0.0033 0.1685  64   LYS A CE    
484  N NZ    . LYS A 64  ? 0.3526 1.0068 0.4522 0.1531  -0.0396 -0.1327 64   LYS A NZ    
485  N N     . ASP A 65  ? 0.2243 0.1812 0.1880 0.0428  0.0063  0.0244  65   ASP A N     
486  C CA    . ASP A 65  ? 0.3711 0.2398 0.1809 0.1094  0.0435  0.0161  65   ASP A CA    
487  C C     . ASP A 65  ? 0.2812 0.2075 0.2216 0.0905  -0.0495 -0.0137 65   ASP A C     
488  O O     . ASP A 65  ? 0.4132 0.2511 0.2384 0.0378  -0.0834 -0.0292 65   ASP A O     
489  C CB    . ASP A 65  ? 0.3883 0.3003 0.2949 0.1616  0.1243  0.0719  65   ASP A CB    
490  C CG    . ASP A 65  ? 0.4414 0.3913 0.3278 0.0615  0.0234  0.1556  65   ASP A CG    
491  O OD1   . ASP A 65  ? 0.5155 0.4433 0.2276 0.2022  0.0584  0.0966  65   ASP A OD1   
492  O OD2   . ASP A 65  ? 0.9212 0.4703 0.1877 -0.1901 -0.0658 -0.0098 65   ASP A OD2   
493  N N     . VAL A 66  ? 0.1844 0.1914 0.2044 0.0337  -0.0187 0.0120  66   VAL A N     
494  C CA    . VAL A 66  ? 0.1865 0.1782 0.1811 0.0228  -0.0071 -0.0013 66   VAL A CA    
495  C C     . VAL A 66  ? 0.1863 0.1700 0.1836 0.0027  -0.0006 -0.0412 66   VAL A C     
496  O O     . VAL A 66  ? 0.2125 0.1543 0.2182 0.0154  -0.0171 -0.0081 66   VAL A O     
497  C CB    . VAL A 66  ? 0.1707 0.2392 0.2137 0.0225  -0.0210 0.0226  66   VAL A CB    
498  C CG1   . VAL A 66  ? 0.1963 0.2350 0.2336 0.0293  -0.0374 0.0180  66   VAL A CG1   
499  C CG2   . VAL A 66  ? 0.2122 0.2609 0.2388 -0.0052 0.0232  -0.0130 66   VAL A CG2   
500  N N     . ALA A 67  ? 0.1823 0.1636 0.1693 -0.0055 -0.0034 -0.0361 67   ALA A N     
501  C CA    . ALA A 67  ? 0.1435 0.1745 0.1720 0.0058  -0.0192 -0.0186 67   ALA A CA    
502  C C     . ALA A 67  ? 0.1600 0.1311 0.1860 0.0057  -0.0346 -0.0229 67   ALA A C     
503  O O     . ALA A 67  ? 0.1679 0.1490 0.1774 0.0062  -0.0213 -0.0202 67   ALA A O     
504  C CB    . ALA A 67  ? 0.1987 0.1627 0.1682 0.0100  -0.0405 -0.0078 67   ALA A CB    
505  N N     . PRO A 68  ? 0.1794 0.1775 0.1938 0.0333  -0.0405 -0.0398 68   PRO A N     
506  C CA    . PRO A 68  ? 0.1773 0.1507 0.1706 0.0078  -0.0496 -0.0036 68   PRO A CA    
507  C C     . PRO A 68  ? 0.1614 0.1300 0.1978 0.0118  -0.0446 -0.0109 68   PRO A C     
508  O O     . PRO A 68  ? 0.1969 0.1646 0.1876 0.0510  -0.0517 -0.0074 68   PRO A O     
509  C CB    . PRO A 68  ? 0.2347 0.2193 0.1884 0.0330  -0.0628 -0.0446 68   PRO A CB    
510  C CG    . PRO A 68  ? 0.2441 0.2256 0.2032 0.0430  -0.0654 -0.0587 68   PRO A CG    
511  C CD    . PRO A 68  ? 0.2341 0.1784 0.1844 0.0226  -0.0428 -0.0420 68   PRO A CD    
512  N N     . CYS A 69  ? 0.1799 0.1420 0.1918 0.0011  -0.0513 0.0050  69   CYS A N     
513  C CA    . CYS A 69  ? 0.1643 0.1529 0.1887 -0.0053 -0.0576 0.0027  69   CYS A CA    
514  C C     . CYS A 69  ? 0.1133 0.1737 0.2109 0.0270  -0.0583 -0.0153 69   CYS A C     
515  O O     . CYS A 69  ? 0.1398 0.1980 0.2521 0.0098  -0.0231 -0.0259 69   CYS A O     
516  C CB    . CYS A 69  ? 0.1767 0.1543 0.2083 -0.0013 -0.0576 0.0167  69   CYS A CB    
517  S SG    . CYS A 69  ? 0.1743 0.1716 0.2412 0.0133  -0.0448 0.0255  69   CYS A SG    
518  N N     . THR A 70  ? 0.1303 0.1493 0.1831 0.0120  -0.0492 -0.0147 70   THR A N     
519  C CA    . THR A 70  ? 0.1548 0.1439 0.1636 0.0328  -0.0445 -0.0064 70   THR A CA    
520  C C     . THR A 70  ? 0.1579 0.1405 0.1670 0.0249  -0.0062 0.0021  70   THR A C     
521  O O     . THR A 70  ? 0.1903 0.1548 0.1650 0.0287  -0.0160 -0.0075 70   THR A O     
522  C CB    . THR A 70  ? 0.1666 0.1441 0.1465 0.0138  -0.0455 0.0000  70   THR A CB    
523  O OG1   . THR A 70  ? 0.1678 0.1561 0.1711 0.0071  -0.0355 0.0032  70   THR A OG1   
524  C CG2   . THR A 70  ? 0.1628 0.1712 0.2090 0.0411  -0.0190 0.0393  70   THR A CG2   
525  N N     . ASP A 71  ? 0.1513 0.1473 0.1701 0.0310  -0.0254 0.0112  71   ASP A N     
526  C CA    . ASP A 71  ? 0.1612 0.1621 0.1593 0.0527  -0.0114 0.0006  71   ASP A CA    
527  C C     . ASP A 71  ? 0.1526 0.1682 0.1804 0.0364  -0.0319 -0.0136 71   ASP A C     
528  O O     . ASP A 71  ? 0.1713 0.2012 0.2101 0.0182  -0.0524 -0.0132 71   ASP A O     
529  C CB    . ASP A 71  ? 0.2036 0.1777 0.1722 0.0448  -0.0149 0.0386  71   ASP A CB    
530  C CG    . ASP A 71  ? 0.1679 0.1903 0.2116 0.0572  -0.0223 0.0430  71   ASP A CG    
531  O OD1   . ASP A 71  ? 0.1986 0.1994 0.2638 0.0695  -0.0331 0.0108  71   ASP A OD1   
532  O OD2   . ASP A 71  ? 0.3267 0.2344 0.2058 0.0868  -0.0439 0.0631  71   ASP A OD2   
533  N N     . SER A 72  ? 0.1621 0.1831 0.1763 0.0353  -0.0072 -0.0110 72   SER A N     
534  C CA    . SER A 72  ? 0.1542 0.1728 0.2145 0.0102  -0.0060 -0.0157 72   SER A CA    
535  C C     . SER A 72  ? 0.1308 0.1797 0.2063 0.0477  -0.0158 -0.0149 72   SER A C     
536  O O     . SER A 72  ? 0.1420 0.2109 0.2070 0.0339  -0.0220 -0.0302 72   SER A O     
537  C CB    . SER A 72  ? 0.1986 0.1812 0.2650 -0.0056 -0.0222 0.0152  72   SER A CB    
538  O OG    . SER A 72  ? 0.2843 0.2560 0.3266 0.0244  -0.0799 0.0345  72   SER A OG    
539  N N     . PRO A 73  ? 0.1478 0.2148 0.1961 0.0630  -0.0223 -0.0047 73   PRO A N     
540  C CA    . PRO A 73  ? 0.1671 0.2301 0.1975 0.0875  -0.0084 -0.0142 73   PRO A CA    
541  C C     . PRO A 73  ? 0.1807 0.2545 0.1695 0.0744  0.0019  -0.0118 73   PRO A C     
542  O O     . PRO A 73  ? 0.2439 0.3035 0.1983 0.0726  -0.0320 -0.0376 73   PRO A O     
543  C CB    . PRO A 73  ? 0.1524 0.3280 0.2854 0.0840  -0.0199 -0.0663 73   PRO A CB    
544  C CG    . PRO A 73  ? 0.1636 0.3680 0.2962 0.0980  -0.0335 -0.0993 73   PRO A CG    
545  C CD    . PRO A 73  ? 0.1312 0.3084 0.2677 0.0660  -0.0117 -0.0488 73   PRO A CD    
546  N N     . GLU A 74  ? 0.1732 0.2665 0.2180 0.0619  0.0145  0.0306  74   GLU A N     
547  C CA    . GLU A 74  ? 0.1521 0.3619 0.2793 0.0252  0.0250  0.1188  74   GLU A CA    
548  C C     . GLU A 74  ? 0.1533 0.3362 0.2044 0.0484  0.0143  0.0451  74   GLU A C     
549  O O     . GLU A 74  ? 0.2151 0.5641 0.2710 0.1277  0.0202  0.1642  74   GLU A O     
550  C CB    . GLU A 74  ? 0.2615 0.4103 0.3707 -0.0633 0.0420  0.1897  74   GLU A CB    
551  C CG    . GLU A 74  ? 0.2754 0.4974 0.5216 -0.0938 0.0716  0.1575  74   GLU A CG    
552  C CD    . GLU A 74  ? 0.2258 0.5752 0.5417 -0.0213 0.0502  0.0587  74   GLU A CD    
553  O OE1   . GLU A 74  ? 0.1894 1.0031 0.7806 -0.0131 0.0915  0.0999  74   GLU A OE1   
554  O OE2   . GLU A 74  ? 0.3149 0.4606 0.4977 -0.0982 0.0030  -0.0176 74   GLU A OE2   
555  N N     . PHE A 75  ? 0.1540 0.2511 0.2055 0.0370  0.0181  -0.0041 75   PHE A N     
556  C CA    . PHE A 75  ? 0.1479 0.1628 0.1780 0.0189  -0.0092 0.0057  75   PHE A CA    
557  C C     . PHE A 75  ? 0.1673 0.1551 0.1542 0.0101  -0.0347 0.0030  75   PHE A C     
558  O O     . PHE A 75  ? 0.1671 0.1834 0.1637 -0.0024 -0.0249 -0.0067 75   PHE A O     
559  C CB    . PHE A 75  ? 0.1474 0.1515 0.1818 0.0049  -0.0173 0.0042  75   PHE A CB    
560  C CG    . PHE A 75  ? 0.1502 0.1683 0.1590 0.0063  -0.0222 0.0062  75   PHE A CG    
561  C CD1   . PHE A 75  ? 0.1345 0.2096 0.2162 0.0061  0.0001  0.0238  75   PHE A CD1   
562  C CD2   . PHE A 75  ? 0.1936 0.1657 0.1800 0.0321  -0.0555 0.0027  75   PHE A CD2   
563  C CE1   . PHE A 75  ? 0.1502 0.2141 0.2578 0.0443  -0.0148 -0.0081 75   PHE A CE1   
564  C CE2   . PHE A 75  ? 0.1914 0.2107 0.2256 0.0377  -0.0663 0.0011  75   PHE A CE2   
565  C CZ    . PHE A 75  ? 0.1955 0.2148 0.1765 0.0388  -0.0194 0.0046  75   PHE A CZ    
566  N N     . TYR A 76  ? 0.1559 0.1541 0.1628 0.0225  -0.0236 0.0118  76   TYR A N     
567  C CA    . TYR A 76  ? 0.1771 0.1407 0.1524 0.0301  -0.0225 -0.0027 76   TYR A CA    
568  C C     . TYR A 76  ? 0.1347 0.1454 0.2094 0.0323  -0.0265 -0.0141 76   TYR A C     
569  O O     . TYR A 76  ? 0.1821 0.1529 0.2061 0.0104  -0.0238 -0.0151 76   TYR A O     
570  C CB    . TYR A 76  ? 0.1838 0.2008 0.1431 0.0074  -0.0229 0.0151  76   TYR A CB    
571  C CG    . TYR A 76  ? 0.2121 0.2124 0.1679 0.0257  -0.0010 0.0208  76   TYR A CG    
572  C CD1   . TYR A 76  ? 0.2495 0.1665 0.2238 -0.0111 0.0377  -0.0173 76   TYR A CD1   
573  C CD2   . TYR A 76  ? 0.2960 0.2531 0.1964 0.0571  -0.0244 0.0663  76   TYR A CD2   
574  C CE1   . TYR A 76  ? 0.2502 0.2820 0.2876 0.0129  0.0561  0.0688  76   TYR A CE1   
575  C CE2   . TYR A 76  ? 0.3059 0.3271 0.2713 0.0504  0.0001  0.1300  76   TYR A CE2   
576  C CZ    . TYR A 76  ? 0.2727 0.3606 0.3341 0.0498  0.0441  0.1336  76   TYR A CZ    
577  O OH    . TYR A 76  ? 0.3712 0.3954 0.3819 0.0237  0.0690  0.1692  76   TYR A OH    
578  N N     . GLY A 77  ? 0.1400 0.1769 0.1936 0.0551  -0.0341 -0.0078 77   GLY A N     
579  C CA    . GLY A 77  ? 0.1883 0.2256 0.1963 0.0888  -0.0265 -0.0291 77   GLY A CA    
580  C C     . GLY A 77  ? 0.1740 0.1926 0.2171 0.0630  -0.0438 -0.0364 77   GLY A C     
581  O O     . GLY A 77  ? 0.2288 0.2076 0.2870 0.0553  -0.0102 -0.0678 77   GLY A O     
582  N N     . LYS A 78  ? 0.1600 0.2432 0.1718 0.0418  0.0053  -0.0194 78   LYS A N     
583  C CA    . LYS A 78  ? 0.1623 0.2554 0.1635 0.0011  0.0222  0.0032  78   LYS A CA    
584  C C     . LYS A 78  ? 0.1639 0.2051 0.1592 0.0104  0.0266  -0.0378 78   LYS A C     
585  O O     . LYS A 78  ? 0.1993 0.2441 0.1817 -0.0076 0.0212  -0.0614 78   LYS A O     
586  C CB    . LYS A 78  ? 0.2104 0.3149 0.2148 0.0010  0.0363  0.0737  78   LYS A CB    
587  C CG    . LYS A 78  ? 0.2671 0.4008 0.3976 -0.0437 0.0618  0.1641  78   LYS A CG    
588  C CD    . LYS A 78  ? 0.3536 0.3459 0.4471 -0.0373 0.0886  0.1753  78   LYS A CD    
589  C CE    . LYS A 78  ? 0.4490 0.4776 0.5124 -0.0962 0.2186  0.1310  78   LYS A CE    
590  N NZ    . LYS A 78  ? 0.5104 0.3948 0.5283 -0.0709 0.2619  0.0929  78   LYS A NZ    
591  N N     . PHE A 79  ? 0.1654 0.1759 0.1466 -0.0014 0.0262  -0.0273 79   PHE A N     
592  C CA    . PHE A 79  ? 0.1500 0.1726 0.1463 0.0223  0.0126  -0.0301 79   PHE A CA    
593  C C     . PHE A 79  ? 0.1416 0.1782 0.1914 -0.0110 -0.0134 -0.0169 79   PHE A C     
594  O O     . PHE A 79  ? 0.1698 0.2193 0.2104 -0.0281 0.0021  -0.0605 79   PHE A O     
595  C CB    . PHE A 79  ? 0.1580 0.2025 0.1393 -0.0173 0.0282  -0.0461 79   PHE A CB    
596  C CG    . PHE A 79  ? 0.1662 0.2146 0.1610 -0.0238 0.0272  -0.0576 79   PHE A CG    
597  C CD1   . PHE A 79  ? 0.1584 0.3144 0.2306 -0.0313 -0.0079 -0.0769 79   PHE A CD1   
598  C CD2   . PHE A 79  ? 0.2453 0.2096 0.1650 -0.0503 0.0827  -0.0649 79   PHE A CD2   
599  C CE1   . PHE A 79  ? 0.1680 0.3530 0.3415 -0.0672 0.0221  -0.0940 79   PHE A CE1   
600  C CE2   . PHE A 79  ? 0.2686 0.2220 0.2930 -0.0442 0.1436  -0.0786 79   PHE A CE2   
601  C CZ    . PHE A 79  ? 0.2451 0.2548 0.3383 -0.0860 0.0851  -0.1418 79   PHE A CZ    
602  N N     . LYS A 80  ? 0.1676 0.1699 0.1911 0.0098  -0.0006 -0.0070 80   LYS A N     
603  C CA    . LYS A 80  ? 0.3406 0.1603 0.1894 0.0150  -0.0038 -0.0154 80   LYS A CA    
604  C C     . LYS A 80  ? 0.2893 0.1782 0.2468 0.0348  0.0096  -0.0383 80   LYS A C     
605  O O     . LYS A 80  ? 0.3083 0.1848 0.2453 0.0265  -0.0186 -0.0526 80   LYS A O     
606  C CB    . LYS A 80  ? 0.4375 0.2408 0.2504 0.0578  -0.0795 0.0129  80   LYS A CB    
607  C CG    . LYS A 80  ? 0.4068 0.3437 0.4390 0.0740  -0.1309 -0.0777 80   LYS A CG    
608  C CD    . LYS A 80  ? 0.4764 0.3883 0.6134 0.1497  -0.1832 -0.0472 80   LYS A CD    
609  C CE    . LYS A 80  ? 0.4618 0.5270 0.6928 0.1729  -0.3149 -0.1675 80   LYS A CE    
610  N NZ    . LYS A 80  ? 0.6692 0.7604 0.6118 0.2568  -0.0496 -0.1354 80   LYS A NZ    
611  N N     . GLU A 81  ? 0.2186 0.1859 0.2279 0.0674  -0.0296 -0.0512 81   GLU A N     
612  C CA    . GLU A 81  ? 0.2324 0.2328 0.2509 0.0764  -0.0083 -0.0693 81   GLU A CA    
613  C C     . GLU A 81  ? 0.2383 0.1861 0.2097 0.0349  0.0088  -0.0523 81   GLU A C     
614  O O     . GLU A 81  ? 0.2925 0.2008 0.2573 0.0196  0.0324  -0.0806 81   GLU A O     
615  C CB    . GLU A 81  ? 0.2090 0.3512 0.3092 0.0631  0.0248  -0.0614 81   GLU A CB    
616  C CG    . GLU A 81  ? 0.2404 0.5214 0.4888 0.0102  -0.0357 -0.1286 81   GLU A CG    
617  C CD    . GLU A 81  ? 0.2472 0.6530 0.5110 -0.0453 0.0459  -0.1695 81   GLU A CD    
618  O OE1   . GLU A 81  ? 0.4839 0.7068 0.4811 -0.0958 0.0828  -0.1117 81   GLU A OE1   
619  O OE2   . GLU A 81  ? 0.3554 1.0701 0.5474 -0.2505 0.0330  -0.2702 81   GLU A OE2   
620  N N     . GLY A 82  ? 0.2033 0.1978 0.1922 0.0253  0.0071  -0.0290 82   GLY A N     
621  C CA    . GLY A 82  ? 0.2081 0.2144 0.2341 -0.0030 -0.0045 -0.0210 82   GLY A CA    
622  C C     . GLY A 82  ? 0.2101 0.1822 0.2194 0.0032  0.0098  -0.0640 82   GLY A C     
623  O O     . GLY A 82  ? 0.2582 0.2302 0.2819 -0.0428 -0.0077 -0.0937 82   GLY A O     
624  N N     . VAL A 83  ? 0.2188 0.1987 0.2287 0.0155  0.0284  -0.0558 83   VAL A N     
625  C CA    . VAL A 83  ? 0.2485 0.1827 0.2448 0.0133  0.0438  -0.0612 83   VAL A CA    
626  C C     . VAL A 83  ? 0.2515 0.1866 0.2847 -0.0042 0.0361  -0.0812 83   VAL A C     
627  O O     . VAL A 83  ? 0.3427 0.2323 0.3512 -0.0734 0.0131  -0.0819 83   VAL A O     
628  C CB    . VAL A 83  ? 0.2623 0.1797 0.2494 -0.0578 0.0528  -0.0728 83   VAL A CB    
629  C CG1   . VAL A 83  ? 0.3898 0.2801 0.2827 -0.1365 0.0615  -0.0125 83   VAL A CG1   
630  C CG2   . VAL A 83  ? 0.2694 0.1816 0.3718 -0.0552 0.0684  -0.1307 83   VAL A CG2   
631  N N     . ALA A 84  ? 0.2891 0.1800 0.2487 0.0421  0.0373  -0.0459 84   ALA A N     
632  C CA    . ALA A 84  ? 0.3967 0.1731 0.2114 0.0450  -0.0096 -0.0146 84   ALA A CA    
633  C C     . ALA A 84  ? 0.3722 0.1707 0.2278 -0.0019 0.0137  -0.0478 84   ALA A C     
634  O O     . ALA A 84  ? 0.5773 0.1803 0.3012 -0.0431 0.0254  -0.0612 84   ALA A O     
635  C CB    . ALA A 84  ? 0.4798 0.2177 0.3111 0.1365  -0.1106 -0.0416 84   ALA A CB    
636  N N     . SER A 85  ? 0.2884 0.2132 0.2217 0.0214  0.0350  -0.0418 85   SER A N     
637  C CA    . SER A 85  ? 0.2725 0.2732 0.2385 0.0002  0.0599  -0.0629 85   SER A CA    
638  C C     . SER A 85  ? 0.3045 0.1661 0.2372 0.0133  0.0256  -0.0715 85   SER A C     
639  O O     . SER A 85  ? 0.3614 0.2771 0.2695 -0.0418 0.0394  -0.1232 85   SER A O     
640  C CB    . SER A 85  ? 0.3427 0.2387 0.2861 -0.0376 0.1206  -0.1097 85   SER A CB    
641  O OG    . SER A 85  ? 0.3177 0.2596 0.2730 -0.0397 0.0504  -0.0959 85   SER A OG    
642  N N     . GLY A 86  ? 0.3172 0.1695 0.2657 0.0322  0.0421  -0.0301 86   GLY A N     
643  C CA    . GLY A 86  ? 0.2885 0.1655 0.3282 -0.0064 0.0555  -0.0003 86   GLY A CA    
644  C C     . GLY A 86  ? 0.2698 0.1833 0.2829 0.0242  0.0452  -0.0163 86   GLY A C     
645  O O     . GLY A 86  ? 0.3392 0.3237 0.3649 0.0538  -0.0399 -0.0215 86   GLY A O     
646  N N     . ASN A 87  ? 0.3802 0.1775 0.2029 -0.0707 0.0406  -0.0468 87   ASN A N     
647  C CA    . ASN A 87  ? 0.3865 0.1475 0.2264 0.0142  0.0500  -0.0341 87   ASN A CA    
648  C C     . ASN A 87  ? 0.3511 0.1514 0.4625 -0.0346 0.1631  -0.0796 87   ASN A C     
649  O O     . ASN A 87  ? 0.3956 0.3499 1.2421 -0.1217 0.3276  -0.3020 87   ASN A O     
650  C CB    . ASN A 87  ? 0.5023 0.2472 0.2611 0.0355  0.1355  -0.0198 87   ASN A CB    
651  C CG    . ASN A 87  ? 0.5961 0.3192 0.2903 0.1005  0.1820  0.0434  87   ASN A CG    
652  O OD1   . ASN A 87  ? 0.3383 0.6359 0.2609 0.1245  0.0901  -0.0195 87   ASN A OD1   
653  N ND2   . ASN A 87  ? 0.9160 0.3701 0.4237 0.2424  0.0394  -0.0006 87   ASN A ND2   
654  N N     . LEU A 88  ? 0.3193 0.1589 0.2566 0.0452  -0.0228 -0.0651 88   LEU A N     
655  C CA    . LEU A 88  ? 0.2598 0.1609 0.2010 0.0092  -0.0066 -0.0301 88   LEU A CA    
656  C C     . LEU A 88  ? 0.2786 0.1677 0.1910 -0.0016 -0.0275 -0.0367 88   LEU A C     
657  O O     . LEU A 88  ? 0.2854 0.1924 0.1951 0.0291  -0.0234 -0.0310 88   LEU A O     
658  C CB    . LEU A 88  ? 0.2448 0.1783 0.1912 -0.0353 -0.0087 -0.0430 88   LEU A CB    
659  C CG    . LEU A 88  ? 0.2180 0.1430 0.2159 -0.0062 -0.0075 -0.0384 88   LEU A CG    
660  C CD1   . LEU A 88  ? 0.2497 0.2244 0.2633 -0.0356 -0.0687 -0.0215 88   LEU A CD1   
661  C CD2   . LEU A 88  ? 0.3486 0.1828 0.2028 0.0203  0.0132  -0.0345 88   LEU A CD2   
662  N N     . ASN A 89  ? 0.2904 0.1542 0.1926 0.0077  -0.0221 -0.0272 89   ASN A N     
663  C CA    . ASN A 89  ? 0.2890 0.1767 0.1974 0.0066  -0.0510 -0.0162 89   ASN A CA    
664  C C     . ASN A 89  ? 0.3166 0.1723 0.2233 0.0059  0.0367  -0.0311 89   ASN A C     
665  O O     . ASN A 89  ? 0.3586 0.3105 0.2457 0.0438  0.0495  -0.0785 89   ASN A O     
666  C CB    . ASN A 89  ? 0.4555 0.2192 0.1624 -0.0356 -0.0391 -0.0215 89   ASN A CB    
667  C CG    . ASN A 89  ? 0.3605 0.2453 0.1729 0.0076  -0.0495 -0.0263 89   ASN A CG    
668  O OD1   . ASN A 89  ? 0.3951 0.2699 0.2505 0.0804  -0.0540 -0.0452 89   ASN A OD1   
669  N ND2   . ASN A 89  ? 0.4322 0.3832 0.1767 0.0332  -0.0857 -0.0396 89   ASN A ND2   
670  N N     . THR A 90  ? 0.2520 0.1661 0.2300 0.0190  0.0023  -0.0318 90   THR A N     
671  C CA    . THR A 90  ? 0.2414 0.1856 0.2206 0.0348  0.0246  -0.0057 90   THR A CA    
672  C C     . THR A 90  ? 0.1854 0.2012 0.1900 -0.0028 0.0139  -0.0321 90   THR A C     
673  O O     . THR A 90  ? 0.2413 0.1701 0.2114 0.0012  0.0534  -0.0030 90   THR A O     
674  C CB    . THR A 90  ? 0.2314 0.2865 0.2979 0.0492  0.0144  0.0429  90   THR A CB    
675  O OG1   . THR A 90  ? 0.2201 0.3927 0.5359 0.0358  0.0140  0.0534  90   THR A OG1   
676  C CG2   . THR A 90  ? 0.3918 0.2347 0.2625 0.0300  -0.0368 0.0294  90   THR A CG2   
677  N N     . MET A 91  ? 0.1788 0.2226 0.2603 -0.0275 0.0394  -0.0469 91   MET A N     
678  C CA    . MET A 91  ? 0.2215 0.2132 0.2131 -0.0221 0.0106  -0.0255 91   MET A CA    
679  C C     . MET A 91  ? 0.2352 0.2365 0.2249 -0.0491 0.0590  -0.0400 91   MET A C     
680  O O     . MET A 91  ? 0.2284 0.3212 0.2912 -0.0465 0.0717  -0.0671 91   MET A O     
681  C CB    . MET A 91  ? 0.4111 0.2768 0.2101 -0.1159 -0.0280 0.0456  91   MET A CB    
682  C CG    . MET A 91  ? 0.5694 0.2828 0.3813 -0.0450 -0.1491 0.0961  91   MET A CG    
683  S SD    . MET A 91  ? 0.4261 0.6460 0.3472 0.1027  -0.0025 0.1791  91   MET A SD    
684  C CE    . MET A 91  ? 0.4618 0.7405 0.2329 0.0564  -0.0400 0.1098  91   MET A CE    
685  N N     . PHE A 92  ? 0.1933 0.1865 0.1751 -0.0226 0.0045  0.0227  92   PHE A N     
686  C CA    . PHE A 92  ? 0.1804 0.1689 0.2280 -0.0058 0.0158  0.0174  92   PHE A CA    
687  C C     . PHE A 92  ? 0.1419 0.1826 0.2191 -0.0041 0.0192  0.0124  92   PHE A C     
688  O O     . PHE A 92  ? 0.1441 0.2181 0.3232 -0.0045 0.0423  -0.0154 92   PHE A O     
689  C CB    . PHE A 92  ? 0.1676 0.1997 0.2546 0.0234  0.0229  0.0263  92   PHE A CB    
690  C CG    . PHE A 92  ? 0.1759 0.2001 0.2366 0.0147  -0.0013 0.0385  92   PHE A CG    
691  C CD1   . PHE A 92  ? 0.2680 0.2002 0.2201 -0.0255 0.0305  0.0104  92   PHE A CD1   
692  C CD2   . PHE A 92  ? 0.1892 0.2296 0.2418 -0.0337 -0.0064 0.0195  92   PHE A CD2   
693  C CE1   . PHE A 92  ? 0.3022 0.3195 0.1882 -0.1029 -0.0128 0.0367  92   PHE A CE1   
694  C CE2   . PHE A 92  ? 0.2162 0.1971 0.2340 0.0025  -0.0076 0.0308  92   PHE A CE2   
695  C CZ    . PHE A 92  ? 0.2619 0.2823 0.2100 -0.0681 0.0175  0.0194  92   PHE A CZ    
696  N N     . GLU A 93  ? 0.1685 0.2059 0.2079 -0.0445 0.0069  0.0143  93   GLU A N     
697  C CA    . GLU A 93  ? 0.2066 0.2146 0.2020 -0.0308 0.0021  0.0139  93   GLU A CA    
698  C C     . GLU A 93  ? 0.1309 0.2190 0.2144 -0.0245 0.0020  0.0006  93   GLU A C     
699  O O     . GLU A 93  ? 0.1977 0.2572 0.2401 0.0336  0.0103  0.0173  93   GLU A O     
700  C CB    . GLU A 93  ? 0.3415 0.1954 0.3215 -0.0552 -0.0083 0.0761  93   GLU A CB    
701  C CG    . GLU A 93  ? 0.4962 0.3159 0.3385 -0.0085 -0.0098 0.1400  93   GLU A CG    
702  C CD    . GLU A 93  ? 0.8377 0.4969 0.4535 -0.1743 -0.0049 0.2745  93   GLU A CD    
703  O OE1   . GLU A 93  ? 1.0073 0.8073 0.7198 -0.5030 -0.1028 0.4435  93   GLU A OE1   
704  O OE2   . GLU A 93  ? 1.3143 0.8140 0.7086 -0.3236 -0.2366 0.5674  93   GLU A OE2   
705  N N     . TYR A 94  ? 0.1555 0.1914 0.1909 -0.0250 0.0011  0.0170  94   TYR A N     
706  C CA    . TYR A 94  ? 0.2106 0.1539 0.2037 -0.0206 -0.0264 0.0165  94   TYR A CA    
707  C C     . TYR A 94  ? 0.1408 0.1455 0.2068 -0.0087 -0.0232 0.0212  94   TYR A C     
708  O O     . TYR A 94  ? 0.2413 0.1778 0.2692 0.0237  -0.0760 0.0143  94   TYR A O     
709  C CB    . TYR A 94  ? 0.1895 0.1458 0.2070 0.0063  -0.0355 0.0481  94   TYR A CB    
710  C CG    . TYR A 94  ? 0.1507 0.1680 0.2076 0.0217  -0.0094 0.0425  94   TYR A CG    
711  C CD1   . TYR A 94  ? 0.1485 0.1753 0.2296 0.0245  -0.0202 0.0351  94   TYR A CD1   
712  C CD2   . TYR A 94  ? 0.1578 0.1762 0.1942 -0.0091 -0.0106 0.0428  94   TYR A CD2   
713  C CE1   . TYR A 94  ? 0.1828 0.1859 0.2221 0.0400  -0.0486 0.0190  94   TYR A CE1   
714  C CE2   . TYR A 94  ? 0.1942 0.1746 0.2095 0.0082  -0.0364 0.0217  94   TYR A CE2   
715  C CZ    . TYR A 94  ? 0.1785 0.1704 0.2262 -0.0008 -0.0472 0.0232  94   TYR A CZ    
716  O OH    . TYR A 94  ? 0.2076 0.2374 0.2212 0.0467  -0.0148 0.0569  94   TYR A OH    
717  N N     . THR A 95  ? 0.1709 0.1900 0.2217 -0.0106 -0.0384 -0.0010 95   THR A N     
718  C CA    . THR A 95  ? 0.1504 0.1864 0.2357 -0.0176 -0.0192 -0.0097 95   THR A CA    
719  C C     . THR A 95  ? 0.1612 0.1488 0.2340 0.0108  -0.0202 0.0089  95   THR A C     
720  O O     . THR A 95  ? 0.1923 0.1938 0.2619 0.0526  -0.0276 0.0169  95   THR A O     
721  C CB    . THR A 95  ? 0.1684 0.2164 0.3109 -0.0402 0.0090  -0.0435 95   THR A CB    
722  O OG1   . THR A 95  ? 0.2259 0.3265 0.3645 -0.0751 0.0188  0.0242  95   THR A OG1   
723  C CG2   . THR A 95  ? 0.2885 0.1778 0.4044 -0.0380 -0.0314 -0.0663 95   THR A CG2   
724  N N     . PHE A 96  ? 0.1761 0.1335 0.1927 0.0211  -0.0366 -0.0097 96   PHE A N     
725  C CA    . PHE A 96  ? 0.1880 0.1615 0.1916 0.0073  -0.0318 -0.0217 96   PHE A CA    
726  C C     . PHE A 96  ? 0.2386 0.1359 0.1910 0.0117  -0.0412 -0.0103 96   PHE A C     
727  O O     . PHE A 96  ? 0.3018 0.1338 0.2497 0.0005  -0.0634 0.0019  96   PHE A O     
728  C CB    . PHE A 96  ? 0.1822 0.1606 0.2399 0.0062  -0.0251 0.0001  96   PHE A CB    
729  C CG    . PHE A 96  ? 0.1847 0.1765 0.1747 0.0024  -0.0259 0.0143  96   PHE A CG    
730  C CD1   . PHE A 96  ? 0.2096 0.1395 0.2117 -0.0272 -0.0340 0.0075  96   PHE A CD1   
731  C CD2   . PHE A 96  ? 0.1742 0.2144 0.1997 -0.0240 -0.0113 0.0422  96   PHE A CD2   
732  C CE1   . PHE A 96  ? 0.2247 0.1676 0.2022 -0.0419 -0.0513 0.0230  96   PHE A CE1   
733  C CE2   . PHE A 96  ? 0.1899 0.2429 0.2093 -0.0382 -0.0209 0.0332  96   PHE A CE2   
734  C CZ    . PHE A 96  ? 0.2098 0.2257 0.1974 -0.0491 -0.0384 0.0284  96   PHE A CZ    
735  N N     . ASP A 97  ? 0.2295 0.1780 0.2133 0.0194  -0.0756 -0.0151 97   ASP A N     
736  C CA    . ASP A 97  ? 0.2382 0.1883 0.2392 0.0133  -0.0846 -0.0333 97   ASP A CA    
737  C C     . ASP A 97  ? 0.3007 0.1726 0.2280 0.0071  -0.1009 -0.0199 97   ASP A C     
738  O O     . ASP A 97  ? 0.4437 0.2375 0.2575 -0.0775 -0.1222 -0.0464 97   ASP A O     
739  C CB    . ASP A 97  ? 0.2424 0.2348 0.2903 0.0084  -0.0885 -0.0374 97   ASP A CB    
740  C CG    . ASP A 97  ? 0.2403 0.2815 0.3139 0.0400  -0.0668 0.0200  97   ASP A CG    
741  O OD1   . ASP A 97  ? 0.2482 0.2531 0.3061 0.0457  -0.0820 -0.0174 97   ASP A OD1   
742  O OD2   . ASP A 97  ? 0.2383 0.3740 0.8148 0.0092  -0.1553 0.0924  97   ASP A OD2   
743  N N     . TYR A 98  ? 0.2239 0.1830 0.2263 0.0593  -0.0609 -0.0464 98   TYR A N     
744  C CA    . TYR A 98  ? 0.2617 0.1658 0.2342 0.0373  -0.0208 -0.0780 98   TYR A CA    
745  C C     . TYR A 98  ? 0.3099 0.1456 0.2258 0.0729  -0.0448 -0.0538 98   TYR A C     
746  O O     . TYR A 98  ? 0.2817 0.1823 0.2536 0.0616  -0.0098 -0.0266 98   TYR A O     
747  C CB    . TYR A 98  ? 0.2861 0.1521 0.2533 0.0607  -0.0578 -0.0520 98   TYR A CB    
748  C CG    . TYR A 98  ? 0.2437 0.1696 0.2619 0.0717  -0.0481 -0.0464 98   TYR A CG    
749  C CD1   . TYR A 98  ? 0.2666 0.1759 0.2730 0.0237  -0.0733 0.0038  98   TYR A CD1   
750  C CD2   . TYR A 98  ? 0.2382 0.1876 0.3183 0.0619  -0.0493 -0.0247 98   TYR A CD2   
751  C CE1   . TYR A 98  ? 0.2559 0.2274 0.2692 0.0627  -0.0478 -0.0142 98   TYR A CE1   
752  C CE2   . TYR A 98  ? 0.2657 0.2381 0.3701 0.0132  -0.0538 0.0523  98   TYR A CE2   
753  C CZ    . TYR A 98  ? 0.3024 0.2166 0.2812 0.0212  -0.0284 -0.0204 98   TYR A CZ    
754  O OH    . TYR A 98  ? 0.3819 0.4387 0.3256 0.0906  0.0127  0.1027  98   TYR A OH    
755  N N     . GLN A 99  ? 0.4004 0.1765 0.2360 0.0860  -0.0349 -0.0862 99   GLN A N     
756  C CA    . GLN A 99  ? 0.4040 0.2114 0.2327 0.0984  0.0024  -0.0714 99   GLN A CA    
757  C C     . GLN A 99  ? 0.4242 0.1819 0.2396 0.1173  0.0208  -0.0825 99   GLN A C     
758  O O     . GLN A 99  ? 0.4416 0.2596 0.3064 0.1630  0.0595  0.0156  99   GLN A O     
759  C CB    . GLN A 99  ? 0.4592 0.2769 0.2799 0.0830  0.0303  -0.0268 99   GLN A CB    
760  C CG    . GLN A 99  ? 0.6021 0.2923 0.3286 0.0658  -0.0142 0.0234  99   GLN A CG    
761  C CD    . GLN A 99  ? 0.6312 0.4625 0.3688 0.0727  0.0187  0.1013  99   GLN A CD    
762  O OE1   . GLN A 99  ? 1.0877 0.5980 0.3380 0.0113  0.0770  0.0615  99   GLN A OE1   
763  N NE2   . GLN A 99  ? 0.5295 0.7929 0.6696 -0.0246 -0.0588 0.2576  99   GLN A NE2   
764  N N     . MET A 100 ? 0.3812 0.2259 0.2435 0.0944  -0.0124 -0.0538 100  MET A N     
765  C CA    . MET A 100 ? 0.4349 0.2537 0.2461 0.1025  -0.0213 -0.0470 100  MET A CA    
766  C C     . MET A 100 ? 0.4725 0.2167 0.2681 0.0903  0.0056  -0.0476 100  MET A C     
767  O O     . MET A 100 ? 0.4610 0.2812 0.3198 0.0955  0.0249  -0.0116 100  MET A O     
768  C CB    . MET A 100 ? 0.4191 0.2256 0.2611 0.1364  -0.0315 -0.0573 100  MET A CB    
769  C CG    . MET A 100 ? 0.3706 0.2092 0.2169 0.0881  0.0247  -0.0184 100  MET A CG    
770  S SD    . MET A 100 ? 0.3978 0.2561 0.4460 -0.0201 0.1189  -0.1306 100  MET A SD    
771  C CE    . MET A 100 ? 0.3196 0.4357 0.4837 0.0280  -0.1795 -0.1423 100  MET A CE    
772  N N     . THR A 101 ? 0.5318 0.1807 0.3767 0.0781  -0.0156 -0.0465 101  THR A N     
773  C CA    . THR A 101 ? 0.6407 0.1387 0.3892 0.0744  0.0371  -0.0387 101  THR A CA    
774  C C     . THR A 101 ? 0.3679 0.1640 0.3480 0.0766  -0.0910 -0.0429 101  THR A C     
775  O O     . THR A 101 ? 0.3196 0.2164 0.3329 0.0189  -0.0555 0.0155  101  THR A O     
776  C CB    . THR A 101 ? 0.6781 0.1921 0.3671 0.1408  0.0075  -0.0283 101  THR A CB    
777  O OG1   . THR A 101 ? 0.9107 0.6838 0.5985 0.2873  -0.2356 -0.0717 101  THR A OG1   
778  C CG2   . THR A 101 ? 0.7784 0.1898 0.6103 0.1569  0.1734  -0.0294 101  THR A CG2   
779  N N     . PRO A 102 ? 0.3373 0.1843 0.3369 0.0104  -0.0920 -0.0303 102  PRO A N     
780  C CA    . PRO A 102 ? 0.2534 0.2349 0.2784 -0.0230 -0.0643 -0.0284 102  PRO A CA    
781  C C     . PRO A 102 ? 0.2794 0.1588 0.3346 -0.0596 -0.1051 -0.0043 102  PRO A C     
782  O O     . PRO A 102 ? 0.3846 0.1787 0.3660 -0.0913 -0.0810 0.0267  102  PRO A O     
783  C CB    . PRO A 102 ? 0.2508 0.3606 0.3799 -0.0330 -0.1031 -0.0729 102  PRO A CB    
784  C CG    . PRO A 102 ? 0.3471 0.4055 0.4628 0.0099  -0.1930 -0.1305 102  PRO A CG    
785  C CD    . PRO A 102 ? 0.4215 0.2689 0.4496 -0.0016 -0.1875 -0.1012 102  PRO A CD    
786  N N     . THR A 103 ? 0.2603 0.1489 0.3273 -0.0158 -0.1078 -0.0375 103  THR A N     
787  C CA    . THR A 103 ? 0.2455 0.1875 0.2729 0.0043  -0.0647 -0.0233 103  THR A CA    
788  C C     . THR A 103 ? 0.2406 0.1450 0.2409 -0.0022 -0.0465 0.0213  103  THR A C     
789  O O     . THR A 103 ? 0.2383 0.1501 0.2600 0.0039  -0.0342 0.0434  103  THR A O     
790  C CB    . THR A 103 ? 0.2370 0.2115 0.3088 0.0247  -0.0697 -0.0472 103  THR A CB    
791  O OG1   . THR A 103 ? 0.2787 0.2225 0.3784 0.0311  -0.0462 -0.0849 103  THR A OG1   
792  C CG2   . THR A 103 ? 0.2519 0.2861 0.3020 0.0596  -0.0588 0.0024  103  THR A CG2   
793  N N     . LYS A 104 ? 0.2293 0.1549 0.2407 -0.0262 -0.0622 0.0309  104  LYS A N     
794  C CA    . LYS A 104 ? 0.2121 0.1970 0.2262 -0.0746 -0.0403 0.0171  104  LYS A CA    
795  C C     . LYS A 104 ? 0.1893 0.1403 0.2310 -0.0371 -0.0328 0.0350  104  LYS A C     
796  O O     . LYS A 104 ? 0.2419 0.1522 0.2574 -0.0001 -0.0386 0.0474  104  LYS A O     
797  C CB    . LYS A 104 ? 0.2256 0.2722 0.2985 -0.0799 -0.0022 0.0632  104  LYS A CB    
798  C CG    . LYS A 104 ? 0.2563 0.5185 0.5385 -0.1793 -0.0161 0.0490  104  LYS A CG    
799  C CD    . LYS A 104 ? 0.2821 0.5921 0.7099 -0.1461 0.1008  0.0912  104  LYS A CD    
800  C CE    . LYS A 104 ? 0.6941 0.7525 0.5893 -0.3453 0.2493  0.0431  104  LYS A CE    
801  N NZ    . LYS A 104 ? 1.2937 0.7720 0.6078 -0.4267 0.2566  0.0630  104  LYS A NZ    
802  N N     . VAL A 105 ? 0.1770 0.1455 0.2070 -0.0278 -0.0463 0.0239  105  VAL A N     
803  C CA    . VAL A 105 ? 0.1491 0.1496 0.2230 -0.0393 -0.0242 0.0242  105  VAL A CA    
804  C C     . VAL A 105 ? 0.1571 0.1389 0.2130 -0.0337 -0.0330 0.0308  105  VAL A C     
805  O O     . VAL A 105 ? 0.1705 0.2132 0.2340 -0.0039 -0.0448 0.0075  105  VAL A O     
806  C CB    . VAL A 105 ? 0.1899 0.1222 0.2404 -0.0111 0.0033  0.0298  105  VAL A CB    
807  C CG1   . VAL A 105 ? 0.1935 0.1689 0.2403 -0.0174 -0.0085 -0.0118 105  VAL A CG1   
808  C CG2   . VAL A 105 ? 0.2068 0.1831 0.2385 0.0056  -0.0220 0.0478  105  VAL A CG2   
809  N N     . LYS A 106 ? 0.1645 0.1420 0.2205 -0.0535 -0.0350 0.0290  106  LYS A N     
810  C CA    . LYS A 106 ? 0.2001 0.1493 0.2018 -0.0657 -0.0277 0.0293  106  LYS A CA    
811  C C     . LYS A 106 ? 0.1465 0.1145 0.2049 -0.0197 -0.0272 0.0335  106  LYS A C     
812  O O     . LYS A 106 ? 0.1650 0.1504 0.2699 0.0061  -0.0014 0.0351  106  LYS A O     
813  C CB    . LYS A 106 ? 0.2904 0.2278 0.1807 -0.0461 0.0000  0.0524  106  LYS A CB    
814  C CG    . LYS A 106 ? 0.4619 0.3313 0.2235 -0.1083 0.0194  -0.0389 106  LYS A CG    
815  C CD    . LYS A 106 ? 0.6726 0.4879 0.2104 -0.1896 -0.0043 -0.0314 106  LYS A CD    
816  C CE    . LYS A 106 ? 0.7162 0.5029 0.4032 -0.2209 -0.1688 0.1491  106  LYS A CE    
817  N NZ    . LYS A 106 ? 1.0498 0.8434 0.5209 -0.2548 -0.2932 0.3639  106  LYS A NZ    
818  N N     . VAL A 107 ? 0.1854 0.1144 0.1975 -0.0094 0.0038  0.0213  107  VAL A N     
819  C CA    . VAL A 107 ? 0.1868 0.1153 0.1550 -0.0262 -0.0203 0.0190  107  VAL A CA    
820  C C     . VAL A 107 ? 0.1241 0.1377 0.1716 -0.0058 -0.0038 -0.0039 107  VAL A C     
821  O O     . VAL A 107 ? 0.1623 0.1979 0.1871 -0.0070 0.0354  -0.0119 107  VAL A O     
822  C CB    . VAL A 107 ? 0.1854 0.1558 0.1611 -0.0091 -0.0289 0.0192  107  VAL A CB    
823  C CG1   . VAL A 107 ? 0.2429 0.1954 0.1937 -0.0151 0.0002  0.0722  107  VAL A CG1   
824  C CG2   . VAL A 107 ? 0.2872 0.2541 0.1815 -0.0329 -0.0465 -0.0524 107  VAL A CG2   
825  N N     . HIS A 108 ? 0.1428 0.1220 0.1906 -0.0266 -0.0186 0.0150  108  HIS A N     
826  C CA    . HIS A 108 ? 0.1814 0.1210 0.2047 -0.0402 -0.0464 0.0273  108  HIS A CA    
827  C C     . HIS A 108 ? 0.1898 0.0877 0.1949 -0.0078 -0.0037 -0.0013 108  HIS A C     
828  O O     . HIS A 108 ? 0.2014 0.1225 0.2292 0.0241  0.0145  0.0121  108  HIS A O     
829  C CB    . HIS A 108 ? 0.2226 0.1710 0.1774 -0.0067 -0.0524 0.0114  108  HIS A CB    
830  C CG    . HIS A 108 ? 0.2563 0.1631 0.1691 -0.0082 -0.0491 0.0217  108  HIS A CG    
831  N ND1   . HIS A 108 ? 0.3047 0.1799 0.1951 -0.0025 -0.0943 0.0018  108  HIS A ND1   
832  C CD2   . HIS A 108 ? 0.2201 0.1749 0.2302 -0.0318 -0.0119 -0.0045 108  HIS A CD2   
833  C CE1   . HIS A 108 ? 0.2815 0.2037 0.2540 -0.0121 -0.0705 -0.0356 108  HIS A CE1   
834  N NE2   . HIS A 108 ? 0.2644 0.2110 0.2072 -0.0157 -0.0211 -0.0177 108  HIS A NE2   
835  N N     . MET A 109 ? 0.1986 0.0934 0.1844 -0.0049 -0.0016 -0.0071 109  MET A N     
836  C CA    . MET A 109 ? 0.2180 0.0866 0.1918 -0.0206 -0.0132 0.0094  109  MET A CA    
837  C C     . MET A 109 ? 0.2165 0.1104 0.1934 -0.0138 0.0018  -0.0126 109  MET A C     
838  O O     . MET A 109 ? 0.2285 0.1707 0.2163 -0.0086 0.0171  -0.0349 109  MET A O     
839  C CB    . MET A 109 ? 0.3012 0.1764 0.2187 -0.0062 -0.0550 0.0418  109  MET A CB    
840  C CG    . MET A 109 ? 0.2995 0.2452 0.2641 0.0094  -0.0955 -0.0010 109  MET A CG    
841  S SD    . MET A 109 ? 0.3298 0.3368 0.2634 0.0324  -0.0831 0.0325  109  MET A SD    
842  C CE    . MET A 109 ? 0.3830 0.2718 0.2856 0.0811  -0.0420 0.0761  109  MET A CE    
843  N N     . LYS A 110 ? 0.2011 0.1474 0.1769 -0.0135 -0.0264 -0.0170 110  LYS A N     
844  C CA    . LYS A 110 ? 0.2226 0.1489 0.1771 -0.0105 -0.0423 -0.0125 110  LYS A CA    
845  C C     . LYS A 110 ? 0.2297 0.1356 0.1631 -0.0110 -0.0455 -0.0237 110  LYS A C     
846  O O     . LYS A 110 ? 0.2600 0.1519 0.1991 -0.0385 -0.0122 -0.0478 110  LYS A O     
847  C CB    . LYS A 110 ? 0.2731 0.1843 0.1741 -0.0150 -0.0502 0.0013  110  LYS A CB    
848  C CG    . LYS A 110 ? 0.3490 0.2414 0.1791 -0.0454 -0.0899 -0.0054 110  LYS A CG    
849  C CD    . LYS A 110 ? 0.3410 0.2468 0.1787 0.0168  -0.0623 -0.0135 110  LYS A CD    
850  C CE    . LYS A 110 ? 0.3549 0.3585 0.1693 -0.0265 -0.0616 -0.0574 110  LYS A CE    
851  N NZ    . LYS A 110 ? 0.3808 0.2922 0.2021 -0.0420 -0.0726 -0.0439 110  LYS A NZ    
852  N N     . LYS A 111 ? 0.2437 0.1361 0.1775 -0.0118 -0.0479 -0.0203 111  LYS A N     
853  C CA    . LYS A 111 ? 0.2102 0.1344 0.2537 -0.0185 -0.0451 -0.0348 111  LYS A CA    
854  C C     . LYS A 111 ? 0.2356 0.1795 0.1656 -0.0185 -0.0442 -0.0071 111  LYS A C     
855  O O     . LYS A 111 ? 0.2985 0.2247 0.1819 -0.0097 -0.0451 0.0206  111  LYS A O     
856  C CB    . LYS A 111 ? 0.3121 0.1256 0.3386 -0.0079 -0.0859 -0.0480 111  LYS A CB    
857  C CG    . LYS A 111 ? 0.5483 0.1754 0.6317 -0.1363 0.0430  -0.0850 111  LYS A CG    
858  C CD    . LYS A 111 ? 0.4125 0.1142 1.0247 0.0138  0.1205  -0.0847 111  LYS A CD    
859  C CE    . LYS A 111 ? 0.5268 0.3088 1.1477 0.0428  0.0687  0.0595  111  LYS A CE    
860  N NZ    . LYS A 111 ? 0.5338 0.6721 1.1962 -0.0155 -0.1577 0.0502  111  LYS A NZ    
861  N N     . ALA A 112 ? 0.2011 0.1955 0.1998 -0.0483 -0.0319 -0.0093 112  ALA A N     
862  C CA    . ALA A 112 ? 0.2137 0.2136 0.2453 -0.0379 -0.0736 -0.0283 112  ALA A CA    
863  C C     . ALA A 112 ? 0.2805 0.1607 0.3117 -0.0259 -0.1455 0.0016  112  ALA A C     
864  O O     . ALA A 112 ? 0.2623 0.1950 0.4113 -0.0131 -0.1602 -0.0571 112  ALA A O     
865  C CB    . ALA A 112 ? 0.1835 0.2728 0.3065 -0.0264 -0.0265 0.0152  112  ALA A CB    
866  N N     . LEU A 113 ? 0.2821 0.1835 0.3563 -0.0420 -0.1782 -0.0048 113  LEU A N     
867  C CA    . LEU A 113 ? 0.2229 0.2440 0.3562 -0.0814 -0.1235 -0.0232 113  LEU A CA    
868  C C     . LEU A 113 ? 0.2884 0.2308 0.3498 -0.1016 -0.1158 -0.0368 113  LEU A C     
869  O O     . LEU A 113 ? 0.4474 0.2568 0.3663 -0.1192 -0.1058 -0.0613 113  LEU A O     
870  C CB    . LEU A 113 ? 0.2364 0.3078 0.3711 -0.0580 -0.1475 -0.0231 113  LEU A CB    
871  C CG    . LEU A 113 ? 0.4136 0.2662 0.4170 -0.0180 -0.2870 0.0211  113  LEU A CG    
872  C CD1   . LEU A 113 ? 0.7173 0.4135 0.3543 -0.1288 -0.2472 -0.0160 113  LEU A CD1   
873  C CD2   . LEU A 113 ? 0.4091 0.2982 0.8091 -0.0499 -0.4280 0.1110  113  LEU A CD2   
874  N N     . SER A 114 ? 0.2184 0.2505 0.3939 -0.0867 -0.0762 -0.0230 114  SER A N     
875  C CA    . SER A 114 ? 0.2986 0.2977 0.4958 -0.1083 -0.0540 0.0422  114  SER A CA    
876  C C     . SER A 114 ? 0.3927 0.2256 0.5106 -0.0809 -0.1338 -0.0056 114  SER A C     
877  O O     . SER A 114 ? 0.6117 0.2352 0.6326 -0.0884 -0.1320 0.0557  114  SER A O     
878  C CB    . SER A 114 ? 0.4917 0.2758 0.5862 -0.1005 0.0794  0.0578  114  SER A CB    
879  O OG    . SER A 114 ? 0.7397 0.4583 0.5792 -0.1621 0.0935  -0.0538 114  SER A OG    
880  N N     . GLY A 115 ? 0.3471 0.2609 0.3829 -0.0397 -0.1316 -0.0533 115  GLY A N     
881  C CA    . GLY A 115 ? 0.3906 0.2570 0.3978 -0.0025 -0.1154 -0.0356 115  GLY A CA    
882  C C     . GLY A 115 ? 0.3793 0.3359 0.4207 -0.0051 -0.1037 0.0503  115  GLY A C     
883  O O     . GLY A 115 ? 0.5370 0.3637 0.5136 0.0998  -0.1766 0.0226  115  GLY A O     
884  N N     . ASP A 116 ? 0.4054 0.2739 0.3922 -0.0806 -0.0972 0.0237  116  ASP A N     
885  C CA    . ASP A 116 ? 0.5825 0.1900 0.4010 -0.1643 -0.1002 0.0616  116  ASP A CA    
886  C C     . ASP A 116 ? 0.3908 0.1932 0.3467 -0.0772 0.0334  0.0395  116  ASP A C     
887  O O     . ASP A 116 ? 0.4539 0.2813 0.3443 -0.1133 0.0306  0.0665  116  ASP A O     
888  C CB    . ASP A 116 ? 0.7134 0.3209 0.5315 -0.2749 -0.0265 0.0724  116  ASP A CB    
889  C CG    . ASP A 116 ? 0.6268 0.4616 0.6672 -0.2353 0.0785  -0.0182 116  ASP A CG    
890  O OD1   . ASP A 116 ? 0.5152 0.4548 0.5367 -0.1515 0.0288  -0.0699 116  ASP A OD1   
891  O OD2   . ASP A 116 ? 0.6904 0.5296 1.0234 -0.2847 0.1920  -0.0524 116  ASP A OD2   
892  N N     . SER A 117 ? 0.2349 0.1724 0.3233 -0.0833 -0.0416 0.0292  117  SER A N     
893  C CA    . SER A 117 ? 0.1983 0.1911 0.2759 -0.0732 -0.0137 0.0142  117  SER A CA    
894  C C     . SER A 117 ? 0.1949 0.1327 0.2461 -0.0427 -0.0052 -0.0135 117  SER A C     
895  O O     . SER A 117 ? 0.2465 0.1335 0.2279 -0.0147 -0.0365 -0.0060 117  SER A O     
896  C CB    . SER A 117 ? 0.2413 0.2779 0.2676 -0.0415 0.0317  0.0010  117  SER A CB    
897  O OG    . SER A 117 ? 0.2359 0.3931 0.3320 0.0274  -0.0049 0.0011  117  SER A OG    
898  N N     . TYR A 118 ? 0.2033 0.1177 0.2176 -0.0341 -0.0256 0.0151  118  TYR A N     
899  C CA    . TYR A 118 ? 0.2206 0.0960 0.2000 -0.0450 -0.0342 0.0195  118  TYR A CA    
900  C C     . TYR A 118 ? 0.2244 0.1119 0.1639 -0.0201 -0.0348 0.0130  118  TYR A C     
901  O O     . TYR A 118 ? 0.4043 0.1421 0.1713 -0.0323 0.0291  0.0051  118  TYR A O     
902  C CB    . TYR A 118 ? 0.1970 0.1278 0.2237 -0.0171 -0.0266 -0.0196 118  TYR A CB    
903  C CG    . TYR A 118 ? 0.1923 0.1417 0.2197 -0.0083 -0.0046 -0.0207 118  TYR A CG    
904  C CD1   . TYR A 118 ? 0.2163 0.1336 0.2308 0.0072  -0.0204 0.0052  118  TYR A CD1   
905  C CD2   . TYR A 118 ? 0.2656 0.1365 0.2092 0.0544  -0.0439 -0.0174 118  TYR A CD2   
906  C CE1   . TYR A 118 ? 0.2625 0.1347 0.2549 0.0236  -0.0004 -0.0040 118  TYR A CE1   
907  C CE2   . TYR A 118 ? 0.3259 0.1422 0.1922 0.0474  -0.0769 -0.0106 118  TYR A CE2   
908  C CZ    . TYR A 118 ? 0.3271 0.1360 0.2244 0.0102  -0.0473 -0.0151 118  TYR A CZ    
909  O OH    . TYR A 118 ? 0.4487 0.1294 0.3115 -0.0162 -0.0110 -0.0206 118  TYR A OH    
910  N N     . TRP A 119 ? 0.2081 0.1172 0.1731 -0.0175 -0.0203 0.0273  119  TRP A N     
911  C CA    . TRP A 119 ? 0.1926 0.1126 0.1917 -0.0403 -0.0366 0.0169  119  TRP A CA    
912  C C     . TRP A 119 ? 0.1767 0.1243 0.1746 -0.0216 -0.0118 -0.0095 119  TRP A C     
913  O O     . TRP A 119 ? 0.2152 0.1376 0.1982 0.0091  0.0085  -0.0059 119  TRP A O     
914  C CB    . TRP A 119 ? 0.1952 0.1495 0.2094 -0.0170 -0.0430 0.0220  119  TRP A CB    
915  C CG    . TRP A 119 ? 0.2031 0.1468 0.2528 -0.0190 -0.0646 0.0097  119  TRP A CG    
916  C CD1   . TRP A 119 ? 0.2319 0.1753 0.2925 -0.0328 -0.0962 0.0054  119  TRP A CD1   
917  C CD2   . TRP A 119 ? 0.1978 0.1083 0.3775 -0.0324 -0.0123 0.0399  119  TRP A CD2   
918  N NE1   . TRP A 119 ? 0.2198 0.1781 0.4333 -0.0216 -0.1106 0.0181  119  TRP A NE1   
919  C CE2   . TRP A 119 ? 0.2090 0.1384 0.4564 -0.0410 -0.0409 0.0475  119  TRP A CE2   
920  C CE3   . TRP A 119 ? 0.1890 0.1771 0.3089 0.0289  -0.0316 0.0269  119  TRP A CE3   
921  C CZ2   . TRP A 119 ? 0.1981 0.2402 0.4858 -0.0241 -0.0408 0.0584  119  TRP A CZ2   
922  C CZ3   . TRP A 119 ? 0.2003 0.2511 0.3773 -0.0021 0.0321  0.0311  119  TRP A CZ3   
923  C CH2   . TRP A 119 ? 0.1983 0.2344 0.4289 0.0009  -0.0047 0.0885  119  TRP A CH2   
924  N N     . VAL A 120 ? 0.1919 0.0940 0.1914 -0.0330 -0.0134 -0.0045 120  VAL A N     
925  C CA    . VAL A 120 ? 0.1825 0.1077 0.1575 -0.0291 -0.0185 0.0215  120  VAL A CA    
926  C C     . VAL A 120 ? 0.1647 0.1123 0.1618 -0.0171 -0.0068 0.0251  120  VAL A C     
927  O O     . VAL A 120 ? 0.1827 0.1569 0.1876 -0.0051 0.0264  0.0212  120  VAL A O     
928  C CB    . VAL A 120 ? 0.1566 0.1448 0.1702 -0.0074 -0.0285 0.0158  120  VAL A CB    
929  C CG1   . VAL A 120 ? 0.1943 0.2074 0.1829 -0.0542 -0.0335 0.0200  120  VAL A CG1   
930  C CG2   . VAL A 120 ? 0.2579 0.1846 0.2184 0.0104  -0.0440 0.0688  120  VAL A CG2   
931  N N     . PHE A 121 ? 0.1540 0.1027 0.1609 -0.0183 -0.0117 0.0237  121  PHE A N     
932  C CA    . PHE A 121 ? 0.1708 0.1052 0.1780 -0.0279 -0.0376 0.0310  121  PHE A CA    
933  C C     . PHE A 121 ? 0.1404 0.1082 0.2253 -0.0175 -0.0292 0.0104  121  PHE A C     
934  O O     . PHE A 121 ? 0.1505 0.1328 0.2417 -0.0108 -0.0040 0.0156  121  PHE A O     
935  C CB    . PHE A 121 ? 0.2004 0.1686 0.1909 -0.0403 -0.0732 0.0300  121  PHE A CB    
936  C CG    . PHE A 121 ? 0.1803 0.1517 0.1847 -0.0152 -0.0470 0.0218  121  PHE A CG    
937  C CD1   . PHE A 121 ? 0.1783 0.1850 0.2135 -0.0206 -0.0305 0.0508  121  PHE A CD1   
938  C CD2   . PHE A 121 ? 0.2362 0.1338 0.2007 -0.0133 -0.0484 0.0296  121  PHE A CD2   
939  C CE1   . PHE A 121 ? 0.2187 0.2379 0.2436 -0.0665 -0.0350 0.0544  121  PHE A CE1   
940  C CE2   . PHE A 121 ? 0.2891 0.1697 0.2322 -0.0528 -0.0689 0.0182  121  PHE A CE2   
941  C CZ    . PHE A 121 ? 0.2511 0.2291 0.2308 -0.0823 -0.0845 0.0475  121  PHE A CZ    
942  N N     . VAL A 122 ? 0.1715 0.1054 0.1818 -0.0223 -0.0234 0.0119  122  VAL A N     
943  C CA    . VAL A 122 ? 0.1884 0.1002 0.1886 -0.0270 -0.0483 0.0252  122  VAL A CA    
944  C C     . VAL A 122 ? 0.1368 0.1125 0.1934 -0.0108 -0.0236 0.0307  122  VAL A C     
945  O O     . VAL A 122 ? 0.1448 0.1471 0.2967 -0.0066 -0.0138 0.0449  122  VAL A O     
946  C CB    . VAL A 122 ? 0.2388 0.1382 0.1898 -0.0334 -0.0740 0.0288  122  VAL A CB    
947  C CG1   . VAL A 122 ? 0.2262 0.2087 0.2093 -0.0653 -0.0730 0.0252  122  VAL A CG1   
948  C CG2   . VAL A 122 ? 0.2827 0.1654 0.2210 -0.0113 -0.1048 0.0443  122  VAL A CG2   
949  N N     . LYS A 123 ? 0.1610 0.1130 0.1824 -0.0129 -0.0236 0.0444  123  LYS A N     
950  C CA    . LYS A 123 ? 0.1736 0.1175 0.2108 -0.0311 -0.0594 0.0627  123  LYS A CA    
951  C C     . LYS A 123 ? 0.1457 0.1304 0.1964 -0.0237 0.0027  0.0304  123  LYS A C     
952  O O     . LYS A 123 ? 0.1587 0.1477 0.2477 -0.0095 -0.0230 0.0270  123  LYS A O     
953  C CB    . LYS A 123 ? 0.2764 0.2499 0.2140 -0.0811 -0.0821 0.1045  123  LYS A CB    
954  C CG    . LYS A 123 ? 0.3278 0.3421 0.1971 -0.0782 -0.0792 0.0633  123  LYS A CG    
955  C CD    . LYS A 123 ? 0.2934 0.3084 0.2056 -0.0315 -0.0653 0.0734  123  LYS A CD    
956  C CE    . LYS A 123 ? 0.3650 0.3554 0.2292 0.0048  -0.0153 0.0898  123  LYS A CE    
957  N NZ    . LYS A 123 ? 0.3406 0.2790 0.2165 -0.0490 -0.0445 0.0527  123  LYS A NZ    
958  N N     . ARG A 124 ? 0.1850 0.1222 0.2139 -0.0250 -0.0013 0.0262  124  ARG A N     
959  C CA    . ARG A 124 ? 0.1841 0.1375 0.2486 -0.0364 -0.0017 0.0238  124  ARG A CA    
960  C C     . ARG A 124 ? 0.1728 0.1659 0.2281 -0.0338 -0.0206 0.0336  124  ARG A C     
961  O O     . ARG A 124 ? 0.1960 0.2295 0.2500 -0.0505 -0.0381 0.0594  124  ARG A O     
962  C CB    . ARG A 124 ? 0.2305 0.1361 0.2810 -0.0310 0.0141  0.0268  124  ARG A CB    
963  C CG    . ARG A 124 ? 0.3231 0.1795 0.3143 -0.0215 0.0787  0.0138  124  ARG A CG    
964  C CD    . ARG A 124 ? 0.3730 0.2169 0.4208 0.0129  0.0429  -0.0684 124  ARG A CD    
965  N NE    . ARG A 124 ? 0.3982 0.2054 0.4545 0.0202  0.0780  -0.0514 124  ARG A NE    
966  C CZ    . ARG A 124 ? 0.5365 0.2901 0.4379 -0.0548 0.1223  -0.0781 124  ARG A CZ    
967  N NH1   . ARG A 124 ? 0.4986 0.5476 0.5786 0.0055  -0.1056 -0.0417 124  ARG A NH1   
968  N NH2   . ARG A 124 ? 0.9051 0.2758 0.5409 -0.0296 0.3396  -0.0627 124  ARG A NH2   
969  N N     . VAL A 125 ? 0.1831 0.1745 0.2661 -0.0664 -0.0293 0.0942  125  VAL A N     
970  C CA    . VAL A 125 ? 0.1631 0.1924 0.2787 -0.0586 -0.0348 0.1022  125  VAL A CA    
971  C C     . VAL A 125 ? 0.1451 0.2303 0.3464 -0.0822 -0.0473 0.0929  125  VAL A C     
972  O O     . VAL A 125 ? 0.2860 0.2842 0.3686 -0.1150 -0.0939 0.0625  125  VAL A O     
973  C CB    . VAL A 125 ? 0.2383 0.2579 0.2929 -0.0073 -0.0287 0.0622  125  VAL A CB    
974  C CG1   . VAL A 125 ? 0.3715 0.2200 0.3932 -0.0458 0.0042  0.0437  125  VAL A CG1   
975  C CG2   . VAL A 125 ? 0.2992 0.3817 0.3302 0.1125  -0.0436 0.0741  125  VAL A CG2   
976  O OXT   . VAL A 125 ? 0.2319 0.2778 0.4066 -0.1191 0.0086  0.1144  125  VAL A OXT   
977  C C1    . HC4 B .   ? 0.1857 0.1324 0.2373 0.0174  -0.0460 -0.0585 169  HC4 A C1    
978  O O1    . HC4 B .   ? 0.1881 0.1937 0.2378 0.0511  -0.0603 -0.0479 169  HC4 A O1    
979  C C2    . HC4 B .   ? 0.1739 0.1483 0.2219 -0.0008 -0.0345 0.0056  169  HC4 A C2    
980  C C3    . HC4 B .   ? 0.1779 0.1476 0.1926 0.0083  -0.0539 -0.0030 169  HC4 A C3    
981  C "C1'" . HC4 B .   ? 0.1774 0.1411 0.1945 0.0168  -0.0425 -0.0020 169  HC4 A "C1'" 
982  C "C2'" . HC4 B .   ? 0.1943 0.1780 0.2144 0.0267  -0.0335 -0.0160 169  HC4 A "C2'" 
983  C "C3'" . HC4 B .   ? 0.1876 0.1848 0.2163 0.0103  -0.0195 0.0011  169  HC4 A "C3'" 
984  C "C4'" . HC4 B .   ? 0.1616 0.1703 0.2234 0.0205  -0.0288 0.0014  169  HC4 A "C4'" 
985  C "C5'" . HC4 B .   ? 0.1583 0.1784 0.2181 0.0219  -0.0385 -0.0276 169  HC4 A "C5'" 
986  C "C6'" . HC4 B .   ? 0.1643 0.1636 0.1889 0.0127  -0.0576 0.0166  169  HC4 A "C6'" 
987  O "O4'" . HC4 B .   ? 0.1532 0.2540 0.2885 -0.0160 -0.0397 -0.0081 169  HC4 A "O4'" 
988  O O     . HOH C .   ? 0.2192 0.2325 0.2932 -0.0160 -0.0770 -0.0038 1001 HOH A O     
989  O O     . HOH C .   ? 0.2732 0.2941 0.3104 -0.0163 -0.0536 0.0398  1002 HOH A O     
990  O O     . HOH C .   ? 0.2318 0.3769 0.2014 0.0717  -0.0247 -0.0294 1003 HOH A O     
991  O O     . HOH C .   ? 0.3372 0.3207 0.2494 -0.0335 -0.0255 -0.0381 1004 HOH A O     
992  O O     . HOH C .   ? 0.3835 0.3921 0.2986 0.0358  -0.0560 0.0989  1005 HOH A O     
993  O O     . HOH C .   ? 0.3416 0.3333 0.3206 -0.0774 -0.0741 0.0982  1006 HOH A O     
994  O O     . HOH C .   ? 0.3937 0.2559 0.3398 0.0444  -0.0087 -0.0179 1007 HOH A O     
995  O O     . HOH C .   ? 0.4042 0.3582 0.3924 0.0332  -0.1268 -0.0264 1008 HOH A O     
996  O O     . HOH C .   ? 0.2382 0.3370 0.4286 0.0731  -0.0258 0.0559  1009 HOH A O     
997  O O     . HOH C .   ? 0.4058 0.2134 0.3263 -0.0097 -0.1180 0.0342  1010 HOH A O     
998  O O     . HOH C .   ? 0.3787 0.2974 0.2827 0.0918  0.0783  0.0877  1011 HOH A O     
999  O O     . HOH C .   ? 0.4893 0.2983 0.4978 0.0497  -0.2072 -0.0845 1012 HOH A O     
1000 O O     . HOH C .   ? 0.6772 0.2075 0.3834 -0.1039 -0.0882 0.0859  1013 HOH A O     
1001 O O     . HOH C .   ? 0.3460 0.3483 0.6013 0.0078  -0.0976 0.0183  1014 HOH A O     
1002 O O     . HOH C .   ? 0.4252 0.3695 0.3824 -0.0091 0.0241  -0.1060 1015 HOH A O     
1003 O O     . HOH C .   ? 0.4567 0.3574 0.4414 -0.1678 -0.0316 -0.0501 1016 HOH A O     
1004 O O     . HOH C .   ? 0.5850 0.7293 0.6880 -0.1775 -0.0941 0.0503  1017 HOH A O     
1005 O O     . HOH C .   ? 0.1803 0.4161 0.5792 0.0219  0.0295  -0.0487 1018 HOH A O     
1006 O O     . HOH C .   ? 0.2937 0.3545 0.2960 0.0579  -0.0139 -0.0580 1019 HOH A O     
1007 O O     . HOH C .   ? 0.2972 0.5231 0.7223 0.0090  0.2138  -0.0903 1020 HOH A O     
1008 O O     . HOH C .   ? 0.3071 0.5001 0.6042 0.0325  -0.0111 -0.1229 1021 HOH A O     
1009 O O     . HOH C .   ? 0.2839 0.4713 0.5913 -0.0345 -0.1077 0.0477  1022 HOH A O     
1010 O O     . HOH C .   ? 0.6198 0.3643 0.6882 -0.0738 0.1959  -0.0723 1023 HOH A O     
1011 O O     . HOH C .   ? 0.3867 0.2862 0.3701 -0.0447 -0.0664 0.0531  1024 HOH A O     
1012 O O     . HOH C .   ? 0.4496 0.5065 0.3414 0.0827  0.0179  0.0606  1025 HOH A O     
1013 O O     . HOH C .   ? 0.5025 0.7113 0.7537 -0.0922 -0.1511 -0.0263 1026 HOH A O     
1014 O O     . HOH C .   ? 0.3849 0.3738 0.3426 0.0129  0.0366  -0.0917 1027 HOH A O     
1015 O O     . HOH C .   ? 0.3417 0.3599 0.5591 0.0335  -0.1170 -0.0239 1028 HOH A O     
1016 O O     . HOH C .   ? 0.6155 0.6084 0.6248 -0.0608 0.1179  -0.1423 1029 HOH A O     
1017 O O     . HOH C .   ? 0.5271 0.6343 0.6725 -0.0996 -0.0476 -0.1086 1030 HOH A O     
1018 O O     . HOH C .   ? 0.3616 0.4703 0.6329 -0.0026 -0.2050 0.1633  1031 HOH A O     
1019 O O     . HOH C .   ? 0.7220 0.6644 0.6810 -0.0137 0.0775  -0.0262 1032 HOH A O     
1020 O O     . HOH C .   ? 0.5141 0.7261 0.3709 -0.1180 -0.0047 0.0450  1033 HOH A O     
1021 O O     . HOH C .   ? 0.5631 0.3473 0.4551 -0.0826 -0.0691 0.0764  1034 HOH A O     
1022 O O     . HOH C .   ? 0.8568 0.4602 0.3943 -0.0171 0.0381  -0.1345 1035 HOH A O     
1023 O O     . HOH C .   ? 0.3602 0.2132 0.3000 0.0776  -0.0004 0.0577  1036 HOH A O     
1024 O O     . HOH C .   ? 0.3900 0.2951 0.3414 -0.0149 0.0710  -0.0094 1037 HOH A O     
1025 O O     . HOH C .   ? 0.4487 0.5195 0.5004 0.0795  -0.0751 0.0485  1038 HOH A O     
1026 O O     . HOH C .   ? 0.3631 0.4581 0.3544 -0.0598 0.0058  0.0875  1039 HOH A O     
1027 O O     . HOH C .   ? 0.3251 0.5484 0.4724 -0.0854 -0.0575 -0.1257 1040 HOH A O     
1028 O O     . HOH C .   ? 0.5529 0.5006 0.3225 -0.1001 -0.0098 -0.0186 1041 HOH A O     
1029 O O     . HOH C .   ? 0.6541 0.6411 0.5831 -0.0112 0.2274  -0.0448 1042 HOH A O     
1030 O O     . HOH C .   ? 0.5322 0.4313 0.5641 -0.1276 -0.2215 0.0679  1043 HOH A O     
1031 O O     . HOH C .   ? 0.7399 0.6591 0.5606 0.0677  0.2704  -0.1453 1044 HOH A O     
1032 O O     . HOH C .   ? 0.6241 0.4890 0.4104 -0.0469 0.0603  0.0721  1045 HOH A O     
1033 O O     . HOH C .   ? 0.5077 0.5857 0.5827 -0.1031 -0.1140 -0.0956 1046 HOH A O     
1034 O O     . HOH C .   ? 0.6137 0.6503 0.6156 -0.2323 -0.0016 -0.1043 1047 HOH A O     
1035 O O     . HOH C .   ? 0.5448 0.4304 0.2918 0.0796  0.1672  -0.0198 1048 HOH A O     
1036 O O     . HOH C .   ? 0.8164 0.4687 0.5354 0.0334  0.2883  -0.0155 1049 HOH A O     
1037 O O     . HOH C .   ? 0.6859 0.7923 0.8616 0.1337  -0.2035 0.0255  1050 HOH A O     
1038 O O     . HOH C .   ? 0.4888 0.5455 0.4805 -0.1261 -0.1513 0.0767  1051 HOH A O     
1039 O O     . HOH C .   ? 0.4500 0.4135 0.4571 -0.0864 0.0604  0.0202  1052 HOH A O     
1040 O O     . HOH C .   ? 0.3810 0.7369 0.4778 -0.0475 0.0839  -0.2224 1053 HOH A O     
1041 O O     . HOH C .   ? 0.6233 0.3812 0.7450 -0.0602 0.0299  -0.0448 1054 HOH A O     
1042 O O     . HOH C .   ? 0.4207 0.6302 0.6721 0.0162  -0.1012 -0.2319 1055 HOH A O     
1043 O O     . HOH C .   ? 0.3702 0.5013 0.5331 0.0209  0.0423  -0.1482 1056 HOH A O     
1044 O O     . HOH C .   ? 0.5711 0.5458 0.4617 0.1398  0.1059  0.1299  1057 HOH A O     
1045 O O     . HOH C .   ? 0.5925 0.4656 0.6176 -0.0083 0.0449  -0.0680 1058 HOH A O     
1046 O O     . HOH C .   ? 0.5030 0.8442 0.7471 0.1887  0.1934  -0.1579 1059 HOH A O     
1047 O O     . HOH C .   ? 0.5668 0.5936 0.4850 0.1106  -0.0416 0.0519  1060 HOH A O     
1048 O O     . HOH C .   ? 0.7484 0.5643 0.8011 0.1400  -0.0473 0.0360  1061 HOH A O     
1049 O O     . HOH C .   ? 0.7328 0.6386 0.7170 0.0222  -0.1603 0.0167  1062 HOH A O     
1050 O O     . HOH C .   ? 0.4786 0.4055 0.5659 0.1308  0.0115  -0.0863 1063 HOH A O     
1051 O O     . HOH C .   ? 0.7107 0.5550 0.5294 -0.1371 0.0222  0.0462  1064 HOH A O     
1052 O O     . HOH C .   ? 0.6225 0.6957 0.7100 0.1662  0.1096  -0.1449 1065 HOH A O     
1053 O O     . HOH C .   ? 0.6194 0.7611 0.7418 0.0786  -0.0593 0.0001  1066 HOH A O     
1054 O O     . HOH C .   ? 0.5966 0.6439 0.4886 0.1986  0.0050  0.0694  1067 HOH A O     
1055 O O     . HOH C .   ? 0.6794 0.6030 0.8014 0.0305  0.0825  0.0041  1068 HOH A O     
1056 O O     . HOH C .   ? 0.5534 0.4785 0.4205 0.0871  -0.0723 -0.0572 1069 HOH A O     
1057 O O     . HOH C .   ? 0.4864 0.6910 0.6702 -0.0623 0.0309  -0.2051 1070 HOH A O     
1058 O O     . HOH C .   ? 0.9997 0.3516 0.6788 -0.0745 -0.0596 -0.0193 1071 HOH A O     
1059 O O     . HOH C .   ? 0.4309 0.5397 0.4432 0.0529  -0.0559 -0.0620 1072 HOH A O     
1060 O O     . HOH C .   ? 0.5806 0.6206 0.6990 0.0385  0.0913  0.0477  1073 HOH A O     
1061 O O     . HOH C .   ? 0.5608 0.7000 0.5670 -0.0613 0.1223  0.0193  1074 HOH A O     
1062 O O     . HOH C .   ? 0.9920 0.7136 0.6618 -0.1213 -0.0031 0.1582  1075 HOH A O     
1063 O O     . HOH C .   ? 0.5196 0.7166 0.6695 -0.0301 0.1855  -0.0554 1076 HOH A O     
1064 O O     . HOH C .   ? 0.6653 0.7511 0.7119 0.0117  0.2628  -0.0258 1077 HOH A O     
1065 O O     . HOH C .   ? 0.6486 0.6504 0.6170 0.0382  -0.0179 0.1310  1078 HOH A O     
1066 O O     . HOH C .   ? 0.8328 0.5642 0.7320 -0.0030 0.1851  -0.1488 1079 HOH A O     
1067 O O     . HOH C .   ? 0.8118 0.5300 0.5789 -0.1401 -0.1736 0.0498  1080 HOH A O     
1068 O O     . HOH C .   ? 0.6181 0.8677 0.9250 0.0705  0.0586  0.0092  1081 HOH A O     
1069 O O     . HOH C .   ? 0.8125 0.7324 0.6789 0.0031  0.3029  -0.1316 1082 HOH A O     
1070 O O     . HOH C .   ? 0.7976 0.6550 0.8503 0.1518  -0.1386 -0.0436 1083 HOH A O     
1071 O O     . HOH C .   ? 0.6678 0.8312 0.6914 -0.0281 -0.1360 0.1569  1084 HOH A O     
1072 O O     . HOH C .   ? 0.7338 0.6689 0.7038 0.1328  0.1880  -0.1912 1085 HOH A O     
1073 O O     . HOH C .   ? 0.6600 0.6424 0.5788 -0.1054 0.0466  0.0709  1086 HOH A O     
1074 O O     . HOH C .   ? 0.5301 0.5631 0.5506 -0.0019 -0.0098 0.0798  1087 HOH A O     
1075 O O     . HOH C .   ? 0.4933 0.9210 0.7760 -0.0671 0.0787  0.0638  1088 HOH A O     
1076 O O     . HOH C .   ? 0.8757 0.4465 0.6588 -0.1474 0.0447  -0.0834 1089 HOH A O     
1077 O O     . HOH C .   ? 0.3493 0.6019 0.6365 -0.1310 -0.0485 0.0485  1090 HOH A O     
1078 O O     . HOH C .   ? 0.4375 0.6119 0.6580 -0.1894 -0.0938 0.0248  1091 HOH A O     
1079 O O     . HOH C .   ? 0.4043 0.6339 0.5319 -0.0698 -0.0857 0.1886  1092 HOH A O     
1080 O O     . HOH C .   ? 0.6487 0.7431 0.5485 -0.0601 -0.0589 -0.0289 1093 HOH A O     
1081 O O     . HOH C .   ? 0.6466 0.4629 0.7494 0.0476  0.0305  -0.2569 1094 HOH A O     
1082 O O     . HOH C .   ? 0.5473 0.8628 0.7854 0.0007  -0.0765 -0.1215 1095 HOH A O     
1083 O O     . HOH C .   ? 0.7317 0.5874 0.7948 0.0159  0.0659  -0.0235 1096 HOH A O     
1084 O O     . HOH C .   ? 0.6281 0.6311 0.7374 0.1411  -0.0177 -0.0464 1097 HOH A O     
1085 O O     . HOH C .   ? 0.5093 0.7570 0.7582 -0.1593 0.0741  0.0272  1098 HOH A O     
1086 O O     . HOH C .   ? 0.6299 0.4443 0.4942 0.1632  0.0539  0.0096  1099 HOH A O     
1087 O O     . HOH C .   ? 0.6965 0.7660 0.7833 0.0384  0.2061  -0.0014 1100 HOH A O     
1088 O O     . HOH C .   ? 0.6887 0.4438 0.3788 -0.0347 0.0478  0.0899  1101 HOH A O     
1089 O O     . HOH C .   ? 0.4386 0.7581 0.6515 0.0194  0.0802  -0.0016 1102 HOH A O     
1090 O O     . HOH C .   ? 0.7532 0.6885 0.8146 0.0432  -0.1565 0.1633  1103 HOH A O     
1091 O O     . HOH C .   ? 0.5497 0.6554 0.5060 0.0190  0.0698  -0.1540 1104 HOH A O     
1092 O O     . HOH C .   ? 0.7313 0.7202 0.6790 0.0003  -0.2088 -0.0572 1105 HOH A O     
1093 O O     . HOH C .   ? 0.5502 0.7590 0.7115 -0.0033 -0.1091 0.0769  1106 HOH A O     
1094 O O     . HOH C .   ? 0.5242 0.8505 0.8107 0.0428  0.0249  -0.1116 1107 HOH A O     
1095 O O     . HOH C .   ? 0.4598 0.7048 0.7469 0.0128  0.0102  0.0274  1108 HOH A O     
1096 O O     . HOH C .   ? 0.3948 0.5871 0.7144 0.0873  0.0777  -0.2088 1109 HOH A O     
1097 O O     . HOH C .   ? 0.6962 0.6778 0.7710 0.0330  -0.0662 0.0030  1110 HOH A O     
1098 O O     . HOH C .   ? 0.7958 0.6232 0.6182 0.0013  0.0847  0.0200  1111 HOH A O     
1099 O O     . HOH C .   ? 0.6892 0.7705 0.9453 0.0790  -0.1915 0.0270  1112 HOH A O     
1100 O O     . HOH C .   ? 0.7998 0.5504 0.5911 -0.3136 -0.1982 -0.0197 1113 HOH A O     
1101 O O     . HOH C .   ? 0.8466 0.7390 0.7032 -0.0703 0.0055  -0.0204 1114 HOH A O     
1102 O O     . HOH C .   ? 0.7450 0.7535 0.8294 0.1471  0.0902  -0.0967 1115 HOH A O     
1103 O O     . HOH C .   ? 0.7916 0.8037 0.5916 -0.1292 -0.0588 0.1280  1116 HOH A O     
1104 O O     . HOH C .   ? 0.7225 0.8488 0.7815 0.0226  -0.0632 0.0235  1117 HOH A O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HC4 1   169  169  HC4 HC4 A . 
C 3 HOH 1   1001 1001 HOH HOH A . 
C 3 HOH 2   1002 1002 HOH HOH A . 
C 3 HOH 3   1003 1003 HOH HOH A . 
C 3 HOH 4   1004 1004 HOH HOH A . 
C 3 HOH 5   1005 1005 HOH HOH A . 
C 3 HOH 6   1006 1006 HOH HOH A . 
C 3 HOH 7   1007 1007 HOH HOH A . 
C 3 HOH 8   1008 1008 HOH HOH A . 
C 3 HOH 9   1009 1009 HOH HOH A . 
C 3 HOH 10  1010 1010 HOH HOH A . 
C 3 HOH 11  1011 1011 HOH HOH A . 
C 3 HOH 12  1012 1012 HOH HOH A . 
C 3 HOH 13  1013 1013 HOH HOH A . 
C 3 HOH 14  1014 1014 HOH HOH A . 
C 3 HOH 15  1015 1015 HOH HOH A . 
C 3 HOH 16  1016 1016 HOH HOH A . 
C 3 HOH 17  1017 1017 HOH HOH A . 
C 3 HOH 18  1018 1018 HOH HOH A . 
C 3 HOH 19  1019 1019 HOH HOH A . 
C 3 HOH 20  1020 1020 HOH HOH A . 
C 3 HOH 21  1021 1021 HOH HOH A . 
C 3 HOH 22  1022 1022 HOH HOH A . 
C 3 HOH 23  1023 1023 HOH HOH A . 
C 3 HOH 24  1024 1024 HOH HOH A . 
C 3 HOH 25  1025 1025 HOH HOH A . 
C 3 HOH 26  1026 1026 HOH HOH A . 
C 3 HOH 27  1027 1027 HOH HOH A . 
C 3 HOH 28  1028 1028 HOH HOH A . 
C 3 HOH 29  1029 1029 HOH HOH A . 
C 3 HOH 30  1030 1030 HOH HOH A . 
C 3 HOH 31  1031 1031 HOH HOH A . 
C 3 HOH 32  1032 1032 HOH HOH A . 
C 3 HOH 33  1033 1033 HOH HOH A . 
C 3 HOH 34  1034 1034 HOH HOH A . 
C 3 HOH 35  1035 1035 HOH HOH A . 
C 3 HOH 36  1036 1036 HOH HOH A . 
C 3 HOH 37  1037 1037 HOH HOH A . 
C 3 HOH 38  1038 1038 HOH HOH A . 
C 3 HOH 39  1039 1039 HOH HOH A . 
C 3 HOH 40  1040 1040 HOH HOH A . 
C 3 HOH 41  1041 1041 HOH HOH A . 
C 3 HOH 42  1042 1042 HOH HOH A . 
C 3 HOH 43  1043 1043 HOH HOH A . 
C 3 HOH 44  1044 1044 HOH HOH A . 
C 3 HOH 45  1045 1045 HOH HOH A . 
C 3 HOH 46  1046 1046 HOH HOH A . 
C 3 HOH 47  1047 1047 HOH HOH A . 
C 3 HOH 48  1048 1048 HOH HOH A . 
C 3 HOH 49  1049 1049 HOH HOH A . 
C 3 HOH 50  1050 1050 HOH HOH A . 
C 3 HOH 51  1051 1051 HOH HOH A . 
C 3 HOH 52  1052 1052 HOH HOH A . 
C 3 HOH 53  1053 1053 HOH HOH A . 
C 3 HOH 54  1054 1054 HOH HOH A . 
C 3 HOH 55  1055 1055 HOH HOH A . 
C 3 HOH 56  1056 1056 HOH HOH A . 
C 3 HOH 57  1057 1057 HOH HOH A . 
C 3 HOH 58  1058 1058 HOH HOH A . 
C 3 HOH 59  1059 1059 HOH HOH A . 
C 3 HOH 60  1060 1060 HOH HOH A . 
C 3 HOH 61  1061 1061 HOH HOH A . 
C 3 HOH 62  1062 1062 HOH HOH A . 
C 3 HOH 63  1063 1063 HOH HOH A . 
C 3 HOH 64  1064 1064 HOH HOH A . 
C 3 HOH 65  1065 1065 HOH HOH A . 
C 3 HOH 66  1066 1066 HOH HOH A . 
C 3 HOH 67  1067 1067 HOH HOH A . 
C 3 HOH 68  1068 1068 HOH HOH A . 
C 3 HOH 69  1069 1069 HOH HOH A . 
C 3 HOH 70  1070 1070 HOH HOH A . 
C 3 HOH 71  1071 1071 HOH HOH A . 
C 3 HOH 72  1072 1072 HOH HOH A . 
C 3 HOH 73  1073 1073 HOH HOH A . 
C 3 HOH 74  1074 1074 HOH HOH A . 
C 3 HOH 75  1075 1075 HOH HOH A . 
C 3 HOH 76  1076 1076 HOH HOH A . 
C 3 HOH 77  1077 1077 HOH HOH A . 
C 3 HOH 78  1078 1078 HOH HOH A . 
C 3 HOH 79  1079 1079 HOH HOH A . 
C 3 HOH 80  1080 1080 HOH HOH A . 
C 3 HOH 81  1081 1081 HOH HOH A . 
C 3 HOH 82  1082 1082 HOH HOH A . 
C 3 HOH 83  1083 1083 HOH HOH A . 
C 3 HOH 84  1084 1084 HOH HOH A . 
C 3 HOH 85  1085 1085 HOH HOH A . 
C 3 HOH 86  1086 1086 HOH HOH A . 
C 3 HOH 87  1087 1087 HOH HOH A . 
C 3 HOH 88  1088 1088 HOH HOH A . 
C 3 HOH 89  1089 1089 HOH HOH A . 
C 3 HOH 90  1090 1090 HOH HOH A . 
C 3 HOH 91  1091 1091 HOH HOH A . 
C 3 HOH 92  1092 1092 HOH HOH A . 
C 3 HOH 93  1093 1093 HOH HOH A . 
C 3 HOH 94  1094 1094 HOH HOH A . 
C 3 HOH 95  1095 1095 HOH HOH A . 
C 3 HOH 96  1096 1096 HOH HOH A . 
C 3 HOH 97  1097 1097 HOH HOH A . 
C 3 HOH 98  1098 1098 HOH HOH A . 
C 3 HOH 99  1099 1099 HOH HOH A . 
C 3 HOH 100 1100 1100 HOH HOH A . 
C 3 HOH 101 1101 1101 HOH HOH A . 
C 3 HOH 102 1102 1102 HOH HOH A . 
C 3 HOH 103 1103 1103 HOH HOH A . 
C 3 HOH 104 1104 1104 HOH HOH A . 
C 3 HOH 105 1105 1105 HOH HOH A . 
C 3 HOH 106 1106 1106 HOH HOH A . 
C 3 HOH 107 1107 1107 HOH HOH A . 
C 3 HOH 108 1108 1108 HOH HOH A . 
C 3 HOH 109 1109 1109 HOH HOH A . 
C 3 HOH 110 1110 1110 HOH HOH A . 
C 3 HOH 111 1111 1111 HOH HOH A . 
C 3 HOH 112 1112 1112 HOH HOH A . 
C 3 HOH 113 1113 1113 HOH HOH A . 
C 3 HOH 114 1114 1114 HOH HOH A . 
C 3 HOH 115 1115 1115 HOH HOH A . 
C 3 HOH 116 1116 1116 HOH HOH A . 
C 3 HOH 117 1117 1117 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-07-24 
5 'Structure model' 1 4 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Refinement description'    
6 5 'Structure model' 'Database references'       
7 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software           
2 4 'Structure model' struct_conn        
3 5 'Structure model' database_2         
4 5 'Structure model' struct_ref_seq_dif 
5 5 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'            
2 4 'Structure model' '_software.name'                      
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 5 'Structure model' '_database_2.pdbx_DOI'                
5 5 'Structure model' '_database_2.pdbx_database_accession' 
6 5 'Structure model' '_struct_ref_seq_dif.details'         
7 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
DENZO     'data reduction' . ? 4 
CNS       phasing          . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 124.66 118.30 6.36  0.90 N 
2 1 CB A ASP 36 ? ? CG A ASP 36 ? ? OD2 A ASP 36 ? ? 111.90 118.30 -6.40 0.90 N 
3 1 CD A LYS 64 ? ? CE A LYS 64 ? ? NZ  A LYS 64 ? ? 134.83 111.70 23.13 2.30 N 
4 1 CB A ASP 65 ? ? CG A ASP 65 ? ? OD2 A ASP 65 ? ? 126.54 118.30 8.24  0.90 N 
5 1 CB A TYR 76 ? ? CG A TYR 76 ? ? CD2 A TYR 76 ? ? 116.54 121.00 -4.46 0.60 N 
6 1 CB A TYR 76 ? ? CG A TYR 76 ? ? CD1 A TYR 76 ? ? 125.25 121.00 4.25  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 75 ? ? -130.82 -77.74 
2 1 ASN A 89 ? ? -167.05 94.45  
3 1 ASP A 97 ? ? -143.63 18.42  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
;4'-HYDROXYCINNAMIC ACID
;
HC4 
3 water                     HOH 
#