data_1OUQ
# 
_entry.id   1OUQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OUQ         
NDB   PD0404       
RCSB  RCSB018683   
WWPDB D_1000018683 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NZB 'pre-cleavage complex (low resolution)'   unspecified 
PDB 1Q3U 'pre-cleavage complex (high resolution)'  unspecified 
PDB 1Q3V 'covalent intermediate (high resolution)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OUQ 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ennifar, E.'   1 
'Meyer, J.E.W.' 2 
'Buchholz, F.'  3 
'Stewart, A.F.' 4 
'Suck, D.'      5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a wild-type Cre recombinase-loxP synapse reveals a novel spacer conformation suggesting an alternative mechanism for DNA cleavage activation
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            31 
_citation.page_first                5449 
_citation.page_last                 5460 
_citation.year                      2003 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12954782 
_citation.pdbx_database_id_DOI      10.1093/nar/gkg732 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ennifar, E.'   1 
primary 'Meyer, J.E.W.' 2 
primary 'Buchholz, F.'  3 
primary 'Stewart, A.F.' 4 
primary 'Suck, D.'      5 
# 
_cell.entry_id           1OUQ 
_cell.length_a           109.500 
_cell.length_b           165.600 
_cell.length_c           193.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OUQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'loxP DNA'        4963.158  2 ? ? ? 
;First strand of loxP site, 5'-end
;
2 polymer     syn 'loxP DNA'        6452.194  2 ? ? ? 
;First strand of loxP site, 3'-end
;
3 polymer     syn 'loxP DNA'        11387.370 2 ? ? ? 'Second strand of loxP site'        
4 polymer     man 'Cre recombinase' 38595.164 4 ? ? ? ?                                   
5 non-polymer syn 'IODIDE ION'      126.904   2 ? ? ? ?                                   
6 non-polymer syn 'MAGNESIUM ION'   24.305    7 ? ? ? ?                                   
7 water       nat water             18.015    3 ? ? ? ?                                   
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        'GST-loxP-cre recombinase fusion protein; Retrofitting vector pRetroES' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DG)(DA)(DT)(DA)(DA)(DC)(UMP)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(A3P)' CGATAACUTCGTATAA C,G     ? 
2 polydeoxyribonucleotide no no  
;(DT)(DG)(DT)(DA)(DT)(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)
(DC)
;
TGTATGCTATACGAAGTTATC X,Y     ? 
3 polydeoxyribonucleotide no no  
;(DG)(DG)(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)(DA)(DT)(DA)
(DC)(DA)(DT)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)(DC)
;
GGATAACTTCGTATAGCATACATTATACGAAGTTATC D,H     ? 
4 'polypeptide(L)'        no no  
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
A,B,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DA  n 
1 4   DT  n 
1 5   DA  n 
1 6   DA  n 
1 7   DC  n 
1 8   UMP n 
1 9   DT  n 
1 10  DC  n 
1 11  DG  n 
1 12  DT  n 
1 13  DA  n 
1 14  DT  n 
1 15  DA  n 
1 16  A3P n 
2 1   DT  n 
2 2   DG  n 
2 3   DT  n 
2 4   DA  n 
2 5   DT  n 
2 6   DG  n 
2 7   DC  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DA  n 
2 12  DC  n 
2 13  DG  n 
2 14  DA  n 
2 15  DA  n 
2 16  DG  n 
2 17  DT  n 
2 18  DT  n 
2 19  DA  n 
2 20  DT  n 
2 21  DC  n 
3 1   DG  n 
3 2   DG  n 
3 3   DA  n 
3 4   DT  n 
3 5   DA  n 
3 6   DA  n 
3 7   DC  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DG  n 
3 12  DT  n 
3 13  DA  n 
3 14  DT  n 
3 15  DA  n 
3 16  DG  n 
3 17  DC  n 
3 18  DA  n 
3 19  DT  n 
3 20  DA  n 
3 21  DC  n 
3 22  DA  n 
3 23  DT  n 
3 24  DT  n 
3 25  DA  n 
3 26  DT  n 
3 27  DA  n 
3 28  DC  n 
3 29  DG  n 
3 30  DA  n 
3 31  DA  n 
3 32  DG  n 
3 33  DT  n 
3 34  DT  n 
3 35  DA  n 
3 36  DT  n 
3 37  DC  n 
4 1   MET n 
4 2   SER n 
4 3   ASN n 
4 4   LEU n 
4 5   LEU n 
4 6   THR n 
4 7   VAL n 
4 8   HIS n 
4 9   GLN n 
4 10  ASN n 
4 11  LEU n 
4 12  PRO n 
4 13  ALA n 
4 14  LEU n 
4 15  PRO n 
4 16  VAL n 
4 17  ASP n 
4 18  ALA n 
4 19  THR n 
4 20  SER n 
4 21  ASP n 
4 22  GLU n 
4 23  VAL n 
4 24  ARG n 
4 25  LYS n 
4 26  ASN n 
4 27  LEU n 
4 28  MET n 
4 29  ASP n 
4 30  MET n 
4 31  PHE n 
4 32  ARG n 
4 33  ASP n 
4 34  ARG n 
4 35  GLN n 
4 36  ALA n 
4 37  PHE n 
4 38  SER n 
4 39  GLU n 
4 40  HIS n 
4 41  THR n 
4 42  TRP n 
4 43  LYS n 
4 44  MET n 
4 45  LEU n 
4 46  LEU n 
4 47  SER n 
4 48  VAL n 
4 49  CYS n 
4 50  ARG n 
4 51  SER n 
4 52  TRP n 
4 53  ALA n 
4 54  ALA n 
4 55  TRP n 
4 56  CYS n 
4 57  LYS n 
4 58  LEU n 
4 59  ASN n 
4 60  ASN n 
4 61  ARG n 
4 62  LYS n 
4 63  TRP n 
4 64  PHE n 
4 65  PRO n 
4 66  ALA n 
4 67  GLU n 
4 68  PRO n 
4 69  GLU n 
4 70  ASP n 
4 71  VAL n 
4 72  ARG n 
4 73  ASP n 
4 74  TYR n 
4 75  LEU n 
4 76  LEU n 
4 77  TYR n 
4 78  LEU n 
4 79  GLN n 
4 80  ALA n 
4 81  ARG n 
4 82  GLY n 
4 83  LEU n 
4 84  ALA n 
4 85  VAL n 
4 86  LYS n 
4 87  THR n 
4 88  ILE n 
4 89  GLN n 
4 90  GLN n 
4 91  HIS n 
4 92  LEU n 
4 93  GLY n 
4 94  GLN n 
4 95  LEU n 
4 96  ASN n 
4 97  MET n 
4 98  LEU n 
4 99  HIS n 
4 100 ARG n 
4 101 ARG n 
4 102 SER n 
4 103 GLY n 
4 104 LEU n 
4 105 PRO n 
4 106 ARG n 
4 107 PRO n 
4 108 SER n 
4 109 ASP n 
4 110 SER n 
4 111 ASN n 
4 112 ALA n 
4 113 VAL n 
4 114 SER n 
4 115 LEU n 
4 116 VAL n 
4 117 MET n 
4 118 ARG n 
4 119 ARG n 
4 120 ILE n 
4 121 ARG n 
4 122 LYS n 
4 123 GLU n 
4 124 ASN n 
4 125 VAL n 
4 126 ASP n 
4 127 ALA n 
4 128 GLY n 
4 129 GLU n 
4 130 ARG n 
4 131 ALA n 
4 132 LYS n 
4 133 GLN n 
4 134 ALA n 
4 135 LEU n 
4 136 ALA n 
4 137 PHE n 
4 138 GLU n 
4 139 ARG n 
4 140 THR n 
4 141 ASP n 
4 142 PHE n 
4 143 ASP n 
4 144 GLN n 
4 145 VAL n 
4 146 ARG n 
4 147 SER n 
4 148 LEU n 
4 149 MET n 
4 150 GLU n 
4 151 ASN n 
4 152 SER n 
4 153 ASP n 
4 154 ARG n 
4 155 CYS n 
4 156 GLN n 
4 157 ASP n 
4 158 ILE n 
4 159 ARG n 
4 160 ASN n 
4 161 LEU n 
4 162 ALA n 
4 163 PHE n 
4 164 LEU n 
4 165 GLY n 
4 166 ILE n 
4 167 ALA n 
4 168 TYR n 
4 169 ASN n 
4 170 THR n 
4 171 LEU n 
4 172 LEU n 
4 173 ARG n 
4 174 ILE n 
4 175 ALA n 
4 176 GLU n 
4 177 ILE n 
4 178 ALA n 
4 179 ARG n 
4 180 ILE n 
4 181 ARG n 
4 182 VAL n 
4 183 LYS n 
4 184 ASP n 
4 185 ILE n 
4 186 SER n 
4 187 ARG n 
4 188 THR n 
4 189 ASP n 
4 190 GLY n 
4 191 GLY n 
4 192 ARG n 
4 193 MET n 
4 194 LEU n 
4 195 ILE n 
4 196 HIS n 
4 197 ILE n 
4 198 GLY n 
4 199 ARG n 
4 200 THR n 
4 201 LYS n 
4 202 THR n 
4 203 LEU n 
4 204 VAL n 
4 205 SER n 
4 206 THR n 
4 207 ALA n 
4 208 GLY n 
4 209 VAL n 
4 210 GLU n 
4 211 LYS n 
4 212 ALA n 
4 213 LEU n 
4 214 SER n 
4 215 LEU n 
4 216 GLY n 
4 217 VAL n 
4 218 THR n 
4 219 LYS n 
4 220 LEU n 
4 221 VAL n 
4 222 GLU n 
4 223 ARG n 
4 224 TRP n 
4 225 ILE n 
4 226 SER n 
4 227 VAL n 
4 228 SER n 
4 229 GLY n 
4 230 VAL n 
4 231 ALA n 
4 232 ASP n 
4 233 ASP n 
4 234 PRO n 
4 235 ASN n 
4 236 ASN n 
4 237 TYR n 
4 238 LEU n 
4 239 PHE n 
4 240 CYS n 
4 241 ARG n 
4 242 VAL n 
4 243 ARG n 
4 244 LYS n 
4 245 ASN n 
4 246 GLY n 
4 247 VAL n 
4 248 ALA n 
4 249 ALA n 
4 250 PRO n 
4 251 SER n 
4 252 ALA n 
4 253 THR n 
4 254 SER n 
4 255 GLN n 
4 256 LEU n 
4 257 SER n 
4 258 THR n 
4 259 ARG n 
4 260 ALA n 
4 261 LEU n 
4 262 GLU n 
4 263 GLY n 
4 264 ILE n 
4 265 PHE n 
4 266 GLU n 
4 267 ALA n 
4 268 THR n 
4 269 HIS n 
4 270 ARG n 
4 271 LEU n 
4 272 ILE n 
4 273 TYR n 
4 274 GLY n 
4 275 ALA n 
4 276 LYS n 
4 277 ASP n 
4 278 ASP n 
4 279 SER n 
4 280 GLY n 
4 281 GLN n 
4 282 ARG n 
4 283 TYR n 
4 284 LEU n 
4 285 ALA n 
4 286 TRP n 
4 287 SER n 
4 288 GLY n 
4 289 HIS n 
4 290 SER n 
4 291 ALA n 
4 292 ARG n 
4 293 VAL n 
4 294 GLY n 
4 295 ALA n 
4 296 ALA n 
4 297 ARG n 
4 298 ASP n 
4 299 MET n 
4 300 ALA n 
4 301 ARG n 
4 302 ALA n 
4 303 GLY n 
4 304 VAL n 
4 305 SER n 
4 306 ILE n 
4 307 PRO n 
4 308 GLU n 
4 309 ILE n 
4 310 MET n 
4 311 GLN n 
4 312 ALA n 
4 313 GLY n 
4 314 GLY n 
4 315 TRP n 
4 316 THR n 
4 317 ASN n 
4 318 VAL n 
4 319 ASN n 
4 320 ILE n 
4 321 VAL n 
4 322 MET n 
4 323 ASN n 
4 324 TYR n 
4 325 ILE n 
4 326 ARG n 
4 327 ASN n 
4 328 LEU n 
4 329 ASP n 
4 330 SER n 
4 331 GLU n 
4 332 THR n 
4 333 GLY n 
4 334 ALA n 
4 335 MET n 
4 336 VAL n 
4 337 ARG n 
4 338 LEU n 
4 339 LEU n 
4 340 GLU n 
4 341 ASP n 
4 342 GLY n 
4 343 ASP n 
# 
_entity_src_gen.entity_id                          4 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGem 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 4 UNP RECR_BPP1 P06956 1 
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
? 
2 1 PDB 1OUQ      1OUQ   ? ? ? 
3 2 PDB 1OUQ      1OUQ   ? ? ? 
4 3 PDB 1OUQ      1OUQ   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1OUQ A 1 ? 343 ? P06956 1   ? 343 ? 1   343 
2  1 1OUQ B 1 ? 343 ? P06956 1   ? 343 ? 1   343 
3  1 1OUQ E 1 ? 343 ? P06956 1   ? 343 ? 1   343 
4  1 1OUQ F 1 ? 343 ? P06956 1   ? 343 ? 1   343 
5  2 1OUQ C 1 ? 16  ? 1OUQ   100 ? 115 ? 100 115 
6  3 1OUQ X 1 ? 21  ? 1OUQ   116 ? 136 ? 116 136 
7  4 1OUQ D 1 ? 37  ? 1OUQ   100 ? 136 ? 100 136 
8  2 1OUQ G 1 ? 16  ? 1OUQ   100 ? 115 ? 100 115 
9  3 1OUQ Y 1 ? 21  ? 1OUQ   116 ? 136 ? 116 136 
10 4 1OUQ H 1 ? 37  ? 1OUQ   100 ? 136 ? 100 136 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A3P 'RNA linking'       n "ADENOSINE-3'-5'-DIPHOSPHATE"        ?    'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?    'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?    'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?    'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?    'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?    'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?    'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?    'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?    'C6 H13 N O2'       131.173 
IOD non-polymer         . 'IODIDE ION'                         ?    'I -1'              126.904 
LEU 'L-peptide linking' y LEUCINE                              ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?    'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?    'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?    'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?    'C9 H11 N O3'       181.189 
UMP non-polymer         . 
;2'-DEOXYURIDINE 5'-MONOPHOSPHATE
;
DUMP 'C9 H13 N2 O8 P'    308.182 
VAL 'L-peptide linking' y VALINE                               ?    'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1OUQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   73.7 
_exptl_crystal.density_Matthews      4.72 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.pdbx_details    
'NaCl, EDTA, Glycerol, HEPES, MgCl2, PEG 2000, MME, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 MME        ? ? ? 
1 2  1 HEPES      ? ? ? 
1 3  1 NaCl       ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 EDTA       ? ? ? 
1 6  1 Glycerol   ? ? ? 
1 7  1 'PEG 2000' ? ? ? 
1 8  2 NaCl       ? ? ? 
1 9  2 MgCl2      ? ? ? 
1 10 2 EDTA       ? ? ? 
1 11 2 Glycerol   ? ? ? 
1 12 2 'PEG 2000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-11-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    crystal 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1OUQ 
_reflns.observed_criterion_sigma_I   -3. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8.0 
_reflns.d_resolution_high            3.20 
_reflns.number_obs                   51910 
_reflns.number_all                   54795 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.154 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        63.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.29 
_reflns_shell.percent_possible_all   86.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OUQ 
_refine.ls_number_reflns_obs                     51908 
_refine.ls_number_reflns_all                     54795 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    94.7 
_refine.ls_R_factor_obs                          0.21 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2626 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               57.8 
_refine.aniso_B[1][1]                            1.46 
_refine.aniso_B[2][2]                            8.36 
_refine.aniso_B[3][3]                            -9.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.343957 
_refine.solvent_model_param_bsol                 55.7878 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1NZB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1OUQ 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.46 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10264 
_refine_hist.pdbx_number_atoms_nucleic_acid   3020 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               13296 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.022 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.32  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.52  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.74  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.01  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.20 
_refine_ls_shell.d_res_low                        3.39 
_refine_ls_shell.number_reflns_R_work             7413 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.percent_reflns_obs               86.3 
_refine_ls_shell.R_factor_R_free                  0.339 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             369 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 DNA-RNA_REP.PARAM ION.TOP     'X-RAY DIFFRACTION' 
4 ION.PARAM         WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1OUQ 
_struct.title                     'Crystal structure of wild-type Cre recombinase-loxP synapse' 
_struct.pdbx_descriptor           'Cre recombinase/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OUQ 
_struct_keywords.pdbx_keywords   REPLICATION/DNA 
_struct_keywords.text            'Cre, recombinase, DNA, REPLICATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 5 ? 
T N N 7 ? 
U N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;dimeric Cre recombinase covalently linked to a loxP DNA through a 3'-phosphotyrosine
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU G 22  ? ASP G 33  ? GLU A 22  ASP A 33  1 ? 12 
HELX_P HELX_P2  2  ARG G 34  ? PHE G 37  ? ARG A 34  PHE A 37  5 ? 4  
HELX_P HELX_P3  3  SER G 38  ? ASN G 60  ? SER A 38  ASN A 60  1 ? 23 
HELX_P HELX_P4  4  GLU G 67  ? GLY G 82  ? GLU A 67  GLY A 82  1 ? 16 
HELX_P HELX_P5  5  ALA G 84  ? ARG G 101 ? ALA A 84  ARG A 101 1 ? 18 
HELX_P HELX_P6  6  SER G 110 ? ALA G 127 ? SER A 110 ALA A 127 1 ? 18 
HELX_P HELX_P7  7  GLU G 138 ? GLU G 150 ? GLU A 138 GLU A 150 1 ? 13 
HELX_P HELX_P8  8  ARG G 154 ? LEU G 171 ? ARG A 154 LEU A 171 1 ? 18 
HELX_P HELX_P9  9  ARG G 173 ? ALA G 178 ? ARG A 173 ALA A 178 1 ? 6  
HELX_P HELX_P10 10 ARG G 179 ? ILE G 180 ? ARG A 179 ILE A 180 5 ? 2  
HELX_P HELX_P11 11 ARG G 181 ? LYS G 183 ? ARG A 181 LYS A 183 5 ? 3  
HELX_P HELX_P12 12 SER G 214 ? GLY G 229 ? SER A 214 GLY A 229 1 ? 16 
HELX_P HELX_P13 13 SER G 257 ? GLY G 274 ? SER A 257 GLY A 274 1 ? 18 
HELX_P HELX_P14 14 HIS G 289 ? ALA G 302 ? HIS A 289 ALA A 302 1 ? 14 
HELX_P HELX_P15 15 SER G 305 ? GLY G 314 ? SER A 305 GLY A 314 1 ? 10 
HELX_P HELX_P16 16 VAL G 318 ? ILE G 325 ? VAL A 318 ILE A 325 1 ? 8  
HELX_P HELX_P17 17 LEU G 328 ? THR G 332 ? LEU A 328 THR A 332 5 ? 5  
HELX_P HELX_P18 18 GLY G 333 ? GLU G 340 ? GLY A 333 GLU A 340 1 ? 8  
HELX_P HELX_P19 19 GLU H 22  ? ASP H 33  ? GLU B 22  ASP B 33  1 ? 12 
HELX_P HELX_P20 20 ARG H 34  ? PHE H 37  ? ARG B 34  PHE B 37  5 ? 4  
HELX_P HELX_P21 21 SER H 38  ? LEU H 58  ? SER B 38  LEU B 58  1 ? 21 
HELX_P HELX_P22 22 GLU H 67  ? ARG H 81  ? GLU B 67  ARG B 81  1 ? 15 
HELX_P HELX_P23 23 ALA H 84  ? SER H 102 ? ALA B 84  SER B 102 1 ? 19 
HELX_P HELX_P24 24 ARG H 106 ? ASP H 109 ? ARG B 106 ASP B 109 5 ? 4  
HELX_P HELX_P25 25 SER H 110 ? GLY H 128 ? SER B 110 GLY B 128 1 ? 19 
HELX_P HELX_P26 26 GLU H 138 ? SER H 147 ? GLU B 138 SER B 147 1 ? 10 
HELX_P HELX_P27 27 ARG H 154 ? LEU H 171 ? ARG B 154 LEU B 171 1 ? 18 
HELX_P HELX_P28 28 ARG H 173 ? ILE H 180 ? ARG B 173 ILE B 180 1 ? 8  
HELX_P HELX_P29 29 ARG H 181 ? ILE H 185 ? ARG B 181 ILE B 185 5 ? 5  
HELX_P HELX_P30 30 SER H 214 ? GLY H 229 ? SER B 214 GLY B 229 1 ? 16 
HELX_P HELX_P31 31 SER H 257 ? GLY H 274 ? SER B 257 GLY B 274 1 ? 18 
HELX_P HELX_P32 32 HIS H 289 ? GLY H 303 ? HIS B 289 GLY B 303 1 ? 15 
HELX_P HELX_P33 33 SER H 305 ? ALA H 312 ? SER B 305 ALA B 312 1 ? 8  
HELX_P HELX_P34 34 ASN H 317 ? MET H 322 ? ASN B 317 MET B 322 1 ? 6  
HELX_P HELX_P35 35 ASN H 323 ? ILE H 325 ? ASN B 323 ILE B 325 5 ? 3  
HELX_P HELX_P36 36 ALA H 334 ? ASP H 341 ? ALA B 334 ASP B 341 1 ? 8  
HELX_P HELX_P37 37 GLU I 22  ? ASP I 33  ? GLU E 22  ASP E 33  1 ? 12 
HELX_P HELX_P38 38 ARG I 34  ? PHE I 37  ? ARG E 34  PHE E 37  5 ? 4  
HELX_P HELX_P39 39 SER I 38  ? LYS I 57  ? SER E 38  LYS E 57  1 ? 20 
HELX_P HELX_P40 40 GLU I 67  ? ARG I 81  ? GLU E 67  ARG E 81  1 ? 15 
HELX_P HELX_P41 41 ALA I 84  ? ARG I 101 ? ALA E 84  ARG E 101 1 ? 18 
HELX_P HELX_P42 42 SER I 110 ? ALA I 127 ? SER E 110 ALA E 127 1 ? 18 
HELX_P HELX_P43 43 GLU I 138 ? LEU I 148 ? GLU E 138 LEU E 148 1 ? 11 
HELX_P HELX_P44 44 ARG I 154 ? LEU I 171 ? ARG E 154 LEU E 171 1 ? 18 
HELX_P HELX_P45 45 ARG I 173 ? ILE I 180 ? ARG E 173 ILE E 180 1 ? 8  
HELX_P HELX_P46 46 ARG I 181 ? ILE I 185 ? ARG E 181 ILE E 185 5 ? 5  
HELX_P HELX_P47 47 LEU I 215 ? SER I 228 ? LEU E 215 SER E 228 1 ? 14 
HELX_P HELX_P48 48 SER I 257 ? GLY I 274 ? SER E 257 GLY E 274 1 ? 18 
HELX_P HELX_P49 49 HIS I 289 ? GLY I 303 ? HIS E 289 GLY E 303 1 ? 15 
HELX_P HELX_P50 50 SER I 305 ? GLY I 314 ? SER E 305 GLY E 314 1 ? 10 
HELX_P HELX_P51 51 VAL I 318 ? ARG I 326 ? VAL E 318 ARG E 326 1 ? 9  
HELX_P HELX_P52 52 ASP I 329 ? THR I 332 ? ASP E 329 THR E 332 5 ? 4  
HELX_P HELX_P53 53 GLY I 333 ? GLU I 340 ? GLY E 333 GLU E 340 1 ? 8  
HELX_P HELX_P54 54 SER J 20  ? ARG J 32  ? SER F 20  ARG F 32  1 ? 13 
HELX_P HELX_P55 55 ASP J 33  ? PHE J 37  ? ASP F 33  PHE F 37  5 ? 5  
HELX_P HELX_P56 56 SER J 38  ? LEU J 58  ? SER F 38  LEU F 58  1 ? 21 
HELX_P HELX_P57 57 GLU J 67  ? ARG J 81  ? GLU F 67  ARG F 81  1 ? 15 
HELX_P HELX_P58 58 ALA J 84  ? GLY J 103 ? ALA F 84  GLY F 103 1 ? 20 
HELX_P HELX_P59 59 ARG J 106 ? ASP J 109 ? ARG F 106 ASP F 109 5 ? 4  
HELX_P HELX_P60 60 SER J 110 ? ALA J 127 ? SER F 110 ALA F 127 1 ? 18 
HELX_P HELX_P61 61 GLU J 138 ? GLU J 150 ? GLU F 138 GLU F 150 1 ? 13 
HELX_P HELX_P62 62 ARG J 154 ? LEU J 171 ? ARG F 154 LEU F 171 1 ? 18 
HELX_P HELX_P63 63 ARG J 173 ? ARG J 179 ? ARG F 173 ARG F 179 1 ? 7  
HELX_P HELX_P64 64 ARG J 181 ? LYS J 183 ? ARG F 181 LYS F 183 5 ? 3  
HELX_P HELX_P65 65 SER J 214 ? GLY J 229 ? SER F 214 GLY F 229 1 ? 16 
HELX_P HELX_P66 66 SER J 257 ? TYR J 273 ? SER F 257 TYR F 273 1 ? 17 
HELX_P HELX_P67 67 HIS J 289 ? ALA J 302 ? HIS F 289 ALA F 302 1 ? 14 
HELX_P HELX_P68 68 SER J 305 ? GLY J 314 ? SER F 305 GLY F 314 1 ? 10 
HELX_P HELX_P69 69 ASN J 317 ? TYR J 324 ? ASN F 317 TYR F 324 1 ? 8  
HELX_P HELX_P70 70 ALA J 334 ? GLU J 340 ? ALA F 334 GLU F 340 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale ? ? A DC  7  "O3'" ? ? ? 1_555 A UMP 8   P   ? ? C DC  106 C UMP 107 1_555 ? ? ? ? ? ? ?               1.610 ? 
covale2   covale ? ? A UMP 8  "O3'" ? ? ? 1_555 A DT  9   P   ? ? C UMP 107 C DT  108 1_555 ? ? ? ? ? ? ?               1.601 ? 
covale3   covale ? ? A DA  15 "O3'" ? ? ? 1_555 A A3P 16  P2  ? ? C DA  114 C A3P 115 1_555 ? ? ? ? ? ? ?               1.589 ? 
covale4   covale ? ? A A3P 16 P1    ? ? ? 1_555 H TYR 324 OH  ? ? C A3P 115 B TYR 324 1_555 ? ? ? ? ? ? ?               1.601 ? 
covale5   covale ? ? D DC  7  "O3'" ? ? ? 1_555 D UMP 8   P   ? ? G DC  106 G UMP 107 1_555 ? ? ? ? ? ? ?               1.628 ? 
covale6   covale ? ? D UMP 8  "O3'" ? ? ? 1_555 D DT  9   P   ? ? G UMP 107 G DT  108 1_555 ? ? ? ? ? ? ?               1.605 ? 
covale7   covale ? ? D DA  15 "O3'" ? ? ? 1_555 D A3P 16  P2  ? ? G DA  114 G A3P 115 1_555 ? ? ? ? ? ? ?               1.599 ? 
covale8   covale ? ? D A3P 16 P1    ? ? ? 1_555 J TYR 324 OH  ? ? G A3P 115 F TYR 324 1_555 ? ? ? ? ? ? ?               1.751 ? 
metalc1   metalc ? ? N MG  .  MG    ? ? ? 1_555 C DT  12  O4  ? ? A MG  344 D DT  111 1_555 ? ? ? ? ? ? ?               3.148 ? 
metalc2   metalc ? ? L MG  .  MG    ? ? ? 1_555 C DA  6   N7  ? ? D MG  310 D DA  105 1_555 ? ? ? ? ? ? ?               3.014 ? 
metalc3   metalc ? ? R MG  .  MG    ? ? ? 1_555 J HIS 91  NE2 ? ? F MG  344 F HIS 91  1_555 ? ? ? ? ? ? ?               2.267 ? 
hydrog1   hydrog ? ? A DG  2  N1    ? ? ? 1_555 C DC  37  N3  ? ? C DG  101 D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DG  2  N2    ? ? ? 1_555 C DC  37  O2  ? ? C DG  101 D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DG  2  O6    ? ? ? 1_555 C DC  37  N4  ? ? C DG  101 D DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DA  3  N6    ? ? ? 1_555 C DA  35  N1  ? ? C DA  102 D DA  134 1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog5   hydrog ? ? A DA  3  N1    ? ? ? 1_555 C DT  36  N3  ? ? C DA  102 D DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DA  3  N6    ? ? ? 1_555 C DT  36  O4  ? ? C DA  102 D DT  135 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DT  4  N3    ? ? ? 1_555 C DA  35  N1  ? ? C DT  103 D DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DT  4  O4    ? ? ? 1_555 C DA  35  N6  ? ? C DT  103 D DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DA  5  N6    ? ? ? 1_555 C DT  33  O4  ? ? C DA  104 D DT  132 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog10  hydrog ? ? A DA  5  N1    ? ? ? 1_555 C DT  34  N3  ? ? C DA  104 D DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DA  5  N6    ? ? ? 1_555 C DT  34  O4  ? ? C DA  104 D DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DA  6  N1    ? ? ? 1_555 C DT  33  N3  ? ? C DA  105 D DT  132 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog13  hydrog ? ? A DC  7  N3    ? ? ? 1_555 C DG  32  N1  ? ? C DC  106 D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DC  7  N4    ? ? ? 1_555 C DG  32  O6  ? ? C DC  106 D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DC  7  O2    ? ? ? 1_555 C DG  32  N2  ? ? C DC  106 D DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A UMP 8  O4    ? ? ? 1_555 C DA  30  N6  ? ? C UMP 107 D DA  129 1_555 ? ? ? ? ? ? 'UMP-DA PAIR'   ?     ? 
hydrog17  hydrog ? ? A UMP 8  N3    ? ? ? 1_555 C DA  31  N1  ? ? C UMP 107 D DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A UMP 8  O4    ? ? ? 1_555 C DA  31  N6  ? ? C UMP 107 D DA  130 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DT  9  N3    ? ? ? 1_555 C DA  30  N1  ? ? C DT  108 D DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DT  9  O4    ? ? ? 1_555 C DA  30  N6  ? ? C DT  108 D DA  129 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DC  10 N3    ? ? ? 1_555 C DG  29  N1  ? ? C DC  109 D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DC  10 N4    ? ? ? 1_555 C DG  29  O6  ? ? C DC  109 D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DC  10 O2    ? ? ? 1_555 C DG  29  N2  ? ? C DC  109 D DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DG  11 N1    ? ? ? 1_555 C DC  28  N3  ? ? C DG  110 D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DG  11 N2    ? ? ? 1_555 C DC  28  O2  ? ? C DG  110 D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DG  11 O6    ? ? ? 1_555 C DC  28  N4  ? ? C DG  110 D DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DT  12 N3    ? ? ? 1_555 C DA  27  N1  ? ? C DT  111 D DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DT  12 O4    ? ? ? 1_555 C DA  27  N6  ? ? C DT  111 D DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DA  13 N1    ? ? ? 1_555 C DT  26  N3  ? ? C DA  112 D DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DA  13 N6    ? ? ? 1_555 C DT  26  O4  ? ? C DA  112 D DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DT  14 N3    ? ? ? 1_555 C DA  25  N1  ? ? C DT  113 D DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DT  14 O4    ? ? ? 1_555 C DA  25  N6  ? ? C DT  113 D DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DA  15 N1    ? ? ? 1_555 C DT  24  N3  ? ? C DA  114 D DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DA  15 N6    ? ? ? 1_555 C DT  24  O4  ? ? C DA  114 D DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? B DT  1  N3    ? ? ? 1_555 C DA  22  N1  ? ? X DT  116 D DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? B DT  1  O4    ? ? ? 1_555 C DA  22  N6  ? ? X DT  116 D DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? B DG  2  N1    ? ? ? 1_555 C DC  21  N3  ? ? X DG  117 D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? B DG  2  N2    ? ? ? 1_555 C DC  21  O2  ? ? X DG  117 D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? B DG  2  O6    ? ? ? 1_555 C DC  21  N4  ? ? X DG  117 D DC  120 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? B DT  3  N3    ? ? ? 1_555 C DA  20  N1  ? ? X DT  118 D DA  119 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog41  hydrog ? ? B DA  4  N1    ? ? ? 1_555 C DT  19  N3  ? ? X DA  119 D DT  118 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog42  hydrog ? ? B DT  5  N3    ? ? ? 1_555 C DA  18  N1  ? ? X DT  120 D DA  117 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog43  hydrog ? ? B DG  6  N1    ? ? ? 1_555 C DC  17  N3  ? ? X DG  121 D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? B DG  6  N2    ? ? ? 1_555 C DC  17  O2  ? ? X DG  121 D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? B DG  6  O6    ? ? ? 1_555 C DC  17  N4  ? ? X DG  121 D DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? B DC  7  N3    ? ? ? 1_555 C DG  16  N1  ? ? X DC  122 D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? B DC  7  N4    ? ? ? 1_555 C DG  16  O6  ? ? X DC  122 D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? B DC  7  O2    ? ? ? 1_555 C DG  16  N2  ? ? X DC  122 D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? B DT  8  N3    ? ? ? 1_555 C DA  15  N1  ? ? X DT  123 D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? B DT  8  O4    ? ? ? 1_555 C DA  15  N6  ? ? X DT  123 D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? B DA  9  N1    ? ? ? 1_555 C DT  14  N3  ? ? X DA  124 D DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? B DA  9  N6    ? ? ? 1_555 C DT  14  O4  ? ? X DA  124 D DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? B DT  10 N3    ? ? ? 1_555 C DA  13  N1  ? ? X DT  125 D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? B DT  10 O4    ? ? ? 1_555 C DA  13  N6  ? ? X DT  125 D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? B DA  11 N1    ? ? ? 1_555 C DT  12  N3  ? ? X DA  126 D DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? B DA  11 N6    ? ? ? 1_555 C DT  12  O4  ? ? X DA  126 D DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? B DC  12 N3    ? ? ? 1_555 C DG  11  N1  ? ? X DC  127 D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? B DC  12 N4    ? ? ? 1_555 C DG  11  O6  ? ? X DC  127 D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? B DC  12 O2    ? ? ? 1_555 C DG  11  N2  ? ? X DC  127 D DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? B DG  13 N1    ? ? ? 1_555 C DC  10  N3  ? ? X DG  128 D DC  109 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog61  hydrog ? ? B DA  14 N1    ? ? ? 1_555 C DT  9   N3  ? ? X DA  129 D DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? B DA  14 N6    ? ? ? 1_555 C DT  9   O4  ? ? X DA  129 D DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? B DA  15 N1    ? ? ? 1_555 C DT  8   N3  ? ? X DA  130 D DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? B DA  15 N6    ? ? ? 1_555 C DT  8   O4  ? ? X DA  130 D DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? B DG  16 N1    ? ? ? 1_555 C DC  7   O2  ? ? X DG  131 D DC  106 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog66  hydrog ? ? B DT  17 N3    ? ? ? 1_555 C DA  6   N1  ? ? X DT  132 D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? B DT  17 O4    ? ? ? 1_555 C DA  6   N6  ? ? X DT  132 D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? B DT  18 N3    ? ? ? 1_555 C DA  5   N1  ? ? X DT  133 D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? B DT  18 O4    ? ? ? 1_555 C DA  5   N6  ? ? X DT  133 D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? B DA  19 N1    ? ? ? 1_555 C DT  4   N3  ? ? X DA  134 D DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? B DA  19 N6    ? ? ? 1_555 C DT  4   O4  ? ? X DA  134 D DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? B DT  20 N3    ? ? ? 1_555 C DA  3   N1  ? ? X DT  135 D DA  102 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog73  hydrog ? ? B DC  21 N3    ? ? ? 1_555 C DG  2   N1  ? ? X DC  136 D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? B DC  21 N4    ? ? ? 1_555 C DG  2   O6  ? ? X DC  136 D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? B DC  21 O2    ? ? ? 1_555 C DG  2   N2  ? ? X DC  136 D DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? D DG  2  N1    ? ? ? 1_555 F DC  37  N3  ? ? G DG  101 H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? D DG  2  N2    ? ? ? 1_555 F DC  37  O2  ? ? G DG  101 H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? D DG  2  O6    ? ? ? 1_555 F DC  37  N4  ? ? G DG  101 H DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? D DA  3  N1    ? ? ? 1_555 F DT  36  N3  ? ? G DA  102 H DT  135 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog80  hydrog ? ? D DT  4  N3    ? ? ? 1_555 F DA  35  N1  ? ? G DT  103 H DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? D DT  4  O4    ? ? ? 1_555 F DA  35  N6  ? ? G DT  103 H DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? D DA  5  N1    ? ? ? 1_555 F DT  34  N3  ? ? G DA  104 H DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? D DA  5  N6    ? ? ? 1_555 F DT  34  O4  ? ? G DA  104 H DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? D DA  6  N1    ? ? ? 1_555 F DT  33  N3  ? ? G DA  105 H DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? D DA  6  N6    ? ? ? 1_555 F DT  33  O4  ? ? G DA  105 H DT  132 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? D DC  7  N3    ? ? ? 1_555 F DG  32  N1  ? ? G DC  106 H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? D DC  7  N4    ? ? ? 1_555 F DG  32  O6  ? ? G DC  106 H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? D DC  7  O2    ? ? ? 1_555 F DG  32  N2  ? ? G DC  106 H DG  131 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? D UMP 8  N3    ? ? ? 1_555 F DA  31  N1  ? ? G UMP 107 H DA  130 1_555 ? ? ? ? ? ? 'UMP-DA PAIR'   ?     ? 
hydrog90  hydrog ? ? D DT  9  N3    ? ? ? 1_555 F DA  30  N1  ? ? G DT  108 H DA  129 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog91  hydrog ? ? D DC  10 N3    ? ? ? 1_555 F DG  29  N1  ? ? G DC  109 H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? D DC  10 N4    ? ? ? 1_555 F DG  29  O6  ? ? G DC  109 H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? D DC  10 O2    ? ? ? 1_555 F DG  29  N2  ? ? G DC  109 H DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? D DG  11 N1    ? ? ? 1_555 F DC  28  N3  ? ? G DG  110 H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? D DG  11 N2    ? ? ? 1_555 F DC  28  O2  ? ? G DG  110 H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? D DG  11 O6    ? ? ? 1_555 F DC  28  N4  ? ? G DG  110 H DC  127 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? D DT  12 N3    ? ? ? 1_555 F DA  27  N1  ? ? G DT  111 H DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? D DT  12 O4    ? ? ? 1_555 F DA  27  N6  ? ? G DT  111 H DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? D DA  13 N1    ? ? ? 1_555 F DT  26  N3  ? ? G DA  112 H DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? D DA  13 N6    ? ? ? 1_555 F DT  26  O4  ? ? G DA  112 H DT  125 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? D DT  14 N3    ? ? ? 1_555 F DA  25  N1  ? ? G DT  113 H DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? D DT  14 O4    ? ? ? 1_555 F DA  25  N6  ? ? G DT  113 H DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? D DA  15 N1    ? ? ? 1_555 F DT  24  N3  ? ? G DA  114 H DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? D DA  15 N6    ? ? ? 1_555 F DT  24  O4  ? ? G DA  114 H DT  123 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? D A3P 16 N1    ? ? ? 1_555 F DT  23  N3  ? ? G A3P 115 H DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? D A3P 16 N6    ? ? ? 1_555 F DT  23  O4  ? ? G A3P 115 H DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? E DT  1  N3    ? ? ? 1_555 F DA  22  N1  ? ? Y DT  116 H DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? E DT  1  O4    ? ? ? 1_555 F DA  22  N6  ? ? Y DT  116 H DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? E DG  2  N1    ? ? ? 1_555 F DC  21  O2  ? ? Y DG  117 H DC  120 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog110 hydrog ? ? E DT  3  N3    ? ? ? 1_555 F DA  20  N1  ? ? Y DT  118 H DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? E DT  3  O4    ? ? ? 1_555 F DA  20  N6  ? ? Y DT  118 H DA  119 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? E DA  4  N1    ? ? ? 1_555 F DT  19  N3  ? ? Y DA  119 H DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? E DA  4  N6    ? ? ? 1_555 F DT  19  O4  ? ? Y DA  119 H DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? E DT  5  N3    ? ? ? 1_555 F DA  18  N1  ? ? Y DT  120 H DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? E DT  5  O4    ? ? ? 1_555 F DA  18  N6  ? ? Y DT  120 H DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? E DG  6  N1    ? ? ? 1_555 F DC  17  N3  ? ? Y DG  121 H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? E DG  6  N2    ? ? ? 1_555 F DC  17  O2  ? ? Y DG  121 H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? E DG  6  O6    ? ? ? 1_555 F DC  17  N4  ? ? Y DG  121 H DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? E DC  7  N3    ? ? ? 1_555 F DG  16  N1  ? ? Y DC  122 H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? E DC  7  N4    ? ? ? 1_555 F DG  16  O6  ? ? Y DC  122 H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? E DC  7  O2    ? ? ? 1_555 F DG  16  N2  ? ? Y DC  122 H DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? E DT  8  N3    ? ? ? 1_555 F DA  15  N1  ? ? Y DT  123 H DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? E DT  8  O4    ? ? ? 1_555 F DA  15  N6  ? ? Y DT  123 H DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? E DA  9  N1    ? ? ? 1_555 F DT  14  N3  ? ? Y DA  124 H DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? E DA  9  N6    ? ? ? 1_555 F DT  14  O4  ? ? Y DA  124 H DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? E DT  10 N3    ? ? ? 1_555 F DA  13  N1  ? ? Y DT  125 H DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? E DT  10 O4    ? ? ? 1_555 F DA  13  N6  ? ? Y DT  125 H DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? E DA  11 N1    ? ? ? 1_555 F DT  12  N3  ? ? Y DA  126 H DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? E DA  11 N6    ? ? ? 1_555 F DT  12  O4  ? ? Y DA  126 H DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? E DC  12 N3    ? ? ? 1_555 F DG  11  N1  ? ? Y DC  127 H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? E DC  12 N4    ? ? ? 1_555 F DG  11  O6  ? ? Y DC  127 H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? E DC  12 O2    ? ? ? 1_555 F DG  11  N2  ? ? Y DC  127 H DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? E DG  13 N1    ? ? ? 1_555 F DC  10  N3  ? ? Y DG  128 H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? E DG  13 N2    ? ? ? 1_555 F DC  10  O2  ? ? Y DG  128 H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? E DG  13 O6    ? ? ? 1_555 F DC  10  N4  ? ? Y DG  128 H DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? E DA  14 N1    ? ? ? 1_555 F DT  9   N3  ? ? Y DA  129 H DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? E DA  14 N6    ? ? ? 1_555 F DT  9   O4  ? ? Y DA  129 H DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? E DA  15 N1    ? ? ? 1_555 F DT  8   N3  ? ? Y DA  130 H DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? E DA  15 N6    ? ? ? 1_555 F DT  8   O4  ? ? Y DA  130 H DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? E DG  16 N1    ? ? ? 1_555 F DC  7   O2  ? ? Y DG  131 H DC  106 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog141 hydrog ? ? E DT  17 N3    ? ? ? 1_555 F DA  6   N1  ? ? Y DT  132 H DA  105 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog142 hydrog ? ? E DT  18 N3    ? ? ? 1_555 F DA  5   N1  ? ? Y DT  133 H DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? E DT  18 O4    ? ? ? 1_555 F DA  5   N6  ? ? Y DT  133 H DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? E DA  19 N1    ? ? ? 1_555 F DT  4   N3  ? ? Y DA  134 H DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? E DA  19 N6    ? ? ? 1_555 F DT  4   O4  ? ? Y DA  134 H DT  103 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? E DT  20 N3    ? ? ? 1_555 F DA  3   N1  ? ? Y DT  135 H DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? E DT  20 O4    ? ? ? 1_555 F DA  3   N6  ? ? Y DT  135 H DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? E DC  21 O2    ? ? ? 1_555 F DG  2   N2  ? ? Y DC  136 H DG  101 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 64 G . ? PHE 64 A PRO 65 G ? PRO 65 A 1 -0.60 
2 PHE 64 H . ? PHE 64 B PRO 65 H ? PRO 65 B 1 -0.97 
3 PHE 64 I . ? PHE 64 E PRO 65 I ? PRO 65 E 1 -0.05 
4 PHE 64 J . ? PHE 64 F PRO 65 J ? PRO 65 F 1 -0.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE G 185 ? SER G 186 ? ILE A 185 SER A 186 
A 2 LEU G 194 ? HIS G 196 ? LEU A 194 HIS A 196 
A 3 GLU G 210 ? ALA G 212 ? GLU A 210 ALA A 212 
B 1 ILE H 197 ? ARG H 199 ? ILE B 197 ARG B 199 
B 2 VAL H 204 ? VAL H 209 ? VAL B 204 VAL B 209 
C 1 ARG I 187 ? THR I 188 ? ARG E 187 THR E 188 
C 2 ARG I 192 ? MET I 193 ? ARG E 192 MET E 193 
D 1 ILE I 195 ? HIS I 196 ? ILE E 195 HIS E 196 
D 2 GLU I 210 ? LYS I 211 ? GLU E 210 LYS E 211 
E 1 ILE J 185 ? ARG J 187 ? ILE F 185 ARG F 187 
E 2 MET J 193 ? ARG J 199 ? MET F 193 ARG F 199 
E 3 VAL J 204 ? LYS J 211 ? VAL F 204 LYS F 211 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER G 186 ? N SER A 186 O LEU G 194 ? O LEU A 194 
A 2 3 N ILE G 195 ? N ILE A 195 O LYS G 211 ? O LYS A 211 
B 1 2 N ILE H 197 ? N ILE B 197 O VAL H 209 ? O VAL B 209 
C 1 2 N THR I 188 ? N THR E 188 O ARG I 192 ? O ARG E 192 
D 1 2 N ILE I 195 ? N ILE E 195 O LYS I 211 ? O LYS E 211 
E 1 2 N SER J 186 ? N SER F 186 O LEU J 194 ? O LEU F 194 
E 2 3 N ILE J 195 ? N ILE F 195 O LYS J 211 ? O LYS F 211 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 344' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 345' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 346' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG A 347' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG F 344' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MG D 310' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LYS G 43  ? LYS A 43  . ? 1_555 ? 
2 AC1 2 DT  C 12  ? DT  D 111 . ? 1_555 ? 
3 AC2 1 HIS G 269 ? HIS A 269 . ? 1_555 ? 
4 AC3 1 GLU G 138 ? GLU A 138 . ? 1_555 ? 
5 AC4 1 DC  C 7   ? DC  D 106 . ? 1_555 ? 
6 AC5 3 THR J 87  ? THR F 87  . ? 1_555 ? 
7 AC5 3 HIS J 91  ? HIS F 91  . ? 1_555 ? 
8 AC5 3 DA  D 13  ? DA  G 112 . ? 1_555 ? 
9 AC6 1 DA  C 6   ? DA  D 105 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OUQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OUQ 
_atom_sites.fract_transf_matrix[1][1]   0.009132 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006039 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005163 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DC  A 1 1   ? 35.105 94.493  28.943  1.00 86.00  ? 100  DC  C "O5'" 1 
ATOM   2     C  "C5'" . DC  A 1 1   ? 35.376 95.883  28.675  1.00 87.36  ? 100  DC  C "C5'" 1 
ATOM   3     C  "C4'" . DC  A 1 1   ? 34.769 96.877  29.644  1.00 86.88  ? 100  DC  C "C4'" 1 
ATOM   4     O  "O4'" . DC  A 1 1   ? 33.329 96.942  29.442  1.00 85.05  ? 100  DC  C "O4'" 1 
ATOM   5     C  "C3'" . DC  A 1 1   ? 34.993 96.528  31.119  1.00 88.18  ? 100  DC  C "C3'" 1 
ATOM   6     O  "O3'" . DC  A 1 1   ? 35.514 97.617  31.891  1.00 91.63  ? 100  DC  C "O3'" 1 
ATOM   7     C  "C2'" . DC  A 1 1   ? 33.620 96.126  31.629  1.00 85.83  ? 100  DC  C "C2'" 1 
ATOM   8     C  "C1'" . DC  A 1 1   ? 32.638 96.795  30.678  1.00 82.39  ? 100  DC  C "C1'" 1 
ATOM   9     N  N1    . DC  A 1 1   ? 31.441 95.950  30.458  1.00 78.36  ? 100  DC  C N1    1 
ATOM   10    C  C2    . DC  A 1 1   ? 31.560 94.749  29.702  1.00 76.31  ? 100  DC  C C2    1 
ATOM   11    O  O2    . DC  A 1 1   ? 32.643 94.466  29.166  1.00 75.41  ? 100  DC  C O2    1 
ATOM   12    N  N3    . DC  A 1 1   ? 30.487 93.937  29.580  1.00 74.53  ? 100  DC  C N3    1 
ATOM   13    C  C4    . DC  A 1 1   ? 29.328 94.276  30.146  1.00 74.31  ? 100  DC  C C4    1 
ATOM   14    N  N4    . DC  A 1 1   ? 28.311 93.430  30.010  1.00 73.32  ? 100  DC  C N4    1 
ATOM   15    C  C5    . DC  A 1 1   ? 29.165 95.498  30.880  1.00 74.16  ? 100  DC  C C5    1 
ATOM   16    C  C6    . DC  A 1 1   ? 30.236 96.298  31.006  1.00 75.75  ? 100  DC  C C6    1 
ATOM   17    P  P     . DG  A 1 2   ? 36.176 97.316  33.336  1.00 93.99  ? 101  DG  C P     1 
ATOM   18    O  OP1   . DG  A 1 2   ? 37.014 98.491  33.733  1.00 93.06  ? 101  DG  C OP1   1 
ATOM   19    O  OP2   . DG  A 1 2   ? 36.799 95.952  33.275  1.00 92.84  ? 101  DG  C OP2   1 
ATOM   20    O  "O5'" . DG  A 1 2   ? 34.910 97.238  34.310  1.00 91.68  ? 101  DG  C "O5'" 1 
ATOM   21    C  "C5'" . DG  A 1 2   ? 33.978 98.325  34.401  1.00 88.89  ? 101  DG  C "C5'" 1 
ATOM   22    C  "C4'" . DG  A 1 2   ? 32.764 97.916  35.206  1.00 87.43  ? 101  DG  C "C4'" 1 
ATOM   23    O  "O4'" . DG  A 1 2   ? 31.976 96.951  34.457  1.00 84.85  ? 101  DG  C "O4'" 1 
ATOM   24    C  "C3'" . DG  A 1 2   ? 33.073 97.257  36.560  1.00 88.16  ? 101  DG  C "C3'" 1 
ATOM   25    O  "O3'" . DG  A 1 2   ? 32.116 97.666  37.561  1.00 90.94  ? 101  DG  C "O3'" 1 
ATOM   26    C  "C2'" . DG  A 1 2   ? 32.905 95.779  36.266  1.00 85.09  ? 101  DG  C "C2'" 1 
ATOM   27    C  "C1'" . DG  A 1 2   ? 31.757 95.802  35.269  1.00 81.26  ? 101  DG  C "C1'" 1 
ATOM   28    N  N9    . DG  A 1 2   ? 31.673 94.619  34.412  1.00 76.25  ? 101  DG  C N9    1 
ATOM   29    C  C8    . DG  A 1 2   ? 32.699 93.961  33.758  1.00 73.77  ? 101  DG  C C8    1 
ATOM   30    N  N7    . DG  A 1 2   ? 32.297 92.897  33.111  1.00 70.73  ? 101  DG  C N7    1 
ATOM   31    C  C5    . DG  A 1 2   ? 30.925 92.857  33.343  1.00 70.47  ? 101  DG  C C5    1 
ATOM   32    C  C6    . DG  A 1 2   ? 29.952 91.927  32.914  1.00 69.40  ? 101  DG  C C6    1 
ATOM   33    O  O6    . DG  A 1 2   ? 30.116 90.908  32.231  1.00 69.82  ? 101  DG  C O6    1 
ATOM   34    N  N1    . DG  A 1 2   ? 28.676 92.269  33.372  1.00 67.51  ? 101  DG  C N1    1 
ATOM   35    C  C2    . DG  A 1 2   ? 28.381 93.363  34.156  1.00 67.80  ? 101  DG  C C2    1 
ATOM   36    N  N2    . DG  A 1 2   ? 27.094 93.530  34.498  1.00 66.28  ? 101  DG  C N2    1 
ATOM   37    N  N3    . DG  A 1 2   ? 29.285 94.231  34.575  1.00 69.11  ? 101  DG  C N3    1 
ATOM   38    C  C4    . DG  A 1 2   ? 30.526 93.920  34.134  1.00 72.11  ? 101  DG  C C4    1 
ATOM   39    P  P     . DA  A 1 3   ? 32.297 97.198  39.102  1.00 92.27  ? 102  DA  C P     1 
ATOM   40    O  OP1   . DA  A 1 3   ? 32.302 98.435  39.946  1.00 91.01  ? 102  DA  C OP1   1 
ATOM   41    O  OP2   . DA  A 1 3   ? 33.458 96.239  39.177  1.00 91.35  ? 102  DA  C OP2   1 
ATOM   42    O  "O5'" . DA  A 1 3   ? 30.945 96.396  39.401  1.00 89.79  ? 102  DA  C "O5'" 1 
ATOM   43    C  "C5'" . DA  A 1 3   ? 29.659 97.012  39.213  1.00 85.43  ? 102  DA  C "C5'" 1 
ATOM   44    C  "C4'" . DA  A 1 3   ? 28.553 95.974  39.245  1.00 82.22  ? 102  DA  C "C4'" 1 
ATOM   45    O  "O4'" . DA  A 1 3   ? 28.729 95.025  38.156  1.00 79.55  ? 102  DA  C "O4'" 1 
ATOM   46    C  "C3'" . DA  A 1 3   ? 28.459 95.125  40.523  1.00 81.60  ? 102  DA  C "C3'" 1 
ATOM   47    O  "O3'" . DA  A 1 3   ? 27.079 94.870  40.886  1.00 82.09  ? 102  DA  C "O3'" 1 
ATOM   48    C  "C2'" . DA  A 1 3   ? 29.127 93.829  40.107  1.00 78.62  ? 102  DA  C "C2'" 1 
ATOM   49    C  "C1'" . DA  A 1 3   ? 28.651 93.706  38.674  1.00 74.98  ? 102  DA  C "C1'" 1 
ATOM   50    N  N9    . DA  A 1 3   ? 29.465 92.818  37.836  1.00 70.60  ? 102  DA  C N9    1 
ATOM   51    C  C8    . DA  A 1 3   ? 30.816 92.882  37.574  1.00 68.33  ? 102  DA  C C8    1 
ATOM   52    N  N7    . DA  A 1 3   ? 31.256 91.904  36.811  1.00 65.35  ? 102  DA  C N7    1 
ATOM   53    C  C5    . DA  A 1 3   ? 30.121 91.158  36.545  1.00 64.86  ? 102  DA  C C5    1 
ATOM   54    C  C6    . DA  A 1 3   ? 29.927 90.005  35.804  1.00 63.98  ? 102  DA  C C6    1 
ATOM   55    N  N6    . DA  A 1 3   ? 30.911 89.371  35.174  1.00 64.27  ? 102  DA  C N6    1 
ATOM   56    N  N1    . DA  A 1 3   ? 28.676 89.510  35.728  1.00 64.37  ? 102  DA  C N1    1 
ATOM   57    C  C2    . DA  A 1 3   ? 27.689 90.147  36.376  1.00 64.89  ? 102  DA  C C2    1 
ATOM   58    N  N3    . DA  A 1 3   ? 27.747 91.243  37.117  1.00 65.60  ? 102  DA  C N3    1 
ATOM   59    C  C4    . DA  A 1 3   ? 29.009 91.708  37.162  1.00 66.95  ? 102  DA  C C4    1 
ATOM   60    P  P     . DT  A 1 4   ? 26.708 94.404  42.398  1.00 82.82  ? 103  DT  C P     1 
ATOM   61    O  OP1   . DT  A 1 4   ? 25.494 95.167  42.816  1.00 81.26  ? 103  DT  C OP1   1 
ATOM   62    O  OP2   . DT  A 1 4   ? 27.955 94.456  43.235  1.00 80.61  ? 103  DT  C OP2   1 
ATOM   63    O  "O5'" . DT  A 1 4   ? 26.277 92.873  42.238  1.00 79.98  ? 103  DT  C "O5'" 1 
ATOM   64    C  "C5'" . DT  A 1 4   ? 26.952 92.031  41.307  1.00 75.82  ? 103  DT  C "C5'" 1 
ATOM   65    C  "C4'" . DT  A 1 4   ? 26.076 90.875  40.889  1.00 71.76  ? 103  DT  C "C4'" 1 
ATOM   66    O  "O4'" . DT  A 1 4   ? 26.703 90.275  39.724  1.00 68.25  ? 103  DT  C "O4'" 1 
ATOM   67    C  "C3'" . DT  A 1 4   ? 25.999 89.781  41.951  1.00 71.29  ? 103  DT  C "C3'" 1 
ATOM   68    O  "O3'" . DT  A 1 4   ? 24.697 89.182  42.072  1.00 72.51  ? 103  DT  C "O3'" 1 
ATOM   69    C  "C2'" . DT  A 1 4   ? 27.049 88.777  41.511  1.00 67.98  ? 103  DT  C "C2'" 1 
ATOM   70    C  "C1'" . DT  A 1 4   ? 27.145 88.960  39.999  1.00 62.55  ? 103  DT  C "C1'" 1 
ATOM   71    N  N1    . DT  A 1 4   ? 28.528 88.845  39.518  1.00 55.16  ? 103  DT  C N1    1 
ATOM   72    C  C2    . DT  A 1 4   ? 28.843 87.891  38.559  1.00 53.25  ? 103  DT  C C2    1 
ATOM   73    O  O2    . DT  A 1 4   ? 28.018 87.157  38.041  1.00 51.78  ? 103  DT  C O2    1 
ATOM   74    N  N3    . DT  A 1 4   ? 30.174 87.827  38.230  1.00 50.73  ? 103  DT  C N3    1 
ATOM   75    C  C4    . DT  A 1 4   ? 31.196 88.598  38.751  1.00 50.28  ? 103  DT  C C4    1 
ATOM   76    O  O4    . DT  A 1 4   ? 32.356 88.410  38.378  1.00 49.12  ? 103  DT  C O4    1 
ATOM   77    C  C5    . DT  A 1 4   ? 30.785 89.590  39.737  1.00 49.95  ? 103  DT  C C5    1 
ATOM   78    C  C7    . DT  A 1 4   ? 31.822 90.472  40.359  1.00 48.75  ? 103  DT  C C7    1 
ATOM   79    C  C6    . DT  A 1 4   ? 29.488 89.665  40.054  1.00 51.00  ? 103  DT  C C6    1 
ATOM   80    P  P     . DA  A 1 5   ? 24.374 88.263  43.366  1.00 74.24  ? 104  DA  C P     1 
ATOM   81    O  OP1   . DA  A 1 5   ? 23.058 88.652  43.985  1.00 71.78  ? 104  DA  C OP1   1 
ATOM   82    O  OP2   . DA  A 1 5   ? 25.625 88.307  44.193  1.00 72.56  ? 104  DA  C OP2   1 
ATOM   83    O  "O5'" . DA  A 1 5   ? 24.209 86.797  42.754  1.00 69.93  ? 104  DA  C "O5'" 1 
ATOM   84    C  "C5'" . DA  A 1 5   ? 23.001 86.431  42.081  1.00 65.58  ? 104  DA  C "C5'" 1 
ATOM   85    C  "C4'" . DA  A 1 5   ? 23.190 85.160  41.281  1.00 62.38  ? 104  DA  C "C4'" 1 
ATOM   86    O  "O4'" . DA  A 1 5   ? 24.426 85.246  40.536  1.00 60.21  ? 104  DA  C "O4'" 1 
ATOM   87    C  "C3'" . DA  A 1 5   ? 23.271 83.859  42.078  1.00 61.53  ? 104  DA  C "C3'" 1 
ATOM   88    O  "O3'" . DA  A 1 5   ? 22.517 82.838  41.423  1.00 63.72  ? 104  DA  C "O3'" 1 
ATOM   89    C  "C2'" . DA  A 1 5   ? 24.749 83.516  42.095  1.00 57.64  ? 104  DA  C "C2'" 1 
ATOM   90    C  "C1'" . DA  A 1 5   ? 25.274 84.148  40.820  1.00 54.41  ? 104  DA  C "C1'" 1 
ATOM   91    N  N9    . DA  A 1 5   ? 26.618 84.683  40.982  1.00 48.21  ? 104  DA  C N9    1 
ATOM   92    C  C8    . DA  A 1 5   ? 27.050 85.566  41.935  1.00 45.84  ? 104  DA  C C8    1 
ATOM   93    N  N7    . DA  A 1 5   ? 28.326 85.847  41.847  1.00 43.49  ? 104  DA  C N7    1 
ATOM   94    C  C5    . DA  A 1 5   ? 28.754 85.105  40.759  1.00 41.81  ? 104  DA  C C5    1 
ATOM   95    C  C6    . DA  A 1 5   ? 29.997 84.967  40.158  1.00 41.26  ? 104  DA  C C6    1 
ATOM   96    N  N6    . DA  A 1 5   ? 31.090 85.599  40.583  1.00 40.70  ? 104  DA  C N6    1 
ATOM   97    N  N1    . DA  A 1 5   ? 30.091 84.146  39.090  1.00 40.55  ? 104  DA  C N1    1 
ATOM   98    C  C2    . DA  A 1 5   ? 28.989 83.516  38.672  1.00 40.23  ? 104  DA  C C2    1 
ATOM   99    N  N3    . DA  A 1 5   ? 27.759 83.572  39.158  1.00 40.68  ? 104  DA  C N3    1 
ATOM   100   C  C4    . DA  A 1 5   ? 27.711 84.391  40.213  1.00 42.92  ? 104  DA  C C4    1 
ATOM   101   P  P     . DA  A 1 6   ? 22.118 81.513  42.236  1.00 65.24  ? 105  DA  C P     1 
ATOM   102   O  OP1   . DA  A 1 6   ? 20.978 80.825  41.549  1.00 64.95  ? 105  DA  C OP1   1 
ATOM   103   O  OP2   . DA  A 1 6   ? 21.949 81.961  43.649  1.00 65.03  ? 105  DA  C OP2   1 
ATOM   104   O  "O5'" . DA  A 1 6   ? 23.443 80.637  42.084  1.00 62.99  ? 105  DA  C "O5'" 1 
ATOM   105   C  "C5'" . DA  A 1 6   ? 23.868 80.235  40.787  1.00 62.80  ? 105  DA  C "C5'" 1 
ATOM   106   C  "C4'" . DA  A 1 6   ? 25.215 79.546  40.830  1.00 62.41  ? 105  DA  C "C4'" 1 
ATOM   107   O  "O4'" . DA  A 1 6   ? 26.331 80.484  40.847  1.00 61.60  ? 105  DA  C "O4'" 1 
ATOM   108   C  "C3'" . DA  A 1 6   ? 25.436 78.569  41.985  1.00 61.61  ? 105  DA  C "C3'" 1 
ATOM   109   O  "O3'" . DA  A 1 6   ? 25.857 77.285  41.498  1.00 60.07  ? 105  DA  C "O3'" 1 
ATOM   110   C  "C2'" . DA  A 1 6   ? 26.542 79.229  42.797  1.00 60.60  ? 105  DA  C "C2'" 1 
ATOM   111   C  "C1'" . DA  A 1 6   ? 27.318 80.013  41.745  1.00 58.39  ? 105  DA  C "C1'" 1 
ATOM   112   N  N9    . DA  A 1 6   ? 28.033 81.165  42.301  1.00 55.47  ? 105  DA  C N9    1 
ATOM   113   C  C8    . DA  A 1 6   ? 27.563 82.050  43.243  1.00 54.42  ? 105  DA  C C8    1 
ATOM   114   N  N7    . DA  A 1 6   ? 28.457 82.928  43.636  1.00 53.16  ? 105  DA  C N7    1 
ATOM   115   C  C5    . DA  A 1 6   ? 29.582 82.614  42.890  1.00 52.38  ? 105  DA  C C5    1 
ATOM   116   C  C6    . DA  A 1 6   ? 30.869 83.162  42.865  1.00 52.39  ? 105  DA  C C6    1 
ATOM   117   N  N6    . DA  A 1 6   ? 31.265 84.148  43.685  1.00 53.39  ? 105  DA  C N6    1 
ATOM   118   N  N1    . DA  A 1 6   ? 31.756 82.647  41.982  1.00 51.90  ? 105  DA  C N1    1 
ATOM   119   C  C2    . DA  A 1 6   ? 31.369 81.625  41.209  1.00 51.76  ? 105  DA  C C2    1 
ATOM   120   N  N3    . DA  A 1 6   ? 30.188 81.000  41.166  1.00 52.90  ? 105  DA  C N3    1 
ATOM   121   C  C4    . DA  A 1 6   ? 29.329 81.552  42.040  1.00 53.07  ? 105  DA  C C4    1 
ATOM   122   P  P     . DC  A 1 7   ? 25.606 75.986  42.399  1.00 57.35  ? 106  DC  C P     1 
ATOM   123   O  OP1   . DC  A 1 7   ? 25.076 74.879  41.573  1.00 57.23  ? 106  DC  C OP1   1 
ATOM   124   O  OP2   . DC  A 1 7   ? 24.814 76.457  43.569  1.00 56.89  ? 106  DC  C OP2   1 
ATOM   125   O  "O5'" . DC  A 1 7   ? 27.083 75.599  42.838  1.00 54.70  ? 106  DC  C "O5'" 1 
ATOM   126   C  "C5'" . DC  A 1 7   ? 27.941 76.582  43.348  1.00 52.72  ? 106  DC  C "C5'" 1 
ATOM   127   C  "C4'" . DC  A 1 7   ? 29.173 76.648  42.493  1.00 54.65  ? 106  DC  C "C4'" 1 
ATOM   128   O  "O4'" . DC  A 1 7   ? 29.690 77.993  42.578  1.00 55.00  ? 106  DC  C "O4'" 1 
ATOM   129   C  "C3'" . DC  A 1 7   ? 30.306 75.704  42.899  1.00 56.06  ? 106  DC  C "C3'" 1 
ATOM   130   O  "O3'" . DC  A 1 7   ? 30.811 74.951  41.788  1.00 58.67  ? 106  DC  C "O3'" 1 
ATOM   131   C  "C2'" . DC  A 1 7   ? 31.385 76.632  43.439  1.00 54.77  ? 106  DC  C "C2'" 1 
ATOM   132   C  "C1'" . DC  A 1 7   ? 31.087 77.982  42.798  1.00 53.18  ? 106  DC  C "C1'" 1 
ATOM   133   N  N1    . DC  A 1 7   ? 31.389 79.124  43.678  1.00 51.55  ? 106  DC  C N1    1 
ATOM   134   C  C2    . DC  A 1 7   ? 32.672 79.715  43.642  1.00 50.88  ? 106  DC  C C2    1 
ATOM   135   O  O2    . DC  A 1 7   ? 33.489 79.348  42.774  1.00 50.77  ? 106  DC  C O2    1 
ATOM   136   N  N3    . DC  A 1 7   ? 32.972 80.678  44.541  1.00 48.99  ? 106  DC  C N3    1 
ATOM   137   C  C4    . DC  A 1 7   ? 32.043 81.081  45.418  1.00 49.70  ? 106  DC  C C4    1 
ATOM   138   N  N4    . DC  A 1 7   ? 32.388 81.996  46.323  1.00 50.26  ? 106  DC  C N4    1 
ATOM   139   C  C5    . DC  A 1 7   ? 30.719 80.555  45.417  1.00 48.60  ? 106  DC  C C5    1 
ATOM   140   C  C6    . DC  A 1 7   ? 30.440 79.587  44.545  1.00 49.21  ? 106  DC  C C6    1 
HETATM 141   N  N1    . UMP A 1 8   ? 35.604 77.080  44.496  1.00 51.64  ? 107  UMP C N1    1 
HETATM 142   C  C2    . UMP A 1 8   ? 36.291 77.896  45.358  1.00 49.88  ? 107  UMP C C2    1 
HETATM 143   N  N3    . UMP A 1 8   ? 35.533 78.457  46.353  1.00 48.83  ? 107  UMP C N3    1 
HETATM 144   C  C4    . UMP A 1 8   ? 34.190 78.247  46.589  1.00 49.64  ? 107  UMP C C4    1 
HETATM 145   C  C5    . UMP A 1 8   ? 33.565 77.336  45.688  1.00 49.08  ? 107  UMP C C5    1 
HETATM 146   C  C6    . UMP A 1 8   ? 34.276 76.800  44.694  1.00 49.76  ? 107  UMP C C6    1 
HETATM 147   O  O2    . UMP A 1 8   ? 37.483 78.089  45.263  1.00 50.32  ? 107  UMP C O2    1 
HETATM 148   O  O4    . UMP A 1 8   ? 33.635 78.839  47.516  1.00 50.99  ? 107  UMP C O4    1 
HETATM 149   C  "C1'" . UMP A 1 8   ? 36.330 76.534  43.339  1.00 56.77  ? 107  UMP C "C1'" 1 
HETATM 150   C  "C2'" . UMP A 1 8   ? 37.166 75.317  43.683  1.00 60.08  ? 107  UMP C "C2'" 1 
HETATM 151   C  "C3'" . UMP A 1 8   ? 36.897 74.315  42.570  1.00 62.44  ? 107  UMP C "C3'" 1 
HETATM 152   C  "C4'" . UMP A 1 8   ? 35.658 74.818  41.846  1.00 60.53  ? 107  UMP C "C4'" 1 
HETATM 153   O  "O3'" . UMP A 1 8   ? 37.994 74.157  41.702  1.00 65.82  ? 107  UMP C "O3'" 1 
HETATM 154   O  "O4'" . UMP A 1 8   ? 35.354 76.122  42.388  1.00 59.74  ? 107  UMP C "O4'" 1 
HETATM 155   C  "C5'" . UMP A 1 8   ? 34.490 73.910  42.102  1.00 59.45  ? 107  UMP C "C5'" 1 
HETATM 156   O  "O5'" . UMP A 1 8   ? 33.292 74.574  41.806  1.00 58.68  ? 107  UMP C "O5'" 1 
HETATM 157   P  P     . UMP A 1 8   ? 31.924 73.816  42.043  1.00 61.10  ? 107  UMP C P     1 
HETATM 158   O  OP1   . UMP A 1 8   ? 31.843 72.698  41.051  1.00 60.39  ? 107  UMP C OP1   1 
HETATM 159   O  OP2   . UMP A 1 8   ? 31.861 73.503  43.491  1.00 60.91  ? 107  UMP C OP2   1 
ATOM   160   P  P     . DT  A 1 9   ? 39.145 73.122  42.109  1.00 69.89  ? 108  DT  C P     1 
ATOM   161   O  OP1   . DT  A 1 9   ? 39.979 72.829  40.898  1.00 69.59  ? 108  DT  C OP1   1 
ATOM   162   O  OP2   . DT  A 1 9   ? 38.512 71.989  42.863  1.00 68.69  ? 108  DT  C OP2   1 
ATOM   163   O  "O5'" . DT  A 1 9   ? 40.006 74.014  43.099  1.00 67.94  ? 108  DT  C "O5'" 1 
ATOM   164   C  "C5'" . DT  A 1 9   ? 40.536 75.231  42.622  1.00 66.84  ? 108  DT  C "C5'" 1 
ATOM   165   C  "C4'" . DT  A 1 9   ? 41.241 75.969  43.727  1.00 65.94  ? 108  DT  C "C4'" 1 
ATOM   166   O  "O4'" . DT  A 1 9   ? 40.277 76.551  44.632  1.00 62.78  ? 108  DT  C "O4'" 1 
ATOM   167   C  "C3'" . DT  A 1 9   ? 42.223 75.159  44.577  1.00 65.77  ? 108  DT  C "C3'" 1 
ATOM   168   O  "O3'" . DT  A 1 9   ? 43.415 75.948  44.666  1.00 70.06  ? 108  DT  C "O3'" 1 
ATOM   169   C  "C2'" . DT  A 1 9   ? 41.509 75.060  45.917  1.00 62.58  ? 108  DT  C "C2'" 1 
ATOM   170   C  "C1'" . DT  A 1 9   ? 40.736 76.370  45.949  1.00 59.65  ? 108  DT  C "C1'" 1 
ATOM   171   N  N1    . DT  A 1 9   ? 39.566 76.471  46.832  1.00 55.37  ? 108  DT  C N1    1 
ATOM   172   C  C2    . DT  A 1 9   ? 39.519 77.536  47.694  1.00 52.92  ? 108  DT  C C2    1 
ATOM   173   O  O2    . DT  A 1 9   ? 40.444 78.297  47.844  1.00 52.53  ? 108  DT  C O2    1 
ATOM   174   N  N3    . DT  A 1 9   ? 38.356 77.664  48.391  1.00 51.96  ? 108  DT  C N3    1 
ATOM   175   C  C4    . DT  A 1 9   ? 37.267 76.826  48.352  1.00 52.20  ? 108  DT  C C4    1 
ATOM   176   O  O4    . DT  A 1 9   ? 36.259 77.103  49.015  1.00 52.01  ? 108  DT  C O4    1 
ATOM   177   C  C5    . DT  A 1 9   ? 37.418 75.659  47.484  1.00 52.09  ? 108  DT  C C5    1 
ATOM   178   C  C7    . DT  A 1 9   ? 36.330 74.631  47.434  1.00 48.79  ? 108  DT  C C7    1 
ATOM   179   C  C6    . DT  A 1 9   ? 38.544 75.555  46.767  1.00 53.01  ? 108  DT  C C6    1 
ATOM   180   P  P     . DC  A 1 10  ? 44.826 75.280  45.062  1.00 72.77  ? 109  DC  C P     1 
ATOM   181   O  OP1   . DC  A 1 10  ? 45.867 75.624  44.041  1.00 72.34  ? 109  DC  C OP1   1 
ATOM   182   O  OP2   . DC  A 1 10  ? 44.566 73.852  45.402  1.00 71.55  ? 109  DC  C OP2   1 
ATOM   183   O  "O5'" . DC  A 1 10  ? 45.154 76.124  46.364  1.00 72.22  ? 109  DC  C "O5'" 1 
ATOM   184   C  "C5'" . DC  A 1 10  ? 44.097 76.865  46.958  1.00 72.80  ? 109  DC  C "C5'" 1 
ATOM   185   C  "C4'" . DC  A 1 10  ? 44.509 77.412  48.298  1.00 73.19  ? 109  DC  C "C4'" 1 
ATOM   186   O  "O4'" . DC  A 1 10  ? 43.278 77.707  49.006  1.00 72.70  ? 109  DC  C "O4'" 1 
ATOM   187   C  "C3'" . DC  A 1 10  ? 45.278 76.432  49.182  1.00 73.56  ? 109  DC  C "C3'" 1 
ATOM   188   O  "O3'" . DC  A 1 10  ? 46.279 77.161  49.896  1.00 76.55  ? 109  DC  C "O3'" 1 
ATOM   189   C  "C2'" . DC  A 1 10  ? 44.209 75.853  50.096  1.00 70.98  ? 109  DC  C "C2'" 1 
ATOM   190   C  "C1'" . DC  A 1 10  ? 43.230 77.006  50.236  1.00 69.17  ? 109  DC  C "C1'" 1 
ATOM   191   N  N1    . DC  A 1 10  ? 41.825 76.638  50.502  1.00 65.46  ? 109  DC  C N1    1 
ATOM   192   C  C2    . DC  A 1 10  ? 41.035 77.492  51.312  1.00 64.25  ? 109  DC  C C2    1 
ATOM   193   O  O2    . DC  A 1 10  ? 41.524 78.554  51.738  1.00 63.03  ? 109  DC  C O2    1 
ATOM   194   N  N3    . DC  A 1 10  ? 39.767 77.130  51.613  1.00 63.17  ? 109  DC  C N3    1 
ATOM   195   C  C4    . DC  A 1 10  ? 39.279 75.973  51.159  1.00 63.27  ? 109  DC  C C4    1 
ATOM   196   N  N4    . DC  A 1 10  ? 38.052 75.624  51.548  1.00 63.19  ? 109  DC  C N4    1 
ATOM   197   C  C5    . DC  A 1 10  ? 40.038 75.113  50.305  1.00 62.78  ? 109  DC  C C5    1 
ATOM   198   C  C6    . DC  A 1 10  ? 41.293 75.483  50.002  1.00 63.48  ? 109  DC  C C6    1 
ATOM   199   P  P     . DG  A 1 11  ? 47.476 76.375  50.625  1.00 80.43  ? 110  DG  C P     1 
ATOM   200   O  OP1   . DG  A 1 11  ? 48.756 77.069  50.301  1.00 80.65  ? 110  DG  C OP1   1 
ATOM   201   O  OP2   . DG  A 1 11  ? 47.342 74.918  50.317  1.00 80.08  ? 110  DG  C OP2   1 
ATOM   202   O  "O5'" . DG  A 1 11  ? 47.159 76.652  52.166  1.00 78.01  ? 110  DG  C "O5'" 1 
ATOM   203   C  "C5'" . DG  A 1 11  ? 47.145 77.995  52.656  1.00 74.30  ? 110  DG  C "C5'" 1 
ATOM   204   C  "C4'" . DG  A 1 11  ? 46.613 78.057  54.071  1.00 72.08  ? 110  DG  C "C4'" 1 
ATOM   205   O  "O4'" . DG  A 1 11  ? 45.168 77.872  54.089  1.00 69.95  ? 110  DG  C "O4'" 1 
ATOM   206   C  "C3'" . DG  A 1 11  ? 47.209 77.049  55.066  1.00 71.18  ? 110  DG  C "C3'" 1 
ATOM   207   O  "O3'" . DG  A 1 11  ? 47.597 77.713  56.292  1.00 70.93  ? 110  DG  C "O3'" 1 
ATOM   208   C  "C2'" . DG  A 1 11  ? 46.068 76.066  55.291  1.00 69.13  ? 110  DG  C "C2'" 1 
ATOM   209   C  "C1'" . DG  A 1 11  ? 44.812 76.913  55.077  1.00 65.92  ? 110  DG  C "C1'" 1 
ATOM   210   N  N9    . DG  A 1 11  ? 43.667 76.140  54.589  1.00 60.30  ? 110  DG  C N9    1 
ATOM   211   C  C8    . DG  A 1 11  ? 43.700 75.128  53.660  1.00 57.72  ? 110  DG  C C8    1 
ATOM   212   N  N7    . DG  A 1 11  ? 42.533 74.581  53.457  1.00 55.77  ? 110  DG  C N7    1 
ATOM   213   C  C5    . DG  A 1 11  ? 41.670 75.283  54.286  1.00 54.53  ? 110  DG  C C5    1 
ATOM   214   C  C6    . DG  A 1 11  ? 40.269 75.140  54.486  1.00 53.83  ? 110  DG  C C6    1 
ATOM   215   O  O6    . DG  A 1 11  ? 39.491 74.338  53.947  1.00 52.12  ? 110  DG  C O6    1 
ATOM   216   N  N1    . DG  A 1 11  ? 39.787 76.053  55.414  1.00 53.29  ? 110  DG  C N1    1 
ATOM   217   C  C2    . DG  A 1 11  ? 40.552 76.987  56.063  1.00 55.13  ? 110  DG  C C2    1 
ATOM   218   N  N2    . DG  A 1 11  ? 39.905 77.789  56.923  1.00 55.24  ? 110  DG  C N2    1 
ATOM   219   N  N3    . DG  A 1 11  ? 41.861 77.132  55.885  1.00 55.98  ? 110  DG  C N3    1 
ATOM   220   C  C4    . DG  A 1 11  ? 42.348 76.253  54.988  1.00 56.34  ? 110  DG  C C4    1 
ATOM   221   P  P     . DT  A 1 12  ? 48.345 76.895  57.475  1.00 69.72  ? 111  DT  C P     1 
ATOM   222   O  OP1   . DT  A 1 12  ? 49.457 77.752  57.961  1.00 70.62  ? 111  DT  C OP1   1 
ATOM   223   O  OP2   . DT  A 1 12  ? 48.626 75.496  57.074  1.00 68.92  ? 111  DT  C OP2   1 
ATOM   224   O  "O5'" . DT  A 1 12  ? 47.239 76.892  58.615  1.00 66.11  ? 111  DT  C "O5'" 1 
ATOM   225   C  "C5'" . DT  A 1 12  ? 46.573 78.108  58.928  1.00 61.32  ? 111  DT  C "C5'" 1 
ATOM   226   C  "C4'" . DT  A 1 12  ? 45.329 77.848  59.742  1.00 57.55  ? 111  DT  C "C4'" 1 
ATOM   227   O  "O4'" . DT  A 1 12  ? 44.309 77.229  58.913  1.00 55.29  ? 111  DT  C "O4'" 1 
ATOM   228   C  "C3'" . DT  A 1 12  ? 45.538 76.938  60.953  1.00 55.42  ? 111  DT  C "C3'" 1 
ATOM   229   O  "O3'" . DT  A 1 12  ? 44.965 77.526  62.131  1.00 53.97  ? 111  DT  C "O3'" 1 
ATOM   230   C  "C2'" . DT  A 1 12  ? 44.820 75.661  60.558  1.00 53.89  ? 111  DT  C "C2'" 1 
ATOM   231   C  "C1'" . DT  A 1 12  ? 43.740 76.137  59.595  1.00 51.14  ? 111  DT  C "C1'" 1 
ATOM   232   N  N1    . DT  A 1 12  ? 43.386 75.108  58.605  1.00 47.51  ? 111  DT  C N1    1 
ATOM   233   C  C2    . DT  A 1 12  ? 42.052 74.757  58.425  1.00 46.24  ? 111  DT  C C2    1 
ATOM   234   O  O2    . DT  A 1 12  ? 41.123 75.319  58.993  1.00 45.66  ? 111  DT  C O2    1 
ATOM   235   N  N3    . DT  A 1 12  ? 41.854 73.705  57.555  1.00 43.48  ? 111  DT  C N3    1 
ATOM   236   C  C4    . DT  A 1 12  ? 42.834 72.996  56.877  1.00 42.62  ? 111  DT  C C4    1 
ATOM   237   O  O4    . DT  A 1 12  ? 42.531 72.043  56.168  1.00 41.35  ? 111  DT  C O4    1 
ATOM   238   C  C5    . DT  A 1 12  ? 44.180 73.450  57.087  1.00 42.41  ? 111  DT  C C5    1 
ATOM   239   C  C7    . DT  A 1 12  ? 45.285 72.748  56.378  1.00 43.20  ? 111  DT  C C7    1 
ATOM   240   C  C6    . DT  A 1 12  ? 44.389 74.475  57.912  1.00 44.07  ? 111  DT  C C6    1 
ATOM   241   P  P     . DA  A 1 13  ? 45.182 76.829  63.571  1.00 53.07  ? 112  DA  C P     1 
ATOM   242   O  OP1   . DA  A 1 13  ? 45.305 77.927  64.583  1.00 52.76  ? 112  DA  C OP1   1 
ATOM   243   O  OP2   . DA  A 1 13  ? 46.254 75.795  63.459  1.00 52.83  ? 112  DA  C OP2   1 
ATOM   244   O  "O5'" . DA  A 1 13  ? 43.792 76.100  63.824  1.00 48.89  ? 112  DA  C "O5'" 1 
ATOM   245   C  "C5'" . DA  A 1 13  ? 42.612 76.887  63.929  1.00 43.84  ? 112  DA  C "C5'" 1 
ATOM   246   C  "C4'" . DA  A 1 13  ? 41.387 76.015  64.064  1.00 39.52  ? 112  DA  C "C4'" 1 
ATOM   247   O  "O4'" . DA  A 1 13  ? 41.139 75.266  62.851  1.00 37.81  ? 112  DA  C "O4'" 1 
ATOM   248   C  "C3'" . DA  A 1 13  ? 41.431 75.001  65.197  1.00 37.44  ? 112  DA  C "C3'" 1 
ATOM   249   O  "O3'" . DA  A 1 13  ? 40.202 75.083  65.892  1.00 36.72  ? 112  DA  C "O3'" 1 
ATOM   250   C  "C2'" . DA  A 1 13  ? 41.540 73.669  64.484  1.00 35.49  ? 112  DA  C "C2'" 1 
ATOM   251   C  "C1'" . DA  A 1 13  ? 40.822 73.936  63.170  1.00 34.03  ? 112  DA  C "C1'" 1 
ATOM   252   N  N9    . DA  A 1 13  ? 41.282 73.083  62.072  1.00 30.44  ? 112  DA  C N9    1 
ATOM   253   C  C8    . DA  A 1 13  ? 42.572 72.867  61.645  1.00 30.02  ? 112  DA  C C8    1 
ATOM   254   N  N7    . DA  A 1 13  ? 42.676 71.957  60.702  1.00 26.50  ? 112  DA  C N7    1 
ATOM   255   C  C5    . DA  A 1 13  ? 41.371 71.581  60.476  1.00 25.92  ? 112  DA  C C5    1 
ATOM   256   C  C6    . DA  A 1 13  ? 40.827 70.661  59.610  1.00 26.85  ? 112  DA  C C6    1 
ATOM   257   N  N6    . DA  A 1 13  ? 41.562 69.916  58.786  1.00 27.17  ? 112  DA  C N6    1 
ATOM   258   N  N1    . DA  A 1 13  ? 39.487 70.511  59.616  1.00 27.03  ? 112  DA  C N1    1 
ATOM   259   C  C2    . DA  A 1 13  ? 38.765 71.255  60.473  1.00 26.72  ? 112  DA  C C2    1 
ATOM   260   N  N3    . DA  A 1 13  ? 39.176 72.161  61.351  1.00 24.69  ? 112  DA  C N3    1 
ATOM   261   C  C4    . DA  A 1 13  ? 40.501 72.277  61.297  1.00 26.47  ? 112  DA  C C4    1 
ATOM   262   P  P     . DT  A 1 14  ? 40.006 74.262  67.243  1.00 36.14  ? 113  DT  C P     1 
ATOM   263   O  OP1   . DT  A 1 14  ? 39.012 74.977  68.099  1.00 33.49  ? 113  DT  C OP1   1 
ATOM   264   O  OP2   . DT  A 1 14  ? 41.353 73.924  67.776  1.00 35.02  ? 113  DT  C OP2   1 
ATOM   265   O  "O5'" . DT  A 1 14  ? 39.278 72.957  66.726  1.00 33.38  ? 113  DT  C "O5'" 1 
ATOM   266   C  "C5'" . DT  A 1 14  ? 37.936 73.064  66.319  1.00 30.20  ? 113  DT  C "C5'" 1 
ATOM   267   C  "C4'" . DT  A 1 14  ? 37.463 71.761  65.743  1.00 27.84  ? 113  DT  C "C4'" 1 
ATOM   268   O  "O4'" . DT  A 1 14  ? 38.339 71.377  64.654  1.00 27.23  ? 113  DT  C "O4'" 1 
ATOM   269   C  "C3'" . DT  A 1 14  ? 37.465 70.589  66.722  1.00 27.45  ? 113  DT  C "C3'" 1 
ATOM   270   O  "O3'" . DT  A 1 14  ? 36.150 70.034  66.760  1.00 26.94  ? 113  DT  C "O3'" 1 
ATOM   271   C  "C2'" . DT  A 1 14  ? 38.453 69.608  66.099  1.00 26.23  ? 113  DT  C "C2'" 1 
ATOM   272   C  "C1'" . DT  A 1 14  ? 38.363 69.979  64.634  1.00 24.71  ? 113  DT  C "C1'" 1 
ATOM   273   N  N1    . DT  A 1 14  ? 39.437 69.496  63.709  1.00 22.31  ? 113  DT  C N1    1 
ATOM   274   C  C2    . DT  A 1 14  ? 39.048 68.571  62.772  1.00 21.20  ? 113  DT  C C2    1 
ATOM   275   O  O2    . DT  A 1 14  ? 37.902 68.228  62.625  1.00 23.41  ? 113  DT  C O2    1 
ATOM   276   N  N3    . DT  A 1 14  ? 40.044 68.063  62.010  1.00 20.34  ? 113  DT  C N3    1 
ATOM   277   C  C4    . DT  A 1 14  ? 41.370 68.376  62.067  1.00 21.27  ? 113  DT  C C4    1 
ATOM   278   O  O4    . DT  A 1 14  ? 42.156 67.805  61.319  1.00 23.95  ? 113  DT  C O4    1 
ATOM   279   C  C5    . DT  A 1 14  ? 41.725 69.373  63.038  1.00 19.65  ? 113  DT  C C5    1 
ATOM   280   C  C7    . DT  A 1 14  ? 43.159 69.756  63.177  1.00 17.43  ? 113  DT  C C7    1 
ATOM   281   C  C6    . DT  A 1 14  ? 40.750 69.898  63.793  1.00 20.41  ? 113  DT  C C6    1 
ATOM   282   P  P     . DA  A 1 15  ? 35.734 69.026  67.933  1.00 27.84  ? 114  DA  C P     1 
ATOM   283   O  OP1   . DA  A 1 15  ? 34.639 69.648  68.693  1.00 22.71  ? 114  DA  C OP1   1 
ATOM   284   O  OP2   . DA  A 1 15  ? 36.945 68.570  68.634  1.00 26.35  ? 114  DA  C OP2   1 
ATOM   285   O  "O5'" . DA  A 1 15  ? 35.140 67.804  67.112  1.00 26.83  ? 114  DA  C "O5'" 1 
ATOM   286   C  "C5'" . DA  A 1 15  ? 34.054 68.041  66.249  1.00 27.75  ? 114  DA  C "C5'" 1 
ATOM   287   C  "C4'" . DA  A 1 15  ? 33.955 66.995  65.167  1.00 28.36  ? 114  DA  C "C4'" 1 
ATOM   288   O  "O4'" . DA  A 1 15  ? 35.168 66.872  64.402  1.00 29.35  ? 114  DA  C "O4'" 1 
ATOM   289   C  "C3'" . DA  A 1 15  ? 33.588 65.592  65.618  1.00 29.78  ? 114  DA  C "C3'" 1 
ATOM   290   O  "O3'" . DA  A 1 15  ? 32.513 65.144  64.805  1.00 28.78  ? 114  DA  C "O3'" 1 
ATOM   291   C  "C2'" . DA  A 1 15  ? 34.838 64.775  65.332  1.00 31.07  ? 114  DA  C "C2'" 1 
ATOM   292   C  "C1'" . DA  A 1 15  ? 35.444 65.502  64.152  1.00 31.81  ? 114  DA  C "C1'" 1 
ATOM   293   N  N9    . DA  A 1 15  ? 36.893 65.374  64.044  1.00 33.60  ? 114  DA  C N9    1 
ATOM   294   C  C8    . DA  A 1 15  ? 37.773 66.033  64.857  1.00 35.49  ? 114  DA  C C8    1 
ATOM   295   N  N7    . DA  A 1 15  ? 39.031 65.837  64.550  1.00 36.11  ? 114  DA  C N7    1 
ATOM   296   C  C5    . DA  A 1 15  ? 38.977 64.980  63.474  1.00 36.12  ? 114  DA  C C5    1 
ATOM   297   C  C6    . DA  A 1 15  ? 39.983 64.427  62.702  1.00 37.80  ? 114  DA  C C6    1 
ATOM   298   N  N6    . DA  A 1 15  ? 41.263 64.716  62.894  1.00 37.30  ? 114  DA  C N6    1 
ATOM   299   N  N1    . DA  A 1 15  ? 39.629 63.583  61.707  1.00 39.26  ? 114  DA  C N1    1 
ATOM   300   C  C2    . DA  A 1 15  ? 38.321 63.365  61.503  1.00 40.18  ? 114  DA  C C2    1 
ATOM   301   N  N3    . DA  A 1 15  ? 37.266 63.866  62.163  1.00 38.86  ? 114  DA  C N3    1 
ATOM   302   C  C4    . DA  A 1 15  ? 37.669 64.668  63.156  1.00 35.56  ? 114  DA  C C4    1 
HETATM 303   P  P1    . A3P A 1 16  ? 31.095 59.091  61.435  1.00 56.47  ? 115  A3P C P1    1 
HETATM 304   O  O1P   . A3P A 1 16  ? 30.679 58.595  60.105  1.00 50.98  ? 115  A3P C O1P   1 
HETATM 305   O  O2P   . A3P A 1 16  ? 31.598 58.197  62.501  1.00 56.71  ? 115  A3P C O2P   1 
HETATM 306   P  P2    . A3P A 1 16  ? 31.652 63.892  65.271  1.00 30.81  ? 115  A3P C P2    1 
HETATM 307   O  O4P   . A3P A 1 16  ? 31.899 63.680  66.730  1.00 29.24  ? 115  A3P C O4P   1 
HETATM 308   O  O5P   . A3P A 1 16  ? 30.267 64.047  64.761  1.00 29.61  ? 115  A3P C O5P   1 
HETATM 309   O  "O5'" . A3P A 1 16  ? 32.328 62.717  64.462  1.00 33.32  ? 115  A3P C "O5'" 1 
HETATM 310   C  "C5'" . A3P A 1 16  ? 32.119 62.645  63.089  1.00 38.34  ? 115  A3P C "C5'" 1 
HETATM 311   C  "C4'" . A3P A 1 16  ? 33.030 61.629  62.458  1.00 42.52  ? 115  A3P C "C4'" 1 
HETATM 312   O  "O4'" . A3P A 1 16  ? 33.997 61.679  63.319  1.00 43.54  ? 115  A3P C "O4'" 1 
HETATM 313   C  "C3'" . A3P A 1 16  ? 32.643 60.166  62.488  1.00 46.38  ? 115  A3P C "C3'" 1 
HETATM 314   O  "O3'" . A3P A 1 16  ? 32.308 59.950  61.138  1.00 48.24  ? 115  A3P C "O3'" 1 
HETATM 315   C  "C2'" . A3P A 1 16  ? 33.956 59.454  62.804  1.00 43.59  ? 115  A3P C "C2'" 1 
HETATM 316   C  "C1'" . A3P A 1 16  ? 34.871 60.642  62.924  1.00 43.25  ? 115  A3P C "C1'" 1 
HETATM 317   N  N9    . A3P A 1 16  ? 35.976 60.647  63.879  1.00 42.61  ? 115  A3P C N9    1 
HETATM 318   C  C8    . A3P A 1 16  ? 35.899 60.945  65.206  1.00 48.00  ? 115  A3P C C8    1 
HETATM 319   N  N7    . A3P A 1 16  ? 37.065 61.053  65.796  1.00 48.41  ? 115  A3P C N7    1 
HETATM 320   C  C5    . A3P A 1 16  ? 37.971 60.774  64.795  1.00 43.30  ? 115  A3P C C5    1 
HETATM 321   C  C6    . A3P A 1 16  ? 39.371 60.741  64.785  1.00 42.56  ? 115  A3P C C6    1 
HETATM 322   N  N6    . A3P A 1 16  ? 40.126 61.006  65.847  1.00 48.29  ? 115  A3P C N6    1 
HETATM 323   N  N1    . A3P A 1 16  ? 39.977 60.425  63.637  1.00 36.35  ? 115  A3P C N1    1 
HETATM 324   C  C2    . A3P A 1 16  ? 39.213 60.154  62.571  1.00 33.71  ? 115  A3P C C2    1 
HETATM 325   N  N3    . A3P A 1 16  ? 37.882 60.154  62.453  1.00 36.14  ? 115  A3P C N3    1 
HETATM 326   C  C4    . A3P A 1 16  ? 37.314 60.480  63.616  1.00 40.04  ? 115  A3P C C4    1 
ATOM   327   O  "O5'" . DT  B 2 1   ? 32.358 56.507  60.573  1.00 56.36  ? 116  DT  X "O5'" 1 
ATOM   328   C  "C5'" . DT  B 2 1   ? 33.776 56.744  60.414  1.00 64.67  ? 116  DT  X "C5'" 1 
ATOM   329   C  "C4'" . DT  B 2 1   ? 34.652 55.722  61.130  1.00 65.42  ? 116  DT  X "C4'" 1 
ATOM   330   O  "O4'" . DT  B 2 1   ? 35.898 56.224  61.688  1.00 64.51  ? 116  DT  X "O4'" 1 
ATOM   331   C  "C3'" . DT  B 2 1   ? 34.117 54.693  62.137  1.00 68.39  ? 116  DT  X "C3'" 1 
ATOM   332   O  "O3'" . DT  B 2 1   ? 34.549 53.389  61.721  1.00 72.79  ? 116  DT  X "O3'" 1 
ATOM   333   C  "C2'" . DT  B 2 1   ? 34.927 54.992  63.388  1.00 64.67  ? 116  DT  X "C2'" 1 
ATOM   334   C  "C1'" . DT  B 2 1   ? 36.259 55.356  62.755  1.00 60.86  ? 116  DT  X "C1'" 1 
ATOM   335   N  N1    . DT  B 2 1   ? 37.210 56.058  63.645  1.00 56.40  ? 116  DT  X N1    1 
ATOM   336   C  C2    . DT  B 2 1   ? 38.564 56.062  63.328  1.00 53.55  ? 116  DT  X C2    1 
ATOM   337   O  O2    . DT  B 2 1   ? 39.030 55.520  62.333  1.00 53.86  ? 116  DT  X O2    1 
ATOM   338   N  N3    . DT  B 2 1   ? 39.361 56.727  64.242  1.00 49.95  ? 116  DT  X N3    1 
ATOM   339   C  C4    . DT  B 2 1   ? 38.950 57.358  65.414  1.00 47.56  ? 116  DT  X C4    1 
ATOM   340   O  O4    . DT  B 2 1   ? 39.774 57.884  66.159  1.00 43.54  ? 116  DT  X O4    1 
ATOM   341   C  C5    . DT  B 2 1   ? 37.530 57.322  65.668  1.00 48.08  ? 116  DT  X C5    1 
ATOM   342   C  C7    . DT  B 2 1   ? 37.000 57.989  66.896  1.00 47.31  ? 116  DT  X C7    1 
ATOM   343   C  C6    . DT  B 2 1   ? 36.744 56.687  64.786  1.00 52.72  ? 116  DT  X C6    1 
ATOM   344   P  P     . DG  B 2 2   ? 33.898 52.072  62.381  0.50 74.71  ? 117  DG  X P     1 
ATOM   345   O  OP1   . DG  B 2 2   ? 32.883 51.502  61.461  0.50 73.82  ? 117  DG  X OP1   1 
ATOM   346   O  OP2   . DG  B 2 2   ? 33.433 52.351  63.758  0.50 73.66  ? 117  DG  X OP2   1 
ATOM   347   O  "O5'" . DG  B 2 2   ? 35.182 51.124  62.574  0.50 79.59  ? 117  DG  X "O5'" 1 
ATOM   348   C  "C5'" . DG  B 2 2   ? 35.896 50.744  61.392  0.50 88.29  ? 117  DG  X "C5'" 1 
ATOM   349   C  "C4'" . DG  B 2 2   ? 37.197 50.010  61.751  0.50 93.59  ? 117  DG  X "C4'" 1 
ATOM   350   O  "O4'" . DG  B 2 2   ? 38.060 50.937  62.489  0.50 95.47  ? 117  DG  X "O4'" 1 
ATOM   351   C  "C3'" . DG  B 2 2   ? 37.047 48.825  62.704  0.50 96.18  ? 117  DG  X "C3'" 1 
ATOM   352   O  "O3'" . DG  B 2 2   ? 37.978 47.763  62.442  0.50 97.93  ? 117  DG  X "O3'" 1 
ATOM   353   C  "C2'" . DG  B 2 2   ? 37.236 49.401  64.064  0.50 96.53  ? 117  DG  X "C2'" 1 
ATOM   354   C  "C1'" . DG  B 2 2   ? 38.369 50.365  63.737  0.50 96.59  ? 117  DG  X "C1'" 1 
ATOM   355   N  N9    . DG  B 2 2   ? 38.609 51.432  64.726  0.50 97.41  ? 117  DG  X N9    1 
ATOM   356   C  C8    . DG  B 2 2   ? 37.693 52.145  65.475  0.50 97.81  ? 117  DG  X C8    1 
ATOM   357   N  N7    . DG  B 2 2   ? 38.257 52.984  66.307  0.50 97.73  ? 117  DG  X N7    1 
ATOM   358   C  C5    . DG  B 2 2   ? 39.621 52.782  66.089  0.50 97.84  ? 117  DG  X C5    1 
ATOM   359   C  C6    . DG  B 2 2   ? 40.741 53.368  66.734  0.50 97.65  ? 117  DG  X C6    1 
ATOM   360   O  O6    . DG  B 2 2   ? 40.779 54.151  67.667  0.50 97.36  ? 117  DG  X O6    1 
ATOM   361   N  N1    . DG  B 2 2   ? 41.946 52.943  66.155  0.50 97.57  ? 117  DG  X N1    1 
ATOM   362   C  C2    . DG  B 2 2   ? 42.057 52.059  65.093  0.50 97.16  ? 117  DG  X C2    1 
ATOM   363   N  N2    . DG  B 2 2   ? 43.300 51.796  64.701  0.50 96.36  ? 117  DG  X N2    1 
ATOM   364   N  N3    . DG  B 2 2   ? 41.021 51.502  64.495  0.50 97.16  ? 117  DG  X N3    1 
ATOM   365   C  C4    . DG  B 2 2   ? 39.845 51.898  65.077  0.50 97.78  ? 117  DG  X C4    1 
ATOM   366   P  P     . DT  B 2 3   ? 37.862 46.383  63.230  0.50 98.27  ? 118  DT  X P     1 
ATOM   367   O  OP1   . DT  B 2 3   ? 37.909 45.248  62.283  0.50 98.51  ? 118  DT  X OP1   1 
ATOM   368   O  OP2   . DT  B 2 3   ? 36.733 46.443  64.182  0.50 98.32  ? 118  DT  X OP2   1 
ATOM   369   O  "O5'" . DT  B 2 3   ? 39.191 46.406  64.141  0.50 98.49  ? 118  DT  X "O5'" 1 
ATOM   370   C  "C5'" . DT  B 2 3   ? 40.436 46.596  63.463  0.50 98.28  ? 118  DT  X "C5'" 1 
ATOM   371   C  "C4'" . DT  B 2 3   ? 41.641 46.624  64.451  0.50 97.81  ? 118  DT  X "C4'" 1 
ATOM   372   O  "O4'" . DT  B 2 3   ? 41.602 47.906  65.170  0.50 97.82  ? 118  DT  X "O4'" 1 
ATOM   373   C  "C3'" . DT  B 2 3   ? 41.683 45.573  65.570  0.50 97.61  ? 118  DT  X "C3'" 1 
ATOM   374   O  "O3'" . DT  B 2 3   ? 43.003 45.023  65.696  0.50 96.79  ? 118  DT  X "O3'" 1 
ATOM   375   C  "C2'" . DT  B 2 3   ? 41.103 46.272  66.787  0.50 97.69  ? 118  DT  X "C2'" 1 
ATOM   376   C  "C1'" . DT  B 2 3   ? 41.603 47.710  66.586  0.50 97.43  ? 118  DT  X "C1'" 1 
ATOM   377   N  N1    . DT  B 2 3   ? 40.836 48.817  67.253  0.50 96.45  ? 118  DT  X N1    1 
ATOM   378   C  C2    . DT  B 2 3   ? 41.500 49.828  67.920  0.50 95.48  ? 118  DT  X C2    1 
ATOM   379   O  O2    . DT  B 2 3   ? 42.716 49.904  68.028  0.50 95.33  ? 118  DT  X O2    1 
ATOM   380   N  N3    . DT  B 2 3   ? 40.664 50.783  68.468  0.50 94.65  ? 118  DT  X N3    1 
ATOM   381   C  C4    . DT  B 2 3   ? 39.272 50.804  68.436  0.50 94.76  ? 118  DT  X C4    1 
ATOM   382   O  O4    . DT  B 2 3   ? 38.688 51.744  68.977  0.50 93.36  ? 118  DT  X O4    1 
ATOM   383   C  C5    . DT  B 2 3   ? 38.681 49.675  67.765  0.50 95.30  ? 118  DT  X C5    1 
ATOM   384   C  C7    . DT  B 2 3   ? 37.155 49.565  67.682  0.50 95.74  ? 118  DT  X C7    1 
ATOM   385   C  C6    . DT  B 2 3   ? 39.450 48.741  67.215  0.50 96.30  ? 118  DT  X C6    1 
ATOM   386   P  P     . DA  B 2 4   ? 43.315 43.774  66.642  0.50 96.24  ? 119  DA  X P     1 
ATOM   387   O  OP1   . DA  B 2 4   ? 43.964 42.689  65.875  0.50 96.41  ? 119  DA  X OP1   1 
ATOM   388   O  OP2   . DA  B 2 4   ? 42.116 43.412  67.428  0.50 96.46  ? 119  DA  X OP2   1 
ATOM   389   O  "O5'" . DA  B 2 4   ? 44.422 44.398  67.631  0.50 95.76  ? 119  DA  X "O5'" 1 
ATOM   390   C  "C5'" . DA  B 2 4   ? 44.463 44.033  69.045  0.50 93.52  ? 119  DA  X "C5'" 1 
ATOM   391   C  "C4'" . DA  B 2 4   ? 45.297 45.042  69.879  0.50 91.55  ? 119  DA  X "C4'" 1 
ATOM   392   O  "O4'" . DA  B 2 4   ? 44.731 46.367  69.594  0.50 89.76  ? 119  DA  X "O4'" 1 
ATOM   393   C  "C3'" . DA  B 2 4   ? 45.266 44.866  71.432  0.50 91.49  ? 119  DA  X "C3'" 1 
ATOM   394   O  "O3'" . DA  B 2 4   ? 46.529 44.920  72.123  0.50 91.66  ? 119  DA  X "O3'" 1 
ATOM   395   C  "C2'" . DA  B 2 4   ? 44.397 45.963  71.976  0.50 89.74  ? 119  DA  X "C2'" 1 
ATOM   396   C  "C1'" . DA  B 2 4   ? 44.257 46.948  70.815  0.50 87.32  ? 119  DA  X "C1'" 1 
ATOM   397   N  N9    . DA  B 2 4   ? 42.804 47.232  70.697  0.50 83.43  ? 119  DA  X N9    1 
ATOM   398   C  C8    . DA  B 2 4   ? 41.897 46.523  69.975  0.50 82.73  ? 119  DA  X C8    1 
ATOM   399   N  N7    . DA  B 2 4   ? 40.692 46.976  70.104  0.50 81.02  ? 119  DA  X N7    1 
ATOM   400   C  C5    . DA  B 2 4   ? 40.792 48.057  70.959  0.50 79.41  ? 119  DA  X C5    1 
ATOM   401   C  C6    . DA  B 2 4   ? 39.840 48.947  71.505  0.50 77.71  ? 119  DA  X C6    1 
ATOM   402   N  N6    . DA  B 2 4   ? 38.516 48.816  71.295  0.50 76.32  ? 119  DA  X N6    1 
ATOM   403   N  N1    . DA  B 2 4   ? 40.302 49.973  72.260  0.50 76.67  ? 119  DA  X N1    1 
ATOM   404   C  C2    . DA  B 2 4   ? 41.634 50.072  72.467  0.50 76.48  ? 119  DA  X C2    1 
ATOM   405   N  N3    . DA  B 2 4   ? 42.594 49.254  72.026  0.50 77.57  ? 119  DA  X N3    1 
ATOM   406   C  C4    . DA  B 2 4   ? 42.103 48.257  71.298  0.50 80.25  ? 119  DA  X C4    1 
ATOM   407   P  P     . DT  B 2 5   ? 46.754 44.040  73.467  0.50 92.34  ? 120  DT  X P     1 
ATOM   408   O  OP1   . DT  B 2 5   ? 48.181 44.050  73.865  0.50 92.61  ? 120  DT  X OP1   1 
ATOM   409   O  OP2   . DT  B 2 5   ? 45.974 42.779  73.405  0.50 92.12  ? 120  DT  X OP2   1 
ATOM   410   O  "O5'" . DT  B 2 5   ? 45.976 44.845  74.646  0.50 91.58  ? 120  DT  X "O5'" 1 
ATOM   411   C  "C5'" . DT  B 2 5   ? 45.585 44.189  75.868  0.50 88.90  ? 120  DT  X "C5'" 1 
ATOM   412   C  "C4'" . DT  B 2 5   ? 45.542 45.183  77.058  0.50 86.52  ? 120  DT  X "C4'" 1 
ATOM   413   O  "O4'" . DT  B 2 5   ? 44.150 45.655  77.209  0.50 84.92  ? 120  DT  X "O4'" 1 
ATOM   414   C  "C3'" . DT  B 2 5   ? 45.860 44.678  78.448  0.50 85.71  ? 120  DT  X "C3'" 1 
ATOM   415   O  "O3'" . DT  B 2 5   ? 46.309 45.675  79.361  0.50 84.79  ? 120  DT  X "O3'" 1 
ATOM   416   C  "C2'" . DT  B 2 5   ? 44.556 44.440  79.181  0.50 84.19  ? 120  DT  X "C2'" 1 
ATOM   417   C  "C1'" . DT  B 2 5   ? 43.802 45.630  78.620  0.50 82.33  ? 120  DT  X "C1'" 1 
ATOM   418   N  N1    . DT  B 2 5   ? 42.333 45.835  78.834  0.50 78.46  ? 120  DT  X N1    1 
ATOM   419   C  C2    . DT  B 2 5   ? 41.845 47.131  78.820  0.50 76.10  ? 120  DT  X C2    1 
ATOM   420   O  O2    . DT  B 2 5   ? 42.568 48.112  78.713  0.50 75.90  ? 120  DT  X O2    1 
ATOM   421   N  N3    . DT  B 2 5   ? 40.477 47.238  78.949  0.50 73.58  ? 120  DT  X N3    1 
ATOM   422   C  C4    . DT  B 2 5   ? 39.570 46.205  79.108  0.50 73.32  ? 120  DT  X C4    1 
ATOM   423   O  O4    . DT  B 2 5   ? 38.361 46.454  79.162  0.50 70.82  ? 120  DT  X O4    1 
ATOM   424   C  C5    . DT  B 2 5   ? 40.158 44.871  79.180  0.50 74.35  ? 120  DT  X C5    1 
ATOM   425   C  C7    . DT  B 2 5   ? 39.266 43.631  79.422  0.50 73.81  ? 120  DT  X C7    1 
ATOM   426   C  C6    . DT  B 2 5   ? 41.489 44.726  79.030  0.50 76.57  ? 120  DT  X C6    1 
ATOM   427   P  P     . DG  B 2 6   ? 47.756 46.338  79.232  1.00 84.95  ? 121  DG  X P     1 
ATOM   428   O  OP1   . DG  B 2 6   ? 48.157 46.409  77.821  1.00 84.99  ? 121  DG  X OP1   1 
ATOM   429   O  OP2   . DG  B 2 6   ? 48.732 45.609  80.075  1.00 85.37  ? 121  DG  X OP2   1 
ATOM   430   O  "O5'" . DG  B 2 6   ? 47.491 47.770  79.850  1.00 79.83  ? 121  DG  X "O5'" 1 
ATOM   431   C  "C5'" . DG  B 2 6   ? 46.736 48.683  79.042  1.00 71.54  ? 121  DG  X "C5'" 1 
ATOM   432   C  "C4'" . DG  B 2 6   ? 46.074 49.767  79.903  1.00 64.87  ? 121  DG  X "C4'" 1 
ATOM   433   O  "O4'" . DG  B 2 6   ? 44.746 49.291  80.272  1.00 61.26  ? 121  DG  X "O4'" 1 
ATOM   434   C  "C3'" . DG  B 2 6   ? 46.707 50.129  81.255  1.00 61.98  ? 121  DG  X "C3'" 1 
ATOM   435   O  "O3'" . DG  B 2 6   ? 46.623 51.503  81.529  1.00 60.41  ? 121  DG  X "O3'" 1 
ATOM   436   C  "C2'" . DG  B 2 6   ? 45.936 49.333  82.299  1.00 60.59  ? 121  DG  X "C2'" 1 
ATOM   437   C  "C1'" . DG  B 2 6   ? 44.558 49.463  81.658  1.00 59.28  ? 121  DG  X "C1'" 1 
ATOM   438   N  N9    . DG  B 2 6   ? 43.529 48.542  82.121  1.00 56.60  ? 121  DG  X N9    1 
ATOM   439   C  C8    . DG  B 2 6   ? 43.688 47.266  82.613  1.00 56.22  ? 121  DG  X C8    1 
ATOM   440   N  N7    . DG  B 2 6   ? 42.555 46.681  82.907  1.00 54.96  ? 121  DG  X N7    1 
ATOM   441   C  C5    . DG  B 2 6   ? 41.590 47.635  82.598  1.00 55.38  ? 121  DG  X C5    1 
ATOM   442   C  C6    . DG  B 2 6   ? 40.150 47.570  82.664  1.00 55.27  ? 121  DG  X C6    1 
ATOM   443   O  O6    . DG  B 2 6   ? 39.450 46.625  83.037  1.00 53.43  ? 121  DG  X O6    1 
ATOM   444   N  N1    . DG  B 2 6   ? 39.568 48.782  82.242  1.00 53.87  ? 121  DG  X N1    1 
ATOM   445   C  C2    . DG  B 2 6   ? 40.270 49.888  81.785  1.00 52.79  ? 121  DG  X C2    1 
ATOM   446   N  N2    . DG  B 2 6   ? 39.509 50.912  81.423  1.00 51.09  ? 121  DG  X N2    1 
ATOM   447   N  N3    . DG  B 2 6   ? 41.595 49.947  81.709  1.00 53.59  ? 121  DG  X N3    1 
ATOM   448   C  C4    . DG  B 2 6   ? 42.184 48.798  82.127  1.00 55.68  ? 121  DG  X C4    1 
ATOM   449   P  P     . DC  B 2 7   ? 47.583 52.175  82.606  1.00 59.07  ? 122  DC  X P     1 
ATOM   450   O  OP1   . DC  B 2 7   ? 48.409 53.226  81.920  1.00 59.97  ? 122  DC  X OP1   1 
ATOM   451   O  OP2   . DC  B 2 7   ? 48.245 51.135  83.428  1.00 59.55  ? 122  DC  X OP2   1 
ATOM   452   O  "O5'" . DC  B 2 7   ? 46.539 52.870  83.572  1.00 52.29  ? 122  DC  X "O5'" 1 
ATOM   453   C  "C5'" . DC  B 2 7   ? 46.230 54.220  83.388  1.00 43.12  ? 122  DC  X "C5'" 1 
ATOM   454   C  "C4'" . DC  B 2 7   ? 44.773 54.369  83.051  1.00 36.37  ? 122  DC  X "C4'" 1 
ATOM   455   O  "O4'" . DC  B 2 7   ? 44.117 53.086  83.146  1.00 35.04  ? 122  DC  X "O4'" 1 
ATOM   456   C  "C3'" . DC  B 2 7   ? 44.083 55.279  84.058  1.00 33.91  ? 122  DC  X "C3'" 1 
ATOM   457   O  "O3'" . DC  B 2 7   ? 43.286 56.244  83.422  1.00 32.08  ? 122  DC  X "O3'" 1 
ATOM   458   C  "C2'" . DC  B 2 7   ? 43.215 54.353  84.882  1.00 33.49  ? 122  DC  X "C2'" 1 
ATOM   459   C  "C1'" . DC  B 2 7   ? 42.914 53.255  83.884  1.00 33.85  ? 122  DC  X "C1'" 1 
ATOM   460   N  N1    . DC  B 2 7   ? 42.495 51.949  84.452  1.00 30.64  ? 122  DC  X N1    1 
ATOM   461   C  C2    . DC  B 2 7   ? 41.131 51.729  84.682  1.00 29.14  ? 122  DC  X C2    1 
ATOM   462   O  O2    . DC  B 2 7   ? 40.330 52.637  84.440  1.00 29.78  ? 122  DC  X O2    1 
ATOM   463   N  N3    . DC  B 2 7   ? 40.718 50.543  85.162  1.00 27.03  ? 122  DC  X N3    1 
ATOM   464   C  C4    . DC  B 2 7   ? 41.603 49.597  85.431  1.00 27.01  ? 122  DC  X C4    1 
ATOM   465   N  N4    . DC  B 2 7   ? 41.145 48.442  85.913  1.00 24.47  ? 122  DC  X N4    1 
ATOM   466   C  C5    . DC  B 2 7   ? 42.999 49.792  85.222  1.00 28.50  ? 122  DC  X C5    1 
ATOM   467   C  C6    . DC  B 2 7   ? 43.399 50.974  84.735  1.00 28.09  ? 122  DC  X C6    1 
ATOM   468   P  P     . DT  B 2 8   ? 42.771 57.477  84.282  1.00 33.67  ? 123  DT  X P     1 
ATOM   469   O  OP1   . DT  B 2 8   ? 42.433 58.646  83.430  1.00 31.87  ? 123  DT  X OP1   1 
ATOM   470   O  OP2   . DT  B 2 8   ? 43.769 57.641  85.369  1.00 31.23  ? 123  DT  X OP2   1 
ATOM   471   O  "O5'" . DT  B 2 8   ? 41.445 56.875  84.918  1.00 32.47  ? 123  DT  X "O5'" 1 
ATOM   472   C  "C5'" . DT  B 2 8   ? 40.236 56.843  84.179  1.00 28.17  ? 123  DT  X "C5'" 1 
ATOM   473   C  "C4'" . DT  B 2 8   ? 39.079 56.611  85.113  1.00 25.25  ? 123  DT  X "C4'" 1 
ATOM   474   O  "O4'" . DT  B 2 8   ? 39.110 55.248  85.591  1.00 24.16  ? 123  DT  X "O4'" 1 
ATOM   475   C  "C3'" . DT  B 2 8   ? 39.116 57.486  86.360  1.00 24.13  ? 123  DT  X "C3'" 1 
ATOM   476   O  "O3'" . DT  B 2 8   ? 37.778 57.692  86.773  1.00 25.76  ? 123  DT  X "O3'" 1 
ATOM   477   C  "C2'" . DT  B 2 8   ? 39.733 56.546  87.376  1.00 22.80  ? 123  DT  X "C2'" 1 
ATOM   478   C  "C1'" . DT  B 2 8   ? 39.026 55.279  86.992  1.00 21.32  ? 123  DT  X "C1'" 1 
ATOM   479   N  N1    . DT  B 2 8   ? 39.524 54.003  87.517  1.00 19.14  ? 123  DT  X N1    1 
ATOM   480   C  C2    . DT  B 2 8   ? 38.571 53.098  87.877  1.00 18.11  ? 123  DT  X C2    1 
ATOM   481   O  O2    . DT  B 2 8   ? 37.404 53.347  87.813  1.00 20.70  ? 123  DT  X O2    1 
ATOM   482   N  N3    . DT  B 2 8   ? 39.032 51.897  88.311  1.00 15.96  ? 123  DT  X N3    1 
ATOM   483   C  C4    . DT  B 2 8   ? 40.343 51.519  88.415  1.00 17.67  ? 123  DT  X C4    1 
ATOM   484   O  O4    . DT  B 2 8   ? 40.627 50.392  88.794  1.00 16.76  ? 123  DT  X O4    1 
ATOM   485   C  C5    . DT  B 2 8   ? 41.305 52.522  88.041  1.00 18.75  ? 123  DT  X C5    1 
ATOM   486   C  C7    . DT  B 2 8   ? 42.756 52.181  88.120  1.00 19.59  ? 123  DT  X C7    1 
ATOM   487   C  C6    . DT  B 2 8   ? 40.855 53.711  87.624  1.00 18.86  ? 123  DT  X C6    1 
ATOM   488   P  P     . DA  B 2 9   ? 37.195 59.174  87.002  1.00 29.64  ? 124  DA  X P     1 
ATOM   489   O  OP1   . DA  B 2 9   ? 37.124 59.808  85.669  1.00 29.77  ? 124  DA  X OP1   1 
ATOM   490   O  OP2   . DA  B 2 9   ? 37.833 59.912  88.140  1.00 23.05  ? 124  DA  X OP2   1 
ATOM   491   O  "O5'" . DA  B 2 9   ? 35.730 58.798  87.479  1.00 27.99  ? 124  DA  X "O5'" 1 
ATOM   492   C  "C5'" . DA  B 2 9   ? 35.567 58.185  88.757  1.00 27.21  ? 124  DA  X "C5'" 1 
ATOM   493   C  "C4'" . DA  B 2 9   ? 34.475 57.143  88.741  1.00 23.82  ? 124  DA  X "C4'" 1 
ATOM   494   O  "O4'" . DA  B 2 9   ? 35.091 55.838  88.599  1.00 20.22  ? 124  DA  X "O4'" 1 
ATOM   495   C  "C3'" . DA  B 2 9   ? 33.778 57.142  90.101  1.00 24.59  ? 124  DA  X "C3'" 1 
ATOM   496   O  "O3'" . DA  B 2 9   ? 32.352 57.226  90.058  1.00 25.73  ? 124  DA  X "O3'" 1 
ATOM   497   C  "C2'" . DA  B 2 9   ? 34.273 55.901  90.809  1.00 23.96  ? 124  DA  X "C2'" 1 
ATOM   498   C  "C1'" . DA  B 2 9   ? 34.860 55.013  89.738  1.00 20.49  ? 124  DA  X "C1'" 1 
ATOM   499   N  N9    . DA  B 2 9   ? 36.155 54.519  90.197  1.00 18.50  ? 124  DA  X N9    1 
ATOM   500   C  C8    . DA  B 2 9   ? 37.357 55.122  90.000  1.00 18.42  ? 124  DA  X C8    1 
ATOM   501   N  N7    . DA  B 2 9   ? 38.370 54.471  90.512  1.00 18.05  ? 124  DA  X N7    1 
ATOM   502   C  C5    . DA  B 2 9   ? 37.790 53.367  91.098  1.00 18.69  ? 124  DA  X C5    1 
ATOM   503   C  C6    . DA  B 2 9   ? 38.337 52.265  91.783  1.00 19.69  ? 124  DA  X C6    1 
ATOM   504   N  N6    . DA  B 2 9   ? 39.634 52.130  92.085  1.00 18.17  ? 124  DA  X N6    1 
ATOM   505   N  N1    . DA  B 2 9   ? 37.493 51.298  92.166  1.00 19.43  ? 124  DA  X N1    1 
ATOM   506   C  C2    . DA  B 2 9   ? 36.194 51.460  91.924  1.00 19.95  ? 124  DA  X C2    1 
ATOM   507   N  N3    . DA  B 2 9   ? 35.558 52.466  91.324  1.00 18.52  ? 124  DA  X N3    1 
ATOM   508   C  C4    . DA  B 2 9   ? 36.424 53.385  90.914  1.00 18.02  ? 124  DA  X C4    1 
ATOM   509   P  P     . DT  B 2 10  ? 31.580 57.846  91.318  1.00 27.06  ? 125  DT  X P     1 
ATOM   510   O  OP1   . DT  B 2 10  ? 30.404 58.595  90.826  1.00 26.18  ? 125  DT  X OP1   1 
ATOM   511   O  OP2   . DT  B 2 10  ? 32.566 58.521  92.180  1.00 26.94  ? 125  DT  X OP2   1 
ATOM   512   O  "O5'" . DT  B 2 10  ? 31.119 56.562  92.120  1.00 25.03  ? 125  DT  X "O5'" 1 
ATOM   513   C  "C5'" . DT  B 2 10  ? 30.395 55.564  91.454  1.00 23.94  ? 125  DT  X "C5'" 1 
ATOM   514   C  "C4'" . DT  B 2 10  ? 30.512 54.255  92.187  1.00 24.97  ? 125  DT  X "C4'" 1 
ATOM   515   O  "O4'" . DT  B 2 10  ? 31.907 53.932  92.344  1.00 24.56  ? 125  DT  X "O4'" 1 
ATOM   516   C  "C3'" . DT  B 2 10  ? 29.905 54.193  93.586  1.00 25.85  ? 125  DT  X "C3'" 1 
ATOM   517   O  "O3'" . DT  B 2 10  ? 29.179 52.969  93.700  1.00 26.46  ? 125  DT  X "O3'" 1 
ATOM   518   C  "C2'" . DT  B 2 10  ? 31.122 54.140  94.488  1.00 25.99  ? 125  DT  X "C2'" 1 
ATOM   519   C  "C1'" . DT  B 2 10  ? 32.093 53.396  93.620  1.00 24.74  ? 125  DT  X "C1'" 1 
ATOM   520   N  N1    . DT  B 2 10  ? 33.511 53.516  93.964  1.00 25.96  ? 125  DT  X N1    1 
ATOM   521   C  C2    . DT  B 2 10  ? 34.042 52.460  94.620  1.00 27.16  ? 125  DT  X C2    1 
ATOM   522   O  O2    . DT  B 2 10  ? 33.386 51.484  94.897  1.00 29.78  ? 125  DT  X O2    1 
ATOM   523   N  N3    . DT  B 2 10  ? 35.372 52.571  94.919  1.00 26.64  ? 125  DT  X N3    1 
ATOM   524   C  C4    . DT  B 2 10  ? 36.205 53.609  94.589  1.00 26.88  ? 125  DT  X C4    1 
ATOM   525   O  O4    . DT  B 2 10  ? 37.385 53.558  94.872  1.00 28.51  ? 125  DT  X O4    1 
ATOM   526   C  C5    . DT  B 2 10  ? 35.591 54.690  93.901  1.00 26.89  ? 125  DT  X C5    1 
ATOM   527   C  C7    . DT  B 2 10  ? 36.441 55.851  93.505  1.00 25.77  ? 125  DT  X C7    1 
ATOM   528   C  C6    . DT  B 2 10  ? 34.279 54.606  93.634  1.00 26.80  ? 125  DT  X C6    1 
ATOM   529   P  P     . DA  B 2 11  ? 28.370 52.644  95.039  1.00 28.17  ? 126  DA  X P     1 
ATOM   530   O  OP1   . DA  B 2 11  ? 26.938 52.680  94.685  1.00 26.50  ? 126  DA  X OP1   1 
ATOM   531   O  OP2   . DA  B 2 11  ? 28.881 53.514  96.130  1.00 23.27  ? 126  DA  X OP2   1 
ATOM   532   O  "O5'" . DA  B 2 11  ? 28.784 51.140  95.363  1.00 24.38  ? 126  DA  X "O5'" 1 
ATOM   533   C  "C5'" . DA  B 2 11  ? 30.103 50.854  95.773  1.00 21.70  ? 126  DA  X "C5'" 1 
ATOM   534   C  "C4'" . DA  B 2 11  ? 30.123 49.805  96.857  1.00 22.04  ? 126  DA  X "C4'" 1 
ATOM   535   O  "O4'" . DA  B 2 11  ? 31.473 49.756  97.328  1.00 24.52  ? 126  DA  X "O4'" 1 
ATOM   536   C  "C3'" . DA  B 2 11  ? 29.324 50.112  98.113  1.00 22.54  ? 126  DA  X "C3'" 1 
ATOM   537   O  "O3'" . DA  B 2 11  ? 29.144 48.916  98.860  1.00 23.54  ? 126  DA  X "O3'" 1 
ATOM   538   C  "C2'" . DA  B 2 11  ? 30.252 51.011  98.892  1.00 22.57  ? 126  DA  X "C2'" 1 
ATOM   539   C  "C1'" . DA  B 2 11  ? 31.615 50.464  98.555  1.00 21.86  ? 126  DA  X "C1'" 1 
ATOM   540   N  N9    . DA  B 2 11  ? 32.584 51.520  98.313  1.00 20.25  ? 126  DA  X N9    1 
ATOM   541   C  C8    . DA  B 2 11  ? 32.356 52.683  97.643  1.00 21.56  ? 126  DA  X C8    1 
ATOM   542   N  N7    . DA  B 2 11  ? 33.416 53.432  97.512  1.00 22.98  ? 126  DA  X N7    1 
ATOM   543   C  C5    . DA  B 2 11  ? 34.404 52.710  98.151  1.00 22.27  ? 126  DA  X C5    1 
ATOM   544   C  C6    . DA  B 2 11  ? 35.751 52.963  98.358  1.00 23.43  ? 126  DA  X C6    1 
ATOM   545   N  N6    . DA  B 2 11  ? 36.381 54.039  97.884  1.00 22.35  ? 126  DA  X N6    1 
ATOM   546   N  N1    . DA  B 2 11  ? 36.451 52.060  99.066  1.00 23.96  ? 126  DA  X N1    1 
ATOM   547   C  C2    . DA  B 2 11  ? 35.823 50.967  99.502  1.00 21.91  ? 126  DA  X C2    1 
ATOM   548   N  N3    . DA  B 2 11  ? 34.565 50.613  99.347  1.00 20.70  ? 126  DA  X N3    1 
ATOM   549   C  C4    . DA  B 2 11  ? 33.901 51.541  98.662  1.00 19.78  ? 126  DA  X C4    1 
ATOM   550   P  P     . DC  B 2 12  ? 28.172 48.925  100.117 1.00 25.96  ? 127  DC  X P     1 
ATOM   551   O  OP1   . DC  B 2 12  ? 27.707 47.547  100.337 1.00 24.78  ? 127  DC  X OP1   1 
ATOM   552   O  OP2   . DC  B 2 12  ? 27.184 50.024  99.883  1.00 26.77  ? 127  DC  X OP2   1 
ATOM   553   O  "O5'" . DC  B 2 12  ? 29.102 49.316  101.344 1.00 25.38  ? 127  DC  X "O5'" 1 
ATOM   554   C  "C5'" . DC  B 2 12  ? 29.938 48.338  101.915 1.00 27.57  ? 127  DC  X "C5'" 1 
ATOM   555   C  "C4'" . DC  B 2 12  ? 30.817 48.934  102.988 1.00 29.65  ? 127  DC  X "C4'" 1 
ATOM   556   O  "O4'" . DC  B 2 12  ? 31.867 49.788  102.459 1.00 29.66  ? 127  DC  X "O4'" 1 
ATOM   557   C  "C3'" . DC  B 2 12  ? 30.084 49.761  104.028 1.00 30.98  ? 127  DC  X "C3'" 1 
ATOM   558   O  "O3'" . DC  B 2 12  ? 30.605 49.430  105.315 1.00 34.23  ? 127  DC  X "O3'" 1 
ATOM   559   C  "C2'" . DC  B 2 12  ? 30.509 51.174  103.679 1.00 30.63  ? 127  DC  X "C2'" 1 
ATOM   560   C  "C1'" . DC  B 2 12  ? 31.931 50.961  103.227 1.00 28.14  ? 127  DC  X "C1'" 1 
ATOM   561   N  N1    . DC  B 2 12  ? 32.464 52.044  102.391 1.00 27.05  ? 127  DC  X N1    1 
ATOM   562   C  C2    . DC  B 2 12  ? 33.854 52.239  102.313 1.00 27.55  ? 127  DC  X C2    1 
ATOM   563   O  O2    . DC  B 2 12  ? 34.598 51.451  102.895 1.00 28.92  ? 127  DC  X O2    1 
ATOM   564   N  N3    . DC  B 2 12  ? 34.345 53.277  101.599 1.00 26.62  ? 127  DC  X N3    1 
ATOM   565   C  C4    . DC  B 2 12  ? 33.506 54.093  100.968 1.00 28.01  ? 127  DC  X C4    1 
ATOM   566   N  N4    . DC  B 2 12  ? 34.016 55.125  100.279 1.00 28.74  ? 127  DC  X N4    1 
ATOM   567   C  C5    . DC  B 2 12  ? 32.092 53.898  101.008 1.00 28.03  ? 127  DC  X C5    1 
ATOM   568   C  C6    . DC  B 2 12  ? 31.622 52.869  101.718 1.00 25.97  ? 127  DC  X C6    1 
ATOM   569   P  P     . DG  B 2 13  ? 29.634 48.856  106.452 1.00 35.94  ? 128  DG  X P     1 
ATOM   570   O  OP1   . DG  B 2 13  ? 29.058 47.581  105.950 1.00 32.40  ? 128  DG  X OP1   1 
ATOM   571   O  OP2   . DG  B 2 13  ? 28.750 49.964  106.908 1.00 35.26  ? 128  DG  X OP2   1 
ATOM   572   O  "O5'" . DG  B 2 13  ? 30.646 48.558  107.636 1.00 37.08  ? 128  DG  X "O5'" 1 
ATOM   573   C  "C5'" . DG  B 2 13  ? 31.809 47.750  107.412 1.00 37.09  ? 128  DG  X "C5'" 1 
ATOM   574   C  "C4'" . DG  B 2 13  ? 33.039 48.393  108.019 1.00 36.18  ? 128  DG  X "C4'" 1 
ATOM   575   O  "O4'" . DG  B 2 13  ? 33.544 49.446  107.162 1.00 34.38  ? 128  DG  X "O4'" 1 
ATOM   576   C  "C3'" . DG  B 2 13  ? 32.852 49.017  109.400 1.00 37.86  ? 128  DG  X "C3'" 1 
ATOM   577   O  "O3'" . DG  B 2 13  ? 33.901 48.582  110.280 1.00 40.91  ? 128  DG  X "O3'" 1 
ATOM   578   C  "C2'" . DG  B 2 13  ? 32.885 50.514  109.120 1.00 34.17  ? 128  DG  X "C2'" 1 
ATOM   579   C  "C1'" . DG  B 2 13  ? 33.773 50.628  107.896 1.00 31.31  ? 128  DG  X "C1'" 1 
ATOM   580   N  N9    . DG  B 2 13  ? 33.469 51.758  107.017 1.00 29.63  ? 128  DG  X N9    1 
ATOM   581   C  C8    . DG  B 2 13  ? 32.229 52.124  106.554 1.00 29.85  ? 128  DG  X C8    1 
ATOM   582   N  N7    . DG  B 2 13  ? 32.257 53.178  105.779 1.00 27.92  ? 128  DG  X N7    1 
ATOM   583   C  C5    . DG  B 2 13  ? 33.591 53.529  105.726 1.00 27.48  ? 128  DG  X C5    1 
ATOM   584   C  C6    . DG  B 2 13  ? 34.219 54.568  105.032 1.00 28.33  ? 128  DG  X C6    1 
ATOM   585   O  O6    . DG  B 2 13  ? 33.710 55.427  104.305 1.00 29.69  ? 128  DG  X O6    1 
ATOM   586   N  N1    . DG  B 2 13  ? 35.588 54.559  105.235 1.00 27.22  ? 128  DG  X N1    1 
ATOM   587   C  C2    . DG  B 2 13  ? 36.259 53.661  105.996 1.00 24.54  ? 128  DG  X C2    1 
ATOM   588   N  N2    . DG  B 2 13  ? 37.560 53.828  106.035 1.00 23.86  ? 128  DG  X N2    1 
ATOM   589   N  N3    . DG  B 2 13  ? 35.694 52.679  106.656 1.00 24.58  ? 128  DG  X N3    1 
ATOM   590   C  C4    . DG  B 2 13  ? 34.360 52.669  106.479 1.00 27.20  ? 128  DG  X C4    1 
ATOM   591   P  P     . DA  B 2 14  ? 33.823 48.905  111.855 1.00 43.17  ? 129  DA  X P     1 
ATOM   592   O  OP1   . DA  B 2 14  ? 34.475 47.744  112.493 1.00 44.49  ? 129  DA  X OP1   1 
ATOM   593   O  OP2   . DA  B 2 14  ? 32.438 49.282  112.250 1.00 42.51  ? 129  DA  X OP2   1 
ATOM   594   O  "O5'" . DA  B 2 14  ? 34.786 50.168  111.998 1.00 41.29  ? 129  DA  X "O5'" 1 
ATOM   595   C  "C5'" . DA  B 2 14  ? 36.093 50.130  111.410 1.00 39.87  ? 129  DA  X "C5'" 1 
ATOM   596   C  "C4'" . DA  B 2 14  ? 36.769 51.483  111.468 1.00 39.53  ? 129  DA  X "C4'" 1 
ATOM   597   O  "O4'" . DA  B 2 14  ? 36.495 52.365  110.348 1.00 37.04  ? 129  DA  X "O4'" 1 
ATOM   598   C  "C3'" . DA  B 2 14  ? 36.506 52.302  112.721 1.00 42.22  ? 129  DA  X "C3'" 1 
ATOM   599   O  "O3'" . DA  B 2 14  ? 37.744 52.909  113.094 1.00 48.26  ? 129  DA  X "O3'" 1 
ATOM   600   C  "C2'" . DA  B 2 14  ? 35.534 53.355  112.221 1.00 38.32  ? 129  DA  X "C2'" 1 
ATOM   601   C  "C1'" . DA  B 2 14  ? 36.093 53.633  110.842 1.00 35.02  ? 129  DA  X "C1'" 1 
ATOM   602   N  N9    . DA  B 2 14  ? 35.114 54.217  109.919 1.00 33.64  ? 129  DA  X N9    1 
ATOM   603   C  C8    . DA  B 2 14  ? 33.757 53.954  109.832 1.00 33.77  ? 129  DA  X C8    1 
ATOM   604   N  N7    . DA  B 2 14  ? 33.129 54.700  108.944 1.00 31.39  ? 129  DA  X N7    1 
ATOM   605   C  C5    . DA  B 2 14  ? 34.134 55.498  108.419 1.00 29.47  ? 129  DA  X C5    1 
ATOM   606   C  C6    . DA  B 2 14  ? 34.106 56.528  107.497 1.00 29.22  ? 129  DA  X C6    1 
ATOM   607   N  N6    . DA  B 2 14  ? 32.981 56.975  106.930 1.00 29.58  ? 129  DA  X N6    1 
ATOM   608   N  N1    . DA  B 2 14  ? 35.276 57.116  107.180 1.00 28.05  ? 129  DA  X N1    1 
ATOM   609   C  C2    . DA  B 2 14  ? 36.386 56.697  107.781 1.00 26.72  ? 129  DA  X C2    1 
ATOM   610   N  N3    . DA  B 2 14  ? 36.539 55.755  108.689 1.00 27.90  ? 129  DA  X N3    1 
ATOM   611   C  C4    . DA  B 2 14  ? 35.362 55.189  108.978 1.00 30.13  ? 129  DA  X C4    1 
ATOM   612   P  P     . DA  B 2 15  ? 37.996 53.372  114.611 1.00 53.34  ? 130  DA  X P     1 
ATOM   613   O  OP1   . DA  B 2 15  ? 38.901 52.364  115.265 1.00 51.17  ? 130  DA  X OP1   1 
ATOM   614   O  OP2   . DA  B 2 15  ? 36.700 53.746  115.245 1.00 52.14  ? 130  DA  X OP2   1 
ATOM   615   O  "O5'" . DA  B 2 15  ? 38.784 54.726  114.396 1.00 50.50  ? 130  DA  X "O5'" 1 
ATOM   616   C  "C5'" . DA  B 2 15  ? 39.876 54.753  113.507 1.00 49.72  ? 130  DA  X "C5'" 1 
ATOM   617   C  "C4'" . DA  B 2 15  ? 40.019 56.138  112.950 1.00 48.37  ? 130  DA  X "C4'" 1 
ATOM   618   O  "O4'" . DA  B 2 15  ? 38.892 56.385  112.080 1.00 46.23  ? 130  DA  X "O4'" 1 
ATOM   619   C  "C3'" . DA  B 2 15  ? 39.942 57.194  114.047 1.00 50.40  ? 130  DA  X "C3'" 1 
ATOM   620   O  "O3'" . DA  B 2 15  ? 40.880 58.238  113.779 1.00 54.94  ? 130  DA  X "O3'" 1 
ATOM   621   C  "C2'" . DA  B 2 15  ? 38.518 57.702  113.928 1.00 48.25  ? 130  DA  X "C2'" 1 
ATOM   622   C  "C1'" . DA  B 2 15  ? 38.333 57.627  112.431 1.00 44.80  ? 130  DA  X "C1'" 1 
ATOM   623   N  N9    . DA  B 2 15  ? 36.953 57.677  111.947 1.00 41.04  ? 130  DA  X N9    1 
ATOM   624   C  C8    . DA  B 2 15  ? 35.884 56.940  112.373 1.00 39.02  ? 130  DA  X C8    1 
ATOM   625   N  N7    . DA  B 2 15  ? 34.765 57.228  111.757 1.00 37.85  ? 130  DA  X N7    1 
ATOM   626   C  C5    . DA  B 2 15  ? 35.123 58.221  110.866 1.00 37.74  ? 130  DA  X C5    1 
ATOM   627   C  C6    . DA  B 2 15  ? 34.382 58.940  109.940 1.00 37.42  ? 130  DA  X C6    1 
ATOM   628   N  N6    . DA  B 2 15  ? 33.072 58.757  109.773 1.00 36.44  ? 130  DA  X N6    1 
ATOM   629   N  N1    . DA  B 2 15  ? 35.028 59.865  109.188 1.00 36.60  ? 130  DA  X N1    1 
ATOM   630   C  C2    . DA  B 2 15  ? 36.337 60.033  109.382 1.00 37.48  ? 130  DA  X C2    1 
ATOM   631   N  N3    . DA  B 2 15  ? 37.149 59.410  110.238 1.00 37.68  ? 130  DA  X N3    1 
ATOM   632   C  C4    . DA  B 2 15  ? 36.467 58.506  110.962 1.00 38.65  ? 130  DA  X C4    1 
ATOM   633   P  P     . DG  B 2 16  ? 41.252 59.303  114.931 1.00 59.69  ? 131  DG  X P     1 
ATOM   634   O  OP1   . DG  B 2 16  ? 42.734 59.216  115.122 1.00 59.63  ? 131  DG  X OP1   1 
ATOM   635   O  OP2   . DG  B 2 16  ? 40.333 59.186  116.115 1.00 57.68  ? 131  DG  X OP2   1 
ATOM   636   O  "O5'" . DG  B 2 16  ? 40.925 60.689  114.232 1.00 56.54  ? 131  DG  X "O5'" 1 
ATOM   637   C  "C5'" . DG  B 2 16  ? 41.516 61.018  112.986 1.00 52.62  ? 131  DG  X "C5'" 1 
ATOM   638   C  "C4'" . DG  B 2 16  ? 40.813 62.214  112.403 1.00 50.19  ? 131  DG  X "C4'" 1 
ATOM   639   O  "O4'" . DG  B 2 16  ? 39.468 61.854  112.004 1.00 48.12  ? 131  DG  X "O4'" 1 
ATOM   640   C  "C3'" . DG  B 2 16  ? 40.651 63.351  113.406 1.00 50.05  ? 131  DG  X "C3'" 1 
ATOM   641   O  "O3'" . DG  B 2 16  ? 40.893 64.580  112.726 1.00 52.66  ? 131  DG  X "O3'" 1 
ATOM   642   C  "C2'" . DG  B 2 16  ? 39.196 63.239  113.831 1.00 46.39  ? 131  DG  X "C2'" 1 
ATOM   643   C  "C1'" . DG  B 2 16  ? 38.555 62.792  112.541 1.00 43.63  ? 131  DG  X "C1'" 1 
ATOM   644   N  N9    . DG  B 2 16  ? 37.249 62.151  112.652 1.00 39.89  ? 131  DG  X N9    1 
ATOM   645   C  C8    . DG  B 2 16  ? 36.922 61.083  113.444 1.00 38.91  ? 131  DG  X C8    1 
ATOM   646   N  N7    . DG  B 2 16  ? 35.670 60.733  113.345 1.00 37.51  ? 131  DG  X N7    1 
ATOM   647   C  C5    . DG  B 2 16  ? 35.133 61.629  112.437 1.00 38.10  ? 131  DG  X C5    1 
ATOM   648   C  C6    . DG  B 2 16  ? 33.801 61.756  111.956 1.00 39.19  ? 131  DG  X C6    1 
ATOM   649   O  O6    . DG  B 2 16  ? 32.803 61.088  112.277 1.00 37.77  ? 131  DG  X O6    1 
ATOM   650   N  N1    . DG  B 2 16  ? 33.682 62.793  111.024 1.00 39.68  ? 131  DG  X N1    1 
ATOM   651   C  C2    . DG  B 2 16  ? 34.717 63.613  110.621 1.00 39.97  ? 131  DG  X C2    1 
ATOM   652   N  N2    . DG  B 2 16  ? 34.407 64.570  109.716 1.00 37.36  ? 131  DG  X N2    1 
ATOM   653   N  N3    . DG  B 2 16  ? 35.969 63.504  111.080 1.00 39.49  ? 131  DG  X N3    1 
ATOM   654   C  C4    . DG  B 2 16  ? 36.098 62.501  111.982 1.00 38.92  ? 131  DG  X C4    1 
ATOM   655   P  P     . DT  B 2 17  ? 41.140 65.923  113.566 1.00 55.39  ? 132  DT  X P     1 
ATOM   656   O  OP1   . DT  B 2 17  ? 42.521 66.411  113.253 1.00 55.97  ? 132  DT  X OP1   1 
ATOM   657   O  OP2   . DT  B 2 17  ? 40.731 65.642  114.996 1.00 53.49  ? 132  DT  X OP2   1 
ATOM   658   O  "O5'" . DT  B 2 17  ? 40.101 66.930  112.915 1.00 49.28  ? 132  DT  X "O5'" 1 
ATOM   659   C  "C5'" . DT  B 2 17  ? 38.789 66.491  112.692 1.00 44.87  ? 132  DT  X "C5'" 1 
ATOM   660   C  "C4'" . DT  B 2 17  ? 38.014 67.529  111.936 1.00 43.58  ? 132  DT  X "C4'" 1 
ATOM   661   O  "O4'" . DT  B 2 17  ? 36.731 66.936  111.691 1.00 42.41  ? 132  DT  X "O4'" 1 
ATOM   662   C  "C3'" . DT  B 2 17  ? 37.748 68.784  112.750 1.00 45.58  ? 132  DT  X "C3'" 1 
ATOM   663   O  "O3'" . DT  B 2 17  ? 37.653 69.921  111.895 1.00 49.14  ? 132  DT  X "O3'" 1 
ATOM   664   C  "C2'" . DT  B 2 17  ? 36.432 68.475  113.437 1.00 44.47  ? 132  DT  X "C2'" 1 
ATOM   665   C  "C1'" . DT  B 2 17  ? 35.729 67.548  112.466 1.00 40.52  ? 132  DT  X "C1'" 1 
ATOM   666   N  N1    . DT  B 2 17  ? 34.958 66.472  113.102 1.00 38.50  ? 132  DT  X N1    1 
ATOM   667   C  C2    . DT  B 2 17  ? 33.631 66.390  112.798 1.00 38.23  ? 132  DT  X C2    1 
ATOM   668   O  O2    . DT  B 2 17  ? 33.068 67.187  112.074 1.00 40.12  ? 132  DT  X O2    1 
ATOM   669   N  N3    . DT  B 2 17  ? 32.978 65.350  113.384 1.00 36.73  ? 132  DT  X N3    1 
ATOM   670   C  C4    . DT  B 2 17  ? 33.505 64.435  114.249 1.00 35.08  ? 132  DT  X C4    1 
ATOM   671   O  O4    . DT  B 2 17  ? 32.814 63.572  114.716 1.00 36.51  ? 132  DT  X O4    1 
ATOM   672   C  C5    . DT  B 2 17  ? 34.868 64.586  114.546 1.00 35.07  ? 132  DT  X C5    1 
ATOM   673   C  C7    . DT  B 2 17  ? 35.470 63.628  115.513 1.00 36.04  ? 132  DT  X C7    1 
ATOM   674   C  C6    . DT  B 2 17  ? 35.544 65.579  113.961 1.00 36.06  ? 132  DT  X C6    1 
ATOM   675   P  P     . DT  B 2 18  ? 37.530 71.388  112.531 1.00 52.09  ? 133  DT  X P     1 
ATOM   676   O  OP1   . DT  B 2 18  ? 38.067 72.333  111.518 1.00 52.79  ? 133  DT  X OP1   1 
ATOM   677   O  OP2   . DT  B 2 18  ? 38.054 71.409  113.922 1.00 52.44  ? 133  DT  X OP2   1 
ATOM   678   O  "O5'" . DT  B 2 18  ? 35.965 71.600  112.620 1.00 51.69  ? 133  DT  X "O5'" 1 
ATOM   679   C  "C5'" . DT  B 2 18  ? 35.212 71.790  111.440 1.00 52.65  ? 133  DT  X "C5'" 1 
ATOM   680   C  "C4'" . DT  B 2 18  ? 33.765 72.014  111.795 1.00 52.40  ? 133  DT  X "C4'" 1 
ATOM   681   O  "O4'" . DT  B 2 18  ? 33.188 70.777  112.294 1.00 51.62  ? 133  DT  X "O4'" 1 
ATOM   682   C  "C3'" . DT  B 2 18  ? 33.602 73.038  112.918 1.00 53.32  ? 133  DT  X "C3'" 1 
ATOM   683   O  "O3'" . DT  B 2 18  ? 32.448 73.856  112.673 1.00 54.64  ? 133  DT  X "O3'" 1 
ATOM   684   C  "C2'" . DT  B 2 18  ? 33.395 72.162  114.145 1.00 51.96  ? 133  DT  X "C2'" 1 
ATOM   685   C  "C1'" . DT  B 2 18  ? 32.567 71.055  113.530 1.00 49.68  ? 133  DT  X "C1'" 1 
ATOM   686   N  N1    . DT  B 2 18  ? 32.425 69.803  114.290 1.00 46.16  ? 133  DT  X N1    1 
ATOM   687   C  C2    . DT  B 2 18  ? 31.215 69.174  114.179 1.00 44.64  ? 133  DT  X C2    1 
ATOM   688   O  O2    . DT  B 2 18  ? 30.311 69.600  113.473 1.00 43.72  ? 133  DT  X O2    1 
ATOM   689   N  N3    . DT  B 2 18  ? 31.094 68.035  114.929 1.00 44.11  ? 133  DT  X N3    1 
ATOM   690   C  C4    . DT  B 2 18  ? 32.046 67.484  115.765 1.00 43.88  ? 133  DT  X C4    1 
ATOM   691   O  O4    . DT  B 2 18  ? 31.789 66.481  116.406 1.00 45.84  ? 133  DT  X O4    1 
ATOM   692   C  C5    . DT  B 2 18  ? 33.299 68.176  115.816 1.00 43.06  ? 133  DT  X C5    1 
ATOM   693   C  C7    . DT  B 2 18  ? 34.387 67.621  116.680 1.00 40.26  ? 133  DT  X C7    1 
ATOM   694   C  C6    . DT  B 2 18  ? 33.431 69.292  115.082 1.00 44.34  ? 133  DT  X C6    1 
ATOM   695   P  P     . DA  B 2 19  ? 32.376 75.334  113.298 1.00 55.32  ? 134  DA  X P     1 
ATOM   696   O  OP1   . DA  B 2 19  ? 32.785 76.294  112.233 1.00 53.50  ? 134  DA  X OP1   1 
ATOM   697   O  OP2   . DA  B 2 19  ? 33.071 75.318  114.620 1.00 53.92  ? 134  DA  X OP2   1 
ATOM   698   O  "O5'" . DA  B 2 19  ? 30.837 75.548  113.609 1.00 53.03  ? 134  DA  X "O5'" 1 
ATOM   699   C  "C5'" . DA  B 2 19  ? 29.873 75.441  112.583 1.00 48.88  ? 134  DA  X "C5'" 1 
ATOM   700   C  "C4'" . DA  B 2 19  ? 28.671 74.703  113.111 1.00 47.16  ? 134  DA  X "C4'" 1 
ATOM   701   O  "O4'" . DA  B 2 19  ? 29.164 73.505  113.756 1.00 45.42  ? 134  DA  X "O4'" 1 
ATOM   702   C  "C3'" . DA  B 2 19  ? 27.845 75.428  114.172 1.00 47.46  ? 134  DA  X "C3'" 1 
ATOM   703   O  "O3'" . DA  B 2 19  ? 26.471 75.138  113.930 1.00 52.17  ? 134  DA  X "O3'" 1 
ATOM   704   C  "C2'" . DA  B 2 19  ? 28.278 74.761  115.468 1.00 45.00  ? 134  DA  X "C2'" 1 
ATOM   705   C  "C1'" . DA  B 2 19  ? 28.529 73.352  115.006 1.00 42.72  ? 134  DA  X "C1'" 1 
ATOM   706   N  N9    . DA  B 2 19  ? 29.377 72.497  115.843 1.00 39.37  ? 134  DA  X N9    1 
ATOM   707   C  C8    . DA  B 2 19  ? 30.698 72.663  116.167 1.00 38.38  ? 134  DA  X C8    1 
ATOM   708   N  N7    . DA  B 2 19  ? 31.191 71.696  116.916 1.00 36.09  ? 134  DA  X N7    1 
ATOM   709   C  C5    . DA  B 2 19  ? 30.121 70.846  117.107 1.00 35.55  ? 134  DA  X C5    1 
ATOM   710   C  C6    . DA  B 2 19  ? 30.001 69.640  117.811 1.00 35.70  ? 134  DA  X C6    1 
ATOM   711   N  N6    . DA  B 2 19  ? 30.998 69.101  118.513 1.00 34.40  ? 134  DA  X N6    1 
ATOM   712   N  N1    . DA  B 2 19  ? 28.803 69.005  117.779 1.00 36.13  ? 134  DA  X N1    1 
ATOM   713   C  C2    . DA  B 2 19  ? 27.792 69.578  117.089 1.00 36.83  ? 134  DA  X C2    1 
ATOM   714   N  N3    . DA  B 2 19  ? 27.780 70.730  116.400 1.00 36.18  ? 134  DA  X N3    1 
ATOM   715   C  C4    . DA  B 2 19  ? 28.992 71.319  116.449 1.00 37.37  ? 134  DA  X C4    1 
ATOM   716   P  P     . DT  B 2 20  ? 25.338 76.207  114.310 1.00 56.15  ? 135  DT  X P     1 
ATOM   717   O  OP1   . DT  B 2 20  ? 24.632 76.639  113.079 1.00 56.99  ? 135  DT  X OP1   1 
ATOM   718   O  OP2   . DT  B 2 20  ? 25.970 77.216  115.197 1.00 56.67  ? 135  DT  X OP2   1 
ATOM   719   O  "O5'" . DT  B 2 20  ? 24.310 75.356  115.162 1.00 54.49  ? 135  DT  X "O5'" 1 
ATOM   720   C  "C5'" . DT  B 2 20  ? 24.781 74.274  115.919 1.00 55.09  ? 135  DT  X "C5'" 1 
ATOM   721   C  "C4'" . DT  B 2 20  ? 23.644 73.353  116.264 1.00 56.04  ? 135  DT  X "C4'" 1 
ATOM   722   O  "O4'" . DT  B 2 20  ? 24.263 72.196  116.836 1.00 56.08  ? 135  DT  X "O4'" 1 
ATOM   723   C  "C3'" . DT  B 2 20  ? 22.698 73.880  117.331 1.00 57.19  ? 135  DT  X "C3'" 1 
ATOM   724   O  "O3'" . DT  B 2 20  ? 21.407 73.287  117.158 1.00 62.04  ? 135  DT  X "O3'" 1 
ATOM   725   C  "C2'" . DT  B 2 20  ? 23.375 73.450  118.620 1.00 54.51  ? 135  DT  X "C2'" 1 
ATOM   726   C  "C1'" . DT  B 2 20  ? 24.124 72.187  118.240 1.00 52.17  ? 135  DT  X "C1'" 1 
ATOM   727   N  N1    . DT  B 2 20  ? 25.481 72.054  118.795 1.00 49.63  ? 135  DT  X N1    1 
ATOM   728   C  C2    . DT  B 2 20  ? 25.802 70.868  119.424 1.00 49.70  ? 135  DT  X C2    1 
ATOM   729   O  O2    . DT  B 2 20  ? 25.025 69.938  119.514 1.00 50.45  ? 135  DT  X O2    1 
ATOM   730   N  N3    . DT  B 2 20  ? 27.076 70.802  119.927 1.00 48.38  ? 135  DT  X N3    1 
ATOM   731   C  C4    . DT  B 2 20  ? 28.045 71.772  119.845 1.00 48.23  ? 135  DT  X C4    1 
ATOM   732   O  O4    . DT  B 2 20  ? 29.148 71.568  120.323 1.00 48.03  ? 135  DT  X O4    1 
ATOM   733   C  C5    . DT  B 2 20  ? 27.651 72.987  119.165 1.00 47.87  ? 135  DT  X C5    1 
ATOM   734   C  C7    . DT  B 2 20  ? 28.653 74.090  119.037 1.00 47.99  ? 135  DT  X C7    1 
ATOM   735   C  C6    . DT  B 2 20  ? 26.401 73.069  118.679 1.00 47.60  ? 135  DT  X C6    1 
ATOM   736   P  P     . DC  B 2 21  ? 20.183 73.722  118.110 1.00 66.57  ? 136  DC  X P     1 
ATOM   737   O  OP1   . DC  B 2 21  ? 19.145 74.454  117.329 1.00 65.35  ? 136  DC  X OP1   1 
ATOM   738   O  OP2   . DC  B 2 21  ? 20.792 74.382  119.288 1.00 68.75  ? 136  DC  X OP2   1 
ATOM   739   O  "O5'" . DC  B 2 21  ? 19.593 72.318  118.587 1.00 66.13  ? 136  DC  X "O5'" 1 
ATOM   740   C  "C5'" . DC  B 2 21  ? 19.441 72.008  119.976 1.00 68.72  ? 136  DC  X "C5'" 1 
ATOM   741   C  "C4'" . DC  B 2 21  ? 19.918 70.600  120.258 1.00 70.28  ? 136  DC  X "C4'" 1 
ATOM   742   O  "O4'" . DC  B 2 21  ? 21.368 70.566  120.301 1.00 70.27  ? 136  DC  X "O4'" 1 
ATOM   743   C  "C3'" . DC  B 2 21  ? 19.462 70.023  121.599 1.00 71.52  ? 136  DC  X "C3'" 1 
ATOM   744   O  "O3'" . DC  B 2 21  ? 19.389 68.603  121.509 1.00 73.36  ? 136  DC  X "O3'" 1 
ATOM   745   C  "C2'" . DC  B 2 21  ? 20.649 70.276  122.510 1.00 71.52  ? 136  DC  X "C2'" 1 
ATOM   746   C  "C1'" . DC  B 2 21  ? 21.818 70.086  121.570 1.00 70.34  ? 136  DC  X "C1'" 1 
ATOM   747   N  N1    . DC  B 2 21  ? 23.009 70.866  121.947 1.00 69.66  ? 136  DC  X N1    1 
ATOM   748   C  C2    . DC  B 2 21  ? 24.101 70.220  122.586 1.00 69.05  ? 136  DC  X C2    1 
ATOM   749   O  O2    . DC  B 2 21  ? 24.012 69.012  122.877 1.00 66.73  ? 136  DC  X O2    1 
ATOM   750   N  N3    . DC  B 2 21  ? 25.213 70.946  122.870 1.00 69.27  ? 136  DC  X N3    1 
ATOM   751   C  C4    . DC  B 2 21  ? 25.255 72.258  122.568 1.00 70.49  ? 136  DC  X C4    1 
ATOM   752   N  N4    . DC  B 2 21  ? 26.372 72.944  122.851 1.00 70.95  ? 136  DC  X N4    1 
ATOM   753   C  C5    . DC  B 2 21  ? 24.153 72.930  121.957 1.00 70.09  ? 136  DC  X C5    1 
ATOM   754   C  C6    . DC  B 2 21  ? 23.065 72.205  121.667 1.00 69.45  ? 136  DC  X C6    1 
ATOM   755   O  "O5'" . DG  C 3 1   ? 36.465 73.462  128.099 1.00 98.37  ? 100  DG  D "O5'" 1 
ATOM   756   C  "C5'" . DG  C 3 1   ? 36.086 72.078  127.957 1.00 97.47  ? 100  DG  D "C5'" 1 
ATOM   757   C  "C4'" . DG  C 3 1   ? 35.656 71.355  129.218 1.00 96.53  ? 100  DG  D "C4'" 1 
ATOM   758   O  "O4'" . DG  C 3 1   ? 34.514 72.008  129.825 1.00 94.72  ? 100  DG  D "O4'" 1 
ATOM   759   C  "C3'" . DG  C 3 1   ? 35.220 69.916  128.971 1.00 96.49  ? 100  DG  D "C3'" 1 
ATOM   760   O  "O3'" . DG  C 3 1   ? 35.647 69.050  130.015 1.00 98.78  ? 100  DG  D "O3'" 1 
ATOM   761   C  "C2'" . DG  C 3 1   ? 33.704 69.979  128.903 1.00 94.41  ? 100  DG  D "C2'" 1 
ATOM   762   C  "C1'" . DG  C 3 1   ? 33.312 71.275  129.604 1.00 91.97  ? 100  DG  D "C1'" 1 
ATOM   763   N  N9    . DG  C 3 1   ? 32.478 72.095  128.728 1.00 88.99  ? 100  DG  D N9    1 
ATOM   764   C  C8    . DG  C 3 1   ? 32.898 73.177  127.983 1.00 87.56  ? 100  DG  D C8    1 
ATOM   765   N  N7    . DG  C 3 1   ? 31.957 73.689  127.238 1.00 85.75  ? 100  DG  D N7    1 
ATOM   766   C  C5    . DG  C 3 1   ? 30.842 72.911  127.514 1.00 84.98  ? 100  DG  D C5    1 
ATOM   767   C  C6    . DG  C 3 1   ? 29.530 72.985  126.992 1.00 83.95  ? 100  DG  D C6    1 
ATOM   768   O  O6    . DG  C 3 1   ? 29.076 73.786  126.147 1.00 82.38  ? 100  DG  D O6    1 
ATOM   769   N  N1    . DG  C 3 1   ? 28.711 71.994  127.539 1.00 83.02  ? 100  DG  D N1    1 
ATOM   770   C  C2    . DG  C 3 1   ? 29.108 71.050  128.459 1.00 82.69  ? 100  DG  D C2    1 
ATOM   771   N  N2    . DG  C 3 1   ? 28.176 70.167  128.840 1.00 82.06  ? 100  DG  D N2    1 
ATOM   772   N  N3    . DG  C 3 1   ? 30.331 70.975  128.958 1.00 83.96  ? 100  DG  D N3    1 
ATOM   773   C  C4    . DG  C 3 1   ? 31.142 71.927  128.443 1.00 86.06  ? 100  DG  D C4    1 
ATOM   774   P  P     . DG  C 3 2   ? 35.726 67.472  129.728 1.00 100.16 ? 101  DG  D P     1 
ATOM   775   O  OP1   . DG  C 3 2   ? 36.295 66.761  130.912 1.00 99.76  ? 101  DG  D OP1   1 
ATOM   776   O  OP2   . DG  C 3 2   ? 36.363 67.308  128.389 1.00 99.61  ? 101  DG  D OP2   1 
ATOM   777   O  "O5'" . DG  C 3 2   ? 34.198 67.061  129.556 1.00 96.70  ? 101  DG  D "O5'" 1 
ATOM   778   C  "C5'" . DG  C 3 2   ? 33.800 66.280  128.441 1.00 89.88  ? 101  DG  D "C5'" 1 
ATOM   779   C  "C4'" . DG  C 3 2   ? 32.351 65.877  128.569 1.00 84.72  ? 101  DG  D "C4'" 1 
ATOM   780   O  "O4'" . DG  C 3 2   ? 31.517 67.035  128.287 1.00 81.50  ? 101  DG  D "O4'" 1 
ATOM   781   C  "C3'" . DG  C 3 2   ? 31.988 64.824  127.521 1.00 82.74  ? 101  DG  D "C3'" 1 
ATOM   782   O  "O3'" . DG  C 3 2   ? 31.134 63.794  128.036 1.00 80.91  ? 101  DG  D "O3'" 1 
ATOM   783   C  "C2'" . DG  C 3 2   ? 31.304 65.618  126.432 1.00 80.43  ? 101  DG  D "C2'" 1 
ATOM   784   C  "C1'" . DG  C 3 2   ? 30.654 66.756  127.194 1.00 77.47  ? 101  DG  D "C1'" 1 
ATOM   785   N  N9    . DG  C 3 2   ? 30.536 67.953  126.364 1.00 72.61  ? 101  DG  D N9    1 
ATOM   786   C  C8    . DG  C 3 2   ? 31.544 68.797  125.953 1.00 70.28  ? 101  DG  D C8    1 
ATOM   787   N  N7    . DG  C 3 2   ? 31.129 69.730  125.139 1.00 68.34  ? 101  DG  D N7    1 
ATOM   788   C  C5    . DG  C 3 2   ? 29.760 69.500  125.019 1.00 68.37  ? 101  DG  D C5    1 
ATOM   789   C  C6    . DG  C 3 2   ? 28.755 70.187  124.249 1.00 67.32  ? 101  DG  D C6    1 
ATOM   790   O  O6    . DG  C 3 2   ? 28.881 71.175  123.507 1.00 66.17  ? 101  DG  D O6    1 
ATOM   791   N  N1    . DG  C 3 2   ? 27.501 69.610  124.415 1.00 66.52  ? 101  DG  D N1    1 
ATOM   792   C  C2    . DG  C 3 2   ? 27.231 68.528  125.216 1.00 68.10  ? 101  DG  D C2    1 
ATOM   793   N  N2    . DG  C 3 2   ? 25.944 68.114  125.237 1.00 69.29  ? 101  DG  D N2    1 
ATOM   794   N  N3    . DG  C 3 2   ? 28.145 67.891  125.941 1.00 68.20  ? 101  DG  D N3    1 
ATOM   795   C  C4    . DG  C 3 2   ? 29.377 68.423  125.788 1.00 69.55  ? 101  DG  D C4    1 
ATOM   796   P  P     . DA  C 3 3   ? 30.910 62.460  127.167 1.00 79.16  ? 102  DA  D P     1 
ATOM   797   O  OP1   . DA  C 3 3   ? 30.647 61.303  128.072 1.00 78.71  ? 102  DA  D OP1   1 
ATOM   798   O  OP2   . DA  C 3 3   ? 32.040 62.394  126.191 1.00 78.78  ? 102  DA  D OP2   1 
ATOM   799   O  "O5'" . DA  C 3 3   ? 29.571 62.791  126.373 1.00 74.74  ? 102  DA  D "O5'" 1 
ATOM   800   C  "C5'" . DA  C 3 3   ? 28.337 62.934  127.072 1.00 68.77  ? 102  DA  D "C5'" 1 
ATOM   801   C  "C4'" . DA  C 3 3   ? 27.196 63.085  126.091 1.00 64.47  ? 102  DA  D "C4'" 1 
ATOM   802   O  "O4'" . DA  C 3 3   ? 27.287 64.364  125.412 1.00 61.25  ? 102  DA  D "O4'" 1 
ATOM   803   C  "C3'" . DA  C 3 3   ? 27.149 62.024  124.993 1.00 62.12  ? 102  DA  D "C3'" 1 
ATOM   804   O  "O3'" . DA  C 3 3   ? 25.787 61.672  124.710 1.00 61.77  ? 102  DA  D "O3'" 1 
ATOM   805   C  "C2'" . DA  C 3 3   ? 27.819 62.713  123.818 1.00 58.75  ? 102  DA  D "C2'" 1 
ATOM   806   C  "C1'" . DA  C 3 3   ? 27.442 64.179  124.015 1.00 56.69  ? 102  DA  D "C1'" 1 
ATOM   807   N  N9    . DA  C 3 3   ? 28.466 65.118  123.559 1.00 51.76  ? 102  DA  D N9    1 
ATOM   808   C  C8    . DA  C 3 3   ? 29.818 65.053  123.808 1.00 50.71  ? 102  DA  D C8    1 
ATOM   809   N  N7    . DA  C 3 3   ? 30.509 66.026  123.262 1.00 47.71  ? 102  DA  D N7    1 
ATOM   810   C  C5    . DA  C 3 3   ? 29.551 66.778  122.608 1.00 46.88  ? 102  DA  D C5    1 
ATOM   811   C  C6    . DA  C 3 3   ? 29.657 67.915  121.815 1.00 46.82  ? 102  DA  D C6    1 
ATOM   812   N  N6    . DA  C 3 3   ? 30.832 68.492  121.521 1.00 44.27  ? 102  DA  D N6    1 
ATOM   813   N  N1    . DA  C 3 3   ? 28.512 68.436  121.306 1.00 47.75  ? 102  DA  D N1    1 
ATOM   814   C  C2    . DA  C 3 3   ? 27.344 67.806  121.574 1.00 49.15  ? 102  DA  D C2    1 
ATOM   815   N  N3    . DA  C 3 3   ? 27.125 66.704  122.293 1.00 47.87  ? 102  DA  D N3    1 
ATOM   816   C  C4    . DA  C 3 3   ? 28.284 66.238  122.790 1.00 48.56  ? 102  DA  D C4    1 
ATOM   817   P  P     . DT  C 3 4   ? 25.466 60.579  123.580 1.00 62.17  ? 103  DT  D P     1 
ATOM   818   O  OP1   . DT  C 3 4   ? 24.161 59.908  123.900 1.00 60.41  ? 103  DT  D OP1   1 
ATOM   819   O  OP2   . DT  C 3 4   ? 26.714 59.770  123.424 1.00 60.38  ? 103  DT  D OP2   1 
ATOM   820   O  "O5'" . DT  C 3 4   ? 25.284 61.460  122.261 1.00 59.94  ? 103  DT  D "O5'" 1 
ATOM   821   C  "C5'" . DT  C 3 4   ? 24.322 62.521  122.226 1.00 56.45  ? 103  DT  D "C5'" 1 
ATOM   822   C  "C4'" . DT  C 3 4   ? 24.235 63.129  120.842 1.00 52.33  ? 103  DT  D "C4'" 1 
ATOM   823   O  "O4'" . DT  C 3 4   ? 25.227 64.167  120.597 1.00 49.96  ? 103  DT  D "O4'" 1 
ATOM   824   C  "C3'" . DT  C 3 4   ? 24.379 62.130  119.701 1.00 50.51  ? 103  DT  D "C3'" 1 
ATOM   825   O  "O3'" . DT  C 3 4   ? 23.444 62.469  118.674 1.00 50.41  ? 103  DT  D "O3'" 1 
ATOM   826   C  "C2'" . DT  C 3 4   ? 25.803 62.382  119.236 1.00 47.61  ? 103  DT  D "C2'" 1 
ATOM   827   C  "C1'" . DT  C 3 4   ? 25.878 63.889  119.375 1.00 43.03  ? 103  DT  D "C1'" 1 
ATOM   828   N  N1    . DT  C 3 4   ? 27.225 64.492  119.401 1.00 36.01  ? 103  DT  D N1    1 
ATOM   829   C  C2    . DT  C 3 4   ? 27.365 65.711  118.782 1.00 33.41  ? 103  DT  D C2    1 
ATOM   830   O  O2    . DT  C 3 4   ? 26.440 66.298  118.281 1.00 33.26  ? 103  DT  D O2    1 
ATOM   831   N  N3    . DT  C 3 4   ? 28.632 66.218  118.773 1.00 31.23  ? 103  DT  D N3    1 
ATOM   832   C  C4    . DT  C 3 4   ? 29.761 65.638  119.323 1.00 31.78  ? 103  DT  D C4    1 
ATOM   833   O  O4    . DT  C 3 4   ? 30.860 66.199  119.226 1.00 31.78  ? 103  DT  D O4    1 
ATOM   834   C  C5    . DT  C 3 4   ? 29.544 64.367  119.982 1.00 30.68  ? 103  DT  D C5    1 
ATOM   835   C  C7    . DT  C 3 4   ? 30.720 63.681  120.607 1.00 29.24  ? 103  DT  D C7    1 
ATOM   836   C  C6    . DT  C 3 4   ? 28.298 63.863  119.993 1.00 31.60  ? 103  DT  D C6    1 
ATOM   837   P  P     . DA  C 3 5   ? 22.806 61.312  117.762 1.00 51.72  ? 104  DA  D P     1 
ATOM   838   O  OP1   . DA  C 3 5   ? 21.545 60.839  118.400 1.00 48.65  ? 104  DA  D OP1   1 
ATOM   839   O  OP2   . DA  C 3 5   ? 23.873 60.324  117.399 1.00 51.15  ? 104  DA  D OP2   1 
ATOM   840   O  "O5'" . DA  C 3 5   ? 22.405 62.106  116.450 1.00 46.68  ? 104  DA  D "O5'" 1 
ATOM   841   C  "C5'" . DA  C 3 5   ? 21.376 63.065  116.515 1.00 40.62  ? 104  DA  D "C5'" 1 
ATOM   842   C  "C4'" . DA  C 3 5   ? 21.637 64.166  115.522 1.00 35.91  ? 104  DA  D "C4'" 1 
ATOM   843   O  "O4'" . DA  C 3 5   ? 22.966 64.653  115.752 1.00 35.31  ? 104  DA  D "O4'" 1 
ATOM   844   C  "C3'" . DA  C 3 5   ? 21.584 63.782  114.052 1.00 32.55  ? 104  DA  D "C3'" 1 
ATOM   845   O  "O3'" . DA  C 3 5   ? 20.879 64.768  113.343 1.00 30.74  ? 104  DA  D "O3'" 1 
ATOM   846   C  "C2'" . DA  C 3 5   ? 23.027 63.799  113.602 1.00 31.91  ? 104  DA  D "C2'" 1 
ATOM   847   C  "C1'" . DA  C 3 5   ? 23.698 64.750  114.550 1.00 31.70  ? 104  DA  D "C1'" 1 
ATOM   848   N  N9    . DA  C 3 5   ? 25.054 64.354  114.884 1.00 28.79  ? 104  DA  D N9    1 
ATOM   849   C  C8    . DA  C 3 5   ? 25.400 63.122  115.382 1.00 28.63  ? 104  DA  D C8    1 
ATOM   850   N  N7    . DA  C 3 5   ? 26.667 63.011  115.691 1.00 27.85  ? 104  DA  D N7    1 
ATOM   851   C  C5    . DA  C 3 5   ? 27.194 64.250  115.365 1.00 27.08  ? 104  DA  D C5    1 
ATOM   852   C  C6    . DA  C 3 5   ? 28.491 64.765  115.485 1.00 26.15  ? 104  DA  D C6    1 
ATOM   853   N  N6    . DA  C 3 5   ? 29.502 64.038  115.980 1.00 23.01  ? 104  DA  D N6    1 
ATOM   854   N  N1    . DA  C 3 5   ? 28.709 66.045  115.078 1.00 24.76  ? 104  DA  D N1    1 
ATOM   855   C  C2    . DA  C 3 5   ? 27.665 66.735  114.576 1.00 26.46  ? 104  DA  D C2    1 
ATOM   856   N  N3    . DA  C 3 5   ? 26.380 66.347  114.416 1.00 26.01  ? 104  DA  D N3    1 
ATOM   857   C  C4    . DA  C 3 5   ? 26.214 65.083  114.840 1.00 27.15  ? 104  DA  D C4    1 
ATOM   858   P  P     . DA  C 3 6   ? 20.401 64.461  111.864 1.00 33.83  ? 105  DA  D P     1 
ATOM   859   O  OP1   . DA  C 3 6   ? 19.450 65.550  111.471 1.00 34.81  ? 105  DA  D OP1   1 
ATOM   860   O  OP2   . DA  C 3 6   ? 19.956 63.047  111.765 1.00 32.06  ? 105  DA  D OP2   1 
ATOM   861   O  "O5'" . DA  C 3 6   ? 21.768 64.636  111.071 1.00 31.83  ? 105  DA  D "O5'" 1 
ATOM   862   C  "C5'" . DA  C 3 6   ? 22.333 65.930  110.970 1.00 31.36  ? 105  DA  D "C5'" 1 
ATOM   863   C  "C4'" . DA  C 3 6   ? 23.640 65.930  110.209 1.00 28.50  ? 105  DA  D "C4'" 1 
ATOM   864   O  "O4'" . DA  C 3 6   ? 24.734 65.502  111.049 1.00 27.64  ? 105  DA  D "O4'" 1 
ATOM   865   C  "C3'" . DA  C 3 6   ? 23.757 65.143  108.904 1.00 27.27  ? 105  DA  D "C3'" 1 
ATOM   866   O  "O3'" . DA  C 3 6   ? 24.123 66.031  107.826 1.00 24.82  ? 105  DA  D "O3'" 1 
ATOM   867   C  "C2'" . DA  C 3 6   ? 24.864 64.139  109.209 1.00 25.17  ? 105  DA  D "C2'" 1 
ATOM   868   C  "C1'" . DA  C 3 6   ? 25.681 64.867  110.249 1.00 22.69  ? 105  DA  D "C1'" 1 
ATOM   869   N  N9    . DA  C 3 6   ? 26.521 64.058  111.123 1.00 19.96  ? 105  DA  D N9    1 
ATOM   870   C  C8    . DA  C 3 6   ? 26.257 62.848  111.697 1.00 18.16  ? 105  DA  D C8    1 
ATOM   871   N  N7    . DA  C 3 6   ? 27.261 62.360  112.389 1.00 16.49  ? 105  DA  D N7    1 
ATOM   872   C  C5    . DA  C 3 6   ? 28.249 63.323  112.265 1.00 16.86  ? 105  DA  D C5    1 
ATOM   873   C  C6    . DA  C 3 6   ? 29.566 63.389  112.735 1.00 15.21  ? 105  DA  D C6    1 
ATOM   874   N  N6    . DA  C 3 6   ? 30.148 62.416  113.411 1.00 15.91  ? 105  DA  D N6    1 
ATOM   875   N  N1    . DA  C 3 6   ? 30.280 64.498  112.467 1.00 15.35  ? 105  DA  D N1    1 
ATOM   876   C  C2    . DA  C 3 6   ? 29.706 65.467  111.752 1.00 18.41  ? 105  DA  D C2    1 
ATOM   877   N  N3    . DA  C 3 6   ? 28.484 65.511  111.222 1.00 20.40  ? 105  DA  D N3    1 
ATOM   878   C  C4    . DA  C 3 6   ? 27.798 64.389  111.517 1.00 19.69  ? 105  DA  D C4    1 
ATOM   879   P  P     . DC  C 3 7   ? 24.113 65.490  106.319 1.00 21.59  ? 106  DC  D P     1 
ATOM   880   O  OP1   . DC  C 3 7   ? 24.400 66.581  105.378 1.00 20.19  ? 106  DC  D OP1   1 
ATOM   881   O  OP2   . DC  C 3 7   ? 22.903 64.669  106.128 1.00 19.43  ? 106  DC  D OP2   1 
ATOM   882   O  "O5'" . DC  C 3 7   ? 25.367 64.521  106.362 1.00 21.86  ? 106  DC  D "O5'" 1 
ATOM   883   C  "C5'" . DC  C 3 7   ? 26.508 64.754  105.551 1.00 22.34  ? 106  DC  D "C5'" 1 
ATOM   884   C  "C4'" . DC  C 3 7   ? 27.461 65.696  106.237 1.00 21.61  ? 106  DC  D "C4'" 1 
ATOM   885   O  "O4'" . DC  C 3 7   ? 27.594 65.257  107.604 1.00 22.95  ? 106  DC  D "O4'" 1 
ATOM   886   C  "C3'" . DC  C 3 7   ? 28.856 65.620  105.642 1.00 22.21  ? 106  DC  D "C3'" 1 
ATOM   887   O  "O3'" . DC  C 3 7   ? 29.249 66.766  104.956 1.00 25.17  ? 106  DC  D "O3'" 1 
ATOM   888   C  "C2'" . DC  C 3 7   ? 29.805 65.348  106.794 1.00 20.44  ? 106  DC  D "C2'" 1 
ATOM   889   C  "C1'" . DC  C 3 7   ? 28.950 65.235  108.033 1.00 20.14  ? 106  DC  D "C1'" 1 
ATOM   890   N  N1    . DC  C 3 7   ? 29.162 63.941  108.679 1.00 18.03  ? 106  DC  D N1    1 
ATOM   891   C  C2    . DC  C 3 7   ? 30.368 63.682  109.320 1.00 19.33  ? 106  DC  D C2    1 
ATOM   892   O  O2    . DC  C 3 7   ? 31.194 64.589  109.413 1.00 21.11  ? 106  DC  D O2    1 
ATOM   893   N  N3    . DC  C 3 7   ? 30.598 62.453  109.833 1.00 19.24  ? 106  DC  D N3    1 
ATOM   894   C  C4    . DC  C 3 7   ? 29.650 61.513  109.748 1.00 20.66  ? 106  DC  D C4    1 
ATOM   895   N  N4    . DC  C 3 7   ? 29.895 60.306  110.274 1.00 21.96  ? 106  DC  D N4    1 
ATOM   896   C  C5    . DC  C 3 7   ? 28.397 61.765  109.125 1.00 20.67  ? 106  DC  D C5    1 
ATOM   897   C  C6    . DC  C 3 7   ? 28.196 62.983  108.615 1.00 19.04  ? 106  DC  D C6    1 
ATOM   898   P  P     . DT  C 3 8   ? 30.121 66.567  103.648 1.00 29.82  ? 107  DT  D P     1 
ATOM   899   O  OP1   . DT  C 3 8   ? 30.126 67.767  102.773 1.00 28.33  ? 107  DT  D OP1   1 
ATOM   900   O  OP2   . DT  C 3 8   ? 29.618 65.288  103.131 1.00 29.06  ? 107  DT  D OP2   1 
ATOM   901   O  "O5'" . DT  C 3 8   ? 31.579 66.331  104.231 1.00 28.05  ? 107  DT  D "O5'" 1 
ATOM   902   C  "C5'" . DT  C 3 8   ? 32.241 67.384  104.892 1.00 28.18  ? 107  DT  D "C5'" 1 
ATOM   903   C  "C4'" . DT  C 3 8   ? 33.619 66.957  105.312 1.00 26.90  ? 107  DT  D "C4'" 1 
ATOM   904   O  "O4'" . DT  C 3 8   ? 33.498 65.831  106.203 1.00 25.18  ? 107  DT  D "O4'" 1 
ATOM   905   C  "C3'" . DT  C 3 8   ? 34.524 66.513  104.184 1.00 27.29  ? 107  DT  D "C3'" 1 
ATOM   906   O  "O3'" . DT  C 3 8   ? 35.836 66.951  104.508 1.00 33.90  ? 107  DT  D "O3'" 1 
ATOM   907   C  "C2'" . DT  C 3 8   ? 34.436 65.007  104.278 1.00 26.28  ? 107  DT  D "C2'" 1 
ATOM   908   C  "C1'" . DT  C 3 8   ? 34.297 64.773  105.765 1.00 24.05  ? 107  DT  D "C1'" 1 
ATOM   909   N  N1    . DT  C 3 8   ? 33.629 63.512  106.172 1.00 22.49  ? 107  DT  D N1    1 
ATOM   910   C  C2    . DT  C 3 8   ? 34.278 62.626  107.026 1.00 23.29  ? 107  DT  D C2    1 
ATOM   911   O  O2    . DT  C 3 8   ? 35.424 62.775  107.442 1.00 24.79  ? 107  DT  D O2    1 
ATOM   912   N  N3    . DT  C 3 8   ? 33.526 61.532  107.375 1.00 22.47  ? 107  DT  D N3    1 
ATOM   913   C  C4    . DT  C 3 8   ? 32.246 61.225  106.951 1.00 19.45  ? 107  DT  D C4    1 
ATOM   914   O  O4    . DT  C 3 8   ? 31.686 60.202  107.325 1.00 18.26  ? 107  DT  D O4    1 
ATOM   915   C  C5    . DT  C 3 8   ? 31.662 62.155  106.066 1.00 18.88  ? 107  DT  D C5    1 
ATOM   916   C  C7    . DT  C 3 8   ? 30.286 61.863  105.570 1.00 20.24  ? 107  DT  D C7    1 
ATOM   917   C  C6    . DT  C 3 8   ? 32.365 63.242  105.716 1.00 19.70  ? 107  DT  D C6    1 
ATOM   918   P  P     . DT  C 3 9   ? 36.967 67.052  103.364 1.00 40.67  ? 108  DT  D P     1 
ATOM   919   O  OP1   . DT  C 3 9   ? 37.638 68.380  103.422 1.00 39.85  ? 108  DT  D OP1   1 
ATOM   920   O  OP2   . DT  C 3 9   ? 36.331 66.613  102.096 1.00 40.64  ? 108  DT  D OP2   1 
ATOM   921   O  "O5'" . DT  C 3 9   ? 38.038 65.977  103.838 1.00 36.94  ? 108  DT  D "O5'" 1 
ATOM   922   C  "C5'" . DT  C 3 9   ? 37.667 65.027  104.803 1.00 34.81  ? 108  DT  D "C5'" 1 
ATOM   923   C  "C4'" . DT  C 3 9   ? 38.879 64.391  105.431 1.00 35.17  ? 108  DT  D "C4'" 1 
ATOM   924   O  "O4'" . DT  C 3 9   ? 38.365 63.233  106.106 1.00 35.45  ? 108  DT  D "O4'" 1 
ATOM   925   C  "C3'" . DT  C 3 9   ? 39.893 63.825  104.450 1.00 37.03  ? 108  DT  D "C3'" 1 
ATOM   926   O  "O3'" . DT  C 3 9   ? 41.112 63.551  105.158 1.00 40.19  ? 108  DT  D "O3'" 1 
ATOM   927   C  "C2'" . DT  C 3 9   ? 39.224 62.537  104.024 1.00 34.96  ? 108  DT  D "C2'" 1 
ATOM   928   C  "C1'" . DT  C 3 9   ? 38.597 62.068  105.318 1.00 31.76  ? 108  DT  D "C1'" 1 
ATOM   929   N  N1    . DT  C 3 9   ? 37.309 61.376  105.173 1.00 27.30  ? 108  DT  D N1    1 
ATOM   930   C  C2    . DT  C 3 9   ? 37.109 60.315  105.983 1.00 26.22  ? 108  DT  D C2    1 
ATOM   931   O  O2    . DT  C 3 9   ? 37.968 59.884  106.726 1.00 27.45  ? 108  DT  D O2    1 
ATOM   932   N  N3    . DT  C 3 9   ? 35.883 59.755  105.886 1.00 25.37  ? 108  DT  D N3    1 
ATOM   933   C  C4    . DT  C 3 9   ? 34.866 60.118  105.038 1.00 24.04  ? 108  DT  D C4    1 
ATOM   934   O  O4    . DT  C 3 9   ? 33.813 59.477  105.042 1.00 26.55  ? 108  DT  D O4    1 
ATOM   935   C  C5    . DT  C 3 9   ? 35.149 61.229  104.188 1.00 21.76  ? 108  DT  D C5    1 
ATOM   936   C  C7    . DT  C 3 9   ? 34.097 61.703  103.239 1.00 19.62  ? 108  DT  D C7    1 
ATOM   937   C  C6    . DT  C 3 9   ? 36.346 61.794  104.290 1.00 22.94  ? 108  DT  D C6    1 
ATOM   938   P  P     . DC  C 3 10  ? 42.482 63.284  104.347 1.00 45.79  ? 109  DC  D P     1 
ATOM   939   O  OP1   . DC  C 3 10  ? 43.567 63.998  105.095 1.00 45.20  ? 109  DC  D OP1   1 
ATOM   940   O  OP2   . DC  C 3 10  ? 42.265 63.554  102.882 1.00 41.74  ? 109  DC  D OP2   1 
ATOM   941   O  "O5'" . DC  C 3 10  ? 42.735 61.728  104.549 1.00 43.70  ? 109  DC  D "O5'" 1 
ATOM   942   C  "C5'" . DC  C 3 10  ? 41.695 60.902  105.051 1.00 43.85  ? 109  DC  D "C5'" 1 
ATOM   943   C  "C4'" . DC  C 3 10  ? 42.249 59.590  105.552 1.00 43.41  ? 109  DC  D "C4'" 1 
ATOM   944   O  "O4'" . DC  C 3 10  ? 41.113 58.752  105.854 1.00 43.35  ? 109  DC  D "O4'" 1 
ATOM   945   C  "C3'" . DC  C 3 10  ? 43.073 58.818  104.524 1.00 43.77  ? 109  DC  D "C3'" 1 
ATOM   946   O  "O3'" . DC  C 3 10  ? 44.108 58.070  105.178 1.00 45.38  ? 109  DC  D "O3'" 1 
ATOM   947   C  "C2'" . DC  C 3 10  ? 42.054 57.917  103.849 1.00 41.77  ? 109  DC  D "C2'" 1 
ATOM   948   C  "C1'" . DC  C 3 10  ? 40.972 57.704  104.897 1.00 41.09  ? 109  DC  D "C1'" 1 
ATOM   949   N  N1    . DC  C 3 10  ? 39.613 57.794  104.329 1.00 39.05  ? 109  DC  D N1    1 
ATOM   950   C  C2    . DC  C 3 10  ? 38.667 56.818  104.637 1.00 39.00  ? 109  DC  D C2    1 
ATOM   951   O  O2    . DC  C 3 10  ? 38.974 55.903  105.411 1.00 39.59  ? 109  DC  D O2    1 
ATOM   952   N  N3    . DC  C 3 10  ? 37.446 56.885  104.077 1.00 39.14  ? 109  DC  D N3    1 
ATOM   953   C  C4    . DC  C 3 10  ? 37.165 57.863  103.222 1.00 40.55  ? 109  DC  D C4    1 
ATOM   954   N  N4    . DC  C 3 10  ? 35.975 57.856  102.626 1.00 43.75  ? 109  DC  D N4    1 
ATOM   955   C  C5    . DC  C 3 10  ? 38.096 58.884  102.918 1.00 40.11  ? 109  DC  D C5    1 
ATOM   956   C  C6    . DC  C 3 10  ? 39.292 58.815  103.491 1.00 38.69  ? 109  DC  D C6    1 
ATOM   957   P  P     . DG  C 3 11  ? 45.347 57.505  104.325 1.00 45.67  ? 110  DG  D P     1 
ATOM   958   O  OP1   . DG  C 3 11  ? 46.536 57.612  105.206 1.00 46.55  ? 110  DG  D OP1   1 
ATOM   959   O  OP2   . DG  C 3 11  ? 45.363 58.149  102.976 1.00 42.84  ? 110  DG  D OP2   1 
ATOM   960   O  "O5'" . DG  C 3 11  ? 44.968 55.965  104.149 1.00 45.31  ? 110  DG  D "O5'" 1 
ATOM   961   C  "C5'" . DG  C 3 11  ? 44.455 55.186  105.251 1.00 42.40  ? 110  DG  D "C5'" 1 
ATOM   962   C  "C4'" . DG  C 3 11  ? 43.925 53.850  104.758 1.00 39.72  ? 110  DG  D "C4'" 1 
ATOM   963   O  "O4'" . DG  C 3 11  ? 42.521 53.913  104.405 1.00 38.23  ? 110  DG  D "O4'" 1 
ATOM   964   C  "C3'" . DG  C 3 11  ? 44.635 53.265  103.530 1.00 38.56  ? 110  DG  D "C3'" 1 
ATOM   965   O  "O3'" . DG  C 3 11  ? 44.782 51.851  103.652 1.00 37.47  ? 110  DG  D "O3'" 1 
ATOM   966   C  "C2'" . DG  C 3 11  ? 43.671 53.566  102.400 1.00 35.38  ? 110  DG  D "C2'" 1 
ATOM   967   C  "C1'" . DG  C 3 11  ? 42.344 53.403  103.091 1.00 33.85  ? 110  DG  D "C1'" 1 
ATOM   968   N  N9    . DG  C 3 11  ? 41.247 54.126  102.469 1.00 30.37  ? 110  DG  D N9    1 
ATOM   969   C  C8    . DG  C 3 11  ? 41.302 55.296  101.759 1.00 29.90  ? 110  DG  D C8    1 
ATOM   970   N  N7    . DG  C 3 11  ? 40.135 55.672  101.306 1.00 29.95  ? 110  DG  D N7    1 
ATOM   971   C  C5    . DG  C 3 11  ? 39.264 54.687  101.753 1.00 27.58  ? 110  DG  D C5    1 
ATOM   972   C  C6    . DG  C 3 11  ? 37.881 54.544  101.572 1.00 26.27  ? 110  DG  D C6    1 
ATOM   973   O  O6    . DG  C 3 11  ? 37.109 55.265  100.953 1.00 25.12  ? 110  DG  D O6    1 
ATOM   974   N  N1    . DG  C 3 11  ? 37.403 53.413  102.204 1.00 27.82  ? 110  DG  D N1    1 
ATOM   975   C  C2    . DG  C 3 11  ? 38.165 52.525  102.918 1.00 28.69  ? 110  DG  D C2    1 
ATOM   976   N  N2    . DG  C 3 11  ? 37.525 51.478  103.473 1.00 29.32  ? 110  DG  D N2    1 
ATOM   977   N  N3    . DG  C 3 11  ? 39.456 52.645  103.083 1.00 28.32  ? 110  DG  D N3    1 
ATOM   978   C  C4    . DG  C 3 11  ? 39.936 53.738  102.479 1.00 28.59  ? 110  DG  D C4    1 
ATOM   979   P  P     . DT  C 3 12  ? 45.866 51.086  102.755 1.00 37.17  ? 111  DT  D P     1 
ATOM   980   O  OP1   . DT  C 3 12  ? 46.968 50.721  103.693 1.00 35.64  ? 111  DT  D OP1   1 
ATOM   981   O  OP2   . DT  C 3 12  ? 46.138 51.889  101.542 1.00 32.59  ? 111  DT  D OP2   1 
ATOM   982   O  "O5'" . DT  C 3 12  ? 45.103 49.758  102.348 1.00 36.51  ? 111  DT  D "O5'" 1 
ATOM   983   C  "C5'" . DT  C 3 12  ? 44.428 49.006  103.356 1.00 38.29  ? 111  DT  D "C5'" 1 
ATOM   984   C  "C4'" . DT  C 3 12  ? 43.109 48.472  102.844 1.00 37.16  ? 111  DT  D "C4'" 1 
ATOM   985   O  "O4'" . DT  C 3 12  ? 42.226 49.532  102.387 1.00 36.96  ? 111  DT  D "O4'" 1 
ATOM   986   C  "C3'" . DT  C 3 12  ? 43.218 47.499  101.677 1.00 38.61  ? 111  DT  D "C3'" 1 
ATOM   987   O  "O3'" . DT  C 3 12  ? 42.323 46.427  101.936 1.00 38.16  ? 111  DT  D "O3'" 1 
ATOM   988   C  "C2'" . DT  C 3 12  ? 42.730 48.311  100.483 1.00 37.30  ? 111  DT  D "C2'" 1 
ATOM   989   C  "C1'" . DT  C 3 12  ? 41.669 49.148  101.146 1.00 34.77  ? 111  DT  D "C1'" 1 
ATOM   990   N  N1    . DT  C 3 12  ? 41.185 50.349  100.432 1.00 31.92  ? 111  DT  D N1    1 
ATOM   991   C  C2    . DT  C 3 12  ? 39.835 50.504  100.412 1.00 30.16  ? 111  DT  D C2    1 
ATOM   992   O  O2    . DT  C 3 12  ? 39.086 49.708  100.908 1.00 34.46  ? 111  DT  D O2    1 
ATOM   993   N  N3    . DT  C 3 12  ? 39.387 51.608  99.783  1.00 26.99  ? 111  DT  D N3    1 
ATOM   994   C  C4    . DT  C 3 12  ? 40.128 52.549  99.162  1.00 27.32  ? 111  DT  D C4    1 
ATOM   995   O  O4    . DT  C 3 12  ? 39.579 53.486  98.653  1.00 29.56  ? 111  DT  D O4    1 
ATOM   996   C  C5    . DT  C 3 12  ? 41.539 52.336  99.175  1.00 27.84  ? 111  DT  D C5    1 
ATOM   997   C  C7    . DT  C 3 12  ? 42.411 53.318  98.466  1.00 26.26  ? 111  DT  D C7    1 
ATOM   998   C  C6    . DT  C 3 12  ? 42.008 51.258  99.818  1.00 29.56  ? 111  DT  D C6    1 
ATOM   999   P  P     . DA  C 3 13  ? 42.504 45.040  101.174 1.00 38.20  ? 112  DA  D P     1 
ATOM   1000  O  OP1   . DA  C 3 13  ? 42.498 44.007  102.260 1.00 34.35  ? 112  DA  D OP1   1 
ATOM   1001  O  OP2   . DA  C 3 13  ? 43.634 45.123  100.192 1.00 34.83  ? 112  DA  D OP2   1 
ATOM   1002  O  "O5'" . DA  C 3 13  ? 41.140 44.919  100.385 1.00 35.08  ? 112  DA  D "O5'" 1 
ATOM   1003  C  "C5'" . DA  C 3 13  ? 39.966 44.599  101.103 1.00 31.67  ? 112  DA  D "C5'" 1 
ATOM   1004  C  "C4'" . DA  C 3 13  ? 38.772 44.637  100.187 1.00 29.42  ? 112  DA  D "C4'" 1 
ATOM   1005  O  "O4'" . DA  C 3 13  ? 38.555 45.987  99.713  1.00 28.54  ? 112  DA  D "O4'" 1 
ATOM   1006  C  "C3'" . DA  C 3 13  ? 38.858 43.762  98.942  1.00 26.71  ? 112  DA  D "C3'" 1 
ATOM   1007  O  "O3'" . DA  C 3 13  ? 37.571 43.201  98.750  1.00 24.17  ? 112  DA  D "O3'" 1 
ATOM   1008  C  "C2'" . DA  C 3 13  ? 39.144 44.771  97.848  1.00 25.89  ? 112  DA  D "C2'" 1 
ATOM   1009  C  "C1'" . DA  C 3 13  ? 38.339 45.952  98.329  1.00 26.66  ? 112  DA  D "C1'" 1 
ATOM   1010  N  N9    . DA  C 3 13  ? 38.733 47.240  97.800  1.00 24.89  ? 112  DA  D N9    1 
ATOM   1011  C  C8    . DA  C 3 13  ? 39.962 47.806  97.836  1.00 27.64  ? 112  DA  D C8    1 
ATOM   1012  N  N7    . DA  C 3 13  ? 40.012 48.991  97.286  1.00 26.89  ? 112  DA  D N7    1 
ATOM   1013  C  C5    . DA  C 3 13  ? 38.722 49.209  96.870  1.00 23.40  ? 112  DA  D C5    1 
ATOM   1014  C  C6    . DA  C 3 13  ? 38.135 50.276  96.246  1.00 22.45  ? 112  DA  D C6    1 
ATOM   1015  N  N6    . DA  C 3 13  ? 38.794 51.377  95.923  1.00 22.89  ? 112  DA  D N6    1 
ATOM   1016  N  N1    . DA  C 3 13  ? 36.830 50.195  95.960  1.00 22.57  ? 112  DA  D N1    1 
ATOM   1017  C  C2    . DA  C 3 13  ? 36.180 49.090  96.299  1.00 24.70  ? 112  DA  D C2    1 
ATOM   1018  N  N3    . DA  C 3 13  ? 36.632 48.009  96.908  1.00 25.59  ? 112  DA  D N3    1 
ATOM   1019  C  C4    . DA  C 3 13  ? 37.928 48.138  97.170  1.00 24.34  ? 112  DA  D C4    1 
ATOM   1020  P  P     . DT  C 3 14  ? 37.377 41.940  97.796  1.00 25.81  ? 113  DT  D P     1 
ATOM   1021  O  OP1   . DT  C 3 14  ? 36.610 40.958  98.596  1.00 25.84  ? 113  DT  D OP1   1 
ATOM   1022  O  OP2   . DT  C 3 14  ? 38.669 41.553  97.179  1.00 23.22  ? 113  DT  D OP2   1 
ATOM   1023  O  "O5'" . DT  C 3 14  ? 36.413 42.493  96.667  1.00 22.25  ? 113  DT  D "O5'" 1 
ATOM   1024  C  "C5'" . DT  C 3 14  ? 36.518 43.829  96.285  1.00 20.64  ? 113  DT  D "C5'" 1 
ATOM   1025  C  "C4'" . DT  C 3 14  ? 35.330 44.248  95.473  1.00 20.89  ? 113  DT  D "C4'" 1 
ATOM   1026  O  "O4'" . DT  C 3 14  ? 35.608 45.617  95.141  1.00 20.67  ? 113  DT  D "O4'" 1 
ATOM   1027  C  "C3'" . DT  C 3 14  ? 35.182 43.538  94.134  1.00 23.49  ? 113  DT  D "C3'" 1 
ATOM   1028  O  "O3'" . DT  C 3 14  ? 33.805 43.688  93.697  1.00 27.16  ? 113  DT  D "O3'" 1 
ATOM   1029  C  "C2'" . DT  C 3 14  ? 36.141 44.323  93.257  1.00 21.06  ? 113  DT  D "C2'" 1 
ATOM   1030  C  "C1'" . DT  C 3 14  ? 35.961 45.732  93.784  1.00 19.37  ? 113  DT  D "C1'" 1 
ATOM   1031  N  N1    . DT  C 3 14  ? 37.116 46.619  93.711  1.00 18.11  ? 113  DT  D N1    1 
ATOM   1032  C  C2    . DT  C 3 14  ? 36.863 47.845  93.201  1.00 20.33  ? 113  DT  D C2    1 
ATOM   1033  O  O2    . DT  C 3 14  ? 35.748 48.176  92.822  1.00 22.01  ? 113  DT  D O2    1 
ATOM   1034  N  N3    . DT  C 3 14  ? 37.953 48.679  93.137  1.00 19.24  ? 113  DT  D N3    1 
ATOM   1035  C  C4    . DT  C 3 14  ? 39.237 48.392  93.519  1.00 17.28  ? 113  DT  D C4    1 
ATOM   1036  O  O4    . DT  C 3 14  ? 40.115 49.231  93.375  1.00 16.24  ? 113  DT  D O4    1 
ATOM   1037  C  C5    . DT  C 3 14  ? 39.432 47.081  94.059  1.00 16.35  ? 113  DT  D C5    1 
ATOM   1038  C  C7    . DT  C 3 14  ? 40.794 46.695  94.517  1.00 15.03  ? 113  DT  D C7    1 
ATOM   1039  C  C6    . DT  C 3 14  ? 38.378 46.263  94.128  1.00 17.26  ? 113  DT  D C6    1 
ATOM   1040  P  P     . DA  C 3 15  ? 33.216 42.789  92.491  1.00 27.80  ? 114  DA  D P     1 
ATOM   1041  O  OP1   . DA  C 3 15  ? 32.120 42.054  93.155  1.00 26.76  ? 114  DA  D OP1   1 
ATOM   1042  O  OP2   . DA  C 3 15  ? 34.288 42.025  91.801  1.00 27.22  ? 114  DA  D OP2   1 
ATOM   1043  O  "O5'" . DA  C 3 15  ? 32.604 43.865  91.493  1.00 22.74  ? 114  DA  D "O5'" 1 
ATOM   1044  C  "C5'" . DA  C 3 15  ? 31.466 44.572  91.900  1.00 24.20  ? 114  DA  D "C5'" 1 
ATOM   1045  C  "C4'" . DA  C 3 15  ? 31.367 45.903  91.204  1.00 25.51  ? 114  DA  D "C4'" 1 
ATOM   1046  O  "O4'" . DA  C 3 15  ? 32.627 46.581  91.314  1.00 27.12  ? 114  DA  D "O4'" 1 
ATOM   1047  C  "C3'" . DA  C 3 15  ? 31.019 45.892  89.724  1.00 27.91  ? 114  DA  D "C3'" 1 
ATOM   1048  O  "O3'" . DA  C 3 15  ? 30.004 46.862  89.494  1.00 31.11  ? 114  DA  D "O3'" 1 
ATOM   1049  C  "C2'" . DA  C 3 15  ? 32.304 46.326  89.041  1.00 28.40  ? 114  DA  D "C2'" 1 
ATOM   1050  C  "C1'" . DA  C 3 15  ? 32.965 47.192  90.088  1.00 26.69  ? 114  DA  D "C1'" 1 
ATOM   1051  N  N9    . DA  C 3 15  ? 34.424 47.254  90.028  1.00 24.01  ? 114  DA  D N9    1 
ATOM   1052  C  C8    . DA  C 3 15  ? 35.276 46.308  90.518  1.00 24.40  ? 114  DA  D C8    1 
ATOM   1053  N  N7    . DA  C 3 15  ? 36.538 46.619  90.398  1.00 24.71  ? 114  DA  D N7    1 
ATOM   1054  C  C5    . DA  C 3 15  ? 36.513 47.853  89.782  1.00 24.67  ? 114  DA  D C5    1 
ATOM   1055  C  C6    . DA  C 3 15  ? 37.535 48.721  89.412  1.00 26.40  ? 114  DA  D C6    1 
ATOM   1056  N  N6    . DA  C 3 15  ? 38.822 48.448  89.601  1.00 29.13  ? 114  DA  D N6    1 
ATOM   1057  N  N1    . DA  C 3 15  ? 37.197 49.886  88.836  1.00 25.12  ? 114  DA  D N1    1 
ATOM   1058  C  C2    . DA  C 3 15  ? 35.902 50.129  88.637  1.00 25.64  ? 114  DA  D C2    1 
ATOM   1059  N  N3    . DA  C 3 15  ? 34.839 49.379  88.938  1.00 24.04  ? 114  DA  D N3    1 
ATOM   1060  C  C4    . DA  C 3 15  ? 35.221 48.246  89.526  1.00 23.17  ? 114  DA  D C4    1 
ATOM   1061  P  P     . DG  C 3 16  ? 29.206 46.860  88.101  1.00 34.10  ? 115  DG  D P     1 
ATOM   1062  O  OP1   . DG  C 3 16  ? 27.805 47.309  88.373  1.00 32.46  ? 115  DG  D OP1   1 
ATOM   1063  O  OP2   . DG  C 3 16  ? 29.478 45.554  87.436  1.00 31.74  ? 115  DG  D OP2   1 
ATOM   1064  O  "O5'" . DG  C 3 16  ? 29.908 48.011  87.282  1.00 31.81  ? 115  DG  D "O5'" 1 
ATOM   1065  C  "C5'" . DG  C 3 16  ? 29.893 49.298  87.813  1.00 32.77  ? 115  DG  D "C5'" 1 
ATOM   1066  C  "C4'" . DG  C 3 16  ? 30.821 50.188  87.045  1.00 34.24  ? 115  DG  D "C4'" 1 
ATOM   1067  O  "O4'" . DG  C 3 16  ? 32.172 49.702  87.145  1.00 33.76  ? 115  DG  D "O4'" 1 
ATOM   1068  C  "C3'" . DG  C 3 16  ? 30.506 50.271  85.562  1.00 36.14  ? 115  DG  D "C3'" 1 
ATOM   1069  O  "O3'" . DG  C 3 16  ? 30.334 51.649  85.252  1.00 40.29  ? 115  DG  D "O3'" 1 
ATOM   1070  C  "C2'" . DG  C 3 16  ? 31.721 49.646  84.879  1.00 33.44  ? 115  DG  D "C2'" 1 
ATOM   1071  C  "C1'" . DG  C 3 16  ? 32.812 49.887  85.899  1.00 33.15  ? 115  DG  D "C1'" 1 
ATOM   1072  N  N9    . DG  C 3 16  ? 33.982 49.021  85.890  1.00 31.08  ? 115  DG  D N9    1 
ATOM   1073  C  C8    . DG  C 3 16  ? 34.003 47.685  86.169  1.00 32.17  ? 115  DG  D C8    1 
ATOM   1074  N  N7    . DG  C 3 16  ? 35.205 47.185  86.184  1.00 31.11  ? 115  DG  D N7    1 
ATOM   1075  C  C5    . DG  C 3 16  ? 36.021 48.255  85.875  1.00 29.49  ? 115  DG  D C5    1 
ATOM   1076  C  C6    . DG  C 3 16  ? 37.420 48.324  85.779  1.00 29.47  ? 115  DG  D C6    1 
ATOM   1077  O  O6    . DG  C 3 16  ? 38.251 47.428  85.962  1.00 31.45  ? 115  DG  D O6    1 
ATOM   1078  N  N1    . DG  C 3 16  ? 37.844 49.595  85.458  1.00 28.27  ? 115  DG  D N1    1 
ATOM   1079  C  C2    . DG  C 3 16  ? 37.028 50.666  85.285  1.00 29.49  ? 115  DG  D C2    1 
ATOM   1080  N  N2    . DG  C 3 16  ? 37.643 51.830  85.025  1.00 31.19  ? 115  DG  D N2    1 
ATOM   1081  N  N3    . DG  C 3 16  ? 35.711 50.615  85.372  1.00 29.74  ? 115  DG  D N3    1 
ATOM   1082  C  C4    . DG  C 3 16  ? 35.281 49.388  85.669  1.00 29.26  ? 115  DG  D C4    1 
ATOM   1083  P  P     . DC  C 3 17  ? 29.338 52.060  84.086  1.00 42.58  ? 116  DC  D P     1 
ATOM   1084  O  OP1   . DC  C 3 17  ? 29.459 53.508  83.837  1.00 42.85  ? 116  DC  D OP1   1 
ATOM   1085  O  OP2   . DC  C 3 17  ? 28.035 51.507  84.522  1.00 42.16  ? 116  DC  D OP2   1 
ATOM   1086  O  "O5'" . DC  C 3 17  ? 29.970 51.255  82.869  1.00 43.66  ? 116  DC  D "O5'" 1 
ATOM   1087  C  "C5'" . DC  C 3 17  ? 30.722 51.910  81.844  1.00 49.69  ? 116  DC  D "C5'" 1 
ATOM   1088  C  "C4'" . DC  C 3 17  ? 32.112 52.311  82.312  1.00 53.45  ? 116  DC  D "C4'" 1 
ATOM   1089  O  "O4'" . DC  C 3 17  ? 32.918 51.206  82.806  1.00 53.72  ? 116  DC  D "O4'" 1 
ATOM   1090  C  "C3'" . DC  C 3 17  ? 32.925 52.914  81.166  1.00 56.70  ? 116  DC  D "C3'" 1 
ATOM   1091  O  "O3'" . DC  C 3 17  ? 33.442 54.191  81.492  1.00 62.57  ? 116  DC  D "O3'" 1 
ATOM   1092  C  "C2'" . DC  C 3 17  ? 34.034 51.911  80.888  1.00 54.89  ? 116  DC  D "C2'" 1 
ATOM   1093  C  "C1'" . DC  C 3 17  ? 34.222 51.272  82.229  1.00 54.12  ? 116  DC  D "C1'" 1 
ATOM   1094  N  N1    . DC  C 3 17  ? 34.799 49.913  82.216  1.00 54.17  ? 116  DC  D N1    1 
ATOM   1095  C  C2    . DC  C 3 17  ? 36.172 49.756  81.979  1.00 53.41  ? 116  DC  D C2    1 
ATOM   1096  O  O2    . DC  C 3 17  ? 36.835 50.743  81.660  1.00 50.70  ? 116  DC  D O2    1 
ATOM   1097  N  N3    . DC  C 3 17  ? 36.735 48.520  82.103  1.00 54.63  ? 116  DC  D N3    1 
ATOM   1098  C  C4    . DC  C 3 17  ? 35.970 47.459  82.429  1.00 56.44  ? 116  DC  D C4    1 
ATOM   1099  N  N4    . DC  C 3 17  ? 36.567 46.254  82.612  1.00 53.12  ? 116  DC  D N4    1 
ATOM   1100  C  C5    . DC  C 3 17  ? 34.559 47.582  82.600  1.00 56.58  ? 116  DC  D C5    1 
ATOM   1101  C  C6    . DC  C 3 17  ? 34.020 48.818  82.483  1.00 56.88  ? 116  DC  D C6    1 
ATOM   1102  P  P     . DA  C 3 18  ? 33.372 55.355  80.384  1.00 68.88  ? 117  DA  D P     1 
ATOM   1103  O  OP1   . DA  C 3 18  ? 32.832 56.597  81.003  1.00 67.41  ? 117  DA  D OP1   1 
ATOM   1104  O  OP2   . DA  C 3 18  ? 32.694 54.772  79.185  1.00 68.82  ? 117  DA  D OP2   1 
ATOM   1105  O  "O5'" . DA  C 3 18  ? 34.893 55.586  79.974  1.00 69.07  ? 117  DA  D "O5'" 1 
ATOM   1106  C  "C5'" . DA  C 3 18  ? 35.880 55.893  80.951  1.00 70.63  ? 117  DA  D "C5'" 1 
ATOM   1107  C  "C4'" . DA  C 3 18  ? 37.223 56.044  80.278  1.00 72.55  ? 117  DA  D "C4'" 1 
ATOM   1108  O  "O4'" . DA  C 3 18  ? 37.679 54.736  79.869  1.00 70.54  ? 117  DA  D "O4'" 1 
ATOM   1109  C  "C3'" . DA  C 3 18  ? 37.152 56.889  79.001  1.00 74.07  ? 117  DA  D "C3'" 1 
ATOM   1110  O  "O3'" . DA  C 3 18  ? 38.376 57.624  78.781  1.00 76.70  ? 117  DA  D "O3'" 1 
ATOM   1111  C  "C2'" . DA  C 3 18  ? 36.902 55.855  77.920  1.00 71.63  ? 117  DA  D "C2'" 1 
ATOM   1112  C  "C1'" . DA  C 3 18  ? 37.639 54.630  78.451  1.00 69.30  ? 117  DA  D "C1'" 1 
ATOM   1113  N  N9    . DA  C 3 18  ? 36.950 53.389  78.162  1.00 66.75  ? 117  DA  D N9    1 
ATOM   1114  C  C8    . DA  C 3 18  ? 35.624 53.189  77.902  1.00 65.53  ? 117  DA  D C8    1 
ATOM   1115  N  N7    . DA  C 3 18  ? 35.301 51.928  77.801  1.00 66.48  ? 117  DA  D N7    1 
ATOM   1116  C  C5    . DA  C 3 18  ? 36.503 51.260  77.990  1.00 66.50  ? 117  DA  D C5    1 
ATOM   1117  C  C6    . DA  C 3 18  ? 36.827 49.895  78.079  1.00 68.31  ? 117  DA  D C6    1 
ATOM   1118  N  N6    . DA  C 3 18  ? 35.913 48.910  78.037  1.00 69.36  ? 117  DA  D N6    1 
ATOM   1119  N  N1    . DA  C 3 18  ? 38.135 49.569  78.260  1.00 68.93  ? 117  DA  D N1    1 
ATOM   1120  C  C2    . DA  C 3 18  ? 39.028 50.560  78.386  1.00 67.69  ? 117  DA  D C2    1 
ATOM   1121  N  N3    . DA  C 3 18  ? 38.827 51.876  78.371  1.00 66.85  ? 117  DA  D N3    1 
ATOM   1122  C  C4    . DA  C 3 18  ? 37.529 52.155  78.168  1.00 65.92  ? 117  DA  D C4    1 
ATOM   1123  P  P     . DT  C 3 19  ? 38.504 58.607  77.502  1.00 78.84  ? 118  DT  D P     1 
ATOM   1124  O  OP1   . DT  C 3 19  ? 38.435 60.049  77.916  1.00 77.49  ? 118  DT  D OP1   1 
ATOM   1125  O  OP2   . DT  C 3 19  ? 37.596 58.094  76.421  1.00 76.87  ? 118  DT  D OP2   1 
ATOM   1126  O  "O5'" . DT  C 3 19  ? 39.986 58.339  77.010  1.00 75.60  ? 118  DT  D "O5'" 1 
ATOM   1127  C  "C5'" . DT  C 3 19  ? 40.990 57.941  77.924  1.00 71.27  ? 118  DT  D "C5'" 1 
ATOM   1128  C  "C4'" . DT  C 3 19  ? 42.053 57.179  77.178  1.00 68.82  ? 118  DT  D "C4'" 1 
ATOM   1129  O  "O4'" . DT  C 3 19  ? 41.567 55.858  76.850  1.00 66.90  ? 118  DT  D "O4'" 1 
ATOM   1130  C  "C3'" . DT  C 3 19  ? 42.425 57.820  75.840  1.00 67.64  ? 118  DT  D "C3'" 1 
ATOM   1131  O  "O3'" . DT  C 3 19  ? 43.788 57.494  75.586  1.00 69.23  ? 118  DT  D "O3'" 1 
ATOM   1132  C  "C2'" . DT  C 3 19  ? 41.537 57.070  74.861  1.00 65.88  ? 118  DT  D "C2'" 1 
ATOM   1133  C  "C1'" . DT  C 3 19  ? 41.643 55.688  75.453  1.00 63.76  ? 118  DT  D "C1'" 1 
ATOM   1134  N  N1    . DT  C 3 19  ? 40.688 54.654  75.088  1.00 61.03  ? 118  DT  D N1    1 
ATOM   1135  C  C2    . DT  C 3 19  ? 41.276 53.445  74.939  1.00 60.89  ? 118  DT  D C2    1 
ATOM   1136  O  O2    . DT  C 3 19  ? 42.423 53.260  75.332  1.00 61.42  ? 118  DT  D O2    1 
ATOM   1137  N  N3    . DT  C 3 19  ? 40.424 52.393  74.713  1.00 60.82  ? 118  DT  D N3    1 
ATOM   1138  C  C4    . DT  C 3 19  ? 39.054 52.445  74.611  1.00 60.25  ? 118  DT  D C4    1 
ATOM   1139  O  O4    . DT  C 3 19  ? 38.411 51.382  74.501  1.00 59.74  ? 118  DT  D O4    1 
ATOM   1140  C  C5    . DT  C 3 19  ? 38.488 53.807  74.689  1.00 59.97  ? 118  DT  D C5    1 
ATOM   1141  C  C7    . DT  C 3 19  ? 37.016 54.005  74.489  1.00 59.09  ? 118  DT  D C7    1 
ATOM   1142  C  C6    . DT  C 3 19  ? 39.331 54.827  74.936  1.00 59.87  ? 118  DT  D C6    1 
ATOM   1143  P  P     . DA  C 3 20  ? 44.786 58.588  74.973  1.00 70.90  ? 119  DA  D P     1 
ATOM   1144  O  OP1   . DA  C 3 20  ? 45.422 59.339  76.089  1.00 69.61  ? 119  DA  D OP1   1 
ATOM   1145  O  OP2   . DA  C 3 20  ? 44.097 59.327  73.868  1.00 70.56  ? 119  DA  D OP2   1 
ATOM   1146  O  "O5'" . DA  C 3 20  ? 45.913 57.672  74.324  1.00 70.04  ? 119  DA  D "O5'" 1 
ATOM   1147  C  "C5'" . DA  C 3 20  ? 46.561 56.669  75.096  1.00 68.17  ? 119  DA  D "C5'" 1 
ATOM   1148  C  "C4'" . DA  C 3 20  ? 47.202 55.656  74.181  1.00 67.89  ? 119  DA  D "C4'" 1 
ATOM   1149  O  "O4'" . DA  C 3 20  ? 46.227 54.767  73.604  1.00 66.57  ? 119  DA  D "O4'" 1 
ATOM   1150  C  "C3'" . DA  C 3 20  ? 47.930 56.278  73.003  1.00 68.23  ? 119  DA  D "C3'" 1 
ATOM   1151  O  "O3'" . DA  C 3 20  ? 49.067 55.480  72.709  1.00 71.19  ? 119  DA  D "O3'" 1 
ATOM   1152  C  "C2'" . DA  C 3 20  ? 46.902 56.237  71.890  1.00 66.34  ? 119  DA  D "C2'" 1 
ATOM   1153  C  "C1'" . DA  C 3 20  ? 46.084 55.002  72.209  1.00 65.05  ? 119  DA  D "C1'" 1 
ATOM   1154  N  N9    . DA  C 3 20  ? 44.650 55.145  71.963  1.00 63.58  ? 119  DA  D N9    1 
ATOM   1155  C  C8    . DA  C 3 20  ? 43.829 56.206  72.283  1.00 60.93  ? 119  DA  D C8    1 
ATOM   1156  N  N7    . DA  C 3 20  ? 42.560 55.976  72.058  1.00 60.38  ? 119  DA  D N7    1 
ATOM   1157  C  C5    . DA  C 3 20  ? 42.541 54.688  71.531  1.00 61.56  ? 119  DA  D C5    1 
ATOM   1158  C  C6    . DA  C 3 20  ? 41.485 53.845  71.105  1.00 62.13  ? 119  DA  D C6    1 
ATOM   1159  N  N6    . DA  C 3 20  ? 40.183 54.184  71.181  1.00 62.22  ? 119  DA  D N6    1 
ATOM   1160  N  N1    . DA  C 3 20  ? 41.819 52.627  70.600  1.00 62.38  ? 119  DA  D N1    1 
ATOM   1161  C  C2    . DA  C 3 20  ? 43.123 52.287  70.543  1.00 62.36  ? 119  DA  D C2    1 
ATOM   1162  N  N3    . DA  C 3 20  ? 44.195 52.979  70.933  1.00 61.04  ? 119  DA  D N3    1 
ATOM   1163  C  C4    . DA  C 3 20  ? 43.829 54.182  71.425  1.00 62.06  ? 119  DA  D C4    1 
ATOM   1164  P  P     . DC  C 3 21  ? 50.084 55.950  71.575  1.00 73.05  ? 120  DC  D P     1 
ATOM   1165  O  OP1   . DC  C 3 21  ? 51.417 55.385  71.936  1.00 72.43  ? 120  DC  D OP1   1 
ATOM   1166  O  OP2   . DC  C 3 21  ? 49.918 57.427  71.416  1.00 72.90  ? 120  DC  D OP2   1 
ATOM   1167  O  "O5'" . DC  C 3 21  ? 49.498 55.208  70.298  1.00 69.41  ? 120  DC  D "O5'" 1 
ATOM   1168  C  "C5'" . DC  C 3 21  ? 49.320 53.807  70.325  1.00 67.20  ? 120  DC  D "C5'" 1 
ATOM   1169  C  "C4'" . DC  C 3 21  ? 48.830 53.325  68.985  1.00 67.63  ? 120  DC  D "C4'" 1 
ATOM   1170  O  "O4'" . DC  C 3 21  ? 47.390 53.420  68.902  1.00 68.60  ? 120  DC  D "O4'" 1 
ATOM   1171  C  "C3'" . DC  C 3 21  ? 49.388 54.087  67.780  1.00 67.36  ? 120  DC  D "C3'" 1 
ATOM   1172  O  "O3'" . DC  C 3 21  ? 49.854 53.157  66.801  1.00 66.38  ? 120  DC  D "O3'" 1 
ATOM   1173  C  "C2'" . DC  C 3 21  ? 48.192 54.870  67.257  1.00 66.98  ? 120  DC  D "C2'" 1 
ATOM   1174  C  "C1'" . DC  C 3 21  ? 47.025 53.991  67.655  1.00 67.19  ? 120  DC  D "C1'" 1 
ATOM   1175  N  N1    . DC  C 3 21  ? 45.756 54.696  67.856  1.00 66.47  ? 120  DC  D N1    1 
ATOM   1176  C  C2    . DC  C 3 21  ? 44.611 54.184  67.257  1.00 66.05  ? 120  DC  D C2    1 
ATOM   1177  O  O2    . DC  C 3 21  ? 44.711 53.175  66.543  1.00 67.19  ? 120  DC  D O2    1 
ATOM   1178  N  N3    . DC  C 3 21  ? 43.429 54.796  67.465  1.00 64.36  ? 120  DC  D N3    1 
ATOM   1179  C  C4    . DC  C 3 21  ? 43.371 55.890  68.221  1.00 63.69  ? 120  DC  D C4    1 
ATOM   1180  N  N4    . DC  C 3 21  ? 42.185 56.471  68.385  1.00 63.28  ? 120  DC  D N4    1 
ATOM   1181  C  C5    . DC  C 3 21  ? 44.526 56.441  68.838  1.00 64.01  ? 120  DC  D C5    1 
ATOM   1182  C  C6    . DC  C 3 21  ? 45.690 55.820  68.628  1.00 65.61  ? 120  DC  D C6    1 
ATOM   1183  P  P     . DA  C 3 22  ? 50.835 53.650  65.631  1.00 65.10  ? 121  DA  D P     1 
ATOM   1184  O  OP1   . DA  C 3 22  ? 51.635 52.455  65.209  1.00 65.19  ? 121  DA  D OP1   1 
ATOM   1185  O  OP2   . DA  C 3 22  ? 51.535 54.900  66.055  1.00 62.85  ? 121  DA  D OP2   1 
ATOM   1186  O  "O5'" . DA  C 3 22  ? 49.809 54.012  64.469  1.00 61.07  ? 121  DA  D "O5'" 1 
ATOM   1187  C  "C5'" . DA  C 3 22  ? 49.003 52.999  63.889  1.00 55.05  ? 121  DA  D "C5'" 1 
ATOM   1188  C  "C4'" . DA  C 3 22  ? 48.186 53.577  62.762  1.00 51.55  ? 121  DA  D "C4'" 1 
ATOM   1189  O  "O4'" . DA  C 3 22  ? 47.055 54.322  63.264  1.00 50.47  ? 121  DA  D "O4'" 1 
ATOM   1190  C  "C3'" . DA  C 3 22  ? 48.953 54.551  61.880  1.00 50.51  ? 121  DA  D "C3'" 1 
ATOM   1191  O  "O3'" . DA  C 3 22  ? 48.552 54.341  60.524  1.00 49.08  ? 121  DA  D "O3'" 1 
ATOM   1192  C  "C2'" . DA  C 3 22  ? 48.483 55.909  62.383  1.00 48.26  ? 121  DA  D "C2'" 1 
ATOM   1193  C  "C1'" . DA  C 3 22  ? 47.036 55.602  62.662  1.00 47.31  ? 121  DA  D "C1'" 1 
ATOM   1194  N  N9    . DA  C 3 22  ? 46.301 56.502  63.548  1.00 45.03  ? 121  DA  D N9    1 
ATOM   1195  C  C8    . DA  C 3 22  ? 46.750 57.410  64.473  1.00 45.12  ? 121  DA  D C8    1 
ATOM   1196  N  N7    . DA  C 3 22  ? 45.786 57.993  65.144  1.00 42.73  ? 121  DA  D N7    1 
ATOM   1197  C  C5    . DA  C 3 22  ? 44.635 57.438  64.611  1.00 41.76  ? 121  DA  D C5    1 
ATOM   1198  C  C6    . DA  C 3 22  ? 43.292 57.618  64.902  1.00 41.65  ? 121  DA  D C6    1 
ATOM   1199  N  N6    . DA  C 3 22  ? 42.851 58.430  65.849  1.00 44.87  ? 121  DA  D N6    1 
ATOM   1200  N  N1    . DA  C 3 22  ? 42.394 56.922  64.188  1.00 42.02  ? 121  DA  D N1    1 
ATOM   1201  C  C2    . DA  C 3 22  ? 42.835 56.098  63.246  1.00 42.18  ? 121  DA  D C2    1 
ATOM   1202  N  N3    . DA  C 3 22  ? 44.078 55.836  62.883  1.00 41.98  ? 121  DA  D N3    1 
ATOM   1203  C  C4    . DA  C 3 22  ? 44.938 56.544  63.617  1.00 42.09  ? 121  DA  D C4    1 
ATOM   1204  P  P     . DT  C 3 23  ? 49.379 55.027  59.344  1.00 48.26  ? 122  DT  D P     1 
ATOM   1205  O  OP1   . DT  C 3 23  ? 48.821 54.479  58.080  1.00 47.90  ? 122  DT  D OP1   1 
ATOM   1206  O  OP2   . DT  C 3 23  ? 50.835 54.880  59.663  1.00 47.15  ? 122  DT  D OP2   1 
ATOM   1207  O  "O5'" . DT  C 3 23  ? 49.020 56.569  59.476  1.00 45.35  ? 122  DT  D "O5'" 1 
ATOM   1208  C  "C5'" . DT  C 3 23  ? 48.267 57.221  58.478  1.00 42.71  ? 122  DT  D "C5'" 1 
ATOM   1209  C  "C4'" . DT  C 3 23  ? 46.839 56.733  58.504  1.00 40.47  ? 122  DT  D "C4'" 1 
ATOM   1210  O  "O4'" . DT  C 3 23  ? 46.241 57.000  59.800  1.00 41.16  ? 122  DT  D "O4'" 1 
ATOM   1211  C  "C3'" . DT  C 3 23  ? 45.971 57.456  57.478  1.00 40.02  ? 122  DT  D "C3'" 1 
ATOM   1212  O  "O3'" . DT  C 3 23  ? 45.197 56.553  56.726  1.00 38.62  ? 122  DT  D "O3'" 1 
ATOM   1213  C  "C2'" . DT  C 3 23  ? 45.053 58.335  58.298  1.00 40.54  ? 122  DT  D "C2'" 1 
ATOM   1214  C  "C1'" . DT  C 3 23  ? 44.980 57.627  59.630  1.00 39.80  ? 122  DT  D "C1'" 1 
ATOM   1215  N  N1    . DT  C 3 23  ? 44.764 58.585  60.733  1.00 37.84  ? 122  DT  D N1    1 
ATOM   1216  C  C2    . DT  C 3 23  ? 43.471 58.767  61.150  1.00 38.85  ? 122  DT  D C2    1 
ATOM   1217  O  O2    . DT  C 3 23  ? 42.529 58.151  60.663  1.00 41.58  ? 122  DT  D O2    1 
ATOM   1218  N  N3    . DT  C 3 23  ? 43.307 59.699  62.150  1.00 38.27  ? 122  DT  D N3    1 
ATOM   1219  C  C4    . DT  C 3 23  ? 44.288 60.455  62.745  1.00 36.51  ? 122  DT  D C4    1 
ATOM   1220  O  O4    . DT  C 3 23  ? 43.992 61.282  63.608  1.00 35.14  ? 122  DT  D O4    1 
ATOM   1221  C  C5    . DT  C 3 23  ? 45.629 60.199  62.262  1.00 36.38  ? 122  DT  D C5    1 
ATOM   1222  C  C7    . DT  C 3 23  ? 46.767 60.966  62.855  1.00 35.02  ? 122  DT  D C7    1 
ATOM   1223  C  C6    . DT  C 3 23  ? 45.796 59.282  61.297  1.00 35.91  ? 122  DT  D C6    1 
ATOM   1224  P  P     . DT  C 3 24  ? 44.802 56.932  55.229  1.00 39.19  ? 123  DT  D P     1 
ATOM   1225  O  OP1   . DT  C 3 24  ? 44.593 55.664  54.464  1.00 37.09  ? 123  DT  D OP1   1 
ATOM   1226  O  OP2   . DT  C 3 24  ? 45.758 57.948  54.752  1.00 39.53  ? 123  DT  D OP2   1 
ATOM   1227  O  "O5'" . DT  C 3 24  ? 43.430 57.693  55.389  1.00 37.59  ? 123  DT  D "O5'" 1 
ATOM   1228  C  "C5'" . DT  C 3 24  ? 42.272 56.961  55.666  1.00 37.19  ? 123  DT  D "C5'" 1 
ATOM   1229  C  "C4'" . DT  C 3 24  ? 41.132 57.898  55.937  1.00 36.38  ? 123  DT  D "C4'" 1 
ATOM   1230  O  "O4'" . DT  C 3 24  ? 41.367 58.582  57.188  1.00 34.15  ? 123  DT  D "O4'" 1 
ATOM   1231  C  "C3'" . DT  C 3 24  ? 40.942 58.980  54.875  1.00 36.60  ? 123  DT  D "C3'" 1 
ATOM   1232  O  "O3'" . DT  C 3 24  ? 39.589 58.967  54.458  1.00 39.48  ? 123  DT  D "O3'" 1 
ATOM   1233  C  "C2'" . DT  C 3 24  ? 41.211 60.265  55.632  1.00 35.53  ? 123  DT  D "C2'" 1 
ATOM   1234  C  "C1'" . DT  C 3 24  ? 40.865 59.874  57.049  1.00 34.00  ? 123  DT  D "C1'" 1 
ATOM   1235  N  N1    . DT  C 3 24  ? 41.439 60.714  58.112  1.00 34.77  ? 123  DT  D N1    1 
ATOM   1236  C  C2    . DT  C 3 24  ? 40.539 61.306  58.972  1.00 36.73  ? 123  DT  D C2    1 
ATOM   1237  O  O2    . DT  C 3 24  ? 39.332 61.148  58.884  1.00 39.59  ? 123  DT  D O2    1 
ATOM   1238  N  N3    . DT  C 3 24  ? 41.092 62.106  59.923  1.00 35.61  ? 123  DT  D N3    1 
ATOM   1239  C  C4    . DT  C 3 24  ? 42.417 62.391  60.083  1.00 35.32  ? 123  DT  D C4    1 
ATOM   1240  O  O4    . DT  C 3 24  ? 42.751 63.158  60.967  1.00 38.73  ? 123  DT  D O4    1 
ATOM   1241  C  C5    . DT  C 3 24  ? 43.318 61.740  59.148  1.00 33.63  ? 123  DT  D C5    1 
ATOM   1242  C  C7    . DT  C 3 24  ? 44.786 62.015  59.241  1.00 32.03  ? 123  DT  D C7    1 
ATOM   1243  C  C6    . DT  C 3 24  ? 42.788 60.927  58.233  1.00 32.54  ? 123  DT  D C6    1 
ATOM   1244  P  P     . DA  C 3 25  ? 39.178 59.568  53.032  1.00 41.88  ? 124  DA  D P     1 
ATOM   1245  O  OP1   . DA  C 3 25  ? 38.804 58.438  52.131  1.00 40.18  ? 124  DA  D OP1   1 
ATOM   1246  O  OP2   . DA  C 3 25  ? 40.245 60.532  52.619  1.00 40.53  ? 124  DA  D OP2   1 
ATOM   1247  O  "O5'" . DA  C 3 25  ? 37.891 60.425  53.420  1.00 38.78  ? 124  DA  D "O5'" 1 
ATOM   1248  C  "C5'" . DA  C 3 25  ? 38.012 61.374  54.471  1.00 37.06  ? 124  DA  D "C5'" 1 
ATOM   1249  C  "C4'" . DA  C 3 25  ? 36.705 61.574  55.198  1.00 36.06  ? 124  DA  D "C4'" 1 
ATOM   1250  O  "O4'" . DA  C 3 25  ? 37.108 61.694  56.579  1.00 34.89  ? 124  DA  D "O4'" 1 
ATOM   1251  C  "C3'" . DA  C 3 25  ? 36.041 62.896  54.829  1.00 36.77  ? 124  DA  D "C3'" 1 
ATOM   1252  O  "O3'" . DA  C 3 25  ? 34.647 62.882  54.585  1.00 37.78  ? 124  DA  D "O3'" 1 
ATOM   1253  C  "C2'" . DA  C 3 25  ? 36.372 63.851  55.956  1.00 36.49  ? 124  DA  D "C2'" 1 
ATOM   1254  C  "C1'" . DA  C 3 25  ? 37.009 63.025  57.056  1.00 35.05  ? 124  DA  D "C1'" 1 
ATOM   1255  N  N9    . DA  C 3 25  ? 38.369 63.503  57.340  1.00 34.42  ? 124  DA  D N9    1 
ATOM   1256  C  C8    . DA  C 3 25  ? 39.535 63.053  56.772  1.00 33.14  ? 124  DA  D C8    1 
ATOM   1257  N  N7    . DA  C 3 25  ? 40.611 63.690  57.181  1.00 32.39  ? 124  DA  D N7    1 
ATOM   1258  C  C5    . DA  C 3 25  ? 40.126 64.618  58.081  1.00 34.54  ? 124  DA  D C5    1 
ATOM   1259  C  C6    . DA  C 3 25  ? 40.772 65.578  58.869  1.00 35.33  ? 124  DA  D C6    1 
ATOM   1260  N  N6    . DA  C 3 25  ? 42.095 65.733  58.889  1.00 34.58  ? 124  DA  D N6    1 
ATOM   1261  N  N1    . DA  C 3 25  ? 40.007 66.364  59.657  1.00 35.28  ? 124  DA  D N1    1 
ATOM   1262  C  C2    . DA  C 3 25  ? 38.676 66.158  59.666  1.00 36.45  ? 124  DA  D C2    1 
ATOM   1263  N  N3    . DA  C 3 25  ? 37.950 65.264  58.988  1.00 34.94  ? 124  DA  D N3    1 
ATOM   1264  C  C4    . DA  C 3 25  ? 38.744 64.517  58.198  1.00 35.02  ? 124  DA  D C4    1 
ATOM   1265  P  P     . DT  C 3 26  ? 34.006 64.122  53.765  1.00 40.89  ? 125  DT  D P     1 
ATOM   1266  O  OP1   . DT  C 3 26  ? 32.660 63.734  53.253  1.00 39.99  ? 125  DT  D OP1   1 
ATOM   1267  O  OP2   . DT  C 3 26  ? 35.025 64.626  52.822  1.00 39.24  ? 125  DT  D OP2   1 
ATOM   1268  O  "O5'" . DT  C 3 26  ? 33.807 65.248  54.869  1.00 39.38  ? 125  DT  D "O5'" 1 
ATOM   1269  C  "C5'" . DT  C 3 26  ? 32.793 65.073  55.844  1.00 40.28  ? 125  DT  D "C5'" 1 
ATOM   1270  C  "C4'" . DT  C 3 26  ? 32.960 66.035  56.993  1.00 39.80  ? 125  DT  D "C4'" 1 
ATOM   1271  O  "O4'" . DT  C 3 26  ? 34.354 66.176  57.347  1.00 38.66  ? 125  DT  D "O4'" 1 
ATOM   1272  C  "C3'" . DT  C 3 26  ? 32.412 67.450  56.799  1.00 40.43  ? 125  DT  D "C3'" 1 
ATOM   1273  O  "O3'" . DT  C 3 26  ? 31.575 67.733  57.913  1.00 41.51  ? 125  DT  D "O3'" 1 
ATOM   1274  C  "C2'" . DT  C 3 26  ? 33.649 68.331  56.833  1.00 38.92  ? 125  DT  D "C2'" 1 
ATOM   1275  C  "C1'" . DT  C 3 26  ? 34.609 67.515  57.673  1.00 38.39  ? 125  DT  D "C1'" 1 
ATOM   1276  N  N1    . DT  C 3 26  ? 36.019 67.770  57.414  1.00 38.81  ? 125  DT  D N1    1 
ATOM   1277  C  C2    . DT  C 3 26  ? 36.669 68.596  58.286  1.00 40.53  ? 125  DT  D C2    1 
ATOM   1278  O  O2    . DT  C 3 26  ? 36.112 69.136  59.227  1.00 42.35  ? 125  DT  D O2    1 
ATOM   1279  N  N3    . DT  C 3 26  ? 38.000 68.773  58.022  1.00 41.75  ? 125  DT  D N3    1 
ATOM   1280  C  C4    . DT  C 3 26  ? 38.721 68.211  56.996  1.00 42.28  ? 125  DT  D C4    1 
ATOM   1281  O  O4    . DT  C 3 26  ? 39.914 68.431  56.896  1.00 45.90  ? 125  DT  D O4    1 
ATOM   1282  C  C5    . DT  C 3 26  ? 37.978 67.377  56.109  1.00 41.31  ? 125  DT  D C5    1 
ATOM   1283  C  C7    . DT  C 3 26  ? 38.700 66.743  54.968  1.00 40.70  ? 125  DT  D C7    1 
ATOM   1284  C  C6    . DT  C 3 26  ? 36.673 67.199  56.351  1.00 39.50  ? 125  DT  D C6    1 
ATOM   1285  P  P     . DA  C 3 27  ? 30.821 69.134  58.014  1.00 43.13  ? 126  DA  D P     1 
ATOM   1286  O  OP1   . DA  C 3 27  ? 29.958 69.008  59.215  1.00 40.21  ? 126  DA  D OP1   1 
ATOM   1287  O  OP2   . DA  C 3 27  ? 30.210 69.424  56.692  1.00 43.14  ? 126  DA  D OP2   1 
ATOM   1288  O  "O5'" . DA  C 3 27  ? 31.975 70.188  58.341  1.00 41.55  ? 126  DA  D "O5'" 1 
ATOM   1289  C  "C5'" . DA  C 3 27  ? 32.456 70.292  59.676  1.00 42.21  ? 126  DA  D "C5'" 1 
ATOM   1290  C  "C4'" . DA  C 3 27  ? 32.585 71.733  60.116  1.00 42.65  ? 126  DA  D "C4'" 1 
ATOM   1291  O  "O4'" . DA  C 3 27  ? 33.938 72.209  60.034  1.00 42.94  ? 126  DA  D "O4'" 1 
ATOM   1292  C  "C3'" . DA  C 3 27  ? 31.740 72.791  59.437  1.00 43.03  ? 126  DA  D "C3'" 1 
ATOM   1293  O  "O3'" . DA  C 3 27  ? 31.394 73.731  60.441  1.00 46.24  ? 126  DA  D "O3'" 1 
ATOM   1294  C  "C2'" . DA  C 3 27  ? 32.699 73.395  58.424  1.00 42.14  ? 126  DA  D "C2'" 1 
ATOM   1295  C  "C1'" . DA  C 3 27  ? 34.073 73.238  59.070  1.00 39.73  ? 126  DA  D "C1'" 1 
ATOM   1296  N  N9    . DA  C 3 27  ? 35.146 72.790  58.187  1.00 36.64  ? 126  DA  D N9    1 
ATOM   1297  C  C8    . DA  C 3 27  ? 35.080 71.742  57.309  1.00 35.51  ? 126  DA  D C8    1 
ATOM   1298  N  N7    . DA  C 3 27  ? 36.232 71.438  56.763  1.00 35.57  ? 126  DA  D N7    1 
ATOM   1299  C  C5    . DA  C 3 27  ? 37.111 72.367  57.295  1.00 34.64  ? 126  DA  D C5    1 
ATOM   1300  C  C6    . DA  C 3 27  ? 38.503 72.554  57.130  1.00 34.38  ? 126  DA  D C6    1 
ATOM   1301  N  N6    . DA  C 3 27  ? 39.262 71.739  56.408  1.00 34.91  ? 126  DA  D N6    1 
ATOM   1302  N  N1    . DA  C 3 27  ? 39.088 73.599  57.758  1.00 33.40  ? 126  DA  D N1    1 
ATOM   1303  C  C2    . DA  C 3 27  ? 38.311 74.384  58.525  1.00 35.65  ? 126  DA  D C2    1 
ATOM   1304  N  N3    . DA  C 3 27  ? 36.985 74.288  58.787  1.00 35.59  ? 126  DA  D N3    1 
ATOM   1305  C  C4    . DA  C 3 27  ? 36.445 73.243  58.133  1.00 35.14  ? 126  DA  D C4    1 
ATOM   1306  P  P     . DC  C 3 28  ? 30.409 74.927  60.092  1.00 49.13  ? 127  DC  D P     1 
ATOM   1307  O  OP1   . DC  C 3 28  ? 29.893 75.507  61.347  1.00 48.58  ? 127  DC  D OP1   1 
ATOM   1308  O  OP2   . DC  C 3 28  ? 29.441 74.403  59.102  1.00 51.55  ? 127  DC  D OP2   1 
ATOM   1309  O  "O5'" . DC  C 3 28  ? 31.409 75.966  59.409  1.00 50.13  ? 127  DC  D "O5'" 1 
ATOM   1310  C  "C5'" . DC  C 3 28  ? 32.377 76.653  60.203  1.00 51.51  ? 127  DC  D "C5'" 1 
ATOM   1311  C  "C4'" . DC  C 3 28  ? 33.105 77.703  59.393  1.00 53.88  ? 127  DC  D "C4'" 1 
ATOM   1312  O  "O4'" . DC  C 3 28  ? 34.256 77.147  58.715  1.00 52.81  ? 127  DC  D "O4'" 1 
ATOM   1313  C  "C3'" . DC  C 3 28  ? 32.284 78.429  58.326  1.00 56.83  ? 127  DC  D "C3'" 1 
ATOM   1314  O  "O3'" . DC  C 3 28  ? 32.653 79.823  58.305  1.00 61.64  ? 127  DC  D "O3'" 1 
ATOM   1315  C  "C2'" . DC  C 3 28  ? 32.739 77.739  57.050  1.00 54.14  ? 127  DC  D "C2'" 1 
ATOM   1316  C  "C1'" . DC  C 3 28  ? 34.208 77.513  57.354  1.00 51.13  ? 127  DC  D "C1'" 1 
ATOM   1317  N  N1    . DC  C 3 28  ? 34.866 76.458  56.582  1.00 48.66  ? 127  DC  D N1    1 
ATOM   1318  C  C2    . DC  C 3 28  ? 36.260 76.503  56.439  1.00 48.74  ? 127  DC  D C2    1 
ATOM   1319  O  O2    . DC  C 3 28  ? 36.886 77.411  56.998  1.00 49.65  ? 127  DC  D O2    1 
ATOM   1320  N  N3    . DC  C 3 28  ? 36.890 75.558  55.700  1.00 47.87  ? 127  DC  D N3    1 
ATOM   1321  C  C4    . DC  C 3 28  ? 36.177 74.588  55.122  1.00 48.38  ? 127  DC  D C4    1 
ATOM   1322  N  N4    . DC  C 3 28  ? 36.831 73.682  54.380  1.00 47.24  ? 127  DC  D N4    1 
ATOM   1323  C  C5    . DC  C 3 28  ? 34.756 74.504  55.272  1.00 48.59  ? 127  DC  D C5    1 
ATOM   1324  C  C6    . DC  C 3 28  ? 34.148 75.455  56.005  1.00 47.81  ? 127  DC  D C6    1 
ATOM   1325  P  P     . DG  C 3 29  ? 31.521 80.974  58.118  1.00 66.82  ? 128  DG  D P     1 
ATOM   1326  O  OP1   . DG  C 3 29  ? 30.711 81.116  59.365  1.00 65.05  ? 128  DG  D OP1   1 
ATOM   1327  O  OP2   . DG  C 3 29  ? 30.817 80.794  56.798  1.00 66.23  ? 128  DG  D OP2   1 
ATOM   1328  O  "O5'" . DG  C 3 29  ? 32.418 82.285  58.008  1.00 65.86  ? 128  DG  D "O5'" 1 
ATOM   1329  C  "C5'" . DG  C 3 29  ? 33.418 82.549  58.991  1.00 63.83  ? 128  DG  D "C5'" 1 
ATOM   1330  C  "C4'" . DG  C 3 29  ? 34.718 82.964  58.336  1.00 62.49  ? 128  DG  D "C4'" 1 
ATOM   1331  O  "O4'" . DG  C 3 29  ? 35.318 81.849  57.628  1.00 58.91  ? 128  DG  D "O4'" 1 
ATOM   1332  C  "C3'" . DG  C 3 29  ? 34.637 84.115  57.329  1.00 64.35  ? 128  DG  D "C3'" 1 
ATOM   1333  O  "O3'" . DG  C 3 29  ? 35.747 85.010  57.560  1.00 70.11  ? 128  DG  D "O3'" 1 
ATOM   1334  C  "C2'" . DG  C 3 29  ? 34.741 83.397  55.987  1.00 59.75  ? 128  DG  D "C2'" 1 
ATOM   1335  C  "C1'" . DG  C 3 29  ? 35.651 82.226  56.301  1.00 53.90  ? 128  DG  D "C1'" 1 
ATOM   1336  N  N9    . DG  C 3 29  ? 35.449 81.056  55.455  1.00 47.30  ? 128  DG  D N9    1 
ATOM   1337  C  C8    . DG  C 3 29  ? 34.251 80.444  55.195  1.00 45.81  ? 128  DG  D C8    1 
ATOM   1338  N  N7    . DG  C 3 29  ? 34.370 79.373  54.453  1.00 43.09  ? 128  DG  D N7    1 
ATOM   1339  C  C5    . DG  C 3 29  ? 35.728 79.280  54.196  1.00 40.47  ? 128  DG  D C5    1 
ATOM   1340  C  C6    . DG  C 3 29  ? 36.449 78.311  53.463  1.00 39.23  ? 128  DG  D C6    1 
ATOM   1341  O  O6    . DG  C 3 29  ? 36.016 77.310  52.877  1.00 38.92  ? 128  DG  D O6    1 
ATOM   1342  N  N1    . DG  C 3 29  ? 37.810 78.587  53.450  1.00 36.54  ? 128  DG  D N1    1 
ATOM   1343  C  C2    . DG  C 3 29  ? 38.396 79.655  54.058  1.00 36.64  ? 128  DG  D C2    1 
ATOM   1344  N  N2    . DG  C 3 29  ? 39.718 79.749  53.895  1.00 36.14  ? 128  DG  D N2    1 
ATOM   1345  N  N3    . DG  C 3 29  ? 37.737 80.567  54.764  1.00 38.04  ? 128  DG  D N3    1 
ATOM   1346  C  C4    . DG  C 3 29  ? 36.413 80.318  54.790  1.00 42.11  ? 128  DG  D C4    1 
ATOM   1347  P  P     . DA  C 3 30  ? 35.734 86.523  56.981  1.00 74.67  ? 129  DA  D P     1 
ATOM   1348  O  OP1   . DA  C 3 30  ? 36.146 87.382  58.129  1.00 75.36  ? 129  DA  D OP1   1 
ATOM   1349  O  OP2   . DA  C 3 30  ? 34.465 86.836  56.241  1.00 72.69  ? 129  DA  D OP2   1 
ATOM   1350  O  "O5'" . DA  C 3 30  ? 36.945 86.497  55.945  1.00 74.25  ? 129  DA  D "O5'" 1 
ATOM   1351  C  "C5'" . DA  C 3 30  ? 37.277 85.289  55.279  1.00 75.84  ? 129  DA  D "C5'" 1 
ATOM   1352  C  "C4'" . DA  C 3 30  ? 38.631 85.388  54.622  1.00 78.37  ? 129  DA  D "C4'" 1 
ATOM   1353  O  "O4'" . DA  C 3 30  ? 38.877 84.112  53.989  1.00 77.97  ? 129  DA  D "O4'" 1 
ATOM   1354  C  "C3'" . DA  C 3 30  ? 38.698 86.422  53.499  1.00 81.33  ? 129  DA  D "C3'" 1 
ATOM   1355  O  "O3'" . DA  C 3 30  ? 40.025 86.972  53.363  1.00 85.48  ? 129  DA  D "O3'" 1 
ATOM   1356  C  "C2'" . DA  C 3 30  ? 38.269 85.637  52.271  1.00 79.41  ? 129  DA  D "C2'" 1 
ATOM   1357  C  "C1'" . DA  C 3 30  ? 38.652 84.191  52.586  1.00 76.46  ? 129  DA  D "C1'" 1 
ATOM   1358  N  N9    . DA  C 3 30  ? 37.565 83.264  52.256  1.00 73.73  ? 129  DA  D N9    1 
ATOM   1359  C  C8    . DA  C 3 30  ? 36.220 83.415  52.550  1.00 72.42  ? 129  DA  D C8    1 
ATOM   1360  N  N7    . DA  C 3 30  ? 35.465 82.446  52.089  1.00 70.72  ? 129  DA  D N7    1 
ATOM   1361  C  C5    . DA  C 3 30  ? 36.367 81.594  51.459  1.00 70.72  ? 129  DA  D C5    1 
ATOM   1362  C  C6    . DA  C 3 30  ? 36.192 80.388  50.760  1.00 70.62  ? 129  DA  D C6    1 
ATOM   1363  N  N6    . DA  C 3 30  ? 34.992 79.815  50.560  1.00 69.76  ? 129  DA  D N6    1 
ATOM   1364  N  N1    . DA  C 3 30  ? 37.301 79.787  50.260  1.00 70.36  ? 129  DA  D N1    1 
ATOM   1365  C  C2    . DA  C 3 30  ? 38.497 80.379  50.446  1.00 69.67  ? 129  DA  D C2    1 
ATOM   1366  N  N3    . DA  C 3 30  ? 38.786 81.517  51.074  1.00 69.54  ? 129  DA  D N3    1 
ATOM   1367  C  C4    . DA  C 3 30  ? 37.667 82.081  51.564  1.00 71.38  ? 129  DA  D C4    1 
ATOM   1368  P  P     . DA  C 3 31  ? 40.313 88.114  52.254  1.00 87.50  ? 130  DA  D P     1 
ATOM   1369  O  OP1   . DA  C 3 31  ? 40.975 89.288  52.904  1.00 87.08  ? 130  DA  D OP1   1 
ATOM   1370  O  OP2   . DA  C 3 31  ? 39.046 88.308  51.469  1.00 87.23  ? 130  DA  D OP2   1 
ATOM   1371  O  "O5'" . DA  C 3 31  ? 41.381 87.431  51.296  1.00 84.90  ? 130  DA  D "O5'" 1 
ATOM   1372  C  "C5'" . DA  C 3 31  ? 41.244 87.536  49.896  1.00 82.96  ? 130  DA  D "C5'" 1 
ATOM   1373  C  "C4'" . DA  C 3 31  ? 41.836 86.323  49.225  1.00 81.93  ? 130  DA  D "C4'" 1 
ATOM   1374  O  "O4'" . DA  C 3 31  ? 40.982 85.173  49.445  1.00 79.51  ? 130  DA  D "O4'" 1 
ATOM   1375  C  "C3'" . DA  C 3 31  ? 41.935 86.499  47.714  1.00 83.08  ? 130  DA  D "C3'" 1 
ATOM   1376  O  "O3'" . DA  C 3 31  ? 43.216 86.095  47.254  1.00 86.26  ? 130  DA  D "O3'" 1 
ATOM   1377  C  "C2'" . DA  C 3 31  ? 40.832 85.624  47.146  1.00 80.52  ? 130  DA  D "C2'" 1 
ATOM   1378  C  "C1'" . DA  C 3 31  ? 40.644 84.555  48.212  1.00 77.78  ? 130  DA  D "C1'" 1 
ATOM   1379  N  N9    . DA  C 3 31  ? 39.254 84.110  48.303  1.00 74.57  ? 130  DA  D N9    1 
ATOM   1380  C  C8    . DA  C 3 31  ? 38.206 84.787  48.888  1.00 74.33  ? 130  DA  D C8    1 
ATOM   1381  N  N7    . DA  C 3 31  ? 37.048 84.175  48.776  1.00 72.46  ? 130  DA  D N7    1 
ATOM   1382  C  C5    . DA  C 3 31  ? 37.357 83.010  48.088  1.00 70.94  ? 130  DA  D C5    1 
ATOM   1383  C  C6    . DA  C 3 31  ? 36.566 81.937  47.666  1.00 69.53  ? 130  DA  D C6    1 
ATOM   1384  N  N6    . DA  C 3 31  ? 35.250 81.860  47.902  1.00 68.44  ? 130  DA  D N6    1 
ATOM   1385  N  N1    . DA  C 3 31  ? 37.176 80.933  46.994  1.00 68.59  ? 130  DA  D N1    1 
ATOM   1386  C  C2    . DA  C 3 31  ? 38.496 81.017  46.775  1.00 68.86  ? 130  DA  D C2    1 
ATOM   1387  N  N3    . DA  C 3 31  ? 39.351 81.973  47.132  1.00 70.09  ? 130  DA  D N3    1 
ATOM   1388  C  C4    . DA  C 3 31  ? 38.713 82.953  47.793  1.00 71.90  ? 130  DA  D C4    1 
ATOM   1389  P  P     . DG  C 3 32  ? 43.682 86.536  45.790  1.00 88.73  ? 131  DG  D P     1 
ATOM   1390  O  OP1   . DG  C 3 32  ? 45.166 86.331  45.687  1.00 88.94  ? 131  DG  D OP1   1 
ATOM   1391  O  OP2   . DG  C 3 32  ? 43.085 87.892  45.557  1.00 87.85  ? 131  DG  D OP2   1 
ATOM   1392  O  "O5'" . DG  C 3 32  ? 42.967 85.459  44.859  1.00 85.07  ? 131  DG  D "O5'" 1 
ATOM   1393  C  "C5'" . DG  C 3 32  ? 43.433 84.111  44.866  1.00 78.87  ? 131  DG  D "C5'" 1 
ATOM   1394  C  "C4'" . DG  C 3 32  ? 42.613 83.261  43.926  1.00 74.22  ? 131  DG  D "C4'" 1 
ATOM   1395  O  "O4'" . DG  C 3 32  ? 41.281 83.106  44.466  1.00 69.55  ? 131  DG  D "O4'" 1 
ATOM   1396  C  "C3'" . DG  C 3 32  ? 42.443 83.830  42.515  1.00 73.61  ? 131  DG  D "C3'" 1 
ATOM   1397  O  "O3'" . DG  C 3 32  ? 42.695 82.824  41.528  1.00 76.94  ? 131  DG  D "O3'" 1 
ATOM   1398  C  "C2'" . DG  C 3 32  ? 40.988 84.257  42.474  1.00 68.51  ? 131  DG  D "C2'" 1 
ATOM   1399  C  "C1'" . DG  C 3 32  ? 40.357 83.267  43.423  1.00 63.85  ? 131  DG  D "C1'" 1 
ATOM   1400  N  N9    . DG  C 3 32  ? 39.095 83.709  43.994  1.00 57.23  ? 131  DG  D N9    1 
ATOM   1401  C  C8    . DG  C 3 32  ? 38.815 84.917  44.586  1.00 55.35  ? 131  DG  D C8    1 
ATOM   1402  N  N7    . DG  C 3 32  ? 37.550 85.050  44.893  1.00 53.45  ? 131  DG  D N7    1 
ATOM   1403  C  C5    . DG  C 3 32  ? 36.972 83.839  44.508  1.00 51.04  ? 131  DG  D C5    1 
ATOM   1404  C  C6    . DG  C 3 32  ? 35.601 83.383  44.565  1.00 49.12  ? 131  DG  D C6    1 
ATOM   1405  O  O6    . DG  C 3 32  ? 34.588 83.982  44.982  1.00 47.66  ? 131  DG  D O6    1 
ATOM   1406  N  N1    . DG  C 3 32  ? 35.474 82.097  44.052  1.00 47.09  ? 131  DG  D N1    1 
ATOM   1407  C  C2    . DG  C 3 32  ? 36.506 81.346  43.542  1.00 48.40  ? 131  DG  D C2    1 
ATOM   1408  N  N2    . DG  C 3 32  ? 36.172 80.135  43.057  1.00 47.14  ? 131  DG  D N2    1 
ATOM   1409  N  N3    . DG  C 3 32  ? 37.769 81.749  43.493  1.00 49.21  ? 131  DG  D N3    1 
ATOM   1410  C  C4    . DG  C 3 32  ? 37.923 82.996  43.980  1.00 52.67  ? 131  DG  D C4    1 
ATOM   1411  P  P     . DT  C 3 33  ? 42.750 83.231  39.968  1.00 81.06  ? 132  DT  D P     1 
ATOM   1412  O  OP1   . DT  C 3 33  ? 43.776 82.357  39.307  1.00 79.18  ? 132  DT  D OP1   1 
ATOM   1413  O  OP2   . DT  C 3 33  ? 42.871 84.715  39.876  1.00 80.69  ? 132  DT  D OP2   1 
ATOM   1414  O  "O5'" . DT  C 3 33  ? 41.301 82.823  39.441  1.00 79.08  ? 132  DT  D "O5'" 1 
ATOM   1415  C  "C5'" . DT  C 3 33  ? 40.912 81.463  39.518  1.00 78.39  ? 132  DT  D "C5'" 1 
ATOM   1416  C  "C4'" . DT  C 3 33  ? 39.534 81.248  38.948  1.00 76.96  ? 132  DT  D "C4'" 1 
ATOM   1417  O  "O4'" . DT  C 3 33  ? 38.509 81.767  39.827  1.00 74.19  ? 132  DT  D "O4'" 1 
ATOM   1418  C  "C3'" . DT  C 3 33  ? 39.258 81.831  37.563  1.00 77.62  ? 132  DT  D "C3'" 1 
ATOM   1419  O  "O3'" . DT  C 3 33  ? 38.790 80.777  36.705  1.00 79.34  ? 132  DT  D "O3'" 1 
ATOM   1420  C  "C2'" . DT  C 3 33  ? 38.149 82.845  37.826  1.00 75.48  ? 132  DT  D "C2'" 1 
ATOM   1421  C  "C1'" . DT  C 3 33  ? 37.458 82.227  39.023  1.00 70.73  ? 132  DT  D "C1'" 1 
ATOM   1422  N  N1    . DT  C 3 33  ? 36.600 83.106  39.833  1.00 66.09  ? 132  DT  D N1    1 
ATOM   1423  C  C2    . DT  C 3 33  ? 35.294 82.708  39.969  1.00 63.92  ? 132  DT  D C2    1 
ATOM   1424  O  O2    . DT  C 3 33  ? 34.886 81.652  39.528  1.00 63.65  ? 132  DT  D O2    1 
ATOM   1425  N  N3    . DT  C 3 33  ? 34.485 83.580  40.652  1.00 62.11  ? 132  DT  D N3    1 
ATOM   1426  C  C4    . DT  C 3 33  ? 34.854 84.777  41.230  1.00 62.88  ? 132  DT  D C4    1 
ATOM   1427  O  O4    . DT  C 3 33  ? 34.001 85.479  41.785  1.00 61.54  ? 132  DT  D O4    1 
ATOM   1428  C  C5    . DT  C 3 33  ? 36.269 85.112  41.106  1.00 63.48  ? 132  DT  D C5    1 
ATOM   1429  C  C7    . DT  C 3 33  ? 36.777 86.366  41.755  1.00 64.02  ? 132  DT  D C7    1 
ATOM   1430  C  C6    . DT  C 3 33  ? 37.060 84.270  40.412  1.00 64.30  ? 132  DT  D C6    1 
ATOM   1431  P  P     . DT  C 3 34  ? 39.473 80.557  35.260  1.00 80.21  ? 133  DT  D P     1 
ATOM   1432  O  OP1   . DT  C 3 34  ? 39.299 79.134  34.847  1.00 79.48  ? 133  DT  D OP1   1 
ATOM   1433  O  OP2   . DT  C 3 34  ? 40.840 81.151  35.300  1.00 79.59  ? 133  DT  D OP2   1 
ATOM   1434  O  "O5'" . DT  C 3 34  ? 38.572 81.466  34.316  1.00 79.19  ? 133  DT  D "O5'" 1 
ATOM   1435  C  "C5'" . DT  C 3 34  ? 37.272 81.827  34.736  1.00 77.62  ? 133  DT  D "C5'" 1 
ATOM   1436  C  "C4'" . DT  C 3 34  ? 36.319 80.685  34.479  1.00 77.23  ? 133  DT  D "C4'" 1 
ATOM   1437  O  "O4'" . DT  C 3 34  ? 35.436 80.639  35.613  1.00 76.19  ? 133  DT  D "O4'" 1 
ATOM   1438  C  "C3'" . DT  C 3 34  ? 35.437 80.891  33.252  1.00 79.06  ? 133  DT  D "C3'" 1 
ATOM   1439  O  "O3'" . DT  C 3 34  ? 35.173 79.697  32.497  1.00 81.46  ? 133  DT  D "O3'" 1 
ATOM   1440  C  "C2'" . DT  C 3 34  ? 34.167 81.502  33.818  1.00 77.33  ? 133  DT  D "C2'" 1 
ATOM   1441  C  "C1'" . DT  C 3 34  ? 34.141 81.115  35.289  1.00 73.63  ? 133  DT  D "C1'" 1 
ATOM   1442  N  N1    . DT  C 3 34  ? 33.873 82.278  36.161  1.00 69.84  ? 133  DT  D N1    1 
ATOM   1443  C  C2    . DT  C 3 34  ? 32.615 82.420  36.720  1.00 68.01  ? 133  DT  D C2    1 
ATOM   1444  O  O2    . DT  C 3 34  ? 31.716 81.608  36.559  1.00 67.21  ? 133  DT  D O2    1 
ATOM   1445  N  N3    . DT  C 3 34  ? 32.450 83.554  37.481  1.00 66.50  ? 133  DT  D N3    1 
ATOM   1446  C  C4    . DT  C 3 34  ? 33.392 84.537  37.730  1.00 66.23  ? 133  DT  D C4    1 
ATOM   1447  O  O4    . DT  C 3 34  ? 33.084 85.515  38.408  1.00 66.63  ? 133  DT  D O4    1 
ATOM   1448  C  C5    . DT  C 3 34  ? 34.702 84.311  37.129  1.00 65.97  ? 133  DT  D C5    1 
ATOM   1449  C  C7    . DT  C 3 34  ? 35.796 85.309  37.354  1.00 63.31  ? 133  DT  D C7    1 
ATOM   1450  C  C6    . DT  C 3 34  ? 34.870 83.206  36.391  1.00 67.14  ? 133  DT  D C6    1 
ATOM   1451  P  P     . DA  C 3 35  ? 34.541 79.821  31.006  1.00 84.25  ? 134  DA  D P     1 
ATOM   1452  O  OP1   . DA  C 3 35  ? 35.212 78.815  30.125  1.00 83.48  ? 134  DA  D OP1   1 
ATOM   1453  O  OP2   . DA  C 3 35  ? 34.509 81.268  30.596  1.00 84.08  ? 134  DA  D OP2   1 
ATOM   1454  O  "O5'" . DA  C 3 35  ? 33.014 79.399  31.184  1.00 81.41  ? 134  DA  D "O5'" 1 
ATOM   1455  C  "C5'" . DA  C 3 35  ? 31.992 80.035  30.422  1.00 77.49  ? 134  DA  D "C5'" 1 
ATOM   1456  C  "C4'" . DA  C 3 35  ? 30.748 80.191  31.261  1.00 74.73  ? 134  DA  D "C4'" 1 
ATOM   1457  O  "O4'" . DA  C 3 35  ? 31.084 80.995  32.410  1.00 72.38  ? 134  DA  D "O4'" 1 
ATOM   1458  C  "C3'" . DA  C 3 35  ? 29.599 80.912  30.565  1.00 75.19  ? 134  DA  D "C3'" 1 
ATOM   1459  O  "O3'" . DA  C 3 35  ? 28.356 80.285  30.854  1.00 77.19  ? 134  DA  D "O3'" 1 
ATOM   1460  C  "C2'" . DA  C 3 35  ? 29.627 82.313  31.149  1.00 73.20  ? 134  DA  D "C2'" 1 
ATOM   1461  C  "C1'" . DA  C 3 35  ? 30.200 82.098  32.532  1.00 70.80  ? 134  DA  D "C1'" 1 
ATOM   1462  N  N9    . DA  C 3 35  ? 30.982 83.224  33.043  1.00 67.96  ? 134  DA  D N9    1 
ATOM   1463  C  C8    . DA  C 3 35  ? 32.268 83.536  32.679  1.00 67.56  ? 134  DA  D C8    1 
ATOM   1464  N  N7    . DA  C 3 35  ? 32.767 84.569  33.318  1.00 66.72  ? 134  DA  D N7    1 
ATOM   1465  C  C5    . DA  C 3 35  ? 31.737 84.975  34.151  1.00 65.53  ? 134  DA  D C5    1 
ATOM   1466  C  C6    . DA  C 3 35  ? 31.645 86.020  35.086  1.00 65.44  ? 134  DA  D C6    1 
ATOM   1467  N  N6    . DA  C 3 35  ? 32.649 86.868  35.339  1.00 63.97  ? 134  DA  D N6    1 
ATOM   1468  N  N1    . DA  C 3 35  ? 30.477 86.165  35.756  1.00 65.43  ? 134  DA  D N1    1 
ATOM   1469  C  C2    . DA  C 3 35  ? 29.476 85.309  35.486  1.00 66.06  ? 134  DA  D C2    1 
ATOM   1470  N  N3    . DA  C 3 35  ? 29.445 84.283  34.626  1.00 65.79  ? 134  DA  D N3    1 
ATOM   1471  C  C4    . DA  C 3 35  ? 30.623 84.166  33.985  1.00 66.22  ? 134  DA  D C4    1 
ATOM   1472  P  P     . DT  C 3 36  ? 27.049 80.745  30.052  1.00 79.61  ? 135  DT  D P     1 
ATOM   1473  O  OP1   . DT  C 3 36  ? 26.008 79.679  30.068  1.00 79.56  ? 135  DT  D OP1   1 
ATOM   1474  O  OP2   . DT  C 3 36  ? 27.541 81.275  28.749  1.00 79.14  ? 135  DT  D OP2   1 
ATOM   1475  O  "O5'" . DT  C 3 36  ? 26.518 81.956  30.926  1.00 78.34  ? 135  DT  D "O5'" 1 
ATOM   1476  C  "C5'" . DT  C 3 36  ? 25.347 82.660  30.559  1.00 78.17  ? 135  DT  D "C5'" 1 
ATOM   1477  C  "C4'" . DT  C 3 36  ? 24.719 83.256  31.791  1.00 77.77  ? 135  DT  D "C4'" 1 
ATOM   1478  O  "O4'" . DT  C 3 36  ? 25.767 83.814  32.613  1.00 77.08  ? 135  DT  D "O4'" 1 
ATOM   1479  C  "C3'" . DT  C 3 36  ? 23.754 84.394  31.500  1.00 78.17  ? 135  DT  D "C3'" 1 
ATOM   1480  O  "O3'" . DT  C 3 36  ? 22.622 84.331  32.344  1.00 80.58  ? 135  DT  D "O3'" 1 
ATOM   1481  C  "C2'" . DT  C 3 36  ? 24.555 85.643  31.799  1.00 76.61  ? 135  DT  D "C2'" 1 
ATOM   1482  C  "C1'" . DT  C 3 36  ? 25.522 85.181  32.869  1.00 74.97  ? 135  DT  D "C1'" 1 
ATOM   1483  N  N1    . DT  C 3 36  ? 26.813 85.881  32.812  1.00 72.51  ? 135  DT  D N1    1 
ATOM   1484  C  C2    . DT  C 3 36  ? 26.974 86.987  33.618  1.00 71.45  ? 135  DT  D C2    1 
ATOM   1485  O  O2    . DT  C 3 36  ? 26.113 87.372  34.396  1.00 70.55  ? 135  DT  D O2    1 
ATOM   1486  N  N3    . DT  C 3 36  ? 28.184 87.630  33.477  1.00 70.16  ? 135  DT  D N3    1 
ATOM   1487  C  C4    . DT  C 3 36  ? 29.223 87.281  32.633  1.00 69.67  ? 135  DT  D C4    1 
ATOM   1488  O  O4    . DT  C 3 36  ? 30.237 87.974  32.592  1.00 67.83  ? 135  DT  D O4    1 
ATOM   1489  C  C5    . DT  C 3 36  ? 28.996 86.085  31.836  1.00 70.05  ? 135  DT  D C5    1 
ATOM   1490  C  C7    . DT  C 3 36  ? 30.076 85.615  30.910  1.00 69.24  ? 135  DT  D C7    1 
ATOM   1491  C  C6    . DT  C 3 36  ? 27.818 85.452  31.967  1.00 70.49  ? 135  DT  D C6    1 
ATOM   1492  P  P     . DC  C 3 37  ? 21.298 85.091  31.891  1.00 83.43  ? 136  DC  D P     1 
ATOM   1493  O  OP1   . DC  C 3 37  ? 20.062 84.472  32.449  1.00 82.94  ? 136  DC  D OP1   1 
ATOM   1494  O  OP2   . DC  C 3 37  ? 21.467 85.189  30.419  1.00 84.33  ? 136  DC  D OP2   1 
ATOM   1495  O  "O5'" . DC  C 3 37  ? 21.487 86.518  32.557  1.00 83.06  ? 136  DC  D "O5'" 1 
ATOM   1496  C  "C5'" . DC  C 3 37  ? 21.428 86.643  33.966  1.00 83.92  ? 136  DC  D "C5'" 1 
ATOM   1497  C  "C4'" . DC  C 3 37  ? 21.651 88.078  34.370  1.00 84.63  ? 136  DC  D "C4'" 1 
ATOM   1498  O  "O4'" . DC  C 3 37  ? 23.049 88.427  34.183  1.00 84.30  ? 136  DC  D "O4'" 1 
ATOM   1499  C  "C3'" . DC  C 3 37  ? 20.842 89.073  33.534  1.00 84.84  ? 136  DC  D "C3'" 1 
ATOM   1500  O  "O3'" . DC  C 3 37  ? 20.483 90.205  34.340  1.00 85.73  ? 136  DC  D "O3'" 1 
ATOM   1501  C  "C2'" . DC  C 3 37  ? 21.858 89.540  32.507  1.00 84.76  ? 136  DC  D "C2'" 1 
ATOM   1502  C  "C1'" . DC  C 3 37  ? 23.126 89.575  33.353  1.00 83.46  ? 136  DC  D "C1'" 1 
ATOM   1503  N  N1    . DC  C 3 37  ? 24.410 89.550  32.621  1.00 81.85  ? 136  DC  D N1    1 
ATOM   1504  C  C2    . DC  C 3 37  ? 25.514 90.202  33.190  1.00 80.99  ? 136  DC  D C2    1 
ATOM   1505  O  O2    . DC  C 3 37  ? 25.382 90.743  34.302  1.00 81.73  ? 136  DC  D O2    1 
ATOM   1506  N  N3    . DC  C 3 37  ? 26.690 90.229  32.517  1.00 79.72  ? 136  DC  D N3    1 
ATOM   1507  C  C4    . DC  C 3 37  ? 26.789 89.638  31.325  1.00 79.65  ? 136  DC  D C4    1 
ATOM   1508  N  N4    . DC  C 3 37  ? 27.963 89.707  30.688  1.00 79.01  ? 136  DC  D N4    1 
ATOM   1509  C  C5    . DC  C 3 37  ? 25.685 88.952  30.728  1.00 80.37  ? 136  DC  D C5    1 
ATOM   1510  C  C6    . DC  C 3 37  ? 24.528 88.929  31.407  1.00 81.11  ? 136  DC  D C6    1 
ATOM   1511  O  "O5'" . DC  D 1 1   ? 30.403 -13.741 103.288 1.00 138.35 ? 100  DC  G "O5'" 1 
ATOM   1512  C  "C5'" . DC  D 1 1   ? 30.504 -15.164 103.347 1.00 137.11 ? 100  DC  G "C5'" 1 
ATOM   1513  C  "C4'" . DC  D 1 1   ? 29.939 -15.784 102.092 1.00 136.44 ? 100  DC  G "C4'" 1 
ATOM   1514  O  "O4'" . DC  D 1 1   ? 28.522 -15.479 102.042 1.00 136.19 ? 100  DC  G "O4'" 1 
ATOM   1515  C  "C3'" . DC  D 1 1   ? 30.554 -15.229 100.803 1.00 135.71 ? 100  DC  G "C3'" 1 
ATOM   1516  O  "O3'" . DC  D 1 1   ? 30.776 -16.258 99.817  1.00 133.92 ? 100  DC  G "O3'" 1 
ATOM   1517  C  "C2'" . DC  D 1 1   ? 29.528 -14.218 100.330 1.00 136.15 ? 100  DC  G "C2'" 1 
ATOM   1518  C  "C1'" . DC  D 1 1   ? 28.208 -14.766 100.860 1.00 136.18 ? 100  DC  G "C1'" 1 
ATOM   1519  N  N1    . DC  D 1 1   ? 27.246 -13.704 101.206 1.00 135.94 ? 100  DC  G N1    1 
ATOM   1520  C  C2    . DC  D 1 1   ? 25.878 -13.970 101.135 1.00 135.70 ? 100  DC  G C2    1 
ATOM   1521  O  O2    . DC  D 1 1   ? 25.503 -15.115 100.845 1.00 135.74 ? 100  DC  G O2    1 
ATOM   1522  N  N3    . DC  D 1 1   ? 24.999 -12.972 101.388 1.00 135.63 ? 100  DC  G N3    1 
ATOM   1523  C  C4    . DC  D 1 1   ? 25.446 -11.755 101.714 1.00 135.54 ? 100  DC  G C4    1 
ATOM   1524  N  N4    . DC  D 1 1   ? 24.551 -10.793 101.936 1.00 135.45 ? 100  DC  G N4    1 
ATOM   1525  C  C5    . DC  D 1 1   ? 26.830 -11.468 101.822 1.00 135.87 ? 100  DC  G C5    1 
ATOM   1526  C  C6    . DC  D 1 1   ? 27.687 -12.461 101.566 1.00 136.16 ? 100  DC  G C6    1 
ATOM   1527  P  P     . DG  D 1 2   ? 31.791 -15.988 98.583  1.00 131.74 ? 101  DG  G P     1 
ATOM   1528  O  OP1   . DG  D 1 2   ? 31.900 -17.241 97.784  1.00 131.87 ? 101  DG  G OP1   1 
ATOM   1529  O  OP2   . DG  D 1 2   ? 33.030 -15.336 99.108  1.00 131.58 ? 101  DG  G OP2   1 
ATOM   1530  O  "O5'" . DG  D 1 2   ? 31.012 -14.923 97.694  1.00 126.91 ? 101  DG  G "O5'" 1 
ATOM   1531  C  "C5'" . DG  D 1 2   ? 31.023 -15.001 96.275  1.00 118.15 ? 101  DG  G "C5'" 1 
ATOM   1532  C  "C4'" . DG  D 1 2   ? 29.711 -15.556 95.771  1.00 111.61 ? 101  DG  G "C4'" 1 
ATOM   1533  O  "O4'" . DG  D 1 2   ? 28.637 -15.151 96.653  1.00 108.65 ? 101  DG  G "O4'" 1 
ATOM   1534  C  "C3'" . DG  D 1 2   ? 29.351 -15.025 94.386  1.00 108.79 ? 101  DG  G "C3'" 1 
ATOM   1535  O  "O3'" . DG  D 1 2   ? 28.744 -16.005 93.550  1.00 105.03 ? 101  DG  G "O3'" 1 
ATOM   1536  C  "C2'" . DG  D 1 2   ? 28.366 -13.912 94.672  1.00 107.58 ? 101  DG  G "C2'" 1 
ATOM   1537  C  "C1'" . DG  D 1 2   ? 27.704 -14.327 95.973  1.00 105.72 ? 101  DG  G "C1'" 1 
ATOM   1538  N  N9    . DG  D 1 2   ? 27.457 -13.160 96.809  1.00 103.12 ? 101  DG  G N9    1 
ATOM   1539  C  C8    . DG  D 1 2   ? 28.359 -12.548 97.644  1.00 102.16 ? 101  DG  G C8    1 
ATOM   1540  N  N7    . DG  D 1 2   ? 27.883 -11.475 98.216  1.00 101.68 ? 101  DG  G N7    1 
ATOM   1541  C  C5    . DG  D 1 2   ? 26.582 -11.381 97.741  1.00 101.80 ? 101  DG  G C5    1 
ATOM   1542  C  C6    . DG  D 1 2   ? 25.576 -10.407 97.998  1.00 101.56 ? 101  DG  G C6    1 
ATOM   1543  O  O6    . DG  D 1 2   ? 25.645 -9.399  98.717  1.00 101.36 ? 101  DG  G O6    1 
ATOM   1544  N  N1    . DG  D 1 2   ? 24.399 -10.692 97.307  1.00 101.07 ? 101  DG  G N1    1 
ATOM   1545  C  C2    . DG  D 1 2   ? 24.214 -11.769 96.473  1.00 101.20 ? 101  DG  G C2    1 
ATOM   1546  N  N2    . DG  D 1 2   ? 23.008 -11.863 95.891  1.00 101.30 ? 101  DG  G N2    1 
ATOM   1547  N  N3    . DG  D 1 2   ? 25.143 -12.683 96.225  1.00 101.43 ? 101  DG  G N3    1 
ATOM   1548  C  C4    . DG  D 1 2   ? 26.296 -12.425 96.885  1.00 102.14 ? 101  DG  G C4    1 
ATOM   1549  P  P     . DA  D 1 3   ? 28.539 -15.678 91.991  1.00 101.10 ? 102  DA  G P     1 
ATOM   1550  O  OP1   . DA  D 1 3   ? 28.118 -16.929 91.298  1.00 101.37 ? 102  DA  G OP1   1 
ATOM   1551  O  OP2   . DA  D 1 3   ? 29.774 -14.964 91.553  1.00 100.79 ? 102  DA  G OP2   1 
ATOM   1552  O  "O5'" . DA  D 1 3   ? 27.313 -14.655 91.975  1.00 95.73  ? 102  DA  G "O5'" 1 
ATOM   1553  C  "C5'" . DA  D 1 3   ? 25.970 -15.133 92.051  1.00 87.17  ? 102  DA  G "C5'" 1 
ATOM   1554  C  "C4'" . DA  D 1 3   ? 24.986 -14.025 91.744  1.00 81.42  ? 102  DA  G "C4'" 1 
ATOM   1555  O  "O4'" . DA  D 1 3   ? 25.026 -13.044 92.809  1.00 77.42  ? 102  DA  G "O4'" 1 
ATOM   1556  C  "C3'" . DA  D 1 3   ? 25.221 -13.256 90.438  1.00 80.02  ? 102  DA  G "C3'" 1 
ATOM   1557  O  "O3'" . DA  D 1 3   ? 23.982 -12.988 89.748  1.00 79.61  ? 102  DA  G "O3'" 1 
ATOM   1558  C  "C2'" . DA  D 1 3   ? 25.853 -11.957 90.905  1.00 76.80  ? 102  DA  G "C2'" 1 
ATOM   1559  C  "C1'" . DA  D 1 3   ? 25.219 -11.744 92.272  1.00 72.71  ? 102  DA  G "C1'" 1 
ATOM   1560  N  N9    . DA  D 1 3   ? 26.074 -10.990 93.193  1.00 66.38  ? 102  DA  G N9    1 
ATOM   1561  C  C8    . DA  D 1 3   ? 27.423 -11.178 93.419  1.00 63.49  ? 102  DA  G C8    1 
ATOM   1562  N  N7    . DA  D 1 3   ? 27.947 -10.317 94.260  1.00 59.99  ? 102  DA  G N7    1 
ATOM   1563  C  C5    . DA  D 1 3   ? 26.876 -9.514  94.623  1.00 59.54  ? 102  DA  G C5    1 
ATOM   1564  C  C6    . DA  D 1 3   ? 26.787 -8.401  95.473  1.00 58.62  ? 102  DA  G C6    1 
ATOM   1565  N  N6    . DA  D 1 3   ? 27.842 -7.894  96.126  1.00 57.32  ? 102  DA  G N6    1 
ATOM   1566  N  N1    . DA  D 1 3   ? 25.570 -7.820  95.626  1.00 57.58  ? 102  DA  G N1    1 
ATOM   1567  C  C2    . DA  D 1 3   ? 24.518 -8.340  94.954  1.00 58.39  ? 102  DA  G C2    1 
ATOM   1568  N  N3    . DA  D 1 3   ? 24.481 -9.381  94.114  1.00 59.11  ? 102  DA  G N3    1 
ATOM   1569  C  C4    . DA  D 1 3   ? 25.708 -9.927  93.988  1.00 61.48  ? 102  DA  G C4    1 
ATOM   1570  P  P     . DT  D 1 4   ? 24.005 -12.185 88.349  1.00 79.22  ? 103  DT  G P     1 
ATOM   1571  O  OP1   . DT  D 1 4   ? 22.779 -12.566 87.600  1.00 79.11  ? 103  DT  G OP1   1 
ATOM   1572  O  OP2   . DT  D 1 4   ? 25.355 -12.340 87.712  1.00 76.77  ? 103  DT  G OP2   1 
ATOM   1573  O  "O5'" . DT  D 1 4   ? 23.781 -10.678 88.798  1.00 76.11  ? 103  DT  G "O5'" 1 
ATOM   1574  C  "C5'" . DT  D 1 4   ? 22.543 -10.310 89.395  1.00 72.07  ? 103  DT  G "C5'" 1 
ATOM   1575  C  "C4'" . DT  D 1 4   ? 22.491 -8.827  89.689  1.00 69.28  ? 103  DT  G "C4'" 1 
ATOM   1576  O  "O4'" . DT  D 1 4   ? 23.383 -8.464  90.780  1.00 67.37  ? 103  DT  G "O4'" 1 
ATOM   1577  C  "C3'" . DT  D 1 4   ? 22.815 -7.884  88.526  1.00 67.66  ? 103  DT  G "C3'" 1 
ATOM   1578  O  "O3'" . DT  D 1 4   ? 21.814 -6.865  88.463  1.00 67.95  ? 103  DT  G "O3'" 1 
ATOM   1579  C  "C2'" . DT  D 1 4   ? 24.142 -7.270  88.939  1.00 65.73  ? 103  DT  G "C2'" 1 
ATOM   1580  C  "C1'" . DT  D 1 4   ? 24.018 -7.248  90.456  1.00 63.09  ? 103  DT  G "C1'" 1 
ATOM   1581  N  N1    . DT  D 1 4   ? 25.296 -7.167  91.198  1.00 58.21  ? 103  DT  G N1    1 
ATOM   1582  C  C2    . DT  D 1 4   ? 25.347 -6.335  92.298  1.00 55.92  ? 103  DT  G C2    1 
ATOM   1583  O  O2    . DT  D 1 4   ? 24.384 -5.699  92.695  1.00 54.83  ? 103  DT  G O2    1 
ATOM   1584  N  N3    . DT  D 1 4   ? 26.576 -6.270  92.914  1.00 53.76  ? 103  DT  G N3    1 
ATOM   1585  C  C4    . DT  D 1 4   ? 27.730 -6.934  92.537  1.00 53.89  ? 103  DT  G C4    1 
ATOM   1586  O  O4    . DT  D 1 4   ? 28.766 -6.799  93.187  1.00 52.88  ? 103  DT  G O4    1 
ATOM   1587  C  C5    . DT  D 1 4   ? 27.608 -7.770  91.370  1.00 54.71  ? 103  DT  G C5    1 
ATOM   1588  C  C7    . DT  D 1 4   ? 28.833 -8.461  90.855  1.00 55.81  ? 103  DT  G C7    1 
ATOM   1589  C  C6    . DT  D 1 4   ? 26.405 -7.870  90.782  1.00 55.83  ? 103  DT  G C6    1 
ATOM   1590  P  P     . DA  D 1 5   ? 21.594 -6.031  87.100  1.00 68.84  ? 104  DA  G P     1 
ATOM   1591  O  OP1   . DA  D 1 5   ? 20.345 -6.479  86.389  1.00 66.86  ? 104  DA  G OP1   1 
ATOM   1592  O  OP2   . DA  D 1 5   ? 22.911 -6.049  86.381  1.00 68.18  ? 104  DA  G OP2   1 
ATOM   1593  O  "O5'" . DA  D 1 5   ? 21.279 -4.571  87.657  1.00 64.71  ? 104  DA  G "O5'" 1 
ATOM   1594  C  "C5'" . DA  D 1 5   ? 20.251 -4.399  88.624  1.00 59.25  ? 104  DA  G "C5'" 1 
ATOM   1595  C  "C4'" . DA  D 1 5   ? 20.481 -3.145  89.433  1.00 55.78  ? 104  DA  G "C4'" 1 
ATOM   1596  O  "O4'" . DA  D 1 5   ? 21.672 -3.245  90.247  1.00 53.48  ? 104  DA  G "O4'" 1 
ATOM   1597  C  "C3'" . DA  D 1 5   ? 20.630 -1.873  88.612  1.00 53.78  ? 104  DA  G "C3'" 1 
ATOM   1598  O  "O3'" . DA  D 1 5   ? 19.904 -0.833  89.244  1.00 53.19  ? 104  DA  G "O3'" 1 
ATOM   1599  C  "C2'" . DA  D 1 5   ? 22.118 -1.589  88.650  1.00 51.48  ? 104  DA  G "C2'" 1 
ATOM   1600  C  "C1'" . DA  D 1 5   ? 22.569 -2.186  89.970  1.00 49.01  ? 104  DA  G "C1'" 1 
ATOM   1601  N  N9    . DA  D 1 5   ? 23.900 -2.773  89.874  1.00 44.86  ? 104  DA  G N9    1 
ATOM   1602  C  C8    . DA  D 1 5   ? 24.314 -3.657  88.918  1.00 42.73  ? 104  DA  G C8    1 
ATOM   1603  N  N7    . DA  D 1 5   ? 25.549 -4.058  89.068  1.00 41.56  ? 104  DA  G N7    1 
ATOM   1604  C  C5    . DA  D 1 5   ? 25.980 -3.389  90.196  1.00 41.20  ? 104  DA  G C5    1 
ATOM   1605  C  C6    . DA  D 1 5   ? 27.201 -3.406  90.878  1.00 41.69  ? 104  DA  G C6    1 
ATOM   1606  N  N6    . DA  D 1 5   ? 28.242 -4.147  90.490  1.00 41.91  ? 104  DA  G N6    1 
ATOM   1607  N  N1    . DA  D 1 5   ? 27.323 -2.630  91.979  1.00 42.20  ? 104  DA  G N1    1 
ATOM   1608  C  C2    . DA  D 1 5   ? 26.263 -1.886  92.348  1.00 44.08  ? 104  DA  G C2    1 
ATOM   1609  N  N3    . DA  D 1 5   ? 25.050 -1.792  91.781  1.00 43.63  ? 104  DA  G N3    1 
ATOM   1610  C  C4    . DA  D 1 5   ? 24.977 -2.583  90.699  1.00 42.67  ? 104  DA  G C4    1 
ATOM   1611  P  P     . DA  D 1 6   ? 19.607 0.511   88.445  1.00 54.25  ? 105  DA  G P     1 
ATOM   1612  O  OP1   . DA  D 1 6   ? 18.508 1.233   89.154  1.00 53.39  ? 105  DA  G OP1   1 
ATOM   1613  O  OP2   . DA  D 1 6   ? 19.470 0.197   86.994  1.00 53.27  ? 105  DA  G OP2   1 
ATOM   1614  O  "O5'" . DA  D 1 6   ? 20.956 1.317   88.673  1.00 54.56  ? 105  DA  G "O5'" 1 
ATOM   1615  C  "C5'" . DA  D 1 6   ? 21.183 1.964   89.916  1.00 53.99  ? 105  DA  G "C5'" 1 
ATOM   1616  C  "C4'" . DA  D 1 6   ? 22.570 2.557   89.971  1.00 52.34  ? 105  DA  G "C4'" 1 
ATOM   1617  O  "O4'" . DA  D 1 6   ? 23.574 1.506   89.967  1.00 50.66  ? 105  DA  G "O4'" 1 
ATOM   1618  C  "C3'" . DA  D 1 6   ? 22.958 3.522   88.843  1.00 51.75  ? 105  DA  G "C3'" 1 
ATOM   1619  O  "O3'" . DA  D 1 6   ? 23.593 4.681   89.408  1.00 52.77  ? 105  DA  G "O3'" 1 
ATOM   1620  C  "C2'" . DA  D 1 6   ? 24.002 2.730   88.074  1.00 49.58  ? 105  DA  G "C2'" 1 
ATOM   1621  C  "C1'" . DA  D 1 6   ? 24.650 1.982   89.212  1.00 47.19  ? 105  DA  G "C1'" 1 
ATOM   1622  N  N9    . DA  D 1 6   ? 25.514 0.871   88.845  1.00 44.87  ? 105  DA  G N9    1 
ATOM   1623  C  C8    . DA  D 1 6   ? 25.398 -0.007  87.800  1.00 45.27  ? 105  DA  G C8    1 
ATOM   1624  N  N7    . DA  D 1 6   ? 26.441 -0.793  87.650  1.00 44.24  ? 105  DA  G N7    1 
ATOM   1625  C  C5    . DA  D 1 6   ? 27.281 -0.425  88.690  1.00 43.48  ? 105  DA  G C5    1 
ATOM   1626  C  C6    . DA  D 1 6   ? 28.573 -0.848  89.054  1.00 43.33  ? 105  DA  G C6    1 
ATOM   1627  N  N6    . DA  D 1 6   ? 29.285 -1.742  88.350  1.00 43.00  ? 105  DA  G N6    1 
ATOM   1628  N  N1    . DA  D 1 6   ? 29.124 -0.298  90.159  1.00 42.48  ? 105  DA  G N1    1 
ATOM   1629  C  C2    . DA  D 1 6   ? 28.420 0.637   90.826  1.00 43.43  ? 105  DA  G C2    1 
ATOM   1630  N  N3    . DA  D 1 6   ? 27.212 1.140   90.559  1.00 42.84  ? 105  DA  G N3    1 
ATOM   1631  C  C4    . DA  D 1 6   ? 26.697 0.562   89.465  1.00 43.52  ? 105  DA  G C4    1 
ATOM   1632  P  P     . DC  D 1 7   ? 23.434 6.111   88.701  1.00 51.37  ? 106  DC  G P     1 
ATOM   1633  O  OP1   . DC  D 1 7   ? 23.267 7.119   89.770  1.00 52.27  ? 106  DC  G OP1   1 
ATOM   1634  O  OP2   . DC  D 1 7   ? 22.378 5.967   87.676  1.00 51.06  ? 106  DC  G OP2   1 
ATOM   1635  O  "O5'" . DC  D 1 7   ? 24.856 6.348   88.030  1.00 48.73  ? 106  DC  G "O5'" 1 
ATOM   1636  C  "C5'" . DC  D 1 7   ? 25.833 5.336   88.049  1.00 46.80  ? 106  DC  G "C5'" 1 
ATOM   1637  C  "C4'" . DC  D 1 7   ? 26.842 5.598   89.140  1.00 48.66  ? 106  DC  G "C4'" 1 
ATOM   1638  O  "O4'" . DC  D 1 7   ? 27.394 4.291   89.427  1.00 49.26  ? 106  DC  G "O4'" 1 
ATOM   1639  C  "C3'" . DC  D 1 7   ? 28.028 6.505   88.768  1.00 50.55  ? 106  DC  G "C3'" 1 
ATOM   1640  O  "O3'" . DC  D 1 7   ? 28.468 7.422   89.796  1.00 50.62  ? 106  DC  G "O3'" 1 
ATOM   1641  C  "C2'" . DC  D 1 7   ? 29.149 5.527   88.465  1.00 49.94  ? 106  DC  G "C2'" 1 
ATOM   1642  C  "C1'" . DC  D 1 7   ? 28.789 4.241   89.196  1.00 46.73  ? 106  DC  G "C1'" 1 
ATOM   1643  N  N1    . DC  D 1 7   ? 29.051 3.082   88.335  1.00 44.36  ? 106  DC  G N1    1 
ATOM   1644  C  C2    . DC  D 1 7   ? 30.243 2.380   88.488  1.00 44.97  ? 106  DC  G C2    1 
ATOM   1645  O  O2    . DC  D 1 7   ? 30.980 2.657   89.434  1.00 46.92  ? 106  DC  G O2    1 
ATOM   1646  N  N3    . DC  D 1 7   ? 30.560 1.412   87.607  1.00 45.55  ? 106  DC  G N3    1 
ATOM   1647  C  C4    . DC  D 1 7   ? 29.720 1.121   86.611  1.00 45.85  ? 106  DC  G C4    1 
ATOM   1648  N  N4    . DC  D 1 7   ? 30.108 0.203   85.710  1.00 46.90  ? 106  DC  G N4    1 
ATOM   1649  C  C5    . DC  D 1 7   ? 28.458 1.768   86.480  1.00 44.27  ? 106  DC  G C5    1 
ATOM   1650  C  C6    . DC  D 1 7   ? 28.167 2.731   87.359  1.00 43.47  ? 106  DC  G C6    1 
HETATM 1651  N  N1    . UMP D 1 8   ? 33.408 5.122   87.740  1.00 56.83  ? 107  UMP G N1    1 
HETATM 1652  C  C2    . UMP D 1 8   ? 34.208 4.246   87.038  1.00 56.15  ? 107  UMP G C2    1 
HETATM 1653  N  N3    . UMP D 1 8   ? 33.597 3.625   85.980  1.00 55.31  ? 107  UMP G N3    1 
HETATM 1654  C  C4    . UMP D 1 8   ? 32.298 3.801   85.556  1.00 56.12  ? 107  UMP G C4    1 
HETATM 1655  C  C5    . UMP D 1 8   ? 31.542 4.725   86.329  1.00 55.55  ? 107  UMP G C5    1 
HETATM 1656  C  C6    . UMP D 1 8   ? 32.110 5.339   87.368  1.00 56.04  ? 107  UMP G C6    1 
HETATM 1657  O  O2    . UMP D 1 8   ? 35.370 4.040   87.323  1.00 56.56  ? 107  UMP G O2    1 
HETATM 1658  O  O4    . UMP D 1 8   ? 31.906 3.224   84.541  1.00 57.12  ? 107  UMP G O4    1 
HETATM 1659  C  "C1'" . UMP D 1 8   ? 33.980 5.815   88.903  1.00 57.97  ? 107  UMP G "C1'" 1 
HETATM 1660  C  "C2'" . UMP D 1 8   ? 34.033 7.330   88.765  1.00 59.21  ? 107  UMP G "C2'" 1 
HETATM 1661  C  "C3'" . UMP D 1 8   ? 33.768 7.831   90.175  1.00 60.06  ? 107  UMP G "C3'" 1 
HETATM 1662  C  "C4'" . UMP D 1 8   ? 32.874 6.752   90.760  1.00 58.07  ? 107  UMP G "C4'" 1 
HETATM 1663  O  "O3'" . UMP D 1 8   ? 34.935 7.894   91.009  1.00 63.85  ? 107  UMP G "O3'" 1 
HETATM 1664  O  "O4'" . UMP D 1 8   ? 33.125 5.554   89.997  1.00 58.33  ? 107  UMP G "O4'" 1 
HETATM 1665  C  "C5'" . UMP D 1 8   ? 31.406 7.079   90.790  1.00 55.40  ? 107  UMP G "C5'" 1 
HETATM 1666  O  "O5'" . UMP D 1 8   ? 30.996 7.595   89.549  1.00 51.30  ? 107  UMP G "O5'" 1 
HETATM 1667  P  P     . UMP D 1 8   ? 29.676 8.467   89.480  1.00 51.95  ? 107  UMP G P     1 
HETATM 1668  O  OP1   . UMP D 1 8   ? 29.769 9.442   90.594  1.00 51.85  ? 107  UMP G OP1   1 
HETATM 1669  O  OP2   . UMP D 1 8   ? 29.564 8.957   88.090  1.00 51.28  ? 107  UMP G OP2   1 
ATOM   1670  P  P     . DT  D 1 9   ? 36.253 8.666   90.517  1.00 64.94  ? 108  DT  G P     1 
ATOM   1671  O  OP1   . DT  D 1 9   ? 37.198 8.776   91.668  1.00 63.31  ? 108  DT  G OP1   1 
ATOM   1672  O  OP2   . DT  D 1 9   ? 35.878 9.887   89.734  1.00 63.74  ? 108  DT  G OP2   1 
ATOM   1673  O  "O5'" . DT  D 1 9   ? 36.898 7.621   89.533  1.00 62.51  ? 108  DT  G "O5'" 1 
ATOM   1674  C  "C5'" . DT  D 1 9   ? 38.150 7.879   89.011  1.00 61.83  ? 108  DT  G "C5'" 1 
ATOM   1675  C  "C4'" . DT  D 1 9   ? 38.882 6.586   88.841  1.00 61.09  ? 108  DT  G "C4'" 1 
ATOM   1676  O  "O4'" . DT  D 1 9   ? 38.018 5.694   88.112  1.00 60.18  ? 108  DT  G "O4'" 1 
ATOM   1677  C  "C3'" . DT  D 1 9   ? 40.090 6.838   87.967  1.00 62.50  ? 108  DT  G "C3'" 1 
ATOM   1678  O  "O3'" . DT  D 1 9   ? 41.242 6.197   88.453  1.00 64.14  ? 108  DT  G "O3'" 1 
ATOM   1679  C  "C2'" . DT  D 1 9   ? 39.685 6.358   86.593  1.00 61.45  ? 108  DT  G "C2'" 1 
ATOM   1680  C  "C1'" . DT  D 1 9   ? 38.617 5.332   86.881  1.00 59.99  ? 108  DT  G "C1'" 1 
ATOM   1681  N  N1    . DT  D 1 9   ? 37.576 5.334   85.846  1.00 59.03  ? 108  DT  G N1    1 
ATOM   1682  C  C2    . DT  D 1 9   ? 37.662 4.362   84.891  1.00 59.45  ? 108  DT  G C2    1 
ATOM   1683  O  O2    . DT  D 1 9   ? 38.570 3.538   84.861  1.00 60.74  ? 108  DT  G O2    1 
ATOM   1684  N  N3    . DT  D 1 9   ? 36.653 4.387   83.964  1.00 58.25  ? 108  DT  G N3    1 
ATOM   1685  C  C4    . DT  D 1 9   ? 35.607 5.272   83.904  1.00 55.57  ? 108  DT  G C4    1 
ATOM   1686  O  O4    . DT  D 1 9   ? 34.757 5.139   83.048  1.00 56.08  ? 108  DT  G O4    1 
ATOM   1687  C  C5    . DT  D 1 9   ? 35.605 6.293   84.903  1.00 54.69  ? 108  DT  G C5    1 
ATOM   1688  C  C7    . DT  D 1 9   ? 34.546 7.339   84.856  1.00 53.39  ? 108  DT  G C7    1 
ATOM   1689  C  C6    . DT  D 1 9   ? 36.566 6.269   85.827  1.00 56.42  ? 108  DT  G C6    1 
ATOM   1690  P  P     . DC  D 1 10  ? 42.642 6.880   88.163  1.00 65.97  ? 109  DC  G P     1 
ATOM   1691  O  OP1   . DC  D 1 10  ? 43.670 6.244   89.041  1.00 65.44  ? 109  DC  G OP1   1 
ATOM   1692  O  OP2   . DC  D 1 10  ? 42.366 8.347   88.260  1.00 64.40  ? 109  DC  G OP2   1 
ATOM   1693  O  "O5'" . DC  D 1 10  ? 42.885 6.482   86.643  1.00 66.03  ? 109  DC  G "O5'" 1 
ATOM   1694  C  "C5'" . DC  D 1 10  ? 42.900 5.107   86.294  1.00 67.92  ? 109  DC  G "C5'" 1 
ATOM   1695  C  "C4'" . DC  D 1 10  ? 42.910 4.913   84.797  1.00 68.15  ? 109  DC  G "C4'" 1 
ATOM   1696  O  "O4'" . DC  D 1 10  ? 41.588 4.783   84.227  1.00 67.38  ? 109  DC  G "O4'" 1 
ATOM   1697  C  "C3'" . DC  D 1 10  ? 43.646 5.949   83.958  1.00 68.59  ? 109  DC  G "C3'" 1 
ATOM   1698  O  "O3'" . DC  D 1 10  ? 44.517 5.258   83.080  1.00 70.37  ? 109  DC  G "O3'" 1 
ATOM   1699  C  "C2'" . DC  D 1 10  ? 42.541 6.561   83.122  1.00 67.50  ? 109  DC  G "C2'" 1 
ATOM   1700  C  "C1'" . DC  D 1 10  ? 41.619 5.373   82.952  1.00 66.31  ? 109  DC  G "C1'" 1 
ATOM   1701  N  N1    . DC  D 1 10  ? 40.251 5.727   82.588  1.00 65.14  ? 109  DC  G N1    1 
ATOM   1702  C  C2    . DC  D 1 10  ? 39.586 4.985   81.605  1.00 64.80  ? 109  DC  G C2    1 
ATOM   1703  O  O2    . DC  D 1 10  ? 40.147 4.006   81.104  1.00 63.96  ? 109  DC  G O2    1 
ATOM   1704  N  N3    . DC  D 1 10  ? 38.348 5.359   81.228  1.00 66.01  ? 109  DC  G N3    1 
ATOM   1705  C  C4    . DC  D 1 10  ? 37.778 6.432   81.792  1.00 67.29  ? 109  DC  G C4    1 
ATOM   1706  N  N4    . DC  D 1 10  ? 36.573 6.823   81.355  1.00 69.73  ? 109  DC  G N4    1 
ATOM   1707  C  C5    . DC  D 1 10  ? 38.420 7.170   82.822  1.00 66.59  ? 109  DC  G C5    1 
ATOM   1708  C  C6    . DC  D 1 10  ? 39.640 6.784   83.187  1.00 64.98  ? 109  DC  G C6    1 
ATOM   1709  P  P     . DG  D 1 11  ? 45.993 5.818   82.840  1.00 71.85  ? 110  DG  G P     1 
ATOM   1710  O  OP1   . DG  D 1 11  ? 46.942 5.014   83.662  1.00 71.04  ? 110  DG  G OP1   1 
ATOM   1711  O  OP2   . DG  D 1 11  ? 45.919 7.299   83.025  1.00 69.75  ? 110  DG  G OP2   1 
ATOM   1712  O  "O5'" . DG  D 1 11  ? 46.240 5.465   81.306  1.00 70.90  ? 110  DG  G "O5'" 1 
ATOM   1713  C  "C5'" . DG  D 1 11  ? 46.073 4.131   80.832  1.00 68.43  ? 110  DG  G "C5'" 1 
ATOM   1714  C  "C4'" . DG  D 1 11  ? 45.668 4.145   79.378  1.00 66.32  ? 110  DG  G "C4'" 1 
ATOM   1715  O  "O4'" . DG  D 1 11  ? 44.239 4.380   79.269  1.00 65.83  ? 110  DG  G "O4'" 1 
ATOM   1716  C  "C3'" . DG  D 1 11  ? 46.352 5.238   78.555  1.00 65.50  ? 110  DG  G "C3'" 1 
ATOM   1717  O  "O3'" . DG  D 1 11  ? 46.885 4.739   77.331  1.00 65.65  ? 110  DG  G "O3'" 1 
ATOM   1718  C  "C2'" . DG  D 1 11  ? 45.231 6.214   78.248  1.00 65.04  ? 110  DG  G "C2'" 1 
ATOM   1719  C  "C1'" . DG  D 1 11  ? 43.993 5.336   78.253  1.00 63.98  ? 110  DG  G "C1'" 1 
ATOM   1720  N  N9    . DG  D 1 11  ? 42.786 6.084   78.597  1.00 62.12  ? 110  DG  G N9    1 
ATOM   1721  C  C8    . DG  D 1 11  ? 42.718 7.113   79.493  1.00 61.40  ? 110  DG  G C8    1 
ATOM   1722  N  N7    . DG  D 1 11  ? 41.540 7.664   79.556  1.00 61.82  ? 110  DG  G N7    1 
ATOM   1723  C  C5    . DG  D 1 11  ? 40.771 6.946   78.657  1.00 61.88  ? 110  DG  G C5    1 
ATOM   1724  C  C6    . DG  D 1 11  ? 39.409 7.105   78.291  1.00 61.96  ? 110  DG  G C6    1 
ATOM   1725  O  O6    . DG  D 1 11  ? 38.613 7.955   78.674  1.00 61.52  ? 110  DG  G O6    1 
ATOM   1726  N  N1    . DG  D 1 11  ? 39.004 6.148   77.368  1.00 62.24  ? 110  DG  G N1    1 
ATOM   1727  C  C2    . DG  D 1 11  ? 39.809 5.170   76.846  1.00 63.01  ? 110  DG  G C2    1 
ATOM   1728  N  N2    . DG  D 1 11  ? 39.212 4.324   75.978  1.00 62.09  ? 110  DG  G N2    1 
ATOM   1729  N  N3    . DG  D 1 11  ? 41.105 5.027   77.157  1.00 63.48  ? 110  DG  G N3    1 
ATOM   1730  C  C4    . DG  D 1 11  ? 41.513 5.947   78.069  1.00 62.37  ? 110  DG  G C4    1 
ATOM   1731  P  P     . DT  D 1 12  ? 47.633 5.752   76.322  1.00 67.03  ? 111  DT  G P     1 
ATOM   1732  O  OP1   . DT  D 1 12  ? 48.968 5.183   75.970  1.00 67.43  ? 111  DT  G OP1   1 
ATOM   1733  O  OP2   . DT  D 1 12  ? 47.544 7.139   76.873  1.00 65.31  ? 111  DT  G OP2   1 
ATOM   1734  O  "O5'" . DT  D 1 12  ? 46.741 5.665   75.009  1.00 64.02  ? 111  DT  G "O5'" 1 
ATOM   1735  C  "C5'" . DT  D 1 12  ? 46.285 4.405   74.551  1.00 60.56  ? 111  DT  G "C5'" 1 
ATOM   1736  C  "C4'" . DT  D 1 12  ? 45.119 4.577   73.608  1.00 57.69  ? 111  DT  G "C4'" 1 
ATOM   1737  O  "O4'" . DT  D 1 12  ? 43.993 5.159   74.317  1.00 56.93  ? 111  DT  G "O4'" 1 
ATOM   1738  C  "C3'" . DT  D 1 12  ? 45.396 5.478   72.407  1.00 55.93  ? 111  DT  G "C3'" 1 
ATOM   1739  O  "O3'" . DT  D 1 12  ? 45.016 4.817   71.195  1.00 52.91  ? 111  DT  G "O3'" 1 
ATOM   1740  C  "C2'" . DT  D 1 12  ? 44.550 6.715   72.677  1.00 55.92  ? 111  DT  G "C2'" 1 
ATOM   1741  C  "C1'" . DT  D 1 12  ? 43.416 6.198   73.549  1.00 56.02  ? 111  DT  G "C1'" 1 
ATOM   1742  N  N1    . DT  D 1 12  ? 42.862 7.209   74.484  1.00 55.51  ? 111  DT  G N1    1 
ATOM   1743  C  C2    . DT  D 1 12  ? 41.512 7.546   74.432  1.00 54.90  ? 111  DT  G C2    1 
ATOM   1744  O  O2    . DT  D 1 12  ? 40.714 7.039   73.673  1.00 53.98  ? 111  DT  G O2    1 
ATOM   1745  N  N3    . DT  D 1 12  ? 41.134 8.513   75.320  1.00 55.12  ? 111  DT  G N3    1 
ATOM   1746  C  C4    . DT  D 1 12  ? 41.932 9.160   76.232  1.00 55.44  ? 111  DT  G C4    1 
ATOM   1747  O  O4    . DT  D 1 12  ? 41.455 10.003  76.964  1.00 57.05  ? 111  DT  G O4    1 
ATOM   1748  C  C5    . DT  D 1 12  ? 43.310 8.762   76.239  1.00 55.71  ? 111  DT  G C5    1 
ATOM   1749  C  C7    . DT  D 1 12  ? 44.244 9.426   77.196  1.00 56.40  ? 111  DT  G C7    1 
ATOM   1750  C  C6    . DT  D 1 12  ? 43.702 7.815   75.382  1.00 55.58  ? 111  DT  G C6    1 
ATOM   1751  P  P     . DA  D 1 13  ? 45.432 5.444   69.774  1.00 51.15  ? 112  DA  G P     1 
ATOM   1752  O  OP1   . DA  D 1 13  ? 45.653 4.311   68.846  1.00 51.31  ? 112  DA  G OP1   1 
ATOM   1753  O  OP2   . DA  D 1 13  ? 46.497 6.472   69.935  1.00 49.82  ? 112  DA  G OP2   1 
ATOM   1754  O  "O5'" . DA  D 1 13  ? 44.075 6.135   69.342  1.00 48.89  ? 112  DA  G "O5'" 1 
ATOM   1755  C  "C5'" . DA  D 1 13  ? 42.898 5.353   69.340  1.00 46.67  ? 112  DA  G "C5'" 1 
ATOM   1756  C  "C4'" . DA  D 1 13  ? 41.687 6.201   69.051  1.00 44.45  ? 112  DA  G "C4'" 1 
ATOM   1757  O  "O4'" . DA  D 1 13  ? 41.315 6.961   70.219  1.00 44.03  ? 112  DA  G "O4'" 1 
ATOM   1758  C  "C3'" . DA  D 1 13  ? 41.819 7.191   67.898  1.00 42.25  ? 112  DA  G "C3'" 1 
ATOM   1759  O  "O3'" . DA  D 1 13  ? 40.678 7.080   67.068  1.00 39.88  ? 112  DA  G "O3'" 1 
ATOM   1760  C  "C2'" . DA  D 1 13  ? 41.817 8.538   68.588  1.00 42.73  ? 112  DA  G "C2'" 1 
ATOM   1761  C  "C1'" . DA  D 1 13  ? 40.973 8.269   69.821  1.00 44.08  ? 112  DA  G "C1'" 1 
ATOM   1762  N  N9    . DA  D 1 13  ? 41.224 9.176   70.949  1.00 44.48  ? 112  DA  G N9    1 
ATOM   1763  C  C8    . DA  D 1 13  ? 42.425 9.451   71.564  1.00 44.95  ? 112  DA  G C8    1 
ATOM   1764  N  N7    . DA  D 1 13  ? 42.339 10.354  72.508  1.00 43.71  ? 112  DA  G N7    1 
ATOM   1765  C  C5    . DA  D 1 13  ? 40.997 10.685  72.523  1.00 43.01  ? 112  DA  G C5    1 
ATOM   1766  C  C6    . DA  D 1 13  ? 40.288 11.585  73.278  1.00 43.54  ? 112  DA  G C6    1 
ATOM   1767  N  N6    . DA  D 1 13  ? 40.854 12.350  74.205  1.00 45.43  ? 112  DA  G N6    1 
ATOM   1768  N  N1    . DA  D 1 13  ? 38.960 11.689  73.057  1.00 43.77  ? 112  DA  G N1    1 
ATOM   1769  C  C2    . DA  D 1 13  ? 38.409 10.917  72.126  1.00 42.22  ? 112  DA  G C2    1 
ATOM   1770  N  N3    . DA  D 1 13  ? 38.980 10.025  71.342  1.00 42.47  ? 112  DA  G N3    1 
ATOM   1771  C  C4    . DA  D 1 13  ? 40.295 9.959   71.588  1.00 43.05  ? 112  DA  G C4    1 
ATOM   1772  P  P     . DT  D 1 14  ? 40.570 7.966   65.747  1.00 41.50  ? 113  DT  G P     1 
ATOM   1773  O  OP1   . DT  D 1 14  ? 39.696 7.244   64.794  1.00 40.96  ? 113  DT  G OP1   1 
ATOM   1774  O  OP2   . DT  D 1 14  ? 41.928 8.359   65.317  1.00 39.50  ? 113  DT  G OP2   1 
ATOM   1775  O  "O5'" . DT  D 1 14  ? 39.744 9.220   66.265  1.00 40.24  ? 113  DT  G "O5'" 1 
ATOM   1776  C  "C5'" . DT  D 1 14  ? 38.390 9.023   66.674  1.00 39.20  ? 113  DT  G "C5'" 1 
ATOM   1777  C  "C4'" . DT  D 1 14  ? 37.671 10.335  66.893  1.00 35.93  ? 113  DT  G "C4'" 1 
ATOM   1778  O  "O4'" . DT  D 1 14  ? 38.083 10.961  68.126  1.00 35.21  ? 113  DT  G "O4'" 1 
ATOM   1779  C  "C3'" . DT  D 1 14  ? 37.858 11.385  65.807  1.00 34.19  ? 113  DT  G "C3'" 1 
ATOM   1780  O  "O3'" . DT  D 1 14  ? 36.655 12.143  65.715  1.00 31.62  ? 113  DT  G "O3'" 1 
ATOM   1781  C  "C2'" . DT  D 1 14  ? 38.945 12.250  66.401  1.00 33.58  ? 113  DT  G "C2'" 1 
ATOM   1782  C  "C1'" . DT  D 1 14  ? 38.477 12.278  67.834  1.00 34.63  ? 113  DT  G "C1'" 1 
ATOM   1783  N  N1    . DT  D 1 14  ? 39.461 12.708  68.832  1.00 33.85  ? 113  DT  G N1    1 
ATOM   1784  C  C2    . DT  D 1 14  ? 39.017 13.600  69.770  1.00 33.95  ? 113  DT  G C2    1 
ATOM   1785  O  O2    . DT  D 1 14  ? 37.857 13.995  69.827  1.00 32.83  ? 113  DT  G O2    1 
ATOM   1786  N  N3    . DT  D 1 14  ? 39.973 14.017  70.642  1.00 34.41  ? 113  DT  G N3    1 
ATOM   1787  C  C4    . DT  D 1 14  ? 41.294 13.647  70.666  1.00 33.65  ? 113  DT  G C4    1 
ATOM   1788  O  O4    . DT  D 1 14  ? 42.043 14.152  71.487  1.00 35.01  ? 113  DT  G O4    1 
ATOM   1789  C  C5    . DT  D 1 14  ? 41.683 12.685  69.679  1.00 32.03  ? 113  DT  G C5    1 
ATOM   1790  C  C7    . DT  D 1 14  ? 43.096 12.206  69.656  1.00 30.99  ? 113  DT  G C7    1 
ATOM   1791  C  C6    . DT  D 1 14  ? 40.759 12.263  68.820  1.00 32.07  ? 113  DT  G C6    1 
ATOM   1792  P  P     . DA  D 1 15  ? 36.371 13.032  64.415  1.00 32.90  ? 114  DA  G P     1 
ATOM   1793  O  OP1   . DA  D 1 15  ? 35.615 12.233  63.415  1.00 32.75  ? 114  DA  G OP1   1 
ATOM   1794  O  OP2   . DA  D 1 15  ? 37.652 13.571  63.890  1.00 31.39  ? 114  DA  G OP2   1 
ATOM   1795  O  "O5'" . DA  D 1 15  ? 35.577 14.259  65.051  1.00 30.99  ? 114  DA  G "O5'" 1 
ATOM   1796  C  "C5'" . DA  D 1 15  ? 34.610 13.915  66.071  1.00 30.75  ? 114  DA  G "C5'" 1 
ATOM   1797  C  "C4'" . DA  D 1 15  ? 34.015 15.083  66.899  1.00 29.92  ? 114  DA  G "C4'" 1 
ATOM   1798  O  "O4'" . DA  D 1 15  ? 34.941 15.314  68.011  1.00 31.41  ? 114  DA  G "O4'" 1 
ATOM   1799  C  "C3'" . DA  D 1 15  ? 33.783 16.438  66.284  1.00 28.63  ? 114  DA  G "C3'" 1 
ATOM   1800  O  "O3'" . DA  D 1 15  ? 32.585 16.930  66.873  1.00 27.09  ? 114  DA  G "O3'" 1 
ATOM   1801  C  "C2'" . DA  D 1 15  ? 34.929 17.344  66.678  1.00 26.39  ? 114  DA  G "C2'" 1 
ATOM   1802  C  "C1'" . DA  D 1 15  ? 35.385 16.707  67.992  1.00 27.72  ? 114  DA  G "C1'" 1 
ATOM   1803  N  N9    . DA  D 1 15  ? 36.853 16.722  68.225  1.00 27.44  ? 114  DA  G N9    1 
ATOM   1804  C  C8    . DA  D 1 15  ? 37.763 15.958  67.560  1.00 27.85  ? 114  DA  G C8    1 
ATOM   1805  N  N7    . DA  D 1 15  ? 38.997 16.130  67.960  1.00 30.36  ? 114  DA  G N7    1 
ATOM   1806  C  C5    . DA  D 1 15  ? 38.890 17.082  68.955  1.00 32.27  ? 114  DA  G C5    1 
ATOM   1807  C  C6    . DA  D 1 15  ? 39.846 17.681  69.779  1.00 35.01  ? 114  DA  G C6    1 
ATOM   1808  N  N6    . DA  D 1 15  ? 41.149 17.396  69.701  1.00 37.82  ? 114  DA  G N6    1 
ATOM   1809  N  N1    . DA  D 1 15  ? 39.419 18.582  70.692  1.00 34.49  ? 114  DA  G N1    1 
ATOM   1810  C  C2    . DA  D 1 15  ? 38.117 18.849  70.749  1.00 33.11  ? 114  DA  G C2    1 
ATOM   1811  N  N3    . DA  D 1 15  ? 37.118 18.353  70.025  1.00 30.74  ? 114  DA  G N3    1 
ATOM   1812  C  C4    . DA  D 1 15  ? 37.575 17.460  69.133  1.00 30.24  ? 114  DA  G C4    1 
HETATM 1813  P  P1    . A3P D 1 16  ? 30.953 23.110  70.510  1.00 44.17  ? 115  A3P G P1    1 
HETATM 1814  O  O1P   . A3P D 1 16  ? 30.908 23.164  71.988  1.00 36.13  ? 115  A3P G O1P   1 
HETATM 1815  O  O2P   . A3P D 1 16  ? 31.102 24.578  70.400  1.00 36.43  ? 115  A3P G O2P   1 
HETATM 1816  P  P2    . A3P D 1 16  ? 31.957 18.343  66.464  1.00 30.48  ? 115  A3P G P2    1 
HETATM 1817  O  O4P   . A3P D 1 16  ? 32.384 18.575  65.074  1.00 25.63  ? 115  A3P G O4P   1 
HETATM 1818  O  O5P   . A3P D 1 16  ? 30.509 18.472  66.771  1.00 25.69  ? 115  A3P G O5P   1 
HETATM 1819  O  "O5'" . A3P D 1 16  ? 32.763 19.397  67.375  1.00 33.10  ? 115  A3P G "O5'" 1 
HETATM 1820  C  "C5'" . A3P D 1 16  ? 32.516 19.274  68.796  1.00 33.03  ? 115  A3P G "C5'" 1 
HETATM 1821  C  "C4'" . A3P D 1 16  ? 33.034 20.483  69.603  1.00 30.81  ? 115  A3P G "C4'" 1 
HETATM 1822  O  "O4'" . A3P D 1 16  ? 34.490 20.379  69.573  1.00 31.53  ? 115  A3P G "O4'" 1 
HETATM 1823  C  "C3'" . A3P D 1 16  ? 32.721 21.872  69.111  1.00 32.82  ? 115  A3P G "C3'" 1 
HETATM 1824  O  "O3'" . A3P D 1 16  ? 32.306 22.726  70.157  1.00 31.05  ? 115  A3P G "O3'" 1 
HETATM 1825  C  "C2'" . A3P D 1 16  ? 33.925 22.340  68.336  1.00 27.06  ? 115  A3P G "C2'" 1 
HETATM 1826  C  "C1'" . A3P D 1 16  ? 35.023 21.634  69.113  1.00 26.75  ? 115  A3P G "C1'" 1 
HETATM 1827  N  N9    . A3P D 1 16  ? 36.324 21.340  68.588  1.00 24.13  ? 115  A3P G N9    1 
HETATM 1828  C  C8    . A3P D 1 16  ? 36.604 20.507  67.541  1.00 24.36  ? 115  A3P G C8    1 
HETATM 1829  N  N7    . A3P D 1 16  ? 37.883 20.361  67.313  1.00 23.35  ? 115  A3P G N7    1 
HETATM 1830  C  C5    . A3P D 1 16  ? 38.483 21.127  68.275  1.00 23.80  ? 115  A3P G C5    1 
HETATM 1831  C  C6    . A3P D 1 16  ? 39.819 21.366  68.582  1.00 25.15  ? 115  A3P G C6    1 
HETATM 1832  N  N6    . A3P D 1 16  ? 40.833 20.782  67.918  1.00 27.99  ? 115  A3P G N6    1 
HETATM 1833  N  N1    . A3P D 1 16  ? 40.087 22.211  69.577  1.00 25.26  ? 115  A3P G N1    1 
HETATM 1834  C  C2    . A3P D 1 16  ? 39.063 22.787  70.214  1.00 27.88  ? 115  A3P G C2    1 
HETATM 1835  N  N3    . A3P D 1 16  ? 37.761 22.647  70.042  1.00 26.37  ? 115  A3P G N3    1 
HETATM 1836  C  C4    . A3P D 1 16  ? 37.535 21.783  69.045  1.00 25.10  ? 115  A3P G C4    1 
ATOM   1837  O  "O5'" . DT  E 2 1   ? 33.949 23.918  71.417  1.00 48.26  ? 116  DT  Y "O5'" 1 
ATOM   1838  C  "C5'" . DT  E 2 1   ? 33.723 24.972  70.430  1.00 66.26  ? 116  DT  Y "C5'" 1 
ATOM   1839  C  "C4'" . DT  E 2 1   ? 34.342 26.310  70.805  1.00 67.73  ? 116  DT  Y "C4'" 1 
ATOM   1840  O  "O4'" . DT  E 2 1   ? 35.774 26.076  70.821  1.00 68.48  ? 116  DT  Y "O4'" 1 
ATOM   1841  C  "C3'" . DT  E 2 1   ? 34.125 27.477  69.821  1.00 72.88  ? 116  DT  Y "C3'" 1 
ATOM   1842  O  "O3'" . DT  E 2 1   ? 34.087 28.769  70.464  1.00 76.62  ? 116  DT  Y "O3'" 1 
ATOM   1843  C  "C2'" . DT  E 2 1   ? 35.349 27.433  68.929  1.00 69.24  ? 116  DT  Y "C2'" 1 
ATOM   1844  C  "C1'" . DT  E 2 1   ? 36.430 26.881  69.843  1.00 67.04  ? 116  DT  Y "C1'" 1 
ATOM   1845  N  N1    . DT  E 2 1   ? 37.389 26.033  69.089  1.00 63.88  ? 116  DT  Y N1    1 
ATOM   1846  C  C2    . DT  E 2 1   ? 38.689 25.905  69.538  1.00 61.52  ? 116  DT  Y C2    1 
ATOM   1847  O  O2    . DT  E 2 1   ? 39.087 26.375  70.597  1.00 61.08  ? 116  DT  Y O2    1 
ATOM   1848  N  N3    . DT  E 2 1   ? 39.513 25.196  68.691  1.00 60.17  ? 116  DT  Y N3    1 
ATOM   1849  C  C4    . DT  E 2 1   ? 39.179 24.614  67.479  1.00 60.69  ? 116  DT  Y C4    1 
ATOM   1850  O  O4    . DT  E 2 1   ? 40.042 24.062  66.801  1.00 59.63  ? 116  DT  Y O4    1 
ATOM   1851  C  C5    . DT  E 2 1   ? 37.791 24.738  67.100  1.00 62.21  ? 116  DT  Y C5    1 
ATOM   1852  C  C7    . DT  E 2 1   ? 37.324 24.115  65.818  1.00 63.03  ? 116  DT  Y C7    1 
ATOM   1853  C  C6    . DT  E 2 1   ? 36.976 25.423  67.918  1.00 63.31  ? 116  DT  Y C6    1 
ATOM   1854  P  P     . DG  E 2 2   ? 33.493 30.097  69.701  0.50 78.36  ? 117  DG  Y P     1 
ATOM   1855  O  OP1   . DG  E 2 2   ? 33.188 31.147  70.698  0.50 76.61  ? 117  DG  Y OP1   1 
ATOM   1856  O  OP2   . DG  E 2 2   ? 32.530 29.715  68.637  0.50 77.51  ? 117  DG  Y OP2   1 
ATOM   1857  O  "O5'" . DG  E 2 2   ? 34.689 30.745  68.778  0.50 81.56  ? 117  DG  Y "O5'" 1 
ATOM   1858  C  "C5'" . DG  E 2 2   ? 34.368 31.619  67.623  0.50 88.96  ? 117  DG  Y "C5'" 1 
ATOM   1859  C  "C4'" . DG  E 2 2   ? 35.417 32.769  67.407  0.50 93.78  ? 117  DG  Y "C4'" 1 
ATOM   1860  O  "O4'" . DG  E 2 2   ? 36.752 32.174  67.369  0.50 95.61  ? 117  DG  Y "O4'" 1 
ATOM   1861  C  "C3'" . DG  E 2 2   ? 35.451 33.566  66.081  0.50 96.35  ? 117  DG  Y "C3'" 1 
ATOM   1862  O  "O3'" . DG  E 2 2   ? 36.095 34.859  66.141  0.50 98.09  ? 117  DG  Y "O3'" 1 
ATOM   1863  C  "C2'" . DG  E 2 2   ? 36.185 32.689  65.124  0.50 96.77  ? 117  DG  Y "C2'" 1 
ATOM   1864  C  "C1'" . DG  E 2 2   ? 37.305 32.233  66.051  0.50 96.56  ? 117  DG  Y "C1'" 1 
ATOM   1865  N  N9    . DG  E 2 2   ? 38.003 30.958  65.801  0.50 96.36  ? 117  DG  Y N9    1 
ATOM   1866  C  C8    . DG  E 2 2   ? 37.461 29.776  65.371  0.50 95.67  ? 117  DG  Y C8    1 
ATOM   1867  N  N7    . DG  E 2 2   ? 38.348 28.816  65.280  0.50 95.12  ? 117  DG  Y N7    1 
ATOM   1868  C  C5    . DG  E 2 2   ? 39.542 29.438  65.688  0.50 95.84  ? 117  DG  Y C5    1 
ATOM   1869  C  C6    . DG  E 2 2   ? 40.836 28.907  65.827  0.50 95.84  ? 117  DG  Y C6    1 
ATOM   1870  O  O6    . DG  E 2 2   ? 41.207 27.747  65.649  0.50 95.14  ? 117  DG  Y O6    1 
ATOM   1871  N  N1    . DG  E 2 2   ? 41.748 29.885  66.219  0.50 97.40  ? 117  DG  Y N1    1 
ATOM   1872  C  C2    . DG  E 2 2   ? 41.442 31.215  66.442  0.50 98.17  ? 117  DG  Y C2    1 
ATOM   1873  N  N2    . DG  E 2 2   ? 42.474 31.964  66.788  0.50 98.83  ? 117  DG  Y N2    1 
ATOM   1874  N  N3    . DG  E 2 2   ? 40.240 31.729  66.322  0.50 97.67  ? 117  DG  Y N3    1 
ATOM   1875  C  C4    . DG  E 2 2   ? 39.344 30.759  65.964  0.50 96.55  ? 117  DG  Y C4    1 
ATOM   1876  P  P     . DT  E 2 3   ? 35.922 35.944  64.964  0.50 98.50  ? 118  DT  Y P     1 
ATOM   1877  O  OP1   . DT  E 2 3   ? 36.194 37.307  65.482  0.50 98.87  ? 118  DT  Y OP1   1 
ATOM   1878  O  OP2   . DT  E 2 3   ? 34.659 35.703  64.221  0.50 98.95  ? 118  DT  Y OP2   1 
ATOM   1879  O  "O5'" . DT  E 2 3   ? 37.058 35.607  63.883  0.50 99.11  ? 118  DT  Y "O5'" 1 
ATOM   1880  C  "C5'" . DT  E 2 3   ? 38.384 36.175  64.053  0.50 99.93  ? 118  DT  Y "C5'" 1 
ATOM   1881  C  "C4'" . DT  E 2 3   ? 39.058 36.727  62.745  0.50 100.29 ? 118  DT  Y "C4'" 1 
ATOM   1882  O  "O4'" . DT  E 2 3   ? 39.995 35.714  62.223  0.50 100.20 ? 118  DT  Y "O4'" 1 
ATOM   1883  C  "C3'" . DT  E 2 3   ? 38.204 36.940  61.474  0.50 100.17 ? 118  DT  Y "C3'" 1 
ATOM   1884  O  "O3'" . DT  E 2 3   ? 38.782 37.877  60.575  0.50 100.38 ? 118  DT  Y "O3'" 1 
ATOM   1885  C  "C2'" . DT  E 2 3   ? 38.050 35.573  60.815  0.50 99.46  ? 118  DT  Y "C2'" 1 
ATOM   1886  C  "C1'" . DT  E 2 3   ? 39.431 34.970  61.115  0.50 99.27  ? 118  DT  Y "C1'" 1 
ATOM   1887  N  N1    . DT  E 2 3   ? 39.355 33.524  61.494  0.50 98.68  ? 118  DT  Y N1    1 
ATOM   1888  C  C2    . DT  E 2 3   ? 40.509 32.776  61.551  0.50 98.57  ? 118  DT  Y C2    1 
ATOM   1889  O  O2    . DT  E 2 3   ? 41.640 33.152  61.269  0.50 98.98  ? 118  DT  Y O2    1 
ATOM   1890  N  N3    . DT  E 2 3   ? 40.286 31.485  61.971  0.50 97.88  ? 118  DT  Y N3    1 
ATOM   1891  C  C4    . DT  E 2 3   ? 39.073 30.913  62.334  0.50 97.51  ? 118  DT  Y C4    1 
ATOM   1892  O  O4    . DT  E 2 3   ? 39.061 29.737  62.711  0.50 96.11  ? 118  DT  Y O4    1 
ATOM   1893  C  C5    . DT  E 2 3   ? 37.925 31.787  62.236  0.50 97.79  ? 118  DT  Y C5    1 
ATOM   1894  C  C7    . DT  E 2 3   ? 36.512 31.297  62.612  0.50 98.05  ? 118  DT  Y C7    1 
ATOM   1895  C  C6    . DT  E 2 3   ? 38.090 33.038  61.817  0.50 98.16  ? 118  DT  Y C6    1 
ATOM   1896  P  P     . DA  E 2 4   ? 38.661 39.441  60.775  0.50 100.94 ? 119  DA  Y P     1 
ATOM   1897  O  OP1   . DA  E 2 4   ? 38.798 39.798  62.207  0.50 101.28 ? 119  DA  Y OP1   1 
ATOM   1898  O  OP2   . DA  E 2 4   ? 37.362 39.907  60.257  0.50 101.00 ? 119  DA  Y OP2   1 
ATOM   1899  O  "O5'" . DA  E 2 4   ? 39.929 39.892  59.865  0.50 100.90 ? 119  DA  Y "O5'" 1 
ATOM   1900  C  "C5'" . DA  E 2 4   ? 41.100 40.501  60.480  0.50 100.20 ? 119  DA  Y "C5'" 1 
ATOM   1901  C  "C4'" . DA  E 2 4   ? 42.473 39.822  60.086  0.50 100.33 ? 119  DA  Y "C4'" 1 
ATOM   1902  O  "O4'" . DA  E 2 4   ? 42.265 38.373  59.962  0.50 99.31  ? 119  DA  Y "O4'" 1 
ATOM   1903  C  "C3'" . DA  E 2 4   ? 43.119 40.160  58.741  0.50 101.07 ? 119  DA  Y "C3'" 1 
ATOM   1904  O  "O3'" . DA  E 2 4   ? 44.517 39.847  58.645  0.50 104.34 ? 119  DA  Y "O3'" 1 
ATOM   1905  C  "C2'" . DA  E 2 4   ? 42.563 39.220  57.712  0.50 98.87  ? 119  DA  Y "C2'" 1 
ATOM   1906  C  "C1'" . DA  E 2 4   ? 42.594 37.972  58.604  0.50 96.76  ? 119  DA  Y "C1'" 1 
ATOM   1907  N  N9    . DA  E 2 4   ? 41.671 36.891  58.285  0.50 92.79  ? 119  DA  Y N9    1 
ATOM   1908  C  C8    . DA  E 2 4   ? 40.362 37.023  58.009  0.50 91.49  ? 119  DA  Y C8    1 
ATOM   1909  N  N7    . DA  E 2 4   ? 39.773 35.881  57.803  0.50 89.61  ? 119  DA  Y N7    1 
ATOM   1910  C  C5    . DA  E 2 4   ? 40.778 34.934  57.948  0.50 88.46  ? 119  DA  Y C5    1 
ATOM   1911  C  C6    . DA  E 2 4   ? 40.761 33.535  57.870  0.50 86.83  ? 119  DA  Y C6    1 
ATOM   1912  N  N6    . DA  E 2 4   ? 39.637 32.832  57.648  0.50 85.57  ? 119  DA  Y N6    1 
ATOM   1913  N  N1    . DA  E 2 4   ? 41.937 32.882  58.007  0.50 85.98  ? 119  DA  Y N1    1 
ATOM   1914  C  C2    . DA  E 2 4   ? 43.041 33.603  58.240  0.50 86.76  ? 119  DA  Y C2    1 
ATOM   1915  N  N3    . DA  E 2 4   ? 43.180 34.927  58.361  0.50 88.17  ? 119  DA  Y N3    1 
ATOM   1916  C  C4    . DA  E 2 4   ? 41.966 35.543  58.228  0.50 89.78  ? 119  DA  Y C4    1 
ATOM   1917  P  P     . DT  E 2 5   ? 45.284 39.938  57.224  1.00 107.52 ? 120  DT  Y P     1 
ATOM   1918  O  OP1   . DT  E 2 5   ? 46.735 40.075  57.458  1.00 107.47 ? 120  DT  Y OP1   1 
ATOM   1919  O  OP2   . DT  E 2 5   ? 44.615 40.910  56.341  1.00 108.07 ? 120  DT  Y OP2   1 
ATOM   1920  O  "O5'" . DT  E 2 5   ? 45.029 38.515  56.495  1.00 105.83 ? 120  DT  Y "O5'" 1 
ATOM   1921  C  "C5'" . DT  E 2 5   ? 45.834 37.360  56.882  1.00 100.92 ? 120  DT  Y "C5'" 1 
ATOM   1922  C  "C4'" . DT  E 2 5   ? 46.139 36.386  55.706  1.00 97.25  ? 120  DT  Y "C4'" 1 
ATOM   1923  O  "O4'" . DT  E 2 5   ? 44.876 35.774  55.265  1.00 95.14  ? 120  DT  Y "O4'" 1 
ATOM   1924  C  "C3'" . DT  E 2 5   ? 46.701 36.972  54.412  1.00 94.90  ? 120  DT  Y "C3'" 1 
ATOM   1925  O  "O3'" . DT  E 2 5   ? 47.567 36.040  53.795  1.00 92.04  ? 120  DT  Y "O3'" 1 
ATOM   1926  C  "C2'" . DT  E 2 5   ? 45.496 37.290  53.552  1.00 92.69  ? 120  DT  Y "C2'" 1 
ATOM   1927  C  "C1'" . DT  E 2 5   ? 44.602 36.089  53.894  1.00 90.69  ? 120  DT  Y "C1'" 1 
ATOM   1928  N  N1    . DT  E 2 5   ? 43.143 36.175  53.751  1.00 86.41  ? 120  DT  Y N1    1 
ATOM   1929  C  C2    . DT  E 2 5   ? 42.388 35.120  54.232  1.00 84.63  ? 120  DT  Y C2    1 
ATOM   1930  O  O2    . DT  E 2 5   ? 42.875 34.115  54.721  1.00 84.31  ? 120  DT  Y O2    1 
ATOM   1931  N  N3    . DT  E 2 5   ? 41.035 35.280  54.119  1.00 83.79  ? 120  DT  Y N3    1 
ATOM   1932  C  C4    . DT  E 2 5   ? 40.363 36.359  53.579  1.00 83.91  ? 120  DT  Y C4    1 
ATOM   1933  O  O4    . DT  E 2 5   ? 39.120 36.375  53.580  1.00 82.75  ? 120  DT  Y O4    1 
ATOM   1934  C  C5    . DT  E 2 5   ? 41.219 37.386  53.052  1.00 84.50  ? 120  DT  Y C5    1 
ATOM   1935  C  C7    . DT  E 2 5   ? 40.580 38.631  52.394  1.00 83.74  ? 120  DT  Y C7    1 
ATOM   1936  C  C6    . DT  E 2 5   ? 42.552 37.276  53.142  1.00 84.68  ? 120  DT  Y C6    1 
ATOM   1937  P  P     . DG  E 2 6   ? 49.094 35.822  54.212  1.00 89.99  ? 121  DG  Y P     1 
ATOM   1938  O  OP1   . DG  E 2 6   ? 49.316 35.851  55.695  1.00 89.01  ? 121  DG  Y OP1   1 
ATOM   1939  O  OP2   . DG  E 2 6   ? 49.960 36.639  53.312  1.00 88.93  ? 121  DG  Y OP2   1 
ATOM   1940  O  "O5'" . DG  E 2 6   ? 49.185 34.292  53.774  1.00 86.42  ? 121  DG  Y "O5'" 1 
ATOM   1941  C  "C5'" . DG  E 2 6   ? 48.473 33.292  54.510  1.00 80.74  ? 121  DG  Y "C5'" 1 
ATOM   1942  C  "C4'" . DG  E 2 6   ? 47.740 32.345  53.582  1.00 76.01  ? 121  DG  Y "C4'" 1 
ATOM   1943  O  "O4'" . DG  E 2 6   ? 46.451 32.849  53.145  1.00 74.11  ? 121  DG  Y "O4'" 1 
ATOM   1944  C  "C3'" . DG  E 2 6   ? 48.492 31.939  52.314  1.00 73.79  ? 121  DG  Y "C3'" 1 
ATOM   1945  O  "O3'" . DG  E 2 6   ? 48.416 30.530  52.142  1.00 69.64  ? 121  DG  Y "O3'" 1 
ATOM   1946  C  "C2'" . DG  E 2 6   ? 47.709 32.611  51.197  1.00 73.11  ? 121  DG  Y "C2'" 1 
ATOM   1947  C  "C1'" . DG  E 2 6   ? 46.300 32.567  51.755  1.00 72.00  ? 121  DG  Y "C1'" 1 
ATOM   1948  N  N9    . DG  E 2 6   ? 45.372 33.542  51.190  1.00 68.78  ? 121  DG  Y N9    1 
ATOM   1949  C  C8    . DG  E 2 6   ? 45.650 34.830  50.798  1.00 67.40  ? 121  DG  Y C8    1 
ATOM   1950  N  N7    . DG  E 2 6   ? 44.592 35.486  50.401  1.00 65.46  ? 121  DG  Y N7    1 
ATOM   1951  C  C5    . DG  E 2 6   ? 43.553 34.571  50.523  1.00 64.58  ? 121  DG  Y C5    1 
ATOM   1952  C  C6    . DG  E 2 6   ? 42.151 34.718  50.272  1.00 63.23  ? 121  DG  Y C6    1 
ATOM   1953  O  O6    . DG  E 2 6   ? 41.520 35.732  49.902  1.00 60.69  ? 121  DG  Y O6    1 
ATOM   1954  N  N1    . DG  E 2 6   ? 41.472 33.530  50.513  1.00 62.73  ? 121  DG  Y N1    1 
ATOM   1955  C  C2    . DG  E 2 6   ? 42.049 32.361  50.952  1.00 63.37  ? 121  DG  Y C2    1 
ATOM   1956  N  N2    . DG  E 2 6   ? 41.221 31.323  51.105  1.00 63.57  ? 121  DG  Y N2    1 
ATOM   1957  N  N3    . DG  E 2 6   ? 43.338 32.220  51.216  1.00 64.10  ? 121  DG  Y N3    1 
ATOM   1958  C  C4    . DG  E 2 6   ? 44.025 33.356  50.981  1.00 66.00  ? 121  DG  Y C4    1 
ATOM   1959  P  P     . DC  E 2 7   ? 49.437 29.815  51.151  1.00 66.62  ? 122  DC  Y P     1 
ATOM   1960  O  OP1   . DC  E 2 7   ? 50.111 28.699  51.881  1.00 65.88  ? 122  DC  Y OP1   1 
ATOM   1961  O  OP2   . DC  E 2 7   ? 50.241 30.896  50.520  1.00 65.13  ? 122  DC  Y OP2   1 
ATOM   1962  O  "O5'" . DC  E 2 7   ? 48.487 29.185  50.052  1.00 63.24  ? 122  DC  Y "O5'" 1 
ATOM   1963  C  "C5'" . DC  E 2 7   ? 48.185 27.801  50.081  1.00 55.59  ? 122  DC  Y "C5'" 1 
ATOM   1964  C  "C4'" . DC  E 2 7   ? 46.692 27.599  50.125  1.00 49.90  ? 122  DC  Y "C4'" 1 
ATOM   1965  O  "O4'" . DC  E 2 7   ? 46.005 28.863  49.997  1.00 47.13  ? 122  DC  Y "O4'" 1 
ATOM   1966  C  "C3'" . DC  E 2 7   ? 46.161 26.723  48.997  1.00 47.25  ? 122  DC  Y "C3'" 1 
ATOM   1967  O  "O3'" . DC  E 2 7   ? 45.222 25.813  49.496  1.00 46.81  ? 122  DC  Y "O3'" 1 
ATOM   1968  C  "C2'" . DC  E 2 7   ? 45.416 27.687  48.106  1.00 45.50  ? 122  DC  Y "C2'" 1 
ATOM   1969  C  "C1'" . DC  E 2 7   ? 44.930 28.688  49.109  1.00 43.62  ? 122  DC  Y "C1'" 1 
ATOM   1970  N  N1    . DC  E 2 7   ? 44.582 29.988  48.539  1.00 41.63  ? 122  DC  Y N1    1 
ATOM   1971  C  C2    . DC  E 2 7   ? 43.250 30.215  48.210  1.00 41.66  ? 122  DC  Y C2    1 
ATOM   1972  O  O2    . DC  E 2 7   ? 42.428 29.301  48.409  1.00 42.96  ? 122  DC  Y O2    1 
ATOM   1973  N  N3    . DC  E 2 7   ? 42.884 31.409  47.686  1.00 38.67  ? 122  DC  Y N3    1 
ATOM   1974  C  C4    . DC  E 2 7   ? 43.799 32.351  47.494  1.00 37.44  ? 122  DC  Y C4    1 
ATOM   1975  N  N4    . DC  E 2 7   ? 43.391 33.512  46.996  1.00 35.84  ? 122  DC  Y N4    1 
ATOM   1976  C  C5    . DC  E 2 7   ? 45.172 32.144  47.813  1.00 38.16  ? 122  DC  Y C5    1 
ATOM   1977  C  C6    . DC  E 2 7   ? 45.518 30.957  48.332  1.00 38.84  ? 122  DC  Y C6    1 
ATOM   1978  P  P     . DT  E 2 8   ? 45.056 24.406  48.772  1.00 47.86  ? 123  DT  Y P     1 
ATOM   1979  O  OP1   . DT  E 2 8   ? 45.172 23.340  49.805  1.00 47.32  ? 123  DT  Y OP1   1 
ATOM   1980  O  OP2   . DT  E 2 8   ? 45.970 24.411  47.593  1.00 46.84  ? 123  DT  Y OP2   1 
ATOM   1981  O  "O5'" . DT  E 2 8   ? 43.563 24.437  48.239  1.00 47.03  ? 123  DT  Y "O5'" 1 
ATOM   1982  C  "C5'" . DT  E 2 8   ? 42.986 25.647  47.782  1.00 44.51  ? 123  DT  Y "C5'" 1 
ATOM   1983  C  "C4'" . DT  E 2 8   ? 41.575 25.390  47.323  1.00 43.28  ? 123  DT  Y "C4'" 1 
ATOM   1984  O  "O4'" . DT  E 2 8   ? 41.002 26.648  46.921  1.00 42.48  ? 123  DT  Y "O4'" 1 
ATOM   1985  C  "C3'" . DT  E 2 8   ? 41.497 24.493  46.099  1.00 42.76  ? 123  DT  Y "C3'" 1 
ATOM   1986  O  "O3'" . DT  E 2 8   ? 40.253 23.781  46.111  1.00 44.66  ? 123  DT  Y "O3'" 1 
ATOM   1987  C  "C2'" . DT  E 2 8   ? 41.621 25.486  44.963  1.00 40.72  ? 123  DT  Y "C2'" 1 
ATOM   1988  C  "C1'" . DT  E 2 8   ? 40.974 26.747  45.512  1.00 38.80  ? 123  DT  Y "C1'" 1 
ATOM   1989  N  N1    . DT  E 2 8   ? 41.653 28.004  45.151  1.00 34.95  ? 123  DT  Y N1    1 
ATOM   1990  C  C2    . DT  E 2 8   ? 40.857 29.054  44.772  1.00 34.26  ? 123  DT  Y C2    1 
ATOM   1991  O  O2    . DT  E 2 8   ? 39.650 28.966  44.694  1.00 36.49  ? 123  DT  Y O2    1 
ATOM   1992  N  N3    . DT  E 2 8   ? 41.520 30.214  44.482  1.00 31.29  ? 123  DT  Y N3    1 
ATOM   1993  C  C4    . DT  E 2 8   ? 42.871 30.418  44.518  1.00 30.48  ? 123  DT  Y C4    1 
ATOM   1994  O  O4    . DT  E 2 8   ? 43.331 31.523  44.230  1.00 28.79  ? 123  DT  Y O4    1 
ATOM   1995  C  C5    . DT  E 2 8   ? 43.653 29.265  44.905  1.00 30.68  ? 123  DT  Y C5    1 
ATOM   1996  C  C7    . DT  E 2 8   ? 45.140 29.397  44.950  1.00 31.84  ? 123  DT  Y C7    1 
ATOM   1997  C  C6    . DT  E 2 8   ? 43.014 28.128  45.202  1.00 30.83  ? 123  DT  Y C6    1 
ATOM   1998  P  P     . DA  E 2 9   ? 39.852 22.814  44.883  1.00 47.70  ? 124  DA  Y P     1 
ATOM   1999  O  OP1   . DA  E 2 9   ? 39.014 21.703  45.398  1.00 47.07  ? 124  DA  Y OP1   1 
ATOM   2000  O  OP2   . DA  E 2 9   ? 41.062 22.487  44.089  1.00 46.85  ? 124  DA  Y OP2   1 
ATOM   2001  O  "O5'" . DA  E 2 9   ? 38.894 23.753  44.025  1.00 47.11  ? 124  DA  Y "O5'" 1 
ATOM   2002  C  "C5'" . DA  E 2 9   ? 37.762 24.360  44.647  1.00 45.98  ? 124  DA  Y "C5'" 1 
ATOM   2003  C  "C4'" . DA  E 2 9   ? 37.058 25.299  43.693  1.00 44.80  ? 124  DA  Y "C4'" 1 
ATOM   2004  O  "O4'" . DA  E 2 9   ? 37.820 26.525  43.534  1.00 42.40  ? 124  DA  Y "O4'" 1 
ATOM   2005  C  "C3'" . DA  E 2 9   ? 36.781 24.761  42.286  1.00 44.88  ? 124  DA  Y "C3'" 1 
ATOM   2006  O  "O3'" . DA  E 2 9   ? 35.422 25.036  41.891  1.00 45.89  ? 124  DA  Y "O3'" 1 
ATOM   2007  C  "C2'" . DA  E 2 9   ? 37.763 25.538  41.429  1.00 43.27  ? 124  DA  Y "C2'" 1 
ATOM   2008  C  "C1'" . DA  E 2 9   ? 37.917 26.860  42.171  1.00 39.61  ? 124  DA  Y "C1'" 1 
ATOM   2009  N  N9    . DA  E 2 9   ? 39.217 27.494  41.953  1.00 35.83  ? 124  DA  Y N9    1 
ATOM   2010  C  C8    . DA  E 2 9   ? 40.465 26.961  42.173  1.00 34.08  ? 124  DA  Y C8    1 
ATOM   2011  N  N7    . DA  E 2 9   ? 41.450 27.756  41.834  1.00 32.10  ? 124  DA  Y N7    1 
ATOM   2012  C  C5    . DA  E 2 9   ? 40.809 28.892  41.368  1.00 32.87  ? 124  DA  Y C5    1 
ATOM   2013  C  C6    . DA  E 2 9   ? 41.301 30.111  40.851  1.00 33.69  ? 124  DA  Y C6    1 
ATOM   2014  N  N6    . DA  E 2 9   ? 42.602 30.392  40.719  1.00 32.97  ? 124  DA  Y N6    1 
ATOM   2015  N  N1    . DA  E 2 9   ? 40.395 31.042  40.473  1.00 33.21  ? 124  DA  Y N1    1 
ATOM   2016  C  C2    . DA  E 2 9   ? 39.085 30.754  40.622  1.00 34.42  ? 124  DA  Y C2    1 
ATOM   2017  N  N3    . DA  E 2 9   ? 38.504 29.645  41.100  1.00 32.11  ? 124  DA  Y N3    1 
ATOM   2018  C  C4    . DA  E 2 9   ? 39.433 28.748  41.450  1.00 33.10  ? 124  DA  Y C4    1 
ATOM   2019  P  P     . DT  E 2 10  ? 34.784 24.314  40.590  1.00 46.50  ? 125  DT  Y P     1 
ATOM   2020  O  OP1   . DT  E 2 10  ? 33.514 23.645  40.986  1.00 44.03  ? 125  DT  Y OP1   1 
ATOM   2021  O  OP2   . DT  E 2 10  ? 35.861 23.532  39.893  1.00 44.72  ? 125  DT  Y OP2   1 
ATOM   2022  O  "O5'" . DT  E 2 10  ? 34.345 25.547  39.683  1.00 44.34  ? 125  DT  Y "O5'" 1 
ATOM   2023  C  "C5'" . DT  E 2 10  ? 33.379 26.482  40.154  1.00 41.60  ? 125  DT  Y "C5'" 1 
ATOM   2024  C  "C4'" . DT  E 2 10  ? 33.603 27.830  39.512  1.00 40.42  ? 125  DT  Y "C4'" 1 
ATOM   2025  O  "O4'" . DT  E 2 10  ? 35.009 28.144  39.540  1.00 39.39  ? 125  DT  Y "O4'" 1 
ATOM   2026  C  "C3'" . DT  E 2 10  ? 33.210 27.962  38.045  1.00 41.50  ? 125  DT  Y "C3'" 1 
ATOM   2027  O  "O3'" . DT  E 2 10  ? 32.711 29.265  37.840  1.00 44.36  ? 125  DT  Y "O3'" 1 
ATOM   2028  C  "C2'" . DT  E 2 10  ? 34.534 27.919  37.317  1.00 40.65  ? 125  DT  Y "C2'" 1 
ATOM   2029  C  "C1'" . DT  E 2 10  ? 35.359 28.685  38.292  1.00 37.68  ? 125  DT  Y "C1'" 1 
ATOM   2030  N  N1    . DT  E 2 10  ? 36.803 28.577  38.124  1.00 36.08  ? 125  DT  Y N1    1 
ATOM   2031  C  C2    . DT  E 2 10  ? 37.442 29.698  37.687  1.00 36.51  ? 125  DT  Y C2    1 
ATOM   2032  O  O2    . DT  E 2 10  ? 36.859 30.730  37.452  1.00 40.21  ? 125  DT  Y O2    1 
ATOM   2033  N  N3    . DT  E 2 10  ? 38.785 29.582  37.549  1.00 35.78  ? 125  DT  Y N3    1 
ATOM   2034  C  C4    . DT  E 2 10  ? 39.543 28.477  37.819  1.00 36.01  ? 125  DT  Y C4    1 
ATOM   2035  O  O4    . DT  E 2 10  ? 40.760 28.523  37.665  1.00 37.36  ? 125  DT  Y O4    1 
ATOM   2036  C  C5    . DT  E 2 10  ? 38.810 27.324  38.278  1.00 35.12  ? 125  DT  Y C5    1 
ATOM   2037  C  C7    . DT  E 2 10  ? 39.564 26.072  38.592  1.00 34.79  ? 125  DT  Y C7    1 
ATOM   2038  C  C6    . DT  E 2 10  ? 37.486 27.427  38.399  1.00 34.15  ? 125  DT  Y C6    1 
ATOM   2039  P  P     . DA  E 2 11  ? 31.647 29.524  36.686  1.00 48.93  ? 126  DA  Y P     1 
ATOM   2040  O  OP1   . DA  E 2 11  ? 30.358 29.790  37.358  1.00 48.52  ? 126  DA  Y OP1   1 
ATOM   2041  O  OP2   . DA  E 2 11  ? 31.749 28.445  35.668  1.00 48.31  ? 126  DA  Y OP2   1 
ATOM   2042  O  "O5'" . DA  E 2 11  ? 32.146 30.870  36.032  1.00 46.55  ? 126  DA  Y "O5'" 1 
ATOM   2043  C  "C5'" . DA  E 2 11  ? 33.508 31.067  35.808  1.00 45.26  ? 126  DA  Y "C5'" 1 
ATOM   2044  C  "C4'" . DA  E 2 11  ? 33.693 32.225  34.870  1.00 46.06  ? 126  DA  Y "C4'" 1 
ATOM   2045  O  "O4'" . DA  E 2 11  ? 35.093 32.342  34.617  1.00 44.67  ? 126  DA  Y "O4'" 1 
ATOM   2046  C  "C3'" . DA  E 2 11  ? 33.070 31.987  33.509  1.00 47.98  ? 126  DA  Y "C3'" 1 
ATOM   2047  O  "O3'" . DA  E 2 11  ? 32.831 33.249  32.880  1.00 51.67  ? 126  DA  Y "O3'" 1 
ATOM   2048  C  "C2'" . DA  E 2 11  ? 34.134 31.178  32.799  1.00 45.78  ? 126  DA  Y "C2'" 1 
ATOM   2049  C  "C1'" . DA  E 2 11  ? 35.432 31.681  33.417  1.00 42.26  ? 126  DA  Y "C1'" 1 
ATOM   2050  N  N9    . DA  E 2 11  ? 36.378 30.633  33.783  1.00 38.97  ? 126  DA  Y N9    1 
ATOM   2051  C  C8    . DA  E 2 11  ? 36.138 29.432  34.407  1.00 38.29  ? 126  DA  Y C8    1 
ATOM   2052  N  N7    . DA  E 2 11  ? 37.223 28.739  34.641  1.00 37.68  ? 126  DA  Y N7    1 
ATOM   2053  C  C5    . DA  E 2 11  ? 38.241 29.536  34.130  1.00 37.44  ? 126  DA  Y C5    1 
ATOM   2054  C  C6    . DA  E 2 11  ? 39.634 29.372  34.075  1.00 38.32  ? 126  DA  Y C6    1 
ATOM   2055  N  N6    . DA  E 2 11  ? 40.267 28.296  34.536  1.00 40.72  ? 126  DA  Y N6    1 
ATOM   2056  N  N1    . DA  E 2 11  ? 40.364 30.356  33.512  1.00 38.11  ? 126  DA  Y N1    1 
ATOM   2057  C  C2    . DA  E 2 11  ? 39.721 31.418  33.013  1.00 37.58  ? 126  DA  Y C2    1 
ATOM   2058  N  N3    . DA  E 2 11  ? 38.416 31.682  32.994  1.00 35.58  ? 126  DA  Y N3    1 
ATOM   2059  C  C4    . DA  E 2 11  ? 37.729 30.692  33.584  1.00 36.93  ? 126  DA  Y C4    1 
ATOM   2060  P  P     . DC  E 2 12  ? 32.023 33.309  31.501  1.00 55.41  ? 127  DC  Y P     1 
ATOM   2061  O  OP1   . DC  E 2 12  ? 31.538 34.705  31.330  1.00 53.49  ? 127  DC  Y OP1   1 
ATOM   2062  O  OP2   . DC  E 2 12  ? 31.044 32.188  31.491  1.00 55.40  ? 127  DC  Y OP2   1 
ATOM   2063  O  "O5'" . DC  E 2 12  ? 33.158 32.978  30.430  1.00 55.90  ? 127  DC  Y "O5'" 1 
ATOM   2064  C  "C5'" . DC  E 2 12  ? 34.256 33.868  30.246  1.00 57.48  ? 127  DC  Y "C5'" 1 
ATOM   2065  C  "C4'" . DC  E 2 12  ? 35.205 33.347  29.188  1.00 58.48  ? 127  DC  Y "C4'" 1 
ATOM   2066  O  "O4'" . DC  E 2 12  ? 36.227 32.458  29.718  1.00 56.75  ? 127  DC  Y "O4'" 1 
ATOM   2067  C  "C3'" . DC  E 2 12  ? 34.568 32.612  28.011  1.00 60.14  ? 127  DC  Y "C3'" 1 
ATOM   2068  O  "O3'" . DC  E 2 12  ? 35.209 33.048  26.804  1.00 65.74  ? 127  DC  Y "O3'" 1 
ATOM   2069  C  "C2'" . DC  E 2 12  ? 34.943 31.164  28.289  1.00 57.50  ? 127  DC  Y "C2'" 1 
ATOM   2070  C  "C1'" . DC  E 2 12  ? 36.334 31.331  28.876  1.00 53.01  ? 127  DC  Y "C1'" 1 
ATOM   2071  N  N1    . DC  E 2 12  ? 36.890 30.208  29.658  1.00 48.38  ? 127  DC  Y N1    1 
ATOM   2072  C  C2    . DC  E 2 12  ? 38.268 30.157  29.841  1.00 47.38  ? 127  DC  Y C2    1 
ATOM   2073  O  O2    . DC  E 2 12  ? 38.954 31.066  29.370  1.00 48.25  ? 127  DC  Y O2    1 
ATOM   2074  N  N3    . DC  E 2 12  ? 38.818 29.127  30.523  1.00 44.97  ? 127  DC  Y N3    1 
ATOM   2075  C  C4    . DC  E 2 12  ? 38.032 28.171  31.017  1.00 45.65  ? 127  DC  Y C4    1 
ATOM   2076  N  N4    . DC  E 2 12  ? 38.606 27.173  31.670  1.00 46.99  ? 127  DC  Y N4    1 
ATOM   2077  C  C5    . DC  E 2 12  ? 36.618 28.198  30.858  1.00 45.16  ? 127  DC  Y C5    1 
ATOM   2078  C  C6    . DC  E 2 12  ? 36.093 29.230  30.180  1.00 46.30  ? 127  DC  Y C6    1 
ATOM   2079  P  P     . DG  E 2 13  ? 34.330 33.395  25.501  1.00 69.38  ? 128  DG  Y P     1 
ATOM   2080  O  OP1   . DG  E 2 13  ? 33.566 34.647  25.779  1.00 69.29  ? 128  DG  Y OP1   1 
ATOM   2081  O  OP2   . DG  E 2 13  ? 33.600 32.152  25.099  1.00 68.01  ? 128  DG  Y OP2   1 
ATOM   2082  O  "O5'" . DG  E 2 13  ? 35.442 33.725  24.404  1.00 68.31  ? 128  DG  Y "O5'" 1 
ATOM   2083  C  "C5'" . DG  E 2 13  ? 36.346 34.821  24.572  1.00 66.93  ? 128  DG  Y "C5'" 1 
ATOM   2084  C  "C4'" . DG  E 2 13  ? 37.702 34.459  24.012  1.00 66.69  ? 128  DG  Y "C4'" 1 
ATOM   2085  O  "O4'" . DG  E 2 13  ? 38.315 33.444  24.846  1.00 63.06  ? 128  DG  Y "O4'" 1 
ATOM   2086  C  "C3'" . DG  E 2 13  ? 37.632 33.862  22.608  1.00 68.96  ? 128  DG  Y "C3'" 1 
ATOM   2087  O  "O3'" . DG  E 2 13  ? 38.724 34.291  21.781  1.00 74.52  ? 128  DG  Y "O3'" 1 
ATOM   2088  C  "C2'" . DG  E 2 13  ? 37.712 32.367  22.852  1.00 64.70  ? 128  DG  Y "C2'" 1 
ATOM   2089  C  "C1'" . DG  E 2 13  ? 38.539 32.242  24.120  1.00 59.00  ? 128  DG  Y "C1'" 1 
ATOM   2090  N  N9    . DG  E 2 13  ? 38.046 31.135  24.932  1.00 53.53  ? 128  DG  Y N9    1 
ATOM   2091  C  C8    . DG  E 2 13  ? 36.719 30.873  25.175  1.00 52.08  ? 128  DG  Y C8    1 
ATOM   2092  N  N7    . DG  E 2 13  ? 36.528 29.809  25.906  1.00 50.53  ? 128  DG  Y N7    1 
ATOM   2093  C  C5    . DG  E 2 13  ? 37.806 29.333  26.170  1.00 48.15  ? 128  DG  Y C5    1 
ATOM   2094  C  C6    . DG  E 2 13  ? 38.213 28.205  26.912  1.00 46.39  ? 128  DG  Y C6    1 
ATOM   2095  O  O6    . DG  E 2 13  ? 37.502 27.374  27.471  1.00 46.13  ? 128  DG  Y O6    1 
ATOM   2096  N  N1    . DG  E 2 13  ? 39.600 28.086  26.962  1.00 42.77  ? 128  DG  Y N1    1 
ATOM   2097  C  C2    . DG  E 2 13  ? 40.475 28.942  26.369  1.00 42.28  ? 128  DG  Y C2    1 
ATOM   2098  N  N2    . DG  E 2 13  ? 41.752 28.657  26.573  1.00 39.26  ? 128  DG  Y N2    1 
ATOM   2099  N  N3    . DG  E 2 13  ? 40.115 30.002  25.639  1.00 44.88  ? 128  DG  Y N3    1 
ATOM   2100  C  C4    . DG  E 2 13  ? 38.765 30.140  25.587  1.00 49.35  ? 128  DG  Y C4    1 
ATOM   2101  P  P     . DA  E 2 14  ? 38.887 33.667  20.308  1.00 76.66  ? 129  DA  Y P     1 
ATOM   2102  O  OP1   . DA  E 2 14  ? 39.751 34.562  19.486  1.00 76.54  ? 129  DA  Y OP1   1 
ATOM   2103  O  OP2   . DA  E 2 14  ? 37.508 33.320  19.844  1.00 76.90  ? 129  DA  Y OP2   1 
ATOM   2104  O  "O5'" . DA  E 2 14  ? 39.685 32.321  20.571  1.00 76.51  ? 129  DA  Y "O5'" 1 
ATOM   2105  C  "C5'" . DA  E 2 14  ? 40.936 32.366  21.224  1.00 78.60  ? 129  DA  Y "C5'" 1 
ATOM   2106  C  "C4'" . DA  E 2 14  ? 41.603 31.017  21.139  1.00 80.18  ? 129  DA  Y "C4'" 1 
ATOM   2107  O  "O4'" . DA  E 2 14  ? 41.115 30.105  22.159  1.00 79.37  ? 129  DA  Y "O4'" 1 
ATOM   2108  C  "C3'" . DA  E 2 14  ? 41.399 30.307  19.800  1.00 81.85  ? 129  DA  Y "C3'" 1 
ATOM   2109  O  "O3'" . DA  E 2 14  ? 42.641 29.696  19.440  1.00 84.90  ? 129  DA  Y "O3'" 1 
ATOM   2110  C  "C2'" . DA  E 2 14  ? 40.358 29.247  20.135  1.00 79.51  ? 129  DA  Y "C2'" 1 
ATOM   2111  C  "C1'" . DA  E 2 14  ? 40.797 28.872  21.540  1.00 76.74  ? 129  DA  Y "C1'" 1 
ATOM   2112  N  N9    . DA  E 2 14  ? 39.836 28.149  22.382  1.00 72.81  ? 129  DA  Y N9    1 
ATOM   2113  C  C8    . DA  E 2 14  ? 38.463 28.258  22.446  1.00 70.63  ? 129  DA  Y C8    1 
ATOM   2114  N  N7    . DA  E 2 14  ? 37.905 27.414  23.284  1.00 68.00  ? 129  DA  Y N7    1 
ATOM   2115  C  C5    . DA  E 2 14  ? 38.981 26.707  23.811  1.00 68.35  ? 129  DA  Y C5    1 
ATOM   2116  C  C6    . DA  E 2 14  ? 39.060 25.656  24.740  1.00 67.36  ? 129  DA  Y C6    1 
ATOM   2117  N  N6    . DA  E 2 14  ? 37.989 25.092  25.297  1.00 67.05  ? 129  DA  Y N6    1 
ATOM   2118  N  N1    . DA  E 2 14  ? 40.288 25.190  25.069  1.00 65.93  ? 129  DA  Y N1    1 
ATOM   2119  C  C2    . DA  E 2 14  ? 41.354 25.734  24.481  1.00 66.89  ? 129  DA  Y C2    1 
ATOM   2120  N  N3    . DA  E 2 14  ? 41.412 26.711  23.577  1.00 67.99  ? 129  DA  Y N3    1 
ATOM   2121  C  C4    . DA  E 2 14  ? 40.175 27.161  23.281  1.00 69.83  ? 129  DA  Y C4    1 
ATOM   2122  P  P     . DA  E 2 15  ? 42.982 29.392  17.898  1.00 87.27  ? 130  DA  Y P     1 
ATOM   2123  O  OP1   . DA  E 2 15  ? 43.958 30.427  17.446  1.00 86.19  ? 130  DA  Y OP1   1 
ATOM   2124  O  OP2   . DA  E 2 15  ? 41.704 29.199  17.139  1.00 86.18  ? 130  DA  Y OP2   1 
ATOM   2125  O  "O5'" . DA  E 2 15  ? 43.769 28.010  18.035  1.00 85.70  ? 130  DA  Y "O5'" 1 
ATOM   2126  C  "C5'" . DA  E 2 15  ? 44.843 27.904  18.973  1.00 83.23  ? 130  DA  Y "C5'" 1 
ATOM   2127  C  "C4'" . DA  E 2 15  ? 44.928 26.512  19.557  1.00 81.41  ? 130  DA  Y "C4'" 1 
ATOM   2128  O  "O4'" . DA  E 2 15  ? 43.756 26.211  20.355  1.00 80.10  ? 130  DA  Y "O4'" 1 
ATOM   2129  C  "C3'" . DA  E 2 15  ? 45.064 25.364  18.554  1.00 81.91  ? 130  DA  Y "C3'" 1 
ATOM   2130  O  "O3'" . DA  E 2 15  ? 46.091 24.467  18.980  1.00 84.26  ? 130  DA  Y "O3'" 1 
ATOM   2131  C  "C2'" . DA  E 2 15  ? 43.723 24.657  18.634  1.00 80.15  ? 130  DA  Y "C2'" 1 
ATOM   2132  C  "C1'" . DA  E 2 15  ? 43.342 24.882  20.081  1.00 76.99  ? 130  DA  Y "C1'" 1 
ATOM   2133  N  N9    . DA  E 2 15  ? 41.909 24.764  20.374  1.00 72.59  ? 130  DA  Y N9    1 
ATOM   2134  C  C8    . DA  E 2 15  ? 40.863 25.467  19.831  1.00 70.65  ? 130  DA  Y C8    1 
ATOM   2135  N  N7    . DA  E 2 15  ? 39.688 25.109  20.291  1.00 68.89  ? 130  DA  Y N7    1 
ATOM   2136  C  C5    . DA  E 2 15  ? 39.979 24.101  21.199  1.00 69.18  ? 130  DA  Y C5    1 
ATOM   2137  C  C6    . DA  E 2 15  ? 39.162 23.308  22.032  1.00 68.89  ? 130  DA  Y C6    1 
ATOM   2138  N  N6    . DA  E 2 15  ? 37.834 23.393  22.059  1.00 69.97  ? 130  DA  Y N6    1 
ATOM   2139  N  N1    . DA  E 2 15  ? 39.764 22.413  22.843  1.00 68.30  ? 130  DA  Y N1    1 
ATOM   2140  C  C2    . DA  E 2 15  ? 41.099 22.320  22.806  1.00 69.34  ? 130  DA  Y C2    1 
ATOM   2141  N  N3    . DA  E 2 15  ? 41.976 23.000  22.058  1.00 69.78  ? 130  DA  Y N3    1 
ATOM   2142  C  C4    . DA  E 2 15  ? 41.343 23.886  21.268  1.00 70.15  ? 130  DA  Y C4    1 
ATOM   2143  P  P     . DG  E 2 16  ? 46.790 23.481  17.912  1.00 86.23  ? 131  DG  Y P     1 
ATOM   2144  O  OP1   . DG  E 2 16  ? 48.161 23.970  17.581  1.00 85.67  ? 131  DG  Y OP1   1 
ATOM   2145  O  OP2   . DG  E 2 16  ? 45.805 23.233  16.812  1.00 84.74  ? 131  DG  Y OP2   1 
ATOM   2146  O  "O5'" . DG  E 2 16  ? 46.984 22.150  18.756  1.00 84.24  ? 131  DG  Y "O5'" 1 
ATOM   2147  C  "C5'" . DG  E 2 16  ? 46.490 20.922  18.266  1.00 81.86  ? 131  DG  Y "C5'" 1 
ATOM   2148  C  "C4'" . DG  E 2 16  ? 45.723 20.193  19.341  1.00 78.58  ? 131  DG  Y "C4'" 1 
ATOM   2149  O  "O4'" . DG  E 2 16  ? 44.485 20.886  19.655  1.00 75.24  ? 131  DG  Y "O4'" 1 
ATOM   2150  C  "C3'" . DG  E 2 16  ? 45.302 18.808  18.859  1.00 78.95  ? 131  DG  Y "C3'" 1 
ATOM   2151  O  "O3'" . DG  E 2 16  ? 45.560 17.823  19.840  1.00 81.96  ? 131  DG  Y "O3'" 1 
ATOM   2152  C  "C2'" . DG  E 2 16  ? 43.812 18.930  18.631  1.00 75.43  ? 131  DG  Y "C2'" 1 
ATOM   2153  C  "C1'" . DG  E 2 16  ? 43.445 19.923  19.689  1.00 70.88  ? 131  DG  Y "C1'" 1 
ATOM   2154  N  N9    . DG  E 2 16  ? 42.172 20.578  19.433  1.00 64.81  ? 131  DG  Y N9    1 
ATOM   2155  C  C8    . DG  E 2 16  ? 41.920 21.654  18.622  1.00 62.23  ? 131  DG  Y C8    1 
ATOM   2156  N  N7    . DG  E 2 16  ? 40.656 21.984  18.593  1.00 60.03  ? 131  DG  Y N7    1 
ATOM   2157  C  C5    . DG  E 2 16  ? 40.040 21.071  19.438  1.00 58.81  ? 131  DG  Y C5    1 
ATOM   2158  C  C6    . DG  E 2 16  ? 38.675 20.918  19.791  1.00 57.19  ? 131  DG  Y C6    1 
ATOM   2159  O  O6    . DG  E 2 16  ? 37.703 21.563  19.396  1.00 55.64  ? 131  DG  Y O6    1 
ATOM   2160  N  N1    . DG  E 2 16  ? 38.491 19.867  20.683  1.00 56.46  ? 131  DG  Y N1    1 
ATOM   2161  C  C2    . DG  E 2 16  ? 39.490 19.044  21.155  1.00 57.49  ? 131  DG  Y C2    1 
ATOM   2162  N  N2    . DG  E 2 16  ? 39.113 18.058  21.990  1.00 56.18  ? 131  DG  Y N2    1 
ATOM   2163  N  N3    . DG  E 2 16  ? 40.766 19.172  20.825  1.00 58.60  ? 131  DG  Y N3    1 
ATOM   2164  C  C4    . DG  E 2 16  ? 40.965 20.200  19.968  1.00 61.05  ? 131  DG  Y C4    1 
ATOM   2165  P  P     . DT  E 2 17  ? 46.107 16.399  19.365  1.00 85.85  ? 132  DT  Y P     1 
ATOM   2166  O  OP1   . DT  E 2 17  ? 47.058 15.900  20.404  1.00 85.91  ? 132  DT  Y OP1   1 
ATOM   2167  O  OP2   . DT  E 2 17  ? 46.561 16.568  17.949  1.00 85.15  ? 132  DT  Y OP2   1 
ATOM   2168  O  "O5'" . DT  E 2 17  ? 44.810 15.480  19.342  1.00 84.14  ? 132  DT  Y "O5'" 1 
ATOM   2169  C  "C5'" . DT  E 2 17  ? 43.516 16.058  19.376  1.00 82.01  ? 132  DT  Y "C5'" 1 
ATOM   2170  C  "C4'" . DT  E 2 17  ? 42.534 15.066  19.940  1.00 80.73  ? 132  DT  Y "C4'" 1 
ATOM   2171  O  "O4'" . DT  E 2 17  ? 41.244 15.693  20.090  1.00 80.44  ? 132  DT  Y "O4'" 1 
ATOM   2172  C  "C3'" . DT  E 2 17  ? 42.323 13.858  19.041  1.00 80.96  ? 132  DT  Y "C3'" 1 
ATOM   2173  O  "O3'" . DT  E 2 17  ? 42.215 12.690  19.847  1.00 81.97  ? 132  DT  Y "O3'" 1 
ATOM   2174  C  "C2'" . DT  E 2 17  ? 41.047 14.188  18.281  1.00 79.84  ? 132  DT  Y "C2'" 1 
ATOM   2175  C  "C1'" . DT  E 2 17  ? 40.292 15.163  19.179  1.00 77.82  ? 132  DT  Y "C1'" 1 
ATOM   2176  N  N1    . DT  E 2 17  ? 39.699 16.315  18.456  1.00 75.40  ? 132  DT  Y N1    1 
ATOM   2177  C  C2    . DT  E 2 17  ? 38.348 16.589  18.596  1.00 74.80  ? 132  DT  Y C2    1 
ATOM   2178  O  O2    . DT  E 2 17  ? 37.594 15.924  19.285  1.00 74.46  ? 132  DT  Y O2    1 
ATOM   2179  N  N3    . DT  E 2 17  ? 37.911 17.685  17.892  1.00 73.48  ? 132  DT  Y N3    1 
ATOM   2180  C  C4    . DT  E 2 17  ? 38.667 18.515  17.084  1.00 73.30  ? 132  DT  Y C4    1 
ATOM   2181  O  O4    . DT  E 2 17  ? 38.131 19.463  16.503  1.00 73.25  ? 132  DT  Y O4    1 
ATOM   2182  C  C5    . DT  E 2 17  ? 40.071 18.172  16.992  1.00 72.89  ? 132  DT  Y C5    1 
ATOM   2183  C  C7    . DT  E 2 17  ? 40.973 19.024  16.156  1.00 73.76  ? 132  DT  Y C7    1 
ATOM   2184  C  C6    . DT  E 2 17  ? 40.505 17.103  17.666  1.00 73.23  ? 132  DT  Y C6    1 
ATOM   2185  P  P     . DT  E 2 18  ? 42.584 11.259  19.233  1.00 82.27  ? 133  DT  Y P     1 
ATOM   2186  O  OP1   . DT  E 2 18  ? 43.326 10.490  20.272  1.00 81.97  ? 133  DT  Y OP1   1 
ATOM   2187  O  OP2   . DT  E 2 18  ? 43.188 11.454  17.891  1.00 82.60  ? 133  DT  Y OP2   1 
ATOM   2188  O  "O5'" . DT  E 2 18  ? 41.146 10.616  19.064  1.00 81.57  ? 133  DT  Y "O5'" 1 
ATOM   2189  C  "C5'" . DT  E 2 18  ? 40.234 10.654  20.147  1.00 81.75  ? 133  DT  Y "C5'" 1 
ATOM   2190  C  "C4'" . DT  E 2 18  ? 38.819 10.609  19.631  1.00 82.34  ? 133  DT  Y "C4'" 1 
ATOM   2191  O  "O4'" . DT  E 2 18  ? 38.378 11.902  19.125  1.00 80.37  ? 133  DT  Y "O4'" 1 
ATOM   2192  C  "C3'" . DT  E 2 18  ? 38.655 9.623   18.475  1.00 83.94  ? 133  DT  Y "C3'" 1 
ATOM   2193  O  "O3'" . DT  E 2 18  ? 37.504 8.800   18.672  1.00 87.20  ? 133  DT  Y "O3'" 1 
ATOM   2194  C  "C2'" . DT  E 2 18  ? 38.421 10.530  17.279  1.00 81.41  ? 133  DT  Y "C2'" 1 
ATOM   2195  C  "C1'" . DT  E 2 18  ? 37.653 11.645  17.942  1.00 77.73  ? 133  DT  Y "C1'" 1 
ATOM   2196  N  N1    . DT  E 2 18  ? 37.509 12.884  17.160  1.00 73.55  ? 133  DT  Y N1    1 
ATOM   2197  C  C2    . DT  E 2 18  ? 36.300 13.540  17.243  1.00 72.11  ? 133  DT  Y C2    1 
ATOM   2198  O  O2    . DT  E 2 18  ? 35.391 13.178  17.974  1.00 71.22  ? 133  DT  Y O2    1 
ATOM   2199  N  N3    . DT  E 2 18  ? 36.190 14.641  16.430  1.00 70.79  ? 133  DT  Y N3    1 
ATOM   2200  C  C4    . DT  E 2 18  ? 37.150 15.141  15.571  1.00 70.33  ? 133  DT  Y C4    1 
ATOM   2201  O  O4    . DT  E 2 18  ? 36.907 16.124  14.884  1.00 70.56  ? 133  DT  Y O4    1 
ATOM   2202  C  C5    . DT  E 2 18  ? 38.397 14.428  15.558  1.00 70.50  ? 133  DT  Y C5    1 
ATOM   2203  C  C7    . DT  E 2 18  ? 39.489 14.920  14.664  1.00 71.04  ? 133  DT  Y C7    1 
ATOM   2204  C  C6    . DT  E 2 18  ? 38.520 13.349  16.348  1.00 71.66  ? 133  DT  Y C6    1 
ATOM   2205  P  P     . DA  E 2 19  ? 37.403 7.385   17.911  1.00 89.96  ? 134  DA  Y P     1 
ATOM   2206  O  OP1   . DA  E 2 19  ? 38.463 6.493   18.468  1.00 89.22  ? 134  DA  Y OP1   1 
ATOM   2207  O  OP2   . DA  E 2 19  ? 37.343 7.636   16.435  1.00 88.74  ? 134  DA  Y OP2   1 
ATOM   2208  O  "O5'" . DA  E 2 19  ? 35.977 6.841   18.356  1.00 88.11  ? 134  DA  Y "O5'" 1 
ATOM   2209  C  "C5'" . DA  E 2 19  ? 34.970 6.587   17.386  1.00 85.69  ? 134  DA  Y "C5'" 1 
ATOM   2210  C  "C4'" . DA  E 2 19  ? 33.857 7.594   17.521  1.00 82.99  ? 134  DA  Y "C4'" 1 
ATOM   2211  O  "O4'" . DA  E 2 19  ? 34.360 8.907   17.182  1.00 80.51  ? 134  DA  Y "O4'" 1 
ATOM   2212  C  "C3'" . DA  E 2 19  ? 32.709 7.318   16.562  1.00 83.44  ? 134  DA  Y "C3'" 1 
ATOM   2213  O  "O3'" . DA  E 2 19  ? 31.457 7.539   17.195  1.00 86.90  ? 134  DA  Y "O3'" 1 
ATOM   2214  C  "C2'" . DA  E 2 19  ? 32.915 8.314   15.440  1.00 82.04  ? 134  DA  Y "C2'" 1 
ATOM   2215  C  "C1'" . DA  E 2 19  ? 33.585 9.478   16.133  1.00 79.83  ? 134  DA  Y "C1'" 1 
ATOM   2216  N  N9    . DA  E 2 19  ? 34.490 10.234  15.257  1.00 77.59  ? 134  DA  Y N9    1 
ATOM   2217  C  C8    . DA  E 2 19  ? 35.767 9.870   14.880  1.00 76.22  ? 134  DA  Y C8    1 
ATOM   2218  N  N7    . DA  E 2 19  ? 36.365 10.751  14.109  1.00 74.63  ? 134  DA  Y N7    1 
ATOM   2219  C  C5    . DA  E 2 19  ? 35.424 11.761  13.958  1.00 74.06  ? 134  DA  Y C5    1 
ATOM   2220  C  C6    . DA  E 2 19  ? 35.463 12.985  13.265  1.00 73.21  ? 134  DA  Y C6    1 
ATOM   2221  N  N6    . DA  E 2 19  ? 36.528 13.397  12.570  1.00 72.55  ? 134  DA  Y N6    1 
ATOM   2222  N  N1    . DA  E 2 19  ? 34.363 13.775  13.315  1.00 72.73  ? 134  DA  Y N1    1 
ATOM   2223  C  C2    . DA  E 2 19  ? 33.299 13.349  14.020  1.00 73.08  ? 134  DA  Y C2    1 
ATOM   2224  N  N3    . DA  E 2 19  ? 33.141 12.216  14.718  1.00 73.63  ? 134  DA  Y N3    1 
ATOM   2225  C  C4    . DA  E 2 19  ? 34.255 11.456  14.649  1.00 75.27  ? 134  DA  Y C4    1 
ATOM   2226  P  P     . DT  E 2 20  ? 30.160 6.787   16.634  1.00 89.67  ? 135  DT  Y P     1 
ATOM   2227  O  OP1   . DT  E 2 20  ? 28.910 7.349   17.230  1.00 89.26  ? 135  DT  Y OP1   1 
ATOM   2228  O  OP2   . DT  E 2 20  ? 30.433 5.323   16.734  1.00 89.19  ? 135  DT  Y OP2   1 
ATOM   2229  O  "O5'" . DT  E 2 20  ? 30.183 7.189   15.101  1.00 88.31  ? 135  DT  Y "O5'" 1 
ATOM   2230  C  "C5'" . DT  E 2 20  ? 28.986 7.234   14.354  1.00 87.71  ? 135  DT  Y "C5'" 1 
ATOM   2231  C  "C4'" . DT  E 2 20  ? 28.440 8.638   14.363  1.00 85.89  ? 135  DT  Y "C4'" 1 
ATOM   2232  O  "O4'" . DT  E 2 20  ? 29.568 9.544   14.293  1.00 84.58  ? 135  DT  Y "O4'" 1 
ATOM   2233  C  "C3'" . DT  E 2 20  ? 27.576 8.914   13.135  1.00 85.66  ? 135  DT  Y "C3'" 1 
ATOM   2234  O  "O3'" . DT  E 2 20  ? 26.425 9.697   13.424  1.00 86.92  ? 135  DT  Y "O3'" 1 
ATOM   2235  C  "C2'" . DT  E 2 20  ? 28.505 9.660   12.204  1.00 83.68  ? 135  DT  Y "C2'" 1 
ATOM   2236  C  "C1'" . DT  E 2 20  ? 29.447 10.374  13.149  1.00 82.48  ? 135  DT  Y "C1'" 1 
ATOM   2237  N  N1    . DT  E 2 20  ? 30.791 10.590  12.581  1.00 79.38  ? 135  DT  Y N1    1 
ATOM   2238  C  C2    . DT  E 2 20  ? 31.065 11.843  12.099  1.00 78.93  ? 135  DT  Y C2    1 
ATOM   2239  O  O2    . DT  E 2 20  ? 30.293 12.777  12.213  1.00 79.27  ? 135  DT  Y O2    1 
ATOM   2240  N  N3    . DT  E 2 20  ? 32.288 11.972  11.489  1.00 77.60  ? 135  DT  Y N3    1 
ATOM   2241  C  C4    . DT  E 2 20  ? 33.255 11.005  11.349  1.00 75.70  ? 135  DT  Y C4    1 
ATOM   2242  O  O4    . DT  E 2 20  ? 34.296 11.267  10.749  1.00 73.78  ? 135  DT  Y O4    1 
ATOM   2243  C  C5    . DT  E 2 20  ? 32.928 9.728   11.938  1.00 75.56  ? 135  DT  Y C5    1 
ATOM   2244  C  C7    . DT  E 2 20  ? 33.944 8.631   11.894  1.00 75.76  ? 135  DT  Y C7    1 
ATOM   2245  C  C6    . DT  E 2 20  ? 31.723 9.582   12.509  1.00 76.94  ? 135  DT  Y C6    1 
ATOM   2246  P  P     . DC  E 2 21  ? 25.203 9.689   12.385  1.00 88.65  ? 136  DC  Y P     1 
ATOM   2247  O  OP1   . DC  E 2 21  ? 23.905 9.765   13.118  1.00 88.98  ? 136  DC  Y OP1   1 
ATOM   2248  O  OP2   . DC  E 2 21  ? 25.463 8.543   11.487  1.00 89.88  ? 136  DC  Y OP2   1 
ATOM   2249  O  "O5'" . DC  E 2 21  ? 25.421 11.011  11.522  1.00 87.27  ? 136  DC  Y "O5'" 1 
ATOM   2250  C  "C5'" . DC  E 2 21  ? 25.171 12.289  12.091  1.00 87.25  ? 136  DC  Y "C5'" 1 
ATOM   2251  C  "C4'" . DC  E 2 21  ? 25.508 13.386  11.109  1.00 86.60  ? 136  DC  Y "C4'" 1 
ATOM   2252  O  "O4'" . DC  E 2 21  ? 26.920 13.311  10.792  1.00 85.33  ? 136  DC  Y "O4'" 1 
ATOM   2253  C  "C3'" . DC  E 2 21  ? 24.769 13.326  9.771   1.00 85.95  ? 136  DC  Y "C3'" 1 
ATOM   2254  O  "O3'" . DC  E 2 21  ? 24.490 14.635  9.243   1.00 86.13  ? 136  DC  Y "O3'" 1 
ATOM   2255  C  "C2'" . DC  E 2 21  ? 25.797 12.694  8.852   1.00 85.07  ? 136  DC  Y "C2'" 1 
ATOM   2256  C  "C1'" . DC  E 2 21  ? 27.092 13.259  9.393   1.00 83.53  ? 136  DC  Y "C1'" 1 
ATOM   2257  N  N1    . DC  E 2 21  ? 28.281 12.445  9.119   1.00 81.73  ? 136  DC  Y N1    1 
ATOM   2258  C  C2    . DC  E 2 21  ? 29.298 12.988  8.349   1.00 81.55  ? 136  DC  Y C2    1 
ATOM   2259  O  O2    . DC  E 2 21  ? 29.149 14.130  7.884   1.00 82.84  ? 136  DC  Y O2    1 
ATOM   2260  N  N3    . DC  E 2 21  ? 30.415 12.259  8.115   1.00 80.95  ? 136  DC  Y N3    1 
ATOM   2261  C  C4    . DC  E 2 21  ? 30.517 11.026  8.602   1.00 80.73  ? 136  DC  Y C4    1 
ATOM   2262  N  N4    . DC  E 2 21  ? 31.634 10.337  8.344   1.00 80.09  ? 136  DC  Y N4    1 
ATOM   2263  C  C5    . DC  E 2 21  ? 29.482 10.442  9.374   1.00 81.52  ? 136  DC  Y C5    1 
ATOM   2264  C  C6    . DC  E 2 21  ? 28.392 11.182  9.612   1.00 81.52  ? 136  DC  Y C6    1 
ATOM   2265  O  "O5'" . DG  F 3 1   ? 40.073 9.939   2.586   1.00 109.59 ? 100  DG  H "O5'" 1 
ATOM   2266  C  "C5'" . DG  F 3 1   ? 40.359 10.269  1.206   1.00 110.11 ? 100  DG  H "C5'" 1 
ATOM   2267  C  "C4'" . DG  F 3 1   ? 39.653 11.488  0.644   1.00 109.95 ? 100  DG  H "C4'" 1 
ATOM   2268  O  "O4'" . DG  F 3 1   ? 38.229 11.223  0.532   1.00 109.56 ? 100  DG  H "O4'" 1 
ATOM   2269  C  "C3'" . DG  F 3 1   ? 39.788 12.745  1.506   1.00 110.12 ? 100  DG  H "C3'" 1 
ATOM   2270  O  "O3'" . DG  F 3 1   ? 39.971 13.942  0.747   1.00 109.20 ? 100  DG  H "O3'" 1 
ATOM   2271  C  "C2'" . DG  F 3 1   ? 38.461 12.835  2.230   1.00 110.17 ? 100  DG  H "C2'" 1 
ATOM   2272  C  "C1'" . DG  F 3 1   ? 37.475 12.166  1.288   1.00 109.21 ? 100  DG  H "C1'" 1 
ATOM   2273  N  N9    . DG  F 3 1   ? 36.490 11.434  2.075   1.00 108.23 ? 100  DG  H N9    1 
ATOM   2274  C  C8    . DG  F 3 1   ? 36.718 10.304  2.825   1.00 108.44 ? 100  DG  H C8    1 
ATOM   2275  N  N7    . DG  F 3 1   ? 35.679 9.929   3.517   1.00 107.96 ? 100  DG  H N7    1 
ATOM   2276  C  C5    . DG  F 3 1   ? 34.696 10.850  3.184   1.00 107.09 ? 100  DG  H C5    1 
ATOM   2277  C  C6    . DG  F 3 1   ? 33.366 10.961  3.639   1.00 106.89 ? 100  DG  H C6    1 
ATOM   2278  O  O6    . DG  F 3 1   ? 32.769 10.244  4.454   1.00 106.91 ? 100  DG  H O6    1 
ATOM   2279  N  N1    . DG  F 3 1   ? 32.717 12.045  3.055   1.00 106.23 ? 100  DG  H N1    1 
ATOM   2280  C  C2    . DG  F 3 1   ? 33.282 12.912  2.151   1.00 106.22 ? 100  DG  H C2    1 
ATOM   2281  N  N2    . DG  F 3 1   ? 32.491 13.907  1.715   1.00 105.90 ? 100  DG  H N2    1 
ATOM   2282  N  N3    . DG  F 3 1   ? 34.528 12.815  1.714   1.00 106.26 ? 100  DG  H N3    1 
ATOM   2283  C  C4    . DG  F 3 1   ? 35.173 11.771  2.274   1.00 107.20 ? 100  DG  H C4    1 
ATOM   2284  P  P     . DG  F 3 2   ? 40.268 15.320  1.524   1.00 108.31 ? 101  DG  H P     1 
ATOM   2285  O  OP1   . DG  F 3 2   ? 40.916 16.258  0.570   1.00 109.10 ? 101  DG  H OP1   1 
ATOM   2286  O  OP2   . DG  F 3 2   ? 40.972 14.949  2.784   1.00 108.62 ? 101  DG  H OP2   1 
ATOM   2287  O  "O5'" . DG  F 3 2   ? 38.824 15.885  1.915   1.00 105.53 ? 101  DG  H "O5'" 1 
ATOM   2288  C  "C5'" . DG  F 3 2   ? 37.974 16.509  0.939   1.00 100.78 ? 101  DG  H "C5'" 1 
ATOM   2289  C  "C4'" . DG  F 3 2   ? 36.853 17.269  1.618   1.00 97.86  ? 101  DG  H "C4'" 1 
ATOM   2290  O  "O4'" . DG  F 3 2   ? 36.004 16.343  2.340   1.00 94.99  ? 101  DG  H "O4'" 1 
ATOM   2291  C  "C3'" . DG  F 3 2   ? 37.288 18.313  2.654   1.00 97.52  ? 101  DG  H "C3'" 1 
ATOM   2292  O  "O3'" . DG  F 3 2   ? 36.339 19.403  2.686   1.00 98.84  ? 101  DG  H "O3'" 1 
ATOM   2293  C  "C2'" . DG  F 3 2   ? 37.231 17.533  3.952   1.00 94.49  ? 101  DG  H "C2'" 1 
ATOM   2294  C  "C1'" . DG  F 3 2   ? 36.002 16.674  3.725   1.00 90.90  ? 101  DG  H "C1'" 1 
ATOM   2295  N  N9    . DG  F 3 2   ? 36.002 15.435  4.491   1.00 85.76  ? 101  DG  H N9    1 
ATOM   2296  C  C8    . DG  F 3 2   ? 37.075 14.622  4.773   1.00 83.49  ? 101  DG  H C8    1 
ATOM   2297  N  N7    . DG  F 3 2   ? 36.755 13.587  5.502   1.00 81.60  ? 101  DG  H N7    1 
ATOM   2298  C  C5    . DG  F 3 2   ? 35.389 13.723  5.706   1.00 81.34  ? 101  DG  H C5    1 
ATOM   2299  C  C6    . DG  F 3 2   ? 34.478 12.899  6.417   1.00 80.20  ? 101  DG  H C6    1 
ATOM   2300  O  O6    . DG  F 3 2   ? 34.703 11.824  7.002   1.00 79.29  ? 101  DG  H O6    1 
ATOM   2301  N  N1    . DG  F 3 2   ? 33.186 13.429  6.393   1.00 78.49  ? 101  DG  H N1    1 
ATOM   2302  C  C2    . DG  F 3 2   ? 32.815 14.587  5.746   1.00 78.49  ? 101  DG  H C2    1 
ATOM   2303  N  N2    . DG  F 3 2   ? 31.526 14.947  5.842   1.00 77.52  ? 101  DG  H N2    1 
ATOM   2304  N  N3    . DG  F 3 2   ? 33.650 15.343  5.057   1.00 80.15  ? 101  DG  H N3    1 
ATOM   2305  C  C4    . DG  F 3 2   ? 34.912 14.860  5.087   1.00 82.60  ? 101  DG  H C4    1 
ATOM   2306  P  P     . DA  F 3 3   ? 36.377 20.482  3.895   1.00 99.41  ? 102  DA  H P     1 
ATOM   2307  O  OP1   . DA  F 3 3   ? 36.225 21.845  3.289   1.00 99.07  ? 102  DA  H OP1   1 
ATOM   2308  O  OP2   . DA  F 3 3   ? 37.573 20.174  4.748   1.00 98.18  ? 102  DA  H OP2   1 
ATOM   2309  O  "O5'" . DA  F 3 3   ? 35.049 20.184  4.738   1.00 95.63  ? 102  DA  H "O5'" 1 
ATOM   2310  C  "C5'" . DA  F 3 3   ? 33.755 20.420  4.169   1.00 90.04  ? 102  DA  H "C5'" 1 
ATOM   2311  C  "C4'" . DA  F 3 3   ? 32.671 20.306  5.221   1.00 86.27  ? 102  DA  H "C4'" 1 
ATOM   2312  O  "O4'" . DA  F 3 3   ? 32.733 19.000  5.838   1.00 82.82  ? 102  DA  H "O4'" 1 
ATOM   2313  C  "C3'" . DA  F 3 3   ? 32.735 21.305  6.377   1.00 86.01  ? 102  DA  H "C3'" 1 
ATOM   2314  O  "O3'" . DA  F 3 3   ? 31.397 21.667  6.774   1.00 87.09  ? 102  DA  H "O3'" 1 
ATOM   2315  C  "C2'" . DA  F 3 3   ? 33.434 20.520  7.471   1.00 82.11  ? 102  DA  H "C2'" 1 
ATOM   2316  C  "C1'" . DA  F 3 3   ? 32.876 19.135  7.240   1.00 78.06  ? 102  DA  H "C1'" 1 
ATOM   2317  N  N9    . DA  F 3 3   ? 33.734 18.053  7.700   1.00 72.45  ? 102  DA  H N9    1 
ATOM   2318  C  C8    . DA  F 3 3   ? 35.101 17.919  7.618   1.00 70.71  ? 102  DA  H C8    1 
ATOM   2319  N  N7    . DA  F 3 3   ? 35.554 16.806  8.143   1.00 68.51  ? 102  DA  H N7    1 
ATOM   2320  C  C5    . DA  F 3 3   ? 34.406 16.168  8.597   1.00 68.97  ? 102  DA  H C5    1 
ATOM   2321  C  C6    . DA  F 3 3   ? 34.200 14.947  9.260   1.00 69.10  ? 102  DA  H C6    1 
ATOM   2322  N  N6    . DA  F 3 3   ? 35.191 14.110  9.612   1.00 69.67  ? 102  DA  H N6    1 
ATOM   2323  N  N1    . DA  F 3 3   ? 32.922 14.610  9.563   1.00 68.01  ? 102  DA  H N1    1 
ATOM   2324  C  C2    . DA  F 3 3   ? 31.935 15.456  9.228   1.00 67.04  ? 102  DA  H C2    1 
ATOM   2325  N  N3    . DA  F 3 3   ? 32.006 16.628  8.617   1.00 67.24  ? 102  DA  H N3    1 
ATOM   2326  C  C4    . DA  F 3 3   ? 33.282 16.927  8.325   1.00 69.27  ? 102  DA  H C4    1 
ATOM   2327  P  P     . DT  F 3 4   ? 31.169 22.754  7.948   1.00 87.54  ? 103  DT  H P     1 
ATOM   2328  O  OP1   . DT  F 3 4   ? 29.695 22.799  8.223   1.00 85.60  ? 103  DT  H OP1   1 
ATOM   2329  O  OP2   . DT  F 3 4   ? 31.905 24.017  7.613   1.00 86.99  ? 103  DT  H OP2   1 
ATOM   2330  O  "O5'" . DT  F 3 4   ? 31.899 22.089  9.200   1.00 85.38  ? 103  DT  H "O5'" 1 
ATOM   2331  C  "C5'" . DT  F 3 4   ? 31.372 22.236  10.521  1.00 83.17  ? 103  DT  H "C5'" 1 
ATOM   2332  C  "C4'" . DT  F 3 4   ? 30.360 21.149  10.810  1.00 79.57  ? 103  DT  H "C4'" 1 
ATOM   2333  O  "O4'" . DT  F 3 4   ? 30.979 19.857  10.603  1.00 77.17  ? 103  DT  H "O4'" 1 
ATOM   2334  C  "C3'" . DT  F 3 4   ? 29.846 21.148  12.245  1.00 78.71  ? 103  DT  H "C3'" 1 
ATOM   2335  O  "O3'" . DT  F 3 4   ? 28.439 20.921  12.295  1.00 79.96  ? 103  DT  H "O3'" 1 
ATOM   2336  C  "C2'" . DT  F 3 4   ? 30.627 20.033  12.917  1.00 75.66  ? 103  DT  H "C2'" 1 
ATOM   2337  C  "C1'" . DT  F 3 4   ? 30.966 19.081  11.786  1.00 72.14  ? 103  DT  H "C1'" 1 
ATOM   2338  N  N1    . DT  F 3 4   ? 32.291 18.443  11.897  1.00 66.54  ? 103  DT  H N1    1 
ATOM   2339  C  C2    . DT  F 3 4   ? 32.355 17.139  12.344  1.00 64.85  ? 103  DT  H C2    1 
ATOM   2340  O  O2    . DT  F 3 4   ? 31.365 16.497  12.650  1.00 62.80  ? 103  DT  H O2    1 
ATOM   2341  N  N3    . DT  F 3 4   ? 33.628 16.609  12.406  1.00 62.98  ? 103  DT  H N3    1 
ATOM   2342  C  C4    . DT  F 3 4   ? 34.812 17.241  12.055  1.00 62.75  ? 103  DT  H C4    1 
ATOM   2343  O  O4    . DT  F 3 4   ? 35.887 16.631  12.137  1.00 61.82  ? 103  DT  H O4    1 
ATOM   2344  C  C5    . DT  F 3 4   ? 34.663 18.617  11.594  1.00 62.41  ? 103  DT  H C5    1 
ATOM   2345  C  C7    . DT  F 3 4   ? 35.884 19.382  11.186  1.00 62.12  ? 103  DT  H C7    1 
ATOM   2346  C  C6    . DT  F 3 4   ? 33.428 19.139  11.548  1.00 63.17  ? 103  DT  H C6    1 
ATOM   2347  P  P     . DA  F 3 5   ? 27.566 21.687  13.403  1.00 81.88  ? 104  DA  H P     1 
ATOM   2348  O  OP1   . DA  F 3 5   ? 26.225 22.052  12.858  1.00 80.65  ? 104  DA  H OP1   1 
ATOM   2349  O  OP2   . DA  F 3 5   ? 28.464 22.755  13.930  1.00 82.46  ? 104  DA  H OP2   1 
ATOM   2350  O  "O5'" . DA  F 3 5   ? 27.363 20.589  14.535  1.00 78.55  ? 104  DA  H "O5'" 1 
ATOM   2351  C  "C5'" . DA  F 3 5   ? 26.593 19.431  14.266  1.00 74.72  ? 104  DA  H "C5'" 1 
ATOM   2352  C  "C4'" . DA  F 3 5   ? 26.836 18.387  15.327  1.00 72.01  ? 104  DA  H "C4'" 1 
ATOM   2353  O  "O4'" . DA  F 3 5   ? 28.202 17.919  15.243  1.00 69.85  ? 104  DA  H "O4'" 1 
ATOM   2354  C  "C3'" . DA  F 3 5   ? 26.647 18.882  16.760  1.00 70.51  ? 104  DA  H "C3'" 1 
ATOM   2355  O  "O3'" . DA  F 3 5   ? 25.938 17.913  17.527  1.00 69.55  ? 104  DA  H "O3'" 1 
ATOM   2356  C  "C2'" . DA  F 3 5   ? 28.063 19.032  17.285  1.00 67.90  ? 104  DA  H "C2'" 1 
ATOM   2357  C  "C1'" . DA  F 3 5   ? 28.814 17.968  16.518  1.00 65.10  ? 104  DA  H "C1'" 1 
ATOM   2358  N  N9    . DA  F 3 5   ? 30.214 18.293  16.304  1.00 59.92  ? 104  DA  H N9    1 
ATOM   2359  C  C8    . DA  F 3 5   ? 30.726 19.518  15.981  1.00 58.99  ? 104  DA  H C8    1 
ATOM   2360  N  N7    . DA  F 3 5   ? 32.024 19.515  15.806  1.00 57.87  ? 104  DA  H N7    1 
ATOM   2361  C  C5    . DA  F 3 5   ? 32.391 18.195  16.038  1.00 55.41  ? 104  DA  H C5    1 
ATOM   2362  C  C6    . DA  F 3 5   ? 33.634 17.537  16.000  1.00 53.26  ? 104  DA  H C6    1 
ATOM   2363  N  N6    . DA  F 3 5   ? 34.774 18.142  15.685  1.00 52.58  ? 104  DA  H N6    1 
ATOM   2364  N  N1    . DA  F 3 5   ? 33.662 16.224  16.295  1.00 51.62  ? 104  DA  H N1    1 
ATOM   2365  C  C2    . DA  F 3 5   ? 32.512 15.622  16.600  1.00 53.85  ? 104  DA  H C2    1 
ATOM   2366  N  N3    . DA  F 3 5   ? 31.276 16.129  16.657  1.00 54.99  ? 104  DA  H N3    1 
ATOM   2367  C  C4    . DA  F 3 5   ? 31.287 17.436  16.361  1.00 56.49  ? 104  DA  H C4    1 
ATOM   2368  P  P     . DA  F 3 6   ? 25.495 18.274  19.014  1.00 68.55  ? 105  DA  H P     1 
ATOM   2369  O  OP1   . DA  F 3 6   ? 24.448 17.312  19.446  1.00 69.19  ? 105  DA  H OP1   1 
ATOM   2370  O  OP2   . DA  F 3 6   ? 25.177 19.728  18.984  1.00 67.46  ? 105  DA  H OP2   1 
ATOM   2371  O  "O5'" . DA  F 3 6   ? 26.821 17.937  19.833  1.00 66.32  ? 105  DA  H "O5'" 1 
ATOM   2372  C  "C5'" . DA  F 3 6   ? 27.179 16.573  20.025  1.00 64.76  ? 105  DA  H "C5'" 1 
ATOM   2373  C  "C4'" . DA  F 3 6   ? 28.386 16.426  20.925  1.00 63.93  ? 105  DA  H "C4'" 1 
ATOM   2374  O  "O4'" . DA  F 3 6   ? 29.599 16.747  20.204  1.00 61.69  ? 105  DA  H "O4'" 1 
ATOM   2375  C  "C3'" . DA  F 3 6   ? 28.422 17.227  22.235  1.00 64.78  ? 105  DA  H "C3'" 1 
ATOM   2376  O  "O3'" . DA  F 3 6   ? 28.779 16.370  23.358  1.00 65.42  ? 105  DA  H "O3'" 1 
ATOM   2377  C  "C2'" . DA  F 3 6   ? 29.506 18.261  21.961  1.00 62.49  ? 105  DA  H "C2'" 1 
ATOM   2378  C  "C1'" . DA  F 3 6   ? 30.442 17.500  21.037  1.00 58.19  ? 105  DA  H "C1'" 1 
ATOM   2379  N  N9    . DA  F 3 6   ? 31.293 18.339  20.199  1.00 52.97  ? 105  DA  H N9    1 
ATOM   2380  C  C8    . DA  F 3 6   ? 31.014 19.576  19.666  1.00 51.44  ? 105  DA  H C8    1 
ATOM   2381  N  N7    . DA  F 3 6   ? 32.031 20.128  19.047  1.00 49.71  ? 105  DA  H N7    1 
ATOM   2382  C  C5    . DA  F 3 6   ? 33.043 19.180  19.164  1.00 49.85  ? 105  DA  H C5    1 
ATOM   2383  C  C6    . DA  F 3 6   ? 34.398 19.176  18.749  1.00 49.53  ? 105  DA  H C6    1 
ATOM   2384  N  N6    . DA  F 3 6   ? 34.997 20.225  18.173  1.00 51.22  ? 105  DA  H N6    1 
ATOM   2385  N  N1    . DA  F 3 6   ? 35.125 18.055  18.978  1.00 47.03  ? 105  DA  H N1    1 
ATOM   2386  C  C2    . DA  F 3 6   ? 34.535 17.034  19.622  1.00 47.55  ? 105  DA  H C2    1 
ATOM   2387  N  N3    . DA  F 3 6   ? 33.285 16.938  20.099  1.00 47.79  ? 105  DA  H N3    1 
ATOM   2388  C  C4    . DA  F 3 6   ? 32.587 18.056  19.833  1.00 50.05  ? 105  DA  H C4    1 
ATOM   2389  P  P     . DC  F 3 7   ? 28.339 16.771  24.863  1.00 63.51  ? 106  DC  H P     1 
ATOM   2390  O  OP1   . DC  F 3 7   ? 27.878 15.562  25.583  1.00 62.86  ? 106  DC  H OP1   1 
ATOM   2391  O  OP2   . DC  F 3 7   ? 27.468 17.981  24.810  1.00 61.41  ? 106  DC  H OP2   1 
ATOM   2392  O  "O5'" . DC  F 3 7   ? 29.721 17.155  25.531  1.00 61.26  ? 106  DC  H "O5'" 1 
ATOM   2393  C  "C5'" . DC  F 3 7   ? 30.754 17.676  24.741  1.00 58.16  ? 106  DC  H "C5'" 1 
ATOM   2394  C  "C4'" . DC  F 3 7   ? 31.869 16.672  24.638  1.00 57.05  ? 106  DC  H "C4'" 1 
ATOM   2395  O  "O4'" . DC  F 3 7   ? 32.448 16.943  23.350  1.00 58.57  ? 106  DC  H "O4'" 1 
ATOM   2396  C  "C3'" . DC  F 3 7   ? 32.974 16.870  25.672  1.00 57.78  ? 106  DC  H "C3'" 1 
ATOM   2397  O  "O3'" . DC  F 3 7   ? 33.342 15.721  26.419  1.00 57.37  ? 106  DC  H "O3'" 1 
ATOM   2398  C  "C2'" . DC  F 3 7   ? 34.186 17.341  24.889  1.00 57.71  ? 106  DC  H "C2'" 1 
ATOM   2399  C  "C1'" . DC  F 3 7   ? 33.814 17.307  23.426  1.00 55.97  ? 106  DC  H "C1'" 1 
ATOM   2400  N  N1    . DC  F 3 7   ? 33.944 18.660  22.862  1.00 53.12  ? 106  DC  H N1    1 
ATOM   2401  C  C2    . DC  F 3 7   ? 35.183 19.056  22.341  1.00 52.56  ? 106  DC  H C2    1 
ATOM   2402  O  O2    . DC  F 3 7   ? 36.106 18.222  22.291  1.00 52.21  ? 106  DC  H O2    1 
ATOM   2403  N  N3    . DC  F 3 7   ? 35.343 20.333  21.910  1.00 51.57  ? 106  DC  H N3    1 
ATOM   2404  C  C4    . DC  F 3 7   ? 34.321 21.194  21.982  1.00 52.42  ? 106  DC  H C4    1 
ATOM   2405  N  N4    . DC  F 3 7   ? 34.529 22.451  21.582  1.00 52.52  ? 106  DC  H N4    1 
ATOM   2406  C  C5    . DC  F 3 7   ? 33.036 20.802  22.475  1.00 52.21  ? 106  DC  H C5    1 
ATOM   2407  C  C6    . DC  F 3 7   ? 32.892 19.535  22.890  1.00 51.90  ? 106  DC  H C6    1 
ATOM   2408  P  P     . DT  F 3 8   ? 34.388 15.888  27.634  1.00 55.55  ? 107  DT  H P     1 
ATOM   2409  O  OP1   . DT  F 3 8   ? 33.752 15.335  28.843  1.00 56.62  ? 107  DT  H OP1   1 
ATOM   2410  O  OP2   . DT  F 3 8   ? 34.914 17.257  27.656  1.00 54.16  ? 107  DT  H OP2   1 
ATOM   2411  O  "O5'" . DT  F 3 8   ? 35.627 14.995  27.222  1.00 53.89  ? 107  DT  H "O5'" 1 
ATOM   2412  C  "C5'" . DT  F 3 8   ? 36.794 15.044  27.994  1.00 53.01  ? 107  DT  H "C5'" 1 
ATOM   2413  C  "C4'" . DT  F 3 8   ? 37.991 15.258  27.108  1.00 52.32  ? 107  DT  H "C4'" 1 
ATOM   2414  O  "O4'" . DT  F 3 8   ? 37.670 16.255  26.114  1.00 49.90  ? 107  DT  H "O4'" 1 
ATOM   2415  C  "C3'" . DT  F 3 8   ? 39.160 15.813  27.904  1.00 54.43  ? 107  DT  H "C3'" 1 
ATOM   2416  O  "O3'" . DT  F 3 8   ? 40.343 15.077  27.759  1.00 60.50  ? 107  DT  H "O3'" 1 
ATOM   2417  C  "C2'" . DT  F 3 8   ? 39.383 17.214  27.376  1.00 50.88  ? 107  DT  H "C2'" 1 
ATOM   2418  C  "C1'" . DT  F 3 8   ? 38.725 17.202  26.024  1.00 46.28  ? 107  DT  H "C1'" 1 
ATOM   2419  N  N1    . DT  F 3 8   ? 38.136 18.511  25.697  1.00 40.74  ? 107  DT  H N1    1 
ATOM   2420  C  C2    . DT  F 3 8   ? 38.930 19.422  25.061  1.00 38.62  ? 107  DT  H C2    1 
ATOM   2421  O  O2    . DT  F 3 8   ? 40.114 19.222  24.827  1.00 38.83  ? 107  DT  H O2    1 
ATOM   2422  N  N3    . DT  F 3 8   ? 38.294 20.594  24.731  1.00 36.04  ? 107  DT  H N3    1 
ATOM   2423  C  C4    . DT  F 3 8   ? 36.983 20.935  25.007  1.00 33.94  ? 107  DT  H C4    1 
ATOM   2424  O  O4    . DT  F 3 8   ? 36.530 22.013  24.639  1.00 34.55  ? 107  DT  H O4    1 
ATOM   2425  C  C5    . DT  F 3 8   ? 36.239 19.962  25.720  1.00 32.78  ? 107  DT  H C5    1 
ATOM   2426  C  C7    . DT  F 3 8   ? 34.833 20.287  26.106  1.00 31.37  ? 107  DT  H C7    1 
ATOM   2427  C  C6    . DT  F 3 8   ? 36.832 18.805  26.017  1.00 35.73  ? 107  DT  H C6    1 
ATOM   2428  P  P     . DT  F 3 9   ? 41.465 15.245  28.882  1.00 66.78  ? 108  DT  H P     1 
ATOM   2429  O  OP1   . DT  F 3 9   ? 42.428 14.101  28.836  1.00 67.08  ? 108  DT  H OP1   1 
ATOM   2430  O  OP2   . DT  F 3 9   ? 40.696 15.523  30.129  1.00 66.57  ? 108  DT  H OP2   1 
ATOM   2431  O  "O5'" . DT  F 3 9   ? 42.217 16.574  28.442  1.00 65.59  ? 108  DT  H "O5'" 1 
ATOM   2432  C  "C5'" . DT  F 3 9   ? 43.001 16.566  27.266  1.00 66.40  ? 108  DT  H "C5'" 1 
ATOM   2433  C  "C4'" . DT  F 3 9   ? 43.629 17.915  27.026  1.00 66.22  ? 108  DT  H "C4'" 1 
ATOM   2434  O  "O4'" . DT  F 3 9   ? 42.637 18.855  26.555  1.00 63.68  ? 108  DT  H "O4'" 1 
ATOM   2435  C  "C3'" . DT  F 3 9   ? 44.345 18.580  28.204  1.00 67.01  ? 108  DT  H "C3'" 1 
ATOM   2436  O  "O3'" . DT  F 3 9   ? 45.639 19.010  27.754  1.00 72.55  ? 108  DT  H "O3'" 1 
ATOM   2437  C  "C2'" . DT  F 3 9   ? 43.457 19.777  28.508  1.00 63.98  ? 108  DT  H "C2'" 1 
ATOM   2438  C  "C1'" . DT  F 3 9   ? 42.898 20.100  27.141  1.00 59.72  ? 108  DT  H "C1'" 1 
ATOM   2439  N  N1    . DT  F 3 9   ? 41.655 20.860  27.112  1.00 55.54  ? 108  DT  H N1    1 
ATOM   2440  C  C2    . DT  F 3 9   ? 41.628 21.977  26.323  1.00 55.04  ? 108  DT  H C2    1 
ATOM   2441  O  O2    . DT  F 3 9   ? 42.573 22.327  25.642  1.00 57.68  ? 108  DT  H O2    1 
ATOM   2442  N  N3    . DT  F 3 9   ? 40.455 22.674  26.354  1.00 52.41  ? 108  DT  H N3    1 
ATOM   2443  C  C4    . DT  F 3 9   ? 39.330 22.364  27.081  1.00 50.48  ? 108  DT  H C4    1 
ATOM   2444  O  O4    . DT  F 3 9   ? 38.364 23.106  27.045  1.00 49.37  ? 108  DT  H O4    1 
ATOM   2445  C  C5    . DT  F 3 9   ? 39.412 21.153  27.860  1.00 50.05  ? 108  DT  H C5    1 
ATOM   2446  C  C7    . DT  F 3 9   ? 38.216 20.716  28.644  1.00 47.87  ? 108  DT  H C7    1 
ATOM   2447  C  C6    . DT  F 3 9   ? 40.562 20.472  27.842  1.00 51.96  ? 108  DT  H C6    1 
ATOM   2448  P  P     . DC  F 3 10  ? 46.878 19.117  28.790  1.00 77.13  ? 109  DC  H P     1 
ATOM   2449  O  OP1   . DC  F 3 10  ? 48.074 18.443  28.203  1.00 78.25  ? 109  DC  H OP1   1 
ATOM   2450  O  OP2   . DC  F 3 10  ? 46.425 18.741  30.165  1.00 75.78  ? 109  DC  H OP2   1 
ATOM   2451  O  "O5'" . DC  F 3 10  ? 47.155 20.679  28.758  1.00 76.15  ? 109  DC  H "O5'" 1 
ATOM   2452  C  "C5'" . DC  F 3 10  ? 46.090 21.550  28.412  1.00 75.03  ? 109  DC  H "C5'" 1 
ATOM   2453  C  "C4'" . DC  F 3 10  ? 46.620 22.805  27.776  1.00 73.95  ? 109  DC  H "C4'" 1 
ATOM   2454  O  "O4'" . DC  F 3 10  ? 45.475 23.518  27.255  1.00 73.53  ? 109  DC  H "O4'" 1 
ATOM   2455  C  "C3'" . DC  F 3 10  ? 47.305 23.741  28.766  1.00 73.69  ? 109  DC  H "C3'" 1 
ATOM   2456  O  "O3'" . DC  F 3 10  ? 48.431 24.379  28.156  1.00 75.13  ? 109  DC  H "O3'" 1 
ATOM   2457  C  "C2'" . DC  F 3 10  ? 46.208 24.722  29.136  1.00 72.31  ? 109  DC  H "C2'" 1 
ATOM   2458  C  "C1'" . DC  F 3 10  ? 45.325 24.770  27.897  1.00 70.75  ? 109  DC  H "C1'" 1 
ATOM   2459  N  N1    . DC  F 3 10  ? 43.879 24.981  28.140  1.00 68.00  ? 109  DC  H N1    1 
ATOM   2460  C  C2    . DC  F 3 10  ? 43.227 26.019  27.447  1.00 67.32  ? 109  DC  H C2    1 
ATOM   2461  O  O2    . DC  F 3 10  ? 43.889 26.723  26.670  1.00 68.74  ? 109  DC  H O2    1 
ATOM   2462  N  N3    . DC  F 3 10  ? 41.903 26.228  27.643  1.00 65.22  ? 109  DC  H N3    1 
ATOM   2463  C  C4    . DC  F 3 10  ? 41.233 25.455  28.494  1.00 64.03  ? 109  DC  H C4    1 
ATOM   2464  N  N4    . DC  F 3 10  ? 39.931 25.696  28.650  1.00 61.98  ? 109  DC  H N4    1 
ATOM   2465  C  C5    . DC  F 3 10  ? 41.870 24.396  29.223  1.00 63.95  ? 109  DC  H C5    1 
ATOM   2466  C  C6    . DC  F 3 10  ? 43.180 24.193  29.013  1.00 64.97  ? 109  DC  H C6    1 
ATOM   2467  P  P     . DG  F 3 11  ? 49.657 24.886  29.072  1.00 76.71  ? 110  DG  H P     1 
ATOM   2468  O  OP1   . DG  F 3 11  ? 50.900 24.769  28.254  1.00 76.84  ? 110  DG  H OP1   1 
ATOM   2469  O  OP2   . DG  F 3 11  ? 49.588 24.187  30.384  1.00 74.86  ? 110  DG  H OP2   1 
ATOM   2470  O  "O5'" . DG  F 3 11  ? 49.316 26.437  29.281  1.00 73.43  ? 110  DG  H "O5'" 1 
ATOM   2471  C  "C5'" . DG  F 3 11  ? 49.232 27.318  28.151  1.00 68.78  ? 110  DG  H "C5'" 1 
ATOM   2472  C  "C4'" . DG  F 3 11  ? 48.630 28.655  28.530  1.00 65.23  ? 110  DG  H "C4'" 1 
ATOM   2473  O  "O4'" . DG  F 3 11  ? 47.177 28.597  28.595  1.00 62.49  ? 110  DG  H "O4'" 1 
ATOM   2474  C  "C3'" . DG  F 3 11  ? 49.114 29.256  29.852  1.00 64.56  ? 110  DG  H "C3'" 1 
ATOM   2475  O  "O3'" . DG  F 3 11  ? 49.541 30.614  29.670  1.00 65.86  ? 110  DG  H "O3'" 1 
ATOM   2476  C  "C2'" . DG  F 3 11  ? 47.891 29.192  30.755  1.00 60.69  ? 110  DG  H "C2'" 1 
ATOM   2477  C  "C1'" . DG  F 3 11  ? 46.694 29.196  29.799  1.00 56.80  ? 110  DG  H "C1'" 1 
ATOM   2478  N  N9    . DG  F 3 11  ? 45.607 28.365  30.325  1.00 49.38  ? 110  DG  H N9    1 
ATOM   2479  C  C8    . DG  F 3 11  ? 45.793 27.191  31.010  1.00 46.58  ? 110  DG  H C8    1 
ATOM   2480  N  N7    . DG  F 3 11  ? 44.682 26.655  31.434  1.00 44.70  ? 110  DG  H N7    1 
ATOM   2481  C  C5    . DG  F 3 11  ? 43.688 27.515  30.994  1.00 43.72  ? 110  DG  H C5    1 
ATOM   2482  C  C6    . DG  F 3 11  ? 42.276 27.443  31.179  1.00 43.22  ? 110  DG  H C6    1 
ATOM   2483  O  O6    . DG  F 3 11  ? 41.615 26.574  31.788  1.00 44.50  ? 110  DG  H O6    1 
ATOM   2484  N  N1    . DG  F 3 11  ? 41.629 28.514  30.583  1.00 40.28  ? 110  DG  H N1    1 
ATOM   2485  C  C2    . DG  F 3 11  ? 42.253 29.517  29.904  1.00 40.78  ? 110  DG  H C2    1 
ATOM   2486  N  N2    . DG  F 3 11  ? 41.430 30.439  29.417  1.00 40.86  ? 110  DG  H N2    1 
ATOM   2487  N  N3    . DG  F 3 11  ? 43.579 29.608  29.720  1.00 41.51  ? 110  DG  H N3    1 
ATOM   2488  C  C4    . DG  F 3 11  ? 44.230 28.576  30.293  1.00 44.42  ? 110  DG  H C4    1 
ATOM   2489  P  P     . DT  F 3 12  ? 50.317 31.376  30.854  1.00 65.21  ? 111  DT  H P     1 
ATOM   2490  O  OP1   . DT  F 3 12  ? 51.620 31.877  30.350  1.00 65.29  ? 111  DT  H OP1   1 
ATOM   2491  O  OP2   . DT  F 3 12  ? 50.291 30.479  32.034  1.00 64.46  ? 111  DT  H OP2   1 
ATOM   2492  O  "O5'" . DT  F 3 12  ? 49.366 32.624  31.107  1.00 63.96  ? 111  DT  H "O5'" 1 
ATOM   2493  C  "C5'" . DT  F 3 12  ? 48.678 33.228  30.016  1.00 63.50  ? 111  DT  H "C5'" 1 
ATOM   2494  C  "C4'" . DT  F 3 12  ? 47.322 33.752  30.445  1.00 64.11  ? 111  DT  H "C4'" 1 
ATOM   2495  O  "O4'" . DT  F 3 12  ? 46.399 32.678  30.783  1.00 64.53  ? 111  DT  H "O4'" 1 
ATOM   2496  C  "C3'" . DT  F 3 12  ? 47.298 34.727  31.631  1.00 64.75  ? 111  DT  H "C3'" 1 
ATOM   2497  O  "O3'" . DT  F 3 12  ? 46.501 35.870  31.295  1.00 63.89  ? 111  DT  H "O3'" 1 
ATOM   2498  C  "C2'" . DT  F 3 12  ? 46.620 33.930  32.738  1.00 63.90  ? 111  DT  H "C2'" 1 
ATOM   2499  C  "C1'" . DT  F 3 12  ? 45.661 33.073  31.932  1.00 62.98  ? 111  DT  H "C1'" 1 
ATOM   2500  N  N1    . DT  F 3 12  ? 45.108 31.865  32.610  1.00 60.46  ? 111  DT  H N1    1 
ATOM   2501  C  C2    . DT  F 3 12  ? 43.728 31.757  32.639  1.00 59.01  ? 111  DT  H C2    1 
ATOM   2502  O  O2    . DT  F 3 12  ? 42.988 32.580  32.113  1.00 59.67  ? 111  DT  H O2    1 
ATOM   2503  N  N3    . DT  F 3 12  ? 43.250 30.650  33.302  1.00 55.72  ? 111  DT  H N3    1 
ATOM   2504  C  C4    . DT  F 3 12  ? 43.996 29.666  33.911  1.00 54.89  ? 111  DT  H C4    1 
ATOM   2505  O  O4    . DT  F 3 12  ? 43.441 28.729  34.461  1.00 54.86  ? 111  DT  H O4    1 
ATOM   2506  C  C5    . DT  F 3 12  ? 45.421 29.833  33.840  1.00 55.08  ? 111  DT  H C5    1 
ATOM   2507  C  C7    . DT  F 3 12  ? 46.284 28.800  34.487  1.00 54.58  ? 111  DT  H C7    1 
ATOM   2508  C  C6    . DT  F 3 12  ? 45.909 30.907  33.200  1.00 56.99  ? 111  DT  H C6    1 
ATOM   2509  P  P     . DA  F 3 13  ? 46.777 37.290  32.006  1.00 63.31  ? 112  DA  H P     1 
ATOM   2510  O  OP1   . DA  F 3 13  ? 47.002 38.299  30.923  1.00 61.30  ? 112  DA  H OP1   1 
ATOM   2511  O  OP2   . DA  F 3 13  ? 47.780 37.138  33.105  1.00 61.99  ? 112  DA  H OP2   1 
ATOM   2512  O  "O5'" . DA  F 3 13  ? 45.367 37.606  32.667  1.00 60.53  ? 112  DA  H "O5'" 1 
ATOM   2513  C  "C5'" . DA  F 3 13  ? 44.234 37.818  31.834  1.00 54.76  ? 112  DA  H "C5'" 1 
ATOM   2514  C  "C4'" . DA  F 3 13  ? 42.955 37.595  32.606  1.00 50.03  ? 112  DA  H "C4'" 1 
ATOM   2515  O  "O4'" . DA  F 3 13  ? 42.849 36.217  33.032  1.00 47.30  ? 112  DA  H "O4'" 1 
ATOM   2516  C  "C3'" . DA  F 3 13  ? 42.790 38.438  33.868  1.00 47.29  ? 112  DA  H "C3'" 1 
ATOM   2517  O  "O3'" . DA  F 3 13  ? 41.475 38.973  33.919  1.00 46.75  ? 112  DA  H "O3'" 1 
ATOM   2518  C  "C2'" . DA  F 3 13  ? 42.929 37.423  34.976  1.00 44.85  ? 112  DA  H "C2'" 1 
ATOM   2519  C  "C1'" . DA  F 3 13  ? 42.316 36.210  34.326  1.00 43.15  ? 112  DA  H "C1'" 1 
ATOM   2520  N  N9    . DA  F 3 13  ? 42.657 34.939  34.960  1.00 39.71  ? 112  DA  H N9    1 
ATOM   2521  C  C8    . DA  F 3 13  ? 43.894 34.410  35.226  1.00 36.98  ? 112  DA  H C8    1 
ATOM   2522  N  N7    . DA  F 3 13  ? 43.851 33.255  35.837  1.00 34.26  ? 112  DA  H N7    1 
ATOM   2523  C  C5    . DA  F 3 13  ? 42.499 32.997  35.964  1.00 35.36  ? 112  DA  H C5    1 
ATOM   2524  C  C6    . DA  F 3 13  ? 41.802 31.925  36.521  1.00 36.17  ? 112  DA  H C6    1 
ATOM   2525  N  N6    . DA  F 3 13  ? 42.397 30.884  37.095  1.00 35.90  ? 112  DA  H N6    1 
ATOM   2526  N  N1    . DA  F 3 13  ? 40.451 31.967  36.490  1.00 36.97  ? 112  DA  H N1    1 
ATOM   2527  C  C2    . DA  F 3 13  ? 39.856 33.054  35.962  1.00 37.60  ? 112  DA  H C2    1 
ATOM   2528  N  N3    . DA  F 3 13  ? 40.412 34.136  35.415  1.00 36.79  ? 112  DA  H N3    1 
ATOM   2529  C  C4    . DA  F 3 13  ? 41.752 34.032  35.439  1.00 37.03  ? 112  DA  H C4    1 
ATOM   2530  P  P     . DT  F 3 14  ? 41.163 40.198  34.900  1.00 46.90  ? 113  DT  H P     1 
ATOM   2531  O  OP1   . DT  F 3 14  ? 40.776 41.416  34.147  1.00 46.09  ? 113  DT  H OP1   1 
ATOM   2532  O  OP2   . DT  F 3 14  ? 42.327 40.249  35.813  1.00 46.25  ? 113  DT  H OP2   1 
ATOM   2533  O  "O5'" . DT  F 3 14  ? 39.905 39.661  35.705  1.00 44.69  ? 113  DT  H "O5'" 1 
ATOM   2534  C  "C5'" . DT  F 3 14  ? 39.983 38.392  36.305  1.00 44.25  ? 113  DT  H "C5'" 1 
ATOM   2535  C  "C4'" . DT  F 3 14  ? 38.671 38.003  36.929  1.00 43.40  ? 113  DT  H "C4'" 1 
ATOM   2536  O  "O4'" . DT  F 3 14  ? 38.799 36.601  37.251  1.00 42.87  ? 113  DT  H "O4'" 1 
ATOM   2537  C  "C3'" . DT  F 3 14  ? 38.364 38.689  38.244  1.00 44.50  ? 113  DT  H "C3'" 1 
ATOM   2538  O  "O3'" . DT  F 3 14  ? 36.949 38.697  38.429  1.00 49.42  ? 113  DT  H "O3'" 1 
ATOM   2539  C  "C2'" . DT  F 3 14  ? 39.058 37.785  39.247  1.00 41.49  ? 113  DT  H "C2'" 1 
ATOM   2540  C  "C1'" . DT  F 3 14  ? 38.947 36.403  38.633  1.00 37.39  ? 113  DT  H "C1'" 1 
ATOM   2541  N  N1    . DT  F 3 14  ? 40.134 35.547  38.828  1.00 32.28  ? 113  DT  H N1    1 
ATOM   2542  C  C2    . DT  F 3 14  ? 39.955 34.277  39.371  1.00 32.23  ? 113  DT  H C2    1 
ATOM   2543  O  O2    . DT  F 3 14  ? 38.865 33.810  39.640  1.00 34.23  ? 113  DT  H O2    1 
ATOM   2544  N  N3    . DT  F 3 14  ? 41.101 33.568  39.587  1.00 29.38  ? 113  DT  H N3    1 
ATOM   2545  C  C4    . DT  F 3 14  ? 42.380 33.979  39.323  1.00 29.26  ? 113  DT  H C4    1 
ATOM   2546  O  O4    . DT  F 3 14  ? 43.325 33.227  39.597  1.00 28.95  ? 113  DT  H O4    1 
ATOM   2547  C  C5    . DT  F 3 14  ? 42.493 35.317  38.728  1.00 27.65  ? 113  DT  H C5    1 
ATOM   2548  C  C7    . DT  F 3 14  ? 43.850 35.858  38.414  1.00 26.50  ? 113  DT  H C7    1 
ATOM   2549  C  C6    . DT  F 3 14  ? 41.375 36.011  38.503  1.00 26.29  ? 113  DT  H C6    1 
ATOM   2550  P  P     . DA  F 3 15  ? 36.300 39.385  39.743  1.00 54.17  ? 114  DA  H P     1 
ATOM   2551  O  OP1   . DA  F 3 15  ? 35.147 40.166  39.214  1.00 54.48  ? 114  DA  H OP1   1 
ATOM   2552  O  OP2   . DA  F 3 15  ? 37.318 40.061  40.605  1.00 53.46  ? 114  DA  H OP2   1 
ATOM   2553  O  "O5'" . DA  F 3 15  ? 35.693 38.173  40.582  1.00 49.59  ? 114  DA  H "O5'" 1 
ATOM   2554  C  "C5'" . DA  F 3 15  ? 34.443 37.637  40.204  1.00 47.02  ? 114  DA  H "C5'" 1 
ATOM   2555  C  "C4'" . DA  F 3 15  ? 34.275 36.238  40.735  1.00 45.21  ? 114  DA  H "C4'" 1 
ATOM   2556  O  "O4'" . DA  F 3 15  ? 35.558 35.573  40.715  1.00 43.48  ? 114  DA  H "O4'" 1 
ATOM   2557  C  "C3'" . DA  F 3 15  ? 33.761 36.145  42.163  1.00 44.78  ? 114  DA  H "C3'" 1 
ATOM   2558  O  "O3'" . DA  F 3 15  ? 32.657 35.251  42.211  1.00 48.79  ? 114  DA  H "O3'" 1 
ATOM   2559  C  "C2'" . DA  F 3 15  ? 34.941 35.612  42.954  1.00 42.95  ? 114  DA  H "C2'" 1 
ATOM   2560  C  "C1'" . DA  F 3 15  ? 35.772 34.877  41.924  1.00 40.39  ? 114  DA  H "C1'" 1 
ATOM   2561  N  N9    . DA  F 3 15  ? 37.216 34.883  42.185  1.00 36.10  ? 114  DA  H N9    1 
ATOM   2562  C  C8    . DA  F 3 15  ? 38.091 35.892  41.876  1.00 34.80  ? 114  DA  H C8    1 
ATOM   2563  N  N7    . DA  F 3 15  ? 39.336 35.631  42.196  1.00 34.03  ? 114  DA  H N7    1 
ATOM   2564  C  C5    . DA  F 3 15  ? 39.280 34.361  42.755  1.00 32.47  ? 114  DA  H C5    1 
ATOM   2565  C  C6    . DA  F 3 15  ? 40.278 33.512  43.286  1.00 31.16  ? 114  DA  H C6    1 
ATOM   2566  N  N6    . DA  F 3 15  ? 41.576 33.810  43.306  1.00 28.85  ? 114  DA  H N6    1 
ATOM   2567  N  N1    . DA  F 3 15  ? 39.889 32.327  43.789  1.00 29.92  ? 114  DA  H N1    1 
ATOM   2568  C  C2    . DA  F 3 15  ? 38.589 32.011  43.732  1.00 32.20  ? 114  DA  H C2    1 
ATOM   2569  N  N3    . DA  F 3 15  ? 37.564 32.712  43.241  1.00 32.27  ? 114  DA  H N3    1 
ATOM   2570  C  C4    . DA  F 3 15  ? 37.979 33.893  42.767  1.00 33.09  ? 114  DA  H C4    1 
ATOM   2571  P  P     . DG  F 3 16  ? 31.739 35.196  43.525  1.00 52.56  ? 115  DG  H P     1 
ATOM   2572  O  OP1   . DG  F 3 16  ? 30.390 34.672  43.171  1.00 52.67  ? 115  DG  H OP1   1 
ATOM   2573  O  OP2   . DG  F 3 16  ? 31.863 36.502  44.220  1.00 52.46  ? 115  DG  H OP2   1 
ATOM   2574  O  "O5'" . DG  F 3 16  ? 32.448 34.065  44.375  1.00 51.08  ? 115  DG  H "O5'" 1 
ATOM   2575  C  "C5'" . DG  F 3 16  ? 32.639 32.801  43.787  1.00 51.68  ? 115  DG  H "C5'" 1 
ATOM   2576  C  "C4'" . DG  F 3 16  ? 33.368 31.895  44.737  1.00 52.89  ? 115  DG  H "C4'" 1 
ATOM   2577  O  "O4'" . DG  F 3 16  ? 34.766 32.254  44.810  1.00 51.46  ? 115  DG  H "O4'" 1 
ATOM   2578  C  "C3'" . DG  F 3 16  ? 32.837 31.958  46.163  1.00 56.12  ? 115  DG  H "C3'" 1 
ATOM   2579  O  "O3'" . DG  F 3 16  ? 32.748 30.634  46.662  1.00 61.60  ? 115  DG  H "O3'" 1 
ATOM   2580  C  "C2'" . DG  F 3 16  ? 33.917 32.722  46.915  1.00 52.57  ? 115  DG  H "C2'" 1 
ATOM   2581  C  "C1'" . DG  F 3 16  ? 35.166 32.299  46.168  1.00 48.81  ? 115  DG  H "C1'" 1 
ATOM   2582  N  N9    . DG  F 3 16  ? 36.297 33.209  46.267  1.00 43.34  ? 115  DG  H N9    1 
ATOM   2583  C  C8    . DG  F 3 16  ? 36.279 34.559  46.047  1.00 43.79  ? 115  DG  H C8    1 
ATOM   2584  N  N7    . DG  F 3 16  ? 37.452 35.112  46.164  1.00 42.76  ? 115  DG  H N7    1 
ATOM   2585  C  C5    . DG  F 3 16  ? 38.291 34.062  46.492  1.00 40.36  ? 115  DG  H C5    1 
ATOM   2586  C  C6    . DG  F 3 16  ? 39.690 34.050  46.722  1.00 39.31  ? 115  DG  H C6    1 
ATOM   2587  O  O6    . DG  F 3 16  ? 40.493 34.996  46.678  1.00 37.41  ? 115  DG  H O6    1 
ATOM   2588  N  N1    . DG  F 3 16  ? 40.138 32.777  47.027  1.00 38.18  ? 115  DG  H N1    1 
ATOM   2589  C  C2    . DG  F 3 16  ? 39.343 31.668  47.102  1.00 38.90  ? 115  DG  H C2    1 
ATOM   2590  N  N2    . DG  F 3 16  ? 39.965 30.547  47.461  1.00 41.17  ? 115  DG  H N2    1 
ATOM   2591  N  N3    . DG  F 3 16  ? 38.042 31.660  46.859  1.00 37.69  ? 115  DG  H N3    1 
ATOM   2592  C  C4    . DG  F 3 16  ? 37.588 32.883  46.570  1.00 40.03  ? 115  DG  H C4    1 
ATOM   2593  P  P     . DC  F 3 17  ? 31.588 30.251  47.677  1.00 65.14  ? 116  DC  H P     1 
ATOM   2594  O  OP1   . DC  F 3 17  ? 30.703 29.344  46.910  1.00 63.57  ? 116  DC  H OP1   1 
ATOM   2595  O  OP2   . DC  F 3 17  ? 31.045 31.486  48.279  1.00 65.91  ? 116  DC  H OP2   1 
ATOM   2596  O  "O5'" . DC  F 3 17  ? 32.391 29.499  48.821  1.00 68.71  ? 116  DC  H "O5'" 1 
ATOM   2597  C  "C5'" . DC  F 3 17  ? 33.511 28.693  48.477  1.00 75.47  ? 116  DC  H "C5'" 1 
ATOM   2598  C  "C4'" . DC  F 3 17  ? 34.678 28.939  49.408  1.00 78.71  ? 116  DC  H "C4'" 1 
ATOM   2599  O  "O4'" . DC  F 3 17  ? 35.448 30.137  49.122  1.00 79.75  ? 116  DC  H "O4'" 1 
ATOM   2600  C  "C3'" . DC  F 3 17  ? 34.365 28.994  50.900  1.00 80.64  ? 116  DC  H "C3'" 1 
ATOM   2601  O  "O3'" . DC  F 3 17  ? 35.308 28.160  51.561  1.00 81.98  ? 116  DC  H "O3'" 1 
ATOM   2602  C  "C2'" . DC  F 3 17  ? 34.692 30.435  51.253  1.00 80.92  ? 116  DC  H "C2'" 1 
ATOM   2603  C  "C1'" . DC  F 3 17  ? 35.894 30.612  50.368  1.00 79.57  ? 116  DC  H "C1'" 1 
ATOM   2604  N  N1    . DC  F 3 17  ? 36.461 31.959  50.211  1.00 79.54  ? 116  DC  H N1    1 
ATOM   2605  C  C2    . DC  F 3 17  ? 37.843 32.097  50.314  1.00 79.48  ? 116  DC  H C2    1 
ATOM   2606  O  O2    . DC  F 3 17  ? 38.525 31.084  50.531  1.00 78.60  ? 116  DC  H O2    1 
ATOM   2607  N  N3    . DC  F 3 17  ? 38.405 33.323  50.178  1.00 79.75  ? 116  DC  H N3    1 
ATOM   2608  C  C4    . DC  F 3 17  ? 37.633 34.388  49.948  1.00 79.96  ? 116  DC  H C4    1 
ATOM   2609  N  N4    . DC  F 3 17  ? 38.229 35.581  49.812  1.00 79.97  ? 116  DC  H N4    1 
ATOM   2610  C  C5    . DC  F 3 17  ? 36.217 34.278  49.843  1.00 80.29  ? 116  DC  H C5    1 
ATOM   2611  C  C6    . DC  F 3 17  ? 35.677 33.052  49.979  1.00 80.27  ? 116  DC  H C6    1 
ATOM   2612  P  P     . DA  F 3 18  ? 35.079 26.578  51.588  1.00 83.73  ? 117  DA  H P     1 
ATOM   2613  O  OP1   . DA  F 3 18  ? 35.359 26.080  50.209  1.00 82.86  ? 117  DA  H OP1   1 
ATOM   2614  O  OP2   . DA  F 3 18  ? 33.746 26.314  52.208  1.00 83.22  ? 117  DA  H OP2   1 
ATOM   2615  O  "O5'" . DA  F 3 18  ? 36.214 26.077  52.597  1.00 83.29  ? 117  DA  H "O5'" 1 
ATOM   2616  C  "C5'" . DA  F 3 18  ? 37.601 26.020  52.214  1.00 83.08  ? 117  DA  H "C5'" 1 
ATOM   2617  C  "C4'" . DA  F 3 18  ? 38.490 26.244  53.419  1.00 82.84  ? 117  DA  H "C4'" 1 
ATOM   2618  O  "O4'" . DA  F 3 18  ? 38.794 27.651  53.588  1.00 81.14  ? 117  DA  H "O4'" 1 
ATOM   2619  C  "C3'" . DA  F 3 18  ? 37.867 25.780  54.745  1.00 83.79  ? 117  DA  H "C3'" 1 
ATOM   2620  O  "O3'" . DA  F 3 18  ? 38.878 25.372  55.683  1.00 85.21  ? 117  DA  H "O3'" 1 
ATOM   2621  C  "C2'" . DA  F 3 18  ? 37.263 27.068  55.279  1.00 81.68  ? 117  DA  H "C2'" 1 
ATOM   2622  C  "C1'" . DA  F 3 18  ? 38.349 28.063  54.881  1.00 79.23  ? 117  DA  H "C1'" 1 
ATOM   2623  N  N9    . DA  F 3 18  ? 37.920 29.451  54.778  1.00 75.29  ? 117  DA  H N9    1 
ATOM   2624  C  C8    . DA  F 3 18  ? 36.649 29.968  54.833  1.00 74.74  ? 117  DA  H C8    1 
ATOM   2625  N  N7    . DA  F 3 18  ? 36.597 31.262  54.615  1.00 73.18  ? 117  DA  H N7    1 
ATOM   2626  C  C5    . DA  F 3 18  ? 37.924 31.619  54.421  1.00 71.85  ? 117  DA  H C5    1 
ATOM   2627  C  C6    . DA  F 3 18  ? 38.536 32.843  54.118  1.00 70.59  ? 117  DA  H C6    1 
ATOM   2628  N  N6    . DA  F 3 18  ? 37.859 33.981  53.923  1.00 68.74  ? 117  DA  H N6    1 
ATOM   2629  N  N1    . DA  F 3 18  ? 39.885 32.858  54.012  1.00 70.51  ? 117  DA  H N1    1 
ATOM   2630  C  C2    . DA  F 3 18  ? 40.559 31.707  54.190  1.00 70.90  ? 117  DA  H C2    1 
ATOM   2631  N  N3    . DA  F 3 18  ? 40.090 30.492  54.456  1.00 71.19  ? 117  DA  H N3    1 
ATOM   2632  C  C4    . DA  F 3 18  ? 38.752 30.517  54.555  1.00 72.73  ? 117  DA  H C4    1 
ATOM   2633  P  P     . DT  F 3 19  ? 39.752 24.047  55.421  1.00 86.26  ? 118  DT  H P     1 
ATOM   2634  O  OP1   . DT  F 3 19  ? 40.056 23.919  53.964  1.00 85.28  ? 118  DT  H OP1   1 
ATOM   2635  O  OP2   . DT  F 3 19  ? 39.073 22.921  56.130  1.00 85.77  ? 118  DT  H OP2   1 
ATOM   2636  O  "O5'" . DT  F 3 19  ? 41.121 24.400  56.164  1.00 84.65  ? 118  DT  H "O5'" 1 
ATOM   2637  C  "C5'" . DT  F 3 19  ? 42.276 24.770  55.406  1.00 84.59  ? 118  DT  H "C5'" 1 
ATOM   2638  C  "C4'" . DT  F 3 19  ? 43.261 25.549  56.253  1.00 83.90  ? 118  DT  H "C4'" 1 
ATOM   2639  O  "O4'" . DT  F 3 19  ? 42.896 26.941  56.393  1.00 81.73  ? 118  DT  H "O4'" 1 
ATOM   2640  C  "C3'" . DT  F 3 19  ? 43.472 25.027  57.666  1.00 84.47  ? 118  DT  H "C3'" 1 
ATOM   2641  O  "O3'" . DT  F 3 19  ? 44.856 25.154  57.998  1.00 87.67  ? 118  DT  H "O3'" 1 
ATOM   2642  C  "C2'" . DT  F 3 19  ? 42.632 25.974  58.505  1.00 82.64  ? 118  DT  H "C2'" 1 
ATOM   2643  C  "C1'" . DT  F 3 19  ? 42.787 27.287  57.761  1.00 79.29  ? 118  DT  H "C1'" 1 
ATOM   2644  N  N1    . DT  F 3 19  ? 41.645 28.194  57.873  1.00 77.17  ? 118  DT  H N1    1 
ATOM   2645  C  C2    . DT  F 3 19  ? 41.879 29.530  57.647  1.00 77.74  ? 118  DT  H C2    1 
ATOM   2646  O  O2    . DT  F 3 19  ? 43.001 29.982  57.462  1.00 79.32  ? 118  DT  H O2    1 
ATOM   2647  N  N3    . DT  F 3 19  ? 40.751 30.325  57.649  1.00 77.11  ? 118  DT  H N3    1 
ATOM   2648  C  C4    . DT  F 3 19  ? 39.444 29.919  57.874  1.00 75.43  ? 118  DT  H C4    1 
ATOM   2649  O  O4    . DT  F 3 19  ? 38.527 30.744  57.799  1.00 74.90  ? 118  DT  H O4    1 
ATOM   2650  C  C5    . DT  F 3 19  ? 39.282 28.498  58.174  1.00 75.08  ? 118  DT  H C5    1 
ATOM   2651  C  C7    . DT  F 3 19  ? 37.916 27.965  58.495  1.00 72.99  ? 118  DT  H C7    1 
ATOM   2652  C  C6    . DT  F 3 19  ? 40.379 27.722  58.153  1.00 75.19  ? 118  DT  H C6    1 
ATOM   2653  P  P     . DA  F 3 20  ? 45.717 23.834  58.312  1.00 89.81  ? 119  DA  H P     1 
ATOM   2654  O  OP1   . DA  F 3 20  ? 46.018 23.111  57.044  1.00 88.78  ? 119  DA  H OP1   1 
ATOM   2655  O  OP2   . DA  F 3 20  ? 45.023 23.123  59.424  1.00 90.58  ? 119  DA  H OP2   1 
ATOM   2656  O  "O5'" . DA  F 3 20  ? 47.082 24.413  58.887  1.00 88.56  ? 119  DA  H "O5'" 1 
ATOM   2657  C  "C5'" . DA  F 3 20  ? 47.808 25.429  58.193  1.00 85.13  ? 119  DA  H "C5'" 1 
ATOM   2658  C  "C4'" . DA  F 3 20  ? 48.203 26.518  59.162  1.00 82.53  ? 119  DA  H "C4'" 1 
ATOM   2659  O  "O4'" . DA  F 3 20  ? 47.025 27.293  59.485  1.00 81.28  ? 119  DA  H "O4'" 1 
ATOM   2660  C  "C3'" . DA  F 3 20  ? 48.744 25.998  60.502  1.00 81.77  ? 119  DA  H "C3'" 1 
ATOM   2661  O  "O3'" . DA  F 3 20  ? 49.798 26.848  60.993  1.00 81.14  ? 119  DA  H "O3'" 1 
ATOM   2662  C  "C2'" . DA  F 3 20  ? 47.528 26.056  61.409  1.00 80.62  ? 119  DA  H "C2'" 1 
ATOM   2663  C  "C1'" . DA  F 3 20  ? 46.841 27.303  60.890  1.00 79.65  ? 119  DA  H "C1'" 1 
ATOM   2664  N  N9    . DA  F 3 20  ? 45.409 27.389  61.147  1.00 78.01  ? 119  DA  H N9    1 
ATOM   2665  C  C8    . DA  F 3 20  ? 44.467 26.391  61.300  1.00 75.62  ? 119  DA  H C8    1 
ATOM   2666  N  N7    . DA  F 3 20  ? 43.253 26.844  61.495  1.00 74.72  ? 119  DA  H N7    1 
ATOM   2667  C  C5    . DA  F 3 20  ? 43.407 28.229  61.471  1.00 76.76  ? 119  DA  H C5    1 
ATOM   2668  C  C6    . DA  F 3 20  ? 42.491 29.282  61.586  1.00 77.17  ? 119  DA  H C6    1 
ATOM   2669  N  N6    . DA  F 3 20  ? 41.197 29.079  61.769  1.00 78.18  ? 119  DA  H N6    1 
ATOM   2670  N  N1    . DA  F 3 20  ? 42.958 30.559  61.500  1.00 76.95  ? 119  DA  H N1    1 
ATOM   2671  C  C2    . DA  F 3 20  ? 44.273 30.742  61.314  1.00 76.57  ? 119  DA  H C2    1 
ATOM   2672  N  N3    . DA  F 3 20  ? 45.243 29.824  61.188  1.00 76.65  ? 119  DA  H N3    1 
ATOM   2673  C  C4    . DA  F 3 20  ? 44.731 28.575  61.271  1.00 77.39  ? 119  DA  H C4    1 
ATOM   2674  P  P     . DC  F 3 21  ? 50.514 26.514  62.396  1.00 80.31  ? 120  DC  H P     1 
ATOM   2675  O  OP1   . DC  F 3 21  ? 51.807 27.239  62.385  1.00 80.59  ? 120  DC  H OP1   1 
ATOM   2676  O  OP2   . DC  F 3 21  ? 50.491 25.036  62.622  1.00 80.46  ? 120  DC  H OP2   1 
ATOM   2677  O  "O5'" . DC  F 3 21  ? 49.587 27.244  63.457  1.00 77.98  ? 120  DC  H "O5'" 1 
ATOM   2678  C  "C5'" . DC  F 3 21  ? 49.614 28.664  63.553  1.00 76.97  ? 120  DC  H "C5'" 1 
ATOM   2679  C  "C4'" . DC  F 3 21  ? 49.113 29.105  64.909  1.00 76.66  ? 120  DC  H "C4'" 1 
ATOM   2680  O  "O4'" . DC  F 3 21  ? 47.666 29.018  64.952  1.00 78.12  ? 120  DC  H "O4'" 1 
ATOM   2681  C  "C3'" . DC  F 3 21  ? 49.627 28.261  66.080  1.00 74.35  ? 120  DC  H "C3'" 1 
ATOM   2682  O  "O3'" . DC  F 3 21  ? 49.857 29.087  67.229  1.00 69.00  ? 120  DC  H "O3'" 1 
ATOM   2683  C  "C2'" . DC  F 3 21  ? 48.474 27.308  66.337  1.00 75.59  ? 120  DC  H "C2'" 1 
ATOM   2684  C  "C1'" . DC  F 3 21  ? 47.278 28.192  66.036  1.00 76.84  ? 120  DC  H "C1'" 1 
ATOM   2685  N  N1    . DC  F 3 21  ? 46.061 27.474  65.648  1.00 77.21  ? 120  DC  H N1    1 
ATOM   2686  C  C2    . DC  F 3 21  ? 44.839 28.047  65.963  1.00 78.31  ? 120  DC  H C2    1 
ATOM   2687  O  O2    . DC  F 3 21  ? 44.832 29.173  66.508  1.00 80.06  ? 120  DC  H O2    1 
ATOM   2688  N  N3    . DC  F 3 21  ? 43.696 27.373  65.671  1.00 77.70  ? 120  DC  H N3    1 
ATOM   2689  C  C4    . DC  F 3 21  ? 43.760 26.176  65.084  1.00 76.60  ? 120  DC  H C4    1 
ATOM   2690  N  N4    . DC  F 3 21  ? 42.612 25.526  64.852  1.00 75.98  ? 120  DC  H N4    1 
ATOM   2691  C  C5    . DC  F 3 21  ? 45.001 25.587  64.718  1.00 76.52  ? 120  DC  H C5    1 
ATOM   2692  C  C6    . DC  F 3 21  ? 46.118 26.265  65.014  1.00 76.57  ? 120  DC  H C6    1 
ATOM   2693  P  P     . DA  F 3 22  ? 50.644 28.494  68.500  1.00 66.16  ? 121  DA  H P     1 
ATOM   2694  O  OP1   . DA  F 3 22  ? 51.392 29.647  69.053  1.00 67.72  ? 121  DA  H OP1   1 
ATOM   2695  O  OP2   . DA  F 3 22  ? 51.366 27.225  68.177  1.00 64.88  ? 121  DA  H OP2   1 
ATOM   2696  O  "O5'" . DA  F 3 22  ? 49.495 28.125  69.529  1.00 61.69  ? 121  DA  H "O5'" 1 
ATOM   2697  C  "C5'" . DA  F 3 22  ? 48.704 29.139  70.121  1.00 54.56  ? 121  DA  H "C5'" 1 
ATOM   2698  C  "C4'" . DA  F 3 22  ? 47.738 28.525  71.107  1.00 50.03  ? 121  DA  H "C4'" 1 
ATOM   2699  O  "O4'" . DA  F 3 22  ? 46.683 27.810  70.422  1.00 48.22  ? 121  DA  H "O4'" 1 
ATOM   2700  C  "C3'" . DA  F 3 22  ? 48.360 27.521  72.077  1.00 46.93  ? 121  DA  H "C3'" 1 
ATOM   2701  O  "O3'" . DA  F 3 22  ? 47.797 27.739  73.372  1.00 43.39  ? 121  DA  H "O3'" 1 
ATOM   2702  C  "C2'" . DA  F 3 22  ? 47.915 26.177  71.525  1.00 45.45  ? 121  DA  H "C2'" 1 
ATOM   2703  C  "C1'" . DA  F 3 22  ? 46.536 26.532  71.012  1.00 46.11  ? 121  DA  H "C1'" 1 
ATOM   2704  N  N9    . DA  F 3 22  ? 45.932 25.644  70.017  1.00 45.17  ? 121  DA  H N9    1 
ATOM   2705  C  C8    . DA  F 3 22  ? 46.529 24.760  69.152  1.00 44.95  ? 121  DA  H C8    1 
ATOM   2706  N  N7    . DA  F 3 22  ? 45.688 24.163  68.347  1.00 43.36  ? 121  DA  H N7    1 
ATOM   2707  C  C5    . DA  F 3 22  ? 44.457 24.687  68.711  1.00 43.48  ? 121  DA  H C5    1 
ATOM   2708  C  C6    . DA  F 3 22  ? 43.174 24.488  68.220  1.00 43.43  ? 121  DA  H C6    1 
ATOM   2709  N  N6    . DA  F 3 22  ? 42.892 23.690  67.193  1.00 44.43  ? 121  DA  H N6    1 
ATOM   2710  N  N1    . DA  F 3 22  ? 42.169 25.153  68.815  1.00 43.65  ? 121  DA  H N1    1 
ATOM   2711  C  C2    . DA  F 3 22  ? 42.448 25.965  69.825  1.00 41.92  ? 121  DA  H C2    1 
ATOM   2712  N  N3    . DA  F 3 22  ? 43.608 26.246  70.364  1.00 42.13  ? 121  DA  H N3    1 
ATOM   2713  C  C4    . DA  F 3 22  ? 44.589 25.573  69.752  1.00 43.48  ? 121  DA  H C4    1 
ATOM   2714  P  P     . DT  F 3 23  ? 48.553 27.192  74.667  1.00 41.69  ? 122  DT  H P     1 
ATOM   2715  O  OP1   . DT  F 3 23  ? 47.811 27.776  75.818  1.00 38.87  ? 122  DT  H OP1   1 
ATOM   2716  O  OP2   . DT  F 3 23  ? 49.996 27.479  74.477  1.00 40.65  ? 122  DT  H OP2   1 
ATOM   2717  O  "O5'" . DT  F 3 23  ? 48.399 25.602  74.567  1.00 40.69  ? 122  DT  H "O5'" 1 
ATOM   2718  C  "C5'" . DT  F 3 23  ? 47.461 24.877  75.376  1.00 37.47  ? 122  DT  H "C5'" 1 
ATOM   2719  C  "C4'" . DT  F 3 23  ? 46.059 25.413  75.182  1.00 34.89  ? 122  DT  H "C4'" 1 
ATOM   2720  O  "O4'" . DT  F 3 23  ? 45.606 25.176  73.827  1.00 35.72  ? 122  DT  H "O4'" 1 
ATOM   2721  C  "C3'" . DT  F 3 23  ? 45.022 24.758  76.087  1.00 32.49  ? 122  DT  H "C3'" 1 
ATOM   2722  O  "O3'" . DT  F 3 23  ? 44.239 25.707  76.745  1.00 29.60  ? 122  DT  H "O3'" 1 
ATOM   2723  C  "C2'" . DT  F 3 23  ? 44.099 24.011  75.157  1.00 34.66  ? 122  DT  H "C2'" 1 
ATOM   2724  C  "C1'" . DT  F 3 23  ? 44.265 24.723  73.838  1.00 35.31  ? 122  DT  H "C1'" 1 
ATOM   2725  N  N1    . DT  F 3 23  ? 44.082 23.792  72.705  1.00 35.64  ? 122  DT  H N1    1 
ATOM   2726  C  C2    . DT  F 3 23  ? 42.811 23.588  72.241  1.00 35.39  ? 122  DT  H C2    1 
ATOM   2727  O  O2    . DT  F 3 23  ? 41.842 24.160  72.692  1.00 36.38  ? 122  DT  H O2    1 
ATOM   2728  N  N3    . DT  F 3 23  ? 42.712 22.689  71.222  1.00 36.26  ? 122  DT  H N3    1 
ATOM   2729  C  C4    . DT  F 3 23  ? 43.736 21.999  70.614  1.00 36.56  ? 122  DT  H C4    1 
ATOM   2730  O  O4    . DT  F 3 23  ? 43.491 21.233  69.669  1.00 38.26  ? 122  DT  H O4    1 
ATOM   2731  C  C5    . DT  F 3 23  ? 45.053 22.264  71.152  1.00 35.53  ? 122  DT  H C5    1 
ATOM   2732  C  C7    . DT  F 3 23  ? 46.234 21.554  70.569  1.00 34.20  ? 122  DT  H C7    1 
ATOM   2733  C  C6    . DT  F 3 23  ? 45.157 23.140  72.155  1.00 34.37  ? 122  DT  H C6    1 
ATOM   2734  P  P     . DT  F 3 24  ? 43.494 25.278  78.080  1.00 28.97  ? 123  DT  H P     1 
ATOM   2735  O  OP1   . DT  F 3 24  ? 43.094 26.500  78.809  1.00 27.91  ? 123  DT  H OP1   1 
ATOM   2736  O  OP2   . DT  F 3 24  ? 44.280 24.244  78.759  1.00 28.14  ? 123  DT  H OP2   1 
ATOM   2737  O  "O5'" . DT  F 3 24  ? 42.213 24.526  77.548  1.00 29.53  ? 123  DT  H "O5'" 1 
ATOM   2738  C  "C5'" . DT  F 3 24  ? 41.043 25.255  77.250  1.00 29.63  ? 123  DT  H "C5'" 1 
ATOM   2739  C  "C4'" . DT  F 3 24  ? 39.887 24.308  77.058  1.00 29.77  ? 123  DT  H "C4'" 1 
ATOM   2740  O  "O4'" . DT  F 3 24  ? 40.060 23.592  75.818  1.00 31.16  ? 123  DT  H "O4'" 1 
ATOM   2741  C  "C3'" . DT  F 3 24  ? 39.733 23.244  78.142  1.00 28.16  ? 123  DT  H "C3'" 1 
ATOM   2742  O  "O3'" . DT  F 3 24  ? 38.355 23.032  78.342  1.00 26.07  ? 123  DT  H "O3'" 1 
ATOM   2743  C  "C2'" . DT  F 3 24  ? 40.306 22.011  77.486  1.00 28.43  ? 123  DT  H "C2'" 1 
ATOM   2744  C  "C1'" . DT  F 3 24  ? 39.847 22.225  76.066  1.00 30.36  ? 123  DT  H "C1'" 1 
ATOM   2745  N  N1    . DT  F 3 24  ? 40.537 21.473  75.023  1.00 31.19  ? 123  DT  H N1    1 
ATOM   2746  C  C2    . DT  F 3 24  ? 39.779 21.046  73.966  1.00 33.15  ? 123  DT  H C2    1 
ATOM   2747  O  O2    . DT  F 3 24  ? 38.582 21.258  73.876  1.00 35.10  ? 123  DT  H O2    1 
ATOM   2748  N  N3    . DT  F 3 24  ? 40.467 20.360  73.019  1.00 33.61  ? 123  DT  H N3    1 
ATOM   2749  C  C4    . DT  F 3 24  ? 41.799 20.059  73.036  1.00 33.01  ? 123  DT  H C4    1 
ATOM   2750  O  O4    . DT  F 3 24  ? 42.287 19.445  72.107  1.00 35.99  ? 123  DT  H O4    1 
ATOM   2751  C  C5    . DT  F 3 24  ? 42.522 20.515  74.186  1.00 30.84  ? 123  DT  H C5    1 
ATOM   2752  C  C7    . DT  F 3 24  ? 43.962 20.171  74.312  1.00 31.61  ? 123  DT  H C7    1 
ATOM   2753  C  C6    . DT  F 3 24  ? 41.870 21.208  75.101  1.00 29.66  ? 123  DT  H C6    1 
ATOM   2754  P  P     . DA  F 3 25  ? 37.852 22.237  79.620  1.00 27.44  ? 124  DA  H P     1 
ATOM   2755  O  OP1   . DA  F 3 25  ? 37.074 23.211  80.402  1.00 26.92  ? 124  DA  H OP1   1 
ATOM   2756  O  OP2   . DA  F 3 25  ? 38.955 21.493  80.253  1.00 26.57  ? 124  DA  H OP2   1 
ATOM   2757  O  "O5'" . DA  F 3 25  ? 36.846 21.194  78.985  1.00 28.55  ? 124  DA  H "O5'" 1 
ATOM   2758  C  "C5'" . DA  F 3 25  ? 35.817 21.690  78.154  1.00 30.91  ? 124  DA  H "C5'" 1 
ATOM   2759  C  "C4'" . DA  F 3 25  ? 35.401 20.687  77.106  1.00 29.99  ? 124  DA  H "C4'" 1 
ATOM   2760  O  "O4'" . DA  F 3 25  ? 36.463 20.423  76.157  1.00 28.73  ? 124  DA  H "O4'" 1 
ATOM   2761  C  "C3'" . DA  F 3 25  ? 34.956 19.345  77.657  1.00 30.19  ? 124  DA  H "C3'" 1 
ATOM   2762  O  "O3'" . DA  F 3 25  ? 33.582 19.109  77.387  1.00 31.39  ? 124  DA  H "O3'" 1 
ATOM   2763  C  "C2'" . DA  F 3 25  ? 35.797 18.343  76.897  1.00 30.79  ? 124  DA  H "C2'" 1 
ATOM   2764  C  "C1'" . DA  F 3 25  ? 36.356 19.101  75.717  1.00 30.55  ? 124  DA  H "C1'" 1 
ATOM   2765  N  N9    . DA  F 3 25  ? 37.700 18.611  75.429  1.00 33.21  ? 124  DA  H N9    1 
ATOM   2766  C  C8    . DA  F 3 25  ? 38.865 18.898  76.079  1.00 33.14  ? 124  DA  H C8    1 
ATOM   2767  N  N7    . DA  F 3 25  ? 39.894 18.206  75.649  1.00 34.08  ? 124  DA  H N7    1 
ATOM   2768  C  C5    . DA  F 3 25  ? 39.369 17.426  74.634  1.00 35.93  ? 124  DA  H C5    1 
ATOM   2769  C  C6    . DA  F 3 25  ? 39.943 16.471  73.773  1.00 38.13  ? 124  DA  H C6    1 
ATOM   2770  N  N6    . DA  F 3 25  ? 41.211 16.077  73.835  1.00 40.70  ? 124  DA  H N6    1 
ATOM   2771  N  N1    . DA  F 3 25  ? 39.156 15.917  72.838  1.00 37.55  ? 124  DA  H N1    1 
ATOM   2772  C  C2    . DA  F 3 25  ? 37.882 16.286  72.785  1.00 37.91  ? 124  DA  H C2    1 
ATOM   2773  N  N3    . DA  F 3 25  ? 37.217 17.149  73.546  1.00 36.90  ? 124  DA  H N3    1 
ATOM   2774  C  C4    . DA  F 3 25  ? 38.029 17.691  74.465  1.00 35.24  ? 124  DA  H C4    1 
ATOM   2775  P  P     . DT  F 3 26  ? 32.819 17.934  78.169  1.00 31.67  ? 125  DT  H P     1 
ATOM   2776  O  OP1   . DT  F 3 26  ? 31.518 18.459  78.660  1.00 29.99  ? 125  DT  H OP1   1 
ATOM   2777  O  OP2   . DT  F 3 26  ? 33.777 17.328  79.125  1.00 28.93  ? 125  DT  H OP2   1 
ATOM   2778  O  "O5'" . DT  F 3 26  ? 32.538 16.879  77.009  1.00 32.03  ? 125  DT  H "O5'" 1 
ATOM   2779  C  "C5'" . DT  F 3 26  ? 31.796 17.256  75.849  1.00 31.50  ? 125  DT  H "C5'" 1 
ATOM   2780  C  "C4'" . DT  F 3 26  ? 31.988 16.232  74.757  1.00 31.93  ? 125  DT  H "C4'" 1 
ATOM   2781  O  "O4'" . DT  F 3 26  ? 33.405 16.032  74.579  1.00 30.64  ? 125  DT  H "O4'" 1 
ATOM   2782  C  "C3'" . DT  F 3 26  ? 31.413 14.832  75.017  1.00 33.94  ? 125  DT  H "C3'" 1 
ATOM   2783  O  "O3'" . DT  F 3 26  ? 31.025 14.256  73.750  1.00 38.10  ? 125  DT  H "O3'" 1 
ATOM   2784  C  "C2'" . DT  F 3 26  ? 32.623 14.084  75.535  1.00 31.64  ? 125  DT  H "C2'" 1 
ATOM   2785  C  "C1'" . DT  F 3 26  ? 33.669 14.657  74.627  1.00 29.15  ? 125  DT  H "C1'" 1 
ATOM   2786  N  N1    . DT  F 3 26  ? 35.038 14.478  75.039  1.00 29.00  ? 125  DT  H N1    1 
ATOM   2787  C  C2    . DT  F 3 26  ? 35.794 13.732  74.207  1.00 29.90  ? 125  DT  H C2    1 
ATOM   2788  O  O2    . DT  F 3 26  ? 35.327 13.213  73.223  1.00 32.22  ? 125  DT  H O2    1 
ATOM   2789  N  N3    . DT  F 3 26  ? 37.108 13.615  74.557  1.00 29.61  ? 125  DT  H N3    1 
ATOM   2790  C  C4    . DT  F 3 26  ? 37.713 14.172  75.649  1.00 30.35  ? 125  DT  H C4    1 
ATOM   2791  O  O4    . DT  F 3 26  ? 38.909 14.020  75.820  1.00 32.80  ? 125  DT  H O4    1 
ATOM   2792  C  C5    . DT  F 3 26  ? 36.843 14.924  76.520  1.00 30.29  ? 125  DT  H C5    1 
ATOM   2793  C  C7    . DT  F 3 26  ? 37.413 15.542  77.753  1.00 29.70  ? 125  DT  H C7    1 
ATOM   2794  C  C6    . DT  F 3 26  ? 35.555 15.036  76.177  1.00 29.48  ? 125  DT  H C6    1 
ATOM   2795  P  P     . DA  F 3 27  ? 29.926 13.085  73.682  1.00 39.10  ? 126  DA  H P     1 
ATOM   2796  O  OP1   . DA  F 3 27  ? 28.668 13.658  73.140  1.00 38.40  ? 126  DA  H OP1   1 
ATOM   2797  O  OP2   . DA  F 3 27  ? 29.914 12.403  74.999  1.00 36.54  ? 126  DA  H OP2   1 
ATOM   2798  O  "O5'" . DA  F 3 27  ? 30.519 12.122  72.562  1.00 38.82  ? 126  DA  H "O5'" 1 
ATOM   2799  C  "C5'" . DA  F 3 27  ? 31.899 11.773  72.563  1.00 38.77  ? 126  DA  H "C5'" 1 
ATOM   2800  C  "C4'" . DA  F 3 27  ? 32.121 10.509  71.765  1.00 39.46  ? 126  DA  H "C4'" 1 
ATOM   2801  O  "O4'" . DA  F 3 27  ? 33.506 10.127  71.888  1.00 38.28  ? 126  DA  H "O4'" 1 
ATOM   2802  C  "C3'" . DA  F 3 27  ? 31.330 9.309   72.273  1.00 39.35  ? 126  DA  H "C3'" 1 
ATOM   2803  O  "O3'" . DA  F 3 27  ? 31.075 8.400   71.194  1.00 39.48  ? 126  DA  H "O3'" 1 
ATOM   2804  C  "C2'" . DA  F 3 27  ? 32.258 8.711   73.308  1.00 39.35  ? 126  DA  H "C2'" 1 
ATOM   2805  C  "C1'" . DA  F 3 27  ? 33.654 9.053   72.807  1.00 37.78  ? 126  DA  H "C1'" 1 
ATOM   2806  N  N9    . DA  F 3 27  ? 34.536 9.524   73.876  1.00 37.73  ? 126  DA  H N9    1 
ATOM   2807  C  C8    . DA  F 3 27  ? 34.214 10.465  74.816  1.00 39.00  ? 126  DA  H C8    1 
ATOM   2808  N  N7    . DA  F 3 27  ? 35.202 10.773  75.617  1.00 38.42  ? 126  DA  H N7    1 
ATOM   2809  C  C5    . DA  F 3 27  ? 36.241 9.974   75.180  1.00 36.79  ? 126  DA  H C5    1 
ATOM   2810  C  C6    . DA  F 3 27  ? 37.555 9.865   75.597  1.00 36.74  ? 126  DA  H C6    1 
ATOM   2811  N  N6    . DA  F 3 27  ? 38.065 10.628  76.552  1.00 39.09  ? 126  DA  H N6    1 
ATOM   2812  N  N1    . DA  F 3 27  ? 38.345 8.960   74.988  1.00 36.13  ? 126  DA  H N1    1 
ATOM   2813  C  C2    . DA  F 3 27  ? 37.827 8.239   74.003  1.00 36.05  ? 126  DA  H C2    1 
ATOM   2814  N  N3    . DA  F 3 27  ? 36.594 8.268   73.497  1.00 36.96  ? 126  DA  H N3    1 
ATOM   2815  C  C4    . DA  F 3 27  ? 35.841 9.173   74.137  1.00 36.78  ? 126  DA  H C4    1 
ATOM   2816  P  P     . DC  F 3 28  ? 30.109 7.140   71.414  1.00 38.45  ? 127  DC  H P     1 
ATOM   2817  O  OP1   . DC  F 3 28  ? 29.900 6.546   70.076  1.00 38.75  ? 127  DC  H OP1   1 
ATOM   2818  O  OP2   . DC  F 3 28  ? 28.930 7.575   72.198  1.00 39.25  ? 127  DC  H OP2   1 
ATOM   2819  O  "O5'" . DC  F 3 28  ? 31.011 6.147   72.270  1.00 38.98  ? 127  DC  H "O5'" 1 
ATOM   2820  C  "C5'" . DC  F 3 28  ? 32.077 5.454   71.644  1.00 43.63  ? 127  DC  H "C5'" 1 
ATOM   2821  C  "C4'" . DC  F 3 28  ? 32.736 4.498   72.606  1.00 49.28  ? 127  DC  H "C4'" 1 
ATOM   2822  O  "O4'" . DC  F 3 28  ? 33.714 5.170   73.426  1.00 50.94  ? 127  DC  H "O4'" 1 
ATOM   2823  C  "C3'" . DC  F 3 28  ? 31.810 3.763   73.576  1.00 53.45  ? 127  DC  H "C3'" 1 
ATOM   2824  O  "O3'" . DC  F 3 28  ? 32.306 2.427   73.749  1.00 58.96  ? 127  DC  H "O3'" 1 
ATOM   2825  C  "C2'" . DC  F 3 28  ? 32.035 4.517   74.873  1.00 51.61  ? 127  DC  H "C2'" 1 
ATOM   2826  C  "C1'" . DC  F 3 28  ? 33.521 4.755   74.760  1.00 50.81  ? 127  DC  H "C1'" 1 
ATOM   2827  N  N1    . DC  F 3 28  ? 34.068 5.776   75.645  1.00 50.30  ? 127  DC  H N1    1 
ATOM   2828  C  C2    . DC  F 3 28  ? 35.418 5.704   76.015  1.00 51.10  ? 127  DC  H C2    1 
ATOM   2829  O  O2    . DC  F 3 28  ? 36.141 4.822   75.515  1.00 50.99  ? 127  DC  H O2    1 
ATOM   2830  N  N3    . DC  F 3 28  ? 35.899 6.596   76.904  1.00 51.20  ? 127  DC  H N3    1 
ATOM   2831  C  C4    . DC  F 3 28  ? 35.094 7.528   77.410  1.00 50.72  ? 127  DC  H C4    1 
ATOM   2832  N  N4    . DC  F 3 28  ? 35.581 8.340   78.336  1.00 52.21  ? 127  DC  H N4    1 
ATOM   2833  C  C5    . DC  F 3 28  ? 33.741 7.654   77.005  1.00 50.63  ? 127  DC  H C5    1 
ATOM   2834  C  C6    . DC  F 3 28  ? 33.273 6.766   76.131  1.00 49.69  ? 127  DC  H C6    1 
ATOM   2835  P  P     . DG  F 3 29  ? 31.311 1.169   73.621  1.00 62.69  ? 128  DG  H P     1 
ATOM   2836  O  OP1   . DG  F 3 29  ? 30.943 1.038   72.173  1.00 61.81  ? 128  DG  H OP1   1 
ATOM   2837  O  OP2   . DG  F 3 29  ? 30.240 1.242   74.670  1.00 60.50  ? 128  DG  H OP2   1 
ATOM   2838  O  "O5'" . DG  F 3 29  ? 32.276 -0.039  73.959  1.00 62.44  ? 128  DG  H "O5'" 1 
ATOM   2839  C  "C5'" . DG  F 3 29  ? 33.386 -0.287  73.115  1.00 64.53  ? 128  DG  H "C5'" 1 
ATOM   2840  C  "C4'" . DG  F 3 29  ? 34.568 -0.729  73.939  1.00 65.69  ? 128  DG  H "C4'" 1 
ATOM   2841  O  "O4'" . DG  F 3 29  ? 35.019 0.376   74.762  1.00 64.41  ? 128  DG  H "O4'" 1 
ATOM   2842  C  "C3'" . DG  F 3 29  ? 34.247 -1.879  74.891  1.00 68.17  ? 128  DG  H "C3'" 1 
ATOM   2843  O  "O3'" . DG  F 3 29  ? 35.353 -2.799  74.876  1.00 73.82  ? 128  DG  H "O3'" 1 
ATOM   2844  C  "C2'" . DG  F 3 29  ? 34.051 -1.174  76.228  1.00 65.44  ? 128  DG  H "C2'" 1 
ATOM   2845  C  "C1'" . DG  F 3 29  ? 35.020 0.001   76.134  1.00 62.50  ? 128  DG  H "C1'" 1 
ATOM   2846  N  N9    . DG  F 3 29  ? 34.699 1.190   76.938  1.00 58.85  ? 128  DG  H N9    1 
ATOM   2847  C  C8    . DG  F 3 29  ? 33.477 1.811   77.047  1.00 56.93  ? 128  DG  H C8    1 
ATOM   2848  N  N7    . DG  F 3 29  ? 33.505 2.867   77.811  1.00 54.28  ? 128  DG  H N7    1 
ATOM   2849  C  C5    . DG  F 3 29  ? 34.819 2.945   78.245  1.00 54.53  ? 128  DG  H C5    1 
ATOM   2850  C  C6    . DG  F 3 29  ? 35.438 3.883   79.093  1.00 54.95  ? 128  DG  H C6    1 
ATOM   2851  O  O6    . DG  F 3 29  ? 34.930 4.855   79.663  1.00 54.95  ? 128  DG  H O6    1 
ATOM   2852  N  N1    . DG  F 3 29  ? 36.789 3.610   79.262  1.00 54.05  ? 128  DG  H N1    1 
ATOM   2853  C  C2    . DG  F 3 29  ? 37.455 2.570   78.689  1.00 53.84  ? 128  DG  H C2    1 
ATOM   2854  N  N2    . DG  F 3 29  ? 38.764 2.500   78.953  1.00 53.65  ? 128  DG  H N2    1 
ATOM   2855  N  N3    . DG  F 3 29  ? 36.885 1.672   77.907  1.00 54.47  ? 128  DG  H N3    1 
ATOM   2856  C  C4    . DG  F 3 29  ? 35.572 1.922   77.725  1.00 55.65  ? 128  DG  H C4    1 
ATOM   2857  P  P     . DA  F 3 30  ? 35.188 -4.296  75.458  1.00 78.63  ? 129  DA  H P     1 
ATOM   2858  O  OP1   . DA  F 3 30  ? 35.482 -5.208  74.326  1.00 79.24  ? 129  DA  H OP1   1 
ATOM   2859  O  OP2   . DA  F 3 30  ? 33.899 -4.437  76.208  1.00 76.87  ? 129  DA  H OP2   1 
ATOM   2860  O  "O5'" . DA  F 3 30  ? 36.403 -4.360  76.482  1.00 79.20  ? 129  DA  H "O5'" 1 
ATOM   2861  C  "C5'" . DA  F 3 30  ? 36.838 -3.150  77.083  1.00 81.65  ? 129  DA  H "C5'" 1 
ATOM   2862  C  "C4'" . DA  F 3 30  ? 37.956 -3.385  78.066  1.00 82.37  ? 129  DA  H "C4'" 1 
ATOM   2863  O  "O4'" . DA  F 3 30  ? 38.040 -2.179  78.859  1.00 81.92  ? 129  DA  H "O4'" 1 
ATOM   2864  C  "C3'" . DA  F 3 30  ? 37.689 -4.497  79.071  1.00 84.04  ? 129  DA  H "C3'" 1 
ATOM   2865  O  "O3'" . DA  F 3 30  ? 38.944 -4.987  79.557  1.00 85.93  ? 129  DA  H "O3'" 1 
ATOM   2866  C  "C2'" . DA  F 3 30  ? 36.882 -3.800  80.152  1.00 82.70  ? 129  DA  H "C2'" 1 
ATOM   2867  C  "C1'" . DA  F 3 30  ? 37.387 -2.358  80.114  1.00 80.96  ? 129  DA  H "C1'" 1 
ATOM   2868  N  N9    . DA  F 3 30  ? 36.297 -1.375  80.212  1.00 78.75  ? 129  DA  H N9    1 
ATOM   2869  C  C8    . DA  F 3 30  ? 35.010 -1.503  79.726  1.00 77.17  ? 129  DA  H C8    1 
ATOM   2870  N  N7    . DA  F 3 30  ? 34.234 -0.484  80.006  1.00 75.60  ? 129  DA  H N7    1 
ATOM   2871  C  C5    . DA  F 3 30  ? 35.060 0.378   80.710  1.00 75.97  ? 129  DA  H C5    1 
ATOM   2872  C  C6    . DA  F 3 30  ? 34.827 1.620   81.294  1.00 75.80  ? 129  DA  H C6    1 
ATOM   2873  N  N6    . DA  F 3 30  ? 33.637 2.227   81.278  1.00 75.89  ? 129  DA  H N6    1 
ATOM   2874  N  N1    . DA  F 3 30  ? 35.863 2.226   81.914  1.00 74.99  ? 129  DA  H N1    1 
ATOM   2875  C  C2    . DA  F 3 30  ? 37.045 1.598   81.954  1.00 74.83  ? 129  DA  H C2    1 
ATOM   2876  N  N3    . DA  F 3 30  ? 37.385 0.418   81.457  1.00 75.23  ? 129  DA  H N3    1 
ATOM   2877  C  C4    . DA  F 3 30  ? 36.337 -0.148  80.835  1.00 76.71  ? 129  DA  H C4    1 
ATOM   2878  P  P     . DA  F 3 31  ? 38.979 -6.077  80.737  1.00 86.95  ? 130  DA  H P     1 
ATOM   2879  O  OP1   . DA  F 3 31  ? 40.174 -6.926  80.445  1.00 86.97  ? 130  DA  H OP1   1 
ATOM   2880  O  OP2   . DA  F 3 31  ? 37.618 -6.704  80.876  1.00 84.86  ? 130  DA  H OP2   1 
ATOM   2881  O  "O5'" . DA  F 3 31  ? 39.268 -5.209  82.044  1.00 85.13  ? 130  DA  H "O5'" 1 
ATOM   2882  C  "C5'" . DA  F 3 31  ? 40.430 -4.382  82.132  1.00 84.00  ? 130  DA  H "C5'" 1 
ATOM   2883  C  "C4'" . DA  F 3 31  ? 40.394 -3.552  83.396  1.00 83.82  ? 130  DA  H "C4'" 1 
ATOM   2884  O  "O4'" . DA  F 3 31  ? 39.327 -2.563  83.305  1.00 82.76  ? 130  DA  H "O4'" 1 
ATOM   2885  C  "C3'" . DA  F 3 31  ? 40.134 -4.355  84.677  1.00 84.72  ? 130  DA  H "C3'" 1 
ATOM   2886  O  "O3'" . DA  F 3 31  ? 41.057 -4.023  85.726  1.00 85.85  ? 130  DA  H "O3'" 1 
ATOM   2887  C  "C2'" . DA  F 3 31  ? 38.721 -3.962  85.078  1.00 83.33  ? 130  DA  H "C2'" 1 
ATOM   2888  C  "C1'" . DA  F 3 31  ? 38.572 -2.559  84.509  1.00 81.18  ? 130  DA  H "C1'" 1 
ATOM   2889  N  N9    . DA  F 3 31  ? 37.180 -2.217  84.195  1.00 78.53  ? 130  DA  H N9    1 
ATOM   2890  C  C8    . DA  F 3 31  ? 36.281 -2.954  83.463  1.00 77.29  ? 130  DA  H C8    1 
ATOM   2891  N  N7    . DA  F 3 31  ? 35.081 -2.429  83.413  1.00 75.81  ? 130  DA  H N7    1 
ATOM   2892  C  C5    . DA  F 3 31  ? 35.201 -1.259  84.147  1.00 76.10  ? 130  DA  H C5    1 
ATOM   2893  C  C6    . DA  F 3 31  ? 34.277 -0.255  84.476  1.00 76.24  ? 130  DA  H C6    1 
ATOM   2894  N  N6    . DA  F 3 31  ? 32.988 -0.279  84.110  1.00 76.52  ? 130  DA  H N6    1 
ATOM   2895  N  N1    . DA  F 3 31  ? 34.721 0.786   85.210  1.00 75.93  ? 130  DA  H N1    1 
ATOM   2896  C  C2    . DA  F 3 31  ? 36.002 0.798   85.592  1.00 75.83  ? 130  DA  H C2    1 
ATOM   2897  N  N3    . DA  F 3 31  ? 36.962 -0.091  85.356  1.00 76.26  ? 130  DA  H N3    1 
ATOM   2898  C  C4    . DA  F 3 31  ? 36.492 -1.106  84.619  1.00 76.60  ? 130  DA  H C4    1 
ATOM   2899  P  P     . DG  F 3 32  ? 41.047 -4.879  87.096  1.00 86.48  ? 131  DG  H P     1 
ATOM   2900  O  OP1   . DG  F 3 32  ? 42.466 -5.026  87.506  1.00 86.84  ? 131  DG  H OP1   1 
ATOM   2901  O  OP2   . DG  F 3 32  ? 40.195 -6.091  86.905  1.00 85.18  ? 131  DG  H OP2   1 
ATOM   2902  O  "O5'" . DG  F 3 32  ? 40.346 -3.909  88.150  1.00 84.99  ? 131  DG  H "O5'" 1 
ATOM   2903  C  "C5'" . DG  F 3 32  ? 40.884 -2.607  88.367  1.00 82.12  ? 131  DG  H "C5'" 1 
ATOM   2904  C  "C4'" . DG  F 3 32  ? 39.902 -1.715  89.096  1.00 79.61  ? 131  DG  H "C4'" 1 
ATOM   2905  O  "O4'" . DG  F 3 32  ? 38.714 -1.457  88.303  1.00 77.67  ? 131  DG  H "O4'" 1 
ATOM   2906  C  "C3'" . DG  F 3 32  ? 39.411 -2.186  90.469  1.00 78.64  ? 131  DG  H "C3'" 1 
ATOM   2907  O  "O3'" . DG  F 3 32  ? 39.606 -1.148  91.426  1.00 79.13  ? 131  DG  H "O3'" 1 
ATOM   2908  C  "C2'" . DG  F 3 32  ? 37.920 -2.384  90.270  1.00 76.43  ? 131  DG  H "C2'" 1 
ATOM   2909  C  "C1'" . DG  F 3 32  ? 37.617 -1.372  89.188  1.00 74.41  ? 131  DG  H "C1'" 1 
ATOM   2910  N  N9    . DG  F 3 32  ? 36.393 -1.655  88.448  1.00 71.12  ? 131  DG  H N9    1 
ATOM   2911  C  C8    . DG  F 3 32  ? 36.126 -2.728  87.632  1.00 69.39  ? 131  DG  H C8    1 
ATOM   2912  N  N7    . DG  F 3 32  ? 34.892 -2.749  87.204  1.00 67.64  ? 131  DG  H N7    1 
ATOM   2913  C  C5    . DG  F 3 32  ? 34.321 -1.609  87.752  1.00 67.70  ? 131  DG  H C5    1 
ATOM   2914  C  C6    . DG  F 3 32  ? 32.992 -1.107  87.663  1.00 67.44  ? 131  DG  H C6    1 
ATOM   2915  O  O6    . DG  F 3 32  ? 32.018 -1.605  87.080  1.00 68.50  ? 131  DG  H O6    1 
ATOM   2916  N  N1    . DG  F 3 32  ? 32.847 0.096   88.358  1.00 66.46  ? 131  DG  H N1    1 
ATOM   2917  C  C2    . DG  F 3 32  ? 33.851 0.730   89.054  1.00 66.95  ? 131  DG  H C2    1 
ATOM   2918  N  N2    . DG  F 3 32  ? 33.528 1.894   89.645  1.00 65.02  ? 131  DG  H N2    1 
ATOM   2919  N  N3    . DG  F 3 32  ? 35.090 0.259   89.160  1.00 68.03  ? 131  DG  H N3    1 
ATOM   2920  C  C4    . DG  F 3 32  ? 35.247 -0.906  88.492  1.00 68.97  ? 131  DG  H C4    1 
ATOM   2921  P  P     . DT  F 3 33  ? 39.601 -1.499  92.994  1.00 80.78  ? 132  DT  H P     1 
ATOM   2922  O  OP1   . DT  F 3 33  ? 40.677 -0.687  93.621  1.00 80.53  ? 132  DT  H OP1   1 
ATOM   2923  O  OP2   . DT  F 3 33  ? 39.583 -2.974  93.192  1.00 80.45  ? 132  DT  H OP2   1 
ATOM   2924  O  "O5'" . DT  F 3 33  ? 38.208 -0.914  93.478  1.00 78.46  ? 132  DT  H "O5'" 1 
ATOM   2925  C  "C5'" . DT  F 3 33  ? 37.996 0.479   93.412  1.00 78.18  ? 132  DT  H "C5'" 1 
ATOM   2926  C  "C4'" . DT  F 3 33  ? 36.622 0.823   93.919  1.00 77.79  ? 132  DT  H "C4'" 1 
ATOM   2927  O  "O4'" . DT  F 3 33  ? 35.596 0.541   92.939  1.00 77.47  ? 132  DT  H "O4'" 1 
ATOM   2928  C  "C3'" . DT  F 3 33  ? 36.227 0.061   95.174  1.00 78.41  ? 132  DT  H "C3'" 1 
ATOM   2929  O  "O3'" . DT  F 3 33  ? 35.534 0.975   96.005  1.00 79.36  ? 132  DT  H "O3'" 1 
ATOM   2930  C  "C2'" . DT  F 3 33  ? 35.249 -0.973  94.645  1.00 77.99  ? 132  DT  H "C2'" 1 
ATOM   2931  C  "C1'" . DT  F 3 33  ? 34.551 -0.147  93.590  1.00 76.56  ? 132  DT  H "C1'" 1 
ATOM   2932  N  N1    . DT  F 3 33  ? 33.766 -0.875  92.579  1.00 75.22  ? 132  DT  H N1    1 
ATOM   2933  C  C2    . DT  F 3 33  ? 32.497 -0.406  92.311  1.00 74.66  ? 132  DT  H C2    1 
ATOM   2934  O  O2    . DT  F 3 33  ? 32.020 0.571   92.862  1.00 75.54  ? 132  DT  H O2    1 
ATOM   2935  N  N3    . DT  F 3 33  ? 31.805 -1.125  91.372  1.00 73.21  ? 132  DT  H N3    1 
ATOM   2936  C  C4    . DT  F 3 33  ? 32.244 -2.239  90.695  1.00 72.68  ? 132  DT  H C4    1 
ATOM   2937  O  O4    . DT  F 3 33  ? 31.502 -2.796  89.894  1.00 71.87  ? 132  DT  H O4    1 
ATOM   2938  C  C5    . DT  F 3 33  ? 33.588 -2.666  91.014  1.00 72.24  ? 132  DT  H C5    1 
ATOM   2939  C  C7    . DT  F 3 33  ? 34.152 -3.855  90.312  1.00 72.42  ? 132  DT  H C7    1 
ATOM   2940  C  C6    . DT  F 3 33  ? 34.274 -1.974  91.928  1.00 73.28  ? 132  DT  H C6    1 
ATOM   2941  P  P     . DT  F 3 34  ? 35.700 0.891   97.590  1.00 80.02  ? 133  DT  H P     1 
ATOM   2942  O  OP1   . DT  F 3 34  ? 36.427 2.132   97.995  1.00 80.19  ? 133  DT  H OP1   1 
ATOM   2943  O  OP2   . DT  F 3 34  ? 36.250 -0.447  97.943  1.00 79.06  ? 133  DT  H OP2   1 
ATOM   2944  O  "O5'" . DT  F 3 34  ? 34.196 1.018   98.083  1.00 79.13  ? 133  DT  H "O5'" 1 
ATOM   2945  C  "C5'" . DT  F 3 34  ? 33.437 2.160   97.696  1.00 78.07  ? 133  DT  H "C5'" 1 
ATOM   2946  C  "C4'" . DT  F 3 34  ? 31.965 1.833   97.640  1.00 77.01  ? 133  DT  H "C4'" 1 
ATOM   2947  O  "O4'" . DT  F 3 34  ? 31.582 1.136   96.423  1.00 75.49  ? 133  DT  H "O4'" 1 
ATOM   2948  C  "C3'" . DT  F 3 34  ? 31.487 0.969   98.800  1.00 77.35  ? 133  DT  H "C3'" 1 
ATOM   2949  O  "O3'" . DT  F 3 34  ? 30.272 1.507   99.288  1.00 79.47  ? 133  DT  H "O3'" 1 
ATOM   2950  C  "C2'" . DT  F 3 34  ? 31.216 -0.367  98.139  1.00 76.47  ? 133  DT  H "C2'" 1 
ATOM   2951  C  "C1'" . DT  F 3 34  ? 30.703 0.097   96.793  1.00 73.85  ? 133  DT  H "C1'" 1 
ATOM   2952  N  N1    . DT  F 3 34  ? 30.668 -0.925  95.727  1.00 70.54  ? 133  DT  H N1    1 
ATOM   2953  C  C2    . DT  F 3 34  ? 29.612 -0.869  94.832  1.00 69.15  ? 133  DT  H C2    1 
ATOM   2954  O  O2    . DT  F 3 34  ? 28.772 0.021   94.833  1.00 66.06  ? 133  DT  H O2    1 
ATOM   2955  N  N3    . DT  F 3 34  ? 29.579 -1.900  93.927  1.00 68.58  ? 133  DT  H N3    1 
ATOM   2956  C  C4    . DT  F 3 34  ? 30.481 -2.941  93.815  1.00 68.05  ? 133  DT  H C4    1 
ATOM   2957  O  O4    . DT  F 3 34  ? 30.305 -3.801  92.966  1.00 68.46  ? 133  DT  H O4    1 
ATOM   2958  C  C5    . DT  F 3 34  ? 31.588 -2.913  94.752  1.00 67.67  ? 133  DT  H C5    1 
ATOM   2959  C  C7    . DT  F 3 34  ? 32.630 -3.983  94.674  1.00 65.80  ? 133  DT  H C7    1 
ATOM   2960  C  C6    . DT  F 3 34  ? 31.625 -1.918  95.650  1.00 68.46  ? 133  DT  H C6    1 
ATOM   2961  P  P     . DA  F 3 35  ? 30.088 1.716   100.862 1.00 83.42  ? 134  DA  H P     1 
ATOM   2962  O  OP1   . DA  F 3 35  ? 31.065 2.733   101.347 1.00 83.07  ? 134  DA  H OP1   1 
ATOM   2963  O  OP2   . DA  F 3 35  ? 30.082 0.350   101.469 1.00 83.41  ? 134  DA  H OP2   1 
ATOM   2964  O  "O5'" . DA  F 3 35  ? 28.637 2.364   100.968 1.00 81.09  ? 134  DA  H "O5'" 1 
ATOM   2965  C  "C5'" . DA  F 3 35  ? 27.513 1.579   101.330 1.00 77.71  ? 134  DA  H "C5'" 1 
ATOM   2966  C  "C4'" . DA  F 3 35  ? 26.515 1.547   100.200 1.00 74.35  ? 134  DA  H "C4'" 1 
ATOM   2967  O  "O4'" . DA  F 3 35  ? 27.077 0.791   99.097  1.00 71.25  ? 134  DA  H "O4'" 1 
ATOM   2968  C  "C3'" . DA  F 3 35  ? 25.231 0.831   100.598 1.00 74.12  ? 134  DA  H "C3'" 1 
ATOM   2969  O  "O3'" . DA  F 3 35  ? 24.079 1.558   100.187 1.00 76.63  ? 134  DA  H "O3'" 1 
ATOM   2970  C  "C2'" . DA  F 3 35  ? 25.336 -0.521  99.920  1.00 72.25  ? 134  DA  H "C2'" 1 
ATOM   2971  C  "C1'" . DA  F 3 35  ? 26.189 -0.245  98.704  1.00 70.24  ? 134  DA  H "C1'" 1 
ATOM   2972  N  N9    . DA  F 3 35  ? 26.994 -1.394  98.265  1.00 68.15  ? 134  DA  H N9    1 
ATOM   2973  C  C8    . DA  F 3 35  ? 28.198 -1.794  98.790  1.00 67.96  ? 134  DA  H C8    1 
ATOM   2974  N  N7    . DA  F 3 35  ? 28.727 -2.835  98.184  1.00 66.75  ? 134  DA  H N7    1 
ATOM   2975  C  C5    . DA  F 3 35  ? 27.811 -3.147  97.192  1.00 66.34  ? 134  DA  H C5    1 
ATOM   2976  C  C6    . DA  F 3 35  ? 27.810 -4.141  96.182  1.00 66.26  ? 134  DA  H C6    1 
ATOM   2977  N  N6    . DA  F 3 35  ? 28.810 -5.005  95.993  1.00 65.97  ? 134  DA  H N6    1 
ATOM   2978  N  N1    . DA  F 3 35  ? 26.739 -4.205  95.362  1.00 66.05  ? 134  DA  H N1    1 
ATOM   2979  C  C2    . DA  F 3 35  ? 25.745 -3.312  95.541  1.00 66.56  ? 134  DA  H C2    1 
ATOM   2980  N  N3    . DA  F 3 35  ? 25.641 -2.316  96.440  1.00 66.40  ? 134  DA  H N3    1 
ATOM   2981  C  C4    . DA  F 3 35  ? 26.722 -2.285  97.243  1.00 66.91  ? 134  DA  H C4    1 
ATOM   2982  P  P     . DT  F 3 36  ? 22.710 1.389   101.014 1.00 80.16  ? 135  DT  H P     1 
ATOM   2983  O  OP1   . DT  F 3 36  ? 21.960 2.666   101.152 1.00 80.54  ? 135  DT  H OP1   1 
ATOM   2984  O  OP2   . DT  F 3 36  ? 23.116 0.645   102.239 1.00 79.79  ? 135  DT  H OP2   1 
ATOM   2985  O  "O5'" . DT  F 3 36  ? 21.858 0.428   100.076 1.00 80.23  ? 135  DT  H "O5'" 1 
ATOM   2986  C  "C5'" . DT  F 3 36  ? 22.518 -0.595  99.364  1.00 79.92  ? 135  DT  H "C5'" 1 
ATOM   2987  C  "C4'" . DT  F 3 36  ? 21.566 -1.335  98.465  1.00 80.48  ? 135  DT  H "C4'" 1 
ATOM   2988  O  "O4'" . DT  F 3 36  ? 22.395 -2.265  97.750  1.00 80.63  ? 135  DT  H "O4'" 1 
ATOM   2989  C  "C3'" . DT  F 3 36  ? 20.533 -2.184  99.189  1.00 81.22  ? 135  DT  H "C3'" 1 
ATOM   2990  O  "O3'" . DT  F 3 36  ? 19.400 -2.367  98.329  1.00 84.39  ? 135  DT  H "O3'" 1 
ATOM   2991  C  "C2'" . DT  F 3 36  ? 21.283 -3.480  99.417  1.00 80.17  ? 135  DT  H "C2'" 1 
ATOM   2992  C  "C1'" . DT  F 3 36  ? 22.169 -3.578  98.197  1.00 78.90  ? 135  DT  H "C1'" 1 
ATOM   2993  N  N1    . DT  F 3 36  ? 23.480 -4.182  98.442  1.00 78.02  ? 135  DT  H N1    1 
ATOM   2994  C  C2    . DT  F 3 36  ? 23.856 -5.206  97.619  1.00 78.97  ? 135  DT  H C2    1 
ATOM   2995  O  O2    . DT  F 3 36  ? 23.188 -5.562  96.667  1.00 81.58  ? 135  DT  H O2    1 
ATOM   2996  N  N3    . DT  F 3 36  ? 25.053 -5.795  97.933  1.00 78.10  ? 135  DT  H N3    1 
ATOM   2997  C  C4    . DT  F 3 36  ? 25.904 -5.447  98.951  1.00 76.98  ? 135  DT  H C4    1 
ATOM   2998  O  O4    . DT  F 3 36  ? 26.929 -6.092  99.141  1.00 76.14  ? 135  DT  H O4    1 
ATOM   2999  C  C5    . DT  F 3 36  ? 25.483 -4.322  99.739  1.00 77.32  ? 135  DT  H C5    1 
ATOM   3000  C  C7    . DT  F 3 36  ? 26.390 -3.832  100.823 1.00 78.04  ? 135  DT  H C7    1 
ATOM   3001  C  C6    . DT  F 3 36  ? 24.295 -3.755  99.458  1.00 77.09  ? 135  DT  H C6    1 
ATOM   3002  P  P     . DC  F 3 37  ? 18.029 -2.994  98.904  1.00 86.54  ? 136  DC  H P     1 
ATOM   3003  O  OP1   . DC  F 3 37  ? 16.877 -2.118  98.548  1.00 85.69  ? 136  DC  H OP1   1 
ATOM   3004  O  OP2   . DC  F 3 37  ? 18.266 -3.342  100.328 1.00 87.53  ? 136  DC  H OP2   1 
ATOM   3005  O  "O5'" . DC  F 3 37  ? 17.872 -4.340  98.063  1.00 88.78  ? 136  DC  H "O5'" 1 
ATOM   3006  C  "C5'" . DC  F 3 37  ? 17.777 -4.286  96.641  1.00 93.27  ? 136  DC  H "C5'" 1 
ATOM   3007  C  "C4'" . DC  F 3 37  ? 18.053 -5.638  96.019  1.00 96.47  ? 136  DC  H "C4'" 1 
ATOM   3008  O  "O4'" . DC  F 3 37  ? 19.421 -6.072  96.242  1.00 97.41  ? 136  DC  H "O4'" 1 
ATOM   3009  C  "C3'" . DC  F 3 37  ? 17.161 -6.792  96.479  1.00 97.56  ? 136  DC  H "C3'" 1 
ATOM   3010  O  "O3'" . DC  F 3 37  ? 16.857 -7.604  95.340  1.00 99.01  ? 136  DC  H "O3'" 1 
ATOM   3011  C  "C2'" . DC  F 3 37  ? 18.083 -7.608  97.368  1.00 97.89  ? 136  DC  H "C2'" 1 
ATOM   3012  C  "C1'" . DC  F 3 37  ? 19.419 -7.425  96.675  1.00 97.43  ? 136  DC  H "C1'" 1 
ATOM   3013  N  N1    . DC  F 3 37  ? 20.580 -7.626  97.553  1.00 97.24  ? 136  DC  H N1    1 
ATOM   3014  C  C2    . DC  F 3 37  ? 21.595 -8.514  97.156  1.00 96.86  ? 136  DC  H C2    1 
ATOM   3015  O  O2    . DC  F 3 37  ? 21.477 -9.126  96.080  1.00 95.94  ? 136  DC  H O2    1 
ATOM   3016  N  N3    . DC  F 3 37  ? 22.673 -8.679  97.961  1.00 97.33  ? 136  DC  H N3    1 
ATOM   3017  C  C4    . DC  F 3 37  ? 22.753 -8.007  99.119  1.00 98.43  ? 136  DC  H C4    1 
ATOM   3018  N  N4    . DC  F 3 37  ? 23.834 -8.187  99.885  1.00 99.34  ? 136  DC  H N4    1 
ATOM   3019  C  C5    . DC  F 3 37  ? 21.728 -7.114  99.546  1.00 98.53  ? 136  DC  H C5    1 
ATOM   3020  C  C6    . DC  F 3 37  ? 20.673 -6.954  98.740  1.00 97.94  ? 136  DC  H C6    1 
ATOM   3021  N  N     . ASN G 4 10  ? 54.758 60.891  99.300  1.00 64.84  ? 10   ASN A N     1 
ATOM   3022  C  CA    . ASN G 4 10  ? 53.842 60.160  98.351  1.00 65.77  ? 10   ASN A CA    1 
ATOM   3023  C  C     . ASN G 4 10  ? 54.148 58.635  98.271  1.00 66.42  ? 10   ASN A C     1 
ATOM   3024  O  O     . ASN G 4 10  ? 53.536 57.847  99.035  1.00 66.86  ? 10   ASN A O     1 
ATOM   3025  C  CB    . ASN G 4 10  ? 53.876 60.834  96.946  1.00 65.63  ? 10   ASN A CB    1 
ATOM   3026  C  CG    . ASN G 4 10  ? 52.596 61.689  96.645  1.00 65.64  ? 10   ASN A CG    1 
ATOM   3027  O  OD1   . ASN G 4 10  ? 52.023 62.351  97.534  1.00 63.32  ? 10   ASN A OD1   1 
ATOM   3028  N  ND2   . ASN G 4 10  ? 52.167 61.675  95.378  1.00 65.47  ? 10   ASN A ND2   1 
ATOM   3029  N  N     . LEU G 4 11  ? 55.069 58.223  97.378  1.00 66.18  ? 11   LEU A N     1 
ATOM   3030  C  CA    . LEU G 4 11  ? 55.465 56.797  97.215  1.00 65.94  ? 11   LEU A CA    1 
ATOM   3031  C  C     . LEU G 4 11  ? 56.164 56.138  98.428  1.00 66.80  ? 11   LEU A C     1 
ATOM   3032  O  O     . LEU G 4 11  ? 56.363 56.779  99.461  1.00 66.81  ? 11   LEU A O     1 
ATOM   3033  C  CB    . LEU G 4 11  ? 56.366 56.635  95.995  1.00 63.51  ? 11   LEU A CB    1 
ATOM   3034  C  CG    . LEU G 4 11  ? 55.646 56.320  94.689  1.00 62.54  ? 11   LEU A CG    1 
ATOM   3035  C  CD1   . LEU G 4 11  ? 56.679 56.139  93.550  1.00 61.32  ? 11   LEU A CD1   1 
ATOM   3036  C  CD2   . LEU G 4 11  ? 54.812 55.052  94.877  1.00 61.84  ? 11   LEU A CD2   1 
ATOM   3037  N  N     . PRO G 4 12  ? 56.531 54.839  98.324  1.00 68.02  ? 12   PRO A N     1 
ATOM   3038  C  CA    . PRO G 4 12  ? 57.194 54.199  99.471  1.00 69.75  ? 12   PRO A CA    1 
ATOM   3039  C  C     . PRO G 4 12  ? 58.547 54.818  99.735  1.00 71.40  ? 12   PRO A C     1 
ATOM   3040  O  O     . PRO G 4 12  ? 58.677 55.728  100.581 1.00 73.45  ? 12   PRO A O     1 
ATOM   3041  C  CB    . PRO G 4 12  ? 57.334 52.731  99.046  1.00 68.57  ? 12   PRO A CB    1 
ATOM   3042  C  CG    . PRO G 4 12  ? 56.167 52.531  98.176  1.00 69.32  ? 12   PRO A CG    1 
ATOM   3043  C  CD    . PRO G 4 12  ? 56.168 53.818  97.327  1.00 68.87  ? 12   PRO A CD    1 
ATOM   3044  N  N     . ALA G 4 13  ? 59.555 54.323  99.017  1.00 71.51  ? 13   ALA A N     1 
ATOM   3045  C  CA    . ALA G 4 13  ? 60.908 54.832  99.192  1.00 71.30  ? 13   ALA A CA    1 
ATOM   3046  C  C     . ALA G 4 13  ? 61.826 54.426  98.051  1.00 71.21  ? 13   ALA A C     1 
ATOM   3047  O  O     . ALA G 4 13  ? 62.725 53.610  98.262  1.00 71.57  ? 13   ALA A O     1 
ATOM   3048  C  CB    . ALA G 4 13  ? 61.485 54.332  100.536 1.00 69.96  ? 13   ALA A CB    1 
ATOM   3049  N  N     . LEU G 4 14  ? 61.597 54.964  96.848  1.00 71.07  ? 14   LEU A N     1 
ATOM   3050  C  CA    . LEU G 4 14  ? 62.475 54.645  95.717  1.00 70.54  ? 14   LEU A CA    1 
ATOM   3051  C  C     . LEU G 4 14  ? 63.876 54.936  96.269  1.00 71.33  ? 14   LEU A C     1 
ATOM   3052  O  O     . LEU G 4 14  ? 64.315 56.114  96.335  1.00 70.95  ? 14   LEU A O     1 
ATOM   3053  C  CB    . LEU G 4 14  ? 62.144 55.522  94.503  1.00 69.63  ? 14   LEU A CB    1 
ATOM   3054  C  CG    . LEU G 4 14  ? 60.985 55.010  93.626  1.00 69.31  ? 14   LEU A CG    1 
ATOM   3055  C  CD1   . LEU G 4 14  ? 61.306 53.573  93.150  1.00 68.62  ? 14   LEU A CD1   1 
ATOM   3056  C  CD2   . LEU G 4 14  ? 59.662 55.041  94.396  1.00 68.45  ? 14   LEU A CD2   1 
ATOM   3057  N  N     . PRO G 4 15  ? 64.590 53.852  96.683  1.00 71.84  ? 15   PRO A N     1 
ATOM   3058  C  CA    . PRO G 4 15  ? 65.936 53.813  97.278  1.00 73.16  ? 15   PRO A CA    1 
ATOM   3059  C  C     . PRO G 4 15  ? 67.113 54.629  96.713  1.00 74.59  ? 15   PRO A C     1 
ATOM   3060  O  O     . PRO G 4 15  ? 67.211 54.909  95.494  1.00 74.73  ? 15   PRO A O     1 
ATOM   3061  C  CB    . PRO G 4 15  ? 66.253 52.311  97.324  1.00 70.73  ? 15   PRO A CB    1 
ATOM   3062  C  CG    . PRO G 4 15  ? 64.898 51.666  97.368  1.00 69.77  ? 15   PRO A CG    1 
ATOM   3063  C  CD    . PRO G 4 15  ? 64.168 52.478  96.338  1.00 70.47  ? 15   PRO A CD    1 
ATOM   3064  N  N     . VAL G 4 16  ? 67.996 55.002  97.651  1.00 75.76  ? 16   VAL A N     1 
ATOM   3065  C  CA    . VAL G 4 16  ? 69.234 55.746  97.379  1.00 76.17  ? 16   VAL A CA    1 
ATOM   3066  C  C     . VAL G 4 16  ? 70.057 54.975  96.288  1.00 77.37  ? 16   VAL A C     1 
ATOM   3067  O  O     . VAL G 4 16  ? 70.451 55.558  95.247  1.00 77.62  ? 16   VAL A O     1 
ATOM   3068  C  CB    . VAL G 4 16  ? 70.070 55.887  98.718  1.00 75.03  ? 16   VAL A CB    1 
ATOM   3069  C  CG1   . VAL G 4 16  ? 71.358 56.688  98.484  1.00 72.52  ? 16   VAL A CG1   1 
ATOM   3070  C  CG2   . VAL G 4 16  ? 69.201 56.535  99.806  1.00 72.91  ? 16   VAL A CG2   1 
ATOM   3071  N  N     . ASP G 4 17  ? 70.276 53.670  96.523  1.00 77.47  ? 17   ASP A N     1 
ATOM   3072  C  CA    . ASP G 4 17  ? 71.029 52.816  95.600  1.00 77.27  ? 17   ASP A CA    1 
ATOM   3073  C  C     . ASP G 4 17  ? 70.148 51.869  94.784  1.00 76.68  ? 17   ASP A C     1 
ATOM   3074  O  O     . ASP G 4 17  ? 70.636 51.286  93.795  1.00 76.64  ? 17   ASP A O     1 
ATOM   3075  C  CB    . ASP G 4 17  ? 72.054 51.962  96.357  1.00 77.34  ? 17   ASP A CB    1 
ATOM   3076  C  CG    . ASP G 4 17  ? 71.391 50.922  97.278  1.00 78.64  ? 17   ASP A CG    1 
ATOM   3077  O  OD1   . ASP G 4 17  ? 71.119 51.261  98.460  1.00 78.32  ? 17   ASP A OD1   1 
ATOM   3078  O  OD2   . ASP G 4 17  ? 71.132 49.772  96.815  1.00 78.70  ? 17   ASP A OD2   1 
ATOM   3079  N  N     . ALA G 4 18  ? 68.881 51.697  95.195  1.00 75.36  ? 18   ALA A N     1 
ATOM   3080  C  CA    . ALA G 4 18  ? 67.964 50.785  94.481  1.00 76.39  ? 18   ALA A CA    1 
ATOM   3081  C  C     . ALA G 4 18  ? 67.428 51.364  93.177  1.00 76.47  ? 18   ALA A C     1 
ATOM   3082  O  O     . ALA G 4 18  ? 67.524 50.738  92.097  1.00 76.69  ? 18   ALA A O     1 
ATOM   3083  C  CB    . ALA G 4 18  ? 66.785 50.366  95.374  1.00 74.67  ? 18   ALA A CB    1 
ATOM   3084  N  N     . THR G 4 19  ? 66.838 52.549  93.279  1.00 77.48  ? 19   THR A N     1 
ATOM   3085  C  CA    . THR G 4 19  ? 66.319 53.195  92.090  1.00 76.27  ? 19   THR A CA    1 
ATOM   3086  C  C     . THR G 4 19  ? 67.625 53.590  91.366  1.00 76.75  ? 19   THR A C     1 
ATOM   3087  O  O     . THR G 4 19  ? 68.246 54.626  91.645  1.00 76.96  ? 19   THR A O     1 
ATOM   3088  C  CB    . THR G 4 19  ? 65.394 54.403  92.479  1.00 75.43  ? 19   THR A CB    1 
ATOM   3089  O  OG1   . THR G 4 19  ? 64.929 54.241  93.827  1.00 72.71  ? 19   THR A OG1   1 
ATOM   3090  C  CG2   . THR G 4 19  ? 64.144 54.418  91.589  1.00 74.22  ? 19   THR A CG2   1 
ATOM   3091  N  N     . SER G 4 20  ? 68.045 52.705  90.460  1.00 77.88  ? 20   SER A N     1 
ATOM   3092  C  CA    . SER G 4 20  ? 69.296 52.867  89.720  1.00 78.42  ? 20   SER A CA    1 
ATOM   3093  C  C     . SER G 4 20  ? 69.231 53.391  88.283  1.00 79.51  ? 20   SER A C     1 
ATOM   3094  O  O     . SER G 4 20  ? 68.685 52.727  87.388  1.00 77.78  ? 20   SER A O     1 
ATOM   3095  C  CB    . SER G 4 20  ? 70.079 51.524  89.701  1.00 77.56  ? 20   SER A CB    1 
ATOM   3096  O  OG    . SER G 4 20  ? 70.516 51.093  90.987  1.00 74.98  ? 20   SER A OG    1 
ATOM   3097  N  N     . ASP G 4 21  ? 69.799 54.586  88.090  1.00 78.96  ? 21   ASP A N     1 
ATOM   3098  C  CA    . ASP G 4 21  ? 69.952 55.218  86.767  1.00 80.76  ? 21   ASP A CA    1 
ATOM   3099  C  C     . ASP G 4 21  ? 68.943 56.233  86.216  1.00 79.44  ? 21   ASP A C     1 
ATOM   3100  O  O     . ASP G 4 21  ? 68.918 57.399  86.613  1.00 78.94  ? 21   ASP A O     1 
ATOM   3101  C  CB    . ASP G 4 21  ? 70.190 54.116  85.706  1.00 82.26  ? 21   ASP A CB    1 
ATOM   3102  C  CG    . ASP G 4 21  ? 71.457 53.277  85.987  1.00 83.99  ? 21   ASP A CG    1 
ATOM   3103  O  OD1   . ASP G 4 21  ? 72.585 53.829  85.865  1.00 85.04  ? 21   ASP A OD1   1 
ATOM   3104  O  OD2   . ASP G 4 21  ? 71.318 52.072  86.334  1.00 84.12  ? 21   ASP A OD2   1 
ATOM   3105  N  N     . GLU G 4 22  ? 68.154 55.782  85.248  1.00 79.34  ? 22   GLU A N     1 
ATOM   3106  C  CA    . GLU G 4 22  ? 67.155 56.615  84.608  1.00 78.56  ? 22   GLU A CA    1 
ATOM   3107  C  C     . GLU G 4 22  ? 65.757 56.278  85.105  1.00 76.89  ? 22   GLU A C     1 
ATOM   3108  O  O     . GLU G 4 22  ? 64.808 57.001  84.827  1.00 77.68  ? 22   GLU A O     1 
ATOM   3109  C  CB    . GLU G 4 22  ? 67.243 56.448  83.091  1.00 80.00  ? 22   GLU A CB    1 
ATOM   3110  C  CG    . GLU G 4 22  ? 67.588 55.030  82.653  1.00 83.27  ? 22   GLU A CG    1 
ATOM   3111  C  CD    . GLU G 4 22  ? 67.754 54.892  81.146  1.00 85.17  ? 22   GLU A CD    1 
ATOM   3112  O  OE1   . GLU G 4 22  ? 68.051 53.757  80.690  1.00 85.29  ? 22   GLU A OE1   1 
ATOM   3113  O  OE2   . GLU G 4 22  ? 67.586 55.913  80.427  1.00 86.32  ? 22   GLU A OE2   1 
ATOM   3114  N  N     . VAL G 4 23  ? 65.616 55.186  85.846  1.00 75.59  ? 23   VAL A N     1 
ATOM   3115  C  CA    . VAL G 4 23  ? 64.308 54.858  86.371  1.00 74.13  ? 23   VAL A CA    1 
ATOM   3116  C  C     . VAL G 4 23  ? 64.001 56.024  87.286  1.00 74.02  ? 23   VAL A C     1 
ATOM   3117  O  O     . VAL G 4 23  ? 62.899 56.158  87.805  1.00 74.74  ? 23   VAL A O     1 
ATOM   3118  C  CB    . VAL G 4 23  ? 64.316 53.557  87.173  1.00 73.70  ? 23   VAL A CB    1 
ATOM   3119  C  CG1   . VAL G 4 23  ? 65.179 52.552  86.473  1.00 74.93  ? 23   VAL A CG1   1 
ATOM   3120  C  CG2   . VAL G 4 23  ? 64.794 53.795  88.572  1.00 73.46  ? 23   VAL A CG2   1 
ATOM   3121  N  N     . ARG G 4 24  ? 65.006 56.868  87.473  1.00 73.66  ? 24   ARG A N     1 
ATOM   3122  C  CA    . ARG G 4 24  ? 64.878 58.055  88.294  1.00 73.46  ? 24   ARG A CA    1 
ATOM   3123  C  C     . ARG G 4 24  ? 64.405 59.152  87.347  1.00 70.91  ? 24   ARG A C     1 
ATOM   3124  O  O     . ARG G 4 24  ? 63.505 59.911  87.676  1.00 70.51  ? 24   ARG A O     1 
ATOM   3125  C  CB    . ARG G 4 24  ? 66.229 58.386  88.934  1.00 78.28  ? 24   ARG A CB    1 
ATOM   3126  C  CG    . ARG G 4 24  ? 66.819 57.207  89.762  1.00 83.91  ? 24   ARG A CG    1 
ATOM   3127  C  CD    . ARG G 4 24  ? 68.360 57.296  89.984  1.00 88.57  ? 24   ARG A CD    1 
ATOM   3128  N  NE    . ARG G 4 24  ? 68.753 57.668  91.355  1.00 92.71  ? 24   ARG A NE    1 
ATOM   3129  C  CZ    . ARG G 4 24  ? 68.870 58.916  91.829  1.00 93.80  ? 24   ARG A CZ    1 
ATOM   3130  N  NH1   . ARG G 4 24  ? 68.633 59.978  91.053  1.00 94.36  ? 24   ARG A NH1   1 
ATOM   3131  N  NH2   . ARG G 4 24  ? 69.221 59.100  93.101  1.00 94.21  ? 24   ARG A NH2   1 
ATOM   3132  N  N     . LYS G 4 25  ? 65.004 59.228  86.164  1.00 68.42  ? 25   LYS A N     1 
ATOM   3133  C  CA    . LYS G 4 25  ? 64.577 60.205  85.162  1.00 66.17  ? 25   LYS A CA    1 
ATOM   3134  C  C     . LYS G 4 25  ? 63.065 60.018  84.969  1.00 64.37  ? 25   LYS A C     1 
ATOM   3135  O  O     . LYS G 4 25  ? 62.267 60.825  85.439  1.00 63.11  ? 25   LYS A O     1 
ATOM   3136  C  CB    . LYS G 4 25  ? 65.322 59.956  83.837  1.00 67.41  ? 25   LYS A CB    1 
ATOM   3137  C  CG    . LYS G 4 25  ? 64.745 60.608  82.557  1.00 69.25  ? 25   LYS A CG    1 
ATOM   3138  C  CD    . LYS G 4 25  ? 64.720 62.146  82.615  1.00 71.33  ? 25   LYS A CD    1 
ATOM   3139  C  CE    . LYS G 4 25  ? 64.617 62.820  81.214  1.00 72.51  ? 25   LYS A CE    1 
ATOM   3140  N  NZ    . LYS G 4 25  ? 63.363 62.593  80.401  1.00 72.51  ? 25   LYS A NZ    1 
ATOM   3141  N  N     . ASN G 4 26  ? 62.688 58.929  84.300  1.00 62.35  ? 26   ASN A N     1 
ATOM   3142  C  CA    . ASN G 4 26  ? 61.290 58.597  84.031  1.00 60.89  ? 26   ASN A CA    1 
ATOM   3143  C  C     . ASN G 4 26  ? 60.399 58.866  85.222  1.00 60.09  ? 26   ASN A C     1 
ATOM   3144  O  O     . ASN G 4 26  ? 59.426 59.598  85.129  1.00 59.69  ? 26   ASN A O     1 
ATOM   3145  C  CB    . ASN G 4 26  ? 61.137 57.120  83.677  1.00 60.22  ? 26   ASN A CB    1 
ATOM   3146  C  CG    . ASN G 4 26  ? 61.926 56.715  82.453  1.00 60.16  ? 26   ASN A CG    1 
ATOM   3147  O  OD1   . ASN G 4 26  ? 61.768 57.281  81.369  1.00 60.84  ? 26   ASN A OD1   1 
ATOM   3148  N  ND2   . ASN G 4 26  ? 62.770 55.712  82.614  1.00 59.95  ? 26   ASN A ND2   1 
ATOM   3149  N  N     . LEU G 4 27  ? 60.723 58.239  86.341  1.00 60.80  ? 27   LEU A N     1 
ATOM   3150  C  CA    . LEU G 4 27  ? 59.936 58.411  87.547  1.00 62.49  ? 27   LEU A CA    1 
ATOM   3151  C  C     . LEU G 4 27  ? 59.697 59.894  87.849  1.00 64.30  ? 27   LEU A C     1 
ATOM   3152  O  O     . LEU G 4 27  ? 58.587 60.304  88.196  1.00 64.79  ? 27   LEU A O     1 
ATOM   3153  C  CB    . LEU G 4 27  ? 60.638 57.723  88.719  1.00 61.11  ? 27   LEU A CB    1 
ATOM   3154  C  CG    . LEU G 4 27  ? 59.844 56.639  89.455  1.00 60.64  ? 27   LEU A CG    1 
ATOM   3155  C  CD1   . LEU G 4 27  ? 59.251 55.655  88.488  1.00 60.85  ? 27   LEU A CD1   1 
ATOM   3156  C  CD2   . LEU G 4 27  ? 60.759 55.920  90.399  1.00 60.16  ? 27   LEU A CD2   1 
ATOM   3157  N  N     . MET G 4 28  ? 60.736 60.704  87.703  1.00 65.68  ? 28   MET A N     1 
ATOM   3158  C  CA    . MET G 4 28  ? 60.601 62.129  87.965  1.00 66.88  ? 28   MET A CA    1 
ATOM   3159  C  C     . MET G 4 28  ? 59.544 62.686  87.010  1.00 66.36  ? 28   MET A C     1 
ATOM   3160  O  O     . MET G 4 28  ? 58.658 63.429  87.424  1.00 66.58  ? 28   MET A O     1 
ATOM   3161  C  CB    . MET G 4 28  ? 61.947 62.828  87.743  1.00 69.47  ? 28   MET A CB    1 
ATOM   3162  C  CG    . MET G 4 28  ? 62.314 63.908  88.776  1.00 72.78  ? 28   MET A CG    1 
ATOM   3163  S  SD    . MET G 4 28  ? 63.939 64.719  88.420  1.00 76.46  ? 28   MET A SD    1 
ATOM   3164  C  CE    . MET G 4 28  ? 63.381 66.128  87.306  1.00 76.86  ? 28   MET A CE    1 
ATOM   3165  N  N     . ASP G 4 29  ? 59.640 62.294  85.740  1.00 65.13  ? 29   ASP A N     1 
ATOM   3166  C  CA    . ASP G 4 29  ? 58.721 62.731  84.689  1.00 64.13  ? 29   ASP A CA    1 
ATOM   3167  C  C     . ASP G 4 29  ? 57.282 62.425  84.976  1.00 62.27  ? 29   ASP A C     1 
ATOM   3168  O  O     . ASP G 4 29  ? 56.424 63.287  84.809  1.00 61.45  ? 29   ASP A O     1 
ATOM   3169  C  CB    . ASP G 4 29  ? 59.032 62.054  83.360  1.00 66.87  ? 29   ASP A CB    1 
ATOM   3170  C  CG    . ASP G 4 29  ? 60.284 62.576  82.709  1.00 69.60  ? 29   ASP A CG    1 
ATOM   3171  O  OD1   . ASP G 4 29  ? 60.481 63.819  82.748  1.00 71.37  ? 29   ASP A OD1   1 
ATOM   3172  O  OD2   . ASP G 4 29  ? 61.046 61.744  82.144  1.00 70.15  ? 29   ASP A OD2   1 
ATOM   3173  N  N     . MET G 4 30  ? 57.017 61.174  85.356  1.00 60.83  ? 30   MET A N     1 
ATOM   3174  C  CA    . MET G 4 30  ? 55.657 60.745  85.643  1.00 59.21  ? 30   MET A CA    1 
ATOM   3175  C  C     . MET G 4 30  ? 55.108 61.607  86.747  1.00 58.30  ? 30   MET A C     1 
ATOM   3176  O  O     . MET G 4 30  ? 53.918 61.886  86.783  1.00 58.36  ? 30   MET A O     1 
ATOM   3177  C  CB    . MET G 4 30  ? 55.601 59.282  86.061  1.00 59.17  ? 30   MET A CB    1 
ATOM   3178  C  CG    . MET G 4 30  ? 54.197 58.847  86.431  1.00 60.83  ? 30   MET A CG    1 
ATOM   3179  S  SD    . MET G 4 30  ? 54.032 57.101  86.902  1.00 63.90  ? 30   MET A SD    1 
ATOM   3180  C  CE    . MET G 4 30  ? 54.456 57.161  88.610  1.00 63.33  ? 30   MET A CE    1 
ATOM   3181  N  N     . PHE G 4 31  ? 55.982 62.047  87.640  1.00 57.11  ? 31   PHE A N     1 
ATOM   3182  C  CA    . PHE G 4 31  ? 55.544 62.894  88.728  1.00 55.73  ? 31   PHE A CA    1 
ATOM   3183  C  C     . PHE G 4 31  ? 55.402 64.337  88.307  1.00 54.11  ? 31   PHE A C     1 
ATOM   3184  O  O     . PHE G 4 31  ? 54.736 65.103  88.981  1.00 53.38  ? 31   PHE A O     1 
ATOM   3185  C  CB    . PHE G 4 31  ? 56.507 62.803  89.917  1.00 57.13  ? 31   PHE A CB    1 
ATOM   3186  C  CG    . PHE G 4 31  ? 56.299 61.579  90.776  1.00 58.56  ? 31   PHE A CG    1 
ATOM   3187  C  CD1   . PHE G 4 31  ? 56.926 60.371  90.459  1.00 58.71  ? 31   PHE A CD1   1 
ATOM   3188  C  CD2   . PHE G 4 31  ? 55.418 61.624  91.868  1.00 58.84  ? 31   PHE A CD2   1 
ATOM   3189  C  CE1   . PHE G 4 31  ? 56.679 59.219  91.205  1.00 59.18  ? 31   PHE A CE1   1 
ATOM   3190  C  CE2   . PHE G 4 31  ? 55.159 60.488  92.621  1.00 59.37  ? 31   PHE A CE2   1 
ATOM   3191  C  CZ    . PHE G 4 31  ? 55.793 59.273  92.287  1.00 59.89  ? 31   PHE A CZ    1 
ATOM   3192  N  N     . ARG G 4 32  ? 56.028 64.706  87.196  1.00 53.44  ? 32   ARG A N     1 
ATOM   3193  C  CA    . ARG G 4 32  ? 55.977 66.081  86.709  1.00 53.21  ? 32   ARG A CA    1 
ATOM   3194  C  C     . ARG G 4 32  ? 54.631 66.311  86.055  1.00 53.73  ? 32   ARG A C     1 
ATOM   3195  O  O     . ARG G 4 32  ? 53.997 67.349  86.238  1.00 53.90  ? 32   ARG A O     1 
ATOM   3196  C  CB    . ARG G 4 32  ? 57.099 66.321  85.699  1.00 52.90  ? 32   ARG A CB    1 
ATOM   3197  C  CG    . ARG G 4 32  ? 57.269 67.763  85.233  1.00 53.70  ? 32   ARG A CG    1 
ATOM   3198  C  CD    . ARG G 4 32  ? 58.314 67.889  84.102  1.00 54.75  ? 32   ARG A CD    1 
ATOM   3199  N  NE    . ARG G 4 32  ? 57.960 67.053  82.956  1.00 56.92  ? 32   ARG A NE    1 
ATOM   3200  C  CZ    . ARG G 4 32  ? 58.769 66.749  81.944  1.00 57.06  ? 32   ARG A CZ    1 
ATOM   3201  N  NH1   . ARG G 4 32  ? 60.008 67.217  81.902  1.00 56.63  ? 32   ARG A NH1   1 
ATOM   3202  N  NH2   . ARG G 4 32  ? 58.345 65.936  80.986  1.00 57.13  ? 32   ARG A NH2   1 
ATOM   3203  N  N     . ASP G 4 33  ? 54.199 65.321  85.287  1.00 54.00  ? 33   ASP A N     1 
ATOM   3204  C  CA    . ASP G 4 33  ? 52.918 65.371  84.594  1.00 54.36  ? 33   ASP A CA    1 
ATOM   3205  C  C     . ASP G 4 33  ? 51.986 64.446  85.357  1.00 54.40  ? 33   ASP A C     1 
ATOM   3206  O  O     . ASP G 4 33  ? 51.402 63.541  84.784  1.00 54.61  ? 33   ASP A O     1 
ATOM   3207  C  CB    . ASP G 4 33  ? 53.070 64.859  83.151  1.00 53.92  ? 33   ASP A CB    1 
ATOM   3208  C  CG    . ASP G 4 33  ? 53.778 65.848  82.250  1.00 52.59  ? 33   ASP A CG    1 
ATOM   3209  O  OD1   . ASP G 4 33  ? 53.247 66.961  82.103  1.00 52.09  ? 33   ASP A OD1   1 
ATOM   3210  O  OD2   . ASP G 4 33  ? 54.850 65.520  81.693  1.00 51.54  ? 33   ASP A OD2   1 
ATOM   3211  N  N     . ARG G 4 34  ? 51.845 64.671  86.653  1.00 55.00  ? 34   ARG A N     1 
ATOM   3212  C  CA    . ARG G 4 34  ? 51.008 63.791  87.437  1.00 55.75  ? 34   ARG A CA    1 
ATOM   3213  C  C     . ARG G 4 34  ? 49.570 63.992  87.086  1.00 53.63  ? 34   ARG A C     1 
ATOM   3214  O  O     . ARG G 4 34  ? 48.829 63.036  87.022  1.00 54.86  ? 34   ARG A O     1 
ATOM   3215  C  CB    . ARG G 4 34  ? 51.253 63.979  88.956  1.00 60.06  ? 34   ARG A CB    1 
ATOM   3216  C  CG    . ARG G 4 34  ? 50.296 64.893  89.737  1.00 65.54  ? 34   ARG A CG    1 
ATOM   3217  C  CD    . ARG G 4 34  ? 50.902 65.318  91.092  1.00 69.99  ? 34   ARG A CD    1 
ATOM   3218  N  NE    . ARG G 4 34  ? 51.646 66.584  90.998  1.00 74.36  ? 34   ARG A NE    1 
ATOM   3219  C  CZ    . ARG G 4 34  ? 52.837 66.833  91.557  1.00 76.08  ? 34   ARG A CZ    1 
ATOM   3220  N  NH1   . ARG G 4 34  ? 53.468 65.902  92.274  1.00 76.24  ? 34   ARG A NH1   1 
ATOM   3221  N  NH2   . ARG G 4 34  ? 53.405 68.026  91.394  1.00 75.84  ? 34   ARG A NH2   1 
ATOM   3222  N  N     . GLN G 4 35  ? 49.166 65.221  86.829  1.00 51.18  ? 35   GLN A N     1 
ATOM   3223  C  CA    . GLN G 4 35  ? 47.773 65.465  86.500  1.00 50.20  ? 35   GLN A CA    1 
ATOM   3224  C  C     . GLN G 4 35  ? 47.265 64.636  85.313  1.00 46.58  ? 35   GLN A C     1 
ATOM   3225  O  O     . GLN G 4 35  ? 46.138 64.807  84.885  1.00 45.78  ? 35   GLN A O     1 
ATOM   3226  C  CB    . GLN G 4 35  ? 47.569 66.959  86.236  1.00 54.85  ? 35   GLN A CB    1 
ATOM   3227  C  CG    . GLN G 4 35  ? 46.998 67.743  87.407  1.00 60.48  ? 35   GLN A CG    1 
ATOM   3228  C  CD    . GLN G 4 35  ? 45.478 67.952  87.297  1.00 65.13  ? 35   GLN A CD    1 
ATOM   3229  O  OE1   . GLN G 4 35  ? 45.002 68.692  86.423  1.00 67.33  ? 35   GLN A OE1   1 
ATOM   3230  N  NE2   . GLN G 4 35  ? 44.714 67.301  88.183  1.00 66.83  ? 35   GLN A NE2   1 
ATOM   3231  N  N     . ALA G 4 36  ? 48.095 63.739  84.794  1.00 42.77  ? 36   ALA A N     1 
ATOM   3232  C  CA    . ALA G 4 36  ? 47.728 62.883  83.662  1.00 40.39  ? 36   ALA A CA    1 
ATOM   3233  C  C     . ALA G 4 36  ? 46.859 61.699  84.053  1.00 39.14  ? 36   ALA A C     1 
ATOM   3234  O  O     . ALA G 4 36  ? 46.271 61.055  83.203  1.00 38.53  ? 36   ALA A O     1 
ATOM   3235  C  CB    . ALA G 4 36  ? 48.975 62.359  82.973  1.00 39.99  ? 36   ALA A CB    1 
ATOM   3236  N  N     . PHE G 4 37  ? 46.802 61.391  85.340  1.00 38.60  ? 37   PHE A N     1 
ATOM   3237  C  CA    . PHE G 4 37  ? 46.012 60.272  85.816  1.00 37.86  ? 37   PHE A CA    1 
ATOM   3238  C  C     . PHE G 4 37  ? 44.972 60.784  86.771  1.00 38.45  ? 37   PHE A C     1 
ATOM   3239  O  O     . PHE G 4 37  ? 45.132 61.829  87.400  1.00 38.45  ? 37   PHE A O     1 
ATOM   3240  C  CB    . PHE G 4 37  ? 46.879 59.266  86.561  1.00 35.17  ? 37   PHE A CB    1 
ATOM   3241  C  CG    . PHE G 4 37  ? 48.056 58.803  85.798  1.00 33.93  ? 37   PHE A CG    1 
ATOM   3242  C  CD1   . PHE G 4 37  ? 49.333 59.227  86.155  1.00 33.69  ? 37   PHE A CD1   1 
ATOM   3243  C  CD2   . PHE G 4 37  ? 47.896 57.965  84.703  1.00 32.69  ? 37   PHE A CD2   1 
ATOM   3244  C  CE1   . PHE G 4 37  ? 50.442 58.824  85.427  1.00 34.75  ? 37   PHE A CE1   1 
ATOM   3245  C  CE2   . PHE G 4 37  ? 48.984 57.554  83.971  1.00 33.42  ? 37   PHE A CE2   1 
ATOM   3246  C  CZ    . PHE G 4 37  ? 50.272 57.985  84.330  1.00 34.33  ? 37   PHE A CZ    1 
ATOM   3247  N  N     . SER G 4 38  ? 43.899 60.026  86.898  1.00 40.16  ? 38   SER A N     1 
ATOM   3248  C  CA    . SER G 4 38  ? 42.840 60.415  87.803  1.00 41.61  ? 38   SER A CA    1 
ATOM   3249  C  C     . SER G 4 38  ? 43.288 60.388  89.241  1.00 42.14  ? 38   SER A C     1 
ATOM   3250  O  O     . SER G 4 38  ? 44.099 59.553  89.649  1.00 40.69  ? 38   SER A O     1 
ATOM   3251  C  CB    . SER G 4 38  ? 41.645 59.486  87.658  1.00 42.88  ? 38   SER A CB    1 
ATOM   3252  O  OG    . SER G 4 38  ? 40.700 59.712  88.693  1.00 45.79  ? 38   SER A OG    1 
ATOM   3253  N  N     . GLU G 4 39  ? 42.739 61.324  89.998  1.00 42.69  ? 39   GLU A N     1 
ATOM   3254  C  CA    . GLU G 4 39  ? 42.999 61.432  91.410  1.00 43.42  ? 39   GLU A CA    1 
ATOM   3255  C  C     . GLU G 4 39  ? 42.867 60.011  91.964  1.00 40.83  ? 39   GLU A C     1 
ATOM   3256  O  O     . GLU G 4 39  ? 43.772 59.498  92.622  1.00 41.25  ? 39   GLU A O     1 
ATOM   3257  C  CB    . GLU G 4 39  ? 41.934 62.316  92.030  1.00 50.06  ? 39   GLU A CB    1 
ATOM   3258  C  CG    . GLU G 4 39  ? 42.443 63.466  92.888  1.00 61.03  ? 39   GLU A CG    1 
ATOM   3259  C  CD    . GLU G 4 39  ? 41.323 64.062  93.797  1.00 68.16  ? 39   GLU A CD    1 
ATOM   3260  O  OE1   . GLU G 4 39  ? 41.483 65.238  94.253  1.00 70.62  ? 39   GLU A OE1   1 
ATOM   3261  O  OE2   . GLU G 4 39  ? 40.299 63.344  94.057  1.00 69.95  ? 39   GLU A OE2   1 
ATOM   3262  N  N     . HIS G 4 40  ? 41.730 59.377  91.678  1.00 37.64  ? 40   HIS A N     1 
ATOM   3263  C  CA    . HIS G 4 40  ? 41.440 58.029  92.140  1.00 33.25  ? 40   HIS A CA    1 
ATOM   3264  C  C     . HIS G 4 40  ? 42.399 57.001  91.621  1.00 32.12  ? 40   HIS A C     1 
ATOM   3265  O  O     . HIS G 4 40  ? 42.388 55.867  92.076  1.00 31.86  ? 40   HIS A O     1 
ATOM   3266  C  CB    . HIS G 4 40  ? 40.085 57.607  91.687  1.00 33.35  ? 40   HIS A CB    1 
ATOM   3267  C  CG    . HIS G 4 40  ? 38.982 58.490  92.156  1.00 34.59  ? 40   HIS A CG    1 
ATOM   3268  N  ND1   . HIS G 4 40  ? 38.671 58.640  93.487  1.00 35.62  ? 40   HIS A ND1   1 
ATOM   3269  C  CD2   . HIS G 4 40  ? 38.049 59.190  91.464  1.00 34.15  ? 40   HIS A CD2   1 
ATOM   3270  C  CE1   . HIS G 4 40  ? 37.588 59.393  93.594  1.00 36.30  ? 40   HIS A CE1   1 
ATOM   3271  N  NE2   . HIS G 4 40  ? 37.190 59.737  92.382  1.00 34.30  ? 40   HIS A NE2   1 
ATOM   3272  N  N     . THR G 4 41  ? 43.192 57.356  90.620  1.00 31.86  ? 41   THR A N     1 
ATOM   3273  C  CA    . THR G 4 41  ? 44.145 56.397  90.129  1.00 29.25  ? 41   THR A CA    1 
ATOM   3274  C  C     . THR G 4 41  ? 45.321 56.485  91.029  1.00 28.77  ? 41   THR A C     1 
ATOM   3275  O  O     . THR G 4 41  ? 45.773 55.498  91.542  1.00 29.25  ? 41   THR A O     1 
ATOM   3276  C  CB    . THR G 4 41  ? 44.562 56.673  88.743  1.00 28.12  ? 41   THR A CB    1 
ATOM   3277  O  OG1   . THR G 4 41  ? 43.426 56.552  87.890  1.00 27.69  ? 41   THR A OG1   1 
ATOM   3278  C  CG2   . THR G 4 41  ? 45.584 55.641  88.311  1.00 29.00  ? 41   THR A CG2   1 
ATOM   3279  N  N     . TRP G 4 42  ? 45.831 57.670  91.254  1.00 29.09  ? 42   TRP A N     1 
ATOM   3280  C  CA    . TRP G 4 42  ? 46.935 57.727  92.177  1.00 30.66  ? 42   TRP A CA    1 
ATOM   3281  C  C     . TRP G 4 42  ? 46.574 57.065  93.495  1.00 30.04  ? 42   TRP A C     1 
ATOM   3282  O  O     . TRP G 4 42  ? 47.402 56.381  94.091  1.00 28.92  ? 42   TRP A O     1 
ATOM   3283  C  CB    . TRP G 4 42  ? 47.351 59.160  92.473  1.00 34.13  ? 42   TRP A CB    1 
ATOM   3284  C  CG    . TRP G 4 42  ? 48.163 59.713  91.430  1.00 37.56  ? 42   TRP A CG    1 
ATOM   3285  C  CD1   . TRP G 4 42  ? 47.740 60.465  90.384  1.00 39.99  ? 42   TRP A CD1   1 
ATOM   3286  C  CD2   . TRP G 4 42  ? 49.531 59.420  91.196  1.00 38.70  ? 42   TRP A CD2   1 
ATOM   3287  N  NE1   . TRP G 4 42  ? 48.767 60.648  89.493  1.00 42.90  ? 42   TRP A NE1   1 
ATOM   3288  C  CE2   . TRP G 4 42  ? 49.880 60.009  89.971  1.00 41.20  ? 42   TRP A CE2   1 
ATOM   3289  C  CE3   . TRP G 4 42  ? 50.492 58.713  91.896  1.00 39.76  ? 42   TRP A CE3   1 
ATOM   3290  C  CZ2   . TRP G 4 42  ? 51.149 59.902  89.430  1.00 41.37  ? 42   TRP A CZ2   1 
ATOM   3291  C  CZ3   . TRP G 4 42  ? 51.745 58.608  91.361  1.00 42.48  ? 42   TRP A CZ3   1 
ATOM   3292  C  CH2   . TRP G 4 42  ? 52.066 59.197  90.138  1.00 42.00  ? 42   TRP A CH2   1 
ATOM   3293  N  N     . LYS G 4 43  ? 45.348 57.265  93.960  1.00 29.53  ? 43   LYS A N     1 
ATOM   3294  C  CA    . LYS G 4 43  ? 44.981 56.685  95.236  1.00 30.64  ? 43   LYS A CA    1 
ATOM   3295  C  C     . LYS G 4 43  ? 45.234 55.202  95.260  1.00 30.02  ? 43   LYS A C     1 
ATOM   3296  O  O     . LYS G 4 43  ? 45.799 54.710  96.225  1.00 31.68  ? 43   LYS A O     1 
ATOM   3297  C  CB    . LYS G 4 43  ? 43.528 56.954  95.584  1.00 33.05  ? 43   LYS A CB    1 
ATOM   3298  C  CG    . LYS G 4 43  ? 43.314 57.648  96.929  1.00 38.07  ? 43   LYS A CG    1 
ATOM   3299  C  CD    . LYS G 4 43  ? 42.729 59.076  96.716  1.00 44.35  ? 43   LYS A CD    1 
ATOM   3300  C  CE    . LYS G 4 43  ? 42.479 59.878  98.036  1.00 47.97  ? 43   LYS A CE    1 
ATOM   3301  N  NZ    . LYS G 4 43  ? 41.933 61.271  97.798  1.00 49.95  ? 43   LYS A NZ    1 
ATOM   3302  N  N     . MET G 4 44  ? 44.828 54.473  94.223  1.00 28.13  ? 44   MET A N     1 
ATOM   3303  C  CA    . MET G 4 44  ? 45.080 53.037  94.220  1.00 25.25  ? 44   MET A CA    1 
ATOM   3304  C  C     . MET G 4 44  ? 46.568 52.741  94.113  1.00 25.08  ? 44   MET A C     1 
ATOM   3305  O  O     . MET G 4 44  ? 47.077 52.030  94.960  1.00 24.13  ? 44   MET A O     1 
ATOM   3306  C  CB    . MET G 4 44  ? 44.320 52.333  93.098  1.00 25.58  ? 44   MET A CB    1 
ATOM   3307  C  CG    . MET G 4 44  ? 42.840 52.153  93.383  1.00 24.98  ? 44   MET A CG    1 
ATOM   3308  S  SD    . MET G 4 44  ? 42.489 51.956  95.150  1.00 28.41  ? 44   MET A SD    1 
ATOM   3309  C  CE    . MET G 4 44  ? 42.565 50.172  95.438  1.00 24.09  ? 44   MET A CE    1 
ATOM   3310  N  N     . LEU G 4 45  ? 47.257 53.286  93.095  1.00 24.36  ? 45   LEU A N     1 
ATOM   3311  C  CA    . LEU G 4 45  ? 48.707 53.102  92.896  1.00 22.85  ? 45   LEU A CA    1 
ATOM   3312  C  C     . LEU G 4 45  ? 49.450 53.219  94.222  1.00 23.34  ? 45   LEU A C     1 
ATOM   3313  O  O     . LEU G 4 45  ? 50.227 52.335  94.593  1.00 22.25  ? 45   LEU A O     1 
ATOM   3314  C  CB    . LEU G 4 45  ? 49.283 54.148  91.927  1.00 20.07  ? 45   LEU A CB    1 
ATOM   3315  C  CG    . LEU G 4 45  ? 50.831 54.183  91.909  1.00 18.75  ? 45   LEU A CG    1 
ATOM   3316  C  CD1   . LEU G 4 45  ? 51.327 52.825  91.502  1.00 17.59  ? 45   LEU A CD1   1 
ATOM   3317  C  CD2   . LEU G 4 45  ? 51.398 55.222  90.979  1.00 15.00  ? 45   LEU A CD2   1 
ATOM   3318  N  N     . LEU G 4 46  ? 49.233 54.327  94.925  1.00 24.60  ? 46   LEU A N     1 
ATOM   3319  C  CA    . LEU G 4 46  ? 49.859 54.507  96.227  1.00 26.69  ? 46   LEU A CA    1 
ATOM   3320  C  C     . LEU G 4 46  ? 49.450 53.370  97.149  1.00 27.68  ? 46   LEU A C     1 
ATOM   3321  O  O     . LEU G 4 46  ? 50.296 52.709  97.728  1.00 29.99  ? 46   LEU A O     1 
ATOM   3322  C  CB    . LEU G 4 46  ? 49.459 55.839  96.843  1.00 26.94  ? 46   LEU A CB    1 
ATOM   3323  C  CG    . LEU G 4 46  ? 50.108 57.010  96.118  1.00 28.53  ? 46   LEU A CG    1 
ATOM   3324  C  CD1   . LEU G 4 46  ? 49.770 58.264  96.826  1.00 29.64  ? 46   LEU A CD1   1 
ATOM   3325  C  CD2   . LEU G 4 46  ? 51.607 56.864  96.102  1.00 29.60  ? 46   LEU A CD2   1 
ATOM   3326  N  N     . SER G 4 47  ? 48.154 53.126  97.269  1.00 26.91  ? 47   SER A N     1 
ATOM   3327  C  CA    . SER G 4 47  ? 47.671 52.053  98.109  1.00 25.31  ? 47   SER A CA    1 
ATOM   3328  C  C     . SER G 4 47  ? 48.278 50.698  97.756  1.00 24.55  ? 47   SER A C     1 
ATOM   3329  O  O     . SER G 4 47  ? 48.535 49.884  98.625  1.00 23.84  ? 47   SER A O     1 
ATOM   3330  C  CB    . SER G 4 47  ? 46.163 51.963  98.011  1.00 25.75  ? 47   SER A CB    1 
ATOM   3331  O  OG    . SER G 4 47  ? 45.651 51.123  99.031  1.00 26.77  ? 47   SER A OG    1 
ATOM   3332  N  N     . VAL G 4 48  ? 48.510 50.421  96.487  1.00 25.43  ? 48   VAL A N     1 
ATOM   3333  C  CA    . VAL G 4 48  ? 49.086 49.125  96.199  1.00 26.76  ? 48   VAL A CA    1 
ATOM   3334  C  C     . VAL G 4 48  ? 50.532 49.088  96.565  1.00 29.02  ? 48   VAL A C     1 
ATOM   3335  O  O     . VAL G 4 48  ? 50.931 48.163  97.264  1.00 31.52  ? 48   VAL A O     1 
ATOM   3336  C  CB    . VAL G 4 48  ? 48.936 48.692  94.760  1.00 24.79  ? 48   VAL A CB    1 
ATOM   3337  C  CG1   . VAL G 4 48  ? 49.725 47.437  94.530  1.00 22.29  ? 48   VAL A CG1   1 
ATOM   3338  C  CG2   . VAL G 4 48  ? 47.488 48.414  94.477  1.00 23.83  ? 48   VAL A CG2   1 
ATOM   3339  N  N     . CYS G 4 49  ? 51.330 50.055  96.114  1.00 29.23  ? 49   CYS A N     1 
ATOM   3340  C  CA    . CYS G 4 49  ? 52.730 50.041  96.498  1.00 29.83  ? 49   CYS A CA    1 
ATOM   3341  C  C     . CYS G 4 49  ? 52.798 49.900  98.013  1.00 30.25  ? 49   CYS A C     1 
ATOM   3342  O  O     . CYS G 4 49  ? 53.477 49.020  98.525  1.00 30.54  ? 49   CYS A O     1 
ATOM   3343  C  CB    . CYS G 4 49  ? 53.408 51.320  96.092  1.00 30.50  ? 49   CYS A CB    1 
ATOM   3344  S  SG    . CYS G 4 49  ? 53.459 51.542  94.348  1.00 36.99  ? 49   CYS A SG    1 
ATOM   3345  N  N     . ARG G 4 50  ? 52.074 50.757  98.725  1.00 29.96  ? 50   ARG A N     1 
ATOM   3346  C  CA    . ARG G 4 50  ? 52.041 50.720  100.184 1.00 31.08  ? 50   ARG A CA    1 
ATOM   3347  C  C     . ARG G 4 50  ? 51.879 49.302  100.721 1.00 30.24  ? 50   ARG A C     1 
ATOM   3348  O  O     . ARG G 4 50  ? 52.598 48.866  101.618 1.00 29.74  ? 50   ARG A O     1 
ATOM   3349  C  CB    . ARG G 4 50  ? 50.879 51.566  100.715 1.00 33.38  ? 50   ARG A CB    1 
ATOM   3350  C  CG    . ARG G 4 50  ? 51.278 52.786  101.580 1.00 37.09  ? 50   ARG A CG    1 
ATOM   3351  C  CD    . ARG G 4 50  ? 50.239 53.132  102.671 1.00 39.30  ? 50   ARG A CD    1 
ATOM   3352  N  NE    . ARG G 4 50  ? 48.915 53.455  102.140 1.00 42.50  ? 50   ARG A NE    1 
ATOM   3353  C  CZ    . ARG G 4 50  ? 48.638 54.510  101.381 1.00 44.48  ? 50   ARG A CZ    1 
ATOM   3354  N  NH1   . ARG G 4 50  ? 49.601 55.369  101.058 1.00 44.75  ? 50   ARG A NH1   1 
ATOM   3355  N  NH2   . ARG G 4 50  ? 47.400 54.692  100.929 1.00 45.33  ? 50   ARG A NH2   1 
ATOM   3356  N  N     . SER G 4 51  ? 50.902 48.601  100.166 1.00 30.42  ? 51   SER A N     1 
ATOM   3357  C  CA    . SER G 4 51  ? 50.567 47.230  100.551 1.00 29.89  ? 51   SER A CA    1 
ATOM   3358  C  C     . SER G 4 51  ? 51.587 46.158  100.164 1.00 27.76  ? 51   SER A C     1 
ATOM   3359  O  O     . SER G 4 51  ? 51.785 45.182  100.882 1.00 26.89  ? 51   SER A O     1 
ATOM   3360  C  CB    . SER G 4 51  ? 49.228 46.854  99.941  1.00 31.55  ? 51   SER A CB    1 
ATOM   3361  O  OG    . SER G 4 51  ? 49.152 45.444  99.849  1.00 35.85  ? 51   SER A OG    1 
ATOM   3362  N  N     . TRP G 4 52  ? 52.181 46.322  98.992  1.00 26.13  ? 52   TRP A N     1 
ATOM   3363  C  CA    . TRP G 4 52  ? 53.197 45.404  98.501  1.00 23.85  ? 52   TRP A CA    1 
ATOM   3364  C  C     . TRP G 4 52  ? 54.388 45.645  99.411  1.00 23.81  ? 52   TRP A C     1 
ATOM   3365  O  O     . TRP G 4 52  ? 54.921 44.727  100.014 1.00 23.59  ? 52   TRP A O     1 
ATOM   3366  C  CB    . TRP G 4 52  ? 53.481 45.759  97.046  1.00 19.92  ? 52   TRP A CB    1 
ATOM   3367  C  CG    . TRP G 4 52  ? 54.796 45.439  96.496  1.00 16.86  ? 52   TRP A CG    1 
ATOM   3368  C  CD1   . TRP G 4 52  ? 55.699 46.327  96.027  1.00 18.25  ? 52   TRP A CD1   1 
ATOM   3369  C  CD2   . TRP G 4 52  ? 55.319 44.154  96.211  1.00 16.03  ? 52   TRP A CD2   1 
ATOM   3370  N  NE1   . TRP G 4 52  ? 56.759 45.682  95.453  1.00 16.58  ? 52   TRP A NE1   1 
ATOM   3371  C  CE2   . TRP G 4 52  ? 56.546 44.339  95.555  1.00 15.41  ? 52   TRP A CE2   1 
ATOM   3372  C  CE3   . TRP G 4 52  ? 54.868 42.860  96.435  1.00 15.65  ? 52   TRP A CE3   1 
ATOM   3373  C  CZ2   . TRP G 4 52  ? 57.321 43.290  95.128  1.00 14.15  ? 52   TRP A CZ2   1 
ATOM   3374  C  CZ3   . TRP G 4 52  ? 55.643 41.809  96.002  1.00 14.53  ? 52   TRP A CZ3   1 
ATOM   3375  C  CH2   . TRP G 4 52  ? 56.852 42.033  95.357  1.00 14.55  ? 52   TRP A CH2   1 
ATOM   3376  N  N     . ALA G 4 53  ? 54.742 46.912  99.567  1.00 23.38  ? 53   ALA A N     1 
ATOM   3377  C  CA    . ALA G 4 53  ? 55.861 47.303  100.409 1.00 23.80  ? 53   ALA A CA    1 
ATOM   3378  C  C     . ALA G 4 53  ? 55.843 46.704  101.796 1.00 23.29  ? 53   ALA A C     1 
ATOM   3379  O  O     . ALA G 4 53  ? 56.883 46.360  102.333 1.00 23.11  ? 53   ALA A O     1 
ATOM   3380  C  CB    . ALA G 4 53  ? 55.930 48.803  100.514 1.00 23.26  ? 53   ALA A CB    1 
ATOM   3381  N  N     . ALA G 4 54  ? 54.672 46.574  102.389 1.00 23.55  ? 54   ALA A N     1 
ATOM   3382  C  CA    . ALA G 4 54  ? 54.610 46.026  103.735 1.00 24.37  ? 54   ALA A CA    1 
ATOM   3383  C  C     . ALA G 4 54  ? 54.756 44.520  103.760 1.00 24.26  ? 54   ALA A C     1 
ATOM   3384  O  O     . ALA G 4 54  ? 55.234 43.952  104.725 1.00 24.06  ? 54   ALA A O     1 
ATOM   3385  C  CB    . ALA G 4 54  ? 53.312 46.436  104.407 1.00 26.97  ? 54   ALA A CB    1 
ATOM   3386  N  N     . TRP G 4 55  ? 54.331 43.864  102.698 1.00 25.24  ? 55   TRP A N     1 
ATOM   3387  C  CA    . TRP G 4 55  ? 54.454 42.428  102.659 1.00 26.00  ? 55   TRP A CA    1 
ATOM   3388  C  C     . TRP G 4 55  ? 55.935 42.117  102.427 1.00 27.66  ? 55   TRP A C     1 
ATOM   3389  O  O     . TRP G 4 55  ? 56.469 41.137  102.929 1.00 27.68  ? 55   TRP A O     1 
ATOM   3390  C  CB    . TRP G 4 55  ? 53.572 41.881  101.538 1.00 23.80  ? 55   TRP A CB    1 
ATOM   3391  C  CG    . TRP G 4 55  ? 53.753 40.450  101.276 1.00 21.26  ? 55   TRP A CG    1 
ATOM   3392  C  CD1   . TRP G 4 55  ? 53.125 39.413  101.879 1.00 20.82  ? 55   TRP A CD1   1 
ATOM   3393  C  CD2   . TRP G 4 55  ? 54.688 39.887  100.371 1.00 20.74  ? 55   TRP A CD2   1 
ATOM   3394  N  NE1   . TRP G 4 55  ? 53.616 38.219  101.406 1.00 21.08  ? 55   TRP A NE1   1 
ATOM   3395  C  CE2   . TRP G 4 55  ? 54.580 38.490  100.475 1.00 19.91  ? 55   TRP A CE2   1 
ATOM   3396  C  CE3   . TRP G 4 55  ? 55.613 40.436  99.470  1.00 19.63  ? 55   TRP A CE3   1 
ATOM   3397  C  CZ2   . TRP G 4 55  ? 55.351 37.640  99.723  1.00 18.21  ? 55   TRP A CZ2   1 
ATOM   3398  C  CZ3   . TRP G 4 55  ? 56.373 39.598  98.720  1.00 18.16  ? 55   TRP A CZ3   1 
ATOM   3399  C  CH2   . TRP G 4 55  ? 56.240 38.206  98.849  1.00 18.80  ? 55   TRP A CH2   1 
ATOM   3400  N  N     . CYS G 4 56  ? 56.600 42.978  101.672 1.00 30.29  ? 56   CYS A N     1 
ATOM   3401  C  CA    . CYS G 4 56  ? 58.012 42.803  101.388 1.00 32.32  ? 56   CYS A CA    1 
ATOM   3402  C  C     . CYS G 4 56  ? 58.827 43.022  102.640 1.00 34.55  ? 56   CYS A C     1 
ATOM   3403  O  O     . CYS G 4 56  ? 59.830 42.361  102.840 1.00 35.59  ? 56   CYS A O     1 
ATOM   3404  C  CB    . CYS G 4 56  ? 58.471 43.790  100.341 1.00 31.86  ? 56   CYS A CB    1 
ATOM   3405  S  SG    . CYS G 4 56  ? 58.026 43.366  98.707  1.00 32.57  ? 56   CYS A SG    1 
ATOM   3406  N  N     . LYS G 4 57  ? 58.440 43.982  103.467 1.00 36.61  ? 57   LYS A N     1 
ATOM   3407  C  CA    . LYS G 4 57  ? 59.189 44.174  104.691 1.00 39.01  ? 57   LYS A CA    1 
ATOM   3408  C  C     . LYS G 4 57  ? 58.938 42.923  105.473 1.00 38.73  ? 57   LYS A C     1 
ATOM   3409  O  O     . LYS G 4 57  ? 59.830 42.146  105.694 1.00 39.93  ? 57   LYS A O     1 
ATOM   3410  C  CB    . LYS G 4 57  ? 58.693 45.370  105.508 1.00 42.67  ? 57   LYS A CB    1 
ATOM   3411  C  CG    . LYS G 4 57  ? 59.045 46.738  104.895 1.00 48.24  ? 57   LYS A CG    1 
ATOM   3412  C  CD    . LYS G 4 57  ? 58.534 47.881  105.779 1.00 51.47  ? 57   LYS A CD    1 
ATOM   3413  C  CE    . LYS G 4 57  ? 58.448 49.219  105.033 1.00 53.55  ? 57   LYS A CE    1 
ATOM   3414  N  NZ    . LYS G 4 57  ? 57.537 50.157  105.777 1.00 54.70  ? 57   LYS A NZ    1 
ATOM   3415  N  N     . LEU G 4 58  ? 57.694 42.705  105.859 1.00 39.50  ? 58   LEU A N     1 
ATOM   3416  C  CA    . LEU G 4 58  ? 57.353 41.534  106.655 1.00 38.91  ? 58   LEU A CA    1 
ATOM   3417  C  C     . LEU G 4 58  ? 57.991 40.234  106.177 1.00 39.06  ? 58   LEU A C     1 
ATOM   3418  O  O     . LEU G 4 58  ? 58.351 39.379  106.978 1.00 38.66  ? 58   LEU A O     1 
ATOM   3419  C  CB    . LEU G 4 58  ? 55.839 41.339  106.699 1.00 38.48  ? 58   LEU A CB    1 
ATOM   3420  C  CG    . LEU G 4 58  ? 55.547 40.231  107.699 1.00 39.03  ? 58   LEU A CG    1 
ATOM   3421  C  CD1   . LEU G 4 58  ? 55.439 40.905  109.022 1.00 41.22  ? 58   LEU A CD1   1 
ATOM   3422  C  CD2   . LEU G 4 58  ? 54.289 39.447  107.390 1.00 39.27  ? 58   LEU A CD2   1 
ATOM   3423  N  N     . ASN G 4 59  ? 58.140 40.095  104.872 1.00 39.12  ? 59   ASN A N     1 
ATOM   3424  C  CA    . ASN G 4 59  ? 58.671 38.878  104.309 1.00 39.44  ? 59   ASN A CA    1 
ATOM   3425  C  C     . ASN G 4 59  ? 60.107 38.935  103.813 1.00 40.57  ? 59   ASN A C     1 
ATOM   3426  O  O     . ASN G 4 59  ? 60.603 38.001  103.199 1.00 41.19  ? 59   ASN A O     1 
ATOM   3427  C  CB    . ASN G 4 59  ? 57.738 38.453  103.205 1.00 40.17  ? 59   ASN A CB    1 
ATOM   3428  C  CG    . ASN G 4 59  ? 56.777 37.417  103.658 1.00 40.71  ? 59   ASN A CG    1 
ATOM   3429  O  OD1   . ASN G 4 59  ? 57.148 36.250  103.728 1.00 43.16  ? 59   ASN A OD1   1 
ATOM   3430  N  ND2   . ASN G 4 59  ? 55.542 37.813  103.986 1.00 37.89  ? 59   ASN A ND2   1 
ATOM   3431  N  N     . ASN G 4 60  ? 60.760 40.060  104.064 1.00 41.48  ? 60   ASN A N     1 
ATOM   3432  C  CA    . ASN G 4 60  ? 62.155 40.271  103.704 1.00 41.48  ? 60   ASN A CA    1 
ATOM   3433  C  C     . ASN G 4 60  ? 62.504 40.131  102.239 1.00 40.48  ? 60   ASN A C     1 
ATOM   3434  O  O     . ASN G 4 60  ? 63.375 39.349  101.897 1.00 40.64  ? 60   ASN A O     1 
ATOM   3435  C  CB    . ASN G 4 60  ? 63.015 39.326  104.534 1.00 43.19  ? 60   ASN A CB    1 
ATOM   3436  C  CG    . ASN G 4 60  ? 62.783 39.489  106.050 1.00 46.03  ? 60   ASN A CG    1 
ATOM   3437  O  OD1   . ASN G 4 60  ? 63.123 40.527  106.643 1.00 46.80  ? 60   ASN A OD1   1 
ATOM   3438  N  ND2   . ASN G 4 60  ? 62.203 38.458  106.677 1.00 46.29  ? 60   ASN A ND2   1 
ATOM   3439  N  N     . ARG G 4 61  ? 61.840 40.893  101.375 1.00 40.21  ? 61   ARG A N     1 
ATOM   3440  C  CA    . ARG G 4 61  ? 62.118 40.841  99.937  1.00 40.25  ? 61   ARG A CA    1 
ATOM   3441  C  C     . ARG G 4 61  ? 62.446 42.254  99.528  1.00 42.17  ? 61   ARG A C     1 
ATOM   3442  O  O     . ARG G 4 61  ? 62.209 43.174  100.297 1.00 43.21  ? 61   ARG A O     1 
ATOM   3443  C  CB    . ARG G 4 61  ? 60.889 40.396  99.142  1.00 38.57  ? 61   ARG A CB    1 
ATOM   3444  C  CG    . ARG G 4 61  ? 59.968 39.448  99.857  1.00 35.16  ? 61   ARG A CG    1 
ATOM   3445  C  CD    . ARG G 4 61  ? 60.647 38.173  100.174 1.00 29.30  ? 61   ARG A CD    1 
ATOM   3446  N  NE    . ARG G 4 61  ? 60.135 37.120  99.333  1.00 26.98  ? 61   ARG A NE    1 
ATOM   3447  C  CZ    . ARG G 4 61  ? 59.301 36.189  99.766  1.00 26.97  ? 61   ARG A CZ    1 
ATOM   3448  N  NH1   . ARG G 4 61  ? 58.912 36.216  101.034 1.00 26.65  ? 61   ARG A NH1   1 
ATOM   3449  N  NH2   . ARG G 4 61  ? 58.870 35.229  98.946  1.00 25.05  ? 61   ARG A NH2   1 
ATOM   3450  N  N     . LYS G 4 62  ? 62.977 42.433  98.325  1.00 44.86  ? 62   LYS A N     1 
ATOM   3451  C  CA    . LYS G 4 62  ? 63.316 43.768  97.831  1.00 47.77  ? 62   LYS A CA    1 
ATOM   3452  C  C     . LYS G 4 62  ? 62.032 44.338  97.201  1.00 46.76  ? 62   LYS A C     1 
ATOM   3453  O  O     . LYS G 4 62  ? 61.432 43.690  96.348  1.00 47.70  ? 62   LYS A O     1 
ATOM   3454  C  CB    . LYS G 4 62  ? 64.439 43.650  96.783  1.00 51.92  ? 62   LYS A CB    1 
ATOM   3455  C  CG    . LYS G 4 62  ? 65.184 44.956  96.459  1.00 59.00  ? 62   LYS A CG    1 
ATOM   3456  C  CD    . LYS G 4 62  ? 65.911 44.907  95.085  1.00 64.76  ? 62   LYS A CD    1 
ATOM   3457  C  CE    . LYS G 4 62  ? 67.060 43.869  95.039  1.00 69.29  ? 62   LYS A CE    1 
ATOM   3458  N  NZ    . LYS G 4 62  ? 67.802 43.805  93.710  1.00 71.54  ? 62   LYS A NZ    1 
ATOM   3459  N  N     . TRP G 4 63  ? 61.603 45.533  97.600  1.00 46.11  ? 63   TRP A N     1 
ATOM   3460  C  CA    . TRP G 4 63  ? 60.360 46.087  97.060  1.00 46.43  ? 63   TRP A CA    1 
ATOM   3461  C  C     . TRP G 4 63  ? 60.382 46.757  95.688  1.00 44.76  ? 63   TRP A C     1 
ATOM   3462  O  O     . TRP G 4 63  ? 59.322 47.036  95.143  1.00 43.65  ? 63   TRP A O     1 
ATOM   3463  C  CB    . TRP G 4 63  ? 59.738 47.076  98.041  1.00 49.76  ? 63   TRP A CB    1 
ATOM   3464  C  CG    . TRP G 4 63  ? 59.947 48.515  97.650  1.00 53.81  ? 63   TRP A CG    1 
ATOM   3465  C  CD1   . TRP G 4 63  ? 61.062 49.259  97.866  1.00 55.88  ? 63   TRP A CD1   1 
ATOM   3466  C  CD2   . TRP G 4 63  ? 59.033 49.363  96.931  1.00 55.37  ? 63   TRP A CD2   1 
ATOM   3467  N  NE1   . TRP G 4 63  ? 60.912 50.516  97.328  1.00 57.52  ? 63   TRP A NE1   1 
ATOM   3468  C  CE2   . TRP G 4 63  ? 59.676 50.609  96.750  1.00 56.90  ? 63   TRP A CE2   1 
ATOM   3469  C  CE3   . TRP G 4 63  ? 57.738 49.192  96.424  1.00 55.02  ? 63   TRP A CE3   1 
ATOM   3470  C  CZ2   . TRP G 4 63  ? 59.068 51.683  96.082  1.00 57.06  ? 63   TRP A CZ2   1 
ATOM   3471  C  CZ3   . TRP G 4 63  ? 57.131 50.261  95.756  1.00 55.40  ? 63   TRP A CZ3   1 
ATOM   3472  C  CH2   . TRP G 4 63  ? 57.799 51.488  95.594  1.00 56.33  ? 63   TRP A CH2   1 
ATOM   3473  N  N     . PHE G 4 64  ? 61.556 47.036  95.136  1.00 42.36  ? 64   PHE A N     1 
ATOM   3474  C  CA    . PHE G 4 64  ? 61.608 47.676  93.830  1.00 41.90  ? 64   PHE A CA    1 
ATOM   3475  C  C     . PHE G 4 64  ? 63.012 47.868  93.255  1.00 42.41  ? 64   PHE A C     1 
ATOM   3476  O  O     . PHE G 4 64  ? 63.882 48.451  93.904  1.00 45.66  ? 64   PHE A O     1 
ATOM   3477  C  CB    . PHE G 4 64  ? 60.904 49.028  93.889  1.00 40.05  ? 64   PHE A CB    1 
ATOM   3478  C  CG    . PHE G 4 64  ? 60.868 49.730  92.568  1.00 38.69  ? 64   PHE A CG    1 
ATOM   3479  C  CD1   . PHE G 4 64  ? 61.990 50.397  92.092  1.00 38.33  ? 64   PHE A CD1   1 
ATOM   3480  C  CD2   . PHE G 4 64  ? 59.750 49.633  91.753  1.00 38.37  ? 64   PHE A CD2   1 
ATOM   3481  C  CE1   . PHE G 4 64  ? 62.004 50.939  90.837  1.00 38.24  ? 64   PHE A CE1   1 
ATOM   3482  C  CE2   . PHE G 4 64  ? 59.749 50.171  90.492  1.00 37.88  ? 64   PHE A CE2   1 
ATOM   3483  C  CZ    . PHE G 4 64  ? 60.877 50.825  90.027  1.00 39.14  ? 64   PHE A CZ    1 
ATOM   3484  N  N     . PRO G 4 65  ? 63.244 47.443  92.003  1.00 41.02  ? 65   PRO A N     1 
ATOM   3485  C  CA    . PRO G 4 65  ? 62.376 46.787  91.030  1.00 42.11  ? 65   PRO A CA    1 
ATOM   3486  C  C     . PRO G 4 65  ? 61.960 45.500  91.650  1.00 42.14  ? 65   PRO A C     1 
ATOM   3487  O  O     . PRO G 4 65  ? 62.656 45.014  92.530  1.00 43.20  ? 65   PRO A O     1 
ATOM   3488  C  CB    . PRO G 4 65  ? 63.290 46.532  89.851  1.00 41.64  ? 65   PRO A CB    1 
ATOM   3489  C  CG    . PRO G 4 65  ? 64.390 47.482  90.049  1.00 42.33  ? 65   PRO A CG    1 
ATOM   3490  C  CD    . PRO G 4 65  ? 64.617 47.449  91.505  1.00 41.67  ? 65   PRO A CD    1 
ATOM   3491  N  N     . ALA G 4 66  ? 60.846 44.943  91.185  1.00 41.09  ? 66   ALA A N     1 
ATOM   3492  C  CA    . ALA G 4 66  ? 60.329 43.707  91.736  1.00 39.40  ? 66   ALA A CA    1 
ATOM   3493  C  C     . ALA G 4 66  ? 60.849 42.514  90.972  1.00 39.35  ? 66   ALA A C     1 
ATOM   3494  O  O     . ALA G 4 66  ? 61.064 42.580  89.768  1.00 40.05  ? 66   ALA A O     1 
ATOM   3495  C  CB    . ALA G 4 66  ? 58.812 43.734  91.712  1.00 37.82  ? 66   ALA A CB    1 
ATOM   3496  N  N     . GLU G 4 67  ? 61.068 41.427  91.691  1.00 39.34  ? 67   GLU A N     1 
ATOM   3497  C  CA    . GLU G 4 67  ? 61.548 40.190  91.101  1.00 40.19  ? 67   GLU A CA    1 
ATOM   3498  C  C     . GLU G 4 67  ? 60.349 39.236  90.946  1.00 39.35  ? 67   GLU A C     1 
ATOM   3499  O  O     . GLU G 4 67  ? 59.572 39.033  91.879  1.00 40.68  ? 67   GLU A O     1 
ATOM   3500  C  CB    . GLU G 4 67  ? 62.602 39.554  92.018  1.00 44.02  ? 67   GLU A CB    1 
ATOM   3501  C  CG    . GLU G 4 67  ? 63.948 39.195  91.366  1.00 50.59  ? 67   GLU A CG    1 
ATOM   3502  C  CD    . GLU G 4 67  ? 64.922 40.389  91.280  1.00 55.25  ? 67   GLU A CD    1 
ATOM   3503  O  OE1   . GLU G 4 67  ? 65.023 41.176  92.257  1.00 57.61  ? 67   GLU A OE1   1 
ATOM   3504  O  OE2   . GLU G 4 67  ? 65.608 40.539  90.240  1.00 58.76  ? 67   GLU A OE2   1 
ATOM   3505  N  N     . PRO G 4 68  ? 60.175 38.641  89.765  1.00 37.71  ? 68   PRO A N     1 
ATOM   3506  C  CA    . PRO G 4 68  ? 59.062 37.721  89.544  1.00 34.39  ? 68   PRO A CA    1 
ATOM   3507  C  C     . PRO G 4 68  ? 58.806 36.687  90.639  1.00 33.69  ? 68   PRO A C     1 
ATOM   3508  O  O     . PRO G 4 68  ? 57.741 36.620  91.236  1.00 32.95  ? 68   PRO A O     1 
ATOM   3509  C  CB    . PRO G 4 68  ? 59.431 37.086  88.221  1.00 34.67  ? 68   PRO A CB    1 
ATOM   3510  C  CG    . PRO G 4 68  ? 59.951 38.252  87.497  1.00 35.91  ? 68   PRO A CG    1 
ATOM   3511  C  CD    . PRO G 4 68  ? 60.855 38.926  88.499  1.00 36.12  ? 68   PRO A CD    1 
ATOM   3512  N  N     . GLU G 4 69  ? 59.786 35.869  90.909  1.00 32.94  ? 69   GLU A N     1 
ATOM   3513  C  CA    . GLU G 4 69  ? 59.582 34.866  91.914  1.00 33.31  ? 69   GLU A CA    1 
ATOM   3514  C  C     . GLU G 4 69  ? 58.866 35.417  93.171  1.00 32.53  ? 69   GLU A C     1 
ATOM   3515  O  O     . GLU G 4 69  ? 58.129 34.682  93.825  1.00 32.80  ? 69   GLU A O     1 
ATOM   3516  C  CB    . GLU G 4 69  ? 60.948 34.245  92.250  1.00 34.79  ? 69   GLU A CB    1 
ATOM   3517  C  CG    . GLU G 4 69  ? 61.014 32.709  92.181  1.00 36.00  ? 69   GLU A CG    1 
ATOM   3518  C  CD    . GLU G 4 69  ? 60.267 32.095  90.997  1.00 37.20  ? 69   GLU A CD    1 
ATOM   3519  O  OE1   . GLU G 4 69  ? 59.315 31.332  91.251  1.00 38.20  ? 69   GLU A OE1   1 
ATOM   3520  O  OE2   . GLU G 4 69  ? 60.614 32.355  89.824  1.00 37.67  ? 69   GLU A OE2   1 
ATOM   3521  N  N     . ASP G 4 70  ? 59.062 36.704  93.489  1.00 32.08  ? 70   ASP A N     1 
ATOM   3522  C  CA    . ASP G 4 70  ? 58.463 37.331  94.687  1.00 29.43  ? 70   ASP A CA    1 
ATOM   3523  C  C     . ASP G 4 70  ? 57.094 37.871  94.409  1.00 27.13  ? 70   ASP A C     1 
ATOM   3524  O  O     . ASP G 4 70  ? 56.207 37.743  95.227  1.00 26.99  ? 70   ASP A O     1 
ATOM   3525  C  CB    . ASP G 4 70  ? 59.285 38.505  95.213  1.00 31.66  ? 70   ASP A CB    1 
ATOM   3526  C  CG    . ASP G 4 70  ? 60.579 38.086  95.901  1.00 34.50  ? 70   ASP A CG    1 
ATOM   3527  O  OD1   . ASP G 4 70  ? 60.654 36.971  96.489  1.00 33.47  ? 70   ASP A OD1   1 
ATOM   3528  O  OD2   . ASP G 4 70  ? 61.523 38.921  95.858  1.00 36.61  ? 70   ASP A OD2   1 
ATOM   3529  N  N     . VAL G 4 71  ? 56.933 38.537  93.279  1.00 24.69  ? 71   VAL A N     1 
ATOM   3530  C  CA    . VAL G 4 71  ? 55.626 39.034  92.920  1.00 23.05  ? 71   VAL A CA    1 
ATOM   3531  C  C     . VAL G 4 71  ? 54.682 37.833  92.905  1.00 21.70  ? 71   VAL A C     1 
ATOM   3532  O  O     . VAL G 4 71  ? 53.547 37.924  93.351  1.00 21.25  ? 71   VAL A O     1 
ATOM   3533  C  CB    . VAL G 4 71  ? 55.658 39.700  91.537  1.00 22.69  ? 71   VAL A CB    1 
ATOM   3534  C  CG1   . VAL G 4 71  ? 54.290 39.602  90.872  1.00 22.45  ? 71   VAL A CG1   1 
ATOM   3535  C  CG2   . VAL G 4 71  ? 56.062 41.159  91.694  1.00 22.29  ? 71   VAL A CG2   1 
ATOM   3536  N  N     . ARG G 4 72  ? 55.158 36.699  92.403  1.00 21.24  ? 72   ARG A N     1 
ATOM   3537  C  CA    . ARG G 4 72  ? 54.333 35.501  92.375  1.00 21.63  ? 72   ARG A CA    1 
ATOM   3538  C  C     . ARG G 4 72  ? 53.981 35.044  93.776  1.00 21.68  ? 72   ARG A C     1 
ATOM   3539  O  O     . ARG G 4 72  ? 52.829 34.818  94.072  1.00 22.11  ? 72   ARG A O     1 
ATOM   3540  C  CB    . ARG G 4 72  ? 55.032 34.351  91.661  1.00 22.60  ? 72   ARG A CB    1 
ATOM   3541  C  CG    . ARG G 4 72  ? 54.261 33.019  91.770  1.00 23.66  ? 72   ARG A CG    1 
ATOM   3542  C  CD    . ARG G 4 72  ? 55.025 31.751  91.305  1.00 24.20  ? 72   ARG A CD    1 
ATOM   3543  N  NE    . ARG G 4 72  ? 54.853 30.695  92.306  1.00 25.20  ? 72   ARG A NE    1 
ATOM   3544  C  CZ    . ARG G 4 72  ? 54.387 29.477  92.055  1.00 24.85  ? 72   ARG A CZ    1 
ATOM   3545  N  NH1   . ARG G 4 72  ? 54.054 29.140  90.817  1.00 22.98  ? 72   ARG A NH1   1 
ATOM   3546  N  NH2   . ARG G 4 72  ? 54.205 28.621  93.057  1.00 22.86  ? 72   ARG A NH2   1 
ATOM   3547  N  N     . ASP G 4 73  ? 54.971 34.884  94.638  1.00 22.19  ? 73   ASP A N     1 
ATOM   3548  C  CA    . ASP G 4 73  ? 54.695 34.456  96.002  1.00 22.48  ? 73   ASP A CA    1 
ATOM   3549  C  C     . ASP G 4 73  ? 53.669 35.403  96.603  1.00 21.89  ? 73   ASP A C     1 
ATOM   3550  O  O     . ASP G 4 73  ? 52.802 34.973  97.362  1.00 23.03  ? 73   ASP A O     1 
ATOM   3551  C  CB    . ASP G 4 73  ? 55.955 34.494  96.881  1.00 26.78  ? 73   ASP A CB    1 
ATOM   3552  C  CG    . ASP G 4 73  ? 56.853 33.270  96.727  1.00 31.69  ? 73   ASP A CG    1 
ATOM   3553  O  OD1   . ASP G 4 73  ? 57.535 32.930  97.729  1.00 33.88  ? 73   ASP A OD1   1 
ATOM   3554  O  OD2   . ASP G 4 73  ? 56.904 32.667  95.623  1.00 34.84  ? 73   ASP A OD2   1 
ATOM   3555  N  N     . TYR G 4 74  ? 53.781 36.690  96.265  1.00 20.73  ? 74   TYR A N     1 
ATOM   3556  C  CA    . TYR G 4 74  ? 52.880 37.731  96.767  1.00 19.11  ? 74   TYR A CA    1 
ATOM   3557  C  C     . TYR G 4 74  ? 51.494 37.604  96.234  1.00 20.09  ? 74   TYR A C     1 
ATOM   3558  O  O     . TYR G 4 74  ? 50.574 37.717  96.996  1.00 23.08  ? 74   TYR A O     1 
ATOM   3559  C  CB    . TYR G 4 74  ? 53.375 39.120  96.418  1.00 18.21  ? 74   TYR A CB    1 
ATOM   3560  C  CG    . TYR G 4 74  ? 52.395 40.241  96.706  1.00 14.99  ? 74   TYR A CG    1 
ATOM   3561  C  CD1   . TYR G 4 74  ? 51.868 40.419  97.969  1.00 14.78  ? 74   TYR A CD1   1 
ATOM   3562  C  CD2   . TYR G 4 74  ? 52.038 41.160  95.709  1.00 13.26  ? 74   TYR A CD2   1 
ATOM   3563  C  CE1   . TYR G 4 74  ? 51.016 41.475  98.234  1.00 14.78  ? 74   TYR A CE1   1 
ATOM   3564  C  CE2   . TYR G 4 74  ? 51.195 42.213  95.957  1.00 12.39  ? 74   TYR A CE2   1 
ATOM   3565  C  CZ    . TYR G 4 74  ? 50.685 42.365  97.225  1.00 15.16  ? 74   TYR A CZ    1 
ATOM   3566  O  OH    . TYR G 4 74  ? 49.825 43.402  97.499  1.00 17.70  ? 74   TYR A OH    1 
ATOM   3567  N  N     . LEU G 4 75  ? 51.311 37.402  94.934  1.00 20.07  ? 75   LEU A N     1 
ATOM   3568  C  CA    . LEU G 4 75  ? 49.949 37.240  94.425  1.00 18.99  ? 75   LEU A CA    1 
ATOM   3569  C  C     . LEU G 4 75  ? 49.289 35.987  95.047  1.00 19.17  ? 75   LEU A C     1 
ATOM   3570  O  O     . LEU G 4 75  ? 48.103 36.005  95.326  1.00 18.15  ? 75   LEU A O     1 
ATOM   3571  C  CB    . LEU G 4 75  ? 49.946 37.138  92.899  1.00 15.77  ? 75   LEU A CB    1 
ATOM   3572  C  CG    . LEU G 4 75  ? 50.428 38.294  92.029  1.00 11.61  ? 75   LEU A CG    1 
ATOM   3573  C  CD1   . LEU G 4 75  ? 50.431 37.810  90.636  1.00 12.06  ? 75   LEU A CD1   1 
ATOM   3574  C  CD2   . LEU G 4 75  ? 49.546 39.474  92.092  1.00 8.09   ? 75   LEU A CD2   1 
ATOM   3575  N  N     . LEU G 4 76  ? 50.042 34.909  95.268  1.00 20.53  ? 76   LEU A N     1 
ATOM   3576  C  CA    . LEU G 4 76  ? 49.459 33.716  95.882  1.00 23.94  ? 76   LEU A CA    1 
ATOM   3577  C  C     . LEU G 4 76  ? 49.081 33.966  97.333  1.00 26.33  ? 76   LEU A C     1 
ATOM   3578  O  O     . LEU G 4 76  ? 48.342 33.167  97.924  1.00 28.72  ? 76   LEU A O     1 
ATOM   3579  C  CB    . LEU G 4 76  ? 50.401 32.510  95.860  1.00 23.41  ? 76   LEU A CB    1 
ATOM   3580  C  CG    . LEU G 4 76  ? 50.594 31.690  94.587  1.00 25.16  ? 76   LEU A CG    1 
ATOM   3581  C  CD1   . LEU G 4 76  ? 51.215 30.363  94.910  1.00 23.96  ? 76   LEU A CD1   1 
ATOM   3582  C  CD2   . LEU G 4 76  ? 49.266 31.470  93.920  1.00 26.81  ? 76   LEU A CD2   1 
ATOM   3583  N  N     . TYR G 4 77  ? 49.610 35.047  97.908  1.00 26.50  ? 77   TYR A N     1 
ATOM   3584  C  CA    . TYR G 4 77  ? 49.318 35.438  99.293  1.00 25.62  ? 77   TYR A CA    1 
ATOM   3585  C  C     . TYR G 4 77  ? 47.954 36.077  99.310  1.00 24.52  ? 77   TYR A C     1 
ATOM   3586  O  O     . TYR G 4 77  ? 47.090 35.659  100.055 1.00 24.26  ? 77   TYR A O     1 
ATOM   3587  C  CB    . TYR G 4 77  ? 50.386 36.420  99.808  1.00 27.27  ? 77   TYR A CB    1 
ATOM   3588  C  CG    . TYR G 4 77  ? 49.986 37.317  100.965 1.00 27.77  ? 77   TYR A CG    1 
ATOM   3589  C  CD1   . TYR G 4 77  ? 49.655 36.799  102.200 1.00 27.70  ? 77   TYR A CD1   1 
ATOM   3590  C  CD2   . TYR G 4 77  ? 49.932 38.709  100.804 1.00 29.09  ? 77   TYR A CD2   1 
ATOM   3591  C  CE1   . TYR G 4 77  ? 49.268 37.656  103.263 1.00 29.57  ? 77   TYR A CE1   1 
ATOM   3592  C  CE2   . TYR G 4 77  ? 49.550 39.569  101.847 1.00 28.11  ? 77   TYR A CE2   1 
ATOM   3593  C  CZ    . TYR G 4 77  ? 49.216 39.042  103.074 1.00 28.82  ? 77   TYR A CZ    1 
ATOM   3594  O  OH    . TYR G 4 77  ? 48.809 39.888  104.097 1.00 29.02  ? 77   TYR A OH    1 
ATOM   3595  N  N     . LEU G 4 78  ? 47.765 37.084  98.471  1.00 23.56  ? 78   LEU A N     1 
ATOM   3596  C  CA    . LEU G 4 78  ? 46.488 37.759  98.379  1.00 23.96  ? 78   LEU A CA    1 
ATOM   3597  C  C     . LEU G 4 78  ? 45.448 36.713  98.152  1.00 25.80  ? 78   LEU A C     1 
ATOM   3598  O  O     . LEU G 4 78  ? 44.433 36.716  98.787  1.00 27.82  ? 78   LEU A O     1 
ATOM   3599  C  CB    . LEU G 4 78  ? 46.431 38.715  97.206  1.00 21.16  ? 78   LEU A CB    1 
ATOM   3600  C  CG    . LEU G 4 78  ? 47.474 39.806  97.190  1.00 19.43  ? 78   LEU A CG    1 
ATOM   3601  C  CD1   . LEU G 4 78  ? 47.607 40.365  95.813  1.00 19.68  ? 78   LEU A CD1   1 
ATOM   3602  C  CD2   . LEU G 4 78  ? 47.083 40.855  98.139  1.00 18.68  ? 78   LEU A CD2   1 
ATOM   3603  N  N     . GLN G 4 79  ? 45.677 35.796  97.247  1.00 28.98  ? 79   GLN A N     1 
ATOM   3604  C  CA    . GLN G 4 79  ? 44.636 34.819  97.038  1.00 33.20  ? 79   GLN A CA    1 
ATOM   3605  C  C     . GLN G 4 79  ? 44.230 34.210  98.341  1.00 33.82  ? 79   GLN A C     1 
ATOM   3606  O  O     . GLN G 4 79  ? 43.046 34.115  98.623  1.00 36.42  ? 79   GLN A O     1 
ATOM   3607  C  CB    . GLN G 4 79  ? 45.091 33.705  96.118  1.00 36.12  ? 79   GLN A CB    1 
ATOM   3608  C  CG    . GLN G 4 79  ? 44.101 32.562  95.976  1.00 37.73  ? 79   GLN A CG    1 
ATOM   3609  C  CD    . GLN G 4 79  ? 44.742 31.429  95.236  1.00 40.60  ? 79   GLN A CD    1 
ATOM   3610  O  OE1   . GLN G 4 79  ? 45.783 30.920  95.659  1.00 42.59  ? 79   GLN A OE1   1 
ATOM   3611  N  NE2   . GLN G 4 79  ? 44.156 31.041  94.111  1.00 41.97  ? 79   GLN A NE2   1 
ATOM   3612  N  N     . ALA G 4 80  ? 45.216 33.802  99.130  1.00 34.42  ? 80   ALA A N     1 
ATOM   3613  C  CA    . ALA G 4 80  ? 44.964 33.163  100.412 1.00 34.96  ? 80   ALA A CA    1 
ATOM   3614  C  C     . ALA G 4 80  ? 44.247 34.075  101.405 1.00 35.91  ? 80   ALA A C     1 
ATOM   3615  O  O     . ALA G 4 80  ? 43.310 33.654  102.076 1.00 37.12  ? 80   ALA A O     1 
ATOM   3616  C  CB    . ALA G 4 80  ? 46.247 32.698  100.984 1.00 35.87  ? 80   ALA A CB    1 
ATOM   3617  N  N     . ARG G 4 81  ? 44.691 35.321  101.520 1.00 35.49  ? 81   ARG A N     1 
ATOM   3618  C  CA    . ARG G 4 81  ? 44.019 36.258  102.409 1.00 34.58  ? 81   ARG A CA    1 
ATOM   3619  C  C     . ARG G 4 81  ? 42.518 36.278  102.030 1.00 31.81  ? 81   ARG A C     1 
ATOM   3620  O  O     . ARG G 4 81  ? 41.691 36.837  102.733 1.00 30.61  ? 81   ARG A O     1 
ATOM   3621  C  CB    . ARG G 4 81  ? 44.653 37.659  102.286 1.00 38.07  ? 81   ARG A CB    1 
ATOM   3622  C  CG    . ARG G 4 81  ? 45.128 38.252  103.618 1.00 44.24  ? 81   ARG A CG    1 
ATOM   3623  C  CD    . ARG G 4 81  ? 45.801 39.599  103.444 1.00 49.11  ? 81   ARG A CD    1 
ATOM   3624  N  NE    . ARG G 4 81  ? 44.940 40.570  102.783 1.00 53.41  ? 81   ARG A NE    1 
ATOM   3625  C  CZ    . ARG G 4 81  ? 45.286 41.831  102.532 1.00 56.70  ? 81   ARG A CZ    1 
ATOM   3626  N  NH1   . ARG G 4 81  ? 46.491 42.297  102.882 1.00 59.03  ? 81   ARG A NH1   1 
ATOM   3627  N  NH2   . ARG G 4 81  ? 44.422 42.633  101.929 1.00 56.05  ? 81   ARG A NH2   1 
ATOM   3628  N  N     . GLY G 4 82  ? 42.182 35.660  100.907 1.00 28.63  ? 82   GLY A N     1 
ATOM   3629  C  CA    . GLY G 4 82  ? 40.800 35.570  100.503 1.00 25.98  ? 82   GLY A CA    1 
ATOM   3630  C  C     . GLY G 4 82  ? 40.306 36.638  99.573  1.00 25.32  ? 82   GLY A C     1 
ATOM   3631  O  O     . GLY G 4 82  ? 39.107 36.753  99.310  1.00 25.19  ? 82   GLY A O     1 
ATOM   3632  N  N     . LEU G 4 83  ? 41.214 37.449  99.078  1.00 23.76  ? 83   LEU A N     1 
ATOM   3633  C  CA    . LEU G 4 83  ? 40.794 38.486  98.172  1.00 23.87  ? 83   LEU A CA    1 
ATOM   3634  C  C     . LEU G 4 83  ? 40.235 37.906  96.882  1.00 23.85  ? 83   LEU A C     1 
ATOM   3635  O  O     . LEU G 4 83  ? 40.508 36.745  96.486  1.00 22.07  ? 83   LEU A O     1 
ATOM   3636  C  CB    . LEU G 4 83  ? 41.956 39.414  97.852  1.00 24.03  ? 83   LEU A CB    1 
ATOM   3637  C  CG    . LEU G 4 83  ? 42.458 40.195  99.054  1.00 23.87  ? 83   LEU A CG    1 
ATOM   3638  C  CD1   . LEU G 4 83  ? 43.897 40.615  98.866  1.00 23.26  ? 83   LEU A CD1   1 
ATOM   3639  C  CD2   . LEU G 4 83  ? 41.584 41.367  99.232  1.00 23.42  ? 83   LEU A CD2   1 
ATOM   3640  N  N     . ALA G 4 84  ? 39.456 38.769  96.242  1.00 24.01  ? 84   ALA A N     1 
ATOM   3641  C  CA    . ALA G 4 84  ? 38.770 38.521  94.986  1.00 25.00  ? 84   ALA A CA    1 
ATOM   3642  C  C     . ALA G 4 84  ? 39.698 38.635  93.765  1.00 24.50  ? 84   ALA A C     1 
ATOM   3643  O  O     . ALA G 4 84  ? 40.758 39.254  93.819  1.00 26.09  ? 84   ALA A O     1 
ATOM   3644  C  CB    . ALA G 4 84  ? 37.627 39.501  94.871  1.00 25.22  ? 84   ALA A CB    1 
ATOM   3645  N  N     . VAL G 4 85  ? 39.285 38.074  92.642  1.00 22.93  ? 85   VAL A N     1 
ATOM   3646  C  CA    . VAL G 4 85  ? 40.137 38.101  91.485  1.00 21.61  ? 85   VAL A CA    1 
ATOM   3647  C  C     . VAL G 4 85  ? 40.310 39.460  90.838  1.00 21.10  ? 85   VAL A C     1 
ATOM   3648  O  O     . VAL G 4 85  ? 41.366 39.751  90.324  1.00 20.10  ? 85   VAL A O     1 
ATOM   3649  C  CB    . VAL G 4 85  ? 39.643 37.077  90.500  1.00 20.64  ? 85   VAL A CB    1 
ATOM   3650  C  CG1   . VAL G 4 85  ? 40.620 36.911  89.365  1.00 21.18  ? 85   VAL A CG1   1 
ATOM   3651  C  CG2   . VAL G 4 85  ? 39.473 35.772  91.237  1.00 19.95  ? 85   VAL A CG2   1 
ATOM   3652  N  N     . LYS G 4 86  ? 39.285 40.302  90.865  1.00 21.62  ? 86   LYS A N     1 
ATOM   3653  C  CA    . LYS G 4 86  ? 39.374 41.646  90.268  1.00 21.45  ? 86   LYS A CA    1 
ATOM   3654  C  C     . LYS G 4 86  ? 40.265 42.508  91.166  1.00 21.25  ? 86   LYS A C     1 
ATOM   3655  O  O     . LYS G 4 86  ? 40.810 43.535  90.763  1.00 23.28  ? 86   LYS A O     1 
ATOM   3656  C  CB    . LYS G 4 86  ? 37.974 42.271  90.165  1.00 22.25  ? 86   LYS A CB    1 
ATOM   3657  C  CG    . LYS G 4 86  ? 37.597 42.776  88.797  1.00 26.13  ? 86   LYS A CG    1 
ATOM   3658  C  CD    . LYS G 4 86  ? 38.097 44.197  88.576  1.00 31.77  ? 86   LYS A CD    1 
ATOM   3659  C  CE    . LYS G 4 86  ? 38.093 44.587  87.077  1.00 36.73  ? 86   LYS A CE    1 
ATOM   3660  N  NZ    . LYS G 4 86  ? 36.781 44.309  86.327  1.00 39.22  ? 86   LYS A NZ    1 
ATOM   3661  N  N     . THR G 4 87  ? 40.409 42.080  92.403  1.00 19.73  ? 87   THR A N     1 
ATOM   3662  C  CA    . THR G 4 87  ? 41.228 42.798  93.328  1.00 17.57  ? 87   THR A CA    1 
ATOM   3663  C  C     . THR G 4 87  ? 42.658 42.399  93.080  1.00 18.60  ? 87   THR A C     1 
ATOM   3664  O  O     . THR G 4 87  ? 43.538 43.233  93.102  1.00 19.34  ? 87   THR A O     1 
ATOM   3665  C  CB    . THR G 4 87  ? 40.826 42.452  94.745  1.00 18.54  ? 87   THR A CB    1 
ATOM   3666  O  OG1   . THR G 4 87  ? 39.843 43.387  95.183  1.00 19.24  ? 87   THR A OG1   1 
ATOM   3667  C  CG2   . THR G 4 87  ? 42.007 42.481  95.671  1.00 19.65  ? 87   THR A CG2   1 
ATOM   3668  N  N     . ILE G 4 88  ? 42.902 41.120  92.832  1.00 18.01  ? 88   ILE A N     1 
ATOM   3669  C  CA    . ILE G 4 88  ? 44.262 40.690  92.597  1.00 16.93  ? 88   ILE A CA    1 
ATOM   3670  C  C     . ILE G 4 88  ? 44.804 41.247  91.309  1.00 21.72  ? 88   ILE A C     1 
ATOM   3671  O  O     . ILE G 4 88  ? 45.971 41.536  91.234  1.00 23.22  ? 88   ILE A O     1 
ATOM   3672  C  CB    . ILE G 4 88  ? 44.367 39.210  92.563  1.00 13.18  ? 88   ILE A CB    1 
ATOM   3673  C  CG1   . ILE G 4 88  ? 43.848 38.662  93.871  1.00 12.15  ? 88   ILE A CG1   1 
ATOM   3674  C  CG2   . ILE G 4 88  ? 45.786 38.809  92.373  1.00 10.75  ? 88   ILE A CG2   1 
ATOM   3675  C  CD1   . ILE G 4 88  ? 43.991 37.235  94.016  1.00 12.62  ? 88   ILE A CD1   1 
ATOM   3676  N  N     . GLN G 4 89  ? 43.972 41.417  90.292  1.00 24.28  ? 89   GLN A N     1 
ATOM   3677  C  CA    . GLN G 4 89  ? 44.447 41.972  89.030  1.00 26.80  ? 89   GLN A CA    1 
ATOM   3678  C  C     . GLN G 4 89  ? 44.737 43.428  89.249  1.00 26.09  ? 89   GLN A C     1 
ATOM   3679  O  O     . GLN G 4 89  ? 45.546 44.014  88.561  1.00 26.02  ? 89   GLN A O     1 
ATOM   3680  C  CB    . GLN G 4 89  ? 43.394 41.852  87.931  1.00 31.82  ? 89   GLN A CB    1 
ATOM   3681  C  CG    . GLN G 4 89  ? 43.465 40.583  87.103  1.00 40.15  ? 89   GLN A CG    1 
ATOM   3682  C  CD    . GLN G 4 89  ? 42.069 40.064  86.699  1.00 45.54  ? 89   GLN A CD    1 
ATOM   3683  O  OE1   . GLN G 4 89  ? 41.934 38.958  86.132  1.00 48.09  ? 89   GLN A OE1   1 
ATOM   3684  N  NE2   . GLN G 4 89  ? 41.028 40.857  86.993  1.00 46.78  ? 89   GLN A NE2   1 
ATOM   3685  N  N     . GLN G 4 90  ? 44.054 44.029  90.201  1.00 25.89  ? 90   GLN A N     1 
ATOM   3686  C  CA    . GLN G 4 90  ? 44.283 45.432  90.463  1.00 25.72  ? 90   GLN A CA    1 
ATOM   3687  C  C     . GLN G 4 90  ? 45.665 45.603  91.047  1.00 25.77  ? 90   GLN A C     1 
ATOM   3688  O  O     . GLN G 4 90  ? 46.389 46.533  90.709  1.00 26.40  ? 90   GLN A O     1 
ATOM   3689  C  CB    . GLN G 4 90  ? 43.239 45.956  91.429  1.00 26.41  ? 90   GLN A CB    1 
ATOM   3690  C  CG    . GLN G 4 90  ? 43.574 47.272  92.053  1.00 26.78  ? 90   GLN A CG    1 
ATOM   3691  C  CD    . GLN G 4 90  ? 43.421 48.404  91.111  1.00 28.56  ? 90   GLN A CD    1 
ATOM   3692  O  OE1   . GLN G 4 90  ? 42.937 49.459  91.480  1.00 30.60  ? 90   GLN A OE1   1 
ATOM   3693  N  NE2   . GLN G 4 90  ? 43.841 48.209  89.887  1.00 31.46  ? 90   GLN A NE2   1 
ATOM   3694  N  N     . HIS G 4 91  ? 46.046 44.696  91.926  1.00 24.56  ? 91   HIS A N     1 
ATOM   3695  C  CA    . HIS G 4 91  ? 47.350 44.811  92.516  1.00 24.52  ? 91   HIS A CA    1 
ATOM   3696  C  C     . HIS G 4 91  ? 48.425 44.584  91.475  1.00 24.10  ? 91   HIS A C     1 
ATOM   3697  O  O     . HIS G 4 91  ? 49.406 45.308  91.411  1.00 24.44  ? 91   HIS A O     1 
ATOM   3698  C  CB    . HIS G 4 91  ? 47.501 43.830  93.675  1.00 24.92  ? 91   HIS A CB    1 
ATOM   3699  C  CG    . HIS G 4 91  ? 46.891 44.310  94.951  1.00 25.55  ? 91   HIS A CG    1 
ATOM   3700  N  ND1   . HIS G 4 91  ? 47.455 44.058  96.181  1.00 25.15  ? 91   HIS A ND1   1 
ATOM   3701  C  CD2   . HIS G 4 91  ? 45.748 44.992  95.191  1.00 25.77  ? 91   HIS A CD2   1 
ATOM   3702  C  CE1   . HIS G 4 91  ? 46.683 44.559  97.127  1.00 25.08  ? 91   HIS A CE1   1 
ATOM   3703  N  NE2   . HIS G 4 91  ? 45.639 45.132  96.553  1.00 25.98  ? 91   HIS A NE2   1 
ATOM   3704  N  N     . LEU G 4 92  ? 48.239 43.579  90.645  1.00 23.52  ? 92   LEU A N     1 
ATOM   3705  C  CA    . LEU G 4 92  ? 49.220 43.270  89.627  1.00 23.42  ? 92   LEU A CA    1 
ATOM   3706  C  C     . LEU G 4 92  ? 49.325 44.437  88.669  1.00 23.52  ? 92   LEU A C     1 
ATOM   3707  O  O     . LEU G 4 92  ? 50.401 44.857  88.283  1.00 24.21  ? 92   LEU A O     1 
ATOM   3708  C  CB    . LEU G 4 92  ? 48.766 42.047  88.869  1.00 23.01  ? 92   LEU A CB    1 
ATOM   3709  C  CG    . LEU G 4 92  ? 49.784 41.022  88.417  1.00 23.97  ? 92   LEU A CG    1 
ATOM   3710  C  CD1   . LEU G 4 92  ? 49.044 39.925  87.634  1.00 22.18  ? 92   LEU A CD1   1 
ATOM   3711  C  CD2   . LEU G 4 92  ? 50.856 41.691  87.579  1.00 23.49  ? 92   LEU A CD2   1 
ATOM   3712  N  N     . GLY G 4 93  ? 48.176 44.964  88.290  1.00 24.96  ? 93   GLY A N     1 
ATOM   3713  C  CA    . GLY G 4 93  ? 48.139 46.066  87.361  1.00 26.09  ? 93   GLY A CA    1 
ATOM   3714  C  C     . GLY G 4 93  ? 48.934 47.265  87.798  1.00 26.43  ? 93   GLY A C     1 
ATOM   3715  O  O     . GLY G 4 93  ? 49.779 47.717  87.039  1.00 28.25  ? 93   GLY A O     1 
ATOM   3716  N  N     . GLN G 4 94  ? 48.669 47.789  88.997  1.00 26.87  ? 94   GLN A N     1 
ATOM   3717  C  CA    . GLN G 4 94  ? 49.386 48.959  89.494  1.00 26.83  ? 94   GLN A CA    1 
ATOM   3718  C  C     . GLN G 4 94  ? 50.873 48.649  89.493  1.00 26.20  ? 94   GLN A C     1 
ATOM   3719  O  O     . GLN G 4 94  ? 51.661 49.391  88.973  1.00 26.99  ? 94   GLN A O     1 
ATOM   3720  C  CB    . GLN G 4 94  ? 48.911 49.327  90.903  1.00 28.37  ? 94   GLN A CB    1 
ATOM   3721  C  CG    . GLN G 4 94  ? 47.494 49.917  91.005  1.00 32.00  ? 94   GLN A CG    1 
ATOM   3722  C  CD    . GLN G 4 94  ? 47.218 50.991  89.956  1.00 34.54  ? 94   GLN A CD    1 
ATOM   3723  O  OE1   . GLN G 4 94  ? 48.024 51.884  89.756  1.00 36.88  ? 94   GLN A OE1   1 
ATOM   3724  N  NE2   . GLN G 4 94  ? 46.073 50.902  89.287  1.00 35.00  ? 94   GLN A NE2   1 
ATOM   3725  N  N     . LEU G 4 95  ? 51.263 47.533  90.069  1.00 26.50  ? 95   LEU A N     1 
ATOM   3726  C  CA    . LEU G 4 95  ? 52.654 47.149  90.074  1.00 25.88  ? 95   LEU A CA    1 
ATOM   3727  C  C     . LEU G 4 95  ? 53.224 47.224  88.660  1.00 26.95  ? 95   LEU A C     1 
ATOM   3728  O  O     . LEU G 4 95  ? 54.335 47.676  88.470  1.00 28.02  ? 95   LEU A O     1 
ATOM   3729  C  CB    . LEU G 4 95  ? 52.766 45.732  90.587  1.00 24.28  ? 95   LEU A CB    1 
ATOM   3730  C  CG    . LEU G 4 95  ? 53.530 45.507  91.871  1.00 25.23  ? 95   LEU A CG    1 
ATOM   3731  C  CD1   . LEU G 4 95  ? 53.533 46.742  92.752  1.00 24.90  ? 95   LEU A CD1   1 
ATOM   3732  C  CD2   . LEU G 4 95  ? 52.883 44.328  92.556  1.00 25.47  ? 95   LEU A CD2   1 
ATOM   3733  N  N     . ASN G 4 96  ? 52.469 46.773  87.663  1.00 28.79  ? 96   ASN A N     1 
ATOM   3734  C  CA    . ASN G 4 96  ? 52.946 46.805  86.278  1.00 30.48  ? 96   ASN A CA    1 
ATOM   3735  C  C     . ASN G 4 96  ? 53.231 48.205  85.805  1.00 31.37  ? 96   ASN A C     1 
ATOM   3736  O  O     . ASN G 4 96  ? 54.226 48.433  85.143  1.00 31.38  ? 96   ASN A O     1 
ATOM   3737  C  CB    . ASN G 4 96  ? 51.939 46.209  85.305  1.00 32.34  ? 96   ASN A CB    1 
ATOM   3738  C  CG    . ASN G 4 96  ? 51.998 44.716  85.246  1.00 35.51  ? 96   ASN A CG    1 
ATOM   3739  O  OD1   . ASN G 4 96  ? 53.054 44.112  85.328  1.00 37.87  ? 96   ASN A OD1   1 
ATOM   3740  N  ND2   . ASN G 4 96  ? 50.849 44.105  85.075  1.00 39.82  ? 96   ASN A ND2   1 
ATOM   3741  N  N     . MET G 4 97  ? 52.335 49.137  86.103  1.00 32.52  ? 97   MET A N     1 
ATOM   3742  C  CA    . MET G 4 97  ? 52.526 50.520  85.699  1.00 33.02  ? 97   MET A CA    1 
ATOM   3743  C  C     . MET G 4 97  ? 53.784 51.073  86.351  1.00 32.47  ? 97   MET A C     1 
ATOM   3744  O  O     . MET G 4 97  ? 54.668 51.583  85.671  1.00 32.95  ? 97   MET A O     1 
ATOM   3745  C  CB    . MET G 4 97  ? 51.325 51.358  86.107  1.00 36.47  ? 97   MET A CB    1 
ATOM   3746  C  CG    . MET G 4 97  ? 51.570 52.847  86.061  1.00 41.68  ? 97   MET A CG    1 
ATOM   3747  S  SD    . MET G 4 97  ? 50.025 53.778  85.932  1.00 49.14  ? 97   MET A SD    1 
ATOM   3748  C  CE    . MET G 4 97  ? 50.378 55.331  86.877  1.00 45.76  ? 97   MET A CE    1 
ATOM   3749  N  N     . LEU G 4 98  ? 53.867 50.961  87.668  1.00 30.53  ? 98   LEU A N     1 
ATOM   3750  C  CA    . LEU G 4 98  ? 55.018 51.452  88.388  1.00 29.34  ? 98   LEU A CA    1 
ATOM   3751  C  C     . LEU G 4 98  ? 56.264 51.090  87.603  1.00 30.53  ? 98   LEU A C     1 
ATOM   3752  O  O     . LEU G 4 98  ? 57.109 51.935  87.340  1.00 32.37  ? 98   LEU A O     1 
ATOM   3753  C  CB    . LEU G 4 98  ? 55.090 50.813  89.765  1.00 27.93  ? 98   LEU A CB    1 
ATOM   3754  C  CG    . LEU G 4 98  ? 55.563 51.664  90.948  1.00 27.01  ? 98   LEU A CG    1 
ATOM   3755  C  CD1   . LEU G 4 98  ? 56.334 50.747  91.906  1.00 26.42  ? 98   LEU A CD1   1 
ATOM   3756  C  CD2   . LEU G 4 98  ? 56.435 52.832  90.495  1.00 24.89  ? 98   LEU A CD2   1 
ATOM   3757  N  N     . HIS G 4 99  ? 56.379 49.831  87.213  1.00 31.16  ? 99   HIS A N     1 
ATOM   3758  C  CA    . HIS G 4 99  ? 57.537 49.404  86.462  1.00 31.78  ? 99   HIS A CA    1 
ATOM   3759  C  C     . HIS G 4 99  ? 57.606 49.961  85.048  1.00 34.25  ? 99   HIS A C     1 
ATOM   3760  O  O     . HIS G 4 99  ? 58.589 50.603  84.698  1.00 34.96  ? 99   HIS A O     1 
ATOM   3761  C  CB    . HIS G 4 99  ? 57.615 47.881  86.457  1.00 28.93  ? 99   HIS A CB    1 
ATOM   3762  C  CG    . HIS G 4 99  ? 58.005 47.310  87.778  1.00 28.42  ? 99   HIS A CG    1 
ATOM   3763  N  ND1   . HIS G 4 99  ? 57.388 47.677  88.952  1.00 28.97  ? 99   HIS A ND1   1 
ATOM   3764  C  CD2   . HIS G 4 99  ? 58.981 46.441  88.127  1.00 29.83  ? 99   HIS A CD2   1 
ATOM   3765  C  CE1   . HIS G 4 99  ? 57.966 47.062  89.970  1.00 28.04  ? 99   HIS A CE1   1 
ATOM   3766  N  NE2   . HIS G 4 99  ? 58.937 46.306  89.497  1.00 29.32  ? 99   HIS A NE2   1 
ATOM   3767  N  N     . ARG G 4 100 ? 56.574 49.751  84.238  1.00 37.00  ? 100  ARG A N     1 
ATOM   3768  C  CA    . ARG G 4 100 ? 56.604 50.233  82.865  1.00 40.97  ? 100  ARG A CA    1 
ATOM   3769  C  C     . ARG G 4 100 ? 56.734 51.736  82.795  1.00 41.22  ? 100  ARG A C     1 
ATOM   3770  O  O     . ARG G 4 100 ? 57.455 52.249  81.964  1.00 40.94  ? 100  ARG A O     1 
ATOM   3771  C  CB    . ARG G 4 100 ? 55.367 49.769  82.099  1.00 45.18  ? 100  ARG A CB    1 
ATOM   3772  C  CG    . ARG G 4 100 ? 55.350 50.155  80.629  1.00 51.95  ? 100  ARG A CG    1 
ATOM   3773  C  CD    . ARG G 4 100 ? 54.165 51.094  80.336  1.00 60.67  ? 100  ARG A CD    1 
ATOM   3774  N  NE    . ARG G 4 100 ? 53.050 50.447  79.623  1.00 67.97  ? 100  ARG A NE    1 
ATOM   3775  C  CZ    . ARG G 4 100 ? 51.752 50.756  79.763  1.00 70.82  ? 100  ARG A CZ    1 
ATOM   3776  N  NH1   . ARG G 4 100 ? 51.360 51.713  80.610  1.00 70.59  ? 100  ARG A NH1   1 
ATOM   3777  N  NH2   . ARG G 4 100 ? 50.838 50.118  79.028  1.00 72.50  ? 100  ARG A NH2   1 
ATOM   3778  N  N     . ARG G 4 101 ? 56.059 52.452  83.678  1.00 42.44  ? 101  ARG A N     1 
ATOM   3779  C  CA    . ARG G 4 101 ? 56.154 53.904  83.658  1.00 44.28  ? 101  ARG A CA    1 
ATOM   3780  C  C     . ARG G 4 101 ? 57.502 54.396  84.155  1.00 45.37  ? 101  ARG A C     1 
ATOM   3781  O  O     . ARG G 4 101 ? 57.741 55.601  84.203  1.00 46.57  ? 101  ARG A O     1 
ATOM   3782  C  CB    . ARG G 4 101 ? 55.045 54.543  84.501  1.00 44.56  ? 101  ARG A CB    1 
ATOM   3783  C  CG    . ARG G 4 101 ? 54.108 55.400  83.686  1.00 45.56  ? 101  ARG A CG    1 
ATOM   3784  C  CD    . ARG G 4 101 ? 53.712 54.626  82.465  1.00 47.36  ? 101  ARG A CD    1 
ATOM   3785  N  NE    . ARG G 4 101 ? 52.557 55.159  81.754  1.00 50.36  ? 101  ARG A NE    1 
ATOM   3786  C  CZ    . ARG G 4 101 ? 52.617 56.129  80.850  1.00 52.04  ? 101  ARG A CZ    1 
ATOM   3787  N  NH1   . ARG G 4 101 ? 53.783 56.691  80.552  1.00 52.12  ? 101  ARG A NH1   1 
ATOM   3788  N  NH2   . ARG G 4 101 ? 51.518 56.502  80.203  1.00 52.43  ? 101  ARG A NH2   1 
ATOM   3789  N  N     . SER G 4 102 ? 58.381 53.481  84.547  1.00 45.63  ? 102  SER A N     1 
ATOM   3790  C  CA    . SER G 4 102 ? 59.691 53.900  85.023  1.00 44.48  ? 102  SER A CA    1 
ATOM   3791  C  C     . SER G 4 102 ? 60.768 53.260  84.188  1.00 43.92  ? 102  SER A C     1 
ATOM   3792  O  O     . SER G 4 102 ? 61.944 53.373  84.487  1.00 44.08  ? 102  SER A O     1 
ATOM   3793  C  CB    . SER G 4 102 ? 59.889 53.576  86.506  1.00 43.64  ? 102  SER A CB    1 
ATOM   3794  O  OG    . SER G 4 102 ? 59.940 52.197  86.735  1.00 43.26  ? 102  SER A OG    1 
ATOM   3795  N  N     . GLY G 4 103 ? 60.356 52.567  83.139  1.00 44.00  ? 103  GLY A N     1 
ATOM   3796  C  CA    . GLY G 4 103 ? 61.327 51.989  82.237  1.00 43.60  ? 103  GLY A CA    1 
ATOM   3797  C  C     . GLY G 4 103 ? 61.698 50.543  82.342  1.00 43.84  ? 103  GLY A C     1 
ATOM   3798  O  O     . GLY G 4 103 ? 62.176 49.993  81.361  1.00 44.47  ? 103  GLY A O     1 
ATOM   3799  N  N     . LEU G 4 104 ? 61.481 49.918  83.493  1.00 44.78  ? 104  LEU A N     1 
ATOM   3800  C  CA    . LEU G 4 104 ? 61.849 48.513  83.673  1.00 46.09  ? 104  LEU A CA    1 
ATOM   3801  C  C     . LEU G 4 104 ? 60.801 47.520  83.177  1.00 47.54  ? 104  LEU A C     1 
ATOM   3802  O  O     . LEU G 4 104 ? 59.631 47.841  83.054  1.00 47.54  ? 104  LEU A O     1 
ATOM   3803  C  CB    . LEU G 4 104 ? 62.109 48.249  85.144  1.00 46.13  ? 104  LEU A CB    1 
ATOM   3804  C  CG    . LEU G 4 104 ? 63.005 49.289  85.821  1.00 47.48  ? 104  LEU A CG    1 
ATOM   3805  C  CD1   . LEU G 4 104 ? 62.736 49.341  87.321  1.00 46.23  ? 104  LEU A CD1   1 
ATOM   3806  C  CD2   . LEU G 4 104 ? 64.469 48.962  85.518  1.00 48.43  ? 104  LEU A CD2   1 
ATOM   3807  N  N     . PRO G 4 105 ? 61.224 46.292  82.866  1.00 49.27  ? 105  PRO A N     1 
ATOM   3808  C  CA    . PRO G 4 105 ? 60.303 45.254  82.390  1.00 48.89  ? 105  PRO A CA    1 
ATOM   3809  C  C     . PRO G 4 105 ? 59.392 44.760  83.505  1.00 48.96  ? 105  PRO A C     1 
ATOM   3810  O  O     . PRO G 4 105 ? 59.847 44.236  84.517  1.00 49.10  ? 105  PRO A O     1 
ATOM   3811  C  CB    . PRO G 4 105 ? 61.242 44.162  81.882  1.00 50.37  ? 105  PRO A CB    1 
ATOM   3812  C  CG    . PRO G 4 105 ? 62.467 44.334  82.742  1.00 50.54  ? 105  PRO A CG    1 
ATOM   3813  C  CD    . PRO G 4 105 ? 62.621 45.845  82.738  1.00 50.55  ? 105  PRO A CD    1 
ATOM   3814  N  N     . ARG G 4 106 ? 58.101 44.933  83.283  1.00 48.88  ? 106  ARG A N     1 
ATOM   3815  C  CA    . ARG G 4 106 ? 57.048 44.564  84.207  1.00 48.58  ? 106  ARG A CA    1 
ATOM   3816  C  C     . ARG G 4 106 ? 56.921 43.065  84.513  1.00 49.11  ? 106  ARG A C     1 
ATOM   3817  O  O     . ARG G 4 106 ? 57.308 42.208  83.716  1.00 50.54  ? 106  ARG A O     1 
ATOM   3818  C  CB    . ARG G 4 106 ? 55.748 45.085  83.608  1.00 48.57  ? 106  ARG A CB    1 
ATOM   3819  C  CG    . ARG G 4 106 ? 55.823 45.195  82.087  1.00 50.60  ? 106  ARG A CG    1 
ATOM   3820  C  CD    . ARG G 4 106 ? 54.527 45.664  81.479  1.00 53.59  ? 106  ARG A CD    1 
ATOM   3821  N  NE    . ARG G 4 106 ? 53.603 44.551  81.275  1.00 58.04  ? 106  ARG A NE    1 
ATOM   3822  C  CZ    . ARG G 4 106 ? 52.379 44.655  80.751  1.00 60.46  ? 106  ARG A CZ    1 
ATOM   3823  N  NH1   . ARG G 4 106 ? 51.905 45.844  80.367  1.00 61.52  ? 106  ARG A NH1   1 
ATOM   3824  N  NH2   . ARG G 4 106 ? 51.626 43.563  80.606  1.00 60.71  ? 106  ARG A NH2   1 
ATOM   3825  N  N     . PRO G 4 107 ? 56.366 42.827  85.714  1.00 49.87  ? 107  PRO A N     1 
ATOM   3826  C  CA    . PRO G 4 107 ? 55.939 41.473  86.114  1.00 49.83  ? 107  PRO A CA    1 
ATOM   3827  C  C     . PRO G 4 107 ? 54.913 40.986  85.119  1.00 52.21  ? 107  PRO A C     1 
ATOM   3828  O  O     . PRO G 4 107 ? 54.560 41.760  84.223  1.00 52.90  ? 107  PRO A O     1 
ATOM   3829  C  CB    . PRO G 4 107 ? 55.504 41.600  87.545  1.00 48.27  ? 107  PRO A CB    1 
ATOM   3830  C  CG    . PRO G 4 107 ? 56.523 42.562  88.055  1.00 48.38  ? 107  PRO A CG    1 
ATOM   3831  C  CD    . PRO G 4 107 ? 57.064 43.347  86.895  1.00 48.71  ? 107  PRO A CD    1 
ATOM   3832  N  N     . SER G 4 108 ? 54.399 39.766  85.225  1.00 54.74  ? 108  SER A N     1 
ATOM   3833  C  CA    . SER G 4 108 ? 53.365 39.358  84.270  1.00 58.31  ? 108  SER A CA    1 
ATOM   3834  C  C     . SER G 4 108 ? 53.728 39.854  82.850  1.00 56.39  ? 108  SER A C     1 
ATOM   3835  O  O     . SER G 4 108 ? 52.930 40.358  82.069  1.00 57.30  ? 108  SER A O     1 
ATOM   3836  C  CB    . SER G 4 108 ? 51.997 39.917  84.686  1.00 61.13  ? 108  SER A CB    1 
ATOM   3837  O  OG    . SER G 4 108 ? 51.032 38.878  84.776  1.00 72.72  ? 108  SER A OG    1 
ATOM   3838  N  N     . ASP G 4 109 ? 55.020 39.659  82.617  1.00 55.16  ? 109  ASP A N     1 
ATOM   3839  C  CA    . ASP G 4 109 ? 55.829 39.913  81.453  1.00 54.43  ? 109  ASP A CA    1 
ATOM   3840  C  C     . ASP G 4 109 ? 56.864 38.825  81.497  1.00 54.92  ? 109  ASP A C     1 
ATOM   3841  O  O     . ASP G 4 109 ? 57.875 38.800  80.782  1.00 55.58  ? 109  ASP A O     1 
ATOM   3842  C  CB    . ASP G 4 109 ? 56.511 41.290  81.502  1.00 56.65  ? 109  ASP A CB    1 
ATOM   3843  C  CG    . ASP G 4 109 ? 56.506 42.094  80.206  1.00 58.41  ? 109  ASP A CG    1 
ATOM   3844  O  OD1   . ASP G 4 109 ? 55.618 41.850  79.369  1.00 60.84  ? 109  ASP A OD1   1 
ATOM   3845  O  OD2   . ASP G 4 109 ? 57.378 42.965  80.024  1.00 58.26  ? 109  ASP A OD2   1 
ATOM   3846  N  N     . SER G 4 110 ? 56.563 37.902  82.406  1.00 53.92  ? 110  SER A N     1 
ATOM   3847  C  CA    . SER G 4 110 ? 57.437 36.775  82.692  1.00 52.89  ? 110  SER A CA    1 
ATOM   3848  C  C     . SER G 4 110 ? 56.651 35.539  83.118  1.00 51.53  ? 110  SER A C     1 
ATOM   3849  O  O     . SER G 4 110 ? 55.846 35.566  84.052  1.00 50.30  ? 110  SER A O     1 
ATOM   3850  C  CB    . SER G 4 110 ? 58.444 37.156  83.773  1.00 52.96  ? 110  SER A CB    1 
ATOM   3851  O  OG    . SER G 4 110 ? 57.776 37.554  84.956  1.00 53.94  ? 110  SER A OG    1 
ATOM   3852  N  N     . ASN G 4 111 ? 56.905 34.466  82.383  1.00 50.68  ? 111  ASN A N     1 
ATOM   3853  C  CA    . ASN G 4 111 ? 56.292 33.161  82.572  1.00 49.25  ? 111  ASN A CA    1 
ATOM   3854  C  C     . ASN G 4 111 ? 55.660 32.867  83.935  1.00 47.96  ? 111  ASN A C     1 
ATOM   3855  O  O     . ASN G 4 111 ? 54.489 32.481  84.005  1.00 48.26  ? 111  ASN A O     1 
ATOM   3856  C  CB    . ASN G 4 111 ? 57.336 32.090  82.281  1.00 50.35  ? 111  ASN A CB    1 
ATOM   3857  C  CG    . ASN G 4 111 ? 56.969 31.223  81.121  1.00 51.18  ? 111  ASN A CG    1 
ATOM   3858  O  OD1   . ASN G 4 111 ? 55.799 30.899  80.919  1.00 52.40  ? 111  ASN A OD1   1 
ATOM   3859  N  ND2   . ASN G 4 111 ? 57.975 30.816  80.351  1.00 53.09  ? 111  ASN A ND2   1 
ATOM   3860  N  N     . ALA G 4 112 ? 56.414 33.058  85.010  1.00 44.25  ? 112  ALA A N     1 
ATOM   3861  C  CA    . ALA G 4 112 ? 55.942 32.741  86.342  1.00 40.36  ? 112  ALA A CA    1 
ATOM   3862  C  C     . ALA G 4 112 ? 54.725 33.554  86.751  1.00 38.05  ? 112  ALA A C     1 
ATOM   3863  O  O     . ALA G 4 112 ? 53.666 32.984  87.002  1.00 37.09  ? 112  ALA A O     1 
ATOM   3864  C  CB    . ALA G 4 112 ? 57.080 32.925  87.339  1.00 41.11  ? 112  ALA A CB    1 
ATOM   3865  N  N     . VAL G 4 113 ? 54.852 34.876  86.817  1.00 35.16  ? 113  VAL A N     1 
ATOM   3866  C  CA    . VAL G 4 113 ? 53.696 35.688  87.192  1.00 33.47  ? 113  VAL A CA    1 
ATOM   3867  C  C     . VAL G 4 113 ? 52.524 35.420  86.289  1.00 34.06  ? 113  VAL A C     1 
ATOM   3868  O  O     . VAL G 4 113 ? 51.422 35.158  86.765  1.00 35.64  ? 113  VAL A O     1 
ATOM   3869  C  CB    . VAL G 4 113 ? 53.967 37.197  87.119  1.00 30.83  ? 113  VAL A CB    1 
ATOM   3870  C  CG1   . VAL G 4 113 ? 52.673 37.998  87.225  1.00 25.17  ? 113  VAL A CG1   1 
ATOM   3871  C  CG2   . VAL G 4 113 ? 54.927 37.624  88.209  1.00 32.67  ? 113  VAL A CG2   1 
ATOM   3872  N  N     . SER G 4 114 ? 52.764 35.467  84.984  1.00 32.69  ? 114  SER A N     1 
ATOM   3873  C  CA    . SER G 4 114 ? 51.725 35.197  84.009  1.00 31.61  ? 114  SER A CA    1 
ATOM   3874  C  C     . SER G 4 114 ? 50.982 33.912  84.310  1.00 30.66  ? 114  SER A C     1 
ATOM   3875  O  O     . SER G 4 114 ? 49.767 33.930  84.457  1.00 30.96  ? 114  SER A O     1 
ATOM   3876  C  CB    . SER G 4 114 ? 52.331 35.101  82.598  1.00 33.13  ? 114  SER A CB    1 
ATOM   3877  O  OG    . SER G 4 114 ? 52.575 36.395  82.064  1.00 36.48  ? 114  SER A OG    1 
ATOM   3878  N  N     . LEU G 4 115 ? 51.701 32.798  84.393  1.00 27.92  ? 115  LEU A N     1 
ATOM   3879  C  CA    . LEU G 4 115 ? 51.077 31.519  84.657  1.00 27.51  ? 115  LEU A CA    1 
ATOM   3880  C  C     . LEU G 4 115 ? 50.312 31.488  85.961  1.00 28.23  ? 115  LEU A C     1 
ATOM   3881  O  O     . LEU G 4 115 ? 49.146 31.062  86.004  1.00 28.30  ? 115  LEU A O     1 
ATOM   3882  C  CB    . LEU G 4 115 ? 52.133 30.421  84.769  1.00 27.06  ? 115  LEU A CB    1 
ATOM   3883  C  CG    . LEU G 4 115 ? 52.756 29.930  83.464  1.00 25.78  ? 115  LEU A CG    1 
ATOM   3884  C  CD1   . LEU G 4 115 ? 53.628 28.701  83.712  1.00 26.91  ? 115  LEU A CD1   1 
ATOM   3885  C  CD2   . LEU G 4 115 ? 51.670 29.623  82.453  1.00 26.69  ? 115  LEU A CD2   1 
ATOM   3886  N  N     . VAL G 4 116 ? 50.945 31.943  87.037  1.00 28.73  ? 116  VAL A N     1 
ATOM   3887  C  CA    . VAL G 4 116 ? 50.296 31.929  88.340  1.00 28.56  ? 116  VAL A CA    1 
ATOM   3888  C  C     . VAL G 4 116 ? 49.003 32.636  88.307  1.00 26.81  ? 116  VAL A C     1 
ATOM   3889  O  O     . VAL G 4 116 ? 48.016 32.139  88.806  1.00 25.06  ? 116  VAL A O     1 
ATOM   3890  C  CB    . VAL G 4 116 ? 51.122 32.601  89.400  1.00 29.18  ? 116  VAL A CB    1 
ATOM   3891  C  CG1   . VAL G 4 116 ? 50.303 32.731  90.652  1.00 30.31  ? 116  VAL A CG1   1 
ATOM   3892  C  CG2   . VAL G 4 116 ? 52.354 31.749  89.695  1.00 31.74  ? 116  VAL A CG2   1 
ATOM   3893  N  N     . MET G 4 117 ? 49.035 33.818  87.723  1.00 27.57  ? 117  MET A N     1 
ATOM   3894  C  CA    . MET G 4 117 ? 47.859 34.653  87.588  1.00 29.21  ? 117  MET A CA    1 
ATOM   3895  C  C     . MET G 4 117 ? 46.731 33.876  86.918  1.00 31.65  ? 117  MET A C     1 
ATOM   3896  O  O     . MET G 4 117 ? 45.584 33.886  87.386  1.00 34.31  ? 117  MET A O     1 
ATOM   3897  C  CB    . MET G 4 117 ? 48.205 35.888  86.765  1.00 29.26  ? 117  MET A CB    1 
ATOM   3898  C  CG    . MET G 4 117 ? 47.242 37.034  86.927  1.00 29.76  ? 117  MET A CG    1 
ATOM   3899  S  SD    . MET G 4 117 ? 46.924 37.325  88.652  1.00 31.62  ? 117  MET A SD    1 
ATOM   3900  C  CE    . MET G 4 117 ? 45.127 37.117  88.747  1.00 29.51  ? 117  MET A CE    1 
ATOM   3901  N  N     . ARG G 4 118 ? 47.053 33.189  85.825  1.00 32.26  ? 118  ARG A N     1 
ATOM   3902  C  CA    . ARG G 4 118 ? 46.062 32.405  85.083  1.00 32.06  ? 118  ARG A CA    1 
ATOM   3903  C  C     . ARG G 4 118 ? 45.518 31.293  85.962  1.00 29.37  ? 118  ARG A C     1 
ATOM   3904  O  O     . ARG G 4 118 ? 44.339 31.000  85.968  1.00 28.15  ? 118  ARG A O     1 
ATOM   3905  C  CB    . ARG G 4 118 ? 46.721 31.844  83.840  1.00 34.45  ? 118  ARG A CB    1 
ATOM   3906  C  CG    . ARG G 4 118 ? 45.813 31.104  82.895  1.00 38.05  ? 118  ARG A CG    1 
ATOM   3907  C  CD    . ARG G 4 118 ? 46.589 30.783  81.633  1.00 38.92  ? 118  ARG A CD    1 
ATOM   3908  N  NE    . ARG G 4 118 ? 45.947 29.764  80.834  1.00 39.47  ? 118  ARG A NE    1 
ATOM   3909  C  CZ    . ARG G 4 118 ? 46.437 29.358  79.679  1.00 41.43  ? 118  ARG A CZ    1 
ATOM   3910  N  NH1   . ARG G 4 118 ? 47.556 29.898  79.232  1.00 43.15  ? 118  ARG A NH1   1 
ATOM   3911  N  NH2   . ARG G 4 118 ? 45.820 28.431  78.970  1.00 42.38  ? 118  ARG A NH2   1 
ATOM   3912  N  N     . ARG G 4 119 ? 46.405 30.687  86.720  1.00 28.49  ? 119  ARG A N     1 
ATOM   3913  C  CA    . ARG G 4 119 ? 46.015 29.649  87.635  1.00 28.83  ? 119  ARG A CA    1 
ATOM   3914  C  C     . ARG G 4 119 ? 45.156 30.213  88.739  1.00 28.75  ? 119  ARG A C     1 
ATOM   3915  O  O     . ARG G 4 119 ? 44.143 29.636  89.073  1.00 28.73  ? 119  ARG A O     1 
ATOM   3916  C  CB    . ARG G 4 119 ? 47.233 29.015  88.261  1.00 28.61  ? 119  ARG A CB    1 
ATOM   3917  C  CG    . ARG G 4 119 ? 46.917 28.338  89.546  1.00 28.57  ? 119  ARG A CG    1 
ATOM   3918  C  CD    . ARG G 4 119 ? 48.095 27.553  90.004  1.00 31.01  ? 119  ARG A CD    1 
ATOM   3919  N  NE    . ARG G 4 119 ? 48.033 27.362  91.434  1.00 34.75  ? 119  ARG A NE    1 
ATOM   3920  C  CZ    . ARG G 4 119 ? 49.054 26.932  92.147  1.00 37.30  ? 119  ARG A CZ    1 
ATOM   3921  N  NH1   . ARG G 4 119 ? 50.185 26.639  91.526  1.00 38.97  ? 119  ARG A NH1   1 
ATOM   3922  N  NH2   . ARG G 4 119 ? 48.966 26.864  93.474  1.00 38.56  ? 119  ARG A NH2   1 
ATOM   3923  N  N     . ILE G 4 120 ? 45.561 31.325  89.334  1.00 29.28  ? 120  ILE A N     1 
ATOM   3924  C  CA    . ILE G 4 120 ? 44.756 31.885  90.403  1.00 30.37  ? 120  ILE A CA    1 
ATOM   3925  C  C     . ILE G 4 120 ? 43.369 32.110  89.902  1.00 32.67  ? 120  ILE A C     1 
ATOM   3926  O  O     . ILE G 4 120 ? 42.409 31.725  90.555  1.00 33.98  ? 120  ILE A O     1 
ATOM   3927  C  CB    . ILE G 4 120 ? 45.276 33.207  90.911  1.00 28.29  ? 120  ILE A CB    1 
ATOM   3928  C  CG1   . ILE G 4 120 ? 46.542 32.958  91.716  1.00 27.63  ? 120  ILE A CG1   1 
ATOM   3929  C  CG2   . ILE G 4 120 ? 44.231 33.872  91.774  1.00 25.67  ? 120  ILE A CG2   1 
ATOM   3930  C  CD1   . ILE G 4 120 ? 47.230 34.198  92.162  1.00 27.77  ? 120  ILE A CD1   1 
ATOM   3931  N  N     . ARG G 4 121 ? 43.252 32.719  88.732  1.00 34.73  ? 121  ARG A N     1 
ATOM   3932  C  CA    . ARG G 4 121 ? 41.932 32.979  88.184  1.00 37.70  ? 121  ARG A CA    1 
ATOM   3933  C  C     . ARG G 4 121 ? 41.062 31.720  88.104  1.00 37.56  ? 121  ARG A C     1 
ATOM   3934  O  O     . ARG G 4 121 ? 39.922 31.718  88.565  1.00 36.29  ? 121  ARG A O     1 
ATOM   3935  C  CB    . ARG G 4 121 ? 42.044 33.636  86.801  1.00 40.48  ? 121  ARG A CB    1 
ATOM   3936  C  CG    . ARG G 4 121 ? 40.697 33.997  86.178  1.00 44.77  ? 121  ARG A CG    1 
ATOM   3937  C  CD    . ARG G 4 121 ? 40.828 35.195  85.273  1.00 50.53  ? 121  ARG A CD    1 
ATOM   3938  N  NE    . ARG G 4 121 ? 41.895 35.029  84.285  1.00 57.73  ? 121  ARG A NE    1 
ATOM   3939  C  CZ    . ARG G 4 121 ? 41.808 34.281  83.175  1.00 60.30  ? 121  ARG A CZ    1 
ATOM   3940  N  NH1   . ARG G 4 121 ? 40.689 33.613  82.889  1.00 60.38  ? 121  ARG A NH1   1 
ATOM   3941  N  NH2   . ARG G 4 121 ? 42.849 34.203  82.339  1.00 60.59  ? 121  ARG A NH2   1 
ATOM   3942  N  N     . LYS G 4 122 ? 41.600 30.647  87.535  1.00 37.64  ? 122  LYS A N     1 
ATOM   3943  C  CA    . LYS G 4 122 ? 40.834 29.427  87.399  1.00 37.98  ? 122  LYS A CA    1 
ATOM   3944  C  C     . LYS G 4 122 ? 40.398 28.897  88.739  1.00 37.99  ? 122  LYS A C     1 
ATOM   3945  O  O     . LYS G 4 122 ? 39.216 28.827  89.016  1.00 37.42  ? 122  LYS A O     1 
ATOM   3946  C  CB    . LYS G 4 122 ? 41.640 28.372  86.668  1.00 38.71  ? 122  LYS A CB    1 
ATOM   3947  C  CG    . LYS G 4 122 ? 40.771 27.309  86.037  1.00 40.65  ? 122  LYS A CG    1 
ATOM   3948  C  CD    . LYS G 4 122 ? 41.425 26.707  84.797  1.00 42.13  ? 122  LYS A CD    1 
ATOM   3949  C  CE    . LYS G 4 122 ? 42.308 25.528  85.130  1.00 45.04  ? 122  LYS A CE    1 
ATOM   3950  N  NZ    . LYS G 4 122 ? 41.513 24.336  85.588  1.00 47.81  ? 122  LYS A NZ    1 
ATOM   3951  N  N     . GLU G 4 123 ? 41.356 28.536  89.579  1.00 39.80  ? 123  GLU A N     1 
ATOM   3952  C  CA    . GLU G 4 123 ? 41.045 27.995  90.902  1.00 41.50  ? 123  GLU A CA    1 
ATOM   3953  C  C     . GLU G 4 123 ? 39.912 28.744  91.540  1.00 39.69  ? 123  GLU A C     1 
ATOM   3954  O  O     . GLU G 4 123 ? 38.931 28.161  91.930  1.00 39.15  ? 123  GLU A O     1 
ATOM   3955  C  CB    . GLU G 4 123 ? 42.268 28.052  91.836  1.00 44.43  ? 123  GLU A CB    1 
ATOM   3956  C  CG    . GLU G 4 123 ? 43.300 26.917  91.652  1.00 49.09  ? 123  GLU A CG    1 
ATOM   3957  C  CD    . GLU G 4 123 ? 44.501 27.022  92.604  1.00 52.53  ? 123  GLU A CD    1 
ATOM   3958  O  OE1   . GLU G 4 123 ? 45.327 27.955  92.445  1.00 53.47  ? 123  GLU A OE1   1 
ATOM   3959  O  OE2   . GLU G 4 123 ? 44.620 26.172  93.521  1.00 55.26  ? 123  GLU A OE2   1 
ATOM   3960  N  N     . ASN G 4 124 ? 40.053 30.051  91.623  1.00 39.19  ? 124  ASN A N     1 
ATOM   3961  C  CA    . ASN G 4 124 ? 39.048 30.897  92.243  1.00 38.92  ? 124  ASN A CA    1 
ATOM   3962  C  C     . ASN G 4 124 ? 37.655 30.798  91.686  1.00 38.82  ? 124  ASN A C     1 
ATOM   3963  O  O     . ASN G 4 124 ? 36.699 30.841  92.438  1.00 38.02  ? 124  ASN A O     1 
ATOM   3964  C  CB    . ASN G 4 124 ? 39.491 32.352  92.184  1.00 38.16  ? 124  ASN A CB    1 
ATOM   3965  C  CG    . ASN G 4 124 ? 40.181 32.791  93.438  1.00 37.35  ? 124  ASN A CG    1 
ATOM   3966  O  OD1   . ASN G 4 124 ? 40.949 32.031  94.048  1.00 36.73  ? 124  ASN A OD1   1 
ATOM   3967  N  ND2   . ASN G 4 124 ? 39.923 34.029  93.839  1.00 37.02  ? 124  ASN A ND2   1 
ATOM   3968  N  N     . VAL G 4 125 ? 37.537 30.700  90.368  1.00 40.94  ? 125  VAL A N     1 
ATOM   3969  C  CA    . VAL G 4 125 ? 36.233 30.598  89.727  1.00 42.19  ? 125  VAL A CA    1 
ATOM   3970  C  C     . VAL G 4 125 ? 35.537 29.295  90.092  1.00 45.96  ? 125  VAL A C     1 
ATOM   3971  O  O     . VAL G 4 125 ? 34.326 29.266  90.344  1.00 46.26  ? 125  VAL A O     1 
ATOM   3972  C  CB    . VAL G 4 125 ? 36.370 30.646  88.245  1.00 39.35  ? 125  VAL A CB    1 
ATOM   3973  C  CG1   . VAL G 4 125 ? 35.029 30.611  87.625  1.00 38.87  ? 125  VAL A CG1   1 
ATOM   3974  C  CG2   . VAL G 4 125 ? 37.100 31.877  87.860  1.00 38.45  ? 125  VAL A CG2   1 
ATOM   3975  N  N     . ASP G 4 126 ? 36.322 28.222  90.127  1.00 50.57  ? 126  ASP A N     1 
ATOM   3976  C  CA    . ASP G 4 126 ? 35.837 26.890  90.466  1.00 54.03  ? 126  ASP A CA    1 
ATOM   3977  C  C     . ASP G 4 126 ? 35.382 26.811  91.902  1.00 54.56  ? 126  ASP A C     1 
ATOM   3978  O  O     . ASP G 4 126 ? 34.518 26.014  92.224  1.00 56.46  ? 126  ASP A O     1 
ATOM   3979  C  CB    . ASP G 4 126 ? 36.923 25.841  90.235  1.00 59.04  ? 126  ASP A CB    1 
ATOM   3980  C  CG    . ASP G 4 126 ? 37.336 25.727  88.759  1.00 64.99  ? 126  ASP A CG    1 
ATOM   3981  O  OD1   . ASP G 4 126 ? 36.436 25.758  87.877  1.00 67.29  ? 126  ASP A OD1   1 
ATOM   3982  O  OD2   . ASP G 4 126 ? 38.560 25.588  88.487  1.00 67.87  ? 126  ASP A OD2   1 
ATOM   3983  N  N     . ALA G 4 127 ? 35.977 27.612  92.775  1.00 53.99  ? 127  ALA A N     1 
ATOM   3984  C  CA    . ALA G 4 127 ? 35.569 27.630  94.167  1.00 52.91  ? 127  ALA A CA    1 
ATOM   3985  C  C     . ALA G 4 127 ? 34.258 28.394  94.169  1.00 53.34  ? 127  ALA A C     1 
ATOM   3986  O  O     . ALA G 4 127 ? 33.671 28.672  95.222  1.00 53.37  ? 127  ALA A O     1 
ATOM   3987  C  CB    . ALA G 4 127 ? 36.574 28.346  94.986  1.00 54.07  ? 127  ALA A CB    1 
ATOM   3988  N  N     . GLY G 4 128 ? 33.826 28.750  92.959  1.00 53.67  ? 128  GLY A N     1 
ATOM   3989  C  CA    . GLY G 4 128 ? 32.577 29.457  92.754  1.00 52.68  ? 128  GLY A CA    1 
ATOM   3990  C  C     . GLY G 4 128 ? 32.516 30.855  93.297  1.00 52.26  ? 128  GLY A C     1 
ATOM   3991  O  O     . GLY G 4 128 ? 31.540 31.233  93.937  1.00 52.10  ? 128  GLY A O     1 
ATOM   3992  N  N     . GLU G 4 129 ? 33.569 31.616  93.052  1.00 52.81  ? 129  GLU A N     1 
ATOM   3993  C  CA    . GLU G 4 129 ? 33.629 32.992  93.502  1.00 53.66  ? 129  GLU A CA    1 
ATOM   3994  C  C     . GLU G 4 129 ? 32.871 33.745  92.437  1.00 53.25  ? 129  GLU A C     1 
ATOM   3995  O  O     . GLU G 4 129 ? 33.068 33.460  91.260  1.00 53.65  ? 129  GLU A O     1 
ATOM   3996  C  CB    . GLU G 4 129 ? 35.090 33.487  93.530  1.00 55.58  ? 129  GLU A CB    1 
ATOM   3997  C  CG    . GLU G 4 129 ? 35.256 34.997  93.181  1.00 58.50  ? 129  GLU A CG    1 
ATOM   3998  C  CD    . GLU G 4 129 ? 36.706 35.501  93.108  1.00 59.34  ? 129  GLU A CD    1 
ATOM   3999  O  OE1   . GLU G 4 129 ? 36.906 36.670  92.694  1.00 59.58  ? 129  GLU A OE1   1 
ATOM   4000  O  OE2   . GLU G 4 129 ? 37.637 34.746  93.460  1.00 60.13  ? 129  GLU A OE2   1 
ATOM   4001  N  N     . ARG G 4 130 ? 31.979 34.661  92.811  1.00 51.72  ? 130  ARG A N     1 
ATOM   4002  C  CA    . ARG G 4 130 ? 31.308 35.431  91.761  1.00 51.02  ? 130  ARG A CA    1 
ATOM   4003  C  C     . ARG G 4 130 ? 30.947 36.845  92.101  1.00 49.27  ? 130  ARG A C     1 
ATOM   4004  O  O     . ARG G 4 130 ? 30.537 37.150  93.220  1.00 49.03  ? 130  ARG A O     1 
ATOM   4005  C  CB    . ARG G 4 130 ? 30.075 34.720  91.176  1.00 51.95  ? 130  ARG A CB    1 
ATOM   4006  C  CG    . ARG G 4 130 ? 29.030 34.231  92.136  1.00 51.97  ? 130  ARG A CG    1 
ATOM   4007  C  CD    . ARG G 4 130 ? 27.814 33.661  91.378  1.00 51.76  ? 130  ARG A CD    1 
ATOM   4008  N  NE    . ARG G 4 130 ? 27.010 34.723  90.772  1.00 51.22  ? 130  ARG A NE    1 
ATOM   4009  C  CZ    . ARG G 4 130 ? 25.681 34.689  90.681  1.00 51.35  ? 130  ARG A CZ    1 
ATOM   4010  N  NH1   . ARG G 4 130 ? 24.999 33.637  91.152  1.00 49.48  ? 130  ARG A NH1   1 
ATOM   4011  N  NH2   . ARG G 4 130 ? 25.035 35.724  90.151  1.00 51.26  ? 130  ARG A NH2   1 
ATOM   4012  N  N     . ALA G 4 131 ? 31.126 37.695  91.095  1.00 47.55  ? 131  ALA A N     1 
ATOM   4013  C  CA    . ALA G 4 131 ? 30.882 39.118  91.183  1.00 46.59  ? 131  ALA A CA    1 
ATOM   4014  C  C     . ALA G 4 131 ? 29.477 39.506  91.581  1.00 46.30  ? 131  ALA A C     1 
ATOM   4015  O  O     . ALA G 4 131 ? 28.498 38.908  91.121  1.00 48.44  ? 131  ALA A O     1 
ATOM   4016  C  CB    . ALA G 4 131 ? 31.213 39.766  89.880  1.00 46.31  ? 131  ALA A CB    1 
ATOM   4017  N  N     . LYS G 4 132 ? 29.408 40.531  92.434  1.00 44.35  ? 132  LYS A N     1 
ATOM   4018  C  CA    . LYS G 4 132 ? 28.171 41.093  92.945  1.00 41.04  ? 132  LYS A CA    1 
ATOM   4019  C  C     . LYS G 4 132 ? 27.997 42.436  92.214  1.00 38.62  ? 132  LYS A C     1 
ATOM   4020  O  O     . LYS G 4 132 ? 28.946 42.942  91.641  1.00 36.96  ? 132  LYS A O     1 
ATOM   4021  C  CB    . LYS G 4 132 ? 28.287 41.262  94.479  1.00 40.72  ? 132  LYS A CB    1 
ATOM   4022  C  CG    . LYS G 4 132 ? 28.377 39.911  95.246  1.00 43.27  ? 132  LYS A CG    1 
ATOM   4023  C  CD    . LYS G 4 132 ? 28.334 40.008  96.807  1.00 47.05  ? 132  LYS A CD    1 
ATOM   4024  C  CE    . LYS G 4 132 ? 29.723 40.367  97.480  1.00 49.50  ? 132  LYS A CE    1 
ATOM   4025  N  NZ    . LYS G 4 132 ? 29.794 40.478  99.014  1.00 45.31  ? 132  LYS A NZ    1 
ATOM   4026  N  N     . GLN G 4 133 ? 26.775 42.963  92.166  1.00 36.80  ? 133  GLN A N     1 
ATOM   4027  C  CA    . GLN G 4 133 ? 26.491 44.250  91.537  1.00 34.72  ? 133  GLN A CA    1 
ATOM   4028  C  C     . GLN G 4 133 ? 25.489 44.920  92.467  1.00 32.92  ? 133  GLN A C     1 
ATOM   4029  O  O     . GLN G 4 133 ? 24.931 44.286  93.373  1.00 32.77  ? 133  GLN A O     1 
ATOM   4030  C  CB    . GLN G 4 133 ? 25.848 44.076  90.183  1.00 36.51  ? 133  GLN A CB    1 
ATOM   4031  C  CG    . GLN G 4 133 ? 24.383 43.735  90.310  1.00 42.38  ? 133  GLN A CG    1 
ATOM   4032  C  CD    . GLN G 4 133 ? 23.687 43.430  88.985  1.00 46.35  ? 133  GLN A CD    1 
ATOM   4033  O  OE1   . GLN G 4 133 ? 22.448 43.377  88.934  1.00 49.16  ? 133  GLN A OE1   1 
ATOM   4034  N  NE2   . GLN G 4 133 ? 24.466 43.215  87.917  1.00 46.79  ? 133  GLN A NE2   1 
ATOM   4035  N  N     . ALA G 4 134 ? 25.249 46.200  92.233  1.00 30.59  ? 134  ALA A N     1 
ATOM   4036  C  CA    . ALA G 4 134 ? 24.330 46.982  93.052  1.00 26.98  ? 134  ALA A CA    1 
ATOM   4037  C  C     . ALA G 4 134 ? 22.932 46.430  93.140  1.00 26.39  ? 134  ALA A C     1 
ATOM   4038  O  O     . ALA G 4 134 ? 22.411 45.869  92.160  1.00 29.39  ? 134  ALA A O     1 
ATOM   4039  C  CB    . ALA G 4 134 ? 24.258 48.365  92.526  1.00 28.43  ? 134  ALA A CB    1 
ATOM   4040  N  N     . LEU G 4 135 ? 22.324 46.613  94.312  1.00 22.79  ? 135  LEU A N     1 
ATOM   4041  C  CA    . LEU G 4 135 ? 20.960 46.180  94.589  1.00 19.99  ? 135  LEU A CA    1 
ATOM   4042  C  C     . LEU G 4 135 ? 20.061 47.247  94.002  1.00 19.99  ? 135  LEU A C     1 
ATOM   4043  O  O     . LEU G 4 135 ? 20.161 48.410  94.337  1.00 19.20  ? 135  LEU A O     1 
ATOM   4044  C  CB    . LEU G 4 135 ? 20.788 46.089  96.072  1.00 19.49  ? 135  LEU A CB    1 
ATOM   4045  C  CG    . LEU G 4 135 ? 19.415 46.166  96.670  1.00 19.39  ? 135  LEU A CG    1 
ATOM   4046  C  CD1   . LEU G 4 135 ? 18.577 45.006  96.282  1.00 21.41  ? 135  LEU A CD1   1 
ATOM   4047  C  CD2   . LEU G 4 135 ? 19.611 46.164  98.143  1.00 21.71  ? 135  LEU A CD2   1 
ATOM   4048  N  N     . ALA G 4 136 ? 19.168 46.850  93.113  1.00 22.18  ? 136  ALA A N     1 
ATOM   4049  C  CA    . ALA G 4 136 ? 18.341 47.821  92.410  1.00 22.71  ? 136  ALA A CA    1 
ATOM   4050  C  C     . ALA G 4 136 ? 17.410 48.680  93.212  1.00 23.66  ? 136  ALA A C     1 
ATOM   4051  O  O     . ALA G 4 136 ? 16.801 48.212  94.164  1.00 26.50  ? 136  ALA A O     1 
ATOM   4052  C  CB    . ALA G 4 136 ? 17.546 47.127  91.324  1.00 21.89  ? 136  ALA A CB    1 
ATOM   4053  N  N     . PHE G 4 137 ? 17.318 49.945  92.802  1.00 22.86  ? 137  PHE A N     1 
ATOM   4054  C  CA    . PHE G 4 137 ? 16.410 50.931  93.355  1.00 21.37  ? 137  PHE A CA    1 
ATOM   4055  C  C     . PHE G 4 137 ? 15.538 51.138  92.147  1.00 22.54  ? 137  PHE A C     1 
ATOM   4056  O  O     . PHE G 4 137 ? 15.812 52.015  91.343  1.00 21.32  ? 137  PHE A O     1 
ATOM   4057  C  CB    . PHE G 4 137 ? 17.093 52.249  93.621  1.00 20.98  ? 137  PHE A CB    1 
ATOM   4058  C  CG    . PHE G 4 137 ? 16.190 53.271  94.229  1.00 19.95  ? 137  PHE A CG    1 
ATOM   4059  C  CD1   . PHE G 4 137 ? 15.775 53.151  95.549  1.00 20.37  ? 137  PHE A CD1   1 
ATOM   4060  C  CD2   . PHE G 4 137 ? 15.740 54.340  93.487  1.00 15.81  ? 137  PHE A CD2   1 
ATOM   4061  C  CE1   . PHE G 4 137 ? 14.927 54.095  96.100  1.00 20.59  ? 137  PHE A CE1   1 
ATOM   4062  C  CE2   . PHE G 4 137 ? 14.901 55.280  94.028  1.00 14.55  ? 137  PHE A CE2   1 
ATOM   4063  C  CZ    . PHE G 4 137 ? 14.490 55.174  95.320  1.00 18.57  ? 137  PHE A CZ    1 
ATOM   4064  N  N     . GLU G 4 138 ? 14.512 50.316  91.997  1.00 24.81  ? 138  GLU A N     1 
ATOM   4065  C  CA    . GLU G 4 138 ? 13.640 50.419  90.849  1.00 26.94  ? 138  GLU A CA    1 
ATOM   4066  C  C     . GLU G 4 138 ? 12.539 51.447  91.078  1.00 26.30  ? 138  GLU A C     1 
ATOM   4067  O  O     . GLU G 4 138 ? 12.502 52.084  92.118  1.00 24.90  ? 138  GLU A O     1 
ATOM   4068  C  CB    . GLU G 4 138 ? 13.070 49.039  90.521  1.00 30.88  ? 138  GLU A CB    1 
ATOM   4069  C  CG    . GLU G 4 138 ? 14.120 48.014  90.065  1.00 36.07  ? 138  GLU A CG    1 
ATOM   4070  C  CD    . GLU G 4 138 ? 13.569 46.586  90.003  1.00 40.79  ? 138  GLU A CD    1 
ATOM   4071  O  OE1   . GLU G 4 138 ? 14.147 45.740  89.273  1.00 42.86  ? 138  GLU A OE1   1 
ATOM   4072  O  OE2   . GLU G 4 138 ? 12.560 46.299  90.697  1.00 44.65  ? 138  GLU A OE2   1 
ATOM   4073  N  N     . ARG G 4 139 ? 11.636 51.601  90.120  1.00 26.31  ? 139  ARG A N     1 
ATOM   4074  C  CA    . ARG G 4 139 ? 10.611 52.613  90.243  1.00 26.85  ? 139  ARG A CA    1 
ATOM   4075  C  C     . ARG G 4 139 ? 9.562  52.436  91.295  1.00 25.79  ? 139  ARG A C     1 
ATOM   4076  O  O     . ARG G 4 139 ? 8.976  53.397  91.778  1.00 24.68  ? 139  ARG A O     1 
ATOM   4077  C  CB    . ARG G 4 139 ? 9.906  52.793  88.939  1.00 31.15  ? 139  ARG A CB    1 
ATOM   4078  C  CG    . ARG G 4 139 ? 8.534  53.300  89.159  1.00 34.70  ? 139  ARG A CG    1 
ATOM   4079  C  CD    . ARG G 4 139 ? 8.164  54.400  88.229  1.00 38.53  ? 139  ARG A CD    1 
ATOM   4080  N  NE    . ARG G 4 139 ? 7.014  55.051  88.820  1.00 41.52  ? 139  ARG A NE    1 
ATOM   4081  C  CZ    . ARG G 4 139 ? 6.192  55.854  88.176  1.00 43.19  ? 139  ARG A CZ    1 
ATOM   4082  N  NH1   . ARG G 4 139 ? 6.392  56.114  86.880  1.00 42.21  ? 139  ARG A NH1   1 
ATOM   4083  N  NH2   . ARG G 4 139 ? 5.174  56.389  88.847  1.00 44.67  ? 139  ARG A NH2   1 
ATOM   4084  N  N     . THR G 4 140 ? 9.281  51.197  91.624  1.00 25.99  ? 140  THR A N     1 
ATOM   4085  C  CA    . THR G 4 140 ? 8.289  50.934  92.628  1.00 24.93  ? 140  THR A CA    1 
ATOM   4086  C  C     . THR G 4 140 ? 8.886  51.233  94.002  1.00 25.93  ? 140  THR A C     1 
ATOM   4087  O  O     . THR G 4 140 ? 8.192  51.237  94.987  1.00 27.38  ? 140  THR A O     1 
ATOM   4088  C  CB    . THR G 4 140 ? 7.767  49.477  92.504  1.00 23.03  ? 140  THR A CB    1 
ATOM   4089  O  OG1   . THR G 4 140 ? 7.930  48.815  93.740  1.00 22.89  ? 140  THR A OG1   1 
ATOM   4090  C  CG2   . THR G 4 140 ? 8.528  48.691  91.433  1.00 22.44  ? 140  THR A CG2   1 
ATOM   4091  N  N     . ASP G 4 141 ? 10.180 51.513  94.064  1.00 27.10  ? 141  ASP A N     1 
ATOM   4092  C  CA    . ASP G 4 141 ? 10.845 51.846  95.329  1.00 28.49  ? 141  ASP A CA    1 
ATOM   4093  C  C     . ASP G 4 141 ? 10.743 53.336  95.525  1.00 28.26  ? 141  ASP A C     1 
ATOM   4094  O  O     . ASP G 4 141 ? 10.581 53.815  96.628  1.00 27.53  ? 141  ASP A O     1 
ATOM   4095  C  CB    . ASP G 4 141 ? 12.321 51.474  95.283  1.00 31.37  ? 141  ASP A CB    1 
ATOM   4096  C  CG    . ASP G 4 141 ? 12.544 49.989  95.373  1.00 34.65  ? 141  ASP A CG    1 
ATOM   4097  O  OD1   . ASP G 4 141 ? 12.277 49.433  96.452  1.00 36.54  ? 141  ASP A OD1   1 
ATOM   4098  O  OD2   . ASP G 4 141 ? 12.973 49.373  94.373  1.00 34.89  ? 141  ASP A OD2   1 
ATOM   4099  N  N     . PHE G 4 142 ? 10.873 54.061  94.425  1.00 28.69  ? 142  PHE A N     1 
ATOM   4100  C  CA    . PHE G 4 142 ? 10.776 55.496  94.438  1.00 27.92  ? 142  PHE A CA    1 
ATOM   4101  C  C     . PHE G 4 142 ? 9.389  55.742  94.899  1.00 29.39  ? 142  PHE A C     1 
ATOM   4102  O  O     . PHE G 4 142 ? 9.184  56.453  95.838  1.00 31.00  ? 142  PHE A O     1 
ATOM   4103  C  CB    . PHE G 4 142 ? 10.953 56.046  93.034  1.00 27.53  ? 142  PHE A CB    1 
ATOM   4104  C  CG    . PHE G 4 142 ? 10.842 57.536  92.926  1.00 27.03  ? 142  PHE A CG    1 
ATOM   4105  C  CD1   . PHE G 4 142 ? 11.544 58.372  93.788  1.00 28.86  ? 142  PHE A CD1   1 
ATOM   4106  C  CD2   . PHE G 4 142 ? 10.072 58.105  91.928  1.00 25.33  ? 142  PHE A CD2   1 
ATOM   4107  C  CE1   . PHE G 4 142 ? 11.475 59.767  93.646  1.00 28.99  ? 142  PHE A CE1   1 
ATOM   4108  C  CE2   . PHE G 4 142 ? 9.994  59.479  91.776  1.00 26.08  ? 142  PHE A CE2   1 
ATOM   4109  C  CZ    . PHE G 4 142 ? 10.691 60.314  92.630  1.00 28.25  ? 142  PHE A CZ    1 
ATOM   4110  N  N     . ASP G 4 143 ? 8.414  55.118  94.270  1.00 31.99  ? 143  ASP A N     1 
ATOM   4111  C  CA    . ASP G 4 143 ? 7.048  55.378  94.686  1.00 34.12  ? 143  ASP A CA    1 
ATOM   4112  C  C     . ASP G 4 143 ? 6.782  55.145  96.157  1.00 32.81  ? 143  ASP A C     1 
ATOM   4113  O  O     . ASP G 4 143 ? 6.126  55.959  96.783  1.00 32.95  ? 143  ASP A O     1 
ATOM   4114  C  CB    . ASP G 4 143 ? 6.046  54.575  93.847  1.00 39.46  ? 143  ASP A CB    1 
ATOM   4115  C  CG    . ASP G 4 143 ? 5.795  55.193  92.453  1.00 45.81  ? 143  ASP A CG    1 
ATOM   4116  O  OD1   . ASP G 4 143 ? 5.822  56.451  92.332  1.00 47.69  ? 143  ASP A OD1   1 
ATOM   4117  O  OD2   . ASP G 4 143 ? 5.546  54.423  91.479  1.00 49.29  ? 143  ASP A OD2   1 
ATOM   4118  N  N     . GLN G 4 144 ? 7.287  54.048  96.711  1.00 32.09  ? 144  GLN A N     1 
ATOM   4119  C  CA    . GLN G 4 144 ? 7.067  53.729  98.113  1.00 31.59  ? 144  GLN A CA    1 
ATOM   4120  C  C     . GLN G 4 144 ? 7.776  54.750  98.982  1.00 31.29  ? 144  GLN A C     1 
ATOM   4121  O  O     . GLN G 4 144 ? 7.207  55.269  99.921  1.00 32.05  ? 144  GLN A O     1 
ATOM   4122  C  CB    . GLN G 4 144 ? 7.575  52.320  98.408  1.00 32.78  ? 144  GLN A CB    1 
ATOM   4123  C  CG    . GLN G 4 144 ? 6.487  51.260  98.520  1.00 37.61  ? 144  GLN A CG    1 
ATOM   4124  C  CD    . GLN G 4 144 ? 6.895  49.831  98.050  1.00 41.15  ? 144  GLN A CD    1 
ATOM   4125  O  OE1   . GLN G 4 144 ? 7.842  49.189  98.556  1.00 42.10  ? 144  GLN A OE1   1 
ATOM   4126  N  NE2   . GLN G 4 144 ? 6.149  49.329  97.076  1.00 43.98  ? 144  GLN A NE2   1 
ATOM   4127  N  N     . VAL G 4 145 ? 9.020  55.058  98.645  1.00 30.08  ? 145  VAL A N     1 
ATOM   4128  C  CA    . VAL G 4 145 ? 9.821  56.016  99.392  1.00 28.53  ? 145  VAL A CA    1 
ATOM   4129  C  C     . VAL G 4 145 ? 9.291  57.408  99.269  1.00 30.59  ? 145  VAL A C     1 
ATOM   4130  O  O     . VAL G 4 145 ? 9.568  58.241  100.097 1.00 32.90  ? 145  VAL A O     1 
ATOM   4131  C  CB    . VAL G 4 145 ? 11.239 56.065  98.871  1.00 25.89  ? 145  VAL A CB    1 
ATOM   4132  C  CG1   . VAL G 4 145 ? 12.028 57.169  99.550  1.00 23.13  ? 145  VAL A CG1   1 
ATOM   4133  C  CG2   . VAL G 4 145 ? 11.877 54.732  99.056  1.00 24.61  ? 145  VAL A CG2   1 
ATOM   4134  N  N     . ARG G 4 146 ? 8.538  57.667  98.215  1.00 33.50  ? 146  ARG A N     1 
ATOM   4135  C  CA    . ARG G 4 146 ? 7.990  58.998  97.958  1.00 35.18  ? 146  ARG A CA    1 
ATOM   4136  C  C     . ARG G 4 146 ? 6.658  59.183  98.673  1.00 34.79  ? 146  ARG A C     1 
ATOM   4137  O  O     . ARG G 4 146 ? 6.382  60.251  99.184  1.00 35.43  ? 146  ARG A O     1 
ATOM   4138  C  CB    . ARG G 4 146 ? 7.830  59.201  96.441  1.00 35.99  ? 146  ARG A CB    1 
ATOM   4139  C  CG    . ARG G 4 146 ? 7.420  60.569  95.981  1.00 38.61  ? 146  ARG A CG    1 
ATOM   4140  C  CD    . ARG G 4 146 ? 6.132  60.535  95.141  1.00 43.32  ? 146  ARG A CD    1 
ATOM   4141  N  NE    . ARG G 4 146 ? 6.257  59.868  93.839  1.00 46.27  ? 146  ARG A NE    1 
ATOM   4142  C  CZ    . ARG G 4 146 ? 6.655  60.459  92.711  1.00 47.49  ? 146  ARG A CZ    1 
ATOM   4143  N  NH1   . ARG G 4 146 ? 6.975  61.753  92.707  1.00 47.97  ? 146  ARG A NH1   1 
ATOM   4144  N  NH2   . ARG G 4 146 ? 6.721  59.755  91.581  1.00 48.23  ? 146  ARG A NH2   1 
ATOM   4145  N  N     . SER G 4 147 ? 5.838  58.146  98.735  1.00 34.13  ? 147  SER A N     1 
ATOM   4146  C  CA    . SER G 4 147 ? 4.562  58.301  99.398  1.00 34.31  ? 147  SER A CA    1 
ATOM   4147  C  C     . SER G 4 147 ? 4.781  58.446  100.884 1.00 35.09  ? 147  SER A C     1 
ATOM   4148  O  O     . SER G 4 147 ? 3.857  58.748  101.621 1.00 36.49  ? 147  SER A O     1 
ATOM   4149  C  CB    . SER G 4 147 ? 3.659  57.102  99.153  1.00 34.43  ? 147  SER A CB    1 
ATOM   4150  O  OG    . SER G 4 147 ? 4.105  56.008  99.918  1.00 35.16  ? 147  SER A OG    1 
ATOM   4151  N  N     . LEU G 4 148 ? 6.000  58.228  101.341 1.00 35.38  ? 148  LEU A N     1 
ATOM   4152  C  CA    . LEU G 4 148 ? 6.265  58.362  102.760 1.00 36.41  ? 148  LEU A CA    1 
ATOM   4153  C  C     . LEU G 4 148 ? 6.869  59.713  103.151 1.00 37.37  ? 148  LEU A C     1 
ATOM   4154  O  O     . LEU G 4 148 ? 6.377  60.361  104.066 1.00 37.87  ? 148  LEU A O     1 
ATOM   4155  C  CB    . LEU G 4 148 ? 7.193  57.248  103.231 1.00 34.04  ? 148  LEU A CB    1 
ATOM   4156  C  CG    . LEU G 4 148 ? 6.593  55.866  103.369 1.00 33.23  ? 148  LEU A CG    1 
ATOM   4157  C  CD1   . LEU G 4 148 ? 7.679  54.884  103.636 1.00 33.42  ? 148  LEU A CD1   1 
ATOM   4158  C  CD2   . LEU G 4 148 ? 5.631  55.843  104.485 1.00 33.12  ? 148  LEU A CD2   1 
ATOM   4159  N  N     . MET G 4 149 ? 7.921  60.139  102.462 1.00 37.90  ? 149  MET A N     1 
ATOM   4160  C  CA    . MET G 4 149 ? 8.584  61.379  102.806 1.00 39.49  ? 149  MET A CA    1 
ATOM   4161  C  C     . MET G 4 149 ? 8.069  62.623  102.097 1.00 41.43  ? 149  MET A C     1 
ATOM   4162  O  O     . MET G 4 149 ? 8.692  63.691  102.151 1.00 41.74  ? 149  MET A O     1 
ATOM   4163  C  CB    . MET G 4 149 ? 10.072 61.260  102.521 1.00 39.97  ? 149  MET A CB    1 
ATOM   4164  C  CG    . MET G 4 149 ? 10.780 60.094  103.132 1.00 39.97  ? 149  MET A CG    1 
ATOM   4165  S  SD    . MET G 4 149 ? 12.226 59.690  102.094 1.00 40.64  ? 149  MET A SD    1 
ATOM   4166  C  CE    . MET G 4 149 ? 13.559 60.516  102.951 1.00 41.14  ? 149  MET A CE    1 
ATOM   4167  N  N     . GLU G 4 150 ? 6.951  62.524  101.412 1.00 42.74  ? 150  GLU A N     1 
ATOM   4168  C  CA    . GLU G 4 150 ? 6.477  63.710  100.744 1.00 44.46  ? 150  GLU A CA    1 
ATOM   4169  C  C     . GLU G 4 150 ? 5.665  64.522  101.718 1.00 44.73  ? 150  GLU A C     1 
ATOM   4170  O  O     . GLU G 4 150 ? 5.330  65.659  101.415 1.00 46.61  ? 150  GLU A O     1 
ATOM   4171  C  CB    . GLU G 4 150 ? 5.630  63.353  99.539  1.00 46.35  ? 150  GLU A CB    1 
ATOM   4172  C  CG    . GLU G 4 150 ? 4.365  62.657  99.934  1.00 50.29  ? 150  GLU A CG    1 
ATOM   4173  C  CD    . GLU G 4 150 ? 3.542  62.199  98.754  1.00 52.05  ? 150  GLU A CD    1 
ATOM   4174  O  OE1   . GLU G 4 150 ? 2.497  61.545  99.001  1.00 53.29  ? 150  GLU A OE1   1 
ATOM   4175  O  OE2   . GLU G 4 150 ? 3.934  62.493  97.596  1.00 52.46  ? 150  GLU A OE2   1 
ATOM   4176  N  N     . ASN G 4 151 ? 5.358  63.949  102.884 1.00 45.75  ? 151  ASN A N     1 
ATOM   4177  C  CA    . ASN G 4 151 ? 4.574  64.641  103.925 1.00 47.25  ? 151  ASN A CA    1 
ATOM   4178  C  C     . ASN G 4 151 ? 5.432  65.236  105.010 1.00 48.22  ? 151  ASN A C     1 
ATOM   4179  O  O     . ASN G 4 151 ? 4.921  65.896  105.891 1.00 49.40  ? 151  ASN A O     1 
ATOM   4180  C  CB    . ASN G 4 151 ? 3.603  63.713  104.650 1.00 46.76  ? 151  ASN A CB    1 
ATOM   4181  C  CG    . ASN G 4 151 ? 2.734  62.931  103.724 1.00 47.16  ? 151  ASN A CG    1 
ATOM   4182  O  OD1   . ASN G 4 151 ? 2.099  63.490  102.832 1.00 47.33  ? 151  ASN A OD1   1 
ATOM   4183  N  ND2   . ASN G 4 151 ? 2.682  61.617  103.937 1.00 47.26  ? 151  ASN A ND2   1 
ATOM   4184  N  N     . SER G 4 152 ? 6.724  64.963  104.976 1.00 49.81  ? 152  SER A N     1 
ATOM   4185  C  CA    . SER G 4 152 ? 7.640  65.478  105.975 1.00 51.69  ? 152  SER A CA    1 
ATOM   4186  C  C     . SER G 4 152 ? 8.045  66.883  105.605 1.00 53.48  ? 152  SER A C     1 
ATOM   4187  O  O     . SER G 4 152 ? 8.113  67.233  104.432 1.00 54.22  ? 152  SER A O     1 
ATOM   4188  C  CB    . SER G 4 152 ? 8.878  64.595  106.050 1.00 52.23  ? 152  SER A CB    1 
ATOM   4189  O  OG    . SER G 4 152 ? 9.737  64.973  107.100 1.00 52.66  ? 152  SER A OG    1 
ATOM   4190  N  N     . ASP G 4 153 ? 8.297  67.703  106.610 1.00 55.87  ? 153  ASP A N     1 
ATOM   4191  C  CA    . ASP G 4 153 ? 8.700  69.064  106.348 1.00 58.72  ? 153  ASP A CA    1 
ATOM   4192  C  C     . ASP G 4 153 ? 10.091 69.273  106.850 1.00 58.43  ? 153  ASP A C     1 
ATOM   4193  O  O     . ASP G 4 153 ? 10.653 70.344  106.703 1.00 58.81  ? 153  ASP A O     1 
ATOM   4194  C  CB    . ASP G 4 153 ? 7.725  70.040  106.988 1.00 62.40  ? 153  ASP A CB    1 
ATOM   4195  C  CG    . ASP G 4 153 ? 6.476  70.249  106.128 1.00 66.79  ? 153  ASP A CG    1 
ATOM   4196  O  OD1   . ASP G 4 153 ? 5.548  70.955  106.587 1.00 69.40  ? 153  ASP A OD1   1 
ATOM   4197  O  OD2   . ASP G 4 153 ? 6.427  69.711  104.987 1.00 67.87  ? 153  ASP A OD2   1 
ATOM   4198  N  N     . ARG G 4 154 ? 10.644 68.230  107.459 1.00 58.99  ? 154  ARG A N     1 
ATOM   4199  C  CA    . ARG G 4 154 ? 12.011 68.285  107.941 1.00 57.98  ? 154  ARG A CA    1 
ATOM   4200  C  C     . ARG G 4 154 ? 12.727 68.672  106.680 1.00 56.38  ? 154  ARG A C     1 
ATOM   4201  O  O     . ARG G 4 154 ? 12.413 68.196  105.598 1.00 55.50  ? 154  ARG A O     1 
ATOM   4202  C  CB    . ARG G 4 154 ? 12.518 66.912  108.399 1.00 59.49  ? 154  ARG A CB    1 
ATOM   4203  C  CG    . ARG G 4 154 ? 12.079 66.458  109.786 1.00 61.12  ? 154  ARG A CG    1 
ATOM   4204  C  CD    . ARG G 4 154 ? 13.229 66.520  110.797 1.00 63.18  ? 154  ARG A CD    1 
ATOM   4205  N  NE    . ARG G 4 154 ? 14.449 65.892  110.291 1.00 64.87  ? 154  ARG A NE    1 
ATOM   4206  C  CZ    . ARG G 4 154 ? 14.529 64.631  109.878 1.00 65.71  ? 154  ARG A CZ    1 
ATOM   4207  N  NH1   . ARG G 4 154 ? 13.458 63.852  109.913 1.00 66.44  ? 154  ARG A NH1   1 
ATOM   4208  N  NH2   . ARG G 4 154 ? 15.676 64.146  109.421 1.00 65.52  ? 154  ARG A NH2   1 
ATOM   4209  N  N     . CYS G 4 155 ? 13.681 69.560  106.818 1.00 55.15  ? 155  CYS A N     1 
ATOM   4210  C  CA    . CYS G 4 155 ? 14.429 70.021  105.680 1.00 53.76  ? 155  CYS A CA    1 
ATOM   4211  C  C     . CYS G 4 155 ? 15.319 68.908  105.095 1.00 51.54  ? 155  CYS A C     1 
ATOM   4212  O  O     . CYS G 4 155 ? 15.555 68.835  103.884 1.00 49.22  ? 155  CYS A O     1 
ATOM   4213  C  CB    . CYS G 4 155 ? 15.248 71.213  106.124 1.00 54.22  ? 155  CYS A CB    1 
ATOM   4214  S  SG    . CYS G 4 155 ? 16.107 71.917  104.797 1.00 59.58  ? 155  CYS A SG    1 
ATOM   4215  N  N     . GLN G 4 156 ? 15.810 68.039  105.969 1.00 50.32  ? 156  GLN A N     1 
ATOM   4216  C  CA    . GLN G 4 156 ? 16.644 66.932  105.543 1.00 47.79  ? 156  GLN A CA    1 
ATOM   4217  C  C     . GLN G 4 156 ? 15.890 66.117  104.532 1.00 45.52  ? 156  GLN A C     1 
ATOM   4218  O  O     . GLN G 4 156 ? 16.332 65.969  103.405 1.00 45.14  ? 156  GLN A O     1 
ATOM   4219  C  CB    . GLN G 4 156 ? 16.978 66.051  106.717 1.00 49.01  ? 156  GLN A CB    1 
ATOM   4220  C  CG    . GLN G 4 156 ? 17.638 64.790  106.309 1.00 52.04  ? 156  GLN A CG    1 
ATOM   4221  C  CD    . GLN G 4 156 ? 18.487 64.226  107.414 1.00 55.30  ? 156  GLN A CD    1 
ATOM   4222  O  OE1   . GLN G 4 156 ? 18.065 63.327  108.164 1.00 56.84  ? 156  GLN A OE1   1 
ATOM   4223  N  NE2   . GLN G 4 156 ? 19.698 64.767  107.544 1.00 56.97  ? 156  GLN A NE2   1 
ATOM   4224  N  N     . ASP G 4 157 ? 14.749 65.583  104.965 1.00 43.90  ? 157  ASP A N     1 
ATOM   4225  C  CA    . ASP G 4 157 ? 13.871 64.785  104.122 1.00 41.69  ? 157  ASP A CA    1 
ATOM   4226  C  C     . ASP G 4 157 ? 13.640 65.486  102.792 1.00 40.17  ? 157  ASP A C     1 
ATOM   4227  O  O     . ASP G 4 157 ? 13.911 64.927  101.727 1.00 41.50  ? 157  ASP A O     1 
ATOM   4228  C  CB    . ASP G 4 157 ? 12.526 64.539  104.806 1.00 42.64  ? 157  ASP A CB    1 
ATOM   4229  C  CG    . ASP G 4 157 ? 12.627 63.561  105.976 1.00 46.06  ? 157  ASP A CG    1 
ATOM   4230  O  OD1   . ASP G 4 157 ? 13.647 62.843  106.068 1.00 47.87  ? 157  ASP A OD1   1 
ATOM   4231  O  OD2   . ASP G 4 157 ? 11.684 63.498  106.803 1.00 47.31  ? 157  ASP A OD2   1 
ATOM   4232  N  N     . ILE G 4 158 ? 13.148 66.711  102.817 1.00 35.61  ? 158  ILE A N     1 
ATOM   4233  C  CA    . ILE G 4 158 ? 12.965 67.366  101.550 1.00 31.05  ? 158  ILE A CA    1 
ATOM   4234  C  C     . ILE G 4 158 ? 14.209 67.228  100.676 1.00 28.93  ? 158  ILE A C     1 
ATOM   4235  O  O     . ILE G 4 158 ? 14.090 66.913  99.514  1.00 28.68  ? 158  ILE A O     1 
ATOM   4236  C  CB    . ILE G 4 158 ? 12.644 68.802  101.732 1.00 29.87  ? 158  ILE A CB    1 
ATOM   4237  C  CG1   . ILE G 4 158 ? 11.297 68.909  102.410 1.00 29.33  ? 158  ILE A CG1   1 
ATOM   4238  C  CG2   . ILE G 4 158 ? 12.617 69.488  100.398 1.00 29.10  ? 158  ILE A CG2   1 
ATOM   4239  C  CD1   . ILE G 4 158 ? 10.737 70.259  102.392 1.00 30.85  ? 158  ILE A CD1   1 
ATOM   4240  N  N     . ARG G 4 159 ? 15.399 67.453  101.225 1.00 28.11  ? 159  ARG A N     1 
ATOM   4241  C  CA    . ARG G 4 159 ? 16.623 67.307  100.440 1.00 26.28  ? 159  ARG A CA    1 
ATOM   4242  C  C     . ARG G 4 159 ? 16.744 65.898  99.919  1.00 26.29  ? 159  ARG A C     1 
ATOM   4243  O  O     . ARG G 4 159 ? 16.809 65.677  98.714  1.00 27.08  ? 159  ARG A O     1 
ATOM   4244  C  CB    . ARG G 4 159 ? 17.872 67.560  101.267 1.00 24.65  ? 159  ARG A CB    1 
ATOM   4245  C  CG    . ARG G 4 159 ? 19.149 67.436  100.457 1.00 21.65  ? 159  ARG A CG    1 
ATOM   4246  C  CD    . ARG G 4 159 ? 20.367 67.419  101.321 1.00 20.10  ? 159  ARG A CD    1 
ATOM   4247  N  NE    . ARG G 4 159 ? 20.416 66.162  102.032 1.00 18.93  ? 159  ARG A NE    1 
ATOM   4248  C  CZ    . ARG G 4 159 ? 21.276 65.883  103.005 1.00 20.70  ? 159  ARG A CZ    1 
ATOM   4249  N  NH1   . ARG G 4 159 ? 22.175 66.776  103.391 1.00 20.88  ? 159  ARG A NH1   1 
ATOM   4250  N  NH2   . ARG G 4 159 ? 21.229 64.704  103.605 1.00 19.76  ? 159  ARG A NH2   1 
ATOM   4251  N  N     . ASN G 4 160 ? 16.801 64.928  100.818 1.00 25.19  ? 160  ASN A N     1 
ATOM   4252  C  CA    . ASN G 4 160 ? 16.944 63.574  100.350 1.00 24.92  ? 160  ASN A CA    1 
ATOM   4253  C  C     . ASN G 4 160 ? 15.973 63.251  99.236  1.00 25.25  ? 160  ASN A C     1 
ATOM   4254  O  O     . ASN G 4 160 ? 16.404 62.924  98.138  1.00 26.75  ? 160  ASN A O     1 
ATOM   4255  C  CB    . ASN G 4 160 ? 16.835 62.604  101.502 1.00 26.64  ? 160  ASN A CB    1 
ATOM   4256  C  CG    . ASN G 4 160 ? 17.981 62.776  102.490 1.00 30.25  ? 160  ASN A CG    1 
ATOM   4257  O  OD1   . ASN G 4 160 ? 18.928 63.517  102.218 1.00 32.03  ? 160  ASN A OD1   1 
ATOM   4258  N  ND2   . ASN G 4 160 ? 17.908 62.090  103.640 1.00 31.33  ? 160  ASN A ND2   1 
ATOM   4259  N  N     . LEU G 4 161 ? 14.672 63.391  99.451  1.00 23.53  ? 161  LEU A N     1 
ATOM   4260  C  CA    . LEU G 4 161 ? 13.745 63.068  98.360  1.00 22.00  ? 161  LEU A CA    1 
ATOM   4261  C  C     . LEU G 4 161 ? 14.107 63.732  97.028  1.00 21.81  ? 161  LEU A C     1 
ATOM   4262  O  O     . LEU G 4 161 ? 13.926 63.154  95.975  1.00 22.06  ? 161  LEU A O     1 
ATOM   4263  C  CB    . LEU G 4 161 ? 12.326 63.446  98.720  1.00 18.13  ? 161  LEU A CB    1 
ATOM   4264  C  CG    . LEU G 4 161 ? 11.385 62.309  98.422  1.00 15.55  ? 161  LEU A CG    1 
ATOM   4265  C  CD1   . LEU G 4 161 ? 9.968  62.771  98.606  1.00 14.62  ? 161  LEU A CD1   1 
ATOM   4266  C  CD2   . LEU G 4 161 ? 11.624 61.829  97.025  1.00 15.86  ? 161  LEU A CD2   1 
ATOM   4267  N  N     . ALA G 4 162 ? 14.611 64.950  97.076  1.00 22.40  ? 162  ALA A N     1 
ATOM   4268  C  CA    . ALA G 4 162 ? 14.995 65.631  95.864  1.00 23.32  ? 162  ALA A CA    1 
ATOM   4269  C  C     . ALA G 4 162 ? 16.033 64.762  95.207  1.00 24.36  ? 162  ALA A C     1 
ATOM   4270  O  O     . ALA G 4 162 ? 15.878 64.362  94.047  1.00 25.57  ? 162  ALA A O     1 
ATOM   4271  C  CB    . ALA G 4 162 ? 15.599 66.980  96.182  1.00 23.40  ? 162  ALA A CB    1 
ATOM   4272  N  N     . PHE G 4 163 ? 17.099 64.476  95.955  1.00 24.38  ? 163  PHE A N     1 
ATOM   4273  C  CA    . PHE G 4 163 ? 18.193 63.648  95.453  1.00 24.21  ? 163  PHE A CA    1 
ATOM   4274  C  C     . PHE G 4 163 ? 17.707 62.313  94.862  1.00 24.32  ? 163  PHE A C     1 
ATOM   4275  O  O     . PHE G 4 163 ? 17.884 62.070  93.665  1.00 23.54  ? 163  PHE A O     1 
ATOM   4276  C  CB    . PHE G 4 163 ? 19.183 63.391  96.569  1.00 23.79  ? 163  PHE A CB    1 
ATOM   4277  C  CG    . PHE G 4 163 ? 20.252 62.424  96.211  1.00 23.39  ? 163  PHE A CG    1 
ATOM   4278  C  CD1   . PHE G 4 163 ? 21.369 62.838  95.513  1.00 24.02  ? 163  PHE A CD1   1 
ATOM   4279  C  CD2   . PHE G 4 163 ? 20.160 61.105  96.612  1.00 23.59  ? 163  PHE A CD2   1 
ATOM   4280  C  CE1   . PHE G 4 163 ? 22.391 61.953  95.224  1.00 26.41  ? 163  PHE A CE1   1 
ATOM   4281  C  CE2   . PHE G 4 163 ? 21.165 60.207  96.333  1.00 26.35  ? 163  PHE A CE2   1 
ATOM   4282  C  CZ    . PHE G 4 163 ? 22.291 60.624  95.639  1.00 27.69  ? 163  PHE A CZ    1 
ATOM   4283  N  N     . LEU G 4 164 ? 17.093 61.454  95.677  1.00 22.46  ? 164  LEU A N     1 
ATOM   4284  C  CA    . LEU G 4 164 ? 16.593 60.191  95.160  1.00 21.65  ? 164  LEU A CA    1 
ATOM   4285  C  C     . LEU G 4 164 ? 15.876 60.434  93.838  1.00 22.16  ? 164  LEU A C     1 
ATOM   4286  O  O     . LEU G 4 164 ? 16.203 59.811  92.852  1.00 22.65  ? 164  LEU A O     1 
ATOM   4287  C  CB    . LEU G 4 164 ? 15.660 59.531  96.156  1.00 20.78  ? 164  LEU A CB    1 
ATOM   4288  C  CG    . LEU G 4 164 ? 16.387 58.825  97.288  1.00 21.05  ? 164  LEU A CG    1 
ATOM   4289  C  CD1   . LEU G 4 164 ? 15.411 58.138  98.182  1.00 19.93  ? 164  LEU A CD1   1 
ATOM   4290  C  CD2   . LEU G 4 164 ? 17.332 57.812  96.716  1.00 21.67  ? 164  LEU A CD2   1 
ATOM   4291  N  N     . GLY G 4 165 ? 14.912 61.346  93.802  1.00 22.95  ? 165  GLY A N     1 
ATOM   4292  C  CA    . GLY G 4 165 ? 14.246 61.635  92.548  1.00 22.71  ? 165  GLY A CA    1 
ATOM   4293  C  C     . GLY G 4 165 ? 15.265 61.906  91.443  1.00 23.77  ? 165  GLY A C     1 
ATOM   4294  O  O     . GLY G 4 165 ? 15.365 61.135  90.480  1.00 24.00  ? 165  GLY A O     1 
ATOM   4295  N  N     . ILE G 4 166 ? 16.047 62.977  91.565  1.00 22.70  ? 166  ILE A N     1 
ATOM   4296  C  CA    . ILE G 4 166 ? 17.024 63.280  90.529  1.00 22.19  ? 166  ILE A CA    1 
ATOM   4297  C  C     . ILE G 4 166 ? 17.919 62.137  90.162  1.00 22.95  ? 166  ILE A C     1 
ATOM   4298  O  O     . ILE G 4 166 ? 18.327 62.018  89.020  1.00 23.93  ? 166  ILE A O     1 
ATOM   4299  C  CB    . ILE G 4 166 ? 17.913 64.432  90.901  1.00 21.16  ? 166  ILE A CB    1 
ATOM   4300  C  CG1   . ILE G 4 166 ? 17.164 65.718  90.623  1.00 21.81  ? 166  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE G 4 166 ? 19.179 64.407  90.081  1.00 18.20  ? 166  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE G 4 166 ? 17.827 66.943  91.153  1.00 24.63  ? 166  ILE A CD1   1 
ATOM   4303  N  N     . ALA G 4 167 ? 18.225 61.283  91.122  1.00 23.57  ? 167  ALA A N     1 
ATOM   4304  C  CA    . ALA G 4 167 ? 19.115 60.148  90.862  1.00 23.32  ? 167  ALA A CA    1 
ATOM   4305  C  C     . ALA G 4 167 ? 18.554 59.072  89.950  1.00 21.72  ? 167  ALA A C     1 
ATOM   4306  O  O     . ALA G 4 167 ? 19.246 58.590  89.068  1.00 20.24  ? 167  ALA A O     1 
ATOM   4307  C  CB    . ALA G 4 167 ? 19.550 59.525  92.175  1.00 23.57  ? 167  ALA A CB    1 
ATOM   4308  N  N     . TYR G 4 168 ? 17.303 58.704  90.192  1.00 22.57  ? 168  TYR A N     1 
ATOM   4309  C  CA    . TYR G 4 168 ? 16.622 57.674  89.422  1.00 24.31  ? 168  TYR A CA    1 
ATOM   4310  C  C     . TYR G 4 168 ? 16.193 58.223  88.091  1.00 25.08  ? 168  TYR A C     1 
ATOM   4311  O  O     . TYR G 4 168 ? 16.277 57.564  87.052  1.00 24.15  ? 168  TYR A O     1 
ATOM   4312  C  CB    . TYR G 4 168 ? 15.378 57.166  90.163  1.00 22.28  ? 168  TYR A CB    1 
ATOM   4313  C  CG    . TYR G 4 168 ? 14.440 56.336  89.314  1.00 20.70  ? 168  TYR A CG    1 
ATOM   4314  C  CD1   . TYR G 4 168 ? 14.581 54.962  89.202  1.00 18.99  ? 168  TYR A CD1   1 
ATOM   4315  C  CD2   . TYR G 4 168 ? 13.395 56.937  88.651  1.00 21.58  ? 168  TYR A CD2   1 
ATOM   4316  C  CE1   . TYR G 4 168 ? 13.696 54.225  88.465  1.00 20.24  ? 168  TYR A CE1   1 
ATOM   4317  C  CE2   . TYR G 4 168 ? 12.510 56.217  87.917  1.00 21.16  ? 168  TYR A CE2   1 
ATOM   4318  C  CZ    . TYR G 4 168 ? 12.648 54.866  87.826  1.00 21.87  ? 168  TYR A CZ    1 
ATOM   4319  O  OH    . TYR G 4 168 ? 11.676 54.179  87.123  1.00 23.56  ? 168  TYR A OH    1 
ATOM   4320  N  N     . ASN G 4 169 ? 15.713 59.443  88.123  1.00 25.47  ? 169  ASN A N     1 
ATOM   4321  C  CA    . ASN G 4 169 ? 15.272 60.027  86.891  1.00 26.93  ? 169  ASN A CA    1 
ATOM   4322  C  C     . ASN G 4 169 ? 16.394 60.246  85.862  1.00 26.60  ? 169  ASN A C     1 
ATOM   4323  O  O     . ASN G 4 169 ? 16.221 59.922  84.697  1.00 25.11  ? 169  ASN A O     1 
ATOM   4324  C  CB    . ASN G 4 169 ? 14.562 61.330  87.189  1.00 28.32  ? 169  ASN A CB    1 
ATOM   4325  C  CG    . ASN G 4 169 ? 13.830 61.845  86.008  1.00 29.85  ? 169  ASN A CG    1 
ATOM   4326  O  OD1   . ASN G 4 169 ? 13.004 62.734  86.125  1.00 33.34  ? 169  ASN A OD1   1 
ATOM   4327  N  ND2   . ASN G 4 169 ? 14.121 61.288  84.845  1.00 30.34  ? 169  ASN A ND2   1 
ATOM   4328  N  N     . THR G 4 170 ? 17.544 60.771  86.288  1.00 27.02  ? 170  THR A N     1 
ATOM   4329  C  CA    . THR G 4 170 ? 18.630 61.042  85.346  1.00 27.56  ? 170  THR A CA    1 
ATOM   4330  C  C     . THR G 4 170 ? 19.721 59.990  85.175  1.00 27.38  ? 170  THR A C     1 
ATOM   4331  O  O     . THR G 4 170 ? 20.577 60.131  84.322  1.00 27.58  ? 170  THR A O     1 
ATOM   4332  C  CB    . THR G 4 170 ? 19.340 62.390  85.659  1.00 27.55  ? 170  THR A CB    1 
ATOM   4333  O  OG1   . THR G 4 170 ? 20.561 62.148  86.362  1.00 26.57  ? 170  THR A OG1   1 
ATOM   4334  C  CG2   . THR G 4 170 ? 18.450 63.286  86.488  1.00 27.59  ? 170  THR A CG2   1 
ATOM   4335  N  N     . LEU G 4 171 ? 19.712 58.936  85.968  1.00 26.62  ? 171  LEU A N     1 
ATOM   4336  C  CA    . LEU G 4 171 ? 20.740 57.937  85.807  1.00 25.47  ? 171  LEU A CA    1 
ATOM   4337  C  C     . LEU G 4 171 ? 22.146 58.483  85.884  1.00 27.07  ? 171  LEU A C     1 
ATOM   4338  O  O     . LEU G 4 171 ? 23.060 57.863  85.384  1.00 26.74  ? 171  LEU A O     1 
ATOM   4339  C  CB    . LEU G 4 171 ? 20.568 57.231  84.486  1.00 22.27  ? 171  LEU A CB    1 
ATOM   4340  C  CG    . LEU G 4 171 ? 19.464 56.190  84.464  1.00 21.19  ? 171  LEU A CG    1 
ATOM   4341  C  CD1   . LEU G 4 171 ? 18.089 56.807  84.325  1.00 19.97  ? 171  LEU A CD1   1 
ATOM   4342  C  CD2   . LEU G 4 171 ? 19.745 55.284  83.315  1.00 20.42  ? 171  LEU A CD2   1 
ATOM   4343  N  N     . LEU G 4 172 ? 22.316 59.644  86.508  1.00 30.36  ? 172  LEU A N     1 
ATOM   4344  C  CA    . LEU G 4 172 ? 23.633 60.287  86.676  1.00 32.15  ? 172  LEU A CA    1 
ATOM   4345  C  C     . LEU G 4 172 ? 24.404 59.576  87.774  1.00 33.63  ? 172  LEU A C     1 
ATOM   4346  O  O     . LEU G 4 172 ? 23.779 59.028  88.691  1.00 33.63  ? 172  LEU A O     1 
ATOM   4347  C  CB    . LEU G 4 172 ? 23.454 61.765  87.063  1.00 31.43  ? 172  LEU A CB    1 
ATOM   4348  C  CG    . LEU G 4 172 ? 23.175 62.693  85.885  1.00 31.90  ? 172  LEU A CG    1 
ATOM   4349  C  CD1   . LEU G 4 172 ? 22.866 64.125  86.269  1.00 29.02  ? 172  LEU A CD1   1 
ATOM   4350  C  CD2   . LEU G 4 172 ? 24.420 62.623  85.049  1.00 34.49  ? 172  LEU A CD2   1 
ATOM   4351  N  N     . ARG G 4 173 ? 25.736 59.569  87.676  1.00 34.92  ? 173  ARG A N     1 
ATOM   4352  C  CA    . ARG G 4 173 ? 26.584 58.934  88.689  1.00 37.98  ? 173  ARG A CA    1 
ATOM   4353  C  C     . ARG G 4 173 ? 26.465 59.752  89.960  1.00 37.67  ? 173  ARG A C     1 
ATOM   4354  O  O     . ARG G 4 173 ? 25.991 60.874  89.887  1.00 37.61  ? 173  ARG A O     1 
ATOM   4355  C  CB    . ARG G 4 173 ? 28.022 58.912  88.204  1.00 42.75  ? 173  ARG A CB    1 
ATOM   4356  C  CG    . ARG G 4 173 ? 28.125 58.211  86.884  1.00 52.14  ? 173  ARG A CG    1 
ATOM   4357  C  CD    . ARG G 4 173 ? 29.556 57.866  86.422  1.00 60.22  ? 173  ARG A CD    1 
ATOM   4358  N  NE    . ARG G 4 173 ? 29.486 56.842  85.364  1.00 67.00  ? 173  ARG A NE    1 
ATOM   4359  C  CZ    . ARG G 4 173 ? 28.983 57.027  84.133  1.00 70.28  ? 173  ARG A CZ    1 
ATOM   4360  N  NH1   . ARG G 4 173 ? 28.498 58.210  83.735  1.00 71.02  ? 173  ARG A NH1   1 
ATOM   4361  N  NH2   . ARG G 4 173 ? 28.920 56.000  83.298  1.00 71.10  ? 173  ARG A NH2   1 
ATOM   4362  N  N     . ILE G 4 174 ? 26.852 59.252  91.131  1.00 37.08  ? 174  ILE A N     1 
ATOM   4363  C  CA    . ILE G 4 174 ? 26.673 60.153  92.276  1.00 37.69  ? 174  ILE A CA    1 
ATOM   4364  C  C     . ILE G 4 174 ? 27.650 61.309  92.268  1.00 36.74  ? 174  ILE A C     1 
ATOM   4365  O  O     . ILE G 4 174 ? 27.296 62.414  92.654  1.00 37.72  ? 174  ILE A O     1 
ATOM   4366  C  CB    . ILE G 4 174 ? 26.763 59.480  93.680  1.00 37.30  ? 174  ILE A CB    1 
ATOM   4367  C  CG1   . ILE G 4 174 ? 27.985 58.572  93.764  1.00 38.12  ? 174  ILE A CG1   1 
ATOM   4368  C  CG2   . ILE G 4 174 ? 25.457 58.790  94.007  1.00 37.86  ? 174  ILE A CG2   1 
ATOM   4369  C  CD1   . ILE G 4 174 ? 28.234 58.004  95.158  1.00 34.72  ? 174  ILE A CD1   1 
ATOM   4370  N  N     . ALA G 4 175 ? 28.877 61.063  91.833  1.00 36.63  ? 175  ALA A N     1 
ATOM   4371  C  CA    . ALA G 4 175 ? 29.875 62.120  91.790  1.00 36.04  ? 175  ALA A CA    1 
ATOM   4372  C  C     . ALA G 4 175 ? 29.453 63.259  90.861  1.00 36.06  ? 175  ALA A C     1 
ATOM   4373  O  O     . ALA G 4 175 ? 29.785 64.410  91.117  1.00 35.67  ? 175  ALA A O     1 
ATOM   4374  C  CB    . ALA G 4 175 ? 31.190 61.548  91.347  1.00 36.82  ? 175  ALA A CB    1 
ATOM   4375  N  N     . GLU G 4 176 ? 28.730 62.919  89.791  1.00 35.64  ? 176  GLU A N     1 
ATOM   4376  C  CA    . GLU G 4 176 ? 28.236 63.874  88.815  1.00 35.85  ? 176  GLU A CA    1 
ATOM   4377  C  C     . GLU G 4 176 ? 27.167 64.715  89.440  1.00 35.38  ? 176  GLU A C     1 
ATOM   4378  O  O     . GLU G 4 176 ? 27.054 65.879  89.109  1.00 37.92  ? 176  GLU A O     1 
ATOM   4379  C  CB    . GLU G 4 176 ? 27.615 63.187  87.597  1.00 39.77  ? 176  GLU A CB    1 
ATOM   4380  C  CG    . GLU G 4 176 ? 28.597 62.577  86.568  1.00 49.01  ? 176  GLU A CG    1 
ATOM   4381  C  CD    . GLU G 4 176 ? 27.917 61.719  85.441  1.00 54.64  ? 176  GLU A CD    1 
ATOM   4382  O  OE1   . GLU G 4 176 ? 28.465 61.746  84.304  1.00 56.76  ? 176  GLU A OE1   1 
ATOM   4383  O  OE2   . GLU G 4 176 ? 26.875 61.014  85.678  1.00 55.85  ? 176  GLU A OE2   1 
ATOM   4384  N  N     . ILE G 4 177 ? 26.359 64.148  90.331  1.00 33.87  ? 177  ILE A N     1 
ATOM   4385  C  CA    . ILE G 4 177 ? 25.295 64.943  90.947  1.00 32.36  ? 177  ILE A CA    1 
ATOM   4386  C  C     . ILE G 4 177 ? 25.823 65.970  91.925  1.00 33.47  ? 177  ILE A C     1 
ATOM   4387  O  O     . ILE G 4 177 ? 25.346 67.094  91.951  1.00 34.36  ? 177  ILE A O     1 
ATOM   4388  C  CB    . ILE G 4 177 ? 24.277 64.097  91.708  1.00 30.42  ? 177  ILE A CB    1 
ATOM   4389  C  CG1   . ILE G 4 177 ? 23.625 63.094  90.790  1.00 30.11  ? 177  ILE A CG1   1 
ATOM   4390  C  CG2   . ILE G 4 177 ? 23.170 64.954  92.192  1.00 28.36  ? 177  ILE A CG2   1 
ATOM   4391  C  CD1   . ILE G 4 177 ? 22.562 62.328  91.484  1.00 31.78  ? 177  ILE A CD1   1 
ATOM   4392  N  N     . ALA G 4 178 ? 26.805 65.601  92.732  1.00 32.71  ? 178  ALA A N     1 
ATOM   4393  C  CA    . ALA G 4 178 ? 27.348 66.535  93.703  1.00 33.74  ? 178  ALA A CA    1 
ATOM   4394  C  C     . ALA G 4 178 ? 28.022 67.778  93.105  1.00 35.65  ? 178  ALA A C     1 
ATOM   4395  O  O     . ALA G 4 178 ? 28.627 68.559  93.841  1.00 35.89  ? 178  ALA A O     1 
ATOM   4396  C  CB    . ALA G 4 178 ? 28.303 65.823  94.611  1.00 32.13  ? 178  ALA A CB    1 
ATOM   4397  N  N     . ARG G 4 179 ? 27.915 67.961  91.782  1.00 36.61  ? 179  ARG A N     1 
ATOM   4398  C  CA    . ARG G 4 179 ? 28.493 69.124  91.071  1.00 35.49  ? 179  ARG A CA    1 
ATOM   4399  C  C     . ARG G 4 179 ? 27.430 70.015  90.409  1.00 34.77  ? 179  ARG A C     1 
ATOM   4400  O  O     . ARG G 4 179 ? 27.698 71.154  90.037  1.00 35.09  ? 179  ARG A O     1 
ATOM   4401  C  CB    . ARG G 4 179 ? 29.475 68.670  89.987  1.00 34.58  ? 179  ARG A CB    1 
ATOM   4402  C  CG    . ARG G 4 179 ? 30.709 67.984  90.519  1.00 35.07  ? 179  ARG A CG    1 
ATOM   4403  C  CD    . ARG G 4 179 ? 31.808 67.890  89.462  1.00 33.67  ? 179  ARG A CD    1 
ATOM   4404  N  NE    . ARG G 4 179 ? 31.471 67.017  88.339  1.00 30.86  ? 179  ARG A NE    1 
ATOM   4405  C  CZ    . ARG G 4 179 ? 31.873 65.759  88.231  1.00 29.81  ? 179  ARG A CZ    1 
ATOM   4406  N  NH1   . ARG G 4 179 ? 32.624 65.213  89.175  1.00 29.08  ? 179  ARG A NH1   1 
ATOM   4407  N  NH2   . ARG G 4 179 ? 31.536 65.053  87.168  1.00 29.65  ? 179  ARG A NH2   1 
ATOM   4408  N  N     . ILE G 4 180 ? 26.235 69.482  90.237  1.00 33.49  ? 180  ILE A N     1 
ATOM   4409  C  CA    . ILE G 4 180 ? 25.181 70.244  89.629  1.00 33.32  ? 180  ILE A CA    1 
ATOM   4410  C  C     . ILE G 4 180 ? 25.034 71.483  90.453  1.00 35.53  ? 180  ILE A C     1 
ATOM   4411  O  O     . ILE G 4 180 ? 24.677 71.366  91.607  1.00 37.82  ? 180  ILE A O     1 
ATOM   4412  C  CB    . ILE G 4 180 ? 23.875 69.484  89.711  1.00 31.56  ? 180  ILE A CB    1 
ATOM   4413  C  CG1   . ILE G 4 180 ? 24.008 68.165  88.950  1.00 31.70  ? 180  ILE A CG1   1 
ATOM   4414  C  CG2   . ILE G 4 180 ? 22.742 70.351  89.230  1.00 28.22  ? 180  ILE A CG2   1 
ATOM   4415  C  CD1   . ILE G 4 180 ? 22.985 67.124  89.312  1.00 31.31  ? 180  ILE A CD1   1 
ATOM   4416  N  N     . ARG G 4 181 ? 25.340 72.663  89.913  1.00 38.09  ? 181  ARG A N     1 
ATOM   4417  C  CA    . ARG G 4 181 ? 25.139 73.895  90.696  1.00 39.21  ? 181  ARG A CA    1 
ATOM   4418  C  C     . ARG G 4 181 ? 23.993 74.707  90.084  1.00 40.16  ? 181  ARG A C     1 
ATOM   4419  O  O     . ARG G 4 181 ? 23.823 74.762  88.869  1.00 39.12  ? 181  ARG A O     1 
ATOM   4420  C  CB    . ARG G 4 181 ? 26.435 74.716  90.853  1.00 37.41  ? 181  ARG A CB    1 
ATOM   4421  C  CG    . ARG G 4 181 ? 27.091 75.187  89.608  1.00 37.45  ? 181  ARG A CG    1 
ATOM   4422  C  CD    . ARG G 4 181 ? 28.603 75.044  89.708  1.00 38.03  ? 181  ARG A CD    1 
ATOM   4423  N  NE    . ARG G 4 181 ? 29.199 75.733  90.849  1.00 38.70  ? 181  ARG A NE    1 
ATOM   4424  C  CZ    . ARG G 4 181 ? 30.463 75.566  91.252  1.00 40.20  ? 181  ARG A CZ    1 
ATOM   4425  N  NH1   . ARG G 4 181 ? 31.280 74.736  90.616  1.00 40.17  ? 181  ARG A NH1   1 
ATOM   4426  N  NH2   . ARG G 4 181 ? 30.920 76.219  92.311  1.00 41.47  ? 181  ARG A NH2   1 
ATOM   4427  N  N     . VAL G 4 182 ? 23.181 75.290  90.956  1.00 41.88  ? 182  VAL A N     1 
ATOM   4428  C  CA    . VAL G 4 182 ? 21.997 76.024  90.559  1.00 43.32  ? 182  VAL A CA    1 
ATOM   4429  C  C     . VAL G 4 182 ? 22.006 76.633  89.194  1.00 45.40  ? 182  VAL A C     1 
ATOM   4430  O  O     . VAL G 4 182 ? 21.113 76.376  88.401  1.00 46.02  ? 182  VAL A O     1 
ATOM   4431  C  CB    . VAL G 4 182 ? 21.685 77.128  91.512  1.00 43.12  ? 182  VAL A CB    1 
ATOM   4432  C  CG1   . VAL G 4 182 ? 20.280 77.600  91.262  1.00 43.53  ? 182  VAL A CG1   1 
ATOM   4433  C  CG2   . VAL G 4 182 ? 21.860 76.655  92.925  1.00 43.96  ? 182  VAL A CG2   1 
ATOM   4434  N  N     . LYS G 4 183 ? 23.008 77.461  88.932  1.00 48.15  ? 183  LYS A N     1 
ATOM   4435  C  CA    . LYS G 4 183 ? 23.149 78.156  87.646  1.00 49.98  ? 183  LYS A CA    1 
ATOM   4436  C  C     . LYS G 4 183 ? 22.981 77.199  86.456  1.00 51.51  ? 183  LYS A C     1 
ATOM   4437  O  O     . LYS G 4 183 ? 22.858 77.634  85.305  1.00 51.50  ? 183  LYS A O     1 
ATOM   4438  C  CB    . LYS G 4 183 ? 24.533 78.832  87.568  1.00 49.29  ? 183  LYS A CB    1 
ATOM   4439  C  CG    . LYS G 4 183 ? 25.513 78.133  86.634  1.00 49.39  ? 183  LYS A CG    1 
ATOM   4440  C  CD    . LYS G 4 183 ? 26.811 78.884  86.449  1.00 50.04  ? 183  LYS A CD    1 
ATOM   4441  C  CE    . LYS G 4 183 ? 27.693 78.808  87.672  1.00 50.42  ? 183  LYS A CE    1 
ATOM   4442  N  NZ    . LYS G 4 183 ? 28.962 79.582  87.469  1.00 51.86  ? 183  LYS A NZ    1 
ATOM   4443  N  N     . ASP G 4 184 ? 22.985 75.898  86.761  1.00 53.01  ? 184  ASP A N     1 
ATOM   4444  C  CA    . ASP G 4 184 ? 22.874 74.836  85.769  1.00 54.63  ? 184  ASP A CA    1 
ATOM   4445  C  C     . ASP G 4 184 ? 21.451 74.404  85.481  1.00 55.13  ? 184  ASP A C     1 
ATOM   4446  O  O     . ASP G 4 184 ? 21.177 73.781  84.451  1.00 54.31  ? 184  ASP A O     1 
ATOM   4447  C  CB    . ASP G 4 184 ? 23.705 73.651  86.224  1.00 55.07  ? 184  ASP A CB    1 
ATOM   4448  C  CG    . ASP G 4 184 ? 25.190 73.881  86.019  1.00 57.31  ? 184  ASP A CG    1 
ATOM   4449  O  OD1   . ASP G 4 184 ? 26.009 73.221  86.714  1.00 58.40  ? 184  ASP A OD1   1 
ATOM   4450  O  OD2   . ASP G 4 184 ? 25.537 74.719  85.145  1.00 58.57  ? 184  ASP A OD2   1 
ATOM   4451  N  N     . ILE G 4 185 ? 20.548 74.748  86.392  1.00 55.48  ? 185  ILE A N     1 
ATOM   4452  C  CA    . ILE G 4 185 ? 19.146 74.420  86.234  1.00 56.03  ? 185  ILE A CA    1 
ATOM   4453  C  C     . ILE G 4 185 ? 18.445 75.517  85.426  1.00 58.10  ? 185  ILE A C     1 
ATOM   4454  O  O     . ILE G 4 185 ? 18.470 76.679  85.812  1.00 59.29  ? 185  ILE A O     1 
ATOM   4455  C  CB    . ILE G 4 185 ? 18.467 74.294  87.596  1.00 54.22  ? 185  ILE A CB    1 
ATOM   4456  C  CG1   . ILE G 4 185 ? 19.186 73.260  88.440  1.00 52.59  ? 185  ILE A CG1   1 
ATOM   4457  C  CG2   . ILE G 4 185 ? 17.041 73.867  87.424  1.00 54.05  ? 185  ILE A CG2   1 
ATOM   4458  C  CD1   . ILE G 4 185 ? 18.462 72.958  89.700  1.00 52.23  ? 185  ILE A CD1   1 
ATOM   4459  N  N     . SER G 4 186 ? 17.849 75.144  84.295  1.00 61.11  ? 186  SER A N     1 
ATOM   4460  C  CA    . SER G 4 186 ? 17.112 76.070  83.435  1.00 63.52  ? 186  SER A CA    1 
ATOM   4461  C  C     . SER G 4 186 ? 15.704 75.509  83.292  1.00 66.16  ? 186  SER A C     1 
ATOM   4462  O  O     . SER G 4 186 ? 15.413 74.461  83.847  1.00 66.91  ? 186  SER A O     1 
ATOM   4463  C  CB    . SER G 4 186 ? 17.783 76.190  82.064  1.00 63.13  ? 186  SER A CB    1 
ATOM   4464  O  OG    . SER G 4 186 ? 18.033 74.929  81.471  1.00 61.37  ? 186  SER A OG    1 
ATOM   4465  N  N     . ARG G 4 187 ? 14.821 76.177  82.563  1.00 70.01  ? 187  ARG A N     1 
ATOM   4466  C  CA    . ARG G 4 187 ? 13.470 75.642  82.442  1.00 74.03  ? 187  ARG A CA    1 
ATOM   4467  C  C     . ARG G 4 187 ? 13.011 75.345  81.015  1.00 76.22  ? 187  ARG A C     1 
ATOM   4468  O  O     . ARG G 4 187 ? 13.533 75.889  80.040  1.00 76.46  ? 187  ARG A O     1 
ATOM   4469  C  CB    . ARG G 4 187 ? 12.481 76.577  83.121  1.00 75.39  ? 187  ARG A CB    1 
ATOM   4470  C  CG    . ARG G 4 187 ? 12.995 77.142  84.445  1.00 79.27  ? 187  ARG A CG    1 
ATOM   4471  C  CD    . ARG G 4 187 ? 13.302 76.067  85.486  1.00 80.95  ? 187  ARG A CD    1 
ATOM   4472  N  NE    . ARG G 4 187 ? 12.388 76.124  86.626  1.00 83.40  ? 187  ARG A NE    1 
ATOM   4473  C  CZ    . ARG G 4 187 ? 11.068 75.972  86.529  1.00 84.85  ? 187  ARG A CZ    1 
ATOM   4474  N  NH1   . ARG G 4 187 ? 10.508 75.753  85.341  1.00 84.99  ? 187  ARG A NH1   1 
ATOM   4475  N  NH2   . ARG G 4 187 ? 10.304 76.036  87.618  1.00 85.67  ? 187  ARG A NH2   1 
ATOM   4476  N  N     . THR G 4 188 ? 12.030 74.458  80.913  1.00 78.48  ? 188  THR A N     1 
ATOM   4477  C  CA    . THR G 4 188 ? 11.476 74.040  79.638  1.00 80.38  ? 188  THR A CA    1 
ATOM   4478  C  C     . THR G 4 188 ? 10.116 74.686  79.511  1.00 81.71  ? 188  THR A C     1 
ATOM   4479  O  O     . THR G 4 188 ? 9.480  74.993  80.523  1.00 81.58  ? 188  THR A O     1 
ATOM   4480  C  CB    . THR G 4 188 ? 11.345 72.486  79.586  1.00 81.05  ? 188  THR A CB    1 
ATOM   4481  O  OG1   . THR G 4 188 ? 12.637 71.912  79.356  1.00 81.03  ? 188  THR A OG1   1 
ATOM   4482  C  CG2   . THR G 4 188 ? 10.394 72.029  78.485  1.00 81.55  ? 188  THR A CG2   1 
ATOM   4483  N  N     . ASP G 4 189 ? 9.689  74.910  78.266  1.00 83.57  ? 189  ASP A N     1 
ATOM   4484  C  CA    . ASP G 4 189 ? 8.387  75.515  77.980  1.00 84.77  ? 189  ASP A CA    1 
ATOM   4485  C  C     . ASP G 4 189 ? 7.256  74.692  78.612  1.00 84.01  ? 189  ASP A C     1 
ATOM   4486  O  O     . ASP G 4 189 ? 6.173  75.216  78.891  1.00 83.91  ? 189  ASP A O     1 
ATOM   4487  C  CB    . ASP G 4 189 ? 8.167  75.634  76.459  1.00 86.93  ? 189  ASP A CB    1 
ATOM   4488  C  CG    . ASP G 4 189 ? 8.798  76.905  75.858  1.00 89.35  ? 189  ASP A CG    1 
ATOM   4489  O  OD1   . ASP G 4 189 ? 8.644  77.133  74.629  1.00 90.02  ? 189  ASP A OD1   1 
ATOM   4490  O  OD2   . ASP G 4 189 ? 9.442  77.679  76.607  1.00 90.29  ? 189  ASP A OD2   1 
ATOM   4491  N  N     . GLY G 4 190 ? 7.527  73.406  78.850  1.00 82.73  ? 190  GLY A N     1 
ATOM   4492  C  CA    . GLY G 4 190 ? 6.543  72.518  79.455  1.00 80.13  ? 190  GLY A CA    1 
ATOM   4493  C  C     . GLY G 4 190 ? 6.442  72.660  80.965  1.00 77.77  ? 190  GLY A C     1 
ATOM   4494  O  O     . GLY G 4 190 ? 5.526  72.109  81.589  1.00 78.23  ? 190  GLY A O     1 
ATOM   4495  N  N     . GLY G 4 191 ? 7.396  73.389  81.547  1.00 75.19  ? 191  GLY A N     1 
ATOM   4496  C  CA    . GLY G 4 191 ? 7.402  73.624  82.981  1.00 71.21  ? 191  GLY A CA    1 
ATOM   4497  C  C     . GLY G 4 191 ? 8.157  72.597  83.792  1.00 67.37  ? 191  GLY A C     1 
ATOM   4498  O  O     . GLY G 4 191 ? 7.888  72.434  84.983  1.00 66.81  ? 191  GLY A O     1 
ATOM   4499  N  N     . ARG G 4 192 ? 9.102  71.917  83.149  1.00 63.55  ? 192  ARG A N     1 
ATOM   4500  C  CA    . ARG G 4 192 ? 9.899  70.882  83.803  1.00 59.80  ? 192  ARG A CA    1 
ATOM   4501  C  C     . ARG G 4 192 ? 11.383 71.222  83.748  1.00 57.80  ? 192  ARG A C     1 
ATOM   4502  O  O     . ARG G 4 192 ? 11.926 71.444  82.686  1.00 57.67  ? 192  ARG A O     1 
ATOM   4503  C  CB    . ARG G 4 192 ? 9.645  69.532  83.125  1.00 57.70  ? 192  ARG A CB    1 
ATOM   4504  C  CG    . ARG G 4 192 ? 10.112 69.483  81.697  1.00 55.37  ? 192  ARG A CG    1 
ATOM   4505  C  CD    . ARG G 4 192 ? 9.535  68.298  80.972  1.00 53.69  ? 192  ARG A CD    1 
ATOM   4506  N  NE    . ARG G 4 192 ? 8.086  68.239  81.112  1.00 52.83  ? 192  ARG A NE    1 
ATOM   4507  C  CZ    . ARG G 4 192 ? 7.302  67.519  80.323  1.00 52.28  ? 192  ARG A CZ    1 
ATOM   4508  N  NH1   . ARG G 4 192 ? 7.844  66.820  79.359  1.00 52.56  ? 192  ARG A NH1   1 
ATOM   4509  N  NH2   . ARG G 4 192 ? 5.988  67.488  80.493  1.00 53.58  ? 192  ARG A NH2   1 
ATOM   4510  N  N     . MET G 4 193 ? 12.045 71.249  84.892  1.00 56.12  ? 193  MET A N     1 
ATOM   4511  C  CA    . MET G 4 193 ? 13.451 71.593  84.919  1.00 54.73  ? 193  MET A CA    1 
ATOM   4512  C  C     . MET G 4 193 ? 14.295 70.894  83.894  1.00 53.82  ? 193  MET A C     1 
ATOM   4513  O  O     . MET G 4 193 ? 13.906 69.886  83.337  1.00 54.54  ? 193  MET A O     1 
ATOM   4514  C  CB    . MET G 4 193 ? 14.031 71.322  86.288  1.00 54.82  ? 193  MET A CB    1 
ATOM   4515  C  CG    . MET G 4 193 ? 13.617 72.333  87.294  1.00 56.68  ? 193  MET A CG    1 
ATOM   4516  S  SD    . MET G 4 193 ? 14.616 72.174  88.734  1.00 59.58  ? 193  MET A SD    1 
ATOM   4517  C  CE    . MET G 4 193 ? 13.403 71.627  89.897  1.00 60.16  ? 193  MET A CE    1 
ATOM   4518  N  N     . LEU G 4 194 ? 15.478 71.434  83.665  1.00 52.98  ? 194  LEU A N     1 
ATOM   4519  C  CA    . LEU G 4 194 ? 16.391 70.859  82.711  1.00 52.59  ? 194  LEU A CA    1 
ATOM   4520  C  C     . LEU G 4 194 ? 17.796 71.179  83.230  1.00 52.88  ? 194  LEU A C     1 
ATOM   4521  O  O     . LEU G 4 194 ? 18.165 72.324  83.360  1.00 52.99  ? 194  LEU A O     1 
ATOM   4522  C  CB    . LEU G 4 194 ? 16.101 71.471  81.350  1.00 53.09  ? 194  LEU A CB    1 
ATOM   4523  C  CG    . LEU G 4 194 ? 16.650 70.759  80.121  1.00 54.78  ? 194  LEU A CG    1 
ATOM   4524  C  CD1   . LEU G 4 194 ? 15.827 71.126  78.897  1.00 54.45  ? 194  LEU A CD1   1 
ATOM   4525  C  CD2   . LEU G 4 194 ? 18.121 71.128  79.940  1.00 55.99  ? 194  LEU A CD2   1 
ATOM   4526  N  N     . ILE G 4 195 ? 18.563 70.146  83.545  1.00 53.82  ? 195  ILE A N     1 
ATOM   4527  C  CA    . ILE G 4 195 ? 19.902 70.277  84.111  1.00 55.21  ? 195  ILE A CA    1 
ATOM   4528  C  C     . ILE G 4 195 ? 21.023 70.179  83.076  1.00 59.59  ? 195  ILE A C     1 
ATOM   4529  O  O     . ILE G 4 195 ? 21.264 69.104  82.567  1.00 59.75  ? 195  ILE A O     1 
ATOM   4530  C  CB    . ILE G 4 195 ? 20.122 69.153  85.168  1.00 51.23  ? 195  ILE A CB    1 
ATOM   4531  C  CG1   . ILE G 4 195 ? 19.120 69.290  86.300  1.00 47.65  ? 195  ILE A CG1   1 
ATOM   4532  C  CG2   . ILE G 4 195 ? 21.517 69.187  85.720  1.00 49.47  ? 195  ILE A CG2   1 
ATOM   4533  C  CD1   . ILE G 4 195 ? 19.061 68.072  87.162  1.00 46.74  ? 195  ILE A CD1   1 
ATOM   4534  N  N     . HIS G 4 196 ? 21.706 71.278  82.756  1.00 65.00  ? 196  HIS A N     1 
ATOM   4535  C  CA    . HIS G 4 196 ? 22.818 71.194  81.800  1.00 71.77  ? 196  HIS A CA    1 
ATOM   4536  C  C     . HIS G 4 196 ? 23.897 70.558  82.620  1.00 73.15  ? 196  HIS A C     1 
ATOM   4537  O  O     . HIS G 4 196 ? 23.969 70.811  83.811  1.00 73.55  ? 196  HIS A O     1 
ATOM   4538  C  CB    . HIS G 4 196 ? 23.303 72.573  81.311  1.00 77.14  ? 196  HIS A CB    1 
ATOM   4539  C  CG    . HIS G 4 196 ? 22.337 73.272  80.390  1.00 83.92  ? 196  HIS A CG    1 
ATOM   4540  N  ND1   . HIS G 4 196 ? 21.192 73.907  80.841  1.00 86.05  ? 196  HIS A ND1   1 
ATOM   4541  C  CD2   . HIS G 4 196 ? 22.328 73.403  79.038  1.00 85.61  ? 196  HIS A CD2   1 
ATOM   4542  C  CE1   . HIS G 4 196 ? 20.523 74.396  79.808  1.00 86.90  ? 196  HIS A CE1   1 
ATOM   4543  N  NE2   . HIS G 4 196 ? 21.190 74.104  78.702  1.00 86.85  ? 196  HIS A NE2   1 
ATOM   4544  N  N     . ILE G 4 197 ? 24.739 69.732  82.013  1.00 75.74  ? 197  ILE A N     1 
ATOM   4545  C  CA    . ILE G 4 197 ? 25.775 69.083  82.797  1.00 77.68  ? 197  ILE A CA    1 
ATOM   4546  C  C     . ILE G 4 197 ? 27.200 69.329  82.349  1.00 79.68  ? 197  ILE A C     1 
ATOM   4547  O  O     . ILE G 4 197 ? 27.846 68.435  81.839  1.00 79.47  ? 197  ILE A O     1 
ATOM   4548  C  CB    . ILE G 4 197 ? 25.537 67.564  82.876  1.00 77.20  ? 197  ILE A CB    1 
ATOM   4549  C  CG1   . ILE G 4 197 ? 25.646 66.924  81.502  1.00 77.51  ? 197  ILE A CG1   1 
ATOM   4550  C  CG2   . ILE G 4 197 ? 24.146 67.288  83.413  1.00 77.48  ? 197  ILE A CG2   1 
ATOM   4551  C  CD1   . ILE G 4 197 ? 25.565 65.407  81.561  1.00 78.08  ? 197  ILE A CD1   1 
ATOM   4552  N  N     . GLY G 4 198 ? 27.692 70.544  82.556  1.00 82.61  ? 198  GLY A N     1 
ATOM   4553  C  CA    . GLY G 4 198 ? 29.055 70.856  82.175  1.00 86.38  ? 198  GLY A CA    1 
ATOM   4554  C  C     . GLY G 4 198 ? 30.021 70.037  83.001  1.00 89.69  ? 198  GLY A C     1 
ATOM   4555  O  O     . GLY G 4 198 ? 29.608 69.327  83.903  1.00 89.60  ? 198  GLY A O     1 
ATOM   4556  N  N     . ARG G 4 199 ? 31.309 70.129  82.701  1.00 94.38  ? 199  ARG A N     1 
ATOM   4557  C  CA    . ARG G 4 199 ? 32.320 69.368  83.436  1.00 99.82  ? 199  ARG A CA    1 
ATOM   4558  C  C     . ARG G 4 199 ? 32.123 67.851  83.346  1.00 101.49 ? 199  ARG A C     1 
ATOM   4559  O  O     . ARG G 4 199 ? 32.416 67.128  84.287  1.00 100.98 ? 199  ARG A O     1 
ATOM   4560  C  CB    . ARG G 4 199 ? 32.354 69.812  84.912  1.00 102.57 ? 199  ARG A CB    1 
ATOM   4561  C  CG    . ARG G 4 199 ? 33.592 70.653  85.297  1.00 105.95 ? 199  ARG A CG    1 
ATOM   4562  C  CD    . ARG G 4 199 ? 33.577 71.132  86.757  1.00 108.29 ? 199  ARG A CD    1 
ATOM   4563  N  NE    . ARG G 4 199 ? 32.589 72.189  86.990  1.00 110.84 ? 199  ARG A NE    1 
ATOM   4564  C  CZ    . ARG G 4 199 ? 32.488 72.903  88.112  1.00 111.85 ? 199  ARG A CZ    1 
ATOM   4565  N  NH1   . ARG G 4 199 ? 33.316 72.688  89.129  1.00 112.74 ? 199  ARG A NH1   1 
ATOM   4566  N  NH2   . ARG G 4 199 ? 31.556 73.840  88.215  1.00 111.76 ? 199  ARG A NH2   1 
ATOM   4567  N  N     . THR G 4 200 ? 31.650 67.388  82.192  1.00 104.75 ? 200  THR A N     1 
ATOM   4568  C  CA    . THR G 4 200 ? 31.400 65.972  81.929  1.00 108.45 ? 200  THR A CA    1 
ATOM   4569  C  C     . THR G 4 200 ? 32.549 65.050  82.285  1.00 111.28 ? 200  THR A C     1 
ATOM   4570  O  O     . THR G 4 200 ? 33.530 65.469  82.907  1.00 112.17 ? 200  THR A O     1 
ATOM   4571  C  CB    . THR G 4 200 ? 31.078 65.717  80.457  1.00 108.13 ? 200  THR A CB    1 
ATOM   4572  O  OG1   . THR G 4 200 ? 32.095 66.298  79.633  1.00 107.45 ? 200  THR A OG1   1 
ATOM   4573  C  CG2   . THR G 4 200 ? 29.744 66.303  80.105  1.00 109.30 ? 200  THR A CG2   1 
ATOM   4574  N  N     . LYS G 4 201 ? 32.437 63.793  81.856  1.00 113.73 ? 201  LYS A N     1 
ATOM   4575  C  CA    . LYS G 4 201 ? 33.453 62.806  82.172  1.00 116.09 ? 201  LYS A CA    1 
ATOM   4576  C  C     . LYS G 4 201 ? 34.356 62.386  81.044  1.00 117.27 ? 201  LYS A C     1 
ATOM   4577  O  O     . LYS G 4 201 ? 35.345 61.705  81.276  1.00 117.46 ? 201  LYS A O     1 
ATOM   4578  C  CB    . LYS G 4 201 ? 32.806 61.557  82.760  1.00 117.54 ? 201  LYS A CB    1 
ATOM   4579  C  CG    . LYS G 4 201 ? 32.494 60.457  81.763  1.00 118.41 ? 201  LYS A CG    1 
ATOM   4580  C  CD    . LYS G 4 201 ? 32.191 59.153  82.507  1.00 119.04 ? 201  LYS A CD    1 
ATOM   4581  C  CE    . LYS G 4 201 ? 33.384 58.702  83.355  1.00 119.09 ? 201  LYS A CE    1 
ATOM   4582  N  NZ    . LYS G 4 201 ? 33.040 57.609  84.304  1.00 118.27 ? 201  LYS A NZ    1 
ATOM   4583  N  N     . THR G 4 202 ? 34.032 62.778  79.823  1.00 118.98 ? 202  THR A N     1 
ATOM   4584  C  CA    . THR G 4 202 ? 34.863 62.384  78.697  1.00 120.69 ? 202  THR A CA    1 
ATOM   4585  C  C     . THR G 4 202 ? 34.876 63.410  77.567  1.00 120.57 ? 202  THR A C     1 
ATOM   4586  O  O     . THR G 4 202 ? 33.914 64.150  77.382  1.00 121.16 ? 202  THR A O     1 
ATOM   4587  C  CB    . THR G 4 202 ? 34.391 61.045  78.154  1.00 121.49 ? 202  THR A CB    1 
ATOM   4588  O  OG1   . THR G 4 202 ? 34.079 60.182  79.252  1.00 122.57 ? 202  THR A OG1   1 
ATOM   4589  C  CG2   . THR G 4 202 ? 35.477 60.405  77.312  1.00 122.85 ? 202  THR A CG2   1 
ATOM   4590  N  N     . LEU G 4 203 ? 35.968 63.456  76.810  1.00 120.32 ? 203  LEU A N     1 
ATOM   4591  C  CA    . LEU G 4 203 ? 36.065 64.412  75.721  1.00 119.49 ? 203  LEU A CA    1 
ATOM   4592  C  C     . LEU G 4 203 ? 34.803 64.311  74.887  1.00 118.65 ? 203  LEU A C     1 
ATOM   4593  O  O     . LEU G 4 203 ? 34.265 65.314  74.440  1.00 118.99 ? 203  LEU A O     1 
ATOM   4594  C  CB    . LEU G 4 203 ? 37.283 64.124  74.853  1.00 120.31 ? 203  LEU A CB    1 
ATOM   4595  C  CG    . LEU G 4 203 ? 37.991 65.364  74.314  1.00 120.19 ? 203  LEU A CG    1 
ATOM   4596  C  CD1   . LEU G 4 203 ? 39.006 64.946  73.286  1.00 121.51 ? 203  LEU A CD1   1 
ATOM   4597  C  CD2   . LEU G 4 203 ? 36.998 66.307  73.699  1.00 120.92 ? 203  LEU A CD2   1 
ATOM   4598  N  N     . VAL G 4 204 ? 34.326 63.089  74.698  1.00 117.22 ? 204  VAL A N     1 
ATOM   4599  C  CA    . VAL G 4 204 ? 33.116 62.847  73.929  1.00 116.09 ? 204  VAL A CA    1 
ATOM   4600  C  C     . VAL G 4 204 ? 32.047 62.288  74.871  1.00 114.27 ? 204  VAL A C     1 
ATOM   4601  O  O     . VAL G 4 204 ? 31.910 61.080  75.032  1.00 114.31 ? 204  VAL A O     1 
ATOM   4602  C  CB    . VAL G 4 204 ? 33.418 61.873  72.759  1.00 116.73 ? 204  VAL A CB    1 
ATOM   4603  C  CG1   . VAL G 4 204 ? 34.338 60.773  73.228  1.00 118.34 ? 204  VAL A CG1   1 
ATOM   4604  C  CG2   . VAL G 4 204 ? 32.140 61.294  72.202  1.00 117.13 ? 204  VAL A CG2   1 
ATOM   4605  N  N     . SER G 4 205 ? 31.296 63.186  75.501  1.00 111.95 ? 205  SER A N     1 
ATOM   4606  C  CA    . SER G 4 205 ? 30.261 62.797  76.455  1.00 109.40 ? 205  SER A CA    1 
ATOM   4607  C  C     . SER G 4 205 ? 29.194 61.933  75.853  1.00 106.53 ? 205  SER A C     1 
ATOM   4608  O  O     . SER G 4 205 ? 28.170 62.427  75.412  1.00 107.02 ? 205  SER A O     1 
ATOM   4609  C  CB    . SER G 4 205 ? 29.602 64.026  77.067  1.00 110.40 ? 205  SER A CB    1 
ATOM   4610  O  OG    . SER G 4 205 ? 30.510 64.719  77.896  1.00 111.74 ? 205  SER A OG    1 
ATOM   4611  N  N     . THR G 4 206 ? 29.421 60.632  75.870  1.00 102.66 ? 206  THR A N     1 
ATOM   4612  C  CA    . THR G 4 206 ? 28.480 59.685  75.300  1.00 98.33  ? 206  THR A CA    1 
ATOM   4613  C  C     . THR G 4 206 ? 27.074 59.695  75.884  1.00 94.69  ? 206  THR A C     1 
ATOM   4614  O  O     . THR G 4 206 ? 26.178 59.076  75.328  1.00 93.62  ? 206  THR A O     1 
ATOM   4615  C  CB    . THR G 4 206 ? 29.046 58.254  75.389  1.00 99.22  ? 206  THR A CB    1 
ATOM   4616  O  OG1   . THR G 4 206 ? 28.014 57.314  75.098  1.00 98.99  ? 206  THR A OG1   1 
ATOM   4617  C  CG2   . THR G 4 206 ? 29.605 57.979  76.776  1.00 101.03 ? 206  THR A CG2   1 
ATOM   4618  N  N     . ALA G 4 207 ? 26.867 60.419  76.978  1.00 91.66  ? 207  ALA A N     1 
ATOM   4619  C  CA    . ALA G 4 207 ? 25.559 60.445  77.638  1.00 88.03  ? 207  ALA A CA    1 
ATOM   4620  C  C     . ALA G 4 207 ? 24.682 61.656  77.380  1.00 85.21  ? 207  ALA A C     1 
ATOM   4621  O  O     . ALA G 4 207 ? 23.469 61.597  77.558  1.00 84.85  ? 207  ALA A O     1 
ATOM   4622  C  CB    . ALA G 4 207 ? 25.747 60.282  79.129  1.00 88.17  ? 207  ALA A CB    1 
ATOM   4623  N  N     . GLY G 4 208 ? 25.298 62.759  76.986  1.00 82.25  ? 208  GLY A N     1 
ATOM   4624  C  CA    . GLY G 4 208 ? 24.535 63.963  76.733  1.00 78.12  ? 208  GLY A CA    1 
ATOM   4625  C  C     . GLY G 4 208 ? 25.189 65.243  77.225  1.00 74.82  ? 208  GLY A C     1 
ATOM   4626  O  O     . GLY G 4 208 ? 26.365 65.279  77.570  1.00 73.97  ? 208  GLY A O     1 
ATOM   4627  N  N     . VAL G 4 209 ? 24.400 66.304  77.264  1.00 71.64  ? 209  VAL A N     1 
ATOM   4628  C  CA    . VAL G 4 209 ? 24.870 67.601  77.688  1.00 68.01  ? 209  VAL A CA    1 
ATOM   4629  C  C     . VAL G 4 209 ? 23.780 68.213  78.551  1.00 65.46  ? 209  VAL A C     1 
ATOM   4630  O  O     . VAL G 4 209 ? 23.851 69.377  78.923  1.00 65.31  ? 209  VAL A O     1 
ATOM   4631  C  CB    . VAL G 4 209 ? 25.102 68.477  76.450  1.00 68.75  ? 209  VAL A CB    1 
ATOM   4632  C  CG1   . VAL G 4 209 ? 25.835 69.776  76.811  1.00 70.36  ? 209  VAL A CG1   1 
ATOM   4633  C  CG2   . VAL G 4 209 ? 25.868 67.688  75.432  1.00 68.30  ? 209  VAL A CG2   1 
ATOM   4634  N  N     . GLU G 4 210 ? 22.764 67.422  78.862  1.00 62.20  ? 210  GLU A N     1 
ATOM   4635  C  CA    . GLU G 4 210 ? 21.657 67.909  79.658  1.00 60.39  ? 210  GLU A CA    1 
ATOM   4636  C  C     . GLU G 4 210 ? 20.698 66.781  79.937  1.00 57.18  ? 210  GLU A C     1 
ATOM   4637  O  O     . GLU G 4 210 ? 20.541 65.907  79.112  1.00 57.39  ? 210  GLU A O     1 
ATOM   4638  C  CB    . GLU G 4 210 ? 20.925 68.999  78.905  1.00 62.95  ? 210  GLU A CB    1 
ATOM   4639  C  CG    . GLU G 4 210 ? 20.041 68.476  77.820  1.00 68.55  ? 210  GLU A CG    1 
ATOM   4640  C  CD    . GLU G 4 210 ? 19.817 69.502  76.726  1.00 73.37  ? 210  GLU A CD    1 
ATOM   4641  O  OE1   . GLU G 4 210 ? 19.536 70.677  77.075  1.00 75.46  ? 210  GLU A OE1   1 
ATOM   4642  O  OE2   . GLU G 4 210 ? 19.921 69.136  75.522  1.00 75.39  ? 210  GLU A OE2   1 
ATOM   4643  N  N     . LYS G 4 211 ? 20.057 66.808  81.101  1.00 53.57  ? 211  LYS A N     1 
ATOM   4644  C  CA    . LYS G 4 211 ? 19.118 65.774  81.502  1.00 49.27  ? 211  LYS A CA    1 
ATOM   4645  C  C     . LYS G 4 211 ? 17.891 66.523  81.917  1.00 47.49  ? 211  LYS A C     1 
ATOM   4646  O  O     . LYS G 4 211 ? 18.012 67.504  82.617  1.00 46.74  ? 211  LYS A O     1 
ATOM   4647  C  CB    . LYS G 4 211 ? 19.642 65.010  82.717  1.00 48.89  ? 211  LYS A CB    1 
ATOM   4648  C  CG    . LYS G 4 211 ? 21.012 64.343  82.551  1.00 49.37  ? 211  LYS A CG    1 
ATOM   4649  C  CD    . LYS G 4 211 ? 20.904 62.867  82.183  1.00 49.79  ? 211  LYS A CD    1 
ATOM   4650  C  CE    . LYS G 4 211 ? 22.277 62.178  82.120  1.00 50.46  ? 211  LYS A CE    1 
ATOM   4651  N  NZ    . LYS G 4 211 ? 22.196 60.696  81.805  1.00 51.04  ? 211  LYS A NZ    1 
ATOM   4652  N  N     . ALA G 4 212 ? 16.718 66.069  81.489  1.00 46.13  ? 212  ALA A N     1 
ATOM   4653  C  CA    . ALA G 4 212 ? 15.458 66.725  81.852  1.00 45.18  ? 212  ALA A CA    1 
ATOM   4654  C  C     . ALA G 4 212 ? 14.740 65.982  82.967  1.00 44.26  ? 212  ALA A C     1 
ATOM   4655  O  O     . ALA G 4 212 ? 14.554 64.763  82.888  1.00 44.29  ? 212  ALA A O     1 
ATOM   4656  C  CB    . ALA G 4 212 ? 14.550 66.796  80.658  1.00 44.34  ? 212  ALA A CB    1 
ATOM   4657  N  N     . LEU G 4 213 ? 14.331 66.702  84.004  1.00 42.12  ? 213  LEU A N     1 
ATOM   4658  C  CA    . LEU G 4 213 ? 13.630 66.055  85.087  1.00 41.35  ? 213  LEU A CA    1 
ATOM   4659  C  C     . LEU G 4 213 ? 12.156 66.013  84.767  1.00 41.90  ? 213  LEU A C     1 
ATOM   4660  O  O     . LEU G 4 213 ? 11.640 66.957  84.208  1.00 43.53  ? 213  LEU A O     1 
ATOM   4661  C  CB    . LEU G 4 213 ? 13.806 66.826  86.372  1.00 40.64  ? 213  LEU A CB    1 
ATOM   4662  C  CG    . LEU G 4 213 ? 15.202 67.215  86.812  1.00 41.16  ? 213  LEU A CG    1 
ATOM   4663  C  CD1   . LEU G 4 213 ? 15.160 67.445  88.320  1.00 42.37  ? 213  LEU A CD1   1 
ATOM   4664  C  CD2   . LEU G 4 213 ? 16.192 66.141  86.475  1.00 41.42  ? 213  LEU A CD2   1 
ATOM   4665  N  N     . SER G 4 214 ? 11.481 64.926  85.128  1.00 42.08  ? 214  SER A N     1 
ATOM   4666  C  CA    . SER G 4 214 ? 10.051 64.769  84.907  1.00 41.12  ? 214  SER A CA    1 
ATOM   4667  C  C     . SER G 4 214 ? 9.314  65.916  85.544  1.00 41.32  ? 214  SER A C     1 
ATOM   4668  O  O     . SER G 4 214 ? 9.892  66.703  86.268  1.00 40.52  ? 214  SER A O     1 
ATOM   4669  C  CB    . SER G 4 214 ? 9.566  63.508  85.582  1.00 42.49  ? 214  SER A CB    1 
ATOM   4670  O  OG    . SER G 4 214 ? 8.559  63.820  86.544  1.00 44.18  ? 214  SER A OG    1 
ATOM   4671  N  N     . LEU G 4 215 ? 8.019  66.001  85.305  1.00 43.41  ? 215  LEU A N     1 
ATOM   4672  C  CA    . LEU G 4 215 ? 7.248  67.071  85.926  1.00 45.45  ? 215  LEU A CA    1 
ATOM   4673  C  C     . LEU G 4 215 ? 7.223  66.922  87.435  1.00 45.92  ? 215  LEU A C     1 
ATOM   4674  O  O     . LEU G 4 215 ? 7.447  67.899  88.159  1.00 45.97  ? 215  LEU A O     1 
ATOM   4675  C  CB    . LEU G 4 215 ? 5.794  67.087  85.447  1.00 46.05  ? 215  LEU A CB    1 
ATOM   4676  C  CG    . LEU G 4 215 ? 5.488  67.449  84.004  1.00 46.66  ? 215  LEU A CG    1 
ATOM   4677  C  CD1   . LEU G 4 215 ? 4.012  67.823  83.916  1.00 46.51  ? 215  LEU A CD1   1 
ATOM   4678  C  CD2   . LEU G 4 215 ? 6.394  68.600  83.549  1.00 46.62  ? 215  LEU A CD2   1 
ATOM   4679  N  N     . GLY G 4 216 ? 6.924  65.702  87.892  1.00 45.04  ? 216  GLY A N     1 
ATOM   4680  C  CA    . GLY G 4 216 ? 6.839  65.429  89.316  1.00 44.98  ? 216  GLY A CA    1 
ATOM   4681  C  C     . GLY G 4 216 ? 8.141  65.494  90.097  1.00 44.82  ? 216  GLY A C     1 
ATOM   4682  O  O     . GLY G 4 216 ? 8.178  65.963  91.236  1.00 44.49  ? 216  GLY A O     1 
ATOM   4683  N  N     . VAL G 4 217 ? 9.214  65.011  89.484  1.00 44.51  ? 217  VAL A N     1 
ATOM   4684  C  CA    . VAL G 4 217 ? 10.516 65.009  90.113  1.00 43.33  ? 217  VAL A CA    1 
ATOM   4685  C  C     . VAL G 4 217 ? 10.950 66.445  90.243  1.00 43.12  ? 217  VAL A C     1 
ATOM   4686  O  O     . VAL G 4 217 ? 11.865 66.745  90.987  1.00 43.87  ? 217  VAL A O     1 
ATOM   4687  C  CB    . VAL G 4 217 ? 11.539 64.274  89.253  1.00 42.05  ? 217  VAL A CB    1 
ATOM   4688  C  CG1   . VAL G 4 217 ? 12.820 64.104  90.021  1.00 41.34  ? 217  VAL A CG1   1 
ATOM   4689  C  CG2   . VAL G 4 217 ? 10.982 62.935  88.811  1.00 41.74  ? 217  VAL A CG2   1 
ATOM   4690  N  N     . THR G 4 218 ? 10.296 67.333  89.496  1.00 43.93  ? 218  THR A N     1 
ATOM   4691  C  CA    . THR G 4 218 ? 10.615 68.765  89.525  1.00 43.01  ? 218  THR A CA    1 
ATOM   4692  C  C     . THR G 4 218 ? 9.992  69.365  90.765  1.00 43.16  ? 218  THR A C     1 
ATOM   4693  O  O     . THR G 4 218 ? 10.654 70.061  91.528  1.00 43.34  ? 218  THR A O     1 
ATOM   4694  C  CB    . THR G 4 218 ? 10.073 69.503  88.288  1.00 41.25  ? 218  THR A CB    1 
ATOM   4695  O  OG1   . THR G 4 218 ? 10.798 69.100  87.126  1.00 40.83  ? 218  THR A OG1   1 
ATOM   4696  C  CG2   . THR G 4 218 ? 10.261 70.963  88.444  1.00 41.26  ? 218  THR A CG2   1 
ATOM   4697  N  N     . LYS G 4 219 ? 8.715  69.075  90.971  1.00 44.16  ? 219  LYS A N     1 
ATOM   4698  C  CA    . LYS G 4 219 ? 8.017  69.571  92.138  1.00 45.36  ? 219  LYS A CA    1 
ATOM   4699  C  C     . LYS G 4 219 ? 8.908  69.171  93.307  1.00 43.51  ? 219  LYS A C     1 
ATOM   4700  O  O     . LYS G 4 219 ? 9.142  69.938  94.226  1.00 44.60  ? 219  LYS A O     1 
ATOM   4701  C  CB    . LYS G 4 219 ? 6.637  68.914  92.225  1.00 49.31  ? 219  LYS A CB    1 
ATOM   4702  C  CG    . LYS G 4 219 ? 5.558  69.733  92.982  1.00 57.14  ? 219  LYS A CG    1 
ATOM   4703  C  CD    . LYS G 4 219 ? 4.160  69.017  92.968  1.00 62.65  ? 219  LYS A CD    1 
ATOM   4704  C  CE    . LYS G 4 219 ? 3.164  69.549  94.039  1.00 64.18  ? 219  LYS A CE    1 
ATOM   4705  N  NZ    . LYS G 4 219 ? 1.889  68.757  94.037  1.00 64.20  ? 219  LYS A NZ    1 
ATOM   4706  N  N     . LEU G 4 220 ? 9.440  67.966  93.227  1.00 41.92  ? 220  LEU A N     1 
ATOM   4707  C  CA    . LEU G 4 220 ? 10.336 67.421  94.238  1.00 40.39  ? 220  LEU A CA    1 
ATOM   4708  C  C     . LEU G 4 220 ? 11.659 68.183  94.445  1.00 39.03  ? 220  LEU A C     1 
ATOM   4709  O  O     . LEU G 4 220 ? 12.178 68.184  95.559  1.00 38.72  ? 220  LEU A O     1 
ATOM   4710  C  CB    . LEU G 4 220 ? 10.667 65.976  93.872  1.00 40.44  ? 220  LEU A CB    1 
ATOM   4711  C  CG    . LEU G 4 220 ? 9.919  64.784  94.460  1.00 40.95  ? 220  LEU A CG    1 
ATOM   4712  C  CD1   . LEU G 4 220 ? 10.569 64.487  95.776  1.00 41.92  ? 220  LEU A CD1   1 
ATOM   4713  C  CD2   . LEU G 4 220 ? 8.401  65.018  94.587  1.00 39.75  ? 220  LEU A CD2   1 
ATOM   4714  N  N     . VAL G 4 221 ? 12.205 68.804  93.394  1.00 37.56  ? 221  VAL A N     1 
ATOM   4715  C  CA    . VAL G 4 221 ? 13.477 69.516  93.493  1.00 38.45  ? 221  VAL A CA    1 
ATOM   4716  C  C     . VAL G 4 221 ? 13.304 70.977  93.784  1.00 39.88  ? 221  VAL A C     1 
ATOM   4717  O  O     . VAL G 4 221 ? 14.166 71.603  94.388  1.00 39.48  ? 221  VAL A O     1 
ATOM   4718  C  CB    . VAL G 4 221 ? 14.313 69.432  92.192  1.00 38.53  ? 221  VAL A CB    1 
ATOM   4719  C  CG1   . VAL G 4 221 ? 15.746 69.934  92.428  1.00 37.47  ? 221  VAL A CG1   1 
ATOM   4720  C  CG2   . VAL G 4 221 ? 14.337 68.031  91.680  1.00 40.18  ? 221  VAL A CG2   1 
ATOM   4721  N  N     . GLU G 4 222 ? 12.191 71.530  93.335  1.00 43.74  ? 222  GLU A N     1 
ATOM   4722  C  CA    . GLU G 4 222 ? 11.909 72.950  93.543  1.00 47.49  ? 222  GLU A CA    1 
ATOM   4723  C  C     . GLU G 4 222 ? 11.575 73.220  95.017  1.00 47.20  ? 222  GLU A C     1 
ATOM   4724  O  O     . GLU G 4 222 ? 11.843 74.285  95.556  1.00 47.57  ? 222  GLU A O     1 
ATOM   4725  C  CB    . GLU G 4 222 ? 10.752 73.376  92.637  1.00 50.99  ? 222  GLU A CB    1 
ATOM   4726  C  CG    . GLU G 4 222 ? 10.789 74.827  92.212  1.00 57.55  ? 222  GLU A CG    1 
ATOM   4727  C  CD    . GLU G 4 222 ? 10.428 75.009  90.727  1.00 62.56  ? 222  GLU A CD    1 
ATOM   4728  O  OE1   . GLU G 4 222 ? 9.404  74.398  90.265  1.00 62.70  ? 222  GLU A OE1   1 
ATOM   4729  O  OE2   . GLU G 4 222 ? 11.177 75.776  90.040  1.00 63.65  ? 222  GLU A OE2   1 
ATOM   4730  N  N     . ARG G 4 223 ? 10.991 72.241  95.676  1.00 45.99  ? 223  ARG A N     1 
ATOM   4731  C  CA    . ARG G 4 223 ? 10.677 72.430  97.057  1.00 44.73  ? 223  ARG A CA    1 
ATOM   4732  C  C     . ARG G 4 223 ? 11.916 72.300  97.920  1.00 44.79  ? 223  ARG A C     1 
ATOM   4733  O  O     . ARG G 4 223 ? 11.845 72.552  99.105  1.00 46.24  ? 223  ARG A O     1 
ATOM   4734  C  CB    . ARG G 4 223 ? 9.623  71.430  97.498  1.00 44.66  ? 223  ARG A CB    1 
ATOM   4735  C  CG    . ARG G 4 223 ? 9.357  71.425  98.990  1.00 44.36  ? 223  ARG A CG    1 
ATOM   4736  C  CD    . ARG G 4 223 ? 8.016  70.827  99.222  1.00 47.57  ? 223  ARG A CD    1 
ATOM   4737  N  NE    . ARG G 4 223 ? 8.007  69.873  100.319 1.00 50.11  ? 223  ARG A NE    1 
ATOM   4738  C  CZ    . ARG G 4 223 ? 7.808  70.206  101.583 1.00 52.37  ? 223  ARG A CZ    1 
ATOM   4739  N  NH1   . ARG G 4 223 ? 7.607  71.491  101.888 1.00 53.87  ? 223  ARG A NH1   1 
ATOM   4740  N  NH2   . ARG G 4 223 ? 7.781  69.259  102.529 1.00 52.40  ? 223  ARG A NH2   1 
ATOM   4741  N  N     . TRP G 4 224 ? 13.050 71.890  97.364  1.00 44.29  ? 224  TRP A N     1 
ATOM   4742  C  CA    . TRP G 4 224 ? 14.266 71.789  98.186  1.00 44.17  ? 224  TRP A CA    1 
ATOM   4743  C  C     . TRP G 4 224 ? 15.024 73.051  97.970  1.00 45.27  ? 224  TRP A C     1 
ATOM   4744  O  O     . TRP G 4 224 ? 15.790 73.504  98.829  1.00 45.24  ? 224  TRP A O     1 
ATOM   4745  C  CB    . TRP G 4 224 ? 15.165 70.651  97.752  1.00 42.20  ? 224  TRP A CB    1 
ATOM   4746  C  CG    . TRP G 4 224 ? 16.631 70.904  98.012  1.00 38.08  ? 224  TRP A CG    1 
ATOM   4747  C  CD1   . TRP G 4 224 ? 17.607 70.977  97.077  1.00 37.92  ? 224  TRP A CD1   1 
ATOM   4748  C  CD2   . TRP G 4 224 ? 17.283 71.041  99.285  1.00 35.42  ? 224  TRP A CD2   1 
ATOM   4749  N  NE1   . TRP G 4 224 ? 18.830 71.138  97.677  1.00 37.04  ? 224  TRP A NE1   1 
ATOM   4750  C  CE2   . TRP G 4 224 ? 18.661 71.185  99.033  1.00 34.74  ? 224  TRP A CE2   1 
ATOM   4751  C  CE3   . TRP G 4 224 ? 16.838 71.049  100.604 1.00 33.83  ? 224  TRP A CE3   1 
ATOM   4752  C  CZ2   . TRP G 4 224 ? 19.601 71.336  100.045 1.00 32.58  ? 224  TRP A CZ2   1 
ATOM   4753  C  CZ3   . TRP G 4 224 ? 17.773 71.194  101.611 1.00 33.44  ? 224  TRP A CZ3   1 
ATOM   4754  C  CH2   . TRP G 4 224 ? 19.144 71.336  101.323 1.00 32.32  ? 224  TRP A CH2   1 
ATOM   4755  N  N     . ILE G 4 225 ? 14.818 73.588  96.777  1.00 46.29  ? 225  ILE A N     1 
ATOM   4756  C  CA    . ILE G 4 225 ? 15.441 74.822  96.388  1.00 47.53  ? 225  ILE A CA    1 
ATOM   4757  C  C     . ILE G 4 225 ? 14.865 75.977  97.206  1.00 50.02  ? 225  ILE A C     1 
ATOM   4758  O  O     . ILE G 4 225 ? 15.599 76.874  97.607  1.00 52.28  ? 225  ILE A O     1 
ATOM   4759  C  CB    . ILE G 4 225 ? 15.250 75.059  94.883  1.00 44.98  ? 225  ILE A CB    1 
ATOM   4760  C  CG1   . ILE G 4 225 ? 16.512 74.616  94.145  1.00 44.69  ? 225  ILE A CG1   1 
ATOM   4761  C  CG2   . ILE G 4 225 ? 14.910 76.498  94.616  1.00 44.02  ? 225  ILE A CG2   1 
ATOM   4762  C  CD1   . ILE G 4 225 ? 16.345 74.437  92.658  1.00 43.66  ? 225  ILE A CD1   1 
ATOM   4763  N  N     . SER G 4 226 ? 13.572 75.954  97.495  1.00 51.78  ? 226  SER A N     1 
ATOM   4764  C  CA    . SER G 4 226 ? 12.989 77.058  98.253  1.00 53.44  ? 226  SER A CA    1 
ATOM   4765  C  C     . SER G 4 226 ? 12.887 76.813  99.745  1.00 53.58  ? 226  SER A C     1 
ATOM   4766  O  O     . SER G 4 226 ? 12.093 77.456  100.418 1.00 55.12  ? 226  SER A O     1 
ATOM   4767  C  CB    . SER G 4 226 ? 11.588 77.405  97.720  1.00 54.72  ? 226  SER A CB    1 
ATOM   4768  O  OG    . SER G 4 226 ? 10.597 76.515  98.235  1.00 55.85  ? 226  SER A OG    1 
ATOM   4769  N  N     . VAL G 4 227 ? 13.669 75.902  100.286 1.00 52.00  ? 227  VAL A N     1 
ATOM   4770  C  CA    . VAL G 4 227 ? 13.558 75.663  101.706 1.00 52.54  ? 227  VAL A CA    1 
ATOM   4771  C  C     . VAL G 4 227 ? 14.961 75.650  102.258 1.00 53.90  ? 227  VAL A C     1 
ATOM   4772  O  O     . VAL G 4 227 ? 15.183 75.701  103.464 1.00 53.37  ? 227  VAL A O     1 
ATOM   4773  C  CB    . VAL G 4 227 ? 12.903 74.315  101.970 1.00 51.87  ? 227  VAL A CB    1 
ATOM   4774  C  CG1   . VAL G 4 227 ? 13.954 73.219  101.939 1.00 51.59  ? 227  VAL A CG1   1 
ATOM   4775  C  CG2   . VAL G 4 227 ? 12.181 74.335  103.287 1.00 52.41  ? 227  VAL A CG2   1 
ATOM   4776  N  N     . SER G 4 228 ? 15.909 75.580  101.338 1.00 55.42  ? 228  SER A N     1 
ATOM   4777  C  CA    . SER G 4 228 ? 17.320 75.535  101.669 1.00 56.55  ? 228  SER A CA    1 
ATOM   4778  C  C     . SER G 4 228 ? 17.930 76.875  101.366 1.00 57.31  ? 228  SER A C     1 
ATOM   4779  O  O     . SER G 4 228 ? 18.851 77.333  102.040 1.00 56.78  ? 228  SER A O     1 
ATOM   4780  C  CB    . SER G 4 228 ? 18.002 74.490  100.793 1.00 57.00  ? 228  SER A CB    1 
ATOM   4781  O  OG    . SER G 4 228 ? 17.871 74.811  99.415  1.00 55.73  ? 228  SER A OG    1 
ATOM   4782  N  N     . GLY G 4 229 ? 17.387 77.475  100.316 1.00 60.55  ? 229  GLY A N     1 
ATOM   4783  C  CA    . GLY G 4 229 ? 17.856 78.750  99.828  1.00 63.88  ? 229  GLY A CA    1 
ATOM   4784  C  C     . GLY G 4 229 ? 19.206 78.529  99.175  1.00 65.73  ? 229  GLY A C     1 
ATOM   4785  O  O     . GLY G 4 229 ? 20.235 78.842  99.765  1.00 67.65  ? 229  GLY A O     1 
ATOM   4786  N  N     . VAL G 4 230 ? 19.237 77.966  97.976  1.00 66.03  ? 230  VAL A N     1 
ATOM   4787  C  CA    . VAL G 4 230 ? 20.528 77.760  97.348  1.00 66.47  ? 230  VAL A CA    1 
ATOM   4788  C  C     . VAL G 4 230 ? 20.593 78.673  96.169  1.00 67.39  ? 230  VAL A C     1 
ATOM   4789  O  O     . VAL G 4 230 ? 21.635 78.835  95.566  1.00 66.02  ? 230  VAL A O     1 
ATOM   4790  C  CB    . VAL G 4 230 ? 20.739 76.290  96.905  1.00 65.83  ? 230  VAL A CB    1 
ATOM   4791  C  CG1   . VAL G 4 230 ? 21.147 75.458  98.089  1.00 64.87  ? 230  VAL A CG1   1 
ATOM   4792  C  CG2   . VAL G 4 230 ? 19.468 75.724  96.317  1.00 65.30  ? 230  VAL A CG2   1 
ATOM   4793  N  N     . ALA G 4 231 ? 19.458 79.285  95.864  1.00 70.03  ? 231  ALA A N     1 
ATOM   4794  C  CA    . ALA G 4 231 ? 19.359 80.202  94.737  1.00 73.38  ? 231  ALA A CA    1 
ATOM   4795  C  C     . ALA G 4 231 ? 20.089 81.523  95.017  1.00 75.37  ? 231  ALA A C     1 
ATOM   4796  O  O     . ALA G 4 231 ? 20.580 82.181  94.087  1.00 76.07  ? 231  ALA A O     1 
ATOM   4797  C  CB    . ALA G 4 231 ? 17.885 80.469  94.404  1.00 73.23  ? 231  ALA A CB    1 
ATOM   4798  N  N     . ASP G 4 232 ? 20.156 81.901  96.297  1.00 77.47  ? 232  ASP A N     1 
ATOM   4799  C  CA    . ASP G 4 232 ? 20.835 83.133  96.729  1.00 78.28  ? 232  ASP A CA    1 
ATOM   4800  C  C     . ASP G 4 232 ? 22.123 83.426  95.929  1.00 77.05  ? 232  ASP A C     1 
ATOM   4801  O  O     . ASP G 4 232 ? 22.469 84.583  95.713  1.00 77.34  ? 232  ASP A O     1 
ATOM   4802  C  CB    . ASP G 4 232 ? 21.172 83.061  98.239  1.00 81.43  ? 232  ASP A CB    1 
ATOM   4803  C  CG    . ASP G 4 232 ? 19.978 83.424  99.149  1.00 83.66  ? 232  ASP A CG    1 
ATOM   4804  O  OD1   . ASP G 4 232 ? 18.854 82.898  98.935  1.00 84.46  ? 232  ASP A OD1   1 
ATOM   4805  O  OD2   . ASP G 4 232 ? 20.179 84.232  100.094 1.00 84.22  ? 232  ASP A OD2   1 
ATOM   4806  N  N     . ASP G 4 233 ? 22.826 82.387  95.491  1.00 74.61  ? 233  ASP A N     1 
ATOM   4807  C  CA    . ASP G 4 233 ? 24.050 82.562  94.724  1.00 72.90  ? 233  ASP A CA    1 
ATOM   4808  C  C     . ASP G 4 233 ? 24.078 81.501  93.642  1.00 71.27  ? 233  ASP A C     1 
ATOM   4809  O  O     . ASP G 4 233 ? 24.315 80.338  93.925  1.00 72.07  ? 233  ASP A O     1 
ATOM   4810  C  CB    . ASP G 4 233 ? 25.269 82.402  95.640  1.00 74.70  ? 233  ASP A CB    1 
ATOM   4811  C  CG    . ASP G 4 233 ? 26.605 82.641  94.915  1.00 75.99  ? 233  ASP A CG    1 
ATOM   4812  O  OD1   . ASP G 4 233 ? 26.760 82.166  93.764  1.00 76.23  ? 233  ASP A OD1   1 
ATOM   4813  O  OD2   . ASP G 4 233 ? 27.507 83.291  95.509  1.00 75.81  ? 233  ASP A OD2   1 
ATOM   4814  N  N     . PRO G 4 234 ? 23.844 81.886  92.384  1.00 69.40  ? 234  PRO A N     1 
ATOM   4815  C  CA    . PRO G 4 234 ? 23.846 80.944  91.266  1.00 67.66  ? 234  PRO A CA    1 
ATOM   4816  C  C     . PRO G 4 234 ? 25.012 79.955  91.251  1.00 65.96  ? 234  PRO A C     1 
ATOM   4817  O  O     . PRO G 4 234 ? 24.825 78.800  90.874  1.00 66.98  ? 234  PRO A O     1 
ATOM   4818  C  CB    . PRO G 4 234 ? 23.856 81.860  90.055  1.00 67.93  ? 234  PRO A CB    1 
ATOM   4819  C  CG    . PRO G 4 234 ? 23.058 82.997  90.518  1.00 68.80  ? 234  PRO A CG    1 
ATOM   4820  C  CD    . PRO G 4 234 ? 23.610 83.252  91.895  1.00 69.65  ? 234  PRO A CD    1 
ATOM   4821  N  N     . ASN G 4 235 ? 26.207 80.399  91.645  1.00 62.89  ? 235  ASN A N     1 
ATOM   4822  C  CA    . ASN G 4 235 ? 27.388 79.527  91.670  1.00 59.45  ? 235  ASN A CA    1 
ATOM   4823  C  C     . ASN G 4 235 ? 27.271 78.411  92.719  1.00 55.81  ? 235  ASN A C     1 
ATOM   4824  O  O     . ASN G 4 235 ? 28.111 77.516  92.791  1.00 54.14  ? 235  ASN A O     1 
ATOM   4825  C  CB    . ASN G 4 235 ? 28.642 80.341  91.982  1.00 62.48  ? 235  ASN A CB    1 
ATOM   4826  C  CG    . ASN G 4 235 ? 29.337 80.875  90.751  1.00 64.16  ? 235  ASN A CG    1 
ATOM   4827  O  OD1   . ASN G 4 235 ? 29.680 80.125  89.831  1.00 64.00  ? 235  ASN A OD1   1 
ATOM   4828  N  ND2   . ASN G 4 235 ? 29.583 82.185  90.742  1.00 67.05  ? 235  ASN A ND2   1 
ATOM   4829  N  N     . ASN G 4 236 ? 26.235 78.494  93.545  1.00 52.31  ? 236  ASN A N     1 
ATOM   4830  C  CA    . ASN G 4 236 ? 25.986 77.519  94.594  1.00 48.81  ? 236  ASN A CA    1 
ATOM   4831  C  C     . ASN G 4 236 ? 25.713 76.123  94.065  1.00 46.87  ? 236  ASN A C     1 
ATOM   4832  O  O     . ASN G 4 236 ? 25.099 75.932  93.016  1.00 46.50  ? 236  ASN A O     1 
ATOM   4833  C  CB    . ASN G 4 236 ? 24.776 77.933  95.428  1.00 49.26  ? 236  ASN A CB    1 
ATOM   4834  C  CG    . ASN G 4 236 ? 25.147 78.671  96.688  1.00 50.09  ? 236  ASN A CG    1 
ATOM   4835  O  OD1   . ASN G 4 236 ? 26.318 78.791  97.038  1.00 51.03  ? 236  ASN A OD1   1 
ATOM   4836  N  ND2   . ASN G 4 236 ? 24.134 79.165  97.391  1.00 50.97  ? 236  ASN A ND2   1 
ATOM   4837  N  N     . TYR G 4 237 ? 26.160 75.142  94.825  1.00 43.32  ? 237  TYR A N     1 
ATOM   4838  C  CA    . TYR G 4 237 ? 25.934 73.764  94.487  1.00 39.98  ? 237  TYR A CA    1 
ATOM   4839  C  C     . TYR G 4 237 ? 24.477 73.461  94.795  1.00 40.03  ? 237  TYR A C     1 
ATOM   4840  O  O     . TYR G 4 237 ? 23.955 73.948  95.789  1.00 41.15  ? 237  TYR A O     1 
ATOM   4841  C  CB    . TYR G 4 237 ? 26.850 72.915  95.335  1.00 37.13  ? 237  TYR A CB    1 
ATOM   4842  C  CG    . TYR G 4 237 ? 28.189 72.832  94.710  1.00 35.30  ? 237  TYR A CG    1 
ATOM   4843  C  CD1   . TYR G 4 237 ? 29.348 73.063  95.436  1.00 34.45  ? 237  TYR A CD1   1 
ATOM   4844  C  CD2   . TYR G 4 237 ? 28.301 72.524  93.369  1.00 36.21  ? 237  TYR A CD2   1 
ATOM   4845  C  CE1   . TYR G 4 237 ? 30.611 72.992  94.829  1.00 34.96  ? 237  TYR A CE1   1 
ATOM   4846  C  CE2   . TYR G 4 237 ? 29.542 72.445  92.747  1.00 37.73  ? 237  TYR A CE2   1 
ATOM   4847  C  CZ    . TYR G 4 237 ? 30.699 72.681  93.476  1.00 37.26  ? 237  TYR A CZ    1 
ATOM   4848  O  OH    . TYR G 4 237 ? 31.910 72.600  92.813  1.00 37.64  ? 237  TYR A OH    1 
ATOM   4849  N  N     . LEU G 4 238 ? 23.814 72.674  93.953  1.00 38.43  ? 238  LEU A N     1 
ATOM   4850  C  CA    . LEU G 4 238 ? 22.416 72.323  94.185  1.00 37.76  ? 238  LEU A CA    1 
ATOM   4851  C  C     . LEU G 4 238 ? 22.183 71.628  95.536  1.00 38.09  ? 238  LEU A C     1 
ATOM   4852  O  O     . LEU G 4 238 ? 21.228 71.938  96.232  1.00 38.05  ? 238  LEU A O     1 
ATOM   4853  C  CB    . LEU G 4 238 ? 21.908 71.410  93.077  1.00 37.00  ? 238  LEU A CB    1 
ATOM   4854  C  CG    . LEU G 4 238 ? 20.416 71.429  92.737  1.00 36.85  ? 238  LEU A CG    1 
ATOM   4855  C  CD1   . LEU G 4 238 ? 20.083 70.116  92.088  1.00 37.11  ? 238  LEU A CD1   1 
ATOM   4856  C  CD2   . LEU G 4 238 ? 19.553 71.628  93.949  1.00 37.55  ? 238  LEU A CD2   1 
ATOM   4857  N  N     . PHE G 4 239 ? 23.037 70.678  95.906  1.00 38.37  ? 239  PHE A N     1 
ATOM   4858  C  CA    . PHE G 4 239 ? 22.865 69.988  97.186  1.00 38.47  ? 239  PHE A CA    1 
ATOM   4859  C  C     . PHE G 4 239 ? 23.874 70.466  98.191  1.00 38.83  ? 239  PHE A C     1 
ATOM   4860  O  O     . PHE G 4 239 ? 24.925 70.958  97.810  1.00 41.65  ? 239  PHE A O     1 
ATOM   4861  C  CB    . PHE G 4 239 ? 22.984 68.475  97.013  1.00 37.00  ? 239  PHE A CB    1 
ATOM   4862  C  CG    . PHE G 4 239 ? 21.847 67.878  96.259  1.00 34.84  ? 239  PHE A CG    1 
ATOM   4863  C  CD1   . PHE G 4 239 ? 22.002 67.486  94.949  1.00 34.47  ? 239  PHE A CD1   1 
ATOM   4864  C  CD2   . PHE G 4 239 ? 20.605 67.777  96.843  1.00 35.20  ? 239  PHE A CD2   1 
ATOM   4865  C  CE1   . PHE G 4 239 ? 20.928 67.000  94.224  1.00 36.16  ? 239  PHE A CE1   1 
ATOM   4866  C  CE2   . PHE G 4 239 ? 19.531 67.298  96.133  1.00 36.87  ? 239  PHE A CE2   1 
ATOM   4867  C  CZ    . PHE G 4 239 ? 19.688 66.905  94.813  1.00 36.57  ? 239  PHE A CZ    1 
ATOM   4868  N  N     . CYS G 4 240 ? 23.563 70.310  99.474  1.00 38.92  ? 240  CYS A N     1 
ATOM   4869  C  CA    . CYS G 4 240 ? 24.445 70.769  100.549 1.00 38.23  ? 240  CYS A CA    1 
ATOM   4870  C  C     . CYS G 4 240 ? 24.086 70.121  101.891 1.00 38.02  ? 240  CYS A C     1 
ATOM   4871  O  O     . CYS G 4 240 ? 23.057 69.448  102.014 1.00 38.90  ? 240  CYS A O     1 
ATOM   4872  C  CB    . CYS G 4 240 ? 24.299 72.268  100.687 1.00 37.44  ? 240  CYS A CB    1 
ATOM   4873  S  SG    . CYS G 4 240 ? 22.636 72.642  101.168 1.00 35.68  ? 240  CYS A SG    1 
ATOM   4874  N  N     . ARG G 4 241 ? 24.925 70.344  102.899 1.00 37.09  ? 241  ARG A N     1 
ATOM   4875  C  CA    . ARG G 4 241 ? 24.702 69.775  104.219 1.00 36.63  ? 241  ARG A CA    1 
ATOM   4876  C  C     . ARG G 4 241 ? 23.452 70.320  104.872 1.00 36.58  ? 241  ARG A C     1 
ATOM   4877  O  O     . ARG G 4 241 ? 22.806 71.216  104.346 1.00 37.94  ? 241  ARG A O     1 
ATOM   4878  C  CB    . ARG G 4 241 ? 25.875 70.087  105.105 1.00 36.49  ? 241  ARG A CB    1 
ATOM   4879  C  CG    . ARG G 4 241 ? 27.170 70.024  104.391 1.00 38.67  ? 241  ARG A CG    1 
ATOM   4880  C  CD    . ARG G 4 241 ? 28.267 70.380  105.356 1.00 40.87  ? 241  ARG A CD    1 
ATOM   4881  N  NE    . ARG G 4 241 ? 27.990 69.821  106.673 1.00 40.51  ? 241  ARG A NE    1 
ATOM   4882  C  CZ    . ARG G 4 241 ? 28.885 69.734  107.648 1.00 41.25  ? 241  ARG A CZ    1 
ATOM   4883  N  NH1   . ARG G 4 241 ? 30.128 70.165  107.457 1.00 41.05  ? 241  ARG A NH1   1 
ATOM   4884  N  NH2   . ARG G 4 241 ? 28.530 69.217  108.816 1.00 41.73  ? 241  ARG A NH2   1 
ATOM   4885  N  N     . VAL G 4 242 ? 23.118 69.769  106.026 1.00 35.75  ? 242  VAL A N     1 
ATOM   4886  C  CA    . VAL G 4 242 ? 21.962 70.185  106.798 1.00 36.71  ? 242  VAL A CA    1 
ATOM   4887  C  C     . VAL G 4 242 ? 22.338 69.677  108.173 1.00 38.72  ? 242  VAL A C     1 
ATOM   4888  O  O     . VAL G 4 242 ? 22.608 68.494  108.331 1.00 40.03  ? 242  VAL A O     1 
ATOM   4889  C  CB    . VAL G 4 242 ? 20.678 69.500  106.315 1.00 35.61  ? 242  VAL A CB    1 
ATOM   4890  C  CG1   . VAL G 4 242 ? 19.865 69.063  107.485 1.00 36.85  ? 242  VAL A CG1   1 
ATOM   4891  C  CG2   . VAL G 4 242 ? 19.854 70.454  105.502 1.00 34.30  ? 242  VAL A CG2   1 
ATOM   4892  N  N     . ARG G 4 243 ? 22.352 70.564  109.166 1.00 40.52  ? 243  ARG A N     1 
ATOM   4893  C  CA    . ARG G 4 243 ? 22.766 70.216  110.529 1.00 41.21  ? 243  ARG A CA    1 
ATOM   4894  C  C     . ARG G 4 243 ? 21.725 69.791  111.544 1.00 41.94  ? 243  ARG A C     1 
ATOM   4895  O  O     . ARG G 4 243 ? 20.532 69.838  111.306 1.00 42.01  ? 243  ARG A O     1 
ATOM   4896  C  CB    . ARG G 4 243 ? 23.538 71.379  111.132 1.00 40.09  ? 243  ARG A CB    1 
ATOM   4897  C  CG    . ARG G 4 243 ? 24.771 71.738  110.391 1.00 38.16  ? 243  ARG A CG    1 
ATOM   4898  C  CD    . ARG G 4 243 ? 24.923 73.237  110.294 1.00 37.77  ? 243  ARG A CD    1 
ATOM   4899  N  NE    . ARG G 4 243 ? 26.182 73.559  109.638 1.00 36.67  ? 243  ARG A NE    1 
ATOM   4900  C  CZ    . ARG G 4 243 ? 27.358 73.056  110.009 1.00 36.45  ? 243  ARG A CZ    1 
ATOM   4901  N  NH1   . ARG G 4 243 ? 27.434 72.210  111.046 1.00 34.15  ? 243  ARG A NH1   1 
ATOM   4902  N  NH2   . ARG G 4 243 ? 28.454 73.377  109.320 1.00 35.33  ? 243  ARG A NH2   1 
ATOM   4903  N  N     . LYS G 4 244 ? 22.233 69.381  112.697 1.00 43.94  ? 244  LYS A N     1 
ATOM   4904  C  CA    . LYS G 4 244 ? 21.431 68.955  113.836 1.00 45.13  ? 244  LYS A CA    1 
ATOM   4905  C  C     . LYS G 4 244 ? 20.071 69.664  113.894 1.00 45.21  ? 244  LYS A C     1 
ATOM   4906  O  O     . LYS G 4 244 ? 19.047 69.053  114.187 1.00 44.33  ? 244  LYS A O     1 
ATOM   4907  C  CB    . LYS G 4 244 ? 22.222 69.290  115.110 1.00 45.99  ? 244  LYS A CB    1 
ATOM   4908  C  CG    . LYS G 4 244 ? 22.306 68.217  116.167 1.00 46.30  ? 244  LYS A CG    1 
ATOM   4909  C  CD    . LYS G 4 244 ? 23.487 68.532  117.057 1.00 47.86  ? 244  LYS A CD    1 
ATOM   4910  C  CE    . LYS G 4 244 ? 23.838 67.392  117.998 1.00 51.03  ? 244  LYS A CE    1 
ATOM   4911  N  NZ    . LYS G 4 244 ? 22.891 67.176  119.158 1.00 53.07  ? 244  LYS A NZ    1 
ATOM   4912  N  N     . ASN G 4 245 ? 20.095 70.964  113.602 1.00 45.46  ? 245  ASN A N     1 
ATOM   4913  C  CA    . ASN G 4 245 ? 18.933 71.838  113.683 1.00 46.05  ? 245  ASN A CA    1 
ATOM   4914  C  C     . ASN G 4 245 ? 18.040 71.974  112.474 1.00 46.53  ? 245  ASN A C     1 
ATOM   4915  O  O     . ASN G 4 245 ? 17.254 72.909  112.390 1.00 46.32  ? 245  ASN A O     1 
ATOM   4916  C  CB    . ASN G 4 245 ? 19.396 73.232  114.089 1.00 46.95  ? 245  ASN A CB    1 
ATOM   4917  C  CG    . ASN G 4 245 ? 20.319 73.849  113.069 1.00 49.15  ? 245  ASN A CG    1 
ATOM   4918  O  OD1   . ASN G 4 245 ? 19.990 73.901  111.887 1.00 50.42  ? 245  ASN A OD1   1 
ATOM   4919  N  ND2   . ASN G 4 245 ? 21.480 74.327  113.516 1.00 50.18  ? 245  ASN A ND2   1 
ATOM   4920  N  N     . GLY G 4 246 ? 18.159 71.057  111.534 1.00 47.82  ? 246  GLY A N     1 
ATOM   4921  C  CA    . GLY G 4 246 ? 17.324 71.114  110.352 1.00 48.62  ? 246  GLY A CA    1 
ATOM   4922  C  C     . GLY G 4 246 ? 17.556 72.336  109.484 1.00 49.94  ? 246  GLY A C     1 
ATOM   4923  O  O     . GLY G 4 246 ? 16.660 72.717  108.720 1.00 51.12  ? 246  GLY A O     1 
ATOM   4924  N  N     . VAL G 4 247 ? 18.736 72.950  109.550 1.00 49.78  ? 247  VAL A N     1 
ATOM   4925  C  CA    . VAL G 4 247 ? 18.962 74.130  108.723 1.00 50.89  ? 247  VAL A CA    1 
ATOM   4926  C  C     . VAL G 4 247 ? 19.952 73.980  107.566 1.00 50.40  ? 247  VAL A C     1 
ATOM   4927  O  O     . VAL G 4 247 ? 21.080 73.508  107.735 1.00 50.26  ? 247  VAL A O     1 
ATOM   4928  C  CB    . VAL G 4 247 ? 19.369 75.330  109.599 1.00 52.54  ? 247  VAL A CB    1 
ATOM   4929  C  CG1   . VAL G 4 247 ? 20.905 75.434  109.718 1.00 54.24  ? 247  VAL A CG1   1 
ATOM   4930  C  CG2   . VAL G 4 247 ? 18.755 76.588  109.030 1.00 53.93  ? 247  VAL A CG2   1 
ATOM   4931  N  N     . ALA G 4 248 ? 19.510 74.398  106.384 1.00 50.91  ? 248  ALA A N     1 
ATOM   4932  C  CA    . ALA G 4 248 ? 20.326 74.326  105.174 1.00 51.23  ? 248  ALA A CA    1 
ATOM   4933  C  C     . ALA G 4 248 ? 21.585 75.139  105.350 1.00 51.15  ? 248  ALA A C     1 
ATOM   4934  O  O     . ALA G 4 248 ? 21.642 76.001  106.219 1.00 52.04  ? 248  ALA A O     1 
ATOM   4935  C  CB    . ALA G 4 248 ? 19.554 74.857  103.997 1.00 52.04  ? 248  ALA A CB    1 
ATOM   4936  N  N     . ALA G 4 249 ? 22.579 74.881  104.504 1.00 49.86  ? 249  ALA A N     1 
ATOM   4937  C  CA    . ALA G 4 249 ? 23.862 75.572  104.578 1.00 49.15  ? 249  ALA A CA    1 
ATOM   4938  C  C     . ALA G 4 249 ? 24.568 75.595  103.241 1.00 48.53  ? 249  ALA A C     1 
ATOM   4939  O  O     . ALA G 4 249 ? 25.503 74.843  103.032 1.00 48.03  ? 249  ALA A O     1 
ATOM   4940  C  CB    . ALA G 4 249 ? 24.753 74.888  105.598 1.00 48.66  ? 249  ALA A CB    1 
ATOM   4941  N  N     . PRO G 4 250 ? 24.128 76.459  102.320 1.00 48.55  ? 250  PRO A N     1 
ATOM   4942  C  CA    . PRO G 4 250 ? 24.684 76.628  100.970 1.00 48.76  ? 250  PRO A CA    1 
ATOM   4943  C  C     . PRO G 4 250 ? 26.164 76.956  100.858 1.00 48.59  ? 250  PRO A C     1 
ATOM   4944  O  O     . PRO G 4 250 ? 26.766 77.493  101.773 1.00 48.94  ? 250  PRO A O     1 
ATOM   4945  C  CB    . PRO G 4 250 ? 23.823 77.737  100.386 1.00 48.39  ? 250  PRO A CB    1 
ATOM   4946  C  CG    . PRO G 4 250 ? 22.495 77.427  100.968 1.00 49.38  ? 250  PRO A CG    1 
ATOM   4947  C  CD    . PRO G 4 250 ? 22.822 77.131  102.426 1.00 48.80  ? 250  PRO A CD    1 
ATOM   4948  N  N     . SER G 4 251 ? 26.742 76.638  99.712  1.00 49.51  ? 251  SER A N     1 
ATOM   4949  C  CA    . SER G 4 251 ? 28.148 76.909  99.458  1.00 51.57  ? 251  SER A CA    1 
ATOM   4950  C  C     . SER G 4 251 ? 28.410 76.943  97.953  1.00 52.41  ? 251  SER A C     1 
ATOM   4951  O  O     . SER G 4 251 ? 27.518 76.634  97.158  1.00 52.82  ? 251  SER A O     1 
ATOM   4952  C  CB    . SER G 4 251 ? 29.013 75.833  100.110 1.00 51.56  ? 251  SER A CB    1 
ATOM   4953  O  OG    . SER G 4 251 ? 30.293 75.752  99.499  1.00 51.31  ? 251  SER A OG    1 
ATOM   4954  N  N     . ALA G 4 252 ? 29.615 77.348  97.555  1.00 53.01  ? 252  ALA A N     1 
ATOM   4955  C  CA    . ALA G 4 252 ? 29.971 77.366  96.139  1.00 52.87  ? 252  ALA A CA    1 
ATOM   4956  C  C     . ALA G 4 252 ? 31.423 76.960  96.037  1.00 52.86  ? 252  ALA A C     1 
ATOM   4957  O  O     . ALA G 4 252 ? 32.050 77.094  95.000  1.00 52.37  ? 252  ALA A O     1 
ATOM   4958  C  CB    . ALA G 4 252 ? 29.761 78.722  95.549  1.00 53.06  ? 252  ALA A CB    1 
ATOM   4959  N  N     . THR G 4 253 ? 31.939 76.442  97.140  1.00 53.80  ? 253  THR A N     1 
ATOM   4960  C  CA    . THR G 4 253 ? 33.309 75.986  97.202  1.00 55.22  ? 253  THR A CA    1 
ATOM   4961  C  C     . THR G 4 253 ? 33.357 74.538  97.689  1.00 54.69  ? 253  THR A C     1 
ATOM   4962  O  O     . THR G 4 253 ? 34.291 73.793  97.371  1.00 55.73  ? 253  THR A O     1 
ATOM   4963  C  CB    . THR G 4 253 ? 34.146 76.865  98.169  1.00 57.52  ? 253  THR A CB    1 
ATOM   4964  O  OG1   . THR G 4 253 ? 33.540 76.875  99.471  1.00 59.13  ? 253  THR A OG1   1 
ATOM   4965  C  CG2   . THR G 4 253 ? 34.246 78.303  97.646  1.00 59.66  ? 253  THR A CG2   1 
ATOM   4966  N  N     . SER G 4 254 ? 32.345 74.131  98.450  1.00 53.31  ? 254  SER A N     1 
ATOM   4967  C  CA    . SER G 4 254 ? 32.316 72.777  98.991  1.00 51.87  ? 254  SER A CA    1 
ATOM   4968  C  C     . SER G 4 254 ? 31.136 71.958  98.546  1.00 50.80  ? 254  SER A C     1 
ATOM   4969  O  O     . SER G 4 254 ? 29.999 72.275  98.886  1.00 52.84  ? 254  SER A O     1 
ATOM   4970  C  CB    . SER G 4 254 ? 32.303 72.821  100.516 1.00 52.17  ? 254  SER A CB    1 
ATOM   4971  O  OG    . SER G 4 254 ? 31.894 71.581  101.064 1.00 51.12  ? 254  SER A OG    1 
ATOM   4972  N  N     . GLN G 4 255 ? 31.389 70.886  97.807  1.00 47.68  ? 255  GLN A N     1 
ATOM   4973  C  CA    . GLN G 4 255 ? 30.284 70.055  97.382  1.00 44.77  ? 255  GLN A CA    1 
ATOM   4974  C  C     . GLN G 4 255 ? 30.037 68.982  98.410  1.00 41.51  ? 255  GLN A C     1 
ATOM   4975  O  O     . GLN G 4 255 ? 30.882 68.700  99.247  1.00 41.03  ? 255  GLN A O     1 
ATOM   4976  C  CB    . GLN G 4 255 ? 30.555 69.420  96.015  1.00 46.98  ? 255  GLN A CB    1 
ATOM   4977  C  CG    . GLN G 4 255 ? 31.917 68.732  95.844  1.00 49.86  ? 255  GLN A CG    1 
ATOM   4978  C  CD    . GLN G 4 255 ? 32.121 68.187  94.421  1.00 51.29  ? 255  GLN A CD    1 
ATOM   4979  O  OE1   . GLN G 4 255 ? 31.984 66.982  94.183  1.00 52.02  ? 255  GLN A OE1   1 
ATOM   4980  N  NE2   . GLN G 4 255 ? 32.432 69.079  93.469  1.00 50.26  ? 255  GLN A NE2   1 
ATOM   4981  N  N     . LEU G 4 256 ? 28.850 68.406  98.368  1.00 38.47  ? 256  LEU A N     1 
ATOM   4982  C  CA    . LEU G 4 256 ? 28.499 67.329  99.272  1.00 34.98  ? 256  LEU A CA    1 
ATOM   4983  C  C     . LEU G 4 256 ? 29.356 66.100  98.905  1.00 34.97  ? 256  LEU A C     1 
ATOM   4984  O  O     . LEU G 4 256 ? 29.550 65.783  97.714  1.00 35.59  ? 256  LEU A O     1 
ATOM   4985  C  CB    . LEU G 4 256 ? 27.036 67.003  99.078  1.00 31.89  ? 256  LEU A CB    1 
ATOM   4986  C  CG    . LEU G 4 256 ? 26.284 67.112  100.359 1.00 29.99  ? 256  LEU A CG    1 
ATOM   4987  C  CD1   . LEU G 4 256 ? 25.057 66.273  100.291 1.00 30.23  ? 256  LEU A CD1   1 
ATOM   4988  C  CD2   . LEU G 4 256 ? 27.186 66.636  101.448 1.00 30.76  ? 256  LEU A CD2   1 
ATOM   4989  N  N     . SER G 4 257 ? 29.879 65.381  99.881  1.00 32.79  ? 257  SER A N     1 
ATOM   4990  C  CA    . SER G 4 257 ? 30.699 64.238  99.499  1.00 32.41  ? 257  SER A CA    1 
ATOM   4991  C  C     . SER G 4 257 ? 29.902 63.147  98.796  1.00 31.23  ? 257  SER A C     1 
ATOM   4992  O  O     . SER G 4 257 ? 28.680 63.091  98.902  1.00 30.51  ? 257  SER A O     1 
ATOM   4993  C  CB    . SER G 4 257 ? 31.339 63.621  100.725 1.00 33.73  ? 257  SER A CB    1 
ATOM   4994  O  OG    . SER G 4 257 ? 30.326 62.999  101.488 1.00 34.81  ? 257  SER A OG    1 
ATOM   4995  N  N     . THR G 4 258 ? 30.598 62.272  98.075  1.00 31.07  ? 258  THR A N     1 
ATOM   4996  C  CA    . THR G 4 258 ? 29.925 61.150  97.442  1.00 30.00  ? 258  THR A CA    1 
ATOM   4997  C  C     . THR G 4 258 ? 29.567 60.191  98.582  1.00 28.95  ? 258  THR A C     1 
ATOM   4998  O  O     . THR G 4 258 ? 28.549 59.505  98.551  1.00 29.33  ? 258  THR A O     1 
ATOM   4999  C  CB    . THR G 4 258 ? 30.825 60.441  96.431  1.00 30.00  ? 258  THR A CB    1 
ATOM   5000  O  OG1   . THR G 4 258 ? 32.185 60.490  96.850  1.00 30.63  ? 258  THR A OG1   1 
ATOM   5001  C  CG2   . THR G 4 258 ? 30.716 61.105  95.124  1.00 31.87  ? 258  THR A CG2   1 
ATOM   5002  N  N     . ARG G 4 259 ? 30.408 60.156  99.606  1.00 27.37  ? 259  ARG A N     1 
ATOM   5003  C  CA    . ARG G 4 259 ? 30.130 59.319  100.767 1.00 25.83  ? 259  ARG A CA    1 
ATOM   5004  C  C     . ARG G 4 259 ? 28.743 59.601  101.335 1.00 26.09  ? 259  ARG A C     1 
ATOM   5005  O  O     . ARG G 4 259 ? 28.033 58.690  101.709 1.00 25.37  ? 259  ARG A O     1 
ATOM   5006  C  CB    . ARG G 4 259 ? 31.118 59.588  101.885 1.00 23.46  ? 259  ARG A CB    1 
ATOM   5007  C  CG    . ARG G 4 259 ? 30.941 58.636  102.994 1.00 18.52  ? 259  ARG A CG    1 
ATOM   5008  C  CD    . ARG G 4 259 ? 31.438 57.330  102.527 1.00 16.71  ? 259  ARG A CD    1 
ATOM   5009  N  NE    . ARG G 4 259 ? 31.291 56.308  103.531 1.00 16.22  ? 259  ARG A NE    1 
ATOM   5010  C  CZ    . ARG G 4 259 ? 30.170 55.658  103.754 1.00 14.87  ? 259  ARG A CZ    1 
ATOM   5011  N  NH1   . ARG G 4 259 ? 29.099 55.924  103.037 1.00 13.29  ? 259  ARG A NH1   1 
ATOM   5012  N  NH2   . ARG G 4 259 ? 30.125 54.745  104.699 1.00 14.85  ? 259  ARG A NH2   1 
ATOM   5013  N  N     . ALA G 4 260 ? 28.388 60.881  101.420 1.00 26.80  ? 260  ALA A N     1 
ATOM   5014  C  CA    . ALA G 4 260 ? 27.102 61.312  101.947 1.00 25.86  ? 260  ALA A CA    1 
ATOM   5015  C  C     . ALA G 4 260 ? 25.937 60.965  101.022 1.00 25.50  ? 260  ALA A C     1 
ATOM   5016  O  O     . ALA G 4 260 ? 24.861 60.574  101.464 1.00 26.12  ? 260  ALA A O     1 
ATOM   5017  C  CB    . ALA G 4 260 ? 27.140 62.784  102.197 1.00 23.92  ? 260  ALA A CB    1 
ATOM   5018  N  N     . LEU G 4 261 ? 26.120 61.113  99.730  1.00 25.25  ? 261  LEU A N     1 
ATOM   5019  C  CA    . LEU G 4 261 ? 25.016 60.751  98.898  1.00 26.58  ? 261  LEU A CA    1 
ATOM   5020  C  C     . LEU G 4 261 ? 24.833 59.249  99.108  1.00 27.54  ? 261  LEU A C     1 
ATOM   5021  O  O     . LEU G 4 261 ? 23.717 58.790  99.340  1.00 29.51  ? 261  LEU A O     1 
ATOM   5022  C  CB    . LEU G 4 261 ? 25.310 61.122  97.460  1.00 25.90  ? 261  LEU A CB    1 
ATOM   5023  C  CG    . LEU G 4 261 ? 25.736 62.590  97.408  1.00 26.45  ? 261  LEU A CG    1 
ATOM   5024  C  CD1   . LEU G 4 261 ? 25.918 62.973  95.972  1.00 28.07  ? 261  LEU A CD1   1 
ATOM   5025  C  CD2   . LEU G 4 261 ? 24.711 63.503  98.052  1.00 23.72  ? 261  LEU A CD2   1 
ATOM   5026  N  N     . GLU G 4 262 ? 25.917 58.476  99.085  1.00 27.43  ? 262  GLU A N     1 
ATOM   5027  C  CA    . GLU G 4 262 ? 25.779 57.037  99.306  1.00 26.29  ? 262  GLU A CA    1 
ATOM   5028  C  C     . GLU G 4 262 ? 25.102 56.839  100.652 1.00 26.03  ? 262  GLU A C     1 
ATOM   5029  O  O     . GLU G 4 262 ? 24.599 55.776  100.942 1.00 26.93  ? 262  GLU A O     1 
ATOM   5030  C  CB    . GLU G 4 262 ? 27.124 56.342  99.387  1.00 26.99  ? 262  GLU A CB    1 
ATOM   5031  C  CG    . GLU G 4 262 ? 27.985 56.383  98.170  1.00 30.63  ? 262  GLU A CG    1 
ATOM   5032  C  CD    . GLU G 4 262 ? 29.340 55.712  98.395  1.00 32.60  ? 262  GLU A CD    1 
ATOM   5033  O  OE1   . GLU G 4 262 ? 30.118 55.587  97.436  1.00 34.91  ? 262  GLU A OE1   1 
ATOM   5034  O  OE2   . GLU G 4 262 ? 29.634 55.314  99.534  1.00 34.32  ? 262  GLU A OE2   1 
ATOM   5035  N  N     . GLY G 4 263 ? 25.126 57.864  101.491 1.00 25.09  ? 263  GLY A N     1 
ATOM   5036  C  CA    . GLY G 4 263 ? 24.510 57.742  102.794 1.00 23.66  ? 263  GLY A CA    1 
ATOM   5037  C  C     . GLY G 4 263 ? 23.017 57.958  102.717 1.00 24.09  ? 263  GLY A C     1 
ATOM   5038  O  O     . GLY G 4 263 ? 22.252 57.341  103.458 1.00 25.23  ? 263  GLY A O     1 
ATOM   5039  N  N     . ILE G 4 264 ? 22.591 58.840  101.822 1.00 22.68  ? 264  ILE A N     1 
ATOM   5040  C  CA    . ILE G 4 264 ? 21.175 59.106  101.664 1.00 20.83  ? 264  ILE A CA    1 
ATOM   5041  C  C     . ILE G 4 264 ? 20.529 57.821  101.179 1.00 20.69  ? 264  ILE A C     1 
ATOM   5042  O  O     . ILE G 4 264 ? 19.416 57.476  101.572 1.00 20.09  ? 264  ILE A O     1 
ATOM   5043  C  CB    . ILE G 4 264 ? 20.964 60.217  100.653 1.00 20.13  ? 264  ILE A CB    1 
ATOM   5044  C  CG1   . ILE G 4 264 ? 21.839 61.388  101.048 1.00 20.89  ? 264  ILE A CG1   1 
ATOM   5045  C  CG2   . ILE G 4 264 ? 19.527 60.646  100.604 1.00 17.67  ? 264  ILE A CG2   1 
ATOM   5046  C  CD1   . ILE G 4 264 ? 21.804 62.514  100.054 1.00 23.77  ? 264  ILE A CD1   1 
ATOM   5047  N  N     . PHE G 4 265 ? 21.243 57.095  100.336 1.00 19.82  ? 265  PHE A N     1 
ATOM   5048  C  CA    . PHE G 4 265 ? 20.702 55.861  99.827  1.00 20.67  ? 265  PHE A CA    1 
ATOM   5049  C  C     . PHE G 4 265 ? 20.630 54.799  100.916 1.00 23.07  ? 265  PHE A C     1 
ATOM   5050  O  O     . PHE G 4 265 ? 19.651 54.066  101.001 1.00 23.80  ? 265  PHE A O     1 
ATOM   5051  C  CB    . PHE G 4 265 ? 21.569 55.339  98.706  1.00 17.36  ? 265  PHE A CB    1 
ATOM   5052  C  CG    . PHE G 4 265 ? 21.117 55.725  97.343  1.00 12.68  ? 265  PHE A CG    1 
ATOM   5053  C  CD1   . PHE G 4 265 ? 19.885 55.347  96.888  1.00 10.40  ? 265  PHE A CD1   1 
ATOM   5054  C  CD2   . PHE G 4 265 ? 21.987 56.383  96.483  1.00 11.62  ? 265  PHE A CD2   1 
ATOM   5055  C  CE1   . PHE G 4 265 ? 19.527 55.606  95.602  1.00 11.52  ? 265  PHE A CE1   1 
ATOM   5056  C  CE2   . PHE G 4 265 ? 21.651 56.647  95.212  1.00 10.09  ? 265  PHE A CE2   1 
ATOM   5057  C  CZ    . PHE G 4 265 ? 20.420 56.261  94.752  1.00 11.21  ? 265  PHE A CZ    1 
ATOM   5058  N  N     . GLU G 4 266 ? 21.674 54.709  101.739 1.00 26.11  ? 266  GLU A N     1 
ATOM   5059  C  CA    . GLU G 4 266 ? 21.739 53.717  102.815 1.00 28.18  ? 266  GLU A CA    1 
ATOM   5060  C  C     . GLU G 4 266 ? 20.653 53.949  103.825 1.00 28.00  ? 266  GLU A C     1 
ATOM   5061  O  O     . GLU G 4 266 ? 19.942 53.023  104.213 1.00 27.70  ? 266  GLU A O     1 
ATOM   5062  C  CB    . GLU G 4 266 ? 23.076 53.766  103.534 1.00 31.27  ? 266  GLU A CB    1 
ATOM   5063  C  CG    . GLU G 4 266 ? 23.321 52.538  104.376 1.00 40.20  ? 266  GLU A CG    1 
ATOM   5064  C  CD    . GLU G 4 266 ? 24.687 52.531  105.080 1.00 47.09  ? 266  GLU A CD    1 
ATOM   5065  O  OE1   . GLU G 4 266 ? 25.711 52.987  104.482 1.00 50.43  ? 266  GLU A OE1   1 
ATOM   5066  O  OE2   . GLU G 4 266 ? 24.736 52.045  106.244 1.00 50.45  ? 266  GLU A OE2   1 
ATOM   5067  N  N     . ALA G 4 267 ? 20.517 55.197  104.248 1.00 27.67  ? 267  ALA A N     1 
ATOM   5068  C  CA    . ALA G 4 267 ? 19.503 55.546  105.224 1.00 27.14  ? 267  ALA A CA    1 
ATOM   5069  C  C     . ALA G 4 267 ? 18.105 55.420  104.678 1.00 27.62  ? 267  ALA A C     1 
ATOM   5070  O  O     . ALA G 4 267 ? 17.219 54.989  105.379 1.00 28.57  ? 267  ALA A O     1 
ATOM   5071  C  CB    . ALA G 4 267 ? 19.716 56.931  105.714 1.00 27.47  ? 267  ALA A CB    1 
ATOM   5072  N  N     . THR G 4 268 ? 17.888 55.796  103.430 1.00 28.22  ? 268  THR A N     1 
ATOM   5073  C  CA    . THR G 4 268 ? 16.555 55.698  102.906 1.00 27.61  ? 268  THR A CA    1 
ATOM   5074  C  C     . THR G 4 268 ? 16.132 54.259  102.834 1.00 27.05  ? 268  THR A C     1 
ATOM   5075  O  O     . THR G 4 268 ? 14.956 53.961  102.772 1.00 27.89  ? 268  THR A O     1 
ATOM   5076  C  CB    . THR G 4 268 ? 16.461 56.361  101.559 1.00 27.81  ? 268  THR A CB    1 
ATOM   5077  O  OG1   . THR G 4 268 ? 16.731 57.762  101.719 1.00 28.85  ? 268  THR A OG1   1 
ATOM   5078  C  CG2   . THR G 4 268 ? 15.071 56.193  100.986 1.00 28.71  ? 268  THR A CG2   1 
ATOM   5079  N  N     . HIS G 4 269 ? 17.088 53.351  102.883 1.00 26.36  ? 269  HIS A N     1 
ATOM   5080  C  CA    . HIS G 4 269 ? 16.743 51.945  102.840 1.00 26.31  ? 269  HIS A CA    1 
ATOM   5081  C  C     . HIS G 4 269 ? 16.577 51.469  104.248 1.00 26.09  ? 269  HIS A C     1 
ATOM   5082  O  O     . HIS G 4 269 ? 15.749 50.624  104.530 1.00 25.63  ? 269  HIS A O     1 
ATOM   5083  C  CB    . HIS G 4 269 ? 17.838 51.142  102.146 1.00 26.36  ? 269  HIS A CB    1 
ATOM   5084  C  CG    . HIS G 4 269 ? 17.567 49.669  102.063 1.00 24.79  ? 269  HIS A CG    1 
ATOM   5085  N  ND1   . HIS G 4 269 ? 17.816 48.806  103.105 1.00 24.36  ? 269  HIS A ND1   1 
ATOM   5086  C  CD2   . HIS G 4 269 ? 17.091 48.908  101.049 1.00 24.88  ? 269  HIS A CD2   1 
ATOM   5087  C  CE1   . HIS G 4 269 ? 17.505 47.577  102.734 1.00 24.93  ? 269  HIS A CE1   1 
ATOM   5088  N  NE2   . HIS G 4 269 ? 17.061 47.611  101.493 1.00 23.03  ? 269  HIS A NE2   1 
ATOM   5089  N  N     . ARG G 4 270 ? 17.373 52.027  105.144 1.00 28.19  ? 270  ARG A N     1 
ATOM   5090  C  CA    . ARG G 4 270 ? 17.303 51.636  106.545 1.00 30.34  ? 270  ARG A CA    1 
ATOM   5091  C  C     . ARG G 4 270 ? 15.944 51.976  107.098 1.00 29.71  ? 270  ARG A C     1 
ATOM   5092  O  O     . ARG G 4 270 ? 15.414 51.270  107.935 1.00 30.32  ? 270  ARG A O     1 
ATOM   5093  C  CB    . ARG G 4 270 ? 18.375 52.348  107.354 1.00 32.24  ? 270  ARG A CB    1 
ATOM   5094  C  CG    . ARG G 4 270 ? 18.556 51.806  108.752 1.00 36.46  ? 270  ARG A CG    1 
ATOM   5095  C  CD    . ARG G 4 270 ? 19.825 52.378  109.416 1.00 40.61  ? 270  ARG A CD    1 
ATOM   5096  N  NE    . ARG G 4 270 ? 19.791 53.838  109.537 1.00 42.00  ? 270  ARG A NE    1 
ATOM   5097  C  CZ    . ARG G 4 270 ? 20.633 54.676  108.934 1.00 41.82  ? 270  ARG A CZ    1 
ATOM   5098  N  NH1   . ARG G 4 270 ? 21.603 54.217  108.149 1.00 39.48  ? 270  ARG A NH1   1 
ATOM   5099  N  NH2   . ARG G 4 270 ? 20.501 55.987  109.124 1.00 42.39  ? 270  ARG A NH2   1 
ATOM   5100  N  N     . LEU G 4 271 ? 15.378 53.058  106.590 1.00 29.18  ? 271  LEU A N     1 
ATOM   5101  C  CA    . LEU G 4 271 ? 14.078 53.553  107.006 1.00 28.71  ? 271  LEU A CA    1 
ATOM   5102  C  C     . LEU G 4 271 ? 12.960 52.576  106.737 1.00 28.89  ? 271  LEU A C     1 
ATOM   5103  O  O     . LEU G 4 271 ? 12.211 52.225  107.626 1.00 29.82  ? 271  LEU A O     1 
ATOM   5104  C  CB    . LEU G 4 271 ? 13.764 54.847  106.273 1.00 28.38  ? 271  LEU A CB    1 
ATOM   5105  C  CG    . LEU G 4 271 ? 12.481 55.545  106.680 1.00 27.86  ? 271  LEU A CG    1 
ATOM   5106  C  CD1   . LEU G 4 271 ? 12.835 56.520  107.772 1.00 26.77  ? 271  LEU A CD1   1 
ATOM   5107  C  CD2   . LEU G 4 271 ? 11.855 56.262  105.504 1.00 27.27  ? 271  LEU A CD2   1 
ATOM   5108  N  N     . ILE G 4 272 ? 12.849 52.146  105.495 1.00 30.14  ? 272  ILE A N     1 
ATOM   5109  C  CA    . ILE G 4 272 ? 11.794 51.238  105.084 1.00 30.51  ? 272  ILE A CA    1 
ATOM   5110  C  C     . ILE G 4 272 ? 11.994 49.801  105.470 1.00 31.03  ? 272  ILE A C     1 
ATOM   5111  O  O     . ILE G 4 272 ? 11.084 49.173  105.989 1.00 31.88  ? 272  ILE A O     1 
ATOM   5112  C  CB    . ILE G 4 272 ? 11.637 51.245  103.572 1.00 29.62  ? 272  ILE A CB    1 
ATOM   5113  C  CG1   . ILE G 4 272 ? 11.410 52.667  103.098 1.00 30.32  ? 272  ILE A CG1   1 
ATOM   5114  C  CG2   . ILE G 4 272 ? 10.521 50.338  103.160 1.00 28.99  ? 272  ILE A CG2   1 
ATOM   5115  C  CD1   . ILE G 4 272 ? 11.402 52.782  101.622 1.00 30.46  ? 272  ILE A CD1   1 
ATOM   5116  N  N     . TYR G 4 273 ? 13.186 49.280  105.207 1.00 31.35  ? 273  TYR A N     1 
ATOM   5117  C  CA    . TYR G 4 273 ? 13.468 47.883  105.456 1.00 31.33  ? 273  TYR A CA    1 
ATOM   5118  C  C     . TYR G 4 273 ? 14.158 47.541  106.752 1.00 32.80  ? 273  TYR A C     1 
ATOM   5119  O  O     . TYR G 4 273 ? 14.345 46.357  107.065 1.00 32.97  ? 273  TYR A O     1 
ATOM   5120  C  CB    . TYR G 4 273 ? 14.253 47.317  104.276 1.00 30.23  ? 273  TYR A CB    1 
ATOM   5121  C  CG    . TYR G 4 273 ? 13.462 47.330  103.000 1.00 29.23  ? 273  TYR A CG    1 
ATOM   5122  C  CD1   . TYR G 4 273 ? 13.377 48.468  102.237 1.00 28.50  ? 273  TYR A CD1   1 
ATOM   5123  C  CD2   . TYR G 4 273 ? 12.711 46.231  102.621 1.00 30.63  ? 273  TYR A CD2   1 
ATOM   5124  C  CE1   . TYR G 4 273 ? 12.559 48.532  101.130 1.00 30.36  ? 273  TYR A CE1   1 
ATOM   5125  C  CE2   . TYR G 4 273 ? 11.884 46.270  101.513 1.00 31.97  ? 273  TYR A CE2   1 
ATOM   5126  C  CZ    . TYR G 4 273 ? 11.799 47.433  100.757 1.00 31.98  ? 273  TYR A CZ    1 
ATOM   5127  O  OH    . TYR G 4 273 ? 10.932 47.511  99.654  1.00 31.76  ? 273  TYR A OH    1 
ATOM   5128  N  N     . GLY G 4 274 ? 14.533 48.564  107.509 1.00 33.23  ? 274  GLY A N     1 
ATOM   5129  C  CA    . GLY G 4 274 ? 15.191 48.324  108.778 1.00 36.06  ? 274  GLY A CA    1 
ATOM   5130  C  C     . GLY G 4 274 ? 16.703 48.139  108.797 1.00 38.64  ? 274  GLY A C     1 
ATOM   5131  O  O     . GLY G 4 274 ? 17.391 48.094  107.765 1.00 38.49  ? 274  GLY A O     1 
ATOM   5132  N  N     . ALA G 4 275 ? 17.225 48.017  110.011 1.00 41.15  ? 275  ALA A N     1 
ATOM   5133  C  CA    . ALA G 4 275 ? 18.651 47.858  110.220 1.00 43.59  ? 275  ALA A CA    1 
ATOM   5134  C  C     . ALA G 4 275 ? 19.228 46.811  109.269 1.00 44.57  ? 275  ALA A C     1 
ATOM   5135  O  O     . ALA G 4 275 ? 18.515 45.920  108.825 1.00 43.00  ? 275  ALA A O     1 
ATOM   5136  C  CB    . ALA G 4 275 ? 18.902 47.487  111.669 1.00 43.84  ? 275  ALA A CB    1 
ATOM   5137  N  N     . LYS G 4 276 ? 20.523 46.928  108.976 1.00 47.81  ? 276  LYS A N     1 
ATOM   5138  C  CA    . LYS G 4 276 ? 21.214 46.035  108.049 1.00 51.15  ? 276  LYS A CA    1 
ATOM   5139  C  C     . LYS G 4 276 ? 21.646 44.700  108.626 1.00 55.33  ? 276  LYS A C     1 
ATOM   5140  O  O     . LYS G 4 276 ? 22.156 44.636  109.732 1.00 56.74  ? 276  LYS A O     1 
ATOM   5141  C  CB    . LYS G 4 276 ? 22.443 46.751  107.471 1.00 49.11  ? 276  LYS A CB    1 
ATOM   5142  C  CG    . LYS G 4 276 ? 23.126 45.994  106.349 1.00 47.47  ? 276  LYS A CG    1 
ATOM   5143  C  CD    . LYS G 4 276 ? 24.523 46.530  105.964 1.00 45.87  ? 276  LYS A CD    1 
ATOM   5144  C  CE    . LYS G 4 276 ? 24.478 47.910  105.321 1.00 44.65  ? 276  LYS A CE    1 
ATOM   5145  N  NZ    . LYS G 4 276 ? 25.829 48.377  104.899 1.00 42.42  ? 276  LYS A NZ    1 
ATOM   5146  N  N     . ASP G 4 277 ? 21.434 43.637  107.856 1.00 60.54  ? 277  ASP A N     1 
ATOM   5147  C  CA    . ASP G 4 277 ? 21.824 42.262  108.214 1.00 65.87  ? 277  ASP A CA    1 
ATOM   5148  C  C     . ASP G 4 277 ? 23.205 42.262  108.921 1.00 67.09  ? 277  ASP A C     1 
ATOM   5149  O  O     . ASP G 4 277 ? 23.986 43.199  108.760 1.00 67.84  ? 277  ASP A O     1 
ATOM   5150  C  CB    . ASP G 4 277 ? 21.830 41.435  106.907 1.00 68.95  ? 277  ASP A CB    1 
ATOM   5151  C  CG    . ASP G 4 277 ? 22.296 40.002  107.090 1.00 71.98  ? 277  ASP A CG    1 
ATOM   5152  O  OD1   . ASP G 4 277 ? 22.260 39.495  108.237 1.00 74.74  ? 277  ASP A OD1   1 
ATOM   5153  O  OD2   . ASP G 4 277 ? 22.710 39.387  106.070 1.00 72.30  ? 277  ASP A OD2   1 
ATOM   5154  N  N     . ASP G 4 278 ? 23.517 41.220  109.690 1.00 69.43  ? 278  ASP A N     1 
ATOM   5155  C  CA    . ASP G 4 278 ? 24.782 41.197  110.442 1.00 72.07  ? 278  ASP A CA    1 
ATOM   5156  C  C     . ASP G 4 278 ? 26.079 40.642  109.840 1.00 71.09  ? 278  ASP A C     1 
ATOM   5157  O  O     . ASP G 4 278 ? 27.139 40.784  110.458 1.00 70.69  ? 278  ASP A O     1 
ATOM   5158  C  CB    . ASP G 4 278 ? 24.556 40.549  111.822 1.00 76.00  ? 278  ASP A CB    1 
ATOM   5159  C  CG    . ASP G 4 278 ? 24.752 41.547  112.985 1.00 79.10  ? 278  ASP A CG    1 
ATOM   5160  O  OD1   . ASP G 4 278 ? 25.921 41.919  113.274 1.00 80.02  ? 278  ASP A OD1   1 
ATOM   5161  O  OD2   . ASP G 4 278 ? 23.733 41.961  113.600 1.00 79.82  ? 278  ASP A OD2   1 
ATOM   5162  N  N     . SER G 4 279 ? 26.020 40.016  108.663 1.00 69.14  ? 279  SER A N     1 
ATOM   5163  C  CA    . SER G 4 279 ? 27.238 39.505  108.018 1.00 66.34  ? 279  SER A CA    1 
ATOM   5164  C  C     . SER G 4 279 ? 28.013 40.716  107.527 1.00 63.66  ? 279  SER A C     1 
ATOM   5165  O  O     . SER G 4 279 ? 27.825 41.816  108.034 1.00 65.27  ? 279  SER A O     1 
ATOM   5166  C  CB    . SER G 4 279 ? 26.892 38.610  106.839 1.00 67.65  ? 279  SER A CB    1 
ATOM   5167  O  OG    . SER G 4 279 ? 25.921 39.232  106.016 1.00 70.99  ? 279  SER A OG    1 
ATOM   5168  N  N     . GLY G 4 280 ? 28.879 40.555  106.545 1.00 60.17  ? 280  GLY A N     1 
ATOM   5169  C  CA    . GLY G 4 280 ? 29.598 41.730  106.102 1.00 56.12  ? 280  GLY A CA    1 
ATOM   5170  C  C     . GLY G 4 280 ? 29.449 41.931  104.624 1.00 53.64  ? 280  GLY A C     1 
ATOM   5171  O  O     . GLY G 4 280 ? 30.157 42.725  104.020 1.00 53.80  ? 280  GLY A O     1 
ATOM   5172  N  N     . GLN G 4 281 ? 28.509 41.204  104.046 1.00 51.20  ? 281  GLN A N     1 
ATOM   5173  C  CA    . GLN G 4 281 ? 28.268 41.248  102.620 1.00 49.89  ? 281  GLN A CA    1 
ATOM   5174  C  C     . GLN G 4 281 ? 28.093 42.661  102.047 1.00 47.41  ? 281  GLN A C     1 
ATOM   5175  O  O     . GLN G 4 281 ? 27.647 43.567  102.744 1.00 47.81  ? 281  GLN A O     1 
ATOM   5176  C  CB    . GLN G 4 281 ? 27.028 40.410  102.290 1.00 51.98  ? 281  GLN A CB    1 
ATOM   5177  C  CG    . GLN G 4 281 ? 26.982 39.001  102.893 1.00 54.77  ? 281  GLN A CG    1 
ATOM   5178  C  CD    . GLN G 4 281 ? 25.799 38.195  102.366 1.00 56.83  ? 281  GLN A CD    1 
ATOM   5179  O  OE1   . GLN G 4 281 ? 25.832 37.708  101.237 1.00 57.96  ? 281  GLN A OE1   1 
ATOM   5180  N  NE2   . GLN G 4 281 ? 24.740 38.073  103.175 1.00 57.88  ? 281  GLN A NE2   1 
ATOM   5181  N  N     . ARG G 4 282 ? 28.444 42.847  100.775 1.00 44.17  ? 282  ARG A N     1 
ATOM   5182  C  CA    . ARG G 4 282 ? 28.269 44.143  100.128 1.00 40.25  ? 282  ARG A CA    1 
ATOM   5183  C  C     . ARG G 4 282 ? 26.900 44.182  99.449  1.00 36.96  ? 282  ARG A C     1 
ATOM   5184  O  O     . ARG G 4 282 ? 26.283 43.158  99.199  1.00 34.98  ? 282  ARG A O     1 
ATOM   5185  C  CB    . ARG G 4 282 ? 29.345 44.391  99.065  1.00 42.86  ? 282  ARG A CB    1 
ATOM   5186  C  CG    . ARG G 4 282 ? 30.693 44.904  99.542  1.00 44.52  ? 282  ARG A CG    1 
ATOM   5187  C  CD    . ARG G 4 282 ? 31.783 44.527  98.532  1.00 45.59  ? 282  ARG A CD    1 
ATOM   5188  N  NE    . ARG G 4 282 ? 31.904 45.439  97.400  1.00 45.61  ? 282  ARG A NE    1 
ATOM   5189  C  CZ    . ARG G 4 282 ? 32.695 46.511  97.386  1.00 45.47  ? 282  ARG A CZ    1 
ATOM   5190  N  NH1   . ARG G 4 282 ? 33.443 46.810  98.457  1.00 41.39  ? 282  ARG A NH1   1 
ATOM   5191  N  NH2   . ARG G 4 282 ? 32.745 47.275  96.288  1.00 44.80  ? 282  ARG A NH2   1 
ATOM   5192  N  N     . TYR G 4 283 ? 26.437 45.380  99.136  1.00 33.76  ? 283  TYR A N     1 
ATOM   5193  C  CA    . TYR G 4 283 ? 25.151 45.546  98.503  1.00 29.49  ? 283  TYR A CA    1 
ATOM   5194  C  C     . TYR G 4 283 ? 23.994 44.953  99.287  1.00 27.60  ? 283  TYR A C     1 
ATOM   5195  O  O     . TYR G 4 283 ? 23.207 44.195  98.742  1.00 28.09  ? 283  TYR A O     1 
ATOM   5196  C  CB    . TYR G 4 283 ? 25.181 44.935  97.127  1.00 28.77  ? 283  TYR A CB    1 
ATOM   5197  C  CG    . TYR G 4 283 ? 26.235 45.525  96.256  1.00 28.03  ? 283  TYR A CG    1 
ATOM   5198  C  CD1   . TYR G 4 283 ? 27.438 44.898  96.081  1.00 28.10  ? 283  TYR A CD1   1 
ATOM   5199  C  CD2   . TYR G 4 283 ? 26.030 46.713  95.614  1.00 29.32  ? 283  TYR A CD2   1 
ATOM   5200  C  CE1   . TYR G 4 283 ? 28.416 45.435  95.286  1.00 28.93  ? 283  TYR A CE1   1 
ATOM   5201  C  CE2   . TYR G 4 283 ? 27.004 47.261  94.819  1.00 31.04  ? 283  TYR A CE2   1 
ATOM   5202  C  CZ    . TYR G 4 283 ? 28.195 46.614  94.663  1.00 29.76  ? 283  TYR A CZ    1 
ATOM   5203  O  OH    . TYR G 4 283 ? 29.170 47.170  93.889  1.00 31.12  ? 283  TYR A OH    1 
ATOM   5204  N  N     . LEU G 4 284 ? 23.887 45.293  100.569 1.00 25.46  ? 284  LEU A N     1 
ATOM   5205  C  CA    . LEU G 4 284 ? 22.784 44.791  101.376 1.00 23.09  ? 284  LEU A CA    1 
ATOM   5206  C  C     . LEU G 4 284 ? 21.700 45.835  101.502 1.00 22.28  ? 284  LEU A C     1 
ATOM   5207  O  O     . LEU G 4 284 ? 20.656 45.571  102.070 1.00 23.76  ? 284  LEU A O     1 
ATOM   5208  C  CB    . LEU G 4 284 ? 23.260 44.362  102.764 1.00 20.44  ? 284  LEU A CB    1 
ATOM   5209  C  CG    . LEU G 4 284 ? 24.095 43.080  102.788 1.00 20.41  ? 284  LEU A CG    1 
ATOM   5210  C  CD1   . LEU G 4 284 ? 24.140 42.527  104.172 1.00 19.10  ? 284  LEU A CD1   1 
ATOM   5211  C  CD2   . LEU G 4 284 ? 23.497 42.012  101.838 1.00 22.47  ? 284  LEU A CD2   1 
ATOM   5212  N  N     . ALA G 4 285 ? 21.972 47.018  100.959 1.00 21.65  ? 285  ALA A N     1 
ATOM   5213  C  CA    . ALA G 4 285 ? 21.066 48.157  100.954 1.00 20.16  ? 285  ALA A CA    1 
ATOM   5214  C  C     . ALA G 4 285 ? 21.439 49.048  99.774  1.00 20.23  ? 285  ALA A C     1 
ATOM   5215  O  O     . ALA G 4 285 ? 22.534 48.972  99.260  1.00 22.22  ? 285  ALA A O     1 
ATOM   5216  C  CB    . ALA G 4 285 ? 21.204 48.901  102.201 1.00 19.41  ? 285  ALA A CB    1 
ATOM   5217  N  N     . TRP G 4 286 ? 20.537 49.900  99.332  1.00 20.54  ? 286  TRP A N     1 
ATOM   5218  C  CA    . TRP G 4 286 ? 20.829 50.753  98.196  1.00 19.42  ? 286  TRP A CA    1 
ATOM   5219  C  C     . TRP G 4 286 ? 22.168 51.486  98.260  1.00 21.01  ? 286  TRP A C     1 
ATOM   5220  O  O     . TRP G 4 286 ? 22.616 51.891  99.334  1.00 22.09  ? 286  TRP A O     1 
ATOM   5221  C  CB    . TRP G 4 286 ? 19.701 51.753  98.046  1.00 16.77  ? 286  TRP A CB    1 
ATOM   5222  C  CG    . TRP G 4 286 ? 18.413 51.093  97.866  1.00 15.98  ? 286  TRP A CG    1 
ATOM   5223  C  CD1   . TRP G 4 286 ? 18.165 50.015  97.097  1.00 15.12  ? 286  TRP A CD1   1 
ATOM   5224  C  CD2   . TRP G 4 286 ? 17.160 51.509  98.391  1.00 17.05  ? 286  TRP A CD2   1 
ATOM   5225  N  NE1   . TRP G 4 286 ? 16.835 49.730  97.095  1.00 16.01  ? 286  TRP A NE1   1 
ATOM   5226  C  CE2   . TRP G 4 286 ? 16.192 50.639  97.885  1.00 17.05  ? 286  TRP A CE2   1 
ATOM   5227  C  CE3   . TRP G 4 286 ? 16.756 52.544  99.243  1.00 18.98  ? 286  TRP A CE3   1 
ATOM   5228  C  CZ2   . TRP G 4 286 ? 14.849 50.770  98.192  1.00 17.31  ? 286  TRP A CZ2   1 
ATOM   5229  C  CZ3   . TRP G 4 286 ? 15.418 52.676  99.549  1.00 17.59  ? 286  TRP A CZ3   1 
ATOM   5230  C  CH2   . TRP G 4 286 ? 14.484 51.800  99.028  1.00 17.99  ? 286  TRP A CH2   1 
ATOM   5231  N  N     . SER G 4 287 ? 22.820 51.644  97.112  1.00 20.79  ? 287  SER A N     1 
ATOM   5232  C  CA    . SER G 4 287 ? 24.084 52.372  97.059  1.00 21.40  ? 287  SER A CA    1 
ATOM   5233  C  C     . SER G 4 287 ? 24.065 53.353  95.893  1.00 22.64  ? 287  SER A C     1 
ATOM   5234  O  O     . SER G 4 287 ? 23.010 53.640  95.348  1.00 23.15  ? 287  SER A O     1 
ATOM   5235  C  CB    . SER G 4 287 ? 25.237 51.419  96.919  1.00 20.44  ? 287  SER A CB    1 
ATOM   5236  O  OG    . SER G 4 287 ? 24.862 50.423  96.006  1.00 22.06  ? 287  SER A OG    1 
ATOM   5237  N  N     . GLY G 4 288 ? 25.217 53.879  95.509  1.00 23.42  ? 288  GLY A N     1 
ATOM   5238  C  CA    . GLY G 4 288 ? 25.231 54.864  94.449  1.00 24.59  ? 288  GLY A CA    1 
ATOM   5239  C  C     . GLY G 4 288 ? 24.780 54.399  93.081  1.00 27.23  ? 288  GLY A C     1 
ATOM   5240  O  O     . GLY G 4 288 ? 24.406 55.210  92.227  1.00 27.65  ? 288  GLY A O     1 
ATOM   5241  N  N     . HIS G 4 289 ? 24.796 53.095  92.856  1.00 28.99  ? 289  HIS A N     1 
ATOM   5242  C  CA    . HIS G 4 289 ? 24.422 52.604  91.550  1.00 29.78  ? 289  HIS A CA    1 
ATOM   5243  C  C     . HIS G 4 289 ? 23.056 52.078  91.475  1.00 28.57  ? 289  HIS A C     1 
ATOM   5244  O  O     . HIS G 4 289 ? 22.587 51.785  90.389  1.00 30.10  ? 289  HIS A O     1 
ATOM   5245  C  CB    . HIS G 4 289 ? 25.371 51.510  91.084  1.00 34.44  ? 289  HIS A CB    1 
ATOM   5246  C  CG    . HIS G 4 289 ? 26.369 51.990  90.090  1.00 39.88  ? 289  HIS A CG    1 
ATOM   5247  N  ND1   . HIS G 4 289 ? 26.342 51.601  88.771  1.00 42.99  ? 289  HIS A ND1   1 
ATOM   5248  C  CD2   . HIS G 4 289 ? 27.342 52.928  90.189  1.00 41.53  ? 289  HIS A CD2   1 
ATOM   5249  C  CE1   . HIS G 4 289 ? 27.251 52.287  88.096  1.00 45.08  ? 289  HIS A CE1   1 
ATOM   5250  N  NE2   . HIS G 4 289 ? 27.869 53.101  88.934  1.00 43.27  ? 289  HIS A NE2   1 
ATOM   5251  N  N     . SER G 4 290 ? 22.407 51.952  92.619  1.00 25.78  ? 290  SER A N     1 
ATOM   5252  C  CA    . SER G 4 290 ? 21.081 51.388  92.646  1.00 22.64  ? 290  SER A CA    1 
ATOM   5253  C  C     . SER G 4 290 ? 20.136 52.000  91.637  1.00 22.46  ? 290  SER A C     1 
ATOM   5254  O  O     . SER G 4 290 ? 19.443 51.279  90.952  1.00 23.42  ? 290  SER A O     1 
ATOM   5255  C  CB    . SER G 4 290 ? 20.518 51.498  94.037  1.00 21.27  ? 290  SER A CB    1 
ATOM   5256  O  OG    . SER G 4 290 ? 21.475 51.060  94.980  1.00 19.45  ? 290  SER A OG    1 
ATOM   5257  N  N     . ALA G 4 291 ? 20.121 53.316  91.493  1.00 22.48  ? 291  ALA A N     1 
ATOM   5258  C  CA    . ALA G 4 291 ? 19.196 53.920  90.543  1.00 22.14  ? 291  ALA A CA    1 
ATOM   5259  C  C     . ALA G 4 291 ? 19.531 53.601  89.078  1.00 22.34  ? 291  ALA A C     1 
ATOM   5260  O  O     . ALA G 4 291 ? 18.648 53.237  88.303  1.00 22.71  ? 291  ALA A O     1 
ATOM   5261  C  CB    . ALA G 4 291 ? 19.135 55.418  90.770  1.00 21.55  ? 291  ALA A CB    1 
ATOM   5262  N  N     . ARG G 4 292 ? 20.792 53.747  88.682  1.00 21.96  ? 292  ARG A N     1 
ATOM   5263  C  CA    . ARG G 4 292 ? 21.170 53.430  87.314  1.00 21.69  ? 292  ARG A CA    1 
ATOM   5264  C  C     . ARG G 4 292 ? 20.687 51.995  87.037  1.00 23.04  ? 292  ARG A C     1 
ATOM   5265  O  O     . ARG G 4 292 ? 20.017 51.741  86.051  1.00 26.00  ? 292  ARG A O     1 
ATOM   5266  C  CB    . ARG G 4 292 ? 22.687 53.489  87.144  1.00 20.58  ? 292  ARG A CB    1 
ATOM   5267  C  CG    . ARG G 4 292 ? 23.313 54.867  87.220  1.00 21.37  ? 292  ARG A CG    1 
ATOM   5268  C  CD    . ARG G 4 292 ? 24.863 54.823  87.162  1.00 21.30  ? 292  ARG A CD    1 
ATOM   5269  N  NE    . ARG G 4 292 ? 25.434 54.359  85.884  1.00 22.03  ? 292  ARG A NE    1 
ATOM   5270  C  CZ    . ARG G 4 292 ? 25.278 54.997  84.731  1.00 19.90  ? 292  ARG A CZ    1 
ATOM   5271  N  NH1   . ARG G 4 292 ? 24.580 56.114  84.691  1.00 18.30  ? 292  ARG A NH1   1 
ATOM   5272  N  NH2   . ARG G 4 292 ? 25.795 54.523  83.622  1.00 18.52  ? 292  ARG A NH2   1 
ATOM   5273  N  N     . VAL G 4 293 ? 21.015 51.051  87.916  1.00 21.71  ? 293  VAL A N     1 
ATOM   5274  C  CA    . VAL G 4 293 ? 20.623 49.659  87.731  1.00 18.82  ? 293  VAL A CA    1 
ATOM   5275  C  C     . VAL G 4 293 ? 19.136 49.547  87.698  1.00 17.58  ? 293  VAL A C     1 
ATOM   5276  O  O     . VAL G 4 293 ? 18.600 48.882  86.842  1.00 18.72  ? 293  VAL A O     1 
ATOM   5277  C  CB    . VAL G 4 293 ? 21.153 48.774  88.860  1.00 18.98  ? 293  VAL A CB    1 
ATOM   5278  C  CG1   . VAL G 4 293 ? 20.667 47.361  88.708  1.00 17.54  ? 293  VAL A CG1   1 
ATOM   5279  C  CG2   . VAL G 4 293 ? 22.650 48.794  88.842  1.00 18.94  ? 293  VAL A CG2   1 
ATOM   5280  N  N     . GLY G 4 294 ? 18.462 50.197  88.630  1.00 15.86  ? 294  GLY A N     1 
ATOM   5281  C  CA    . GLY G 4 294 ? 17.013 50.143  88.640  1.00 16.47  ? 294  GLY A CA    1 
ATOM   5282  C  C     . GLY G 4 294 ? 16.460 50.670  87.330  1.00 16.35  ? 294  GLY A C     1 
ATOM   5283  O  O     . GLY G 4 294 ? 15.888 49.920  86.541  1.00 15.50  ? 294  GLY A O     1 
ATOM   5284  N  N     . ALA G 4 295 ? 16.643 51.963  87.088  1.00 16.94  ? 295  ALA A N     1 
ATOM   5285  C  CA    . ALA G 4 295 ? 16.175 52.586  85.868  1.00 16.75  ? 295  ALA A CA    1 
ATOM   5286  C  C     . ALA G 4 295 ? 16.452 51.715  84.653  1.00 18.33  ? 295  ALA A C     1 
ATOM   5287  O  O     . ALA G 4 295 ? 15.638 51.608  83.753  1.00 18.12  ? 295  ALA A O     1 
ATOM   5288  C  CB    . ALA G 4 295 ? 16.826 53.896  85.710  1.00 15.12  ? 295  ALA A CB    1 
ATOM   5289  N  N     . ALA G 4 296 ? 17.606 51.080  84.617  1.00 19.78  ? 296  ALA A N     1 
ATOM   5290  C  CA    . ALA G 4 296 ? 17.918 50.211  83.494  1.00 22.13  ? 296  ALA A CA    1 
ATOM   5291  C  C     . ALA G 4 296 ? 16.870 49.104  83.391  1.00 23.37  ? 296  ALA A C     1 
ATOM   5292  O  O     . ALA G 4 296 ? 16.346 48.819  82.318  1.00 23.14  ? 296  ALA A O     1 
ATOM   5293  C  CB    . ALA G 4 296 ? 19.291 49.609  83.657  1.00 21.25  ? 296  ALA A CB    1 
ATOM   5294  N  N     . ARG G 4 297 ? 16.541 48.483  84.507  1.00 25.15  ? 297  ARG A N     1 
ATOM   5295  C  CA    . ARG G 4 297 ? 15.554 47.430  84.434  1.00 27.09  ? 297  ARG A CA    1 
ATOM   5296  C  C     . ARG G 4 297 ? 14.184 47.957  84.105  1.00 28.02  ? 297  ARG A C     1 
ATOM   5297  O  O     . ARG G 4 297 ? 13.478 47.344  83.342  1.00 29.56  ? 297  ARG A O     1 
ATOM   5298  C  CB    . ARG G 4 297 ? 15.485 46.652  85.730  1.00 26.01  ? 297  ARG A CB    1 
ATOM   5299  C  CG    . ARG G 4 297 ? 16.801 46.083  86.129  1.00 25.11  ? 297  ARG A CG    1 
ATOM   5300  C  CD    . ARG G 4 297 ? 16.709 45.676  87.553  1.00 26.28  ? 297  ARG A CD    1 
ATOM   5301  N  NE    . ARG G 4 297 ? 15.907 44.487  87.673  1.00 26.47  ? 297  ARG A NE    1 
ATOM   5302  C  CZ    . ARG G 4 297 ? 16.435 43.282  87.647  1.00 28.27  ? 297  ARG A CZ    1 
ATOM   5303  N  NH1   . ARG G 4 297 ? 17.759 43.147  87.522  1.00 28.75  ? 297  ARG A NH1   1 
ATOM   5304  N  NH2   . ARG G 4 297 ? 15.648 42.224  87.719  1.00 29.03  ? 297  ARG A NH2   1 
ATOM   5305  N  N     . ASP G 4 298 ? 13.799 49.094  84.661  1.00 29.12  ? 298  ASP A N     1 
ATOM   5306  C  CA    . ASP G 4 298 ? 12.467 49.604  84.381  1.00 30.04  ? 298  ASP A CA    1 
ATOM   5307  C  C     . ASP G 4 298 ? 12.302 49.872  82.907  1.00 29.27  ? 298  ASP A C     1 
ATOM   5308  O  O     . ASP G 4 298 ? 11.265 49.586  82.324  1.00 28.49  ? 298  ASP A O     1 
ATOM   5309  C  CB    . ASP G 4 298 ? 12.174 50.898  85.150  1.00 33.29  ? 298  ASP A CB    1 
ATOM   5310  C  CG    . ASP G 4 298 ? 11.895 50.676  86.647  1.00 36.29  ? 298  ASP A CG    1 
ATOM   5311  O  OD1   . ASP G 4 298 ? 11.184 49.693  87.036  1.00 37.70  ? 298  ASP A OD1   1 
ATOM   5312  O  OD2   . ASP G 4 298 ? 12.380 51.531  87.429  1.00 35.85  ? 298  ASP A OD2   1 
ATOM   5313  N  N     . MET G 4 299 ? 13.327 50.432  82.294  1.00 29.06  ? 299  MET A N     1 
ATOM   5314  C  CA    . MET G 4 299 ? 13.231 50.722  80.874  1.00 29.68  ? 299  MET A CA    1 
ATOM   5315  C  C     . MET G 4 299 ? 13.092 49.434  80.044  1.00 28.80  ? 299  MET A C     1 
ATOM   5316  O  O     . MET G 4 299 ? 12.307 49.365  79.097  1.00 27.91  ? 299  MET A O     1 
ATOM   5317  C  CB    . MET G 4 299 ? 14.440 51.540  80.432  1.00 29.69  ? 299  MET A CB    1 
ATOM   5318  C  CG    . MET G 4 299 ? 14.281 52.998  80.719  1.00 31.07  ? 299  MET A CG    1 
ATOM   5319  S  SD    . MET G 4 299 ? 15.784 53.917  80.483  1.00 35.82  ? 299  MET A SD    1 
ATOM   5320  C  CE    . MET G 4 299 ? 16.101 53.625  78.740  1.00 34.70  ? 299  MET A CE    1 
ATOM   5321  N  N     . ALA G 4 300 ? 13.848 48.411  80.407  1.00 27.15  ? 300  ALA A N     1 
ATOM   5322  C  CA    . ALA G 4 300 ? 13.755 47.174  79.694  1.00 25.79  ? 300  ALA A CA    1 
ATOM   5323  C  C     . ALA G 4 300 ? 12.344 46.657  79.812  1.00 26.42  ? 300  ALA A C     1 
ATOM   5324  O  O     . ALA G 4 300 ? 11.721 46.315  78.828  1.00 25.24  ? 300  ALA A O     1 
ATOM   5325  C  CB    . ALA G 4 300 ? 14.695 46.194  80.276  1.00 25.60  ? 300  ALA A CB    1 
ATOM   5326  N  N     . ARG G 4 301 ? 11.832 46.614  81.033  1.00 29.41  ? 301  ARG A N     1 
ATOM   5327  C  CA    . ARG G 4 301 ? 10.497 46.090  81.281  1.00 31.22  ? 301  ARG A CA    1 
ATOM   5328  C  C     . ARG G 4 301 ? 9.422  46.826  80.539  1.00 33.14  ? 301  ARG A C     1 
ATOM   5329  O  O     . ARG G 4 301 ? 8.339  46.301  80.317  1.00 34.96  ? 301  ARG A O     1 
ATOM   5330  C  CB    . ARG G 4 301 ? 10.151 46.115  82.763  1.00 30.23  ? 301  ARG A CB    1 
ATOM   5331  C  CG    . ARG G 4 301 ? 10.841 45.096  83.645  1.00 29.25  ? 301  ARG A CG    1 
ATOM   5332  C  CD    . ARG G 4 301 ? 10.192 45.173  85.009  1.00 30.93  ? 301  ARG A CD    1 
ATOM   5333  N  NE    . ARG G 4 301 ? 10.806 44.293  85.993  1.00 32.75  ? 301  ARG A NE    1 
ATOM   5334  C  CZ    . ARG G 4 301 ? 11.698 44.691  86.899  1.00 34.66  ? 301  ARG A CZ    1 
ATOM   5335  N  NH1   . ARG G 4 301 ? 12.083 45.967  86.931  1.00 34.77  ? 301  ARG A NH1   1 
ATOM   5336  N  NH2   . ARG G 4 301 ? 12.189 43.821  87.789  1.00 34.56  ? 301  ARG A NH2   1 
ATOM   5337  N  N     . ALA G 4 302 ? 9.689  48.045  80.139  1.00 35.17  ? 302  ALA A N     1 
ATOM   5338  C  CA    . ALA G 4 302 ? 8.641  48.730  79.429  1.00 37.06  ? 302  ALA A CA    1 
ATOM   5339  C  C     . ALA G 4 302 ? 8.868  48.820  77.925  1.00 37.73  ? 302  ALA A C     1 
ATOM   5340  O  O     . ALA G 4 302 ? 8.310  49.702  77.268  1.00 39.30  ? 302  ALA A O     1 
ATOM   5341  C  CB    . ALA G 4 302 ? 8.446  50.093  80.016  1.00 37.97  ? 302  ALA A CB    1 
ATOM   5342  N  N     . GLY G 4 303 ? 9.675  47.912  77.383  1.00 36.98  ? 303  GLY A N     1 
ATOM   5343  C  CA    . GLY G 4 303 ? 9.945  47.913  75.952  1.00 37.02  ? 303  GLY A CA    1 
ATOM   5344  C  C     . GLY G 4 303 ? 10.683 49.126  75.403  1.00 37.52  ? 303  GLY A C     1 
ATOM   5345  O  O     . GLY G 4 303 ? 10.095 49.991  74.740  1.00 39.00  ? 303  GLY A O     1 
ATOM   5346  N  N     . VAL G 4 304 ? 11.980 49.192  75.674  1.00 36.24  ? 304  VAL A N     1 
ATOM   5347  C  CA    . VAL G 4 304 ? 12.814 50.288  75.214  1.00 35.79  ? 304  VAL A CA    1 
ATOM   5348  C  C     . VAL G 4 304 ? 14.056 49.688  74.533  1.00 35.64  ? 304  VAL A C     1 
ATOM   5349  O  O     . VAL G 4 304 ? 14.693 48.783  75.057  1.00 35.14  ? 304  VAL A O     1 
ATOM   5350  C  CB    . VAL G 4 304 ? 13.149 51.210  76.405  1.00 35.35  ? 304  VAL A CB    1 
ATOM   5351  C  CG1   . VAL G 4 304 ? 14.323 52.079  76.091  1.00 36.95  ? 304  VAL A CG1   1 
ATOM   5352  C  CG2   . VAL G 4 304 ? 11.949 52.090  76.715  1.00 33.20  ? 304  VAL A CG2   1 
ATOM   5353  N  N     . SER G 4 305 ? 14.366 50.170  73.334  1.00 35.64  ? 305  SER A N     1 
ATOM   5354  C  CA    . SER G 4 305 ? 15.487 49.656  72.556  1.00 36.53  ? 305  SER A CA    1 
ATOM   5355  C  C     . SER G 4 305 ? 16.805 49.787  73.263  1.00 35.92  ? 305  SER A C     1 
ATOM   5356  O  O     . SER G 4 305 ? 17.087 50.815  73.856  1.00 36.71  ? 305  SER A O     1 
ATOM   5357  C  CB    . SER G 4 305 ? 15.560 50.376  71.217  1.00 38.31  ? 305  SER A CB    1 
ATOM   5358  O  OG    . SER G 4 305 ? 15.338 51.765  71.375  1.00 42.19  ? 305  SER A OG    1 
ATOM   5359  N  N     . ILE G 4 306 ? 17.634 48.761  73.180  1.00 35.70  ? 306  ILE A N     1 
ATOM   5360  C  CA    . ILE G 4 306 ? 18.902 48.827  73.856  1.00 35.82  ? 306  ILE A CA    1 
ATOM   5361  C  C     . ILE G 4 306 ? 19.677 50.091  73.530  1.00 37.00  ? 306  ILE A C     1 
ATOM   5362  O  O     . ILE G 4 306 ? 20.479 50.545  74.333  1.00 38.70  ? 306  ILE A O     1 
ATOM   5363  C  CB    . ILE G 4 306 ? 19.718 47.614  73.553  1.00 35.00  ? 306  ILE A CB    1 
ATOM   5364  C  CG1   . ILE G 4 306 ? 18.861 46.389  73.805  1.00 35.68  ? 306  ILE A CG1   1 
ATOM   5365  C  CG2   . ILE G 4 306 ? 20.911 47.533  74.471  1.00 33.47  ? 306  ILE A CG2   1 
ATOM   5366  C  CD1   . ILE G 4 306 ? 18.335 46.296  75.209  1.00 36.89  ? 306  ILE A CD1   1 
ATOM   5367  N  N     . PRO G 4 307 ? 19.471 50.683  72.349  1.00 38.18  ? 307  PRO A N     1 
ATOM   5368  C  CA    . PRO G 4 307 ? 20.233 51.912  72.084  1.00 39.20  ? 307  PRO A CA    1 
ATOM   5369  C  C     . PRO G 4 307 ? 19.636 53.022  72.905  1.00 38.85  ? 307  PRO A C     1 
ATOM   5370  O  O     . PRO G 4 307 ? 20.326 53.758  73.573  1.00 39.50  ? 307  PRO A O     1 
ATOM   5371  C  CB    . PRO G 4 307 ? 19.999 52.161  70.616  1.00 38.41  ? 307  PRO A CB    1 
ATOM   5372  C  CG    . PRO G 4 307 ? 19.830 50.800  70.093  1.00 40.14  ? 307  PRO A CG    1 
ATOM   5373  C  CD    . PRO G 4 307 ? 18.947 50.129  71.096  1.00 39.32  ? 307  PRO A CD    1 
ATOM   5374  N  N     . GLU G 4 308 ? 18.326 53.127  72.856  1.00 39.52  ? 308  GLU A N     1 
ATOM   5375  C  CA    . GLU G 4 308 ? 17.655 54.161  73.596  1.00 41.10  ? 308  GLU A CA    1 
ATOM   5376  C  C     . GLU G 4 308 ? 18.000 54.084  75.080  1.00 40.11  ? 308  GLU A C     1 
ATOM   5377  O  O     . GLU G 4 308 ? 18.158 55.130  75.721  1.00 41.09  ? 308  GLU A O     1 
ATOM   5378  C  CB    . GLU G 4 308 ? 16.158 54.051  73.366  1.00 44.44  ? 308  GLU A CB    1 
ATOM   5379  C  CG    . GLU G 4 308 ? 15.456 55.381  73.302  1.00 50.60  ? 308  GLU A CG    1 
ATOM   5380  C  CD    . GLU G 4 308 ? 14.014 55.252  72.836  1.00 55.91  ? 308  GLU A CD    1 
ATOM   5381  O  OE1   . GLU G 4 308 ? 13.287 56.274  72.937  1.00 59.66  ? 308  GLU A OE1   1 
ATOM   5382  O  OE2   . GLU G 4 308 ? 13.608 54.143  72.372  1.00 56.62  ? 308  GLU A OE2   1 
ATOM   5383  N  N     . ILE G 4 309 ? 18.114 52.862  75.614  1.00 37.78  ? 309  ILE A N     1 
ATOM   5384  C  CA    . ILE G 4 309 ? 18.480 52.623  77.013  1.00 35.61  ? 309  ILE A CA    1 
ATOM   5385  C  C     . ILE G 4 309 ? 19.914 53.095  77.253  1.00 35.58  ? 309  ILE A C     1 
ATOM   5386  O  O     . ILE G 4 309 ? 20.164 53.916  78.121  1.00 35.80  ? 309  ILE A O     1 
ATOM   5387  C  CB    . ILE G 4 309 ? 18.497 51.141  77.352  1.00 34.57  ? 309  ILE A CB    1 
ATOM   5388  C  CG1   . ILE G 4 309 ? 17.095 50.578  77.463  1.00 34.39  ? 309  ILE A CG1   1 
ATOM   5389  C  CG2   . ILE G 4 309 ? 19.257 50.916  78.624  1.00 34.61  ? 309  ILE A CG2   1 
ATOM   5390  C  CD1   . ILE G 4 309 ? 17.110 49.071  77.838  1.00 32.16  ? 309  ILE A CD1   1 
ATOM   5391  N  N     . MET G 4 310 ? 20.856 52.542  76.487  1.00 33.93  ? 310  MET A N     1 
ATOM   5392  C  CA    . MET G 4 310 ? 22.260 52.888  76.607  1.00 32.54  ? 310  MET A CA    1 
ATOM   5393  C  C     . MET G 4 310 ? 22.496 54.383  76.574  1.00 33.98  ? 310  MET A C     1 
ATOM   5394  O  O     . MET G 4 310 ? 23.331 54.902  77.303  1.00 36.44  ? 310  MET A O     1 
ATOM   5395  C  CB    . MET G 4 310 ? 23.051 52.221  75.508  1.00 29.97  ? 310  MET A CB    1 
ATOM   5396  C  CG    . MET G 4 310 ? 23.154 50.773  75.754  1.00 32.45  ? 310  MET A CG    1 
ATOM   5397  S  SD    . MET G 4 310 ? 23.853 49.731  74.448  1.00 40.03  ? 310  MET A SD    1 
ATOM   5398  C  CE    . MET G 4 310 ? 25.614 49.925  74.654  1.00 38.55  ? 310  MET A CE    1 
ATOM   5399  N  N     . GLN G 4 311 ? 21.775 55.111  75.744  1.00 34.62  ? 311  GLN A N     1 
ATOM   5400  C  CA    . GLN G 4 311 ? 22.033 56.520  75.739  1.00 34.76  ? 311  GLN A CA    1 
ATOM   5401  C  C     . GLN G 4 311 ? 21.441 57.142  76.964  1.00 35.35  ? 311  GLN A C     1 
ATOM   5402  O  O     . GLN G 4 311 ? 21.905 58.163  77.424  1.00 36.21  ? 311  GLN A O     1 
ATOM   5403  C  CB    . GLN G 4 311 ? 21.467 57.197  74.506  1.00 34.59  ? 311  GLN A CB    1 
ATOM   5404  C  CG    . GLN G 4 311 ? 21.498 58.712  74.631  1.00 36.18  ? 311  GLN A CG    1 
ATOM   5405  C  CD    . GLN G 4 311 ? 20.233 59.277  75.310  1.00 39.87  ? 311  GLN A CD    1 
ATOM   5406  O  OE1   . GLN G 4 311 ? 20.221 60.436  75.735  1.00 39.86  ? 311  GLN A OE1   1 
ATOM   5407  N  NE2   . GLN G 4 311 ? 19.153 58.459  75.394  1.00 40.64  ? 311  GLN A NE2   1 
ATOM   5408  N  N     . ALA G 4 312 ? 20.402 56.544  77.508  1.00 36.40  ? 312  ALA A N     1 
ATOM   5409  C  CA    . ALA G 4 312 ? 19.789 57.154  78.672  1.00 37.48  ? 312  ALA A CA    1 
ATOM   5410  C  C     . ALA G 4 312 ? 20.755 57.110  79.837  1.00 38.42  ? 312  ALA A C     1 
ATOM   5411  O  O     . ALA G 4 312 ? 20.742 57.983  80.710  1.00 39.29  ? 312  ALA A O     1 
ATOM   5412  C  CB    . ALA G 4 312 ? 18.502 56.438  79.023  1.00 37.03  ? 312  ALA A CB    1 
ATOM   5413  N  N     . GLY G 4 313 ? 21.622 56.105  79.827  1.00 38.96  ? 313  GLY A N     1 
ATOM   5414  C  CA    . GLY G 4 313 ? 22.560 55.946  80.920  1.00 40.44  ? 313  GLY A CA    1 
ATOM   5415  C  C     . GLY G 4 313 ? 23.942 56.488  80.663  1.00 41.22  ? 313  GLY A C     1 
ATOM   5416  O  O     . GLY G 4 313 ? 24.611 56.981  81.580  1.00 42.36  ? 313  GLY A O     1 
ATOM   5417  N  N     . GLY G 4 314 ? 24.370 56.407  79.413  1.00 41.15  ? 314  GLY A N     1 
ATOM   5418  C  CA    . GLY G 4 314 ? 25.684 56.894  79.080  1.00 40.89  ? 314  GLY A CA    1 
ATOM   5419  C  C     . GLY G 4 314 ? 26.523 55.691  78.792  1.00 40.41  ? 314  GLY A C     1 
ATOM   5420  O  O     . GLY G 4 314 ? 27.711 55.771  78.505  1.00 41.76  ? 314  GLY A O     1 
ATOM   5421  N  N     . TRP G 4 315 ? 25.893 54.541  78.878  1.00 40.51  ? 315  TRP A N     1 
ATOM   5422  C  CA    . TRP G 4 315 ? 26.615 53.327  78.606  1.00 41.54  ? 315  TRP A CA    1 
ATOM   5423  C  C     . TRP G 4 315 ? 27.076 53.402  77.177  1.00 42.78  ? 315  TRP A C     1 
ATOM   5424  O  O     . TRP G 4 315 ? 26.683 54.294  76.444  1.00 42.09  ? 315  TRP A O     1 
ATOM   5425  C  CB    . TRP G 4 315 ? 25.719 52.136  78.859  1.00 38.45  ? 315  TRP A CB    1 
ATOM   5426  C  CG    . TRP G 4 315 ? 25.531 51.930  80.303  1.00 35.22  ? 315  TRP A CG    1 
ATOM   5427  C  CD1   . TRP G 4 315 ? 26.471 51.530  81.180  1.00 33.84  ? 315  TRP A CD1   1 
ATOM   5428  C  CD2   . TRP G 4 315 ? 24.328 52.098  81.045  1.00 34.77  ? 315  TRP A CD2   1 
ATOM   5429  N  NE1   . TRP G 4 315 ? 25.937 51.428  82.424  1.00 34.84  ? 315  TRP A NE1   1 
ATOM   5430  C  CE2   . TRP G 4 315 ? 24.616 51.774  82.371  1.00 34.79  ? 315  TRP A CE2   1 
ATOM   5431  C  CE3   . TRP G 4 315 ? 23.033 52.484  80.713  1.00 35.02  ? 315  TRP A CE3   1 
ATOM   5432  C  CZ2   . TRP G 4 315 ? 23.661 51.821  83.375  1.00 34.81  ? 315  TRP A CZ2   1 
ATOM   5433  C  CZ3   . TRP G 4 315 ? 22.085 52.528  81.705  1.00 36.02  ? 315  TRP A CZ3   1 
ATOM   5434  C  CH2   . TRP G 4 315 ? 22.402 52.198  83.023  1.00 35.75  ? 315  TRP A CH2   1 
ATOM   5435  N  N     . THR G 4 316 ? 27.924 52.475  76.782  1.00 45.26  ? 316  THR A N     1 
ATOM   5436  C  CA    . THR G 4 316 ? 28.447 52.502  75.437  1.00 48.28  ? 316  THR A CA    1 
ATOM   5437  C  C     . THR G 4 316 ? 28.868 51.092  75.125  1.00 49.92  ? 316  THR A C     1 
ATOM   5438  O  O     . THR G 4 316 ? 29.421 50.815  74.067  1.00 50.78  ? 316  THR A O     1 
ATOM   5439  C  CB    . THR G 4 316 ? 29.670 53.429  75.383  1.00 49.24  ? 316  THR A CB    1 
ATOM   5440  O  OG1   . THR G 4 316 ? 30.528 53.056  74.302  1.00 49.70  ? 316  THR A OG1   1 
ATOM   5441  C  CG2   . THR G 4 316 ? 30.457 53.324  76.687  1.00 52.39  ? 316  THR A CG2   1 
ATOM   5442  N  N     . ASN G 4 317 ? 28.593 50.186  76.049  1.00 51.10  ? 317  ASN A N     1 
ATOM   5443  C  CA    . ASN G 4 317 ? 28.989 48.816  75.835  1.00 52.37  ? 317  ASN A CA    1 
ATOM   5444  C  C     . ASN G 4 317 ? 27.958 47.804  76.295  1.00 51.13  ? 317  ASN A C     1 
ATOM   5445  O  O     . ASN G 4 317 ? 28.052 47.276  77.383  1.00 51.64  ? 317  ASN A O     1 
ATOM   5446  C  CB    . ASN G 4 317 ? 30.314 48.582  76.547  1.00 56.98  ? 317  ASN A CB    1 
ATOM   5447  C  CG    . ASN G 4 317 ? 31.271 47.772  75.711  1.00 61.74  ? 317  ASN A CG    1 
ATOM   5448  O  OD1   . ASN G 4 317 ? 31.010 46.594  75.418  1.00 63.34  ? 317  ASN A OD1   1 
ATOM   5449  N  ND2   . ASN G 4 317 ? 32.386 48.399  75.297  1.00 65.02  ? 317  ASN A ND2   1 
ATOM   5450  N  N     . VAL G 4 318 ? 26.979 47.523  75.458  1.00 49.42  ? 318  VAL A N     1 
ATOM   5451  C  CA    . VAL G 4 318 ? 25.940 46.571  75.797  1.00 48.64  ? 318  VAL A CA    1 
ATOM   5452  C  C     . VAL G 4 318 ? 26.300 45.549  76.853  1.00 48.21  ? 318  VAL A C     1 
ATOM   5453  O  O     . VAL G 4 318 ? 25.497 45.252  77.725  1.00 48.46  ? 318  VAL A O     1 
ATOM   5454  C  CB    . VAL G 4 318 ? 25.524 45.795  74.590  1.00 48.01  ? 318  VAL A CB    1 
ATOM   5455  C  CG1   . VAL G 4 318 ? 25.045 46.747  73.513  1.00 48.22  ? 318  VAL A CG1   1 
ATOM   5456  C  CG2   . VAL G 4 318 ? 26.684 44.972  74.117  1.00 48.09  ? 318  VAL A CG2   1 
ATOM   5457  N  N     . ASN G 4 319 ? 27.502 44.997  76.783  1.00 48.82  ? 319  ASN A N     1 
ATOM   5458  C  CA    . ASN G 4 319 ? 27.888 43.985  77.766  1.00 49.91  ? 319  ASN A CA    1 
ATOM   5459  C  C     . ASN G 4 319 ? 27.502 44.385  79.189  1.00 47.73  ? 319  ASN A C     1 
ATOM   5460  O  O     . ASN G 4 319 ? 27.328 43.526  80.034  1.00 48.60  ? 319  ASN A O     1 
ATOM   5461  C  CB    . ASN G 4 319 ? 29.407 43.623  77.671  1.00 53.03  ? 319  ASN A CB    1 
ATOM   5462  C  CG    . ASN G 4 319 ? 30.336 44.567  78.494  1.00 55.43  ? 319  ASN A CG    1 
ATOM   5463  O  OD1   . ASN G 4 319 ? 30.521 45.749  78.160  1.00 55.24  ? 319  ASN A OD1   1 
ATOM   5464  N  ND2   . ASN G 4 319 ? 30.937 44.022  79.561  1.00 55.57  ? 319  ASN A ND2   1 
ATOM   5465  N  N     . ILE G 4 320 ? 27.341 45.678  79.451  1.00 45.13  ? 320  ILE A N     1 
ATOM   5466  C  CA    . ILE G 4 320 ? 26.964 46.115  80.782  1.00 42.16  ? 320  ILE A CA    1 
ATOM   5467  C  C     . ILE G 4 320 ? 25.465 46.194  80.951  1.00 41.17  ? 320  ILE A C     1 
ATOM   5468  O  O     . ILE G 4 320 ? 24.912 45.418  81.708  1.00 41.92  ? 320  ILE A O     1 
ATOM   5469  C  CB    . ILE G 4 320 ? 27.546 47.487  81.146  1.00 42.01  ? 320  ILE A CB    1 
ATOM   5470  C  CG1   . ILE G 4 320 ? 29.043 47.512  80.841  1.00 42.18  ? 320  ILE A CG1   1 
ATOM   5471  C  CG2   . ILE G 4 320 ? 27.323 47.768  82.636  1.00 39.54  ? 320  ILE A CG2   1 
ATOM   5472  C  CD1   . ILE G 4 320 ? 29.816 46.395  81.494  1.00 43.55  ? 320  ILE A CD1   1 
ATOM   5473  N  N     . VAL G 4 321 ? 24.781 47.097  80.256  1.00 39.63  ? 321  VAL A N     1 
ATOM   5474  C  CA    . VAL G 4 321 ? 23.340 47.186  80.475  1.00 40.16  ? 321  VAL A CA    1 
ATOM   5475  C  C     . VAL G 4 321 ? 22.637 45.855  80.333  1.00 39.93  ? 321  VAL A C     1 
ATOM   5476  O  O     . VAL G 4 321 ? 21.460 45.723  80.638  1.00 39.51  ? 321  VAL A O     1 
ATOM   5477  C  CB    . VAL G 4 321 ? 22.680 48.228  79.580  1.00 38.74  ? 321  VAL A CB    1 
ATOM   5478  C  CG1   . VAL G 4 321 ? 23.732 49.009  78.924  1.00 39.65  ? 321  VAL A CG1   1 
ATOM   5479  C  CG2   . VAL G 4 321 ? 21.748 47.589  78.588  1.00 38.20  ? 321  VAL A CG2   1 
ATOM   5480  N  N     . MET G 4 322 ? 23.361 44.852  79.882  1.00 41.50  ? 322  MET A N     1 
ATOM   5481  C  CA    . MET G 4 322 ? 22.748 43.556  79.773  1.00 44.52  ? 322  MET A CA    1 
ATOM   5482  C  C     . MET G 4 322 ? 22.906 42.829  81.103  1.00 43.24  ? 322  MET A C     1 
ATOM   5483  O  O     . MET G 4 322 ? 21.993 42.169  81.567  1.00 44.28  ? 322  MET A O     1 
ATOM   5484  C  CB    . MET G 4 322 ? 23.371 42.773  78.622  1.00 48.73  ? 322  MET A CB    1 
ATOM   5485  C  CG    . MET G 4 322 ? 22.950 43.289  77.230  1.00 53.60  ? 322  MET A CG    1 
ATOM   5486  S  SD    . MET G 4 322 ? 21.177 43.034  76.789  1.00 59.40  ? 322  MET A SD    1 
ATOM   5487  C  CE    . MET G 4 322 ? 21.306 41.441  75.759  1.00 57.81  ? 322  MET A CE    1 
ATOM   5488  N  N     . ASN G 4 323 ? 24.060 42.969  81.733  1.00 42.11  ? 323  ASN A N     1 
ATOM   5489  C  CA    . ASN G 4 323 ? 24.301 42.327  83.022  1.00 39.58  ? 323  ASN A CA    1 
ATOM   5490  C  C     . ASN G 4 323 ? 23.314 42.804  84.045  1.00 37.52  ? 323  ASN A C     1 
ATOM   5491  O  O     . ASN G 4 323 ? 23.286 42.287  85.151  1.00 37.87  ? 323  ASN A O     1 
ATOM   5492  C  CB    . ASN G 4 323 ? 25.703 42.647  83.540  1.00 40.50  ? 323  ASN A CB    1 
ATOM   5493  C  CG    . ASN G 4 323 ? 26.646 41.484  83.403  1.00 41.81  ? 323  ASN A CG    1 
ATOM   5494  O  OD1   . ASN G 4 323 ? 26.573 40.709  82.430  1.00 43.03  ? 323  ASN A OD1   1 
ATOM   5495  N  ND2   . ASN G 4 323 ? 27.557 41.354  84.362  1.00 40.77  ? 323  ASN A ND2   1 
ATOM   5496  N  N     . TYR G 4 324 ? 22.525 43.813  83.699  1.00 35.74  ? 324  TYR A N     1 
ATOM   5497  C  CA    . TYR G 4 324 ? 21.549 44.337  84.648  1.00 33.67  ? 324  TYR A CA    1 
ATOM   5498  C  C     . TYR G 4 324 ? 20.198 43.687  84.425  1.00 32.75  ? 324  TYR A C     1 
ATOM   5499  O  O     . TYR G 4 324 ? 19.549 43.215  85.366  1.00 31.93  ? 324  TYR A O     1 
ATOM   5500  C  CB    . TYR G 4 324 ? 21.436 45.864  84.529  1.00 30.95  ? 324  TYR A CB    1 
ATOM   5501  C  CG    . TYR G 4 324 ? 22.643 46.610  85.060  1.00 30.08  ? 324  TYR A CG    1 
ATOM   5502  C  CD1   . TYR G 4 324 ? 23.599 45.970  85.841  1.00 30.79  ? 324  TYR A CD1   1 
ATOM   5503  C  CD2   . TYR G 4 324 ? 22.843 47.940  84.765  1.00 29.39  ? 324  TYR A CD2   1 
ATOM   5504  C  CE1   . TYR G 4 324 ? 24.723 46.643  86.299  1.00 29.50  ? 324  TYR A CE1   1 
ATOM   5505  C  CE2   . TYR G 4 324 ? 23.955 48.615  85.220  1.00 28.53  ? 324  TYR A CE2   1 
ATOM   5506  C  CZ    . TYR G 4 324 ? 24.893 47.969  85.980  1.00 28.33  ? 324  TYR A CZ    1 
ATOM   5507  O  OH    . TYR G 4 324 ? 26.014 48.642  86.410  1.00 27.91  ? 324  TYR A OH    1 
ATOM   5508  N  N     . ILE G 4 325 ? 19.815 43.637  83.160  1.00 31.59  ? 325  ILE A N     1 
ATOM   5509  C  CA    . ILE G 4 325 ? 18.561 43.072  82.756  1.00 31.96  ? 325  ILE A CA    1 
ATOM   5510  C  C     . ILE G 4 325 ? 18.690 41.628  82.303  1.00 35.94  ? 325  ILE A C     1 
ATOM   5511  O  O     . ILE G 4 325 ? 17.881 41.155  81.527  1.00 36.50  ? 325  ILE A O     1 
ATOM   5512  C  CB    . ILE G 4 325 ? 18.002 43.879  81.628  1.00 28.48  ? 325  ILE A CB    1 
ATOM   5513  C  CG1   . ILE G 4 325 ? 18.783 43.603  80.359  1.00 26.15  ? 325  ILE A CG1   1 
ATOM   5514  C  CG2   . ILE G 4 325 ? 18.175 45.317  81.941  1.00 29.33  ? 325  ILE A CG2   1 
ATOM   5515  C  CD1   . ILE G 4 325 ? 18.108 44.076  79.160  1.00 22.69  ? 325  ILE A CD1   1 
ATOM   5516  N  N     . ARG G 4 326 ? 19.690 40.904  82.783  1.00 41.28  ? 326  ARG A N     1 
ATOM   5517  C  CA    . ARG G 4 326 ? 19.842 39.514  82.348  1.00 45.38  ? 326  ARG A CA    1 
ATOM   5518  C  C     . ARG G 4 326 ? 18.727 38.617  82.844  1.00 45.39  ? 326  ARG A C     1 
ATOM   5519  O  O     . ARG G 4 326 ? 18.222 37.794  82.083  1.00 47.30  ? 326  ARG A O     1 
ATOM   5520  C  CB    . ARG G 4 326 ? 21.197 38.927  82.782  1.00 48.55  ? 326  ARG A CB    1 
ATOM   5521  C  CG    . ARG G 4 326 ? 21.562 39.213  84.230  1.00 55.47  ? 326  ARG A CG    1 
ATOM   5522  C  CD    . ARG G 4 326 ? 22.762 38.381  84.737  1.00 61.23  ? 326  ARG A CD    1 
ATOM   5523  N  NE    . ARG G 4 326 ? 23.794 38.147  83.724  1.00 64.58  ? 326  ARG A NE    1 
ATOM   5524  C  CZ    . ARG G 4 326 ? 25.007 37.675  83.995  1.00 66.03  ? 326  ARG A CZ    1 
ATOM   5525  N  NH1   . ARG G 4 326 ? 25.351 37.393  85.253  1.00 65.77  ? 326  ARG A NH1   1 
ATOM   5526  N  NH2   . ARG G 4 326 ? 25.865 37.467  83.001  1.00 66.97  ? 326  ARG A NH2   1 
ATOM   5527  N  N     . ASN G 4 327 ? 18.326 38.778  84.102  1.00 44.97  ? 327  ASN A N     1 
ATOM   5528  C  CA    . ASN G 4 327 ? 17.284 37.928  84.653  1.00 45.36  ? 327  ASN A CA    1 
ATOM   5529  C  C     . ASN G 4 327 ? 15.872 38.438  84.479  1.00 45.26  ? 327  ASN A C     1 
ATOM   5530  O  O     . ASN G 4 327 ? 14.989 38.097  85.260  1.00 44.36  ? 327  ASN A O     1 
ATOM   5531  C  CB    . ASN G 4 327 ? 17.541 37.688  86.119  1.00 46.12  ? 327  ASN A CB    1 
ATOM   5532  C  CG    . ASN G 4 327 ? 17.294 38.901  86.927  1.00 47.37  ? 327  ASN A CG    1 
ATOM   5533  O  OD1   . ASN G 4 327 ? 16.223 39.060  87.507  1.00 48.58  ? 327  ASN A OD1   1 
ATOM   5534  N  ND2   . ASN G 4 327 ? 18.272 39.797  86.956  1.00 48.40  ? 327  ASN A ND2   1 
ATOM   5535  N  N     . LEU G 4 328 ? 15.666 39.270  83.466  1.00 46.19  ? 328  LEU A N     1 
ATOM   5536  C  CA    . LEU G 4 328 ? 14.340 39.784  83.166  1.00 48.09  ? 328  LEU A CA    1 
ATOM   5537  C  C     . LEU G 4 328 ? 13.688 38.698  82.346  1.00 50.74  ? 328  LEU A C     1 
ATOM   5538  O  O     . LEU G 4 328 ? 14.386 37.854  81.798  1.00 52.34  ? 328  LEU A O     1 
ATOM   5539  C  CB    . LEU G 4 328 ? 14.423 41.054  82.338  1.00 45.65  ? 328  LEU A CB    1 
ATOM   5540  C  CG    . LEU G 4 328 ? 14.579 42.301  83.185  1.00 44.27  ? 328  LEU A CG    1 
ATOM   5541  C  CD1   . LEU G 4 328 ? 14.690 43.499  82.295  1.00 43.85  ? 328  LEU A CD1   1 
ATOM   5542  C  CD2   . LEU G 4 328 ? 13.398 42.436  84.096  1.00 44.46  ? 328  LEU A CD2   1 
ATOM   5543  N  N     . ASP G 4 329 ? 12.365 38.694  82.254  1.00 53.38  ? 329  ASP A N     1 
ATOM   5544  C  CA    . ASP G 4 329 ? 11.714 37.654  81.474  1.00 56.13  ? 329  ASP A CA    1 
ATOM   5545  C  C     . ASP G 4 329 ? 11.789 37.980  80.003  1.00 56.51  ? 329  ASP A C     1 
ATOM   5546  O  O     . ASP G 4 329 ? 11.771 37.090  79.155  1.00 56.01  ? 329  ASP A O     1 
ATOM   5547  C  CB    . ASP G 4 329 ? 10.269 37.494  81.908  1.00 58.98  ? 329  ASP A CB    1 
ATOM   5548  C  CG    . ASP G 4 329 ? 10.144 36.749  83.219  1.00 61.90  ? 329  ASP A CG    1 
ATOM   5549  O  OD1   . ASP G 4 329 ? 10.382 35.509  83.234  1.00 60.32  ? 329  ASP A OD1   1 
ATOM   5550  O  OD2   . ASP G 4 329 ? 9.817  37.422  84.232  1.00 65.25  ? 329  ASP A OD2   1 
ATOM   5551  N  N     . SER G 4 330 ? 11.883 39.268  79.707  1.00 57.27  ? 330  SER A N     1 
ATOM   5552  C  CA    . SER G 4 330 ? 11.983 39.723  78.337  1.00 57.75  ? 330  SER A CA    1 
ATOM   5553  C  C     . SER G 4 330 ? 13.280 39.250  77.672  1.00 58.56  ? 330  SER A C     1 
ATOM   5554  O  O     . SER G 4 330 ? 13.491 39.488  76.489  1.00 58.93  ? 330  SER A O     1 
ATOM   5555  C  CB    . SER G 4 330 ? 11.913 41.246  78.310  1.00 58.47  ? 330  SER A CB    1 
ATOM   5556  O  OG    . SER G 4 330 ? 12.368 41.754  77.067  1.00 59.89  ? 330  SER A OG    1 
ATOM   5557  N  N     . GLU G 4 331 ? 14.144 38.574  78.423  1.00 58.91  ? 331  GLU A N     1 
ATOM   5558  C  CA    . GLU G 4 331 ? 15.418 38.102  77.879  1.00 59.33  ? 331  GLU A CA    1 
ATOM   5559  C  C     . GLU G 4 331 ? 15.663 36.639  78.179  1.00 58.44  ? 331  GLU A C     1 
ATOM   5560  O  O     . GLU G 4 331 ? 16.805 36.193  78.155  1.00 59.08  ? 331  GLU A O     1 
ATOM   5561  C  CB    . GLU G 4 331 ? 16.572 38.883  78.491  1.00 60.54  ? 331  GLU A CB    1 
ATOM   5562  C  CG    . GLU G 4 331 ? 16.276 40.335  78.711  1.00 64.58  ? 331  GLU A CG    1 
ATOM   5563  C  CD    . GLU G 4 331 ? 16.502 41.161  77.467  1.00 67.23  ? 331  GLU A CD    1 
ATOM   5564  O  OE1   . GLU G 4 331 ? 17.635 41.084  76.925  1.00 69.24  ? 331  GLU A OE1   1 
ATOM   5565  O  OE2   . GLU G 4 331 ? 15.558 41.885  77.041  1.00 68.23  ? 331  GLU A OE2   1 
ATOM   5566  N  N     . THR G 4 332 ? 14.610 35.892  78.475  1.00 57.15  ? 332  THR A N     1 
ATOM   5567  C  CA    . THR G 4 332 ? 14.784 34.493  78.799  1.00 56.07  ? 332  THR A CA    1 
ATOM   5568  C  C     . THR G 4 332 ? 15.485 33.705  77.698  1.00 55.72  ? 332  THR A C     1 
ATOM   5569  O  O     . THR G 4 332 ? 16.012 32.623  77.952  1.00 56.19  ? 332  THR A O     1 
ATOM   5570  C  CB    . THR G 4 332 ? 13.448 33.838  79.123  1.00 55.71  ? 332  THR A CB    1 
ATOM   5571  O  OG1   . THR G 4 332 ? 12.532 34.046  78.043  1.00 55.89  ? 332  THR A OG1   1 
ATOM   5572  C  CG2   . THR G 4 332 ? 12.881 34.432  80.381  1.00 55.88  ? 332  THR A CG2   1 
ATOM   5573  N  N     . GLY G 4 333 ? 15.507 34.228  76.478  1.00 53.91  ? 333  GLY A N     1 
ATOM   5574  C  CA    . GLY G 4 333 ? 16.185 33.502  75.415  1.00 53.08  ? 333  GLY A CA    1 
ATOM   5575  C  C     . GLY G 4 333 ? 15.282 32.935  74.337  1.00 52.32  ? 333  GLY A C     1 
ATOM   5576  O  O     . GLY G 4 333 ? 14.067 33.140  74.394  1.00 52.79  ? 333  GLY A O     1 
ATOM   5577  N  N     . ALA G 4 334 ? 15.865 32.222  73.365  1.00 50.66  ? 334  ALA A N     1 
ATOM   5578  C  CA    . ALA G 4 334 ? 15.084 31.657  72.259  1.00 49.41  ? 334  ALA A CA    1 
ATOM   5579  C  C     . ALA G 4 334 ? 14.655 30.239  72.486  1.00 48.49  ? 334  ALA A C     1 
ATOM   5580  O  O     . ALA G 4 334 ? 13.557 29.858  72.104  1.00 48.82  ? 334  ALA A O     1 
ATOM   5581  C  CB    . ALA G 4 334 ? 15.856 31.733  70.966  1.00 48.42  ? 334  ALA A CB    1 
ATOM   5582  N  N     . MET G 4 335 ? 15.519 29.440  73.088  1.00 47.35  ? 335  MET A N     1 
ATOM   5583  C  CA    . MET G 4 335 ? 15.146 28.065  73.322  1.00 46.45  ? 335  MET A CA    1 
ATOM   5584  C  C     . MET G 4 335 ? 13.931 27.983  74.230  1.00 45.51  ? 335  MET A C     1 
ATOM   5585  O  O     . MET G 4 335 ? 13.254 26.971  74.266  1.00 45.39  ? 335  MET A O     1 
ATOM   5586  C  CB    . MET G 4 335 ? 16.312 27.289  73.915  1.00 47.21  ? 335  MET A CB    1 
ATOM   5587  C  CG    . MET G 4 335 ? 17.366 26.913  72.906  1.00 48.18  ? 335  MET A CG    1 
ATOM   5588  S  SD    . MET G 4 335 ? 16.682 25.901  71.591  1.00 50.55  ? 335  MET A SD    1 
ATOM   5589  C  CE    . MET G 4 335 ? 16.030 24.519  72.512  1.00 50.68  ? 335  MET A CE    1 
ATOM   5590  N  N     . VAL G 4 336 ? 13.645 29.043  74.971  1.00 44.51  ? 336  VAL A N     1 
ATOM   5591  C  CA    . VAL G 4 336 ? 12.479 29.005  75.829  1.00 43.84  ? 336  VAL A CA    1 
ATOM   5592  C  C     . VAL G 4 336 ? 11.260 29.300  74.981  1.00 45.25  ? 336  VAL A C     1 
ATOM   5593  O  O     . VAL G 4 336 ? 10.210 28.721  75.200  1.00 45.81  ? 336  VAL A O     1 
ATOM   5594  C  CB    . VAL G 4 336 ? 12.586 30.016  76.994  1.00 42.28  ? 336  VAL A CB    1 
ATOM   5595  C  CG1   . VAL G 4 336 ? 11.386 30.938  77.040  1.00 42.96  ? 336  VAL A CG1   1 
ATOM   5596  C  CG2   . VAL G 4 336 ? 12.647 29.280  78.274  1.00 41.27  ? 336  VAL A CG2   1 
ATOM   5597  N  N     . ARG G 4 337 ? 11.396 30.194  74.002  1.00 48.00  ? 337  ARG A N     1 
ATOM   5598  C  CA    . ARG G 4 337 ? 10.269 30.547  73.130  1.00 49.87  ? 337  ARG A CA    1 
ATOM   5599  C  C     . ARG G 4 337 ? 9.803  29.338  72.337  1.00 49.77  ? 337  ARG A C     1 
ATOM   5600  O  O     . ARG G 4 337 ? 8.605  29.163  72.128  1.00 49.98  ? 337  ARG A O     1 
ATOM   5601  C  CB    . ARG G 4 337 ? 10.630 31.694  72.164  1.00 52.46  ? 337  ARG A CB    1 
ATOM   5602  C  CG    . ARG G 4 337 ? 10.418 33.122  72.737  1.00 56.91  ? 337  ARG A CG    1 
ATOM   5603  C  CD    . ARG G 4 337 ? 10.791 34.254  71.747  1.00 59.07  ? 337  ARG A CD    1 
ATOM   5604  N  NE    . ARG G 4 337 ? 12.133 34.091  71.168  1.00 62.43  ? 337  ARG A NE    1 
ATOM   5605  C  CZ    . ARG G 4 337 ? 12.406 33.458  70.021  1.00 63.38  ? 337  ARG A CZ    1 
ATOM   5606  N  NH1   . ARG G 4 337 ? 11.434 32.918  69.285  1.00 64.14  ? 337  ARG A NH1   1 
ATOM   5607  N  NH2   . ARG G 4 337 ? 13.665 33.342  69.619  1.00 62.40  ? 337  ARG A NH2   1 
ATOM   5608  N  N     . LEU G 4 338 ? 10.742 28.500  71.905  1.00 48.63  ? 338  LEU A N     1 
ATOM   5609  C  CA    . LEU G 4 338 ? 10.386 27.306  71.154  1.00 48.59  ? 338  LEU A CA    1 
ATOM   5610  C  C     . LEU G 4 338 ? 9.672  26.321  72.046  1.00 49.47  ? 338  LEU A C     1 
ATOM   5611  O  O     . LEU G 4 338 ? 8.547  25.945  71.775  1.00 50.19  ? 338  LEU A O     1 
ATOM   5612  C  CB    . LEU G 4 338 ? 11.625 26.650  70.550  1.00 47.99  ? 338  LEU A CB    1 
ATOM   5613  C  CG    . LEU G 4 338 ? 12.032 27.180  69.175  1.00 47.11  ? 338  LEU A CG    1 
ATOM   5614  C  CD1   . LEU G 4 338 ? 12.203 28.676  69.243  1.00 48.02  ? 338  LEU A CD1   1 
ATOM   5615  C  CD2   . LEU G 4 338 ? 13.309 26.532  68.733  1.00 46.94  ? 338  LEU A CD2   1 
ATOM   5616  N  N     . LEU G 4 339 ? 10.327 25.904  73.114  1.00 51.91  ? 339  LEU A N     1 
ATOM   5617  C  CA    . LEU G 4 339 ? 9.733  24.969  74.050  1.00 54.32  ? 339  LEU A CA    1 
ATOM   5618  C  C     . LEU G 4 339 ? 8.357  25.406  74.494  1.00 57.68  ? 339  LEU A C     1 
ATOM   5619  O  O     . LEU G 4 339 ? 7.529  24.577  74.836  1.00 58.59  ? 339  LEU A O     1 
ATOM   5620  C  CB    . LEU G 4 339 ? 10.618 24.830  75.275  1.00 52.20  ? 339  LEU A CB    1 
ATOM   5621  C  CG    . LEU G 4 339 ? 11.779 23.885  75.059  1.00 50.76  ? 339  LEU A CG    1 
ATOM   5622  C  CD1   . LEU G 4 339 ? 12.847 24.083  76.104  1.00 49.56  ? 339  LEU A CD1   1 
ATOM   5623  C  CD2   . LEU G 4 339 ? 11.221 22.487  75.082  1.00 50.04  ? 339  LEU A CD2   1 
ATOM   5624  N  N     . GLU G 4 340 ? 8.102  26.706  74.491  1.00 62.32  ? 340  GLU A N     1 
ATOM   5625  C  CA    . GLU G 4 340 ? 6.807  27.195  74.926  1.00 67.56  ? 340  GLU A CA    1 
ATOM   5626  C  C     . GLU G 4 340 ? 5.821  27.516  73.797  1.00 71.25  ? 340  GLU A C     1 
ATOM   5627  O  O     . GLU G 4 340 ? 5.326  28.637  73.708  1.00 71.73  ? 340  GLU A O     1 
ATOM   5628  C  CB    . GLU G 4 340 ? 7.010  28.408  75.840  1.00 67.75  ? 340  GLU A CB    1 
ATOM   5629  C  CG    . GLU G 4 340 ? 7.413  28.032  77.276  1.00 69.95  ? 340  GLU A CG    1 
ATOM   5630  C  CD    . GLU G 4 340 ? 7.744  29.241  78.168  1.00 71.67  ? 340  GLU A CD    1 
ATOM   5631  O  OE1   . GLU G 4 340 ? 7.091  30.306  78.022  1.00 72.24  ? 340  GLU A OE1   1 
ATOM   5632  O  OE2   . GLU G 4 340 ? 8.650  29.114  79.031  1.00 71.90  ? 340  GLU A OE2   1 
ATOM   5633  N  N     . ASP G 4 341 ? 5.524  26.510  72.966  1.00 76.45  ? 341  ASP A N     1 
ATOM   5634  C  CA    . ASP G 4 341 ? 4.595  26.607  71.817  1.00 81.55  ? 341  ASP A CA    1 
ATOM   5635  C  C     . ASP G 4 341 ? 4.482  28.006  71.224  1.00 82.52  ? 341  ASP A C     1 
ATOM   5636  O  O     . ASP G 4 341 ? 3.331  28.425  70.923  1.00 83.13  ? 341  ASP A O     1 
ATOM   5637  C  CB    . ASP G 4 341 ? 3.163  26.146  72.190  1.00 85.95  ? 341  ASP A CB    1 
ATOM   5638  C  CG    . ASP G 4 341 ? 3.074  24.653  72.538  1.00 90.08  ? 341  ASP A CG    1 
ATOM   5639  O  OD1   . ASP G 4 341 ? 3.686  23.825  71.809  1.00 92.31  ? 341  ASP A OD1   1 
ATOM   5640  O  OD2   . ASP G 4 341 ? 2.372  24.315  73.532  1.00 90.58  ? 341  ASP A OD2   1 
ATOM   5641  N  N     . SER H 4 20  ? 69.843 60.706  58.671  1.00 100.06 ? 20   SER B N     1 
ATOM   5642  C  CA    . SER H 4 20  ? 70.602 59.448  58.388  1.00 100.77 ? 20   SER B CA    1 
ATOM   5643  C  C     . SER H 4 20  ? 70.464 59.007  56.932  1.00 101.59 ? 20   SER B C     1 
ATOM   5644  O  O     . SER H 4 20  ? 69.685 59.583  56.181  1.00 101.91 ? 20   SER B O     1 
ATOM   5645  C  CB    . SER H 4 20  ? 70.114 58.325  59.302  1.00 101.02 ? 20   SER B CB    1 
ATOM   5646  O  OG    . SER H 4 20  ? 70.767 57.102  58.994  1.00 101.08 ? 20   SER B OG    1 
ATOM   5647  N  N     . ASP H 4 21  ? 71.210 57.979  56.532  1.00 102.06 ? 21   ASP B N     1 
ATOM   5648  C  CA    . ASP H 4 21  ? 71.157 57.495  55.150  1.00 102.53 ? 21   ASP B CA    1 
ATOM   5649  C  C     . ASP H 4 21  ? 69.866 56.761  54.800  1.00 101.49 ? 21   ASP B C     1 
ATOM   5650  O  O     . ASP H 4 21  ? 69.216 57.106  53.818  1.00 101.47 ? 21   ASP B O     1 
ATOM   5651  C  CB    . ASP H 4 21  ? 72.355 56.587  54.847  1.00 104.91 ? 21   ASP B CB    1 
ATOM   5652  C  CG    . ASP H 4 21  ? 73.174 57.076  53.649  1.00 107.08 ? 21   ASP B CG    1 
ATOM   5653  O  OD1   . ASP H 4 21  ? 74.092 56.337  53.211  1.00 107.38 ? 21   ASP B OD1   1 
ATOM   5654  O  OD2   . ASP H 4 21  ? 72.899 58.201  53.153  1.00 108.09 ? 21   ASP B OD2   1 
ATOM   5655  N  N     . GLU H 4 22  ? 69.504 55.748  55.588  1.00 100.49 ? 22   GLU B N     1 
ATOM   5656  C  CA    . GLU H 4 22  ? 68.271 54.993  55.347  1.00 99.26  ? 22   GLU B CA    1 
ATOM   5657  C  C     . GLU H 4 22  ? 67.064 55.929  55.407  1.00 97.34  ? 22   GLU B C     1 
ATOM   5658  O  O     . GLU H 4 22  ? 66.304 56.032  54.448  1.00 97.29  ? 22   GLU B O     1 
ATOM   5659  C  CB    . GLU H 4 22  ? 68.087 53.891  56.394  1.00 99.90  ? 22   GLU B CB    1 
ATOM   5660  C  CG    . GLU H 4 22  ? 69.181 52.847  56.424  1.00 102.16 ? 22   GLU B CG    1 
ATOM   5661  C  CD    . GLU H 4 22  ? 68.959 51.804  57.517  1.00 104.21 ? 22   GLU B CD    1 
ATOM   5662  O  OE1   . GLU H 4 22  ? 68.789 52.198  58.698  1.00 105.11 ? 22   GLU B OE1   1 
ATOM   5663  O  OE2   . GLU H 4 22  ? 68.959 50.589  57.199  1.00 105.11 ? 22   GLU B OE2   1 
ATOM   5664  N  N     . VAL H 4 23  ? 66.905 56.611  56.539  1.00 95.14  ? 23   VAL B N     1 
ATOM   5665  C  CA    . VAL H 4 23  ? 65.800 57.546  56.762  1.00 92.98  ? 23   VAL B CA    1 
ATOM   5666  C  C     . VAL H 4 23  ? 65.481 58.478  55.583  1.00 92.08  ? 23   VAL B C     1 
ATOM   5667  O  O     . VAL H 4 23  ? 64.377 59.022  55.490  1.00 91.33  ? 23   VAL B O     1 
ATOM   5668  C  CB    . VAL H 4 23  ? 66.077 58.407  58.005  1.00 93.11  ? 23   VAL B CB    1 
ATOM   5669  C  CG1   . VAL H 4 23  ? 64.889 59.321  58.286  1.00 93.34  ? 23   VAL B CG1   1 
ATOM   5670  C  CG2   . VAL H 4 23  ? 66.378 57.505  59.199  1.00 92.18  ? 23   VAL B CG2   1 
ATOM   5671  N  N     . ARG H 4 24  ? 66.454 58.675  54.700  1.00 91.43  ? 24   ARG B N     1 
ATOM   5672  C  CA    . ARG H 4 24  ? 66.270 59.520  53.525  1.00 90.83  ? 24   ARG B CA    1 
ATOM   5673  C  C     . ARG H 4 24  ? 65.628 58.658  52.443  1.00 88.64  ? 24   ARG B C     1 
ATOM   5674  O  O     . ARG H 4 24  ? 65.034 59.167  51.492  1.00 88.49  ? 24   ARG B O     1 
ATOM   5675  C  CB    . ARG H 4 24  ? 67.621 60.075  53.048  1.00 93.65  ? 24   ARG B CB    1 
ATOM   5676  C  CG    . ARG H 4 24  ? 68.016 61.427  53.659  1.00 97.42  ? 24   ARG B CG    1 
ATOM   5677  C  CD    . ARG H 4 24  ? 69.545 61.648  53.628  1.00 101.49 ? 24   ARG B CD    1 
ATOM   5678  N  NE    . ARG H 4 24  ? 69.963 63.045  53.844  1.00 105.27 ? 24   ARG B NE    1 
ATOM   5679  C  CZ    . ARG H 4 24  ? 69.666 63.800  54.910  1.00 107.05 ? 24   ARG B CZ    1 
ATOM   5680  N  NH1   . ARG H 4 24  ? 68.926 63.320  55.909  1.00 108.32 ? 24   ARG B NH1   1 
ATOM   5681  N  NH2   . ARG H 4 24  ? 70.120 65.050  54.983  1.00 107.40 ? 24   ARG B NH2   1 
ATOM   5682  N  N     . LYS H 4 25  ? 65.763 57.344  52.600  1.00 86.14  ? 25   LYS B N     1 
ATOM   5683  C  CA    . LYS H 4 25  ? 65.174 56.384  51.674  1.00 84.13  ? 25   LYS B CA    1 
ATOM   5684  C  C     . LYS H 4 25  ? 63.713 56.203  52.083  1.00 82.91  ? 25   LYS B C     1 
ATOM   5685  O  O     . LYS H 4 25  ? 62.794 56.508  51.318  1.00 83.24  ? 25   LYS B O     1 
ATOM   5686  C  CB    . LYS H 4 25  ? 65.895 55.029  51.753  1.00 84.31  ? 25   LYS B CB    1 
ATOM   5687  C  CG    . LYS H 4 25  ? 65.334 53.947  50.805  1.00 84.44  ? 25   LYS B CG    1 
ATOM   5688  C  CD    . LYS H 4 25  ? 66.117 52.636  50.914  1.00 84.32  ? 25   LYS B CD    1 
ATOM   5689  C  CE    . LYS H 4 25  ? 65.658 51.591  49.894  1.00 84.29  ? 25   LYS B CE    1 
ATOM   5690  N  NZ    . LYS H 4 25  ? 66.489 50.337  49.956  1.00 83.90  ? 25   LYS B NZ    1 
ATOM   5691  N  N     . ASN H 4 26  ? 63.509 55.705  53.299  1.00 80.36  ? 26   ASN B N     1 
ATOM   5692  C  CA    . ASN H 4 26  ? 62.174 55.492  53.827  1.00 77.87  ? 26   ASN B CA    1 
ATOM   5693  C  C     . ASN H 4 26  ? 61.309 56.697  53.549  1.00 76.93  ? 26   ASN B C     1 
ATOM   5694  O  O     . ASN H 4 26  ? 60.176 56.564  53.090  1.00 76.32  ? 26   ASN B O     1 
ATOM   5695  C  CB    . ASN H 4 26  ? 62.242 55.260  55.325  1.00 76.67  ? 26   ASN B CB    1 
ATOM   5696  C  CG    . ASN H 4 26  ? 62.872 53.947  55.668  1.00 76.08  ? 26   ASN B CG    1 
ATOM   5697  O  OD1   . ASN H 4 26  ? 63.728 53.452  54.941  1.00 75.83  ? 26   ASN B OD1   1 
ATOM   5698  N  ND2   . ASN H 4 26  ? 62.462 53.369  56.788  1.00 76.68  ? 26   ASN B ND2   1 
ATOM   5699  N  N     . LEU H 4 27  ? 61.843 57.881  53.818  1.00 76.32  ? 27   LEU B N     1 
ATOM   5700  C  CA    . LEU H 4 27  ? 61.058 59.077  53.593  1.00 76.68  ? 27   LEU B CA    1 
ATOM   5701  C  C     . LEU H 4 27  ? 60.765 59.203  52.122  1.00 77.47  ? 27   LEU B C     1 
ATOM   5702  O  O     . LEU H 4 27  ? 59.701 59.679  51.722  1.00 77.76  ? 27   LEU B O     1 
ATOM   5703  C  CB    . LEU H 4 27  ? 61.774 60.327  54.105  1.00 75.22  ? 27   LEU B CB    1 
ATOM   5704  C  CG    . LEU H 4 27  ? 60.845 61.198  54.963  1.00 73.82  ? 27   LEU B CG    1 
ATOM   5705  C  CD1   . LEU H 4 27  ? 59.574 61.559  54.183  1.00 72.43  ? 27   LEU B CD1   1 
ATOM   5706  C  CD2   . LEU H 4 27  ? 60.481 60.438  56.235  1.00 72.74  ? 27   LEU B CD2   1 
ATOM   5707  N  N     . MET H 4 28  ? 61.707 58.765  51.305  1.00 79.17  ? 28   MET B N     1 
ATOM   5708  C  CA    . MET H 4 28  ? 61.487 58.836  49.878  1.00 80.70  ? 28   MET B CA    1 
ATOM   5709  C  C     . MET H 4 28  ? 60.390 57.842  49.489  1.00 80.70  ? 28   MET B C     1 
ATOM   5710  O  O     . MET H 4 28  ? 59.317 58.262  49.051  1.00 80.79  ? 28   MET B O     1 
ATOM   5711  C  CB    . MET H 4 28  ? 62.799 58.587  49.113  1.00 82.08  ? 28   MET B CB    1 
ATOM   5712  C  CG    . MET H 4 28  ? 63.687 59.844  48.951  1.00 83.78  ? 28   MET B CG    1 
ATOM   5713  S  SD    . MET H 4 28  ? 62.860 61.272  48.110  1.00 86.78  ? 28   MET B SD    1 
ATOM   5714  C  CE    . MET H 4 28  ? 63.401 61.076  46.355  1.00 87.12  ? 28   MET B CE    1 
ATOM   5715  N  N     . ASP H 4 29  ? 60.635 56.542  49.670  1.00 80.67  ? 29   ASP B N     1 
ATOM   5716  C  CA    . ASP H 4 29  ? 59.636 55.524  49.332  1.00 81.22  ? 29   ASP B CA    1 
ATOM   5717  C  C     . ASP H 4 29  ? 58.254 56.074  49.649  1.00 81.22  ? 29   ASP B C     1 
ATOM   5718  O  O     . ASP H 4 29  ? 57.333 55.992  48.833  1.00 80.58  ? 29   ASP B O     1 
ATOM   5719  C  CB    . ASP H 4 29  ? 59.855 54.242  50.143  1.00 82.69  ? 29   ASP B CB    1 
ATOM   5720  C  CG    . ASP H 4 29  ? 61.082 53.453  49.693  1.00 84.41  ? 29   ASP B CG    1 
ATOM   5721  O  OD1   . ASP H 4 29  ? 61.720 53.861  48.695  1.00 85.39  ? 29   ASP B OD1   1 
ATOM   5722  O  OD2   . ASP H 4 29  ? 61.403 52.419  50.339  1.00 84.77  ? 29   ASP B OD2   1 
ATOM   5723  N  N     . MET H 4 30  ? 58.137 56.641  50.846  1.00 81.26  ? 30   MET B N     1 
ATOM   5724  C  CA    . MET H 4 30  ? 56.904 57.239  51.329  1.00 81.39  ? 30   MET B CA    1 
ATOM   5725  C  C     . MET H 4 30  ? 56.369 58.279  50.358  1.00 81.41  ? 30   MET B C     1 
ATOM   5726  O  O     . MET H 4 30  ? 55.306 58.096  49.779  1.00 81.17  ? 30   MET B O     1 
ATOM   5727  C  CB    . MET H 4 30  ? 57.154 57.889  52.683  1.00 83.03  ? 30   MET B CB    1 
ATOM   5728  C  CG    . MET H 4 30  ? 56.435 57.240  53.858  1.00 85.14  ? 30   MET B CG    1 
ATOM   5729  S  SD    . MET H 4 30  ? 54.926 58.132  54.320  1.00 87.71  ? 30   MET B SD    1 
ATOM   5730  C  CE    . MET H 4 30  ? 55.651 59.696  54.890  1.00 87.61  ? 30   MET B CE    1 
ATOM   5731  N  N     . PHE H 4 31  ? 57.096 59.377  50.190  1.00 82.03  ? 31   PHE B N     1 
ATOM   5732  C  CA    . PHE H 4 31  ? 56.664 60.426  49.267  1.00 83.40  ? 31   PHE B CA    1 
ATOM   5733  C  C     . PHE H 4 31  ? 56.425 59.802  47.881  1.00 82.53  ? 31   PHE B C     1 
ATOM   5734  O  O     . PHE H 4 31  ? 55.552 60.257  47.131  1.00 81.54  ? 31   PHE B O     1 
ATOM   5735  C  CB    . PHE H 4 31  ? 57.737 61.537  49.189  1.00 86.31  ? 31   PHE B CB    1 
ATOM   5736  C  CG    . PHE H 4 31  ? 57.421 62.671  48.199  1.00 90.28  ? 31   PHE B CG    1 
ATOM   5737  C  CD1   . PHE H 4 31  ? 56.812 63.861  48.632  1.00 91.60  ? 31   PHE B CD1   1 
ATOM   5738  C  CD2   . PHE H 4 31  ? 57.778 62.566  46.838  1.00 91.55  ? 31   PHE B CD2   1 
ATOM   5739  C  CE1   . PHE H 4 31  ? 56.565 64.937  47.727  1.00 92.57  ? 31   PHE B CE1   1 
ATOM   5740  C  CE2   . PHE H 4 31  ? 57.535 63.632  45.926  1.00 92.16  ? 31   PHE B CE2   1 
ATOM   5741  C  CZ    . PHE H 4 31  ? 56.929 64.817  46.377  1.00 92.43  ? 31   PHE B CZ    1 
ATOM   5742  N  N     . ARG H 4 32  ? 57.190 58.751  47.562  1.00 81.83  ? 32   ARG B N     1 
ATOM   5743  C  CA    . ARG H 4 32  ? 57.092 58.071  46.266  1.00 81.28  ? 32   ARG B CA    1 
ATOM   5744  C  C     . ARG H 4 32  ? 55.691 57.577  45.954  1.00 81.55  ? 32   ARG B C     1 
ATOM   5745  O  O     . ARG H 4 32  ? 55.075 58.028  44.987  1.00 82.47  ? 32   ARG B O     1 
ATOM   5746  C  CB    . ARG H 4 32  ? 58.070 56.891  46.179  1.00 80.76  ? 32   ARG B CB    1 
ATOM   5747  C  CG    . ARG H 4 32  ? 57.965 56.118  44.861  1.00 79.35  ? 32   ARG B CG    1 
ATOM   5748  C  CD    . ARG H 4 32  ? 59.173 55.222  44.565  1.00 77.62  ? 32   ARG B CD    1 
ATOM   5749  N  NE    . ARG H 4 32  ? 59.393 54.161  45.550  1.00 75.21  ? 32   ARG B NE    1 
ATOM   5750  C  CZ    . ARG H 4 32  ? 60.251 53.157  45.380  1.00 73.88  ? 32   ARG B CZ    1 
ATOM   5751  N  NH1   . ARG H 4 32  ? 60.962 53.072  44.266  1.00 72.69  ? 32   ARG B NH1   1 
ATOM   5752  N  NH2   . ARG H 4 32  ? 60.418 52.247  46.324  1.00 73.47  ? 32   ARG B NH2   1 
ATOM   5753  N  N     . ASP H 4 33  ? 55.193 56.637  46.752  1.00 81.08  ? 33   ASP B N     1 
ATOM   5754  C  CA    . ASP H 4 33  ? 53.845 56.111  46.550  1.00 79.99  ? 33   ASP B CA    1 
ATOM   5755  C  C     . ASP H 4 33  ? 52.896 56.905  47.437  1.00 79.08  ? 33   ASP B C     1 
ATOM   5756  O  O     . ASP H 4 33  ? 51.978 56.357  48.024  1.00 78.42  ? 33   ASP B O     1 
ATOM   5757  C  CB    . ASP H 4 33  ? 53.794 54.633  46.934  1.00 80.99  ? 33   ASP B CB    1 
ATOM   5758  C  CG    . ASP H 4 33  ? 54.657 53.759  46.036  1.00 82.08  ? 33   ASP B CG    1 
ATOM   5759  O  OD1   . ASP H 4 33  ? 54.395 53.732  44.805  1.00 81.50  ? 33   ASP B OD1   1 
ATOM   5760  O  OD2   . ASP H 4 33  ? 55.589 53.098  46.565  1.00 82.61  ? 33   ASP B OD2   1 
ATOM   5761  N  N     . ARG H 4 34  ? 53.126 58.207  47.531  1.00 78.84  ? 34   ARG B N     1 
ATOM   5762  C  CA    . ARG H 4 34  ? 52.305 59.057  48.373  1.00 78.72  ? 34   ARG B CA    1 
ATOM   5763  C  C     . ARG H 4 34  ? 50.829 58.911  48.065  1.00 76.38  ? 34   ARG B C     1 
ATOM   5764  O  O     . ARG H 4 34  ? 49.981 59.382  48.816  1.00 76.17  ? 34   ARG B O     1 
ATOM   5765  C  CB    . ARG H 4 34  ? 52.723 60.525  48.225  1.00 82.14  ? 34   ARG B CB    1 
ATOM   5766  C  CG    . ARG H 4 34  ? 52.208 61.238  46.980  1.00 87.37  ? 34   ARG B CG    1 
ATOM   5767  C  CD    . ARG H 4 34  ? 52.644 62.712  46.994  1.00 92.84  ? 34   ARG B CD    1 
ATOM   5768  N  NE    . ARG H 4 34  ? 52.203 63.468  45.817  1.00 96.93  ? 34   ARG B NE    1 
ATOM   5769  C  CZ    . ARG H 4 34  ? 52.672 64.669  45.471  1.00 98.90  ? 34   ARG B CZ    1 
ATOM   5770  N  NH1   . ARG H 4 34  ? 53.607 65.268  46.209  1.00 98.78  ? 34   ARG B NH1   1 
ATOM   5771  N  NH2   . ARG H 4 34  ? 52.206 65.274  44.380  1.00 100.20 ? 34   ARG B NH2   1 
ATOM   5772  N  N     . GLN H 4 35  ? 50.510 58.252  46.964  1.00 74.01  ? 35   GLN B N     1 
ATOM   5773  C  CA    . GLN H 4 35  ? 49.117 58.082  46.617  1.00 71.30  ? 35   GLN B CA    1 
ATOM   5774  C  C     . GLN H 4 35  ? 48.487 56.898  47.349  1.00 69.05  ? 35   GLN B C     1 
ATOM   5775  O  O     . GLN H 4 35  ? 47.314 56.596  47.161  1.00 68.96  ? 35   GLN B O     1 
ATOM   5776  C  CB    . GLN H 4 35  ? 48.973 57.939  45.105  1.00 72.98  ? 35   GLN B CB    1 
ATOM   5777  C  CG    . GLN H 4 35  ? 47.583 58.288  44.573  1.00 75.53  ? 35   GLN B CG    1 
ATOM   5778  C  CD    . GLN H 4 35  ? 47.046 59.648  45.053  1.00 77.24  ? 35   GLN B CD    1 
ATOM   5779  O  OE1   . GLN H 4 35  ? 46.365 60.358  44.301  1.00 77.06  ? 35   GLN B OE1   1 
ATOM   5780  N  NE2   . GLN H 4 35  ? 47.329 60.002  46.310  1.00 77.84  ? 35   GLN B NE2   1 
ATOM   5781  N  N     . ALA H 4 36  ? 49.275 56.246  48.201  1.00 65.86  ? 36   ALA B N     1 
ATOM   5782  C  CA    . ALA H 4 36  ? 48.808 55.114  48.996  1.00 62.33  ? 36   ALA B CA    1 
ATOM   5783  C  C     . ALA H 4 36  ? 48.162 55.631  50.268  1.00 61.11  ? 36   ALA B C     1 
ATOM   5784  O  O     . ALA H 4 36  ? 47.774 54.863  51.130  1.00 62.10  ? 36   ALA B O     1 
ATOM   5785  C  CB    . ALA H 4 36  ? 49.960 54.211  49.353  1.00 60.65  ? 36   ALA B CB    1 
ATOM   5786  N  N     . PHE H 4 37  ? 48.070 56.944  50.391  1.00 59.75  ? 37   PHE B N     1 
ATOM   5787  C  CA    . PHE H 4 37  ? 47.462 57.558  51.544  1.00 57.96  ? 37   PHE B CA    1 
ATOM   5788  C  C     . PHE H 4 37  ? 46.443 58.522  50.991  1.00 58.58  ? 37   PHE B C     1 
ATOM   5789  O  O     . PHE H 4 37  ? 46.522 58.906  49.834  1.00 58.73  ? 37   PHE B O     1 
ATOM   5790  C  CB    . PHE H 4 37  ? 48.500 58.313  52.360  1.00 56.30  ? 37   PHE B CB    1 
ATOM   5791  C  CG    . PHE H 4 37  ? 49.539 57.432  52.993  1.00 57.03  ? 37   PHE B CG    1 
ATOM   5792  C  CD1   . PHE H 4 37  ? 50.683 57.067  52.302  1.00 57.67  ? 37   PHE B CD1   1 
ATOM   5793  C  CD2   . PHE H 4 37  ? 49.384 56.972  54.298  1.00 58.49  ? 37   PHE B CD2   1 
ATOM   5794  C  CE1   . PHE H 4 37  ? 51.671 56.250  52.908  1.00 57.74  ? 37   PHE B CE1   1 
ATOM   5795  C  CE2   . PHE H 4 37  ? 50.366 56.156  54.911  1.00 58.99  ? 37   PHE B CE2   1 
ATOM   5796  C  CZ    . PHE H 4 37  ? 51.510 55.799  54.207  1.00 58.02  ? 37   PHE B CZ    1 
ATOM   5797  N  N     . SER H 4 38  ? 45.482 58.911  51.814  1.00 59.52  ? 38   SER B N     1 
ATOM   5798  C  CA    . SER H 4 38  ? 44.437 59.837  51.391  1.00 60.70  ? 38   SER B CA    1 
ATOM   5799  C  C     . SER H 4 38  ? 44.981 61.211  51.059  1.00 61.48  ? 38   SER B C     1 
ATOM   5800  O  O     . SER H 4 38  ? 46.079 61.571  51.472  1.00 61.65  ? 38   SER B O     1 
ATOM   5801  C  CB    . SER H 4 38  ? 43.378 59.987  52.494  1.00 61.17  ? 38   SER B CB    1 
ATOM   5802  O  OG    . SER H 4 38  ? 42.484 61.071  52.233  1.00 60.77  ? 38   SER B OG    1 
ATOM   5803  N  N     . GLU H 4 39  ? 44.200 61.977  50.304  1.00 62.19  ? 39   GLU B N     1 
ATOM   5804  C  CA    . GLU H 4 39  ? 44.584 63.339  49.965  1.00 62.71  ? 39   GLU B CA    1 
ATOM   5805  C  C     . GLU H 4 39  ? 44.796 64.102  51.277  1.00 61.24  ? 39   GLU B C     1 
ATOM   5806  O  O     . GLU H 4 39  ? 45.915 64.504  51.611  1.00 60.31  ? 39   GLU B O     1 
ATOM   5807  C  CB    . GLU H 4 39  ? 43.479 64.017  49.136  1.00 64.83  ? 39   GLU B CB    1 
ATOM   5808  C  CG    . GLU H 4 39  ? 43.534 65.549  49.151  1.00 71.65  ? 39   GLU B CG    1 
ATOM   5809  C  CD    . GLU H 4 39  ? 42.926 66.223  47.894  1.00 76.91  ? 39   GLU B CD    1 
ATOM   5810  O  OE1   . GLU H 4 39  ? 43.511 66.104  46.779  1.00 79.77  ? 39   GLU B OE1   1 
ATOM   5811  O  OE2   . GLU H 4 39  ? 41.864 66.886  48.022  1.00 79.03  ? 39   GLU B OE2   1 
ATOM   5812  N  N     . HIS H 4 40  ? 43.720 64.258  52.041  1.00 59.26  ? 40   HIS B N     1 
ATOM   5813  C  CA    . HIS H 4 40  ? 43.801 64.997  53.273  1.00 56.82  ? 40   HIS B CA    1 
ATOM   5814  C  C     . HIS H 4 40  ? 44.746 64.436  54.296  1.00 56.33  ? 40   HIS B C     1 
ATOM   5815  O  O     . HIS H 4 40  ? 44.967 65.064  55.322  1.00 56.93  ? 40   HIS B O     1 
ATOM   5816  C  CB    . HIS H 4 40  ? 42.438 65.151  53.906  1.00 56.36  ? 40   HIS B CB    1 
ATOM   5817  C  CG    . HIS H 4 40  ? 41.332 65.323  52.923  1.00 56.10  ? 40   HIS B CG    1 
ATOM   5818  N  ND1   . HIS H 4 40  ? 40.661 64.253  52.369  1.00 56.57  ? 40   HIS B ND1   1 
ATOM   5819  C  CD2   . HIS H 4 40  ? 40.745 66.434  52.426  1.00 55.62  ? 40   HIS B CD2   1 
ATOM   5820  C  CE1   . HIS H 4 40  ? 39.702 64.700  51.577  1.00 55.88  ? 40   HIS B CE1   1 
ATOM   5821  N  NE2   . HIS H 4 40  ? 39.731 66.019  51.594  1.00 55.45  ? 40   HIS B NE2   1 
ATOM   5822  N  N     . THR H 4 41  ? 45.297 63.256  54.081  1.00 55.66  ? 41   THR B N     1 
ATOM   5823  C  CA    . THR H 4 41  ? 46.243 62.807  55.090  1.00 55.74  ? 41   THR B CA    1 
ATOM   5824  C  C     . THR H 4 41  ? 47.477 63.670  54.870  1.00 57.03  ? 41   THR B C     1 
ATOM   5825  O  O     . THR H 4 41  ? 47.944 64.366  55.788  1.00 56.49  ? 41   THR B O     1 
ATOM   5826  C  CB    . THR H 4 41  ? 46.652 61.337  54.946  1.00 54.09  ? 41   THR B CB    1 
ATOM   5827  O  OG1   . THR H 4 41  ? 45.557 60.494  55.316  1.00 51.77  ? 41   THR B OG1   1 
ATOM   5828  C  CG2   . THR H 4 41  ? 47.842 61.037  55.856  1.00 52.62  ? 41   THR B CG2   1 
ATOM   5829  N  N     . TRP H 4 42  ? 47.986 63.634  53.633  1.00 58.24  ? 42   TRP B N     1 
ATOM   5830  C  CA    . TRP H 4 42  ? 49.164 64.409  53.260  1.00 57.15  ? 42   TRP B CA    1 
ATOM   5831  C  C     . TRP H 4 42  ? 48.882 65.882  53.456  1.00 55.75  ? 42   TRP B C     1 
ATOM   5832  O  O     . TRP H 4 42  ? 49.709 66.587  54.016  1.00 55.40  ? 42   TRP B O     1 
ATOM   5833  C  CB    . TRP H 4 42  ? 49.579 64.120  51.817  1.00 59.52  ? 42   TRP B CB    1 
ATOM   5834  C  CG    . TRP H 4 42  ? 50.744 63.200  51.739  1.00 63.14  ? 42   TRP B CG    1 
ATOM   5835  C  CD1   . TRP H 4 42  ? 50.762 61.879  52.046  1.00 64.97  ? 42   TRP B CD1   1 
ATOM   5836  C  CD2   . TRP H 4 42  ? 52.088 63.553  51.422  1.00 66.21  ? 42   TRP B CD2   1 
ATOM   5837  N  NE1   . TRP H 4 42  ? 52.040 61.375  51.953  1.00 65.83  ? 42   TRP B NE1   1 
ATOM   5838  C  CE2   . TRP H 4 42  ? 52.875 62.386  51.569  1.00 66.84  ? 42   TRP B CE2   1 
ATOM   5839  C  CE3   . TRP H 4 42  ? 52.715 64.751  51.028  1.00 68.61  ? 42   TRP B CE3   1 
ATOM   5840  C  CZ2   . TRP H 4 42  ? 54.257 62.375  51.338  1.00 68.76  ? 42   TRP B CZ2   1 
ATOM   5841  C  CZ3   . TRP H 4 42  ? 54.100 64.744  50.794  1.00 69.48  ? 42   TRP B CZ3   1 
ATOM   5842  C  CH2   . TRP H 4 42  ? 54.852 63.558  50.953  1.00 69.68  ? 42   TRP B CH2   1 
ATOM   5843  N  N     . LYS H 4 43  ? 47.713 66.354  53.030  1.00 54.44  ? 43   LYS B N     1 
ATOM   5844  C  CA    . LYS H 4 43  ? 47.401 67.768  53.221  1.00 54.11  ? 43   LYS B CA    1 
ATOM   5845  C  C     . LYS H 4 43  ? 47.784 68.147  54.649  1.00 53.00  ? 43   LYS B C     1 
ATOM   5846  O  O     . LYS H 4 43  ? 48.694 68.947  54.882  1.00 53.06  ? 43   LYS B O     1 
ATOM   5847  C  CB    . LYS H 4 43  ? 45.909 68.049  53.001  1.00 53.87  ? 43   LYS B CB    1 
ATOM   5848  C  CG    . LYS H 4 43  ? 45.492 69.464  53.386  1.00 55.30  ? 43   LYS B CG    1 
ATOM   5849  C  CD    . LYS H 4 43  ? 43.975 69.669  53.319  1.00 57.86  ? 43   LYS B CD    1 
ATOM   5850  C  CE    . LYS H 4 43  ? 43.242 68.800  54.378  1.00 60.34  ? 43   LYS B CE    1 
ATOM   5851  N  NZ    . LYS H 4 43  ? 41.723 68.745  54.320  1.00 59.08  ? 43   LYS B NZ    1 
ATOM   5852  N  N     . MET H 4 44  ? 47.108 67.519  55.603  1.00 51.36  ? 44   MET B N     1 
ATOM   5853  C  CA    . MET H 4 44  ? 47.325 67.770  57.016  1.00 48.89  ? 44   MET B CA    1 
ATOM   5854  C  C     . MET H 4 44  ? 48.699 67.434  57.578  1.00 46.66  ? 44   MET B C     1 
ATOM   5855  O  O     . MET H 4 44  ? 49.117 68.026  58.561  1.00 45.38  ? 44   MET B O     1 
ATOM   5856  C  CB    . MET H 4 44  ? 46.252 67.046  57.802  1.00 50.07  ? 44   MET B CB    1 
ATOM   5857  C  CG    . MET H 4 44  ? 44.900 67.678  57.656  1.00 51.23  ? 44   MET B CG    1 
ATOM   5858  S  SD    . MET H 4 44  ? 44.972 69.261  58.483  1.00 55.93  ? 44   MET B SD    1 
ATOM   5859  C  CE    . MET H 4 44  ? 44.938 68.758  60.195  1.00 58.49  ? 44   MET B CE    1 
ATOM   5860  N  N     . LEU H 4 45  ? 49.402 66.488  56.975  1.00 45.91  ? 45   LEU B N     1 
ATOM   5861  C  CA    . LEU H 4 45  ? 50.727 66.151  57.476  1.00 46.89  ? 45   LEU B CA    1 
ATOM   5862  C  C     . LEU H 4 45  ? 51.613 67.368  57.352  1.00 48.09  ? 45   LEU B C     1 
ATOM   5863  O  O     . LEU H 4 45  ? 52.224 67.818  58.317  1.00 49.12  ? 45   LEU B O     1 
ATOM   5864  C  CB    . LEU H 4 45  ? 51.350 65.034  56.660  1.00 46.75  ? 45   LEU B CB    1 
ATOM   5865  C  CG    . LEU H 4 45  ? 52.684 64.470  57.137  1.00 46.57  ? 45   LEU B CG    1 
ATOM   5866  C  CD1   . LEU H 4 45  ? 53.114 63.396  56.136  1.00 48.17  ? 45   LEU B CD1   1 
ATOM   5867  C  CD2   . LEU H 4 45  ? 53.740 65.540  57.243  1.00 45.91  ? 45   LEU B CD2   1 
ATOM   5868  N  N     . LEU H 4 46  ? 51.697 67.893  56.140  1.00 48.90  ? 46   LEU B N     1 
ATOM   5869  C  CA    . LEU H 4 46  ? 52.522 69.063  55.876  1.00 48.30  ? 46   LEU B CA    1 
ATOM   5870  C  C     . LEU H 4 46  ? 52.100 70.202  56.798  1.00 47.59  ? 46   LEU B C     1 
ATOM   5871  O  O     . LEU H 4 46  ? 52.918 70.705  57.562  1.00 47.44  ? 46   LEU B O     1 
ATOM   5872  C  CB    . LEU H 4 46  ? 52.382 69.484  54.403  1.00 49.23  ? 46   LEU B CB    1 
ATOM   5873  C  CG    . LEU H 4 46  ? 52.365 68.394  53.303  1.00 48.88  ? 46   LEU B CG    1 
ATOM   5874  C  CD1   . LEU H 4 46  ? 52.106 69.082  51.958  1.00 47.37  ? 46   LEU B CD1   1 
ATOM   5875  C  CD2   . LEU H 4 46  ? 53.663 67.545  53.291  1.00 46.11  ? 46   LEU B CD2   1 
ATOM   5876  N  N     . SER H 4 47  ? 50.826 70.589  56.736  1.00 46.20  ? 47   SER B N     1 
ATOM   5877  C  CA    . SER H 4 47  ? 50.305 71.659  57.582  1.00 46.43  ? 47   SER B CA    1 
ATOM   5878  C  C     . SER H 4 47  ? 50.802 71.611  59.029  1.00 47.28  ? 47   SER B C     1 
ATOM   5879  O  O     . SER H 4 47  ? 50.895 72.638  59.691  1.00 47.27  ? 47   SER B O     1 
ATOM   5880  C  CB    . SER H 4 47  ? 48.779 71.636  57.601  1.00 45.33  ? 47   SER B CB    1 
ATOM   5881  O  OG    . SER H 4 47  ? 48.293 72.411  58.689  1.00 45.94  ? 47   SER B OG    1 
ATOM   5882  N  N     . VAL H 4 48  ? 51.093 70.418  59.529  1.00 48.19  ? 48   VAL B N     1 
ATOM   5883  C  CA    . VAL H 4 48  ? 51.578 70.285  60.890  1.00 50.31  ? 48   VAL B CA    1 
ATOM   5884  C  C     . VAL H 4 48  ? 53.067 70.527  60.924  1.00 50.96  ? 48   VAL B C     1 
ATOM   5885  O  O     . VAL H 4 48  ? 53.558 71.253  61.781  1.00 50.85  ? 48   VAL B O     1 
ATOM   5886  C  CB    . VAL H 4 48  ? 51.279 68.888  61.474  1.00 51.27  ? 48   VAL B CB    1 
ATOM   5887  C  CG1   . VAL H 4 48  ? 52.242 68.566  62.644  1.00 51.26  ? 48   VAL B CG1   1 
ATOM   5888  C  CG2   . VAL H 4 48  ? 49.841 68.846  61.959  1.00 51.19  ? 48   VAL B CG2   1 
ATOM   5889  N  N     . CYS H 4 49  ? 53.795 69.915  60.005  1.00 51.73  ? 49   CYS B N     1 
ATOM   5890  C  CA    . CYS H 4 49  ? 55.222 70.137  59.984  1.00 54.32  ? 49   CYS B CA    1 
ATOM   5891  C  C     . CYS H 4 49  ? 55.464 71.631  59.756  1.00 55.70  ? 49   CYS B C     1 
ATOM   5892  O  O     . CYS H 4 49  ? 56.498 72.171  60.144  1.00 55.53  ? 49   CYS B O     1 
ATOM   5893  C  CB    . CYS H 4 49  ? 55.861 69.336  58.866  1.00 55.73  ? 49   CYS B CB    1 
ATOM   5894  S  SG    . CYS H 4 49  ? 55.621 67.566  58.988  1.00 60.23  ? 49   CYS B SG    1 
ATOM   5895  N  N     . ARG H 4 50  ? 54.502 72.301  59.126  1.00 57.27  ? 50   ARG B N     1 
ATOM   5896  C  CA    . ARG H 4 50  ? 54.635 73.725  58.863  1.00 57.97  ? 50   ARG B CA    1 
ATOM   5897  C  C     . ARG H 4 50  ? 54.341 74.565  60.108  1.00 58.24  ? 50   ARG B C     1 
ATOM   5898  O  O     . ARG H 4 50  ? 54.694 75.747  60.146  1.00 59.58  ? 50   ARG B O     1 
ATOM   5899  C  CB    . ARG H 4 50  ? 53.721 74.157  57.706  1.00 59.71  ? 50   ARG B CB    1 
ATOM   5900  C  CG    . ARG H 4 50  ? 54.064 73.488  56.375  1.00 63.68  ? 50   ARG B CG    1 
ATOM   5901  C  CD    . ARG H 4 50  ? 53.377 74.140  55.146  1.00 66.30  ? 50   ARG B CD    1 
ATOM   5902  N  NE    . ARG H 4 50  ? 51.933 73.887  55.034  1.00 67.60  ? 50   ARG B NE    1 
ATOM   5903  C  CZ    . ARG H 4 50  ? 50.971 74.690  55.498  1.00 67.83  ? 50   ARG B CZ    1 
ATOM   5904  N  NH1   . ARG H 4 50  ? 51.263 75.826  56.124  1.00 65.88  ? 50   ARG B NH1   1 
ATOM   5905  N  NH2   . ARG H 4 50  ? 49.700 74.357  55.316  1.00 68.18  ? 50   ARG B NH2   1 
ATOM   5906  N  N     . SER H 4 51  ? 53.694 73.975  61.119  1.00 56.53  ? 51   SER B N     1 
ATOM   5907  C  CA    . SER H 4 51  ? 53.396 74.705  62.361  1.00 54.50  ? 51   SER B CA    1 
ATOM   5908  C  C     . SER H 4 51  ? 54.517 74.361  63.313  1.00 52.99  ? 51   SER B C     1 
ATOM   5909  O  O     . SER H 4 51  ? 55.018 75.206  64.048  1.00 52.64  ? 51   SER B O     1 
ATOM   5910  C  CB    . SER H 4 51  ? 52.050 74.270  62.971  1.00 54.48  ? 51   SER B CB    1 
ATOM   5911  O  OG    . SER H 4 51  ? 51.640 75.133  64.032  1.00 52.61  ? 51   SER B OG    1 
ATOM   5912  N  N     . TRP H 4 52  ? 54.910 73.100  63.270  1.00 51.02  ? 52   TRP B N     1 
ATOM   5913  C  CA    . TRP H 4 52  ? 55.979 72.591  64.102  1.00 50.38  ? 52   TRP B CA    1 
ATOM   5914  C  C     . TRP H 4 52  ? 57.299 73.227  63.692  1.00 52.29  ? 52   TRP B C     1 
ATOM   5915  O  O     . TRP H 4 52  ? 58.042 73.699  64.552  1.00 53.55  ? 52   TRP B O     1 
ATOM   5916  C  CB    . TRP H 4 52  ? 56.053 71.074  63.955  1.00 44.93  ? 52   TRP B CB    1 
ATOM   5917  C  CG    . TRP H 4 52  ? 57.294 70.443  64.439  1.00 38.47  ? 52   TRP B CG    1 
ATOM   5918  C  CD1   . TRP H 4 52  ? 58.165 69.689  63.710  1.00 36.54  ? 52   TRP B CD1   1 
ATOM   5919  C  CD2   . TRP H 4 52  ? 57.751 70.404  65.776  1.00 37.39  ? 52   TRP B CD2   1 
ATOM   5920  N  NE1   . TRP H 4 52  ? 59.137 69.169  64.515  1.00 35.73  ? 52   TRP B NE1   1 
ATOM   5921  C  CE2   . TRP H 4 52  ? 58.909 69.595  65.797  1.00 37.16  ? 52   TRP B CE2   1 
ATOM   5922  C  CE3   . TRP H 4 52  ? 57.293 70.967  66.972  1.00 37.17  ? 52   TRP B CE3   1 
ATOM   5923  C  CZ2   . TRP H 4 52  ? 59.619 69.336  66.972  1.00 35.60  ? 52   TRP B CZ2   1 
ATOM   5924  C  CZ3   . TRP H 4 52  ? 57.996 70.710  68.138  1.00 36.81  ? 52   TRP B CZ3   1 
ATOM   5925  C  CH2   . TRP H 4 52  ? 59.147 69.902  68.129  1.00 36.21  ? 52   TRP B CH2   1 
ATOM   5926  N  N     . ALA H 4 53  ? 57.590 73.257  62.390  1.00 53.84  ? 53   ALA B N     1 
ATOM   5927  C  CA    . ALA H 4 53  ? 58.848 73.840  61.917  1.00 55.79  ? 53   ALA B CA    1 
ATOM   5928  C  C     . ALA H 4 53  ? 58.910 75.309  62.307  1.00 56.91  ? 53   ALA B C     1 
ATOM   5929  O  O     . ALA H 4 53  ? 59.968 75.820  62.704  1.00 56.60  ? 53   ALA B O     1 
ATOM   5930  C  CB    . ALA H 4 53  ? 58.969 73.697  60.422  1.00 56.33  ? 53   ALA B CB    1 
ATOM   5931  N  N     . ALA H 4 54  ? 57.765 75.980  62.187  1.00 58.05  ? 54   ALA B N     1 
ATOM   5932  C  CA    . ALA H 4 54  ? 57.648 77.391  62.556  1.00 58.07  ? 54   ALA B CA    1 
ATOM   5933  C  C     . ALA H 4 54  ? 58.108 77.509  64.009  1.00 57.25  ? 54   ALA B C     1 
ATOM   5934  O  O     . ALA H 4 54  ? 59.259 77.860  64.271  1.00 57.02  ? 54   ALA B O     1 
ATOM   5935  C  CB    . ALA H 4 54  ? 56.186 77.868  62.415  1.00 58.23  ? 54   ALA B CB    1 
ATOM   5936  N  N     . TRP H 4 55  ? 57.209 77.197  64.938  1.00 56.19  ? 55   TRP B N     1 
ATOM   5937  C  CA    . TRP H 4 55  ? 57.515 77.246  66.362  1.00 55.74  ? 55   TRP B CA    1 
ATOM   5938  C  C     . TRP H 4 55  ? 58.934 76.765  66.667  1.00 57.62  ? 55   TRP B C     1 
ATOM   5939  O  O     . TRP H 4 55  ? 59.551 77.200  67.642  1.00 57.56  ? 55   TRP B O     1 
ATOM   5940  C  CB    . TRP H 4 55  ? 56.532 76.368  67.131  1.00 51.12  ? 55   TRP B CB    1 
ATOM   5941  C  CG    . TRP H 4 55  ? 56.731 76.382  68.607  1.00 44.79  ? 55   TRP B CG    1 
ATOM   5942  C  CD1   . TRP H 4 55  ? 56.091 77.171  69.505  1.00 42.84  ? 55   TRP B CD1   1 
ATOM   5943  C  CD2   . TRP H 4 55  ? 57.643 75.572  69.355  1.00 42.11  ? 55   TRP B CD2   1 
ATOM   5944  N  NE1   . TRP H 4 55  ? 56.540 76.904  70.770  1.00 42.06  ? 55   TRP B NE1   1 
ATOM   5945  C  CE2   . TRP H 4 55  ? 57.497 75.925  70.707  1.00 41.12  ? 55   TRP B CE2   1 
ATOM   5946  C  CE3   . TRP H 4 55  ? 58.569 74.579  69.012  1.00 41.00  ? 55   TRP B CE3   1 
ATOM   5947  C  CZ2   . TRP H 4 55  ? 58.244 75.322  71.722  1.00 39.19  ? 55   TRP B CZ2   1 
ATOM   5948  C  CZ3   . TRP H 4 55  ? 59.308 73.982  70.016  1.00 39.53  ? 55   TRP B CZ3   1 
ATOM   5949  C  CH2   . TRP H 4 55  ? 59.140 74.357  71.356  1.00 38.78  ? 55   TRP B CH2   1 
ATOM   5950  N  N     . CYS H 4 56  ? 59.439 75.856  65.845  1.00 60.28  ? 56   CYS B N     1 
ATOM   5951  C  CA    . CYS H 4 56  ? 60.776 75.320  66.047  1.00 64.63  ? 56   CYS B CA    1 
ATOM   5952  C  C     . CYS H 4 56  ? 61.894 76.315  65.731  1.00 66.39  ? 56   CYS B C     1 
ATOM   5953  O  O     . CYS H 4 56  ? 62.934 76.325  66.396  1.00 66.78  ? 56   CYS B O     1 
ATOM   5954  C  CB    . CYS H 4 56  ? 60.968 74.063  65.203  1.00 65.95  ? 56   CYS B CB    1 
ATOM   5955  S  SG    . CYS H 4 56  ? 61.194 72.575  66.169  1.00 69.64  ? 56   CYS B SG    1 
ATOM   5956  N  N     . LYS H 4 57  ? 61.697 77.134  64.704  1.00 68.06  ? 57   LYS B N     1 
ATOM   5957  C  CA    . LYS H 4 57  ? 62.710 78.121  64.341  1.00 69.49  ? 57   LYS B CA    1 
ATOM   5958  C  C     . LYS H 4 57  ? 62.766 79.133  65.489  1.00 68.61  ? 57   LYS B C     1 
ATOM   5959  O  O     . LYS H 4 57  ? 63.718 79.145  66.266  1.00 67.99  ? 57   LYS B O     1 
ATOM   5960  C  CB    . LYS H 4 57  ? 62.334 78.809  63.006  1.00 72.02  ? 57   LYS B CB    1 
ATOM   5961  C  CG    . LYS H 4 57  ? 63.551 79.202  62.107  1.00 74.82  ? 57   LYS B CG    1 
ATOM   5962  C  CD    . LYS H 4 57  ? 63.194 79.378  60.592  1.00 76.45  ? 57   LYS B CD    1 
ATOM   5963  C  CE    . LYS H 4 57  ? 62.732 80.796  60.199  1.00 77.08  ? 57   LYS B CE    1 
ATOM   5964  N  NZ    . LYS H 4 57  ? 61.419 81.221  60.793  1.00 78.65  ? 57   LYS B NZ    1 
ATOM   5965  N  N     . LEU H 4 58  ? 61.719 79.950  65.594  1.00 67.81  ? 58   LEU B N     1 
ATOM   5966  C  CA    . LEU H 4 58  ? 61.583 80.980  66.621  1.00 67.45  ? 58   LEU B CA    1 
ATOM   5967  C  C     . LEU H 4 58  ? 61.949 80.564  68.066  1.00 68.85  ? 58   LEU B C     1 
ATOM   5968  O  O     . LEU H 4 58  ? 61.938 81.400  68.974  1.00 68.80  ? 58   LEU B O     1 
ATOM   5969  C  CB    . LEU H 4 58  ? 60.147 81.530  66.559  1.00 64.95  ? 58   LEU B CB    1 
ATOM   5970  C  CG    . LEU H 4 58  ? 59.323 81.869  67.806  1.00 63.50  ? 58   LEU B CG    1 
ATOM   5971  C  CD1   . LEU H 4 58  ? 59.977 82.984  68.602  1.00 63.22  ? 58   LEU B CD1   1 
ATOM   5972  C  CD2   . LEU H 4 58  ? 57.928 82.283  67.380  1.00 61.37  ? 58   LEU B CD2   1 
ATOM   5973  N  N     . ASN H 4 59  ? 62.290 79.295  68.287  1.00 69.93  ? 59   ASN B N     1 
ATOM   5974  C  CA    . ASN H 4 59  ? 62.632 78.837  69.637  1.00 71.53  ? 59   ASN B CA    1 
ATOM   5975  C  C     . ASN H 4 59  ? 63.980 78.127  69.733  1.00 72.98  ? 59   ASN B C     1 
ATOM   5976  O  O     . ASN H 4 59  ? 64.391 77.691  70.805  1.00 73.30  ? 59   ASN B O     1 
ATOM   5977  C  CB    . ASN H 4 59  ? 61.520 77.928  70.179  1.00 71.79  ? 59   ASN B CB    1 
ATOM   5978  C  CG    . ASN H 4 59  ? 60.577 78.654  71.146  1.00 72.18  ? 59   ASN B CG    1 
ATOM   5979  O  OD1   . ASN H 4 59  ? 60.950 78.958  72.291  1.00 71.56  ? 59   ASN B OD1   1 
ATOM   5980  N  ND2   . ASN H 4 59  ? 59.353 78.935  70.688  1.00 71.16  ? 59   ASN B ND2   1 
ATOM   5981  N  N     . ASN H 4 60  ? 64.663 78.012  68.601  1.00 75.29  ? 60   ASN B N     1 
ATOM   5982  C  CA    . ASN H 4 60  ? 65.988 77.388  68.533  1.00 77.08  ? 60   ASN B CA    1 
ATOM   5983  C  C     . ASN H 4 60  ? 66.023 75.909  68.887  1.00 76.56  ? 60   ASN B C     1 
ATOM   5984  O  O     . ASN H 4 60  ? 66.835 75.482  69.713  1.00 76.42  ? 60   ASN B O     1 
ATOM   5985  C  CB    . ASN H 4 60  ? 66.982 78.137  69.440  1.00 79.33  ? 60   ASN B CB    1 
ATOM   5986  C  CG    . ASN H 4 60  ? 68.287 78.505  68.717  1.00 81.49  ? 60   ASN B CG    1 
ATOM   5987  O  OD1   . ASN H 4 60  ? 69.297 78.827  69.364  1.00 82.48  ? 60   ASN B OD1   1 
ATOM   5988  N  ND2   . ASN H 4 60  ? 68.265 78.473  67.375  1.00 80.94  ? 60   ASN B ND2   1 
ATOM   5989  N  N     . ARG H 4 61  ? 65.159 75.126  68.250  1.00 76.14  ? 61   ARG B N     1 
ATOM   5990  C  CA    . ARG H 4 61  ? 65.118 73.693  68.501  1.00 75.34  ? 61   ARG B CA    1 
ATOM   5991  C  C     . ARG H 4 61  ? 65.090 72.923  67.189  1.00 74.74  ? 61   ARG B C     1 
ATOM   5992  O  O     . ARG H 4 61  ? 64.393 73.313  66.249  1.00 74.53  ? 61   ARG B O     1 
ATOM   5993  C  CB    . ARG H 4 61  ? 63.892 73.359  69.337  1.00 75.80  ? 61   ARG B CB    1 
ATOM   5994  C  CG    . ARG H 4 61  ? 63.837 74.116  70.656  1.00 76.79  ? 61   ARG B CG    1 
ATOM   5995  C  CD    . ARG H 4 61  ? 62.426 74.065  71.212  1.00 77.99  ? 61   ARG B CD    1 
ATOM   5996  N  NE    . ARG H 4 61  ? 62.246 74.806  72.457  1.00 77.67  ? 61   ARG B NE    1 
ATOM   5997  C  CZ    . ARG H 4 61  ? 62.960 74.593  73.551  1.00 77.80  ? 61   ARG B CZ    1 
ATOM   5998  N  NH1   . ARG H 4 61  ? 63.911 73.664  73.540  1.00 77.67  ? 61   ARG B NH1   1 
ATOM   5999  N  NH2   . ARG H 4 61  ? 62.698 75.284  74.659  1.00 77.59  ? 61   ARG B NH2   1 
ATOM   6000  N  N     . LYS H 4 62  ? 65.863 71.843  67.125  1.00 73.90  ? 62   LYS B N     1 
ATOM   6001  C  CA    . LYS H 4 62  ? 65.915 71.018  65.925  1.00 74.21  ? 62   LYS B CA    1 
ATOM   6002  C  C     . LYS H 4 62  ? 64.473 70.575  65.610  1.00 73.63  ? 62   LYS B C     1 
ATOM   6003  O  O     . LYS H 4 62  ? 63.642 70.483  66.514  1.00 73.25  ? 62   LYS B O     1 
ATOM   6004  C  CB    . LYS H 4 62  ? 66.830 69.813  66.178  1.00 75.16  ? 62   LYS B CB    1 
ATOM   6005  C  CG    . LYS H 4 62  ? 67.323 69.089  64.911  1.00 76.89  ? 62   LYS B CG    1 
ATOM   6006  C  CD    . LYS H 4 62  ? 68.447 68.066  65.228  1.00 78.14  ? 62   LYS B CD    1 
ATOM   6007  C  CE    . LYS H 4 62  ? 69.657 68.722  65.932  1.00 78.68  ? 62   LYS B CE    1 
ATOM   6008  N  NZ    . LYS H 4 62  ? 70.787 67.779  66.198  1.00 78.16  ? 62   LYS B NZ    1 
ATOM   6009  N  N     . TRP H 4 63  ? 64.164 70.305  64.343  1.00 72.68  ? 63   TRP B N     1 
ATOM   6010  C  CA    . TRP H 4 63  ? 62.804 69.912  63.995  1.00 71.52  ? 63   TRP B CA    1 
ATOM   6011  C  C     . TRP H 4 63  ? 62.666 68.472  63.517  1.00 70.49  ? 63   TRP B C     1 
ATOM   6012  O  O     . TRP H 4 63  ? 61.543 68.022  63.251  1.00 69.72  ? 63   TRP B O     1 
ATOM   6013  C  CB    . TRP H 4 63  ? 62.240 70.838  62.918  1.00 73.87  ? 63   TRP B CB    1 
ATOM   6014  C  CG    . TRP H 4 63  ? 62.496 70.324  61.531  1.00 76.51  ? 63   TRP B CG    1 
ATOM   6015  C  CD1   . TRP H 4 63  ? 63.711 70.148  60.940  1.00 77.13  ? 63   TRP B CD1   1 
ATOM   6016  C  CD2   . TRP H 4 63  ? 61.522 69.833  60.596  1.00 77.76  ? 63   TRP B CD2   1 
ATOM   6017  N  NE1   . TRP H 4 63  ? 63.560 69.572  59.705  1.00 77.58  ? 63   TRP B NE1   1 
ATOM   6018  C  CE2   . TRP H 4 63  ? 62.228 69.366  59.466  1.00 78.06  ? 63   TRP B CE2   1 
ATOM   6019  C  CE3   . TRP H 4 63  ? 60.124 69.739  60.605  1.00 79.35  ? 63   TRP B CE3   1 
ATOM   6020  C  CZ2   . TRP H 4 63  ? 61.584 68.810  58.349  1.00 78.51  ? 63   TRP B CZ2   1 
ATOM   6021  C  CZ3   . TRP H 4 63  ? 59.477 69.183  59.485  1.00 80.21  ? 63   TRP B CZ3   1 
ATOM   6022  C  CH2   . TRP H 4 63  ? 60.214 68.727  58.376  1.00 79.15  ? 63   TRP B CH2   1 
ATOM   6023  N  N     . PHE H 4 64  ? 63.781 67.751  63.398  1.00 68.75  ? 64   PHE B N     1 
ATOM   6024  C  CA    . PHE H 4 64  ? 63.706 66.361  62.944  1.00 68.65  ? 64   PHE B CA    1 
ATOM   6025  C  C     . PHE H 4 64  ? 65.039 65.624  62.963  1.00 68.99  ? 64   PHE B C     1 
ATOM   6026  O  O     . PHE H 4 64  ? 65.948 66.006  62.255  1.00 70.76  ? 64   PHE B O     1 
ATOM   6027  C  CB    . PHE H 4 64  ? 63.141 66.300  61.515  1.00 67.11  ? 64   PHE B CB    1 
ATOM   6028  C  CG    . PHE H 4 64  ? 62.921 64.903  61.020  1.00 66.24  ? 64   PHE B CG    1 
ATOM   6029  C  CD1   . PHE H 4 64  ? 61.774 64.204  61.357  1.00 66.18  ? 64   PHE B CD1   1 
ATOM   6030  C  CD2   . PHE H 4 64  ? 63.888 64.258  60.268  1.00 65.95  ? 64   PHE B CD2   1 
ATOM   6031  C  CE1   . PHE H 4 64  ? 61.603 62.877  60.954  1.00 66.17  ? 64   PHE B CE1   1 
ATOM   6032  C  CE2   . PHE H 4 64  ? 63.725 62.929  59.861  1.00 65.46  ? 64   PHE B CE2   1 
ATOM   6033  C  CZ    . PHE H 4 64  ? 62.587 62.240  60.202  1.00 65.03  ? 64   PHE B CZ    1 
ATOM   6034  N  N     . PRO H 4 65  ? 65.192 64.572  63.783  1.00 68.76  ? 65   PRO B N     1 
ATOM   6035  C  CA    . PRO H 4 65  ? 64.304 63.934  64.750  1.00 68.88  ? 65   PRO B CA    1 
ATOM   6036  C  C     . PRO H 4 65  ? 63.912 64.895  65.856  1.00 69.55  ? 65   PRO B C     1 
ATOM   6037  O  O     . PRO H 4 65  ? 64.766 65.599  66.393  1.00 70.15  ? 65   PRO B O     1 
ATOM   6038  C  CB    . PRO H 4 65  ? 65.153 62.779  65.280  1.00 68.37  ? 65   PRO B CB    1 
ATOM   6039  C  CG    . PRO H 4 65  ? 65.842 62.337  64.083  1.00 68.17  ? 65   PRO B CG    1 
ATOM   6040  C  CD    . PRO H 4 65  ? 66.297 63.658  63.460  1.00 68.44  ? 65   PRO B CD    1 
ATOM   6041  N  N     . ALA H 4 66  ? 62.623 64.923  66.188  1.00 69.71  ? 66   ALA B N     1 
ATOM   6042  C  CA    . ALA H 4 66  ? 62.125 65.787  67.243  1.00 69.39  ? 66   ALA B CA    1 
ATOM   6043  C  C     . ALA H 4 66  ? 62.452 65.127  68.574  1.00 70.55  ? 66   ALA B C     1 
ATOM   6044  O  O     . ALA H 4 66  ? 62.282 63.911  68.749  1.00 70.54  ? 66   ALA B O     1 
ATOM   6045  C  CB    . ALA H 4 66  ? 60.632 65.984  67.096  1.00 68.08  ? 66   ALA B CB    1 
ATOM   6046  N  N     . GLU H 4 67  ? 62.959 65.927  69.504  1.00 72.10  ? 67   GLU B N     1 
ATOM   6047  C  CA    . GLU H 4 67  ? 63.309 65.407  70.816  1.00 73.60  ? 67   GLU B CA    1 
ATOM   6048  C  C     . GLU H 4 67  ? 62.122 65.563  71.783  1.00 72.81  ? 67   GLU B C     1 
ATOM   6049  O  O     . GLU H 4 67  ? 61.471 66.619  71.841  1.00 72.69  ? 67   GLU B O     1 
ATOM   6050  C  CB    . GLU H 4 67  ? 64.567 66.110  71.344  1.00 76.37  ? 67   GLU B CB    1 
ATOM   6051  C  CG    . GLU H 4 67  ? 65.721 66.074  70.340  1.00 80.75  ? 67   GLU B CG    1 
ATOM   6052  C  CD    . GLU H 4 67  ? 67.041 66.628  70.887  1.00 83.57  ? 67   GLU B CD    1 
ATOM   6053  O  OE1   . GLU H 4 67  ? 67.709 65.899  71.667  1.00 84.77  ? 67   GLU B OE1   1 
ATOM   6054  O  OE2   . GLU H 4 67  ? 67.405 67.786  70.533  1.00 84.07  ? 67   GLU B OE2   1 
ATOM   6055  N  N     . PRO H 4 68  ? 61.827 64.495  72.548  1.00 71.57  ? 68   PRO B N     1 
ATOM   6056  C  CA    . PRO H 4 68  ? 60.735 64.453  73.514  1.00 68.80  ? 68   PRO B CA    1 
ATOM   6057  C  C     . PRO H 4 68  ? 60.419 65.827  74.055  1.00 67.50  ? 68   PRO B C     1 
ATOM   6058  O  O     . PRO H 4 68  ? 59.447 66.458  73.653  1.00 67.25  ? 68   PRO B O     1 
ATOM   6059  C  CB    . PRO H 4 68  ? 61.279 63.524  74.582  1.00 69.53  ? 68   PRO B CB    1 
ATOM   6060  C  CG    . PRO H 4 68  ? 62.002 62.534  73.781  1.00 70.42  ? 68   PRO B CG    1 
ATOM   6061  C  CD    . PRO H 4 68  ? 62.757 63.376  72.788  1.00 71.39  ? 68   PRO B CD    1 
ATOM   6062  N  N     . GLU H 4 69  ? 61.267 66.291  74.959  1.00 65.12  ? 69   GLU B N     1 
ATOM   6063  C  CA    . GLU H 4 69  ? 61.077 67.579  75.575  1.00 61.91  ? 69   GLU B CA    1 
ATOM   6064  C  C     . GLU H 4 69  ? 60.513 68.595  74.608  1.00 59.76  ? 69   GLU B C     1 
ATOM   6065  O  O     . GLU H 4 69  ? 59.447 69.165  74.840  1.00 59.10  ? 69   GLU B O     1 
ATOM   6066  C  CB    . GLU H 4 69  ? 62.400 68.040  76.157  1.00 63.13  ? 69   GLU B CB    1 
ATOM   6067  C  CG    . GLU H 4 69  ? 62.783 67.205  77.361  1.00 64.83  ? 69   GLU B CG    1 
ATOM   6068  C  CD    . GLU H 4 69  ? 61.783 67.352  78.526  1.00 66.22  ? 69   GLU B CD    1 
ATOM   6069  O  OE1   . GLU H 4 69  ? 61.569 66.354  79.265  1.00 65.70  ? 69   GLU B OE1   1 
ATOM   6070  O  OE2   . GLU H 4 69  ? 61.231 68.474  78.707  1.00 66.47  ? 69   GLU B OE2   1 
ATOM   6071  N  N     . ASP H 4 70  ? 61.216 68.792  73.503  1.00 58.38  ? 70   ASP B N     1 
ATOM   6072  C  CA    . ASP H 4 70  ? 60.793 69.747  72.490  1.00 57.03  ? 70   ASP B CA    1 
ATOM   6073  C  C     . ASP H 4 70  ? 59.346 69.519  72.066  1.00 53.50  ? 70   ASP B C     1 
ATOM   6074  O  O     . ASP H 4 70  ? 58.518 70.422  72.176  1.00 51.76  ? 70   ASP B O     1 
ATOM   6075  C  CB    . ASP H 4 70  ? 61.728 69.672  71.274  1.00 62.22  ? 70   ASP B CB    1 
ATOM   6076  C  CG    . ASP H 4 70  ? 63.214 69.989  71.625  1.00 66.67  ? 70   ASP B CG    1 
ATOM   6077  O  OD1   . ASP H 4 70  ? 63.463 70.991  72.362  1.00 68.97  ? 70   ASP B OD1   1 
ATOM   6078  O  OD2   . ASP H 4 70  ? 64.126 69.244  71.146  1.00 68.11  ? 70   ASP B OD2   1 
ATOM   6079  N  N     . VAL H 4 71  ? 59.037 68.321  71.583  1.00 49.16  ? 71   VAL B N     1 
ATOM   6080  C  CA    . VAL H 4 71  ? 57.663 68.031  71.197  1.00 47.37  ? 71   VAL B CA    1 
ATOM   6081  C  C     . VAL H 4 71  ? 56.734 68.488  72.319  1.00 46.58  ? 71   VAL B C     1 
ATOM   6082  O  O     . VAL H 4 71  ? 55.774 69.209  72.082  1.00 45.83  ? 71   VAL B O     1 
ATOM   6083  C  CB    . VAL H 4 71  ? 57.403 66.526  71.007  1.00 46.71  ? 71   VAL B CB    1 
ATOM   6084  C  CG1   . VAL H 4 71  ? 55.937 66.305  70.681  1.00 46.33  ? 71   VAL B CG1   1 
ATOM   6085  C  CG2   . VAL H 4 71  ? 58.271 65.961  69.919  1.00 47.03  ? 71   VAL B CG2   1 
ATOM   6086  N  N     . ARG H 4 72  ? 57.036 68.051  73.542  1.00 46.91  ? 72   ARG B N     1 
ATOM   6087  C  CA    . ARG H 4 72  ? 56.248 68.384  74.715  1.00 45.98  ? 72   ARG B CA    1 
ATOM   6088  C  C     . ARG H 4 72  ? 56.063 69.863  74.899  1.00 47.77  ? 72   ARG B C     1 
ATOM   6089  O  O     . ARG H 4 72  ? 54.934 70.346  75.015  1.00 48.06  ? 72   ARG B O     1 
ATOM   6090  C  CB    . ARG H 4 72  ? 56.893 67.838  75.960  1.00 44.23  ? 72   ARG B CB    1 
ATOM   6091  C  CG    . ARG H 4 72  ? 56.235 68.320  77.230  1.00 42.89  ? 72   ARG B CG    1 
ATOM   6092  C  CD    . ARG H 4 72  ? 56.741 67.510  78.414  1.00 43.59  ? 72   ARG B CD    1 
ATOM   6093  N  NE    . ARG H 4 72  ? 56.996 68.314  79.606  1.00 42.12  ? 72   ARG B NE    1 
ATOM   6094  C  CZ    . ARG H 4 72  ? 56.049 68.771  80.405  1.00 41.43  ? 72   ARG B CZ    1 
ATOM   6095  N  NH1   . ARG H 4 72  ? 54.787 68.497  80.131  1.00 42.02  ? 72   ARG B NH1   1 
ATOM   6096  N  NH2   . ARG H 4 72  ? 56.362 69.494  81.467  1.00 40.79  ? 72   ARG B NH2   1 
ATOM   6097  N  N     . ASP H 4 73  ? 57.171 70.594  74.942  1.00 50.02  ? 73   ASP B N     1 
ATOM   6098  C  CA    . ASP H 4 73  ? 57.088 72.043  75.117  1.00 51.29  ? 73   ASP B CA    1 
ATOM   6099  C  C     . ASP H 4 73  ? 56.093 72.638  74.115  1.00 51.02  ? 73   ASP B C     1 
ATOM   6100  O  O     . ASP H 4 73  ? 55.313 73.556  74.442  1.00 50.04  ? 73   ASP B O     1 
ATOM   6101  C  CB    . ASP H 4 73  ? 58.472 72.677  74.960  1.00 53.43  ? 73   ASP B CB    1 
ATOM   6102  C  CG    . ASP H 4 73  ? 59.179 72.858  76.299  1.00 56.82  ? 73   ASP B CG    1 
ATOM   6103  O  OD1   . ASP H 4 73  ? 58.483 73.253  77.265  1.00 58.55  ? 73   ASP B OD1   1 
ATOM   6104  O  OD2   . ASP H 4 73  ? 60.414 72.627  76.393  1.00 59.38  ? 73   ASP B OD2   1 
ATOM   6105  N  N     . TYR H 4 74  ? 56.115 72.070  72.908  1.00 49.72  ? 74   TYR B N     1 
ATOM   6106  C  CA    . TYR H 4 74  ? 55.241 72.484  71.823  1.00 47.79  ? 74   TYR B CA    1 
ATOM   6107  C  C     . TYR H 4 74  ? 53.806 72.093  72.126  1.00 46.58  ? 74   TYR B C     1 
ATOM   6108  O  O     . TYR H 4 74  ? 52.923 72.944  72.169  1.00 46.38  ? 74   TYR B O     1 
ATOM   6109  C  CB    . TYR H 4 74  ? 55.696 71.839  70.508  1.00 47.92  ? 74   TYR B CB    1 
ATOM   6110  C  CG    . TYR H 4 74  ? 54.752 72.050  69.347  1.00 48.11  ? 74   TYR B CG    1 
ATOM   6111  C  CD1   . TYR H 4 74  ? 54.261 73.312  69.042  1.00 49.35  ? 74   TYR B CD1   1 
ATOM   6112  C  CD2   . TYR H 4 74  ? 54.345 70.991  68.555  1.00 48.34  ? 74   TYR B CD2   1 
ATOM   6113  C  CE1   . TYR H 4 74  ? 53.385 73.514  67.975  1.00 48.84  ? 74   TYR B CE1   1 
ATOM   6114  C  CE2   . TYR H 4 74  ? 53.467 71.181  67.489  1.00 48.52  ? 74   TYR B CE2   1 
ATOM   6115  C  CZ    . TYR H 4 74  ? 52.992 72.445  67.206  1.00 48.75  ? 74   TYR B CZ    1 
ATOM   6116  O  OH    . TYR H 4 74  ? 52.116 72.640  66.163  1.00 48.93  ? 74   TYR B OH    1 
ATOM   6117  N  N     . LEU H 4 75  ? 53.574 70.803  72.345  1.00 45.92  ? 75   LEU B N     1 
ATOM   6118  C  CA    . LEU H 4 75  ? 52.224 70.341  72.618  1.00 44.31  ? 75   LEU B CA    1 
ATOM   6119  C  C     . LEU H 4 75  ? 51.694 71.184  73.712  1.00 43.62  ? 75   LEU B C     1 
ATOM   6120  O  O     . LEU H 4 75  ? 50.501 71.425  73.795  1.00 44.64  ? 75   LEU B O     1 
ATOM   6121  C  CB    . LEU H 4 75  ? 52.195 68.876  73.047  1.00 42.64  ? 75   LEU B CB    1 
ATOM   6122  C  CG    . LEU H 4 75  ? 52.342 67.906  71.882  1.00 40.84  ? 75   LEU B CG    1 
ATOM   6123  C  CD1   . LEU H 4 75  ? 52.284 66.484  72.372  1.00 40.36  ? 75   LEU B CD1   1 
ATOM   6124  C  CD2   . LEU H 4 75  ? 51.229 68.179  70.906  1.00 39.83  ? 75   LEU B CD2   1 
ATOM   6125  N  N     . LEU H 4 76  ? 52.597 71.651  74.554  1.00 42.51  ? 76   LEU B N     1 
ATOM   6126  C  CA    . LEU H 4 76  ? 52.184 72.486  75.660  1.00 42.97  ? 76   LEU B CA    1 
ATOM   6127  C  C     . LEU H 4 76  ? 51.748 73.851  75.151  1.00 45.16  ? 76   LEU B C     1 
ATOM   6128  O  O     . LEU H 4 76  ? 50.709 74.407  75.563  1.00 45.02  ? 76   LEU B O     1 
ATOM   6129  C  CB    . LEU H 4 76  ? 53.325 72.607  76.643  1.00 39.51  ? 76   LEU B CB    1 
ATOM   6130  C  CG    . LEU H 4 76  ? 52.860 71.859  77.867  1.00 34.85  ? 76   LEU B CG    1 
ATOM   6131  C  CD1   . LEU H 4 76  ? 53.919 71.868  78.917  1.00 34.61  ? 76   LEU B CD1   1 
ATOM   6132  C  CD2   . LEU H 4 76  ? 51.588 72.514  78.338  1.00 34.54  ? 76   LEU B CD2   1 
ATOM   6133  N  N     . TYR H 4 77  ? 52.572 74.371  74.250  1.00 46.68  ? 77   TYR B N     1 
ATOM   6134  C  CA    . TYR H 4 77  ? 52.328 75.634  73.587  1.00 48.54  ? 77   TYR B CA    1 
ATOM   6135  C  C     . TYR H 4 77  ? 50.908 75.634  73.031  1.00 48.69  ? 77   TYR B C     1 
ATOM   6136  O  O     . TYR H 4 77  ? 50.084 76.428  73.446  1.00 48.16  ? 77   TYR B O     1 
ATOM   6137  C  CB    . TYR H 4 77  ? 53.354 75.785  72.469  1.00 50.19  ? 77   TYR B CB    1 
ATOM   6138  C  CG    . TYR H 4 77  ? 53.050 76.810  71.411  1.00 52.86  ? 77   TYR B CG    1 
ATOM   6139  C  CD1   . TYR H 4 77  ? 52.885 78.154  71.727  1.00 53.81  ? 77   TYR B CD1   1 
ATOM   6140  C  CD2   . TYR H 4 77  ? 52.993 76.433  70.072  1.00 54.84  ? 77   TYR B CD2   1 
ATOM   6141  C  CE1   . TYR H 4 77  ? 52.679 79.108  70.724  1.00 57.10  ? 77   TYR B CE1   1 
ATOM   6142  C  CE2   . TYR H 4 77  ? 52.789 77.359  69.062  1.00 57.28  ? 77   TYR B CE2   1 
ATOM   6143  C  CZ    . TYR H 4 77  ? 52.635 78.703  69.378  1.00 58.72  ? 77   TYR B CZ    1 
ATOM   6144  O  OH    . TYR H 4 77  ? 52.484 79.624  68.337  1.00 60.05  ? 77   TYR B OH    1 
ATOM   6145  N  N     . LEU H 4 78  ? 50.622 74.728  72.103  1.00 49.18  ? 78   LEU B N     1 
ATOM   6146  C  CA    . LEU H 4 78  ? 49.300 74.650  71.508  1.00 50.16  ? 78   LEU B CA    1 
ATOM   6147  C  C     . LEU H 4 78  ? 48.179 74.715  72.517  1.00 52.28  ? 78   LEU B C     1 
ATOM   6148  O  O     . LEU H 4 78  ? 47.123 75.278  72.232  1.00 52.63  ? 78   LEU B O     1 
ATOM   6149  C  CB    . LEU H 4 78  ? 49.130 73.364  70.733  1.00 49.83  ? 78   LEU B CB    1 
ATOM   6150  C  CG    . LEU H 4 78  ? 50.077 73.201  69.573  1.00 50.35  ? 78   LEU B CG    1 
ATOM   6151  C  CD1   . LEU H 4 78  ? 49.837 71.857  68.914  1.00 50.65  ? 78   LEU B CD1   1 
ATOM   6152  C  CD2   . LEU H 4 78  ? 49.849 74.331  68.600  1.00 50.94  ? 78   LEU B CD2   1 
ATOM   6153  N  N     . GLN H 4 79  ? 48.369 74.118  73.689  1.00 54.39  ? 79   GLN B N     1 
ATOM   6154  C  CA    . GLN H 4 79  ? 47.283 74.157  74.655  1.00 56.85  ? 79   GLN B CA    1 
ATOM   6155  C  C     . GLN H 4 79  ? 47.083 75.579  75.120  1.00 57.62  ? 79   GLN B C     1 
ATOM   6156  O  O     . GLN H 4 79  ? 45.972 75.973  75.480  1.00 57.71  ? 79   GLN B O     1 
ATOM   6157  C  CB    . GLN H 4 79  ? 47.546 73.281  75.867  1.00 56.75  ? 79   GLN B CB    1 
ATOM   6158  C  CG    . GLN H 4 79  ? 46.376 73.380  76.828  1.00 57.51  ? 79   GLN B CG    1 
ATOM   6159  C  CD    . GLN H 4 79  ? 46.658 72.737  78.161  1.00 59.10  ? 79   GLN B CD    1 
ATOM   6160  O  OE1   . GLN H 4 79  ? 47.749 72.900  78.726  1.00 59.84  ? 79   GLN B OE1   1 
ATOM   6161  N  NE2   . GLN H 4 79  ? 45.670 72.016  78.690  1.00 58.72  ? 79   GLN B NE2   1 
ATOM   6162  N  N     . ALA H 4 80  ? 48.178 76.335  75.110  1.00 58.87  ? 80   ALA B N     1 
ATOM   6163  C  CA    . ALA H 4 80  ? 48.174 77.740  75.511  1.00 59.20  ? 80   ALA B CA    1 
ATOM   6164  C  C     . ALA H 4 80  ? 47.454 78.567  74.462  1.00 58.81  ? 80   ALA B C     1 
ATOM   6165  O  O     . ALA H 4 80  ? 46.559 79.333  74.797  1.00 59.09  ? 80   ALA B O     1 
ATOM   6166  C  CB    . ALA H 4 80  ? 49.626 78.257  75.682  1.00 61.20  ? 80   ALA B CB    1 
ATOM   6167  N  N     . ARG H 4 81  ? 47.853 78.400  73.200  1.00 58.20  ? 81   ARG B N     1 
ATOM   6168  C  CA    . ARG H 4 81  ? 47.256 79.123  72.085  1.00 57.54  ? 81   ARG B CA    1 
ATOM   6169  C  C     . ARG H 4 81  ? 45.741 78.851  71.982  1.00 56.01  ? 81   ARG B C     1 
ATOM   6170  O  O     . ARG H 4 81  ? 45.098 79.286  71.028  1.00 55.92  ? 81   ARG B O     1 
ATOM   6171  C  CB    . ARG H 4 81  ? 47.983 78.755  70.775  1.00 60.32  ? 81   ARG B CB    1 
ATOM   6172  C  CG    . ARG H 4 81  ? 47.903 79.811  69.654  1.00 65.43  ? 81   ARG B CG    1 
ATOM   6173  C  CD    . ARG H 4 81  ? 48.897 79.555  68.492  1.00 68.69  ? 81   ARG B CD    1 
ATOM   6174  N  NE    . ARG H 4 81  ? 48.442 78.557  67.512  1.00 72.15  ? 81   ARG B NE    1 
ATOM   6175  C  CZ    . ARG H 4 81  ? 49.186 78.090  66.501  1.00 73.92  ? 81   ARG B CZ    1 
ATOM   6176  N  NH1   . ARG H 4 81  ? 50.433 78.526  66.328  1.00 74.85  ? 81   ARG B NH1   1 
ATOM   6177  N  NH2   . ARG H 4 81  ? 48.689 77.185  65.652  1.00 74.29  ? 81   ARG B NH2   1 
ATOM   6178  N  N     . GLY H 4 82  ? 45.193 78.124  72.967  1.00 54.68  ? 82   GLY B N     1 
ATOM   6179  C  CA    . GLY H 4 82  ? 43.757 77.832  73.052  1.00 51.90  ? 82   GLY B CA    1 
ATOM   6180  C  C     . GLY H 4 82  ? 43.112 76.748  72.201  1.00 50.30  ? 82   GLY B C     1 
ATOM   6181  O  O     . GLY H 4 82  ? 41.884 76.667  72.116  1.00 48.76  ? 82   GLY B O     1 
ATOM   6182  N  N     . LEU H 4 83  ? 43.937 75.899  71.593  1.00 48.64  ? 83   LEU B N     1 
ATOM   6183  C  CA    . LEU H 4 83  ? 43.471 74.837  70.707  1.00 46.62  ? 83   LEU B CA    1 
ATOM   6184  C  C     . LEU H 4 83  ? 42.617 73.744  71.325  1.00 46.67  ? 83   LEU B C     1 
ATOM   6185  O  O     . LEU H 4 83  ? 42.634 73.542  72.538  1.00 48.12  ? 83   LEU B O     1 
ATOM   6186  C  CB    . LEU H 4 83  ? 44.675 74.231  70.002  1.00 44.87  ? 83   LEU B CB    1 
ATOM   6187  C  CG    . LEU H 4 83  ? 45.174 75.202  68.940  1.00 42.14  ? 83   LEU B CG    1 
ATOM   6188  C  CD1   . LEU H 4 83  ? 46.446 74.731  68.303  1.00 42.50  ? 83   LEU B CD1   1 
ATOM   6189  C  CD2   . LEU H 4 83  ? 44.094 75.335  67.905  1.00 41.02  ? 83   LEU B CD2   1 
ATOM   6190  N  N     . ALA H 4 84  ? 41.864 73.040  70.484  1.00 45.52  ? 84   ALA B N     1 
ATOM   6191  C  CA    . ALA H 4 84  ? 40.996 71.968  70.964  1.00 44.54  ? 84   ALA B CA    1 
ATOM   6192  C  C     . ALA H 4 84  ? 41.827 70.734  71.246  1.00 43.24  ? 84   ALA B C     1 
ATOM   6193  O  O     . ALA H 4 84  ? 42.862 70.536  70.598  1.00 43.68  ? 84   ALA B O     1 
ATOM   6194  C  CB    . ALA H 4 84  ? 39.954 71.657  69.940  1.00 44.92  ? 84   ALA B CB    1 
ATOM   6195  N  N     . VAL H 4 85  ? 41.398 69.909  72.203  1.00 41.49  ? 85   VAL B N     1 
ATOM   6196  C  CA    . VAL H 4 85  ? 42.175 68.709  72.517  1.00 40.35  ? 85   VAL B CA    1 
ATOM   6197  C  C     . VAL H 4 85  ? 42.339 67.954  71.220  1.00 40.90  ? 85   VAL B C     1 
ATOM   6198  O  O     . VAL H 4 85  ? 43.457 67.721  70.760  1.00 41.55  ? 85   VAL B O     1 
ATOM   6199  C  CB    . VAL H 4 85  ? 41.474 67.758  73.510  1.00 38.79  ? 85   VAL B CB    1 
ATOM   6200  C  CG1   . VAL H 4 85  ? 42.272 66.499  73.650  1.00 36.65  ? 85   VAL B CG1   1 
ATOM   6201  C  CG2   . VAL H 4 85  ? 41.343 68.395  74.840  1.00 37.52  ? 85   VAL B CG2   1 
ATOM   6202  N  N     . LYS H 4 86  ? 41.200 67.594  70.638  1.00 40.52  ? 86   LYS B N     1 
ATOM   6203  C  CA    . LYS H 4 86  ? 41.135 66.862  69.382  1.00 40.84  ? 86   LYS B CA    1 
ATOM   6204  C  C     . LYS H 4 86  ? 42.182 67.350  68.354  1.00 39.91  ? 86   LYS B C     1 
ATOM   6205  O  O     . LYS H 4 86  ? 42.733 66.549  67.600  1.00 39.91  ? 86   LYS B O     1 
ATOM   6206  C  CB    . LYS H 4 86  ? 39.720 67.010  68.820  1.00 40.91  ? 86   LYS B CB    1 
ATOM   6207  C  CG    . LYS H 4 86  ? 39.196 65.821  68.067  1.00 41.07  ? 86   LYS B CG    1 
ATOM   6208  C  CD    . LYS H 4 86  ? 38.743 64.722  68.994  1.00 42.30  ? 86   LYS B CD    1 
ATOM   6209  C  CE    . LYS H 4 86  ? 38.097 63.619  68.188  1.00 43.02  ? 86   LYS B CE    1 
ATOM   6210  N  NZ    . LYS H 4 86  ? 37.430 62.599  69.037  1.00 46.58  ? 86   LYS B NZ    1 
ATOM   6211  N  N     . THR H 4 87  ? 42.445 68.662  68.334  1.00 39.12  ? 87   THR B N     1 
ATOM   6212  C  CA    . THR H 4 87  ? 43.418 69.285  67.428  1.00 38.48  ? 87   THR B CA    1 
ATOM   6213  C  C     . THR H 4 87  ? 44.850 68.965  67.807  1.00 38.44  ? 87   THR B C     1 
ATOM   6214  O  O     . THR H 4 87  ? 45.632 68.477  66.986  1.00 37.79  ? 87   THR B O     1 
ATOM   6215  C  CB    . THR H 4 87  ? 43.308 70.808  67.435  1.00 38.31  ? 87   THR B CB    1 
ATOM   6216  O  OG1   . THR H 4 87  ? 42.166 71.218  66.676  1.00 40.38  ? 87   THR B OG1   1 
ATOM   6217  C  CG2   . THR H 4 87  ? 44.533 71.410  66.823  1.00 37.71  ? 87   THR B CG2   1 
ATOM   6218  N  N     . ILE H 4 88  ? 45.198 69.279  69.052  1.00 38.51  ? 88   ILE B N     1 
ATOM   6219  C  CA    . ILE H 4 88  ? 46.540 69.016  69.548  1.00 38.23  ? 88   ILE B CA    1 
ATOM   6220  C  C     . ILE H 4 88  ? 46.855 67.558  69.237  1.00 38.59  ? 88   ILE B C     1 
ATOM   6221  O  O     . ILE H 4 88  ? 47.961 67.218  68.814  1.00 37.87  ? 88   ILE B O     1 
ATOM   6222  C  CB    . ILE H 4 88  ? 46.619 69.282  71.052  1.00 36.17  ? 88   ILE B CB    1 
ATOM   6223  C  CG1   . ILE H 4 88  ? 46.216 70.726  71.310  1.00 35.70  ? 88   ILE B CG1   1 
ATOM   6224  C  CG2   . ILE H 4 88  ? 48.038 69.078  71.563  1.00 36.00  ? 88   ILE B CG2   1 
ATOM   6225  C  CD1   . ILE H 4 88  ? 45.386 70.911  72.536  1.00 35.21  ? 88   ILE B CD1   1 
ATOM   6226  N  N     . GLN H 4 89  ? 45.857 66.702  69.409  1.00 40.66  ? 89   GLN B N     1 
ATOM   6227  C  CA    . GLN H 4 89  ? 46.035 65.279  69.132  1.00 43.30  ? 89   GLN B CA    1 
ATOM   6228  C  C     . GLN H 4 89  ? 46.436 65.023  67.675  1.00 43.16  ? 89   GLN B C     1 
ATOM   6229  O  O     . GLN H 4 89  ? 47.192 64.083  67.401  1.00 43.77  ? 89   GLN B O     1 
ATOM   6230  C  CB    . GLN H 4 89  ? 44.754 64.478  69.441  1.00 45.20  ? 89   GLN B CB    1 
ATOM   6231  C  CG    . GLN H 4 89  ? 44.364 64.341  70.923  1.00 47.17  ? 89   GLN B CG    1 
ATOM   6232  C  CD    . GLN H 4 89  ? 43.287 63.273  71.150  1.00 49.27  ? 89   GLN B CD    1 
ATOM   6233  O  OE1   . GLN H 4 89  ? 42.372 63.099  70.332  1.00 50.56  ? 89   GLN B OE1   1 
ATOM   6234  N  NE2   . GLN H 4 89  ? 43.389 62.558  72.271  1.00 51.13  ? 89   GLN B NE2   1 
ATOM   6235  N  N     . GLN H 4 90  ? 45.924 65.841  66.751  1.00 42.53  ? 90   GLN B N     1 
ATOM   6236  C  CA    . GLN H 4 90  ? 46.232 65.687  65.328  1.00 39.92  ? 90   GLN B CA    1 
ATOM   6237  C  C     . GLN H 4 90  ? 47.684 66.055  65.136  1.00 37.95  ? 90   GLN B C     1 
ATOM   6238  O  O     . GLN H 4 90  ? 48.435 65.359  64.454  1.00 36.21  ? 90   GLN B O     1 
ATOM   6239  C  CB    . GLN H 4 90  ? 45.332 66.592  64.484  1.00 42.15  ? 90   GLN B CB    1 
ATOM   6240  C  CG    . GLN H 4 90  ? 45.785 66.795  63.034  1.00 44.81  ? 90   GLN B CG    1 
ATOM   6241  C  CD    . GLN H 4 90  ? 45.438 65.640  62.113  1.00 45.93  ? 90   GLN B CD    1 
ATOM   6242  O  OE1   . GLN H 4 90  ? 44.288 65.235  62.039  1.00 47.06  ? 90   GLN B OE1   1 
ATOM   6243  N  NE2   . GLN H 4 90  ? 46.430 65.118  61.391  1.00 45.48  ? 90   GLN B NE2   1 
ATOM   6244  N  N     . HIS H 4 91  ? 48.091 67.151  65.753  1.00 37.04  ? 91   HIS B N     1 
ATOM   6245  C  CA    . HIS H 4 91  ? 49.474 67.542  65.629  1.00 37.82  ? 91   HIS B CA    1 
ATOM   6246  C  C     . HIS H 4 91  ? 50.381 66.433  66.156  1.00 37.88  ? 91   HIS B C     1 
ATOM   6247  O  O     . HIS H 4 91  ? 51.309 65.999  65.467  1.00 38.32  ? 91   HIS B O     1 
ATOM   6248  C  CB    . HIS H 4 91  ? 49.718 68.827  66.389  1.00 38.91  ? 91   HIS B CB    1 
ATOM   6249  C  CG    . HIS H 4 91  ? 49.185 70.030  65.694  1.00 42.20  ? 91   HIS B CG    1 
ATOM   6250  N  ND1   . HIS H 4 91  ? 49.906 70.713  64.740  1.00 43.17  ? 91   HIS B ND1   1 
ATOM   6251  C  CD2   . HIS H 4 91  ? 47.984 70.652  65.782  1.00 43.48  ? 91   HIS B CD2   1 
ATOM   6252  C  CE1   . HIS H 4 91  ? 49.171 71.708  64.271  1.00 44.89  ? 91   HIS B CE1   1 
ATOM   6253  N  NE2   . HIS H 4 91  ? 48.000 71.693  64.886  1.00 43.91  ? 91   HIS B NE2   1 
ATOM   6254  N  N     . LEU H 4 92  ? 50.119 65.960  67.371  1.00 36.24  ? 92   LEU B N     1 
ATOM   6255  C  CA    . LEU H 4 92  ? 50.956 64.915  67.907  1.00 35.02  ? 92   LEU B CA    1 
ATOM   6256  C  C     . LEU H 4 92  ? 50.947 63.746  66.959  1.00 35.62  ? 92   LEU B C     1 
ATOM   6257  O  O     . LEU H 4 92  ? 51.971 63.120  66.730  1.00 37.48  ? 92   LEU B O     1 
ATOM   6258  C  CB    . LEU H 4 92  ? 50.466 64.463  69.269  1.00 32.83  ? 92   LEU B CB    1 
ATOM   6259  C  CG    . LEU H 4 92  ? 51.194 63.262  69.888  1.00 31.54  ? 92   LEU B CG    1 
ATOM   6260  C  CD1   . LEU H 4 92  ? 52.715 63.348  69.835  1.00 29.11  ? 92   LEU B CD1   1 
ATOM   6261  C  CD2   . LEU H 4 92  ? 50.740 63.206  71.310  1.00 31.64  ? 92   LEU B CD2   1 
ATOM   6262  N  N     . GLY H 4 93  ? 49.794 63.467  66.380  1.00 36.06  ? 93   GLY B N     1 
ATOM   6263  C  CA    . GLY H 4 93  ? 49.695 62.334  65.487  1.00 37.41  ? 93   GLY B CA    1 
ATOM   6264  C  C     . GLY H 4 93  ? 50.569 62.396  64.265  1.00 38.36  ? 93   GLY B C     1 
ATOM   6265  O  O     . GLY H 4 93  ? 51.364 61.490  64.012  1.00 38.02  ? 93   GLY B O     1 
ATOM   6266  N  N     . GLN H 4 94  ? 50.399 63.461  63.490  1.00 40.40  ? 94   GLN B N     1 
ATOM   6267  C  CA    . GLN H 4 94  ? 51.185 63.657  62.276  1.00 42.31  ? 94   GLN B CA    1 
ATOM   6268  C  C     . GLN H 4 94  ? 52.667 63.581  62.613  1.00 43.20  ? 94   GLN B C     1 
ATOM   6269  O  O     . GLN H 4 94  ? 53.465 63.036  61.860  1.00 43.80  ? 94   GLN B O     1 
ATOM   6270  C  CB    . GLN H 4 94  ? 50.839 65.006  61.657  1.00 42.42  ? 94   GLN B CB    1 
ATOM   6271  C  CG    . GLN H 4 94  ? 49.439 65.035  61.124  1.00 43.63  ? 94   GLN B CG    1 
ATOM   6272  C  CD    . GLN H 4 94  ? 49.254 64.048  59.995  1.00 45.67  ? 94   GLN B CD    1 
ATOM   6273  O  OE1   . GLN H 4 94  ? 49.705 62.905  60.072  1.00 47.21  ? 94   GLN B OE1   1 
ATOM   6274  N  NE2   . GLN H 4 94  ? 48.586 64.481  58.935  1.00 47.24  ? 94   GLN B NE2   1 
ATOM   6275  N  N     . LEU H 4 95  ? 53.031 64.126  63.760  1.00 43.23  ? 95   LEU B N     1 
ATOM   6276  C  CA    . LEU H 4 95  ? 54.408 64.076  64.173  1.00 43.48  ? 95   LEU B CA    1 
ATOM   6277  C  C     . LEU H 4 95  ? 54.855 62.618  64.301  1.00 43.41  ? 95   LEU B C     1 
ATOM   6278  O  O     . LEU H 4 95  ? 55.952 62.286  63.882  1.00 42.80  ? 95   LEU B O     1 
ATOM   6279  C  CB    . LEU H 4 95  ? 54.576 64.820  65.500  1.00 43.71  ? 95   LEU B CB    1 
ATOM   6280  C  CG    . LEU H 4 95  ? 55.741 65.811  65.605  1.00 43.16  ? 95   LEU B CG    1 
ATOM   6281  C  CD1   . LEU H 4 95  ? 56.117 66.284  64.229  1.00 41.57  ? 95   LEU B CD1   1 
ATOM   6282  C  CD2   . LEU H 4 95  ? 55.350 66.998  66.493  1.00 42.39  ? 95   LEU B CD2   1 
ATOM   6283  N  N     . ASN H 4 96  ? 54.010 61.744  64.847  1.00 44.70  ? 96   ASN B N     1 
ATOM   6284  C  CA    . ASN H 4 96  ? 54.400 60.334  65.005  1.00 46.19  ? 96   ASN B CA    1 
ATOM   6285  C  C     . ASN H 4 96  ? 54.436 59.531  63.726  1.00 46.84  ? 96   ASN B C     1 
ATOM   6286  O  O     . ASN H 4 96  ? 55.175 58.559  63.633  1.00 47.66  ? 96   ASN B O     1 
ATOM   6287  C  CB    . ASN H 4 96  ? 53.489 59.566  65.973  1.00 46.53  ? 96   ASN B CB    1 
ATOM   6288  C  CG    . ASN H 4 96  ? 53.589 60.060  67.386  1.00 47.35  ? 96   ASN B CG    1 
ATOM   6289  O  OD1   . ASN H 4 96  ? 54.658 60.476  67.833  1.00 48.09  ? 96   ASN B OD1   1 
ATOM   6290  N  ND2   . ASN H 4 96  ? 52.472 60.008  68.113  1.00 47.33  ? 96   ASN B ND2   1 
ATOM   6291  N  N     . MET H 4 97  ? 53.622 59.898  62.751  1.00 47.87  ? 97   MET B N     1 
ATOM   6292  C  CA    . MET H 4 97  ? 53.622 59.150  61.507  1.00 48.81  ? 97   MET B CA    1 
ATOM   6293  C  C     . MET H 4 97  ? 54.983 59.348  60.859  1.00 48.98  ? 97   MET B C     1 
ATOM   6294  O  O     . MET H 4 97  ? 55.706 58.394  60.558  1.00 48.66  ? 97   MET B O     1 
ATOM   6295  C  CB    . MET H 4 97  ? 52.532 59.670  60.589  1.00 50.11  ? 97   MET B CB    1 
ATOM   6296  C  CG    . MET H 4 97  ? 52.227 58.755  59.452  1.00 53.15  ? 97   MET B CG    1 
ATOM   6297  S  SD    . MET H 4 97  ? 51.399 59.664  58.156  1.00 58.46  ? 97   MET B SD    1 
ATOM   6298  C  CE    . MET H 4 97  ? 49.747 60.089  58.950  1.00 56.73  ? 97   MET B CE    1 
ATOM   6299  N  N     . LEU H 4 98  ? 55.341 60.610  60.674  1.00 49.00  ? 98   LEU B N     1 
ATOM   6300  C  CA    . LEU H 4 98  ? 56.611 60.960  60.063  1.00 50.14  ? 98   LEU B CA    1 
ATOM   6301  C  C     . LEU H 4 98  ? 57.812 60.227  60.685  1.00 50.19  ? 98   LEU B C     1 
ATOM   6302  O  O     . LEU H 4 98  ? 58.712 59.813  59.970  1.00 51.00  ? 98   LEU B O     1 
ATOM   6303  C  CB    . LEU H 4 98  ? 56.804 62.479  60.125  1.00 50.12  ? 98   LEU B CB    1 
ATOM   6304  C  CG    . LEU H 4 98  ? 58.071 63.079  59.525  1.00 49.56  ? 98   LEU B CG    1 
ATOM   6305  C  CD1   . LEU H 4 98  ? 58.199 62.701  58.071  1.00 48.90  ? 98   LEU B CD1   1 
ATOM   6306  C  CD2   . LEU H 4 98  ? 58.005 64.585  59.691  1.00 50.08  ? 98   LEU B CD2   1 
ATOM   6307  N  N     . HIS H 4 99  ? 57.832 60.051  61.999  1.00 50.39  ? 99   HIS B N     1 
ATOM   6308  C  CA    . HIS H 4 99  ? 58.953 59.360  62.609  1.00 51.20  ? 99   HIS B CA    1 
ATOM   6309  C  C     . HIS H 4 99  ? 58.950 57.864  62.390  1.00 53.91  ? 99   HIS B C     1 
ATOM   6310  O  O     . HIS H 4 99  ? 59.985 57.289  62.049  1.00 54.95  ? 99   HIS B O     1 
ATOM   6311  C  CB    . HIS H 4 99  ? 59.023 59.643  64.093  1.00 48.85  ? 99   HIS B CB    1 
ATOM   6312  C  CG    . HIS H 4 99  ? 59.585 60.984  64.403  1.00 48.50  ? 99   HIS B CG    1 
ATOM   6313  N  ND1   . HIS H 4 99  ? 58.906 62.152  64.133  1.00 49.29  ? 99   HIS B ND1   1 
ATOM   6314  C  CD2   . HIS H 4 99  ? 60.786 61.352  64.902  1.00 48.34  ? 99   HIS B CD2   1 
ATOM   6315  C  CE1   . HIS H 4 99  ? 59.666 63.184  64.451  1.00 48.96  ? 99   HIS B CE1   1 
ATOM   6316  N  NE2   . HIS H 4 99  ? 60.812 62.725  64.918  1.00 49.03  ? 99   HIS B NE2   1 
ATOM   6317  N  N     . ARG H 4 100 ? 57.799 57.225  62.585  1.00 56.96  ? 100  ARG B N     1 
ATOM   6318  C  CA    . ARG H 4 100 ? 57.706 55.777  62.405  1.00 58.99  ? 100  ARG B CA    1 
ATOM   6319  C  C     . ARG H 4 100 ? 57.817 55.440  60.921  1.00 59.24  ? 100  ARG B C     1 
ATOM   6320  O  O     . ARG H 4 100 ? 58.568 54.549  60.517  1.00 59.61  ? 100  ARG B O     1 
ATOM   6321  C  CB    . ARG H 4 100 ? 56.379 55.242  62.962  1.00 60.12  ? 100  ARG B CB    1 
ATOM   6322  C  CG    . ARG H 4 100 ? 56.375 53.730  63.218  1.00 63.62  ? 100  ARG B CG    1 
ATOM   6323  C  CD    . ARG H 4 100 ? 54.980 53.203  63.601  1.00 66.48  ? 100  ARG B CD    1 
ATOM   6324  N  NE    . ARG H 4 100 ? 53.968 53.509  62.582  1.00 68.61  ? 100  ARG B NE    1 
ATOM   6325  C  CZ    . ARG H 4 100 ? 53.316 52.601  61.853  1.00 69.14  ? 100  ARG B CZ    1 
ATOM   6326  N  NH1   . ARG H 4 100 ? 53.554 51.299  62.014  1.00 67.86  ? 100  ARG B NH1   1 
ATOM   6327  N  NH2   . ARG H 4 100 ? 52.420 53.006  60.957  1.00 68.91  ? 100  ARG B NH2   1 
ATOM   6328  N  N     . ARG H 4 101 ? 57.083 56.170  60.099  1.00 58.84  ? 101  ARG B N     1 
ATOM   6329  C  CA    . ARG H 4 101 ? 57.129 55.891  58.688  1.00 59.49  ? 101  ARG B CA    1 
ATOM   6330  C  C     . ARG H 4 101 ? 58.561 55.999  58.155  1.00 60.61  ? 101  ARG B C     1 
ATOM   6331  O  O     . ARG H 4 101 ? 58.899 55.382  57.135  1.00 62.25  ? 101  ARG B O     1 
ATOM   6332  C  CB    . ARG H 4 101 ? 56.202 56.843  57.933  1.00 59.71  ? 101  ARG B CB    1 
ATOM   6333  C  CG    . ARG H 4 101 ? 55.347 56.142  56.885  1.00 60.48  ? 101  ARG B CG    1 
ATOM   6334  C  CD    . ARG H 4 101 ? 54.331 55.197  57.521  1.00 61.29  ? 101  ARG B CD    1 
ATOM   6335  N  NE    . ARG H 4 101 ? 53.786 54.241  56.558  1.00 62.70  ? 101  ARG B NE    1 
ATOM   6336  C  CZ    . ARG H 4 101 ? 52.604 53.642  56.682  1.00 62.30  ? 101  ARG B CZ    1 
ATOM   6337  N  NH1   . ARG H 4 101 ? 51.838 53.902  57.725  1.00 62.24  ? 101  ARG B NH1   1 
ATOM   6338  N  NH2   . ARG H 4 101 ? 52.187 52.786  55.759  1.00 62.92  ? 101  ARG B NH2   1 
ATOM   6339  N  N     . SER H 4 102 ? 59.411 56.761  58.843  1.00 60.10  ? 102  SER B N     1 
ATOM   6340  C  CA    . SER H 4 102 ? 60.792 56.926  58.389  1.00 59.11  ? 102  SER B CA    1 
ATOM   6341  C  C     . SER H 4 102 ? 61.800 56.025  59.114  1.00 58.81  ? 102  SER B C     1 
ATOM   6342  O  O     . SER H 4 102 ? 62.998 56.135  58.891  1.00 58.19  ? 102  SER B O     1 
ATOM   6343  C  CB    . SER H 4 102 ? 61.225 58.385  58.526  1.00 59.01  ? 102  SER B CB    1 
ATOM   6344  O  OG    . SER H 4 102 ? 61.657 58.665  59.848  1.00 60.25  ? 102  SER B OG    1 
ATOM   6345  N  N     . GLY H 4 103 ? 61.321 55.138  59.980  1.00 59.18  ? 103  GLY B N     1 
ATOM   6346  C  CA    . GLY H 4 103 ? 62.224 54.241  60.680  1.00 59.82  ? 103  GLY B CA    1 
ATOM   6347  C  C     . GLY H 4 103 ? 62.752 54.709  62.026  1.00 60.34  ? 103  GLY B C     1 
ATOM   6348  O  O     . GLY H 4 103 ? 63.767 54.206  62.509  1.00 61.29  ? 103  GLY B O     1 
ATOM   6349  N  N     . LEU H 4 104 ? 62.071 55.660  62.653  1.00 60.52  ? 104  LEU B N     1 
ATOM   6350  C  CA    . LEU H 4 104 ? 62.513 56.161  63.951  1.00 60.62  ? 104  LEU B CA    1 
ATOM   6351  C  C     . LEU H 4 104 ? 61.487 55.934  65.047  1.00 60.02  ? 104  LEU B C     1 
ATOM   6352  O  O     . LEU H 4 104 ? 60.311 55.696  64.779  1.00 60.84  ? 104  LEU B O     1 
ATOM   6353  C  CB    . LEU H 4 104 ? 62.800 57.655  63.862  1.00 60.91  ? 104  LEU B CB    1 
ATOM   6354  C  CG    . LEU H 4 104 ? 63.867 58.019  62.841  1.00 61.60  ? 104  LEU B CG    1 
ATOM   6355  C  CD1   . LEU H 4 104 ? 63.951 59.530  62.674  1.00 61.15  ? 104  LEU B CD1   1 
ATOM   6356  C  CD2   . LEU H 4 104 ? 65.186 57.424  63.306  1.00 62.49  ? 104  LEU B CD2   1 
ATOM   6357  N  N     . PRO H 4 105 ? 61.928 55.987  66.307  1.00 59.00  ? 105  PRO B N     1 
ATOM   6358  C  CA    . PRO H 4 105 ? 61.020 55.797  67.437  1.00 58.16  ? 105  PRO B CA    1 
ATOM   6359  C  C     . PRO H 4 105 ? 60.084 57.004  67.495  1.00 57.18  ? 105  PRO B C     1 
ATOM   6360  O  O     . PRO H 4 105 ? 60.503 58.134  67.235  1.00 56.99  ? 105  PRO B O     1 
ATOM   6361  C  CB    . PRO H 4 105 ? 61.973 55.736  68.631  1.00 59.12  ? 105  PRO B CB    1 
ATOM   6362  C  CG    . PRO H 4 105 ? 63.110 56.628  68.206  1.00 59.09  ? 105  PRO B CG    1 
ATOM   6363  C  CD    . PRO H 4 105 ? 63.313 56.167  66.774  1.00 59.44  ? 105  PRO B CD    1 
ATOM   6364  N  N     . ARG H 4 106 ? 58.824 56.777  67.838  1.00 55.85  ? 106  ARG B N     1 
ATOM   6365  C  CA    . ARG H 4 106 ? 57.870 57.879  67.883  1.00 54.99  ? 106  ARG B CA    1 
ATOM   6366  C  C     . ARG H 4 106 ? 58.079 58.772  69.095  1.00 53.89  ? 106  ARG B C     1 
ATOM   6367  O  O     . ARG H 4 106 ? 58.477 58.308  70.149  1.00 54.16  ? 106  ARG B O     1 
ATOM   6368  C  CB    . ARG H 4 106 ? 56.434 57.331  67.900  1.00 55.44  ? 106  ARG B CB    1 
ATOM   6369  C  CG    . ARG H 4 106 ? 56.208 56.186  66.945  1.00 56.32  ? 106  ARG B CG    1 
ATOM   6370  C  CD    . ARG H 4 106 ? 55.632 54.966  67.635  1.00 57.09  ? 106  ARG B CD    1 
ATOM   6371  N  NE    . ARG H 4 106 ? 54.173 54.974  67.600  1.00 58.36  ? 106  ARG B NE    1 
ATOM   6372  C  CZ    . ARG H 4 106 ? 53.383 55.375  68.594  1.00 58.89  ? 106  ARG B CZ    1 
ATOM   6373  N  NH1   . ARG H 4 106 ? 53.886 55.809  69.741  1.00 58.30  ? 106  ARG B NH1   1 
ATOM   6374  N  NH2   . ARG H 4 106 ? 52.071 55.344  68.437  1.00 59.69  ? 106  ARG B NH2   1 
ATOM   6375  N  N     . PRO H 4 107 ? 57.847 60.078  68.953  1.00 52.98  ? 107  PRO B N     1 
ATOM   6376  C  CA    . PRO H 4 107 ? 58.026 60.939  70.120  1.00 52.60  ? 107  PRO B CA    1 
ATOM   6377  C  C     . PRO H 4 107 ? 56.961 60.589  71.164  1.00 52.33  ? 107  PRO B C     1 
ATOM   6378  O  O     . PRO H 4 107 ? 57.117 60.842  72.348  1.00 51.86  ? 107  PRO B O     1 
ATOM   6379  C  CB    . PRO H 4 107 ? 57.858 62.341  69.544  1.00 52.78  ? 107  PRO B CB    1 
ATOM   6380  C  CG    . PRO H 4 107 ? 57.011 62.114  68.316  1.00 53.52  ? 107  PRO B CG    1 
ATOM   6381  C  CD    . PRO H 4 107 ? 57.623 60.876  67.744  1.00 53.09  ? 107  PRO B CD    1 
ATOM   6382  N  N     . SER H 4 108 ? 55.874 59.988  70.717  1.00 52.15  ? 108  SER B N     1 
ATOM   6383  C  CA    . SER H 4 108 ? 54.831 59.593  71.637  1.00 52.75  ? 108  SER B CA    1 
ATOM   6384  C  C     . SER H 4 108 ? 55.232 58.252  72.229  1.00 54.14  ? 108  SER B C     1 
ATOM   6385  O  O     . SER H 4 108 ? 54.397 57.501  72.729  1.00 55.59  ? 108  SER B O     1 
ATOM   6386  C  CB    . SER H 4 108 ? 53.511 59.450  70.901  1.00 52.14  ? 108  SER B CB    1 
ATOM   6387  O  OG    . SER H 4 108 ? 52.506 60.216  71.533  1.00 52.37  ? 108  SER B OG    1 
ATOM   6388  N  N     . ASP H 4 109 ? 56.520 57.945  72.152  1.00 54.84  ? 109  ASP B N     1 
ATOM   6389  C  CA    . ASP H 4 109 ? 57.042 56.694  72.672  1.00 55.07  ? 109  ASP B CA    1 
ATOM   6390  C  C     . ASP H 4 109 ? 57.778 57.030  73.938  1.00 54.48  ? 109  ASP B C     1 
ATOM   6391  O  O     . ASP H 4 109 ? 58.183 56.142  74.690  1.00 54.66  ? 109  ASP B O     1 
ATOM   6392  C  CB    . ASP H 4 109 ? 58.035 56.063  71.690  1.00 58.07  ? 109  ASP B CB    1 
ATOM   6393  C  CG    . ASP H 4 109 ? 57.425 54.940  70.865  1.00 61.63  ? 109  ASP B CG    1 
ATOM   6394  O  OD1   . ASP H 4 109 ? 58.128 54.388  69.962  1.00 63.24  ? 109  ASP B OD1   1 
ATOM   6395  O  OD2   . ASP H 4 109 ? 56.238 54.608  71.129  1.00 63.33  ? 109  ASP B OD2   1 
ATOM   6396  N  N     . SER H 4 110 ? 57.974 58.318  74.172  1.00 53.39  ? 110  SER B N     1 
ATOM   6397  C  CA    . SER H 4 110 ? 58.702 58.725  75.356  1.00 53.38  ? 110  SER B CA    1 
ATOM   6398  C  C     . SER H 4 110 ? 57.785 59.063  76.495  1.00 52.36  ? 110  SER B C     1 
ATOM   6399  O  O     . SER H 4 110 ? 56.890 59.883  76.374  1.00 53.42  ? 110  SER B O     1 
ATOM   6400  C  CB    . SER H 4 110 ? 59.614 59.902  75.034  1.00 54.23  ? 110  SER B CB    1 
ATOM   6401  O  OG    . SER H 4 110 ? 60.612 59.494  74.107  1.00 57.23  ? 110  SER B OG    1 
ATOM   6402  N  N     . ASN H 4 111 ? 58.015 58.407  77.612  1.00 50.89  ? 111  ASN B N     1 
ATOM   6403  C  CA    . ASN H 4 111 ? 57.216 58.608  78.795  1.00 49.70  ? 111  ASN B CA    1 
ATOM   6404  C  C     . ASN H 4 111 ? 56.716 60.044  79.006  1.00 47.62  ? 111  ASN B C     1 
ATOM   6405  O  O     . ASN H 4 111 ? 55.697 60.252  79.645  1.00 47.15  ? 111  ASN B O     1 
ATOM   6406  C  CB    . ASN H 4 111 ? 58.045 58.168  79.993  1.00 52.61  ? 111  ASN B CB    1 
ATOM   6407  C  CG    . ASN H 4 111 ? 57.221 57.472  81.044  1.00 54.57  ? 111  ASN B CG    1 
ATOM   6408  O  OD1   . ASN H 4 111 ? 56.587 56.438  80.769  1.00 55.32  ? 111  ASN B OD1   1 
ATOM   6409  N  ND2   . ASN H 4 111 ? 57.224 58.026  82.264  1.00 54.16  ? 111  ASN B ND2   1 
ATOM   6410  N  N     . ALA H 4 112 ? 57.432 61.025  78.465  1.00 45.05  ? 112  ALA B N     1 
ATOM   6411  C  CA    . ALA H 4 112 ? 57.092 62.438  78.626  1.00 43.42  ? 112  ALA B CA    1 
ATOM   6412  C  C     . ALA H 4 112 ? 56.067 63.009  77.672  1.00 42.51  ? 112  ALA B C     1 
ATOM   6413  O  O     . ALA H 4 112 ? 55.220 63.793  78.069  1.00 43.06  ? 112  ALA B O     1 
ATOM   6414  C  CB    . ALA H 4 112 ? 58.348 63.273  78.544  1.00 42.58  ? 112  ALA B CB    1 
ATOM   6415  N  N     . VAL H 4 113 ? 56.164 62.657  76.405  1.00 41.90  ? 113  VAL B N     1 
ATOM   6416  C  CA    . VAL H 4 113 ? 55.226 63.170  75.426  1.00 41.08  ? 113  VAL B CA    1 
ATOM   6417  C  C     . VAL H 4 113 ? 53.869 62.631  75.756  1.00 40.64  ? 113  VAL B C     1 
ATOM   6418  O  O     . VAL H 4 113 ? 52.905 63.387  75.835  1.00 41.22  ? 113  VAL B O     1 
ATOM   6419  C  CB    . VAL H 4 113 ? 55.591 62.724  73.994  1.00 41.68  ? 113  VAL B CB    1 
ATOM   6420  C  CG1   . VAL H 4 113 ? 54.536 63.154  73.002  1.00 41.70  ? 113  VAL B CG1   1 
ATOM   6421  C  CG2   . VAL H 4 113 ? 56.910 63.329  73.599  1.00 43.63  ? 113  VAL B CG2   1 
ATOM   6422  N  N     . SER H 4 114 ? 53.784 61.324  75.975  1.00 40.14  ? 114  SER B N     1 
ATOM   6423  C  CA    . SER H 4 114 ? 52.485 60.727  76.256  1.00 39.72  ? 114  SER B CA    1 
ATOM   6424  C  C     . SER H 4 114 ? 51.851 61.219  77.535  1.00 38.28  ? 114  SER B C     1 
ATOM   6425  O  O     . SER H 4 114 ? 50.693 61.572  77.517  1.00 39.51  ? 114  SER B O     1 
ATOM   6426  C  CB    . SER H 4 114 ? 52.554 59.203  76.271  1.00 40.90  ? 114  SER B CB    1 
ATOM   6427  O  OG    . SER H 4 114 ? 53.161 58.732  77.459  1.00 45.34  ? 114  SER B OG    1 
ATOM   6428  N  N     . LEU H 4 115 ? 52.573 61.265  78.645  1.00 36.28  ? 115  LEU B N     1 
ATOM   6429  C  CA    . LEU H 4 115 ? 51.932 61.752  79.854  1.00 35.73  ? 115  LEU B CA    1 
ATOM   6430  C  C     . LEU H 4 115 ? 51.456 63.170  79.680  1.00 35.24  ? 115  LEU B C     1 
ATOM   6431  O  O     . LEU H 4 115 ? 50.411 63.539  80.199  1.00 35.56  ? 115  LEU B O     1 
ATOM   6432  C  CB    . LEU H 4 115 ? 52.849 61.683  81.067  1.00 35.21  ? 115  LEU B CB    1 
ATOM   6433  C  CG    . LEU H 4 115 ? 53.268 60.267  81.405  1.00 35.75  ? 115  LEU B CG    1 
ATOM   6434  C  CD1   . LEU H 4 115 ? 53.427 60.139  82.887  1.00 38.00  ? 115  LEU B CD1   1 
ATOM   6435  C  CD2   . LEU H 4 115 ? 52.219 59.306  80.929  1.00 35.99  ? 115  LEU B CD2   1 
ATOM   6436  N  N     . VAL H 4 116 ? 52.194 63.982  78.945  1.00 34.29  ? 116  VAL B N     1 
ATOM   6437  C  CA    . VAL H 4 116 ? 51.729 65.339  78.788  1.00 35.40  ? 116  VAL B CA    1 
ATOM   6438  C  C     . VAL H 4 116 ? 50.483 65.379  77.918  1.00 35.99  ? 116  VAL B C     1 
ATOM   6439  O  O     . VAL H 4 116 ? 49.551 66.147  78.176  1.00 36.01  ? 116  VAL B O     1 
ATOM   6440  C  CB    . VAL H 4 116 ? 52.773 66.235  78.173  1.00 34.48  ? 116  VAL B CB    1 
ATOM   6441  C  CG1   . VAL H 4 116 ? 52.920 65.943  76.696  1.00 34.81  ? 116  VAL B CG1   1 
ATOM   6442  C  CG2   . VAL H 4 116 ? 52.359 67.659  78.402  1.00 34.15  ? 116  VAL B CG2   1 
ATOM   6443  N  N     . MET H 4 117 ? 50.451 64.540  76.893  1.00 35.95  ? 117  MET B N     1 
ATOM   6444  C  CA    . MET H 4 117 ? 49.297 64.516  76.014  1.00 36.70  ? 117  MET B CA    1 
ATOM   6445  C  C     . MET H 4 117 ? 48.030 64.140  76.788  1.00 37.41  ? 117  MET B C     1 
ATOM   6446  O  O     . MET H 4 117 ? 46.977 64.747  76.603  1.00 37.67  ? 117  MET B O     1 
ATOM   6447  C  CB    . MET H 4 117 ? 49.554 63.539  74.874  1.00 37.16  ? 117  MET B CB    1 
ATOM   6448  C  CG    . MET H 4 117 ? 48.498 63.564  73.772  1.00 39.23  ? 117  MET B CG    1 
ATOM   6449  S  SD    . MET H 4 117 ? 48.152 65.194  73.075  1.00 40.17  ? 117  MET B SD    1 
ATOM   6450  C  CE    . MET H 4 117 ? 46.381 65.167  73.086  1.00 38.85  ? 117  MET B CE    1 
ATOM   6451  N  N     . ARG H 4 118 ? 48.161 63.144  77.663  1.00 38.75  ? 118  ARG B N     1 
ATOM   6452  C  CA    . ARG H 4 118 ? 47.079 62.646  78.508  1.00 38.84  ? 118  ARG B CA    1 
ATOM   6453  C  C     . ARG H 4 118 ? 46.666 63.744  79.445  1.00 39.11  ? 118  ARG B C     1 
ATOM   6454  O  O     . ARG H 4 118 ? 45.498 63.907  79.753  1.00 39.46  ? 118  ARG B O     1 
ATOM   6455  C  CB    . ARG H 4 118 ? 47.554 61.481  79.353  1.00 38.31  ? 118  ARG B CB    1 
ATOM   6456  C  CG    . ARG H 4 118 ? 46.847 60.177  79.120  1.00 40.80  ? 118  ARG B CG    1 
ATOM   6457  C  CD    . ARG H 4 118 ? 46.796 59.373  80.425  1.00 44.62  ? 118  ARG B CD    1 
ATOM   6458  N  NE    . ARG H 4 118 ? 46.420 57.989  80.211  1.00 46.48  ? 118  ARG B NE    1 
ATOM   6459  C  CZ    . ARG H 4 118 ? 47.170 57.143  79.517  1.00 50.14  ? 118  ARG B CZ    1 
ATOM   6460  N  NH1   . ARG H 4 118 ? 48.321 57.568  78.995  1.00 50.08  ? 118  ARG B NH1   1 
ATOM   6461  N  NH2   . ARG H 4 118 ? 46.770 55.886  79.324  1.00 51.73  ? 118  ARG B NH2   1 
ATOM   6462  N  N     . ARG H 4 119 ? 47.637 64.498  79.917  1.00 39.07  ? 119  ARG B N     1 
ATOM   6463  C  CA    . ARG H 4 119 ? 47.323 65.569  80.825  1.00 39.89  ? 119  ARG B CA    1 
ATOM   6464  C  C     . ARG H 4 119 ? 46.537 66.645  80.123  1.00 39.93  ? 119  ARG B C     1 
ATOM   6465  O  O     . ARG H 4 119 ? 45.488 67.073  80.598  1.00 39.01  ? 119  ARG B O     1 
ATOM   6466  C  CB    . ARG H 4 119 ? 48.597 66.171  81.397  1.00 41.93  ? 119  ARG B CB    1 
ATOM   6467  C  CG    . ARG H 4 119 ? 48.389 67.509  82.074  1.00 44.33  ? 119  ARG B CG    1 
ATOM   6468  C  CD    . ARG H 4 119 ? 49.629 67.925  82.797  1.00 46.05  ? 119  ARG B CD    1 
ATOM   6469  N  NE    . ARG H 4 119 ? 49.764 69.368  82.804  1.00 49.42  ? 119  ARG B NE    1 
ATOM   6470  C  CZ    . ARG H 4 119 ? 50.814 70.002  83.307  1.00 51.27  ? 119  ARG B CZ    1 
ATOM   6471  N  NH1   . ARG H 4 119 ? 51.807 69.300  83.846  1.00 52.02  ? 119  ARG B NH1   1 
ATOM   6472  N  NH2   . ARG H 4 119 ? 50.880 71.328  83.250  1.00 51.40  ? 119  ARG B NH2   1 
ATOM   6473  N  N     . ILE H 4 120 ? 47.039 67.090  78.980  1.00 40.10  ? 120  ILE B N     1 
ATOM   6474  C  CA    . ILE H 4 120 ? 46.352 68.155  78.277  1.00 40.98  ? 120  ILE B CA    1 
ATOM   6475  C  C     . ILE H 4 120 ? 44.890 67.813  78.014  1.00 42.06  ? 120  ILE B C     1 
ATOM   6476  O  O     . ILE H 4 120 ? 44.047 68.697  77.988  1.00 41.14  ? 120  ILE B O     1 
ATOM   6477  C  CB    . ILE H 4 120 ? 47.064 68.524  76.972  1.00 40.10  ? 120  ILE B CB    1 
ATOM   6478  C  CG1   . ILE H 4 120 ? 48.529 68.821  77.257  1.00 40.09  ? 120  ILE B CG1   1 
ATOM   6479  C  CG2   . ILE H 4 120 ? 46.479 69.782  76.417  1.00 40.05  ? 120  ILE B CG2   1 
ATOM   6480  C  CD1   . ILE H 4 120 ? 49.305 69.292  76.062  1.00 41.36  ? 120  ILE B CD1   1 
ATOM   6481  N  N     . ARG H 4 121 ? 44.565 66.543  77.825  1.00 43.00  ? 121  ARG B N     1 
ATOM   6482  C  CA    . ARG H 4 121 ? 43.170 66.236  77.617  1.00 45.11  ? 121  ARG B CA    1 
ATOM   6483  C  C     . ARG H 4 121 ? 42.432 66.390  78.943  1.00 46.82  ? 121  ARG B C     1 
ATOM   6484  O  O     . ARG H 4 121 ? 41.535 67.233  79.079  1.00 47.55  ? 121  ARG B O     1 
ATOM   6485  C  CB    . ARG H 4 121 ? 42.982 64.830  77.122  1.00 45.58  ? 121  ARG B CB    1 
ATOM   6486  C  CG    . ARG H 4 121 ? 41.541 64.467  77.208  1.00 49.88  ? 121  ARG B CG    1 
ATOM   6487  C  CD    . ARG H 4 121 ? 41.299 63.127  76.617  1.00 54.96  ? 121  ARG B CD    1 
ATOM   6488  N  NE    . ARG H 4 121 ? 42.144 62.132  77.258  1.00 58.09  ? 121  ARG B NE    1 
ATOM   6489  C  CZ    . ARG H 4 121 ? 42.932 61.299  76.589  1.00 59.57  ? 121  ARG B CZ    1 
ATOM   6490  N  NH1   . ARG H 4 121 ? 42.979 61.358  75.254  1.00 58.77  ? 121  ARG B NH1   1 
ATOM   6491  N  NH2   . ARG H 4 121 ? 43.653 60.400  77.257  1.00 59.69  ? 121  ARG B NH2   1 
ATOM   6492  N  N     . LYS H 4 122 ? 42.815 65.562  79.917  1.00 48.71  ? 122  LYS B N     1 
ATOM   6493  C  CA    . LYS H 4 122 ? 42.220 65.580  81.245  1.00 48.87  ? 122  LYS B CA    1 
ATOM   6494  C  C     . LYS H 4 122 ? 41.944 66.992  81.698  1.00 49.48  ? 122  LYS B C     1 
ATOM   6495  O  O     . LYS H 4 122 ? 40.836 67.305  82.096  1.00 49.83  ? 122  LYS B O     1 
ATOM   6496  C  CB    . LYS H 4 122 ? 43.153 64.952  82.267  1.00 49.77  ? 122  LYS B CB    1 
ATOM   6497  C  CG    . LYS H 4 122 ? 43.134 63.464  82.342  1.00 52.46  ? 122  LYS B CG    1 
ATOM   6498  C  CD    . LYS H 4 122 ? 42.187 62.971  83.418  1.00 55.62  ? 122  LYS B CD    1 
ATOM   6499  C  CE    . LYS H 4 122 ? 41.998 61.431  83.330  1.00 58.01  ? 122  LYS B CE    1 
ATOM   6500  N  NZ    . LYS H 4 122 ? 41.459 60.917  82.000  1.00 58.58  ? 122  LYS B NZ    1 
ATOM   6501  N  N     . GLU H 4 123 ? 42.951 67.852  81.646  1.00 50.43  ? 123  GLU B N     1 
ATOM   6502  C  CA    . GLU H 4 123 ? 42.753 69.210  82.101  1.00 52.32  ? 123  GLU B CA    1 
ATOM   6503  C  C     . GLU H 4 123 ? 41.681 69.938  81.332  1.00 52.46  ? 123  GLU B C     1 
ATOM   6504  O  O     . GLU H 4 123 ? 40.891 70.668  81.921  1.00 53.56  ? 123  GLU B O     1 
ATOM   6505  C  CB    . GLU H 4 123 ? 44.050 69.998  82.034  1.00 55.31  ? 123  GLU B CB    1 
ATOM   6506  C  CG    . GLU H 4 123 ? 45.121 69.433  82.935  1.00 60.84  ? 123  GLU B CG    1 
ATOM   6507  C  CD    . GLU H 4 123 ? 46.224 70.432  83.228  1.00 64.69  ? 123  GLU B CD    1 
ATOM   6508  O  OE1   . GLU H 4 123 ? 47.240 70.027  83.858  1.00 66.46  ? 123  GLU B OE1   1 
ATOM   6509  O  OE2   . GLU H 4 123 ? 46.062 71.621  82.833  1.00 66.56  ? 123  GLU B OE2   1 
ATOM   6510  N  N     . ASN H 4 124 ? 41.636 69.750  80.020  1.00 52.20  ? 124  ASN B N     1 
ATOM   6511  C  CA    . ASN H 4 124 ? 40.628 70.430  79.245  1.00 50.85  ? 124  ASN B CA    1 
ATOM   6512  C  C     . ASN H 4 124 ? 39.308 69.831  79.541  1.00 50.90  ? 124  ASN B C     1 
ATOM   6513  O  O     . ASN H 4 124 ? 38.403 70.531  79.920  1.00 50.42  ? 124  ASN B O     1 
ATOM   6514  C  CB    . ASN H 4 124 ? 40.920 70.344  77.766  1.00 50.31  ? 124  ASN B CB    1 
ATOM   6515  C  CG    . ASN H 4 124 ? 41.887 71.394  77.326  1.00 50.29  ? 124  ASN B CG    1 
ATOM   6516  O  OD1   . ASN H 4 124 ? 42.661 71.897  78.138  1.00 50.59  ? 124  ASN B OD1   1 
ATOM   6517  N  ND2   . ASN H 4 124 ? 41.864 71.737  76.040  1.00 50.28  ? 124  ASN B ND2   1 
ATOM   6518  N  N     . VAL H 4 125 ? 39.173 68.532  79.405  1.00 52.73  ? 125  VAL B N     1 
ATOM   6519  C  CA    . VAL H 4 125 ? 37.871 67.986  79.698  1.00 57.12  ? 125  VAL B CA    1 
ATOM   6520  C  C     . VAL H 4 125 ? 37.404 68.425  81.078  1.00 60.42  ? 125  VAL B C     1 
ATOM   6521  O  O     . VAL H 4 125 ? 36.316 68.979  81.216  1.00 61.08  ? 125  VAL B O     1 
ATOM   6522  C  CB    . VAL H 4 125 ? 37.850 66.475  79.666  1.00 57.37  ? 125  VAL B CB    1 
ATOM   6523  C  CG1   . VAL H 4 125 ? 36.406 65.997  79.817  1.00 56.91  ? 125  VAL B CG1   1 
ATOM   6524  C  CG2   . VAL H 4 125 ? 38.475 65.971  78.377  1.00 57.71  ? 125  VAL B CG2   1 
ATOM   6525  N  N     . ASP H 4 126 ? 38.230 68.184  82.093  1.00 64.24  ? 126  ASP B N     1 
ATOM   6526  C  CA    . ASP H 4 126 ? 37.890 68.547  83.470  1.00 68.21  ? 126  ASP B CA    1 
ATOM   6527  C  C     . ASP H 4 126 ? 37.582 70.037  83.659  1.00 69.28  ? 126  ASP B C     1 
ATOM   6528  O  O     . ASP H 4 126 ? 37.009 70.431  84.683  1.00 70.34  ? 126  ASP B O     1 
ATOM   6529  C  CB    . ASP H 4 126 ? 39.004 68.101  84.449  1.00 71.02  ? 126  ASP B CB    1 
ATOM   6530  C  CG    . ASP H 4 126 ? 38.722 66.719  85.098  1.00 74.15  ? 126  ASP B CG    1 
ATOM   6531  O  OD1   . ASP H 4 126 ? 37.765 66.603  85.920  1.00 75.29  ? 126  ASP B OD1   1 
ATOM   6532  O  OD2   . ASP H 4 126 ? 39.460 65.747  84.786  1.00 75.30  ? 126  ASP B OD2   1 
ATOM   6533  N  N     . ALA H 4 127 ? 37.958 70.861  82.682  1.00 69.60  ? 127  ALA B N     1 
ATOM   6534  C  CA    . ALA H 4 127 ? 37.680 72.286  82.764  1.00 70.25  ? 127  ALA B CA    1 
ATOM   6535  C  C     . ALA H 4 127 ? 36.227 72.449  82.351  1.00 71.62  ? 127  ALA B C     1 
ATOM   6536  O  O     . ALA H 4 127 ? 35.385 72.895  83.134  1.00 72.04  ? 127  ALA B O     1 
ATOM   6537  C  CB    . ALA H 4 127 ? 38.573 73.048  81.830  1.00 68.84  ? 127  ALA B CB    1 
ATOM   6538  N  N     . GLY H 4 128 ? 35.936 72.059  81.117  1.00 73.09  ? 128  GLY B N     1 
ATOM   6539  C  CA    . GLY H 4 128 ? 34.585 72.147  80.602  1.00 74.69  ? 128  GLY B CA    1 
ATOM   6540  C  C     . GLY H 4 128 ? 34.500 71.689  79.158  1.00 76.21  ? 128  GLY B C     1 
ATOM   6541  O  O     . GLY H 4 128 ? 33.417 71.348  78.678  1.00 76.41  ? 128  GLY B O     1 
ATOM   6542  N  N     . GLU H 4 129 ? 35.640 71.673  78.463  1.00 77.35  ? 129  GLU B N     1 
ATOM   6543  C  CA    . GLU H 4 129 ? 35.668 71.262  77.066  1.00 77.28  ? 129  GLU B CA    1 
ATOM   6544  C  C     . GLU H 4 129 ? 34.896 69.979  76.846  1.00 75.94  ? 129  GLU B C     1 
ATOM   6545  O  O     . GLU H 4 129 ? 34.747 69.152  77.737  1.00 76.05  ? 129  GLU B O     1 
ATOM   6546  C  CB    . GLU H 4 129 ? 37.101 71.094  76.530  1.00 78.53  ? 129  GLU B CB    1 
ATOM   6547  C  CG    . GLU H 4 129 ? 37.098 70.851  75.001  1.00 81.51  ? 129  GLU B CG    1 
ATOM   6548  C  CD    . GLU H 4 129 ? 38.454 71.022  74.303  1.00 82.92  ? 129  GLU B CD    1 
ATOM   6549  O  OE1   . GLU H 4 129 ? 39.193 71.974  74.645  1.00 84.52  ? 129  GLU B OE1   1 
ATOM   6550  O  OE2   . GLU H 4 129 ? 38.768 70.218  73.385  1.00 82.70  ? 129  GLU B OE2   1 
ATOM   6551  N  N     . ARG H 4 130 ? 34.400 69.848  75.629  1.00 74.75  ? 130  ARG B N     1 
ATOM   6552  C  CA    . ARG H 4 130 ? 33.614 68.720  75.196  1.00 72.77  ? 130  ARG B CA    1 
ATOM   6553  C  C     . ARG H 4 130 ? 33.610 68.843  73.669  1.00 71.78  ? 130  ARG B C     1 
ATOM   6554  O  O     . ARG H 4 130 ? 33.869 69.926  73.124  1.00 71.35  ? 130  ARG B O     1 
ATOM   6555  C  CB    . ARG H 4 130 ? 32.221 68.853  75.798  1.00 74.24  ? 130  ARG B CB    1 
ATOM   6556  C  CG    . ARG H 4 130 ? 31.090 68.236  75.026  1.00 76.95  ? 130  ARG B CG    1 
ATOM   6557  C  CD    . ARG H 4 130 ? 29.762 68.437  75.762  1.00 79.17  ? 130  ARG B CD    1 
ATOM   6558  N  NE    . ARG H 4 130 ? 29.604 69.786  76.309  1.00 81.73  ? 130  ARG B NE    1 
ATOM   6559  C  CZ    . ARG H 4 130 ? 29.830 70.121  77.577  1.00 82.05  ? 130  ARG B CZ    1 
ATOM   6560  N  NH1   . ARG H 4 130 ? 30.221 69.217  78.454  1.00 81.28  ? 130  ARG B NH1   1 
ATOM   6561  N  NH2   . ARG H 4 130 ? 29.670 71.372  77.970  1.00 84.34  ? 130  ARG B NH2   1 
ATOM   6562  N  N     . ALA H 4 131 ? 33.345 67.735  72.985  1.00 69.51  ? 131  ALA B N     1 
ATOM   6563  C  CA    . ALA H 4 131 ? 33.339 67.703  71.528  1.00 67.47  ? 131  ALA B CA    1 
ATOM   6564  C  C     . ALA H 4 131 ? 31.987 67.990  70.891  1.00 66.58  ? 131  ALA B C     1 
ATOM   6565  O  O     . ALA H 4 131 ? 31.009 67.266  71.126  1.00 66.16  ? 131  ALA B O     1 
ATOM   6566  C  CB    . ALA H 4 131 ? 33.836 66.365  71.055  1.00 66.77  ? 131  ALA B CB    1 
ATOM   6567  N  N     . LYS H 4 132 ? 31.955 69.041  70.067  1.00 65.34  ? 132  LYS B N     1 
ATOM   6568  C  CA    . LYS H 4 132 ? 30.754 69.457  69.347  1.00 63.03  ? 132  LYS B CA    1 
ATOM   6569  C  C     . LYS H 4 132 ? 30.426 68.454  68.247  1.00 60.86  ? 132  LYS B C     1 
ATOM   6570  O  O     . LYS H 4 132 ? 31.272 67.674  67.815  1.00 60.56  ? 132  LYS B O     1 
ATOM   6571  C  CB    . LYS H 4 132 ? 30.946 70.844  68.736  1.00 64.38  ? 132  LYS B CB    1 
ATOM   6572  C  CG    . LYS H 4 132 ? 30.597 71.979  69.658  1.00 66.71  ? 132  LYS B CG    1 
ATOM   6573  C  CD    . LYS H 4 132 ? 31.462 71.984  70.895  1.00 70.39  ? 132  LYS B CD    1 
ATOM   6574  C  CE    . LYS H 4 132 ? 30.850 72.875  72.000  1.00 73.72  ? 132  LYS B CE    1 
ATOM   6575  N  NZ    . LYS H 4 132 ? 31.636 72.917  73.303  1.00 75.68  ? 132  LYS B NZ    1 
ATOM   6576  N  N     . GLN H 4 133 ? 29.192 68.492  67.786  1.00 57.74  ? 133  GLN B N     1 
ATOM   6577  C  CA    . GLN H 4 133 ? 28.749 67.568  66.776  1.00 55.41  ? 133  GLN B CA    1 
ATOM   6578  C  C     . GLN H 4 133 ? 27.736 68.304  65.910  1.00 55.17  ? 133  GLN B C     1 
ATOM   6579  O  O     . GLN H 4 133 ? 27.019 69.187  66.397  1.00 55.95  ? 133  GLN B O     1 
ATOM   6580  C  CB    . GLN H 4 133 ? 28.120 66.382  67.481  1.00 55.45  ? 133  GLN B CB    1 
ATOM   6581  C  CG    . GLN H 4 133 ? 27.485 65.342  66.607  1.00 57.03  ? 133  GLN B CG    1 
ATOM   6582  C  CD    . GLN H 4 133 ? 26.162 64.867  67.194  1.00 58.04  ? 133  GLN B CD    1 
ATOM   6583  O  OE1   . GLN H 4 133 ? 25.890 63.658  67.286  1.00 58.01  ? 133  GLN B OE1   1 
ATOM   6584  N  NE2   . GLN H 4 133 ? 25.322 65.827  67.589  1.00 57.77  ? 133  GLN B NE2   1 
ATOM   6585  N  N     . ALA H 4 134 ? 27.687 67.946  64.629  1.00 53.49  ? 134  ALA B N     1 
ATOM   6586  C  CA    . ALA H 4 134 ? 26.784 68.566  63.672  1.00 50.96  ? 134  ALA B CA    1 
ATOM   6587  C  C     . ALA H 4 134 ? 25.365 68.739  64.162  1.00 49.93  ? 134  ALA B C     1 
ATOM   6588  O  O     . ALA H 4 134 ? 24.855 67.915  64.909  1.00 51.68  ? 134  ALA B O     1 
ATOM   6589  C  CB    . ALA H 4 134 ? 26.782 67.775  62.428  1.00 50.24  ? 134  ALA B CB    1 
ATOM   6590  N  N     . LEU H 4 135 ? 24.724 69.819  63.746  1.00 47.72  ? 135  LEU B N     1 
ATOM   6591  C  CA    . LEU H 4 135 ? 23.347 70.071  64.132  1.00 45.21  ? 135  LEU B CA    1 
ATOM   6592  C  C     . LEU H 4 135 ? 22.447 69.076  63.384  1.00 45.05  ? 135  LEU B C     1 
ATOM   6593  O  O     . LEU H 4 135 ? 22.571 68.883  62.187  1.00 43.85  ? 135  LEU B O     1 
ATOM   6594  C  CB    . LEU H 4 135 ? 23.011 71.512  63.790  1.00 45.01  ? 135  LEU B CB    1 
ATOM   6595  C  CG    . LEU H 4 135 ? 21.574 71.997  63.917  1.00 45.15  ? 135  LEU B CG    1 
ATOM   6596  C  CD1   . LEU H 4 135 ? 20.972 71.532  65.238  1.00 46.26  ? 135  LEU B CD1   1 
ATOM   6597  C  CD2   . LEU H 4 135 ? 21.561 73.525  63.782  1.00 44.84  ? 135  LEU B CD2   1 
ATOM   6598  N  N     . ALA H 4 136 ? 21.531 68.438  64.083  1.00 45.68  ? 136  ALA B N     1 
ATOM   6599  C  CA    . ALA H 4 136 ? 20.704 67.436  63.436  1.00 47.49  ? 136  ALA B CA    1 
ATOM   6600  C  C     . ALA H 4 136 ? 19.751 67.920  62.380  1.00 49.71  ? 136  ALA B C     1 
ATOM   6601  O  O     . ALA H 4 136 ? 19.205 69.017  62.487  1.00 50.71  ? 136  ALA B O     1 
ATOM   6602  C  CB    . ALA H 4 136 ? 19.928 66.668  64.465  1.00 48.26  ? 136  ALA B CB    1 
ATOM   6603  N  N     . PHE H 4 137 ? 19.544 67.058  61.376  1.00 52.39  ? 137  PHE B N     1 
ATOM   6604  C  CA    . PHE H 4 137 ? 18.620 67.265  60.246  1.00 53.71  ? 137  PHE B CA    1 
ATOM   6605  C  C     . PHE H 4 137 ? 17.711 66.043  60.282  1.00 54.60  ? 137  PHE B C     1 
ATOM   6606  O  O     . PHE H 4 137 ? 17.852 65.152  59.461  1.00 54.19  ? 137  PHE B O     1 
ATOM   6607  C  CB    . PHE H 4 137 ? 19.382 67.276  58.918  1.00 53.80  ? 137  PHE B CB    1 
ATOM   6608  C  CG    . PHE H 4 137 ? 18.529 67.616  57.718  1.00 54.99  ? 137  PHE B CG    1 
ATOM   6609  C  CD1   . PHE H 4 137 ? 18.186 68.930  57.438  1.00 55.28  ? 137  PHE B CD1   1 
ATOM   6610  C  CD2   . PHE H 4 137 ? 18.081 66.614  56.853  1.00 55.71  ? 137  PHE B CD2   1 
ATOM   6611  C  CE1   . PHE H 4 137 ? 17.417 69.230  56.320  1.00 56.07  ? 137  PHE B CE1   1 
ATOM   6612  C  CE2   . PHE H 4 137 ? 17.307 66.910  55.726  1.00 54.59  ? 137  PHE B CE2   1 
ATOM   6613  C  CZ    . PHE H 4 137 ? 16.977 68.208  55.461  1.00 55.64  ? 137  PHE B CZ    1 
ATOM   6614  N  N     . GLU H 4 138 ? 16.799 65.994  61.247  1.00 57.41  ? 138  GLU B N     1 
ATOM   6615  C  CA    . GLU H 4 138 ? 15.899 64.855  61.404  1.00 60.22  ? 138  GLU B CA    1 
ATOM   6616  C  C     . GLU H 4 138 ? 14.868 64.734  60.306  1.00 61.42  ? 138  GLU B C     1 
ATOM   6617  O  O     . GLU H 4 138 ? 14.769 65.588  59.438  1.00 62.01  ? 138  GLU B O     1 
ATOM   6618  C  CB    . GLU H 4 138 ? 15.171 64.913  62.754  1.00 62.11  ? 138  GLU B CB    1 
ATOM   6619  C  CG    . GLU H 4 138 ? 16.076 64.640  63.954  1.00 64.98  ? 138  GLU B CG    1 
ATOM   6620  C  CD    . GLU H 4 138 ? 16.132 65.796  64.961  1.00 65.98  ? 138  GLU B CD    1 
ATOM   6621  O  OE1   . GLU H 4 138 ? 16.058 66.982  64.521  1.00 64.80  ? 138  GLU B OE1   1 
ATOM   6622  O  OE2   . GLU H 4 138 ? 16.275 65.503  66.182  1.00 65.43  ? 138  GLU B OE2   1 
ATOM   6623  N  N     . ARG H 4 139 ? 14.102 63.650  60.370  1.00 62.92  ? 139  ARG B N     1 
ATOM   6624  C  CA    . ARG H 4 139 ? 13.047 63.353  59.414  1.00 64.01  ? 139  ARG B CA    1 
ATOM   6625  C  C     . ARG H 4 139 ? 12.033 64.478  59.351  1.00 64.50  ? 139  ARG B C     1 
ATOM   6626  O  O     . ARG H 4 139 ? 11.378 64.683  58.336  1.00 65.43  ? 139  ARG B O     1 
ATOM   6627  C  CB    . ARG H 4 139 ? 12.347 62.072  59.824  1.00 63.75  ? 139  ARG B CB    1 
ATOM   6628  C  CG    . ARG H 4 139 ? 10.959 61.941  59.299  1.00 63.80  ? 139  ARG B CG    1 
ATOM   6629  C  CD    . ARG H 4 139 ? 10.954 61.844  57.816  1.00 64.66  ? 139  ARG B CD    1 
ATOM   6630  N  NE    . ARG H 4 139 ? 9.715  61.225  57.384  1.00 68.18  ? 139  ARG B NE    1 
ATOM   6631  C  CZ    . ARG H 4 139 ? 9.360  59.987  57.708  1.00 70.63  ? 139  ARG B CZ    1 
ATOM   6632  N  NH1   . ARG H 4 139 ? 10.158 59.243  58.465  1.00 72.09  ? 139  ARG B NH1   1 
ATOM   6633  N  NH2   . ARG H 4 139 ? 8.205  59.492  57.281  1.00 71.99  ? 139  ARG B NH2   1 
ATOM   6634  N  N     . THR H 4 140 ? 11.902 65.201  60.450  1.00 64.84  ? 140  THR B N     1 
ATOM   6635  C  CA    . THR H 4 140 ? 10.973 66.313  60.529  1.00 64.55  ? 140  THR B CA    1 
ATOM   6636  C  C     . THR H 4 140 ? 11.505 67.550  59.799  1.00 64.32  ? 140  THR B C     1 
ATOM   6637  O  O     . THR H 4 140 ? 10.743 68.438  59.436  1.00 64.32  ? 140  THR B O     1 
ATOM   6638  C  CB    . THR H 4 140 ? 10.662 66.616  62.017  1.00 65.12  ? 140  THR B CB    1 
ATOM   6639  O  OG1   . THR H 4 140 ? 9.369  66.081  62.334  1.00 64.63  ? 140  THR B OG1   1 
ATOM   6640  C  CG2   . THR H 4 140 ? 10.735 68.115  62.327  1.00 64.32  ? 140  THR B CG2   1 
ATOM   6641  N  N     . ASP H 4 141 ? 12.814 67.611  59.584  1.00 64.11  ? 141  ASP B N     1 
ATOM   6642  C  CA    . ASP H 4 141 ? 13.401 68.741  58.874  1.00 64.15  ? 141  ASP B CA    1 
ATOM   6643  C  C     . ASP H 4 141 ? 13.262 68.449  57.394  1.00 62.87  ? 141  ASP B C     1 
ATOM   6644  O  O     . ASP H 4 141 ? 13.249 69.349  56.575  1.00 62.80  ? 141  ASP B O     1 
ATOM   6645  C  CB    . ASP H 4 141 ? 14.893 68.917  59.216  1.00 66.20  ? 141  ASP B CB    1 
ATOM   6646  C  CG    . ASP H 4 141 ? 15.130 69.430  60.645  1.00 69.06  ? 141  ASP B CG    1 
ATOM   6647  O  OD1   . ASP H 4 141 ? 14.586 70.507  61.003  1.00 69.97  ? 141  ASP B OD1   1 
ATOM   6648  O  OD2   . ASP H 4 141 ? 15.872 68.758  61.410  1.00 70.16  ? 141  ASP B OD2   1 
ATOM   6649  N  N     . PHE H 4 142 ? 13.159 67.176  57.048  1.00 62.61  ? 142  PHE B N     1 
ATOM   6650  C  CA    . PHE H 4 142 ? 13.026 66.815  55.653  1.00 62.47  ? 142  PHE B CA    1 
ATOM   6651  C  C     . PHE H 4 142 ? 11.679 67.327  55.190  1.00 65.10  ? 142  PHE B C     1 
ATOM   6652  O  O     . PHE H 4 142 ? 11.631 68.234  54.351  1.00 66.63  ? 142  PHE B O     1 
ATOM   6653  C  CB    . PHE H 4 142 ? 13.108 65.302  55.467  1.00 58.42  ? 142  PHE B CB    1 
ATOM   6654  C  CG    . PHE H 4 142 ? 13.387 64.874  54.053  1.00 54.70  ? 142  PHE B CG    1 
ATOM   6655  C  CD1   . PHE H 4 142 ? 14.331 65.545  53.282  1.00 53.30  ? 142  PHE B CD1   1 
ATOM   6656  C  CD2   . PHE H 4 142 ? 12.750 63.760  53.512  1.00 52.94  ? 142  PHE B CD2   1 
ATOM   6657  C  CE1   . PHE H 4 142 ? 14.637 65.102  51.994  1.00 52.51  ? 142  PHE B CE1   1 
ATOM   6658  C  CE2   . PHE H 4 142 ? 13.047 63.312  52.232  1.00 51.92  ? 142  PHE B CE2   1 
ATOM   6659  C  CZ    . PHE H 4 142 ? 13.991 63.979  51.471  1.00 51.96  ? 142  PHE B CZ    1 
ATOM   6660  N  N     . ASP H 4 143 ? 10.596 66.769  55.750  1.00 66.03  ? 143  ASP B N     1 
ATOM   6661  C  CA    . ASP H 4 143 ? 9.226  67.165  55.389  1.00 67.19  ? 143  ASP B CA    1 
ATOM   6662  C  C     . ASP H 4 143 ? 9.063  68.664  55.201  1.00 67.70  ? 143  ASP B C     1 
ATOM   6663  O  O     . ASP H 4 143 ? 8.405  69.107  54.267  1.00 68.44  ? 143  ASP B O     1 
ATOM   6664  C  CB    . ASP H 4 143 ? 8.214  66.699  56.436  1.00 68.48  ? 143  ASP B CB    1 
ATOM   6665  C  CG    . ASP H 4 143 ? 8.124  65.189  56.530  1.00 70.67  ? 143  ASP B CG    1 
ATOM   6666  O  OD1   . ASP H 4 143 ? 8.631  64.517  55.595  1.00 70.66  ? 143  ASP B OD1   1 
ATOM   6667  O  OD2   . ASP H 4 143 ? 7.538  64.681  57.531  1.00 71.36  ? 143  ASP B OD2   1 
ATOM   6668  N  N     . GLN H 4 144 ? 9.650  69.450  56.092  1.00 67.62  ? 144  GLN B N     1 
ATOM   6669  C  CA    . GLN H 4 144 ? 9.559  70.891  55.956  1.00 67.90  ? 144  GLN B CA    1 
ATOM   6670  C  C     . GLN H 4 144 ? 10.256 71.308  54.675  1.00 67.25  ? 144  GLN B C     1 
ATOM   6671  O  O     . GLN H 4 144 ? 9.612  71.802  53.750  1.00 67.39  ? 144  GLN B O     1 
ATOM   6672  C  CB    . GLN H 4 144 ? 10.219 71.599  57.134  1.00 69.51  ? 144  GLN B CB    1 
ATOM   6673  C  CG    . GLN H 4 144 ? 9.248  72.348  58.027  1.00 71.19  ? 144  GLN B CG    1 
ATOM   6674  C  CD    . GLN H 4 144 ? 9.934  73.445  58.811  1.00 72.69  ? 144  GLN B CD    1 
ATOM   6675  O  OE1   . GLN H 4 144 ? 10.533 74.349  58.227  1.00 71.98  ? 144  GLN B OE1   1 
ATOM   6676  N  NE2   . GLN H 4 144 ? 9.967  73.551  60.145  1.00 73.85  ? 144  GLN B NE2   1 
ATOM   6677  N  N     . VAL H 4 145 ? 11.571 71.105  54.616  1.00 66.44  ? 145  VAL B N     1 
ATOM   6678  C  CA    . VAL H 4 145 ? 12.328 71.473  53.431  1.00 66.30  ? 145  VAL B CA    1 
ATOM   6679  C  C     . VAL H 4 145 ? 11.651 70.959  52.174  1.00 67.03  ? 145  VAL B C     1 
ATOM   6680  O  O     . VAL H 4 145 ? 11.878 71.518  51.106  1.00 66.58  ? 145  VAL B O     1 
ATOM   6681  C  CB    . VAL H 4 145 ? 13.773 70.964  53.500  1.00 65.59  ? 145  VAL B CB    1 
ATOM   6682  C  CG1   . VAL H 4 145 ? 14.439 71.027  52.142  1.00 65.49  ? 145  VAL B CG1   1 
ATOM   6683  C  CG2   . VAL H 4 145 ? 14.576 71.785  54.506  1.00 65.09  ? 145  VAL B CG2   1 
ATOM   6684  N  N     . ARG H 4 146 ? 10.821 69.906  52.292  1.00 67.90  ? 146  ARG B N     1 
ATOM   6685  C  CA    . ARG H 4 146 ? 10.113 69.357  51.132  1.00 69.47  ? 146  ARG B CA    1 
ATOM   6686  C  C     . ARG H 4 146 ? 8.892  70.222  50.764  1.00 71.06  ? 146  ARG B C     1 
ATOM   6687  O  O     . ARG H 4 146 ? 8.968  71.010  49.822  1.00 72.35  ? 146  ARG B O     1 
ATOM   6688  C  CB    . ARG H 4 146 ? 9.708  67.906  51.364  1.00 69.20  ? 146  ARG B CB    1 
ATOM   6689  C  CG    . ARG H 4 146 ? 9.189  67.234  50.096  1.00 71.30  ? 146  ARG B CG    1 
ATOM   6690  C  CD    . ARG H 4 146 ? 9.584  65.757  50.018  1.00 72.91  ? 146  ARG B CD    1 
ATOM   6691  N  NE    . ARG H 4 146 ? 8.937  64.984  51.082  1.00 73.73  ? 146  ARG B NE    1 
ATOM   6692  C  CZ    . ARG H 4 146 ? 9.159  63.690  51.334  1.00 73.59  ? 146  ARG B CZ    1 
ATOM   6693  N  NH1   . ARG H 4 146 ? 10.018 62.992  50.595  1.00 73.07  ? 146  ARG B NH1   1 
ATOM   6694  N  NH2   . ARG H 4 146 ? 8.499  63.099  52.318  1.00 73.23  ? 146  ARG B NH2   1 
ATOM   6695  N  N     . SER H 4 147 ? 7.783  70.093  51.449  1.00 72.81  ? 147  SER B N     1 
ATOM   6696  C  CA    . SER H 4 147 ? 6.674  70.969  51.102  1.00 74.07  ? 147  SER B CA    1 
ATOM   6697  C  C     . SER H 4 147 ? 7.128  72.420  51.279  1.00 75.12  ? 147  SER B C     1 
ATOM   6698  O  O     . SER H 4 147 ? 6.894  73.034  52.317  1.00 76.12  ? 147  SER B O     1 
ATOM   6699  C  CB    . SER H 4 147 ? 5.435  70.691  51.957  1.00 73.04  ? 147  SER B CB    1 
ATOM   6700  O  OG    . SER H 4 147 ? 5.138  69.307  51.987  1.00 73.72  ? 147  SER B OG    1 
ATOM   6701  N  N     . LEU H 4 148 ? 7.789  72.940  50.270  1.00 74.97  ? 148  LEU B N     1 
ATOM   6702  C  CA    . LEU H 4 148 ? 8.347  74.281  50.374  1.00 76.04  ? 148  LEU B CA    1 
ATOM   6703  C  C     . LEU H 4 148 ? 9.285  74.447  49.205  1.00 77.38  ? 148  LEU B C     1 
ATOM   6704  O  O     . LEU H 4 148 ? 9.721  75.541  48.880  1.00 77.80  ? 148  LEU B O     1 
ATOM   6705  C  CB    . LEU H 4 148 ? 9.100  74.414  51.722  1.00 75.09  ? 148  LEU B CB    1 
ATOM   6706  C  CG    . LEU H 4 148 ? 9.519  75.771  52.252  1.00 74.50  ? 148  LEU B CG    1 
ATOM   6707  C  CD1   . LEU H 4 148 ? 10.902 76.163  51.722  1.00 74.11  ? 148  LEU B CD1   1 
ATOM   6708  C  CD2   . LEU H 4 148 ? 8.491  76.822  51.889  1.00 73.39  ? 148  LEU B CD2   1 
ATOM   6709  N  N     . MET H 4 149 ? 9.580  73.314  48.579  1.00 78.67  ? 149  MET B N     1 
ATOM   6710  C  CA    . MET H 4 149 ? 10.488 73.251  47.440  1.00 80.80  ? 149  MET B CA    1 
ATOM   6711  C  C     . MET H 4 149 ? 9.972  72.173  46.491  1.00 82.64  ? 149  MET B C     1 
ATOM   6712  O  O     . MET H 4 149 ? 10.436 72.036  45.352  1.00 83.23  ? 149  MET B O     1 
ATOM   6713  C  CB    . MET H 4 149 ? 11.908 72.893  47.864  1.00 81.47  ? 149  MET B CB    1 
ATOM   6714  C  CG    . MET H 4 149 ? 12.730 74.058  48.412  1.00 83.55  ? 149  MET B CG    1 
ATOM   6715  S  SD    . MET H 4 149 ? 14.427 73.576  48.765  1.00 84.93  ? 149  MET B SD    1 
ATOM   6716  C  CE    . MET H 4 149 ? 15.260 74.215  47.308  1.00 86.31  ? 149  MET B CE    1 
ATOM   6717  N  N     . GLU H 4 150 ? 9.002  71.411  46.988  1.00 85.08  ? 150  GLU B N     1 
ATOM   6718  C  CA    . GLU H 4 150 ? 8.368  70.303  46.265  1.00 86.89  ? 150  GLU B CA    1 
ATOM   6719  C  C     . GLU H 4 150 ? 7.701  70.742  44.950  1.00 87.07  ? 150  GLU B C     1 
ATOM   6720  O  O     . GLU H 4 150 ? 7.673  69.991  43.968  1.00 86.72  ? 150  GLU B O     1 
ATOM   6721  C  CB    . GLU H 4 150 ? 7.333  69.639  47.202  1.00 88.10  ? 150  GLU B CB    1 
ATOM   6722  C  CG    . GLU H 4 150 ? 6.661  68.363  46.689  1.00 91.25  ? 150  GLU B CG    1 
ATOM   6723  C  CD    . GLU H 4 150 ? 5.498  67.906  47.582  1.00 93.58  ? 150  GLU B CD    1 
ATOM   6724  O  OE1   . GLU H 4 150 ? 4.861  66.870  47.258  1.00 94.52  ? 150  GLU B OE1   1 
ATOM   6725  O  OE2   . GLU H 4 150 ? 5.221  68.586  48.605  1.00 94.42  ? 150  GLU B OE2   1 
ATOM   6726  N  N     . ASN H 4 151 ? 7.182  71.968  44.935  1.00 87.69  ? 151  ASN B N     1 
ATOM   6727  C  CA    . ASN H 4 151 ? 6.488  72.487  43.768  1.00 88.18  ? 151  ASN B CA    1 
ATOM   6728  C  C     . ASN H 4 151 ? 7.338  73.344  42.829  1.00 88.69  ? 151  ASN B C     1 
ATOM   6729  O  O     . ASN H 4 151 ? 7.042  73.410  41.639  1.00 89.53  ? 151  ASN B O     1 
ATOM   6730  C  CB    . ASN H 4 151 ? 5.244  73.277  44.208  1.00 87.90  ? 151  ASN B CB    1 
ATOM   6731  C  CG    . ASN H 4 151 ? 4.281  72.447  45.071  1.00 87.80  ? 151  ASN B CG    1 
ATOM   6732  O  OD1   . ASN H 4 151 ? 3.935  71.326  44.712  1.00 87.35  ? 151  ASN B OD1   1 
ATOM   6733  N  ND2   . ASN H 4 151 ? 3.870  73.009  46.207  1.00 86.87  ? 151  ASN B ND2   1 
ATOM   6734  N  N     . SER H 4 152 ? 8.386  73.994  43.339  1.00 89.04  ? 152  SER B N     1 
ATOM   6735  C  CA    . SER H 4 152 ? 9.239  74.843  42.489  1.00 89.01  ? 152  SER B CA    1 
ATOM   6736  C  C     . SER H 4 152 ? 9.670  74.164  41.190  1.00 89.27  ? 152  SER B C     1 
ATOM   6737  O  O     . SER H 4 152 ? 9.653  72.937  41.078  1.00 89.09  ? 152  SER B O     1 
ATOM   6738  C  CB    . SER H 4 152 ? 10.489 75.300  43.247  1.00 88.18  ? 152  SER B CB    1 
ATOM   6739  O  OG    . SER H 4 152 ? 11.372 75.986  42.379  1.00 86.25  ? 152  SER B OG    1 
ATOM   6740  N  N     . ASP H 4 153 ? 10.053 74.968  40.206  1.00 89.43  ? 153  ASP B N     1 
ATOM   6741  C  CA    . ASP H 4 153 ? 10.478 74.430  38.918  1.00 90.22  ? 153  ASP B CA    1 
ATOM   6742  C  C     . ASP H 4 153 ? 11.906 74.840  38.576  1.00 89.61  ? 153  ASP B C     1 
ATOM   6743  O  O     . ASP H 4 153 ? 12.427 74.445  37.531  1.00 89.07  ? 153  ASP B O     1 
ATOM   6744  C  CB    . ASP H 4 153 ? 9.541  74.896  37.778  1.00 92.64  ? 153  ASP B CB    1 
ATOM   6745  C  CG    . ASP H 4 153 ? 8.288  74.012  37.615  1.00 94.56  ? 153  ASP B CG    1 
ATOM   6746  O  OD1   . ASP H 4 153 ? 8.442  72.773  37.529  1.00 94.97  ? 153  ASP B OD1   1 
ATOM   6747  O  OD2   . ASP H 4 153 ? 7.153  74.555  37.553  1.00 95.62  ? 153  ASP B OD2   1 
ATOM   6748  N  N     . ARG H 4 154 ? 12.535 75.628  39.448  1.00 89.21  ? 154  ARG B N     1 
ATOM   6749  C  CA    . ARG H 4 154 ? 13.902 76.096  39.206  1.00 88.95  ? 154  ARG B CA    1 
ATOM   6750  C  C     . ARG H 4 154 ? 14.843 74.913  39.017  1.00 88.88  ? 154  ARG B C     1 
ATOM   6751  O  O     . ARG H 4 154 ? 14.603 73.841  39.560  1.00 89.16  ? 154  ARG B O     1 
ATOM   6752  C  CB    . ARG H 4 154 ? 14.372 76.965  40.367  1.00 89.14  ? 154  ARG B CB    1 
ATOM   6753  C  CG    . ARG H 4 154 ? 13.449 78.139  40.679  1.00 90.67  ? 154  ARG B CG    1 
ATOM   6754  C  CD    . ARG H 4 154 ? 14.039 78.967  41.801  1.00 92.27  ? 154  ARG B CD    1 
ATOM   6755  N  NE    . ARG H 4 154 ? 15.389 79.406  41.451  1.00 94.44  ? 154  ARG B NE    1 
ATOM   6756  C  CZ    . ARG H 4 154 ? 16.330 79.731  42.333  1.00 95.57  ? 154  ARG B CZ    1 
ATOM   6757  N  NH1   . ARG H 4 154 ? 16.067 79.664  43.637  1.00 95.94  ? 154  ARG B NH1   1 
ATOM   6758  N  NH2   . ARG H 4 154 ? 17.534 80.122  41.911  1.00 95.81  ? 154  ARG B NH2   1 
ATOM   6759  N  N     . CYS H 4 155 ? 15.915 75.099  38.252  1.00 88.79  ? 155  CYS B N     1 
ATOM   6760  C  CA    . CYS H 4 155 ? 16.848 74.002  37.993  1.00 88.67  ? 155  CYS B CA    1 
ATOM   6761  C  C     . CYS H 4 155 ? 17.697 73.640  39.210  1.00 86.17  ? 155  CYS B C     1 
ATOM   6762  O  O     . CYS H 4 155 ? 18.133 72.497  39.352  1.00 85.51  ? 155  CYS B O     1 
ATOM   6763  C  CB    . CYS H 4 155 ? 17.752 74.344  36.799  1.00 91.40  ? 155  CYS B CB    1 
ATOM   6764  S  SG    . CYS H 4 155 ? 18.389 72.904  35.821  1.00 97.60  ? 155  CYS B SG    1 
ATOM   6765  N  N     . GLN H 4 156 ? 17.924 74.597  40.100  1.00 83.95  ? 156  GLN B N     1 
ATOM   6766  C  CA    . GLN H 4 156 ? 18.724 74.294  41.276  1.00 81.71  ? 156  GLN B CA    1 
ATOM   6767  C  C     . GLN H 4 156 ? 17.911 73.926  42.520  1.00 79.98  ? 156  GLN B C     1 
ATOM   6768  O  O     . GLN H 4 156 ? 18.443 73.332  43.449  1.00 80.18  ? 156  GLN B O     1 
ATOM   6769  C  CB    . GLN H 4 156 ? 19.684 75.445  41.590  1.00 82.10  ? 156  GLN B CB    1 
ATOM   6770  C  CG    . GLN H 4 156 ? 19.145 76.511  42.508  1.00 81.70  ? 156  GLN B CG    1 
ATOM   6771  C  CD    . GLN H 4 156 ? 20.237 77.440  42.984  1.00 81.79  ? 156  GLN B CD    1 
ATOM   6772  O  OE1   . GLN H 4 156 ? 19.961 78.459  43.612  1.00 81.79  ? 156  GLN B OE1   1 
ATOM   6773  N  NE2   . GLN H 4 156 ? 21.491 77.087  42.693  1.00 81.70  ? 156  GLN B NE2   1 
ATOM   6774  N  N     . ASP H 4 157 ? 16.634 74.279  42.555  1.00 77.62  ? 157  ASP B N     1 
ATOM   6775  C  CA    . ASP H 4 157 ? 15.803 73.915  43.701  1.00 75.52  ? 157  ASP B CA    1 
ATOM   6776  C  C     . ASP H 4 157 ? 15.434 72.456  43.505  1.00 72.86  ? 157  ASP B C     1 
ATOM   6777  O  O     . ASP H 4 157 ? 15.093 71.755  44.444  1.00 72.49  ? 157  ASP B O     1 
ATOM   6778  C  CB    . ASP H 4 157 ? 14.527 74.769  43.762  1.00 77.31  ? 157  ASP B CB    1 
ATOM   6779  C  CG    . ASP H 4 157 ? 14.749 76.122  44.447  1.00 79.50  ? 157  ASP B CG    1 
ATOM   6780  O  OD1   . ASP H 4 157 ? 15.895 76.640  44.395  1.00 80.59  ? 157  ASP B OD1   1 
ATOM   6781  O  OD2   . ASP H 4 157 ? 13.774 76.675  45.024  1.00 80.42  ? 157  ASP B OD2   1 
ATOM   6782  N  N     . ILE H 4 158 ? 15.505 72.001  42.264  1.00 69.83  ? 158  ILE B N     1 
ATOM   6783  C  CA    . ILE H 4 158 ? 15.179 70.624  41.978  1.00 67.28  ? 158  ILE B CA    1 
ATOM   6784  C  C     . ILE H 4 158 ? 16.355 69.759  42.356  1.00 65.26  ? 158  ILE B C     1 
ATOM   6785  O  O     . ILE H 4 158 ? 16.156 68.640  42.823  1.00 65.16  ? 158  ILE B O     1 
ATOM   6786  C  CB    . ILE H 4 158 ? 14.826 70.409  40.492  1.00 67.58  ? 158  ILE B CB    1 
ATOM   6787  C  CG1   . ILE H 4 158 ? 13.396 70.889  40.237  1.00 68.11  ? 158  ILE B CG1   1 
ATOM   6788  C  CG2   . ILE H 4 158 ? 14.954 68.935  40.118  1.00 67.18  ? 158  ILE B CG2   1 
ATOM   6789  C  CD1   . ILE H 4 158 ? 12.377 70.390  41.280  1.00 70.47  ? 158  ILE B CD1   1 
ATOM   6790  N  N     . ARG H 4 159 ? 17.572 70.273  42.153  1.00 62.46  ? 159  ARG B N     1 
ATOM   6791  C  CA    . ARG H 4 159 ? 18.784 69.528  42.511  1.00 59.15  ? 159  ARG B CA    1 
ATOM   6792  C  C     . ARG H 4 159 ? 18.865 69.427  44.017  1.00 58.95  ? 159  ARG B C     1 
ATOM   6793  O  O     . ARG H 4 159 ? 18.648 68.376  44.605  1.00 59.75  ? 159  ARG B O     1 
ATOM   6794  C  CB    . ARG H 4 159 ? 20.061 70.227  42.041  1.00 55.90  ? 159  ARG B CB    1 
ATOM   6795  C  CG    . ARG H 4 159 ? 21.305 69.532  42.555  1.00 51.24  ? 159  ARG B CG    1 
ATOM   6796  C  CD    . ARG H 4 159 ? 22.541 70.295  42.236  1.00 49.28  ? 159  ARG B CD    1 
ATOM   6797  N  NE    . ARG H 4 159 ? 22.555 71.576  42.937  1.00 48.23  ? 159  ARG B NE    1 
ATOM   6798  C  CZ    . ARG H 4 159 ? 23.580 72.435  42.920  1.00 47.71  ? 159  ARG B CZ    1 
ATOM   6799  N  NH1   . ARG H 4 159 ? 24.691 72.153  42.242  1.00 45.26  ? 159  ARG B NH1   1 
ATOM   6800  N  NH2   . ARG H 4 159 ? 23.487 73.595  43.563  1.00 46.07  ? 159  ARG B NH2   1 
ATOM   6801  N  N     . ASN H 4 160 ? 19.186 70.549  44.635  1.00 58.34  ? 160  ASN B N     1 
ATOM   6802  C  CA    . ASN H 4 160 ? 19.314 70.622  46.073  1.00 57.35  ? 160  ASN B CA    1 
ATOM   6803  C  C     . ASN H 4 160 ? 18.346 69.754  46.873  1.00 55.79  ? 160  ASN B C     1 
ATOM   6804  O  O     . ASN H 4 160 ? 18.713 69.228  47.917  1.00 56.08  ? 160  ASN B O     1 
ATOM   6805  C  CB    . ASN H 4 160 ? 19.236 72.086  46.480  1.00 57.79  ? 160  ASN B CB    1 
ATOM   6806  C  CG    . ASN H 4 160 ? 20.401 72.887  45.914  1.00 59.12  ? 160  ASN B CG    1 
ATOM   6807  O  OD1   . ASN H 4 160 ? 21.082 72.438  44.974  1.00 58.06  ? 160  ASN B OD1   1 
ATOM   6808  N  ND2   . ASN H 4 160 ? 20.639 74.073  46.474  1.00 59.66  ? 160  ASN B ND2   1 
ATOM   6809  N  N     . LEU H 4 161 ? 17.128 69.559  46.390  1.00 54.35  ? 161  LEU B N     1 
ATOM   6810  C  CA    . LEU H 4 161 ? 16.191 68.732  47.142  1.00 52.36  ? 161  LEU B CA    1 
ATOM   6811  C  C     . LEU H 4 161 ? 16.452 67.237  46.981  1.00 50.86  ? 161  LEU B C     1 
ATOM   6812  O  O     . LEU H 4 161 ? 16.047 66.447  47.818  1.00 50.23  ? 161  LEU B O     1 
ATOM   6813  C  CB    . LEU H 4 161 ? 14.752 69.028  46.735  1.00 52.60  ? 161  LEU B CB    1 
ATOM   6814  C  CG    . LEU H 4 161 ? 13.784 68.372  47.709  1.00 53.17  ? 161  LEU B CG    1 
ATOM   6815  C  CD1   . LEU H 4 161 ? 13.265 69.449  48.605  1.00 54.93  ? 161  LEU B CD1   1 
ATOM   6816  C  CD2   . LEU H 4 161 ? 12.645 67.680  46.994  1.00 54.00  ? 161  LEU B CD2   1 
ATOM   6817  N  N     . ALA H 4 162 ? 17.098 66.837  45.895  1.00 49.91  ? 162  ALA B N     1 
ATOM   6818  C  CA    . ALA H 4 162 ? 17.391 65.427  45.698  1.00 49.31  ? 162  ALA B CA    1 
ATOM   6819  C  C     . ALA H 4 162 ? 18.545 65.144  46.627  1.00 49.57  ? 162  ALA B C     1 
ATOM   6820  O  O     . ALA H 4 162 ? 18.491 64.203  47.416  1.00 50.92  ? 162  ALA B O     1 
ATOM   6821  C  CB    . ALA H 4 162 ? 17.800 65.145  44.267  1.00 48.33  ? 162  ALA B CB    1 
ATOM   6822  N  N     . PHE H 4 163 ? 19.593 65.964  46.531  1.00 48.48  ? 163  PHE B N     1 
ATOM   6823  C  CA    . PHE H 4 163 ? 20.765 65.815  47.383  1.00 46.30  ? 163  PHE B CA    1 
ATOM   6824  C  C     . PHE H 4 163 ? 20.284 65.661  48.802  1.00 46.53  ? 163  PHE B C     1 
ATOM   6825  O  O     . PHE H 4 163 ? 20.538 64.650  49.422  1.00 48.09  ? 163  PHE B O     1 
ATOM   6826  C  CB    . PHE H 4 163 ? 21.641 67.032  47.302  1.00 45.32  ? 163  PHE B CB    1 
ATOM   6827  C  CG    . PHE H 4 163 ? 22.721 67.047  48.312  1.00 45.78  ? 163  PHE B CG    1 
ATOM   6828  C  CD1   . PHE H 4 163 ? 23.935 66.437  48.056  1.00 45.58  ? 163  PHE B CD1   1 
ATOM   6829  C  CD2   . PHE H 4 163 ? 22.543 67.702  49.518  1.00 45.85  ? 163  PHE B CD2   1 
ATOM   6830  C  CE1   . PHE H 4 163 ? 24.962 66.487  48.984  1.00 45.44  ? 163  PHE B CE1   1 
ATOM   6831  C  CE2   . PHE H 4 163 ? 23.566 67.756  50.450  1.00 45.74  ? 163  PHE B CE2   1 
ATOM   6832  C  CZ    . PHE H 4 163 ? 24.776 67.150  50.182  1.00 45.41  ? 163  PHE B CZ    1 
ATOM   6833  N  N     . LEU H 4 164 ? 19.586 66.658  49.326  1.00 45.32  ? 164  LEU B N     1 
ATOM   6834  C  CA    . LEU H 4 164 ? 19.074 66.536  50.668  1.00 44.58  ? 164  LEU B CA    1 
ATOM   6835  C  C     . LEU H 4 164 ? 18.297 65.241  50.865  1.00 43.82  ? 164  LEU B C     1 
ATOM   6836  O  O     . LEU H 4 164 ? 18.249 64.715  51.954  1.00 44.76  ? 164  LEU B O     1 
ATOM   6837  C  CB    . LEU H 4 164 ? 18.162 67.689  51.007  1.00 46.42  ? 164  LEU B CB    1 
ATOM   6838  C  CG    . LEU H 4 164 ? 18.795 69.065  51.156  1.00 48.59  ? 164  LEU B CG    1 
ATOM   6839  C  CD1   . LEU H 4 164 ? 17.790 69.938  51.905  1.00 49.20  ? 164  LEU B CD1   1 
ATOM   6840  C  CD2   . LEU H 4 164 ? 20.111 69.004  51.905  1.00 48.16  ? 164  LEU B CD2   1 
ATOM   6841  N  N     . GLY H 4 165 ? 17.665 64.719  49.829  1.00 43.09  ? 165  GLY B N     1 
ATOM   6842  C  CA    . GLY H 4 165 ? 16.933 63.466  50.001  1.00 41.70  ? 165  GLY B CA    1 
ATOM   6843  C  C     . GLY H 4 165 ? 17.908 62.311  50.126  1.00 40.08  ? 165  GLY B C     1 
ATOM   6844  O  O     . GLY H 4 165 ? 17.897 61.581  51.108  1.00 39.25  ? 165  GLY B O     1 
ATOM   6845  N  N     . ILE H 4 166 ? 18.760 62.155  49.117  1.00 38.79  ? 166  ILE B N     1 
ATOM   6846  C  CA    . ILE H 4 166 ? 19.778 61.114  49.115  1.00 38.78  ? 166  ILE B CA    1 
ATOM   6847  C  C     . ILE H 4 166 ? 20.651 61.200  50.386  1.00 38.75  ? 166  ILE B C     1 
ATOM   6848  O  O     . ILE H 4 166 ? 21.145 60.197  50.897  1.00 38.42  ? 166  ILE B O     1 
ATOM   6849  C  CB    . ILE H 4 166 ? 20.665 61.233  47.829  1.00 37.94  ? 166  ILE B CB    1 
ATOM   6850  C  CG1   . ILE H 4 166 ? 20.127 60.296  46.749  1.00 37.69  ? 166  ILE B CG1   1 
ATOM   6851  C  CG2   . ILE H 4 166 ? 22.140 60.949  48.138  1.00 37.75  ? 166  ILE B CG2   1 
ATOM   6852  C  CD1   . ILE H 4 166 ? 20.891 60.375  45.452  1.00 37.01  ? 166  ILE B CD1   1 
ATOM   6853  N  N     . ALA H 4 167 ? 20.818 62.401  50.907  1.00 37.60  ? 167  ALA B N     1 
ATOM   6854  C  CA    . ALA H 4 167 ? 21.636 62.575  52.082  1.00 37.89  ? 167  ALA B CA    1 
ATOM   6855  C  C     . ALA H 4 167 ? 20.990 61.933  53.293  1.00 38.45  ? 167  ALA B C     1 
ATOM   6856  O  O     . ALA H 4 167 ? 21.502 60.962  53.844  1.00 39.47  ? 167  ALA B O     1 
ATOM   6857  C  CB    . ALA H 4 167 ? 21.873 64.051  52.335  1.00 37.26  ? 167  ALA B CB    1 
ATOM   6858  N  N     . TYR H 4 168 ? 19.866 62.481  53.722  1.00 37.96  ? 168  TYR B N     1 
ATOM   6859  C  CA    . TYR H 4 168 ? 19.187 61.938  54.878  1.00 37.50  ? 168  TYR B CA    1 
ATOM   6860  C  C     . TYR H 4 168 ? 18.730 60.507  54.654  1.00 38.20  ? 168  TYR B C     1 
ATOM   6861  O  O     . TYR H 4 168 ? 18.567 59.757  55.591  1.00 38.95  ? 168  TYR B O     1 
ATOM   6862  C  CB    . TYR H 4 168 ? 17.975 62.788  55.223  1.00 34.71  ? 168  TYR B CB    1 
ATOM   6863  C  CG    . TYR H 4 168 ? 17.022 62.081  56.136  1.00 32.47  ? 168  TYR B CG    1 
ATOM   6864  C  CD1   . TYR H 4 168 ? 16.976 62.371  57.505  1.00 31.89  ? 168  TYR B CD1   1 
ATOM   6865  C  CD2   . TYR H 4 168 ? 16.193 61.093  55.644  1.00 31.11  ? 168  TYR B CD2   1 
ATOM   6866  C  CE1   . TYR H 4 168 ? 16.123 61.697  58.347  1.00 30.53  ? 168  TYR B CE1   1 
ATOM   6867  C  CE2   . TYR H 4 168 ? 15.351 60.412  56.472  1.00 32.92  ? 168  TYR B CE2   1 
ATOM   6868  C  CZ    . TYR H 4 168 ? 15.312 60.717  57.818  1.00 32.40  ? 168  TYR B CZ    1 
ATOM   6869  O  OH    . TYR H 4 168 ? 14.416 60.042  58.595  1.00 33.52  ? 168  TYR B OH    1 
ATOM   6870  N  N     . ASN H 4 169 ? 18.517 60.117  53.415  1.00 39.34  ? 169  ASN B N     1 
ATOM   6871  C  CA    . ASN H 4 169 ? 18.035 58.777  53.173  1.00 40.07  ? 169  ASN B CA    1 
ATOM   6872  C  C     . ASN H 4 169 ? 19.107 57.717  53.153  1.00 39.83  ? 169  ASN B C     1 
ATOM   6873  O  O     . ASN H 4 169 ? 18.843 56.601  53.571  1.00 40.58  ? 169  ASN B O     1 
ATOM   6874  C  CB    . ASN H 4 169 ? 17.279 58.728  51.851  1.00 42.67  ? 169  ASN B CB    1 
ATOM   6875  C  CG    . ASN H 4 169 ? 16.582 57.396  51.616  1.00 44.09  ? 169  ASN B CG    1 
ATOM   6876  O  OD1   . ASN H 4 169 ? 15.397 57.249  51.901  1.00 46.52  ? 169  ASN B OD1   1 
ATOM   6877  N  ND2   . ASN H 4 169 ? 17.318 56.421  51.096  1.00 42.80  ? 169  ASN B ND2   1 
ATOM   6878  N  N     . THR H 4 170 ? 20.305 58.050  52.672  1.00 39.15  ? 170  THR B N     1 
ATOM   6879  C  CA    . THR H 4 170 ? 21.395 57.068  52.563  1.00 39.03  ? 170  THR B CA    1 
ATOM   6880  C  C     . THR H 4 170 ? 22.440 57.126  53.663  1.00 38.52  ? 170  THR B C     1 
ATOM   6881  O  O     . THR H 4 170 ? 23.190 56.179  53.870  1.00 38.91  ? 170  THR B O     1 
ATOM   6882  C  CB    . THR H 4 170 ? 22.182 57.241  51.250  1.00 40.18  ? 170  THR B CB    1 
ATOM   6883  O  OG1   . THR H 4 170 ? 23.091 58.342  51.383  1.00 41.75  ? 170  THR B OG1   1 
ATOM   6884  C  CG2   . THR H 4 170 ? 21.254 57.528  50.085  1.00 40.14  ? 170  THR B CG2   1 
ATOM   6885  N  N     . LEU H 4 171 ? 22.489 58.261  54.343  1.00 37.84  ? 171  LEU B N     1 
ATOM   6886  C  CA    . LEU H 4 171 ? 23.449 58.538  55.404  1.00 35.85  ? 171  LEU B CA    1 
ATOM   6887  C  C     . LEU H 4 171 ? 24.845 58.746  54.873  1.00 35.50  ? 171  LEU B C     1 
ATOM   6888  O  O     . LEU H 4 171 ? 25.708 59.142  55.635  1.00 36.58  ? 171  LEU B O     1 
ATOM   6889  C  CB    . LEU H 4 171 ? 23.465 57.451  56.489  1.00 33.40  ? 171  LEU B CB    1 
ATOM   6890  C  CG    . LEU H 4 171 ? 22.418 57.599  57.605  1.00 31.20  ? 171  LEU B CG    1 
ATOM   6891  C  CD1   . LEU H 4 171 ? 21.288 56.639  57.368  1.00 29.81  ? 171  LEU B CD1   1 
ATOM   6892  C  CD2   . LEU H 4 171 ? 23.025 57.336  58.950  1.00 30.40  ? 171  LEU B CD2   1 
ATOM   6893  N  N     . LEU H 4 172 ? 25.065 58.495  53.580  1.00 34.94  ? 172  LEU B N     1 
ATOM   6894  C  CA    . LEU H 4 172 ? 26.376 58.682  52.943  1.00 34.91  ? 172  LEU B CA    1 
ATOM   6895  C  C     . LEU H 4 172 ? 27.064 59.976  53.360  1.00 36.17  ? 172  LEU B C     1 
ATOM   6896  O  O     . LEU H 4 172 ? 26.404 60.935  53.735  1.00 36.99  ? 172  LEU B O     1 
ATOM   6897  C  CB    . LEU H 4 172 ? 26.206 58.677  51.433  1.00 32.82  ? 172  LEU B CB    1 
ATOM   6898  C  CG    . LEU H 4 172 ? 26.138 57.270  50.857  1.00 33.79  ? 172  LEU B CG    1 
ATOM   6899  C  CD1   . LEU H 4 172 ? 25.301 57.233  49.620  1.00 34.28  ? 172  LEU B CD1   1 
ATOM   6900  C  CD2   . LEU H 4 172 ? 27.536 56.793  50.551  1.00 33.69  ? 172  LEU B CD2   1 
ATOM   6901  N  N     . ARG H 4 173 ? 28.388 60.009  53.313  1.00 37.53  ? 173  ARG B N     1 
ATOM   6902  C  CA    . ARG H 4 173 ? 29.115 61.235  53.666  1.00 40.90  ? 173  ARG B CA    1 
ATOM   6903  C  C     . ARG H 4 173 ? 29.197 62.070  52.400  1.00 41.19  ? 173  ARG B C     1 
ATOM   6904  O  O     . ARG H 4 173 ? 29.295 61.504  51.316  1.00 42.70  ? 173  ARG B O     1 
ATOM   6905  C  CB    . ARG H 4 173 ? 30.542 60.924  54.118  1.00 43.73  ? 173  ARG B CB    1 
ATOM   6906  C  CG    . ARG H 4 173 ? 30.668 59.871  55.192  1.00 45.36  ? 173  ARG B CG    1 
ATOM   6907  C  CD    . ARG H 4 173 ? 32.117 59.589  55.375  1.00 47.39  ? 173  ARG B CD    1 
ATOM   6908  N  NE    . ARG H 4 173 ? 32.416 59.086  56.705  1.00 50.67  ? 173  ARG B NE    1 
ATOM   6909  C  CZ    . ARG H 4 173 ? 32.426 57.801  57.037  1.00 51.49  ? 173  ARG B CZ    1 
ATOM   6910  N  NH1   . ARG H 4 173 ? 32.147 56.869  56.130  1.00 48.97  ? 173  ARG B NH1   1 
ATOM   6911  N  NH2   . ARG H 4 173 ? 32.722 57.447  58.283  1.00 54.35  ? 173  ARG B NH2   1 
ATOM   6912  N  N     . ILE H 4 174 ? 29.200 63.396  52.501  1.00 40.98  ? 174  ILE B N     1 
ATOM   6913  C  CA    . ILE H 4 174 ? 29.239 64.202  51.271  1.00 40.65  ? 174  ILE B CA    1 
ATOM   6914  C  C     . ILE H 4 174 ? 30.290 63.804  50.231  1.00 40.89  ? 174  ILE B C     1 
ATOM   6915  O  O     . ILE H 4 174 ? 29.966 63.671  49.060  1.00 41.20  ? 174  ILE B O     1 
ATOM   6916  C  CB    . ILE H 4 174 ? 29.371 65.701  51.565  1.00 39.54  ? 174  ILE B CB    1 
ATOM   6917  C  CG1   . ILE H 4 174 ? 30.622 65.967  52.387  1.00 38.52  ? 174  ILE B CG1   1 
ATOM   6918  C  CG2   . ILE H 4 174 ? 28.117 66.189  52.270  1.00 39.18  ? 174  ILE B CG2   1 
ATOM   6919  C  CD1   . ILE H 4 174 ? 30.706 67.384  52.895  1.00 37.96  ? 174  ILE B CD1   1 
ATOM   6920  N  N     . ALA H 4 175 ? 31.535 63.598  50.637  1.00 41.46  ? 175  ALA B N     1 
ATOM   6921  C  CA    . ALA H 4 175 ? 32.569 63.197  49.680  1.00 41.89  ? 175  ALA B CA    1 
ATOM   6922  C  C     . ALA H 4 175 ? 32.141 61.974  48.859  1.00 42.35  ? 175  ALA B C     1 
ATOM   6923  O  O     . ALA H 4 175 ? 32.471 61.854  47.690  1.00 41.97  ? 175  ALA B O     1 
ATOM   6924  C  CB    . ALA H 4 175 ? 33.882 62.901  50.413  1.00 41.46  ? 175  ALA B CB    1 
ATOM   6925  N  N     . GLU H 4 176 ? 31.416 61.059  49.480  1.00 43.94  ? 176  GLU B N     1 
ATOM   6926  C  CA    . GLU H 4 176 ? 30.965 59.889  48.776  1.00 46.50  ? 176  GLU B CA    1 
ATOM   6927  C  C     . GLU H 4 176 ? 29.934 60.363  47.787  1.00 47.28  ? 176  GLU B C     1 
ATOM   6928  O  O     . GLU H 4 176 ? 30.080 60.125  46.598  1.00 50.12  ? 176  GLU B O     1 
ATOM   6929  C  CB    . GLU H 4 176 ? 30.348 58.874  49.735  1.00 49.37  ? 176  GLU B CB    1 
ATOM   6930  C  CG    . GLU H 4 176 ? 31.365 57.962  50.426  1.00 55.15  ? 176  GLU B CG    1 
ATOM   6931  C  CD    . GLU H 4 176 ? 31.335 58.040  51.965  1.00 58.12  ? 176  GLU B CD    1 
ATOM   6932  O  OE1   . GLU H 4 176 ? 30.284 57.693  52.565  1.00 59.40  ? 176  GLU B OE1   1 
ATOM   6933  O  OE2   . GLU H 4 176 ? 32.369 58.445  52.567  1.00 59.13  ? 176  GLU B OE2   1 
ATOM   6934  N  N     . ILE H 4 177 ? 28.897 61.053  48.261  1.00 46.80  ? 177  ILE B N     1 
ATOM   6935  C  CA    . ILE H 4 177 ? 27.842 61.547  47.373  1.00 44.86  ? 177  ILE B CA    1 
ATOM   6936  C  C     . ILE H 4 177 ? 28.411 62.178  46.118  1.00 45.25  ? 177  ILE B C     1 
ATOM   6937  O  O     . ILE H 4 177 ? 28.066 61.792  45.009  1.00 44.74  ? 177  ILE B O     1 
ATOM   6938  C  CB    . ILE H 4 177 ? 26.980 62.561  48.074  1.00 43.46  ? 177  ILE B CB    1 
ATOM   6939  C  CG1   . ILE H 4 177 ? 26.313 61.885  49.267  1.00 43.70  ? 177  ILE B CG1   1 
ATOM   6940  C  CG2   . ILE H 4 177 ? 25.981 63.127  47.110  1.00 41.74  ? 177  ILE B CG2   1 
ATOM   6941  C  CD1   . ILE H 4 177 ? 25.199 62.677  49.903  1.00 45.79  ? 177  ILE B CD1   1 
ATOM   6942  N  N     . ALA H 4 178 ? 29.304 63.140  46.303  1.00 45.80  ? 178  ALA B N     1 
ATOM   6943  C  CA    . ALA H 4 178 ? 29.942 63.819  45.190  1.00 47.38  ? 178  ALA B CA    1 
ATOM   6944  C  C     . ALA H 4 178 ? 30.382 62.834  44.107  1.00 48.79  ? 178  ALA B C     1 
ATOM   6945  O  O     . ALA H 4 178 ? 30.115 63.058  42.929  1.00 50.36  ? 178  ALA B O     1 
ATOM   6946  C  CB    . ALA H 4 178 ? 31.133 64.625  45.682  1.00 45.40  ? 178  ALA B CB    1 
ATOM   6947  N  N     . ARG H 4 179 ? 31.040 61.748  44.500  1.00 48.69  ? 179  ARG B N     1 
ATOM   6948  C  CA    . ARG H 4 179 ? 31.517 60.743  43.547  1.00 49.36  ? 179  ARG B CA    1 
ATOM   6949  C  C     . ARG H 4 179 ? 30.466 59.893  42.811  1.00 48.43  ? 179  ARG B C     1 
ATOM   6950  O  O     . ARG H 4 179 ? 30.814 59.147  41.896  1.00 47.87  ? 179  ARG B O     1 
ATOM   6951  C  CB    . ARG H 4 179 ? 32.481 59.776  44.237  1.00 51.39  ? 179  ARG B CB    1 
ATOM   6952  C  CG    . ARG H 4 179 ? 33.808 60.356  44.645  1.00 55.24  ? 179  ARG B CG    1 
ATOM   6953  C  CD    . ARG H 4 179 ? 34.797 59.236  45.008  1.00 58.75  ? 179  ARG B CD    1 
ATOM   6954  N  NE    . ARG H 4 179 ? 34.723 58.800  46.402  1.00 61.78  ? 179  ARG B NE    1 
ATOM   6955  C  CZ    . ARG H 4 179 ? 35.013 59.580  47.447  1.00 63.12  ? 179  ARG B CZ    1 
ATOM   6956  N  NH1   . ARG H 4 179 ? 35.394 60.842  47.257  1.00 63.58  ? 179  ARG B NH1   1 
ATOM   6957  N  NH2   . ARG H 4 179 ? 34.933 59.101  48.685  1.00 62.55  ? 179  ARG B NH2   1 
ATOM   6958  N  N     . ILE H 4 180 ? 29.196 59.986  43.185  1.00 47.69  ? 180  ILE B N     1 
ATOM   6959  C  CA    . ILE H 4 180 ? 28.200 59.146  42.528  1.00 48.03  ? 180  ILE B CA    1 
ATOM   6960  C  C     . ILE H 4 180 ? 28.021 59.400  41.048  1.00 49.71  ? 180  ILE B C     1 
ATOM   6961  O  O     . ILE H 4 180 ? 27.515 60.453  40.691  1.00 51.15  ? 180  ILE B O     1 
ATOM   6962  C  CB    . ILE H 4 180 ? 26.810 59.307  43.137  1.00 46.84  ? 180  ILE B CB    1 
ATOM   6963  C  CG1   . ILE H 4 180 ? 26.804 58.869  44.589  1.00 46.13  ? 180  ILE B CG1   1 
ATOM   6964  C  CG2   . ILE H 4 180 ? 25.834 58.452  42.387  1.00 45.58  ? 180  ILE B CG2   1 
ATOM   6965  C  CD1   . ILE H 4 180 ? 25.420 58.839  45.172  1.00 46.54  ? 180  ILE B CD1   1 
ATOM   6966  N  N     . ARG H 4 181 ? 28.401 58.445  40.191  1.00 50.93  ? 181  ARG B N     1 
ATOM   6967  C  CA    . ARG H 4 181 ? 28.217 58.601  38.736  1.00 51.89  ? 181  ARG B CA    1 
ATOM   6968  C  C     . ARG H 4 181 ? 26.925 57.904  38.309  1.00 51.88  ? 181  ARG B C     1 
ATOM   6969  O  O     . ARG H 4 181 ? 26.445 57.012  38.996  1.00 52.19  ? 181  ARG B O     1 
ATOM   6970  C  CB    . ARG H 4 181 ? 29.369 57.996  37.955  1.00 51.82  ? 181  ARG B CB    1 
ATOM   6971  C  CG    . ARG H 4 181 ? 30.642 57.898  38.719  1.00 54.82  ? 181  ARG B CG    1 
ATOM   6972  C  CD    . ARG H 4 181 ? 31.799 57.605  37.784  1.00 56.27  ? 181  ARG B CD    1 
ATOM   6973  N  NE    . ARG H 4 181 ? 32.224 58.815  37.098  1.00 56.61  ? 181  ARG B NE    1 
ATOM   6974  C  CZ    . ARG H 4 181 ? 33.485 59.220  37.031  1.00 57.92  ? 181  ARG B CZ    1 
ATOM   6975  N  NH1   . ARG H 4 181 ? 34.444 58.499  37.607  1.00 57.80  ? 181  ARG B NH1   1 
ATOM   6976  N  NH2   . ARG H 4 181 ? 33.780 60.360  36.414  1.00 58.13  ? 181  ARG B NH2   1 
ATOM   6977  N  N     . VAL H 4 182 ? 26.372 58.291  37.169  1.00 51.59  ? 182  VAL B N     1 
ATOM   6978  C  CA    . VAL H 4 182 ? 25.124 57.708  36.724  1.00 52.22  ? 182  VAL B CA    1 
ATOM   6979  C  C     . VAL H 4 182 ? 25.188 56.224  36.472  1.00 53.54  ? 182  VAL B C     1 
ATOM   6980  O  O     . VAL H 4 182 ? 24.218 55.508  36.717  1.00 54.40  ? 182  VAL B O     1 
ATOM   6981  C  CB    . VAL H 4 182 ? 24.622 58.362  35.453  1.00 51.70  ? 182  VAL B CB    1 
ATOM   6982  C  CG1   . VAL H 4 182 ? 23.193 57.942  35.191  1.00 51.48  ? 182  VAL B CG1   1 
ATOM   6983  C  CG2   . VAL H 4 182 ? 24.704 59.849  35.585  1.00 52.03  ? 182  VAL B CG2   1 
ATOM   6984  N  N     . LYS H 4 183 ? 26.315 55.738  35.979  1.00 54.64  ? 183  LYS B N     1 
ATOM   6985  C  CA    . LYS H 4 183 ? 26.389 54.313  35.712  1.00 56.45  ? 183  LYS B CA    1 
ATOM   6986  C  C     . LYS H 4 183 ? 26.334 53.520  37.006  1.00 57.65  ? 183  LYS B C     1 
ATOM   6987  O  O     . LYS H 4 183 ? 26.221 52.295  36.974  1.00 58.37  ? 183  LYS B O     1 
ATOM   6988  C  CB    . LYS H 4 183 ? 27.663 53.965  34.939  1.00 56.40  ? 183  LYS B CB    1 
ATOM   6989  C  CG    . LYS H 4 183 ? 28.947 54.148  35.696  1.00 56.04  ? 183  LYS B CG    1 
ATOM   6990  C  CD    . LYS H 4 183 ? 30.127 53.921  34.782  1.00 57.20  ? 183  LYS B CD    1 
ATOM   6991  C  CE    . LYS H 4 183 ? 31.427 54.128  35.531  1.00 59.36  ? 183  LYS B CE    1 
ATOM   6992  N  NZ    . LYS H 4 183 ? 32.620 54.286  34.640  1.00 60.48  ? 183  LYS B NZ    1 
ATOM   6993  N  N     . ASP H 4 184 ? 26.395 54.223  38.140  1.00 58.12  ? 184  ASP B N     1 
ATOM   6994  C  CA    . ASP H 4 184 ? 26.379 53.592  39.462  1.00 58.72  ? 184  ASP B CA    1 
ATOM   6995  C  C     . ASP H 4 184 ? 24.982 53.240  39.973  1.00 59.32  ? 184  ASP B C     1 
ATOM   6996  O  O     . ASP H 4 184 ? 24.819 52.349  40.808  1.00 60.30  ? 184  ASP B O     1 
ATOM   6997  C  CB    . ASP H 4 184 ? 27.088 54.490  40.482  1.00 58.48  ? 184  ASP B CB    1 
ATOM   6998  C  CG    . ASP H 4 184 ? 28.603 54.533  40.286  1.00 60.07  ? 184  ASP B CG    1 
ATOM   6999  O  OD1   . ASP H 4 184 ? 29.160 53.492  39.852  1.00 60.31  ? 184  ASP B OD1   1 
ATOM   7000  O  OD2   . ASP H 4 184 ? 29.237 55.586  40.586  1.00 59.26  ? 184  ASP B OD2   1 
ATOM   7001  N  N     . ILE H 4 185 ? 23.973 53.934  39.467  1.00 59.14  ? 185  ILE B N     1 
ATOM   7002  C  CA    . ILE H 4 185 ? 22.600 53.682  39.872  1.00 59.30  ? 185  ILE B CA    1 
ATOM   7003  C  C     . ILE H 4 185 ? 22.007 52.503  39.101  1.00 61.63  ? 185  ILE B C     1 
ATOM   7004  O  O     . ILE H 4 185 ? 22.313 52.314  37.930  1.00 63.05  ? 185  ILE B O     1 
ATOM   7005  C  CB    . ILE H 4 185 ? 21.754 54.896  39.583  1.00 56.82  ? 185  ILE B CB    1 
ATOM   7006  C  CG1   . ILE H 4 185 ? 22.374 56.104  40.250  1.00 54.76  ? 185  ILE B CG1   1 
ATOM   7007  C  CG2   . ILE H 4 185 ? 20.347 54.669  40.059  1.00 56.06  ? 185  ILE B CG2   1 
ATOM   7008  C  CD1   . ILE H 4 185 ? 21.682 57.360  39.923  1.00 53.84  ? 185  ILE B CD1   1 
ATOM   7009  N  N     . SER H 4 186 ? 21.169 51.707  39.755  1.00 63.94  ? 186  SER B N     1 
ATOM   7010  C  CA    . SER H 4 186 ? 20.508 50.571  39.108  1.00 65.79  ? 186  SER B CA    1 
ATOM   7011  C  C     . SER H 4 186 ? 19.116 50.555  39.740  1.00 67.83  ? 186  SER B C     1 
ATOM   7012  O  O     . SER H 4 186 ? 18.778 51.509  40.435  1.00 69.54  ? 186  SER B O     1 
ATOM   7013  C  CB    . SER H 4 186 ? 21.276 49.268  39.377  1.00 64.93  ? 186  SER B CB    1 
ATOM   7014  O  OG    . SER H 4 186 ? 20.896 48.634  40.586  1.00 63.48  ? 186  SER B OG    1 
ATOM   7015  N  N     . ARG H 4 187 ? 18.294 49.531  39.518  1.00 69.61  ? 187  ARG B N     1 
ATOM   7016  C  CA    . ARG H 4 187 ? 16.969 49.540  40.147  1.00 71.68  ? 187  ARG B CA    1 
ATOM   7017  C  C     . ARG H 4 187 ? 16.400 48.209  40.633  1.00 72.68  ? 187  ARG B C     1 
ATOM   7018  O  O     . ARG H 4 187 ? 16.685 47.148  40.093  1.00 72.06  ? 187  ARG B O     1 
ATOM   7019  C  CB    . ARG H 4 187 ? 15.945 50.205  39.225  1.00 72.50  ? 187  ARG B CB    1 
ATOM   7020  C  CG    . ARG H 4 187 ? 16.111 51.711  39.074  1.00 74.64  ? 187  ARG B CG    1 
ATOM   7021  C  CD    . ARG H 4 187 ? 14.849 52.353  38.506  1.00 76.72  ? 187  ARG B CD    1 
ATOM   7022  N  NE    . ARG H 4 187 ? 14.934 53.810  38.356  1.00 78.81  ? 187  ARG B NE    1 
ATOM   7023  C  CZ    . ARG H 4 187 ? 15.758 54.455  37.521  1.00 80.47  ? 187  ARG B CZ    1 
ATOM   7024  N  NH1   . ARG H 4 187 ? 16.607 53.784  36.735  1.00 80.81  ? 187  ARG B NH1   1 
ATOM   7025  N  NH2   . ARG H 4 187 ? 15.715 55.785  37.446  1.00 80.76  ? 187  ARG B NH2   1 
ATOM   7026  N  N     . THR H 4 188 ? 15.591 48.271  41.678  1.00 74.54  ? 188  THR B N     1 
ATOM   7027  C  CA    . THR H 4 188 ? 14.974 47.062  42.195  1.00 77.15  ? 188  THR B CA    1 
ATOM   7028  C  C     . THR H 4 188 ? 13.689 46.898  41.410  1.00 79.29  ? 188  THR B C     1 
ATOM   7029  O  O     . THR H 4 188 ? 13.167 47.867  40.845  1.00 79.87  ? 188  THR B O     1 
ATOM   7030  C  CB    . THR H 4 188 ? 14.608 47.165  43.697  1.00 77.07  ? 188  THR B CB    1 
ATOM   7031  O  OG1   . THR H 4 188 ? 13.394 47.916  43.860  1.00 76.06  ? 188  THR B OG1   1 
ATOM   7032  C  CG2   . THR H 4 188 ? 15.735 47.834  44.464  1.00 77.60  ? 188  THR B CG2   1 
ATOM   7033  N  N     . ASP H 4 189 ? 13.179 45.673  41.382  1.00 80.72  ? 189  ASP B N     1 
ATOM   7034  C  CA    . ASP H 4 189 ? 11.954 45.377  40.661  1.00 81.76  ? 189  ASP B CA    1 
ATOM   7035  C  C     . ASP H 4 189 ? 10.777 46.163  41.243  1.00 80.97  ? 189  ASP B C     1 
ATOM   7036  O  O     . ASP H 4 189 ? 9.822  46.504  40.538  1.00 80.97  ? 189  ASP B O     1 
ATOM   7037  C  CB    . ASP H 4 189 ? 11.728 43.871  40.704  1.00 84.68  ? 189  ASP B CB    1 
ATOM   7038  C  CG    . ASP H 4 189 ? 12.861 43.105  40.017  1.00 88.64  ? 189  ASP B CG    1 
ATOM   7039  O  OD1   . ASP H 4 189 ? 12.898 43.102  38.759  1.00 89.64  ? 189  ASP B OD1   1 
ATOM   7040  O  OD2   . ASP H 4 189 ? 13.728 42.529  40.728  1.00 91.43  ? 189  ASP B OD2   1 
ATOM   7041  N  N     . GLY H 4 190 ? 10.858 46.463  42.533  1.00 79.67  ? 190  GLY B N     1 
ATOM   7042  C  CA    . GLY H 4 190 ? 9.810  47.241  43.160  1.00 77.62  ? 190  GLY B CA    1 
ATOM   7043  C  C     . GLY H 4 190 ? 9.911  48.631  42.574  1.00 75.83  ? 190  GLY B C     1 
ATOM   7044  O  O     . GLY H 4 190 ? 8.947  49.401  42.587  1.00 76.28  ? 190  GLY B O     1 
ATOM   7045  N  N     . GLY H 4 191 ? 11.100 48.942  42.058  1.00 73.22  ? 191  GLY B N     1 
ATOM   7046  C  CA    . GLY H 4 191 ? 11.343 50.235  41.443  1.00 70.33  ? 191  GLY B CA    1 
ATOM   7047  C  C     . GLY H 4 191 ? 11.841 51.300  42.397  1.00 67.76  ? 191  GLY B C     1 
ATOM   7048  O  O     . GLY H 4 191 ? 11.180 52.326  42.585  1.00 67.41  ? 191  GLY B O     1 
ATOM   7049  N  N     . ARG H 4 192 ? 13.004 51.046  42.998  1.00 65.25  ? 192  ARG B N     1 
ATOM   7050  C  CA    . ARG H 4 192 ? 13.641 51.965  43.942  1.00 62.47  ? 192  ARG B CA    1 
ATOM   7051  C  C     . ARG H 4 192 ? 15.092 52.122  43.528  1.00 60.80  ? 192  ARG B C     1 
ATOM   7052  O  O     . ARG H 4 192 ? 15.823 51.142  43.470  1.00 60.30  ? 192  ARG B O     1 
ATOM   7053  C  CB    . ARG H 4 192 ? 13.604 51.395  45.358  1.00 61.25  ? 192  ARG B CB    1 
ATOM   7054  C  CG    . ARG H 4 192 ? 12.226 51.123  45.897  1.00 60.69  ? 192  ARG B CG    1 
ATOM   7055  C  CD    . ARG H 4 192 ? 12.243 49.849  46.701  1.00 61.27  ? 192  ARG B CD    1 
ATOM   7056  N  NE    . ARG H 4 192 ? 10.911 49.444  47.127  1.00 61.43  ? 192  ARG B NE    1 
ATOM   7057  C  CZ    . ARG H 4 192 ? 10.215 50.081  48.054  1.00 61.85  ? 192  ARG B CZ    1 
ATOM   7058  N  NH1   . ARG H 4 192 ? 10.735 51.146  48.645  1.00 62.48  ? 192  ARG B NH1   1 
ATOM   7059  N  NH2   . ARG H 4 192 ? 9.006  49.656  48.385  1.00 62.25  ? 192  ARG B NH2   1 
ATOM   7060  N  N     . MET H 4 193 ? 15.526 53.339  43.235  1.00 59.21  ? 193  MET B N     1 
ATOM   7061  C  CA    . MET H 4 193 ? 16.909 53.493  42.844  1.00 57.73  ? 193  MET B CA    1 
ATOM   7062  C  C     . MET H 4 193 ? 17.756 52.799  43.889  1.00 56.15  ? 193  MET B C     1 
ATOM   7063  O  O     . MET H 4 193 ? 17.322 52.578  45.019  1.00 55.57  ? 193  MET B O     1 
ATOM   7064  C  CB    . MET H 4 193 ? 17.280 54.960  42.715  1.00 59.31  ? 193  MET B CB    1 
ATOM   7065  C  CG    . MET H 4 193 ? 16.783 55.551  41.426  1.00 61.36  ? 193  MET B CG    1 
ATOM   7066  S  SD    . MET H 4 193 ? 17.008 57.323  41.320  1.00 64.85  ? 193  MET B SD    1 
ATOM   7067  C  CE    . MET H 4 193 ? 18.725 57.424  40.913  1.00 63.76  ? 193  MET B CE    1 
ATOM   7068  N  N     . LEU H 4 194 ? 18.975 52.458  43.509  1.00 54.12  ? 194  LEU B N     1 
ATOM   7069  C  CA    . LEU H 4 194 ? 19.842 51.736  44.400  1.00 51.49  ? 194  LEU B CA    1 
ATOM   7070  C  C     . LEU H 4 194 ? 21.291 52.051  44.072  1.00 49.95  ? 194  LEU B C     1 
ATOM   7071  O  O     . LEU H 4 194 ? 21.972 51.270  43.433  1.00 49.19  ? 194  LEU B O     1 
ATOM   7072  C  CB    . LEU H 4 194 ? 19.511 50.275  44.200  1.00 51.69  ? 194  LEU B CB    1 
ATOM   7073  C  CG    . LEU H 4 194 ? 20.143 49.106  44.919  1.00 52.62  ? 194  LEU B CG    1 
ATOM   7074  C  CD1   . LEU H 4 194 ? 20.369 49.410  46.392  1.00 53.94  ? 194  LEU B CD1   1 
ATOM   7075  C  CD2   . LEU H 4 194 ? 19.199 47.922  44.718  1.00 51.49  ? 194  LEU B CD2   1 
ATOM   7076  N  N     . ILE H 4 195 ? 21.741 53.221  44.515  1.00 49.04  ? 195  ILE B N     1 
ATOM   7077  C  CA    . ILE H 4 195 ? 23.101 53.720  44.303  1.00 48.51  ? 195  ILE B CA    1 
ATOM   7078  C  C     . ILE H 4 195 ? 24.181 52.712  44.666  1.00 49.94  ? 195  ILE B C     1 
ATOM   7079  O  O     . ILE H 4 195 ? 23.953 51.814  45.440  1.00 51.61  ? 195  ILE B O     1 
ATOM   7080  C  CB    . ILE H 4 195 ? 23.325 54.941  45.158  1.00 47.16  ? 195  ILE B CB    1 
ATOM   7081  C  CG1   . ILE H 4 195 ? 22.254 55.976  44.844  1.00 47.07  ? 195  ILE B CG1   1 
ATOM   7082  C  CG2   . ILE H 4 195 ? 24.697 55.475  44.942  1.00 46.68  ? 195  ILE B CG2   1 
ATOM   7083  C  CD1   . ILE H 4 195 ? 22.245 57.163  45.781  1.00 48.07  ? 195  ILE B CD1   1 
ATOM   7084  N  N     . HIS H 4 196 ? 25.367 52.847  44.113  1.00 50.74  ? 196  HIS B N     1 
ATOM   7085  C  CA    . HIS H 4 196 ? 26.404 51.915  44.470  1.00 52.05  ? 196  HIS B CA    1 
ATOM   7086  C  C     . HIS H 4 196 ? 27.672 52.650  44.825  1.00 52.85  ? 196  HIS B C     1 
ATOM   7087  O  O     . HIS H 4 196 ? 28.258 53.349  43.997  1.00 53.29  ? 196  HIS B O     1 
ATOM   7088  C  CB    . HIS H 4 196 ? 26.658 50.955  43.339  1.00 53.17  ? 196  HIS B CB    1 
ATOM   7089  C  CG    . HIS H 4 196 ? 27.905 50.144  43.510  1.00 57.56  ? 196  HIS B CG    1 
ATOM   7090  N  ND1   . HIS H 4 196 ? 29.142 50.578  43.077  1.00 59.34  ? 196  HIS B ND1   1 
ATOM   7091  C  CD2   . HIS H 4 196 ? 28.105 48.911  44.040  1.00 59.38  ? 196  HIS B CD2   1 
ATOM   7092  C  CE1   . HIS H 4 196 ? 30.048 49.646  43.326  1.00 60.26  ? 196  HIS B CE1   1 
ATOM   7093  N  NE2   . HIS H 4 196 ? 29.445 48.624  43.910  1.00 60.87  ? 196  HIS B NE2   1 
ATOM   7094  N  N     . ILE H 4 197 ? 28.097 52.496  46.073  1.00 53.03  ? 197  ILE B N     1 
ATOM   7095  C  CA    . ILE H 4 197 ? 29.295 53.160  46.540  1.00 52.96  ? 197  ILE B CA    1 
ATOM   7096  C  C     . ILE H 4 197 ? 30.428 52.153  46.556  1.00 53.62  ? 197  ILE B C     1 
ATOM   7097  O  O     . ILE H 4 197 ? 30.184 50.961  46.690  1.00 52.56  ? 197  ILE B O     1 
ATOM   7098  C  CB    . ILE H 4 197 ? 29.090 53.713  47.947  1.00 52.42  ? 197  ILE B CB    1 
ATOM   7099  C  CG1   . ILE H 4 197 ? 27.636 54.157  48.138  1.00 51.58  ? 197  ILE B CG1   1 
ATOM   7100  C  CG2   . ILE H 4 197 ? 30.033 54.869  48.183  1.00 53.70  ? 197  ILE B CG2   1 
ATOM   7101  C  CD1   . ILE H 4 197 ? 27.127 55.108  47.116  1.00 49.34  ? 197  ILE B CD1   1 
ATOM   7102  N  N     . GLY H 4 198 ? 31.661 52.637  46.413  1.00 55.28  ? 198  GLY B N     1 
ATOM   7103  C  CA    . GLY H 4 198 ? 32.827 51.760  46.402  1.00 57.55  ? 198  GLY B CA    1 
ATOM   7104  C  C     . GLY H 4 198 ? 34.016 52.239  47.230  1.00 59.39  ? 198  GLY B C     1 
ATOM   7105  O  O     . GLY H 4 198 ? 34.873 51.449  47.632  1.00 59.01  ? 198  GLY B O     1 
ATOM   7106  N  N     . ARG H 4 199 ? 34.083 53.539  47.483  1.00 61.93  ? 199  ARG B N     1 
ATOM   7107  C  CA    . ARG H 4 199 ? 35.167 54.079  48.282  1.00 64.68  ? 199  ARG B CA    1 
ATOM   7108  C  C     . ARG H 4 199 ? 34.582 55.015  49.312  1.00 65.11  ? 199  ARG B C     1 
ATOM   7109  O  O     . ARG H 4 199 ? 33.859 55.948  48.980  1.00 64.41  ? 199  ARG B O     1 
ATOM   7110  C  CB    . ARG H 4 199 ? 36.164 54.830  47.405  1.00 67.35  ? 199  ARG B CB    1 
ATOM   7111  C  CG    . ARG H 4 199 ? 37.554 54.955  48.012  1.00 71.15  ? 199  ARG B CG    1 
ATOM   7112  C  CD    . ARG H 4 199 ? 38.539 55.561  47.015  1.00 73.62  ? 199  ARG B CD    1 
ATOM   7113  N  NE    . ARG H 4 199 ? 38.374 57.002  46.908  1.00 76.36  ? 199  ARG B NE    1 
ATOM   7114  C  CZ    . ARG H 4 199 ? 38.792 57.858  47.833  1.00 77.92  ? 199  ARG B CZ    1 
ATOM   7115  N  NH1   . ARG H 4 199 ? 39.403 57.403  48.923  1.00 78.50  ? 199  ARG B NH1   1 
ATOM   7116  N  NH2   . ARG H 4 199 ? 38.585 59.161  47.678  1.00 78.28  ? 199  ARG B NH2   1 
ATOM   7117  N  N     . THR H 4 200 ? 34.878 54.734  50.572  1.00 66.38  ? 200  THR B N     1 
ATOM   7118  C  CA    . THR H 4 200 ? 34.395 55.547  51.669  1.00 68.22  ? 200  THR B CA    1 
ATOM   7119  C  C     . THR H 4 200 ? 35.577 55.765  52.579  1.00 68.60  ? 200  THR B C     1 
ATOM   7120  O  O     . THR H 4 200 ? 36.675 55.294  52.300  1.00 69.43  ? 200  THR B O     1 
ATOM   7121  C  CB    . THR H 4 200 ? 33.335 54.844  52.498  1.00 68.91  ? 200  THR B CB    1 
ATOM   7122  O  OG1   . THR H 4 200 ? 33.981 53.925  53.375  1.00 69.80  ? 200  THR B OG1   1 
ATOM   7123  C  CG2   . THR H 4 200 ? 32.374 54.088  51.622  1.00 70.36  ? 200  THR B CG2   1 
ATOM   7124  N  N     . LYS H 4 201 ? 35.334 56.465  53.675  1.00 68.52  ? 201  LYS B N     1 
ATOM   7125  C  CA    . LYS H 4 201 ? 36.366 56.774  54.639  1.00 68.37  ? 201  LYS B CA    1 
ATOM   7126  C  C     . LYS H 4 201 ? 36.914 55.538  55.320  1.00 69.18  ? 201  LYS B C     1 
ATOM   7127  O  O     . LYS H 4 201 ? 38.100 55.484  55.644  1.00 69.27  ? 201  LYS B O     1 
ATOM   7128  C  CB    . LYS H 4 201 ? 35.799 57.734  55.686  1.00 67.36  ? 201  LYS B CB    1 
ATOM   7129  C  CG    . LYS H 4 201 ? 36.613 57.881  56.969  1.00 66.56  ? 201  LYS B CG    1 
ATOM   7130  C  CD    . LYS H 4 201 ? 35.896 58.795  57.970  1.00 66.10  ? 201  LYS B CD    1 
ATOM   7131  C  CE    . LYS H 4 201 ? 36.405 58.619  59.398  1.00 65.84  ? 201  LYS B CE    1 
ATOM   7132  N  NZ    . LYS H 4 201 ? 37.879 58.427  59.452  1.00 64.86  ? 201  LYS B NZ    1 
ATOM   7133  N  N     . THR H 4 202 ? 36.060 54.538  55.522  1.00 70.29  ? 202  THR B N     1 
ATOM   7134  C  CA    . THR H 4 202 ? 36.470 53.324  56.222  1.00 71.82  ? 202  THR B CA    1 
ATOM   7135  C  C     . THR H 4 202 ? 36.945 52.126  55.417  1.00 72.85  ? 202  THR B C     1 
ATOM   7136  O  O     . THR H 4 202 ? 37.787 51.383  55.903  1.00 72.85  ? 202  THR B O     1 
ATOM   7137  C  CB    . THR H 4 202 ? 35.367 52.845  57.199  1.00 72.34  ? 202  THR B CB    1 
ATOM   7138  O  OG1   . THR H 4 202 ? 34.088 52.913  56.562  1.00 73.03  ? 202  THR B OG1   1 
ATOM   7139  C  CG2   . THR H 4 202 ? 35.347 53.711  58.454  1.00 72.42  ? 202  THR B CG2   1 
ATOM   7140  N  N     . LEU H 4 203 ? 36.428 51.925  54.205  1.00 75.21  ? 203  LEU B N     1 
ATOM   7141  C  CA    . LEU H 4 203 ? 36.848 50.781  53.380  1.00 76.92  ? 203  LEU B CA    1 
ATOM   7142  C  C     . LEU H 4 203 ? 36.976 51.089  51.895  1.00 77.81  ? 203  LEU B C     1 
ATOM   7143  O  O     . LEU H 4 203 ? 36.294 51.964  51.366  1.00 78.27  ? 203  LEU B O     1 
ATOM   7144  C  CB    . LEU H 4 203 ? 35.887 49.594  53.552  1.00 77.21  ? 203  LEU B CB    1 
ATOM   7145  C  CG    . LEU H 4 203 ? 34.681 49.404  52.623  1.00 77.01  ? 203  LEU B CG    1 
ATOM   7146  C  CD1   . LEU H 4 203 ? 34.046 48.068  52.940  1.00 77.00  ? 203  LEU B CD1   1 
ATOM   7147  C  CD2   . LEU H 4 203 ? 33.666 50.518  52.789  1.00 77.34  ? 203  LEU B CD2   1 
ATOM   7148  N  N     . VAL H 4 204 ? 37.853 50.346  51.227  1.00 79.21  ? 204  VAL B N     1 
ATOM   7149  C  CA    . VAL H 4 204 ? 38.093 50.520  49.800  1.00 79.92  ? 204  VAL B CA    1 
ATOM   7150  C  C     . VAL H 4 204 ? 38.276 49.154  49.135  1.00 80.73  ? 204  VAL B C     1 
ATOM   7151  O  O     . VAL H 4 204 ? 39.236 48.435  49.427  1.00 81.26  ? 204  VAL B O     1 
ATOM   7152  C  CB    . VAL H 4 204 ? 39.343 51.402  49.565  1.00 79.42  ? 204  VAL B CB    1 
ATOM   7153  C  CG1   . VAL H 4 204 ? 40.584 50.734  50.130  1.00 79.37  ? 204  VAL B CG1   1 
ATOM   7154  C  CG2   . VAL H 4 204 ? 39.499 51.681  48.113  1.00 78.31  ? 204  VAL B CG2   1 
ATOM   7155  N  N     . SER H 4 205 ? 37.343 48.796  48.251  1.00 81.13  ? 205  SER B N     1 
ATOM   7156  C  CA    . SER H 4 205 ? 37.391 47.508  47.566  1.00 81.45  ? 205  SER B CA    1 
ATOM   7157  C  C     . SER H 4 205 ? 36.479 47.468  46.365  1.00 81.20  ? 205  SER B C     1 
ATOM   7158  O  O     . SER H 4 205 ? 35.638 48.340  46.181  1.00 80.68  ? 205  SER B O     1 
ATOM   7159  C  CB    . SER H 4 205 ? 36.932 46.391  48.489  1.00 82.57  ? 205  SER B CB    1 
ATOM   7160  O  OG    . SER H 4 205 ? 35.522 46.237  48.379  1.00 82.95  ? 205  SER B OG    1 
ATOM   7161  N  N     . THR H 4 206 ? 36.629 46.406  45.582  1.00 81.49  ? 206  THR B N     1 
ATOM   7162  C  CA    . THR H 4 206 ? 35.827 46.185  44.385  1.00 82.25  ? 206  THR B CA    1 
ATOM   7163  C  C     . THR H 4 206 ? 34.419 45.668  44.691  1.00 82.40  ? 206  THR B C     1 
ATOM   7164  O  O     . THR H 4 206 ? 33.519 45.787  43.861  1.00 82.63  ? 206  THR B O     1 
ATOM   7165  C  CB    . THR H 4 206 ? 36.502 45.180  43.453  1.00 82.37  ? 206  THR B CB    1 
ATOM   7166  O  OG1   . THR H 4 206 ? 37.629 44.607  44.119  1.00 82.86  ? 206  THR B OG1   1 
ATOM   7167  C  CG2   . THR H 4 206 ? 36.952 45.857  42.181  1.00 83.21  ? 206  THR B CG2   1 
ATOM   7168  N  N     . ALA H 4 207 ? 34.221 45.089  45.871  1.00 82.05  ? 207  ALA B N     1 
ATOM   7169  C  CA    . ALA H 4 207 ? 32.899 44.585  46.230  1.00 81.59  ? 207  ALA B CA    1 
ATOM   7170  C  C     . ALA H 4 207 ? 31.921 45.743  46.447  1.00 80.65  ? 207  ALA B C     1 
ATOM   7171  O  O     . ALA H 4 207 ? 30.888 45.813  45.788  1.00 81.40  ? 207  ALA B O     1 
ATOM   7172  C  CB    . ALA H 4 207 ? 32.980 43.722  47.486  1.00 82.91  ? 207  ALA B CB    1 
ATOM   7173  N  N     . GLY H 4 208 ? 32.246 46.648  47.369  1.00 78.80  ? 208  GLY B N     1 
ATOM   7174  C  CA    . GLY H 4 208 ? 31.373 47.782  47.630  1.00 75.81  ? 208  GLY B CA    1 
ATOM   7175  C  C     . GLY H 4 208 ? 30.000 47.432  48.176  1.00 73.67  ? 208  GLY B C     1 
ATOM   7176  O  O     . GLY H 4 208 ? 29.598 46.271  48.188  1.00 72.95  ? 208  GLY B O     1 
ATOM   7177  N  N     . VAL H 4 209 ? 29.275 48.447  48.628  1.00 72.41  ? 209  VAL B N     1 
ATOM   7178  C  CA    . VAL H 4 209 ? 27.945 48.252  49.184  1.00 70.89  ? 209  VAL B CA    1 
ATOM   7179  C  C     . VAL H 4 209 ? 26.903 48.938  48.306  1.00 69.96  ? 209  VAL B C     1 
ATOM   7180  O  O     . VAL H 4 209 ? 27.257 49.789  47.496  1.00 69.95  ? 209  VAL B O     1 
ATOM   7181  C  CB    . VAL H 4 209 ? 27.884 48.826  50.591  1.00 71.17  ? 209  VAL B CB    1 
ATOM   7182  C  CG1   . VAL H 4 209 ? 28.361 50.263  50.577  1.00 70.57  ? 209  VAL B CG1   1 
ATOM   7183  C  CG2   . VAL H 4 209 ? 26.470 48.709  51.135  1.00 72.59  ? 209  VAL B CG2   1 
ATOM   7184  N  N     . GLU H 4 210 ? 25.628 48.576  48.460  1.00 68.36  ? 210  GLU B N     1 
ATOM   7185  C  CA    . GLU H 4 210 ? 24.570 49.171  47.644  1.00 67.61  ? 210  GLU B CA    1 
ATOM   7186  C  C     . GLU H 4 210 ? 23.436 49.853  48.400  1.00 65.66  ? 210  GLU B C     1 
ATOM   7187  O  O     . GLU H 4 210 ? 22.452 49.216  48.751  1.00 65.94  ? 210  GLU B O     1 
ATOM   7188  C  CB    . GLU H 4 210 ? 23.949 48.121  46.723  1.00 70.34  ? 210  GLU B CB    1 
ATOM   7189  C  CG    . GLU H 4 210 ? 24.911 47.517  45.716  1.00 75.65  ? 210  GLU B CG    1 
ATOM   7190  C  CD    . GLU H 4 210 ? 24.454 47.690  44.268  1.00 79.19  ? 210  GLU B CD    1 
ATOM   7191  O  OE1   . GLU H 4 210 ? 25.095 47.101  43.359  1.00 80.76  ? 210  GLU B OE1   1 
ATOM   7192  O  OE2   . GLU H 4 210 ? 23.459 48.421  44.040  1.00 80.53  ? 210  GLU B OE2   1 
ATOM   7193  N  N     . LYS H 4 211 ? 23.553 51.158  48.615  1.00 63.14  ? 211  LYS B N     1 
ATOM   7194  C  CA    . LYS H 4 211 ? 22.524 51.920  49.313  1.00 60.89  ? 211  LYS B CA    1 
ATOM   7195  C  C     . LYS H 4 211 ? 21.234 52.112  48.485  1.00 59.71  ? 211  LYS B C     1 
ATOM   7196  O  O     . LYS H 4 211 ? 21.259 52.740  47.428  1.00 60.03  ? 211  LYS B O     1 
ATOM   7197  C  CB    . LYS H 4 211 ? 23.105 53.277  49.723  1.00 60.17  ? 211  LYS B CB    1 
ATOM   7198  C  CG    . LYS H 4 211 ? 24.046 53.225  50.924  1.00 60.14  ? 211  LYS B CG    1 
ATOM   7199  C  CD    . LYS H 4 211 ? 23.297 52.735  52.184  1.00 60.95  ? 211  LYS B CD    1 
ATOM   7200  C  CE    . LYS H 4 211 ? 24.059 52.960  53.498  1.00 60.29  ? 211  LYS B CE    1 
ATOM   7201  N  NZ    . LYS H 4 211 ? 25.340 52.208  53.595  1.00 61.21  ? 211  LYS B NZ    1 
ATOM   7202  N  N     . ALA H 4 212 ? 20.107 51.577  48.960  1.00 58.28  ? 212  ALA B N     1 
ATOM   7203  C  CA    . ALA H 4 212 ? 18.839 51.714  48.236  1.00 56.64  ? 212  ALA B CA    1 
ATOM   7204  C  C     . ALA H 4 212 ? 18.001 52.867  48.769  1.00 55.77  ? 212  ALA B C     1 
ATOM   7205  O  O     . ALA H 4 212 ? 17.860 53.003  49.977  1.00 55.80  ? 212  ALA B O     1 
ATOM   7206  C  CB    . ALA H 4 212 ? 18.056 50.441  48.338  1.00 55.79  ? 212  ALA B CB    1 
ATOM   7207  N  N     . LEU H 4 213 ? 17.440 53.686  47.869  1.00 55.40  ? 213  LEU B N     1 
ATOM   7208  C  CA    . LEU H 4 213 ? 16.601 54.839  48.256  1.00 53.99  ? 213  LEU B CA    1 
ATOM   7209  C  C     . LEU H 4 213 ? 15.113 54.495  48.391  1.00 54.04  ? 213  LEU B C     1 
ATOM   7210  O  O     . LEU H 4 213 ? 14.632 53.537  47.799  1.00 53.66  ? 213  LEU B O     1 
ATOM   7211  C  CB    . LEU H 4 213 ? 16.722 55.965  47.238  1.00 51.75  ? 213  LEU B CB    1 
ATOM   7212  C  CG    . LEU H 4 213 ? 18.085 56.419  46.756  1.00 51.28  ? 213  LEU B CG    1 
ATOM   7213  C  CD1   . LEU H 4 213 ? 17.912 57.692  45.975  1.00 51.75  ? 213  LEU B CD1   1 
ATOM   7214  C  CD2   . LEU H 4 213 ? 18.992 56.660  47.906  1.00 51.74  ? 213  LEU B CD2   1 
ATOM   7215  N  N     . SER H 4 214 ? 14.379 55.292  49.161  1.00 54.75  ? 214  SER B N     1 
ATOM   7216  C  CA    . SER H 4 214 ? 12.949 55.054  49.356  1.00 56.26  ? 214  SER B CA    1 
ATOM   7217  C  C     . SER H 4 214 ? 12.237 55.146  48.015  1.00 57.14  ? 214  SER B C     1 
ATOM   7218  O  O     . SER H 4 214 ? 12.887 55.288  46.983  1.00 57.84  ? 214  SER B O     1 
ATOM   7219  C  CB    . SER H 4 214 ? 12.363 56.108  50.303  1.00 57.27  ? 214  SER B CB    1 
ATOM   7220  O  OG    . SER H 4 214 ? 12.115 57.354  49.652  1.00 58.79  ? 214  SER B OG    1 
ATOM   7221  N  N     . LEU H 4 215 ? 10.909 55.046  48.019  1.00 57.67  ? 215  LEU B N     1 
ATOM   7222  C  CA    . LEU H 4 215 ? 10.153 55.195  46.772  1.00 57.62  ? 215  LEU B CA    1 
ATOM   7223  C  C     . LEU H 4 215 ? 10.049 56.687  46.537  1.00 57.85  ? 215  LEU B C     1 
ATOM   7224  O  O     . LEU H 4 215 ? 10.536 57.204  45.527  1.00 58.52  ? 215  LEU B O     1 
ATOM   7225  C  CB    . LEU H 4 215 ? 8.735  54.634  46.875  1.00 57.15  ? 215  LEU B CB    1 
ATOM   7226  C  CG    . LEU H 4 215 ? 8.462  53.211  46.399  1.00 56.40  ? 215  LEU B CG    1 
ATOM   7227  C  CD1   . LEU H 4 215 ? 7.017  52.896  46.703  1.00 56.00  ? 215  LEU B CD1   1 
ATOM   7228  C  CD2   . LEU H 4 215 ? 8.753  53.065  44.914  1.00 55.95  ? 215  LEU B CD2   1 
ATOM   7229  N  N     . GLY H 4 216 ? 9.425  57.379  47.486  1.00 57.69  ? 216  GLY B N     1 
ATOM   7230  C  CA    . GLY H 4 216 ? 9.270  58.815  47.349  1.00 58.88  ? 216  GLY B CA    1 
ATOM   7231  C  C     . GLY H 4 216 ? 10.531 59.609  47.000  1.00 59.04  ? 216  GLY B C     1 
ATOM   7232  O  O     . GLY H 4 216 ? 10.442 60.641  46.322  1.00 58.73  ? 216  GLY B O     1 
ATOM   7233  N  N     . VAL H 4 217 ? 11.696 59.138  47.455  1.00 58.69  ? 217  VAL B N     1 
ATOM   7234  C  CA    . VAL H 4 217 ? 12.964 59.829  47.224  1.00 58.24  ? 217  VAL B CA    1 
ATOM   7235  C  C     . VAL H 4 217 ? 13.627 59.396  45.931  1.00 58.18  ? 217  VAL B C     1 
ATOM   7236  O  O     . VAL H 4 217 ? 14.393 60.148  45.338  1.00 57.80  ? 217  VAL B O     1 
ATOM   7237  C  CB    . VAL H 4 217 ? 13.944 59.596  48.419  1.00 57.83  ? 217  VAL B CB    1 
ATOM   7238  C  CG1   . VAL H 4 217 ? 15.231 60.405  48.241  1.00 56.73  ? 217  VAL B CG1   1 
ATOM   7239  C  CG2   . VAL H 4 217 ? 13.261 59.975  49.721  1.00 58.23  ? 217  VAL B CG2   1 
ATOM   7240  N  N     . THR H 4 218 ? 13.335 58.183  45.488  1.00 58.90  ? 218  THR B N     1 
ATOM   7241  C  CA    . THR H 4 218 ? 13.933 57.697  44.257  1.00 60.10  ? 218  THR B CA    1 
ATOM   7242  C  C     . THR H 4 218 ? 13.282 58.478  43.122  1.00 62.20  ? 218  THR B C     1 
ATOM   7243  O  O     . THR H 4 218 ? 13.804 58.562  42.021  1.00 62.33  ? 218  THR B O     1 
ATOM   7244  C  CB    . THR H 4 218 ? 13.686 56.191  44.084  1.00 58.48  ? 218  THR B CB    1 
ATOM   7245  O  OG1   . THR H 4 218 ? 14.471 55.695  42.999  1.00 56.91  ? 218  THR B OG1   1 
ATOM   7246  C  CG2   . THR H 4 218 ? 12.236 55.931  43.802  1.00 58.17  ? 218  THR B CG2   1 
ATOM   7247  N  N     . LYS H 4 219 ? 12.138 59.071  43.436  1.00 65.34  ? 219  LYS B N     1 
ATOM   7248  C  CA    . LYS H 4 219 ? 11.334 59.873  42.510  1.00 68.18  ? 219  LYS B CA    1 
ATOM   7249  C  C     . LYS H 4 219 ? 11.928 61.285  42.311  1.00 69.10  ? 219  LYS B C     1 
ATOM   7250  O  O     . LYS H 4 219 ? 11.980 61.801  41.186  1.00 70.03  ? 219  LYS B O     1 
ATOM   7251  C  CB    . LYS H 4 219 ? 9.904  59.931  43.074  1.00 69.45  ? 219  LYS B CB    1 
ATOM   7252  C  CG    . LYS H 4 219 ? 8.913  60.853  42.420  1.00 72.02  ? 219  LYS B CG    1 
ATOM   7253  C  CD    . LYS H 4 219 ? 7.563  60.654  43.121  1.00 74.86  ? 219  LYS B CD    1 
ATOM   7254  C  CE    . LYS H 4 219 ? 6.463  61.624  42.649  1.00 76.94  ? 219  LYS B CE    1 
ATOM   7255  N  NZ    . LYS H 4 219 ? 6.063  61.495  41.196  1.00 78.01  ? 219  LYS B NZ    1 
ATOM   7256  N  N     . LEU H 4 220 ? 12.391 61.897  43.401  1.00 68.61  ? 220  LEU B N     1 
ATOM   7257  C  CA    . LEU H 4 220 ? 12.987 63.228  43.342  1.00 67.41  ? 220  LEU B CA    1 
ATOM   7258  C  C     . LEU H 4 220 ? 14.334 63.173  42.649  1.00 66.60  ? 220  LEU B C     1 
ATOM   7259  O  O     . LEU H 4 220 ? 14.950 64.207  42.433  1.00 66.16  ? 220  LEU B O     1 
ATOM   7260  C  CB    . LEU H 4 220 ? 13.216 63.788  44.739  1.00 67.60  ? 220  LEU B CB    1 
ATOM   7261  C  CG    . LEU H 4 220 ? 12.094 63.762  45.762  1.00 67.75  ? 220  LEU B CG    1 
ATOM   7262  C  CD1   . LEU H 4 220 ? 12.646 64.282  47.060  1.00 67.41  ? 220  LEU B CD1   1 
ATOM   7263  C  CD2   . LEU H 4 220 ? 10.921 64.613  45.297  1.00 69.05  ? 220  LEU B CD2   1 
ATOM   7264  N  N     . VAL H 4 221 ? 14.809 61.969  42.346  1.00 66.45  ? 221  VAL B N     1 
ATOM   7265  C  CA    . VAL H 4 221 ? 16.092 61.804  41.673  1.00 66.57  ? 221  VAL B CA    1 
ATOM   7266  C  C     . VAL H 4 221 ? 15.759 61.583  40.215  1.00 67.86  ? 221  VAL B C     1 
ATOM   7267  O  O     . VAL H 4 221 ? 16.355 62.198  39.337  1.00 67.40  ? 221  VAL B O     1 
ATOM   7268  C  CB    . VAL H 4 221 ? 16.885 60.581  42.223  1.00 65.78  ? 221  VAL B CB    1 
ATOM   7269  C  CG1   . VAL H 4 221 ? 18.283 60.544  41.637  1.00 63.92  ? 221  VAL B CG1   1 
ATOM   7270  C  CG2   . VAL H 4 221 ? 16.963 60.653  43.737  1.00 65.95  ? 221  VAL B CG2   1 
ATOM   7271  N  N     . GLU H 4 222 ? 14.787 60.710  39.962  1.00 70.08  ? 222  GLU B N     1 
ATOM   7272  C  CA    . GLU H 4 222 ? 14.370 60.434  38.595  1.00 72.48  ? 222  GLU B CA    1 
ATOM   7273  C  C     . GLU H 4 222 ? 14.027 61.768  37.973  1.00 72.58  ? 222  GLU B C     1 
ATOM   7274  O  O     . GLU H 4 222 ? 13.988 61.887  36.750  1.00 74.53  ? 222  GLU B O     1 
ATOM   7275  C  CB    . GLU H 4 222 ? 13.135 59.518  38.530  1.00 74.37  ? 222  GLU B CB    1 
ATOM   7276  C  CG    . GLU H 4 222 ? 13.424 58.011  38.635  1.00 77.34  ? 222  GLU B CG    1 
ATOM   7277  C  CD    . GLU H 4 222 ? 12.199 57.117  38.328  1.00 78.82  ? 222  GLU B CD    1 
ATOM   7278  O  OE1   . GLU H 4 222 ? 11.083 57.376  38.867  1.00 78.69  ? 222  GLU B OE1   1 
ATOM   7279  O  OE2   . GLU H 4 222 ? 12.371 56.142  37.550  1.00 78.87  ? 222  GLU B OE2   1 
ATOM   7280  N  N     . ARG H 4 223 ? 13.765 62.770  38.810  1.00 70.90  ? 223  ARG B N     1 
ATOM   7281  C  CA    . ARG H 4 223 ? 13.463 64.092  38.291  1.00 69.22  ? 223  ARG B CA    1 
ATOM   7282  C  C     . ARG H 4 223 ? 14.734 64.823  37.864  1.00 67.89  ? 223  ARG B C     1 
ATOM   7283  O  O     . ARG H 4 223 ? 15.009 64.917  36.678  1.00 68.44  ? 223  ARG B O     1 
ATOM   7284  C  CB    . ARG H 4 223 ? 12.721 64.912  39.319  1.00 69.93  ? 223  ARG B CB    1 
ATOM   7285  C  CG    . ARG H 4 223 ? 12.472 66.327  38.874  1.00 72.05  ? 223  ARG B CG    1 
ATOM   7286  C  CD    . ARG H 4 223 ? 11.153 66.792  39.442  1.00 75.60  ? 223  ARG B CD    1 
ATOM   7287  N  NE    . ARG H 4 223 ? 10.854 68.176  39.108  1.00 79.81  ? 223  ARG B NE    1 
ATOM   7288  C  CZ    . ARG H 4 223 ? 9.748  68.797  39.501  1.00 82.17  ? 223  ARG B CZ    1 
ATOM   7289  N  NH1   . ARG H 4 223 ? 8.850  68.140  40.235  1.00 82.93  ? 223  ARG B NH1   1 
ATOM   7290  N  NH2   . ARG H 4 223 ? 9.545  70.069  39.173  1.00 82.70  ? 223  ARG B NH2   1 
ATOM   7291  N  N     . TRP H 4 224 ? 15.511 65.329  38.817  1.00 66.17  ? 224  TRP B N     1 
ATOM   7292  C  CA    . TRP H 4 224 ? 16.766 66.036  38.509  1.00 64.57  ? 224  TRP B CA    1 
ATOM   7293  C  C     . TRP H 4 224 ? 17.618 65.352  37.434  1.00 64.98  ? 224  TRP B C     1 
ATOM   7294  O  O     . TRP H 4 224 ? 18.392 66.006  36.735  1.00 64.34  ? 224  TRP B O     1 
ATOM   7295  C  CB    . TRP H 4 224 ? 17.607 66.222  39.782  1.00 61.83  ? 224  TRP B CB    1 
ATOM   7296  C  CG    . TRP H 4 224 ? 19.047 66.466  39.518  1.00 58.15  ? 224  TRP B CG    1 
ATOM   7297  C  CD1   . TRP H 4 224 ? 20.039 65.538  39.500  1.00 56.94  ? 224  TRP B CD1   1 
ATOM   7298  C  CD2   . TRP H 4 224 ? 19.653 67.713  39.174  1.00 57.95  ? 224  TRP B CD2   1 
ATOM   7299  N  NE1   . TRP H 4 224 ? 21.232 66.123  39.164  1.00 56.57  ? 224  TRP B NE1   1 
ATOM   7300  C  CE2   . TRP H 4 224 ? 21.026 67.460  38.955  1.00 57.85  ? 224  TRP B CE2   1 
ATOM   7301  C  CE3   . TRP H 4 224 ? 19.171 69.025  39.025  1.00 57.70  ? 224  TRP B CE3   1 
ATOM   7302  C  CZ2   . TRP H 4 224 ? 21.930 68.474  38.592  1.00 58.15  ? 224  TRP B CZ2   1 
ATOM   7303  C  CZ3   . TRP H 4 224 ? 20.068 70.035  38.664  1.00 57.39  ? 224  TRP B CZ3   1 
ATOM   7304  C  CH2   . TRP H 4 224 ? 21.430 69.750  38.452  1.00 57.87  ? 224  TRP B CH2   1 
ATOM   7305  N  N     . ILE H 4 225 ? 17.491 64.035  37.313  1.00 66.23  ? 225  ILE B N     1 
ATOM   7306  C  CA    . ILE H 4 225 ? 18.237 63.315  36.291  1.00 67.19  ? 225  ILE B CA    1 
ATOM   7307  C  C     . ILE H 4 225 ? 17.751 63.848  34.947  1.00 67.41  ? 225  ILE B C     1 
ATOM   7308  O  O     . ILE H 4 225 ? 18.548 64.142  34.049  1.00 67.49  ? 225  ILE B O     1 
ATOM   7309  C  CB    . ILE H 4 225 ? 17.960 61.799  36.326  1.00 66.58  ? 225  ILE B CB    1 
ATOM   7310  C  CG1   . ILE H 4 225 ? 18.553 61.174  37.574  1.00 65.81  ? 225  ILE B CG1   1 
ATOM   7311  C  CG2   . ILE H 4 225 ? 18.593 61.134  35.121  1.00 68.60  ? 225  ILE B CG2   1 
ATOM   7312  C  CD1   . ILE H 4 225 ? 18.359 59.674  37.620  1.00 64.96  ? 225  ILE B CD1   1 
ATOM   7313  N  N     . SER H 4 226 ? 16.432 63.953  34.817  1.00 67.30  ? 226  SER B N     1 
ATOM   7314  C  CA    . SER H 4 226 ? 15.832 64.456  33.596  1.00 67.42  ? 226  SER B CA    1 
ATOM   7315  C  C     . SER H 4 226 ? 16.116 65.956  33.493  1.00 67.94  ? 226  SER B C     1 
ATOM   7316  O  O     . SER H 4 226 ? 17.041 66.360  32.808  1.00 68.93  ? 226  SER B O     1 
ATOM   7317  C  CB    . SER H 4 226 ? 14.318 64.191  33.579  1.00 67.21  ? 226  SER B CB    1 
ATOM   7318  O  OG    . SER H 4 226 ? 13.586 65.166  34.307  1.00 66.93  ? 226  SER B OG    1 
ATOM   7319  N  N     . VAL H 4 227 ? 15.342 66.779  34.183  1.00 67.44  ? 227  VAL B N     1 
ATOM   7320  C  CA    . VAL H 4 227 ? 15.539 68.210  34.131  1.00 67.54  ? 227  VAL B CA    1 
ATOM   7321  C  C     . VAL H 4 227 ? 16.968 68.684  33.878  1.00 69.04  ? 227  VAL B C     1 
ATOM   7322  O  O     . VAL H 4 227 ? 17.156 69.702  33.226  1.00 70.85  ? 227  VAL B O     1 
ATOM   7323  C  CB    . VAL H 4 227 ? 15.002 68.855  35.391  1.00 66.81  ? 227  VAL B CB    1 
ATOM   7324  C  CG1   . VAL H 4 227 ? 15.372 70.323  35.421  1.00 66.58  ? 227  VAL B CG1   1 
ATOM   7325  C  CG2   . VAL H 4 227 ? 13.480 68.675  35.436  1.00 66.84  ? 227  VAL B CG2   1 
ATOM   7326  N  N     . SER H 4 228 ? 17.980 67.969  34.363  1.00 70.78  ? 228  SER B N     1 
ATOM   7327  C  CA    . SER H 4 228 ? 19.375 68.390  34.123  1.00 72.53  ? 228  SER B CA    1 
ATOM   7328  C  C     . SER H 4 228 ? 20.030 67.519  33.060  1.00 73.21  ? 228  SER B C     1 
ATOM   7329  O  O     . SER H 4 228 ? 21.007 67.912  32.423  1.00 72.39  ? 228  SER B O     1 
ATOM   7330  C  CB    . SER H 4 228 ? 20.212 68.277  35.390  1.00 73.31  ? 228  SER B CB    1 
ATOM   7331  O  OG    . SER H 4 228 ? 20.645 66.936  35.563  1.00 74.16  ? 228  SER B OG    1 
ATOM   7332  N  N     . GLY H 4 229 ? 19.496 66.313  32.910  1.00 75.09  ? 229  GLY B N     1 
ATOM   7333  C  CA    . GLY H 4 229 ? 19.997 65.379  31.920  1.00 77.35  ? 229  GLY B CA    1 
ATOM   7334  C  C     . GLY H 4 229 ? 21.484 65.163  32.020  1.00 78.66  ? 229  GLY B C     1 
ATOM   7335  O  O     . GLY H 4 229 ? 22.236 65.483  31.099  1.00 79.01  ? 229  GLY B O     1 
ATOM   7336  N  N     . VAL H 4 230 ? 21.912 64.644  33.160  1.00 79.18  ? 230  VAL B N     1 
ATOM   7337  C  CA    . VAL H 4 230 ? 23.317 64.358  33.370  1.00 79.98  ? 230  VAL B CA    1 
ATOM   7338  C  C     . VAL H 4 230 ? 23.406 62.936  32.873  1.00 80.58  ? 230  VAL B C     1 
ATOM   7339  O  O     . VAL H 4 230 ? 24.471 62.319  32.871  1.00 80.15  ? 230  VAL B O     1 
ATOM   7340  C  CB    . VAL H 4 230 ? 23.681 64.408  34.872  1.00 80.37  ? 230  VAL B CB    1 
ATOM   7341  C  CG1   . VAL H 4 230 ? 23.294 65.758  35.453  1.00 80.63  ? 230  VAL B CG1   1 
ATOM   7342  C  CG2   . VAL H 4 230 ? 22.964 63.306  35.628  1.00 80.26  ? 230  VAL B CG2   1 
ATOM   7343  N  N     . ALA H 4 231 ? 22.248 62.444  32.435  1.00 81.43  ? 231  ALA B N     1 
ATOM   7344  C  CA    . ALA H 4 231 ? 22.086 61.083  31.947  1.00 83.40  ? 231  ALA B CA    1 
ATOM   7345  C  C     . ALA H 4 231 ? 22.286 60.891  30.440  1.00 84.50  ? 231  ALA B C     1 
ATOM   7346  O  O     . ALA H 4 231 ? 21.608 60.066  29.818  1.00 84.42  ? 231  ALA B O     1 
ATOM   7347  C  CB    . ALA H 4 231 ? 20.708 60.578  32.357  1.00 83.45  ? 231  ALA B CB    1 
ATOM   7348  N  N     . ASP H 4 232 ? 23.219 61.643  29.858  1.00 86.00  ? 232  ASP B N     1 
ATOM   7349  C  CA    . ASP H 4 232 ? 23.508 61.549  28.426  1.00 86.47  ? 232  ASP B CA    1 
ATOM   7350  C  C     . ASP H 4 232 ? 24.882 60.908  28.167  1.00 85.65  ? 232  ASP B C     1 
ATOM   7351  O  O     . ASP H 4 232 ? 25.263 60.634  27.026  1.00 85.12  ? 232  ASP B O     1 
ATOM   7352  C  CB    . ASP H 4 232 ? 23.398 62.941  27.778  1.00 88.44  ? 232  ASP B CB    1 
ATOM   7353  C  CG    . ASP H 4 232 ? 21.957 63.474  27.772  1.00 89.90  ? 232  ASP B CG    1 
ATOM   7354  O  OD1   . ASP H 4 232 ? 21.058 62.783  27.235  1.00 90.62  ? 232  ASP B OD1   1 
ATOM   7355  O  OD2   . ASP H 4 232 ? 21.723 64.582  28.303  1.00 90.48  ? 232  ASP B OD2   1 
ATOM   7356  N  N     . ASP H 4 233 ? 25.610 60.672  29.252  1.00 84.71  ? 233  ASP B N     1 
ATOM   7357  C  CA    . ASP H 4 233 ? 26.909 60.014  29.215  1.00 84.05  ? 233  ASP B CA    1 
ATOM   7358  C  C     . ASP H 4 233 ? 26.992 59.266  30.542  1.00 82.77  ? 233  ASP B C     1 
ATOM   7359  O  O     . ASP H 4 233 ? 26.961 59.889  31.605  1.00 82.77  ? 233  ASP B O     1 
ATOM   7360  C  CB    . ASP H 4 233 ? 28.058 61.026  29.126  1.00 85.47  ? 233  ASP B CB    1 
ATOM   7361  C  CG    . ASP H 4 233 ? 29.431 60.346  28.958  1.00 86.61  ? 233  ASP B CG    1 
ATOM   7362  O  OD1   . ASP H 4 233 ? 29.624 59.227  29.492  1.00 86.53  ? 233  ASP B OD1   1 
ATOM   7363  O  OD2   . ASP H 4 233 ? 30.322 60.936  28.300  1.00 87.02  ? 233  ASP B OD2   1 
ATOM   7364  N  N     . PRO H 4 234 ? 27.088 57.924  30.509  1.00 81.41  ? 234  PRO B N     1 
ATOM   7365  C  CA    . PRO H 4 234 ? 27.162 57.227  31.793  1.00 79.64  ? 234  PRO B CA    1 
ATOM   7366  C  C     . PRO H 4 234 ? 28.155 57.853  32.785  1.00 77.44  ? 234  PRO B C     1 
ATOM   7367  O  O     . PRO H 4 234 ? 27.752 58.273  33.866  1.00 76.91  ? 234  PRO B O     1 
ATOM   7368  C  CB    . PRO H 4 234 ? 27.511 55.789  31.389  1.00 80.02  ? 234  PRO B CB    1 
ATOM   7369  C  CG    . PRO H 4 234 ? 28.183 55.948  30.064  1.00 80.95  ? 234  PRO B CG    1 
ATOM   7370  C  CD    . PRO H 4 234 ? 27.340 56.992  29.400  1.00 81.23  ? 234  PRO B CD    1 
ATOM   7371  N  N     . ASN H 4 235 ? 29.428 57.940  32.406  1.00 75.14  ? 235  ASN B N     1 
ATOM   7372  C  CA    . ASN H 4 235 ? 30.477 58.438  33.301  1.00 73.13  ? 235  ASN B CA    1 
ATOM   7373  C  C     . ASN H 4 235 ? 30.225 59.898  33.685  1.00 70.87  ? 235  ASN B C     1 
ATOM   7374  O  O     . ASN H 4 235 ? 31.144 60.708  33.770  1.00 70.03  ? 235  ASN B O     1 
ATOM   7375  C  CB    . ASN H 4 235 ? 31.851 58.308  32.624  1.00 76.20  ? 235  ASN B CB    1 
ATOM   7376  C  CG    . ASN H 4 235 ? 32.208 56.855  32.275  1.00 79.36  ? 235  ASN B CG    1 
ATOM   7377  O  OD1   . ASN H 4 235 ? 33.334 56.560  31.849  1.00 80.41  ? 235  ASN B OD1   1 
ATOM   7378  N  ND2   . ASN H 4 235 ? 31.247 55.948  32.448  1.00 81.83  ? 235  ASN B ND2   1 
ATOM   7379  N  N     . ASN H 4 236 ? 28.970 60.217  33.948  1.00 67.96  ? 236  ASN B N     1 
ATOM   7380  C  CA    . ASN H 4 236 ? 28.510 61.479  34.412  1.00 66.71  ? 236  ASN B CA    1 
ATOM   7381  C  C     . ASN H 4 236 ? 28.105 61.580  35.880  1.00 64.87  ? 236  ASN B C     1 
ATOM   7382  O  O     . ASN H 4 236 ? 27.162 60.936  36.324  1.00 65.11  ? 236  ASN B O     1 
ATOM   7383  C  CB    . ASN H 4 236 ? 27.350 61.922  33.531  1.00 68.39  ? 236  ASN B CB    1 
ATOM   7384  C  CG    . ASN H 4 236 ? 27.736 63.036  32.588  1.00 70.10  ? 236  ASN B CG    1 
ATOM   7385  O  OD1   . ASN H 4 236 ? 28.891 63.116  32.134  1.00 70.45  ? 236  ASN B OD1   1 
ATOM   7386  N  ND2   . ASN H 4 236 ? 26.770 63.908  32.275  1.00 70.14  ? 236  ASN B ND2   1 
ATOM   7387  N  N     . TYR H 4 237 ? 28.816 62.410  36.630  1.00 61.70  ? 237  TYR B N     1 
ATOM   7388  C  CA    . TYR H 4 237 ? 28.505 62.595  38.036  1.00 58.39  ? 237  TYR B CA    1 
ATOM   7389  C  C     . TYR H 4 237 ? 27.055 63.035  38.206  1.00 56.84  ? 237  TYR B C     1 
ATOM   7390  O  O     . TYR H 4 237 ? 26.645 64.072  37.699  1.00 57.16  ? 237  TYR B O     1 
ATOM   7391  C  CB    . TYR H 4 237 ? 29.464 63.623  38.646  1.00 57.54  ? 237  TYR B CB    1 
ATOM   7392  C  CG    . TYR H 4 237 ? 30.879 63.095  38.812  1.00 57.04  ? 237  TYR B CG    1 
ATOM   7393  C  CD1   . TYR H 4 237 ? 31.982 63.927  38.663  1.00 56.48  ? 237  TYR B CD1   1 
ATOM   7394  C  CD2   . TYR H 4 237 ? 31.115 61.755  39.097  1.00 57.48  ? 237  TYR B CD2   1 
ATOM   7395  C  CE1   . TYR H 4 237 ? 33.287 63.432  38.786  1.00 56.20  ? 237  TYR B CE1   1 
ATOM   7396  C  CE2   . TYR H 4 237 ? 32.415 61.256  39.225  1.00 57.39  ? 237  TYR B CE2   1 
ATOM   7397  C  CZ    . TYR H 4 237 ? 33.495 62.098  39.066  1.00 56.65  ? 237  TYR B CZ    1 
ATOM   7398  O  OH    . TYR H 4 237 ? 34.775 61.590  39.177  1.00 57.22  ? 237  TYR B OH    1 
ATOM   7399  N  N     . LEU H 4 238 ? 26.280 62.224  38.913  1.00 55.08  ? 238  LEU B N     1 
ATOM   7400  C  CA    . LEU H 4 238 ? 24.879 62.512  39.159  1.00 53.68  ? 238  LEU B CA    1 
ATOM   7401  C  C     . LEU H 4 238 ? 24.634 63.925  39.666  1.00 54.59  ? 238  LEU B C     1 
ATOM   7402  O  O     . LEU H 4 238 ? 23.575 64.488  39.428  1.00 55.37  ? 238  LEU B O     1 
ATOM   7403  C  CB    . LEU H 4 238 ? 24.305 61.504  40.150  1.00 50.98  ? 238  LEU B CB    1 
ATOM   7404  C  CG    . LEU H 4 238 ? 22.908 61.782  40.698  1.00 48.98  ? 238  LEU B CG    1 
ATOM   7405  C  CD1   . LEU H 4 238 ? 21.970 62.125  39.595  1.00 48.95  ? 238  LEU B CD1   1 
ATOM   7406  C  CD2   . LEU H 4 238 ? 22.399 60.566  41.404  1.00 49.17  ? 238  LEU B CD2   1 
ATOM   7407  N  N     . PHE H 4 239 ? 25.588 64.513  40.374  1.00 56.10  ? 239  PHE B N     1 
ATOM   7408  C  CA    . PHE H 4 239 ? 25.375 65.872  40.860  1.00 57.39  ? 239  PHE B CA    1 
ATOM   7409  C  C     . PHE H 4 239 ? 26.346 66.839  40.204  1.00 58.96  ? 239  PHE B C     1 
ATOM   7410  O  O     . PHE H 4 239 ? 27.525 66.539  40.059  1.00 59.83  ? 239  PHE B O     1 
ATOM   7411  C  CB    . PHE H 4 239 ? 25.471 65.930  42.395  1.00 56.34  ? 239  PHE B CB    1 
ATOM   7412  C  CG    . PHE H 4 239 ? 24.224 65.443  43.097  1.00 55.53  ? 239  PHE B CG    1 
ATOM   7413  C  CD1   . PHE H 4 239 ? 24.023 64.085  43.339  1.00 55.37  ? 239  PHE B CD1   1 
ATOM   7414  C  CD2   . PHE H 4 239 ? 23.210 66.334  43.434  1.00 54.89  ? 239  PHE B CD2   1 
ATOM   7415  C  CE1   . PHE H 4 239 ? 22.826 63.619  43.903  1.00 54.63  ? 239  PHE B CE1   1 
ATOM   7416  C  CE2   . PHE H 4 239 ? 22.012 65.879  43.998  1.00 54.58  ? 239  PHE B CE2   1 
ATOM   7417  C  CZ    . PHE H 4 239 ? 21.820 64.519  44.229  1.00 54.38  ? 239  PHE B CZ    1 
ATOM   7418  N  N     . CYS H 4 240 ? 25.841 68.001  39.797  1.00 60.63  ? 240  CYS B N     1 
ATOM   7419  C  CA    . CYS H 4 240 ? 26.665 69.005  39.110  1.00 61.75  ? 240  CYS B CA    1 
ATOM   7420  C  C     . CYS H 4 240 ? 26.133 70.429  39.302  1.00 61.56  ? 240  CYS B C     1 
ATOM   7421  O  O     . CYS H 4 240 ? 24.940 70.651  39.581  1.00 60.04  ? 240  CYS B O     1 
ATOM   7422  C  CB    . CYS H 4 240 ? 26.676 68.719  37.627  1.00 62.19  ? 240  CYS B CB    1 
ATOM   7423  S  SG    . CYS H 4 240 ? 24.977 68.825  37.072  1.00 64.84  ? 240  CYS B SG    1 
ATOM   7424  N  N     . ARG H 4 241 ? 27.034 71.383  39.088  1.00 61.63  ? 241  ARG B N     1 
ATOM   7425  C  CA    . ARG H 4 241 ? 26.733 72.789  39.272  1.00 62.31  ? 241  ARG B CA    1 
ATOM   7426  C  C     . ARG H 4 241 ? 25.643 73.353  38.403  1.00 61.68  ? 241  ARG B C     1 
ATOM   7427  O  O     . ARG H 4 241 ? 25.369 72.859  37.323  1.00 62.36  ? 241  ARG B O     1 
ATOM   7428  C  CB    . ARG H 4 241 ? 28.002 73.619  39.102  1.00 62.95  ? 241  ARG B CB    1 
ATOM   7429  C  CG    . ARG H 4 241 ? 28.876 73.183  37.948  1.00 65.08  ? 241  ARG B CG    1 
ATOM   7430  C  CD    . ARG H 4 241 ? 30.177 73.971  37.969  1.00 67.96  ? 241  ARG B CD    1 
ATOM   7431  N  NE    . ARG H 4 241 ? 29.953 75.339  38.451  1.00 70.82  ? 241  ARG B NE    1 
ATOM   7432  C  CZ    . ARG H 4 241 ? 30.862 76.317  38.412  1.00 72.16  ? 241  ARG B CZ    1 
ATOM   7433  N  NH1   . ARG H 4 241 ? 32.075 76.085  37.901  1.00 72.09  ? 241  ARG B NH1   1 
ATOM   7434  N  NH2   . ARG H 4 241 ? 30.559 77.529  38.891  1.00 71.92  ? 241  ARG B NH2   1 
ATOM   7435  N  N     . VAL H 4 242 ? 25.010 74.392  38.922  1.00 61.27  ? 242  VAL B N     1 
ATOM   7436  C  CA    . VAL H 4 242 ? 23.952 75.106  38.245  1.00 60.24  ? 242  VAL B CA    1 
ATOM   7437  C  C     . VAL H 4 242 ? 24.629 76.462  38.091  1.00 61.22  ? 242  VAL B C     1 
ATOM   7438  O  O     . VAL H 4 242 ? 25.627 76.725  38.781  1.00 61.04  ? 242  VAL B O     1 
ATOM   7439  C  CB    . VAL H 4 242 ? 22.686 75.190  39.143  1.00 59.53  ? 242  VAL B CB    1 
ATOM   7440  C  CG1   . VAL H 4 242 ? 22.300 76.648  39.416  1.00 59.05  ? 242  VAL B CG1   1 
ATOM   7441  C  CG2   . VAL H 4 242 ? 21.540 74.424  38.496  1.00 58.63  ? 242  VAL B CG2   1 
ATOM   7442  N  N     . ARG H 4 243 ? 24.126 77.291  37.172  1.00 61.85  ? 243  ARG B N     1 
ATOM   7443  C  CA    . ARG H 4 243 ? 24.690 78.616  36.917  1.00 62.40  ? 243  ARG B CA    1 
ATOM   7444  C  C     . ARG H 4 243 ? 23.597 79.655  37.100  1.00 65.04  ? 243  ARG B C     1 
ATOM   7445  O  O     . ARG H 4 243 ? 22.432 79.292  37.283  1.00 65.80  ? 243  ARG B O     1 
ATOM   7446  C  CB    . ARG H 4 243 ? 25.263 78.665  35.507  1.00 59.67  ? 243  ARG B CB    1 
ATOM   7447  C  CG    . ARG H 4 243 ? 26.477 77.762  35.331  1.00 57.69  ? 243  ARG B CG    1 
ATOM   7448  C  CD    . ARG H 4 243 ? 26.923 77.631  33.884  1.00 56.85  ? 243  ARG B CD    1 
ATOM   7449  N  NE    . ARG H 4 243 ? 28.159 76.852  33.729  1.00 57.03  ? 243  ARG B NE    1 
ATOM   7450  C  CZ    . ARG H 4 243 ? 29.346 77.183  34.251  1.00 57.37  ? 243  ARG B CZ    1 
ATOM   7451  N  NH1   . ARG H 4 243 ? 29.482 78.296  34.985  1.00 55.12  ? 243  ARG B NH1   1 
ATOM   7452  N  NH2   . ARG H 4 243 ? 30.407 76.400  34.030  1.00 55.99  ? 243  ARG B NH2   1 
ATOM   7453  N  N     . LYS H 4 244 ? 23.965 80.936  37.069  1.00 67.86  ? 244  LYS B N     1 
ATOM   7454  C  CA    . LYS H 4 244 ? 23.001 82.037  37.257  1.00 70.43  ? 244  LYS B CA    1 
ATOM   7455  C  C     . LYS H 4 244 ? 21.662 81.870  36.505  1.00 71.58  ? 244  LYS B C     1 
ATOM   7456  O  O     . LYS H 4 244 ? 20.587 82.137  37.062  1.00 71.02  ? 244  LYS B O     1 
ATOM   7457  C  CB    . LYS H 4 244 ? 23.634 83.364  36.829  1.00 71.50  ? 244  LYS B CB    1 
ATOM   7458  C  CG    . LYS H 4 244 ? 25.149 83.404  36.943  1.00 73.69  ? 244  LYS B CG    1 
ATOM   7459  C  CD    . LYS H 4 244 ? 25.704 84.750  36.469  1.00 74.40  ? 244  LYS B CD    1 
ATOM   7460  C  CE    . LYS H 4 244 ? 25.220 85.898  37.364  1.00 74.20  ? 244  LYS B CE    1 
ATOM   7461  N  NZ    . LYS H 4 244 ? 25.597 87.261  36.871  1.00 74.16  ? 244  LYS B NZ    1 
ATOM   7462  N  N     . ASN H 4 245 ? 21.757 81.425  35.243  1.00 72.95  ? 245  ASN B N     1 
ATOM   7463  C  CA    . ASN H 4 245 ? 20.624 81.220  34.319  1.00 73.82  ? 245  ASN B CA    1 
ATOM   7464  C  C     . ASN H 4 245 ? 19.689 80.036  34.551  1.00 74.87  ? 245  ASN B C     1 
ATOM   7465  O  O     . ASN H 4 245 ? 18.689 79.895  33.844  1.00 75.37  ? 245  ASN B O     1 
ATOM   7466  C  CB    . ASN H 4 245 ? 21.138 81.102  32.885  1.00 73.38  ? 245  ASN B CB    1 
ATOM   7467  C  CG    . ASN H 4 245 ? 22.075 79.925  32.701  1.00 73.40  ? 245  ASN B CG    1 
ATOM   7468  O  OD1   . ASN H 4 245 ? 21.850 78.848  33.259  1.00 72.81  ? 245  ASN B OD1   1 
ATOM   7469  N  ND2   . ASN H 4 245 ? 23.128 80.119  31.905  1.00 72.87  ? 245  ASN B ND2   1 
ATOM   7470  N  N     . GLY H 4 246 ? 20.012 79.172  35.504  1.00 76.15  ? 246  GLY B N     1 
ATOM   7471  C  CA    . GLY H 4 246 ? 19.153 78.031  35.761  1.00 77.36  ? 246  GLY B CA    1 
ATOM   7472  C  C     . GLY H 4 246 ? 19.347 76.933  34.736  1.00 77.99  ? 246  GLY B C     1 
ATOM   7473  O  O     . GLY H 4 246 ? 18.371 76.331  34.275  1.00 78.10  ? 246  GLY B O     1 
ATOM   7474  N  N     . VAL H 4 247 ? 20.603 76.682  34.374  1.00 77.95  ? 247  VAL B N     1 
ATOM   7475  C  CA    . VAL H 4 247 ? 20.931 75.640  33.407  1.00 78.34  ? 247  VAL B CA    1 
ATOM   7476  C  C     . VAL H 4 247 ? 21.922 74.654  34.025  1.00 78.29  ? 247  VAL B C     1 
ATOM   7477  O  O     . VAL H 4 247 ? 22.848 75.059  34.732  1.00 79.07  ? 247  VAL B O     1 
ATOM   7478  C  CB    . VAL H 4 247 ? 21.568 76.237  32.119  1.00 78.14  ? 247  VAL B CB    1 
ATOM   7479  C  CG1   . VAL H 4 247 ? 21.829 75.142  31.094  1.00 78.27  ? 247  VAL B CG1   1 
ATOM   7480  C  CG2   . VAL H 4 247 ? 20.653 77.266  31.526  1.00 78.48  ? 247  VAL B CG2   1 
ATOM   7481  N  N     . ALA H 4 248 ? 21.723 73.365  33.752  1.00 77.46  ? 248  ALA B N     1 
ATOM   7482  C  CA    . ALA H 4 248 ? 22.607 72.314  34.251  1.00 75.70  ? 248  ALA B CA    1 
ATOM   7483  C  C     . ALA H 4 248 ? 24.059 72.541  33.818  1.00 74.26  ? 248  ALA B C     1 
ATOM   7484  O  O     . ALA H 4 248 ? 24.445 73.666  33.494  1.00 73.28  ? 248  ALA B O     1 
ATOM   7485  C  CB    . ALA H 4 248 ? 22.128 70.968  33.755  1.00 76.33  ? 248  ALA B CB    1 
ATOM   7486  N  N     . ALA H 4 249 ? 24.860 71.473  33.817  1.00 72.90  ? 249  ALA B N     1 
ATOM   7487  C  CA    . ALA H 4 249 ? 26.275 71.569  33.433  1.00 72.28  ? 249  ALA B CA    1 
ATOM   7488  C  C     . ALA H 4 249 ? 27.094 70.296  33.689  1.00 71.43  ? 249  ALA B C     1 
ATOM   7489  O  O     . ALA H 4 249 ? 28.158 70.350  34.311  1.00 71.28  ? 249  ALA B O     1 
ATOM   7490  C  CB    . ALA H 4 249 ? 26.930 72.748  34.163  1.00 71.74  ? 249  ALA B CB    1 
ATOM   7491  N  N     . PRO H 4 250 ? 26.624 69.143  33.189  1.00 70.59  ? 250  PRO B N     1 
ATOM   7492  C  CA    . PRO H 4 250 ? 27.271 67.835  33.341  1.00 70.16  ? 250  PRO B CA    1 
ATOM   7493  C  C     . PRO H 4 250 ? 28.793 67.790  33.212  1.00 69.59  ? 250  PRO B C     1 
ATOM   7494  O  O     . PRO H 4 250 ? 29.419 68.756  32.770  1.00 69.83  ? 250  PRO B O     1 
ATOM   7495  C  CB    . PRO H 4 250 ? 26.588 66.999  32.267  1.00 70.34  ? 250  PRO B CB    1 
ATOM   7496  C  CG    . PRO H 4 250 ? 25.193 67.526  32.311  1.00 70.88  ? 250  PRO B CG    1 
ATOM   7497  C  CD    . PRO H 4 250 ? 25.419 69.026  32.348  1.00 70.70  ? 250  PRO B CD    1 
ATOM   7498  N  N     . SER H 4 251 ? 29.372 66.658  33.620  1.00 69.05  ? 251  SER B N     1 
ATOM   7499  C  CA    . SER H 4 251 ? 30.813 66.417  33.535  1.00 68.63  ? 251  SER B CA    1 
ATOM   7500  C  C     . SER H 4 251 ? 31.189 64.991  33.855  1.00 68.84  ? 251  SER B C     1 
ATOM   7501  O  O     . SER H 4 251 ? 30.361 64.182  34.251  1.00 68.56  ? 251  SER B O     1 
ATOM   7502  C  CB    . SER H 4 251 ? 31.611 67.322  34.471  1.00 68.10  ? 251  SER B CB    1 
ATOM   7503  O  OG    . SER H 4 251 ? 32.979 66.921  34.497  1.00 66.68  ? 251  SER B OG    1 
ATOM   7504  N  N     . ALA H 4 252 ? 32.465 64.696  33.682  1.00 69.64  ? 252  ALA B N     1 
ATOM   7505  C  CA    . ALA H 4 252 ? 32.976 63.374  33.954  1.00 72.06  ? 252  ALA B CA    1 
ATOM   7506  C  C     . ALA H 4 252 ? 34.424 63.527  34.365  1.00 73.43  ? 252  ALA B C     1 
ATOM   7507  O  O     . ALA H 4 252 ? 35.162 62.545  34.467  1.00 75.30  ? 252  ALA B O     1 
ATOM   7508  C  CB    . ALA H 4 252 ? 32.870 62.505  32.726  1.00 72.01  ? 252  ALA B CB    1 
ATOM   7509  N  N     . THR H 4 253 ? 34.834 64.769  34.594  1.00 73.48  ? 253  THR B N     1 
ATOM   7510  C  CA    . THR H 4 253 ? 36.204 65.043  35.017  1.00 73.47  ? 253  THR B CA    1 
ATOM   7511  C  C     . THR H 4 253 ? 36.219 66.035  36.179  1.00 72.82  ? 253  THR B C     1 
ATOM   7512  O  O     . THR H 4 253 ? 37.281 66.369  36.714  1.00 73.63  ? 253  THR B O     1 
ATOM   7513  C  CB    . THR H 4 253 ? 37.037 65.607  33.853  1.00 74.16  ? 253  THR B CB    1 
ATOM   7514  O  OG1   . THR H 4 253 ? 36.264 66.603  33.164  1.00 74.78  ? 253  THR B OG1   1 
ATOM   7515  C  CG2   . THR H 4 253 ? 37.450 64.479  32.887  1.00 73.59  ? 253  THR B CG2   1 
ATOM   7516  N  N     . SER H 4 254 ? 35.034 66.502  36.567  1.00 70.69  ? 254  SER B N     1 
ATOM   7517  C  CA    . SER H 4 254 ? 34.927 67.443  37.665  1.00 68.47  ? 254  SER B CA    1 
ATOM   7518  C  C     . SER H 4 254 ? 33.707 67.163  38.551  1.00 67.22  ? 254  SER B C     1 
ATOM   7519  O  O     . SER H 4 254 ? 32.557 67.344  38.126  1.00 66.16  ? 254  SER B O     1 
ATOM   7520  C  CB    . SER H 4 254 ? 34.872 68.868  37.112  1.00 68.32  ? 254  SER B CB    1 
ATOM   7521  O  OG    . SER H 4 254 ? 35.076 69.828  38.139  1.00 68.61  ? 254  SER B OG    1 
ATOM   7522  N  N     . GLN H 4 255 ? 33.968 66.713  39.784  1.00 66.33  ? 255  GLN B N     1 
ATOM   7523  C  CA    . GLN H 4 255 ? 32.896 66.423  40.745  1.00 64.48  ? 255  GLN B CA    1 
ATOM   7524  C  C     . GLN H 4 255 ? 32.502 67.734  41.359  1.00 61.91  ? 255  GLN B C     1 
ATOM   7525  O  O     . GLN H 4 255 ? 33.323 68.647  41.470  1.00 61.76  ? 255  GLN B O     1 
ATOM   7526  C  CB    . GLN H 4 255 ? 33.361 65.555  41.912  1.00 65.89  ? 255  GLN B CB    1 
ATOM   7527  C  CG    . GLN H 4 255 ? 34.197 64.367  41.581  1.00 67.98  ? 255  GLN B CG    1 
ATOM   7528  C  CD    . GLN H 4 255 ? 34.993 63.910  42.785  1.00 70.25  ? 255  GLN B CD    1 
ATOM   7529  O  OE1   . GLN H 4 255 ? 35.839 63.004  42.688  1.00 71.98  ? 255  GLN B OE1   1 
ATOM   7530  N  NE2   . GLN H 4 255 ? 34.733 64.541  43.935  1.00 70.01  ? 255  GLN B NE2   1 
ATOM   7531  N  N     . LEU H 4 256 ? 31.251 67.831  41.776  1.00 58.87  ? 256  LEU B N     1 
ATOM   7532  C  CA    . LEU H 4 256 ? 30.819 69.049  42.423  1.00 56.44  ? 256  LEU B CA    1 
ATOM   7533  C  C     . LEU H 4 256 ? 31.671 69.127  43.713  1.00 57.25  ? 256  LEU B C     1 
ATOM   7534  O  O     . LEU H 4 256 ? 32.066 68.104  44.284  1.00 58.10  ? 256  LEU B O     1 
ATOM   7535  C  CB    . LEU H 4 256 ? 29.320 68.963  42.700  1.00 52.04  ? 256  LEU B CB    1 
ATOM   7536  C  CG    . LEU H 4 256 ? 28.685 70.168  43.350  1.00 49.41  ? 256  LEU B CG    1 
ATOM   7537  C  CD1   . LEU H 4 256 ? 29.208 71.391  42.677  1.00 49.67  ? 256  LEU B CD1   1 
ATOM   7538  C  CD2   . LEU H 4 256 ? 27.192 70.092  43.248  1.00 48.71  ? 256  LEU B CD2   1 
ATOM   7539  N  N     . SER H 4 257 ? 32.001 70.332  44.154  1.00 57.58  ? 257  SER B N     1 
ATOM   7540  C  CA    . SER H 4 257 ? 32.830 70.490  45.348  1.00 56.89  ? 257  SER B CA    1 
ATOM   7541  C  C     . SER H 4 257 ? 32.136 70.181  46.671  1.00 55.87  ? 257  SER B C     1 
ATOM   7542  O  O     . SER H 4 257 ? 30.993 70.599  46.895  1.00 55.02  ? 257  SER B O     1 
ATOM   7543  C  CB    . SER H 4 257 ? 33.367 71.908  45.417  1.00 57.93  ? 257  SER B CB    1 
ATOM   7544  O  OG    . SER H 4 257 ? 34.015 72.111  46.652  1.00 61.38  ? 257  SER B OG    1 
ATOM   7545  N  N     . THR H 4 258 ? 32.844 69.463  47.551  1.00 54.81  ? 258  THR B N     1 
ATOM   7546  C  CA    . THR H 4 258 ? 32.321 69.099  48.874  1.00 53.06  ? 258  THR B CA    1 
ATOM   7547  C  C     . THR H 4 258 ? 31.933 70.396  49.573  1.00 51.99  ? 258  THR B C     1 
ATOM   7548  O  O     . THR H 4 258 ? 30.895 70.467  50.248  1.00 51.54  ? 258  THR B O     1 
ATOM   7549  C  CB    . THR H 4 258 ? 33.384 68.418  49.694  1.00 52.46  ? 258  THR B CB    1 
ATOM   7550  O  OG1   . THR H 4 258 ? 34.513 69.288  49.767  1.00 55.33  ? 258  THR B OG1   1 
ATOM   7551  C  CG2   . THR H 4 258 ? 33.819 67.138  49.044  1.00 51.74  ? 258  THR B CG2   1 
ATOM   7552  N  N     . ARG H 4 259 ? 32.786 71.415  49.389  1.00 50.24  ? 259  ARG B N     1 
ATOM   7553  C  CA    . ARG H 4 259 ? 32.581 72.762  49.938  1.00 47.53  ? 259  ARG B CA    1 
ATOM   7554  C  C     . ARG H 4 259 ? 31.225 73.272  49.480  1.00 46.31  ? 259  ARG B C     1 
ATOM   7555  O  O     . ARG H 4 259 ? 30.610 74.099  50.135  1.00 44.92  ? 259  ARG B O     1 
ATOM   7556  C  CB    . ARG H 4 259 ? 33.655 73.735  49.434  1.00 46.95  ? 259  ARG B CB    1 
ATOM   7557  C  CG    . ARG H 4 259 ? 33.524 75.136  50.005  1.00 45.95  ? 259  ARG B CG    1 
ATOM   7558  C  CD    . ARG H 4 259 ? 34.050 75.160  51.435  1.00 47.74  ? 259  ARG B CD    1 
ATOM   7559  N  NE    . ARG H 4 259 ? 33.596 76.301  52.236  1.00 48.06  ? 259  ARG B NE    1 
ATOM   7560  C  CZ    . ARG H 4 259 ? 32.321 76.550  52.536  1.00 48.44  ? 259  ARG B CZ    1 
ATOM   7561  N  NH1   . ARG H 4 259 ? 31.366 75.738  52.092  1.00 47.52  ? 259  ARG B NH1   1 
ATOM   7562  N  NH2   . ARG H 4 259 ? 31.999 77.594  53.302  1.00 48.29  ? 259  ARG B NH2   1 
ATOM   7563  N  N     . ALA H 4 260 ? 30.772 72.761  48.341  1.00 46.67  ? 260  ALA B N     1 
ATOM   7564  C  CA    . ALA H 4 260 ? 29.491 73.149  47.772  1.00 47.68  ? 260  ALA B CA    1 
ATOM   7565  C  C     . ALA H 4 260 ? 28.331 72.521  48.516  1.00 47.78  ? 260  ALA B C     1 
ATOM   7566  O  O     . ALA H 4 260 ? 27.429 73.211  48.989  1.00 47.24  ? 260  ALA B O     1 
ATOM   7567  C  CB    . ALA H 4 260 ? 29.442 72.746  46.330  1.00 47.91  ? 260  ALA B CB    1 
ATOM   7568  N  N     . LEU H 4 261 ? 28.366 71.198  48.603  1.00 48.06  ? 261  LEU B N     1 
ATOM   7569  C  CA    . LEU H 4 261 ? 27.335 70.443  49.285  1.00 47.99  ? 261  LEU B CA    1 
ATOM   7570  C  C     . LEU H 4 261 ? 27.149 70.933  50.719  1.00 49.15  ? 261  LEU B C     1 
ATOM   7571  O  O     . LEU H 4 261 ? 26.019 70.894  51.238  1.00 49.33  ? 261  LEU B O     1 
ATOM   7572  C  CB    . LEU H 4 261 ? 27.694 68.970  49.239  1.00 46.05  ? 261  LEU B CB    1 
ATOM   7573  C  CG    . LEU H 4 261 ? 28.071 68.673  47.797  1.00 44.70  ? 261  LEU B CG    1 
ATOM   7574  C  CD1   . LEU H 4 261 ? 29.436 68.118  47.782  1.00 44.22  ? 261  LEU B CD1   1 
ATOM   7575  C  CD2   . LEU H 4 261 ? 27.102 67.740  47.165  1.00 43.02  ? 261  LEU B CD2   1 
ATOM   7576  N  N     . GLU H 4 262 ? 28.233 71.405  51.353  1.00 48.90  ? 262  GLU B N     1 
ATOM   7577  C  CA    . GLU H 4 262 ? 28.131 71.942  52.722  1.00 50.19  ? 262  GLU B CA    1 
ATOM   7578  C  C     . GLU H 4 262 ? 27.339 73.228  52.644  1.00 50.14  ? 262  GLU B C     1 
ATOM   7579  O  O     . GLU H 4 262 ? 26.721 73.643  53.626  1.00 49.13  ? 262  GLU B O     1 
ATOM   7580  C  CB    . GLU H 4 262 ? 29.488 72.305  53.334  1.00 50.92  ? 262  GLU B CB    1 
ATOM   7581  C  CG    . GLU H 4 262 ? 30.544 71.240  53.238  1.00 54.67  ? 262  GLU B CG    1 
ATOM   7582  C  CD    . GLU H 4 262 ? 31.624 71.409  54.286  1.00 56.14  ? 262  GLU B CD    1 
ATOM   7583  O  OE1   . GLU H 4 262 ? 31.343 71.098  55.465  1.00 57.22  ? 262  GLU B OE1   1 
ATOM   7584  O  OE2   . GLU H 4 262 ? 32.745 71.854  53.932  1.00 57.22  ? 262  GLU B OE2   1 
ATOM   7585  N  N     . GLY H 4 263 ? 27.398 73.866  51.470  1.00 50.18  ? 263  GLY B N     1 
ATOM   7586  C  CA    . GLY H 4 263 ? 26.684 75.111  51.244  1.00 49.54  ? 263  GLY B CA    1 
ATOM   7587  C  C     . GLY H 4 263 ? 25.194 74.860  51.160  1.00 49.61  ? 263  GLY B C     1 
ATOM   7588  O  O     . GLY H 4 263 ? 24.390 75.510  51.844  1.00 49.17  ? 263  GLY B O     1 
ATOM   7589  N  N     . ILE H 4 264 ? 24.841 73.897  50.317  1.00 49.20  ? 264  ILE B N     1 
ATOM   7590  C  CA    . ILE H 4 264 ? 23.466 73.492  50.096  1.00 49.51  ? 264  ILE B CA    1 
ATOM   7591  C  C     . ILE H 4 264 ? 22.692 73.360  51.396  1.00 49.58  ? 264  ILE B C     1 
ATOM   7592  O  O     . ILE H 4 264 ? 21.527 73.752  51.471  1.00 48.99  ? 264  ILE B O     1 
ATOM   7593  C  CB    . ILE H 4 264 ? 23.445 72.166  49.374  1.00 50.65  ? 264  ILE B CB    1 
ATOM   7594  C  CG1   . ILE H 4 264 ? 24.406 72.245  48.190  1.00 51.04  ? 264  ILE B CG1   1 
ATOM   7595  C  CG2   . ILE H 4 264 ? 22.032 71.831  48.933  1.00 50.75  ? 264  ILE B CG2   1 
ATOM   7596  C  CD1   . ILE H 4 264 ? 24.597 70.942  47.468  1.00 53.57  ? 264  ILE B CD1   1 
ATOM   7597  N  N     . PHE H 4 265 ? 23.344 72.802  52.417  1.00 50.23  ? 265  PHE B N     1 
ATOM   7598  C  CA    . PHE H 4 265 ? 22.718 72.627  53.730  1.00 50.90  ? 265  PHE B CA    1 
ATOM   7599  C  C     . PHE H 4 265 ? 22.464 73.954  54.465  1.00 52.39  ? 265  PHE B C     1 
ATOM   7600  O  O     . PHE H 4 265 ? 21.368 74.171  54.999  1.00 51.06  ? 265  PHE B O     1 
ATOM   7601  C  CB    . PHE H 4 265 ? 23.577 71.718  54.621  1.00 48.22  ? 265  PHE B CB    1 
ATOM   7602  C  CG    . PHE H 4 265 ? 23.365 70.241  54.394  1.00 44.56  ? 265  PHE B CG    1 
ATOM   7603  C  CD1   . PHE H 4 265 ? 24.362 69.462  53.811  1.00 43.42  ? 265  PHE B CD1   1 
ATOM   7604  C  CD2   . PHE H 4 265 ? 22.189 69.626  54.802  1.00 42.53  ? 265  PHE B CD2   1 
ATOM   7605  C  CE1   . PHE H 4 265 ? 24.196 68.099  53.639  1.00 41.11  ? 265  PHE B CE1   1 
ATOM   7606  C  CE2   . PHE H 4 265 ? 22.006 68.268  54.637  1.00 41.00  ? 265  PHE B CE2   1 
ATOM   7607  C  CZ    . PHE H 4 265 ? 23.018 67.500  54.051  1.00 41.27  ? 265  PHE B CZ    1 
ATOM   7608  N  N     . GLU H 4 266 ? 23.485 74.820  54.500  1.00 55.32  ? 266  GLU B N     1 
ATOM   7609  C  CA    . GLU H 4 266 ? 23.399 76.141  55.154  1.00 58.30  ? 266  GLU B CA    1 
ATOM   7610  C  C     . GLU H 4 266 ? 22.232 76.900  54.552  1.00 59.32  ? 266  GLU B C     1 
ATOM   7611  O  O     . GLU H 4 266 ? 21.351 77.436  55.257  1.00 59.20  ? 266  GLU B O     1 
ATOM   7612  C  CB    . GLU H 4 266 ? 24.643 76.984  54.882  1.00 59.64  ? 266  GLU B CB    1 
ATOM   7613  C  CG    . GLU H 4 266 ? 25.873 76.211  54.540  1.00 63.95  ? 266  GLU B CG    1 
ATOM   7614  C  CD    . GLU H 4 266 ? 27.128 77.005  54.855  1.00 67.51  ? 266  GLU B CD    1 
ATOM   7615  O  OE1   . GLU H 4 266 ? 28.245 76.502  54.555  1.00 68.62  ? 266  GLU B OE1   1 
ATOM   7616  O  OE2   . GLU H 4 266 ? 26.987 78.129  55.414  1.00 68.38  ? 266  GLU B OE2   1 
ATOM   7617  N  N     . ALA H 4 267 ? 22.288 76.955  53.221  1.00 58.40  ? 267  ALA B N     1 
ATOM   7618  C  CA    . ALA H 4 267 ? 21.297 77.601  52.402  1.00 56.82  ? 267  ALA B CA    1 
ATOM   7619  C  C     . ALA H 4 267 ? 19.933 77.168  52.883  1.00 56.33  ? 267  ALA B C     1 
ATOM   7620  O  O     . ALA H 4 267 ? 19.165 77.985  53.386  1.00 56.60  ? 267  ALA B O     1 
ATOM   7621  C  CB    . ALA H 4 267 ? 21.498 77.190  50.971  1.00 55.82  ? 267  ALA B CB    1 
ATOM   7622  N  N     . THR H 4 268 ? 19.649 75.875  52.749  1.00 56.07  ? 268  THR B N     1 
ATOM   7623  C  CA    . THR H 4 268 ? 18.360 75.345  53.157  1.00 56.46  ? 268  THR B CA    1 
ATOM   7624  C  C     . THR H 4 268 ? 18.062 75.673  54.613  1.00 58.25  ? 268  THR B C     1 
ATOM   7625  O  O     . THR H 4 268 ? 16.897 75.744  55.021  1.00 58.30  ? 268  THR B O     1 
ATOM   7626  C  CB    . THR H 4 268 ? 18.287 73.836  52.931  1.00 55.10  ? 268  THR B CB    1 
ATOM   7627  O  OG1   . THR H 4 268 ? 18.752 73.540  51.612  1.00 55.33  ? 268  THR B OG1   1 
ATOM   7628  C  CG2   . THR H 4 268 ? 16.855 73.355  53.047  1.00 52.54  ? 268  THR B CG2   1 
ATOM   7629  N  N     . HIS H 4 269 ? 19.102 75.877  55.412  1.00 59.78  ? 269  HIS B N     1 
ATOM   7630  C  CA    . HIS H 4 269 ? 18.841 76.240  56.784  1.00 62.13  ? 269  HIS B CA    1 
ATOM   7631  C  C     . HIS H 4 269 ? 18.459 77.715  56.777  1.00 64.33  ? 269  HIS B C     1 
ATOM   7632  O  O     . HIS H 4 269 ? 17.534 78.126  57.481  1.00 65.03  ? 269  HIS B O     1 
ATOM   7633  C  CB    . HIS H 4 269 ? 20.057 76.014  57.673  1.00 61.42  ? 269  HIS B CB    1 
ATOM   7634  C  CG    . HIS H 4 269 ? 19.769 76.210  59.134  1.00 60.34  ? 269  HIS B CG    1 
ATOM   7635  N  ND1   . HIS H 4 269 ? 20.072 77.377  59.808  1.00 59.27  ? 269  HIS B ND1   1 
ATOM   7636  C  CD2   . HIS H 4 269 ? 19.135 75.414  60.028  1.00 58.62  ? 269  HIS B CD2   1 
ATOM   7637  C  CE1   . HIS H 4 269 ? 19.634 77.289  61.050  1.00 58.82  ? 269  HIS B CE1   1 
ATOM   7638  N  NE2   . HIS H 4 269 ? 19.060 76.109  61.209  1.00 58.74  ? 269  HIS B NE2   1 
ATOM   7639  N  N     . ARG H 4 270 ? 19.159 78.519  55.980  1.00 66.25  ? 270  ARG B N     1 
ATOM   7640  C  CA    . ARG H 4 270 ? 18.814 79.936  55.906  1.00 67.78  ? 270  ARG B CA    1 
ATOM   7641  C  C     . ARG H 4 270 ? 17.331 80.011  55.582  1.00 66.96  ? 270  ARG B C     1 
ATOM   7642  O  O     . ARG H 4 270 ? 16.539 80.551  56.354  1.00 66.52  ? 270  ARG B O     1 
ATOM   7643  C  CB    . ARG H 4 270 ? 19.612 80.657  54.811  1.00 70.75  ? 270  ARG B CB    1 
ATOM   7644  C  CG    . ARG H 4 270 ? 20.697 81.580  55.363  1.00 75.51  ? 270  ARG B CG    1 
ATOM   7645  C  CD    . ARG H 4 270 ? 20.822 82.864  54.558  1.00 80.90  ? 270  ARG B CD    1 
ATOM   7646  N  NE    . ARG H 4 270 ? 21.202 82.615  53.162  1.00 86.82  ? 270  ARG B NE    1 
ATOM   7647  C  CZ    . ARG H 4 270 ? 22.447 82.385  52.727  1.00 88.57  ? 270  ARG B CZ    1 
ATOM   7648  N  NH1   . ARG H 4 270 ? 23.476 82.372  53.584  1.00 89.36  ? 270  ARG B NH1   1 
ATOM   7649  N  NH2   . ARG H 4 270 ? 22.664 82.168  51.426  1.00 88.29  ? 270  ARG B NH2   1 
ATOM   7650  N  N     . LEU H 4 271 ? 16.978 79.430  54.441  1.00 65.95  ? 271  LEU B N     1 
ATOM   7651  C  CA    . LEU H 4 271 ? 15.612 79.381  53.942  1.00 65.60  ? 271  LEU B CA    1 
ATOM   7652  C  C     . LEU H 4 271 ? 14.534 79.332  55.009  1.00 65.55  ? 271  LEU B C     1 
ATOM   7653  O  O     . LEU H 4 271 ? 13.443 79.860  54.812  1.00 65.26  ? 271  LEU B O     1 
ATOM   7654  C  CB    . LEU H 4 271 ? 15.443 78.165  53.032  1.00 65.79  ? 271  LEU B CB    1 
ATOM   7655  C  CG    . LEU H 4 271 ? 14.810 78.333  51.641  1.00 65.61  ? 271  LEU B CG    1 
ATOM   7656  C  CD1   . LEU H 4 271 ? 13.334 78.697  51.772  1.00 66.08  ? 271  LEU B CD1   1 
ATOM   7657  C  CD2   . LEU H 4 271 ? 15.590 79.387  50.845  1.00 64.87  ? 271  LEU B CD2   1 
ATOM   7658  N  N     . ILE H 4 272 ? 14.816 78.698  56.138  1.00 66.00  ? 272  ILE B N     1 
ATOM   7659  C  CA    . ILE H 4 272 ? 13.795 78.610  57.173  1.00 66.65  ? 272  ILE B CA    1 
ATOM   7660  C  C     . ILE H 4 272 ? 14.105 79.339  58.469  1.00 67.75  ? 272  ILE B C     1 
ATOM   7661  O  O     . ILE H 4 272 ? 13.205 79.875  59.118  1.00 68.04  ? 272  ILE B O     1 
ATOM   7662  C  CB    . ILE H 4 272 ? 13.505 77.153  57.556  1.00 65.30  ? 272  ILE B CB    1 
ATOM   7663  C  CG1   . ILE H 4 272 ? 13.638 76.252  56.326  1.00 64.35  ? 272  ILE B CG1   1 
ATOM   7664  C  CG2   . ILE H 4 272 ? 12.111 77.065  58.180  1.00 64.82  ? 272  ILE B CG2   1 
ATOM   7665  C  CD1   . ILE H 4 272 ? 13.352 74.785  56.596  1.00 62.60  ? 272  ILE B CD1   1 
ATOM   7666  N  N     . TYR H 4 273 ? 15.375 79.362  58.852  1.00 68.94  ? 273  TYR B N     1 
ATOM   7667  C  CA    . TYR H 4 273 ? 15.738 79.983  60.115  1.00 69.55  ? 273  TYR B CA    1 
ATOM   7668  C  C     . TYR H 4 273 ? 16.426 81.340  60.059  1.00 71.74  ? 273  TYR B C     1 
ATOM   7669  O  O     . TYR H 4 273 ? 16.914 81.846  61.079  1.00 72.47  ? 273  TYR B O     1 
ATOM   7670  C  CB    . TYR H 4 273 ? 16.554 78.981  60.947  1.00 66.51  ? 273  TYR B CB    1 
ATOM   7671  C  CG    . TYR H 4 273 ? 15.729 77.779  61.303  1.00 63.48  ? 273  TYR B CG    1 
ATOM   7672  C  CD1   . TYR H 4 273 ? 15.898 76.571  60.645  1.00 61.83  ? 273  TYR B CD1   1 
ATOM   7673  C  CD2   . TYR H 4 273 ? 14.685 77.894  62.211  1.00 63.25  ? 273  TYR B CD2   1 
ATOM   7674  C  CE1   . TYR H 4 273 ? 15.037 75.514  60.873  1.00 61.67  ? 273  TYR B CE1   1 
ATOM   7675  C  CE2   . TYR H 4 273 ? 13.823 76.850  62.448  1.00 62.59  ? 273  TYR B CE2   1 
ATOM   7676  C  CZ    . TYR H 4 273 ? 13.996 75.666  61.775  1.00 62.28  ? 273  TYR B CZ    1 
ATOM   7677  O  OH    . TYR H 4 273 ? 13.082 74.660  61.978  1.00 63.41  ? 273  TYR B OH    1 
ATOM   7678  N  N     . GLY H 4 274 ? 16.467 81.941  58.878  1.00 73.25  ? 274  GLY B N     1 
ATOM   7679  C  CA    . GLY H 4 274 ? 17.074 83.252  58.785  1.00 75.96  ? 274  GLY B CA    1 
ATOM   7680  C  C     . GLY H 4 274 ? 18.568 83.242  58.609  1.00 77.59  ? 274  GLY B C     1 
ATOM   7681  O  O     . GLY H 4 274 ? 19.063 82.554  57.724  1.00 78.13  ? 274  GLY B O     1 
ATOM   7682  N  N     . ALA H 4 275 ? 19.283 83.999  59.440  1.00 79.31  ? 275  ALA B N     1 
ATOM   7683  C  CA    . ALA H 4 275 ? 20.736 84.079  59.320  1.00 82.59  ? 275  ALA B CA    1 
ATOM   7684  C  C     . ALA H 4 275 ? 21.505 83.502  60.481  1.00 84.36  ? 275  ALA B C     1 
ATOM   7685  O  O     . ALA H 4 275 ? 21.099 83.588  61.649  1.00 84.52  ? 275  ALA B O     1 
ATOM   7686  C  CB    . ALA H 4 275 ? 21.187 85.527  59.081  1.00 81.93  ? 275  ALA B CB    1 
ATOM   7687  N  N     . LYS H 4 276 ? 22.631 82.900  60.124  1.00 86.77  ? 276  LYS B N     1 
ATOM   7688  C  CA    . LYS H 4 276 ? 23.510 82.299  61.092  1.00 89.41  ? 276  LYS B CA    1 
ATOM   7689  C  C     . LYS H 4 276 ? 23.959 83.423  62.011  1.00 91.17  ? 276  LYS B C     1 
ATOM   7690  O  O     . LYS H 4 276 ? 24.708 84.321  61.607  1.00 90.87  ? 276  LYS B O     1 
ATOM   7691  C  CB    . LYS H 4 276 ? 24.699 81.648  60.376  1.00 89.79  ? 276  LYS B CB    1 
ATOM   7692  C  CG    . LYS H 4 276 ? 25.800 81.128  61.291  1.00 90.68  ? 276  LYS B CG    1 
ATOM   7693  C  CD    . LYS H 4 276 ? 26.662 80.069  60.594  1.00 92.98  ? 276  LYS B CD    1 
ATOM   7694  C  CE    . LYS H 4 276 ? 27.399 80.591  59.354  1.00 94.39  ? 276  LYS B CE    1 
ATOM   7695  N  NZ    . LYS H 4 276 ? 28.100 79.493  58.593  1.00 95.08  ? 276  LYS B NZ    1 
ATOM   7696  N  N     . ASP H 4 277 ? 23.457 83.382  63.238  1.00 93.15  ? 277  ASP B N     1 
ATOM   7697  C  CA    . ASP H 4 277 ? 23.799 84.372  64.241  1.00 95.53  ? 277  ASP B CA    1 
ATOM   7698  C  C     . ASP H 4 277 ? 25.321 84.535  64.291  1.00 96.11  ? 277  ASP B C     1 
ATOM   7699  O  O     . ASP H 4 277 ? 26.046 83.602  63.966  1.00 96.26  ? 277  ASP B O     1 
ATOM   7700  C  CB    . ASP H 4 277 ? 23.255 83.908  65.590  1.00 97.96  ? 277  ASP B CB    1 
ATOM   7701  C  CG    . ASP H 4 277 ? 23.682 84.804  66.731  1.00 100.56 ? 277  ASP B CG    1 
ATOM   7702  O  OD1   . ASP H 4 277 ? 23.466 86.040  66.649  1.00 101.08 ? 277  ASP B OD1   1 
ATOM   7703  O  OD2   . ASP H 4 277 ? 24.234 84.260  67.718  1.00 102.67 ? 277  ASP B OD2   1 
ATOM   7704  N  N     . ASP H 4 278 ? 25.806 85.713  64.682  1.00 97.21  ? 278  ASP B N     1 
ATOM   7705  C  CA    . ASP H 4 278 ? 27.253 85.951  64.750  1.00 98.40  ? 278  ASP B CA    1 
ATOM   7706  C  C     . ASP H 4 278 ? 27.827 85.699  66.145  1.00 97.88  ? 278  ASP B C     1 
ATOM   7707  O  O     . ASP H 4 278 ? 27.707 86.536  67.044  1.00 98.03  ? 278  ASP B O     1 
ATOM   7708  C  CB    . ASP H 4 278 ? 27.598 87.384  64.328  1.00 99.74  ? 278  ASP B CB    1 
ATOM   7709  C  CG    . ASP H 4 278 ? 29.102 87.592  64.143  1.00 101.02 ? 278  ASP B CG    1 
ATOM   7710  O  OD1   . ASP H 4 278 ? 29.894 87.020  64.936  1.00 101.29 ? 278  ASP B OD1   1 
ATOM   7711  O  OD2   . ASP H 4 278 ? 29.486 88.335  63.208  1.00 101.45 ? 278  ASP B OD2   1 
ATOM   7712  N  N     . SER H 4 279 ? 28.466 84.543  66.300  1.00 96.74  ? 279  SER B N     1 
ATOM   7713  C  CA    . SER H 4 279 ? 29.068 84.132  67.559  1.00 95.11  ? 279  SER B CA    1 
ATOM   7714  C  C     . SER H 4 279 ? 30.383 83.418  67.284  1.00 94.36  ? 279  SER B C     1 
ATOM   7715  O  O     . SER H 4 279 ? 31.069 82.982  68.213  1.00 95.26  ? 279  SER B O     1 
ATOM   7716  C  CB    . SER H 4 279 ? 28.131 83.182  68.305  1.00 94.77  ? 279  SER B CB    1 
ATOM   7717  O  OG    . SER H 4 279 ? 28.784 82.618  69.428  1.00 94.33  ? 279  SER B OG    1 
ATOM   7718  N  N     . GLY H 4 280 ? 30.725 83.296  66.004  1.00 92.48  ? 280  GLY B N     1 
ATOM   7719  C  CA    . GLY H 4 280 ? 31.955 82.623  65.625  1.00 89.73  ? 280  GLY B CA    1 
ATOM   7720  C  C     . GLY H 4 280 ? 31.933 81.125  65.886  1.00 87.17  ? 280  GLY B C     1 
ATOM   7721  O  O     . GLY H 4 280 ? 32.816 80.398  65.421  1.00 86.98  ? 280  GLY B O     1 
ATOM   7722  N  N     . GLN H 4 281 ? 30.929 80.656  66.628  1.00 84.75  ? 281  GLN B N     1 
ATOM   7723  C  CA    . GLN H 4 281 ? 30.825 79.235  66.944  1.00 81.91  ? 281  GLN B CA    1 
ATOM   7724  C  C     . GLN H 4 281 ? 30.463 78.392  65.724  1.00 78.31  ? 281  GLN B C     1 
ATOM   7725  O  O     . GLN H 4 281 ? 29.974 78.904  64.709  1.00 78.53  ? 281  GLN B O     1 
ATOM   7726  C  CB    . GLN H 4 281 ? 29.797 78.990  68.060  1.00 84.09  ? 281  GLN B CB    1 
ATOM   7727  C  CG    . GLN H 4 281 ? 30.303 79.263  69.486  1.00 87.44  ? 281  GLN B CG    1 
ATOM   7728  C  CD    . GLN H 4 281 ? 29.445 78.581  70.571  1.00 89.75  ? 281  GLN B CD    1 
ATOM   7729  O  OE1   . GLN H 4 281 ? 29.450 77.354  70.710  1.00 91.12  ? 281  GLN B OE1   1 
ATOM   7730  N  NE2   . GLN H 4 281 ? 28.704 79.381  71.336  1.00 90.61  ? 281  GLN B NE2   1 
ATOM   7731  N  N     . ARG H 4 282 ? 30.725 77.093  65.826  1.00 72.79  ? 282  ARG B N     1 
ATOM   7732  C  CA    . ARG H 4 282 ? 30.419 76.183  64.744  1.00 66.92  ? 282  ARG B CA    1 
ATOM   7733  C  C     . ARG H 4 282 ? 29.038 75.630  64.898  1.00 64.67  ? 282  ARG B C     1 
ATOM   7734  O  O     . ARG H 4 282 ? 28.309 75.995  65.806  1.00 64.04  ? 282  ARG B O     1 
ATOM   7735  C  CB    . ARG H 4 282 ? 31.390 75.021  64.698  1.00 65.11  ? 282  ARG B CB    1 
ATOM   7736  C  CG    . ARG H 4 282 ? 32.788 75.394  64.303  1.00 62.82  ? 282  ARG B CG    1 
ATOM   7737  C  CD    . ARG H 4 282 ? 33.508 74.187  63.772  1.00 59.36  ? 282  ARG B CD    1 
ATOM   7738  N  NE    . ARG H 4 282 ? 34.872 74.515  63.410  1.00 57.31  ? 282  ARG B NE    1 
ATOM   7739  C  CZ    . ARG H 4 282 ? 35.717 73.635  62.904  1.00 57.66  ? 282  ARG B CZ    1 
ATOM   7740  N  NH1   . ARG H 4 282 ? 35.313 72.384  62.707  1.00 58.09  ? 282  ARG B NH1   1 
ATOM   7741  N  NH2   . ARG H 4 282 ? 36.956 73.995  62.606  1.00 57.07  ? 282  ARG B NH2   1 
ATOM   7742  N  N     . TYR H 4 283 ? 28.710 74.719  63.998  1.00 63.27  ? 283  TYR B N     1 
ATOM   7743  C  CA    . TYR H 4 283 ? 27.410 74.067  63.936  1.00 62.48  ? 283  TYR B CA    1 
ATOM   7744  C  C     . TYR H 4 283 ? 26.249 74.972  64.332  1.00 61.44  ? 283  TYR B C     1 
ATOM   7745  O  O     . TYR H 4 283 ? 25.475 74.647  65.231  1.00 61.49  ? 283  TYR B O     1 
ATOM   7746  C  CB    . TYR H 4 283 ? 27.411 72.777  64.777  1.00 62.36  ? 283  TYR B CB    1 
ATOM   7747  C  CG    . TYR H 4 283 ? 28.568 71.857  64.452  1.00 62.12  ? 283  TYR B CG    1 
ATOM   7748  C  CD1   . TYR H 4 283 ? 29.782 71.987  65.112  1.00 62.66  ? 283  TYR B CD1   1 
ATOM   7749  C  CD2   . TYR H 4 283 ? 28.483 70.932  63.422  1.00 61.86  ? 283  TYR B CD2   1 
ATOM   7750  C  CE1   . TYR H 4 283 ? 30.886 71.229  64.752  1.00 62.40  ? 283  TYR B CE1   1 
ATOM   7751  C  CE2   . TYR H 4 283 ? 29.584 70.166  63.051  1.00 62.16  ? 283  TYR B CE2   1 
ATOM   7752  C  CZ    . TYR H 4 283 ? 30.783 70.329  63.723  1.00 62.35  ? 283  TYR B CZ    1 
ATOM   7753  O  OH    . TYR H 4 283 ? 31.901 69.634  63.347  1.00 62.66  ? 283  TYR B OH    1 
ATOM   7754  N  N     . LEU H 4 284 ? 26.122 76.110  63.649  1.00 60.61  ? 284  LEU B N     1 
ATOM   7755  C  CA    . LEU H 4 284 ? 25.032 77.042  63.934  1.00 58.83  ? 284  LEU B CA    1 
ATOM   7756  C  C     . LEU H 4 284 ? 23.861 76.820  62.985  1.00 57.65  ? 284  LEU B C     1 
ATOM   7757  O  O     . LEU H 4 284 ? 22.753 77.313  63.213  1.00 57.77  ? 284  LEU B O     1 
ATOM   7758  C  CB    . LEU H 4 284 ? 25.542 78.475  63.856  1.00 58.58  ? 284  LEU B CB    1 
ATOM   7759  C  CG    . LEU H 4 284 ? 26.342 78.784  65.117  1.00 57.74  ? 284  LEU B CG    1 
ATOM   7760  C  CD1   . LEU H 4 284 ? 27.192 79.999  64.918  1.00 58.95  ? 284  LEU B CD1   1 
ATOM   7761  C  CD2   . LEU H 4 284 ? 25.382 78.970  66.270  1.00 57.83  ? 284  LEU B CD2   1 
ATOM   7762  N  N     . ALA H 4 285 ? 24.135 76.059  61.927  1.00 55.75  ? 285  ALA B N     1 
ATOM   7763  C  CA    . ALA H 4 285 ? 23.154 75.692  60.917  1.00 53.59  ? 285  ALA B CA    1 
ATOM   7764  C  C     . ALA H 4 285 ? 23.675 74.456  60.193  1.00 52.62  ? 285  ALA B C     1 
ATOM   7765  O  O     . ALA H 4 285 ? 24.886 74.223  60.140  1.00 54.23  ? 285  ALA B O     1 
ATOM   7766  C  CB    . ALA H 4 285 ? 22.960 76.822  59.939  1.00 53.24  ? 285  ALA B CB    1 
ATOM   7767  N  N     . TRP H 4 286 ? 22.759 73.666  59.649  1.00 49.90  ? 286  TRP B N     1 
ATOM   7768  C  CA    . TRP H 4 286 ? 23.084 72.448  58.918  1.00 47.20  ? 286  TRP B CA    1 
ATOM   7769  C  C     . TRP H 4 286 ? 24.401 72.411  58.138  1.00 46.99  ? 286  TRP B C     1 
ATOM   7770  O  O     . TRP H 4 286 ? 24.844 73.415  57.594  1.00 46.65  ? 286  TRP B O     1 
ATOM   7771  C  CB    . TRP H 4 286 ? 21.937 72.147  57.985  1.00 44.88  ? 286  TRP B CB    1 
ATOM   7772  C  CG    . TRP H 4 286 ? 20.702 72.001  58.732  1.00 42.83  ? 286  TRP B CG    1 
ATOM   7773  C  CD1   . TRP H 4 286 ? 20.588 71.521  59.980  1.00 41.88  ? 286  TRP B CD1   1 
ATOM   7774  C  CD2   . TRP H 4 286 ? 19.374 72.222  58.259  1.00 43.42  ? 286  TRP B CD2   1 
ATOM   7775  N  NE1   . TRP H 4 286 ? 19.271 71.409  60.329  1.00 43.25  ? 286  TRP B NE1   1 
ATOM   7776  C  CE2   . TRP H 4 286 ? 18.501 71.836  59.284  1.00 43.26  ? 286  TRP B CE2   1 
ATOM   7777  C  CE3   . TRP H 4 286 ? 18.837 72.705  57.068  1.00 44.55  ? 286  TRP B CE3   1 
ATOM   7778  C  CZ2   . TRP H 4 286 ? 17.115 71.915  59.159  1.00 43.40  ? 286  TRP B CZ2   1 
ATOM   7779  C  CZ3   . TRP H 4 286 ? 17.455 72.785  56.947  1.00 44.46  ? 286  TRP B CZ3   1 
ATOM   7780  C  CH2   . TRP H 4 286 ? 16.614 72.391  57.986  1.00 43.48  ? 286  TRP B CH2   1 
ATOM   7781  N  N     . SER H 4 287 ? 25.023 71.239  58.081  1.00 45.67  ? 287  SER B N     1 
ATOM   7782  C  CA    . SER H 4 287 ? 26.280 71.085  57.371  1.00 45.28  ? 287  SER B CA    1 
ATOM   7783  C  C     . SER H 4 287 ? 26.399 69.658  56.902  1.00 44.08  ? 287  SER B C     1 
ATOM   7784  O  O     . SER H 4 287 ? 25.434 68.925  56.967  1.00 44.44  ? 287  SER B O     1 
ATOM   7785  C  CB    . SER H 4 287 ? 27.444 71.378  58.282  1.00 46.76  ? 287  SER B CB    1 
ATOM   7786  O  OG    . SER H 4 287 ? 27.788 70.192  58.955  1.00 49.73  ? 287  SER B OG    1 
ATOM   7787  N  N     . GLY H 4 288 ? 27.584 69.260  56.454  1.00 43.70  ? 288  GLY B N     1 
ATOM   7788  C  CA    . GLY H 4 288 ? 27.787 67.904  55.961  1.00 44.98  ? 288  GLY B CA    1 
ATOM   7789  C  C     . GLY H 4 288 ? 27.183 66.716  56.715  1.00 45.30  ? 288  GLY B C     1 
ATOM   7790  O  O     . GLY H 4 288 ? 26.372 65.950  56.156  1.00 44.42  ? 288  GLY B O     1 
ATOM   7791  N  N     . HIS H 4 289 ? 27.569 66.542  57.980  1.00 44.74  ? 289  HIS B N     1 
ATOM   7792  C  CA    . HIS H 4 289 ? 27.061 65.420  58.772  1.00 44.18  ? 289  HIS B CA    1 
ATOM   7793  C  C     . HIS H 4 289 ? 25.626 65.518  59.263  1.00 43.88  ? 289  HIS B C     1 
ATOM   7794  O  O     . HIS H 4 289 ? 25.020 64.528  59.665  1.00 44.27  ? 289  HIS B O     1 
ATOM   7795  C  CB    . HIS H 4 289 ? 27.985 65.167  59.961  1.00 44.70  ? 289  HIS B CB    1 
ATOM   7796  C  CG    . HIS H 4 289 ? 29.063 64.178  59.668  1.00 46.77  ? 289  HIS B CG    1 
ATOM   7797  N  ND1   . HIS H 4 289 ? 29.944 64.329  58.618  1.00 47.85  ? 289  HIS B ND1   1 
ATOM   7798  C  CD2   . HIS H 4 289 ? 29.352 62.982  60.230  1.00 47.43  ? 289  HIS B CD2   1 
ATOM   7799  C  CE1   . HIS H 4 289 ? 30.724 63.266  58.543  1.00 47.89  ? 289  HIS B CE1   1 
ATOM   7800  N  NE2   . HIS H 4 289 ? 30.385 62.432  59.510  1.00 48.12  ? 289  HIS B NE2   1 
ATOM   7801  N  N     . SER H 4 290 ? 25.069 66.712  59.214  1.00 43.36  ? 290  SER B N     1 
ATOM   7802  C  CA    . SER H 4 290 ? 23.720 66.918  59.703  1.00 43.12  ? 290  SER B CA    1 
ATOM   7803  C  C     . SER H 4 290 ? 22.710 65.897  59.244  1.00 42.46  ? 290  SER B C     1 
ATOM   7804  O  O     . SER H 4 290 ? 21.696 65.703  59.890  1.00 42.63  ? 290  SER B O     1 
ATOM   7805  C  CB    . SER H 4 290 ? 23.269 68.314  59.337  1.00 44.10  ? 290  SER B CB    1 
ATOM   7806  O  OG    . SER H 4 290 ? 24.294 69.230  59.703  1.00 47.38  ? 290  SER B OG    1 
ATOM   7807  N  N     . ALA H 4 291 ? 22.972 65.235  58.130  1.00 42.71  ? 291  ALA B N     1 
ATOM   7808  C  CA    . ALA H 4 291 ? 22.023 64.230  57.672  1.00 42.24  ? 291  ALA B CA    1 
ATOM   7809  C  C     . ALA H 4 291 ? 22.303 62.932  58.432  1.00 41.47  ? 291  ALA B C     1 
ATOM   7810  O  O     . ALA H 4 291 ? 21.381 62.275  58.908  1.00 41.04  ? 291  ALA B O     1 
ATOM   7811  C  CB    . ALA H 4 291 ? 22.161 64.014  56.178  1.00 43.27  ? 291  ALA B CB    1 
ATOM   7812  N  N     . ARG H 4 292 ? 23.579 62.564  58.541  1.00 39.40  ? 292  ARG B N     1 
ATOM   7813  C  CA    . ARG H 4 292 ? 23.940 61.352  59.256  1.00 36.99  ? 292  ARG B CA    1 
ATOM   7814  C  C     . ARG H 4 292 ? 23.444 61.403  60.698  1.00 36.66  ? 292  ARG B C     1 
ATOM   7815  O  O     . ARG H 4 292 ? 22.605 60.581  61.079  1.00 38.72  ? 292  ARG B O     1 
ATOM   7816  C  CB    . ARG H 4 292 ? 25.453 61.130  59.237  1.00 34.77  ? 292  ARG B CB    1 
ATOM   7817  C  CG    . ARG H 4 292 ? 25.909 60.293  58.092  1.00 32.93  ? 292  ARG B CG    1 
ATOM   7818  C  CD    . ARG H 4 292 ? 27.364 60.538  57.767  1.00 33.19  ? 292  ARG B CD    1 
ATOM   7819  N  NE    . ARG H 4 292 ? 28.286 59.585  58.370  1.00 35.09  ? 292  ARG B NE    1 
ATOM   7820  C  CZ    . ARG H 4 292 ? 28.279 58.276  58.127  1.00 37.84  ? 292  ARG B CZ    1 
ATOM   7821  N  NH1   . ARG H 4 292 ? 27.387 57.758  57.293  1.00 40.35  ? 292  ARG B NH1   1 
ATOM   7822  N  NH2   . ARG H 4 292 ? 29.175 57.477  58.707  1.00 37.99  ? 292  ARG B NH2   1 
ATOM   7823  N  N     . VAL H 4 293 ? 23.928 62.354  61.500  1.00 34.11  ? 293  VAL B N     1 
ATOM   7824  C  CA    . VAL H 4 293 ? 23.497 62.404  62.885  1.00 30.46  ? 293  VAL B CA    1 
ATOM   7825  C  C     . VAL H 4 293 ? 21.999 62.419  62.887  1.00 30.37  ? 293  VAL B C     1 
ATOM   7826  O  O     . VAL H 4 293 ? 21.381 61.759  63.707  1.00 31.44  ? 293  VAL B O     1 
ATOM   7827  C  CB    . VAL H 4 293 ? 23.991 63.630  63.595  1.00 28.18  ? 293  VAL B CB    1 
ATOM   7828  C  CG1   . VAL H 4 293 ? 25.044 64.264  62.790  1.00 29.37  ? 293  VAL B CG1   1 
ATOM   7829  C  CG2   . VAL H 4 293 ? 22.879 64.569  63.847  1.00 26.73  ? 293  VAL B CG2   1 
ATOM   7830  N  N     . GLY H 4 294 ? 21.407 63.156  61.953  1.00 30.05  ? 294  GLY B N     1 
ATOM   7831  C  CA    . GLY H 4 294 ? 19.956 63.204  61.886  1.00 29.00  ? 294  GLY B CA    1 
ATOM   7832  C  C     . GLY H 4 294 ? 19.371 61.809  61.805  1.00 28.08  ? 294  GLY B C     1 
ATOM   7833  O  O     . GLY H 4 294 ? 18.815 61.306  62.756  1.00 26.71  ? 294  GLY B O     1 
ATOM   7834  N  N     . ALA H 4 295 ? 19.522 61.161  60.667  1.00 28.38  ? 295  ALA B N     1 
ATOM   7835  C  CA    . ALA H 4 295 ? 18.984 59.828  60.491  1.00 30.87  ? 295  ALA B CA    1 
ATOM   7836  C  C     . ALA H 4 295 ? 19.271 58.930  61.659  1.00 32.14  ? 295  ALA B C     1 
ATOM   7837  O  O     . ALA H 4 295 ? 18.371 58.264  62.145  1.00 32.43  ? 295  ALA B O     1 
ATOM   7838  C  CB    . ALA H 4 295 ? 19.532 59.212  59.246  1.00 31.70  ? 295  ALA B CB    1 
ATOM   7839  N  N     . ALA H 4 296 ? 20.528 58.893  62.092  1.00 33.39  ? 296  ALA B N     1 
ATOM   7840  C  CA    . ALA H 4 296 ? 20.929 58.067  63.229  1.00 35.11  ? 296  ALA B CA    1 
ATOM   7841  C  C     . ALA H 4 296 ? 19.980 58.271  64.421  1.00 35.94  ? 296  ALA B C     1 
ATOM   7842  O  O     . ALA H 4 296 ? 19.465 57.319  65.005  1.00 35.77  ? 296  ALA B O     1 
ATOM   7843  C  CB    . ALA H 4 296 ? 22.346 58.408  63.635  1.00 34.27  ? 296  ALA B CB    1 
ATOM   7844  N  N     . ARG H 4 297 ? 19.739 59.519  64.779  1.00 36.65  ? 297  ARG B N     1 
ATOM   7845  C  CA    . ARG H 4 297 ? 18.851 59.776  65.876  1.00 38.28  ? 297  ARG B CA    1 
ATOM   7846  C  C     . ARG H 4 297 ? 17.430 59.317  65.617  1.00 41.15  ? 297  ARG B C     1 
ATOM   7847  O  O     . ARG H 4 297 ? 16.803 58.758  66.513  1.00 43.03  ? 297  ARG B O     1 
ATOM   7848  C  CB    . ARG H 4 297 ? 18.884 61.247  66.229  1.00 37.22  ? 297  ARG B CB    1 
ATOM   7849  C  CG    . ARG H 4 297 ? 19.973 61.516  67.207  1.00 38.04  ? 297  ARG B CG    1 
ATOM   7850  C  CD    . ARG H 4 297 ? 20.566 62.907  67.122  1.00 38.70  ? 297  ARG B CD    1 
ATOM   7851  N  NE    . ARG H 4 297 ? 19.599 63.950  67.415  1.00 39.23  ? 297  ARG B NE    1 
ATOM   7852  C  CZ    . ARG H 4 297 ? 19.946 65.202  67.661  1.00 38.38  ? 297  ARG B CZ    1 
ATOM   7853  N  NH1   . ARG H 4 297 ? 21.229 65.546  67.653  1.00 36.11  ? 297  ARG B NH1   1 
ATOM   7854  N  NH2   . ARG H 4 297 ? 19.007 66.104  67.889  1.00 38.47  ? 297  ARG B NH2   1 
ATOM   7855  N  N     . ASP H 4 298 ? 16.905 59.527  64.414  1.00 42.66  ? 298  ASP B N     1 
ATOM   7856  C  CA    . ASP H 4 298 ? 15.534 59.095  64.143  1.00 44.87  ? 298  ASP B CA    1 
ATOM   7857  C  C     . ASP H 4 298 ? 15.391 57.603  64.305  1.00 44.75  ? 298  ASP B C     1 
ATOM   7858  O  O     . ASP H 4 298 ? 14.417 57.119  64.867  1.00 43.84  ? 298  ASP B O     1 
ATOM   7859  C  CB    . ASP H 4 298 ? 15.092 59.454  62.731  1.00 47.94  ? 298  ASP B CB    1 
ATOM   7860  C  CG    . ASP H 4 298 ? 15.006 60.950  62.504  1.00 52.35  ? 298  ASP B CG    1 
ATOM   7861  O  OD1   . ASP H 4 298 ? 14.855 61.710  63.494  1.00 54.83  ? 298  ASP B OD1   1 
ATOM   7862  O  OD2   . ASP H 4 298 ? 15.073 61.369  61.322  1.00 54.19  ? 298  ASP B OD2   1 
ATOM   7863  N  N     . MET H 4 299 ? 16.367 56.874  63.793  1.00 46.18  ? 299  MET B N     1 
ATOM   7864  C  CA    . MET H 4 299 ? 16.317 55.438  63.873  1.00 48.29  ? 299  MET B CA    1 
ATOM   7865  C  C     . MET H 4 299 ? 16.351 55.058  65.324  1.00 50.35  ? 299  MET B C     1 
ATOM   7866  O  O     . MET H 4 299 ? 15.588 54.210  65.751  1.00 53.03  ? 299  MET B O     1 
ATOM   7867  C  CB    . MET H 4 299 ? 17.505 54.814  63.160  1.00 48.12  ? 299  MET B CB    1 
ATOM   7868  C  CG    . MET H 4 299 ? 17.767 55.410  61.818  1.00 49.00  ? 299  MET B CG    1 
ATOM   7869  S  SD    . MET H 4 299 ? 18.969 54.495  60.881  1.00 49.96  ? 299  MET B SD    1 
ATOM   7870  C  CE    . MET H 4 299 ? 18.041 52.992  60.573  1.00 46.86  ? 299  MET B CE    1 
ATOM   7871  N  N     . ALA H 4 300 ? 17.235 55.683  66.093  1.00 51.54  ? 300  ALA B N     1 
ATOM   7872  C  CA    . ALA H 4 300 ? 17.344 55.358  67.514  1.00 51.43  ? 300  ALA B CA    1 
ATOM   7873  C  C     . ALA H 4 300 ? 15.973 55.400  68.174  1.00 51.09  ? 300  ALA B C     1 
ATOM   7874  O  O     . ALA H 4 300 ? 15.545 54.416  68.789  1.00 49.45  ? 300  ALA B O     1 
ATOM   7875  C  CB    . ALA H 4 300 ? 18.289 56.324  68.199  1.00 50.89  ? 300  ALA B CB    1 
ATOM   7876  N  N     . ARG H 4 301 ? 15.297 56.539  68.025  1.00 51.56  ? 301  ARG B N     1 
ATOM   7877  C  CA    . ARG H 4 301 ? 13.964 56.743  68.581  1.00 53.72  ? 301  ARG B CA    1 
ATOM   7878  C  C     . ARG H 4 301 ? 13.009 55.682  68.075  1.00 52.95  ? 301  ARG B C     1 
ATOM   7879  O  O     . ARG H 4 301 ? 12.432 54.938  68.854  1.00 53.20  ? 301  ARG B O     1 
ATOM   7880  C  CB    . ARG H 4 301 ? 13.382 58.093  68.163  1.00 57.00  ? 301  ARG B CB    1 
ATOM   7881  C  CG    . ARG H 4 301 ? 13.953 59.313  68.821  1.00 62.80  ? 301  ARG B CG    1 
ATOM   7882  C  CD    . ARG H 4 301 ? 13.531 60.579  68.042  1.00 67.64  ? 301  ARG B CD    1 
ATOM   7883  N  NE    . ARG H 4 301 ? 14.412 61.709  68.361  1.00 71.20  ? 301  ARG B NE    1 
ATOM   7884  C  CZ    . ARG H 4 301 ? 14.454 62.858  67.694  1.00 71.50  ? 301  ARG B CZ    1 
ATOM   7885  N  NH1   . ARG H 4 301 ? 13.648 63.044  66.649  1.00 70.51  ? 301  ARG B NH1   1 
ATOM   7886  N  NH2   . ARG H 4 301 ? 15.319 63.807  68.073  1.00 71.18  ? 301  ARG B NH2   1 
ATOM   7887  N  N     . ALA H 4 302 ? 12.824 55.644  66.761  1.00 52.12  ? 302  ALA B N     1 
ATOM   7888  C  CA    . ALA H 4 302 ? 11.925 54.686  66.140  1.00 51.42  ? 302  ALA B CA    1 
ATOM   7889  C  C     . ALA H 4 302 ? 12.055 53.278  66.733  1.00 50.71  ? 302  ALA B C     1 
ATOM   7890  O  O     . ALA H 4 302 ? 11.135 52.467  66.633  1.00 51.30  ? 302  ALA B O     1 
ATOM   7891  C  CB    . ALA H 4 302 ? 12.168 54.657  64.645  1.00 51.73  ? 302  ALA B CB    1 
ATOM   7892  N  N     . GLY H 4 303 ? 13.197 52.988  67.347  1.00 50.17  ? 303  GLY B N     1 
ATOM   7893  C  CA    . GLY H 4 303 ? 13.392 51.688  67.957  1.00 49.21  ? 303  GLY B CA    1 
ATOM   7894  C  C     . GLY H 4 303 ? 14.009 50.632  67.067  1.00 48.88  ? 303  GLY B C     1 
ATOM   7895  O  O     . GLY H 4 303 ? 13.699 49.445  67.202  1.00 49.26  ? 303  GLY B O     1 
ATOM   7896  N  N     . VAL H 4 304 ? 14.882 51.038  66.152  1.00 48.51  ? 304  VAL B N     1 
ATOM   7897  C  CA    . VAL H 4 304 ? 15.519 50.060  65.287  1.00 48.08  ? 304  VAL B CA    1 
ATOM   7898  C  C     . VAL H 4 304 ? 16.688 49.495  66.078  1.00 48.33  ? 304  VAL B C     1 
ATOM   7899  O  O     . VAL H 4 304 ? 17.287 50.210  66.880  1.00 47.31  ? 304  VAL B O     1 
ATOM   7900  C  CB    . VAL H 4 304 ? 16.056 50.680  63.986  1.00 48.11  ? 304  VAL B CB    1 
ATOM   7901  C  CG1   . VAL H 4 304 ? 15.903 49.671  62.865  1.00 48.11  ? 304  VAL B CG1   1 
ATOM   7902  C  CG2   . VAL H 4 304 ? 15.348 51.990  63.664  1.00 46.63  ? 304  VAL B CG2   1 
ATOM   7903  N  N     . SER H 4 305 ? 17.009 48.224  65.846  1.00 48.82  ? 305  SER B N     1 
ATOM   7904  C  CA    . SER H 4 305 ? 18.092 47.542  66.558  1.00 49.27  ? 305  SER B CA    1 
ATOM   7905  C  C     . SER H 4 305 ? 19.488 48.065  66.262  1.00 48.97  ? 305  SER B C     1 
ATOM   7906  O  O     . SER H 4 305 ? 19.666 48.904  65.393  1.00 49.53  ? 305  SER B O     1 
ATOM   7907  C  CB    . SER H 4 305 ? 18.066 46.057  66.242  1.00 50.33  ? 305  SER B CB    1 
ATOM   7908  O  OG    . SER H 4 305 ? 18.646 45.834  64.970  1.00 52.55  ? 305  SER B OG    1 
ATOM   7909  N  N     . ILE H 4 306 ? 20.474 47.549  66.992  1.00 48.71  ? 306  ILE B N     1 
ATOM   7910  C  CA    . ILE H 4 306 ? 21.868 47.952  66.827  1.00 48.88  ? 306  ILE B CA    1 
ATOM   7911  C  C     . ILE H 4 306 ? 22.451 47.458  65.496  1.00 50.42  ? 306  ILE B C     1 
ATOM   7912  O  O     . ILE H 4 306 ? 22.968 48.252  64.702  1.00 51.64  ? 306  ILE B O     1 
ATOM   7913  C  CB    . ILE H 4 306 ? 22.776 47.386  67.954  1.00 48.19  ? 306  ILE B CB    1 
ATOM   7914  C  CG1   . ILE H 4 306 ? 22.234 47.758  69.337  1.00 46.97  ? 306  ILE B CG1   1 
ATOM   7915  C  CG2   . ILE H 4 306 ? 24.190 47.924  67.786  1.00 47.19  ? 306  ILE B CG2   1 
ATOM   7916  C  CD1   . ILE H 4 306 ? 22.619 49.144  69.798  1.00 44.25  ? 306  ILE B CD1   1 
ATOM   7917  N  N     . PRO H 4 307 ? 22.367 46.143  65.224  1.00 50.70  ? 307  PRO B N     1 
ATOM   7918  C  CA    . PRO H 4 307 ? 22.908 45.602  63.982  1.00 51.40  ? 307  PRO B CA    1 
ATOM   7919  C  C     . PRO H 4 307 ? 22.240 46.167  62.753  1.00 53.61  ? 307  PRO B C     1 
ATOM   7920  O  O     . PRO H 4 307 ? 22.814 46.092  61.667  1.00 55.47  ? 307  PRO B O     1 
ATOM   7921  C  CB    . PRO H 4 307 ? 22.636 44.125  64.113  1.00 50.02  ? 307  PRO B CB    1 
ATOM   7922  C  CG    . PRO H 4 307 ? 21.313 44.143  64.716  1.00 49.94  ? 307  PRO B CG    1 
ATOM   7923  C  CD    . PRO H 4 307 ? 21.488 45.147  65.845  1.00 50.13  ? 307  PRO B CD    1 
ATOM   7924  N  N     . GLU H 4 308 ? 21.025 46.703  62.904  1.00 54.56  ? 308  GLU B N     1 
ATOM   7925  C  CA    . GLU H 4 308 ? 20.309 47.275  61.761  1.00 54.89  ? 308  GLU B CA    1 
ATOM   7926  C  C     . GLU H 4 308 ? 20.667 48.757  61.580  1.00 52.77  ? 308  GLU B C     1 
ATOM   7927  O  O     . GLU H 4 308 ? 20.553 49.297  60.477  1.00 53.19  ? 308  GLU B O     1 
ATOM   7928  C  CB    . GLU H 4 308 ? 18.794 47.077  61.910  1.00 58.25  ? 308  GLU B CB    1 
ATOM   7929  C  CG    . GLU H 4 308 ? 18.355 45.592  61.953  1.00 64.96  ? 308  GLU B CG    1 
ATOM   7930  C  CD    . GLU H 4 308 ? 16.816 45.380  61.920  1.00 69.49  ? 308  GLU B CD    1 
ATOM   7931  O  OE1   . GLU H 4 308 ? 16.094 45.802  62.875  1.00 70.46  ? 308  GLU B OE1   1 
ATOM   7932  O  OE2   . GLU H 4 308 ? 16.331 44.779  60.923  1.00 71.12  ? 308  GLU B OE2   1 
ATOM   7933  N  N     . ILE H 4 309 ? 21.111 49.412  62.651  1.00 49.79  ? 309  ILE B N     1 
ATOM   7934  C  CA    . ILE H 4 309 ? 21.524 50.799  62.542  1.00 47.35  ? 309  ILE B CA    1 
ATOM   7935  C  C     . ILE H 4 309 ? 22.940 50.793  62.024  1.00 48.08  ? 309  ILE B C     1 
ATOM   7936  O  O     . ILE H 4 309 ? 23.293 51.574  61.151  1.00 46.92  ? 309  ILE B O     1 
ATOM   7937  C  CB    . ILE H 4 309 ? 21.551 51.528  63.875  1.00 44.22  ? 309  ILE B CB    1 
ATOM   7938  C  CG1   . ILE H 4 309 ? 20.145 51.961  64.255  1.00 42.91  ? 309  ILE B CG1   1 
ATOM   7939  C  CG2   . ILE H 4 309 ? 22.452 52.731  63.776  1.00 41.83  ? 309  ILE B CG2   1 
ATOM   7940  C  CD1   . ILE H 4 309 ? 20.105 53.094  65.259  1.00 41.90  ? 309  ILE B CD1   1 
ATOM   7941  N  N     . MET H 4 310 ? 23.753 49.904  62.577  1.00 49.68  ? 310  MET B N     1 
ATOM   7942  C  CA    . MET H 4 310 ? 25.142 49.803  62.160  1.00 52.24  ? 310  MET B CA    1 
ATOM   7943  C  C     . MET H 4 310 ? 25.222 49.712  60.653  1.00 52.33  ? 310  MET B C     1 
ATOM   7944  O  O     . MET H 4 310 ? 25.995 50.411  60.018  1.00 52.69  ? 310  MET B O     1 
ATOM   7945  C  CB    . MET H 4 310 ? 25.805 48.565  62.751  1.00 54.05  ? 310  MET B CB    1 
ATOM   7946  C  CG    . MET H 4 310 ? 26.100 48.621  64.226  1.00 57.65  ? 310  MET B CG    1 
ATOM   7947  S  SD    . MET H 4 310 ? 27.389 47.400  64.569  1.00 63.48  ? 310  MET B SD    1 
ATOM   7948  C  CE    . MET H 4 310 ? 26.468 45.768  64.563  1.00 61.21  ? 310  MET B CE    1 
ATOM   7949  N  N     . GLN H 4 311 ? 24.420 48.826  60.092  1.00 52.98  ? 311  GLN B N     1 
ATOM   7950  C  CA    . GLN H 4 311 ? 24.366 48.615  58.662  1.00 54.31  ? 311  GLN B CA    1 
ATOM   7951  C  C     . GLN H 4 311 ? 23.881 49.852  57.912  1.00 54.47  ? 311  GLN B C     1 
ATOM   7952  O  O     . GLN H 4 311 ? 24.439 50.235  56.894  1.00 54.79  ? 311  GLN B O     1 
ATOM   7953  C  CB    . GLN H 4 311 ? 23.428 47.460  58.383  1.00 56.53  ? 311  GLN B CB    1 
ATOM   7954  C  CG    . GLN H 4 311 ? 24.117 46.207  57.950  1.00 60.50  ? 311  GLN B CG    1 
ATOM   7955  C  CD    . GLN H 4 311 ? 24.230 46.131  56.444  1.00 63.13  ? 311  GLN B CD    1 
ATOM   7956  O  OE1   . GLN H 4 311 ? 23.253 46.420  55.728  1.00 63.76  ? 311  GLN B OE1   1 
ATOM   7957  N  NE2   . GLN H 4 311 ? 25.413 45.730  55.944  1.00 63.35  ? 311  GLN B NE2   1 
ATOM   7958  N  N     . ALA H 4 312 ? 22.831 50.480  58.413  1.00 53.58  ? 312  ALA B N     1 
ATOM   7959  C  CA    . ALA H 4 312 ? 22.295 51.661  57.762  1.00 51.74  ? 312  ALA B CA    1 
ATOM   7960  C  C     . ALA H 4 312 ? 23.236 52.873  57.771  1.00 50.50  ? 312  ALA B C     1 
ATOM   7961  O  O     . ALA H 4 312 ? 22.890 53.927  57.265  1.00 50.90  ? 312  ALA B O     1 
ATOM   7962  C  CB    . ALA H 4 312 ? 20.991 52.022  58.412  1.00 52.22  ? 312  ALA B CB    1 
ATOM   7963  N  N     . GLY H 4 313 ? 24.424 52.731  58.333  1.00 48.77  ? 313  GLY B N     1 
ATOM   7964  C  CA    . GLY H 4 313 ? 25.326 53.860  58.377  1.00 46.52  ? 313  GLY B CA    1 
ATOM   7965  C  C     . GLY H 4 313 ? 26.758 53.487  58.092  1.00 45.97  ? 313  GLY B C     1 
ATOM   7966  O  O     . GLY H 4 313 ? 27.655 54.317  58.164  1.00 46.32  ? 313  GLY B O     1 
ATOM   7967  N  N     . GLY H 4 314 ? 26.984 52.225  57.776  1.00 45.83  ? 314  GLY B N     1 
ATOM   7968  C  CA    . GLY H 4 314 ? 28.327 51.779  57.462  1.00 46.44  ? 314  GLY B CA    1 
ATOM   7969  C  C     . GLY H 4 314 ? 29.279 51.702  58.635  1.00 46.67  ? 314  GLY B C     1 
ATOM   7970  O  O     . GLY H 4 314 ? 30.485 51.943  58.501  1.00 47.57  ? 314  GLY B O     1 
ATOM   7971  N  N     . TRP H 4 315 ? 28.742 51.367  59.797  1.00 45.63  ? 315  TRP B N     1 
ATOM   7972  C  CA    . TRP H 4 315 ? 29.568 51.249  60.980  1.00 44.65  ? 315  TRP B CA    1 
ATOM   7973  C  C     . TRP H 4 315 ? 29.737 49.783  61.317  1.00 46.23  ? 315  TRP B C     1 
ATOM   7974  O  O     . TRP H 4 315 ? 28.872 48.981  61.052  1.00 47.65  ? 315  TRP B O     1 
ATOM   7975  C  CB    . TRP H 4 315 ? 28.912 51.975  62.129  1.00 38.82  ? 315  TRP B CB    1 
ATOM   7976  C  CG    . TRP H 4 315 ? 28.714 53.424  61.896  1.00 32.70  ? 315  TRP B CG    1 
ATOM   7977  C  CD1   . TRP H 4 315 ? 29.674 54.391  61.803  1.00 29.82  ? 315  TRP B CD1   1 
ATOM   7978  C  CD2   . TRP H 4 315 ? 27.470 54.095  61.858  1.00 31.21  ? 315  TRP B CD2   1 
ATOM   7979  N  NE1   . TRP H 4 315 ? 29.096 55.629  61.723  1.00 27.00  ? 315  TRP B NE1   1 
ATOM   7980  C  CE2   . TRP H 4 315 ? 27.738 55.472  61.757  1.00 29.83  ? 315  TRP B CE2   1 
ATOM   7981  C  CE3   . TRP H 4 315 ? 26.145 53.668  61.912  1.00 31.25  ? 315  TRP B CE3   1 
ATOM   7982  C  CZ2   . TRP H 4 315 ? 26.725 56.420  61.710  1.00 29.95  ? 315  TRP B CZ2   1 
ATOM   7983  C  CZ3   . TRP H 4 315 ? 25.142 54.618  61.867  1.00 31.46  ? 315  TRP B CZ3   1 
ATOM   7984  C  CH2   . TRP H 4 315 ? 25.437 55.976  61.768  1.00 29.99  ? 315  TRP B CH2   1 
ATOM   7985  N  N     . THR H 4 316 ? 30.850 49.418  61.908  1.00 48.09  ? 316  THR B N     1 
ATOM   7986  C  CA    . THR H 4 316 ? 31.036 48.028  62.219  1.00 50.82  ? 316  THR B CA    1 
ATOM   7987  C  C     . THR H 4 316 ? 31.139 47.783  63.707  1.00 52.44  ? 316  THR B C     1 
ATOM   7988  O  O     . THR H 4 316 ? 31.686 46.763  64.115  1.00 52.99  ? 316  THR B O     1 
ATOM   7989  C  CB    . THR H 4 316 ? 32.299 47.476  61.537  1.00 51.02  ? 316  THR B CB    1 
ATOM   7990  O  OG1   . THR H 4 316 ? 33.445 48.223  61.964  1.00 51.56  ? 316  THR B OG1   1 
ATOM   7991  C  CG2   . THR H 4 316 ? 32.173 47.574  60.035  1.00 51.95  ? 316  THR B CG2   1 
ATOM   7992  N  N     . ASN H 4 317 ? 30.630 48.697  64.527  1.00 54.38  ? 317  ASN B N     1 
ATOM   7993  C  CA    . ASN H 4 317 ? 30.720 48.470  65.957  1.00 56.62  ? 317  ASN B CA    1 
ATOM   7994  C  C     . ASN H 4 317 ? 29.825 49.351  66.811  1.00 57.80  ? 317  ASN B C     1 
ATOM   7995  O  O     . ASN H 4 317 ? 29.751 50.558  66.622  1.00 58.94  ? 317  ASN B O     1 
ATOM   7996  C  CB    . ASN H 4 317 ? 32.180 48.597  66.413  1.00 58.83  ? 317  ASN B CB    1 
ATOM   7997  C  CG    . ASN H 4 317 ? 32.557 50.011  66.816  1.00 61.50  ? 317  ASN B CG    1 
ATOM   7998  O  OD1   . ASN H 4 317 ? 32.062 50.545  67.828  1.00 62.20  ? 317  ASN B OD1   1 
ATOM   7999  N  ND2   . ASN H 4 317 ? 33.447 50.631  66.033  1.00 63.45  ? 317  ASN B ND2   1 
ATOM   8000  N  N     . VAL H 4 318 ? 29.166 48.727  67.782  1.00 59.41  ? 318  VAL B N     1 
ATOM   8001  C  CA    . VAL H 4 318 ? 28.243 49.415  68.683  1.00 59.73  ? 318  VAL B CA    1 
ATOM   8002  C  C     . VAL H 4 318 ? 28.769 50.731  69.184  1.00 59.39  ? 318  VAL B C     1 
ATOM   8003  O  O     . VAL H 4 318 ? 28.020 51.692  69.333  1.00 58.06  ? 318  VAL B O     1 
ATOM   8004  C  CB    . VAL H 4 318 ? 27.938 48.576  69.935  1.00 59.86  ? 318  VAL B CB    1 
ATOM   8005  C  CG1   . VAL H 4 318 ? 26.498 48.785  70.333  1.00 60.21  ? 318  VAL B CG1   1 
ATOM   8006  C  CG2   . VAL H 4 318 ? 28.266 47.091  69.695  1.00 60.39  ? 318  VAL B CG2   1 
ATOM   8007  N  N     . ASN H 4 319 ? 30.068 50.765  69.438  1.00 60.71  ? 319  ASN B N     1 
ATOM   8008  C  CA    . ASN H 4 319 ? 30.667 51.959  69.980  1.00 64.30  ? 319  ASN B CA    1 
ATOM   8009  C  C     . ASN H 4 319 ? 30.874 53.115  69.023  1.00 64.68  ? 319  ASN B C     1 
ATOM   8010  O  O     . ASN H 4 319 ? 31.831 53.860  69.161  1.00 66.19  ? 319  ASN B O     1 
ATOM   8011  C  CB    . ASN H 4 319 ? 31.987 51.635  70.702  1.00 66.18  ? 319  ASN B CB    1 
ATOM   8012  C  CG    . ASN H 4 319 ? 32.342 52.694  71.786  1.00 70.03  ? 319  ASN B CG    1 
ATOM   8013  O  OD1   . ASN H 4 319 ? 33.095 52.417  72.733  1.00 72.18  ? 319  ASN B OD1   1 
ATOM   8014  N  ND2   . ASN H 4 319 ? 31.791 53.908  71.642  1.00 70.56  ? 319  ASN B ND2   1 
ATOM   8015  N  N     . ILE H 4 320 ? 30.005 53.274  68.041  1.00 64.46  ? 320  ILE B N     1 
ATOM   8016  C  CA    . ILE H 4 320 ? 30.146 54.420  67.160  1.00 64.40  ? 320  ILE B CA    1 
ATOM   8017  C  C     . ILE H 4 320 ? 28.726 54.854  66.994  1.00 65.44  ? 320  ILE B C     1 
ATOM   8018  O  O     . ILE H 4 320 ? 28.414 56.033  67.111  1.00 67.70  ? 320  ILE B O     1 
ATOM   8019  C  CB    . ILE H 4 320 ? 30.747 54.086  65.803  1.00 62.56  ? 320  ILE B CB    1 
ATOM   8020  C  CG1   . ILE H 4 320 ? 32.140 53.467  65.969  1.00 61.96  ? 320  ILE B CG1   1 
ATOM   8021  C  CG2   . ILE H 4 320 ? 30.861 55.359  64.999  1.00 61.22  ? 320  ILE B CG2   1 
ATOM   8022  C  CD1   . ILE H 4 320 ? 33.257 54.435  66.389  1.00 61.26  ? 320  ILE B CD1   1 
ATOM   8023  N  N     . VAL H 4 321 ? 27.857 53.884  66.707  1.00 65.26  ? 321  VAL B N     1 
ATOM   8024  C  CA    . VAL H 4 321 ? 26.441 54.157  66.653  1.00 65.80  ? 321  VAL B CA    1 
ATOM   8025  C  C     . VAL H 4 321 ? 26.132 54.917  67.897  1.00 67.90  ? 321  VAL B C     1 
ATOM   8026  O  O     . VAL H 4 321 ? 25.461 55.958  67.898  1.00 67.72  ? 321  VAL B O     1 
ATOM   8027  C  CB    . VAL H 4 321 ? 25.639 52.882  66.670  1.00 63.93  ? 321  VAL B CB    1 
ATOM   8028  C  CG1   . VAL H 4 321 ? 24.141 53.187  66.724  1.00 61.83  ? 321  VAL B CG1   1 
ATOM   8029  C  CG2   . VAL H 4 321 ? 25.986 52.024  65.465  1.00 62.63  ? 321  VAL B CG2   1 
ATOM   8030  N  N     . MET H 4 322 ? 26.636 54.367  68.995  1.00 69.52  ? 322  MET B N     1 
ATOM   8031  C  CA    . MET H 4 322 ? 26.448 54.988  70.288  1.00 71.08  ? 322  MET B CA    1 
ATOM   8032  C  C     . MET H 4 322 ? 27.084 56.360  70.249  1.00 71.79  ? 322  MET B C     1 
ATOM   8033  O  O     . MET H 4 322 ? 26.529 57.334  70.769  1.00 71.43  ? 322  MET B O     1 
ATOM   8034  C  CB    . MET H 4 322 ? 27.078 54.135  71.387  1.00 71.14  ? 322  MET B CB    1 
ATOM   8035  C  CG    . MET H 4 322 ? 26.168 53.006  71.877  1.00 70.01  ? 322  MET B CG    1 
ATOM   8036  S  SD    . MET H 4 322 ? 24.473 53.535  72.133  1.00 69.07  ? 322  MET B SD    1 
ATOM   8037  C  CE    . MET H 4 322 ? 24.720 54.923  73.239  1.00 65.49  ? 322  MET B CE    1 
ATOM   8038  N  N     . ASN H 4 323 ? 28.247 56.437  69.615  1.00 73.37  ? 323  ASN B N     1 
ATOM   8039  C  CA    . ASN H 4 323 ? 28.935 57.711  69.503  1.00 74.42  ? 323  ASN B CA    1 
ATOM   8040  C  C     . ASN H 4 323 ? 28.113 58.703  68.709  1.00 73.26  ? 323  ASN B C     1 
ATOM   8041  O  O     . ASN H 4 323 ? 28.324 59.899  68.876  1.00 73.79  ? 323  ASN B O     1 
ATOM   8042  C  CB    . ASN H 4 323 ? 30.319 57.505  68.862  1.00 76.50  ? 323  ASN B CB    1 
ATOM   8043  C  CG    . ASN H 4 323 ? 31.388 57.104  69.882  1.00 79.02  ? 323  ASN B CG    1 
ATOM   8044  O  OD1   . ASN H 4 323 ? 31.237 56.114  70.608  1.00 80.03  ? 323  ASN B OD1   1 
ATOM   8045  N  ND2   . ASN H 4 323 ? 32.468 57.884  69.943  1.00 78.79  ? 323  ASN B ND2   1 
ATOM   8046  N  N     . TYR H 4 324 ? 27.167 58.263  67.847  1.00 72.55  ? 324  TYR B N     1 
ATOM   8047  C  CA    . TYR H 4 324 ? 26.396 59.286  67.084  1.00 73.61  ? 324  TYR B CA    1 
ATOM   8048  C  C     . TYR H 4 324 ? 25.113 59.807  67.774  1.00 76.48  ? 324  TYR B C     1 
ATOM   8049  O  O     . TYR H 4 324 ? 24.294 60.452  67.116  1.00 76.63  ? 324  TYR B O     1 
ATOM   8050  C  CB    . TYR H 4 324 ? 25.998 58.745  65.714  1.00 72.16  ? 324  TYR B CB    1 
ATOM   8051  C  CG    . TYR H 4 324 ? 27.001 59.060  64.631  1.00 71.07  ? 324  TYR B CG    1 
ATOM   8052  C  CD1   . TYR H 4 324 ? 27.435 60.354  64.372  1.00 71.19  ? 324  TYR B CD1   1 
ATOM   8053  C  CD2   . TYR H 4 324 ? 27.514 58.035  63.835  1.00 69.60  ? 324  TYR B CD2   1 
ATOM   8054  C  CE1   . TYR H 4 324 ? 28.354 60.616  63.377  1.00 71.75  ? 324  TYR B CE1   1 
ATOM   8055  C  CE2   . TYR H 4 324 ? 28.447 58.284  62.834  1.00 70.37  ? 324  TYR B CE2   1 
ATOM   8056  C  CZ    . TYR H 4 324 ? 28.849 59.578  62.606  1.00 71.63  ? 324  TYR B CZ    1 
ATOM   8057  O  OH    . TYR H 4 324 ? 29.715 59.890  61.581  1.00 74.81  ? 324  TYR B OH    1 
ATOM   8058  N  N     . ILE H 4 325 ? 24.955 59.535  69.067  1.00 77.13  ? 325  ILE B N     1 
ATOM   8059  C  CA    . ILE H 4 325 ? 23.750 59.973  69.754  1.00 77.79  ? 325  ILE B CA    1 
ATOM   8060  C  C     . ILE H 4 325 ? 23.969 60.869  71.006  1.00 79.82  ? 325  ILE B C     1 
ATOM   8061  O  O     . ILE H 4 325 ? 24.820 60.603  71.869  1.00 77.23  ? 325  ILE B O     1 
ATOM   8062  C  CB    . ILE H 4 325 ? 22.908 58.752  70.092  1.00 74.60  ? 325  ILE B CB    1 
ATOM   8063  C  CG1   . ILE H 4 325 ? 22.745 57.866  68.850  1.00 70.62  ? 325  ILE B CG1   1 
ATOM   8064  C  CG2   . ILE H 4 325 ? 21.546 59.160  70.628  1.00 74.02  ? 325  ILE B CG2   1 
ATOM   8065  C  CD1   . ILE H 4 325 ? 22.039 56.559  69.134  1.00 67.77  ? 325  ILE B CD1   1 
ATOM   8066  N  N     . ARG H 4 326 ? 23.153 61.926  71.017  1.00 84.69  ? 326  ARG B N     1 
ATOM   8067  C  CA    . ARG H 4 326 ? 23.041 62.954  72.059  1.00 90.14  ? 326  ARG B CA    1 
ATOM   8068  C  C     . ARG H 4 326 ? 21.574 63.346  71.987  1.00 92.76  ? 326  ARG B C     1 
ATOM   8069  O  O     . ARG H 4 326 ? 21.227 64.509  71.852  1.00 92.95  ? 326  ARG B O     1 
ATOM   8070  C  CB    . ARG H 4 326 ? 23.992 64.140  71.819  1.00 91.30  ? 326  ARG B CB    1 
ATOM   8071  C  CG    . ARG H 4 326 ? 25.457 63.746  71.902  1.00 95.93  ? 326  ARG B CG    1 
ATOM   8072  C  CD    . ARG H 4 326 ? 26.279 64.429  70.811  1.00 97.80  ? 326  ARG B CD    1 
ATOM   8073  N  NE    . ARG H 4 326 ? 27.715 64.122  70.845  1.00 98.32  ? 326  ARG B NE    1 
ATOM   8074  C  CZ    . ARG H 4 326 ? 28.226 62.884  70.900  1.00 96.92  ? 326  ARG B CZ    1 
ATOM   8075  N  NH1   . ARG H 4 326 ? 27.423 61.833  70.951  1.00 95.20  ? 326  ARG B NH1   1 
ATOM   8076  N  NH2   . ARG H 4 326 ? 29.535 62.700  70.890  1.00 95.77  ? 326  ARG B NH2   1 
ATOM   8077  N  N     . ASN H 4 327 ? 20.738 62.318  72.054  1.00 96.82  ? 327  ASN B N     1 
ATOM   8078  C  CA    . ASN H 4 327 ? 19.258 62.333  71.885  1.00 101.00 ? 327  ASN B CA    1 
ATOM   8079  C  C     . ASN H 4 327 ? 18.392 63.469  72.440  1.00 105.52 ? 327  ASN B C     1 
ATOM   8080  O  O     . ASN H 4 327 ? 18.871 64.498  72.927  1.00 106.20 ? 327  ASN B O     1 
ATOM   8081  C  CB    . ASN H 4 327 ? 18.715 61.020  72.413  1.00 99.44  ? 327  ASN B CB    1 
ATOM   8082  C  CG    . ASN H 4 327 ? 18.167 60.216  71.269  1.00 98.53  ? 327  ASN B CG    1 
ATOM   8083  O  OD1   . ASN H 4 327 ? 17.322 60.666  70.508  1.00 99.40  ? 327  ASN B OD1   1 
ATOM   8084  N  ND2   . ASN H 4 327 ? 18.672 58.991  71.131  1.00 97.63  ? 327  ASN B ND2   1 
ATOM   8085  N  N     . LEU H 4 328 ? 17.095 63.186  72.307  1.00 110.58 ? 328  LEU B N     1 
ATOM   8086  C  CA    . LEU H 4 328 ? 15.925 64.024  72.652  1.00 115.48 ? 328  LEU B CA    1 
ATOM   8087  C  C     . LEU H 4 328 ? 16.148 65.084  73.731  1.00 117.92 ? 328  LEU B C     1 
ATOM   8088  O  O     . LEU H 4 328 ? 16.646 64.781  74.814  1.00 117.74 ? 328  LEU B O     1 
ATOM   8089  C  CB    . LEU H 4 328 ? 14.772 63.097  73.088  1.00 117.97 ? 328  LEU B CB    1 
ATOM   8090  C  CG    . LEU H 4 328 ? 14.231 62.002  72.146  1.00 119.85 ? 328  LEU B CG    1 
ATOM   8091  C  CD1   . LEU H 4 328 ? 14.992 60.698  72.356  1.00 119.73 ? 328  LEU B CD1   1 
ATOM   8092  C  CD2   . LEU H 4 328 ? 12.743 61.801  72.346  1.00 121.03 ? 328  LEU B CD2   1 
ATOM   8093  N  N     . ASP H 4 329 ? 15.785 66.324  73.387  1.00 121.46 ? 329  ASP B N     1 
ATOM   8094  C  CA    . ASP H 4 329 ? 15.878 67.486  74.291  1.00 124.75 ? 329  ASP B CA    1 
ATOM   8095  C  C     . ASP H 4 329 ? 14.511 67.696  74.971  1.00 125.31 ? 329  ASP B C     1 
ATOM   8096  O  O     . ASP H 4 329 ? 13.555 66.974  74.692  1.00 126.45 ? 329  ASP B O     1 
ATOM   8097  C  CB    . ASP H 4 329 ? 16.243 68.772  73.511  1.00 126.54 ? 329  ASP B CB    1 
ATOM   8098  C  CG    . ASP H 4 329 ? 17.572 68.667  72.756  1.00 128.12 ? 329  ASP B CG    1 
ATOM   8099  O  OD1   . ASP H 4 329 ? 18.620 68.465  73.408  1.00 129.05 ? 329  ASP B OD1   1 
ATOM   8100  O  OD2   . ASP H 4 329 ? 17.568 68.799  71.508  1.00 128.09 ? 329  ASP B OD2   1 
ATOM   8101  N  N     . SER H 4 330 ? 14.426 68.683  75.877  1.00 124.52 ? 330  SER B N     1 
ATOM   8102  C  CA    . SER H 4 330 ? 13.188 69.030  76.621  1.00 122.45 ? 330  SER B CA    1 
ATOM   8103  C  C     . SER H 4 330 ? 12.408 67.822  77.190  1.00 119.91 ? 330  SER B C     1 
ATOM   8104  O  O     . SER H 4 330 ? 12.968 66.992  77.906  1.00 119.24 ? 330  SER B O     1 
ATOM   8105  C  CB    . SER H 4 330 ? 12.258 69.887  75.735  1.00 123.56 ? 330  SER B CB    1 
ATOM   8106  O  OG    . SER H 4 330 ? 12.909 71.066  75.273  1.00 123.99 ? 330  SER B OG    1 
ATOM   8107  N  N     . GLU H 4 331 ? 11.115 67.732  76.887  1.00 116.94 ? 331  GLU B N     1 
ATOM   8108  C  CA    . GLU H 4 331 ? 10.306 66.606  77.359  1.00 113.57 ? 331  GLU B CA    1 
ATOM   8109  C  C     . GLU H 4 331 ? 11.065 65.301  77.127  1.00 108.74 ? 331  GLU B C     1 
ATOM   8110  O  O     . GLU H 4 331 ? 10.643 64.237  77.558  1.00 108.00 ? 331  GLU B O     1 
ATOM   8111  C  CB    . GLU H 4 331 ? 8.969  66.531  76.602  1.00 116.91 ? 331  GLU B CB    1 
ATOM   8112  C  CG    . GLU H 4 331 ? 8.177  67.841  76.510  1.00 120.68 ? 331  GLU B CG    1 
ATOM   8113  C  CD    . GLU H 4 331 ? 6.677  67.608  76.319  1.00 122.83 ? 331  GLU B CD    1 
ATOM   8114  O  OE1   . GLU H 4 331 ? 6.295  66.738  75.498  1.00 123.33 ? 331  GLU B OE1   1 
ATOM   8115  O  OE2   . GLU H 4 331 ? 5.882  68.304  76.992  1.00 124.27 ? 331  GLU B OE2   1 
ATOM   8116  N  N     . THR H 4 332 ? 12.178 65.412  76.417  1.00 103.67 ? 332  THR B N     1 
ATOM   8117  C  CA    . THR H 4 332 ? 13.046 64.299  76.073  1.00 99.13  ? 332  THR B CA    1 
ATOM   8118  C  C     . THR H 4 332 ? 12.261 63.037  75.643  1.00 95.31  ? 332  THR B C     1 
ATOM   8119  O  O     . THR H 4 332 ? 11.352 63.104  74.800  1.00 95.05  ? 332  THR B O     1 
ATOM   8120  C  CB    . THR H 4 332 ? 14.028 63.990  77.259  1.00 99.34  ? 332  THR B CB    1 
ATOM   8121  O  OG1   . THR H 4 332 ? 14.534 65.218  77.787  1.00 97.97  ? 332  THR B OG1   1 
ATOM   8122  C  CG2   . THR H 4 332 ? 15.237 63.185  76.788  1.00 99.46  ? 332  THR B CG2   1 
ATOM   8123  N  N     . GLY H 4 333 ? 12.655 61.897  76.211  1.00 90.34  ? 333  GLY B N     1 
ATOM   8124  C  CA    . GLY H 4 333 ? 12.036 60.612  75.939  1.00 83.21  ? 333  GLY B CA    1 
ATOM   8125  C  C     . GLY H 4 333 ? 12.472 59.674  77.058  1.00 78.30  ? 333  GLY B C     1 
ATOM   8126  O  O     . GLY H 4 333 ? 13.151 60.101  77.992  1.00 78.13  ? 333  GLY B O     1 
ATOM   8127  N  N     . ALA H 4 334 ? 12.096 58.402  76.974  1.00 72.92  ? 334  ALA B N     1 
ATOM   8128  C  CA    . ALA H 4 334 ? 12.454 57.416  77.992  1.00 66.42  ? 334  ALA B CA    1 
ATOM   8129  C  C     . ALA H 4 334 ? 12.004 57.820  79.392  1.00 62.13  ? 334  ALA B C     1 
ATOM   8130  O  O     . ALA H 4 334 ? 10.843 58.146  79.608  1.00 62.07  ? 334  ALA B O     1 
ATOM   8131  C  CB    . ALA H 4 334 ? 13.939 57.187  77.980  1.00 66.81  ? 334  ALA B CB    1 
ATOM   8132  N  N     . MET H 4 335 ? 12.931 57.794  80.343  1.00 56.60  ? 335  MET B N     1 
ATOM   8133  C  CA    . MET H 4 335 ? 12.638 58.151  81.722  1.00 50.96  ? 335  MET B CA    1 
ATOM   8134  C  C     . MET H 4 335 ? 11.526 59.157  81.923  1.00 49.10  ? 335  MET B C     1 
ATOM   8135  O  O     . MET H 4 335 ? 10.693 58.983  82.804  1.00 49.27  ? 335  MET B O     1 
ATOM   8136  C  CB    . MET H 4 335 ? 13.884 58.678  82.401  1.00 48.22  ? 335  MET B CB    1 
ATOM   8137  C  CG    . MET H 4 335 ? 14.983 57.676  82.473  1.00 46.73  ? 335  MET B CG    1 
ATOM   8138  S  SD    . MET H 4 335 ? 14.375 56.032  82.867  1.00 44.50  ? 335  MET B SD    1 
ATOM   8139  C  CE    . MET H 4 335 ? 13.494 56.295  84.399  1.00 43.13  ? 335  MET B CE    1 
ATOM   8140  N  N     . VAL H 4 336 ? 11.506 60.222  81.130  1.00 46.72  ? 336  VAL B N     1 
ATOM   8141  C  CA    . VAL H 4 336 ? 10.468 61.226  81.295  1.00 44.46  ? 336  VAL B CA    1 
ATOM   8142  C  C     . VAL H 4 336 ? 9.139  60.650  80.886  1.00 44.76  ? 336  VAL B C     1 
ATOM   8143  O  O     . VAL H 4 336 ? 8.149  60.807  81.585  1.00 44.04  ? 336  VAL B O     1 
ATOM   8144  C  CB    . VAL H 4 336 ? 10.720 62.453  80.445  1.00 42.86  ? 336  VAL B CB    1 
ATOM   8145  C  CG1   . VAL H 4 336 ? 9.634  63.427  80.671  1.00 43.17  ? 336  VAL B CG1   1 
ATOM   8146  C  CG2   . VAL H 4 336 ? 12.015 63.083  80.810  1.00 42.80  ? 336  VAL B CG2   1 
ATOM   8147  N  N     . ARG H 4 337 ? 9.124  59.988  79.735  1.00 46.51  ? 337  ARG B N     1 
ATOM   8148  C  CA    . ARG H 4 337 ? 7.904  59.366  79.221  1.00 47.96  ? 337  ARG B CA    1 
ATOM   8149  C  C     . ARG H 4 337 ? 7.433  58.320  80.204  1.00 46.84  ? 337  ARG B C     1 
ATOM   8150  O  O     . ARG H 4 337 ? 6.244  58.154  80.430  1.00 45.94  ? 337  ARG B O     1 
ATOM   8151  C  CB    . ARG H 4 337 ? 8.145  58.648  77.867  1.00 51.24  ? 337  ARG B CB    1 
ATOM   8152  C  CG    . ARG H 4 337 ? 8.084  59.494  76.573  1.00 55.98  ? 337  ARG B CG    1 
ATOM   8153  C  CD    . ARG H 4 337 ? 7.917  58.619  75.291  1.00 60.87  ? 337  ARG B CD    1 
ATOM   8154  N  NE    . ARG H 4 337 ? 9.082  57.786  74.915  1.00 65.76  ? 337  ARG B NE    1 
ATOM   8155  C  CZ    . ARG H 4 337 ? 9.195  56.458  75.104  1.00 68.00  ? 337  ARG B CZ    1 
ATOM   8156  N  NH1   . ARG H 4 337 ? 8.210  55.746  75.679  1.00 68.61  ? 337  ARG B NH1   1 
ATOM   8157  N  NH2   . ARG H 4 337 ? 10.302 55.830  74.697  1.00 67.90  ? 337  ARG B NH2   1 
ATOM   8158  N  N     . LEU H 4 338 ? 8.402  57.616  80.769  1.00 46.89  ? 338  LEU B N     1 
ATOM   8159  C  CA    . LEU H 4 338 ? 8.163  56.522  81.682  1.00 48.35  ? 338  LEU B CA    1 
ATOM   8160  C  C     . LEU H 4 338 ? 7.527  56.906  83.007  1.00 50.51  ? 338  LEU B C     1 
ATOM   8161  O  O     . LEU H 4 338 ? 6.717  56.152  83.563  1.00 50.47  ? 338  LEU B O     1 
ATOM   8162  C  CB    . LEU H 4 338 ? 9.483  55.791  81.920  1.00 47.67  ? 338  LEU B CB    1 
ATOM   8163  C  CG    . LEU H 4 338 ? 9.355  54.275  82.048  1.00 47.82  ? 338  LEU B CG    1 
ATOM   8164  C  CD1   . LEU H 4 338 ? 8.708  53.771  80.768  1.00 47.48  ? 338  LEU B CD1   1 
ATOM   8165  C  CD2   . LEU H 4 338 ? 10.715 53.614  82.302  1.00 45.91  ? 338  LEU B CD2   1 
ATOM   8166  N  N     . LEU H 4 339 ? 7.902  58.072  83.516  1.00 52.72  ? 339  LEU B N     1 
ATOM   8167  C  CA    . LEU H 4 339 ? 7.380  58.565  84.777  1.00 55.04  ? 339  LEU B CA    1 
ATOM   8168  C  C     . LEU H 4 339 ? 6.040  59.263  84.601  1.00 57.92  ? 339  LEU B C     1 
ATOM   8169  O  O     . LEU H 4 339 ? 5.184  59.185  85.469  1.00 58.67  ? 339  LEU B O     1 
ATOM   8170  C  CB    . LEU H 4 339 ? 8.366  59.540  85.387  1.00 54.19  ? 339  LEU B CB    1 
ATOM   8171  C  CG    . LEU H 4 339 ? 9.647  59.022  86.022  1.00 53.91  ? 339  LEU B CG    1 
ATOM   8172  C  CD1   . LEU H 4 339 ? 10.754 60.024  85.792  1.00 54.81  ? 339  LEU B CD1   1 
ATOM   8173  C  CD2   . LEU H 4 339 ? 9.428  58.817  87.505  1.00 53.49  ? 339  LEU B CD2   1 
ATOM   8174  N  N     . GLU H 4 340 ? 5.851  59.941  83.477  1.00 61.75  ? 340  GLU B N     1 
ATOM   8175  C  CA    . GLU H 4 340 ? 4.605  60.658  83.247  1.00 65.84  ? 340  GLU B CA    1 
ATOM   8176  C  C     . GLU H 4 340 ? 3.435  59.781  82.802  1.00 68.57  ? 340  GLU B C     1 
ATOM   8177  O  O     . GLU H 4 340 ? 2.293  60.231  82.778  1.00 69.60  ? 340  GLU B O     1 
ATOM   8178  C  CB    . GLU H 4 340 ? 4.836  61.798  82.242  1.00 65.94  ? 340  GLU B CB    1 
ATOM   8179  C  CG    . GLU H 4 340 ? 5.973  62.738  82.648  1.00 66.49  ? 340  GLU B CG    1 
ATOM   8180  C  CD    . GLU H 4 340 ? 6.024  64.036  81.854  1.00 66.47  ? 340  GLU B CD    1 
ATOM   8181  O  OE1   . GLU H 4 340 ? 6.998  64.795  82.041  1.00 65.25  ? 340  GLU B OE1   1 
ATOM   8182  O  OE2   . GLU H 4 340 ? 5.098  64.307  81.058  1.00 67.99  ? 340  GLU B OE2   1 
ATOM   8183  N  N     . ASP H 4 341 ? 3.709  58.530  82.453  1.00 72.17  ? 341  ASP B N     1 
ATOM   8184  C  CA    . ASP H 4 341 ? 2.647  57.611  82.039  1.00 76.26  ? 341  ASP B CA    1 
ATOM   8185  C  C     . ASP H 4 341 ? 2.027  57.014  83.311  1.00 77.26  ? 341  ASP B C     1 
ATOM   8186  O  O     . ASP H 4 341 ? 0.794  57.199  83.509  1.00 77.32  ? 341  ASP B O     1 
ATOM   8187  C  CB    . ASP H 4 341 ? 3.222  56.484  81.161  1.00 79.29  ? 341  ASP B CB    1 
ATOM   8188  C  CG    . ASP H 4 341 ? 2.140  55.555  80.576  1.00 81.86  ? 341  ASP B CG    1 
ATOM   8189  O  OD1   . ASP H 4 341 ? 1.127  55.263  81.264  1.00 82.36  ? 341  ASP B OD1   1 
ATOM   8190  O  OD2   . ASP H 4 341 ? 2.324  55.098  79.421  1.00 83.53  ? 341  ASP B OD2   1 
ATOM   8191  N  N     . ASP I 4 21  ? 71.747 28.412  48.574  1.00 114.01 ? 21   ASP E N     1 
ATOM   8192  C  CA    . ASP I 4 21  ? 72.515 27.316  49.243  1.00 114.33 ? 21   ASP E CA    1 
ATOM   8193  C  C     . ASP I 4 21  ? 71.598 26.335  49.967  1.00 113.68 ? 21   ASP E C     1 
ATOM   8194  O  O     . ASP I 4 21  ? 71.452 25.177  49.556  1.00 113.48 ? 21   ASP E O     1 
ATOM   8195  C  CB    . ASP I 4 21  ? 73.511 27.897  50.260  1.00 115.43 ? 21   ASP E CB    1 
ATOM   8196  C  CG    . ASP I 4 21  ? 74.304 26.807  51.005  1.00 116.00 ? 21   ASP E CG    1 
ATOM   8197  O  OD1   . ASP I 4 21  ? 75.077 27.143  51.942  1.00 115.27 ? 21   ASP E OD1   1 
ATOM   8198  O  OD2   . ASP I 4 21  ? 74.154 25.611  50.649  1.00 116.40 ? 21   ASP E OD2   1 
ATOM   8199  N  N     . GLU I 4 22  ? 71.005 26.799  51.067  1.00 112.29 ? 22   GLU E N     1 
ATOM   8200  C  CA    . GLU I 4 22  ? 70.100 25.969  51.852  1.00 110.64 ? 22   GLU E CA    1 
ATOM   8201  C  C     . GLU I 4 22  ? 68.744 25.915  51.154  1.00 109.25 ? 22   GLU E C     1 
ATOM   8202  O  O     . GLU I 4 22  ? 68.145 24.850  51.039  1.00 109.55 ? 22   GLU E O     1 
ATOM   8203  C  CB    . GLU I 4 22  ? 69.930 26.530  53.275  1.00 111.03 ? 22   GLU E CB    1 
ATOM   8204  C  CG    . GLU I 4 22  ? 69.189 27.872  53.356  1.00 112.58 ? 22   GLU E CG    1 
ATOM   8205  C  CD    . GLU I 4 22  ? 68.641 28.182  54.754  1.00 113.40 ? 22   GLU E CD    1 
ATOM   8206  O  OE1   . GLU I 4 22  ? 67.901 29.188  54.892  1.00 113.47 ? 22   GLU E OE1   1 
ATOM   8207  O  OE2   . GLU I 4 22  ? 68.946 27.426  55.710  1.00 113.44 ? 22   GLU E OE2   1 
ATOM   8208  N  N     . VAL I 4 23  ? 68.281 27.071  50.679  1.00 106.91 ? 23   VAL E N     1 
ATOM   8209  C  CA    . VAL I 4 23  ? 66.998 27.197  49.990  1.00 104.57 ? 23   VAL E CA    1 
ATOM   8210  C  C     . VAL I 4 23  ? 66.729 26.058  49.012  1.00 103.82 ? 23   VAL E C     1 
ATOM   8211  O  O     . VAL I 4 23  ? 65.595 25.589  48.889  1.00 103.63 ? 23   VAL E O     1 
ATOM   8212  C  CB    . VAL I 4 23  ? 66.919 28.527  49.213  1.00 104.27 ? 23   VAL E CB    1 
ATOM   8213  C  CG1   . VAL I 4 23  ? 67.649 29.620  49.992  1.00 103.72 ? 23   VAL E CG1   1 
ATOM   8214  C  CG2   . VAL I 4 23  ? 67.492 28.359  47.805  1.00 103.68 ? 23   VAL E CG2   1 
ATOM   8215  N  N     . ARG I 4 24  ? 67.769 25.622  48.309  1.00 103.26 ? 24   ARG E N     1 
ATOM   8216  C  CA    . ARG I 4 24  ? 67.633 24.535  47.346  1.00 102.79 ? 24   ARG E CA    1 
ATOM   8217  C  C     . ARG I 4 24  ? 67.096 23.276  48.040  1.00 100.90 ? 24   ARG E C     1 
ATOM   8218  O  O     . ARG I 4 24  ? 66.379 22.473  47.437  1.00 100.80 ? 24   ARG E O     1 
ATOM   8219  C  CB    . ARG I 4 24  ? 68.984 24.264  46.655  1.00 104.77 ? 24   ARG E CB    1 
ATOM   8220  C  CG    . ARG I 4 24  ? 69.412 25.349  45.634  1.00 106.61 ? 24   ARG E CG    1 
ATOM   8221  C  CD    . ARG I 4 24  ? 70.681 24.957  44.857  1.00 108.67 ? 24   ARG E CD    1 
ATOM   8222  N  NE    . ARG I 4 24  ? 70.774 23.508  44.651  1.00 111.32 ? 24   ARG E NE    1 
ATOM   8223  C  CZ    . ARG I 4 24  ? 71.554 22.911  43.749  1.00 112.85 ? 24   ARG E CZ    1 
ATOM   8224  N  NH1   . ARG I 4 24  ? 72.326 23.631  42.936  1.00 113.39 ? 24   ARG E NH1   1 
ATOM   8225  N  NH2   . ARG I 4 24  ? 71.570 21.582  43.669  1.00 113.40 ? 24   ARG E NH2   1 
ATOM   8226  N  N     . LYS I 4 25  ? 67.443 23.116  49.312  1.00 98.86  ? 25   LYS E N     1 
ATOM   8227  C  CA    . LYS I 4 25  ? 66.961 21.987  50.092  1.00 96.65  ? 25   LYS E CA    1 
ATOM   8228  C  C     . LYS I 4 25  ? 65.479 22.234  50.362  1.00 95.44  ? 25   LYS E C     1 
ATOM   8229  O  O     . LYS I 4 25  ? 64.646 21.369  50.097  1.00 95.70  ? 25   LYS E O     1 
ATOM   8230  C  CB    . LYS I 4 25  ? 67.709 21.881  51.424  1.00 96.51  ? 25   LYS E CB    1 
ATOM   8231  C  CG    . LYS I 4 25  ? 67.200 20.752  52.308  1.00 96.82  ? 25   LYS E CG    1 
ATOM   8232  C  CD    . LYS I 4 25  ? 67.774 20.814  53.720  1.00 97.52  ? 25   LYS E CD    1 
ATOM   8233  C  CE    . LYS I 4 25  ? 67.136 19.754  54.633  1.00 97.49  ? 25   LYS E CE    1 
ATOM   8234  N  NZ    . LYS I 4 25  ? 65.662 19.950  54.849  1.00 96.90  ? 25   LYS E NZ    1 
ATOM   8235  N  N     . ASN I 4 26  ? 65.153 23.418  50.886  1.00 93.66  ? 26   ASN E N     1 
ATOM   8236  C  CA    . ASN I 4 26  ? 63.759 23.761  51.175  1.00 92.44  ? 26   ASN E CA    1 
ATOM   8237  C  C     . ASN I 4 26  ? 62.970 23.475  49.906  1.00 91.66  ? 26   ASN E C     1 
ATOM   8238  O  O     . ASN I 4 26  ? 61.941 22.802  49.939  1.00 92.33  ? 26   ASN E O     1 
ATOM   8239  C  CB    . ASN I 4 26  ? 63.580 25.254  51.537  1.00 91.59  ? 26   ASN E CB    1 
ATOM   8240  C  CG    . ASN I 4 26  ? 64.359 25.684  52.794  1.00 90.79  ? 26   ASN E CG    1 
ATOM   8241  O  OD1   . ASN I 4 26  ? 64.317 25.026  53.841  1.00 90.40  ? 26   ASN E OD1   1 
ATOM   8242  N  ND2   . ASN I 4 26  ? 65.053 26.816  52.690  1.00 89.86  ? 26   ASN E ND2   1 
ATOM   8243  N  N     . LEU I 4 27  ? 63.468 23.985  48.785  1.00 90.10  ? 27   LEU E N     1 
ATOM   8244  C  CA    . LEU I 4 27  ? 62.806 23.778  47.517  1.00 88.78  ? 27   LEU E CA    1 
ATOM   8245  C  C     . LEU I 4 27  ? 62.523 22.311  47.235  1.00 89.36  ? 27   LEU E C     1 
ATOM   8246  O  O     . LEU I 4 27  ? 61.439 21.996  46.774  1.00 89.27  ? 27   LEU E O     1 
ATOM   8247  C  CB    . LEU I 4 27  ? 63.630 24.375  46.388  1.00 87.53  ? 27   LEU E CB    1 
ATOM   8248  C  CG    . LEU I 4 27  ? 62.917 25.482  45.610  1.00 86.55  ? 27   LEU E CG    1 
ATOM   8249  C  CD1   . LEU I 4 27  ? 61.678 24.921  44.936  1.00 85.50  ? 27   LEU E CD1   1 
ATOM   8250  C  CD2   . LEU I 4 27  ? 62.548 26.612  46.552  1.00 86.45  ? 27   LEU E CD2   1 
ATOM   8251  N  N     . MET I 4 28  ? 63.469 21.410  47.509  1.00 90.74  ? 28   MET E N     1 
ATOM   8252  C  CA    . MET I 4 28  ? 63.232 19.976  47.257  1.00 92.36  ? 28   MET E CA    1 
ATOM   8253  C  C     . MET I 4 28  ? 62.138 19.399  48.177  1.00 91.30  ? 28   MET E C     1 
ATOM   8254  O  O     . MET I 4 28  ? 61.336 18.557  47.754  1.00 91.36  ? 28   MET E O     1 
ATOM   8255  C  CB    . MET I 4 28  ? 64.528 19.137  47.414  1.00 95.86  ? 28   MET E CB    1 
ATOM   8256  C  CG    . MET I 4 28  ? 64.365 17.606  47.036  1.00 100.41 ? 28   MET E CG    1 
ATOM   8257  S  SD    . MET I 4 28  ? 65.705 16.348  47.518  1.00 104.94 ? 28   MET E SD    1 
ATOM   8258  C  CE    . MET I 4 28  ? 64.954 15.473  49.009  1.00 103.13 ? 28   MET E CE    1 
ATOM   8259  N  N     . ASP I 4 29  ? 62.104 19.838  49.433  1.00 90.16  ? 29   ASP E N     1 
ATOM   8260  C  CA    . ASP I 4 29  ? 61.087 19.346  50.362  1.00 88.73  ? 29   ASP E CA    1 
ATOM   8261  C  C     . ASP I 4 29  ? 59.761 19.940  49.930  1.00 86.55  ? 29   ASP E C     1 
ATOM   8262  O  O     . ASP I 4 29  ? 58.736 19.263  49.919  1.00 86.08  ? 29   ASP E O     1 
ATOM   8263  C  CB    . ASP I 4 29  ? 61.387 19.784  51.800  1.00 90.39  ? 29   ASP E CB    1 
ATOM   8264  C  CG    . ASP I 4 29  ? 62.798 19.406  52.257  1.00 92.28  ? 29   ASP E CG    1 
ATOM   8265  O  OD1   . ASP I 4 29  ? 63.317 18.341  51.832  1.00 93.86  ? 29   ASP E OD1   1 
ATOM   8266  O  OD2   . ASP I 4 29  ? 63.382 20.175  53.061  1.00 92.40  ? 29   ASP E OD2   1 
ATOM   8267  N  N     . MET I 4 30  ? 59.811 21.223  49.579  1.00 83.92  ? 30   MET E N     1 
ATOM   8268  C  CA    . MET I 4 30  ? 58.654 21.974  49.120  1.00 81.36  ? 30   MET E CA    1 
ATOM   8269  C  C     . MET I 4 30  ? 57.965 21.190  48.030  1.00 80.75  ? 30   MET E C     1 
ATOM   8270  O  O     . MET I 4 30  ? 56.753 21.317  47.824  1.00 80.27  ? 30   MET E O     1 
ATOM   8271  C  CB    . MET I 4 30  ? 59.106 23.320  48.561  1.00 80.37  ? 30   MET E CB    1 
ATOM   8272  C  CG    . MET I 4 30  ? 58.431 23.734  47.249  1.00 79.61  ? 30   MET E CG    1 
ATOM   8273  S  SD    . MET I 4 30  ? 56.772 24.436  47.382  1.00 78.47  ? 30   MET E SD    1 
ATOM   8274  C  CE    . MET I 4 30  ? 57.028 26.042  46.656  1.00 77.86  ? 30   MET E CE    1 
ATOM   8275  N  N     . PHE I 4 31  ? 58.769 20.387  47.335  1.00 80.15  ? 31   PHE E N     1 
ATOM   8276  C  CA    . PHE I 4 31  ? 58.322 19.554  46.224  1.00 79.59  ? 31   PHE E CA    1 
ATOM   8277  C  C     . PHE I 4 31  ? 58.019 18.145  46.699  1.00 79.26  ? 31   PHE E C     1 
ATOM   8278  O  O     . PHE I 4 31  ? 57.033 17.553  46.285  1.00 79.65  ? 31   PHE E O     1 
ATOM   8279  C  CB    . PHE I 4 31  ? 59.401 19.502  45.129  1.00 78.77  ? 31   PHE E CB    1 
ATOM   8280  C  CG    . PHE I 4 31  ? 59.445 20.725  44.225  1.00 79.05  ? 31   PHE E CG    1 
ATOM   8281  C  CD1   . PHE I 4 31  ? 60.668 21.261  43.816  1.00 79.15  ? 31   PHE E CD1   1 
ATOM   8282  C  CD2   . PHE I 4 31  ? 58.274 21.301  43.731  1.00 79.38  ? 31   PHE E CD2   1 
ATOM   8283  C  CE1   . PHE I 4 31  ? 60.721 22.346  42.928  1.00 78.98  ? 31   PHE E CE1   1 
ATOM   8284  C  CE2   . PHE I 4 31  ? 58.316 22.390  42.839  1.00 79.06  ? 31   PHE E CE2   1 
ATOM   8285  C  CZ    . PHE I 4 31  ? 59.539 22.907  42.441  1.00 79.18  ? 31   PHE E CZ    1 
ATOM   8286  N  N     . ARG I 4 32  ? 58.860 17.608  47.573  1.00 79.16  ? 32   ARG E N     1 
ATOM   8287  C  CA    . ARG I 4 32  ? 58.659 16.252  48.079  1.00 79.62  ? 32   ARG E CA    1 
ATOM   8288  C  C     . ARG I 4 32  ? 57.216 15.975  48.467  1.00 79.62  ? 32   ARG E C     1 
ATOM   8289  O  O     . ARG I 4 32  ? 56.725 14.852  48.369  1.00 78.21  ? 32   ARG E O     1 
ATOM   8290  C  CB    . ARG I 4 32  ? 59.552 16.009  49.291  1.00 80.77  ? 32   ARG E CB    1 
ATOM   8291  C  CG    . ARG I 4 32  ? 59.314 14.669  49.982  1.00 81.53  ? 32   ARG E CG    1 
ATOM   8292  C  CD    . ARG I 4 32  ? 60.223 14.562  51.190  1.00 82.71  ? 32   ARG E CD    1 
ATOM   8293  N  NE    . ARG I 4 32  ? 60.051 15.729  52.052  1.00 82.55  ? 32   ARG E NE    1 
ATOM   8294  C  CZ    . ARG I 4 32  ? 60.884 16.086  53.020  1.00 81.61  ? 32   ARG E CZ    1 
ATOM   8295  N  NH1   . ARG I 4 32  ? 61.976 15.375  53.280  1.00 80.58  ? 32   ARG E NH1   1 
ATOM   8296  N  NH2   . ARG I 4 32  ? 60.618 17.168  53.727  1.00 81.86  ? 32   ARG E NH2   1 
ATOM   8297  N  N     . ASP I 4 33  ? 56.552 17.021  48.930  1.00 80.99  ? 33   ASP E N     1 
ATOM   8298  C  CA    . ASP I 4 33  ? 55.167 16.937  49.344  1.00 82.58  ? 33   ASP E CA    1 
ATOM   8299  C  C     . ASP I 4 33  ? 54.417 18.002  48.551  1.00 83.37  ? 33   ASP E C     1 
ATOM   8300  O  O     . ASP I 4 33  ? 53.915 18.964  49.116  1.00 83.58  ? 33   ASP E O     1 
ATOM   8301  C  CB    . ASP I 4 33  ? 55.041 17.208  50.857  1.00 82.28  ? 33   ASP E CB    1 
ATOM   8302  C  CG    . ASP I 4 33  ? 55.673 16.105  51.725  1.00 82.49  ? 33   ASP E CG    1 
ATOM   8303  O  OD1   . ASP I 4 33  ? 55.247 14.930  51.619  1.00 81.83  ? 33   ASP E OD1   1 
ATOM   8304  O  OD2   . ASP I 4 33  ? 56.591 16.419  52.525  1.00 81.44  ? 33   ASP E OD2   1 
ATOM   8305  N  N     . ARG I 4 34  ? 54.369 17.846  47.234  1.00 84.41  ? 34   ARG E N     1 
ATOM   8306  C  CA    . ARG I 4 34  ? 53.664 18.814  46.407  1.00 85.63  ? 34   ARG E CA    1 
ATOM   8307  C  C     . ARG I 4 34  ? 52.185 18.540  46.618  1.00 84.49  ? 34   ARG E C     1 
ATOM   8308  O  O     . ARG I 4 34  ? 51.336 19.370  46.317  1.00 84.31  ? 34   ARG E O     1 
ATOM   8309  C  CB    . ARG I 4 34  ? 54.031 18.650  44.920  1.00 88.97  ? 34   ARG E CB    1 
ATOM   8310  C  CG    . ARG I 4 34  ? 53.581 17.328  44.295  1.00 94.03  ? 34   ARG E CG    1 
ATOM   8311  C  CD    . ARG I 4 34  ? 53.863 17.228  42.787  1.00 97.44  ? 34   ARG E CD    1 
ATOM   8312  N  NE    . ARG I 4 34  ? 53.370 15.959  42.225  1.00 101.63 ? 34   ARG E NE    1 
ATOM   8313  C  CZ    . ARG I 4 34  ? 53.914 14.755  42.447  1.00 103.06 ? 34   ARG E CZ    1 
ATOM   8314  N  NH1   . ARG I 4 34  ? 54.989 14.642  43.225  1.00 103.99 ? 34   ARG E NH1   1 
ATOM   8315  N  NH2   . ARG I 4 34  ? 53.381 13.656  41.901  1.00 102.40 ? 34   ARG E NH2   1 
ATOM   8316  N  N     . GLN I 4 35  ? 51.896 17.358  47.149  1.00 83.46  ? 35   GLN E N     1 
ATOM   8317  C  CA    . GLN I 4 35  ? 50.529 16.929  47.424  1.00 82.87  ? 35   GLN E CA    1 
ATOM   8318  C  C     . GLN I 4 35  ? 49.784 17.933  48.301  1.00 80.78  ? 35   GLN E C     1 
ATOM   8319  O  O     . GLN I 4 35  ? 48.559 18.007  48.274  1.00 80.21  ? 35   GLN E O     1 
ATOM   8320  C  CB    . GLN I 4 35  ? 50.551 15.574  48.138  1.00 85.86  ? 35   GLN E CB    1 
ATOM   8321  C  CG    . GLN I 4 35  ? 51.188 14.427  47.356  1.00 89.68  ? 35   GLN E CG    1 
ATOM   8322  C  CD    . GLN I 4 35  ? 50.217 13.742  46.391  1.00 92.05  ? 35   GLN E CD    1 
ATOM   8323  O  OE1   . GLN I 4 35  ? 50.584 12.774  45.716  1.00 92.76  ? 35   GLN E OE1   1 
ATOM   8324  N  NE2   . GLN I 4 35  ? 48.972 14.238  46.328  1.00 93.08  ? 35   GLN E NE2   1 
ATOM   8325  N  N     . ALA I 4 36  ? 50.542 18.700  49.075  1.00 78.39  ? 36   ALA E N     1 
ATOM   8326  C  CA    . ALA I 4 36  ? 49.993 19.682  49.994  1.00 76.20  ? 36   ALA E CA    1 
ATOM   8327  C  C     . ALA I 4 36  ? 49.155 20.822  49.393  1.00 74.62  ? 36   ALA E C     1 
ATOM   8328  O  O     . ALA I 4 36  ? 48.608 21.630  50.137  1.00 75.32  ? 36   ALA E O     1 
ATOM   8329  C  CB    . ALA I 4 36  ? 51.118 20.255  50.841  1.00 75.40  ? 36   ALA E CB    1 
ATOM   8330  N  N     . PHE I 4 37  ? 49.054 20.912  48.071  1.00 72.27  ? 37   PHE E N     1 
ATOM   8331  C  CA    . PHE I 4 37  ? 48.239 21.965  47.460  1.00 70.14  ? 37   PHE E CA    1 
ATOM   8332  C  C     . PHE I 4 37  ? 47.339 21.382  46.380  1.00 70.33  ? 37   PHE E C     1 
ATOM   8333  O  O     . PHE I 4 37  ? 47.479 20.222  45.990  1.00 70.40  ? 37   PHE E O     1 
ATOM   8334  C  CB    . PHE I 4 37  ? 49.095 23.050  46.821  1.00 67.72  ? 37   PHE E CB    1 
ATOM   8335  C  CG    . PHE I 4 37  ? 50.118 23.634  47.727  1.00 65.94  ? 37   PHE E CG    1 
ATOM   8336  C  CD1   . PHE I 4 37  ? 51.185 22.875  48.174  1.00 65.80  ? 37   PHE E CD1   1 
ATOM   8337  C  CD2   . PHE I 4 37  ? 50.050 24.959  48.095  1.00 65.66  ? 37   PHE E CD2   1 
ATOM   8338  C  CE1   . PHE I 4 37  ? 52.171 23.430  48.970  1.00 65.00  ? 37   PHE E CE1   1 
ATOM   8339  C  CE2   . PHE I 4 37  ? 51.032 25.523  48.893  1.00 65.01  ? 37   PHE E CE2   1 
ATOM   8340  C  CZ    . PHE I 4 37  ? 52.095 24.756  49.329  1.00 64.67  ? 37   PHE E CZ    1 
ATOM   8341  N  N     . SER I 4 38  ? 46.410 22.193  45.893  1.00 70.14  ? 38   SER E N     1 
ATOM   8342  C  CA    . SER I 4 38  ? 45.504 21.744  44.850  1.00 70.38  ? 38   SER E CA    1 
ATOM   8343  C  C     . SER I 4 38  ? 46.236 21.720  43.527  1.00 70.92  ? 38   SER E C     1 
ATOM   8344  O  O     . SER I 4 38  ? 47.098 22.574  43.287  1.00 71.32  ? 38   SER E O     1 
ATOM   8345  C  CB    . SER I 4 38  ? 44.315 22.696  44.730  1.00 70.27  ? 38   SER E CB    1 
ATOM   8346  O  OG    . SER I 4 38  ? 43.172 22.185  45.386  1.00 72.01  ? 38   SER E OG    1 
ATOM   8347  N  N     . GLU I 4 39  ? 45.913 20.751  42.668  1.00 71.20  ? 39   GLU E N     1 
ATOM   8348  C  CA    . GLU I 4 39  ? 46.552 20.716  41.363  1.00 70.64  ? 39   GLU E CA    1 
ATOM   8349  C  C     . GLU I 4 39  ? 46.265 22.114  40.820  1.00 68.15  ? 39   GLU E C     1 
ATOM   8350  O  O     . GLU I 4 39  ? 47.073 22.701  40.117  1.00 68.35  ? 39   GLU E O     1 
ATOM   8351  C  CB    . GLU I 4 39  ? 45.940 19.637  40.458  1.00 74.26  ? 39   GLU E CB    1 
ATOM   8352  C  CG    . GLU I 4 39  ? 44.454 19.847  40.072  1.00 80.69  ? 39   GLU E CG    1 
ATOM   8353  C  CD    . GLU I 4 39  ? 43.953 18.907  38.932  1.00 83.96  ? 39   GLU E CD    1 
ATOM   8354  O  OE1   . GLU I 4 39  ? 42.726 18.925  38.643  1.00 85.27  ? 39   GLU E OE1   1 
ATOM   8355  O  OE2   . GLU I 4 39  ? 44.775 18.163  38.327  1.00 85.16  ? 39   GLU E OE2   1 
ATOM   8356  N  N     . HIS I 4 40  ? 45.123 22.662  41.209  1.00 65.08  ? 40   HIS E N     1 
ATOM   8357  C  CA    . HIS I 4 40  ? 44.725 23.987  40.786  1.00 62.64  ? 40   HIS E CA    1 
ATOM   8358  C  C     . HIS I 4 40  ? 45.542 25.144  41.326  1.00 61.05  ? 40   HIS E C     1 
ATOM   8359  O  O     . HIS I 4 40  ? 45.412 26.272  40.855  1.00 60.00  ? 40   HIS E O     1 
ATOM   8360  C  CB    . HIS I 4 40  ? 43.289 24.213  41.154  1.00 64.49  ? 40   HIS E CB    1 
ATOM   8361  C  CG    . HIS I 4 40  ? 42.337 23.765  40.107  1.00 66.99  ? 40   HIS E CG    1 
ATOM   8362  N  ND1   . HIS I 4 40  ? 41.256 22.958  40.383  1.00 68.33  ? 40   HIS E ND1   1 
ATOM   8363  C  CD2   . HIS I 4 40  ? 42.286 24.036  38.782  1.00 67.81  ? 40   HIS E CD2   1 
ATOM   8364  C  CE1   . HIS I 4 40  ? 40.576 22.752  39.270  1.00 69.20  ? 40   HIS E CE1   1 
ATOM   8365  N  NE2   . HIS I 4 40  ? 41.179 23.394  38.284  1.00 68.51  ? 40   HIS E NE2   1 
ATOM   8366  N  N     . THR I 4 41  ? 46.346 24.902  42.348  1.00 59.61  ? 41   THR E N     1 
ATOM   8367  C  CA    . THR I 4 41  ? 47.152 25.987  42.858  1.00 58.82  ? 41   THR E CA    1 
ATOM   8368  C  C     . THR I 4 41  ? 48.422 25.931  42.051  1.00 58.95  ? 41   THR E C     1 
ATOM   8369  O  O     . THR I 4 41  ? 48.787 26.918  41.415  1.00 59.12  ? 41   THR E O     1 
ATOM   8370  C  CB    . THR I 4 41  ? 47.481 25.852  44.347  1.00 58.84  ? 41   THR E CB    1 
ATOM   8371  O  OG1   . THR I 4 41  ? 46.282 25.968  45.117  1.00 58.12  ? 41   THR E OG1   1 
ATOM   8372  C  CG2   . THR I 4 41  ? 48.423 26.964  44.775  1.00 58.60  ? 41   THR E CG2   1 
ATOM   8373  N  N     . TRP I 4 42  ? 49.090 24.778  42.050  1.00 58.91  ? 42   TRP E N     1 
ATOM   8374  C  CA    . TRP I 4 42  ? 50.311 24.663  41.267  1.00 59.06  ? 42   TRP E CA    1 
ATOM   8375  C  C     . TRP I 4 42  ? 50.146 25.340  39.902  1.00 60.08  ? 42   TRP E C     1 
ATOM   8376  O  O     . TRP I 4 42  ? 51.045 26.079  39.458  1.00 60.11  ? 42   TRP E O     1 
ATOM   8377  C  CB    . TRP I 4 42  ? 50.695 23.210  41.065  1.00 58.28  ? 42   TRP E CB    1 
ATOM   8378  C  CG    . TRP I 4 42  ? 51.269 22.613  42.265  1.00 57.75  ? 42   TRP E CG    1 
ATOM   8379  C  CD1   . TRP I 4 42  ? 50.652 21.776  43.137  1.00 57.96  ? 42   TRP E CD1   1 
ATOM   8380  C  CD2   . TRP I 4 42  ? 52.576 22.846  42.783  1.00 56.78  ? 42   TRP E CD2   1 
ATOM   8381  N  NE1   . TRP I 4 42  ? 51.496 21.471  44.176  1.00 57.61  ? 42   TRP E NE1   1 
ATOM   8382  C  CE2   . TRP I 4 42  ? 52.684 22.121  43.981  1.00 56.55  ? 42   TRP E CE2   1 
ATOM   8383  C  CE3   . TRP I 4 42  ? 53.663 23.604  42.355  1.00 56.07  ? 42   TRP E CE3   1 
ATOM   8384  C  CZ2   . TRP I 4 42  ? 53.833 22.134  44.754  1.00 55.61  ? 42   TRP E CZ2   1 
ATOM   8385  C  CZ3   . TRP I 4 42  ? 54.804 23.616  43.127  1.00 55.21  ? 42   TRP E CZ3   1 
ATOM   8386  C  CH2   . TRP I 4 42  ? 54.879 22.888  44.311  1.00 54.85  ? 42   TRP E CH2   1 
ATOM   8387  N  N     . LYS I 4 43  ? 49.008 25.108  39.239  1.00 59.53  ? 43   LYS E N     1 
ATOM   8388  C  CA    . LYS I 4 43  ? 48.789 25.742  37.948  1.00 59.98  ? 43   LYS E CA    1 
ATOM   8389  C  C     . LYS I 4 43  ? 49.124 27.216  38.038  1.00 57.91  ? 43   LYS E C     1 
ATOM   8390  O  O     . LYS I 4 43  ? 50.011 27.686  37.325  1.00 58.86  ? 43   LYS E O     1 
ATOM   8391  C  CB    . LYS I 4 43  ? 47.350 25.589  37.458  1.00 62.74  ? 43   LYS E CB    1 
ATOM   8392  C  CG    . LYS I 4 43  ? 47.041 24.232  36.778  1.00 69.00  ? 43   LYS E CG    1 
ATOM   8393  C  CD    . LYS I 4 43  ? 48.045 23.841  35.636  1.00 72.56  ? 43   LYS E CD    1 
ATOM   8394  C  CE    . LYS I 4 43  ? 47.587 22.590  34.796  1.00 73.69  ? 43   LYS E CE    1 
ATOM   8395  N  NZ    . LYS I 4 43  ? 47.484 21.246  35.497  1.00 73.00  ? 43   LYS E NZ    1 
ATOM   8396  N  N     . MET I 4 44  ? 48.449 27.952  38.912  1.00 54.79  ? 44   MET E N     1 
ATOM   8397  C  CA    . MET I 4 44  ? 48.751 29.372  39.014  1.00 52.50  ? 44   MET E CA    1 
ATOM   8398  C  C     . MET I 4 44  ? 50.160 29.650  39.546  1.00 52.14  ? 44   MET E C     1 
ATOM   8399  O  O     . MET I 4 44  ? 50.758 30.678  39.218  1.00 51.99  ? 44   MET E O     1 
ATOM   8400  C  CB    . MET I 4 44  ? 47.749 30.092  39.908  1.00 51.67  ? 44   MET E CB    1 
ATOM   8401  C  CG    . MET I 4 44  ? 46.307 29.877  39.561  1.00 50.70  ? 44   MET E CG    1 
ATOM   8402  S  SD    . MET I 4 44  ? 45.929 30.373  37.918  1.00 49.80  ? 44   MET E SD    1 
ATOM   8403  C  CE    . MET I 4 44  ? 45.851 32.140  38.031  1.00 50.51  ? 44   MET E CE    1 
ATOM   8404  N  N     . LEU I 4 45  ? 50.706 28.757  40.363  1.00 50.91  ? 45   LEU E N     1 
ATOM   8405  C  CA    . LEU I 4 45  ? 52.033 29.033  40.897  1.00 50.07  ? 45   LEU E CA    1 
ATOM   8406  C  C     . LEU I 4 45  ? 53.010 29.100  39.769  1.00 50.20  ? 45   LEU E C     1 
ATOM   8407  O  O     . LEU I 4 45  ? 53.905 29.938  39.779  1.00 51.16  ? 45   LEU E O     1 
ATOM   8408  C  CB    . LEU I 4 45  ? 52.503 27.973  41.893  1.00 48.11  ? 45   LEU E CB    1 
ATOM   8409  C  CG    . LEU I 4 45  ? 53.963 28.138  42.323  1.00 45.33  ? 45   LEU E CG    1 
ATOM   8410  C  CD1   . LEU I 4 45  ? 54.160 29.424  43.067  1.00 44.91  ? 45   LEU E CD1   1 
ATOM   8411  C  CD2   . LEU I 4 45  ? 54.344 26.993  43.190  1.00 44.38  ? 45   LEU E CD2   1 
ATOM   8412  N  N     . LEU I 4 46  ? 52.837 28.212  38.798  1.00 49.91  ? 46   LEU E N     1 
ATOM   8413  C  CA    . LEU I 4 46  ? 53.727 28.170  37.640  1.00 50.27  ? 46   LEU E CA    1 
ATOM   8414  C  C     . LEU I 4 46  ? 53.347 29.295  36.673  1.00 49.89  ? 46   LEU E C     1 
ATOM   8415  O  O     . LEU I 4 46  ? 54.190 30.065  36.206  1.00 49.03  ? 46   LEU E O     1 
ATOM   8416  C  CB    . LEU I 4 46  ? 53.607 26.802  36.957  1.00 51.26  ? 46   LEU E CB    1 
ATOM   8417  C  CG    . LEU I 4 46  ? 53.931 25.616  37.878  1.00 52.18  ? 46   LEU E CG    1 
ATOM   8418  C  CD1   . LEU I 4 46  ? 53.611 24.281  37.216  1.00 52.20  ? 46   LEU E CD1   1 
ATOM   8419  C  CD2   . LEU I 4 46  ? 55.399 25.684  38.248  1.00 52.45  ? 46   LEU E CD2   1 
ATOM   8420  N  N     . SER I 4 47  ? 52.052 29.377  36.399  1.00 49.46  ? 47   SER E N     1 
ATOM   8421  C  CA    . SER I 4 47  ? 51.501 30.377  35.515  1.00 49.31  ? 47   SER E CA    1 
ATOM   8422  C  C     . SER I 4 47  ? 51.963 31.776  35.889  1.00 48.81  ? 47   SER E C     1 
ATOM   8423  O  O     . SER I 4 47  ? 52.041 32.669  35.046  1.00 48.39  ? 47   SER E O     1 
ATOM   8424  C  CB    . SER I 4 47  ? 49.981 30.299  35.555  1.00 49.36  ? 47   SER E CB    1 
ATOM   8425  O  OG    . SER I 4 47  ? 49.403 31.434  34.939  1.00 51.78  ? 47   SER E OG    1 
ATOM   8426  N  N     . VAL I 4 48  ? 52.274 31.989  37.152  1.00 49.30  ? 48   VAL E N     1 
ATOM   8427  C  CA    . VAL I 4 48  ? 52.708 33.313  37.511  1.00 51.42  ? 48   VAL E CA    1 
ATOM   8428  C  C     . VAL I 4 48  ? 54.216 33.355  37.520  1.00 52.60  ? 48   VAL E C     1 
ATOM   8429  O  O     . VAL I 4 48  ? 54.796 34.291  37.001  1.00 51.84  ? 48   VAL E O     1 
ATOM   8430  C  CB    . VAL I 4 48  ? 52.118 33.755  38.861  1.00 51.68  ? 48   VAL E CB    1 
ATOM   8431  C  CG1   . VAL I 4 48  ? 53.146 33.633  39.966  1.00 52.18  ? 48   VAL E CG1   1 
ATOM   8432  C  CG2   . VAL I 4 48  ? 51.601 35.176  38.741  1.00 51.73  ? 48   VAL E CG2   1 
ATOM   8433  N  N     . CYS I 4 49  ? 54.854 32.340  38.093  1.00 55.10  ? 49   CYS E N     1 
ATOM   8434  C  CA    . CYS I 4 49  ? 56.309 32.299  38.106  1.00 58.62  ? 49   CYS E CA    1 
ATOM   8435  C  C     . CYS I 4 49  ? 56.758 32.428  36.666  1.00 60.35  ? 49   CYS E C     1 
ATOM   8436  O  O     . CYS I 4 49  ? 57.750 33.101  36.374  1.00 61.24  ? 49   CYS E O     1 
ATOM   8437  C  CB    . CYS I 4 49  ? 56.817 30.983  38.670  1.00 60.73  ? 49   CYS E CB    1 
ATOM   8438  S  SG    . CYS I 4 49  ? 56.564 30.819  40.434  1.00 68.26  ? 49   CYS E SG    1 
ATOM   8439  N  N     . ARG I 4 50  ? 56.033 31.769  35.761  1.00 61.23  ? 50   ARG E N     1 
ATOM   8440  C  CA    . ARG I 4 50  ? 56.353 31.868  34.344  1.00 61.54  ? 50   ARG E CA    1 
ATOM   8441  C  C     . ARG I 4 50  ? 56.352 33.355  33.978  1.00 60.87  ? 50   ARG E C     1 
ATOM   8442  O  O     . ARG I 4 50  ? 57.392 33.891  33.579  1.00 61.02  ? 50   ARG E O     1 
ATOM   8443  C  CB    . ARG I 4 50  ? 55.321 31.131  33.483  1.00 63.78  ? 50   ARG E CB    1 
ATOM   8444  C  CG    . ARG I 4 50  ? 55.689 29.690  33.114  1.00 66.82  ? 50   ARG E CG    1 
ATOM   8445  C  CD    . ARG I 4 50  ? 54.985 29.244  31.807  1.00 69.66  ? 50   ARG E CD    1 
ATOM   8446  N  NE    . ARG I 4 50  ? 53.535 29.053  31.946  1.00 72.68  ? 50   ARG E NE    1 
ATOM   8447  C  CZ    . ARG I 4 50  ? 52.962 27.940  32.414  1.00 74.46  ? 50   ARG E CZ    1 
ATOM   8448  N  NH1   . ARG I 4 50  ? 53.713 26.902  32.787  1.00 73.95  ? 50   ARG E NH1   1 
ATOM   8449  N  NH2   . ARG I 4 50  ? 51.635 27.863  32.519  1.00 75.55  ? 50   ARG E NH2   1 
ATOM   8450  N  N     . SER I 4 51  ? 55.204 34.021  34.144  1.00 59.03  ? 51   SER E N     1 
ATOM   8451  C  CA    . SER I 4 51  ? 55.080 35.446  33.819  1.00 58.10  ? 51   SER E CA    1 
ATOM   8452  C  C     . SER I 4 51  ? 56.107 36.391  34.476  1.00 58.26  ? 51   SER E C     1 
ATOM   8453  O  O     . SER I 4 51  ? 56.632 37.303  33.827  1.00 57.95  ? 51   SER E O     1 
ATOM   8454  C  CB    . SER I 4 51  ? 53.675 35.939  34.153  1.00 57.54  ? 51   SER E CB    1 
ATOM   8455  O  OG    . SER I 4 51  ? 53.527 37.312  33.803  1.00 55.39  ? 51   SER E OG    1 
ATOM   8456  N  N     . TRP I 4 52  ? 56.371 36.183  35.765  1.00 57.86  ? 52   TRP E N     1 
ATOM   8457  C  CA    . TRP I 4 52  ? 57.327 36.995  36.524  1.00 56.11  ? 52   TRP E CA    1 
ATOM   8458  C  C     . TRP I 4 52  ? 58.671 36.876  35.823  1.00 56.88  ? 52   TRP E C     1 
ATOM   8459  O  O     . TRP I 4 52  ? 59.263 37.891  35.446  1.00 57.14  ? 52   TRP E O     1 
ATOM   8460  C  CB    . TRP I 4 52  ? 57.382 36.482  37.975  1.00 52.25  ? 52   TRP E CB    1 
ATOM   8461  C  CG    . TRP I 4 52  ? 58.548 36.895  38.819  1.00 47.55  ? 52   TRP E CG    1 
ATOM   8462  C  CD1   . TRP I 4 52  ? 59.400 36.063  39.471  1.00 45.82  ? 52   TRP E CD1   1 
ATOM   8463  C  CD2   . TRP I 4 52  ? 59.000 38.222  39.094  1.00 45.94  ? 52   TRP E CD2   1 
ATOM   8464  N  NE1   . TRP I 4 52  ? 60.358 36.781  40.131  1.00 44.71  ? 52   TRP E NE1   1 
ATOM   8465  C  CE2   . TRP I 4 52  ? 60.141 38.111  39.914  1.00 44.96  ? 52   TRP E CE2   1 
ATOM   8466  C  CE3   . TRP I 4 52  ? 58.560 39.492  38.723  1.00 45.88  ? 52   TRP E CE3   1 
ATOM   8467  C  CZ2   . TRP I 4 52  ? 60.853 39.221  40.367  1.00 44.80  ? 52   TRP E CZ2   1 
ATOM   8468  C  CZ3   . TRP I 4 52  ? 59.279 40.610  39.179  1.00 46.44  ? 52   TRP E CZ3   1 
ATOM   8469  C  CH2   . TRP I 4 52  ? 60.411 40.460  39.989  1.00 45.11  ? 52   TRP E CH2   1 
ATOM   8470  N  N     . ALA I 4 53  ? 59.121 35.636  35.613  1.00 58.01  ? 53   ALA E N     1 
ATOM   8471  C  CA    . ALA I 4 53  ? 60.394 35.360  34.936  1.00 59.19  ? 53   ALA E CA    1 
ATOM   8472  C  C     . ALA I 4 53  ? 60.460 36.042  33.562  1.00 60.20  ? 53   ALA E C     1 
ATOM   8473  O  O     . ALA I 4 53  ? 61.434 36.732  33.256  1.00 60.01  ? 53   ALA E O     1 
ATOM   8474  C  CB    . ALA I 4 53  ? 60.595 33.851  34.790  1.00 57.39  ? 53   ALA E CB    1 
ATOM   8475  N  N     . ALA I 4 54  ? 59.421 35.854  32.749  1.00 60.80  ? 54   ALA E N     1 
ATOM   8476  C  CA    . ALA I 4 54  ? 59.345 36.458  31.419  1.00 62.14  ? 54   ALA E CA    1 
ATOM   8477  C  C     . ALA I 4 54  ? 59.643 37.952  31.468  1.00 64.01  ? 54   ALA E C     1 
ATOM   8478  O  O     . ALA I 4 54  ? 60.369 38.492  30.630  1.00 63.96  ? 54   ALA E O     1 
ATOM   8479  C  CB    . ALA I 4 54  ? 57.961 36.247  30.834  1.00 61.08  ? 54   ALA E CB    1 
ATOM   8480  N  N     . TRP I 4 55  ? 59.057 38.614  32.457  1.00 66.06  ? 55   TRP E N     1 
ATOM   8481  C  CA    . TRP I 4 55  ? 59.211 40.046  32.650  1.00 67.09  ? 55   TRP E CA    1 
ATOM   8482  C  C     . TRP I 4 55  ? 60.621 40.380  33.106  1.00 69.18  ? 55   TRP E C     1 
ATOM   8483  O  O     . TRP I 4 55  ? 61.168 41.416  32.738  1.00 69.51  ? 55   TRP E O     1 
ATOM   8484  C  CB    . TRP I 4 55  ? 58.203 40.519  33.692  1.00 64.99  ? 55   TRP E CB    1 
ATOM   8485  C  CG    . TRP I 4 55  ? 58.194 41.988  33.914  1.00 62.37  ? 55   TRP E CG    1 
ATOM   8486  C  CD1   . TRP I 4 55  ? 57.433 42.907  33.270  1.00 62.07  ? 55   TRP E CD1   1 
ATOM   8487  C  CD2   . TRP I 4 55  ? 59.003 42.712  34.842  1.00 60.21  ? 55   TRP E CD2   1 
ATOM   8488  N  NE1   . TRP I 4 55  ? 57.715 44.169  33.738  1.00 60.84  ? 55   TRP E NE1   1 
ATOM   8489  C  CE2   . TRP I 4 55  ? 58.677 44.073  34.705  1.00 59.45  ? 55   TRP E CE2   1 
ATOM   8490  C  CE3   . TRP I 4 55  ? 59.971 42.340  35.775  1.00 59.49  ? 55   TRP E CE3   1 
ATOM   8491  C  CZ2   . TRP I 4 55  ? 59.283 45.062  35.462  1.00 58.93  ? 55   TRP E CZ2   1 
ATOM   8492  C  CZ3   . TRP I 4 55  ? 60.574 43.325  36.530  1.00 59.37  ? 55   TRP E CZ3   1 
ATOM   8493  C  CH2   . TRP I 4 55  ? 60.227 44.673  36.368  1.00 58.93  ? 55   TRP E CH2   1 
ATOM   8494  N  N     . CYS I 4 56  ? 61.202 39.503  33.917  1.00 72.41  ? 56   CYS E N     1 
ATOM   8495  C  CA    . CYS I 4 56  ? 62.551 39.720  34.420  1.00 76.26  ? 56   CYS E CA    1 
ATOM   8496  C  C     . CYS I 4 56  ? 63.572 39.799  33.289  1.00 78.52  ? 56   CYS E C     1 
ATOM   8497  O  O     . CYS I 4 56  ? 64.286 40.806  33.162  1.00 78.87  ? 56   CYS E O     1 
ATOM   8498  C  CB    . CYS I 4 56  ? 62.930 38.620  35.411  1.00 77.09  ? 56   CYS E CB    1 
ATOM   8499  S  SG    . CYS I 4 56  ? 62.228 38.884  37.074  1.00 79.86  ? 56   CYS E SG    1 
ATOM   8500  N  N     . LYS I 4 57  ? 63.656 38.741  32.479  1.00 80.71  ? 57   LYS E N     1 
ATOM   8501  C  CA    . LYS I 4 57  ? 64.571 38.733  31.326  1.00 82.33  ? 57   LYS E CA    1 
ATOM   8502  C  C     . LYS I 4 57  ? 63.797 39.522  30.272  1.00 82.46  ? 57   LYS E C     1 
ATOM   8503  O  O     . LYS I 4 57  ? 62.930 38.969  29.593  1.00 82.89  ? 57   LYS E O     1 
ATOM   8504  C  CB    . LYS I 4 57  ? 64.838 37.304  30.788  1.00 83.06  ? 57   LYS E CB    1 
ATOM   8505  C  CG    . LYS I 4 57  ? 65.389 36.255  31.797  1.00 85.18  ? 57   LYS E CG    1 
ATOM   8506  C  CD    . LYS I 4 57  ? 64.349 35.830  32.890  1.00 85.90  ? 57   LYS E CD    1 
ATOM   8507  C  CE    . LYS I 4 57  ? 64.730 34.533  33.660  1.00 85.81  ? 57   LYS E CE    1 
ATOM   8508  N  NZ    . LYS I 4 57  ? 64.651 33.248  32.865  1.00 85.64  ? 57   LYS E NZ    1 
ATOM   8509  N  N     . LEU I 4 58  ? 64.095 40.815  30.166  1.00 82.25  ? 58   LEU E N     1 
ATOM   8510  C  CA    . LEU I 4 58  ? 63.438 41.721  29.223  1.00 82.16  ? 58   LEU E CA    1 
ATOM   8511  C  C     . LEU I 4 58  ? 63.610 43.091  29.818  1.00 82.81  ? 58   LEU E C     1 
ATOM   8512  O  O     . LEU I 4 58  ? 63.523 44.101  29.125  1.00 83.10  ? 58   LEU E O     1 
ATOM   8513  C  CB    . LEU I 4 58  ? 61.940 41.402  29.081  1.00 82.03  ? 58   LEU E CB    1 
ATOM   8514  C  CG    . LEU I 4 58  ? 60.920 42.337  28.391  1.00 82.14  ? 58   LEU E CG    1 
ATOM   8515  C  CD1   . LEU I 4 58  ? 61.572 43.305  27.423  1.00 81.48  ? 58   LEU E CD1   1 
ATOM   8516  C  CD2   . LEU I 4 58  ? 59.884 41.470  27.658  1.00 81.79  ? 58   LEU E CD2   1 
ATOM   8517  N  N     . ASN I 4 59  ? 63.867 43.116  31.118  1.00 83.32  ? 59   ASN E N     1 
ATOM   8518  C  CA    . ASN I 4 59  ? 64.061 44.368  31.824  1.00 83.91  ? 59   ASN E CA    1 
ATOM   8519  C  C     . ASN I 4 59  ? 65.366 44.318  32.617  1.00 84.16  ? 59   ASN E C     1 
ATOM   8520  O  O     . ASN I 4 59  ? 65.791 45.324  33.193  1.00 84.12  ? 59   ASN E O     1 
ATOM   8521  C  CB    . ASN I 4 59  ? 62.857 44.639  32.742  1.00 84.22  ? 59   ASN E CB    1 
ATOM   8522  C  CG    . ASN I 4 59  ? 61.690 45.348  32.014  1.00 84.80  ? 59   ASN E CG    1 
ATOM   8523  O  OD1   . ASN I 4 59  ? 61.775 46.546  31.701  1.00 84.70  ? 59   ASN E OD1   1 
ATOM   8524  N  ND2   . ASN I 4 59  ? 60.602 44.610  31.750  1.00 83.53  ? 59   ASN E ND2   1 
ATOM   8525  N  N     . ASN I 4 60  ? 66.003 43.144  32.619  1.00 84.77  ? 60   ASN E N     1 
ATOM   8526  C  CA    . ASN I 4 60  ? 67.278 42.922  33.321  1.00 85.86  ? 60   ASN E CA    1 
ATOM   8527  C  C     . ASN I 4 60  ? 67.093 42.810  34.839  1.00 85.52  ? 60   ASN E C     1 
ATOM   8528  O  O     . ASN I 4 60  ? 67.385 43.761  35.570  1.00 85.42  ? 60   ASN E O     1 
ATOM   8529  C  CB    . ASN I 4 60  ? 68.278 44.067  33.024  1.00 86.78  ? 60   ASN E CB    1 
ATOM   8530  C  CG    . ASN I 4 60  ? 69.540 43.592  32.277  1.00 87.95  ? 60   ASN E CG    1 
ATOM   8531  O  OD1   . ASN I 4 60  ? 70.143 42.560  32.619  1.00 87.32  ? 60   ASN E OD1   1 
ATOM   8532  N  ND2   . ASN I 4 60  ? 69.950 44.362  31.264  1.00 88.13  ? 60   ASN E ND2   1 
ATOM   8533  N  N     . ARG I 4 61  ? 66.623 41.655  35.312  1.00 84.44  ? 61   ARG E N     1 
ATOM   8534  C  CA    . ARG I 4 61  ? 66.402 41.451  36.743  1.00 83.02  ? 61   ARG E CA    1 
ATOM   8535  C  C     . ARG I 4 61  ? 66.477 39.954  37.063  1.00 83.10  ? 61   ARG E C     1 
ATOM   8536  O  O     . ARG I 4 61  ? 66.097 39.136  36.232  1.00 83.22  ? 61   ARG E O     1 
ATOM   8537  C  CB    . ARG I 4 61  ? 65.010 41.972  37.144  1.00 81.44  ? 61   ARG E CB    1 
ATOM   8538  C  CG    . ARG I 4 61  ? 64.539 43.298  36.510  1.00 80.17  ? 61   ARG E CG    1 
ATOM   8539  C  CD    . ARG I 4 61  ? 65.243 44.535  37.070  1.00 79.50  ? 61   ARG E CD    1 
ATOM   8540  N  NE    . ARG I 4 61  ? 64.329 45.598  37.518  1.00 79.59  ? 61   ARG E NE    1 
ATOM   8541  C  CZ    . ARG I 4 61  ? 63.747 46.513  36.737  1.00 78.34  ? 61   ARG E CZ    1 
ATOM   8542  N  NH1   . ARG I 4 61  ? 63.967 46.519  35.429  1.00 76.64  ? 61   ARG E NH1   1 
ATOM   8543  N  NH2   . ARG I 4 61  ? 62.960 47.442  37.279  1.00 77.51  ? 61   ARG E NH2   1 
ATOM   8544  N  N     . LYS I 4 62  ? 66.970 39.596  38.252  1.00 83.21  ? 62   LYS E N     1 
ATOM   8545  C  CA    . LYS I 4 62  ? 67.038 38.184  38.676  1.00 83.57  ? 62   LYS E CA    1 
ATOM   8546  C  C     . LYS I 4 62  ? 65.630 37.777  39.143  1.00 82.57  ? 62   LYS E C     1 
ATOM   8547  O  O     . LYS I 4 62  ? 65.130 38.317  40.125  1.00 82.99  ? 62   LYS E O     1 
ATOM   8548  C  CB    . LYS I 4 62  ? 68.011 37.991  39.861  1.00 85.60  ? 62   LYS E CB    1 
ATOM   8549  C  CG    . LYS I 4 62  ? 69.510 38.207  39.578  1.00 88.69  ? 62   LYS E CG    1 
ATOM   8550  C  CD    . LYS I 4 62  ? 69.929 39.688  39.667  1.00 90.82  ? 62   LYS E CD    1 
ATOM   8551  C  CE    . LYS I 4 62  ? 71.423 39.892  39.312  1.00 91.39  ? 62   LYS E CE    1 
ATOM   8552  N  NZ    . LYS I 4 62  ? 71.850 41.338  39.292  1.00 90.51  ? 62   LYS E NZ    1 
ATOM   8553  N  N     . TRP I 4 63  ? 64.988 36.826  38.472  1.00 81.19  ? 63   TRP E N     1 
ATOM   8554  C  CA    . TRP I 4 63  ? 63.637 36.447  38.878  1.00 79.51  ? 63   TRP E CA    1 
ATOM   8555  C  C     . TRP I 4 63  ? 63.547 35.718  40.217  1.00 78.77  ? 63   TRP E C     1 
ATOM   8556  O  O     . TRP I 4 63  ? 62.459 35.570  40.770  1.00 78.90  ? 63   TRP E O     1 
ATOM   8557  C  CB    . TRP I 4 63  ? 62.962 35.590  37.812  1.00 79.62  ? 63   TRP E CB    1 
ATOM   8558  C  CG    . TRP I 4 63  ? 63.277 34.131  37.928  1.00 79.31  ? 63   TRP E CG    1 
ATOM   8559  C  CD1   . TRP I 4 63  ? 64.326 33.474  37.362  1.00 79.69  ? 63   TRP E CD1   1 
ATOM   8560  C  CD2   . TRP I 4 63  ? 62.534 33.147  38.660  1.00 78.71  ? 63   TRP E CD2   1 
ATOM   8561  N  NE1   . TRP I 4 63  ? 64.281 32.140  37.688  1.00 79.66  ? 63   TRP E NE1   1 
ATOM   8562  C  CE2   . TRP I 4 63  ? 63.192 31.912  38.486  1.00 78.69  ? 63   TRP E CE2   1 
ATOM   8563  C  CE3   . TRP I 4 63  ? 61.378 33.191  39.448  1.00 78.39  ? 63   TRP E CE3   1 
ATOM   8564  C  CZ2   . TRP I 4 63  ? 62.735 30.728  39.069  1.00 78.44  ? 63   TRP E CZ2   1 
ATOM   8565  C  CZ3   . TRP I 4 63  ? 60.923 32.014  40.028  1.00 78.87  ? 63   TRP E CZ3   1 
ATOM   8566  C  CH2   . TRP I 4 63  ? 61.603 30.799  39.835  1.00 78.68  ? 63   TRP E CH2   1 
ATOM   8567  N  N     . PHE I 4 64  ? 64.671 35.240  40.734  1.00 77.36  ? 64   PHE E N     1 
ATOM   8568  C  CA    . PHE I 4 64  ? 64.656 34.553  42.017  1.00 76.51  ? 64   PHE E CA    1 
ATOM   8569  C  C     . PHE I 4 64  ? 66.047 34.559  42.609  1.00 76.57  ? 64   PHE E C     1 
ATOM   8570  O  O     . PHE I 4 64  ? 67.001 34.192  41.940  1.00 77.68  ? 64   PHE E O     1 
ATOM   8571  C  CB    . PHE I 4 64  ? 64.171 33.111  41.855  1.00 75.88  ? 64   PHE E CB    1 
ATOM   8572  C  CG    . PHE I 4 64  ? 64.235 32.302  43.125  1.00 75.32  ? 64   PHE E CG    1 
ATOM   8573  C  CD1   . PHE I 4 64  ? 65.457 31.866  43.630  1.00 74.85  ? 64   PHE E CD1   1 
ATOM   8574  C  CD2   . PHE I 4 64  ? 63.077 32.010  43.836  1.00 74.58  ? 64   PHE E CD2   1 
ATOM   8575  C  CE1   . PHE I 4 64  ? 65.522 31.162  44.819  1.00 74.23  ? 64   PHE E CE1   1 
ATOM   8576  C  CE2   . PHE I 4 64  ? 63.135 31.303  45.031  1.00 74.03  ? 64   PHE E CE2   1 
ATOM   8577  C  CZ    . PHE I 4 64  ? 64.358 30.879  45.522  1.00 74.09  ? 64   PHE E CZ    1 
ATOM   8578  N  N     . PRO I 4 65  ? 66.184 34.976  43.877  1.00 76.22  ? 65   PRO E N     1 
ATOM   8579  C  CA    . PRO I 4 65  ? 65.113 35.435  44.765  1.00 75.78  ? 65   PRO E CA    1 
ATOM   8580  C  C     . PRO I 4 65  ? 64.613 36.789  44.300  1.00 75.41  ? 65   PRO E C     1 
ATOM   8581  O  O     . PRO I 4 65  ? 65.366 37.563  43.720  1.00 75.17  ? 65   PRO E O     1 
ATOM   8582  C  CB    . PRO I 4 65  ? 65.809 35.530  46.120  1.00 75.53  ? 65   PRO E CB    1 
ATOM   8583  C  CG    . PRO I 4 65  ? 66.973 34.577  45.990  1.00 75.64  ? 65   PRO E CG    1 
ATOM   8584  C  CD    . PRO I 4 65  ? 67.454 34.897  44.613  1.00 76.22  ? 65   PRO E CD    1 
ATOM   8585  N  N     . ALA I 4 66  ? 63.349 37.086  44.553  1.00 75.51  ? 66   ALA E N     1 
ATOM   8586  C  CA    . ALA I 4 66  ? 62.809 38.367  44.137  1.00 76.04  ? 66   ALA E CA    1 
ATOM   8587  C  C     . ALA I 4 66  ? 63.249 39.503  45.059  1.00 77.11  ? 66   ALA E C     1 
ATOM   8588  O  O     . ALA I 4 66  ? 63.323 39.342  46.283  1.00 77.42  ? 66   ALA E O     1 
ATOM   8589  C  CB    . ALA I 4 66  ? 61.294 38.295  44.091  1.00 75.95  ? 66   ALA E CB    1 
ATOM   8590  N  N     . GLU I 4 67  ? 63.559 40.648  44.461  1.00 78.16  ? 67   GLU E N     1 
ATOM   8591  C  CA    . GLU I 4 67  ? 63.961 41.826  45.223  1.00 79.28  ? 67   GLU E CA    1 
ATOM   8592  C  C     . GLU I 4 67  ? 62.782 42.799  45.153  1.00 78.42  ? 67   GLU E C     1 
ATOM   8593  O  O     . GLU I 4 67  ? 62.276 43.097  44.071  1.00 77.41  ? 67   GLU E O     1 
ATOM   8594  C  CB    . GLU I 4 67  ? 65.237 42.461  44.635  1.00 81.78  ? 67   GLU E CB    1 
ATOM   8595  C  CG    . GLU I 4 67  ? 66.544 41.626  44.814  1.00 85.35  ? 67   GLU E CG    1 
ATOM   8596  C  CD    . GLU I 4 67  ? 67.110 41.620  46.257  1.00 87.46  ? 67   GLU E CD    1 
ATOM   8597  O  OE1   . GLU I 4 67  ? 66.359 41.259  47.200  1.00 87.38  ? 67   GLU E OE1   1 
ATOM   8598  O  OE2   . GLU I 4 67  ? 68.310 41.968  46.441  1.00 88.55  ? 67   GLU E OE2   1 
ATOM   8599  N  N     . PRO I 4 68  ? 62.333 43.304  46.314  1.00 78.42  ? 68   PRO E N     1 
ATOM   8600  C  CA    . PRO I 4 68  ? 61.206 44.233  46.370  1.00 77.15  ? 68   PRO E CA    1 
ATOM   8601  C  C     . PRO I 4 68  ? 61.231 45.247  45.265  1.00 76.97  ? 68   PRO E C     1 
ATOM   8602  O  O     . PRO I 4 68  ? 60.342 45.268  44.415  1.00 77.02  ? 68   PRO E O     1 
ATOM   8603  C  CB    . PRO I 4 68  ? 61.352 44.882  47.740  1.00 77.44  ? 68   PRO E CB    1 
ATOM   8604  C  CG    . PRO I 4 68  ? 62.813 44.820  47.985  1.00 78.78  ? 68   PRO E CG    1 
ATOM   8605  C  CD    . PRO I 4 68  ? 63.121 43.404  47.552  1.00 79.08  ? 68   PRO E CD    1 
ATOM   8606  N  N     . GLU I 4 69  ? 62.259 46.082  45.271  1.00 76.55  ? 69   GLU E N     1 
ATOM   8607  C  CA    . GLU I 4 69  ? 62.369 47.115  44.263  1.00 75.73  ? 69   GLU E CA    1 
ATOM   8608  C  C     . GLU I 4 69  ? 61.822 46.644  42.914  1.00 73.77  ? 69   GLU E C     1 
ATOM   8609  O  O     . GLU I 4 69  ? 61.073 47.369  42.252  1.00 73.33  ? 69   GLU E O     1 
ATOM   8610  C  CB    . GLU I 4 69  ? 63.823 47.570  44.129  1.00 78.68  ? 69   GLU E CB    1 
ATOM   8611  C  CG    . GLU I 4 69  ? 63.889 49.024  43.759  1.00 83.07  ? 69   GLU E CG    1 
ATOM   8612  C  CD    . GLU I 4 69  ? 62.819 49.829  44.516  1.00 86.45  ? 69   GLU E CD    1 
ATOM   8613  O  OE1   . GLU I 4 69  ? 63.060 50.239  45.682  1.00 87.60  ? 69   GLU E OE1   1 
ATOM   8614  O  OE2   . GLU I 4 69  ? 61.716 50.029  43.947  1.00 88.17  ? 69   GLU E OE2   1 
ATOM   8615  N  N     . ASP I 4 70  ? 62.174 45.411  42.544  1.00 71.75  ? 70   ASP E N     1 
ATOM   8616  C  CA    . ASP I 4 70  ? 61.752 44.783  41.284  1.00 68.48  ? 70   ASP E CA    1 
ATOM   8617  C  C     . ASP I 4 70  ? 60.250 44.438  41.299  1.00 65.85  ? 70   ASP E C     1 
ATOM   8618  O  O     . ASP I 4 70  ? 59.471 44.963  40.489  1.00 65.17  ? 70   ASP E O     1 
ATOM   8619  C  CB    . ASP I 4 70  ? 62.586 43.508  41.034  1.00 68.82  ? 70   ASP E CB    1 
ATOM   8620  C  CG    . ASP I 4 70  ? 64.100 43.797  40.816  1.00 69.76  ? 70   ASP E CG    1 
ATOM   8621  O  OD1   . ASP I 4 70  ? 64.911 42.827  40.916  1.00 69.56  ? 70   ASP E OD1   1 
ATOM   8622  O  OD2   . ASP I 4 70  ? 64.475 44.975  40.538  1.00 68.70  ? 70   ASP E OD2   1 
ATOM   8623  N  N     . VAL I 4 71  ? 59.854 43.559  42.220  1.00 61.89  ? 71   VAL E N     1 
ATOM   8624  C  CA    . VAL I 4 71  ? 58.456 43.151  42.350  1.00 57.18  ? 71   VAL E CA    1 
ATOM   8625  C  C     . VAL I 4 71  ? 57.586 44.381  42.169  1.00 55.32  ? 71   VAL E C     1 
ATOM   8626  O  O     . VAL I 4 71  ? 56.630 44.380  41.401  1.00 53.18  ? 71   VAL E O     1 
ATOM   8627  C  CB    . VAL I 4 71  ? 58.173 42.525  43.746  1.00 54.84  ? 71   VAL E CB    1 
ATOM   8628  C  CG1   . VAL I 4 71  ? 56.726 42.167  43.863  1.00 53.06  ? 71   VAL E CG1   1 
ATOM   8629  C  CG2   . VAL I 4 71  ? 59.019 41.287  43.956  1.00 52.95  ? 71   VAL E CG2   1 
ATOM   8630  N  N     . ARG I 4 72  ? 57.951 45.445  42.866  1.00 54.63  ? 72   ARG E N     1 
ATOM   8631  C  CA    . ARG I 4 72  ? 57.202 46.685  42.787  1.00 54.81  ? 72   ARG E CA    1 
ATOM   8632  C  C     . ARG I 4 72  ? 57.039 47.179  41.359  1.00 55.59  ? 72   ARG E C     1 
ATOM   8633  O  O     . ARG I 4 72  ? 55.947 47.596  40.953  1.00 55.43  ? 72   ARG E O     1 
ATOM   8634  C  CB    . ARG I 4 72  ? 57.869 47.785  43.614  1.00 54.19  ? 72   ARG E CB    1 
ATOM   8635  C  CG    . ARG I 4 72  ? 57.184 49.116  43.419  1.00 53.73  ? 72   ARG E CG    1 
ATOM   8636  C  CD    . ARG I 4 72  ? 57.751 50.235  44.273  1.00 55.09  ? 72   ARG E CD    1 
ATOM   8637  N  NE    . ARG I 4 72  ? 56.962 51.457  44.079  1.00 56.32  ? 72   ARG E NE    1 
ATOM   8638  C  CZ    . ARG I 4 72  ? 57.258 52.420  43.210  1.00 55.85  ? 72   ARG E CZ    1 
ATOM   8639  N  NH1   . ARG I 4 72  ? 58.347 52.321  42.457  1.00 56.59  ? 72   ARG E NH1   1 
ATOM   8640  N  NH2   . ARG I 4 72  ? 56.438 53.454  43.058  1.00 55.22  ? 72   ARG E NH2   1 
ATOM   8641  N  N     . ASP I 4 73  ? 58.126 47.151  40.593  1.00 57.08  ? 73   ASP E N     1 
ATOM   8642  C  CA    . ASP I 4 73  ? 58.054 47.623  39.214  1.00 58.01  ? 73   ASP E CA    1 
ATOM   8643  C  C     . ASP I 4 73  ? 57.174 46.672  38.392  1.00 56.48  ? 73   ASP E C     1 
ATOM   8644  O  O     . ASP I 4 73  ? 56.426 47.096  37.499  1.00 53.53  ? 73   ASP E O     1 
ATOM   8645  C  CB    . ASP I 4 73  ? 59.477 47.789  38.635  1.00 60.72  ? 73   ASP E CB    1 
ATOM   8646  C  CG    . ASP I 4 73  ? 60.215 49.022  39.224  1.00 63.66  ? 73   ASP E CG    1 
ATOM   8647  O  OD1   . ASP I 4 73  ? 60.525 48.999  40.435  1.00 65.61  ? 73   ASP E OD1   1 
ATOM   8648  O  OD2   . ASP I 4 73  ? 60.467 50.018  38.494  1.00 63.86  ? 73   ASP E OD2   1 
ATOM   8649  N  N     . TYR I 4 74  ? 57.238 45.392  38.757  1.00 56.26  ? 74   TYR E N     1 
ATOM   8650  C  CA    . TYR I 4 74  ? 56.450 44.346  38.114  1.00 55.56  ? 74   TYR E CA    1 
ATOM   8651  C  C     . TYR I 4 74  ? 54.975 44.536  38.444  1.00 55.38  ? 74   TYR E C     1 
ATOM   8652  O  O     . TYR I 4 74  ? 54.127 44.504  37.555  1.00 54.80  ? 74   TYR E O     1 
ATOM   8653  C  CB    . TYR I 4 74  ? 56.911 42.971  38.600  1.00 54.62  ? 74   TYR E CB    1 
ATOM   8654  C  CG    . TYR I 4 74  ? 56.062 41.801  38.123  1.00 54.88  ? 74   TYR E CG    1 
ATOM   8655  C  CD1   . TYR I 4 74  ? 55.756 41.616  36.772  1.00 55.44  ? 74   TYR E CD1   1 
ATOM   8656  C  CD2   . TYR I 4 74  ? 55.607 40.843  39.024  1.00 54.99  ? 74   TYR E CD2   1 
ATOM   8657  C  CE1   . TYR I 4 74  ? 55.016 40.493  36.343  1.00 54.59  ? 74   TYR E CE1   1 
ATOM   8658  C  CE2   . TYR I 4 74  ? 54.874 39.735  38.606  1.00 54.35  ? 74   TYR E CE2   1 
ATOM   8659  C  CZ    . TYR I 4 74  ? 54.582 39.568  37.278  1.00 53.93  ? 74   TYR E CZ    1 
ATOM   8660  O  OH    . TYR I 4 74  ? 53.828 38.489  36.917  1.00 52.17  ? 74   TYR E OH    1 
ATOM   8661  N  N     . LEU I 4 75  ? 54.664 44.745  39.722  1.00 54.67  ? 75   LEU E N     1 
ATOM   8662  C  CA    . LEU I 4 75  ? 53.276 44.919  40.092  1.00 53.33  ? 75   LEU E CA    1 
ATOM   8663  C  C     . LEU I 4 75  ? 52.690 46.111  39.384  1.00 53.91  ? 75   LEU E C     1 
ATOM   8664  O  O     . LEU I 4 75  ? 51.632 46.006  38.781  1.00 54.57  ? 75   LEU E O     1 
ATOM   8665  C  CB    . LEU I 4 75  ? 53.120 45.050  41.600  1.00 51.19  ? 75   LEU E CB    1 
ATOM   8666  C  CG    . LEU I 4 75  ? 53.372 43.729  42.336  1.00 49.92  ? 75   LEU E CG    1 
ATOM   8667  C  CD1   . LEU I 4 75  ? 52.940 43.827  43.768  1.00 49.75  ? 75   LEU E CD1   1 
ATOM   8668  C  CD2   . LEU I 4 75  ? 52.587 42.635  41.697  1.00 50.23  ? 75   LEU E CD2   1 
ATOM   8669  N  N     . LEU I 4 76  ? 53.390 47.236  39.413  1.00 54.44  ? 76   LEU E N     1 
ATOM   8670  C  CA    . LEU I 4 76  ? 52.900 48.454  38.754  1.00 55.09  ? 76   LEU E CA    1 
ATOM   8671  C  C     . LEU I 4 76  ? 52.677 48.257  37.253  1.00 55.68  ? 76   LEU E C     1 
ATOM   8672  O  O     . LEU I 4 76  ? 52.000 49.047  36.578  1.00 53.97  ? 76   LEU E O     1 
ATOM   8673  C  CB    . LEU I 4 76  ? 53.895 49.590  38.983  1.00 54.01  ? 76   LEU E CB    1 
ATOM   8674  C  CG    . LEU I 4 76  ? 53.473 50.618  40.020  1.00 52.64  ? 76   LEU E CG    1 
ATOM   8675  C  CD1   . LEU I 4 76  ? 54.598 51.597  40.196  1.00 53.34  ? 76   LEU E CD1   1 
ATOM   8676  C  CD2   . LEU I 4 76  ? 52.195 51.315  39.574  1.00 51.13  ? 76   LEU E CD2   1 
ATOM   8677  N  N     . TYR I 4 77  ? 53.273 47.181  36.759  1.00 57.36  ? 77   TYR E N     1 
ATOM   8678  C  CA    . TYR I 4 77  ? 53.206 46.784  35.362  1.00 58.68  ? 77   TYR E CA    1 
ATOM   8679  C  C     . TYR I 4 77  ? 51.870 46.113  35.085  1.00 57.30  ? 77   TYR E C     1 
ATOM   8680  O  O     . TYR I 4 77  ? 51.147 46.501  34.171  1.00 55.94  ? 77   TYR E O     1 
ATOM   8681  C  CB    . TYR I 4 77  ? 54.383 45.842  35.092  1.00 62.48  ? 77   TYR E CB    1 
ATOM   8682  C  CG    . TYR I 4 77  ? 54.316 45.001  33.851  1.00 65.41  ? 77   TYR E CG    1 
ATOM   8683  C  CD1   . TYR I 4 77  ? 54.367 45.573  32.584  1.00 66.77  ? 77   TYR E CD1   1 
ATOM   8684  C  CD2   . TYR I 4 77  ? 54.220 43.612  33.951  1.00 66.97  ? 77   TYR E CD2   1 
ATOM   8685  C  CE1   . TYR I 4 77  ? 54.319 44.766  31.430  1.00 69.05  ? 77   TYR E CE1   1 
ATOM   8686  C  CE2   . TYR I 4 77  ? 54.174 42.801  32.818  1.00 68.64  ? 77   TYR E CE2   1 
ATOM   8687  C  CZ    . TYR I 4 77  ? 54.220 43.376  31.559  1.00 69.17  ? 77   TYR E CZ    1 
ATOM   8688  O  OH    . TYR I 4 77  ? 54.144 42.555  30.451  1.00 69.77  ? 77   TYR E OH    1 
ATOM   8689  N  N     . LEU I 4 78  ? 51.538 45.119  35.900  1.00 56.10  ? 78   LEU E N     1 
ATOM   8690  C  CA    . LEU I 4 78  ? 50.279 44.405  35.746  1.00 55.65  ? 78   LEU E CA    1 
ATOM   8691  C  C     . LEU I 4 78  ? 49.113 45.379  35.832  1.00 56.01  ? 78   LEU E C     1 
ATOM   8692  O  O     . LEU I 4 78  ? 48.028 45.104  35.335  1.00 55.04  ? 78   LEU E O     1 
ATOM   8693  C  CB    . LEU I 4 78  ? 50.145 43.299  36.806  1.00 53.79  ? 78   LEU E CB    1 
ATOM   8694  C  CG    . LEU I 4 78  ? 51.087 42.105  36.607  1.00 52.85  ? 78   LEU E CG    1 
ATOM   8695  C  CD1   . LEU I 4 78  ? 52.495 42.592  36.730  1.00 53.10  ? 78   LEU E CD1   1 
ATOM   8696  C  CD2   . LEU I 4 78  ? 50.849 41.012  37.627  1.00 51.20  ? 78   LEU E CD2   1 
ATOM   8697  N  N     . GLN I 4 79  ? 49.344 46.527  36.454  1.00 57.60  ? 79   GLN E N     1 
ATOM   8698  C  CA    . GLN I 4 79  ? 48.292 47.521  36.577  1.00 59.32  ? 79   GLN E CA    1 
ATOM   8699  C  C     . GLN I 4 79  ? 48.081 48.138  35.208  1.00 60.46  ? 79   GLN E C     1 
ATOM   8700  O  O     . GLN I 4 79  ? 46.942 48.252  34.742  1.00 60.66  ? 79   GLN E O     1 
ATOM   8701  C  CB    . GLN I 4 79  ? 48.678 48.616  37.585  1.00 59.25  ? 79   GLN E CB    1 
ATOM   8702  C  CG    . GLN I 4 79  ? 47.613 49.709  37.750  1.00 59.66  ? 79   GLN E CG    1 
ATOM   8703  C  CD    . GLN I 4 79  ? 48.047 50.839  38.682  1.00 60.72  ? 79   GLN E CD    1 
ATOM   8704  O  OE1   . GLN I 4 79  ? 49.034 51.540  38.419  1.00 61.19  ? 79   GLN E OE1   1 
ATOM   8705  N  NE2   . GLN I 4 79  ? 47.309 51.022  39.774  1.00 60.13  ? 79   GLN E NE2   1 
ATOM   8706  N  N     . ALA I 4 80  ? 49.196 48.516  34.571  1.00 61.70  ? 80   ALA E N     1 
ATOM   8707  C  CA    . ALA I 4 80  ? 49.200 49.153  33.248  1.00 62.16  ? 80   ALA E CA    1 
ATOM   8708  C  C     . ALA I 4 80  ? 48.579 48.267  32.187  1.00 62.64  ? 80   ALA E C     1 
ATOM   8709  O  O     . ALA I 4 80  ? 47.761 48.733  31.384  1.00 61.44  ? 80   ALA E O     1 
ATOM   8710  C  CB    . ALA I 4 80  ? 50.611 49.513  32.854  1.00 62.31  ? 80   ALA E CB    1 
ATOM   8711  N  N     . ARG I 4 81  ? 48.976 46.993  32.195  1.00 63.52  ? 81   ARG E N     1 
ATOM   8712  C  CA    . ARG I 4 81  ? 48.456 46.001  31.265  1.00 63.73  ? 81   ARG E CA    1 
ATOM   8713  C  C     . ARG I 4 81  ? 46.938 45.920  31.448  1.00 62.41  ? 81   ARG E C     1 
ATOM   8714  O  O     . ARG I 4 81  ? 46.240 45.399  30.593  1.00 63.55  ? 81   ARG E O     1 
ATOM   8715  C  CB    . ARG I 4 81  ? 49.118 44.633  31.519  1.00 66.80  ? 81   ARG E CB    1 
ATOM   8716  C  CG    . ARG I 4 81  ? 48.986 43.600  30.374  1.00 72.21  ? 81   ARG E CG    1 
ATOM   8717  C  CD    . ARG I 4 81  ? 50.013 42.451  30.476  1.00 74.80  ? 81   ARG E CD    1 
ATOM   8718  N  NE    . ARG I 4 81  ? 49.488 41.232  31.099  1.00 78.24  ? 81   ARG E NE    1 
ATOM   8719  C  CZ    . ARG I 4 81  ? 50.240 40.180  31.449  1.00 81.04  ? 81   ARG E CZ    1 
ATOM   8720  N  NH1   . ARG I 4 81  ? 51.559 40.197  31.240  1.00 81.45  ? 81   ARG E NH1   1 
ATOM   8721  N  NH2   . ARG I 4 81  ? 49.683 39.101  32.005  1.00 81.82  ? 81   ARG E NH2   1 
ATOM   8722  N  N     . GLY I 4 82  ? 46.431 46.444  32.563  1.00 61.15  ? 82   GLY E N     1 
ATOM   8723  C  CA    . GLY I 4 82  ? 44.993 46.450  32.803  1.00 59.12  ? 82   GLY E CA    1 
ATOM   8724  C  C     . GLY I 4 82  ? 44.380 45.327  33.632  1.00 57.72  ? 82   GLY E C     1 
ATOM   8725  O  O     . GLY I 4 82  ? 43.172 45.340  33.885  1.00 56.38  ? 82   GLY E O     1 
ATOM   8726  N  N     . LEU I 4 83  ? 45.194 44.356  34.044  1.00 56.92  ? 83   LEU E N     1 
ATOM   8727  C  CA    . LEU I 4 83  ? 44.717 43.234  34.848  1.00 56.04  ? 83   LEU E CA    1 
ATOM   8728  C  C     . LEU I 4 83  ? 43.993 43.814  36.047  1.00 56.53  ? 83   LEU E C     1 
ATOM   8729  O  O     . LEU I 4 83  ? 44.391 44.857  36.577  1.00 57.28  ? 83   LEU E O     1 
ATOM   8730  C  CB    . LEU I 4 83  ? 45.895 42.387  35.310  1.00 55.39  ? 83   LEU E CB    1 
ATOM   8731  C  CG    . LEU I 4 83  ? 46.815 41.968  34.167  1.00 54.88  ? 83   LEU E CG    1 
ATOM   8732  C  CD1   . LEU I 4 83  ? 48.135 41.467  34.684  1.00 54.92  ? 83   LEU E CD1   1 
ATOM   8733  C  CD2   . LEU I 4 83  ? 46.132 40.912  33.362  1.00 55.46  ? 83   LEU E CD2   1 
ATOM   8734  N  N     . ALA I 4 84  ? 42.928 43.150  36.478  1.00 56.38  ? 84   ALA E N     1 
ATOM   8735  C  CA    . ALA I 4 84  ? 42.145 43.640  37.614  1.00 55.62  ? 84   ALA E CA    1 
ATOM   8736  C  C     . ALA I 4 84  ? 42.817 43.379  38.969  1.00 54.06  ? 84   ALA E C     1 
ATOM   8737  O  O     . ALA I 4 84  ? 43.554 42.406  39.128  1.00 54.54  ? 84   ALA E O     1 
ATOM   8738  C  CB    . ALA I 4 84  ? 40.752 43.030  37.575  1.00 55.68  ? 84   ALA E CB    1 
ATOM   8739  N  N     . VAL I 4 85  ? 42.550 44.257  39.934  1.00 51.57  ? 85   VAL E N     1 
ATOM   8740  C  CA    . VAL I 4 85  ? 43.133 44.166  41.266  1.00 49.62  ? 85   VAL E CA    1 
ATOM   8741  C  C     . VAL I 4 85  ? 43.228 42.768  41.826  1.00 50.12  ? 85   VAL E C     1 
ATOM   8742  O  O     . VAL I 4 85  ? 44.326 42.286  42.143  1.00 49.77  ? 85   VAL E O     1 
ATOM   8743  C  CB    . VAL I 4 85  ? 42.348 44.993  42.264  1.00 48.38  ? 85   VAL E CB    1 
ATOM   8744  C  CG1   . VAL I 4 85  ? 43.200 45.287  43.479  1.00 45.43  ? 85   VAL E CG1   1 
ATOM   8745  C  CG2   . VAL I 4 85  ? 41.906 46.265  41.614  1.00 48.34  ? 85   VAL E CG2   1 
ATOM   8746  N  N     . LYS I 4 86  ? 42.079 42.115  41.956  1.00 49.25  ? 86   LYS E N     1 
ATOM   8747  C  CA    . LYS I 4 86  ? 42.052 40.763  42.506  1.00 49.29  ? 86   LYS E CA    1 
ATOM   8748  C  C     . LYS I 4 86  ? 43.032 39.787  41.845  1.00 48.63  ? 86   LYS E C     1 
ATOM   8749  O  O     . LYS I 4 86  ? 43.232 38.665  42.324  1.00 49.37  ? 86   LYS E O     1 
ATOM   8750  C  CB    . LYS I 4 86  ? 40.641 40.185  42.408  1.00 50.93  ? 86   LYS E CB    1 
ATOM   8751  C  CG    . LYS I 4 86  ? 40.158 39.458  43.679  1.00 51.76  ? 86   LYS E CG    1 
ATOM   8752  C  CD    . LYS I 4 86  ? 41.030 38.273  44.082  1.00 51.09  ? 86   LYS E CD    1 
ATOM   8753  C  CE    . LYS I 4 86  ? 40.648 37.788  45.482  1.00 51.70  ? 86   LYS E CE    1 
ATOM   8754  N  NZ    . LYS I 4 86  ? 39.169 37.512  45.580  1.00 50.66  ? 86   LYS E NZ    1 
ATOM   8755  N  N     . THR I 4 87  ? 43.631 40.211  40.738  1.00 48.18  ? 87   THR E N     1 
ATOM   8756  C  CA    . THR I 4 87  ? 44.575 39.383  40.000  1.00 46.21  ? 87   THR E CA    1 
ATOM   8757  C  C     . THR I 4 87  ? 45.985 39.750  40.387  1.00 45.80  ? 87   THR E C     1 
ATOM   8758  O  O     . THR I 4 87  ? 46.819 38.876  40.595  1.00 44.92  ? 87   THR E O     1 
ATOM   8759  C  CB    . THR I 4 87  ? 44.447 39.616  38.507  1.00 46.10  ? 87   THR E CB    1 
ATOM   8760  O  OG1   . THR I 4 87  ? 43.096 39.383  38.103  1.00 46.06  ? 87   THR E OG1   1 
ATOM   8761  C  CG2   . THR I 4 87  ? 45.386 38.701  37.750  1.00 46.46  ? 87   THR E CG2   1 
ATOM   8762  N  N     . ILE I 4 88  ? 46.243 41.053  40.458  1.00 44.71  ? 88   ILE E N     1 
ATOM   8763  C  CA    . ILE I 4 88  ? 47.552 41.550  40.817  1.00 44.40  ? 88   ILE E CA    1 
ATOM   8764  C  C     . ILE I 4 88  ? 47.916 40.895  42.122  1.00 47.52  ? 88   ILE E C     1 
ATOM   8765  O  O     . ILE I 4 88  ? 49.068 40.503  42.346  1.00 47.23  ? 88   ILE E O     1 
ATOM   8766  C  CB    . ILE I 4 88  ? 47.514 43.050  40.987  1.00 41.82  ? 88   ILE E CB    1 
ATOM   8767  C  CG1   . ILE I 4 88  ? 46.993 43.646  39.701  1.00 40.49  ? 88   ILE E CG1   1 
ATOM   8768  C  CG2   . ILE I 4 88  ? 48.895 43.608  41.314  1.00 39.18  ? 88   ILE E CG2   1 
ATOM   8769  C  CD1   . ILE I 4 88  ? 47.239 45.080  39.602  1.00 42.19  ? 88   ILE E CD1   1 
ATOM   8770  N  N     . GLN I 4 89  ? 46.906 40.748  42.975  1.00 50.09  ? 89   GLN E N     1 
ATOM   8771  C  CA    . GLN I 4 89  ? 47.108 40.136  44.275  1.00 52.96  ? 89   GLN E CA    1 
ATOM   8772  C  C     . GLN I 4 89  ? 47.433 38.638  44.163  1.00 53.06  ? 89   GLN E C     1 
ATOM   8773  O  O     . GLN I 4 89  ? 48.237 38.133  44.939  1.00 52.66  ? 89   GLN E O     1 
ATOM   8774  C  CB    . GLN I 4 89  ? 45.875 40.359  45.170  1.00 55.69  ? 89   GLN E CB    1 
ATOM   8775  C  CG    . GLN I 4 89  ? 46.176 40.197  46.680  1.00 60.43  ? 89   GLN E CG    1 
ATOM   8776  C  CD    . GLN I 4 89  ? 46.355 41.538  47.438  1.00 63.10  ? 89   GLN E CD    1 
ATOM   8777  O  OE1   . GLN I 4 89  ? 47.153 41.636  48.396  1.00 62.48  ? 89   GLN E OE1   1 
ATOM   8778  N  NE2   . GLN I 4 89  ? 45.592 42.561  47.027  1.00 64.14  ? 89   GLN E NE2   1 
ATOM   8779  N  N     . GLN I 4 90  ? 46.818 37.932  43.208  1.00 53.33  ? 90   GLN E N     1 
ATOM   8780  C  CA    . GLN I 4 90  ? 47.087 36.498  43.032  1.00 53.12  ? 90   GLN E CA    1 
ATOM   8781  C  C     . GLN I 4 90  ? 48.520 36.323  42.530  1.00 52.51  ? 90   GLN E C     1 
ATOM   8782  O  O     . GLN I 4 90  ? 49.184 35.327  42.837  1.00 52.61  ? 90   GLN E O     1 
ATOM   8783  C  CB    . GLN I 4 90  ? 46.095 35.856  42.042  1.00 53.97  ? 90   GLN E CB    1 
ATOM   8784  C  CG    . GLN I 4 90  ? 46.421 34.392  41.660  1.00 55.93  ? 90   GLN E CG    1 
ATOM   8785  C  CD    . GLN I 4 90  ? 45.965 33.387  42.700  1.00 58.86  ? 90   GLN E CD    1 
ATOM   8786  O  OE1   . GLN I 4 90  ? 44.778 33.105  42.811  1.00 60.36  ? 90   GLN E OE1   1 
ATOM   8787  N  NE2   . GLN I 4 90  ? 46.905 32.852  43.477  1.00 59.87  ? 90   GLN E NE2   1 
ATOM   8788  N  N     . HIS I 4 91  ? 48.995 37.295  41.756  1.00 51.51  ? 91   HIS E N     1 
ATOM   8789  C  CA    . HIS I 4 91  ? 50.359 37.251  41.249  1.00 50.40  ? 91   HIS E CA    1 
ATOM   8790  C  C     . HIS I 4 91  ? 51.276 37.395  42.447  1.00 48.88  ? 91   HIS E C     1 
ATOM   8791  O  O     . HIS I 4 91  ? 52.116 36.515  42.705  1.00 47.95  ? 91   HIS E O     1 
ATOM   8792  C  CB    . HIS I 4 91  ? 50.606 38.394  40.265  1.00 52.49  ? 91   HIS E CB    1 
ATOM   8793  C  CG    . HIS I 4 91  ? 50.098 38.122  38.879  1.00 53.85  ? 91   HIS E CG    1 
ATOM   8794  N  ND1   . HIS I 4 91  ? 50.939 37.885  37.813  1.00 52.96  ? 91   HIS E ND1   1 
ATOM   8795  C  CD2   . HIS I 4 91  ? 48.837 38.041  38.392  1.00 53.15  ? 91   HIS E CD2   1 
ATOM   8796  C  CE1   . HIS I 4 91  ? 50.216 37.667  36.731  1.00 53.49  ? 91   HIS E CE1   1 
ATOM   8797  N  NE2   . HIS I 4 91  ? 48.938 37.757  37.055  1.00 53.34  ? 91   HIS E NE2   1 
ATOM   8798  N  N     . LEU I 4 92  ? 51.085 38.504  43.174  1.00 47.27  ? 92   LEU E N     1 
ATOM   8799  C  CA    . LEU I 4 92  ? 51.851 38.827  44.382  1.00 45.02  ? 92   LEU E CA    1 
ATOM   8800  C  C     . LEU I 4 92  ? 51.730 37.662  45.342  1.00 45.14  ? 92   LEU E C     1 
ATOM   8801  O  O     . LEU I 4 92  ? 52.711 37.190  45.905  1.00 45.20  ? 92   LEU E O     1 
ATOM   8802  C  CB    . LEU I 4 92  ? 51.287 40.072  45.055  1.00 42.92  ? 92   LEU E CB    1 
ATOM   8803  C  CG    . LEU I 4 92  ? 52.294 41.012  45.721  1.00 41.77  ? 92   LEU E CG    1 
ATOM   8804  C  CD1   . LEU I 4 92  ? 51.581 42.115  46.486  1.00 40.13  ? 92   LEU E CD1   1 
ATOM   8805  C  CD2   . LEU I 4 92  ? 53.170 40.228  46.634  1.00 41.36  ? 92   LEU E CD2   1 
ATOM   8806  N  N     . GLY I 4 93  ? 50.504 37.198  45.519  1.00 45.65  ? 93   GLY E N     1 
ATOM   8807  C  CA    . GLY I 4 93  ? 50.266 36.083  46.404  1.00 46.67  ? 93   GLY E CA    1 
ATOM   8808  C  C     . GLY I 4 93  ? 51.204 34.954  46.065  1.00 46.94  ? 93   GLY E C     1 
ATOM   8809  O  O     . GLY I 4 93  ? 52.089 34.623  46.835  1.00 47.20  ? 93   GLY E O     1 
ATOM   8810  N  N     . GLN I 4 94  ? 51.023 34.371  44.891  1.00 47.32  ? 94   GLN E N     1 
ATOM   8811  C  CA    . GLN I 4 94  ? 51.848 33.261  44.460  1.00 46.73  ? 94   GLN E CA    1 
ATOM   8812  C  C     . GLN I 4 94  ? 53.347 33.494  44.641  1.00 46.53  ? 94   GLN E C     1 
ATOM   8813  O  O     . GLN I 4 94  ? 54.083 32.612  45.103  1.00 45.38  ? 94   GLN E O     1 
ATOM   8814  C  CB    . GLN I 4 94  ? 51.524 32.958  43.006  1.00 47.34  ? 94   GLN E CB    1 
ATOM   8815  C  CG    . GLN I 4 94  ? 50.128 32.443  42.828  1.00 48.71  ? 94   GLN E CG    1 
ATOM   8816  C  CD    . GLN I 4 94  ? 49.898 31.124  43.550  1.00 51.00  ? 94   GLN E CD    1 
ATOM   8817  O  OE1   . GLN I 4 94  ? 48.762 30.653  43.652  1.00 52.10  ? 94   GLN E OE1   1 
ATOM   8818  N  NE2   . GLN I 4 94  ? 50.974 30.517  44.047  1.00 51.28  ? 94   GLN E NE2   1 
ATOM   8819  N  N     . LEU I 4 95  ? 53.807 34.679  44.266  1.00 45.70  ? 95   LEU E N     1 
ATOM   8820  C  CA    . LEU I 4 95  ? 55.213 34.966  44.406  1.00 44.83  ? 95   LEU E CA    1 
ATOM   8821  C  C     . LEU I 4 95  ? 55.577 34.670  45.850  1.00 45.24  ? 95   LEU E C     1 
ATOM   8822  O  O     . LEU I 4 95  ? 56.449 33.834  46.094  1.00 44.58  ? 95   LEU E O     1 
ATOM   8823  C  CB    . LEU I 4 95  ? 55.490 36.417  44.032  1.00 43.79  ? 95   LEU E CB    1 
ATOM   8824  C  CG    . LEU I 4 95  ? 56.589 36.645  42.993  1.00 42.85  ? 95   LEU E CG    1 
ATOM   8825  C  CD1   . LEU I 4 95  ? 56.661 35.493  42.015  1.00 40.67  ? 95   LEU E CD1   1 
ATOM   8826  C  CD2   . LEU I 4 95  ? 56.314 37.957  42.277  1.00 42.84  ? 95   LEU E CD2   1 
ATOM   8827  N  N     . ASN I 4 96  ? 54.888 35.327  46.792  1.00 46.01  ? 96   ASN E N     1 
ATOM   8828  C  CA    . ASN I 4 96  ? 55.104 35.123  48.233  1.00 46.80  ? 96   ASN E CA    1 
ATOM   8829  C  C     . ASN I 4 96  ? 55.270 33.654  48.608  1.00 47.81  ? 96   ASN E C     1 
ATOM   8830  O  O     . ASN I 4 96  ? 56.303 33.268  49.110  1.00 48.36  ? 96   ASN E O     1 
ATOM   8831  C  CB    . ASN I 4 96  ? 53.943 35.665  49.057  1.00 46.59  ? 96   ASN E CB    1 
ATOM   8832  C  CG    . ASN I 4 96  ? 53.964 37.160  49.196  1.00 47.34  ? 96   ASN E CG    1 
ATOM   8833  O  OD1   . ASN I 4 96  ? 54.982 37.743  49.534  1.00 49.53  ? 96   ASN E OD1   1 
ATOM   8834  N  ND2   . ASN I 4 96  ? 52.825 37.791  48.961  1.00 47.50  ? 96   ASN E ND2   1 
ATOM   8835  N  N     . MET I 4 97  ? 54.255 32.830  48.387  1.00 49.72  ? 97   MET E N     1 
ATOM   8836  C  CA    . MET I 4 97  ? 54.374 31.416  48.716  1.00 52.27  ? 97   MET E CA    1 
ATOM   8837  C  C     . MET I 4 97  ? 55.681 30.808  48.217  1.00 54.76  ? 97   MET E C     1 
ATOM   8838  O  O     . MET I 4 97  ? 56.304 29.999  48.913  1.00 54.68  ? 97   MET E O     1 
ATOM   8839  C  CB    . MET I 4 97  ? 53.231 30.619  48.110  1.00 53.58  ? 97   MET E CB    1 
ATOM   8840  C  CG    . MET I 4 97  ? 53.330 29.123  48.395  1.00 55.14  ? 97   MET E CG    1 
ATOM   8841  S  SD    . MET I 4 97  ? 52.327 28.094  47.298  1.00 59.25  ? 97   MET E SD    1 
ATOM   8842  C  CE    . MET I 4 97  ? 50.690 28.976  47.314  1.00 56.53  ? 97   MET E CE    1 
ATOM   8843  N  N     . LEU I 4 98  ? 56.094 31.185  47.008  1.00 57.34  ? 98   LEU E N     1 
ATOM   8844  C  CA    . LEU I 4 98  ? 57.326 30.648  46.436  1.00 60.09  ? 98   LEU E CA    1 
ATOM   8845  C  C     . LEU I 4 98  ? 58.561 30.945  47.280  1.00 62.12  ? 98   LEU E C     1 
ATOM   8846  O  O     . LEU I 4 98  ? 59.474 30.111  47.362  1.00 63.72  ? 98   LEU E O     1 
ATOM   8847  C  CB    . LEU I 4 98  ? 57.546 31.169  45.018  1.00 58.66  ? 98   LEU E CB    1 
ATOM   8848  C  CG    . LEU I 4 98  ? 58.784 30.566  44.346  1.00 56.98  ? 98   LEU E CG    1 
ATOM   8849  C  CD1   . LEU I 4 98  ? 58.673 29.059  44.284  1.00 54.88  ? 98   LEU E CD1   1 
ATOM   8850  C  CD2   . LEU I 4 98  ? 58.922 31.137  42.958  1.00 56.67  ? 98   LEU E CD2   1 
ATOM   8851  N  N     . HIS I 4 99  ? 58.600 32.123  47.899  1.00 63.76  ? 99   HIS E N     1 
ATOM   8852  C  CA    . HIS I 4 99  ? 59.733 32.487  48.744  1.00 65.54  ? 99   HIS E CA    1 
ATOM   8853  C  C     . HIS I 4 99  ? 59.564 31.948  50.171  1.00 66.93  ? 99   HIS E C     1 
ATOM   8854  O  O     . HIS I 4 99  ? 60.525 31.466  50.772  1.00 68.11  ? 99   HIS E O     1 
ATOM   8855  C  CB    . HIS I 4 99  ? 59.907 33.973  48.838  1.00 65.75  ? 99   HIS E CB    1 
ATOM   8856  C  CG    . HIS I 4 99  ? 60.137 34.655  47.478  1.00 66.70  ? 99   HIS E CG    1 
ATOM   8857  N  ND1   . HIS I 4 99  ? 59.271 34.510  46.414  1.00 66.89  ? 99   HIS E ND1   1 
ATOM   8858  C  CD2   . HIS I 4 99  ? 61.106 35.506  47.060  1.00 66.68  ? 99   HIS E CD2   1 
ATOM   8859  C  CE1   . HIS I 4 99  ? 59.695 35.246  45.401  1.00 66.60  ? 99   HIS E CE1   1 
ATOM   8860  N  NE2   . HIS I 4 99  ? 60.807 35.861  45.767  1.00 66.24  ? 99   HIS E NE2   1 
ATOM   8861  N  N     . ARG I 4 100 ? 58.355 32.023  50.720  1.00 67.35  ? 100  ARG E N     1 
ATOM   8862  C  CA    . ARG I 4 100 ? 58.154 31.533  52.070  1.00 68.60  ? 100  ARG E CA    1 
ATOM   8863  C  C     . ARG I 4 100 ? 58.546 30.073  52.163  1.00 68.23  ? 100  ARG E C     1 
ATOM   8864  O  O     . ARG I 4 100 ? 59.254 29.677  53.089  1.00 68.27  ? 100  ARG E O     1 
ATOM   8865  C  CB    . ARG I 4 100 ? 56.707 31.698  52.527  1.00 71.62  ? 100  ARG E CB    1 
ATOM   8866  C  CG    . ARG I 4 100 ? 56.546 31.479  54.037  1.00 77.09  ? 100  ARG E CG    1 
ATOM   8867  C  CD    . ARG I 4 100 ? 55.129 31.714  54.513  1.00 81.69  ? 100  ARG E CD    1 
ATOM   8868  N  NE    . ARG I 4 100 ? 54.232 30.665  54.039  1.00 86.76  ? 100  ARG E NE    1 
ATOM   8869  C  CZ    . ARG I 4 100 ? 52.904 30.710  54.132  1.00 89.66  ? 100  ARG E CZ    1 
ATOM   8870  N  NH1   . ARG I 4 100 ? 52.306 31.765  54.688  1.00 91.85  ? 100  ARG E NH1   1 
ATOM   8871  N  NH2   . ARG I 4 100 ? 52.173 29.699  53.666  1.00 90.07  ? 100  ARG E NH2   1 
ATOM   8872  N  N     . ARG I 4 101 ? 58.098 29.260  51.215  1.00 67.74  ? 101  ARG E N     1 
ATOM   8873  C  CA    . ARG I 4 101 ? 58.462 27.857  51.270  1.00 67.95  ? 101  ARG E CA    1 
ATOM   8874  C  C     . ARG I 4 101 ? 59.916 27.672  50.877  1.00 68.91  ? 101  ARG E C     1 
ATOM   8875  O  O     . ARG I 4 101 ? 60.229 26.801  50.073  1.00 69.31  ? 101  ARG E O     1 
ATOM   8876  C  CB    . ARG I 4 101 ? 57.547 27.018  50.385  1.00 66.50  ? 101  ARG E CB    1 
ATOM   8877  C  CG    . ARG I 4 101 ? 56.401 26.369  51.114  1.00 65.31  ? 101  ARG E CG    1 
ATOM   8878  C  CD    . ARG I 4 101 ? 55.415 27.410  51.580  1.00 65.70  ? 101  ARG E CD    1 
ATOM   8879  N  NE    . ARG I 4 101 ? 54.234 26.840  52.211  1.00 65.70  ? 101  ARG E NE    1 
ATOM   8880  C  CZ    . ARG I 4 101 ? 54.198 26.383  53.456  1.00 66.28  ? 101  ARG E CZ    1 
ATOM   8881  N  NH1   . ARG I 4 101 ? 55.286 26.424  54.214  1.00 66.10  ? 101  ARG E NH1   1 
ATOM   8882  N  NH2   . ARG I 4 101 ? 53.066 25.902  53.948  1.00 66.66  ? 101  ARG E NH2   1 
ATOM   8883  N  N     . SER I 4 102 ? 60.807 28.503  51.459  1.00 70.08  ? 102  SER E N     1 
ATOM   8884  C  CA    . SER I 4 102 ? 62.241 28.337  51.187  1.00 70.87  ? 102  SER E CA    1 
ATOM   8885  C  C     . SER I 4 102 ? 63.217 29.131  52.078  1.00 71.72  ? 102  SER E C     1 
ATOM   8886  O  O     . SER I 4 102 ? 64.214 29.665  51.587  1.00 71.84  ? 102  SER E O     1 
ATOM   8887  C  CB    . SER I 4 102 ? 62.517 28.649  49.729  1.00 70.17  ? 102  SER E CB    1 
ATOM   8888  O  OG    . SER I 4 102 ? 61.943 29.892  49.364  1.00 68.13  ? 102  SER E OG    1 
ATOM   8889  N  N     . GLY I 4 103 ? 62.895 29.210  53.382  1.00 73.42  ? 103  GLY E N     1 
ATOM   8890  C  CA    . GLY I 4 103 ? 63.688 29.934  54.374  1.00 74.94  ? 103  GLY E CA    1 
ATOM   8891  C  C     . GLY I 4 103 ? 63.883 31.395  54.022  1.00 75.83  ? 103  GLY E C     1 
ATOM   8892  O  O     . GLY I 4 103 ? 64.482 32.164  54.765  1.00 76.20  ? 103  GLY E O     1 
ATOM   8893  N  N     . LEU I 4 104 ? 63.310 31.774  52.850  1.00 74.90  ? 104  LEU E N     1 
ATOM   8894  C  CA    . LEU I 4 104 ? 63.456 33.152  52.301  1.00 75.78  ? 104  LEU E CA    1 
ATOM   8895  C  C     . LEU I 4 104 ? 62.350 34.193  52.659  1.00 76.82  ? 104  LEU E C     1 
ATOM   8896  O  O     . LEU I 4 104 ? 61.202 33.833  52.915  1.00 77.10  ? 104  LEU E O     1 
ATOM   8897  C  CB    . LEU I 4 104 ? 63.599 33.080  50.776  1.00 74.99  ? 104  LEU E CB    1 
ATOM   8898  C  CG    . LEU I 4 104 ? 64.742 33.912  50.204  1.00 73.70  ? 104  LEU E CG    1 
ATOM   8899  C  CD1   . LEU I 4 104 ? 65.753 33.019  49.504  1.00 73.23  ? 104  LEU E CD1   1 
ATOM   8900  C  CD2   . LEU I 4 104 ? 64.199 34.956  49.250  1.00 73.46  ? 104  LEU E CD2   1 
ATOM   8901  N  N     . PRO I 4 105 ? 62.753 35.512  52.679  1.00 77.70  ? 105  PRO E N     1 
ATOM   8902  C  CA    . PRO I 4 105 ? 61.826 36.702  52.883  1.00 77.53  ? 105  PRO E CA    1 
ATOM   8903  C  C     . PRO I 4 105 ? 60.713 36.909  51.881  1.00 77.87  ? 105  PRO E C     1 
ATOM   8904  O  O     . PRO I 4 105 ? 61.036 37.173  50.717  1.00 79.06  ? 105  PRO E O     1 
ATOM   8905  C  CB    . PRO I 4 105 ? 62.731 37.909  52.982  1.00 78.38  ? 105  PRO E CB    1 
ATOM   8906  C  CG    . PRO I 4 105 ? 63.875 37.395  53.765  1.00 78.83  ? 105  PRO E CG    1 
ATOM   8907  C  CD    . PRO I 4 105 ? 63.884 35.903  53.585  1.00 78.41  ? 105  PRO E CD    1 
ATOM   8908  N  N     . ARG I 4 106 ? 59.465 36.834  52.215  1.00 77.83  ? 106  ARG E N     1 
ATOM   8909  C  CA    . ARG I 4 106 ? 58.620 37.113  51.085  1.00 77.41  ? 106  ARG E CA    1 
ATOM   8910  C  C     . ARG I 4 106 ? 58.903 38.605  50.645  1.00 75.51  ? 106  ARG E C     1 
ATOM   8911  O  O     . ARG I 4 106 ? 59.584 39.362  51.330  1.00 75.75  ? 106  ARG E O     1 
ATOM   8912  C  CB    . ARG I 4 106 ? 57.138 36.809  51.376  1.00 79.00  ? 106  ARG E CB    1 
ATOM   8913  C  CG    . ARG I 4 106 ? 56.535 37.415  52.638  1.00 81.90  ? 106  ARG E CG    1 
ATOM   8914  C  CD    . ARG I 4 106 ? 56.480 36.402  53.787  1.00 85.53  ? 106  ARG E CD    1 
ATOM   8915  N  NE    . ARG I 4 106 ? 55.294 35.533  53.772  1.00 88.45  ? 106  ARG E NE    1 
ATOM   8916  C  CZ    . ARG I 4 106 ? 54.022 35.932  53.734  1.00 89.32  ? 106  ARG E CZ    1 
ATOM   8917  N  NH1   . ARG I 4 106 ? 53.727 37.232  53.726  1.00 88.75  ? 106  ARG E NH1   1 
ATOM   8918  N  NH2   . ARG I 4 106 ? 53.044 35.026  53.699  1.00 89.44  ? 106  ARG E NH2   1 
ATOM   8919  N  N     . PRO I 4 107 ? 58.349 38.931  49.503  1.00 73.26  ? 107  PRO E N     1 
ATOM   8920  C  CA    . PRO I 4 107 ? 58.356 40.296  48.982  1.00 71.63  ? 107  PRO E CA    1 
ATOM   8921  C  C     . PRO I 4 107 ? 57.300 41.211  49.593  1.00 71.08  ? 107  PRO E C     1 
ATOM   8922  O  O     . PRO I 4 107 ? 57.410 42.427  49.492  1.00 70.57  ? 107  PRO E O     1 
ATOM   8923  C  CB    . PRO I 4 107 ? 58.138 40.087  47.492  1.00 71.72  ? 107  PRO E CB    1 
ATOM   8924  C  CG    . PRO I 4 107 ? 57.334 38.814  47.449  1.00 71.62  ? 107  PRO E CG    1 
ATOM   8925  C  CD    . PRO I 4 107 ? 58.073 37.967  48.428  1.00 71.63  ? 107  PRO E CD    1 
ATOM   8926  N  N     . SER I 4 108 ? 56.279 40.627  50.218  1.00 71.12  ? 108  SER E N     1 
ATOM   8927  C  CA    . SER I 4 108 ? 55.207 41.412  50.835  1.00 70.42  ? 108  SER E CA    1 
ATOM   8928  C  C     . SER I 4 108 ? 55.546 41.856  52.246  1.00 71.32  ? 108  SER E C     1 
ATOM   8929  O  O     . SER I 4 108 ? 54.767 42.572  52.875  1.00 71.47  ? 108  SER E O     1 
ATOM   8930  C  CB    . SER I 4 108 ? 53.917 40.619  50.873  1.00 68.55  ? 108  SER E CB    1 
ATOM   8931  O  OG    . SER I 4 108 ? 53.572 40.201  49.578  1.00 67.25  ? 108  SER E OG    1 
ATOM   8932  N  N     . ASP I 4 109 ? 56.699 41.410  52.744  1.00 72.16  ? 109  ASP E N     1 
ATOM   8933  C  CA    . ASP I 4 109 ? 57.169 41.783  54.077  1.00 72.53  ? 109  ASP E CA    1 
ATOM   8934  C  C     . ASP I 4 109 ? 58.085 42.985  53.900  1.00 71.41  ? 109  ASP E C     1 
ATOM   8935  O  O     . ASP I 4 109 ? 58.615 43.515  54.870  1.00 72.23  ? 109  ASP E O     1 
ATOM   8936  C  CB    . ASP I 4 109 ? 57.953 40.634  54.744  1.00 74.32  ? 109  ASP E CB    1 
ATOM   8937  C  CG    . ASP I 4 109 ? 57.062 39.425  55.114  1.00 76.58  ? 109  ASP E CG    1 
ATOM   8938  O  OD1   . ASP I 4 109 ? 55.808 39.550  55.046  1.00 77.35  ? 109  ASP E OD1   1 
ATOM   8939  O  OD2   . ASP I 4 109 ? 57.623 38.352  55.484  1.00 76.59  ? 109  ASP E OD2   1 
ATOM   8940  N  N     . SER I 4 110 ? 58.269 43.394  52.647  1.00 69.21  ? 110  SER E N     1 
ATOM   8941  C  CA    . SER I 4 110 ? 59.110 44.533  52.310  1.00 67.02  ? 110  SER E CA    1 
ATOM   8942  C  C     . SER I 4 110 ? 58.238 45.757  52.412  1.00 65.87  ? 110  SER E C     1 
ATOM   8943  O  O     . SER I 4 110 ? 57.032 45.674  52.219  1.00 65.39  ? 110  SER E O     1 
ATOM   8944  C  CB    . SER I 4 110 ? 59.577 44.451  50.880  1.00 67.83  ? 110  SER E CB    1 
ATOM   8945  O  OG    . SER I 4 110 ? 58.631 45.127  50.064  1.00 69.01  ? 110  SER E OG    1 
ATOM   8946  N  N     . ASN I 4 111 ? 58.856 46.901  52.659  1.00 64.97  ? 111  ASN E N     1 
ATOM   8947  C  CA    . ASN I 4 111 ? 58.122 48.144  52.810  1.00 63.80  ? 111  ASN E CA    1 
ATOM   8948  C  C     . ASN I 4 111 ? 57.606 48.734  51.499  1.00 62.11  ? 111  ASN E C     1 
ATOM   8949  O  O     . ASN I 4 111 ? 56.550 49.372  51.468  1.00 61.30  ? 111  ASN E O     1 
ATOM   8950  C  CB    . ASN I 4 111 ? 59.027 49.144  53.552  1.00 66.59  ? 111  ASN E CB    1 
ATOM   8951  C  CG    . ASN I 4 111 ? 58.482 50.583  53.557  1.00 69.11  ? 111  ASN E CG    1 
ATOM   8952  O  OD1   . ASN I 4 111 ? 57.314 50.827  53.882  1.00 70.78  ? 111  ASN E OD1   1 
ATOM   8953  N  ND2   . ASN I 4 111 ? 59.350 51.546  53.216  1.00 69.98  ? 111  ASN E ND2   1 
ATOM   8954  N  N     . ALA I 4 112 ? 58.331 48.496  50.414  1.00 60.36  ? 112  ALA E N     1 
ATOM   8955  C  CA    . ALA I 4 112 ? 57.974 49.066  49.120  1.00 59.57  ? 112  ALA E CA    1 
ATOM   8956  C  C     . ALA I 4 112 ? 56.787 48.424  48.401  1.00 59.07  ? 112  ALA E C     1 
ATOM   8957  O  O     . ALA I 4 112 ? 55.944 49.126  47.806  1.00 57.89  ? 112  ALA E O     1 
ATOM   8958  C  CB    . ALA I 4 112 ? 59.193 49.052  48.224  1.00 59.58  ? 112  ALA E CB    1 
ATOM   8959  N  N     . VAL I 4 113 ? 56.745 47.093  48.452  1.00 58.42  ? 113  VAL E N     1 
ATOM   8960  C  CA    . VAL I 4 113 ? 55.693 46.303  47.823  1.00 57.71  ? 113  VAL E CA    1 
ATOM   8961  C  C     . VAL I 4 113 ? 54.352 46.679  48.413  1.00 58.43  ? 113  VAL E C     1 
ATOM   8962  O  O     . VAL I 4 113 ? 53.488 47.243  47.736  1.00 58.57  ? 113  VAL E O     1 
ATOM   8963  C  CB    . VAL I 4 113 ? 55.909 44.817  48.081  1.00 56.80  ? 113  VAL E CB    1 
ATOM   8964  C  CG1   . VAL I 4 113 ? 54.901 44.001  47.319  1.00 56.13  ? 113  VAL E CG1   1 
ATOM   8965  C  CG2   . VAL I 4 113 ? 57.300 44.438  47.687  1.00 56.40  ? 113  VAL E CG2   1 
ATOM   8966  N  N     . SER I 4 114 ? 54.190 46.353  49.693  1.00 59.43  ? 114  SER E N     1 
ATOM   8967  C  CA    . SER I 4 114 ? 52.954 46.646  50.428  1.00 60.32  ? 114  SER E CA    1 
ATOM   8968  C  C     . SER I 4 114 ? 52.556 48.110  50.247  1.00 59.67  ? 114  SER E C     1 
ATOM   8969  O  O     . SER I 4 114 ? 51.372 48.469  50.271  1.00 59.42  ? 114  SER E O     1 
ATOM   8970  C  CB    . SER I 4 114 ? 53.140 46.331  51.917  1.00 59.64  ? 114  SER E CB    1 
ATOM   8971  O  OG    . SER I 4 114 ? 54.316 46.956  52.401  1.00 60.88  ? 114  SER E OG    1 
ATOM   8972  N  N     . LEU I 4 115 ? 53.558 48.951  50.058  1.00 57.97  ? 115  LEU E N     1 
ATOM   8973  C  CA    . LEU I 4 115 ? 53.294 50.349  49.853  1.00 57.59  ? 115  LEU E CA    1 
ATOM   8974  C  C     . LEU I 4 115 ? 52.594 50.615  48.510  1.00 57.57  ? 115  LEU E C     1 
ATOM   8975  O  O     . LEU I 4 115 ? 51.617 51.366  48.480  1.00 57.53  ? 115  LEU E O     1 
ATOM   8976  C  CB    . LEU I 4 115 ? 54.597 51.121  49.973  1.00 57.48  ? 115  LEU E CB    1 
ATOM   8977  C  CG    . LEU I 4 115 ? 54.577 52.068  51.168  1.00 55.54  ? 115  LEU E CG    1 
ATOM   8978  C  CD1   . LEU I 4 115 ? 55.997 52.364  51.664  1.00 52.92  ? 115  LEU E CD1   1 
ATOM   8979  C  CD2   . LEU I 4 115 ? 53.828 53.326  50.726  1.00 53.91  ? 115  LEU E CD2   1 
ATOM   8980  N  N     . VAL I 4 116 ? 53.066 50.002  47.416  1.00 57.16  ? 116  VAL E N     1 
ATOM   8981  C  CA    . VAL I 4 116 ? 52.423 50.196  46.095  1.00 56.38  ? 116  VAL E CA    1 
ATOM   8982  C  C     . VAL I 4 116 ? 51.074 49.513  45.995  1.00 55.61  ? 116  VAL E C     1 
ATOM   8983  O  O     . VAL I 4 116 ? 50.150 50.042  45.377  1.00 54.39  ? 116  VAL E O     1 
ATOM   8984  C  CB    . VAL I 4 116 ? 53.247 49.631  44.905  1.00 56.36  ? 116  VAL E CB    1 
ATOM   8985  C  CG1   . VAL I 4 116 ? 54.122 50.717  44.312  1.00 56.39  ? 116  VAL E CG1   1 
ATOM   8986  C  CG2   . VAL I 4 116 ? 54.066 48.426  45.350  1.00 56.26  ? 116  VAL E CG2   1 
ATOM   8987  N  N     . MET I 4 117 ? 50.981 48.321  46.581  1.00 55.75  ? 117  MET E N     1 
ATOM   8988  C  CA    . MET I 4 117 ? 49.746 47.550  46.561  1.00 56.41  ? 117  MET E CA    1 
ATOM   8989  C  C     . MET I 4 117 ? 48.557 48.351  47.078  1.00 57.84  ? 117  MET E C     1 
ATOM   8990  O  O     . MET I 4 117 ? 47.429 48.214  46.587  1.00 57.80  ? 117  MET E O     1 
ATOM   8991  C  CB    . MET I 4 117 ? 49.924 46.279  47.379  1.00 54.90  ? 117  MET E CB    1 
ATOM   8992  C  CG    . MET I 4 117 ? 50.483 45.140  46.574  1.00 55.28  ? 117  MET E CG    1 
ATOM   8993  S  SD    . MET I 4 117 ? 49.255 44.312  45.517  1.00 56.61  ? 117  MET E SD    1 
ATOM   8994  C  CE    . MET I 4 117 ? 48.630 45.646  44.471  1.00 56.02  ? 117  MET E CE    1 
ATOM   8995  N  N     . ARG I 4 118 ? 48.825 49.189  48.074  1.00 58.85  ? 118  ARG E N     1 
ATOM   8996  C  CA    . ARG I 4 118 ? 47.808 50.035  48.676  1.00 59.13  ? 118  ARG E CA    1 
ATOM   8997  C  C     . ARG I 4 118 ? 47.523 51.123  47.641  1.00 58.93  ? 118  ARG E C     1 
ATOM   8998  O  O     . ARG I 4 118 ? 46.377 51.503  47.410  1.00 58.74  ? 118  ARG E O     1 
ATOM   8999  C  CB    . ARG I 4 118 ? 48.364 50.615  49.981  1.00 60.61  ? 118  ARG E CB    1 
ATOM   9000  C  CG    . ARG I 4 118 ? 47.332 51.229  50.939  1.00 62.34  ? 118  ARG E CG    1 
ATOM   9001  C  CD    . ARG I 4 118 ? 47.952 51.486  52.323  1.00 62.19  ? 118  ARG E CD    1 
ATOM   9002  N  NE    . ARG I 4 118 ? 47.235 52.522  53.056  1.00 63.07  ? 118  ARG E NE    1 
ATOM   9003  C  CZ    . ARG I 4 118 ? 47.470 52.838  54.326  1.00 64.55  ? 118  ARG E CZ    1 
ATOM   9004  N  NH1   . ARG I 4 118 ? 48.407 52.191  55.014  1.00 65.18  ? 118  ARG E NH1   1 
ATOM   9005  N  NH2   . ARG I 4 118 ? 46.766 53.801  54.912  1.00 64.04  ? 118  ARG E NH2   1 
ATOM   9006  N  N     . ARG I 4 119 ? 48.587 51.598  47.004  1.00 59.14  ? 119  ARG E N     1 
ATOM   9007  C  CA    . ARG I 4 119 ? 48.494 52.618  45.966  1.00 59.02  ? 119  ARG E CA    1 
ATOM   9008  C  C     . ARG I 4 119 ? 47.539 52.095  44.896  1.00 58.13  ? 119  ARG E C     1 
ATOM   9009  O  O     . ARG I 4 119 ? 46.524 52.721  44.587  1.00 56.95  ? 119  ARG E O     1 
ATOM   9010  C  CB    . ARG I 4 119 ? 49.893 52.846  45.367  1.00 60.59  ? 119  ARG E CB    1 
ATOM   9011  C  CG    . ARG I 4 119 ? 50.027 53.930  44.283  1.00 63.76  ? 119  ARG E CG    1 
ATOM   9012  C  CD    . ARG I 4 119 ? 51.498 54.000  43.756  1.00 67.23  ? 119  ARG E CD    1 
ATOM   9013  N  NE    . ARG I 4 119 ? 51.735 55.090  42.805  1.00 68.27  ? 119  ARG E NE    1 
ATOM   9014  C  CZ    . ARG I 4 119 ? 51.237 55.136  41.573  1.00 69.00  ? 119  ARG E CZ    1 
ATOM   9015  N  NH1   . ARG I 4 119 ? 50.475 54.151  41.118  1.00 69.00  ? 119  ARG E NH1   1 
ATOM   9016  N  NH2   . ARG I 4 119 ? 51.470 56.188  40.803  1.00 70.11  ? 119  ARG E NH2   1 
ATOM   9017  N  N     . ILE I 4 120 ? 47.879 50.922  44.364  1.00 58.36  ? 120  ILE E N     1 
ATOM   9018  C  CA    . ILE I 4 120 ? 47.118 50.253  43.310  1.00 58.35  ? 120  ILE E CA    1 
ATOM   9019  C  C     . ILE I 4 120 ? 45.657 49.970  43.635  1.00 59.43  ? 120  ILE E C     1 
ATOM   9020  O  O     . ILE I 4 120 ? 44.773 50.187  42.798  1.00 59.50  ? 120  ILE E O     1 
ATOM   9021  C  CB    . ILE I 4 120 ? 47.746 48.903  42.946  1.00 57.35  ? 120  ILE E CB    1 
ATOM   9022  C  CG1   . ILE I 4 120 ? 49.195 49.082  42.532  1.00 55.85  ? 120  ILE E CG1   1 
ATOM   9023  C  CG2   . ILE I 4 120 ? 46.972 48.271  41.819  1.00 57.18  ? 120  ILE E CG2   1 
ATOM   9024  C  CD1   . ILE I 4 120 ? 49.856 47.785  42.197  1.00 55.67  ? 120  ILE E CD1   1 
ATOM   9025  N  N     . ARG I 4 121 ? 45.400 49.459  44.836  1.00 59.36  ? 121  ARG E N     1 
ATOM   9026  C  CA    . ARG I 4 121 ? 44.034 49.137  45.201  1.00 59.48  ? 121  ARG E CA    1 
ATOM   9027  C  C     . ARG I 4 121 ? 43.173 50.384  45.242  1.00 58.47  ? 121  ARG E C     1 
ATOM   9028  O  O     . ARG I 4 121 ? 42.063 50.387  44.722  1.00 58.33  ? 121  ARG E O     1 
ATOM   9029  C  CB    . ARG I 4 121 ? 43.980 48.409  46.546  1.00 61.21  ? 121  ARG E CB    1 
ATOM   9030  C  CG    . ARG I 4 121 ? 42.590 47.881  46.880  1.00 64.54  ? 121  ARG E CG    1 
ATOM   9031  C  CD    . ARG I 4 121 ? 42.563 47.032  48.153  1.00 69.20  ? 121  ARG E CD    1 
ATOM   9032  N  NE    . ARG I 4 121 ? 42.799 47.787  49.398  1.00 74.15  ? 121  ARG E NE    1 
ATOM   9033  C  CZ    . ARG I 4 121 ? 43.937 47.764  50.105  1.00 75.86  ? 121  ARG E CZ    1 
ATOM   9034  N  NH1   . ARG I 4 121 ? 44.970 47.025  49.694  1.00 77.03  ? 121  ARG E NH1   1 
ATOM   9035  N  NH2   . ARG I 4 121 ? 44.041 48.458  51.239  1.00 75.56  ? 121  ARG E NH2   1 
ATOM   9036  N  N     . LYS I 4 122 ? 43.695 51.449  45.835  1.00 57.76  ? 122  LYS E N     1 
ATOM   9037  C  CA    . LYS I 4 122 ? 42.937 52.685  45.939  1.00 57.73  ? 122  LYS E CA    1 
ATOM   9038  C  C     . LYS I 4 122 ? 42.812 53.357  44.597  1.00 57.96  ? 122  LYS E C     1 
ATOM   9039  O  O     . LYS I 4 122 ? 41.804 53.996  44.305  1.00 56.79  ? 122  LYS E O     1 
ATOM   9040  C  CB    . LYS I 4 122 ? 43.603 53.661  46.908  1.00 57.73  ? 122  LYS E CB    1 
ATOM   9041  C  CG    . LYS I 4 122 ? 42.783 54.931  47.130  1.00 58.36  ? 122  LYS E CG    1 
ATOM   9042  C  CD    . LYS I 4 122 ? 43.637 56.114  47.580  1.00 58.79  ? 122  LYS E CD    1 
ATOM   9043  C  CE    . LYS I 4 122 ? 42.784 57.371  47.703  1.00 59.25  ? 122  LYS E CE    1 
ATOM   9044  N  NZ    . LYS I 4 122 ? 43.592 58.616  47.847  1.00 60.12  ? 122  LYS E NZ    1 
ATOM   9045  N  N     . GLU I 4 123 ? 43.854 53.219  43.788  1.00 59.67  ? 123  GLU E N     1 
ATOM   9046  C  CA    . GLU I 4 123 ? 43.874 53.836  42.478  1.00 61.70  ? 123  GLU E CA    1 
ATOM   9047  C  C     . GLU I 4 123 ? 42.856 53.170  41.549  1.00 62.49  ? 123  GLU E C     1 
ATOM   9048  O  O     . GLU I 4 123 ? 42.107 53.854  40.849  1.00 62.40  ? 123  GLU E O     1 
ATOM   9049  C  CB    . GLU I 4 123 ? 45.297 53.770  41.909  1.00 62.78  ? 123  GLU E CB    1 
ATOM   9050  C  CG    . GLU I 4 123 ? 45.834 55.114  41.375  1.00 66.38  ? 123  GLU E CG    1 
ATOM   9051  C  CD    . GLU I 4 123 ? 47.375 55.146  41.179  1.00 69.25  ? 123  GLU E CD    1 
ATOM   9052  O  OE1   . GLU I 4 123 ? 48.112 55.190  42.199  1.00 69.15  ? 123  GLU E OE1   1 
ATOM   9053  O  OE2   . GLU I 4 123 ? 47.853 55.128  40.007  1.00 70.73  ? 123  GLU E OE2   1 
ATOM   9054  N  N     . ASN I 4 124 ? 42.797 51.841  41.577  1.00 62.96  ? 124  ASN E N     1 
ATOM   9055  C  CA    . ASN I 4 124 ? 41.884 51.098  40.718  1.00 63.81  ? 124  ASN E CA    1 
ATOM   9056  C  C     . ASN I 4 124 ? 40.431 51.167  41.091  1.00 65.09  ? 124  ASN E C     1 
ATOM   9057  O  O     . ASN I 4 124 ? 39.581 51.375  40.244  1.00 64.37  ? 124  ASN E O     1 
ATOM   9058  C  CB    . ASN I 4 124 ? 42.293 49.642  40.651  1.00 64.00  ? 124  ASN E CB    1 
ATOM   9059  C  CG    . ASN I 4 124 ? 43.196 49.360  39.487  1.00 65.31  ? 124  ASN E CG    1 
ATOM   9060  O  OD1   . ASN I 4 124 ? 44.294 49.900  39.398  1.00 66.17  ? 124  ASN E OD1   1 
ATOM   9061  N  ND2   . ASN I 4 124 ? 42.737 48.515  38.571  1.00 66.24  ? 124  ASN E ND2   1 
ATOM   9062  N  N     . VAL I 4 125 ? 40.135 50.962  42.361  1.00 67.60  ? 125  VAL E N     1 
ATOM   9063  C  CA    . VAL I 4 125 ? 38.756 51.012  42.811  1.00 70.41  ? 125  VAL E CA    1 
ATOM   9064  C  C     . VAL I 4 125 ? 38.211 52.406  42.593  1.00 72.70  ? 125  VAL E C     1 
ATOM   9065  O  O     . VAL I 4 125 ? 37.022 52.605  42.346  1.00 71.27  ? 125  VAL E O     1 
ATOM   9066  C  CB    . VAL I 4 125 ? 38.670 50.703  44.273  1.00 69.42  ? 125  VAL E CB    1 
ATOM   9067  C  CG1   . VAL I 4 125 ? 39.730 51.459  44.994  1.00 68.94  ? 125  VAL E CG1   1 
ATOM   9068  C  CG2   . VAL I 4 125 ? 37.309 51.096  44.791  1.00 70.49  ? 125  VAL E CG2   1 
ATOM   9069  N  N     . ASP I 4 126 ? 39.114 53.366  42.699  1.00 76.91  ? 126  ASP E N     1 
ATOM   9070  C  CA    . ASP I 4 126 ? 38.784 54.765  42.519  1.00 81.15  ? 126  ASP E CA    1 
ATOM   9071  C  C     . ASP I 4 126 ? 38.564 55.018  41.033  1.00 81.94  ? 126  ASP E C     1 
ATOM   9072  O  O     . ASP I 4 126 ? 37.572 55.637  40.645  1.00 82.88  ? 126  ASP E O     1 
ATOM   9073  C  CB    . ASP I 4 126 ? 39.927 55.640  43.037  1.00 84.30  ? 126  ASP E CB    1 
ATOM   9074  C  CG    . ASP I 4 126 ? 39.437 56.946  43.649  1.00 86.99  ? 126  ASP E CG    1 
ATOM   9075  O  OD1   . ASP I 4 126 ? 40.296 57.812  43.953  1.00 88.21  ? 126  ASP E OD1   1 
ATOM   9076  O  OD2   . ASP I 4 126 ? 38.201 57.097  43.832  1.00 87.97  ? 126  ASP E OD2   1 
ATOM   9077  N  N     . ALA I 4 127 ? 39.490 54.535  40.205  1.00 82.29  ? 127  ALA E N     1 
ATOM   9078  C  CA    . ALA I 4 127 ? 39.371 54.697  38.760  1.00 82.16  ? 127  ALA E CA    1 
ATOM   9079  C  C     . ALA I 4 127 ? 38.085 54.029  38.253  1.00 82.01  ? 127  ALA E C     1 
ATOM   9080  O  O     . ALA I 4 127 ? 37.823 54.005  37.050  1.00 82.12  ? 127  ALA E O     1 
ATOM   9081  C  CB    . ALA I 4 127 ? 40.591 54.110  38.057  1.00 81.60  ? 127  ALA E CB    1 
ATOM   9082  N  N     . GLY I 4 128 ? 37.299 53.478  39.180  1.00 82.06  ? 128  GLY E N     1 
ATOM   9083  C  CA    . GLY I 4 128 ? 36.036 52.856  38.826  1.00 81.77  ? 128  GLY E CA    1 
ATOM   9084  C  C     . GLY I 4 128 ? 36.000 51.364  38.557  1.00 81.77  ? 128  GLY E C     1 
ATOM   9085  O  O     . GLY I 4 128 ? 35.043 50.881  37.941  1.00 82.15  ? 128  GLY E O     1 
ATOM   9086  N  N     . GLU I 4 129 ? 37.011 50.621  39.004  1.00 81.01  ? 129  GLU E N     1 
ATOM   9087  C  CA    . GLU I 4 129 ? 37.009 49.179  38.763  1.00 80.31  ? 129  GLU E CA    1 
ATOM   9088  C  C     . GLU I 4 129 ? 35.920 48.542  39.588  1.00 78.82  ? 129  GLU E C     1 
ATOM   9089  O  O     . GLU I 4 129 ? 35.588 49.021  40.664  1.00 79.21  ? 129  GLU E O     1 
ATOM   9090  C  CB    . GLU I 4 129 ? 38.343 48.527  39.130  1.00 81.33  ? 129  GLU E CB    1 
ATOM   9091  C  CG    . GLU I 4 129 ? 38.329 47.014  38.901  1.00 83.37  ? 129  GLU E CG    1 
ATOM   9092  C  CD    . GLU I 4 129 ? 39.609 46.314  39.338  1.00 85.09  ? 129  GLU E CD    1 
ATOM   9093  O  OE1   . GLU I 4 129 ? 40.682 46.634  38.779  1.00 86.19  ? 129  GLU E OE1   1 
ATOM   9094  O  OE2   . GLU I 4 129 ? 39.544 45.436  40.236  1.00 85.72  ? 129  GLU E OE2   1 
ATOM   9095  N  N     . ARG I 4 130 ? 35.363 47.451  39.099  1.00 77.04  ? 130  ARG E N     1 
ATOM   9096  C  CA    . ARG I 4 130 ? 34.311 46.812  39.849  1.00 75.75  ? 130  ARG E CA    1 
ATOM   9097  C  C     . ARG I 4 130 ? 34.395 45.286  39.768  1.00 75.32  ? 130  ARG E C     1 
ATOM   9098  O  O     . ARG I 4 130 ? 34.905 44.734  38.787  1.00 76.36  ? 130  ARG E O     1 
ATOM   9099  C  CB    . ARG I 4 130 ? 32.973 47.334  39.340  1.00 74.82  ? 130  ARG E CB    1 
ATOM   9100  C  CG    . ARG I 4 130 ? 31.854 47.189  40.332  1.00 75.13  ? 130  ARG E CG    1 
ATOM   9101  C  CD    . ARG I 4 130 ? 30.773 48.210  40.084  1.00 73.83  ? 130  ARG E CD    1 
ATOM   9102  N  NE    . ARG I 4 130 ? 29.495 47.744  40.598  1.00 72.68  ? 130  ARG E NE    1 
ATOM   9103  C  CZ    . ARG I 4 130 ? 28.331 48.306  40.299  1.00 72.82  ? 130  ARG E CZ    1 
ATOM   9104  N  NH1   . ARG I 4 130 ? 28.289 49.366  39.493  1.00 72.19  ? 130  ARG E NH1   1 
ATOM   9105  N  NH2   . ARG I 4 130 ? 27.206 47.786  40.775  1.00 72.87  ? 130  ARG E NH2   1 
ATOM   9106  N  N     . ALA I 4 131 ? 33.929 44.614  40.822  1.00 73.71  ? 131  ALA E N     1 
ATOM   9107  C  CA    . ALA I 4 131 ? 33.928 43.154  40.890  1.00 71.84  ? 131  ALA E CA    1 
ATOM   9108  C  C     . ALA I 4 131 ? 32.554 42.683  40.489  1.00 71.37  ? 131  ALA E C     1 
ATOM   9109  O  O     . ALA I 4 131 ? 31.554 43.267  40.907  1.00 71.87  ? 131  ALA E O     1 
ATOM   9110  C  CB    . ALA I 4 131 ? 34.230 42.693  42.287  1.00 71.54  ? 131  ALA E CB    1 
ATOM   9111  N  N     . LYS I 4 132 ? 32.501 41.629  39.683  1.00 70.46  ? 132  LYS E N     1 
ATOM   9112  C  CA    . LYS I 4 132 ? 31.229 41.099  39.209  1.00 69.66  ? 132  LYS E CA    1 
ATOM   9113  C  C     . LYS I 4 132 ? 30.958 39.710  39.731  1.00 68.29  ? 132  LYS E C     1 
ATOM   9114  O  O     . LYS I 4 132 ? 31.811 39.107  40.372  1.00 68.11  ? 132  LYS E O     1 
ATOM   9115  C  CB    . LYS I 4 132 ? 31.190 41.083  37.676  1.00 70.41  ? 132  LYS E CB    1 
ATOM   9116  C  CG    . LYS I 4 132 ? 32.491 40.634  37.009  1.00 71.82  ? 132  LYS E CG    1 
ATOM   9117  C  CD    . LYS I 4 132 ? 33.308 41.819  36.447  1.00 74.40  ? 132  LYS E CD    1 
ATOM   9118  C  CE    . LYS I 4 132 ? 32.684 42.470  35.174  1.00 75.83  ? 132  LYS E CE    1 
ATOM   9119  N  NZ    . LYS I 4 132 ? 31.520 43.394  35.398  1.00 75.60  ? 132  LYS E NZ    1 
ATOM   9120  N  N     . GLN I 4 133 ? 29.758 39.213  39.452  1.00 67.21  ? 133  GLN E N     1 
ATOM   9121  C  CA    . GLN I 4 133 ? 29.345 37.880  39.885  1.00 65.51  ? 133  GLN E CA    1 
ATOM   9122  C  C     . GLN I 4 133 ? 28.526 37.278  38.763  1.00 63.94  ? 133  GLN E C     1 
ATOM   9123  O  O     . GLN I 4 133 ? 28.139 37.965  37.812  1.00 62.79  ? 133  GLN E O     1 
ATOM   9124  C  CB    . GLN I 4 133 ? 28.449 37.966  41.106  1.00 65.50  ? 133  GLN E CB    1 
ATOM   9125  C  CG    . GLN I 4 133 ? 27.197 38.726  40.741  1.00 66.95  ? 133  GLN E CG    1 
ATOM   9126  C  CD    . GLN I 4 133 ? 26.212 38.883  41.862  1.00 67.38  ? 133  GLN E CD    1 
ATOM   9127  O  OE1   . GLN I 4 133 ? 26.591 39.132  43.018  1.00 67.50  ? 133  GLN E OE1   1 
ATOM   9128  N  NE2   . GLN I 4 133 ? 24.918 38.773  41.522  1.00 67.34  ? 133  GLN E NE2   1 
ATOM   9129  N  N     . ALA I 4 134 ? 28.230 35.999  38.923  1.00 62.33  ? 134  ALA E N     1 
ATOM   9130  C  CA    . ALA I 4 134 ? 27.459 35.238  37.955  1.00 61.34  ? 134  ALA E CA    1 
ATOM   9131  C  C     . ALA I 4 134 ? 26.072 35.809  37.665  1.00 60.48  ? 134  ALA E C     1 
ATOM   9132  O  O     . ALA I 4 134 ? 25.500 36.515  38.500  1.00 61.67  ? 134  ALA E O     1 
ATOM   9133  C  CB    . ALA I 4 134 ? 27.333 33.816  38.445  1.00 61.03  ? 134  ALA E CB    1 
ATOM   9134  N  N     . LEU I 4 135 ? 25.540 35.508  36.479  1.00 58.54  ? 135  LEU E N     1 
ATOM   9135  C  CA    . LEU I 4 135 ? 24.207 35.965  36.117  1.00 56.55  ? 135  LEU E CA    1 
ATOM   9136  C  C     . LEU I 4 135 ? 23.358 34.887  36.732  1.00 57.14  ? 135  LEU E C     1 
ATOM   9137  O  O     . LEU I 4 135 ? 23.615 33.711  36.524  1.00 55.51  ? 135  LEU E O     1 
ATOM   9138  C  CB    . LEU I 4 135 ? 24.018 35.968  34.610  1.00 54.69  ? 135  LEU E CB    1 
ATOM   9139  C  CG    . LEU I 4 135 ? 22.893 36.790  33.980  1.00 52.27  ? 135  LEU E CG    1 
ATOM   9140  C  CD1   . LEU I 4 135 ? 22.949 36.539  32.523  1.00 52.27  ? 135  LEU E CD1   1 
ATOM   9141  C  CD2   . LEU I 4 135 ? 21.521 36.418  34.487  1.00 52.37  ? 135  LEU E CD2   1 
ATOM   9142  N  N     . ALA I 4 136 ? 22.346 35.294  37.488  1.00 58.76  ? 136  ALA E N     1 
ATOM   9143  C  CA    . ALA I 4 136 ? 21.463 34.375  38.218  1.00 60.17  ? 136  ALA E CA    1 
ATOM   9144  C  C     . ALA I 4 136 ? 20.492 33.492  37.451  1.00 60.14  ? 136  ALA E C     1 
ATOM   9145  O  O     . ALA I 4 136 ? 19.660 33.995  36.706  1.00 61.70  ? 136  ALA E O     1 
ATOM   9146  C  CB    . ALA I 4 136 ? 20.686 35.166  39.258  1.00 61.64  ? 136  ALA E CB    1 
ATOM   9147  N  N     . PHE I 4 137 ? 20.576 32.181  37.660  1.00 59.98  ? 137  PHE E N     1 
ATOM   9148  C  CA    . PHE I 4 137 ? 19.666 31.258  37.000  1.00 60.16  ? 137  PHE E CA    1 
ATOM   9149  C  C     . PHE I 4 137 ? 18.571 30.910  37.992  1.00 60.04  ? 137  PHE E C     1 
ATOM   9150  O  O     . PHE I 4 137 ? 18.618 29.883  38.651  1.00 58.32  ? 137  PHE E O     1 
ATOM   9151  C  CB    . PHE I 4 137 ? 20.396 29.986  36.548  1.00 61.22  ? 137  PHE E CB    1 
ATOM   9152  C  CG    . PHE I 4 137 ? 19.491 28.961  35.926  1.00 61.58  ? 137  PHE E CG    1 
ATOM   9153  C  CD1   . PHE I 4 137 ? 19.328 27.715  36.512  1.00 61.24  ? 137  PHE E CD1   1 
ATOM   9154  C  CD2   . PHE I 4 137 ? 18.742 29.272  34.803  1.00 61.54  ? 137  PHE E CD2   1 
ATOM   9155  C  CE1   . PHE I 4 137 ? 18.429 26.794  35.997  1.00 60.87  ? 137  PHE E CE1   1 
ATOM   9156  C  CE2   . PHE I 4 137 ? 17.844 28.360  34.284  1.00 61.59  ? 137  PHE E CE2   1 
ATOM   9157  C  CZ    . PHE I 4 137 ? 17.684 27.116  34.887  1.00 61.93  ? 137  PHE E CZ    1 
ATOM   9158  N  N     . GLU I 4 138 ? 17.582 31.787  38.081  1.00 61.47  ? 138  GLU E N     1 
ATOM   9159  C  CA    . GLU I 4 138 ? 16.466 31.627  39.001  1.00 64.33  ? 138  GLU E CA    1 
ATOM   9160  C  C     . GLU I 4 138 ? 15.488 30.509  38.625  1.00 65.59  ? 138  GLU E C     1 
ATOM   9161  O  O     . GLU I 4 138 ? 15.699 29.795  37.644  1.00 65.82  ? 138  GLU E O     1 
ATOM   9162  C  CB    . GLU I 4 138 ? 15.702 32.949  39.106  1.00 65.41  ? 138  GLU E CB    1 
ATOM   9163  C  CG    . GLU I 4 138 ? 16.587 34.192  39.062  1.00 68.07  ? 138  GLU E CG    1 
ATOM   9164  C  CD    . GLU I 4 138 ? 15.851 35.463  39.485  1.00 70.14  ? 138  GLU E CD    1 
ATOM   9165  O  OE1   . GLU I 4 138 ? 14.666 35.643  39.085  1.00 70.27  ? 138  GLU E OE1   1 
ATOM   9166  O  OE2   . GLU I 4 138 ? 16.466 36.283  40.213  1.00 69.87  ? 138  GLU E OE2   1 
ATOM   9167  N  N     . ARG I 4 139 ? 14.425 30.376  39.430  1.00 66.85  ? 139  ARG E N     1 
ATOM   9168  C  CA    . ARG I 4 139 ? 13.349 29.384  39.255  1.00 67.31  ? 139  ARG E CA    1 
ATOM   9169  C  C     . ARG I 4 139 ? 12.560 29.754  38.006  1.00 67.49  ? 139  ARG E C     1 
ATOM   9170  O  O     . ARG I 4 139 ? 12.200 28.899  37.202  1.00 66.67  ? 139  ARG E O     1 
ATOM   9171  C  CB    . ARG I 4 139 ? 12.430 29.400  40.489  1.00 67.65  ? 139  ARG E CB    1 
ATOM   9172  C  CG    . ARG I 4 139 ? 11.063 28.734  40.336  1.00 68.79  ? 139  ARG E CG    1 
ATOM   9173  C  CD    . ARG I 4 139 ? 11.133 27.223  40.426  1.00 71.01  ? 139  ARG E CD    1 
ATOM   9174  N  NE    . ARG I 4 139 ? 9.809  26.591  40.388  1.00 73.61  ? 139  ARG E NE    1 
ATOM   9175  C  CZ    . ARG I 4 139 ? 9.081  26.255  41.459  1.00 75.36  ? 139  ARG E CZ    1 
ATOM   9176  N  NH1   . ARG I 4 139 ? 9.528  26.481  42.696  1.00 75.70  ? 139  ARG E NH1   1 
ATOM   9177  N  NH2   . ARG I 4 139 ? 7.895  25.673  41.293  1.00 75.89  ? 139  ARG E NH2   1 
ATOM   9178  N  N     . THR I 4 140 ? 12.299 31.045  37.863  1.00 68.16  ? 140  THR E N     1 
ATOM   9179  C  CA    . THR I 4 140 ? 11.595 31.575  36.711  1.00 69.34  ? 140  THR E CA    1 
ATOM   9180  C  C     . THR I 4 140 ? 12.239 30.990  35.450  1.00 70.33  ? 140  THR E C     1 
ATOM   9181  O  O     . THR I 4 140 ? 11.569 30.747  34.443  1.00 71.31  ? 140  THR E O     1 
ATOM   9182  C  CB    . THR I 4 140 ? 11.747 33.096  36.643  1.00 69.60  ? 140  THR E CB    1 
ATOM   9183  O  OG1   . THR I 4 140 ? 12.766 33.438  35.681  1.00 67.48  ? 140  THR E OG1   1 
ATOM   9184  C  CG2   . THR I 4 140 ? 12.140 33.641  38.036  1.00 69.82  ? 140  THR E CG2   1 
ATOM   9185  N  N     . ASP I 4 141 ? 13.550 30.778  35.512  1.00 70.85  ? 141  ASP E N     1 
ATOM   9186  C  CA    . ASP I 4 141 ? 14.295 30.229  34.388  1.00 70.93  ? 141  ASP E CA    1 
ATOM   9187  C  C     . ASP I 4 141 ? 14.250 28.720  34.327  1.00 71.11  ? 141  ASP E C     1 
ATOM   9188  O  O     . ASP I 4 141 ? 14.299 28.131  33.257  1.00 70.98  ? 141  ASP E O     1 
ATOM   9189  C  CB    . ASP I 4 141 ? 15.743 30.672  34.463  1.00 70.95  ? 141  ASP E CB    1 
ATOM   9190  C  CG    . ASP I 4 141 ? 15.897 32.141  34.230  1.00 71.89  ? 141  ASP E CG    1 
ATOM   9191  O  OD1   . ASP I 4 141 ? 15.541 32.603  33.120  1.00 72.12  ? 141  ASP E OD1   1 
ATOM   9192  O  OD2   . ASP I 4 141 ? 16.366 32.829  35.158  1.00 72.07  ? 141  ASP E OD2   1 
ATOM   9193  N  N     . PHE I 4 142 ? 14.173 28.075  35.474  1.00 71.37  ? 142  PHE E N     1 
ATOM   9194  C  CA    . PHE I 4 142 ? 14.126 26.639  35.437  1.00 71.32  ? 142  PHE E CA    1 
ATOM   9195  C  C     . PHE I 4 142 ? 12.786 26.228  34.911  1.00 73.06  ? 142  PHE E C     1 
ATOM   9196  O  O     . PHE I 4 142 ? 12.657 25.158  34.349  1.00 73.90  ? 142  PHE E O     1 
ATOM   9197  C  CB    . PHE I 4 142 ? 14.285 26.042  36.808  1.00 69.21  ? 142  PHE E CB    1 
ATOM   9198  C  CG    . PHE I 4 142 ? 14.462 24.566  36.786  1.00 67.52  ? 142  PHE E CG    1 
ATOM   9199  C  CD1   . PHE I 4 142 ? 15.629 24.012  36.274  1.00 66.83  ? 142  PHE E CD1   1 
ATOM   9200  C  CD2   . PHE I 4 142 ? 13.483 23.730  37.301  1.00 66.45  ? 142  PHE E CD2   1 
ATOM   9201  C  CE1   . PHE I 4 142 ? 15.823 22.655  36.283  1.00 65.53  ? 142  PHE E CE1   1 
ATOM   9202  C  CE2   . PHE I 4 142 ? 13.667 22.368  37.314  1.00 66.16  ? 142  PHE E CE2   1 
ATOM   9203  C  CZ    . PHE I 4 142 ? 14.844 21.829  36.804  1.00 65.99  ? 142  PHE E CZ    1 
ATOM   9204  N  N     . ASP I 4 143 ? 11.778 27.068  35.104  1.00 75.10  ? 143  ASP E N     1 
ATOM   9205  C  CA    . ASP I 4 143 ? 10.442 26.727  34.628  1.00 77.49  ? 143  ASP E CA    1 
ATOM   9206  C  C     . ASP I 4 143 ? 10.290 26.941  33.130  1.00 77.91  ? 143  ASP E C     1 
ATOM   9207  O  O     . ASP I 4 143 ? 9.591  26.187  32.449  1.00 79.29  ? 143  ASP E O     1 
ATOM   9208  C  CB    . ASP I 4 143 ? 9.362  27.529  35.378  1.00 79.66  ? 143  ASP E CB    1 
ATOM   9209  C  CG    . ASP I 4 143 ? 8.978  26.892  36.723  1.00 81.82  ? 143  ASP E CG    1 
ATOM   9210  O  OD1   . ASP I 4 143 ? 9.022  25.638  36.830  1.00 82.73  ? 143  ASP E OD1   1 
ATOM   9211  O  OD2   . ASP I 4 143 ? 8.614  27.644  37.665  1.00 82.19  ? 143  ASP E OD2   1 
ATOM   9212  N  N     . GLN I 4 144 ? 10.951 27.964  32.615  1.00 77.29  ? 144  GLN E N     1 
ATOM   9213  C  CA    . GLN I 4 144 ? 10.876 28.266  31.199  1.00 76.71  ? 144  GLN E CA    1 
ATOM   9214  C  C     . GLN I 4 144 ? 11.783 27.329  30.407  1.00 75.71  ? 144  GLN E C     1 
ATOM   9215  O  O     . GLN I 4 144 ? 11.570 27.107  29.232  1.00 76.32  ? 144  GLN E O     1 
ATOM   9216  C  CB    . GLN I 4 144 ? 11.264 29.721  30.992  1.00 78.02  ? 144  GLN E CB    1 
ATOM   9217  C  CG    . GLN I 4 144 ? 11.201 30.228  29.588  1.00 79.72  ? 144  GLN E CG    1 
ATOM   9218  C  CD    . GLN I 4 144 ? 11.505 31.715  29.524  1.00 81.41  ? 144  GLN E CD    1 
ATOM   9219  O  OE1   . GLN I 4 144 ? 11.810 32.254  28.456  1.00 82.93  ? 144  GLN E OE1   1 
ATOM   9220  N  NE2   . GLN I 4 144 ? 11.414 32.394  30.674  1.00 81.72  ? 144  GLN E NE2   1 
ATOM   9221  N  N     . VAL I 4 145 ? 12.794 26.768  31.052  1.00 75.34  ? 145  VAL E N     1 
ATOM   9222  C  CA    . VAL I 4 145 ? 13.688 25.845  30.372  1.00 74.44  ? 145  VAL E CA    1 
ATOM   9223  C  C     . VAL I 4 145 ? 13.152 24.436  30.518  1.00 75.35  ? 145  VAL E C     1 
ATOM   9224  O  O     . VAL I 4 145 ? 13.543 23.538  29.780  1.00 75.04  ? 145  VAL E O     1 
ATOM   9225  C  CB    . VAL I 4 145 ? 15.106 25.917  30.951  1.00 73.18  ? 145  VAL E CB    1 
ATOM   9226  C  CG1   . VAL I 4 145 ? 15.909 24.694  30.561  1.00 71.88  ? 145  VAL E CG1   1 
ATOM   9227  C  CG2   . VAL I 4 145 ? 15.782 27.157  30.433  1.00 72.27  ? 145  VAL E CG2   1 
ATOM   9228  N  N     . ARG I 4 146 ? 12.250 24.245  31.477  1.00 77.40  ? 146  ARG E N     1 
ATOM   9229  C  CA    . ARG I 4 146 ? 11.667 22.931  31.694  1.00 79.27  ? 146  ARG E CA    1 
ATOM   9230  C  C     . ARG I 4 146 ? 10.670 22.715  30.588  1.00 79.54  ? 146  ARG E C     1 
ATOM   9231  O  O     . ARG I 4 146 ? 10.634 21.640  30.022  1.00 80.38  ? 146  ARG E O     1 
ATOM   9232  C  CB    . ARG I 4 146 ? 10.973 22.816  33.058  1.00 81.49  ? 146  ARG E CB    1 
ATOM   9233  C  CG    . ARG I 4 146 ? 9.519  23.310  33.142  1.00 84.76  ? 146  ARG E CG    1 
ATOM   9234  C  CD    . ARG I 4 146 ? 8.954  23.096  34.568  1.00 87.47  ? 146  ARG E CD    1 
ATOM   9235  N  NE    . ARG I 4 146 ? 9.038  21.692  34.993  1.00 89.29  ? 146  ARG E NE    1 
ATOM   9236  C  CZ    . ARG I 4 146 ? 9.645  21.258  36.098  1.00 89.21  ? 146  ARG E CZ    1 
ATOM   9237  N  NH1   . ARG I 4 146 ? 10.239 22.108  36.930  1.00 88.46  ? 146  ARG E NH1   1 
ATOM   9238  N  NH2   . ARG I 4 146 ? 9.670  19.957  36.361  1.00 89.92  ? 146  ARG E NH2   1 
ATOM   9239  N  N     . SER I 4 147 ? 9.871  23.731  30.269  1.00 79.12  ? 147  SER E N     1 
ATOM   9240  C  CA    . SER I 4 147 ? 8.904  23.606  29.183  1.00 78.61  ? 147  SER E CA    1 
ATOM   9241  C  C     . SER I 4 147 ? 9.579  23.204  27.863  1.00 79.32  ? 147  SER E C     1 
ATOM   9242  O  O     . SER I 4 147 ? 9.550  22.039  27.468  1.00 79.84  ? 147  SER E O     1 
ATOM   9243  C  CB    . SER I 4 147 ? 8.167  24.917  28.972  1.00 77.99  ? 147  SER E CB    1 
ATOM   9244  O  OG    . SER I 4 147 ? 7.882  25.098  27.594  1.00 76.83  ? 147  SER E OG    1 
ATOM   9245  N  N     . LEU I 4 148 ? 10.193 24.157  27.172  1.00 79.21  ? 148  LEU E N     1 
ATOM   9246  C  CA    . LEU I 4 148 ? 10.830 23.823  25.908  1.00 79.77  ? 148  LEU E CA    1 
ATOM   9247  C  C     . LEU I 4 148 ? 12.050 22.926  26.030  1.00 81.27  ? 148  LEU E C     1 
ATOM   9248  O  O     . LEU I 4 148 ? 13.164 23.377  25.805  1.00 82.09  ? 148  LEU E O     1 
ATOM   9249  C  CB    . LEU I 4 148 ? 11.212 25.090  25.134  1.00 77.24  ? 148  LEU E CB    1 
ATOM   9250  C  CG    . LEU I 4 148 ? 11.529 26.379  25.875  1.00 75.71  ? 148  LEU E CG    1 
ATOM   9251  C  CD1   . LEU I 4 148 ? 12.333 27.290  24.966  1.00 75.19  ? 148  LEU E CD1   1 
ATOM   9252  C  CD2   . LEU I 4 148 ? 10.234 27.050  26.313  1.00 75.02  ? 148  LEU E CD2   1 
ATOM   9253  N  N     . MET I 4 149 ? 11.840 21.655  26.354  1.00 83.38  ? 149  MET E N     1 
ATOM   9254  C  CA    . MET I 4 149 ? 12.946 20.705  26.487  1.00 86.49  ? 149  MET E CA    1 
ATOM   9255  C  C     . MET I 4 149 ? 12.426 19.534  27.326  1.00 87.85  ? 149  MET E C     1 
ATOM   9256  O  O     . MET I 4 149 ? 13.087 18.501  27.494  1.00 87.43  ? 149  MET E O     1 
ATOM   9257  C  CB    . MET I 4 149 ? 14.139 21.385  27.186  1.00 87.86  ? 149  MET E CB    1 
ATOM   9258  C  CG    . MET I 4 149 ? 15.535 20.846  26.814  1.00 90.00  ? 149  MET E CG    1 
ATOM   9259  S  SD    . MET I 4 149 ? 16.929 21.789  27.583  1.00 93.11  ? 149  MET E SD    1 
ATOM   9260  C  CE    . MET I 4 149 ? 17.813 22.512  26.089  1.00 92.39  ? 149  MET E CE    1 
ATOM   9261  N  N     . GLU I 4 150 ? 11.209 19.727  27.825  1.00 89.59  ? 150  GLU E N     1 
ATOM   9262  C  CA    . GLU I 4 150 ? 10.484 18.782  28.677  1.00 91.72  ? 150  GLU E CA    1 
ATOM   9263  C  C     . GLU I 4 150 ? 10.002 17.551  27.927  1.00 93.17  ? 150  GLU E C     1 
ATOM   9264  O  O     . GLU I 4 150 ? 10.226 16.414  28.364  1.00 93.26  ? 150  GLU E O     1 
ATOM   9265  C  CB    . GLU I 4 150 ? 9.288  19.523  29.275  1.00 91.90  ? 150  GLU E CB    1 
ATOM   9266  C  CG    . GLU I 4 150 ? 8.296  18.749  30.108  1.00 92.92  ? 150  GLU E CG    1 
ATOM   9267  C  CD    . GLU I 4 150 ? 7.214  19.682  30.650  1.00 93.92  ? 150  GLU E CD    1 
ATOM   9268  O  OE1   . GLU I 4 150 ? 6.630  20.445  29.841  1.00 93.95  ? 150  GLU E OE1   1 
ATOM   9269  O  OE2   . GLU I 4 150 ? 6.951  19.663  31.876  1.00 94.70  ? 150  GLU E OE2   1 
ATOM   9270  N  N     . ASN I 4 151 ? 9.330  17.802  26.803  1.00 94.67  ? 151  ASN E N     1 
ATOM   9271  C  CA    . ASN I 4 151 ? 8.767  16.760  25.946  1.00 95.72  ? 151  ASN E CA    1 
ATOM   9272  C  C     . ASN I 4 151 ? 9.700  16.481  24.781  1.00 96.42  ? 151  ASN E C     1 
ATOM   9273  O  O     . ASN I 4 151 ? 9.250  16.256  23.664  1.00 96.64  ? 151  ASN E O     1 
ATOM   9274  C  CB    . ASN I 4 151 ? 7.409  17.209  25.400  1.00 95.57  ? 151  ASN E CB    1 
ATOM   9275  C  CG    . ASN I 4 151 ? 6.915  18.495  26.051  1.00 95.88  ? 151  ASN E CG    1 
ATOM   9276  O  OD1   . ASN I 4 151 ? 6.135  18.464  27.012  1.00 95.76  ? 151  ASN E OD1   1 
ATOM   9277  N  ND2   . ASN I 4 151 ? 7.386  19.639  25.541  1.00 95.32  ? 151  ASN E ND2   1 
ATOM   9278  N  N     . SER I 4 152 ? 11.001 16.534  25.032  1.00 97.18  ? 152  SER E N     1 
ATOM   9279  C  CA    . SER I 4 152 ? 11.965 16.245  23.985  1.00 97.77  ? 152  SER E CA    1 
ATOM   9280  C  C     . SER I 4 152 ? 12.150 14.736  24.025  1.00 98.73  ? 152  SER E C     1 
ATOM   9281  O  O     . SER I 4 152 ? 11.457 14.039  24.778  1.00 99.69  ? 152  SER E O     1 
ATOM   9282  C  CB    . SER I 4 152 ? 13.300 16.937  24.260  1.00 97.47  ? 152  SER E CB    1 
ATOM   9283  O  OG    . SER I 4 152 ? 14.244 16.643  23.241  1.00 97.05  ? 152  SER E OG    1 
ATOM   9284  N  N     . ASP I 4 153 ? 13.081 14.232  23.223  1.00 99.27  ? 153  ASP E N     1 
ATOM   9285  C  CA    . ASP I 4 153 ? 13.344 12.800  23.173  1.00 99.28  ? 153  ASP E CA    1 
ATOM   9286  C  C     . ASP I 4 153 ? 14.849 12.581  23.048  1.00 98.54  ? 153  ASP E C     1 
ATOM   9287  O  O     . ASP I 4 153 ? 15.409 11.656  23.648  1.00 98.43  ? 153  ASP E O     1 
ATOM   9288  C  CB    . ASP I 4 153 ? 12.623 12.166  21.972  1.00 101.28 ? 153  ASP E CB    1 
ATOM   9289  C  CG    . ASP I 4 153 ? 11.310 12.884  21.608  1.00 103.07 ? 153  ASP E CG    1 
ATOM   9290  O  OD1   . ASP I 4 153 ? 11.359 13.871  20.829  1.00 102.95 ? 153  ASP E OD1   1 
ATOM   9291  O  OD2   . ASP I 4 153 ? 10.235 12.459  22.102  1.00 103.76 ? 153  ASP E OD2   1 
ATOM   9292  N  N     . ARG I 4 154 ? 15.494 13.447  22.268  1.00 97.55  ? 154  ARG E N     1 
ATOM   9293  C  CA    . ARG I 4 154 ? 16.938 13.382  22.036  1.00 95.78  ? 154  ARG E CA    1 
ATOM   9294  C  C     . ARG I 4 154 ? 17.706 12.997  23.304  1.00 94.40  ? 154  ARG E C     1 
ATOM   9295  O  O     . ARG I 4 154 ? 17.532 13.583  24.369  1.00 93.29  ? 154  ARG E O     1 
ATOM   9296  C  CB    . ARG I 4 154 ? 17.436 14.724  21.473  1.00 95.58  ? 154  ARG E CB    1 
ATOM   9297  C  CG    . ARG I 4 154 ? 16.356 15.806  21.392  1.00 95.55  ? 154  ARG E CG    1 
ATOM   9298  C  CD    . ARG I 4 154 ? 16.434 16.647  20.114  1.00 96.43  ? 154  ARG E CD    1 
ATOM   9299  N  NE    . ARG I 4 154 ? 17.590 17.550  20.046  1.00 97.59  ? 154  ARG E NE    1 
ATOM   9300  C  CZ    . ARG I 4 154 ? 18.853 17.178  19.816  1.00 97.65  ? 154  ARG E CZ    1 
ATOM   9301  N  NH1   . ARG I 4 154 ? 19.158 15.897  19.623  1.00 97.52  ? 154  ARG E NH1   1 
ATOM   9302  N  NH2   . ARG I 4 154 ? 19.819 18.096  19.774  1.00 97.12  ? 154  ARG E NH2   1 
ATOM   9303  N  N     . CYS I 4 155 ? 18.551 11.989  23.175  1.00 93.28  ? 155  CYS E N     1 
ATOM   9304  C  CA    . CYS I 4 155 ? 19.337 11.499  24.294  1.00 92.68  ? 155  CYS E CA    1 
ATOM   9305  C  C     . CYS I 4 155 ? 20.175 12.581  24.987  1.00 90.30  ? 155  CYS E C     1 
ATOM   9306  O  O     . CYS I 4 155 ? 20.815 12.323  26.004  1.00 90.03  ? 155  CYS E O     1 
ATOM   9307  C  CB    . CYS I 4 155 ? 20.238 10.363  23.801  1.00 94.94  ? 155  CYS E CB    1 
ATOM   9308  S  SG    . CYS I 4 155 ? 21.085 9.386   25.074  1.00 98.32  ? 155  CYS E SG    1 
ATOM   9309  N  N     . GLN I 4 156 ? 20.185 13.788  24.438  1.00 88.44  ? 156  GLN E N     1 
ATOM   9310  C  CA    . GLN I 4 156 ? 20.944 14.879  25.045  1.00 86.00  ? 156  GLN E CA    1 
ATOM   9311  C  C     . GLN I 4 156 ? 20.010 15.817  25.774  1.00 84.29  ? 156  GLN E C     1 
ATOM   9312  O  O     . GLN I 4 156 ? 20.162 16.047  26.963  1.00 84.10  ? 156  GLN E O     1 
ATOM   9313  C  CB    . GLN I 4 156 ? 21.702 15.677  23.998  1.00 86.89  ? 156  GLN E CB    1 
ATOM   9314  C  CG    . GLN I 4 156 ? 22.287 16.939  24.565  1.00 88.09  ? 156  GLN E CG    1 
ATOM   9315  C  CD    . GLN I 4 156 ? 23.040 17.755  23.535  1.00 89.99  ? 156  GLN E CD    1 
ATOM   9316  O  OE1   . GLN I 4 156 ? 22.435 18.437  22.686  1.00 90.47  ? 156  GLN E OE1   1 
ATOM   9317  N  NE2   . GLN I 4 156 ? 24.376 17.692  23.600  1.00 90.27  ? 156  GLN E NE2   1 
ATOM   9318  N  N     . ASP I 4 157 ? 19.045 16.365  25.050  1.00 81.93  ? 157  ASP E N     1 
ATOM   9319  C  CA    . ASP I 4 157 ? 18.076 17.263  25.648  1.00 80.09  ? 157  ASP E CA    1 
ATOM   9320  C  C     . ASP I 4 157 ? 17.460 16.687  26.915  1.00 77.73  ? 157  ASP E C     1 
ATOM   9321  O  O     . ASP I 4 157 ? 16.676 17.348  27.582  1.00 77.82  ? 157  ASP E O     1 
ATOM   9322  C  CB    . ASP I 4 157 ? 16.975 17.597  24.647  1.00 81.36  ? 157  ASP E CB    1 
ATOM   9323  C  CG    . ASP I 4 157 ? 17.194 18.937  23.984  1.00 83.09  ? 157  ASP E CG    1 
ATOM   9324  O  OD1   . ASP I 4 157 ? 18.333 19.168  23.518  1.00 83.83  ? 157  ASP E OD1   1 
ATOM   9325  O  OD2   . ASP I 4 157 ? 16.241 19.757  23.930  1.00 83.82  ? 157  ASP E OD2   1 
ATOM   9326  N  N     . ILE I 4 158 ? 17.795 15.449  27.237  1.00 75.07  ? 158  ILE E N     1 
ATOM   9327  C  CA    . ILE I 4 158 ? 17.288 14.840  28.450  1.00 73.08  ? 158  ILE E CA    1 
ATOM   9328  C  C     . ILE I 4 158 ? 18.347 15.065  29.516  1.00 71.95  ? 158  ILE E C     1 
ATOM   9329  O  O     . ILE I 4 158 ? 18.052 15.612  30.591  1.00 72.23  ? 158  ILE E O     1 
ATOM   9330  C  CB    . ILE I 4 158 ? 17.016 13.318  28.258  1.00 73.74  ? 158  ILE E CB    1 
ATOM   9331  C  CG1   . ILE I 4 158 ? 15.523 13.102  27.981  1.00 74.06  ? 158  ILE E CG1   1 
ATOM   9332  C  CG2   . ILE I 4 158 ? 17.465 12.508  29.482  1.00 72.34  ? 158  ILE E CG2   1 
ATOM   9333  C  CD1   . ILE I 4 158 ? 15.128 11.641  27.820  1.00 74.58  ? 158  ILE E CD1   1 
ATOM   9334  N  N     . ARG I 4 159 ? 19.579 14.655  29.201  1.00 69.63  ? 159  ARG E N     1 
ATOM   9335  C  CA    . ARG I 4 159 ? 20.725 14.802  30.107  1.00 66.89  ? 159  ARG E CA    1 
ATOM   9336  C  C     . ARG I 4 159 ? 20.895 16.252  30.558  1.00 66.09  ? 159  ARG E C     1 
ATOM   9337  O  O     . ARG I 4 159 ? 21.275 16.523  31.687  1.00 66.37  ? 159  ARG E O     1 
ATOM   9338  C  CB    . ARG I 4 159 ? 22.002 14.368  29.411  1.00 63.97  ? 159  ARG E CB    1 
ATOM   9339  C  CG    . ARG I 4 159 ? 23.191 14.324  30.319  1.00 60.07  ? 159  ARG E CG    1 
ATOM   9340  C  CD    . ARG I 4 159 ? 24.439 14.514  29.516  1.00 57.02  ? 159  ARG E CD    1 
ATOM   9341  N  NE    . ARG I 4 159 ? 24.404 15.838  28.928  1.00 53.74  ? 159  ARG E NE    1 
ATOM   9342  C  CZ    . ARG I 4 159 ? 25.309 16.291  28.078  1.00 52.54  ? 159  ARG E CZ    1 
ATOM   9343  N  NH1   . ARG I 4 159 ? 26.319 15.508  27.723  1.00 51.40  ? 159  ARG E NH1   1 
ATOM   9344  N  NH2   . ARG I 4 159 ? 25.198 17.522  27.591  1.00 50.97  ? 159  ARG E NH2   1 
ATOM   9345  N  N     . ASN I 4 160 ? 20.620 17.181  29.658  1.00 65.33  ? 160  ASN E N     1 
ATOM   9346  C  CA    . ASN I 4 160 ? 20.730 18.583  29.973  1.00 63.82  ? 160  ASN E CA    1 
ATOM   9347  C  C     . ASN I 4 160 ? 19.679 19.052  30.953  1.00 64.09  ? 160  ASN E C     1 
ATOM   9348  O  O     . ASN I 4 160 ? 19.982 19.828  31.846  1.00 65.73  ? 160  ASN E O     1 
ATOM   9349  C  CB    . ASN I 4 160 ? 20.635 19.403  28.705  1.00 62.97  ? 160  ASN E CB    1 
ATOM   9350  C  CG    . ASN I 4 160 ? 21.983 19.664  28.097  1.00 62.61  ? 160  ASN E CG    1 
ATOM   9351  O  OD1   . ASN I 4 160 ? 22.915 18.860  28.243  1.00 61.24  ? 160  ASN E OD1   1 
ATOM   9352  N  ND2   . ASN I 4 160 ? 22.101 20.792  27.394  1.00 62.04  ? 160  ASN E ND2   1 
ATOM   9353  N  N     . LEU I 4 161 ? 18.441 18.601  30.810  1.00 63.46  ? 161  LEU E N     1 
ATOM   9354  C  CA    . LEU I 4 161 ? 17.419 19.060  31.734  1.00 62.82  ? 161  LEU E CA    1 
ATOM   9355  C  C     . LEU I 4 161 ? 17.583 18.445  33.111  1.00 62.29  ? 161  LEU E C     1 
ATOM   9356  O  O     . LEU I 4 161 ? 17.096 18.988  34.099  1.00 61.02  ? 161  LEU E O     1 
ATOM   9357  C  CB    . LEU I 4 161 ? 16.032 18.750  31.200  1.00 64.12  ? 161  LEU E CB    1 
ATOM   9358  C  CG    . LEU I 4 161 ? 14.963 19.674  31.788  1.00 65.50  ? 161  LEU E CG    1 
ATOM   9359  C  CD1   . LEU I 4 161 ? 15.241 21.111  31.368  1.00 65.87  ? 161  LEU E CD1   1 
ATOM   9360  C  CD2   . LEU I 4 161 ? 13.585 19.244  31.310  1.00 66.71  ? 161  LEU E CD2   1 
ATOM   9361  N  N     . ALA I 4 162 ? 18.269 17.307  33.172  1.00 62.04  ? 162  ALA E N     1 
ATOM   9362  C  CA    . ALA I 4 162 ? 18.509 16.628  34.448  1.00 62.02  ? 162  ALA E CA    1 
ATOM   9363  C  C     . ALA I 4 162 ? 19.662 17.288  35.188  1.00 61.57  ? 162  ALA E C     1 
ATOM   9364  O  O     . ALA I 4 162 ? 19.618 17.435  36.407  1.00 62.51  ? 162  ALA E O     1 
ATOM   9365  C  CB    . ALA I 4 162 ? 18.822 15.157  34.224  1.00 62.97  ? 162  ALA E CB    1 
ATOM   9366  N  N     . PHE I 4 163 ? 20.708 17.664  34.460  1.00 59.94  ? 163  PHE E N     1 
ATOM   9367  C  CA    . PHE I 4 163 ? 21.836 18.338  35.084  1.00 57.57  ? 163  PHE E CA    1 
ATOM   9368  C  C     . PHE I 4 163 ? 21.353 19.666  35.627  1.00 56.50  ? 163  PHE E C     1 
ATOM   9369  O  O     . PHE I 4 163 ? 21.667 20.017  36.742  1.00 56.09  ? 163  PHE E O     1 
ATOM   9370  C  CB    . PHE I 4 163 ? 22.961 18.558  34.082  1.00 56.29  ? 163  PHE E CB    1 
ATOM   9371  C  CG    . PHE I 4 163 ? 23.920 19.633  34.474  1.00 54.74  ? 163  PHE E CG    1 
ATOM   9372  C  CD1   . PHE I 4 163 ? 23.620 20.969  34.226  1.00 54.33  ? 163  PHE E CD1   1 
ATOM   9373  C  CD2   . PHE I 4 163 ? 25.149 19.309  35.034  1.00 53.84  ? 163  PHE E CD2   1 
ATOM   9374  C  CE1   . PHE I 4 163 ? 24.534 21.964  34.516  1.00 53.51  ? 163  PHE E CE1   1 
ATOM   9375  C  CE2   . PHE I 4 163 ? 26.068 20.294  35.329  1.00 52.98  ? 163  PHE E CE2   1 
ATOM   9376  C  CZ    . PHE I 4 163 ? 25.762 21.626  35.066  1.00 53.28  ? 163  PHE E CZ    1 
ATOM   9377  N  N     . LEU I 4 164 ? 20.584 20.409  34.850  1.00 56.00  ? 164  LEU E N     1 
ATOM   9378  C  CA    . LEU I 4 164 ? 20.086 21.672  35.357  1.00 56.82  ? 164  LEU E CA    1 
ATOM   9379  C  C     . LEU I 4 164 ? 19.175 21.459  36.577  1.00 57.31  ? 164  LEU E C     1 
ATOM   9380  O  O     . LEU I 4 164 ? 19.230 22.214  37.552  1.00 57.98  ? 164  LEU E O     1 
ATOM   9381  C  CB    . LEU I 4 164 ? 19.328 22.441  34.268  1.00 56.80  ? 164  LEU E CB    1 
ATOM   9382  C  CG    . LEU I 4 164 ? 20.134 23.008  33.094  1.00 56.57  ? 164  LEU E CG    1 
ATOM   9383  C  CD1   . LEU I 4 164 ? 19.304 24.120  32.441  1.00 55.57  ? 164  LEU E CD1   1 
ATOM   9384  C  CD2   . LEU I 4 164 ? 21.494 23.543  33.564  1.00 54.88  ? 164  LEU E CD2   1 
ATOM   9385  N  N     . GLY I 4 165 ? 18.334 20.434  36.534  1.00 56.81  ? 165  GLY E N     1 
ATOM   9386  C  CA    . GLY I 4 165 ? 17.450 20.182  37.660  1.00 54.98  ? 165  GLY E CA    1 
ATOM   9387  C  C     . GLY I 4 165 ? 18.239 19.954  38.930  1.00 53.74  ? 165  GLY E C     1 
ATOM   9388  O  O     . GLY I 4 165 ? 17.788 20.296  40.020  1.00 54.84  ? 165  GLY E O     1 
ATOM   9389  N  N     . ILE I 4 166 ? 19.422 19.369  38.789  1.00 51.90  ? 166  ILE E N     1 
ATOM   9390  C  CA    . ILE I 4 166 ? 20.276 19.108  39.928  1.00 49.95  ? 166  ILE E CA    1 
ATOM   9391  C  C     . ILE I 4 166 ? 20.954 20.382  40.411  1.00 49.60  ? 166  ILE E C     1 
ATOM   9392  O  O     . ILE I 4 166 ? 20.873 20.714  41.584  1.00 50.62  ? 166  ILE E O     1 
ATOM   9393  C  CB    . ILE I 4 166 ? 21.344 18.062  39.588  1.00 49.35  ? 166  ILE E CB    1 
ATOM   9394  C  CG1   . ILE I 4 166 ? 20.722 16.669  39.640  1.00 49.03  ? 166  ILE E CG1   1 
ATOM   9395  C  CG2   . ILE I 4 166 ? 22.523 18.198  40.518  1.00 48.63  ? 166  ILE E CG2   1 
ATOM   9396  C  CD1   . ILE I 4 166 ? 21.691 15.562  40.022  1.00 49.17  ? 166  ILE E CD1   1 
ATOM   9397  N  N     . ALA I 4 167 ? 21.604 21.105  39.503  1.00 48.65  ? 167  ALA E N     1 
ATOM   9398  C  CA    . ALA I 4 167 ? 22.317 22.344  39.847  1.00 47.23  ? 167  ALA E CA    1 
ATOM   9399  C  C     . ALA I 4 167 ? 21.475 23.335  40.601  1.00 46.27  ? 167  ALA E C     1 
ATOM   9400  O  O     . ALA I 4 167 ? 21.998 24.093  41.387  1.00 46.67  ? 167  ALA E O     1 
ATOM   9401  C  CB    . ALA I 4 167 ? 22.874 23.023  38.604  1.00 45.84  ? 167  ALA E CB    1 
ATOM   9402  N  N     . TYR I 4 168 ? 20.181 23.357  40.359  1.00 45.38  ? 168  TYR E N     1 
ATOM   9403  C  CA    . TYR I 4 168 ? 19.360 24.297  41.074  1.00 45.66  ? 168  TYR E CA    1 
ATOM   9404  C  C     . TYR I 4 168 ? 18.804 23.611  42.313  1.00 48.04  ? 168  TYR E C     1 
ATOM   9405  O  O     . TYR I 4 168 ? 18.476 24.249  43.309  1.00 49.39  ? 168  TYR E O     1 
ATOM   9406  C  CB    . TYR I 4 168 ? 18.226 24.774  40.181  1.00 43.40  ? 168  TYR E CB    1 
ATOM   9407  C  CG    . TYR I 4 168 ? 17.253 25.693  40.857  1.00 40.86  ? 168  TYR E CG    1 
ATOM   9408  C  CD1   . TYR I 4 168 ? 17.246 27.048  40.585  1.00 40.67  ? 168  TYR E CD1   1 
ATOM   9409  C  CD2   . TYR I 4 168 ? 16.318 25.202  41.751  1.00 40.55  ? 168  TYR E CD2   1 
ATOM   9410  C  CE1   . TYR I 4 168 ? 16.315 27.905  41.181  1.00 40.95  ? 168  TYR E CE1   1 
ATOM   9411  C  CE2   . TYR I 4 168 ? 15.391 26.041  42.363  1.00 41.48  ? 168  TYR E CE2   1 
ATOM   9412  C  CZ    . TYR I 4 168 ? 15.386 27.396  42.072  1.00 41.48  ? 168  TYR E CZ    1 
ATOM   9413  O  OH    . TYR I 4 168 ? 14.438 28.221  42.656  1.00 41.00  ? 168  TYR E OH    1 
ATOM   9414  N  N     . ASN I 4 169 ? 18.706 22.298  42.273  1.00 48.59  ? 169  ASN E N     1 
ATOM   9415  C  CA    . ASN I 4 169 ? 18.147 21.615  43.417  1.00 49.44  ? 169  ASN E CA    1 
ATOM   9416  C  C     . ASN I 4 169 ? 19.146 21.252  44.500  1.00 48.44  ? 169  ASN E C     1 
ATOM   9417  O  O     . ASN I 4 169 ? 18.770 20.644  45.488  1.00 48.58  ? 169  ASN E O     1 
ATOM   9418  C  CB    . ASN I 4 169 ? 17.426 20.345  42.971  1.00 51.43  ? 169  ASN E CB    1 
ATOM   9419  C  CG    . ASN I 4 169 ? 16.262 20.004  43.871  1.00 53.40  ? 169  ASN E CG    1 
ATOM   9420  O  OD1   . ASN I 4 169 ? 15.246 20.684  43.835  1.00 55.83  ? 169  ASN E OD1   1 
ATOM   9421  N  ND2   . ASN I 4 169 ? 16.405 18.966  44.696  1.00 53.54  ? 169  ASN E ND2   1 
ATOM   9422  N  N     . THR I 4 170 ? 20.413 21.602  44.342  1.00 47.53  ? 170  THR E N     1 
ATOM   9423  C  CA    . THR I 4 170 ? 21.374 21.223  45.374  1.00 47.75  ? 170  THR E CA    1 
ATOM   9424  C  C     . THR I 4 170 ? 22.472 22.243  45.605  1.00 47.95  ? 170  THR E C     1 
ATOM   9425  O  O     . THR I 4 170 ? 23.291 22.101  46.506  1.00 49.26  ? 170  THR E O     1 
ATOM   9426  C  CB    . THR I 4 170 ? 22.080 19.937  45.022  1.00 47.62  ? 170  THR E CB    1 
ATOM   9427  O  OG1   . THR I 4 170 ? 23.220 20.249  44.217  1.00 47.02  ? 170  THR E OG1   1 
ATOM   9428  C  CG2   . THR I 4 170 ? 21.163 19.023  44.255  1.00 47.22  ? 170  THR E CG2   1 
ATOM   9429  N  N     . LEU I 4 171 ? 22.495 23.265  44.772  1.00 47.75  ? 171  LEU E N     1 
ATOM   9430  C  CA    . LEU I 4 171 ? 23.499 24.299  44.872  1.00 46.36  ? 171  LEU E CA    1 
ATOM   9431  C  C     . LEU I 4 171 ? 24.842 23.622  45.037  1.00 46.20  ? 171  LEU E C     1 
ATOM   9432  O  O     . LEU I 4 171 ? 25.717 24.131  45.716  1.00 46.85  ? 171  LEU E O     1 
ATOM   9433  C  CB    . LEU I 4 171 ? 23.202 25.217  46.046  1.00 44.37  ? 171  LEU E CB    1 
ATOM   9434  C  CG    . LEU I 4 171 ? 21.743 25.308  46.493  1.00 43.92  ? 171  LEU E CG    1 
ATOM   9435  C  CD1   . LEU I 4 171 ? 21.567 26.594  47.222  1.00 45.78  ? 171  LEU E CD1   1 
ATOM   9436  C  CD2   . LEU I 4 171 ? 20.789 25.302  45.346  1.00 44.68  ? 171  LEU E CD2   1 
ATOM   9437  N  N     . LEU I 4 172 ? 24.985 22.447  44.438  1.00 45.76  ? 172  LEU E N     1 
ATOM   9438  C  CA    . LEU I 4 172 ? 26.243 21.730  44.477  1.00 46.00  ? 172  LEU E CA    1 
ATOM   9439  C  C     . LEU I 4 172 ? 27.087 22.467  43.455  1.00 47.88  ? 172  LEU E C     1 
ATOM   9440  O  O     . LEU I 4 172 ? 26.544 23.052  42.527  1.00 47.80  ? 172  LEU E O     1 
ATOM   9441  C  CB    . LEU I 4 172 ? 26.038 20.283  44.037  1.00 45.14  ? 172  LEU E CB    1 
ATOM   9442  C  CG    . LEU I 4 172 ? 25.616 19.265  45.096  1.00 45.12  ? 172  LEU E CG    1 
ATOM   9443  C  CD1   . LEU I 4 172 ? 24.815 18.124  44.512  1.00 44.26  ? 172  LEU E CD1   1 
ATOM   9444  C  CD2   . LEU I 4 172 ? 26.861 18.734  45.740  1.00 45.96  ? 172  LEU E CD2   1 
ATOM   9445  N  N     . ARG I 4 173 ? 28.401 22.471  43.628  1.00 51.12  ? 173  ARG E N     1 
ATOM   9446  C  CA    . ARG I 4 173 ? 29.281 23.140  42.675  1.00 55.37  ? 173  ARG E CA    1 
ATOM   9447  C  C     . ARG I 4 173 ? 29.278 22.319  41.396  1.00 56.03  ? 173  ARG E C     1 
ATOM   9448  O  O     . ARG I 4 173 ? 28.988 21.125  41.440  1.00 56.50  ? 173  ARG E O     1 
ATOM   9449  C  CB    . ARG I 4 173 ? 30.712 23.222  43.223  1.00 58.74  ? 173  ARG E CB    1 
ATOM   9450  C  CG    . ARG I 4 173 ? 30.906 24.275  44.306  1.00 65.10  ? 173  ARG E CG    1 
ATOM   9451  C  CD    . ARG I 4 173 ? 31.218 23.668  45.681  1.00 69.86  ? 173  ARG E CD    1 
ATOM   9452  N  NE    . ARG I 4 173 ? 30.983 24.621  46.772  1.00 73.17  ? 173  ARG E NE    1 
ATOM   9453  C  CZ    . ARG I 4 173 ? 31.550 25.825  46.863  1.00 75.38  ? 173  ARG E CZ    1 
ATOM   9454  N  NH1   . ARG I 4 173 ? 32.401 26.247  45.921  1.00 74.84  ? 173  ARG E NH1   1 
ATOM   9455  N  NH2   . ARG I 4 173 ? 31.265 26.610  47.903  1.00 75.88  ? 173  ARG E NH2   1 
ATOM   9456  N  N     . ILE I 4 174 ? 29.598 22.921  40.252  1.00 57.27  ? 174  ILE E N     1 
ATOM   9457  C  CA    . ILE I 4 174 ? 29.596 22.111  39.027  1.00 57.48  ? 174  ILE E CA    1 
ATOM   9458  C  C     . ILE I 4 174 ? 30.599 20.963  39.131  1.00 57.32  ? 174  ILE E C     1 
ATOM   9459  O  O     . ILE I 4 174 ? 30.374 19.900  38.575  1.00 58.00  ? 174  ILE E O     1 
ATOM   9460  C  CB    . ILE I 4 174 ? 29.936 22.919  37.732  1.00 56.54  ? 174  ILE E CB    1 
ATOM   9461  C  CG1   . ILE I 4 174 ? 31.384 23.385  37.776  1.00 55.11  ? 174  ILE E CG1   1 
ATOM   9462  C  CG2   . ILE I 4 174 ? 28.945 24.076  37.546  1.00 56.74  ? 174  ILE E CG2   1 
ATOM   9463  C  CD1   . ILE I 4 174 ? 31.822 24.003  36.506  1.00 54.61  ? 174  ILE E CD1   1 
ATOM   9464  N  N     . ALA I 4 175 ? 31.690 21.177  39.858  1.00 56.65  ? 175  ALA E N     1 
ATOM   9465  C  CA    . ALA I 4 175 ? 32.722 20.157  40.005  1.00 55.78  ? 175  ALA E CA    1 
ATOM   9466  C  C     . ALA I 4 175 ? 32.286 18.961  40.825  1.00 55.15  ? 175  ALA E C     1 
ATOM   9467  O  O     . ALA I 4 175 ? 32.767 17.859  40.602  1.00 55.39  ? 175  ALA E O     1 
ATOM   9468  C  CB    . ALA I 4 175 ? 33.978 20.763  40.611  1.00 56.59  ? 175  ALA E CB    1 
ATOM   9469  N  N     . GLU I 4 176 ? 31.398 19.180  41.783  1.00 54.52  ? 176  GLU E N     1 
ATOM   9470  C  CA    . GLU I 4 176 ? 30.909 18.093  42.611  1.00 54.94  ? 176  GLU E CA    1 
ATOM   9471  C  C     . GLU I 4 176 ? 29.876 17.366  41.770  1.00 54.47  ? 176  GLU E C     1 
ATOM   9472  O  O     . GLU I 4 176 ? 29.731 16.152  41.878  1.00 54.60  ? 176  GLU E O     1 
ATOM   9473  C  CB    . GLU I 4 176 ? 30.220 18.618  43.875  1.00 57.66  ? 176  GLU E CB    1 
ATOM   9474  C  CG    . GLU I 4 176 ? 31.078 19.443  44.856  1.00 62.94  ? 176  GLU E CG    1 
ATOM   9475  C  CD    . GLU I 4 176 ? 30.231 20.247  45.879  1.00 65.79  ? 176  GLU E CD    1 
ATOM   9476  O  OE1   . GLU I 4 176 ? 30.764 20.591  46.969  1.00 68.58  ? 176  GLU E OE1   1 
ATOM   9477  O  OE2   . GLU I 4 176 ? 29.040 20.547  45.586  1.00 65.94  ? 176  GLU E OE2   1 
ATOM   9478  N  N     . ILE I 4 177 ? 29.152 18.110  40.930  1.00 52.60  ? 177  ILE E N     1 
ATOM   9479  C  CA    . ILE I 4 177 ? 28.131 17.503  40.088  1.00 51.25  ? 177  ILE E CA    1 
ATOM   9480  C  C     . ILE I 4 177 ? 28.738 16.557  39.081  1.00 51.41  ? 177  ILE E C     1 
ATOM   9481  O  O     . ILE I 4 177 ? 28.054 15.708  38.545  1.00 52.09  ? 177  ILE E O     1 
ATOM   9482  C  CB    . ILE I 4 177 ? 27.309 18.535  39.334  1.00 50.56  ? 177  ILE E CB    1 
ATOM   9483  C  CG1   . ILE I 4 177 ? 26.616 19.448  40.323  1.00 49.75  ? 177  ILE E CG1   1 
ATOM   9484  C  CG2   . ILE I 4 177 ? 26.251 17.845  38.496  1.00 51.36  ? 177  ILE E CG2   1 
ATOM   9485  C  CD1   . ILE I 4 177 ? 25.597 20.335  39.692  1.00 48.87  ? 177  ILE E CD1   1 
ATOM   9486  N  N     . ALA I 4 178 ? 30.019 16.698  38.801  1.00 51.64  ? 178  ALA E N     1 
ATOM   9487  C  CA    . ALA I 4 178 ? 30.632 15.779  37.877  1.00 53.03  ? 178  ALA E CA    1 
ATOM   9488  C  C     . ALA I 4 178 ? 30.841 14.441  38.597  1.00 54.94  ? 178  ALA E C     1 
ATOM   9489  O  O     . ALA I 4 178 ? 30.246 13.427  38.230  1.00 55.32  ? 178  ALA E O     1 
ATOM   9490  C  CB    . ALA I 4 178 ? 31.942 16.321  37.403  1.00 51.24  ? 178  ALA E CB    1 
ATOM   9491  N  N     . ARG I 4 179 ? 31.663 14.479  39.647  1.00 56.59  ? 179  ARG E N     1 
ATOM   9492  C  CA    . ARG I 4 179 ? 32.051 13.325  40.456  1.00 56.59  ? 179  ARG E CA    1 
ATOM   9493  C  C     . ARG I 4 179 ? 30.953 12.462  41.015  1.00 56.13  ? 179  ARG E C     1 
ATOM   9494  O  O     . ARG I 4 179 ? 31.234 11.369  41.503  1.00 55.45  ? 179  ARG E O     1 
ATOM   9495  C  CB    . ARG I 4 179 ? 32.952 13.778  41.601  1.00 58.42  ? 179  ARG E CB    1 
ATOM   9496  C  CG    . ARG I 4 179 ? 34.186 14.536  41.124  1.00 64.32  ? 179  ARG E CG    1 
ATOM   9497  C  CD    . ARG I 4 179 ? 35.185 14.849  42.242  1.00 69.30  ? 179  ARG E CD    1 
ATOM   9498  N  NE    . ARG I 4 179 ? 34.631 15.731  43.273  1.00 73.90  ? 179  ARG E NE    1 
ATOM   9499  C  CZ    . ARG I 4 179 ? 34.764 17.054  43.288  1.00 75.44  ? 179  ARG E CZ    1 
ATOM   9500  N  NH1   . ARG I 4 179 ? 35.438 17.670  42.326  1.00 76.99  ? 179  ARG E NH1   1 
ATOM   9501  N  NH2   . ARG I 4 179 ? 34.216 17.760  44.267  1.00 77.13  ? 179  ARG E NH2   1 
ATOM   9502  N  N     . ILE I 4 180 ? 29.713 12.941  40.969  1.00 55.90  ? 180  ILE E N     1 
ATOM   9503  C  CA    . ILE I 4 180 ? 28.581 12.161  41.481  1.00 56.30  ? 180  ILE E CA    1 
ATOM   9504  C  C     . ILE I 4 180 ? 28.575 10.895  40.676  1.00 58.37  ? 180  ILE E C     1 
ATOM   9505  O  O     . ILE I 4 180 ? 28.957 10.929  39.515  1.00 60.17  ? 180  ILE E O     1 
ATOM   9506  C  CB    . ILE I 4 180 ? 27.244 12.837  41.205  1.00 54.09  ? 180  ILE E CB    1 
ATOM   9507  C  CG1   . ILE I 4 180 ? 27.163 14.158  41.952  1.00 53.66  ? 180  ILE E CG1   1 
ATOM   9508  C  CG2   . ILE I 4 180 ? 26.121 11.916  41.578  1.00 51.77  ? 180  ILE E CG2   1 
ATOM   9509  C  CD1   . ILE I 4 180 ? 26.030 15.032  41.505  1.00 53.31  ? 180  ILE E CD1   1 
ATOM   9510  N  N     . ARG I 4 181 ? 28.153 9.781   41.259  1.00 60.54  ? 181  ARG E N     1 
ATOM   9511  C  CA    . ARG I 4 181 ? 28.097 8.538   40.494  1.00 63.01  ? 181  ARG E CA    1 
ATOM   9512  C  C     . ARG I 4 181 ? 27.083 7.554   41.077  1.00 65.14  ? 181  ARG E C     1 
ATOM   9513  O  O     . ARG I 4 181 ? 27.003 7.383   42.293  1.00 66.54  ? 181  ARG E O     1 
ATOM   9514  C  CB    . ARG I 4 181 ? 29.494 7.906   40.385  1.00 61.76  ? 181  ARG E CB    1 
ATOM   9515  C  CG    . ARG I 4 181 ? 30.017 7.297   41.634  1.00 62.29  ? 181  ARG E CG    1 
ATOM   9516  C  CD    . ARG I 4 181 ? 31.501 7.525   41.780  1.00 64.03  ? 181  ARG E CD    1 
ATOM   9517  N  NE    . ARG I 4 181 ? 32.296 6.969   40.694  1.00 65.02  ? 181  ARG E NE    1 
ATOM   9518  C  CZ    . ARG I 4 181 ? 33.626 6.997   40.679  1.00 66.26  ? 181  ARG E CZ    1 
ATOM   9519  N  NH1   . ARG I 4 181 ? 34.284 7.553   41.691  1.00 66.01  ? 181  ARG E NH1   1 
ATOM   9520  N  NH2   . ARG I 4 181 ? 34.301 6.470   39.666  1.00 66.71  ? 181  ARG E NH2   1 
ATOM   9521  N  N     . VAL I 4 182 ? 26.294 6.937   40.197  1.00 66.91  ? 182  VAL E N     1 
ATOM   9522  C  CA    . VAL I 4 182 ? 25.257 5.972   40.569  1.00 68.19  ? 182  VAL E CA    1 
ATOM   9523  C  C     . VAL I 4 182 ? 25.253 5.475   42.016  1.00 69.20  ? 182  VAL E C     1 
ATOM   9524  O  O     . VAL I 4 182 ? 24.286 5.727   42.746  1.00 68.21  ? 182  VAL E O     1 
ATOM   9525  C  CB    . VAL I 4 182 ? 25.289 4.753   39.638  1.00 67.60  ? 182  VAL E CB    1 
ATOM   9526  C  CG1   . VAL I 4 182 ? 24.018 4.716   38.824  1.00 67.32  ? 182  VAL E CG1   1 
ATOM   9527  C  CG2   . VAL I 4 182 ? 26.498 4.827   38.720  1.00 67.61  ? 182  VAL E CG2   1 
ATOM   9528  N  N     . LYS I 4 183 ? 26.309 4.762   42.423  1.00 70.86  ? 183  LYS E N     1 
ATOM   9529  C  CA    . LYS I 4 183 ? 26.408 4.257   43.800  1.00 72.90  ? 183  LYS E CA    1 
ATOM   9530  C  C     . LYS I 4 183 ? 25.794 5.336   44.675  1.00 74.54  ? 183  LYS E C     1 
ATOM   9531  O  O     . LYS I 4 183 ? 24.800 5.125   45.377  1.00 75.39  ? 183  LYS E O     1 
ATOM   9532  C  CB    . LYS I 4 183 ? 27.873 4.073   44.246  1.00 73.05  ? 183  LYS E CB    1 
ATOM   9533  C  CG    . LYS I 4 183 ? 28.755 3.267   43.308  1.00 74.25  ? 183  LYS E CG    1 
ATOM   9534  C  CD    . LYS I 4 183 ? 29.931 2.591   44.045  1.00 75.15  ? 183  LYS E CD    1 
ATOM   9535  C  CE    . LYS I 4 183 ? 31.082 3.538   44.398  1.00 74.44  ? 183  LYS E CE    1 
ATOM   9536  N  NZ    . LYS I 4 183 ? 32.164 2.808   45.141  1.00 73.57  ? 183  LYS E NZ    1 
ATOM   9537  N  N     . ASP I 4 184 ? 26.403 6.512   44.589  1.00 74.54  ? 184  ASP E N     1 
ATOM   9538  C  CA    . ASP I 4 184 ? 25.983 7.665   45.342  1.00 74.67  ? 184  ASP E CA    1 
ATOM   9539  C  C     . ASP I 4 184 ? 24.469 7.879   45.337  1.00 75.51  ? 184  ASP E C     1 
ATOM   9540  O  O     . ASP I 4 184 ? 23.918 8.422   46.295  1.00 76.71  ? 184  ASP E O     1 
ATOM   9541  C  CB    . ASP I 4 184 ? 26.726 8.899   44.819  1.00 73.71  ? 184  ASP E CB    1 
ATOM   9542  C  CG    . ASP I 4 184 ? 28.246 8.782   44.985  1.00 73.99  ? 184  ASP E CG    1 
ATOM   9543  O  OD1   . ASP I 4 184 ? 28.988 9.751   44.666  1.00 74.53  ? 184  ASP E OD1   1 
ATOM   9544  O  OD2   . ASP I 4 184 ? 28.698 7.710   45.443  1.00 73.35  ? 184  ASP E OD2   1 
ATOM   9545  N  N     . ILE I 4 185 ? 23.774 7.442   44.296  1.00 75.75  ? 185  ILE E N     1 
ATOM   9546  C  CA    . ILE I 4 185 ? 22.332 7.650   44.277  1.00 76.67  ? 185  ILE E CA    1 
ATOM   9547  C  C     . ILE I 4 185 ? 21.604 6.543   45.014  1.00 78.48  ? 185  ILE E C     1 
ATOM   9548  O  O     . ILE I 4 185 ? 22.027 5.400   44.968  1.00 79.31  ? 185  ILE E O     1 
ATOM   9549  C  CB    . ILE I 4 185 ? 21.821 7.721   42.864  1.00 75.58  ? 185  ILE E CB    1 
ATOM   9550  C  CG1   . ILE I 4 185 ? 22.783 8.564   42.035  1.00 74.73  ? 185  ILE E CG1   1 
ATOM   9551  C  CG2   . ILE I 4 185 ? 20.440 8.326   42.856  1.00 74.48  ? 185  ILE E CG2   1 
ATOM   9552  C  CD1   . ILE I 4 185 ? 22.524 8.500   40.569  1.00 74.88  ? 185  ILE E CD1   1 
ATOM   9553  N  N     . SER I 4 186 ? 20.516 6.896   45.695  1.00 80.76  ? 186  SER E N     1 
ATOM   9554  C  CA    . SER I 4 186 ? 19.700 5.953   46.472  1.00 83.21  ? 186  SER E CA    1 
ATOM   9555  C  C     . SER I 4 186 ? 18.316 6.564   46.664  1.00 85.16  ? 186  SER E C     1 
ATOM   9556  O  O     . SER I 4 186 ? 18.096 7.689   46.234  1.00 85.65  ? 186  SER E O     1 
ATOM   9557  C  CB    . SER I 4 186 ? 20.347 5.696   47.827  1.00 83.18  ? 186  SER E CB    1 
ATOM   9558  O  OG    . SER I 4 186 ? 20.613 6.911   48.505  1.00 84.78  ? 186  SER E OG    1 
ATOM   9559  N  N     . ARG I 4 187 ? 17.376 5.875   47.305  1.00 87.84  ? 187  ARG E N     1 
ATOM   9560  C  CA    . ARG I 4 187 ? 16.052 6.492   47.428  1.00 92.15  ? 187  ARG E CA    1 
ATOM   9561  C  C     . ARG I 4 187 ? 15.374 6.558   48.793  1.00 94.29  ? 187  ARG E C     1 
ATOM   9562  O  O     . ARG I 4 187 ? 15.543 5.683   49.648  1.00 94.69  ? 187  ARG E O     1 
ATOM   9563  C  CB    . ARG I 4 187 ? 15.084 5.862   46.409  1.00 92.79  ? 187  ARG E CB    1 
ATOM   9564  C  CG    . ARG I 4 187 ? 15.671 5.822   44.995  1.00 94.82  ? 187  ARG E CG    1 
ATOM   9565  C  CD    . ARG I 4 187 ? 14.644 5.700   43.872  1.00 95.80  ? 187  ARG E CD    1 
ATOM   9566  N  NE    . ARG I 4 187 ? 15.313 5.707   42.565  1.00 97.41  ? 187  ARG E NE    1 
ATOM   9567  C  CZ    . ARG I 4 187 ? 14.690 5.806   41.391  1.00 98.44  ? 187  ARG E CZ    1 
ATOM   9568  N  NH1   . ARG I 4 187 ? 13.363 5.908   41.350  1.00 98.61  ? 187  ARG E NH1   1 
ATOM   9569  N  NH2   . ARG I 4 187 ? 15.396 5.809   40.257  1.00 98.68  ? 187  ARG E NH2   1 
ATOM   9570  N  N     . THR I 4 188 ? 14.606 7.631   48.975  1.00 96.21  ? 188  THR E N     1 
ATOM   9571  C  CA    . THR I 4 188 ? 13.854 7.882   50.199  1.00 97.88  ? 188  THR E CA    1 
ATOM   9572  C  C     . THR I 4 188 ? 12.427 7.418   49.979  1.00 99.06  ? 188  THR E C     1 
ATOM   9573  O  O     . THR I 4 188 ? 11.839 7.682   48.927  1.00 98.92  ? 188  THR E O     1 
ATOM   9574  C  CB    . THR I 4 188 ? 13.831 9.385   50.541  1.00 98.21  ? 188  THR E CB    1 
ATOM   9575  O  OG1   . THR I 4 188 ? 15.116 9.775   51.032  1.00 98.67  ? 188  THR E OG1   1 
ATOM   9576  C  CG2   . THR I 4 188 ? 12.767 9.698   51.592  1.00 98.49  ? 188  THR E CG2   1 
ATOM   9577  N  N     . ASP I 4 189 ? 11.876 6.728   50.975  1.00 100.50 ? 189  ASP E N     1 
ATOM   9578  C  CA    . ASP I 4 189 ? 10.509 6.214   50.904  1.00 101.53 ? 189  ASP E CA    1 
ATOM   9579  C  C     . ASP I 4 189 ? 9.481  7.301   50.576  1.00 100.93 ? 189  ASP E C     1 
ATOM   9580  O  O     . ASP I 4 189 ? 8.287  7.013   50.399  1.00 101.48 ? 189  ASP E O     1 
ATOM   9581  C  CB    . ASP I 4 189 ? 10.134 5.487   52.212  1.00 103.15 ? 189  ASP E CB    1 
ATOM   9582  C  CG    . ASP I 4 189 ? 10.891 6.016   53.441  1.00 104.66 ? 189  ASP E CG    1 
ATOM   9583  O  OD1   . ASP I 4 189 ? 12.143 5.894   53.487  1.00 104.34 ? 189  ASP E OD1   1 
ATOM   9584  O  OD2   . ASP I 4 189 ? 10.223 6.542   54.366  1.00 105.67 ? 189  ASP E OD2   1 
ATOM   9585  N  N     . GLY I 4 190 ? 9.949  8.546   50.503  1.00 99.41  ? 190  GLY E N     1 
ATOM   9586  C  CA    . GLY I 4 190 ? 9.072  9.641   50.151  1.00 97.30  ? 190  GLY E CA    1 
ATOM   9587  C  C     . GLY I 4 190 ? 8.920  9.549   48.645  1.00 95.88  ? 190  GLY E C     1 
ATOM   9588  O  O     . GLY I 4 190 ? 7.907  9.959   48.079  1.00 95.57  ? 190  GLY E O     1 
ATOM   9589  N  N     . GLY I 4 191 ? 9.945  8.987   48.002  1.00 94.40  ? 191  GLY E N     1 
ATOM   9590  C  CA    . GLY I 4 191 ? 9.944  8.823   46.556  1.00 92.37  ? 191  GLY E CA    1 
ATOM   9591  C  C     . GLY I 4 191 ? 10.783 9.867   45.838  1.00 90.53  ? 191  GLY E C     1 
ATOM   9592  O  O     . GLY I 4 191 ? 10.480 10.250  44.703  1.00 91.12  ? 191  GLY E O     1 
ATOM   9593  N  N     . ARG I 4 192 ? 11.842 10.321  46.508  1.00 88.68  ? 192  ARG E N     1 
ATOM   9594  C  CA    . ARG I 4 192 ? 12.757 11.338  45.987  1.00 85.60  ? 192  ARG E CA    1 
ATOM   9595  C  C     . ARG I 4 192 ? 14.204 10.862  46.106  1.00 84.27  ? 192  ARG E C     1 
ATOM   9596  O  O     . ARG I 4 192 ? 14.602 10.321  47.137  1.00 84.54  ? 192  ARG E O     1 
ATOM   9597  C  CB    . ARG I 4 192 ? 12.566 12.639  46.774  1.00 84.35  ? 192  ARG E CB    1 
ATOM   9598  C  CG    . ARG I 4 192 ? 12.227 12.411  48.243  1.00 83.36  ? 192  ARG E CG    1 
ATOM   9599  C  CD    . ARG I 4 192 ? 12.055 13.714  49.003  1.00 83.16  ? 192  ARG E CD    1 
ATOM   9600  N  NE    . ARG I 4 192 ? 10.881 14.488  48.602  1.00 82.21  ? 192  ARG E NE    1 
ATOM   9601  C  CZ    . ARG I 4 192 ? 9.686  14.385  49.173  1.00 81.61  ? 192  ARG E CZ    1 
ATOM   9602  N  NH1   . ARG I 4 192 ? 9.495  13.538  50.175  1.00 81.26  ? 192  ARG E NH1   1 
ATOM   9603  N  NH2   . ARG I 4 192 ? 8.684  15.140  48.750  1.00 81.25  ? 192  ARG E NH2   1 
ATOM   9604  N  N     . MET I 4 193 ? 14.993 11.047  45.054  1.00 82.18  ? 193  MET E N     1 
ATOM   9605  C  CA    . MET I 4 193 ? 16.381 10.619  45.119  1.00 79.88  ? 193  MET E CA    1 
ATOM   9606  C  C     . MET I 4 193 ? 17.116 11.348  46.226  1.00 78.22  ? 193  MET E C     1 
ATOM   9607  O  O     . MET I 4 193 ? 16.645 12.344  46.774  1.00 78.06  ? 193  MET E O     1 
ATOM   9608  C  CB    . MET I 4 193 ? 17.109 10.874  43.809  1.00 80.60  ? 193  MET E CB    1 
ATOM   9609  C  CG    . MET I 4 193 ? 16.515 10.178  42.628  1.00 81.57  ? 193  MET E CG    1 
ATOM   9610  S  SD    . MET I 4 193 ? 17.669 10.159  41.260  1.00 83.19  ? 193  MET E SD    1 
ATOM   9611  C  CE    . MET I 4 193 ? 17.865 8.373   41.009  1.00 82.94  ? 193  MET E CE    1 
ATOM   9612  N  N     . LEU I 4 194 ? 18.301 10.859  46.527  1.00 75.88  ? 194  LEU E N     1 
ATOM   9613  C  CA    . LEU I 4 194 ? 19.086 11.435  47.578  1.00 74.44  ? 194  LEU E CA    1 
ATOM   9614  C  C     . LEU I 4 194 ? 20.540 11.083  47.280  1.00 74.51  ? 194  LEU E C     1 
ATOM   9615  O  O     . LEU I 4 194 ? 21.039 10.019  47.653  1.00 74.81  ? 194  LEU E O     1 
ATOM   9616  C  CB    . LEU I 4 194 ? 18.610 10.840  48.903  1.00 73.70  ? 194  LEU E CB    1 
ATOM   9617  C  CG    . LEU I 4 194 ? 19.049 11.407  50.254  1.00 74.00  ? 194  LEU E CG    1 
ATOM   9618  C  CD1   . LEU I 4 194 ? 17.806 11.760  51.061  1.00 73.49  ? 194  LEU E CD1   1 
ATOM   9619  C  CD2   . LEU I 4 194 ? 19.906 10.391  51.013  1.00 73.42  ? 194  LEU E CD2   1 
ATOM   9620  N  N     . ILE I 4 195 ? 21.216 11.979  46.577  1.00 74.41  ? 195  ILE E N     1 
ATOM   9621  C  CA    . ILE I 4 195 ? 22.614 11.783  46.223  1.00 74.24  ? 195  ILE E CA    1 
ATOM   9622  C  C     . ILE I 4 195 ? 23.536 11.778  47.449  1.00 75.85  ? 195  ILE E C     1 
ATOM   9623  O  O     . ILE I 4 195 ? 23.610 12.755  48.194  1.00 75.25  ? 195  ILE E O     1 
ATOM   9624  C  CB    . ILE I 4 195 ? 23.068 12.894  45.257  1.00 72.56  ? 195  ILE E CB    1 
ATOM   9625  C  CG1   . ILE I 4 195 ? 22.122 12.925  44.057  1.00 72.10  ? 195  ILE E CG1   1 
ATOM   9626  C  CG2   . ILE I 4 195 ? 24.516 12.684  44.848  1.00 70.12  ? 195  ILE E CG2   1 
ATOM   9627  C  CD1   . ILE I 4 195 ? 22.248 14.151  43.177  1.00 72.91  ? 195  ILE E CD1   1 
ATOM   9628  N  N     . HIS I 4 196 ? 24.211 10.663  47.684  1.00 78.05  ? 196  HIS E N     1 
ATOM   9629  C  CA    . HIS I 4 196 ? 25.150 10.609  48.784  1.00 81.56  ? 196  HIS E CA    1 
ATOM   9630  C  C     . HIS I 4 196 ? 26.278 11.451  48.222  1.00 84.02  ? 196  HIS E C     1 
ATOM   9631  O  O     . HIS I 4 196 ? 26.687 11.272  47.079  1.00 83.73  ? 196  HIS E O     1 
ATOM   9632  C  CB    . HIS I 4 196 ? 25.602 9.176   49.048  1.00 82.16  ? 196  HIS E CB    1 
ATOM   9633  C  CG    . HIS I 4 196 ? 26.625 9.055   50.134  1.00 83.55  ? 196  HIS E CG    1 
ATOM   9634  N  ND1   . HIS I 4 196 ? 27.981 9.009   49.879  1.00 84.01  ? 196  HIS E ND1   1 
ATOM   9635  C  CD2   . HIS I 4 196 ? 26.493 8.992   51.482  1.00 83.72  ? 196  HIS E CD2   1 
ATOM   9636  C  CE1   . HIS I 4 196 ? 28.640 8.924   51.022  1.00 84.29  ? 196  HIS E CE1   1 
ATOM   9637  N  NE2   . HIS I 4 196 ? 27.760 8.912   52.011  1.00 84.31  ? 196  HIS E NE2   1 
ATOM   9638  N  N     . ILE I 4 197 ? 26.767 12.384  49.021  1.00 88.21  ? 197  ILE E N     1 
ATOM   9639  C  CA    . ILE I 4 197 ? 27.806 13.312  48.588  1.00 92.23  ? 197  ILE E CA    1 
ATOM   9640  C  C     . ILE I 4 197 ? 29.224 12.920  49.024  1.00 94.80  ? 197  ILE E C     1 
ATOM   9641  O  O     . ILE I 4 197 ? 30.026 13.776  49.387  1.00 94.46  ? 197  ILE E O     1 
ATOM   9642  C  CB    . ILE I 4 197 ? 27.423 14.746  49.096  1.00 92.53  ? 197  ILE E CB    1 
ATOM   9643  C  CG1   . ILE I 4 197 ? 28.334 15.827  48.522  1.00 92.62  ? 197  ILE E CG1   1 
ATOM   9644  C  CG2   . ILE I 4 197 ? 27.491 14.788  50.593  1.00 94.25  ? 197  ILE E CG2   1 
ATOM   9645  C  CD1   . ILE I 4 197 ? 27.952 17.240  49.009  1.00 91.63  ? 197  ILE E CD1   1 
ATOM   9646  N  N     . GLY I 4 198 ? 29.530 11.626  48.968  1.00 98.50  ? 198  GLY E N     1 
ATOM   9647  C  CA    . GLY I 4 198 ? 30.849 11.153  49.353  1.00 103.86 ? 198  GLY E CA    1 
ATOM   9648  C  C     . GLY I 4 198 ? 31.973 12.021  48.819  1.00 108.17 ? 198  GLY E C     1 
ATOM   9649  O  O     . GLY I 4 198 ? 31.763 12.861  47.949  1.00 108.42 ? 198  GLY E O     1 
ATOM   9650  N  N     . ARG I 4 199 ? 33.175 11.818  49.340  1.00 113.21 ? 199  ARG E N     1 
ATOM   9651  C  CA    . ARG I 4 199 ? 34.340 12.594  48.930  1.00 118.99 ? 199  ARG E CA    1 
ATOM   9652  C  C     . ARG I 4 199 ? 34.084 14.105  48.858  1.00 121.68 ? 199  ARG E C     1 
ATOM   9653  O  O     . ARG I 4 199 ? 34.096 14.700  47.781  1.00 121.57 ? 199  ARG E O     1 
ATOM   9654  C  CB    . ARG I 4 199 ? 34.862 12.086  47.586  1.00 121.81 ? 199  ARG E CB    1 
ATOM   9655  C  CG    . ARG I 4 199 ? 35.094 10.571  47.541  1.00 125.38 ? 199  ARG E CG    1 
ATOM   9656  C  CD    . ARG I 4 199 ? 36.279 10.183  46.635  1.00 128.60 ? 199  ARG E CD    1 
ATOM   9657  N  NE    . ARG I 4 199 ? 36.201 10.751  45.286  1.00 131.22 ? 199  ARG E NE    1 
ATOM   9658  C  CZ    . ARG I 4 199 ? 37.173 10.669  44.377  1.00 132.51 ? 199  ARG E CZ    1 
ATOM   9659  N  NH1   . ARG I 4 199 ? 38.311 10.039  44.661  1.00 132.78 ? 199  ARG E NH1   1 
ATOM   9660  N  NH2   . ARG I 4 199 ? 37.010 11.225  43.180  1.00 133.22 ? 199  ARG E NH2   1 
ATOM   9661  N  N     . THR I 4 200 ? 33.860 14.713  50.023  1.00 125.46 ? 200  THR E N     1 
ATOM   9662  C  CA    . THR I 4 200 ? 33.614 16.149  50.140  1.00 128.76 ? 200  THR E CA    1 
ATOM   9663  C  C     . THR I 4 200 ? 34.882 16.837  49.694  1.00 130.88 ? 200  THR E C     1 
ATOM   9664  O  O     . THR I 4 200 ? 35.715 16.231  49.020  1.00 131.66 ? 200  THR E O     1 
ATOM   9665  C  CB    . THR I 4 200 ? 33.377 16.589  51.601  1.00 128.64 ? 200  THR E CB    1 
ATOM   9666  O  OG1   . THR I 4 200 ? 32.544 15.639  52.271  1.00 128.77 ? 200  THR E OG1   1 
ATOM   9667  C  CG2   . THR I 4 200 ? 32.705 17.954  51.640  1.00 129.36 ? 200  THR E CG2   1 
ATOM   9668  N  N     . LYS I 4 201 ? 35.031 18.100  50.087  1.00 133.05 ? 201  LYS E N     1 
ATOM   9669  C  CA    . LYS I 4 201 ? 36.220 18.874  49.754  1.00 135.19 ? 201  LYS E CA    1 
ATOM   9670  C  C     . LYS I 4 201 ? 36.552 19.818  50.903  1.00 135.26 ? 201  LYS E C     1 
ATOM   9671  O  O     . LYS I 4 201 ? 36.854 20.991  50.695  1.00 135.15 ? 201  LYS E O     1 
ATOM   9672  C  CB    . LYS I 4 201 ? 36.015 19.656  48.445  1.00 137.26 ? 201  LYS E CB    1 
ATOM   9673  C  CG    . LYS I 4 201 ? 37.097 19.396  47.365  1.00 139.13 ? 201  LYS E CG    1 
ATOM   9674  C  CD    . LYS I 4 201 ? 37.196 17.905  46.980  1.00 140.60 ? 201  LYS E CD    1 
ATOM   9675  C  CE    . LYS I 4 201 ? 38.290 17.618  45.944  1.00 140.59 ? 201  LYS E CE    1 
ATOM   9676  N  NZ    . LYS I 4 201 ? 38.417 16.160  45.640  1.00 139.46 ? 201  LYS E NZ    1 
ATOM   9677  N  N     . THR I 4 202 ? 36.488 19.273  52.117  1.00 135.57 ? 202  THR E N     1 
ATOM   9678  C  CA    . THR I 4 202 ? 36.780 19.981  53.363  1.00 135.34 ? 202  THR E CA    1 
ATOM   9679  C  C     . THR I 4 202 ? 36.599 18.966  54.484  1.00 134.42 ? 202  THR E C     1 
ATOM   9680  O  O     . THR I 4 202 ? 35.650 18.194  54.460  1.00 134.66 ? 202  THR E O     1 
ATOM   9681  C  CB    . THR I 4 202 ? 35.792 21.117  53.624  1.00 135.92 ? 202  THR E CB    1 
ATOM   9682  O  OG1   . THR I 4 202 ? 35.913 22.105  52.599  1.00 137.02 ? 202  THR E OG1   1 
ATOM   9683  C  CG2   . THR I 4 202 ? 36.078 21.758  54.969  1.00 137.18 ? 202  THR E CG2   1 
ATOM   9684  N  N     . LEU I 4 203 ? 37.491 18.954  55.466  1.00 133.43 ? 203  LEU E N     1 
ATOM   9685  C  CA    . LEU I 4 203 ? 37.348 17.996  56.556  1.00 132.09 ? 203  LEU E CA    1 
ATOM   9686  C  C     . LEU I 4 203 ? 35.981 18.161  57.214  1.00 130.79 ? 203  LEU E C     1 
ATOM   9687  O  O     . LEU I 4 203 ? 35.233 17.197  57.364  1.00 130.73 ? 203  LEU E O     1 
ATOM   9688  C  CB    . LEU I 4 203 ? 38.457 18.191  57.587  1.00 132.90 ? 203  LEU E CB    1 
ATOM   9689  C  CG    . LEU I 4 203 ? 38.515 17.131  58.687  1.00 133.31 ? 203  LEU E CG    1 
ATOM   9690  C  CD1   . LEU I 4 203 ? 38.521 15.748  58.076  1.00 133.65 ? 203  LEU E CD1   1 
ATOM   9691  C  CD2   . LEU I 4 203 ? 39.756 17.340  59.530  1.00 134.33 ? 203  LEU E CD2   1 
ATOM   9692  N  N     . VAL I 4 204 ? 35.663 19.389  57.605  1.00 128.95 ? 204  VAL E N     1 
ATOM   9693  C  CA    . VAL I 4 204 ? 34.382 19.697  58.221  1.00 126.75 ? 204  VAL E CA    1 
ATOM   9694  C  C     . VAL I 4 204 ? 33.512 20.252  57.111  1.00 125.24 ? 204  VAL E C     1 
ATOM   9695  O  O     . VAL I 4 204 ? 33.647 21.411  56.732  1.00 125.09 ? 204  VAL E O     1 
ATOM   9696  C  CB    . VAL I 4 204 ? 34.538 20.753  59.320  1.00 126.84 ? 204  VAL E CB    1 
ATOM   9697  C  CG1   . VAL I 4 204 ? 33.186 21.150  59.855  1.00 127.31 ? 204  VAL E CG1   1 
ATOM   9698  C  CG2   . VAL I 4 204 ? 35.395 20.205  60.438  1.00 127.34 ? 204  VAL E CG2   1 
ATOM   9699  N  N     . SER I 4 205 ? 32.625 19.415  56.588  1.00 123.69 ? 205  SER E N     1 
ATOM   9700  C  CA    . SER I 4 205 ? 31.750 19.801  55.484  1.00 122.35 ? 205  SER E CA    1 
ATOM   9701  C  C     . SER I 4 205 ? 30.560 20.634  55.912  1.00 120.06 ? 205  SER E C     1 
ATOM   9702  O  O     . SER I 4 205 ? 29.558 20.084  56.336  1.00 119.65 ? 205  SER E O     1 
ATOM   9703  C  CB    . SER I 4 205 ? 31.246 18.547  54.762  1.00 123.57 ? 205  SER E CB    1 
ATOM   9704  O  OG    . SER I 4 205 ? 30.470 18.880  53.625  1.00 125.16 ? 205  SER E OG    1 
ATOM   9705  N  N     . THR I 4 206 ? 30.657 21.955  55.783  1.00 117.78 ? 206  THR E N     1 
ATOM   9706  C  CA    . THR I 4 206 ? 29.556 22.828  56.175  1.00 115.40 ? 206  THR E CA    1 
ATOM   9707  C  C     . THR I 4 206 ? 28.298 22.551  55.373  1.00 113.69 ? 206  THR E C     1 
ATOM   9708  O  O     . THR I 4 206 ? 27.207 22.961  55.754  1.00 113.51 ? 206  THR E O     1 
ATOM   9709  C  CB    . THR I 4 206 ? 29.927 24.324  56.062  1.00 115.77 ? 206  THR E CB    1 
ATOM   9710  O  OG1   . THR I 4 206 ? 28.794 25.062  55.592  1.00 115.69 ? 206  THR E OG1   1 
ATOM   9711  C  CG2   . THR I 4 206 ? 31.105 24.529  55.137  1.00 117.34 ? 206  THR E CG2   1 
ATOM   9712  N  N     . ALA I 4 207 ? 28.457 21.863  54.250  1.00 112.15 ? 207  ALA E N     1 
ATOM   9713  C  CA    . ALA I 4 207 ? 27.320 21.481  53.423  1.00 110.00 ? 207  ALA E CA    1 
ATOM   9714  C  C     . ALA I 4 207 ? 27.059 20.084  53.933  1.00 108.22 ? 207  ALA E C     1 
ATOM   9715  O  O     . ALA I 4 207 ? 27.893 19.526  54.640  1.00 109.29 ? 207  ALA E O     1 
ATOM   9716  C  CB    . ALA I 4 207 ? 27.709 21.437  51.967  1.00 111.01 ? 207  ALA E CB    1 
ATOM   9717  N  N     . GLY I 4 208 ? 25.929 19.496  53.580  1.00 105.23 ? 208  GLY E N     1 
ATOM   9718  C  CA    . GLY I 4 208 ? 25.654 18.162  54.086  1.00 101.03 ? 208  GLY E CA    1 
ATOM   9719  C  C     . GLY I 4 208 ? 26.635 17.026  53.793  1.00 97.62  ? 208  GLY E C     1 
ATOM   9720  O  O     . GLY I 4 208 ? 27.847 17.204  53.627  1.00 96.51  ? 208  GLY E O     1 
ATOM   9721  N  N     . VAL I 4 209 ? 26.054 15.831  53.767  1.00 94.36  ? 209  VAL E N     1 
ATOM   9722  C  CA    . VAL I 4 209 ? 26.716 14.570  53.494  1.00 90.55  ? 209  VAL E CA    1 
ATOM   9723  C  C     . VAL I 4 209 ? 25.619 13.826  52.742  1.00 87.74  ? 209  VAL E C     1 
ATOM   9724  O  O     . VAL I 4 209 ? 25.688 12.625  52.543  1.00 87.32  ? 209  VAL E O     1 
ATOM   9725  C  CB    . VAL I 4 209 ? 27.050 13.821  54.801  1.00 91.40  ? 209  VAL E CB    1 
ATOM   9726  C  CG1   . VAL I 4 209 ? 27.762 12.519  54.498  1.00 92.22  ? 209  VAL E CG1   1 
ATOM   9727  C  CG2   . VAL I 4 209 ? 27.917 14.689  55.691  1.00 91.65  ? 209  VAL E CG2   1 
ATOM   9728  N  N     . GLU I 4 210 ? 24.608 14.587  52.323  1.00 85.22  ? 210  GLU E N     1 
ATOM   9729  C  CA    . GLU I 4 210 ? 23.444 14.078  51.603  1.00 82.65  ? 210  GLU E CA    1 
ATOM   9730  C  C     . GLU I 4 210 ? 22.519 15.165  51.049  1.00 79.34  ? 210  GLU E C     1 
ATOM   9731  O  O     . GLU I 4 210 ? 21.798 15.807  51.798  1.00 78.79  ? 210  GLU E O     1 
ATOM   9732  C  CB    . GLU I 4 210 ? 22.601 13.195  52.517  1.00 84.87  ? 210  GLU E CB    1 
ATOM   9733  C  CG    . GLU I 4 210 ? 23.076 11.774  52.638  1.00 89.93  ? 210  GLU E CG    1 
ATOM   9734  C  CD    . GLU I 4 210 ? 22.217 10.952  53.586  1.00 93.40  ? 210  GLU E CD    1 
ATOM   9735  O  OE1   . GLU I 4 210 ? 22.396 9.710   53.617  1.00 96.12  ? 210  GLU E OE1   1 
ATOM   9736  O  OE2   . GLU I 4 210 ? 21.373 11.546  54.302  1.00 94.46  ? 210  GLU E OE2   1 
ATOM   9737  N  N     . LYS I 4 211 ? 22.522 15.367  49.740  1.00 75.85  ? 211  LYS E N     1 
ATOM   9738  C  CA    . LYS I 4 211 ? 21.625 16.350  49.138  1.00 72.03  ? 211  LYS E CA    1 
ATOM   9739  C  C     . LYS I 4 211 ? 20.449 15.527  48.620  1.00 69.76  ? 211  LYS E C     1 
ATOM   9740  O  O     . LYS I 4 211 ? 20.633 14.368  48.284  1.00 68.86  ? 211  LYS E O     1 
ATOM   9741  C  CB    . LYS I 4 211 ? 22.328 17.070  47.991  1.00 71.86  ? 211  LYS E CB    1 
ATOM   9742  C  CG    . LYS I 4 211 ? 23.461 18.001  48.423  1.00 71.49  ? 211  LYS E CG    1 
ATOM   9743  C  CD    . LYS I 4 211 ? 22.929 19.352  48.914  1.00 70.53  ? 211  LYS E CD    1 
ATOM   9744  C  CE    . LYS I 4 211 ? 24.049 20.375  49.099  1.00 69.10  ? 211  LYS E CE    1 
ATOM   9745  N  NZ    . LYS I 4 211 ? 23.513 21.758  49.166  1.00 67.58  ? 211  LYS E NZ    1 
ATOM   9746  N  N     . ALA I 4 212 ? 19.250 16.100  48.555  1.00 67.45  ? 212  ALA E N     1 
ATOM   9747  C  CA    . ALA I 4 212 ? 18.094 15.329  48.098  1.00 66.77  ? 212  ALA E CA    1 
ATOM   9748  C  C     . ALA I 4 212 ? 17.235 15.986  47.030  1.00 66.60  ? 212  ALA E C     1 
ATOM   9749  O  O     . ALA I 4 212 ? 16.554 16.978  47.293  1.00 67.06  ? 212  ALA E O     1 
ATOM   9750  C  CB    . ALA I 4 212 ? 17.231 14.972  49.275  1.00 65.79  ? 212  ALA E CB    1 
ATOM   9751  N  N     . LEU I 4 213 ? 17.241 15.411  45.832  1.00 66.30  ? 213  LEU E N     1 
ATOM   9752  C  CA    . LEU I 4 213 ? 16.461 15.950  44.733  1.00 65.92  ? 213  LEU E CA    1 
ATOM   9753  C  C     . LEU I 4 213 ? 15.003 16.026  45.142  1.00 67.68  ? 213  LEU E C     1 
ATOM   9754  O  O     . LEU I 4 213 ? 14.547 15.212  45.928  1.00 68.14  ? 213  LEU E O     1 
ATOM   9755  C  CB    . LEU I 4 213 ? 16.611 15.065  43.497  1.00 63.84  ? 213  LEU E CB    1 
ATOM   9756  C  CG    . LEU I 4 213 ? 17.979 14.956  42.804  1.00 62.94  ? 213  LEU E CG    1 
ATOM   9757  C  CD1   . LEU I 4 213 ? 18.543 16.332  42.640  1.00 62.86  ? 213  LEU E CD1   1 
ATOM   9758  C  CD2   . LEU I 4 213 ? 18.953 14.111  43.591  1.00 62.37  ? 213  LEU E CD2   1 
ATOM   9759  N  N     . SER I 4 214 ? 14.276 17.008  44.617  1.00 69.91  ? 214  SER E N     1 
ATOM   9760  C  CA    . SER I 4 214 ? 12.852 17.176  44.926  1.00 72.54  ? 214  SER E CA    1 
ATOM   9761  C  C     . SER I 4 214 ? 12.071 15.999  44.361  1.00 74.60  ? 214  SER E C     1 
ATOM   9762  O  O     . SER I 4 214 ? 12.619 14.908  44.199  1.00 75.22  ? 214  SER E O     1 
ATOM   9763  C  CB    . SER I 4 214 ? 12.298 18.456  44.292  1.00 72.26  ? 214  SER E CB    1 
ATOM   9764  O  OG    . SER I 4 214 ? 11.833 18.230  42.968  1.00 71.77  ? 214  SER E OG    1 
ATOM   9765  N  N     . LEU I 4 215 ? 10.790 16.213  44.061  1.00 76.80  ? 215  LEU E N     1 
ATOM   9766  C  CA    . LEU I 4 215 ? 9.979  15.142  43.482  1.00 78.73  ? 215  LEU E CA    1 
ATOM   9767  C  C     . LEU I 4 215 ? 10.112 15.146  41.952  1.00 79.69  ? 215  LEU E C     1 
ATOM   9768  O  O     . LEU I 4 215 ? 10.429 14.112  41.342  1.00 79.89  ? 215  LEU E O     1 
ATOM   9769  C  CB    . LEU I 4 215 ? 8.507  15.278  43.905  1.00 79.11  ? 215  LEU E CB    1 
ATOM   9770  C  CG    . LEU I 4 215 ? 8.136  14.417  45.126  1.00 79.05  ? 215  LEU E CG    1 
ATOM   9771  C  CD1   . LEU I 4 215 ? 6.657  14.596  45.480  1.00 79.37  ? 215  LEU E CD1   1 
ATOM   9772  C  CD2   . LEU I 4 215 ? 8.440  12.953  44.823  1.00 78.18  ? 215  LEU E CD2   1 
ATOM   9773  N  N     . GLY I 4 216 ? 9.887  16.312  41.344  1.00 79.42  ? 216  GLY E N     1 
ATOM   9774  C  CA    . GLY I 4 216 ? 10.013 16.430  39.902  1.00 78.94  ? 216  GLY E CA    1 
ATOM   9775  C  C     . GLY I 4 216 ? 11.441 16.168  39.430  1.00 78.40  ? 216  GLY E C     1 
ATOM   9776  O  O     . GLY I 4 216 ? 11.667 15.334  38.541  1.00 78.12  ? 216  GLY E O     1 
ATOM   9777  N  N     . VAL I 4 217 ? 12.400 16.882  40.032  1.00 77.70  ? 217  VAL E N     1 
ATOM   9778  C  CA    . VAL I 4 217 ? 13.825 16.757  39.708  1.00 75.91  ? 217  VAL E CA    1 
ATOM   9779  C  C     . VAL I 4 217 ? 14.309 15.305  39.767  1.00 76.47  ? 217  VAL E C     1 
ATOM   9780  O  O     . VAL I 4 217 ? 15.244 14.934  39.056  1.00 76.25  ? 217  VAL E O     1 
ATOM   9781  C  CB    . VAL I 4 217 ? 14.687 17.612  40.656  1.00 74.12  ? 217  VAL E CB    1 
ATOM   9782  C  CG1   . VAL I 4 217 ? 16.134 17.500  40.283  1.00 73.30  ? 217  VAL E CG1   1 
ATOM   9783  C  CG2   . VAL I 4 217 ? 14.261 19.041  40.579  1.00 73.51  ? 217  VAL E CG2   1 
ATOM   9784  N  N     . THR I 4 218 ? 13.678 14.486  40.613  1.00 77.29  ? 218  THR E N     1 
ATOM   9785  C  CA    . THR I 4 218 ? 14.040 13.068  40.723  1.00 77.41  ? 218  THR E CA    1 
ATOM   9786  C  C     . THR I 4 218 ? 13.609 12.399  39.429  1.00 77.89  ? 218  THR E C     1 
ATOM   9787  O  O     . THR I 4 218 ? 14.430 11.818  38.709  1.00 77.13  ? 218  THR E O     1 
ATOM   9788  C  CB    . THR I 4 218 ? 13.294 12.354  41.874  1.00 76.70  ? 218  THR E CB    1 
ATOM   9789  O  OG1   . THR I 4 218 ? 13.710 12.885  43.131  1.00 76.92  ? 218  THR E OG1   1 
ATOM   9790  C  CG2   . THR I 4 218 ? 13.597 10.878  41.857  1.00 76.72  ? 218  THR E CG2   1 
ATOM   9791  N  N     . LYS I 4 219 ? 12.307 12.505  39.152  1.00 78.47  ? 219  LYS E N     1 
ATOM   9792  C  CA    . LYS I 4 219 ? 11.690 11.930  37.960  1.00 79.83  ? 219  LYS E CA    1 
ATOM   9793  C  C     . LYS I 4 219 ? 12.510 12.310  36.738  1.00 79.72  ? 219  LYS E C     1 
ATOM   9794  O  O     . LYS I 4 219 ? 12.865 11.447  35.925  1.00 79.67  ? 219  LYS E O     1 
ATOM   9795  C  CB    . LYS I 4 219 ? 10.250 12.442  37.809  1.00 81.17  ? 219  LYS E CB    1 
ATOM   9796  C  CG    . LYS I 4 219 ? 9.378  11.626  36.848  1.00 83.78  ? 219  LYS E CG    1 
ATOM   9797  C  CD    . LYS I 4 219 ? 7.924  12.145  36.823  1.00 86.37  ? 219  LYS E CD    1 
ATOM   9798  C  CE    . LYS I 4 219 ? 7.041  11.510  35.700  1.00 87.99  ? 219  LYS E CE    1 
ATOM   9799  N  NZ    . LYS I 4 219 ? 6.518  10.111  35.957  1.00 88.08  ? 219  LYS E NZ    1 
ATOM   9800  N  N     . LEU I 4 220 ? 12.815 13.603  36.630  1.00 78.99  ? 220  LEU E N     1 
ATOM   9801  C  CA    . LEU I 4 220 ? 13.605 14.147  35.526  1.00 77.89  ? 220  LEU E CA    1 
ATOM   9802  C  C     . LEU I 4 220 ? 15.007 13.553  35.450  1.00 78.06  ? 220  LEU E C     1 
ATOM   9803  O  O     . LEU I 4 220 ? 15.601 13.498  34.374  1.00 77.90  ? 220  LEU E O     1 
ATOM   9804  C  CB    . LEU I 4 220 ? 13.714 15.661  35.662  1.00 76.66  ? 220  LEU E CB    1 
ATOM   9805  C  CG    . LEU I 4 220 ? 13.145 16.446  34.490  1.00 76.33  ? 220  LEU E CG    1 
ATOM   9806  C  CD1   . LEU I 4 220 ? 13.347 17.925  34.750  1.00 75.49  ? 220  LEU E CD1   1 
ATOM   9807  C  CD2   . LEU I 4 220 ? 13.826 16.006  33.186  1.00 76.42  ? 220  LEU E CD2   1 
ATOM   9808  N  N     . VAL I 4 221 ? 15.537 13.125  36.595  1.00 78.46  ? 221  VAL E N     1 
ATOM   9809  C  CA    . VAL I 4 221 ? 16.861 12.528  36.643  1.00 78.86  ? 221  VAL E CA    1 
ATOM   9810  C  C     . VAL I 4 221 ? 16.785 11.054  36.295  1.00 80.48  ? 221  VAL E C     1 
ATOM   9811  O  O     . VAL I 4 221 ? 17.733 10.485  35.758  1.00 80.93  ? 221  VAL E O     1 
ATOM   9812  C  CB    . VAL I 4 221 ? 17.487 12.681  38.024  1.00 77.34  ? 221  VAL E CB    1 
ATOM   9813  C  CG1   . VAL I 4 221 ? 18.753 11.859  38.127  1.00 76.32  ? 221  VAL E CG1   1 
ATOM   9814  C  CG2   . VAL I 4 221 ? 17.825 14.118  38.247  1.00 77.92  ? 221  VAL E CG2   1 
ATOM   9815  N  N     . GLU I 4 222 ? 15.653 10.431  36.600  1.00 82.65  ? 222  GLU E N     1 
ATOM   9816  C  CA    . GLU I 4 222 ? 15.472 9.012   36.291  1.00 84.09  ? 222  GLU E CA    1 
ATOM   9817  C  C     . GLU I 4 222 ? 15.484 8.810   34.772  1.00 83.50  ? 222  GLU E C     1 
ATOM   9818  O  O     . GLU I 4 222 ? 16.191 7.933   34.253  1.00 83.28  ? 222  GLU E O     1 
ATOM   9819  C  CB    . GLU I 4 222 ? 14.146 8.488   36.888  1.00 86.35  ? 222  GLU E CB    1 
ATOM   9820  C  CG    . GLU I 4 222 ? 14.283 7.743   38.244  1.00 89.01  ? 222  GLU E CG    1 
ATOM   9821  C  CD    . GLU I 4 222 ? 12.960 7.118   38.737  1.00 90.76  ? 222  GLU E CD    1 
ATOM   9822  O  OE1   . GLU I 4 222 ? 12.053 7.867   39.189  1.00 90.82  ? 222  GLU E OE1   1 
ATOM   9823  O  OE2   . GLU I 4 222 ? 12.831 5.869   38.664  1.00 91.57  ? 222  GLU E OE2   1 
ATOM   9824  N  N     . ARG I 4 223 ? 14.708 9.635   34.068  1.00 82.29  ? 223  ARG E N     1 
ATOM   9825  C  CA    . ARG I 4 223 ? 14.627 9.560   32.615  1.00 81.45  ? 223  ARG E CA    1 
ATOM   9826  C  C     . ARG I 4 223 ? 16.036 9.413   32.054  1.00 79.86  ? 223  ARG E C     1 
ATOM   9827  O  O     . ARG I 4 223 ? 16.359 8.399   31.450  1.00 79.12  ? 223  ARG E O     1 
ATOM   9828  C  CB    . ARG I 4 223 ? 13.942 10.816  32.061  1.00 82.98  ? 223  ARG E CB    1 
ATOM   9829  C  CG    . ARG I 4 223 ? 13.450 10.719  30.619  1.00 85.34  ? 223  ARG E CG    1 
ATOM   9830  C  CD    . ARG I 4 223 ? 12.435 11.838  30.300  1.00 88.36  ? 223  ARG E CD    1 
ATOM   9831  N  NE    . ARG I 4 223 ? 12.171 11.999  28.862  1.00 91.52  ? 223  ARG E NE    1 
ATOM   9832  C  CZ    . ARG I 4 223 ? 11.497 11.134  28.099  1.00 92.64  ? 223  ARG E CZ    1 
ATOM   9833  N  NH1   . ARG I 4 223 ? 10.992 10.017  28.624  1.00 93.32  ? 223  ARG E NH1   1 
ATOM   9834  N  NH2   . ARG I 4 223 ? 11.339 11.379  26.799  1.00 92.02  ? 223  ARG E NH2   1 
ATOM   9835  N  N     . TRP I 4 224 ? 16.885 10.404  32.284  1.00 78.18  ? 224  TRP E N     1 
ATOM   9836  C  CA    . TRP I 4 224 ? 18.248 10.333  31.787  1.00 77.11  ? 224  TRP E CA    1 
ATOM   9837  C  C     . TRP I 4 224 ? 19.025 9.090   32.210  1.00 77.85  ? 224  TRP E C     1 
ATOM   9838  O  O     . TRP I 4 224 ? 19.940 8.687   31.503  1.00 78.24  ? 224  TRP E O     1 
ATOM   9839  C  CB    . TRP I 4 224 ? 19.050 11.574  32.201  1.00 74.78  ? 224  TRP E CB    1 
ATOM   9840  C  CG    . TRP I 4 224 ? 20.542 11.346  32.190  1.00 71.35  ? 224  TRP E CG    1 
ATOM   9841  C  CD1   . TRP I 4 224 ? 21.341 11.086  33.271  1.00 70.63  ? 224  TRP E CD1   1 
ATOM   9842  C  CD2   . TRP I 4 224 ? 21.391 11.265  31.040  1.00 69.46  ? 224  TRP E CD2   1 
ATOM   9843  N  NE1   . TRP I 4 224 ? 22.632 10.845  32.865  1.00 69.54  ? 224  TRP E NE1   1 
ATOM   9844  C  CE2   . TRP I 4 224 ? 22.692 10.948  31.500  1.00 69.18  ? 224  TRP E CE2   1 
ATOM   9845  C  CE3   . TRP I 4 224 ? 21.181 11.422  29.667  1.00 67.67  ? 224  TRP E CE3   1 
ATOM   9846  C  CZ2   . TRP I 4 224 ? 23.777 10.788  30.630  1.00 67.70  ? 224  TRP E CZ2   1 
ATOM   9847  C  CZ3   . TRP I 4 224 ? 22.261 11.262  28.805  1.00 66.77  ? 224  TRP E CZ3   1 
ATOM   9848  C  CH2   . TRP I 4 224 ? 23.543 10.949  29.291  1.00 66.75  ? 224  TRP E CH2   1 
ATOM   9849  N  N     . ILE I 4 225 ? 18.687 8.476   33.343  1.00 78.67  ? 225  ILE E N     1 
ATOM   9850  C  CA    . ILE I 4 225 ? 19.446 7.298   33.783  1.00 79.34  ? 225  ILE E CA    1 
ATOM   9851  C  C     . ILE I 4 225 ? 19.195 6.034   32.976  1.00 79.85  ? 225  ILE E C     1 
ATOM   9852  O  O     . ILE I 4 225 ? 20.123 5.235   32.777  1.00 79.03  ? 225  ILE E O     1 
ATOM   9853  C  CB    . ILE I 4 225 ? 19.201 6.954   35.267  1.00 79.26  ? 225  ILE E CB    1 
ATOM   9854  C  CG1   . ILE I 4 225 ? 19.660 8.108   36.156  1.00 79.43  ? 225  ILE E CG1   1 
ATOM   9855  C  CG2   . ILE I 4 225 ? 19.972 5.686   35.632  1.00 78.26  ? 225  ILE E CG2   1 
ATOM   9856  C  CD1   . ILE I 4 225 ? 19.914 7.710   37.600  1.00 80.61  ? 225  ILE E CD1   1 
ATOM   9857  N  N     . SER I 4 226 ? 17.941 5.848   32.543  1.00 80.53  ? 226  SER E N     1 
ATOM   9858  C  CA    . SER I 4 226 ? 17.545 4.685   31.731  1.00 81.01  ? 226  SER E CA    1 
ATOM   9859  C  C     . SER I 4 226 ? 18.079 4.884   30.303  1.00 80.02  ? 226  SER E C     1 
ATOM   9860  O  O     . SER I 4 226 ? 18.861 4.076   29.804  1.00 80.42  ? 226  SER E O     1 
ATOM   9861  C  CB    . SER I 4 226 ? 16.008 4.524   31.714  1.00 81.69  ? 226  SER E CB    1 
ATOM   9862  O  OG    . SER I 4 226 ? 15.354 5.568   30.995  1.00 82.14  ? 226  SER E OG    1 
ATOM   9863  N  N     . VAL I 4 227 ? 17.654 5.978   29.672  1.00 78.34  ? 227  VAL E N     1 
ATOM   9864  C  CA    . VAL I 4 227 ? 18.073 6.369   28.324  1.00 76.62  ? 227  VAL E CA    1 
ATOM   9865  C  C     . VAL I 4 227 ? 19.577 6.224   28.083  1.00 76.47  ? 227  VAL E C     1 
ATOM   9866  O  O     . VAL I 4 227 ? 20.018 5.663   27.079  1.00 76.55  ? 227  VAL E O     1 
ATOM   9867  C  CB    . VAL I 4 227 ? 17.685 7.840   28.071  1.00 76.07  ? 227  VAL E CB    1 
ATOM   9868  C  CG1   . VAL I 4 227 ? 18.397 8.380   26.834  1.00 74.20  ? 227  VAL E CG1   1 
ATOM   9869  C  CG2   . VAL I 4 227 ? 16.160 7.950   27.953  1.00 75.48  ? 227  VAL E CG2   1 
ATOM   9870  N  N     . SER I 4 228 ? 20.353 6.750   29.015  1.00 76.49  ? 228  SER E N     1 
ATOM   9871  C  CA    . SER I 4 228 ? 21.801 6.717   28.938  1.00 76.69  ? 228  SER E CA    1 
ATOM   9872  C  C     . SER I 4 228 ? 22.351 5.388   29.404  1.00 76.14  ? 228  SER E C     1 
ATOM   9873  O  O     . SER I 4 228 ? 23.437 4.979   29.017  1.00 74.34  ? 228  SER E O     1 
ATOM   9874  C  CB    . SER I 4 228 ? 22.374 7.828   29.814  1.00 77.91  ? 228  SER E CB    1 
ATOM   9875  O  OG    . SER I 4 228 ? 22.020 7.628   31.179  1.00 80.34  ? 228  SER E OG    1 
ATOM   9876  N  N     . GLY I 4 229 ? 21.594 4.726   30.261  1.00 77.57  ? 229  GLY E N     1 
ATOM   9877  C  CA    . GLY I 4 229 ? 22.039 3.455   30.782  1.00 81.10  ? 229  GLY E CA    1 
ATOM   9878  C  C     . GLY I 4 229 ? 23.389 3.532   31.479  1.00 83.52  ? 229  GLY E C     1 
ATOM   9879  O  O     . GLY I 4 229 ? 24.279 2.715   31.219  1.00 84.42  ? 229  GLY E O     1 
ATOM   9880  N  N     . VAL I 4 230 ? 23.575 4.518   32.349  1.00 84.84  ? 230  VAL E N     1 
ATOM   9881  C  CA    . VAL I 4 230 ? 24.837 4.606   33.070  1.00 85.53  ? 230  VAL E CA    1 
ATOM   9882  C  C     . VAL I 4 230 ? 24.611 3.608   34.181  1.00 86.04  ? 230  VAL E C     1 
ATOM   9883  O  O     . VAL I 4 230 ? 25.548 3.082   34.781  1.00 85.34  ? 230  VAL E O     1 
ATOM   9884  C  CB    . VAL I 4 230 ? 25.046 5.985   33.695  1.00 85.33  ? 230  VAL E CB    1 
ATOM   9885  C  CG1   . VAL I 4 230 ? 26.473 6.108   34.190  1.00 86.18  ? 230  VAL E CG1   1 
ATOM   9886  C  CG2   . VAL I 4 230 ? 24.724 7.064   32.695  1.00 84.40  ? 230  VAL E CG2   1 
ATOM   9887  N  N     . ALA I 4 231 ? 23.321 3.363   34.406  1.00 87.44  ? 231  ALA E N     1 
ATOM   9888  C  CA    . ALA I 4 231 ? 22.798 2.461   35.419  1.00 89.39  ? 231  ALA E CA    1 
ATOM   9889  C  C     . ALA I 4 231 ? 23.611 1.185   35.638  1.00 91.60  ? 231  ALA E C     1 
ATOM   9890  O  O     . ALA I 4 231 ? 24.017 0.898   36.771  1.00 91.52  ? 231  ALA E O     1 
ATOM   9891  C  CB    . ALA I 4 231 ? 21.350 2.112   35.076  1.00 88.70  ? 231  ALA E CB    1 
ATOM   9892  N  N     . ASP I 4 232 ? 23.830 0.424   34.560  1.00 93.98  ? 232  ASP E N     1 
ATOM   9893  C  CA    . ASP I 4 232 ? 24.583 -0.837  34.602  1.00 95.23  ? 232  ASP E CA    1 
ATOM   9894  C  C     . ASP I 4 232 ? 25.619 -0.887  35.734  1.00 95.87  ? 232  ASP E C     1 
ATOM   9895  O  O     . ASP I 4 232 ? 25.347 -1.430  36.819  1.00 96.20  ? 232  ASP E O     1 
ATOM   9896  C  CB    . ASP I 4 232 ? 25.277 -1.084  33.250  1.00 96.75  ? 232  ASP E CB    1 
ATOM   9897  C  CG    . ASP I 4 232 ? 24.457 -1.974  32.312  1.00 98.31  ? 232  ASP E CG    1 
ATOM   9898  O  OD1   . ASP I 4 232 ? 24.338 -3.190  32.601  1.00 98.46  ? 232  ASP E OD1   1 
ATOM   9899  O  OD2   . ASP I 4 232 ? 23.937 -1.462  31.288  1.00 98.98  ? 232  ASP E OD2   1 
ATOM   9900  N  N     . ASP I 4 233 ? 26.802 -0.326  35.482  1.00 95.56  ? 233  ASP E N     1 
ATOM   9901  C  CA    . ASP I 4 233 ? 27.869 -0.304  36.484  1.00 94.78  ? 233  ASP E CA    1 
ATOM   9902  C  C     . ASP I 4 233 ? 27.657 0.850   37.476  1.00 94.23  ? 233  ASP E C     1 
ATOM   9903  O  O     . ASP I 4 233 ? 27.456 2.000   37.070  1.00 94.08  ? 233  ASP E O     1 
ATOM   9904  C  CB    . ASP I 4 233 ? 29.234 -0.144  35.802  1.00 94.89  ? 233  ASP E CB    1 
ATOM   9905  C  CG    . ASP I 4 233 ? 30.400 -0.280  36.777  1.00 94.81  ? 233  ASP E CG    1 
ATOM   9906  O  OD1   . ASP I 4 233 ? 30.248 0.127   37.949  1.00 94.08  ? 233  ASP E OD1   1 
ATOM   9907  O  OD2   . ASP I 4 233 ? 31.474 -0.781  36.368  1.00 95.02  ? 233  ASP E OD2   1 
ATOM   9908  N  N     . PRO I 4 234 ? 27.688 0.553   38.792  1.00 93.50  ? 234  PRO E N     1 
ATOM   9909  C  CA    . PRO I 4 234 ? 27.499 1.609   39.795  1.00 92.05  ? 234  PRO E CA    1 
ATOM   9910  C  C     . PRO I 4 234 ? 28.687 2.604   39.920  1.00 90.81  ? 234  PRO E C     1 
ATOM   9911  O  O     . PRO I 4 234 ? 28.495 3.758   40.318  1.00 90.82  ? 234  PRO E O     1 
ATOM   9912  C  CB    . PRO I 4 234 ? 27.227 0.814   41.079  1.00 92.18  ? 234  PRO E CB    1 
ATOM   9913  C  CG    . PRO I 4 234 ? 28.002 -0.455  40.865  1.00 92.34  ? 234  PRO E CG    1 
ATOM   9914  C  CD    . PRO I 4 234 ? 27.691 -0.781  39.427  1.00 92.99  ? 234  PRO E CD    1 
ATOM   9915  N  N     . ASN I 4 235 ? 29.899 2.168   39.570  1.00 88.54  ? 235  ASN E N     1 
ATOM   9916  C  CA    . ASN I 4 235 ? 31.075 3.041   39.644  1.00 85.89  ? 235  ASN E CA    1 
ATOM   9917  C  C     . ASN I 4 235 ? 31.015 4.157   38.585  1.00 84.09  ? 235  ASN E C     1 
ATOM   9918  O  O     . ASN I 4 235 ? 31.667 5.196   38.721  1.00 83.19  ? 235  ASN E O     1 
ATOM   9919  C  CB    . ASN I 4 235 ? 32.374 2.229   39.463  1.00 86.12  ? 235  ASN E CB    1 
ATOM   9920  C  CG    . ASN I 4 235 ? 32.606 1.206   40.579  1.00 86.05  ? 235  ASN E CG    1 
ATOM   9921  O  OD1   . ASN I 4 235 ? 33.700 0.646   40.707  1.00 85.16  ? 235  ASN E OD1   1 
ATOM   9922  N  ND2   . ASN I 4 235 ? 31.577 0.954   41.382  1.00 86.19  ? 235  ASN E ND2   1 
ATOM   9923  N  N     . ASN I 4 236 ? 30.233 3.928   37.532  1.00 82.86  ? 236  ASN E N     1 
ATOM   9924  C  CA    . ASN I 4 236 ? 30.064 4.898   36.448  1.00 81.17  ? 236  ASN E CA    1 
ATOM   9925  C  C     . ASN I 4 236 ? 29.619 6.230   37.016  1.00 79.56  ? 236  ASN E C     1 
ATOM   9926  O  O     . ASN I 4 236 ? 28.979 6.276   38.071  1.00 80.25  ? 236  ASN E O     1 
ATOM   9927  C  CB    . ASN I 4 236 ? 28.986 4.440   35.458  1.00 81.94  ? 236  ASN E CB    1 
ATOM   9928  C  CG    . ASN I 4 236 ? 29.482 3.402   34.482  1.00 82.75  ? 236  ASN E CG    1 
ATOM   9929  O  OD1   . ASN I 4 236 ? 30.683 3.113   34.419  1.00 83.29  ? 236  ASN E OD1   1 
ATOM   9930  N  ND2   . ASN I 4 236 ? 28.559 2.841   33.695  1.00 82.48  ? 236  ASN E ND2   1 
ATOM   9931  N  N     . TYR I 4 237 ? 29.937 7.308   36.306  1.00 76.61  ? 237  TYR E N     1 
ATOM   9932  C  CA    . TYR I 4 237 ? 29.539 8.640   36.739  1.00 73.38  ? 237  TYR E CA    1 
ATOM   9933  C  C     . TYR I 4 237 ? 28.186 9.013   36.122  1.00 71.41  ? 237  TYR E C     1 
ATOM   9934  O  O     . TYR I 4 237 ? 27.989 8.950   34.912  1.00 70.75  ? 237  TYR E O     1 
ATOM   9935  C  CB    . TYR I 4 237 ? 30.592 9.673   36.343  1.00 73.36  ? 237  TYR E CB    1 
ATOM   9936  C  CG    . TYR I 4 237 ? 31.988 9.447   36.898  1.00 73.58  ? 237  TYR E CG    1 
ATOM   9937  C  CD1   . TYR I 4 237 ? 32.782 8.411   36.444  1.00 74.84  ? 237  TYR E CD1   1 
ATOM   9938  C  CD2   . TYR I 4 237 ? 32.549 10.339  37.817  1.00 74.09  ? 237  TYR E CD2   1 
ATOM   9939  C  CE1   . TYR I 4 237 ? 34.119 8.271   36.883  1.00 75.71  ? 237  TYR E CE1   1 
ATOM   9940  C  CE2   . TYR I 4 237 ? 33.880 10.209  38.262  1.00 73.97  ? 237  TYR E CE2   1 
ATOM   9941  C  CZ    . TYR I 4 237 ? 34.660 9.176   37.788  1.00 74.61  ? 237  TYR E CZ    1 
ATOM   9942  O  OH    . TYR I 4 237 ? 35.981 9.057   38.179  1.00 74.50  ? 237  TYR E OH    1 
ATOM   9943  N  N     . LEU I 4 238 ? 27.255 9.399   36.973  1.00 69.57  ? 238  LEU E N     1 
ATOM   9944  C  CA    . LEU I 4 238 ? 25.918 9.774   36.554  1.00 68.53  ? 238  LEU E CA    1 
ATOM   9945  C  C     . LEU I 4 238 ? 25.840 10.452  35.181  1.00 67.83  ? 238  LEU E C     1 
ATOM   9946  O  O     . LEU I 4 238 ? 25.059 10.038  34.332  1.00 67.81  ? 238  LEU E O     1 
ATOM   9947  C  CB    . LEU I 4 238 ? 25.305 10.684  37.612  1.00 68.37  ? 238  LEU E CB    1 
ATOM   9948  C  CG    . LEU I 4 238 ? 23.786 10.810  37.671  1.00 68.71  ? 238  LEU E CG    1 
ATOM   9949  C  CD1   . LEU I 4 238 ? 23.423 11.893  38.672  1.00 69.00  ? 238  LEU E CD1   1 
ATOM   9950  C  CD2   . LEU I 4 238 ? 23.227 11.167  36.309  1.00 69.93  ? 238  LEU E CD2   1 
ATOM   9951  N  N     . PHE I 4 239 ? 26.614 11.505  34.958  1.00 67.69  ? 239  PHE E N     1 
ATOM   9952  C  CA    . PHE I 4 239 ? 26.564 12.178  33.659  1.00 68.10  ? 239  PHE E CA    1 
ATOM   9953  C  C     . PHE I 4 239 ? 27.712 11.749  32.720  1.00 70.22  ? 239  PHE E C     1 
ATOM   9954  O  O     . PHE I 4 239 ? 28.695 11.119  33.152  1.00 71.25  ? 239  PHE E O     1 
ATOM   9955  C  CB    . PHE I 4 239 ? 26.553 13.701  33.832  1.00 64.77  ? 239  PHE E CB    1 
ATOM   9956  C  CG    . PHE I 4 239 ? 25.288 14.232  34.430  1.00 62.10  ? 239  PHE E CG    1 
ATOM   9957  C  CD1   . PHE I 4 239 ? 25.074 14.186  35.793  1.00 61.36  ? 239  PHE E CD1   1 
ATOM   9958  C  CD2   . PHE I 4 239 ? 24.302 14.772  33.626  1.00 60.90  ? 239  PHE E CD2   1 
ATOM   9959  C  CE1   . PHE I 4 239 ? 23.891 14.672  36.343  1.00 60.77  ? 239  PHE E CE1   1 
ATOM   9960  C  CE2   . PHE I 4 239 ? 23.113 15.260  34.174  1.00 59.37  ? 239  PHE E CE2   1 
ATOM   9961  C  CZ    . PHE I 4 239 ? 22.910 15.209  35.527  1.00 59.14  ? 239  PHE E CZ    1 
ATOM   9962  N  N     . CYS I 4 240 ? 27.591 12.097  31.434  1.00 70.96  ? 240  CYS E N     1 
ATOM   9963  C  CA    . CYS I 4 240 ? 28.593 11.694  30.452  1.00 70.56  ? 240  CYS E CA    1 
ATOM   9964  C  C     . CYS I 4 240 ? 28.369 12.329  29.090  1.00 70.76  ? 240  CYS E C     1 
ATOM   9965  O  O     . CYS I 4 240 ? 27.323 12.956  28.830  1.00 69.81  ? 240  CYS E O     1 
ATOM   9966  C  CB    . CYS I 4 240 ? 28.522 10.199  30.266  1.00 70.56  ? 240  CYS E CB    1 
ATOM   9967  S  SG    . CYS I 4 240 ? 26.847 9.802   29.728  1.00 72.49  ? 240  CYS E SG    1 
ATOM   9968  N  N     . ARG I 4 241 ? 29.366 12.092  28.229  1.00 71.13  ? 241  ARG E N     1 
ATOM   9969  C  CA    . ARG I 4 241 ? 29.466 12.576  26.848  1.00 70.86  ? 241  ARG E CA    1 
ATOM   9970  C  C     . ARG I 4 241 ? 28.314 12.048  26.026  1.00 69.99  ? 241  ARG E C     1 
ATOM   9971  O  O     . ARG I 4 241 ? 27.756 11.012  26.343  1.00 69.69  ? 241  ARG E O     1 
ATOM   9972  C  CB    . ARG I 4 241 ? 30.790 12.089  26.253  1.00 72.87  ? 241  ARG E CB    1 
ATOM   9973  C  CG    . ARG I 4 241 ? 31.367 12.927  25.119  1.00 75.99  ? 241  ARG E CG    1 
ATOM   9974  C  CD    . ARG I 4 241 ? 32.736 12.364  24.682  1.00 76.95  ? 241  ARG E CD    1 
ATOM   9975  N  NE    . ARG I 4 241 ? 33.512 13.337  23.905  1.00 78.90  ? 241  ARG E NE    1 
ATOM   9976  C  CZ    . ARG I 4 241 ? 34.770 13.154  23.490  1.00 79.89  ? 241  ARG E CZ    1 
ATOM   9977  N  NH1   . ARG I 4 241 ? 35.411 12.021  23.764  1.00 79.78  ? 241  ARG E NH1   1 
ATOM   9978  N  NH2   . ARG I 4 241 ? 35.402 14.122  22.825  1.00 79.83  ? 241  ARG E NH2   1 
ATOM   9979  N  N     . VAL I 4 242 ? 27.961 12.758  24.965  1.00 70.03  ? 242  VAL E N     1 
ATOM   9980  C  CA    . VAL I 4 242 ? 26.849 12.347  24.100  1.00 70.60  ? 242  VAL E CA    1 
ATOM   9981  C  C     . VAL I 4 242 ? 27.177 12.810  22.681  1.00 71.54  ? 242  VAL E C     1 
ATOM   9982  O  O     . VAL I 4 242 ? 27.031 13.998  22.372  1.00 71.80  ? 242  VAL E O     1 
ATOM   9983  C  CB    . VAL I 4 242 ? 25.490 12.978  24.591  1.00 69.45  ? 242  VAL E CB    1 
ATOM   9984  C  CG1   . VAL I 4 242 ? 24.450 12.962  23.500  1.00 68.62  ? 242  VAL E CG1   1 
ATOM   9985  C  CG2   . VAL I 4 242 ? 24.964 12.204  25.776  1.00 69.33  ? 242  VAL E CG2   1 
ATOM   9986  N  N     . ARG I 4 243 ? 27.606 11.875  21.821  1.00 72.17  ? 243  ARG E N     1 
ATOM   9987  C  CA    . ARG I 4 243 ? 28.003 12.207  20.445  1.00 72.45  ? 243  ARG E CA    1 
ATOM   9988  C  C     . ARG I 4 243 ? 26.911 12.695  19.507  1.00 73.22  ? 243  ARG E C     1 
ATOM   9989  O  O     . ARG I 4 243 ? 25.723 12.657  19.834  1.00 72.44  ? 243  ARG E O     1 
ATOM   9990  C  CB    . ARG I 4 243 ? 28.752 11.037  19.808  1.00 70.68  ? 243  ARG E CB    1 
ATOM   9991  C  CG    . ARG I 4 243 ? 30.057 10.705  20.503  1.00 69.60  ? 243  ARG E CG    1 
ATOM   9992  C  CD    . ARG I 4 243 ? 30.042 9.269   21.040  1.00 69.82  ? 243  ARG E CD    1 
ATOM   9993  N  NE    . ARG I 4 243 ? 31.196 8.932   21.880  1.00 69.06  ? 243  ARG E NE    1 
ATOM   9994  C  CZ    . ARG I 4 243 ? 32.447 9.345   21.667  1.00 68.51  ? 243  ARG E CZ    1 
ATOM   9995  N  NH1   . ARG I 4 243 ? 32.739 10.133  20.632  1.00 66.54  ? 243  ARG E NH1   1 
ATOM   9996  N  NH2   . ARG I 4 243 ? 33.417 8.955   22.492  1.00 67.86  ? 243  ARG E NH2   1 
ATOM   9997  N  N     . LYS I 4 244 ? 27.343 13.159  18.337  1.00 74.52  ? 244  LYS E N     1 
ATOM   9998  C  CA    . LYS I 4 244 ? 26.445 13.714  17.323  1.00 76.53  ? 244  LYS E CA    1 
ATOM   9999  C  C     . LYS I 4 244 ? 25.213 12.912  16.886  1.00 77.05  ? 244  LYS E C     1 
ATOM   10000 O  O     . LYS I 4 244 ? 24.368 13.423  16.147  1.00 76.61  ? 244  LYS E O     1 
ATOM   10001 C  CB    . LYS I 4 244 ? 27.259 14.155  16.091  1.00 76.79  ? 244  LYS E CB    1 
ATOM   10002 C  CG    . LYS I 4 244 ? 28.477 13.294  15.732  1.00 77.45  ? 244  LYS E CG    1 
ATOM   10003 C  CD    . LYS I 4 244 ? 29.310 13.965  14.621  1.00 77.39  ? 244  LYS E CD    1 
ATOM   10004 C  CE    . LYS I 4 244 ? 28.412 14.429  13.457  1.00 78.80  ? 244  LYS E CE    1 
ATOM   10005 N  NZ    . LYS I 4 244 ? 29.063 15.328  12.449  1.00 78.30  ? 244  LYS E NZ    1 
ATOM   10006 N  N     . ASN I 4 245 ? 25.094 11.671  17.348  1.00 77.87  ? 245  ASN E N     1 
ATOM   10007 C  CA    . ASN I 4 245 ? 23.931 10.864  17.003  1.00 78.67  ? 245  ASN E CA    1 
ATOM   10008 C  C     . ASN I 4 245 ? 22.791 11.064  18.011  1.00 79.79  ? 245  ASN E C     1 
ATOM   10009 O  O     . ASN I 4 245 ? 21.714 11.555  17.664  1.00 80.07  ? 245  ASN E O     1 
ATOM   10010 C  CB    . ASN I 4 245 ? 24.317 9.379   16.911  1.00 78.39  ? 245  ASN E CB    1 
ATOM   10011 C  CG    . ASN I 4 245 ? 25.156 8.901   18.086  1.00 77.99  ? 245  ASN E CG    1 
ATOM   10012 O  OD1   . ASN I 4 245 ? 24.728 8.969   19.232  1.00 78.26  ? 245  ASN E OD1   1 
ATOM   10013 N  ND2   . ASN I 4 245 ? 26.356 8.395   17.797  1.00 77.59  ? 245  ASN E ND2   1 
ATOM   10014 N  N     . GLY I 4 246 ? 23.045 10.708  19.265  1.00 81.20  ? 246  GLY E N     1 
ATOM   10015 C  CA    . GLY I 4 246 ? 22.043 10.839  20.311  1.00 82.06  ? 246  GLY E CA    1 
ATOM   10016 C  C     . GLY I 4 246 ? 22.138 9.603   21.187  1.00 82.50  ? 246  GLY E C     1 
ATOM   10017 O  O     . GLY I 4 246 ? 21.128 8.992   21.564  1.00 82.55  ? 246  GLY E O     1 
ATOM   10018 N  N     . VAL I 4 247 ? 23.374 9.228   21.502  1.00 82.64  ? 247  VAL E N     1 
ATOM   10019 C  CA    . VAL I 4 247 ? 23.622 8.050   22.312  1.00 83.05  ? 247  VAL E CA    1 
ATOM   10020 C  C     . VAL I 4 247 ? 24.679 8.278   23.378  1.00 83.12  ? 247  VAL E C     1 
ATOM   10021 O  O     . VAL I 4 247 ? 25.787 8.763   23.103  1.00 82.47  ? 247  VAL E O     1 
ATOM   10022 C  CB    . VAL I 4 247 ? 24.062 6.872   21.437  1.00 83.32  ? 247  VAL E CB    1 
ATOM   10023 C  CG1   . VAL I 4 247 ? 24.216 5.619   22.291  1.00 84.04  ? 247  VAL E CG1   1 
ATOM   10024 C  CG2   . VAL I 4 247 ? 23.047 6.657   20.326  1.00 83.68  ? 247  VAL E CG2   1 
ATOM   10025 N  N     . ALA I 4 248 ? 24.325 7.902   24.599  1.00 82.82  ? 248  ALA E N     1 
ATOM   10026 C  CA    . ALA I 4 248 ? 25.223 8.059   25.719  1.00 82.98  ? 248  ALA E CA    1 
ATOM   10027 C  C     . ALA I 4 248 ? 26.359 7.039   25.696  1.00 83.33  ? 248  ALA E C     1 
ATOM   10028 O  O     . ALA I 4 248 ? 26.161 5.849   25.421  1.00 83.88  ? 248  ALA E O     1 
ATOM   10029 C  CB    . ALA I 4 248 ? 24.450 7.942   27.004  1.00 83.11  ? 248  ALA E CB    1 
ATOM   10030 N  N     . ALA I 4 249 ? 27.556 7.523   25.988  1.00 82.74  ? 249  ALA E N     1 
ATOM   10031 C  CA    . ALA I 4 249 ? 28.738 6.683   26.031  1.00 82.79  ? 249  ALA E CA    1 
ATOM   10032 C  C     . ALA I 4 249 ? 29.208 6.604   27.490  1.00 81.90  ? 249  ALA E C     1 
ATOM   10033 O  O     . ALA I 4 249 ? 30.160 7.281   27.890  1.00 81.74  ? 249  ALA E O     1 
ATOM   10034 C  CB    . ALA I 4 249 ? 29.834 7.284   25.136  1.00 83.37  ? 249  ALA E CB    1 
ATOM   10035 N  N     . PRO I 4 250 ? 28.533 5.783   28.310  1.00 81.01  ? 250  PRO E N     1 
ATOM   10036 C  CA    . PRO I 4 250 ? 28.902 5.639   29.722  1.00 80.49  ? 250  PRO E CA    1 
ATOM   10037 C  C     . PRO I 4 250 ? 30.377 5.328   29.956  1.00 80.15  ? 250  PRO E C     1 
ATOM   10038 O  O     . PRO I 4 250 ? 31.089 4.891   29.048  1.00 79.91  ? 250  PRO E O     1 
ATOM   10039 C  CB    . PRO I 4 250 ? 27.993 4.508   30.200  1.00 80.51  ? 250  PRO E CB    1 
ATOM   10040 C  CG    . PRO I 4 250 ? 26.760 4.732   29.389  1.00 81.05  ? 250  PRO E CG    1 
ATOM   10041 C  CD    . PRO I 4 250 ? 27.327 4.997   28.004  1.00 80.70  ? 250  PRO E CD    1 
ATOM   10042 N  N     . SER I 4 251 ? 30.830 5.580   31.180  1.00 80.28  ? 251  SER E N     1 
ATOM   10043 C  CA    . SER I 4 251 ? 32.210 5.305   31.567  1.00 80.77  ? 251  SER E CA    1 
ATOM   10044 C  C     . SER I 4 251 ? 32.409 5.563   33.051  1.00 80.42  ? 251  SER E C     1 
ATOM   10045 O  O     . SER I 4 251 ? 31.644 6.294   33.683  1.00 80.16  ? 251  SER E O     1 
ATOM   10046 C  CB    . SER I 4 251 ? 33.209 6.146   30.756  1.00 81.04  ? 251  SER E CB    1 
ATOM   10047 O  OG    . SER I 4 251 ? 34.551 5.749   31.024  1.00 80.66  ? 251  SER E OG    1 
ATOM   10048 N  N     . ALA I 4 252 ? 33.447 4.947   33.595  1.00 80.01  ? 252  ALA E N     1 
ATOM   10049 C  CA    . ALA I 4 252 ? 33.751 5.076   34.997  1.00 80.42  ? 252  ALA E CA    1 
ATOM   10050 C  C     . ALA I 4 252 ? 35.220 5.426   35.193  1.00 80.34  ? 252  ALA E C     1 
ATOM   10051 O  O     . ALA I 4 252 ? 35.789 5.188   36.266  1.00 80.91  ? 252  ALA E O     1 
ATOM   10052 C  CB    . ALA I 4 252 ? 33.410 3.781   35.710  1.00 80.43  ? 252  ALA E CB    1 
ATOM   10053 N  N     . THR I 4 253 ? 35.834 5.990   34.159  1.00 79.52  ? 253  THR E N     1 
ATOM   10054 C  CA    . THR I 4 253 ? 37.240 6.378   34.251  1.00 79.24  ? 253  THR E CA    1 
ATOM   10055 C  C     . THR I 4 253 ? 37.381 7.878   34.065  1.00 77.96  ? 253  THR E C     1 
ATOM   10056 O  O     . THR I 4 253 ? 38.149 8.536   34.772  1.00 77.30  ? 253  THR E O     1 
ATOM   10057 C  CB    . THR I 4 253 ? 38.097 5.658   33.188  1.00 80.45  ? 253  THR E CB    1 
ATOM   10058 O  OG1   . THR I 4 253 ? 37.336 5.523   31.992  1.00 81.30  ? 253  THR E OG1   1 
ATOM   10059 C  CG2   . THR I 4 253 ? 38.535 4.288   33.682  1.00 79.54  ? 253  THR E CG2   1 
ATOM   10060 N  N     . SER I 4 254 ? 36.632 8.405   33.102  1.00 77.40  ? 254  SER E N     1 
ATOM   10061 C  CA    . SER I 4 254 ? 36.641 9.833   32.799  1.00 76.58  ? 254  SER E CA    1 
ATOM   10062 C  C     . SER I 4 254 ? 35.277 10.446  33.145  1.00 75.34  ? 254  SER E C     1 
ATOM   10063 O  O     . SER I 4 254 ? 34.220 9.877   32.829  1.00 75.63  ? 254  SER E O     1 
ATOM   10064 C  CB    . SER I 4 254 ? 36.969 10.067  31.314  1.00 77.02  ? 254  SER E CB    1 
ATOM   10065 O  OG    . SER I 4 254 ? 38.250 9.541   30.995  1.00 78.52  ? 254  SER E OG    1 
ATOM   10066 N  N     . GLN I 4 255 ? 35.314 11.596  33.812  1.00 72.38  ? 255  GLN E N     1 
ATOM   10067 C  CA    . GLN I 4 255 ? 34.102 12.289  34.201  1.00 70.31  ? 255  GLN E CA    1 
ATOM   10068 C  C     . GLN I 4 255 ? 33.780 13.389  33.202  1.00 67.81  ? 255  GLN E C     1 
ATOM   10069 O  O     . GLN I 4 255 ? 34.671 13.935  32.539  1.00 66.65  ? 255  GLN E O     1 
ATOM   10070 C  CB    . GLN I 4 255 ? 34.274 12.868  35.603  1.00 73.17  ? 255  GLN E CB    1 
ATOM   10071 C  CG    . GLN I 4 255 ? 35.643 13.503  35.847  1.00 76.18  ? 255  GLN E CG    1 
ATOM   10072 C  CD    . GLN I 4 255 ? 35.866 13.893  37.315  1.00 76.56  ? 255  GLN E CD    1 
ATOM   10073 O  OE1   . GLN I 4 255 ? 35.062 14.629  37.887  1.00 76.47  ? 255  GLN E OE1   1 
ATOM   10074 N  NE2   . GLN I 4 255 ? 36.875 13.515  38.108  1.00 76.18  ? 255  GLN E NE2   1 
ATOM   10075 N  N     . LEU I 4 256 ? 32.500 13.745  33.093  1.00 64.40  ? 256  LEU E N     1 
ATOM   10076 C  CA    . LEU I 4 256 ? 32.047 14.765  32.151  1.00 62.16  ? 256  LEU E CA    1 
ATOM   10077 C  C     . LEU I 4 256 ? 32.513 16.163  32.580  1.00 62.29  ? 256  LEU E C     1 
ATOM   10078 O  O     . LEU I 4 256 ? 31.825 16.923  33.271  1.00 63.66  ? 256  LEU E O     1 
ATOM   10079 C  CB    . LEU I 4 256 ? 30.530 14.701  31.998  1.00 59.55  ? 256  LEU E CB    1 
ATOM   10080 C  CG    . LEU I 4 256 ? 29.968 15.192  30.679  1.00 57.68  ? 256  LEU E CG    1 
ATOM   10081 C  CD1   . LEU I 4 256 ? 28.582 15.797  30.881  1.00 57.20  ? 256  LEU E CD1   1 
ATOM   10082 C  CD2   . LEU I 4 256 ? 30.915 16.186  30.036  1.00 55.76  ? 256  LEU E CD2   1 
ATOM   10083 N  N     . SER I 4 257 ? 33.749 16.446  32.138  1.00 61.71  ? 257  SER E N     1 
ATOM   10084 C  CA    . SER I 4 257 ? 34.548 17.646  32.363  1.00 61.43  ? 257  SER E CA    1 
ATOM   10085 C  C     . SER I 4 257 ? 33.801 18.872  32.916  1.00 61.45  ? 257  SER E C     1 
ATOM   10086 O  O     . SER I 4 257 ? 32.600 19.044  32.695  1.00 60.53  ? 257  SER E O     1 
ATOM   10087 C  CB    . SER I 4 257 ? 35.238 18.055  31.060  1.00 60.75  ? 257  SER E CB    1 
ATOM   10088 O  OG    . SER I 4 257 ? 34.441 18.965  30.326  1.00 60.26  ? 257  SER E OG    1 
ATOM   10089 N  N     . THR I 4 258 ? 34.571 19.710  33.615  1.00 61.60  ? 258  THR E N     1 
ATOM   10090 C  CA    . THR I 4 258 ? 34.051 20.958  34.197  1.00 60.32  ? 258  THR E CA    1 
ATOM   10091 C  C     . THR I 4 258 ? 33.556 21.834  33.065  1.00 56.69  ? 258  THR E C     1 
ATOM   10092 O  O     . THR I 4 258 ? 32.422 22.309  33.042  1.00 55.42  ? 258  THR E O     1 
ATOM   10093 C  CB    . THR I 4 258 ? 35.145 21.741  34.968  1.00 62.80  ? 258  THR E CB    1 
ATOM   10094 O  OG1   . THR I 4 258 ? 36.199 22.131  34.082  1.00 65.22  ? 258  THR E OG1   1 
ATOM   10095 C  CG2   . THR I 4 258 ? 35.715 20.885  36.083  1.00 64.07  ? 258  THR E CG2   1 
ATOM   10096 N  N     . ARG I 4 259 ? 34.471 22.024  32.108  1.00 53.29  ? 259  ARG E N     1 
ATOM   10097 C  CA    . ARG I 4 259 ? 34.253 22.819  30.900  1.00 49.05  ? 259  ARG E CA    1 
ATOM   10098 C  C     . ARG I 4 259 ? 32.963 22.440  30.229  1.00 47.66  ? 259  ARG E C     1 
ATOM   10099 O  O     . ARG I 4 259 ? 32.163 23.283  29.852  1.00 45.74  ? 259  ARG E O     1 
ATOM   10100 C  CB    . ARG I 4 259 ? 35.366 22.580  29.875  1.00 45.61  ? 259  ARG E CB    1 
ATOM   10101 C  CG    . ARG I 4 259 ? 35.401 23.594  28.761  1.00 43.25  ? 259  ARG E CG    1 
ATOM   10102 C  CD    . ARG I 4 259 ? 35.775 24.913  29.356  1.00 42.53  ? 259  ARG E CD    1 
ATOM   10103 N  NE    . ARG I 4 259 ? 35.623 26.000  28.428  1.00 40.94  ? 259  ARG E NE    1 
ATOM   10104 C  CZ    . ARG I 4 259 ? 34.470 26.549  28.062  1.00 40.56  ? 259  ARG E CZ    1 
ATOM   10105 N  NH1   . ARG I 4 259 ? 33.328 26.092  28.551  1.00 40.34  ? 259  ARG E NH1   1 
ATOM   10106 N  NH2   . ARG I 4 259 ? 34.463 27.575  27.206  1.00 38.47  ? 259  ARG E NH2   1 
ATOM   10107 N  N     . ALA I 4 260 ? 32.795 21.137  30.103  1.00 46.94  ? 260  ALA E N     1 
ATOM   10108 C  CA    . ALA I 4 260 ? 31.620 20.582  29.499  1.00 47.84  ? 260  ALA E CA    1 
ATOM   10109 C  C     . ALA I 4 260 ? 30.390 21.179  30.152  1.00 47.90  ? 260  ALA E C     1 
ATOM   10110 O  O     . ALA I 4 260 ? 29.645 21.944  29.544  1.00 46.75  ? 260  ALA E O     1 
ATOM   10111 C  CB    . ALA I 4 260 ? 31.600 19.068  29.629  1.00 48.58  ? 260  ALA E CB    1 
ATOM   10112 N  N     . LEU I 4 261 ? 30.201 20.816  31.414  1.00 49.51  ? 261  LEU E N     1 
ATOM   10113 C  CA    . LEU I 4 261 ? 29.060 21.262  32.194  1.00 50.25  ? 261  LEU E CA    1 
ATOM   10114 C  C     . LEU I 4 261 ? 28.800 22.771  32.152  1.00 52.26  ? 261  LEU E C     1 
ATOM   10115 O  O     . LEU I 4 261 ? 27.642 23.206  32.151  1.00 51.64  ? 261  LEU E O     1 
ATOM   10116 C  CB    . LEU I 4 261 ? 29.224 20.773  33.634  1.00 48.55  ? 261  LEU E CB    1 
ATOM   10117 C  CG    . LEU I 4 261 ? 29.173 19.262  33.826  1.00 47.08  ? 261  LEU E CG    1 
ATOM   10118 C  CD1   . LEU I 4 261 ? 29.231 18.914  35.293  1.00 47.80  ? 261  LEU E CD1   1 
ATOM   10119 C  CD2   . LEU I 4 261 ? 27.931 18.681  33.168  1.00 47.86  ? 261  LEU E CD2   1 
ATOM   10120 N  N     . GLU I 4 262 ? 29.864 23.567  32.113  1.00 53.77  ? 262  GLU E N     1 
ATOM   10121 C  CA    . GLU I 4 262 ? 29.695 25.014  32.019  1.00 55.62  ? 262  GLU E CA    1 
ATOM   10122 C  C     . GLU I 4 262 ? 28.952 25.327  30.745  1.00 55.64  ? 262  GLU E C     1 
ATOM   10123 O  O     . GLU I 4 262 ? 27.972 26.086  30.730  1.00 55.73  ? 262  GLU E O     1 
ATOM   10124 C  CB    . GLU I 4 262 ? 31.026 25.728  31.967  1.00 57.78  ? 262  GLU E CB    1 
ATOM   10125 C  CG    . GLU I 4 262 ? 32.011 25.375  33.060  1.00 62.43  ? 262  GLU E CG    1 
ATOM   10126 C  CD    . GLU I 4 262 ? 33.040 26.453  33.188  1.00 65.48  ? 262  GLU E CD    1 
ATOM   10127 O  OE1   . GLU I 4 262 ? 32.714 27.546  33.706  1.00 66.19  ? 262  GLU E OE1   1 
ATOM   10128 O  OE2   . GLU I 4 262 ? 34.189 26.214  32.784  1.00 67.71  ? 262  GLU E OE2   1 
ATOM   10129 N  N     . GLY I 4 263 ? 29.433 24.707  29.669  1.00 55.44  ? 263  GLY E N     1 
ATOM   10130 C  CA    . GLY I 4 263 ? 28.841 24.885  28.358  1.00 54.24  ? 263  GLY E CA    1 
ATOM   10131 C  C     . GLY I 4 263 ? 27.355 24.600  28.377  1.00 52.47  ? 263  GLY E C     1 
ATOM   10132 O  O     . GLY I 4 263 ? 26.574 25.312  27.731  1.00 52.91  ? 263  GLY E O     1 
ATOM   10133 N  N     . ILE I 4 264 ? 26.955 23.572  29.116  1.00 49.56  ? 264  ILE E N     1 
ATOM   10134 C  CA    . ILE I 4 264 ? 25.554 23.239  29.199  1.00 48.57  ? 264  ILE E CA    1 
ATOM   10135 C  C     . ILE I 4 264 ? 24.686 24.426  29.611  1.00 49.52  ? 264  ILE E C     1 
ATOM   10136 O  O     . ILE I 4 264 ? 23.536 24.544  29.203  1.00 48.11  ? 264  ILE E O     1 
ATOM   10137 C  CB    . ILE I 4 264 ? 25.371 22.119  30.149  1.00 47.84  ? 264  ILE E CB    1 
ATOM   10138 C  CG1   . ILE I 4 264 ? 26.319 20.998  29.735  1.00 48.04  ? 264  ILE E CG1   1 
ATOM   10139 C  CG2   . ILE I 4 264 ? 23.927 21.694  30.159  1.00 46.77  ? 264  ILE E CG2   1 
ATOM   10140 C  CD1   . ILE I 4 264 ? 26.191 19.723  30.542  1.00 49.63  ? 264  ILE E CD1   1 
ATOM   10141 N  N     . PHE I 4 265 ? 25.246 25.311  30.420  1.00 51.87  ? 265  PHE E N     1 
ATOM   10142 C  CA    . PHE I 4 265 ? 24.527 26.499  30.856  1.00 54.88  ? 265  PHE E CA    1 
ATOM   10143 C  C     . PHE I 4 265 ? 24.548 27.480  29.699  1.00 56.97  ? 265  PHE E C     1 
ATOM   10144 O  O     . PHE I 4 265 ? 23.530 28.053  29.339  1.00 57.62  ? 265  PHE E O     1 
ATOM   10145 C  CB    . PHE I 4 265 ? 25.236 27.150  32.049  1.00 55.45  ? 265  PHE E CB    1 
ATOM   10146 C  CG    . PHE I 4 265 ? 24.857 26.582  33.403  1.00 54.89  ? 265  PHE E CG    1 
ATOM   10147 C  CD1   . PHE I 4 265 ? 23.665 26.950  34.017  1.00 53.77  ? 265  PHE E CD1   1 
ATOM   10148 C  CD2   . PHE I 4 265 ? 25.735 25.744  34.093  1.00 54.57  ? 265  PHE E CD2   1 
ATOM   10149 C  CE1   . PHE I 4 265 ? 23.371 26.503  35.283  1.00 53.43  ? 265  PHE E CE1   1 
ATOM   10150 C  CE2   . PHE I 4 265 ? 25.445 25.293  35.364  1.00 53.20  ? 265  PHE E CE2   1 
ATOM   10151 C  CZ    . PHE I 4 265 ? 24.270 25.671  35.960  1.00 53.36  ? 265  PHE E CZ    1 
ATOM   10152 N  N     . GLU I 4 266 ? 25.745 27.666  29.139  1.00 60.87  ? 266  GLU E N     1 
ATOM   10153 C  CA    . GLU I 4 266 ? 26.014 28.578  28.019  1.00 63.13  ? 266  GLU E CA    1 
ATOM   10154 C  C     . GLU I 4 266 ? 25.044 28.349  26.871  1.00 62.42  ? 266  GLU E C     1 
ATOM   10155 O  O     . GLU I 4 266 ? 24.535 29.300  26.276  1.00 61.57  ? 266  GLU E O     1 
ATOM   10156 C  CB    . GLU I 4 266 ? 27.470 28.387  27.556  1.00 66.41  ? 266  GLU E CB    1 
ATOM   10157 C  CG    . GLU I 4 266 ? 27.957 29.335  26.463  1.00 72.87  ? 266  GLU E CG    1 
ATOM   10158 C  CD    . GLU I 4 266 ? 29.485 29.600  26.519  1.00 77.02  ? 266  GLU E CD    1 
ATOM   10159 O  OE1   . GLU I 4 266 ? 30.295 28.635  26.589  1.00 79.08  ? 266  GLU E OE1   1 
ATOM   10160 O  OE2   . GLU I 4 266 ? 29.880 30.792  26.481  1.00 79.45  ? 266  GLU E OE2   1 
ATOM   10161 N  N     . ALA I 4 267 ? 24.785 27.076  26.589  1.00 61.76  ? 267  ALA E N     1 
ATOM   10162 C  CA    . ALA I 4 267 ? 23.867 26.677  25.534  1.00 61.94  ? 267  ALA E CA    1 
ATOM   10163 C  C     . ALA I 4 267 ? 22.458 27.141  25.859  1.00 61.61  ? 267  ALA E C     1 
ATOM   10164 O  O     . ALA I 4 267 ? 21.917 28.046  25.235  1.00 61.27  ? 267  ALA E O     1 
ATOM   10165 C  CB    . ALA I 4 267 ? 23.885 25.163  25.373  1.00 60.79  ? 267  ALA E CB    1 
ATOM   10166 N  N     . THR I 4 268 ? 21.861 26.506  26.850  1.00 61.81  ? 268  THR E N     1 
ATOM   10167 C  CA    . THR I 4 268 ? 20.513 26.857  27.243  1.00 62.27  ? 268  THR E CA    1 
ATOM   10168 C  C     . THR I 4 268 ? 20.253 28.364  27.230  1.00 63.60  ? 268  THR E C     1 
ATOM   10169 O  O     . THR I 4 268 ? 19.169 28.803  26.856  1.00 63.36  ? 268  THR E O     1 
ATOM   10170 C  CB    . THR I 4 268 ? 20.199 26.293  28.633  1.00 60.98  ? 268  THR E CB    1 
ATOM   10171 O  OG1   . THR I 4 268 ? 20.570 24.908  28.674  1.00 59.87  ? 268  THR E OG1   1 
ATOM   10172 C  CG2   . THR I 4 268 ? 18.719 26.418  28.929  1.00 60.43  ? 268  THR E CG2   1 
ATOM   10173 N  N     . HIS I 4 269 ? 21.243 29.160  27.618  1.00 65.73  ? 269  HIS E N     1 
ATOM   10174 C  CA    . HIS I 4 269 ? 21.047 30.604  27.646  1.00 68.90  ? 269  HIS E CA    1 
ATOM   10175 C  C     . HIS I 4 269 ? 21.072 31.232  26.257  1.00 70.65  ? 269  HIS E C     1 
ATOM   10176 O  O     . HIS I 4 269 ? 20.508 32.308  26.038  1.00 71.10  ? 269  HIS E O     1 
ATOM   10177 C  CB    . HIS I 4 269 ? 22.099 31.274  28.525  1.00 69.81  ? 269  HIS E CB    1 
ATOM   10178 C  CG    . HIS I 4 269 ? 21.975 32.765  28.570  1.00 71.42  ? 269  HIS E CG    1 
ATOM   10179 N  ND1   . HIS I 4 269 ? 22.303 33.571  27.501  1.00 72.24  ? 269  HIS E ND1   1 
ATOM   10180 C  CD2   . HIS I 4 269 ? 21.502 33.591  29.533  1.00 72.00  ? 269  HIS E CD2   1 
ATOM   10181 C  CE1   . HIS I 4 269 ? 22.033 34.829  27.802  1.00 73.08  ? 269  HIS E CE1   1 
ATOM   10182 N  NE2   . HIS I 4 269 ? 21.546 34.868  29.030  1.00 72.86  ? 269  HIS E NE2   1 
ATOM   10183 N  N     . ARG I 4 270 ? 21.736 30.553  25.327  1.00 72.37  ? 270  ARG E N     1 
ATOM   10184 C  CA    . ARG I 4 270 ? 21.852 31.003  23.936  1.00 72.11  ? 270  ARG E CA    1 
ATOM   10185 C  C     . ARG I 4 270 ? 20.542 30.664  23.222  1.00 69.78  ? 270  ARG E C     1 
ATOM   10186 O  O     . ARG I 4 270 ? 20.077 31.399  22.355  1.00 68.51  ? 270  ARG E O     1 
ATOM   10187 C  CB    . ARG I 4 270 ? 23.053 30.291  23.288  1.00 75.51  ? 270  ARG E CB    1 
ATOM   10188 C  CG    . ARG I 4 270 ? 23.324 30.584  21.822  1.00 79.98  ? 270  ARG E CG    1 
ATOM   10189 C  CD    . ARG I 4 270 ? 24.696 30.023  21.385  1.00 84.75  ? 270  ARG E CD    1 
ATOM   10190 N  NE    . ARG I 4 270 ? 24.980 28.685  21.929  1.00 88.70  ? 270  ARG E NE    1 
ATOM   10191 C  CZ    . ARG I 4 270 ? 26.048 27.945  21.620  1.00 90.26  ? 270  ARG E CZ    1 
ATOM   10192 N  NH1   . ARG I 4 270 ? 26.953 28.394  20.757  1.00 91.59  ? 270  ARG E NH1   1 
ATOM   10193 N  NH2   . ARG I 4 270 ? 26.227 26.759  22.192  1.00 90.33  ? 270  ARG E NH2   1 
ATOM   10194 N  N     . LEU I 4 271 ? 19.947 29.558  23.656  1.00 67.58  ? 271  LEU E N     1 
ATOM   10195 C  CA    . LEU I 4 271 ? 18.698 29.031  23.132  1.00 66.36  ? 271  LEU E CA    1 
ATOM   10196 C  C     . LEU I 4 271 ? 17.458 29.860  23.494  1.00 66.02  ? 271  LEU E C     1 
ATOM   10197 O  O     . LEU I 4 271 ? 16.342 29.522  23.112  1.00 65.49  ? 271  LEU E O     1 
ATOM   10198 C  CB    . LEU I 4 271 ? 18.543 27.595  23.638  1.00 65.49  ? 271  LEU E CB    1 
ATOM   10199 C  CG    . LEU I 4 271 ? 17.389 26.672  23.236  1.00 65.35  ? 271  LEU E CG    1 
ATOM   10200 C  CD1   . LEU I 4 271 ? 17.785 25.213  23.477  1.00 66.12  ? 271  LEU E CD1   1 
ATOM   10201 C  CD2   . LEU I 4 271 ? 16.152 27.007  24.043  1.00 65.46  ? 271  LEU E CD2   1 
ATOM   10202 N  N     . ILE I 4 272 ? 17.629 30.956  24.213  1.00 65.77  ? 272  ILE E N     1 
ATOM   10203 C  CA    . ILE I 4 272 ? 16.460 31.741  24.573  1.00 66.37  ? 272  ILE E CA    1 
ATOM   10204 C  C     . ILE I 4 272 ? 16.675 33.235  24.373  1.00 67.48  ? 272  ILE E C     1 
ATOM   10205 O  O     . ILE I 4 272 ? 15.716 34.001  24.237  1.00 67.91  ? 272  ILE E O     1 
ATOM   10206 C  CB    . ILE I 4 272 ? 16.059 31.494  26.051  1.00 65.94  ? 272  ILE E CB    1 
ATOM   10207 C  CG1   . ILE I 4 272 ? 15.949 29.995  26.315  1.00 65.69  ? 272  ILE E CG1   1 
ATOM   10208 C  CG2   . ILE I 4 272 ? 14.724 32.174  26.359  1.00 64.92  ? 272  ILE E CG2   1 
ATOM   10209 C  CD1   . ILE I 4 272 ? 15.356 29.648  27.660  1.00 65.62  ? 272  ILE E CD1   1 
ATOM   10210 N  N     . TYR I 4 273 ? 17.930 33.661  24.354  1.00 68.38  ? 273  TYR E N     1 
ATOM   10211 C  CA    . TYR I 4 273 ? 18.205 35.077  24.189  1.00 69.45  ? 273  TYR E CA    1 
ATOM   10212 C  C     . TYR I 4 273 ? 19.197 35.330  23.056  1.00 70.35  ? 273  TYR E C     1 
ATOM   10213 O  O     . TYR I 4 273 ? 19.766 36.424  22.939  1.00 70.29  ? 273  TYR E O     1 
ATOM   10214 C  CB    . TYR I 4 273 ? 18.733 35.666  25.512  1.00 68.89  ? 273  TYR E CB    1 
ATOM   10215 C  CG    . TYR I 4 273 ? 17.821 35.429  26.700  1.00 68.48  ? 273  TYR E CG    1 
ATOM   10216 C  CD1   . TYR I 4 273 ? 17.996 34.322  27.532  1.00 68.16  ? 273  TYR E CD1   1 
ATOM   10217 C  CD2   . TYR I 4 273 ? 16.741 36.285  26.956  1.00 68.38  ? 273  TYR E CD2   1 
ATOM   10218 C  CE1   . TYR I 4 273 ? 17.117 34.066  28.584  1.00 68.06  ? 273  TYR E CE1   1 
ATOM   10219 C  CE2   . TYR I 4 273 ? 15.852 36.040  28.006  1.00 67.94  ? 273  TYR E CE2   1 
ATOM   10220 C  CZ    . TYR I 4 273 ? 16.045 34.926  28.812  1.00 67.93  ? 273  TYR E CZ    1 
ATOM   10221 O  OH    . TYR I 4 273 ? 15.153 34.662  29.828  1.00 67.71  ? 273  TYR E OH    1 
ATOM   10222 N  N     . GLY I 4 274 ? 19.408 34.319  22.221  1.00 70.65  ? 274  GLY E N     1 
ATOM   10223 C  CA    . GLY I 4 274 ? 20.332 34.491  21.120  1.00 72.93  ? 274  GLY E CA    1 
ATOM   10224 C  C     . GLY I 4 274 ? 21.753 34.294  21.584  1.00 74.31  ? 274  GLY E C     1 
ATOM   10225 O  O     . GLY I 4 274 ? 21.979 33.426  22.413  1.00 74.76  ? 274  GLY E O     1 
ATOM   10226 N  N     . ALA I 4 275 ? 22.701 35.077  21.068  1.00 76.07  ? 275  ALA E N     1 
ATOM   10227 C  CA    . ALA I 4 275 ? 24.095 34.927  21.466  1.00 79.19  ? 275  ALA E CA    1 
ATOM   10228 C  C     . ALA I 4 275 ? 24.678 36.168  22.116  1.00 81.97  ? 275  ALA E C     1 
ATOM   10229 O  O     . ALA I 4 275 ? 24.020 37.209  22.220  1.00 81.92  ? 275  ALA E O     1 
ATOM   10230 C  CB    . ALA I 4 275 ? 24.946 34.519  20.277  1.00 78.51  ? 275  ALA E CB    1 
ATOM   10231 N  N     . LYS I 4 276 ? 25.928 36.034  22.552  1.00 85.57  ? 276  LYS E N     1 
ATOM   10232 C  CA    . LYS I 4 276 ? 26.660 37.102  23.231  1.00 89.07  ? 276  LYS E CA    1 
ATOM   10233 C  C     . LYS I 4 276 ? 27.000 38.304  22.347  1.00 91.60  ? 276  LYS E C     1 
ATOM   10234 O  O     . LYS I 4 276 ? 27.032 38.196  21.119  1.00 92.40  ? 276  LYS E O     1 
ATOM   10235 C  CB    . LYS I 4 276 ? 27.952 36.524  23.846  1.00 88.94  ? 276  LYS E CB    1 
ATOM   10236 C  CG    . LYS I 4 276 ? 27.724 35.662  25.106  1.00 88.14  ? 276  LYS E CG    1 
ATOM   10237 C  CD    . LYS I 4 276 ? 28.896 34.709  25.440  1.00 86.33  ? 276  LYS E CD    1 
ATOM   10238 C  CE    . LYS I 4 276 ? 30.123 35.406  25.980  1.00 84.68  ? 276  LYS E CE    1 
ATOM   10239 N  NZ    . LYS I 4 276 ? 31.161 34.389  26.236  1.00 82.74  ? 276  LYS E NZ    1 
ATOM   10240 N  N     . ASP I 4 277 ? 27.260 39.446  22.984  1.00 94.54  ? 277  ASP E N     1 
ATOM   10241 C  CA    . ASP I 4 277 ? 27.613 40.675  22.270  1.00 97.93  ? 277  ASP E CA    1 
ATOM   10242 C  C     . ASP I 4 277 ? 28.881 40.483  21.438  1.00 99.89  ? 277  ASP E C     1 
ATOM   10243 O  O     . ASP I 4 277 ? 29.213 39.370  21.010  1.00 100.05 ? 277  ASP E O     1 
ATOM   10244 C  CB    . ASP I 4 277 ? 27.864 41.825  23.257  1.00 98.28  ? 277  ASP E CB    1 
ATOM   10245 C  CG    . ASP I 4 277 ? 26.658 42.143  24.119  1.00 99.37  ? 277  ASP E CG    1 
ATOM   10246 O  OD1   . ASP I 4 277 ? 25.570 41.581  23.857  1.00 99.23  ? 277  ASP E OD1   1 
ATOM   10247 O  OD2   . ASP I 4 277 ? 26.803 42.964  25.057  1.00 100.33 ? 277  ASP E OD2   1 
ATOM   10248 N  N     . ASP I 4 278 ? 29.570 41.595  21.191  1.00 102.02 ? 278  ASP E N     1 
ATOM   10249 C  CA    . ASP I 4 278 ? 30.837 41.573  20.466  1.00 103.82 ? 278  ASP E CA    1 
ATOM   10250 C  C     . ASP I 4 278 ? 31.891 41.755  21.569  1.00 103.65 ? 278  ASP E C     1 
ATOM   10251 O  O     . ASP I 4 278 ? 33.016 41.235  21.473  1.00 103.66 ? 278  ASP E O     1 
ATOM   10252 C  CB    . ASP I 4 278 ? 30.930 42.726  19.436  1.00 106.13 ? 278  ASP E CB    1 
ATOM   10253 C  CG    . ASP I 4 278 ? 30.183 42.427  18.116  1.00 108.20 ? 278  ASP E CG    1 
ATOM   10254 O  OD1   . ASP I 4 278 ? 30.301 41.294  17.587  1.00 109.08 ? 278  ASP E OD1   1 
ATOM   10255 O  OD2   . ASP I 4 278 ? 29.495 43.340  17.593  1.00 108.76 ? 278  ASP E OD2   1 
ATOM   10256 N  N     . SER I 4 279 ? 31.482 42.475  22.624  1.00 102.83 ? 279  SER E N     1 
ATOM   10257 C  CA    . SER I 4 279 ? 32.312 42.783  23.802  1.00 101.57 ? 279  SER E CA    1 
ATOM   10258 C  C     . SER I 4 279 ? 32.888 41.544  24.482  1.00 100.70 ? 279  SER E C     1 
ATOM   10259 O  O     . SER I 4 279 ? 32.618 40.410  24.071  1.00 101.33 ? 279  SER E O     1 
ATOM   10260 C  CB    . SER I 4 279 ? 31.503 43.577  24.840  1.00 101.39 ? 279  SER E CB    1 
ATOM   10261 O  OG    . SER I 4 279 ? 32.284 43.858  25.992  1.00 100.59 ? 279  SER E OG    1 
ATOM   10262 N  N     . GLY I 4 280 ? 33.673 41.768  25.534  1.00 98.58  ? 280  GLY E N     1 
ATOM   10263 C  CA    . GLY I 4 280 ? 34.281 40.658  26.243  1.00 95.37  ? 280  GLY E CA    1 
ATOM   10264 C  C     . GLY I 4 280 ? 33.883 40.540  27.701  1.00 93.15  ? 280  GLY E C     1 
ATOM   10265 O  O     . GLY I 4 280 ? 34.570 39.856  28.464  1.00 93.41  ? 280  GLY E O     1 
ATOM   10266 N  N     . GLN I 4 281 ? 32.790 41.196  28.096  1.00 90.28  ? 281  GLN E N     1 
ATOM   10267 C  CA    . GLN I 4 281 ? 32.324 41.136  29.482  1.00 86.89  ? 281  GLN E CA    1 
ATOM   10268 C  C     . GLN I 4 281 ? 32.044 39.683  29.894  1.00 83.51  ? 281  GLN E C     1 
ATOM   10269 O  O     . GLN I 4 281 ? 31.482 38.905  29.119  1.00 83.46  ? 281  GLN E O     1 
ATOM   10270 C  CB    . GLN I 4 281 ? 31.039 41.954  29.653  1.00 87.85  ? 281  GLN E CB    1 
ATOM   10271 C  CG    . GLN I 4 281 ? 31.139 43.402  29.220  1.00 90.65  ? 281  GLN E CG    1 
ATOM   10272 C  CD    . GLN I 4 281 ? 29.799 44.145  29.304  1.00 92.55  ? 281  GLN E CD    1 
ATOM   10273 O  OE1   . GLN I 4 281 ? 29.294 44.436  30.399  1.00 92.67  ? 281  GLN E OE1   1 
ATOM   10274 N  NE2   . GLN I 4 281 ? 29.217 44.452  28.136  1.00 93.44  ? 281  GLN E NE2   1 
ATOM   10275 N  N     . ARG I 4 282 ? 32.447 39.309  31.103  1.00 79.16  ? 282  ARG E N     1 
ATOM   10276 C  CA    . ARG I 4 282 ? 32.190 37.963  31.583  1.00 74.02  ? 282  ARG E CA    1 
ATOM   10277 C  C     . ARG I 4 282 ? 30.752 37.948  32.098  1.00 71.54  ? 282  ARG E C     1 
ATOM   10278 O  O     . ARG I 4 282 ? 30.134 38.998  32.241  1.00 70.68  ? 282  ARG E O     1 
ATOM   10279 C  CB    . ARG I 4 282 ? 33.213 37.594  32.674  1.00 73.30  ? 282  ARG E CB    1 
ATOM   10280 C  CG    . ARG I 4 282 ? 34.509 37.014  32.077  1.00 71.62  ? 282  ARG E CG    1 
ATOM   10281 C  CD    . ARG I 4 282 ? 35.746 37.071  32.976  1.00 69.37  ? 282  ARG E CD    1 
ATOM   10282 N  NE    . ARG I 4 282 ? 35.673 36.267  34.195  1.00 67.44  ? 282  ARG E NE    1 
ATOM   10283 C  CZ    . ARG I 4 282 ? 36.699 35.576  34.702  1.00 67.24  ? 282  ARG E CZ    1 
ATOM   10284 N  NH1   . ARG I 4 282 ? 37.879 35.580  34.082  1.00 67.01  ? 282  ARG E NH1   1 
ATOM   10285 N  NH2   . ARG I 4 282 ? 36.560 34.903  35.848  1.00 65.76  ? 282  ARG E NH2   1 
ATOM   10286 N  N     . TYR I 4 283 ? 30.207 36.763  32.344  1.00 69.20  ? 283  TYR E N     1 
ATOM   10287 C  CA    . TYR I 4 283 ? 28.828 36.630  32.832  1.00 66.07  ? 283  TYR E CA    1 
ATOM   10288 C  C     . TYR I 4 283 ? 27.807 37.340  31.952  1.00 64.91  ? 283  TYR E C     1 
ATOM   10289 O  O     . TYR I 4 283 ? 27.067 38.213  32.424  1.00 64.68  ? 283  TYR E O     1 
ATOM   10290 C  CB    . TYR I 4 283 ? 28.694 37.162  34.259  1.00 63.98  ? 283  TYR E CB    1 
ATOM   10291 C  CG    . TYR I 4 283 ? 29.651 36.536  35.245  1.00 61.79  ? 283  TYR E CG    1 
ATOM   10292 C  CD1   . TYR I 4 283 ? 30.611 37.303  35.883  1.00 61.24  ? 283  TYR E CD1   1 
ATOM   10293 C  CD2   . TYR I 4 283 ? 29.607 35.183  35.528  1.00 60.73  ? 283  TYR E CD2   1 
ATOM   10294 C  CE1   . TYR I 4 283 ? 31.500 36.749  36.770  1.00 60.14  ? 283  TYR E CE1   1 
ATOM   10295 C  CE2   . TYR I 4 283 ? 30.498 34.615  36.422  1.00 60.44  ? 283  TYR E CE2   1 
ATOM   10296 C  CZ    . TYR I 4 283 ? 31.442 35.410  37.037  1.00 60.07  ? 283  TYR E CZ    1 
ATOM   10297 O  OH    . TYR I 4 283 ? 32.340 34.872  37.922  1.00 59.81  ? 283  TYR E OH    1 
ATOM   10298 N  N     . LEU I 4 284 ? 27.785 36.968  30.670  1.00 63.49  ? 284  LEU E N     1 
ATOM   10299 C  CA    . LEU I 4 284 ? 26.847 37.537  29.705  1.00 60.96  ? 284  LEU E CA    1 
ATOM   10300 C  C     . LEU I 4 284 ? 25.806 36.478  29.486  1.00 59.21  ? 284  LEU E C     1 
ATOM   10301 O  O     . LEU I 4 284 ? 24.759 36.737  28.878  1.00 58.48  ? 284  LEU E O     1 
ATOM   10302 C  CB    . LEU I 4 284 ? 27.521 37.860  28.369  1.00 61.01  ? 284  LEU E CB    1 
ATOM   10303 C  CG    . LEU I 4 284 ? 28.304 39.173  28.248  1.00 60.86  ? 284  LEU E CG    1 
ATOM   10304 C  CD1   . LEU I 4 284 ? 28.641 39.416  26.779  1.00 59.55  ? 284  LEU E CD1   1 
ATOM   10305 C  CD2   . LEU I 4 284 ? 27.483 40.332  28.812  1.00 60.16  ? 284  LEU E CD2   1 
ATOM   10306 N  N     . ALA I 4 285 ? 26.127 35.284  29.987  1.00 56.90  ? 285  ALA E N     1 
ATOM   10307 C  CA    . ALA I 4 285 ? 25.247 34.130  29.916  1.00 55.58  ? 285  ALA E CA    1 
ATOM   10308 C  C     . ALA I 4 285 ? 25.589 33.143  31.019  1.00 54.85  ? 285  ALA E C     1 
ATOM   10309 O  O     . ALA I 4 285 ? 26.760 32.899  31.302  1.00 55.53  ? 285  ALA E O     1 
ATOM   10310 C  CB    . ALA I 4 285 ? 25.378 33.464  28.596  1.00 56.65  ? 285  ALA E CB    1 
ATOM   10311 N  N     . TRP I 4 286 ? 24.555 32.572  31.630  1.00 53.16  ? 286  TRP E N     1 
ATOM   10312 C  CA    . TRP I 4 286 ? 24.704 31.606  32.709  1.00 51.03  ? 286  TRP E CA    1 
ATOM   10313 C  C     . TRP I 4 286 ? 25.976 30.810  32.666  1.00 50.50  ? 286  TRP E C     1 
ATOM   10314 O  O     . TRP I 4 286 ? 26.387 30.372  31.604  1.00 49.58  ? 286  TRP E O     1 
ATOM   10315 C  CB    . TRP I 4 286 ? 23.542 30.611  32.698  1.00 50.11  ? 286  TRP E CB    1 
ATOM   10316 C  CG    . TRP I 4 286 ? 22.225 31.278  32.756  1.00 51.81  ? 286  TRP E CG    1 
ATOM   10317 C  CD1   . TRP I 4 286 ? 21.949 32.478  33.328  1.00 52.17  ? 286  TRP E CD1   1 
ATOM   10318 C  CD2   . TRP I 4 286 ? 20.996 30.808  32.203  1.00 53.22  ? 286  TRP E CD2   1 
ATOM   10319 N  NE1   . TRP I 4 286 ? 20.627 32.794  33.164  1.00 52.82  ? 286  TRP E NE1   1 
ATOM   10320 C  CE2   . TRP I 4 286 ? 20.017 31.786  32.473  1.00 53.52  ? 286  TRP E CE2   1 
ATOM   10321 C  CE3   . TRP I 4 286 ? 20.625 29.660  31.503  1.00 54.10  ? 286  TRP E CE3   1 
ATOM   10322 C  CZ2   . TRP I 4 286 ? 18.694 31.654  32.066  1.00 54.54  ? 286  TRP E CZ2   1 
ATOM   10323 C  CZ3   . TRP I 4 286 ? 19.305 29.529  31.100  1.00 54.44  ? 286  TRP E CZ3   1 
ATOM   10324 C  CH2   . TRP I 4 286 ? 18.357 30.522  31.381  1.00 54.61  ? 286  TRP E CH2   1 
ATOM   10325 N  N     . SER I 4 287 ? 26.604 30.634  33.826  1.00 50.33  ? 287  SER E N     1 
ATOM   10326 C  CA    . SER I 4 287 ? 27.799 29.797  33.927  1.00 50.67  ? 287  SER E CA    1 
ATOM   10327 C  C     . SER I 4 287 ? 27.591 28.935  35.165  1.00 49.74  ? 287  SER E C     1 
ATOM   10328 O  O     . SER I 4 287 ? 26.516 28.959  35.739  1.00 48.57  ? 287  SER E O     1 
ATOM   10329 C  CB    . SER I 4 287 ? 29.065 30.628  34.057  1.00 50.77  ? 287  SER E CB    1 
ATOM   10330 O  OG    . SER I 4 287 ? 29.353 30.844  35.412  1.00 53.28  ? 287  SER E OG    1 
ATOM   10331 N  N     . GLY I 4 288 ? 28.597 28.183  35.582  1.00 49.37  ? 288  GLY E N     1 
ATOM   10332 C  CA    . GLY I 4 288 ? 28.427 27.319  36.744  1.00 52.44  ? 288  GLY E CA    1 
ATOM   10333 C  C     . GLY I 4 288 ? 27.707 27.814  38.011  1.00 54.51  ? 288  GLY E C     1 
ATOM   10334 O  O     . GLY I 4 288 ? 26.866 27.114  38.605  1.00 55.11  ? 288  GLY E O     1 
ATOM   10335 N  N     . HIS I 4 289 ? 28.030 29.020  38.452  1.00 55.02  ? 289  HIS E N     1 
ATOM   10336 C  CA    . HIS I 4 289 ? 27.417 29.541  39.653  1.00 55.05  ? 289  HIS E CA    1 
ATOM   10337 C  C     . HIS I 4 289 ? 25.988 29.948  39.495  1.00 54.27  ? 289  HIS E C     1 
ATOM   10338 O  O     . HIS I 4 289 ? 25.225 29.922  40.445  1.00 56.63  ? 289  HIS E O     1 
ATOM   10339 C  CB    . HIS I 4 289 ? 28.223 30.714  40.171  1.00 58.21  ? 289  HIS E CB    1 
ATOM   10340 C  CG    . HIS I 4 289 ? 29.158 30.335  41.266  1.00 62.20  ? 289  HIS E CG    1 
ATOM   10341 N  ND1   . HIS I 4 289 ? 29.851 29.142  41.265  1.00 64.07  ? 289  HIS E ND1   1 
ATOM   10342 C  CD2   . HIS I 4 289 ? 29.504 30.973  42.408  1.00 64.26  ? 289  HIS E CD2   1 
ATOM   10343 C  CE1   . HIS I 4 289 ? 30.584 29.059  42.360  1.00 64.99  ? 289  HIS E CE1   1 
ATOM   10344 N  NE2   . HIS I 4 289 ? 30.391 30.157  43.071  1.00 66.92  ? 289  HIS E NE2   1 
ATOM   10345 N  N     . SER I 4 290 ? 25.622 30.334  38.290  1.00 51.86  ? 290  SER E N     1 
ATOM   10346 C  CA    . SER I 4 290 ? 24.273 30.774  38.011  1.00 48.91  ? 290  SER E CA    1 
ATOM   10347 C  C     . SER I 4 290 ? 23.268 30.037  38.883  1.00 48.03  ? 290  SER E C     1 
ATOM   10348 O  O     . SER I 4 290 ? 22.344 30.624  39.411  1.00 46.02  ? 290  SER E O     1 
ATOM   10349 C  CB    . SER I 4 290 ? 24.008 30.542  36.538  1.00 48.68  ? 290  SER E CB    1 
ATOM   10350 O  OG    . SER I 4 290 ? 25.175 30.865  35.795  1.00 47.04  ? 290  SER E OG    1 
ATOM   10351 N  N     . ALA I 4 291 ? 23.492 28.742  39.049  1.00 48.56  ? 291  ALA E N     1 
ATOM   10352 C  CA    . ALA I 4 291 ? 22.636 27.870  39.850  1.00 49.55  ? 291  ALA E CA    1 
ATOM   10353 C  C     . ALA I 4 291 ? 22.434 28.352  41.291  1.00 50.07  ? 291  ALA E C     1 
ATOM   10354 O  O     . ALA I 4 291 ? 21.318 28.665  41.734  1.00 50.86  ? 291  ALA E O     1 
ATOM   10355 C  CB    . ALA I 4 291 ? 23.246 26.488  39.876  1.00 51.24  ? 291  ALA E CB    1 
ATOM   10356 N  N     . ARG I 4 292 ? 23.535 28.351  42.033  1.00 48.19  ? 292  ARG E N     1 
ATOM   10357 C  CA    . ARG I 4 292 ? 23.556 28.780  43.414  1.00 44.95  ? 292  ARG E CA    1 
ATOM   10358 C  C     . ARG I 4 292 ? 22.926 30.162  43.573  1.00 42.41  ? 292  ARG E C