data_1OW8
# 
_entry.id   1OW8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OW8         
RCSB  RCSB018729   
WWPDB D_1000018729 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1K05 
_pdbx_database_related.details        
;Crystal Structure Of The Focal Adhesion Targeting 
Domain Of Focal Adhesion Kinase
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OW8 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoellerer, M.K.' 1 
'Noble, M.E.M.'   2 
'Labesse, G.'     3 
'Werner, J.M.'    4 
'Arold, S.T.'     5 
# 
_citation.id                        primary 
_citation.title                     
;Molecular Recognition of Paxillin LD Motifs    
by the Focal Adhesion Targeting Domain
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                1207 
_citation.page_last                 1217 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14527389 
_citation.pdbx_database_id_DOI      10.1016/j.str.2003.08.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoellerer, M.K.' 1 
primary 'Noble, M.E.M.'   2 
primary 'Labesse, G.'     3 
primary 'Werner, J.M.'    4 
primary 'Arold, S.T.'     5 
# 
_cell.entry_id           1OW8 
_cell.length_a           87.976 
_cell.length_b           220.780 
_cell.length_c           97.373 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OW8 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Focal adhesion kinase 1' 17836.539 3  2.7.1.112 ? 'Focal Adhesion Targeting' ? 
2 polymer syn Paxillin                  1542.755  2  ?         ? 'Paxillin LD2 motif'       ? 
3 water   nat water                     18.015    41 ?         ? ?                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'FADK 1, pp125FAK, Protein- tyrosine kinase 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRP
H
;
;SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRP
H
;
A,B,C ? 
2 'polypeptide(L)' no no NLSELDRLLLELN NLSELDRLLLELN D,F   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   PRO n 
1 4   ALA n 
1 5   ASP n 
1 6   SER n 
1 7   TYR n 
1 8   ASN n 
1 9   GLU n 
1 10  GLY n 
1 11  VAL n 
1 12  LYS n 
1 13  LEU n 
1 14  GLN n 
1 15  PRO n 
1 16  GLN n 
1 17  GLU n 
1 18  ILE n 
1 19  SER n 
1 20  PRO n 
1 21  PRO n 
1 22  PRO n 
1 23  THR n 
1 24  ALA n 
1 25  ASN n 
1 26  LEU n 
1 27  ASP n 
1 28  ARG n 
1 29  SER n 
1 30  ASN n 
1 31  ASP n 
1 32  LYS n 
1 33  VAL n 
1 34  TYR n 
1 35  GLU n 
1 36  ASN n 
1 37  VAL n 
1 38  THR n 
1 39  GLY n 
1 40  LEU n 
1 41  VAL n 
1 42  LYS n 
1 43  ALA n 
1 44  VAL n 
1 45  ILE n 
1 46  GLU n 
1 47  MET n 
1 48  SER n 
1 49  SER n 
1 50  LYS n 
1 51  ILE n 
1 52  GLN n 
1 53  PRO n 
1 54  ALA n 
1 55  PRO n 
1 56  PRO n 
1 57  GLU n 
1 58  GLU n 
1 59  TYR n 
1 60  VAL n 
1 61  PRO n 
1 62  MET n 
1 63  VAL n 
1 64  LYS n 
1 65  GLU n 
1 66  VAL n 
1 67  GLY n 
1 68  LEU n 
1 69  ALA n 
1 70  LEU n 
1 71  ARG n 
1 72  THR n 
1 73  LEU n 
1 74  LEU n 
1 75  ALA n 
1 76  THR n 
1 77  VAL n 
1 78  ASP n 
1 79  GLU n 
1 80  THR n 
1 81  ILE n 
1 82  PRO n 
1 83  LEU n 
1 84  LEU n 
1 85  PRO n 
1 86  ALA n 
1 87  SER n 
1 88  THR n 
1 89  HIS n 
1 90  ARG n 
1 91  GLU n 
1 92  ILE n 
1 93  GLU n 
1 94  MET n 
1 95  ALA n 
1 96  GLN n 
1 97  LYS n 
1 98  LEU n 
1 99  LEU n 
1 100 ASN n 
1 101 SER n 
1 102 ASP n 
1 103 LEU n 
1 104 GLY n 
1 105 GLU n 
1 106 LEU n 
1 107 ILE n 
1 108 ASN n 
1 109 LYS n 
1 110 MET n 
1 111 LYS n 
1 112 LEU n 
1 113 ALA n 
1 114 GLN n 
1 115 GLN n 
1 116 TYR n 
1 117 VAL n 
1 118 MET n 
1 119 THR n 
1 120 SER n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 GLU n 
1 125 TYR n 
1 126 LYS n 
1 127 LYS n 
1 128 GLN n 
1 129 MET n 
1 130 LEU n 
1 131 THR n 
1 132 ALA n 
1 133 ALA n 
1 134 HIS n 
1 135 ALA n 
1 136 LEU n 
1 137 ALA n 
1 138 VAL n 
1 139 ASP n 
1 140 ALA n 
1 141 LYS n 
1 142 ASN n 
1 143 LEU n 
1 144 LEU n 
1 145 ASP n 
1 146 VAL n 
1 147 ILE n 
1 148 ASP n 
1 149 GLN n 
1 150 ALA n 
1 151 ARG n 
1 152 LEU n 
1 153 LYS n 
1 154 MET n 
1 155 LEU n 
1 156 GLY n 
1 157 GLN n 
1 158 THR n 
1 159 ARG n 
1 160 PRO n 
1 161 HIS n 
2 1   ASN n 
2 2   LEU n 
2 3   SER n 
2 4   GLU n 
2 5   LEU n 
2 6   ASP n 
2 7   ARG n 
2 8   LEU n 
2 9   LEU n 
2 10  LEU n 
2 11  GLU n 
2 12  LEU n 
2 13  ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PTK2 OR FAK1 OR FAK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Sequence derived from human paxillin' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FAK1_HUMAN Q05397 1 
;SSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRP
H
;
892 ? 
2 PDB 1OW8       1OW8   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OW8 A 1 ? 161 ? Q05397 892 ? 1052 ? 892 1052 
2 1 1OW8 B 1 ? 161 ? Q05397 892 ? 1052 ? 892 1052 
3 1 1OW8 C 1 ? 161 ? Q05397 892 ? 1052 ? 892 1052 
4 2 1OW8 D 1 ? 13  ? 1OW8   1   ? 13   ? 1   13   
5 2 1OW8 F 1 ? 13  ? 1OW8   1   ? 13   ? 1   13   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OW8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.86 
_exptl_crystal.density_percent_sol   74.51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    'sodium chloride, glycerol, Hepes, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-06-30 
_diffrn_detector.details                'two crystals monochromator between two cylindrical parabolic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    silicon 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM30A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM30A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     1OW8 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.85 
_reflns.d_resolution_low             34.5 
_reflns.number_all                   22456 
_reflns.number_obs                   22456 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              0.1 
_reflns.pdbx_netI_over_sigmaI        5.1 
_reflns.B_iso_Wilson_estimate        82.6 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.85 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.81 
_reflns_shell.pdbx_Rsym_value        0.68 
_reflns_shell.meanI_over_sigI_obs    1.2 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2159 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OW8 
_refine.ls_number_reflns_obs                     22456 
_refine.ls_number_reflns_all                     22456 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.5 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    99.26 
_refine.ls_R_factor_obs                          0.23726 
_refine.ls_R_factor_all                          0.23726 
_refine.ls_R_factor_R_work                       0.23524 
_refine.ls_R_factor_R_free                       0.27548 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1149 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.B_iso_mean                               67.913 
_refine.aniso_B[1][1]                            5.32 
_refine.aniso_B[2][2]                            -0.18 
_refine.aniso_B[3][3]                            -5.14 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;The second LD2 motif (chain F, bound to molecule C)      
was fitted into the unbiased     
3Fo-2Fc maps (CNS). Its position and orientation     
were inferred from homology with the     
well-defined other LD2 - FAT interaction (chains A and C),    
and are supported by NMR data (see publication).
;
_refine.pdbx_starting_model                      'PDBentry 1K05' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.471 
_refine.pdbx_overall_ESU_R_Free                  0.324 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3431 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               3472 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        34.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012 0.022 ? 3477 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.000 0.020 ? 3341 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.059 2.011 ? 4705 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        3.464 3.000 ? 7837 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.183 5.000 ? 437  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.112 0.200 ? 579  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.010 0.020 ? 3729 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.009 0.020 ? 529  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.273 0.200 ? 1049 'X-RAY DIFFRACTION' ? 
r_nbd_other              0.291 0.200 ? 3971 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.109 0.200 ? 1919 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.164 0.200 ? 83   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.296 0.200 ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.293 0.200 ? 83   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.223 0.200 ? 6    'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.767 1.500 ? 2223 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.820 2.000 ? 3599 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.352 3.000 ? 1254 'X-RAY DIFFRACTION' ? 
r_scangle_it             6.896 4.500 ? 1106 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.850 
_refine_ls_shell.d_res_low                        2.924 
_refine_ls_shell.number_reflns_R_work             1540 
_refine_ls_shell.R_factor_R_work                  0.394 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             78 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1OW8 
_struct.title                     
'Paxillin LD2 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase' 
_struct.pdbx_descriptor           'Focal adhesion kinase 1, Paxillin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OW8 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            '4 helical bundle, amphiphatic helix, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 31  ? ILE A 51  ? ASP A 922  ILE A 942  1 ? 21 
HELX_P HELX_P2  2  PRO A 55  ? ILE A 81  ? PRO A 946  ILE A 972  1 ? 27 
HELX_P HELX_P3  3  PRO A 82  ? LEU A 84  ? PRO A 973  LEU A 975  5 ? 3  
HELX_P HELX_P4  4  PRO A 85  ? SER A 87  ? PRO A 976  SER A 978  5 ? 3  
HELX_P HELX_P5  5  THR A 88  ? TYR A 116 ? THR A 979  TYR A 1007 1 ? 29 
HELX_P HELX_P6  6  LEU A 121 ? GLY A 156 ? LEU A 1012 GLY A 1047 1 ? 36 
HELX_P HELX_P7  7  ASP B 31  ? ILE B 51  ? ASP B 922  ILE B 942  1 ? 21 
HELX_P HELX_P8  8  PRO B 55  ? GLU B 79  ? PRO B 946  GLU B 970  1 ? 25 
HELX_P HELX_P9  9  THR B 80  ? LEU B 84  ? THR B 971  LEU B 975  5 ? 5  
HELX_P HELX_P10 10 PRO B 85  ? SER B 87  ? PRO B 976  SER B 978  5 ? 3  
HELX_P HELX_P11 11 THR B 88  ? TYR B 116 ? THR B 979  TYR B 1007 1 ? 29 
HELX_P HELX_P12 12 LEU B 121 ? LEU B 155 ? LEU B 1012 LEU B 1046 1 ? 35 
HELX_P HELX_P13 13 ASP C 31  ? LYS C 50  ? ASP C 922  LYS C 941  1 ? 20 
HELX_P HELX_P14 14 PRO C 55  ? GLU C 79  ? PRO C 946  GLU C 970  1 ? 25 
HELX_P HELX_P15 15 PRO C 85  ? SER C 87  ? PRO C 976  SER C 978  5 ? 3  
HELX_P HELX_P16 16 THR C 88  ? TYR C 116 ? THR C 979  TYR C 1007 1 ? 29 
HELX_P HELX_P17 17 THR C 119 ? GLY C 156 ? THR C 1010 GLY C 1047 1 ? 38 
HELX_P HELX_P18 18 LEU D 2   ? ASN D 13  ? LEU D 2    ASN D 13   1 ? 12 
HELX_P HELX_P19 19 LEU E 2   ? ASN E 13  ? LEU F 2    ASN F 13   1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1OW8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OW8 
_atom_sites.fract_transf_matrix[1][1]   0.011367 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004529 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010270 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 25  ? 18.386  39.090  17.977 1.00 85.27  ? 916  ASN A N   1 
ATOM   2    C CA  . ASN A 1 25  ? 17.718  40.414  18.129 1.00 84.19  ? 916  ASN A CA  1 
ATOM   3    C C   . ASN A 1 25  ? 18.408  41.271  19.198 1.00 78.96  ? 916  ASN A C   1 
ATOM   4    O O   . ASN A 1 25  ? 18.941  42.322  18.854 1.00 78.28  ? 916  ASN A O   1 
ATOM   5    C CB  . ASN A 1 25  ? 16.189  40.291  18.328 1.00 91.62  ? 916  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 25  ? 15.755  39.024  19.089 1.00 98.94  ? 916  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 25  ? 16.240  37.915  18.854 1.00 104.01 ? 916  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 25  ? 14.793  39.190  19.987 1.00 99.41  ? 916  ASN A ND2 1 
ATOM   9    N N   . LEU A 1 26  ? 18.493  40.824  20.450 1.00 73.58  ? 917  LEU A N   1 
ATOM   10   C CA  . LEU A 1 26  ? 19.162  41.599  21.510 1.00 69.15  ? 917  LEU A CA  1 
ATOM   11   C C   . LEU A 1 26  ? 20.603  42.099  21.301 1.00 69.72  ? 917  LEU A C   1 
ATOM   12   O O   . LEU A 1 26  ? 21.507  41.410  20.829 1.00 72.04  ? 917  LEU A O   1 
ATOM   13   C CB  . LEU A 1 26  ? 19.206  40.806  22.811 1.00 62.54  ? 917  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 26  ? 18.022  40.747  23.760 1.00 57.66  ? 917  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 26  ? 18.455  40.045  25.017 1.00 57.69  ? 917  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 26  ? 17.588  42.125  24.136 1.00 59.82  ? 917  LEU A CD2 1 
ATOM   17   N N   . ASP A 1 27  ? 20.850  43.293  21.814 1.00 69.22  ? 918  ASP A N   1 
ATOM   18   C CA  . ASP A 1 27  ? 22.106  43.988  21.579 1.00 68.82  ? 918  ASP A CA  1 
ATOM   19   C C   . ASP A 1 27  ? 22.969  43.626  22.773 1.00 67.06  ? 918  ASP A C   1 
ATOM   20   O O   . ASP A 1 27  ? 22.619  43.897  23.919 1.00 69.17  ? 918  ASP A O   1 
ATOM   21   C CB  . ASP A 1 27  ? 21.847  45.496  21.443 1.00 69.63  ? 918  ASP A CB  1 
ATOM   22   C CG  . ASP A 1 27  ? 23.110  46.335  21.470 1.00 71.31  ? 918  ASP A CG  1 
ATOM   23   O OD1 . ASP A 1 27  ? 23.033  47.553  21.769 1.00 69.68  ? 918  ASP A OD1 1 
ATOM   24   O OD2 . ASP A 1 27  ? 24.218  45.859  21.144 1.00 74.79  ? 918  ASP A OD2 1 
ATOM   25   N N   . ARG A 1 28  ? 24.066  42.936  22.486 1.00 64.96  ? 919  ARG A N   1 
ATOM   26   C CA  . ARG A 1 28  ? 24.955  42.422  23.523 1.00 60.46  ? 919  ARG A CA  1 
ATOM   27   C C   . ARG A 1 28  ? 26.128  43.331  23.880 1.00 60.77  ? 919  ARG A C   1 
ATOM   28   O O   . ARG A 1 28  ? 26.950  42.941  24.700 1.00 60.62  ? 919  ARG A O   1 
ATOM   29   C CB  . ARG A 1 28  ? 25.474  41.059  23.087 1.00 56.52  ? 919  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 28  ? 24.352  40.116  22.718 1.00 52.55  ? 919  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 28  ? 23.517  39.695  23.908 1.00 48.46  ? 919  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 28  ? 22.697  38.542  23.571 1.00 45.39  ? 919  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 28  ? 22.017  37.842  24.459 1.00 47.56  ? 919  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 28  ? 21.999  38.194  25.730 1.00 46.06  ? 919  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 28  ? 21.327  36.785  24.078 1.00 49.54  ? 919  ARG A NH2 1 
ATOM   36   N N   . SER A 1 29  ? 26.124  44.571  23.393 1.00 58.97  ? 920  SER A N   1 
ATOM   37   C CA  . SER A 1 29  ? 27.265  45.473  23.526 1.00 60.85  ? 920  SER A CA  1 
ATOM   38   C C   . SER A 1 29  ? 27.725  45.708  24.966 1.00 62.83  ? 920  SER A C   1 
ATOM   39   O O   . SER A 1 29  ? 28.894  45.977  25.240 1.00 62.16  ? 920  SER A O   1 
ATOM   40   C CB  . SER A 1 29  ? 26.940  46.823  22.885 1.00 61.13  ? 920  SER A CB  1 
ATOM   41   O OG  . SER A 1 29  ? 26.736  46.725  21.487 1.00 64.73  ? 920  SER A OG  1 
ATOM   42   N N   . ASN A 1 30  ? 26.789  45.660  25.900 1.00 63.68  ? 921  ASN A N   1 
ATOM   43   C CA  . ASN A 1 30  ? 27.162  45.793  27.296 1.00 68.70  ? 921  ASN A CA  1 
ATOM   44   C C   . ASN A 1 30  ? 26.276  44.872  28.099 1.00 72.66  ? 921  ASN A C   1 
ATOM   45   O O   . ASN A 1 30  ? 25.758  45.270  29.146 1.00 75.66  ? 921  ASN A O   1 
ATOM   46   C CB  . ASN A 1 30  ? 26.996  47.233  27.781 1.00 72.32  ? 921  ASN A CB  1 
ATOM   47   C CG  . ASN A 1 30  ? 28.083  48.141  27.249 1.00 77.88  ? 921  ASN A CG  1 
ATOM   48   O OD1 . ASN A 1 30  ? 29.217  48.091  27.730 1.00 80.42  ? 921  ASN A OD1 1 
ATOM   49   N ND2 . ASN A 1 30  ? 27.764  48.923  26.213 1.00 78.59  ? 921  ASN A ND2 1 
ATOM   50   N N   . ASP A 1 31  ? 26.108  43.660  27.568 1.00 73.68  ? 922  ASP A N   1 
ATOM   51   C CA  . ASP A 1 31  ? 25.380  42.597  28.250 1.00 71.80  ? 922  ASP A CA  1 
ATOM   52   C C   . ASP A 1 31  ? 26.421  41.846  29.046 1.00 68.93  ? 922  ASP A C   1 
ATOM   53   O O   . ASP A 1 31  ? 27.139  41.043  28.472 1.00 71.96  ? 922  ASP A O   1 
ATOM   54   C CB  . ASP A 1 31  ? 24.719  41.651  27.251 1.00 72.21  ? 922  ASP A CB  1 
ATOM   55   C CG  . ASP A 1 31  ? 23.675  40.768  27.908 1.00 76.30  ? 922  ASP A CG  1 
ATOM   56   O OD1 . ASP A 1 31  ? 23.970  40.297  29.027 1.00 73.45  ? 922  ASP A OD1 1 
ATOM   57   O OD2 . ASP A 1 31  ? 22.541  40.526  27.424 1.00 79.09  ? 922  ASP A OD2 1 
ATOM   58   N N   . LYS A 1 32  ? 26.586  42.187  30.318 1.00 66.05  ? 923  LYS A N   1 
ATOM   59   C CA  . LYS A 1 32  ? 27.617  41.545  31.125 1.00 65.38  ? 923  LYS A CA  1 
ATOM   60   C C   . LYS A 1 32  ? 27.304  40.046  31.361 1.00 65.03  ? 923  LYS A C   1 
ATOM   61   O O   . LYS A 1 32  ? 28.214  39.234  31.560 1.00 65.59  ? 923  LYS A O   1 
ATOM   62   C CB  . LYS A 1 32  ? 27.845  42.345  32.420 1.00 63.45  ? 923  LYS A CB  1 
ATOM   63   C CG  . LYS A 1 32  ? 29.114  43.215  32.488 1.00 64.53  ? 923  LYS A CG  1 
ATOM   64   C CD  . LYS A 1 32  ? 29.466  43.947  31.169 1.00 75.76  ? 923  LYS A CD  1 
ATOM   65   C CE  . LYS A 1 32  ? 30.081  45.370  31.340 1.00 84.64  ? 923  LYS A CE  1 
ATOM   66   N NZ  . LYS A 1 32  ? 29.874  46.414  30.259 1.00 80.88  ? 923  LYS A NZ  1 
ATOM   67   N N   . VAL A 1 33  ? 26.035  39.645  31.278 1.00 62.44  ? 924  VAL A N   1 
ATOM   68   C CA  . VAL A 1 33  ? 25.621  38.278  31.593 1.00 55.18  ? 924  VAL A CA  1 
ATOM   69   C C   . VAL A 1 33  ? 25.993  37.377  30.435 1.00 55.77  ? 924  VAL A C   1 
ATOM   70   O O   . VAL A 1 33  ? 26.502  36.277  30.592 1.00 58.61  ? 924  VAL A O   1 
ATOM   71   C CB  . VAL A 1 33  ? 24.097  38.205  31.805 1.00 50.58  ? 924  VAL A CB  1 
ATOM   72   C CG1 . VAL A 1 33  ? 23.612  36.780  31.979 1.00 46.62  ? 924  VAL A CG1 1 
ATOM   73   C CG2 . VAL A 1 33  ? 23.722  39.007  33.017 1.00 43.53  ? 924  VAL A CG2 1 
ATOM   74   N N   . TYR A 1 34  ? 25.698  37.866  29.242 1.00 57.93  ? 925  TYR A N   1 
ATOM   75   C CA  . TYR A 1 34  ? 26.156  37.230  28.016 1.00 59.23  ? 925  TYR A CA  1 
ATOM   76   C C   . TYR A 1 34  ? 27.689  37.197  27.912 1.00 58.17  ? 925  TYR A C   1 
ATOM   77   O O   . TYR A 1 34  ? 28.275  36.225  27.466 1.00 60.11  ? 925  TYR A O   1 
ATOM   78   C CB  . TYR A 1 34  ? 25.518  37.962  26.830 1.00 56.98  ? 925  TYR A CB  1 
ATOM   79   C CG  . TYR A 1 34  ? 26.001  37.491  25.488 1.00 57.88  ? 925  TYR A CG  1 
ATOM   80   C CD1 . TYR A 1 34  ? 27.231  37.905  25.016 1.00 61.05  ? 925  TYR A CD1 1 
ATOM   81   C CD2 . TYR A 1 34  ? 25.266  36.605  24.726 1.00 55.60  ? 925  TYR A CD2 1 
ATOM   82   C CE1 . TYR A 1 34  ? 27.703  37.489  23.811 1.00 58.01  ? 925  TYR A CE1 1 
ATOM   83   C CE2 . TYR A 1 34  ? 25.739  36.170  23.524 1.00 55.15  ? 925  TYR A CE2 1 
ATOM   84   C CZ  . TYR A 1 34  ? 26.968  36.608  23.090 1.00 55.60  ? 925  TYR A CZ  1 
ATOM   85   O OH  . TYR A 1 34  ? 27.519  36.229  21.898 1.00 63.27  ? 925  TYR A OH  1 
ATOM   86   N N   . GLU A 1 35  ? 28.354  38.267  28.308 1.00 58.98  ? 926  GLU A N   1 
ATOM   87   C CA  . GLU A 1 35  ? 29.802  38.337  28.259 1.00 61.37  ? 926  GLU A CA  1 
ATOM   88   C C   . GLU A 1 35  ? 30.365  37.274  29.210 1.00 61.81  ? 926  GLU A C   1 
ATOM   89   O O   . GLU A 1 35  ? 31.393  36.665  28.928 1.00 62.51  ? 926  GLU A O   1 
ATOM   90   C CB  . GLU A 1 35  ? 30.234  39.763  28.636 1.00 62.68  ? 926  GLU A CB  1 
ATOM   91   C CG  . GLU A 1 35  ? 31.605  40.253  28.180 1.00 72.64  ? 926  GLU A CG  1 
ATOM   92   C CD  . GLU A 1 35  ? 31.793  41.763  28.373 1.00 80.73  ? 926  GLU A CD  1 
ATOM   93   O OE1 . GLU A 1 35  ? 32.562  42.144  29.284 1.00 86.31  ? 926  GLU A OE1 1 
ATOM   94   O OE2 . GLU A 1 35  ? 31.207  42.599  27.637 1.00 80.46  ? 926  GLU A OE2 1 
ATOM   95   N N   . ASN A 1 36  ? 29.681  36.992  30.311 1.00 61.19  ? 927  ASN A N   1 
ATOM   96   C CA  . ASN A 1 36  ? 30.242  36.128  31.353 1.00 61.52  ? 927  ASN A CA  1 
ATOM   97   C C   . ASN A 1 36  ? 30.029  34.639  31.114 1.00 62.00  ? 927  ASN A C   1 
ATOM   98   O O   . ASN A 1 36  ? 30.835  33.798  31.488 1.00 67.72  ? 927  ASN A O   1 
ATOM   99   C CB  . ASN A 1 36  ? 29.611  36.479  32.701 1.00 58.87  ? 927  ASN A CB  1 
ATOM   100  C CG  . ASN A 1 36  ? 30.223  37.719  33.298 1.00 61.26  ? 927  ASN A CG  1 
ATOM   101  O OD1 . ASN A 1 36  ? 31.283  38.138  32.846 1.00 64.16  ? 927  ASN A OD1 1 
ATOM   102  N ND2 . ASN A 1 36  ? 29.594  38.296  34.311 1.00 59.86  ? 927  ASN A ND2 1 
ATOM   103  N N   . VAL A 1 37  ? 28.840  34.334  30.623 1.00 60.47  ? 928  VAL A N   1 
ATOM   104  C CA  . VAL A 1 37  ? 28.506  33.026  30.108 1.00 57.28  ? 928  VAL A CA  1 
ATOM   105  C C   . VAL A 1 37  ? 29.527  32.653  29.038 1.00 55.52  ? 928  VAL A C   1 
ATOM   106  O O   . VAL A 1 37  ? 30.055  31.547  28.989 1.00 54.71  ? 928  VAL A O   1 
ATOM   107  C CB  . VAL A 1 37  ? 27.086  33.095  29.501 1.00 55.37  ? 928  VAL A CB  1 
ATOM   108  C CG1 . VAL A 1 37  ? 26.809  31.847  28.668 1.00 51.67  ? 928  VAL A CG1 1 
ATOM   109  C CG2 . VAL A 1 37  ? 26.051  33.254  30.608 1.00 49.30  ? 928  VAL A CG2 1 
ATOM   110  N N   . THR A 1 38  ? 29.790  33.580  28.135 1.00 50.54  ? 929  THR A N   1 
ATOM   111  C CA  . THR A 1 38  ? 30.657  33.240  27.034 1.00 48.40  ? 929  THR A CA  1 
ATOM   112  C C   . THR A 1 38  ? 32.025  32.868  27.568 1.00 50.06  ? 929  THR A C   1 
ATOM   113  O O   . THR A 1 38  ? 32.689  31.983  27.051 1.00 50.60  ? 929  THR A O   1 
ATOM   114  C CB  . THR A 1 38  ? 30.743  34.417  26.101 1.00 45.12  ? 929  THR A CB  1 
ATOM   115  O OG1 . THR A 1 38  ? 29.482  34.527  25.430 1.00 54.51  ? 929  THR A OG1 1 
ATOM   116  C CG2 . THR A 1 38  ? 31.737  34.145  25.003 1.00 43.76  ? 929  THR A CG2 1 
ATOM   117  N N   . GLY A 1 39  ? 32.407  33.505  28.662 1.00 49.52  ? 930  GLY A N   1 
ATOM   118  C CA  . GLY A 1 39  ? 33.677  33.215  29.278 1.00 47.98  ? 930  GLY A CA  1 
ATOM   119  C C   . GLY A 1 39  ? 33.581  31.882  29.963 1.00 49.40  ? 930  GLY A C   1 
ATOM   120  O O   . GLY A 1 39  ? 34.494  31.085  29.884 1.00 54.34  ? 930  GLY A O   1 
ATOM   121  N N   . LEU A 1 40  ? 32.493  31.611  30.663 1.00 47.88  ? 931  LEU A N   1 
ATOM   122  C CA  . LEU A 1 40  ? 32.406  30.355  31.393 1.00 47.66  ? 931  LEU A CA  1 
ATOM   123  C C   . LEU A 1 40  ? 32.379  29.225  30.406 1.00 47.54  ? 931  LEU A C   1 
ATOM   124  O O   . LEU A 1 40  ? 32.959  28.193  30.663 1.00 47.78  ? 931  LEU A O   1 
ATOM   125  C CB  . LEU A 1 40  ? 31.129  30.289  32.209 1.00 48.82  ? 931  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 40  ? 30.810  28.945  32.855 1.00 49.51  ? 931  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 40  ? 32.004  28.411  33.620 1.00 52.72  ? 931  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 40  ? 29.610  29.166  33.787 1.00 45.69  ? 931  LEU A CD2 1 
ATOM   129  N N   . VAL A 1 41  ? 31.688  29.432  29.294 1.00 48.55  ? 932  VAL A N   1 
ATOM   130  C CA  . VAL A 1 41  ? 31.661  28.450  28.229 1.00 51.65  ? 932  VAL A CA  1 
ATOM   131  C C   . VAL A 1 41  ? 32.992  28.332  27.515 1.00 53.92  ? 932  VAL A C   1 
ATOM   132  O O   . VAL A 1 41  ? 33.325  27.254  27.042 1.00 58.22  ? 932  VAL A O   1 
ATOM   133  C CB  . VAL A 1 41  ? 30.573  28.766  27.202 1.00 52.55  ? 932  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 41  ? 30.680  27.880  25.941 1.00 48.65  ? 932  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 41  ? 29.216  28.613  27.874 1.00 50.89  ? 932  VAL A CG2 1 
ATOM   136  N N   . LYS A 1 42  ? 33.739  29.416  27.381 1.00 52.80  ? 933  LYS A N   1 
ATOM   137  C CA  . LYS A 1 42  ? 35.026  29.317  26.708 1.00 52.28  ? 933  LYS A CA  1 
ATOM   138  C C   . LYS A 1 42  ? 35.946  28.545  27.639 1.00 52.91  ? 933  LYS A C   1 
ATOM   139  O O   . LYS A 1 42  ? 36.935  27.947  27.237 1.00 57.48  ? 933  LYS A O   1 
ATOM   140  C CB  . LYS A 1 42  ? 35.627  30.700  26.434 1.00 52.09  ? 933  LYS A CB  1 
ATOM   141  C CG  . LYS A 1 42  ? 35.357  31.287  25.046 1.00 54.78  ? 933  LYS A CG  1 
ATOM   142  C CD  . LYS A 1 42  ? 36.176  32.551  24.767 1.00 62.12  ? 933  LYS A CD  1 
ATOM   143  C CE  . LYS A 1 42  ? 35.869  33.168  23.393 1.00 67.09  ? 933  LYS A CE  1 
ATOM   144  N NZ  . LYS A 1 42  ? 35.445  34.600  23.479 1.00 66.50  ? 933  LYS A NZ  1 
ATOM   145  N N   . ALA A 1 43  ? 35.618  28.577  28.918 1.00 50.77  ? 934  ALA A N   1 
ATOM   146  C CA  . ALA A 1 43  ? 36.567  28.137  29.921 1.00 48.56  ? 934  ALA A CA  1 
ATOM   147  C C   . ALA A 1 43  ? 36.479  26.642  29.967 1.00 48.51  ? 934  ALA A C   1 
ATOM   148  O O   . ALA A 1 43  ? 37.459  25.983  30.279 1.00 50.54  ? 934  ALA A O   1 
ATOM   149  C CB  . ALA A 1 43  ? 36.187  28.675  31.278 1.00 44.18  ? 934  ALA A CB  1 
ATOM   150  N N   . VAL A 1 44  ? 35.247  26.174  29.832 1.00 47.06  ? 935  VAL A N   1 
ATOM   151  C CA  . VAL A 1 44  ? 34.909  24.767  29.821 1.00 45.37  ? 935  VAL A CA  1 
ATOM   152  C C   . VAL A 1 44  ? 35.495  24.153  28.563 1.00 51.44  ? 935  VAL A C   1 
ATOM   153  O O   . VAL A 1 44  ? 35.915  23.008  28.554 1.00 51.98  ? 935  VAL A O   1 
ATOM   154  C CB  . VAL A 1 44  ? 33.370  24.622  29.807 1.00 43.01  ? 935  VAL A CB  1 
ATOM   155  C CG1 . VAL A 1 44  ? 32.923  23.251  29.335 1.00 36.34  ? 935  VAL A CG1 1 
ATOM   156  C CG2 . VAL A 1 44  ? 32.853  24.843  31.200 1.00 39.37  ? 935  VAL A CG2 1 
ATOM   157  N N   . ILE A 1 45  ? 35.480  24.903  27.474 1.00 51.04  ? 936  ILE A N   1 
ATOM   158  C CA  . ILE A 1 45  ? 36.012  24.386  26.229 1.00 49.74  ? 936  ILE A CA  1 
ATOM   159  C C   . ILE A 1 45  ? 37.535  24.276  26.247 1.00 53.63  ? 936  ILE A C   1 
ATOM   160  O O   . ILE A 1 45  ? 38.107  23.383  25.633 1.00 53.07  ? 936  ILE A O   1 
ATOM   161  C CB  . ILE A 1 45  ? 35.640  25.337  25.104 1.00 45.00  ? 936  ILE A CB  1 
ATOM   162  C CG1 . ILE A 1 45  ? 34.228  25.049  24.619 1.00 38.20  ? 936  ILE A CG1 1 
ATOM   163  C CG2 . ILE A 1 45  ? 36.654  25.235  23.983 1.00 40.50  ? 936  ILE A CG2 1 
ATOM   164  C CD1 . ILE A 1 45  ? 33.674  26.184  23.812 1.00 37.38  ? 936  ILE A CD1 1 
ATOM   165  N N   . GLU A 1 46  ? 38.210  25.245  26.855 1.00 58.17  ? 937  GLU A N   1 
ATOM   166  C CA  . GLU A 1 46  ? 39.657  25.179  26.855 1.00 61.59  ? 937  GLU A CA  1 
ATOM   167  C C   . GLU A 1 46  ? 39.960  23.908  27.640 1.00 60.09  ? 937  GLU A C   1 
ATOM   168  O O   . GLU A 1 46  ? 40.788  23.120  27.192 1.00 64.14  ? 937  GLU A O   1 
ATOM   169  C CB  . GLU A 1 46  ? 40.355  26.433  27.408 1.00 62.12  ? 937  GLU A CB  1 
ATOM   170  C CG  . GLU A 1 46  ? 41.877  26.419  27.218 1.00 73.70  ? 937  GLU A CG  1 
ATOM   171  C CD  . GLU A 1 46  ? 42.658  27.240  28.244 1.00 84.49  ? 937  GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 46  ? 42.226  28.366  28.594 1.00 91.60  ? 937  GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 46  ? 43.755  26.803  28.678 1.00 87.43  ? 937  GLU A OE2 1 
ATOM   174  N N   . MET A 1 47  ? 39.276  23.676  28.755 1.00 54.10  ? 938  MET A N   1 
ATOM   175  C CA  . MET A 1 47  ? 39.562  22.511  29.579 1.00 49.80  ? 938  MET A CA  1 
ATOM   176  C C   . MET A 1 47  ? 39.272  21.236  28.817 1.00 49.35  ? 938  MET A C   1 
ATOM   177  O O   . MET A 1 47  ? 40.002  20.263  28.880 1.00 50.22  ? 938  MET A O   1 
ATOM   178  C CB  . MET A 1 47  ? 38.667  22.492  30.806 1.00 52.47  ? 938  MET A CB  1 
ATOM   179  C CG  . MET A 1 47  ? 39.097  21.529  31.907 1.00 52.95  ? 938  MET A CG  1 
ATOM   180  S SD  . MET A 1 47  ? 37.782  20.605  32.739 1.00 56.03  ? 938  MET A SD  1 
ATOM   181  C CE  . MET A 1 47  ? 36.429  21.696  32.757 1.00 55.25  ? 938  MET A CE  1 
ATOM   182  N N   . SER A 1 48  ? 38.172  21.239  28.086 1.00 49.08  ? 939  SER A N   1 
ATOM   183  C CA  . SER A 1 48  ? 37.664  20.021  27.496 1.00 46.40  ? 939  SER A CA  1 
ATOM   184  C C   . SER A 1 48  ? 38.645  19.653  26.419 1.00 47.49  ? 939  SER A C   1 
ATOM   185  O O   . SER A 1 48  ? 38.992  18.494  26.253 1.00 50.36  ? 939  SER A O   1 
ATOM   186  C CB  . SER A 1 48  ? 36.276  20.256  26.905 1.00 44.32  ? 939  SER A CB  1 
ATOM   187  O OG  . SER A 1 48  ? 35.304  20.361  27.930 1.00 44.58  ? 939  SER A OG  1 
ATOM   188  N N   . SER A 1 49  ? 39.115  20.652  25.690 1.00 48.60  ? 940  SER A N   1 
ATOM   189  C CA  . SER A 1 49  ? 39.948  20.394  24.535 1.00 51.24  ? 940  SER A CA  1 
ATOM   190  C C   . SER A 1 49  ? 41.372  20.029  24.949 1.00 55.38  ? 940  SER A C   1 
ATOM   191  O O   . SER A 1 49  ? 42.140  19.527  24.128 1.00 56.68  ? 940  SER A O   1 
ATOM   192  C CB  . SER A 1 49  ? 39.917  21.627  23.647 1.00 51.15  ? 940  SER A CB  1 
ATOM   193  O OG  . SER A 1 49  ? 40.575  22.687  24.318 1.00 56.15  ? 940  SER A OG  1 
ATOM   194  N N   . LYS A 1 50  ? 41.700  20.205  26.229 1.00 59.54  ? 941  LYS A N   1 
ATOM   195  C CA  . LYS A 1 50  ? 43.075  20.077  26.724 1.00 63.49  ? 941  LYS A CA  1 
ATOM   196  C C   . LYS A 1 50  ? 43.304  18.839  27.577 1.00 64.95  ? 941  LYS A C   1 
ATOM   197  O O   . LYS A 1 50  ? 44.439  18.523  27.937 1.00 62.84  ? 941  LYS A O   1 
ATOM   198  C CB  . LYS A 1 50  ? 43.477  21.299  27.569 1.00 63.43  ? 941  LYS A CB  1 
ATOM   199  C CG  . LYS A 1 50  ? 43.800  22.534  26.750 1.00 67.99  ? 941  LYS A CG  1 
ATOM   200  C CD  . LYS A 1 50  ? 44.934  23.357  27.305 1.00 72.63  ? 941  LYS A CD  1 
ATOM   201  C CE  . LYS A 1 50  ? 45.433  24.313  26.227 1.00 70.27  ? 941  LYS A CE  1 
ATOM   202  N NZ  . LYS A 1 50  ? 45.214  25.721  26.654 1.00 76.23  ? 941  LYS A NZ  1 
ATOM   203  N N   . ILE A 1 51  ? 42.222  18.186  27.969 1.00 66.49  ? 942  ILE A N   1 
ATOM   204  C CA  . ILE A 1 51  ? 42.305  17.392  29.179 1.00 72.09  ? 942  ILE A CA  1 
ATOM   205  C C   . ILE A 1 51  ? 43.008  16.058  28.959 1.00 77.44  ? 942  ILE A C   1 
ATOM   206  O O   . ILE A 1 51  ? 43.799  15.646  29.816 1.00 78.00  ? 942  ILE A O   1 
ATOM   207  C CB  . ILE A 1 51  ? 40.931  17.200  29.860 1.00 70.80  ? 942  ILE A CB  1 
ATOM   208  C CG1 . ILE A 1 51  ? 41.138  16.590  31.250 1.00 68.76  ? 942  ILE A CG1 1 
ATOM   209  C CG2 . ILE A 1 51  ? 40.051  16.300  29.034 1.00 68.28  ? 942  ILE A CG2 1 
ATOM   210  C CD1 . ILE A 1 51  ? 40.643  17.424  32.387 1.00 69.25  ? 942  ILE A CD1 1 
ATOM   211  N N   . GLN A 1 52  ? 42.730  15.377  27.847 1.00 81.02  ? 943  GLN A N   1 
ATOM   212  C CA  . GLN A 1 52  ? 43.180  13.993  27.734 1.00 83.56  ? 943  GLN A CA  1 
ATOM   213  C C   . GLN A 1 52  ? 44.710  13.901  27.867 1.00 80.20  ? 943  GLN A C   1 
ATOM   214  O O   . GLN A 1 52  ? 45.211  13.215  28.762 1.00 83.92  ? 943  GLN A O   1 
ATOM   215  C CB  . GLN A 1 52  ? 42.618  13.324  26.474 1.00 91.00  ? 943  GLN A CB  1 
ATOM   216  C CG  . GLN A 1 52  ? 42.331  11.809  26.587 1.00 102.12 ? 943  GLN A CG  1 
ATOM   217  C CD  . GLN A 1 52  ? 42.053  11.106  25.228 1.00 108.18 ? 943  GLN A CD  1 
ATOM   218  O OE1 . GLN A 1 52  ? 42.394  11.621  24.141 1.00 106.65 ? 943  GLN A OE1 1 
ATOM   219  N NE2 . GLN A 1 52  ? 41.406  9.934   25.299 1.00 107.27 ? 943  GLN A NE2 1 
ATOM   220  N N   . PRO A 1 53  ? 45.470  14.636  27.065 1.00 74.79  ? 944  PRO A N   1 
ATOM   221  C CA  . PRO A 1 53  ? 46.917  14.719  27.256 1.00 73.64  ? 944  PRO A CA  1 
ATOM   222  C C   . PRO A 1 53  ? 47.442  15.119  28.625 1.00 74.26  ? 944  PRO A C   1 
ATOM   223  O O   . PRO A 1 53  ? 48.645  14.975  28.841 1.00 79.09  ? 944  PRO A O   1 
ATOM   224  C CB  . PRO A 1 53  ? 47.318  15.799  26.257 1.00 75.53  ? 944  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 53  ? 46.354  15.622  25.121 1.00 75.89  ? 944  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 53  ? 45.062  15.334  25.837 1.00 76.44  ? 944  PRO A CD  1 
ATOM   227  N N   . ALA A 1 54  ? 46.605  15.612  29.530 1.00 69.35  ? 945  ALA A N   1 
ATOM   228  C CA  . ALA A 1 54  ? 47.103  16.490  30.574 1.00 63.72  ? 945  ALA A CA  1 
ATOM   229  C C   . ALA A 1 54  ? 47.188  15.863  31.957 1.00 65.51  ? 945  ALA A C   1 
ATOM   230  O O   . ALA A 1 54  ? 46.280  15.155  32.394 1.00 67.66  ? 945  ALA A O   1 
ATOM   231  C CB  . ALA A 1 54  ? 46.236  17.715  30.619 1.00 61.17  ? 945  ALA A CB  1 
ATOM   232  N N   . PRO A 1 55  ? 48.260  16.191  32.668 1.00 64.55  ? 946  PRO A N   1 
ATOM   233  C CA  . PRO A 1 55  ? 48.399  15.869  34.094 1.00 66.82  ? 946  PRO A CA  1 
ATOM   234  C C   . PRO A 1 55  ? 47.497  16.667  35.049 1.00 71.44  ? 946  PRO A C   1 
ATOM   235  O O   . PRO A 1 55  ? 46.992  17.724  34.661 1.00 71.45  ? 946  PRO A O   1 
ATOM   236  C CB  . PRO A 1 55  ? 49.860  16.210  34.397 1.00 62.01  ? 946  PRO A CB  1 
ATOM   237  C CG  . PRO A 1 55  ? 50.332  17.061  33.291 1.00 60.65  ? 946  PRO A CG  1 
ATOM   238  C CD  . PRO A 1 55  ? 49.426  16.902  32.123 1.00 61.38  ? 946  PRO A CD  1 
ATOM   239  N N   . PRO A 1 56  ? 47.305  16.164  36.271 1.00 73.82  ? 947  PRO A N   1 
ATOM   240  C CA  . PRO A 1 56  ? 46.671  16.881  37.383 1.00 74.62  ? 947  PRO A CA  1 
ATOM   241  C C   . PRO A 1 56  ? 47.094  18.327  37.631 1.00 77.59  ? 947  PRO A C   1 
ATOM   242  O O   . PRO A 1 56  ? 46.264  19.148  38.031 1.00 78.02  ? 947  PRO A O   1 
ATOM   243  C CB  . PRO A 1 56  ? 47.091  16.030  38.584 1.00 72.05  ? 947  PRO A CB  1 
ATOM   244  C CG  . PRO A 1 56  ? 47.082  14.654  38.080 1.00 71.16  ? 947  PRO A CG  1 
ATOM   245  C CD  . PRO A 1 56  ? 47.598  14.774  36.668 1.00 75.18  ? 947  PRO A CD  1 
ATOM   246  N N   . GLU A 1 57  ? 48.382  18.605  37.451 1.00 80.04  ? 948  GLU A N   1 
ATOM   247  C CA  . GLU A 1 57  ? 48.966  19.908  37.779 1.00 82.51  ? 948  GLU A CA  1 
ATOM   248  C C   . GLU A 1 57  ? 48.555  20.926  36.716 1.00 82.65  ? 948  GLU A C   1 
ATOM   249  O O   . GLU A 1 57  ? 48.493  22.122  37.014 1.00 82.93  ? 948  GLU A O   1 
ATOM   250  C CB  . GLU A 1 57  ? 50.505  19.868  37.861 1.00 87.69  ? 948  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 57  ? 51.146  18.660  38.551 1.00 97.86  ? 948  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 57  ? 51.359  17.465  37.620 1.00 102.29 ? 948  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 57  ? 52.257  17.517  36.743 1.00 104.74 ? 948  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 57  ? 50.602  16.470  37.749 1.00 101.85 ? 948  GLU A OE2 1 
ATOM   255  N N   . GLU A 1 58  ? 48.318  20.451  35.490 1.00 79.95  ? 949  GLU A N   1 
ATOM   256  C CA  . GLU A 1 58  ? 47.674  21.243  34.443 1.00 74.79  ? 949  GLU A CA  1 
ATOM   257  C C   . GLU A 1 58  ? 46.148  21.271  34.543 1.00 71.57  ? 949  GLU A C   1 
ATOM   258  O O   . GLU A 1 58  ? 45.566  22.313  34.282 1.00 73.07  ? 949  GLU A O   1 
ATOM   259  C CB  . GLU A 1 58  ? 48.106  20.806  33.040 1.00 77.57  ? 949  GLU A CB  1 
ATOM   260  C CG  . GLU A 1 58  ? 49.611  20.629  32.854 1.00 81.88  ? 949  GLU A CG  1 
ATOM   261  C CD  . GLU A 1 58  ? 50.075  20.599  31.403 1.00 85.29  ? 949  GLU A CD  1 
ATOM   262  O OE1 . GLU A 1 58  ? 49.210  20.581  30.499 1.00 86.16  ? 949  GLU A OE1 1 
ATOM   263  O OE2 . GLU A 1 58  ? 51.304  20.634  31.149 1.00 85.13  ? 949  GLU A OE2 1 
ATOM   264  N N   . TYR A 1 59  ? 45.470  20.207  34.960 1.00 64.27  ? 950  TYR A N   1 
ATOM   265  C CA  . TYR A 1 59  ? 44.019  20.271  34.893 1.00 63.34  ? 950  TYR A CA  1 
ATOM   266  C C   . TYR A 1 59  ? 43.292  20.879  36.077 1.00 62.28  ? 950  TYR A C   1 
ATOM   267  O O   . TYR A 1 59  ? 42.125  21.263  35.979 1.00 62.98  ? 950  TYR A O   1 
ATOM   268  C CB  . TYR A 1 59  ? 43.347  18.975  34.432 1.00 66.69  ? 950  TYR A CB  1 
ATOM   269  C CG  . TYR A 1 59  ? 43.505  17.703  35.228 1.00 72.30  ? 950  TYR A CG  1 
ATOM   270  C CD1 . TYR A 1 59  ? 42.810  17.499  36.410 1.00 71.00  ? 950  TYR A CD1 1 
ATOM   271  C CD2 . TYR A 1 59  ? 44.196  16.621  34.682 1.00 76.88  ? 950  TYR A CD2 1 
ATOM   272  C CE1 . TYR A 1 59  ? 42.913  16.292  37.087 1.00 72.17  ? 950  TYR A CE1 1 
ATOM   273  C CE2 . TYR A 1 59  ? 44.305  15.413  35.351 1.00 77.48  ? 950  TYR A CE2 1 
ATOM   274  C CZ  . TYR A 1 59  ? 43.654  15.251  36.555 1.00 74.93  ? 950  TYR A CZ  1 
ATOM   275  O OH  . TYR A 1 59  ? 43.750  14.030  37.194 1.00 75.83  ? 950  TYR A OH  1 
ATOM   276  N N   . VAL A 1 60  ? 43.972  21.003  37.204 1.00 58.23  ? 951  VAL A N   1 
ATOM   277  C CA  . VAL A 1 60  ? 43.305  21.622  38.339 1.00 56.15  ? 951  VAL A CA  1 
ATOM   278  C C   . VAL A 1 60  ? 43.160  23.138  38.126 1.00 55.08  ? 951  VAL A C   1 
ATOM   279  O O   . VAL A 1 60  ? 42.111  23.719  38.375 1.00 58.81  ? 951  VAL A O   1 
ATOM   280  C CB  . VAL A 1 60  ? 44.034  21.242  39.634 1.00 55.65  ? 951  VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 60  ? 43.628  22.154  40.764 1.00 50.70  ? 951  VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 60  ? 43.784  19.777  39.980 1.00 47.37  ? 951  VAL A CG2 1 
ATOM   283  N N   . PRO A 1 61  ? 44.196  23.810  37.644 1.00 51.46  ? 952  PRO A N   1 
ATOM   284  C CA  . PRO A 1 61  ? 44.073  25.216  37.263 1.00 53.46  ? 952  PRO A CA  1 
ATOM   285  C C   . PRO A 1 61  ? 42.995  25.506  36.241 1.00 54.24  ? 952  PRO A C   1 
ATOM   286  O O   . PRO A 1 61  ? 42.377  26.559  36.322 1.00 56.53  ? 952  PRO A O   1 
ATOM   287  C CB  . PRO A 1 61  ? 45.426  25.534  36.641 1.00 46.92  ? 952  PRO A CB  1 
ATOM   288  C CG  . PRO A 1 61  ? 46.325  24.557  37.175 1.00 44.10  ? 952  PRO A CG  1 
ATOM   289  C CD  . PRO A 1 61  ? 45.590  23.351  37.602 1.00 46.55  ? 952  PRO A CD  1 
ATOM   290  N N   . MET A 1 62  ? 42.909  24.673  35.214 1.00 54.35  ? 953  MET A N   1 
ATOM   291  C CA  . MET A 1 62  ? 41.801  24.681  34.276 1.00 54.17  ? 953  MET A CA  1 
ATOM   292  C C   . MET A 1 62  ? 40.473  24.640  35.036 1.00 54.67  ? 953  MET A C   1 
ATOM   293  O O   . MET A 1 62  ? 39.564  25.399  34.729 1.00 58.61  ? 953  MET A O   1 
ATOM   294  C CB  . MET A 1 62  ? 41.908  23.457  33.367 1.00 54.20  ? 953  MET A CB  1 
ATOM   295  C CG  . MET A 1 62  ? 42.434  23.722  31.971 1.00 59.68  ? 953  MET A CG  1 
ATOM   296  S SD  . MET A 1 62  ? 43.328  22.359  31.102 1.00 66.41  ? 953  MET A SD  1 
ATOM   297  C CE  . MET A 1 62  ? 42.552  20.924  31.699 1.00 64.18  ? 953  MET A CE  1 
ATOM   298  N N   . VAL A 1 63  ? 40.310  23.755  36.007 1.00 50.77  ? 954  VAL A N   1 
ATOM   299  C CA  . VAL A 1 63  ? 39.024  23.709  36.673 1.00 53.72  ? 954  VAL A CA  1 
ATOM   300  C C   . VAL A 1 63  ? 38.842  24.939  37.559 1.00 54.40  ? 954  VAL A C   1 
ATOM   301  O O   . VAL A 1 63  ? 37.722  25.443  37.735 1.00 52.89  ? 954  VAL A O   1 
ATOM   302  C CB  . VAL A 1 63  ? 38.847  22.402  37.472 1.00 52.40  ? 954  VAL A CB  1 
ATOM   303  C CG1 . VAL A 1 63  ? 37.657  22.483  38.391 1.00 53.58  ? 954  VAL A CG1 1 
ATOM   304  C CG2 . VAL A 1 63  ? 38.571  21.264  36.548 1.00 54.55  ? 954  VAL A CG2 1 
ATOM   305  N N   . LYS A 1 64  ? 39.954  25.413  38.119 1.00 54.95  ? 955  LYS A N   1 
ATOM   306  C CA  . LYS A 1 64  ? 39.989  26.694  38.825 1.00 57.01  ? 955  LYS A CA  1 
ATOM   307  C C   . LYS A 1 64  ? 39.430  27.847  37.994 1.00 56.27  ? 955  LYS A C   1 
ATOM   308  O O   . LYS A 1 64  ? 38.582  28.594  38.479 1.00 57.98  ? 955  LYS A O   1 
ATOM   309  C CB  . LYS A 1 64  ? 41.416  27.029  39.261 1.00 58.46  ? 955  LYS A CB  1 
ATOM   310  C CG  . LYS A 1 64  ? 41.652  26.786  40.749 1.00 63.69  ? 955  LYS A CG  1 
ATOM   311  C CD  . LYS A 1 64  ? 43.126  26.634  41.145 1.00 63.45  ? 955  LYS A CD  1 
ATOM   312  C CE  . LYS A 1 64  ? 43.314  25.476  42.125 1.00 60.71  ? 955  LYS A CE  1 
ATOM   313  N NZ  . LYS A 1 64  ? 44.717  25.430  42.594 1.00 59.05  ? 955  LYS A NZ  1 
ATOM   314  N N   . GLU A 1 65  ? 39.867  27.961  36.741 1.00 55.20  ? 956  GLU A N   1 
ATOM   315  C CA  . GLU A 1 65  ? 39.374  29.010  35.851 1.00 58.15  ? 956  GLU A CA  1 
ATOM   316  C C   . GLU A 1 65  ? 37.877  28.888  35.621 1.00 55.15  ? 956  GLU A C   1 
ATOM   317  O O   . GLU A 1 65  ? 37.132  29.863  35.652 1.00 53.44  ? 956  GLU A O   1 
ATOM   318  C CB  . GLU A 1 65  ? 40.115  29.028  34.516 1.00 61.52  ? 956  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 65  ? 41.546  29.516  34.659 1.00 76.38  ? 956  GLU A CG  1 
ATOM   320  C CD  . GLU A 1 65  ? 42.072  30.209  33.415 1.00 89.69  ? 956  GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 65  ? 42.058  29.652  32.277 1.00 91.29  ? 956  GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 65  ? 42.528  31.355  33.626 1.00 96.35  ? 956  GLU A OE2 1 
ATOM   323  N N   . VAL A 1 66  ? 37.448  27.651  35.444 1.00 54.07  ? 957  VAL A N   1 
ATOM   324  C CA  . VAL A 1 66  ? 36.044  27.386  35.241 1.00 50.85  ? 957  VAL A CA  1 
ATOM   325  C C   . VAL A 1 66  ? 35.321  27.936  36.445 1.00 52.47  ? 957  VAL A C   1 
ATOM   326  O O   . VAL A 1 66  ? 34.309  28.587  36.271 1.00 52.84  ? 957  VAL A O   1 
ATOM   327  C CB  . VAL A 1 66  ? 35.765  25.887  35.089 1.00 49.95  ? 957  VAL A CB  1 
ATOM   328  C CG1 . VAL A 1 66  ? 34.284  25.567  35.237 1.00 47.01  ? 957  VAL A CG1 1 
ATOM   329  C CG2 . VAL A 1 66  ? 36.237  25.447  33.729 1.00 47.38  ? 957  VAL A CG2 1 
ATOM   330  N N   . GLY A 1 67  ? 35.838  27.697  37.643 1.00 51.14  ? 958  GLY A N   1 
ATOM   331  C CA  . GLY A 1 67  ? 35.116  28.064  38.845 1.00 47.48  ? 958  GLY A CA  1 
ATOM   332  C C   . GLY A 1 67  ? 35.133  29.566  38.990 1.00 47.25  ? 958  GLY A C   1 
ATOM   333  O O   . GLY A 1 67  ? 34.153  30.178  39.363 1.00 46.02  ? 958  GLY A O   1 
ATOM   334  N N   . LEU A 1 68  ? 36.246  30.198  38.662 1.00 45.54  ? 959  LEU A N   1 
ATOM   335  C CA  . LEU A 1 68  ? 36.293  31.647  38.768 1.00 46.06  ? 959  LEU A CA  1 
ATOM   336  C C   . LEU A 1 68  ? 35.279  32.293  37.827 1.00 48.36  ? 959  LEU A C   1 
ATOM   337  O O   . LEU A 1 68  ? 34.644  33.302  38.123 1.00 47.00  ? 959  LEU A O   1 
ATOM   338  C CB  . LEU A 1 68  ? 37.704  32.142  38.417 1.00 42.57  ? 959  LEU A CB  1 
ATOM   339  C CG  . LEU A 1 68  ? 37.873  33.615  38.030 1.00 36.11  ? 959  LEU A CG  1 
ATOM   340  C CD1 . LEU A 1 68  ? 37.454  34.504  39.160 1.00 31.73  ? 959  LEU A CD1 1 
ATOM   341  C CD2 . LEU A 1 68  ? 39.310  33.840  37.739 1.00 32.59  ? 959  LEU A CD2 1 
ATOM   342  N N   . ALA A 1 69  ? 35.208  31.740  36.628 1.00 48.82  ? 960  ALA A N   1 
ATOM   343  C CA  . ALA A 1 69  ? 34.303  32.286  35.639 1.00 50.75  ? 960  ALA A CA  1 
ATOM   344  C C   . ALA A 1 69  ? 32.870  32.096  36.096 1.00 49.31  ? 960  ALA A C   1 
ATOM   345  O O   . ALA A 1 69  ? 31.998  32.913  35.859 1.00 50.43  ? 960  ALA A O   1 
ATOM   346  C CB  . ALA A 1 69  ? 34.530  31.617  34.317 1.00 46.27  ? 960  ALA A CB  1 
ATOM   347  N N   . LEU A 1 70  ? 32.631  31.001  36.783 1.00 50.42  ? 961  LEU A N   1 
ATOM   348  C CA  . LEU A 1 70  ? 31.301  30.743  37.263 1.00 52.59  ? 961  LEU A CA  1 
ATOM   349  C C   . LEU A 1 70  ? 30.998  31.777  38.321 1.00 54.49  ? 961  LEU A C   1 
ATOM   350  O O   . LEU A 1 70  ? 29.861  32.268  38.422 1.00 55.61  ? 961  LEU A O   1 
ATOM   351  C CB  . LEU A 1 70  ? 31.215  29.346  37.867 1.00 46.68  ? 961  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 70  ? 29.806  29.127  38.408 1.00 48.23  ? 961  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 70  ? 28.685  29.438  37.422 1.00 44.90  ? 961  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 70  ? 29.695  27.695  38.884 1.00 51.55  ? 961  LEU A CD2 1 
ATOM   355  N N   . ARG A 1 71  ? 31.996  32.033  39.162 1.00 53.70  ? 962  ARG A N   1 
ATOM   356  C CA  . ARG A 1 71  ? 31.761  32.863  40.341 1.00 52.23  ? 962  ARG A CA  1 
ATOM   357  C C   . ARG A 1 71  ? 31.382  34.252  39.830 1.00 50.90  ? 962  ARG A C   1 
ATOM   358  O O   . ARG A 1 71  ? 30.396  34.829  40.252 1.00 50.89  ? 962  ARG A O   1 
ATOM   359  C CB  . ARG A 1 71  ? 32.989  32.915  41.261 1.00 50.76  ? 962  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 71  ? 32.947  31.882  42.364 1.00 50.27  ? 962  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 71  ? 33.981  32.055  43.463 1.00 49.20  ? 962  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 71  ? 35.348  32.129  42.960 1.00 52.32  ? 962  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 71  ? 36.063  31.081  42.575 1.00 56.43  ? 962  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 71  ? 35.481  29.887  42.568 1.00 56.62  ? 962  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 71  ? 37.299  31.238  42.101 1.00 52.31  ? 962  ARG A NH2 1 
ATOM   366  N N   . THR A 1 72  ? 32.130  34.729  38.847 1.00 48.95  ? 963  THR A N   1 
ATOM   367  C CA  . THR A 1 72  ? 31.933  36.043  38.260 1.00 51.29  ? 963  THR A CA  1 
ATOM   368  C C   . THR A 1 72  ? 30.523  36.146  37.708 1.00 53.09  ? 963  THR A C   1 
ATOM   369  O O   . THR A 1 72  ? 29.950  37.219  37.672 1.00 54.72  ? 963  THR A O   1 
ATOM   370  C CB  . THR A 1 72  ? 32.908  36.235  37.074 1.00 50.72  ? 963  THR A CB  1 
ATOM   371  O OG1 . THR A 1 72  ? 34.263  36.375  37.514 1.00 53.56  ? 963  THR A OG1 1 
ATOM   372  C CG2 . THR A 1 72  ? 32.626  37.522  36.338 1.00 44.04  ? 963  THR A CG2 1 
ATOM   373  N N   . LEU A 1 73  ? 30.022  35.053  37.150 1.00 57.31  ? 964  LEU A N   1 
ATOM   374  C CA  . LEU A 1 73  ? 28.795  35.057  36.364 1.00 54.44  ? 964  LEU A CA  1 
ATOM   375  C C   . LEU A 1 73  ? 27.669  35.154  37.359 1.00 56.77  ? 964  LEU A C   1 
ATOM   376  O O   . LEU A 1 73  ? 26.676  35.835  37.147 1.00 58.78  ? 964  LEU A O   1 
ATOM   377  C CB  . LEU A 1 73  ? 28.622  33.728  35.637 1.00 50.21  ? 964  LEU A CB  1 
ATOM   378  C CG  . LEU A 1 73  ? 27.215  33.482  35.102 1.00 48.36  ? 964  LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 73  ? 26.842  34.567  34.126 1.00 46.28  ? 964  LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 73  ? 27.203  32.162  34.380 1.00 40.63  ? 964  LEU A CD2 1 
ATOM   381  N N   . LEU A 1 74  ? 27.829  34.424  38.450 1.00 57.33  ? 965  LEU A N   1 
ATOM   382  C CA  . LEU A 1 74  ? 26.737  34.336  39.391 1.00 57.78  ? 965  LEU A CA  1 
ATOM   383  C C   . LEU A 1 74  ? 26.614  35.679  40.096 1.00 58.98  ? 965  LEU A C   1 
ATOM   384  O O   . LEU A 1 74  ? 25.514  36.076  40.467 1.00 58.92  ? 965  LEU A O   1 
ATOM   385  C CB  . LEU A 1 74  ? 26.986  33.191  40.373 1.00 54.62  ? 965  LEU A CB  1 
ATOM   386  C CG  . LEU A 1 74  ? 26.964  31.753  39.862 1.00 52.10  ? 965  LEU A CG  1 
ATOM   387  C CD1 . LEU A 1 74  ? 27.058  30.815  41.046 1.00 49.69  ? 965  LEU A CD1 1 
ATOM   388  C CD2 . LEU A 1 74  ? 25.713  31.415  39.077 1.00 50.12  ? 965  LEU A CD2 1 
ATOM   389  N N   . ALA A 1 75  ? 27.732  36.383  40.254 1.00 58.56  ? 966  ALA A N   1 
ATOM   390  C CA  . ALA A 1 75  ? 27.728  37.702  40.878 1.00 56.18  ? 966  ALA A CA  1 
ATOM   391  C C   . ALA A 1 75  ? 27.006  38.668  39.944 1.00 57.29  ? 966  ALA A C   1 
ATOM   392  O O   . ALA A 1 75  ? 25.989  39.254  40.273 1.00 60.58  ? 966  ALA A O   1 
ATOM   393  C CB  . ALA A 1 75  ? 29.140  38.184  41.138 1.00 49.86  ? 966  ALA A CB  1 
ATOM   394  N N   . THR A 1 76  ? 27.480  38.796  38.720 1.00 55.47  ? 967  THR A N   1 
ATOM   395  C CA  . THR A 1 76  ? 26.710  39.542  37.747 1.00 56.32  ? 967  THR A CA  1 
ATOM   396  C C   . THR A 1 76  ? 25.226  39.188  37.754 1.00 58.51  ? 967  THR A C   1 
ATOM   397  O O   . THR A 1 76  ? 24.388  40.068  37.583 1.00 59.67  ? 967  THR A O   1 
ATOM   398  C CB  . THR A 1 76  ? 27.302  39.263  36.382 1.00 54.83  ? 967  THR A CB  1 
ATOM   399  O OG1 . THR A 1 76  ? 28.648  39.735  36.351 1.00 58.46  ? 967  THR A OG1 1 
ATOM   400  C CG2 . THR A 1 76  ? 26.638  40.069  35.320 1.00 54.67  ? 967  THR A CG2 1 
ATOM   401  N N   . VAL A 1 77  ? 24.858  37.923  37.917 1.00 58.65  ? 968  VAL A N   1 
ATOM   402  C CA  . VAL A 1 77  ? 23.438  37.617  37.819 1.00 62.33  ? 968  VAL A CA  1 
ATOM   403  C C   . VAL A 1 77  ? 22.744  38.113  39.082 1.00 65.97  ? 968  VAL A C   1 
ATOM   404  O O   . VAL A 1 77  ? 21.593  38.567  39.060 1.00 65.19  ? 968  VAL A O   1 
ATOM   405  C CB  . VAL A 1 77  ? 23.163  36.121  37.632 1.00 61.32  ? 968  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 77  ? 21.669  35.854  37.693 1.00 60.26  ? 968  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 77  ? 23.672  35.654  36.286 1.00 65.84  ? 968  VAL A CG2 1 
ATOM   408  N N   . ASP A 1 78  ? 23.454  37.983  40.196 1.00 68.36  ? 969  ASP A N   1 
ATOM   409  C CA  . ASP A 1 78  ? 22.946  38.451  41.472 1.00 70.11  ? 969  ASP A CA  1 
ATOM   410  C C   . ASP A 1 78  ? 22.608  39.938  41.347 1.00 71.65  ? 969  ASP A C   1 
ATOM   411  O O   . ASP A 1 78  ? 21.659  40.422  41.948 1.00 76.36  ? 969  ASP A O   1 
ATOM   412  C CB  . ASP A 1 78  ? 23.988  38.233  42.573 1.00 72.87  ? 969  ASP A CB  1 
ATOM   413  C CG  . ASP A 1 78  ? 23.959  36.827  43.171 1.00 80.61  ? 969  ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 78  ? 22.949  36.082  43.067 1.00 82.03  ? 969  ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 78  ? 24.945  36.411  43.822 1.00 82.48  ? 969  ASP A OD2 1 
ATOM   416  N N   . GLU A 1 79  ? 23.340  40.688  40.537 1.00 70.33  ? 970  GLU A N   1 
ATOM   417  C CA  . GLU A 1 79  ? 23.095  42.120  40.463 1.00 66.03  ? 970  GLU A CA  1 
ATOM   418  C C   . GLU A 1 79  ? 22.023  42.457  39.471 1.00 66.24  ? 970  GLU A C   1 
ATOM   419  O O   . GLU A 1 79  ? 21.492  43.556  39.492 1.00 67.68  ? 970  GLU A O   1 
ATOM   420  C CB  . GLU A 1 79  ? 24.335  42.829  39.978 1.00 66.42  ? 970  GLU A CB  1 
ATOM   421  C CG  . GLU A 1 79  ? 25.308  43.011  41.111 1.00 75.72  ? 970  GLU A CG  1 
ATOM   422  C CD  . GLU A 1 79  ? 26.478  43.811  40.616 1.00 85.59  ? 970  GLU A CD  1 
ATOM   423  O OE1 . GLU A 1 79  ? 26.650  43.871  39.374 1.00 86.30  ? 970  GLU A OE1 1 
ATOM   424  O OE2 . GLU A 1 79  ? 27.156  44.410  41.479 1.00 93.42  ? 970  GLU A OE2 1 
ATOM   425  N N   . THR A 1 80  ? 21.822  41.562  38.516 1.00 66.62  ? 971  THR A N   1 
ATOM   426  C CA  . THR A 1 80  ? 20.878  41.824  37.449 1.00 65.56  ? 971  THR A CA  1 
ATOM   427  C C   . THR A 1 80  ? 19.466  41.513  37.883 1.00 65.70  ? 971  THR A C   1 
ATOM   428  O O   . THR A 1 80  ? 18.542  41.908  37.203 1.00 67.53  ? 971  THR A O   1 
ATOM   429  C CB  . THR A 1 80  ? 21.231  40.996  36.212 1.00 63.56  ? 971  THR A CB  1 
ATOM   430  O OG1 . THR A 1 80  ? 22.454  41.490  35.644 1.00 65.66  ? 971  THR A OG1 1 
ATOM   431  C CG2 . THR A 1 80  ? 20.169  41.167  35.124 1.00 60.50  ? 971  THR A CG2 1 
ATOM   432  N N   . ILE A 1 81  ? 19.289  40.765  38.963 1.00 68.05  ? 972  ILE A N   1 
ATOM   433  C CA  . ILE A 1 81  ? 17.973  40.207  39.260 1.00 68.34  ? 972  ILE A CA  1 
ATOM   434  C C   . ILE A 1 81  ? 16.985  41.322  39.579 1.00 70.15  ? 972  ILE A C   1 
ATOM   435  O O   . ILE A 1 81  ? 15.907  41.359  38.988 1.00 69.59  ? 972  ILE A O   1 
ATOM   436  C CB  . ILE A 1 81  ? 18.038  39.187  40.423 1.00 67.47  ? 972  ILE A CB  1 
ATOM   437  C CG1 . ILE A 1 81  ? 18.437  37.810  39.899 1.00 62.97  ? 972  ILE A CG1 1 
ATOM   438  C CG2 . ILE A 1 81  ? 16.715  39.122  41.199 1.00 61.52  ? 972  ILE A CG2 1 
ATOM   439  C CD1 . ILE A 1 81  ? 18.791  36.880  41.025 1.00 67.39  ? 972  ILE A CD1 1 
ATOM   440  N N   . PRO A 1 82  ? 17.349  42.199  40.516 1.00 69.55  ? 973  PRO A N   1 
ATOM   441  C CA  . PRO A 1 82  ? 16.511  43.337  40.907 1.00 69.45  ? 973  PRO A CA  1 
ATOM   442  C C   . PRO A 1 82  ? 15.954  44.176  39.763 1.00 67.96  ? 973  PRO A C   1 
ATOM   443  O O   . PRO A 1 82  ? 14.851  44.687  39.912 1.00 71.30  ? 973  PRO A O   1 
ATOM   444  C CB  . PRO A 1 82  ? 17.466  44.168  41.755 1.00 66.12  ? 973  PRO A CB  1 
ATOM   445  C CG  . PRO A 1 82  ? 18.288  43.124  42.420 1.00 65.80  ? 973  PRO A CG  1 
ATOM   446  C CD  . PRO A 1 82  ? 18.587  42.159  41.317 1.00 67.10  ? 973  PRO A CD  1 
ATOM   447  N N   . LEU A 1 83  ? 16.628  44.248  38.625 1.00 65.87  ? 974  LEU A N   1 
ATOM   448  C CA  . LEU A 1 83  ? 16.102  44.981  37.481 1.00 66.79  ? 974  LEU A CA  1 
ATOM   449  C C   . LEU A 1 83  ? 15.110  44.223  36.619 1.00 65.71  ? 974  LEU A C   1 
ATOM   450  O O   . LEU A 1 83  ? 14.830  44.634  35.493 1.00 65.25  ? 974  LEU A O   1 
ATOM   451  C CB  . LEU A 1 83  ? 17.255  45.381  36.568 1.00 68.01  ? 974  LEU A CB  1 
ATOM   452  C CG  . LEU A 1 83  ? 18.567  45.823  37.218 1.00 68.79  ? 974  LEU A CG  1 
ATOM   453  C CD1 . LEU A 1 83  ? 19.521  46.173  36.087 1.00 66.94  ? 974  LEU A CD1 1 
ATOM   454  C CD2 . LEU A 1 83  ? 18.345  46.988  38.182 1.00 68.84  ? 974  LEU A CD2 1 
ATOM   455  N N   . LEU A 1 84  ? 14.631  43.099  37.141 1.00 67.32  ? 975  LEU A N   1 
ATOM   456  C CA  . LEU A 1 84  ? 13.898  42.095  36.379 1.00 68.38  ? 975  LEU A CA  1 
ATOM   457  C C   . LEU A 1 84  ? 12.669  41.660  37.166 1.00 73.14  ? 975  LEU A C   1 
ATOM   458  O O   . LEU A 1 84  ? 12.725  41.535  38.394 1.00 74.90  ? 975  LEU A O   1 
ATOM   459  C CB  . LEU A 1 84  ? 14.743  40.836  36.189 1.00 63.82  ? 975  LEU A CB  1 
ATOM   460  C CG  . LEU A 1 84  ? 15.942  40.865  35.247 1.00 64.35  ? 975  LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 84  ? 16.706  39.561  35.405 1.00 62.97  ? 975  LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 84  ? 15.557  41.096  33.799 1.00 63.23  ? 975  LEU A CD2 1 
ATOM   463  N N   . PRO A 1 85  ? 11.612  41.297  36.447 1.00 74.06  ? 976  PRO A N   1 
ATOM   464  C CA  . PRO A 1 85  ? 10.300  41.081  37.059 1.00 74.30  ? 976  PRO A CA  1 
ATOM   465  C C   . PRO A 1 85  ? 10.378  40.012  38.136 1.00 73.71  ? 976  PRO A C   1 
ATOM   466  O O   . PRO A 1 85  ? 11.057  39.017  37.910 1.00 78.18  ? 976  PRO A O   1 
ATOM   467  C CB  . PRO A 1 85  ? 9.460   40.566  35.889 1.00 75.13  ? 976  PRO A CB  1 
ATOM   468  C CG  . PRO A 1 85  ? 10.153  41.070  34.683 1.00 74.22  ? 976  PRO A CG  1 
ATOM   469  C CD  . PRO A 1 85  ? 11.606  40.950  35.015 1.00 74.22  ? 976  PRO A CD  1 
ATOM   470  N N   . ALA A 1 86  ? 9.713   40.202  39.271 1.00 70.74  ? 977  ALA A N   1 
ATOM   471  C CA  . ALA A 1 86  ? 9.700   39.181  40.313 1.00 69.52  ? 977  ALA A CA  1 
ATOM   472  C C   . ALA A 1 86  ? 9.107   37.861  39.808 1.00 70.59  ? 977  ALA A C   1 
ATOM   473  O O   . ALA A 1 86  ? 9.407   36.790  40.348 1.00 70.44  ? 977  ALA A O   1 
ATOM   474  C CB  . ALA A 1 86  ? 8.978   39.687  41.567 1.00 66.05  ? 977  ALA A CB  1 
ATOM   475  N N   . SER A 1 87  ? 8.306   37.910  38.745 1.00 72.92  ? 978  SER A N   1 
ATOM   476  C CA  . SER A 1 87  ? 7.686   36.675  38.256 1.00 77.08  ? 978  SER A CA  1 
ATOM   477  C C   . SER A 1 87  ? 8.728   35.629  37.838 1.00 76.56  ? 978  SER A C   1 
ATOM   478  O O   . SER A 1 87  ? 8.452   34.428  37.828 1.00 75.51  ? 978  SER A O   1 
ATOM   479  C CB  . SER A 1 87  ? 6.643   36.910  37.146 1.00 78.64  ? 978  SER A CB  1 
ATOM   480  O OG  . SER A 1 87  ? 6.969   37.979  36.278 1.00 80.26  ? 978  SER A OG  1 
ATOM   481  N N   . THR A 1 88  ? 9.937   36.094  37.533 1.00 76.49  ? 979  THR A N   1 
ATOM   482  C CA  . THR A 1 88  ? 10.984  35.244  36.986 1.00 75.66  ? 979  THR A CA  1 
ATOM   483  C C   . THR A 1 88  ? 12.063  34.939  38.002 1.00 80.57  ? 979  THR A C   1 
ATOM   484  O O   . THR A 1 88  ? 12.928  34.114  37.726 1.00 82.61  ? 979  THR A O   1 
ATOM   485  C CB  . THR A 1 88  ? 11.663  35.957  35.837 1.00 71.08  ? 979  THR A CB  1 
ATOM   486  O OG1 . THR A 1 88  ? 12.254  37.150  36.353 1.00 67.46  ? 979  THR A OG1 1 
ATOM   487  C CG2 . THR A 1 88  ? 10.645  36.445  34.819 1.00 73.04  ? 979  THR A CG2 1 
ATOM   488  N N   . HIS A 1 89  ? 12.050  35.603  39.153 1.00 82.31  ? 980  HIS A N   1 
ATOM   489  C CA  . HIS A 1 89  ? 13.206  35.533  40.038 1.00 83.42  ? 980  HIS A CA  1 
ATOM   490  C C   . HIS A 1 89  ? 13.570  34.129  40.484 1.00 86.38  ? 980  HIS A C   1 
ATOM   491  O O   . HIS A 1 89  ? 14.701  33.916  40.904 1.00 89.32  ? 980  HIS A O   1 
ATOM   492  C CB  . HIS A 1 89  ? 13.036  36.392  41.285 1.00 80.95  ? 980  HIS A CB  1 
ATOM   493  C CG  . HIS A 1 89  ? 13.133  37.856  41.013 1.00 81.29  ? 980  HIS A CG  1 
ATOM   494  N ND1 . HIS A 1 89  ? 13.111  38.799  42.016 1.00 83.61  ? 980  HIS A ND1 1 
ATOM   495  C CD2 . HIS A 1 89  ? 13.233  38.543  39.851 1.00 80.87  ? 980  HIS A CD2 1 
ATOM   496  C CE1 . HIS A 1 89  ? 13.204  40.004  41.482 1.00 85.59  ? 980  HIS A CE1 1 
ATOM   497  N NE2 . HIS A 1 89  ? 13.277  39.878  40.169 1.00 82.63  ? 980  HIS A NE2 1 
ATOM   498  N N   . ARG A 1 90  ? 12.641  33.180  40.508 1.00 87.97  ? 981  ARG A N   1 
ATOM   499  C CA  . ARG A 1 90  ? 13.033  31.911  41.105 1.00 89.90  ? 981  ARG A CA  1 
ATOM   500  C C   . ARG A 1 90  ? 13.517  30.956  40.034 1.00 87.74  ? 981  ARG A C   1 
ATOM   501  O O   . ARG A 1 90  ? 14.428  30.181  40.295 1.00 86.88  ? 981  ARG A O   1 
ATOM   502  C CB  . ARG A 1 90  ? 11.982  31.282  42.028 1.00 95.45  ? 981  ARG A CB  1 
ATOM   503  C CG  . ARG A 1 90  ? 12.543  30.915  43.428 1.00 105.11 ? 981  ARG A CG  1 
ATOM   504  C CD  . ARG A 1 90  ? 12.151  29.535  43.998 1.00 110.48 ? 981  ARG A CD  1 
ATOM   505  N NE  . ARG A 1 90  ? 10.847  29.080  43.502 1.00 118.32 ? 981  ARG A NE  1 
ATOM   506  C CZ  . ARG A 1 90  ? 10.508  27.823  43.214 1.00 119.83 ? 981  ARG A CZ  1 
ATOM   507  N NH1 . ARG A 1 90  ? 11.352  26.814  43.409 1.00 120.10 ? 981  ARG A NH1 1 
ATOM   508  N NH2 . ARG A 1 90  ? 9.296   27.574  42.729 1.00 119.70 ? 981  ARG A NH2 1 
ATOM   509  N N   . GLU A 1 91  ? 12.969  31.029  38.826 1.00 86.80  ? 982  GLU A N   1 
ATOM   510  C CA  . GLU A 1 91  ? 13.507  30.197  37.751 1.00 86.68  ? 982  GLU A CA  1 
ATOM   511  C C   . GLU A 1 91  ? 15.020  30.447  37.705 1.00 86.04  ? 982  GLU A C   1 
ATOM   512  O O   . GLU A 1 91  ? 15.817  29.513  37.629 1.00 84.60  ? 982  GLU A O   1 
ATOM   513  C CB  . GLU A 1 91  ? 12.816  30.481  36.407 1.00 87.90  ? 982  GLU A CB  1 
ATOM   514  C CG  . GLU A 1 91  ? 12.400  29.231  35.644 1.00 90.44  ? 982  GLU A CG  1 
ATOM   515  C CD  . GLU A 1 91  ? 12.133  29.484  34.168 1.00 93.76  ? 982  GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 91  ? 11.595  30.561  33.834 1.00 91.98  ? 982  GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 91  ? 12.449  28.609  33.328 1.00 95.44  ? 982  GLU A OE2 1 
ATOM   518  N N   . ILE A 1 92  ? 15.401  31.714  37.851 1.00 85.14  ? 983  ILE A N   1 
ATOM   519  C CA  . ILE A 1 92  ? 16.786  32.161  37.747 1.00 82.10  ? 983  ILE A CA  1 
ATOM   520  C C   . ILE A 1 92  ? 17.567  31.703  38.963 1.00 82.02  ? 983  ILE A C   1 
ATOM   521  O O   . ILE A 1 92  ? 18.699  31.259  38.862 1.00 82.16  ? 983  ILE A O   1 
ATOM   522  C CB  . ILE A 1 92  ? 16.814  33.699  37.670 1.00 78.83  ? 983  ILE A CB  1 
ATOM   523  C CG1 . ILE A 1 92  ? 16.328  34.139  36.289 1.00 73.35  ? 983  ILE A CG1 1 
ATOM   524  C CG2 . ILE A 1 92  ? 18.204  34.252  37.985 1.00 76.49  ? 983  ILE A CG2 1 
ATOM   525  C CD1 . ILE A 1 92  ? 16.254  35.634  36.107 1.00 72.04  ? 983  ILE A CD1 1 
ATOM   526  N N   . GLU A 1 93  ? 16.959  31.837  40.130 1.00 82.77  ? 984  GLU A N   1 
ATOM   527  C CA  . GLU A 1 93  ? 17.602  31.387  41.347 1.00 84.74  ? 984  GLU A CA  1 
ATOM   528  C C   . GLU A 1 93  ? 17.911  29.900  41.240 1.00 83.99  ? 984  GLU A C   1 
ATOM   529  O O   . GLU A 1 93  ? 18.885  29.433  41.825 1.00 85.99  ? 984  GLU A O   1 
ATOM   530  C CB  . GLU A 1 93  ? 16.700  31.655  42.555 1.00 89.29  ? 984  GLU A CB  1 
ATOM   531  C CG  . GLU A 1 93  ? 17.300  32.588  43.598 1.00 95.75  ? 984  GLU A CG  1 
ATOM   532  C CD  . GLU A 1 93  ? 16.434  33.801  43.871 1.00 99.69  ? 984  GLU A CD  1 
ATOM   533  O OE1 . GLU A 1 93  ? 15.200  33.740  43.643 1.00 100.42 ? 984  GLU A OE1 1 
ATOM   534  O OE2 . GLU A 1 93  ? 17.008  34.810  44.331 1.00 102.15 ? 984  GLU A OE2 1 
ATOM   535  N N   . MET A 1 94  ? 17.078  29.148  40.526 1.00 81.99  ? 985  MET A N   1 
ATOM   536  C CA  . MET A 1 94  ? 17.215  27.691  40.486 1.00 78.42  ? 985  MET A CA  1 
ATOM   537  C C   . MET A 1 94  ? 18.298  27.335  39.482 1.00 75.09  ? 985  MET A C   1 
ATOM   538  O O   . MET A 1 94  ? 19.112  26.451  39.731 1.00 73.59  ? 985  MET A O   1 
ATOM   539  C CB  . MET A 1 94  ? 15.911  26.992  40.074 1.00 80.16  ? 985  MET A CB  1 
ATOM   540  C CG  . MET A 1 94  ? 14.794  26.940  41.112 1.00 81.58  ? 985  MET A CG  1 
ATOM   541  S SD  . MET A 1 94  ? 15.301  26.351  42.750 1.00 89.97  ? 985  MET A SD  1 
ATOM   542  C CE  . MET A 1 94  ? 14.989  24.523  42.549 1.00 89.50  ? 985  MET A CE  1 
ATOM   543  N N   . ALA A 1 95  ? 18.280  28.024  38.345 1.00 72.62  ? 986  ALA A N   1 
ATOM   544  C CA  . ALA A 1 95  ? 19.350  27.915  37.364 1.00 73.91  ? 986  ALA A CA  1 
ATOM   545  C C   . ALA A 1 95  ? 20.694  28.176  38.025 1.00 75.80  ? 986  ALA A C   1 
ATOM   546  O O   . ALA A 1 95  ? 21.709  27.581  37.649 1.00 78.76  ? 986  ALA A O   1 
ATOM   547  C CB  . ALA A 1 95  ? 19.146  28.897  36.234 1.00 69.16  ? 986  ALA A CB  1 
ATOM   548  N N   . GLN A 1 96  ? 20.691  29.089  38.990 1.00 75.34  ? 987  GLN A N   1 
ATOM   549  C CA  . GLN A 1 96  ? 21.926  29.545  39.601 1.00 72.68  ? 987  GLN A CA  1 
ATOM   550  C C   . GLN A 1 96  ? 22.399  28.381  40.460 1.00 72.71  ? 987  GLN A C   1 
ATOM   551  O O   . GLN A 1 96  ? 23.576  28.045  40.452 1.00 72.36  ? 987  GLN A O   1 
ATOM   552  C CB  . GLN A 1 96  ? 21.697  30.813  40.437 1.00 72.32  ? 987  GLN A CB  1 
ATOM   553  C CG  . GLN A 1 96  ? 21.830  32.159  39.715 1.00 71.07  ? 987  GLN A CG  1 
ATOM   554  C CD  . GLN A 1 96  ? 21.718  33.355  40.659 1.00 72.16  ? 987  GLN A CD  1 
ATOM   555  O OE1 . GLN A 1 96  ? 20.631  33.708  41.112 1.00 74.60  ? 987  GLN A OE1 1 
ATOM   556  N NE2 . GLN A 1 96  ? 22.852  33.967  40.975 1.00 73.83  ? 987  GLN A NE2 1 
ATOM   557  N N   . LYS A 1 97  ? 21.479  27.756  41.188 1.00 74.16  ? 988  LYS A N   1 
ATOM   558  C CA  . LYS A 1 97  ? 21.807  26.662  42.114 1.00 75.98  ? 988  LYS A CA  1 
ATOM   559  C C   . LYS A 1 97  ? 22.415  25.486  41.352 1.00 73.19  ? 988  LYS A C   1 
ATOM   560  O O   . LYS A 1 97  ? 23.325  24.778  41.810 1.00 71.18  ? 988  LYS A O   1 
ATOM   561  C CB  . LYS A 1 97  ? 20.534  26.144  42.799 1.00 78.42  ? 988  LYS A CB  1 
ATOM   562  C CG  . LYS A 1 97  ? 20.467  26.373  44.307 1.00 84.30  ? 988  LYS A CG  1 
ATOM   563  C CD  . LYS A 1 97  ? 19.120  25.915  44.896 1.00 87.73  ? 988  LYS A CD  1 
ATOM   564  C CE  . LYS A 1 97  ? 18.968  24.385  45.010 1.00 86.54  ? 988  LYS A CE  1 
ATOM   565  N NZ  . LYS A 1 97  ? 17.542  23.953  44.790 1.00 89.41  ? 988  LYS A NZ  1 
ATOM   566  N N   . LEU A 1 98  ? 21.817  25.300  40.178 1.00 69.23  ? 989  LEU A N   1 
ATOM   567  C CA  . LEU A 1 98  ? 22.096  24.174  39.310 1.00 62.58  ? 989  LEU A CA  1 
ATOM   568  C C   . LEU A 1 98  ? 23.548  24.291  38.888 1.00 62.81  ? 989  LEU A C   1 
ATOM   569  O O   . LEU A 1 98  ? 24.312  23.351  39.063 1.00 62.70  ? 989  LEU A O   1 
ATOM   570  C CB  . LEU A 1 98  ? 21.169  24.209  38.103 1.00 54.96  ? 989  LEU A CB  1 
ATOM   571  C CG  . LEU A 1 98  ? 21.452  23.078  37.126 1.00 54.92  ? 989  LEU A CG  1 
ATOM   572  C CD1 . LEU A 1 98  ? 21.429  21.739  37.828 1.00 48.99  ? 989  LEU A CD1 1 
ATOM   573  C CD2 . LEU A 1 98  ? 20.426  23.126  36.020 1.00 57.41  ? 989  LEU A CD2 1 
ATOM   574  N N   . LEU A 1 99  ? 23.938  25.469  38.413 1.00 61.41  ? 990  LEU A N   1 
ATOM   575  C CA  . LEU A 1 99  ? 25.323  25.726  38.060 1.00 58.68  ? 990  LEU A CA  1 
ATOM   576  C C   . LEU A 1 99  ? 26.267  25.404  39.221 1.00 59.79  ? 990  LEU A C   1 
ATOM   577  O O   . LEU A 1 99  ? 27.317  24.801  39.007 1.00 60.53  ? 990  LEU A O   1 
ATOM   578  C CB  . LEU A 1 99  ? 25.478  27.168  37.596 1.00 52.76  ? 990  LEU A CB  1 
ATOM   579  C CG  . LEU A 1 99  ? 24.881  27.449  36.223 1.00 49.09  ? 990  LEU A CG  1 
ATOM   580  C CD1 . LEU A 1 99  ? 24.876  28.924  35.967 1.00 48.24  ? 990  LEU A CD1 1 
ATOM   581  C CD2 . LEU A 1 99  ? 25.653  26.789  35.097 1.00 50.20  ? 990  LEU A CD2 1 
ATOM   582  N N   . ASN A 1 100 ? 25.870  25.709  40.454 1.00 61.97  ? 991  ASN A N   1 
ATOM   583  C CA  . ASN A 1 100 ? 26.765  25.497  41.593 1.00 64.97  ? 991  ASN A CA  1 
ATOM   584  C C   . ASN A 1 100 ? 26.934  24.019  41.830 1.00 66.89  ? 991  ASN A C   1 
ATOM   585  O O   . ASN A 1 100 ? 28.017  23.508  42.130 1.00 67.65  ? 991  ASN A O   1 
ATOM   586  C CB  . ASN A 1 100 ? 26.241  26.134  42.873 1.00 59.27  ? 991  ASN A CB  1 
ATOM   587  C CG  . ASN A 1 100 ? 26.811  27.506  43.074 1.00 62.62  ? 991  ASN A CG  1 
ATOM   588  O OD1 . ASN A 1 100 ? 28.000  27.719  42.812 1.00 58.84  ? 991  ASN A OD1 1 
ATOM   589  N ND2 . ASN A 1 100 ? 25.948  28.466  43.413 1.00 63.86  ? 991  ASN A ND2 1 
ATOM   590  N N   . SER A 1 101 ? 25.804  23.350  41.674 1.00 67.12  ? 992  SER A N   1 
ATOM   591  C CA  . SER A 1 101 ? 25.793  21.912  41.775 1.00 67.44  ? 992  SER A CA  1 
ATOM   592  C C   . SER A 1 101 ? 26.686  21.272  40.705 1.00 67.53  ? 992  SER A C   1 
ATOM   593  O O   . SER A 1 101 ? 27.407  20.336  41.024 1.00 67.55  ? 992  SER A O   1 
ATOM   594  C CB  . SER A 1 101 ? 24.342  21.463  41.697 1.00 71.59  ? 992  SER A CB  1 
ATOM   595  O OG  . SER A 1 101 ? 24.272  20.053  41.620 1.00 78.96  ? 992  SER A OG  1 
ATOM   596  N N   . ASP A 1 102 ? 26.695  21.776  39.473 1.00 63.08  ? 993  ASP A N   1 
ATOM   597  C CA  . ASP A 1 102 ? 27.436  21.136  38.400 1.00 61.03  ? 993  ASP A CA  1 
ATOM   598  C C   . ASP A 1 102 ? 28.920  21.318  38.669 1.00 62.85  ? 993  ASP A C   1 
ATOM   599  O O   . ASP A 1 102 ? 29.732  20.453  38.335 1.00 63.65  ? 993  ASP A O   1 
ATOM   600  C CB  . ASP A 1 102 ? 27.178  21.809  37.058 1.00 65.45  ? 993  ASP A CB  1 
ATOM   601  C CG  . ASP A 1 102 ? 25.793  21.530  36.468 1.00 70.23  ? 993  ASP A CG  1 
ATOM   602  O OD1 . ASP A 1 102 ? 24.927  20.948  37.153 1.00 72.59  ? 993  ASP A OD1 1 
ATOM   603  O OD2 . ASP A 1 102 ? 25.472  21.888  35.306 1.00 71.81  ? 993  ASP A OD2 1 
ATOM   604  N N   . LEU A 1 103 ? 29.301  22.490  39.175 1.00 61.39  ? 994  LEU A N   1 
ATOM   605  C CA  . LEU A 1 103 ? 30.711  22.771  39.408 1.00 57.43  ? 994  LEU A CA  1 
ATOM   606  C C   . LEU A 1 103 ? 31.026  21.843  40.560 1.00 58.80  ? 994  LEU A C   1 
ATOM   607  O O   . LEU A 1 103 ? 32.159  21.409  40.728 1.00 61.45  ? 994  LEU A O   1 
ATOM   608  C CB  . LEU A 1 103 ? 30.965  24.227  39.809 1.00 50.65  ? 994  LEU A CB  1 
ATOM   609  C CG  . LEU A 1 103 ? 32.400  24.519  40.282 1.00 51.41  ? 994  LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 103 ? 33.446  24.121  39.247 1.00 49.02  ? 994  LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 103 ? 32.656  25.969  40.662 1.00 47.82  ? 994  LEU A CD2 1 
ATOM   612  N N   . GLY A 1 104 ? 30.014  21.568  41.376 1.00 57.22  ? 995  GLY A N   1 
ATOM   613  C CA  . GLY A 1 104 ? 30.144  20.575  42.424 1.00 55.02  ? 995  GLY A CA  1 
ATOM   614  C C   . GLY A 1 104 ? 30.586  19.237  41.865 1.00 58.92  ? 995  GLY A C   1 
ATOM   615  O O   . GLY A 1 104 ? 31.679  18.759  42.159 1.00 58.82  ? 995  GLY A O   1 
ATOM   616  N N   . GLU A 1 105 ? 29.732  18.633  41.045 1.00 61.98  ? 996  GLU A N   1 
ATOM   617  C CA  . GLU A 1 105 ? 30.037  17.365  40.409 1.00 63.35  ? 996  GLU A CA  1 
ATOM   618  C C   . GLU A 1 105 ? 31.351  17.391  39.632 1.00 62.73  ? 996  GLU A C   1 
ATOM   619  O O   . GLU A 1 105 ? 31.964  16.349  39.423 1.00 65.56  ? 996  GLU A O   1 
ATOM   620  C CB  . GLU A 1 105 ? 28.889  16.972  39.480 1.00 68.21  ? 996  GLU A CB  1 
ATOM   621  C CG  . GLU A 1 105 ? 27.692  16.397  40.219 1.00 84.63  ? 996  GLU A CG  1 
ATOM   622  C CD  . GLU A 1 105 ? 26.420  16.319  39.385 1.00 94.20  ? 996  GLU A CD  1 
ATOM   623  O OE1 . GLU A 1 105 ? 26.488  16.097  38.145 1.00 97.53  ? 996  GLU A OE1 1 
ATOM   624  O OE2 . GLU A 1 105 ? 25.338  16.463  40.006 1.00 99.48  ? 996  GLU A OE2 1 
ATOM   625  N N   . LEU A 1 106 ? 31.764  18.542  39.120 1.00 59.50  ? 997  LEU A N   1 
ATOM   626  C CA  . LEU A 1 106 ? 32.947  18.537  38.272 1.00 57.63  ? 997  LEU A CA  1 
ATOM   627  C C   . LEU A 1 106 ? 34.169  18.479  39.179 1.00 59.85  ? 997  LEU A C   1 
ATOM   628  O O   . LEU A 1 106 ? 35.162  17.806  38.906 1.00 59.29  ? 997  LEU A O   1 
ATOM   629  C CB  . LEU A 1 106 ? 32.999  19.782  37.390 1.00 51.51  ? 997  LEU A CB  1 
ATOM   630  C CG  . LEU A 1 106 ? 34.372  20.142  36.825 1.00 46.16  ? 997  LEU A CG  1 
ATOM   631  C CD1 . LEU A 1 106 ? 34.877  19.018  35.969 1.00 43.60  ? 997  LEU A CD1 1 
ATOM   632  C CD2 . LEU A 1 106 ? 34.304  21.403  36.003 1.00 36.83  ? 997  LEU A CD2 1 
ATOM   633  N N   . ILE A 1 107 ? 34.083  19.202  40.286 1.00 60.99  ? 998  ILE A N   1 
ATOM   634  C CA  . ILE A 1 107 ? 35.207  19.261  41.198 1.00 60.82  ? 998  ILE A CA  1 
ATOM   635  C C   . ILE A 1 107 ? 35.395  17.848  41.731 1.00 60.18  ? 998  ILE A C   1 
ATOM   636  O O   . ILE A 1 107 ? 36.517  17.343  41.744 1.00 61.15  ? 998  ILE A O   1 
ATOM   637  C CB  . ILE A 1 107 ? 34.962  20.322  42.282 1.00 60.23  ? 998  ILE A CB  1 
ATOM   638  C CG1 . ILE A 1 107 ? 35.532  21.662  41.793 1.00 62.61  ? 998  ILE A CG1 1 
ATOM   639  C CG2 . ILE A 1 107 ? 35.633  19.916  43.560 1.00 59.90  ? 998  ILE A CG2 1 
ATOM   640  C CD1 . ILE A 1 107 ? 35.113  22.898  42.563 1.00 58.09  ? 998  ILE A CD1 1 
ATOM   641  N N   . ASN A 1 108 ? 34.281  17.191  42.039 1.00 59.13  ? 999  ASN A N   1 
ATOM   642  C CA  . ASN A 1 108 ? 34.238  15.800  42.501 1.00 58.29  ? 999  ASN A CA  1 
ATOM   643  C C   . ASN A 1 108 ? 35.021  14.861  41.607 1.00 57.20  ? 999  ASN A C   1 
ATOM   644  O O   . ASN A 1 108 ? 35.783  14.013  42.068 1.00 56.36  ? 999  ASN A O   1 
ATOM   645  C CB  . ASN A 1 108 ? 32.802  15.265  42.491 1.00 60.44  ? 999  ASN A CB  1 
ATOM   646  C CG  . ASN A 1 108 ? 32.075  15.470  43.807 1.00 69.17  ? 999  ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 108 ? 32.462  16.276  44.654 1.00 76.75  ? 999  ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 108 ? 30.967  14.770  43.959 1.00 71.13  ? 999  ASN A ND2 1 
ATOM   649  N N   . LYS A 1 109 ? 34.753  14.963  40.314 1.00 56.21  ? 1000 LYS A N   1 
ATOM   650  C CA  . LYS A 1 109 ? 35.305  13.981  39.416 1.00 54.36  ? 1000 LYS A CA  1 
ATOM   651  C C   . LYS A 1 109 ? 36.745  14.343  39.170 1.00 55.35  ? 1000 LYS A C   1 
ATOM   652  O O   . LYS A 1 109 ? 37.561  13.461  38.990 1.00 56.09  ? 1000 LYS A O   1 
ATOM   653  C CB  . LYS A 1 109 ? 34.508  13.944  38.138 1.00 51.18  ? 1000 LYS A CB  1 
ATOM   654  C CG  . LYS A 1 109 ? 33.054  13.673  38.462 1.00 52.70  ? 1000 LYS A CG  1 
ATOM   655  C CD  . LYS A 1 109 ? 32.644  12.189  38.498 1.00 52.83  ? 1000 LYS A CD  1 
ATOM   656  C CE  . LYS A 1 109 ? 31.126  12.116  38.304 1.00 57.64  ? 1000 LYS A CE  1 
ATOM   657  N NZ  . LYS A 1 109 ? 30.422  10.937  38.877 1.00 58.46  ? 1000 LYS A NZ  1 
ATOM   658  N N   . MET A 1 110 ? 37.074  15.625  39.247 1.00 57.80  ? 1001 MET A N   1 
ATOM   659  C CA  . MET A 1 110 ? 38.466  16.059  39.157 1.00 58.13  ? 1001 MET A CA  1 
ATOM   660  C C   . MET A 1 110 ? 39.279  15.378  40.258 1.00 61.42  ? 1001 MET A C   1 
ATOM   661  O O   . MET A 1 110 ? 40.492  15.143  40.120 1.00 63.18  ? 1001 MET A O   1 
ATOM   662  C CB  . MET A 1 110 ? 38.578  17.586  39.303 1.00 54.65  ? 1001 MET A CB  1 
ATOM   663  C CG  . MET A 1 110 ? 40.014  18.102  39.235 1.00 53.77  ? 1001 MET A CG  1 
ATOM   664  S SD  . MET A 1 110 ? 40.338  19.754  39.870 1.00 60.93  ? 1001 MET A SD  1 
ATOM   665  C CE  . MET A 1 110 ? 39.389  19.714  41.393 1.00 60.23  ? 1001 MET A CE  1 
ATOM   666  N N   . LYS A 1 111 ? 38.631  15.151  41.396 1.00 61.53  ? 1002 LYS A N   1 
ATOM   667  C CA  . LYS A 1 111 ? 39.387  14.740  42.565 1.00 62.11  ? 1002 LYS A CA  1 
ATOM   668  C C   . LYS A 1 111 ? 39.639  13.252  42.394 1.00 61.39  ? 1002 LYS A C   1 
ATOM   669  O O   . LYS A 1 111 ? 40.798  12.817  42.461 1.00 61.92  ? 1002 LYS A O   1 
ATOM   670  C CB  . LYS A 1 111 ? 38.662  15.088  43.861 1.00 63.11  ? 1002 LYS A CB  1 
ATOM   671  C CG  . LYS A 1 111 ? 38.820  16.562  44.239 1.00 64.92  ? 1002 LYS A CG  1 
ATOM   672  C CD  . LYS A 1 111 ? 38.024  16.947  45.512 1.00 64.31  ? 1002 LYS A CD  1 
ATOM   673  C CE  . LYS A 1 111 ? 38.203  18.420  45.925 1.00 61.33  ? 1002 LYS A CE  1 
ATOM   674  N NZ  . LYS A 1 111 ? 37.783  18.686  47.325 1.00 61.80  ? 1002 LYS A NZ  1 
ATOM   675  N N   . LEU A 1 112 ? 38.588  12.520  42.013 1.00 59.74  ? 1003 LEU A N   1 
ATOM   676  C CA  . LEU A 1 112 ? 38.757  11.135  41.549 1.00 57.75  ? 1003 LEU A CA  1 
ATOM   677  C C   . LEU A 1 112 ? 39.936  11.020  40.576 1.00 59.54  ? 1003 LEU A C   1 
ATOM   678  O O   . LEU A 1 112 ? 40.962  10.477  40.951 1.00 64.52  ? 1003 LEU A O   1 
ATOM   679  C CB  . LEU A 1 112 ? 37.466  10.522  41.003 1.00 52.77  ? 1003 LEU A CB  1 
ATOM   680  C CG  . LEU A 1 112 ? 36.436  10.355  42.128 1.00 56.88  ? 1003 LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 112 ? 34.973  10.164  41.703 1.00 58.86  ? 1003 LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 112 ? 36.829  9.230   43.071 1.00 52.04  ? 1003 LEU A CD2 1 
ATOM   683  N N   . ALA A 1 113 ? 39.891  11.641  39.406 1.00 54.77  ? 1004 ALA A N   1 
ATOM   684  C CA  . ALA A 1 113 ? 41.020  11.623  38.484 1.00 55.10  ? 1004 ALA A CA  1 
ATOM   685  C C   . ALA A 1 113 ? 42.433  11.817  39.039 1.00 61.49  ? 1004 ALA A C   1 
ATOM   686  O O   . ALA A 1 113 ? 43.394  11.222  38.543 1.00 63.70  ? 1004 ALA A O   1 
ATOM   687  C CB  . ALA A 1 113 ? 40.793  12.661  37.436 1.00 55.88  ? 1004 ALA A CB  1 
ATOM   688  N N   . GLN A 1 114 ? 42.603  12.742  39.977 1.00 64.07  ? 1005 GLN A N   1 
ATOM   689  C CA  . GLN A 1 114 ? 43.897  12.913  40.636 1.00 68.48  ? 1005 GLN A CA  1 
ATOM   690  C C   . GLN A 1 114 ? 44.325  11.687  41.463 1.00 70.90  ? 1005 GLN A C   1 
ATOM   691  O O   . GLN A 1 114 ? 45.497  11.261  41.448 1.00 68.99  ? 1005 GLN A O   1 
ATOM   692  C CB  . GLN A 1 114 ? 43.782  14.069  41.618 1.00 69.49  ? 1005 GLN A CB  1 
ATOM   693  C CG  . GLN A 1 114 ? 44.264  15.419  41.163 1.00 70.94  ? 1005 GLN A CG  1 
ATOM   694  C CD  . GLN A 1 114 ? 43.763  16.464  42.133 1.00 73.90  ? 1005 GLN A CD  1 
ATOM   695  O OE1 . GLN A 1 114 ? 42.545  16.623  42.303 1.00 75.42  ? 1005 GLN A OE1 1 
ATOM   696  N NE2 . GLN A 1 114 ? 44.689  17.071  42.868 1.00 71.71  ? 1005 GLN A NE2 1 
ATOM   697  N N   . GLN A 1 115 ? 43.369  11.235  42.278 1.00 72.76  ? 1006 GLN A N   1 
ATOM   698  C CA  . GLN A 1 115 ? 43.452  9.996   43.050 1.00 76.47  ? 1006 GLN A CA  1 
ATOM   699  C C   . GLN A 1 115 ? 43.942  8.821   42.211 1.00 79.10  ? 1006 GLN A C   1 
ATOM   700  O O   . GLN A 1 115 ? 44.815  8.084   42.664 1.00 82.80  ? 1006 GLN A O   1 
ATOM   701  C CB  . GLN A 1 115 ? 42.083  9.633   43.624 1.00 75.55  ? 1006 GLN A CB  1 
ATOM   702  C CG  . GLN A 1 115 ? 42.091  8.692   44.817 1.00 77.86  ? 1006 GLN A CG  1 
ATOM   703  C CD  . GLN A 1 115 ? 40.698  8.576   45.438 1.00 80.31  ? 1006 GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 115 ? 40.177  7.479   45.660 1.00 78.54  ? 1006 GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 115 ? 40.087  9.723   45.708 1.00 83.58  ? 1006 GLN A NE2 1 
ATOM   706  N N   . TYR A 1 116 ? 43.439  8.692   40.984 1.00 78.00  ? 1007 TYR A N   1 
ATOM   707  C CA  . TYR A 1 116 ? 43.748  7.571   40.106 1.00 76.74  ? 1007 TYR A CA  1 
ATOM   708  C C   . TYR A 1 116 ? 44.663  7.927   38.923 1.00 75.30  ? 1007 TYR A C   1 
ATOM   709  O O   . TYR A 1 116 ? 44.584  7.323   37.860 1.00 72.70  ? 1007 TYR A O   1 
ATOM   710  C CB  . TYR A 1 116 ? 42.414  6.961   39.649 1.00 79.31  ? 1007 TYR A CB  1 
ATOM   711  C CG  . TYR A 1 116 ? 41.511  6.466   40.775 1.00 81.06  ? 1007 TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 116 ? 40.205  6.916   40.876 1.00 80.16  ? 1007 TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 116 ? 41.911  5.468   41.665 1.00 83.78  ? 1007 TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 116 ? 39.327  6.411   41.830 1.00 83.38  ? 1007 TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 116 ? 41.049  4.985   42.662 1.00 85.89  ? 1007 TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 116 ? 39.742  5.450   42.740 1.00 87.25  ? 1007 TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 116 ? 38.847  4.998   43.710 1.00 84.92  ? 1007 TYR A OH  1 
ATOM   718  N N   . VAL A 1 117 ? 45.554  8.897   39.087 1.00 76.62  ? 1008 VAL A N   1 
ATOM   719  C CA  . VAL A 1 117 ? 46.483  9.238   38.011 1.00 83.11  ? 1008 VAL A CA  1 
ATOM   720  C C   . VAL A 1 117 ? 47.467  8.093   37.766 1.00 86.41  ? 1008 VAL A C   1 
ATOM   721  O O   . VAL A 1 117 ? 47.995  7.539   38.733 1.00 88.13  ? 1008 VAL A O   1 
ATOM   722  C CB  . VAL A 1 117 ? 47.225  10.594  38.257 1.00 83.61  ? 1008 VAL A CB  1 
ATOM   723  C CG1 . VAL A 1 117 ? 48.382  10.471  39.246 1.00 82.57  ? 1008 VAL A CG1 1 
ATOM   724  C CG2 . VAL A 1 117 ? 47.758  11.212  36.946 1.00 85.04  ? 1008 VAL A CG2 1 
ATOM   725  N N   . MET A 1 118 ? 47.729  7.759   36.497 1.00 89.25  ? 1009 MET A N   1 
ATOM   726  C CA  . MET A 1 118 ? 48.433  6.530   36.098 1.00 88.73  ? 1009 MET A CA  1 
ATOM   727  C C   . MET A 1 118 ? 47.667  5.209   36.280 1.00 86.02  ? 1009 MET A C   1 
ATOM   728  O O   . MET A 1 118 ? 48.262  4.141   36.299 1.00 87.03  ? 1009 MET A O   1 
ATOM   729  C CB  . MET A 1 118 ? 49.767  6.403   36.838 1.00 91.82  ? 1009 MET A CB  1 
ATOM   730  C CG  . MET A 1 118 ? 50.533  7.706   36.944 1.00 98.19  ? 1009 MET A CG  1 
ATOM   731  S SD  . MET A 1 118 ? 51.505  7.995   35.448 1.00 106.53 ? 1009 MET A SD  1 
ATOM   732  C CE  . MET A 1 118 ? 53.056  8.884   36.139 1.00 102.94 ? 1009 MET A CE  1 
ATOM   733  N N   . THR A 1 119 ? 46.347  5.229   36.385 1.00 81.28  ? 1010 THR A N   1 
ATOM   734  C CA  . THR A 1 119 ? 45.657  3.968   36.498 1.00 78.50  ? 1010 THR A CA  1 
ATOM   735  C C   . THR A 1 119 ? 44.704  3.654   35.361 1.00 83.06  ? 1010 THR A C   1 
ATOM   736  O O   . THR A 1 119 ? 44.305  4.487   34.568 1.00 84.24  ? 1010 THR A O   1 
ATOM   737  C CB  . THR A 1 119 ? 44.973  3.831   37.863 1.00 77.85  ? 1010 THR A CB  1 
ATOM   738  O OG1 . THR A 1 119 ? 43.633  4.343   37.853 1.00 77.69  ? 1010 THR A OG1 1 
ATOM   739  C CG2 . THR A 1 119 ? 45.748  4.614   38.906 1.00 74.60  ? 1010 THR A CG2 1 
ATOM   740  N N   . SER A 1 120 ? 44.417  2.366   35.252 1.00 88.96  ? 1011 SER A N   1 
ATOM   741  C CA  . SER A 1 120 ? 43.295  1.867   34.476 1.00 91.65  ? 1011 SER A CA  1 
ATOM   742  C C   . SER A 1 120 ? 42.020  2.688   34.694 1.00 92.96  ? 1011 SER A C   1 
ATOM   743  O O   . SER A 1 120 ? 41.067  2.539   33.927 1.00 96.42  ? 1011 SER A O   1 
ATOM   744  C CB  . SER A 1 120 ? 43.039  0.392   34.843 1.00 92.62  ? 1011 SER A CB  1 
ATOM   745  O OG  . SER A 1 120 ? 43.164  0.114   36.237 1.00 95.55  ? 1011 SER A OG  1 
ATOM   746  N N   . LEU A 1 121 ? 41.910  3.486   35.752 1.00 91.28  ? 1012 LEU A N   1 
ATOM   747  C CA  . LEU A 1 121 ? 40.666  4.251   35.890 1.00 89.99  ? 1012 LEU A CA  1 
ATOM   748  C C   . LEU A 1 121 ? 40.744  5.746   35.502 1.00 87.33  ? 1012 LEU A C   1 
ATOM   749  O O   . LEU A 1 121 ? 39.712  6.409   35.367 1.00 88.08  ? 1012 LEU A O   1 
ATOM   750  C CB  . LEU A 1 121 ? 40.033  4.030   37.269 1.00 92.65  ? 1012 LEU A CB  1 
ATOM   751  C CG  . LEU A 1 121 ? 40.024  2.615   37.864 1.00 95.28  ? 1012 LEU A CG  1 
ATOM   752  C CD1 . LEU A 1 121 ? 38.824  2.382   38.792 1.00 97.62  ? 1012 LEU A CD1 1 
ATOM   753  C CD2 . LEU A 1 121 ? 40.034  1.536   36.793 1.00 95.35  ? 1012 LEU A CD2 1 
ATOM   754  N N   . GLN A 1 122 ? 41.947  6.230   35.210 1.00 82.40  ? 1013 GLN A N   1 
ATOM   755  C CA  . GLN A 1 122 ? 42.216  7.629   34.903 1.00 80.47  ? 1013 GLN A CA  1 
ATOM   756  C C   . GLN A 1 122 ? 41.327  8.217   33.809 1.00 82.03  ? 1013 GLN A C   1 
ATOM   757  O O   . GLN A 1 122 ? 40.737  9.276   33.998 1.00 82.50  ? 1013 GLN A O   1 
ATOM   758  C CB  . GLN A 1 122 ? 43.677  7.769   34.491 1.00 78.08  ? 1013 GLN A CB  1 
ATOM   759  C CG  . GLN A 1 122 ? 44.052  9.186   34.201 1.00 82.79  ? 1013 GLN A CG  1 
ATOM   760  C CD  . GLN A 1 122 ? 45.315  9.300   33.372 1.00 89.17  ? 1013 GLN A CD  1 
ATOM   761  O OE1 . GLN A 1 122 ? 45.239  9.310   32.137 1.00 94.64  ? 1013 GLN A OE1 1 
ATOM   762  N NE2 . GLN A 1 122 ? 46.464  9.472   34.035 1.00 87.90  ? 1013 GLN A NE2 1 
ATOM   763  N N   . GLN A 1 123 ? 41.276  7.544   32.662 1.00 81.51  ? 1014 GLN A N   1 
ATOM   764  C CA  . GLN A 1 123 ? 40.345  7.837   31.572 1.00 79.63  ? 1014 GLN A CA  1 
ATOM   765  C C   . GLN A 1 123 ? 38.909  7.936   32.047 1.00 76.43  ? 1014 GLN A C   1 
ATOM   766  O O   . GLN A 1 123 ? 38.279  8.954   31.830 1.00 75.73  ? 1014 GLN A O   1 
ATOM   767  C CB  . GLN A 1 123 ? 40.403  6.770   30.458 1.00 87.35  ? 1014 GLN A CB  1 
ATOM   768  C CG  . GLN A 1 123 ? 39.109  6.579   29.596 1.00 91.61  ? 1014 GLN A CG  1 
ATOM   769  C CD  . GLN A 1 123 ? 38.858  5.168   29.039 1.00 91.35  ? 1014 GLN A CD  1 
ATOM   770  O OE1 . GLN A 1 123 ? 39.708  4.276   29.125 1.00 92.60  ? 1014 GLN A OE1 1 
ATOM   771  N NE2 . GLN A 1 123 ? 37.710  4.995   28.394 1.00 89.38  ? 1014 GLN A NE2 1 
ATOM   772  N N   . GLU A 1 124 ? 38.311  6.865   32.544 1.00 73.97  ? 1015 GLU A N   1 
ATOM   773  C CA  . GLU A 1 124 ? 36.882  6.981   32.775 1.00 77.24  ? 1015 GLU A CA  1 
ATOM   774  C C   . GLU A 1 124 ? 36.623  8.186   33.683 1.00 75.94  ? 1015 GLU A C   1 
ATOM   775  O O   . GLU A 1 124 ? 35.480  8.652   33.844 1.00 75.97  ? 1015 GLU A O   1 
ATOM   776  C CB  . GLU A 1 124 ? 36.296  5.688   33.363 1.00 82.94  ? 1015 GLU A CB  1 
ATOM   777  C CG  . GLU A 1 124 ? 34.885  5.814   33.947 1.00 83.41  ? 1015 GLU A CG  1 
ATOM   778  C CD  . GLU A 1 124 ? 33.788  5.856   32.900 1.00 85.54  ? 1015 GLU A CD  1 
ATOM   779  O OE1 . GLU A 1 124 ? 34.106  6.005   31.694 1.00 82.23  ? 1015 GLU A OE1 1 
ATOM   780  O OE2 . GLU A 1 124 ? 32.604  5.744   33.303 1.00 86.57  ? 1015 GLU A OE2 1 
ATOM   781  N N   . TYR A 1 125 ? 37.675  8.680   34.330 1.00 72.91  ? 1016 TYR A N   1 
ATOM   782  C CA  . TYR A 1 125 ? 37.448  9.774   35.281 1.00 70.71  ? 1016 TYR A CA  1 
ATOM   783  C C   . TYR A 1 125 ? 37.491  11.154  34.580 1.00 65.66  ? 1016 TYR A C   1 
ATOM   784  O O   . TYR A 1 125 ? 36.508  11.891  34.650 1.00 61.62  ? 1016 TYR A O   1 
ATOM   785  C CB  . TYR A 1 125 ? 38.244  9.581   36.604 1.00 72.83  ? 1016 TYR A CB  1 
ATOM   786  C CG  . TYR A 1 125 ? 37.533  8.672   37.612 1.00 74.09  ? 1016 TYR A CG  1 
ATOM   787  C CD1 . TYR A 1 125 ? 36.147  8.798   37.801 1.00 73.83  ? 1016 TYR A CD1 1 
ATOM   788  C CD2 . TYR A 1 125 ? 38.192  7.630   38.282 1.00 74.59  ? 1016 TYR A CD2 1 
ATOM   789  C CE1 . TYR A 1 125 ? 35.431  7.966   38.664 1.00 75.05  ? 1016 TYR A CE1 1 
ATOM   790  C CE2 . TYR A 1 125 ? 37.477  6.763   39.140 1.00 77.30  ? 1016 TYR A CE2 1 
ATOM   791  C CZ  . TYR A 1 125 ? 36.091  6.944   39.328 1.00 78.94  ? 1016 TYR A CZ  1 
ATOM   792  O OH  . TYR A 1 125 ? 35.305  6.175   40.167 1.00 77.74  ? 1016 TYR A OH  1 
ATOM   793  N N   . LYS A 1 126 ? 38.500  11.396  33.744 1.00 60.80  ? 1017 LYS A N   1 
ATOM   794  C CA  . LYS A 1 126 ? 38.430  12.407  32.685 1.00 58.11  ? 1017 LYS A CA  1 
ATOM   795  C C   . LYS A 1 126 ? 37.162  12.437  31.842 1.00 58.76  ? 1017 LYS A C   1 
ATOM   796  O O   . LYS A 1 126 ? 36.671  13.502  31.516 1.00 60.72  ? 1017 LYS A O   1 
ATOM   797  C CB  . LYS A 1 126 ? 39.663  12.374  31.784 1.00 51.53  ? 1017 LYS A CB  1 
ATOM   798  C CG  . LYS A 1 126 ? 40.938  12.461  32.607 1.00 52.10  ? 1017 LYS A CG  1 
ATOM   799  C CD  . LYS A 1 126 ? 42.062  13.173  31.895 1.00 55.18  ? 1017 LYS A CD  1 
ATOM   800  C CE  . LYS A 1 126 ? 43.450  12.674  32.284 1.00 52.29  ? 1017 LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 126 ? 44.539  13.655  31.987 1.00 54.48  ? 1017 LYS A NZ  1 
ATOM   802  N N   . LYS A 1 127 ? 36.565  11.303  31.522 1.00 61.57  ? 1018 LYS A N   1 
ATOM   803  C CA  . LYS A 1 127 ? 35.359  11.329  30.713 1.00 66.13  ? 1018 LYS A CA  1 
ATOM   804  C C   . LYS A 1 127 ? 34.197  11.833  31.557 1.00 64.41  ? 1018 LYS A C   1 
ATOM   805  O O   . LYS A 1 127 ? 33.241  12.421  31.048 1.00 63.82  ? 1018 LYS A O   1 
ATOM   806  C CB  . LYS A 1 127 ? 35.029  9.935   30.161 1.00 73.89  ? 1018 LYS A CB  1 
ATOM   807  C CG  . LYS A 1 127 ? 35.855  9.505   28.945 1.00 80.54  ? 1018 LYS A CG  1 
ATOM   808  C CD  . LYS A 1 127 ? 35.084  8.502   28.082 1.00 91.02  ? 1018 LYS A CD  1 
ATOM   809  C CE  . LYS A 1 127 ? 35.966  7.340   27.578 1.00 96.97  ? 1018 LYS A CE  1 
ATOM   810  N NZ  . LYS A 1 127 ? 35.409  5.975   27.908 1.00 102.19 ? 1018 LYS A NZ  1 
ATOM   811  N N   . GLN A 1 128 ? 34.246  11.569  32.855 1.00 65.70  ? 1019 GLN A N   1 
ATOM   812  C CA  . GLN A 1 128 ? 33.151  12.023  33.711 1.00 68.48  ? 1019 GLN A CA  1 
ATOM   813  C C   . GLN A 1 128 ? 33.268  13.512  34.050 1.00 66.70  ? 1019 GLN A C   1 
ATOM   814  O O   . GLN A 1 128 ? 32.269  14.197  34.272 1.00 64.96  ? 1019 GLN A O   1 
ATOM   815  C CB  . GLN A 1 128 ? 33.113  11.196  34.995 1.00 71.62  ? 1019 GLN A CB  1 
ATOM   816  C CG  . GLN A 1 128 ? 32.375  9.872   34.879 1.00 73.84  ? 1019 GLN A CG  1 
ATOM   817  C CD  . GLN A 1 128 ? 32.651  8.991   36.075 1.00 77.12  ? 1019 GLN A CD  1 
ATOM   818  O OE1 . GLN A 1 128 ? 32.370  9.368   37.218 1.00 78.96  ? 1019 GLN A OE1 1 
ATOM   819  N NE2 . GLN A 1 128 ? 33.287  7.855   35.821 1.00 79.14  ? 1019 GLN A NE2 1 
ATOM   820  N N   . MET A 1 129 ? 34.518  13.965  34.112 1.00 62.68  ? 1020 MET A N   1 
ATOM   821  C CA  . MET A 1 129 ? 34.880  15.369  33.993 1.00 59.17  ? 1020 MET A CA  1 
ATOM   822  C C   . MET A 1 129 ? 34.318  16.062  32.754 1.00 58.89  ? 1020 MET A C   1 
ATOM   823  O O   . MET A 1 129 ? 33.534  17.005  32.871 1.00 59.26  ? 1020 MET A O   1 
ATOM   824  C CB  . MET A 1 129 ? 36.400  15.529  34.004 1.00 57.19  ? 1020 MET A CB  1 
ATOM   825  C CG  . MET A 1 129 ? 36.913  16.021  35.332 1.00 56.66  ? 1020 MET A CG  1 
ATOM   826  S SD  . MET A 1 129 ? 38.669  15.865  35.399 1.00 62.05  ? 1020 MET A SD  1 
ATOM   827  C CE  . MET A 1 129 ? 39.119  17.571  35.226 1.00 60.32  ? 1020 MET A CE  1 
ATOM   828  N N   . LEU A 1 130 ? 34.717  15.648  31.561 1.00 53.88  ? 1021 LEU A N   1 
ATOM   829  C CA  . LEU A 1 130 ? 34.121  16.317  30.419 1.00 53.36  ? 1021 LEU A CA  1 
ATOM   830  C C   . LEU A 1 130 ? 32.616  16.300  30.593 1.00 53.24  ? 1021 LEU A C   1 
ATOM   831  O O   . LEU A 1 130 ? 31.928  17.251  30.260 1.00 57.32  ? 1021 LEU A O   1 
ATOM   832  C CB  . LEU A 1 130 ? 34.466  15.662  29.090 1.00 50.52  ? 1021 LEU A CB  1 
ATOM   833  C CG  . LEU A 1 130 ? 35.979  15.582  28.959 1.00 50.33  ? 1021 LEU A CG  1 
ATOM   834  C CD1 . LEU A 1 130 ? 36.414  14.811  27.734 1.00 52.23  ? 1021 LEU A CD1 1 
ATOM   835  C CD2 . LEU A 1 130 ? 36.547  16.966  28.936 1.00 46.67  ? 1021 LEU A CD2 1 
ATOM   836  N N   . THR A 1 131 ? 32.064  15.215  31.102 1.00 50.77  ? 1022 THR A N   1 
ATOM   837  C CA  . THR A 1 131 ? 30.623  15.199  31.099 1.00 51.15  ? 1022 THR A CA  1 
ATOM   838  C C   . THR A 1 131 ? 30.146  16.315  32.010 1.00 52.17  ? 1022 THR A C   1 
ATOM   839  O O   . THR A 1 131 ? 29.150  16.968  31.712 1.00 52.61  ? 1022 THR A O   1 
ATOM   840  C CB  . THR A 1 131 ? 30.073  13.824  31.494 1.00 49.60  ? 1022 THR A CB  1 
ATOM   841  O OG1 . THR A 1 131 ? 30.271  12.931  30.398 1.00 50.05  ? 1022 THR A OG1 1 
ATOM   842  C CG2 . THR A 1 131 ? 28.558  13.863  31.611 1.00 50.46  ? 1022 THR A CG2 1 
ATOM   843  N N   . ALA A 1 132 ? 30.816  16.508  33.136 1.00 51.04  ? 1023 ALA A N   1 
ATOM   844  C CA  . ALA A 1 132 ? 30.319  17.491  34.085 1.00 52.18  ? 1023 ALA A CA  1 
ATOM   845  C C   . ALA A 1 132 ? 30.491  18.909  33.506 1.00 53.19  ? 1023 ALA A C   1 
ATOM   846  O O   . ALA A 1 132 ? 29.601  19.759  33.572 1.00 54.73  ? 1023 ALA A O   1 
ATOM   847  C CB  . ALA A 1 132 ? 31.050  17.343  35.417 1.00 49.46  ? 1023 ALA A CB  1 
ATOM   848  N N   . ALA A 1 133 ? 31.659  19.163  32.931 1.00 48.87  ? 1024 ALA A N   1 
ATOM   849  C CA  . ALA A 1 133 ? 31.941  20.461  32.362 1.00 49.28  ? 1024 ALA A CA  1 
ATOM   850  C C   . ALA A 1 133 ? 30.870  20.745  31.324 1.00 50.78  ? 1024 ALA A C   1 
ATOM   851  O O   . ALA A 1 133 ? 30.341  21.837  31.273 1.00 51.10  ? 1024 ALA A O   1 
ATOM   852  C CB  . ALA A 1 133 ? 33.326  20.470  31.734 1.00 39.65  ? 1024 ALA A CB  1 
ATOM   853  N N   . HIS A 1 134 ? 30.540  19.771  30.488 1.00 51.95  ? 1025 HIS A N   1 
ATOM   854  C CA  . HIS A 1 134 ? 29.712  20.036  29.323 1.00 54.98  ? 1025 HIS A CA  1 
ATOM   855  C C   . HIS A 1 134 ? 28.303  20.320  29.855 1.00 52.06  ? 1025 HIS A C   1 
ATOM   856  O O   . HIS A 1 134 ? 27.565  21.143  29.343 1.00 51.49  ? 1025 HIS A O   1 
ATOM   857  C CB  . HIS A 1 134 ? 29.786  18.867  28.322 1.00 55.88  ? 1025 HIS A CB  1 
ATOM   858  C CG  . HIS A 1 134 ? 28.747  18.925  27.240 1.00 67.64  ? 1025 HIS A CG  1 
ATOM   859  N ND1 . HIS A 1 134 ? 29.048  19.174  25.916 1.00 72.87  ? 1025 HIS A ND1 1 
ATOM   860  C CD2 . HIS A 1 134 ? 27.395  18.821  27.295 1.00 71.32  ? 1025 HIS A CD2 1 
ATOM   861  C CE1 . HIS A 1 134 ? 27.934  19.220  25.203 1.00 72.76  ? 1025 HIS A CE1 1 
ATOM   862  N NE2 . HIS A 1 134 ? 26.916  18.992  26.015 1.00 73.17  ? 1025 HIS A NE2 1 
ATOM   863  N N   . ALA A 1 135 ? 27.943  19.704  30.966 1.00 48.39  ? 1026 ALA A N   1 
ATOM   864  C CA  . ALA A 1 135 ? 26.667  19.991  31.587 1.00 50.20  ? 1026 ALA A CA  1 
ATOM   865  C C   . ALA A 1 135 ? 26.582  21.417  32.129 1.00 53.05  ? 1026 ALA A C   1 
ATOM   866  O O   . ALA A 1 135 ? 25.510  22.008  32.275 1.00 54.47  ? 1026 ALA A O   1 
ATOM   867  C CB  . ALA A 1 135 ? 26.474  19.035  32.708 1.00 40.68  ? 1026 ALA A CB  1 
ATOM   868  N N   . LEU A 1 136 ? 27.732  21.905  32.570 1.00 54.72  ? 1027 LEU A N   1 
ATOM   869  C CA  . LEU A 1 136 ? 27.846  23.217  33.181 1.00 53.63  ? 1027 LEU A CA  1 
ATOM   870  C C   . LEU A 1 136 ? 27.645  24.212  32.033 1.00 52.27  ? 1027 LEU A C   1 
ATOM   871  O O   . LEU A 1 136 ? 26.770  25.074  32.037 1.00 51.72  ? 1027 LEU A O   1 
ATOM   872  C CB  . LEU A 1 136 ? 29.234  23.303  33.829 1.00 50.77  ? 1027 LEU A CB  1 
ATOM   873  C CG  . LEU A 1 136 ? 29.636  24.526  34.652 1.00 50.72  ? 1027 LEU A CG  1 
ATOM   874  C CD1 . LEU A 1 136 ? 28.565  24.787  35.679 1.00 49.34  ? 1027 LEU A CD1 1 
ATOM   875  C CD2 . LEU A 1 136 ? 30.979  24.354  35.346 1.00 44.95  ? 1027 LEU A CD2 1 
ATOM   876  N N   . ALA A 1 137 ? 28.460  24.065  31.002 1.00 53.31  ? 1028 ALA A N   1 
ATOM   877  C CA  . ALA A 1 137 ? 28.304  24.899  29.828 1.00 53.07  ? 1028 ALA A CA  1 
ATOM   878  C C   . ALA A 1 137 ? 26.829  24.909  29.445 1.00 52.32  ? 1028 ALA A C   1 
ATOM   879  O O   . ALA A 1 137 ? 26.239  25.955  29.274 1.00 52.30  ? 1028 ALA A O   1 
ATOM   880  C CB  . ALA A 1 137 ? 29.167  24.381  28.692 1.00 44.59  ? 1028 ALA A CB  1 
ATOM   881  N N   . VAL A 1 138 ? 26.198  23.747  29.379 1.00 55.41  ? 1029 VAL A N   1 
ATOM   882  C CA  . VAL A 1 138 ? 24.870  23.667  28.781 1.00 57.14  ? 1029 VAL A CA  1 
ATOM   883  C C   . VAL A 1 138 ? 23.827  24.351  29.664 1.00 59.68  ? 1029 VAL A C   1 
ATOM   884  O O   . VAL A 1 138 ? 22.883  24.923  29.131 1.00 60.69  ? 1029 VAL A O   1 
ATOM   885  C CB  . VAL A 1 138 ? 24.492  22.196  28.441 1.00 54.20  ? 1029 VAL A CB  1 
ATOM   886  C CG1 . VAL A 1 138 ? 23.003  21.928  28.604 1.00 44.79  ? 1029 VAL A CG1 1 
ATOM   887  C CG2 . VAL A 1 138 ? 24.966  21.870  27.019 1.00 51.03  ? 1029 VAL A CG2 1 
ATOM   888  N N   . ASP A 1 139 ? 24.013  24.287  30.980 1.00 61.23  ? 1030 ASP A N   1 
ATOM   889  C CA  . ASP A 1 139 ? 23.141  24.914  31.962 1.00 62.30  ? 1030 ASP A CA  1 
ATOM   890  C C   . ASP A 1 139 ? 23.406  26.405  32.120 1.00 63.16  ? 1030 ASP A C   1 
ATOM   891  O O   . ASP A 1 139 ? 22.506  27.179  32.464 1.00 67.56  ? 1030 ASP A O   1 
ATOM   892  C CB  . ASP A 1 139 ? 23.352  24.266  33.330 1.00 62.43  ? 1030 ASP A CB  1 
ATOM   893  C CG  . ASP A 1 139 ? 22.694  22.905  33.444 1.00 63.73  ? 1030 ASP A CG  1 
ATOM   894  O OD1 . ASP A 1 139 ? 21.975  22.514  32.512 1.00 64.49  ? 1030 ASP A OD1 1 
ATOM   895  O OD2 . ASP A 1 139 ? 22.800  22.158  34.435 1.00 63.13  ? 1030 ASP A OD2 1 
ATOM   896  N N   . ALA A 1 140 ? 24.663  26.794  31.937 1.00 62.47  ? 1031 ALA A N   1 
ATOM   897  C CA  . ALA A 1 140 ? 25.039  28.201  31.894 1.00 61.47  ? 1031 ALA A CA  1 
ATOM   898  C C   . ALA A 1 140 ? 24.333  28.848  30.717 1.00 62.19  ? 1031 ALA A C   1 
ATOM   899  O O   . ALA A 1 140 ? 23.855  29.969  30.799 1.00 63.48  ? 1031 ALA A O   1 
ATOM   900  C CB  . ALA A 1 140 ? 26.536  28.322  31.708 1.00 58.79  ? 1031 ALA A CB  1 
ATOM   901  N N   . LYS A 1 141 ? 24.311  28.147  29.594 1.00 61.55  ? 1032 LYS A N   1 
ATOM   902  C CA  . LYS A 1 141 ? 23.578  28.611  28.430 1.00 61.21  ? 1032 LYS A CA  1 
ATOM   903  C C   . LYS A 1 141 ? 22.095  28.628  28.776 1.00 61.77  ? 1032 LYS A C   1 
ATOM   904  O O   . LYS A 1 141 ? 21.355  29.473  28.311 1.00 62.16  ? 1032 LYS A O   1 
ATOM   905  C CB  . LYS A 1 141 ? 23.843  27.705  27.228 1.00 59.83  ? 1032 LYS A CB  1 
ATOM   906  C CG  . LYS A 1 141 ? 23.673  28.395  25.886 1.00 64.37  ? 1032 LYS A CG  1 
ATOM   907  C CD  . LYS A 1 141 ? 22.329  29.145  25.684 1.00 64.90  ? 1032 LYS A CD  1 
ATOM   908  C CE  . LYS A 1 141 ? 22.304  29.933  24.379 1.00 65.56  ? 1032 LYS A CE  1 
ATOM   909  N NZ  . LYS A 1 141 ? 21.073  29.743  23.579 1.00 71.01  ? 1032 LYS A NZ  1 
ATOM   910  N N   . ASN A 1 142 ? 21.622  27.718  29.610 1.00 64.05  ? 1033 ASN A N   1 
ATOM   911  C CA  . ASN A 1 142 ? 20.210  27.764  29.902 1.00 65.43  ? 1033 ASN A CA  1 
ATOM   912  C C   . ASN A 1 142 ? 19.906  28.975  30.758 1.00 66.96  ? 1033 ASN A C   1 
ATOM   913  O O   . ASN A 1 142 ? 18.746  29.393  30.849 1.00 67.92  ? 1033 ASN A O   1 
ATOM   914  C CB  . ASN A 1 142 ? 19.700  26.519  30.618 1.00 66.02  ? 1033 ASN A CB  1 
ATOM   915  C CG  . ASN A 1 142 ? 18.191  26.571  30.820 1.00 69.41  ? 1033 ASN A CG  1 
ATOM   916  O OD1 . ASN A 1 142 ? 17.716  26.781  31.940 1.00 70.93  ? 1033 ASN A OD1 1 
ATOM   917  N ND2 . ASN A 1 142 ? 17.437  26.468  29.724 1.00 69.27  ? 1033 ASN A ND2 1 
ATOM   918  N N   . LEU A 1 143 ? 20.923  29.484  31.443 1.00 66.93  ? 1034 LEU A N   1 
ATOM   919  C CA  . LEU A 1 143 ? 20.683  30.553  32.397 1.00 64.99  ? 1034 LEU A CA  1 
ATOM   920  C C   . LEU A 1 143 ? 20.673  31.841  31.612 1.00 63.68  ? 1034 LEU A C   1 
ATOM   921  O O   . LEU A 1 143 ? 19.886  32.734  31.873 1.00 65.29  ? 1034 LEU A O   1 
ATOM   922  C CB  . LEU A 1 143 ? 21.785  30.593  33.441 1.00 63.64  ? 1034 LEU A CB  1 
ATOM   923  C CG  . LEU A 1 143 ? 21.800  31.816  34.356 1.00 63.64  ? 1034 LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 143 ? 20.480  31.945  35.050 1.00 61.95  ? 1034 LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 143 ? 22.899  31.699  35.405 1.00 60.79  ? 1034 LEU A CD2 1 
ATOM   926  N N   . LEU A 1 144 ? 21.548  31.927  30.626 1.00 62.15  ? 1035 LEU A N   1 
ATOM   927  C CA  . LEU A 1 144 ? 21.487  33.036  29.693 1.00 61.85  ? 1035 LEU A CA  1 
ATOM   928  C C   . LEU A 1 144 ? 20.113  33.020  29.060 1.00 64.56  ? 1035 LEU A C   1 
ATOM   929  O O   . LEU A 1 144 ? 19.509  34.067  28.946 1.00 64.93  ? 1035 LEU A O   1 
ATOM   930  C CB  . LEU A 1 144 ? 22.535  32.886  28.592 1.00 57.40  ? 1035 LEU A CB  1 
ATOM   931  C CG  . LEU A 1 144 ? 23.013  34.119  27.830 1.00 52.76  ? 1035 LEU A CG  1 
ATOM   932  C CD1 . LEU A 1 144 ? 23.097  33.857  26.349 1.00 50.44  ? 1035 LEU A CD1 1 
ATOM   933  C CD2 . LEU A 1 144 ? 22.186  35.350  28.062 1.00 58.04  ? 1035 LEU A CD2 1 
ATOM   934  N N   . ASP A 1 145 ? 19.614  31.856  28.652 1.00 69.01  ? 1036 ASP A N   1 
ATOM   935  C CA  . ASP A 1 145 ? 18.327  31.776  27.957 1.00 69.14  ? 1036 ASP A CA  1 
ATOM   936  C C   . ASP A 1 145 ? 17.233  32.208  28.927 1.00 68.32  ? 1036 ASP A C   1 
ATOM   937  O O   . ASP A 1 145 ? 16.425  33.058  28.610 1.00 69.49  ? 1036 ASP A O   1 
ATOM   938  C CB  . ASP A 1 145 ? 18.066  30.402  27.311 1.00 70.16  ? 1036 ASP A CB  1 
ATOM   939  C CG  . ASP A 1 145 ? 18.785  30.227  25.952 1.00 77.86  ? 1036 ASP A CG  1 
ATOM   940  O OD1 . ASP A 1 145 ? 19.604  31.098  25.549 1.00 80.45  ? 1036 ASP A OD1 1 
ATOM   941  O OD2 . ASP A 1 145 ? 18.593  29.250  25.184 1.00 80.61  ? 1036 ASP A OD2 1 
ATOM   942  N N   . VAL A 1 146 ? 17.303  31.822  30.186 1.00 68.69  ? 1037 VAL A N   1 
ATOM   943  C CA  . VAL A 1 146 ? 16.286  32.338  31.084 1.00 69.22  ? 1037 VAL A CA  1 
ATOM   944  C C   . VAL A 1 146 ? 16.323  33.854  31.135 1.00 68.97  ? 1037 VAL A C   1 
ATOM   945  O O   . VAL A 1 146 ? 15.296  34.499  30.929 1.00 73.85  ? 1037 VAL A O   1 
ATOM   946  C CB  . VAL A 1 146 ? 16.393  31.784  32.514 1.00 67.22  ? 1037 VAL A CB  1 
ATOM   947  C CG1 . VAL A 1 146 ? 15.480  32.554  33.444 1.00 66.22  ? 1037 VAL A CG1 1 
ATOM   948  C CG2 . VAL A 1 146 ? 15.966  30.329  32.530 1.00 67.87  ? 1037 VAL A CG2 1 
ATOM   949  N N   . ILE A 1 147 ? 17.479  34.399  31.490 1.00 66.59  ? 1038 ILE A N   1 
ATOM   950  C CA  . ILE A 1 147 ? 17.607  35.807  31.839 1.00 62.66  ? 1038 ILE A CA  1 
ATOM   951  C C   . ILE A 1 147 ? 17.296  36.694  30.649 1.00 61.10  ? 1038 ILE A C   1 
ATOM   952  O O   . ILE A 1 147 ? 16.813  37.798  30.842 1.00 61.19  ? 1038 ILE A O   1 
ATOM   953  C CB  . ILE A 1 147 ? 19.030  36.078  32.377 1.00 61.53  ? 1038 ILE A CB  1 
ATOM   954  C CG1 . ILE A 1 147 ? 19.041  35.883  33.881 1.00 59.42  ? 1038 ILE A CG1 1 
ATOM   955  C CG2 . ILE A 1 147 ? 19.555  37.480  32.096 1.00 57.29  ? 1038 ILE A CG2 1 
ATOM   956  C CD1 . ILE A 1 147 ? 20.365  35.407  34.340 1.00 59.93  ? 1038 ILE A CD1 1 
ATOM   957  N N   . ASP A 1 148 ? 17.601  36.230  29.442 1.00 61.34  ? 1039 ASP A N   1 
ATOM   958  C CA  . ASP A 1 148 ? 17.209  36.918  28.218 1.00 64.06  ? 1039 ASP A CA  1 
ATOM   959  C C   . ASP A 1 148 ? 15.697  37.035  28.174 1.00 67.21  ? 1039 ASP A C   1 
ATOM   960  O O   . ASP A 1 148 ? 15.144  38.084  27.865 1.00 70.56  ? 1039 ASP A O   1 
ATOM   961  C CB  . ASP A 1 148 ? 17.645  36.144  26.975 1.00 60.45  ? 1039 ASP A CB  1 
ATOM   962  C CG  . ASP A 1 148 ? 19.026  36.529  26.521 1.00 63.67  ? 1039 ASP A CG  1 
ATOM   963  O OD1 . ASP A 1 148 ? 19.628  37.365  27.220 1.00 69.08  ? 1039 ASP A OD1 1 
ATOM   964  O OD2 . ASP A 1 148 ? 19.607  36.043  25.529 1.00 63.60  ? 1039 ASP A OD2 1 
ATOM   965  N N   . GLN A 1 149 ? 15.016  35.938  28.469 1.00 68.61  ? 1040 GLN A N   1 
ATOM   966  C CA  . GLN A 1 149 ? 13.572  35.937  28.349 1.00 68.44  ? 1040 GLN A CA  1 
ATOM   967  C C   . GLN A 1 149 ? 12.987  36.913  29.353 1.00 67.93  ? 1040 GLN A C   1 
ATOM   968  O O   . GLN A 1 149 ? 11.986  37.551  29.061 1.00 70.92  ? 1040 GLN A O   1 
ATOM   969  C CB  . GLN A 1 149 ? 13.004  34.528  28.510 1.00 70.21  ? 1040 GLN A CB  1 
ATOM   970  C CG  . GLN A 1 149 ? 13.191  33.675  27.247 1.00 74.60  ? 1040 GLN A CG  1 
ATOM   971  C CD  . GLN A 1 149 ? 12.409  34.171  26.032 1.00 79.24  ? 1040 GLN A CD  1 
ATOM   972  O OE1 . GLN A 1 149 ? 11.172  34.195  26.059 1.00 80.89  ? 1040 GLN A OE1 1 
ATOM   973  N NE2 . GLN A 1 149 ? 13.118  34.541  24.962 1.00 79.04  ? 1040 GLN A NE2 1 
ATOM   974  N N   . ALA A 1 150 ? 13.656  37.115  30.479 1.00 63.02  ? 1041 ALA A N   1 
ATOM   975  C CA  . ALA A 1 150 ? 13.196  38.098  31.440 1.00 60.68  ? 1041 ALA A CA  1 
ATOM   976  C C   . ALA A 1 150 ? 13.506  39.529  31.005 1.00 62.54  ? 1041 ALA A C   1 
ATOM   977  O O   . ALA A 1 150 ? 12.805  40.468  31.383 1.00 65.97  ? 1041 ALA A O   1 
ATOM   978  C CB  . ALA A 1 150 ? 13.794  37.804  32.801 1.00 55.59  ? 1041 ALA A CB  1 
ATOM   979  N N   . ARG A 1 151 ? 14.559  39.747  30.234 1.00 61.23  ? 1042 ARG A N   1 
ATOM   980  C CA  . ARG A 1 151 ? 14.830  41.122  29.852 1.00 61.73  ? 1042 ARG A CA  1 
ATOM   981  C C   . ARG A 1 151 ? 13.868  41.496  28.756 1.00 62.47  ? 1042 ARG A C   1 
ATOM   982  O O   . ARG A 1 151 ? 13.568  42.667  28.595 1.00 63.79  ? 1042 ARG A O   1 
ATOM   983  C CB  . ARG A 1 151 ? 16.180  41.322  29.180 1.00 61.51  ? 1042 ARG A CB  1 
ATOM   984  C CG  . ARG A 1 151 ? 17.419  40.869  29.889 1.00 61.39  ? 1042 ARG A CG  1 
ATOM   985  C CD  . ARG A 1 151 ? 18.606  41.184  29.008 1.00 65.60  ? 1042 ARG A CD  1 
ATOM   986  N NE  . ARG A 1 151 ? 19.643  41.772  29.832 1.00 71.25  ? 1042 ARG A NE  1 
ATOM   987  C CZ  . ARG A 1 151 ? 20.745  41.142  30.174 1.00 72.76  ? 1042 ARG A CZ  1 
ATOM   988  N NH1 . ARG A 1 151 ? 21.041  39.939  29.675 1.00 70.44  ? 1042 ARG A NH1 1 
ATOM   989  N NH2 . ARG A 1 151 ? 21.570  41.778  30.989 1.00 68.98  ? 1042 ARG A NH2 1 
ATOM   990  N N   . LEU A 1 152 ? 13.598  40.551  27.865 1.00 61.72  ? 1043 LEU A N   1 
ATOM   991  C CA  . LEU A 1 152 ? 12.595  40.754  26.827 1.00 59.92  ? 1043 LEU A CA  1 
ATOM   992  C C   . LEU A 1 152 ? 11.274  41.133  27.485 1.00 61.22  ? 1043 LEU A C   1 
ATOM   993  O O   . LEU A 1 152 ? 10.606  42.070  27.068 1.00 59.16  ? 1043 LEU A O   1 
ATOM   994  C CB  . LEU A 1 152 ? 12.451  39.485  25.986 1.00 58.26  ? 1043 LEU A CB  1 
ATOM   995  C CG  . LEU A 1 152 ? 13.697  39.269  25.118 1.00 56.01  ? 1043 LEU A CG  1 
ATOM   996  C CD1 . LEU A 1 152 ? 13.525  38.211  24.037 1.00 54.34  ? 1043 LEU A CD1 1 
ATOM   997  C CD2 . LEU A 1 152 ? 14.085  40.569  24.458 1.00 55.24  ? 1043 LEU A CD2 1 
ATOM   998  N N   . LYS A 1 153 ? 10.941  40.475  28.585 1.00 63.64  ? 1044 LYS A N   1 
ATOM   999  C CA  . LYS A 1 153 ? 9.737   40.867  29.284 1.00 68.06  ? 1044 LYS A CA  1 
ATOM   1000 C C   . LYS A 1 153 ? 9.902   42.308  29.750 1.00 71.86  ? 1044 LYS A C   1 
ATOM   1001 O O   . LYS A 1 153 ? 8.958   43.086  29.648 1.00 77.25  ? 1044 LYS A O   1 
ATOM   1002 C CB  . LYS A 1 153 ? 9.411   39.932  30.450 1.00 70.59  ? 1044 LYS A CB  1 
ATOM   1003 C CG  . LYS A 1 153 ? 8.541   38.729  30.065 1.00 78.89  ? 1044 LYS A CG  1 
ATOM   1004 C CD  . LYS A 1 153 ? 8.190   37.849  31.276 1.00 84.12  ? 1044 LYS A CD  1 
ATOM   1005 C CE  . LYS A 1 153 ? 7.046   38.444  32.120 1.00 87.66  ? 1044 LYS A CE  1 
ATOM   1006 N NZ  . LYS A 1 153 ? 6.879   37.882  33.504 1.00 92.28  ? 1044 LYS A NZ  1 
ATOM   1007 N N   . MET A 1 154 ? 11.060  42.699  30.272 1.00 70.48  ? 1045 MET A N   1 
ATOM   1008 C CA  . MET A 1 154 ? 11.097  43.983  30.963 1.00 65.61  ? 1045 MET A CA  1 
ATOM   1009 C C   . MET A 1 154 ? 11.162  45.119  29.994 1.00 63.15  ? 1045 MET A C   1 
ATOM   1010 O O   . MET A 1 154 ? 10.767  46.214  30.339 1.00 68.55  ? 1045 MET A O   1 
ATOM   1011 C CB  . MET A 1 154 ? 12.303  44.149  31.868 1.00 67.19  ? 1045 MET A CB  1 
ATOM   1012 C CG  . MET A 1 154 ? 12.044  43.669  33.269 1.00 73.43  ? 1045 MET A CG  1 
ATOM   1013 S SD  . MET A 1 154 ? 11.298  44.881  34.361 1.00 75.74  ? 1045 MET A SD  1 
ATOM   1014 C CE  . MET A 1 154 ? 9.771   45.348  33.506 1.00 77.04  ? 1045 MET A CE  1 
ATOM   1015 N N   . LEU A 1 155 ? 11.765  44.892  28.840 1.00 58.67  ? 1046 LEU A N   1 
ATOM   1016 C CA  . LEU A 1 155 ? 11.917  45.959  27.879 1.00 58.03  ? 1046 LEU A CA  1 
ATOM   1017 C C   . LEU A 1 155 ? 10.673  45.992  27.036 1.00 59.86  ? 1046 LEU A C   1 
ATOM   1018 O O   . LEU A 1 155 ? 10.581  46.824  26.137 1.00 58.67  ? 1046 LEU A O   1 
ATOM   1019 C CB  . LEU A 1 155 ? 13.087  45.680  26.950 1.00 61.50  ? 1046 LEU A CB  1 
ATOM   1020 C CG  . LEU A 1 155 ? 14.439  45.366  27.581 1.00 63.37  ? 1046 LEU A CG  1 
ATOM   1021 C CD1 . LEU A 1 155 ? 15.202  44.433  26.662 1.00 64.93  ? 1046 LEU A CD1 1 
ATOM   1022 C CD2 . LEU A 1 155 ? 15.239  46.629  27.828 1.00 63.28  ? 1046 LEU A CD2 1 
ATOM   1023 N N   . GLY A 1 156 ? 9.808   45.001  27.255 1.00 61.54  ? 1047 GLY A N   1 
ATOM   1024 C CA  . GLY A 1 156 ? 8.459   44.960  26.710 1.00 64.34  ? 1047 GLY A CA  1 
ATOM   1025 C C   . GLY A 1 156 ? 8.340   44.563  25.251 1.00 67.07  ? 1047 GLY A C   1 
ATOM   1026 O O   . GLY A 1 156 ? 7.809   45.323  24.457 1.00 66.75  ? 1047 GLY A O   1 
ATOM   1027 N N   . GLN A 1 157 ? 8.775   43.368  24.876 1.00 70.29  ? 1048 GLN A N   1 
ATOM   1028 C CA  . GLN A 1 157 ? 8.632   42.931  23.495 1.00 72.22  ? 1048 GLN A CA  1 
ATOM   1029 C C   . GLN A 1 157 ? 7.337   42.138  23.325 1.00 72.26  ? 1048 GLN A C   1 
ATOM   1030 O O   . GLN A 1 157 ? 6.789   41.645  24.302 1.00 70.10  ? 1048 GLN A O   1 
ATOM   1031 C CB  . GLN A 1 157 ? 9.835   42.065  23.146 1.00 77.11  ? 1048 GLN A CB  1 
ATOM   1032 C CG  . GLN A 1 157 ? 9.913   41.614  21.704 1.00 84.45  ? 1048 GLN A CG  1 
ATOM   1033 C CD  . GLN A 1 157 ? 10.826  40.423  21.588 1.00 89.50  ? 1048 GLN A CD  1 
ATOM   1034 O OE1 . GLN A 1 157 ? 10.582  39.377  22.211 1.00 90.51  ? 1048 GLN A OE1 1 
ATOM   1035 N NE2 . GLN A 1 157 ? 11.910  40.595  20.835 1.00 92.19  ? 1048 GLN A NE2 1 
ATOM   1036 N N   . THR A 1 158 ? 6.915   41.934  22.080 1.00 71.78  ? 1049 THR A N   1 
ATOM   1037 C CA  . THR A 1 158 ? 5.523   41.665  21.737 1.00 71.74  ? 1049 THR A CA  1 
ATOM   1038 C C   . THR A 1 158 ? 5.135   40.184  21.481 1.00 74.02  ? 1049 THR A C   1 
ATOM   1039 O O   . THR A 1 158 ? 5.031   39.470  20.473 1.00 75.52  ? 1049 THR A O   1 
ATOM   1040 C CB  . THR A 1 158 ? 5.182   42.610  20.549 1.00 70.82  ? 1049 THR A CB  1 
ATOM   1041 O OG1 . THR A 1 158 ? 6.373   42.991  19.850 1.00 67.34  ? 1049 THR A OG1 1 
ATOM   1042 C CG2 . THR A 1 158 ? 4.678   43.968  21.025 1.00 66.24  ? 1049 THR A CG2 1 
ATOM   1043 N N   . GLN B 1 16  ? 3.599   74.324  20.584 1.00 117.89 ? 907  GLN B N   1 
ATOM   1044 C CA  . GLN B 1 16  ? 3.770   74.091  19.124 1.00 119.86 ? 907  GLN B CA  1 
ATOM   1045 C C   . GLN B 1 16  ? 4.065   72.641  18.814 1.00 119.66 ? 907  GLN B C   1 
ATOM   1046 O O   . GLN B 1 16  ? 3.567   72.078  17.839 1.00 123.55 ? 907  GLN B O   1 
ATOM   1047 C CB  . GLN B 1 16  ? 4.911   74.931  18.558 1.00 124.06 ? 907  GLN B CB  1 
ATOM   1048 C CG  . GLN B 1 16  ? 5.240   74.554  17.112 1.00 122.52 ? 907  GLN B CG  1 
ATOM   1049 C CD  . GLN B 1 16  ? 6.485   75.230  16.616 1.00 125.93 ? 907  GLN B CD  1 
ATOM   1050 O OE1 . GLN B 1 16  ? 7.252   75.801  17.412 1.00 125.33 ? 907  GLN B OE1 1 
ATOM   1051 N NE2 . GLN B 1 16  ? 6.728   75.176  15.295 1.00 126.31 ? 907  GLN B NE2 1 
ATOM   1052 N N   . GLU B 1 17  ? 4.916   72.012  19.658 1.00 116.13 ? 908  GLU B N   1 
ATOM   1053 C CA  . GLU B 1 17  ? 5.265   70.626  19.425 1.00 109.25 ? 908  GLU B CA  1 
ATOM   1054 C C   . GLU B 1 17  ? 4.237   69.624  19.904 1.00 101.31 ? 908  GLU B C   1 
ATOM   1055 O O   . GLU B 1 17  ? 3.429   69.878  20.800 1.00 96.48  ? 908  GLU B O   1 
ATOM   1056 C CB  . GLU B 1 17  ? 6.641   70.294  20.030 1.00 116.80 ? 908  GLU B CB  1 
ATOM   1057 C CG  . GLU B 1 17  ? 7.590   69.824  18.922 1.00 122.46 ? 908  GLU B CG  1 
ATOM   1058 C CD  . GLU B 1 17  ? 9.006   69.532  19.390 1.00 128.82 ? 908  GLU B CD  1 
ATOM   1059 O OE1 . GLU B 1 17  ? 9.187   68.563  20.168 1.00 136.42 ? 908  GLU B OE1 1 
ATOM   1060 O OE2 . GLU B 1 17  ? 9.933   70.277  18.966 1.00 126.00 ? 908  GLU B OE2 1 
ATOM   1061 N N   . ILE B 1 18  ? 4.281   68.450  19.265 1.00 90.64  ? 909  ILE B N   1 
ATOM   1062 C CA  . ILE B 1 18  ? 3.354   67.381  19.574 1.00 81.79  ? 909  ILE B CA  1 
ATOM   1063 C C   . ILE B 1 18  ? 3.993   66.084  19.127 1.00 78.56  ? 909  ILE B C   1 
ATOM   1064 O O   . ILE B 1 18  ? 4.732   66.031  18.147 1.00 77.68  ? 909  ILE B O   1 
ATOM   1065 C CB  . ILE B 1 18  ? 2.005   67.564  18.809 1.00 79.49  ? 909  ILE B CB  1 
ATOM   1066 C CG1 . ILE B 1 18  ? 1.020   66.456  19.205 1.00 82.34  ? 909  ILE B CG1 1 
ATOM   1067 C CG2 . ILE B 1 18  ? 2.247   67.547  17.289 1.00 72.38  ? 909  ILE B CG2 1 
ATOM   1068 C CD1 . ILE B 1 18  ? 0.476   66.557  20.623 1.00 83.56  ? 909  ILE B CD1 1 
ATOM   1069 N N   . SER B 1 19  ? 3.702   64.996  19.863 1.00 73.94  ? 910  SER B N   1 
ATOM   1070 C CA  . SER B 1 19  ? 4.249   63.711  19.503 1.00 70.91  ? 910  SER B CA  1 
ATOM   1071 C C   . SER B 1 19  ? 3.151   62.650  19.463 1.00 64.70  ? 910  SER B C   1 
ATOM   1072 O O   . SER B 1 19  ? 2.170   62.728  20.200 1.00 62.17  ? 910  SER B O   1 
ATOM   1073 C CB  . SER B 1 19  ? 5.369   63.327  20.472 1.00 74.79  ? 910  SER B CB  1 
ATOM   1074 O OG  . SER B 1 19  ? 5.020   63.650  21.806 1.00 85.71  ? 910  SER B OG  1 
ATOM   1075 N N   . PRO B 1 20  ? 3.324   61.632  18.610 1.00 61.36  ? 911  PRO B N   1 
ATOM   1076 C CA  . PRO B 1 20  ? 2.419   60.508  18.366 1.00 57.06  ? 911  PRO B CA  1 
ATOM   1077 C C   . PRO B 1 20  ? 2.214   59.653  19.595 1.00 57.93  ? 911  PRO B C   1 
ATOM   1078 O O   . PRO B 1 20  ? 3.027   59.524  20.502 1.00 62.43  ? 911  PRO B O   1 
ATOM   1079 C CB  . PRO B 1 20  ? 3.236   59.620  17.465 1.00 51.62  ? 911  PRO B CB  1 
ATOM   1080 C CG  . PRO B 1 20  ? 4.149   60.513  16.852 1.00 53.09  ? 911  PRO B CG  1 
ATOM   1081 C CD  . PRO B 1 20  ? 4.598   61.371  17.928 1.00 56.92  ? 911  PRO B CD  1 
ATOM   1082 N N   . PRO B 1 21  ? 1.075   59.007  19.658 1.00 58.01  ? 912  PRO B N   1 
ATOM   1083 C CA  . PRO B 1 21  ? 0.831   58.232  20.859 1.00 57.64  ? 912  PRO B CA  1 
ATOM   1084 C C   . PRO B 1 21  ? 1.993   57.274  20.960 1.00 54.61  ? 912  PRO B C   1 
ATOM   1085 O O   . PRO B 1 21  ? 2.549   56.773  19.998 1.00 55.81  ? 912  PRO B O   1 
ATOM   1086 C CB  . PRO B 1 21  ? -0.461  57.470  20.548 1.00 58.59  ? 912  PRO B CB  1 
ATOM   1087 C CG  . PRO B 1 21  ? -0.780  57.723  19.145 1.00 56.43  ? 912  PRO B CG  1 
ATOM   1088 C CD  . PRO B 1 21  ? -0.037  58.926  18.707 1.00 57.69  ? 912  PRO B CD  1 
ATOM   1089 N N   . PRO B 1 22  ? 2.325   56.929  22.207 1.00 52.92  ? 913  PRO B N   1 
ATOM   1090 C CA  . PRO B 1 22  ? 3.472   56.071  22.448 1.00 53.26  ? 913  PRO B CA  1 
ATOM   1091 C C   . PRO B 1 22  ? 3.412   54.863  21.533 1.00 51.21  ? 913  PRO B C   1 
ATOM   1092 O O   . PRO B 1 22  ? 2.333   54.342  21.309 1.00 51.43  ? 913  PRO B O   1 
ATOM   1093 C CB  . PRO B 1 22  ? 3.289   55.686  23.914 1.00 52.54  ? 913  PRO B CB  1 
ATOM   1094 C CG  . PRO B 1 22  ? 2.553   56.815  24.508 1.00 47.18  ? 913  PRO B CG  1 
ATOM   1095 C CD  . PRO B 1 22  ? 1.551   57.162  23.436 1.00 51.09  ? 913  PRO B CD  1 
ATOM   1096 N N   . THR B 1 23  ? 4.558   54.416  21.029 1.00 52.55  ? 914  THR B N   1 
ATOM   1097 C CA  . THR B 1 23  ? 4.575   53.313  20.079 1.00 55.52  ? 914  THR B CA  1 
ATOM   1098 C C   . THR B 1 23  ? 3.697   52.148  20.497 1.00 53.04  ? 914  THR B C   1 
ATOM   1099 O O   . THR B 1 23  ? 3.602   51.794  21.676 1.00 51.22  ? 914  THR B O   1 
ATOM   1100 C CB  . THR B 1 23  ? 5.993   52.786  19.853 1.00 53.48  ? 914  THR B CB  1 
ATOM   1101 O OG1 . THR B 1 23  ? 6.019   51.867  18.751 1.00 56.12  ? 914  THR B OG1 1 
ATOM   1102 C CG2 . THR B 1 23  ? 6.381   51.924  21.005 1.00 55.82  ? 914  THR B CG2 1 
ATOM   1103 N N   . ALA B 1 24  ? 3.093   51.556  19.476 1.00 54.06  ? 915  ALA B N   1 
ATOM   1104 C CA  . ALA B 1 24  ? 2.334   50.324  19.643 1.00 59.31  ? 915  ALA B CA  1 
ATOM   1105 C C   . ALA B 1 24  ? 3.176   49.067  19.595 1.00 64.39  ? 915  ALA B C   1 
ATOM   1106 O O   . ALA B 1 24  ? 2.656   48.031  19.985 1.00 65.93  ? 915  ALA B O   1 
ATOM   1107 C CB  . ALA B 1 24  ? 1.254   50.204  18.590 1.00 60.95  ? 915  ALA B CB  1 
ATOM   1108 N N   . ASN B 1 25  ? 4.413   49.138  19.100 1.00 68.71  ? 916  ASN B N   1 
ATOM   1109 C CA  . ASN B 1 25  ? 5.374   48.041  19.216 1.00 68.63  ? 916  ASN B CA  1 
ATOM   1110 C C   . ASN B 1 25  ? 5.982   47.764  20.586 1.00 66.96  ? 916  ASN B C   1 
ATOM   1111 O O   . ASN B 1 25  ? 7.108   47.300  20.629 1.00 69.55  ? 916  ASN B O   1 
ATOM   1112 C CB  . ASN B 1 25  ? 6.593   48.304  18.327 1.00 76.42  ? 916  ASN B CB  1 
ATOM   1113 C CG  . ASN B 1 25  ? 6.227   48.572  16.885 1.00 84.04  ? 916  ASN B CG  1 
ATOM   1114 O OD1 . ASN B 1 25  ? 5.376   47.880  16.327 1.00 89.06  ? 916  ASN B OD1 1 
ATOM   1115 N ND2 . ASN B 1 25  ? 6.879   49.559  16.266 1.00 86.65  ? 916  ASN B ND2 1 
ATOM   1116 N N   . LEU B 1 26  ? 5.344   48.042  21.712 1.00 63.59  ? 917  LEU B N   1 
ATOM   1117 C CA  . LEU B 1 26  ? 5.862   47.495  22.960 1.00 59.53  ? 917  LEU B CA  1 
ATOM   1118 C C   . LEU B 1 26  ? 4.713   47.041  23.839 1.00 59.30  ? 917  LEU B C   1 
ATOM   1119 O O   . LEU B 1 26  ? 3.715   47.734  23.960 1.00 61.76  ? 917  LEU B O   1 
ATOM   1120 C CB  . LEU B 1 26  ? 6.723   48.504  23.726 1.00 58.65  ? 917  LEU B CB  1 
ATOM   1121 C CG  . LEU B 1 26  ? 8.050   48.953  23.099 1.00 58.65  ? 917  LEU B CG  1 
ATOM   1122 C CD1 . LEU B 1 26  ? 8.528   50.304  23.611 1.00 55.12  ? 917  LEU B CD1 1 
ATOM   1123 C CD2 . LEU B 1 26  ? 9.144   47.937  23.344 1.00 61.32  ? 917  LEU B CD2 1 
ATOM   1124 N N   . ASP B 1 27  ? 4.850   45.865  24.434 1.00 60.93  ? 918  ASP B N   1 
ATOM   1125 C CA  . ASP B 1 27  ? 3.910   45.376  25.440 1.00 66.41  ? 918  ASP B CA  1 
ATOM   1126 C C   . ASP B 1 27  ? 3.872   46.255  26.694 1.00 67.17  ? 918  ASP B C   1 
ATOM   1127 O O   . ASP B 1 27  ? 4.921   46.699  27.180 1.00 70.08  ? 918  ASP B O   1 
ATOM   1128 C CB  . ASP B 1 27  ? 4.278   43.930  25.801 1.00 69.38  ? 918  ASP B CB  1 
ATOM   1129 C CG  . ASP B 1 27  ? 3.363   43.309  26.848 1.00 72.51  ? 918  ASP B CG  1 
ATOM   1130 O OD1 . ASP B 1 27  ? 2.189   43.000  26.568 1.00 76.07  ? 918  ASP B OD1 1 
ATOM   1131 O OD2 . ASP B 1 27  ? 3.767   42.979  27.977 1.00 80.66  ? 918  ASP B OD2 1 
ATOM   1132 N N   . ARG B 1 28  ? 2.674   46.507  27.225 1.00 64.97  ? 919  ARG B N   1 
ATOM   1133 C CA  . ARG B 1 28  ? 2.571   47.464  28.319 1.00 63.57  ? 919  ARG B CA  1 
ATOM   1134 C C   . ARG B 1 28  ? 2.006   46.908  29.610 1.00 69.10  ? 919  ARG B C   1 
ATOM   1135 O O   . ARG B 1 28  ? 1.764   47.664  30.548 1.00 74.72  ? 919  ARG B O   1 
ATOM   1136 C CB  . ARG B 1 28  ? 1.837   48.731  27.896 1.00 54.12  ? 919  ARG B CB  1 
ATOM   1137 C CG  . ARG B 1 28  ? 2.431   49.361  26.642 1.00 49.02  ? 919  ARG B CG  1 
ATOM   1138 C CD  . ARG B 1 28  ? 3.519   50.386  26.865 1.00 40.93  ? 919  ARG B CD  1 
ATOM   1139 N NE  . ARG B 1 28  ? 3.854   51.016  25.596 1.00 42.35  ? 919  ARG B NE  1 
ATOM   1140 C CZ  . ARG B 1 28  ? 4.899   51.804  25.411 1.00 43.00  ? 919  ARG B CZ  1 
ATOM   1141 N NH1 . ARG B 1 28  ? 5.750   51.974  26.412 1.00 45.17  ? 919  ARG B NH1 1 
ATOM   1142 N NH2 . ARG B 1 28  ? 5.131   52.352  24.220 1.00 36.34  ? 919  ARG B NH2 1 
ATOM   1143 N N   . SER B 1 29  ? 1.949   45.588  29.734 1.00 71.43  ? 920  SER B N   1 
ATOM   1144 C CA  . SER B 1 29  ? 1.494   44.978  30.983 1.00 74.31  ? 920  SER B CA  1 
ATOM   1145 C C   . SER B 1 29  ? 2.562   44.846  32.065 1.00 76.47  ? 920  SER B C   1 
ATOM   1146 O O   . SER B 1 29  ? 2.242   44.572  33.217 1.00 77.03  ? 920  SER B O   1 
ATOM   1147 C CB  . SER B 1 29  ? 0.987   43.585  30.657 1.00 75.48  ? 920  SER B CB  1 
ATOM   1148 O OG  . SER B 1 29  ? 1.873   43.007  29.717 1.00 76.15  ? 920  SER B OG  1 
ATOM   1149 N N   . ASN B 1 30  ? 3.831   44.927  31.672 1.00 80.68  ? 921  ASN B N   1 
ATOM   1150 C CA  . ASN B 1 30  ? 4.959   44.872  32.602 1.00 82.07  ? 921  ASN B CA  1 
ATOM   1151 C C   . ASN B 1 30  ? 5.667   46.226  32.576 1.00 78.46  ? 921  ASN B C   1 
ATOM   1152 O O   . ASN B 1 30  ? 6.894   46.300  32.781 1.00 81.28  ? 921  ASN B O   1 
ATOM   1153 C CB  . ASN B 1 30  ? 5.984   43.805  32.164 1.00 91.56  ? 921  ASN B CB  1 
ATOM   1154 C CG  . ASN B 1 30  ? 5.532   42.360  32.414 1.00 97.28  ? 921  ASN B CG  1 
ATOM   1155 O OD1 . ASN B 1 30  ? 5.545   41.860  33.547 1.00 97.51  ? 921  ASN B OD1 1 
ATOM   1156 N ND2 . ASN B 1 30  ? 5.225   41.653  31.324 1.00 100.08 ? 921  ASN B ND2 1 
ATOM   1157 N N   . ASP B 1 31  ? 4.941   47.280  32.207 1.00 70.98  ? 922  ASP B N   1 
ATOM   1158 C CA  . ASP B 1 31  ? 5.641   48.522  31.897 1.00 66.47  ? 922  ASP B CA  1 
ATOM   1159 C C   . ASP B 1 31  ? 5.360   49.519  32.995 1.00 63.61  ? 922  ASP B C   1 
ATOM   1160 O O   . ASP B 1 31  ? 4.276   50.080  33.027 1.00 63.81  ? 922  ASP B O   1 
ATOM   1161 C CB  . ASP B 1 31  ? 5.332   49.095  30.516 1.00 62.08  ? 922  ASP B CB  1 
ATOM   1162 C CG  . ASP B 1 31  ? 6.266   50.234  30.165 1.00 60.55  ? 922  ASP B CG  1 
ATOM   1163 O OD1 . ASP B 1 31  ? 6.857   50.744  31.142 1.00 57.55  ? 922  ASP B OD1 1 
ATOM   1164 O OD2 . ASP B 1 31  ? 6.475   50.696  29.015 1.00 56.36  ? 922  ASP B OD2 1 
ATOM   1165 N N   . LYS B 1 32  ? 6.326   49.680  33.896 1.00 61.00  ? 923  LYS B N   1 
ATOM   1166 C CA  . LYS B 1 32  ? 6.086   50.353  35.162 1.00 61.90  ? 923  LYS B CA  1 
ATOM   1167 C C   . LYS B 1 32  ? 6.420   51.832  34.993 1.00 61.70  ? 923  LYS B C   1 
ATOM   1168 O O   . LYS B 1 32  ? 6.001   52.693  35.780 1.00 62.29  ? 923  LYS B O   1 
ATOM   1169 C CB  . LYS B 1 32  ? 6.913   49.709  36.276 1.00 65.48  ? 923  LYS B CB  1 
ATOM   1170 C CG  . LYS B 1 32  ? 6.131   49.512  37.589 1.00 70.53  ? 923  LYS B CG  1 
ATOM   1171 C CD  . LYS B 1 32  ? 6.898   50.067  38.820 1.00 77.45  ? 923  LYS B CD  1 
ATOM   1172 C CE  . LYS B 1 32  ? 6.041   50.077  40.112 1.00 79.71  ? 923  LYS B CE  1 
ATOM   1173 N NZ  . LYS B 1 32  ? 6.198   51.306  40.959 1.00 76.27  ? 923  LYS B NZ  1 
ATOM   1174 N N   . VAL B 1 33  ? 7.174   52.092  33.930 1.00 59.19  ? 924  VAL B N   1 
ATOM   1175 C CA  . VAL B 1 33  ? 7.558   53.435  33.547 1.00 56.65  ? 924  VAL B CA  1 
ATOM   1176 C C   . VAL B 1 33  ? 6.353   54.121  32.974 1.00 56.48  ? 924  VAL B C   1 
ATOM   1177 O O   . VAL B 1 33  ? 6.156   55.306  33.221 1.00 58.36  ? 924  VAL B O   1 
ATOM   1178 C CB  . VAL B 1 33  ? 8.602   53.400  32.440 1.00 57.62  ? 924  VAL B CB  1 
ATOM   1179 C CG1 . VAL B 1 33  ? 8.813   54.774  31.825 1.00 55.03  ? 924  VAL B CG1 1 
ATOM   1180 C CG2 . VAL B 1 33  ? 9.894   52.878  33.017 1.00 56.68  ? 924  VAL B CG2 1 
ATOM   1181 N N   . TYR B 1 34  ? 5.636   53.380  32.133 1.00 56.07  ? 925  TYR B N   1 
ATOM   1182 C CA  . TYR B 1 34  ? 4.328   53.764  31.601 1.00 54.79  ? 925  TYR B CA  1 
ATOM   1183 C C   . TYR B 1 34  ? 3.380   53.945  32.768 1.00 54.37  ? 925  TYR B C   1 
ATOM   1184 O O   . TYR B 1 34  ? 2.698   54.952  32.881 1.00 55.98  ? 925  TYR B O   1 
ATOM   1185 C CB  . TYR B 1 34  ? 3.780   52.695  30.653 1.00 50.84  ? 925  TYR B CB  1 
ATOM   1186 C CG  . TYR B 1 34  ? 2.799   53.160  29.593 1.00 46.81  ? 925  TYR B CG  1 
ATOM   1187 C CD1 . TYR B 1 34  ? 1.436   53.219  29.868 1.00 46.75  ? 925  TYR B CD1 1 
ATOM   1188 C CD2 . TYR B 1 34  ? 3.203   53.419  28.294 1.00 44.39  ? 925  TYR B CD2 1 
ATOM   1189 C CE1 . TYR B 1 34  ? 0.514   53.602  28.909 1.00 44.26  ? 925  TYR B CE1 1 
ATOM   1190 C CE2 . TYR B 1 34  ? 2.296   53.813  27.334 1.00 45.78  ? 925  TYR B CE2 1 
ATOM   1191 C CZ  . TYR B 1 34  ? 0.946   53.895  27.648 1.00 45.92  ? 925  TYR B CZ  1 
ATOM   1192 O OH  . TYR B 1 34  ? -0.003  54.246  26.719 1.00 49.90  ? 925  TYR B OH  1 
ATOM   1193 N N   . GLU B 1 35  ? 3.411   53.014  33.700 1.00 53.49  ? 926  GLU B N   1 
ATOM   1194 C CA  . GLU B 1 35  ? 2.443   53.075  34.777 1.00 57.73  ? 926  GLU B CA  1 
ATOM   1195 C C   . GLU B 1 35  ? 2.707   54.318  35.625 1.00 58.13  ? 926  GLU B C   1 
ATOM   1196 O O   . GLU B 1 35  ? 1.782   54.958  36.156 1.00 59.97  ? 926  GLU B O   1 
ATOM   1197 C CB  . GLU B 1 35  ? 2.501   51.776  35.574 1.00 59.46  ? 926  GLU B CB  1 
ATOM   1198 C CG  . GLU B 1 35  ? 1.791   51.761  36.919 1.00 73.07  ? 926  GLU B CG  1 
ATOM   1199 C CD  . GLU B 1 35  ? 1.913   50.401  37.609 1.00 85.37  ? 926  GLU B CD  1 
ATOM   1200 O OE1 . GLU B 1 35  ? 1.975   50.414  38.861 1.00 91.50  ? 926  GLU B OE1 1 
ATOM   1201 O OE2 . GLU B 1 35  ? 1.976   49.330  36.933 1.00 87.18  ? 926  GLU B OE2 1 
ATOM   1202 N N   . ASN B 1 36  ? 3.975   54.701  35.700 1.00 57.19  ? 927  ASN B N   1 
ATOM   1203 C CA  . ASN B 1 36  ? 4.344   55.753  36.635 1.00 59.34  ? 927  ASN B CA  1 
ATOM   1204 C C   . ASN B 1 36  ? 4.178   57.119  35.973 1.00 58.56  ? 927  ASN B C   1 
ATOM   1205 O O   . ASN B 1 36  ? 3.810   58.116  36.602 1.00 60.47  ? 927  ASN B O   1 
ATOM   1206 C CB  . ASN B 1 36  ? 5.773   55.552  37.143 1.00 58.96  ? 927  ASN B CB  1 
ATOM   1207 C CG  . ASN B 1 36  ? 5.909   54.382  38.102 1.00 61.20  ? 927  ASN B CG  1 
ATOM   1208 O OD1 . ASN B 1 36  ? 4.927   53.765  38.524 1.00 61.06  ? 927  ASN B OD1 1 
ATOM   1209 N ND2 . ASN B 1 36  ? 7.148   54.090  38.468 1.00 62.22  ? 927  ASN B ND2 1 
ATOM   1210 N N   . VAL B 1 37  ? 4.446   57.154  34.677 1.00 56.05  ? 928  VAL B N   1 
ATOM   1211 C CA  . VAL B 1 37  ? 4.144   58.352  33.914 1.00 52.57  ? 928  VAL B CA  1 
ATOM   1212 C C   . VAL B 1 37  ? 2.638   58.553  33.976 1.00 52.97  ? 928  VAL B C   1 
ATOM   1213 O O   . VAL B 1 37  ? 2.169   59.670  34.199 1.00 54.28  ? 928  VAL B O   1 
ATOM   1214 C CB  . VAL B 1 37  ? 4.622   58.195  32.476 1.00 49.39  ? 928  VAL B CB  1 
ATOM   1215 C CG1 . VAL B 1 37  ? 4.108   59.305  31.599 1.00 43.71  ? 928  VAL B CG1 1 
ATOM   1216 C CG2 . VAL B 1 37  ? 6.126   58.180  32.493 1.00 48.65  ? 928  VAL B CG2 1 
ATOM   1217 N N   . THR B 1 38  ? 1.880   57.468  33.862 1.00 50.64  ? 929  THR B N   1 
ATOM   1218 C CA  . THR B 1 38  ? 0.437   57.621  33.861 1.00 49.36  ? 929  THR B CA  1 
ATOM   1219 C C   . THR B 1 38  ? 0.028   58.121  35.233 1.00 50.37  ? 929  THR B C   1 
ATOM   1220 O O   . THR B 1 38  ? -0.889  58.935  35.368 1.00 50.73  ? 929  THR B O   1 
ATOM   1221 C CB  . THR B 1 38  ? -0.234  56.286  33.632 1.00 45.16  ? 929  THR B CB  1 
ATOM   1222 O OG1 . THR B 1 38  ? -0.393  56.052  32.233 1.00 45.48  ? 929  THR B OG1 1 
ATOM   1223 C CG2 . THR B 1 38  ? -1.638  56.375  34.121 1.00 45.35  ? 929  THR B CG2 1 
ATOM   1224 N N   . GLY B 1 39  ? 0.724   57.604  36.243 1.00 49.51  ? 930  GLY B N   1 
ATOM   1225 C CA  . GLY B 1 39  ? 0.389   57.934  37.615 1.00 45.16  ? 930  GLY B CA  1 
ATOM   1226 C C   . GLY B 1 39  ? 0.569   59.402  37.914 1.00 43.11  ? 930  GLY B C   1 
ATOM   1227 O O   . GLY B 1 39  ? -0.021  59.963  38.819 1.00 46.47  ? 930  GLY B O   1 
ATOM   1228 N N   . LEU B 1 40  ? 1.475   60.026  37.186 1.00 41.69  ? 931  LEU B N   1 
ATOM   1229 C CA  . LEU B 1 40  ? 2.049   61.270  37.652 1.00 42.26  ? 931  LEU B CA  1 
ATOM   1230 C C   . LEU B 1 40  ? 1.202   62.276  36.916 1.00 45.14  ? 931  LEU B C   1 
ATOM   1231 O O   . LEU B 1 40  ? 0.857   63.315  37.474 1.00 47.22  ? 931  LEU B O   1 
ATOM   1232 C CB  . LEU B 1 40  ? 3.518   61.426  37.228 1.00 36.54  ? 931  LEU B CB  1 
ATOM   1233 C CG  . LEU B 1 40  ? 3.969   62.857  36.920 1.00 33.23  ? 931  LEU B CG  1 
ATOM   1234 C CD1 . LEU B 1 40  ? 4.043   63.690  38.180 1.00 30.81  ? 931  LEU B CD1 1 
ATOM   1235 C CD2 . LEU B 1 40  ? 5.337   62.857  36.319 1.00 40.85  ? 931  LEU B CD2 1 
ATOM   1236 N N   . VAL B 1 41  ? 0.948   61.999  35.642 1.00 44.61  ? 932  VAL B N   1 
ATOM   1237 C CA  . VAL B 1 41  ? 0.027   62.847  34.909 1.00 46.01  ? 932  VAL B CA  1 
ATOM   1238 C C   . VAL B 1 41  ? -1.357  62.846  35.571 1.00 48.04  ? 932  VAL B C   1 
ATOM   1239 O O   . VAL B 1 41  ? -1.988  63.887  35.722 1.00 45.93  ? 932  VAL B O   1 
ATOM   1240 C CB  . VAL B 1 41  ? -0.072  62.433  33.467 1.00 43.83  ? 932  VAL B CB  1 
ATOM   1241 C CG1 . VAL B 1 41  ? -1.096  63.285  32.805 1.00 43.30  ? 932  VAL B CG1 1 
ATOM   1242 C CG2 . VAL B 1 41  ? 1.263   62.651  32.800 1.00 41.04  ? 932  VAL B CG2 1 
ATOM   1243 N N   . LYS B 1 42  ? -1.756  61.723  36.150 1.00 49.67  ? 933  LYS B N   1 
ATOM   1244 C CA  . LYS B 1 42  ? -3.051  61.708  36.795 1.00 51.52  ? 933  LYS B CA  1 
ATOM   1245 C C   . LYS B 1 42  ? -2.986  62.663  37.967 1.00 53.55  ? 933  LYS B C   1 
ATOM   1246 O O   . LYS B 1 42  ? -3.819  63.554  38.069 1.00 60.52  ? 933  LYS B O   1 
ATOM   1247 C CB  . LYS B 1 42  ? -3.554  60.300  37.135 1.00 47.52  ? 933  LYS B CB  1 
ATOM   1248 C CG  . LYS B 1 42  ? -4.393  59.760  35.980 1.00 48.60  ? 933  LYS B CG  1 
ATOM   1249 C CD  . LYS B 1 42  ? -4.655  58.269  36.033 1.00 51.80  ? 933  LYS B CD  1 
ATOM   1250 C CE  . LYS B 1 42  ? -5.358  57.800  34.752 1.00 59.83  ? 933  LYS B CE  1 
ATOM   1251 N NZ  . LYS B 1 42  ? -6.470  56.847  35.086 1.00 63.43  ? 933  LYS B NZ  1 
ATOM   1252 N N   . ALA B 1 43  ? -1.997  62.532  38.835 1.00 54.53  ? 934  ALA B N   1 
ATOM   1253 C CA  . ALA B 1 43  ? -1.926  63.414  39.993 1.00 51.68  ? 934  ALA B CA  1 
ATOM   1254 C C   . ALA B 1 43  ? -1.903  64.871  39.561 1.00 52.91  ? 934  ALA B C   1 
ATOM   1255 O O   . ALA B 1 43  ? -2.283  65.720  40.363 1.00 56.40  ? 934  ALA B O   1 
ATOM   1256 C CB  . ALA B 1 43  ? -0.695  63.118  40.799 1.00 47.59  ? 934  ALA B CB  1 
ATOM   1257 N N   . VAL B 1 44  ? -1.457  65.163  38.338 1.00 51.77  ? 935  VAL B N   1 
ATOM   1258 C CA  . VAL B 1 44  ? -1.314  66.546  37.893 1.00 50.86  ? 935  VAL B CA  1 
ATOM   1259 C C   . VAL B 1 44  ? -2.674  67.036  37.437 1.00 52.68  ? 935  VAL B C   1 
ATOM   1260 O O   . VAL B 1 44  ? -3.045  68.183  37.656 1.00 56.60  ? 935  VAL B O   1 
ATOM   1261 C CB  . VAL B 1 44  ? -0.296  66.716  36.742 1.00 48.29  ? 935  VAL B CB  1 
ATOM   1262 C CG1 . VAL B 1 44  ? -0.467  68.032  36.054 1.00 44.94  ? 935  VAL B CG1 1 
ATOM   1263 C CG2 . VAL B 1 44  ? 1.091   66.705  37.269 1.00 49.06  ? 935  VAL B CG2 1 
ATOM   1264 N N   . ILE B 1 45  ? -3.420  66.166  36.769 1.00 53.24  ? 936  ILE B N   1 
ATOM   1265 C CA  . ILE B 1 45  ? -4.809  66.465  36.448 1.00 52.37  ? 936  ILE B CA  1 
ATOM   1266 C C   . ILE B 1 45  ? -5.618  66.663  37.718 1.00 53.55  ? 936  ILE B C   1 
ATOM   1267 O O   . ILE B 1 45  ? -6.391  67.605  37.797 1.00 55.06  ? 936  ILE B O   1 
ATOM   1268 C CB  . ILE B 1 45  ? -5.424  65.364  35.578 1.00 49.81  ? 936  ILE B CB  1 
ATOM   1269 C CG1 . ILE B 1 45  ? -4.782  65.394  34.196 1.00 43.24  ? 936  ILE B CG1 1 
ATOM   1270 C CG2 . ILE B 1 45  ? -6.914  65.599  35.435 1.00 53.06  ? 936  ILE B CG2 1 
ATOM   1271 C CD1 . ILE B 1 45  ? -4.679  64.054  33.556 1.00 43.43  ? 936  ILE B CD1 1 
ATOM   1272 N N   . GLU B 1 46  ? -5.430  65.800  38.709 1.00 56.00  ? 937  GLU B N   1 
ATOM   1273 C CA  . GLU B 1 46  ? -6.221  65.877  39.927 1.00 55.50  ? 937  GLU B CA  1 
ATOM   1274 C C   . GLU B 1 46  ? -6.009  67.268  40.461 1.00 53.94  ? 937  GLU B C   1 
ATOM   1275 O O   . GLU B 1 46  ? -6.952  68.037  40.552 1.00 53.08  ? 937  GLU B O   1 
ATOM   1276 C CB  . GLU B 1 46  ? -5.833  64.806  40.947 1.00 61.10  ? 937  GLU B CB  1 
ATOM   1277 C CG  . GLU B 1 46  ? -6.515  64.902  42.311 1.00 73.17  ? 937  GLU B CG  1 
ATOM   1278 C CD  . GLU B 1 46  ? -8.016  64.608  42.318 1.00 80.83  ? 937  GLU B CD  1 
ATOM   1279 O OE1 . GLU B 1 46  ? -8.626  64.331  41.255 1.00 82.04  ? 937  GLU B OE1 1 
ATOM   1280 O OE2 . GLU B 1 46  ? -8.616  64.689  43.422 1.00 83.83  ? 937  GLU B OE2 1 
ATOM   1281 N N   . MET B 1 47  ? -4.762  67.655  40.668 1.00 55.12  ? 938  MET B N   1 
ATOM   1282 C CA  . MET B 1 47  ? -4.503  69.021  41.119 1.00 56.84  ? 938  MET B CA  1 
ATOM   1283 C C   . MET B 1 47  ? -5.196  70.124  40.306 1.00 58.18  ? 938  MET B C   1 
ATOM   1284 O O   . MET B 1 47  ? -5.849  71.009  40.859 1.00 58.64  ? 938  MET B O   1 
ATOM   1285 C CB  . MET B 1 47  ? -3.005  69.295  41.146 1.00 54.24  ? 938  MET B CB  1 
ATOM   1286 C CG  . MET B 1 47  ? -2.626  70.471  42.019 1.00 57.98  ? 938  MET B CG  1 
ATOM   1287 S SD  . MET B 1 47  ? -1.487  71.508  41.112 1.00 62.80  ? 938  MET B SD  1 
ATOM   1288 C CE  . MET B 1 47  ? -0.003  70.826  41.709 1.00 62.89  ? 938  MET B CE  1 
ATOM   1289 N N   . SER B 1 48  ? -5.059  70.101  38.988 1.00 60.41  ? 939  SER B N   1 
ATOM   1290 C CA  . SER B 1 48  ? -5.563  71.218  38.205 1.00 60.72  ? 939  SER B CA  1 
ATOM   1291 C C   . SER B 1 48  ? -7.089  71.202  38.113 1.00 62.10  ? 939  SER B C   1 
ATOM   1292 O O   . SER B 1 48  ? -7.719  72.235  37.935 1.00 61.67  ? 939  SER B O   1 
ATOM   1293 C CB  . SER B 1 48  ? -4.891  71.271  36.835 1.00 57.18  ? 939  SER B CB  1 
ATOM   1294 O OG  . SER B 1 48  ? -4.986  70.018  36.216 1.00 57.67  ? 939  SER B OG  1 
ATOM   1295 N N   . SER B 1 49  ? -7.718  70.066  38.371 1.00 63.46  ? 940  SER B N   1 
ATOM   1296 C CA  . SER B 1 49  ? -9.173  70.079  38.438 1.00 67.05  ? 940  SER B CA  1 
ATOM   1297 C C   . SER B 1 49  ? -9.669  70.618  39.781 1.00 68.79  ? 940  SER B C   1 
ATOM   1298 O O   . SER B 1 49  ? -10.696 71.290  39.829 1.00 69.85  ? 940  SER B O   1 
ATOM   1299 C CB  . SER B 1 49  ? -9.774  68.706  38.108 1.00 65.95  ? 940  SER B CB  1 
ATOM   1300 O OG  . SER B 1 49  ? -9.659  67.847  39.227 1.00 71.73  ? 940  SER B OG  1 
ATOM   1301 N N   . LYS B 1 50  ? -8.951  70.363  40.870 1.00 69.51  ? 941  LYS B N   1 
ATOM   1302 C CA  . LYS B 1 50  ? -9.395  70.848  42.172 1.00 68.74  ? 941  LYS B CA  1 
ATOM   1303 C C   . LYS B 1 50  ? -8.893  72.239  42.516 1.00 69.18  ? 941  LYS B C   1 
ATOM   1304 O O   . LYS B 1 50  ? -9.315  72.793  43.525 1.00 71.66  ? 941  LYS B O   1 
ATOM   1305 C CB  . LYS B 1 50  ? -8.932  69.939  43.311 1.00 67.64  ? 941  LYS B CB  1 
ATOM   1306 C CG  . LYS B 1 50  ? -9.376  68.484  43.245 1.00 69.91  ? 941  LYS B CG  1 
ATOM   1307 C CD  . LYS B 1 50  ? -10.838 68.330  42.848 1.00 74.28  ? 941  LYS B CD  1 
ATOM   1308 C CE  . LYS B 1 50  ? -11.271 66.873  42.842 1.00 76.18  ? 941  LYS B CE  1 
ATOM   1309 N NZ  . LYS B 1 50  ? -11.635 66.496  44.234 1.00 78.36  ? 941  LYS B NZ  1 
ATOM   1310 N N   . ILE B 1 51  ? -7.929  72.788  41.791 1.00 67.83  ? 942  ILE B N   1 
ATOM   1311 C CA  . ILE B 1 51  ? -7.107  73.766  42.488 1.00 67.72  ? 942  ILE B CA  1 
ATOM   1312 C C   . ILE B 1 51  ? -7.822  75.077  42.745 1.00 67.67  ? 942  ILE B C   1 
ATOM   1313 O O   . ILE B 1 51  ? -7.515  75.754  43.723 1.00 67.27  ? 942  ILE B O   1 
ATOM   1314 C CB  . ILE B 1 51  ? -5.745  74.008  41.834 1.00 64.13  ? 942  ILE B CB  1 
ATOM   1315 C CG1 . ILE B 1 51  ? -4.812  74.646  42.861 1.00 60.87  ? 942  ILE B CG1 1 
ATOM   1316 C CG2 . ILE B 1 51  ? -5.891  74.884  40.628 1.00 67.56  ? 942  ILE B CG2 1 
ATOM   1317 C CD1 . ILE B 1 51  ? -3.486  75.125  42.335 1.00 58.59  ? 942  ILE B CD1 1 
ATOM   1318 N N   . GLN B 1 52  ? -8.753  75.462  41.882 1.00 69.30  ? 943  GLN B N   1 
ATOM   1319 C CA  . GLN B 1 52  ? -9.170  76.855  41.923 1.00 69.32  ? 943  GLN B CA  1 
ATOM   1320 C C   . GLN B 1 52  ? -9.786  77.255  43.267 1.00 64.87  ? 943  GLN B C   1 
ATOM   1321 O O   . GLN B 1 52  ? -9.306  78.209  43.870 1.00 67.48  ? 943  GLN B O   1 
ATOM   1322 C CB  . GLN B 1 52  ? -10.041 77.201  40.722 1.00 75.28  ? 943  GLN B CB  1 
ATOM   1323 C CG  . GLN B 1 52  ? -9.670  78.520  40.043 1.00 87.85  ? 943  GLN B CG  1 
ATOM   1324 C CD  . GLN B 1 52  ? -10.896 79.305  39.580 1.00 95.29  ? 943  GLN B CD  1 
ATOM   1325 O OE1 . GLN B 1 52  ? -11.998 78.752  39.506 1.00 100.22 ? 943  GLN B OE1 1 
ATOM   1326 N NE2 . GLN B 1 52  ? -10.712 80.593  39.280 1.00 96.73  ? 943  GLN B NE2 1 
ATOM   1327 N N   . PRO B 1 53  ? -10.793 76.546  43.776 1.00 62.80  ? 944  PRO B N   1 
ATOM   1328 C CA  . PRO B 1 53  ? -11.365 76.860  45.091 1.00 61.77  ? 944  PRO B CA  1 
ATOM   1329 C C   . PRO B 1 53  ? -10.555 76.437  46.318 1.00 64.06  ? 944  PRO B C   1 
ATOM   1330 O O   . PRO B 1 53  ? -10.911 76.737  47.461 1.00 67.34  ? 944  PRO B O   1 
ATOM   1331 C CB  . PRO B 1 53  ? -12.676 76.076  45.070 1.00 58.53  ? 944  PRO B CB  1 
ATOM   1332 C CG  . PRO B 1 53  ? -12.380 74.894  44.243 1.00 55.69  ? 944  PRO B CG  1 
ATOM   1333 C CD  . PRO B 1 53  ? -11.560 75.473  43.119 1.00 62.10  ? 944  PRO B CD  1 
ATOM   1334 N N   . ALA B 1 54  ? -9.469  75.709  46.097 1.00 62.74  ? 945  ALA B N   1 
ATOM   1335 C CA  . ALA B 1 54  ? -8.770  75.041  47.192 1.00 59.43  ? 945  ALA B CA  1 
ATOM   1336 C C   . ALA B 1 54  ? -7.955  76.046  47.995 1.00 59.27  ? 945  ALA B C   1 
ATOM   1337 O O   . ALA B 1 54  ? -7.320  76.926  47.420 1.00 56.23  ? 945  ALA B O   1 
ATOM   1338 C CB  . ALA B 1 54  ? -7.850  73.952  46.645 1.00 56.34  ? 945  ALA B CB  1 
ATOM   1339 N N   . PRO B 1 55  ? -8.003  75.929  49.320 1.00 58.87  ? 946  PRO B N   1 
ATOM   1340 C CA  . PRO B 1 55  ? -7.088  76.659  50.199 1.00 57.47  ? 946  PRO B CA  1 
ATOM   1341 C C   . PRO B 1 55  ? -5.798  75.881  50.365 1.00 57.08  ? 946  PRO B C   1 
ATOM   1342 O O   . PRO B 1 55  ? -5.718  74.730  49.973 1.00 60.08  ? 946  PRO B O   1 
ATOM   1343 C CB  . PRO B 1 55  ? -7.850  76.680  51.523 1.00 54.29  ? 946  PRO B CB  1 
ATOM   1344 C CG  . PRO B 1 55  ? -8.596  75.402  51.533 1.00 49.43  ? 946  PRO B CG  1 
ATOM   1345 C CD  . PRO B 1 55  ? -8.964  75.125  50.101 1.00 54.82  ? 946  PRO B CD  1 
ATOM   1346 N N   . PRO B 1 56  ? -4.798  76.491  50.973 1.00 56.21  ? 947  PRO B N   1 
ATOM   1347 C CA  . PRO B 1 56  ? -3.495  75.854  51.186 1.00 54.86  ? 947  PRO B CA  1 
ATOM   1348 C C   . PRO B 1 56  ? -3.502  74.483  51.861 1.00 57.42  ? 947  PRO B C   1 
ATOM   1349 O O   . PRO B 1 56  ? -2.801  73.588  51.390 1.00 59.67  ? 947  PRO B O   1 
ATOM   1350 C CB  . PRO B 1 56  ? -2.779  76.848  52.084 1.00 56.23  ? 947  PRO B CB  1 
ATOM   1351 C CG  . PRO B 1 56  ? -3.474  78.136  51.876 1.00 52.97  ? 947  PRO B CG  1 
ATOM   1352 C CD  . PRO B 1 56  ? -4.844  77.905  51.372 1.00 51.97  ? 947  PRO B CD  1 
ATOM   1353 N N   . GLU B 1 57  ? -4.211  74.324  52.975 1.00 58.06  ? 948  GLU B N   1 
ATOM   1354 C CA  . GLU B 1 57  ? -4.461  72.989  53.521 1.00 58.23  ? 948  GLU B CA  1 
ATOM   1355 C C   . GLU B 1 57  ? -4.720  71.938  52.436 1.00 58.64  ? 948  GLU B C   1 
ATOM   1356 O O   . GLU B 1 57  ? -4.314  70.784  52.586 1.00 61.79  ? 948  GLU B O   1 
ATOM   1357 C CB  . GLU B 1 57  ? -5.699  72.974  54.404 1.00 51.84  ? 948  GLU B CB  1 
ATOM   1358 C CG  . GLU B 1 57  ? -5.878  74.195  55.264 1.00 54.50  ? 948  GLU B CG  1 
ATOM   1359 C CD  . GLU B 1 57  ? -6.882  75.163  54.687 1.00 58.80  ? 948  GLU B CD  1 
ATOM   1360 O OE1 . GLU B 1 57  ? -8.075  74.793  54.598 1.00 51.31  ? 948  GLU B OE1 1 
ATOM   1361 O OE2 . GLU B 1 57  ? -6.450  76.298  54.387 1.00 59.59  ? 948  GLU B OE2 1 
ATOM   1362 N N   . GLU B 1 58  ? -5.501  72.307  51.424 1.00 57.77  ? 949  GLU B N   1 
ATOM   1363 C CA  . GLU B 1 58  ? -5.885  71.389  50.349 1.00 59.69  ? 949  GLU B CA  1 
ATOM   1364 C C   . GLU B 1 58  ? -4.831  71.231  49.251 1.00 57.84  ? 949  GLU B C   1 
ATOM   1365 O O   . GLU B 1 58  ? -4.568  70.110  48.833 1.00 53.73  ? 949  GLU B O   1 
ATOM   1366 C CB  . GLU B 1 58  ? -7.242  71.769  49.722 1.00 61.93  ? 949  GLU B CB  1 
ATOM   1367 C CG  . GLU B 1 58  ? -8.493  71.158  50.367 1.00 71.03  ? 949  GLU B CG  1 
ATOM   1368 C CD  . GLU B 1 58  ? -9.833  71.631  49.786 1.00 79.77  ? 949  GLU B CD  1 
ATOM   1369 O OE1 . GLU B 1 58  ? -10.055 71.780  48.544 1.00 82.38  ? 949  GLU B OE1 1 
ATOM   1370 O OE2 . GLU B 1 58  ? -10.734 71.831  50.628 1.00 81.56  ? 949  GLU B OE2 1 
ATOM   1371 N N   . TYR B 1 59  ? -4.238  72.328  48.781 1.00 56.38  ? 950  TYR B N   1 
ATOM   1372 C CA  . TYR B 1 59  ? -3.455  72.289  47.558 1.00 54.40  ? 950  TYR B CA  1 
ATOM   1373 C C   . TYR B 1 59  ? -1.994  72.013  47.851 1.00 54.23  ? 950  TYR B C   1 
ATOM   1374 O O   . TYR B 1 59  ? -1.247  71.522  47.022 1.00 54.00  ? 950  TYR B O   1 
ATOM   1375 C CB  . TYR B 1 59  ? -3.673  73.508  46.656 1.00 53.89  ? 950  TYR B CB  1 
ATOM   1376 C CG  . TYR B 1 59  ? -3.212  74.864  47.148 1.00 54.92  ? 950  TYR B CG  1 
ATOM   1377 C CD1 . TYR B 1 59  ? -1.872  75.156  47.390 1.00 56.48  ? 950  TYR B CD1 1 
ATOM   1378 C CD2 . TYR B 1 59  ? -4.113  75.916  47.250 1.00 56.53  ? 950  TYR B CD2 1 
ATOM   1379 C CE1 . TYR B 1 59  ? -1.480  76.433  47.816 1.00 54.65  ? 950  TYR B CE1 1 
ATOM   1380 C CE2 . TYR B 1 59  ? -3.722  77.199  47.623 1.00 56.38  ? 950  TYR B CE2 1 
ATOM   1381 C CZ  . TYR B 1 59  ? -2.405  77.452  47.937 1.00 56.06  ? 950  TYR B CZ  1 
ATOM   1382 O OH  . TYR B 1 59  ? -2.056  78.726  48.344 1.00 55.50  ? 950  TYR B OH  1 
ATOM   1383 N N   . VAL B 1 60  ? -1.584  72.218  49.085 1.00 53.44  ? 951  VAL B N   1 
ATOM   1384 C CA  . VAL B 1 60  ? -0.234  71.822  49.415 1.00 52.85  ? 951  VAL B CA  1 
ATOM   1385 C C   . VAL B 1 60  ? -0.064  70.310  49.285 1.00 54.00  ? 951  VAL B C   1 
ATOM   1386 O O   . VAL B 1 60  ? 0.908   69.821  48.707 1.00 56.10  ? 951  VAL B O   1 
ATOM   1387 C CB  . VAL B 1 60  ? 0.131   72.349  50.797 1.00 50.17  ? 951  VAL B CB  1 
ATOM   1388 C CG1 . VAL B 1 60  ? 1.364   71.638  51.325 1.00 49.53  ? 951  VAL B CG1 1 
ATOM   1389 C CG2 . VAL B 1 60  ? 0.339   73.853  50.697 1.00 45.80  ? 951  VAL B CG2 1 
ATOM   1390 N N   . PRO B 1 61  ? -0.979  69.545  49.854 1.00 52.35  ? 952  PRO B N   1 
ATOM   1391 C CA  . PRO B 1 61  ? -0.935  68.098  49.665 1.00 51.83  ? 952  PRO B CA  1 
ATOM   1392 C C   . PRO B 1 61  ? -1.143  67.685  48.225 1.00 54.23  ? 952  PRO B C   1 
ATOM   1393 O O   . PRO B 1 61  ? -0.655  66.635  47.820 1.00 56.76  ? 952  PRO B O   1 
ATOM   1394 C CB  . PRO B 1 61  ? -2.095  67.627  50.517 1.00 45.47  ? 952  PRO B CB  1 
ATOM   1395 C CG  . PRO B 1 61  ? -2.143  68.607  51.568 1.00 47.78  ? 952  PRO B CG  1 
ATOM   1396 C CD  . PRO B 1 61  ? -1.977  69.919  50.865 1.00 49.04  ? 952  PRO B CD  1 
ATOM   1397 N N   . MET B 1 62  ? -1.868  68.481  47.453 1.00 58.33  ? 953  MET B N   1 
ATOM   1398 C CA  . MET B 1 62  ? -2.052  68.127  46.054 1.00 58.98  ? 953  MET B CA  1 
ATOM   1399 C C   . MET B 1 62  ? -0.680  68.181  45.403 1.00 56.52  ? 953  MET B C   1 
ATOM   1400 O O   . MET B 1 62  ? -0.369  67.381  44.535 1.00 59.85  ? 953  MET B O   1 
ATOM   1401 C CB  . MET B 1 62  ? -3.017  69.083  45.344 1.00 57.73  ? 953  MET B CB  1 
ATOM   1402 C CG  . MET B 1 62  ? -4.458  68.995  45.815 1.00 62.01  ? 953  MET B CG  1 
ATOM   1403 S SD  . MET B 1 62  ? -5.573  69.954  44.751 1.00 69.97  ? 953  MET B SD  1 
ATOM   1404 C CE  . MET B 1 62  ? -6.531  70.847  45.906 1.00 68.79  ? 953  MET B CE  1 
ATOM   1405 N N   . VAL B 1 63  ? 0.160   69.122  45.798 1.00 53.76  ? 954  VAL B N   1 
ATOM   1406 C CA  . VAL B 1 63  ? 1.479   69.130  45.202 1.00 53.50  ? 954  VAL B CA  1 
ATOM   1407 C C   . VAL B 1 63  ? 2.325   67.993  45.752 1.00 57.23  ? 954  VAL B C   1 
ATOM   1408 O O   . VAL B 1 63  ? 3.156   67.476  45.033 1.00 53.87  ? 954  VAL B O   1 
ATOM   1409 C CB  . VAL B 1 63  ? 2.245   70.415  45.453 1.00 53.13  ? 954  VAL B CB  1 
ATOM   1410 C CG1 . VAL B 1 63  ? 3.573   70.303  44.763 1.00 49.31  ? 954  VAL B CG1 1 
ATOM   1411 C CG2 . VAL B 1 63  ? 1.492   71.623  44.926 1.00 51.69  ? 954  VAL B CG2 1 
ATOM   1412 N N   . LYS B 1 64  ? 2.138   67.599  47.010 1.00 61.91  ? 955  LYS B N   1 
ATOM   1413 C CA  . LYS B 1 64  ? 2.945   66.531  47.597 1.00 63.50  ? 955  LYS B CA  1 
ATOM   1414 C C   . LYS B 1 64  ? 2.745   65.305  46.733 1.00 65.41  ? 955  LYS B C   1 
ATOM   1415 O O   . LYS B 1 64  ? 3.700   64.755  46.189 1.00 68.45  ? 955  LYS B O   1 
ATOM   1416 C CB  . LYS B 1 64  ? 2.519   66.210  49.030 1.00 65.40  ? 955  LYS B CB  1 
ATOM   1417 C CG  . LYS B 1 64  ? 3.550   65.417  49.821 1.00 70.22  ? 955  LYS B CG  1 
ATOM   1418 C CD  . LYS B 1 64  ? 4.669   66.319  50.387 1.00 77.77  ? 955  LYS B CD  1 
ATOM   1419 C CE  . LYS B 1 64  ? 6.095   65.712  50.240 1.00 84.07  ? 955  LYS B CE  1 
ATOM   1420 N NZ  . LYS B 1 64  ? 7.291   66.626  50.414 1.00 83.17  ? 955  LYS B NZ  1 
ATOM   1421 N N   . GLU B 1 65  ? 1.483   64.941  46.545 1.00 64.98  ? 956  GLU B N   1 
ATOM   1422 C CA  . GLU B 1 65  ? 1.122   63.881  45.611 1.00 66.57  ? 956  GLU B CA  1 
ATOM   1423 C C   . GLU B 1 65  ? 1.833   63.958  44.246 1.00 64.04  ? 956  GLU B C   1 
ATOM   1424 O O   . GLU B 1 65  ? 2.244   62.934  43.694 1.00 63.01  ? 956  GLU B O   1 
ATOM   1425 C CB  . GLU B 1 65  ? -0.401  63.835  45.443 1.00 67.75  ? 956  GLU B CB  1 
ATOM   1426 C CG  . GLU B 1 65  ? -1.122  63.458  46.731 1.00 73.76  ? 956  GLU B CG  1 
ATOM   1427 C CD  . GLU B 1 65  ? -0.926  61.996  47.088 1.00 81.37  ? 956  GLU B CD  1 
ATOM   1428 O OE1 . GLU B 1 65  ? -1.327  61.181  46.226 1.00 82.35  ? 956  GLU B OE1 1 
ATOM   1429 O OE2 . GLU B 1 65  ? -0.360  61.673  48.171 1.00 84.54  ? 956  GLU B OE2 1 
ATOM   1430 N N   . VAL B 1 66  ? 2.025   65.162  43.715 1.00 58.69  ? 957  VAL B N   1 
ATOM   1431 C CA  . VAL B 1 66  ? 2.751   65.274  42.466 1.00 54.49  ? 957  VAL B CA  1 
ATOM   1432 C C   . VAL B 1 66  ? 4.214   64.881  42.624 1.00 57.02  ? 957  VAL B C   1 
ATOM   1433 O O   . VAL B 1 66  ? 4.783   64.223  41.754 1.00 57.90  ? 957  VAL B O   1 
ATOM   1434 C CB  . VAL B 1 66  ? 2.606   66.657  41.853 1.00 48.14  ? 957  VAL B CB  1 
ATOM   1435 C CG1 . VAL B 1 66  ? 3.516   66.817  40.644 1.00 43.61  ? 957  VAL B CG1 1 
ATOM   1436 C CG2 . VAL B 1 66  ? 1.172   66.837  41.444 1.00 45.90  ? 957  VAL B CG2 1 
ATOM   1437 N N   . GLY B 1 67  ? 4.805   65.253  43.749 1.00 54.75  ? 958  GLY B N   1 
ATOM   1438 C CA  . GLY B 1 67  ? 6.188   64.931  44.008 1.00 55.71  ? 958  GLY B CA  1 
ATOM   1439 C C   . GLY B 1 67  ? 6.350   63.453  44.310 1.00 58.34  ? 958  GLY B C   1 
ATOM   1440 O O   . GLY B 1 67  ? 7.317   62.826  43.852 1.00 57.78  ? 958  GLY B O   1 
ATOM   1441 N N   . LEU B 1 68  ? 5.409   62.889  45.070 1.00 58.97  ? 959  LEU B N   1 
ATOM   1442 C CA  . LEU B 1 68  ? 5.510   61.473  45.414 1.00 59.29  ? 959  LEU B CA  1 
ATOM   1443 C C   . LEU B 1 68  ? 5.487   60.690  44.114 1.00 57.86  ? 959  LEU B C   1 
ATOM   1444 O O   . LEU B 1 68  ? 6.305   59.823  43.843 1.00 57.97  ? 959  LEU B O   1 
ATOM   1445 C CB  . LEU B 1 68  ? 4.354   61.003  46.295 1.00 61.79  ? 959  LEU B CB  1 
ATOM   1446 C CG  . LEU B 1 68  ? 4.396   61.505  47.741 1.00 65.14  ? 959  LEU B CG  1 
ATOM   1447 C CD1 . LEU B 1 68  ? 3.101   61.182  48.513 1.00 59.15  ? 959  LEU B CD1 1 
ATOM   1448 C CD2 . LEU B 1 68  ? 5.649   61.009  48.484 1.00 66.20  ? 959  LEU B CD2 1 
ATOM   1449 N N   . ALA B 1 69  ? 4.517   61.036  43.291 1.00 55.78  ? 960  ALA B N   1 
ATOM   1450 C CA  . ALA B 1 69  ? 4.422   60.454  41.974 1.00 52.94  ? 960  ALA B CA  1 
ATOM   1451 C C   . ALA B 1 69  ? 5.735   60.559  41.218 1.00 52.24  ? 960  ALA B C   1 
ATOM   1452 O O   . ALA B 1 69  ? 6.082   59.653  40.471 1.00 54.18  ? 960  ALA B O   1 
ATOM   1453 C CB  . ALA B 1 69  ? 3.323   61.162  41.209 1.00 51.90  ? 960  ALA B CB  1 
ATOM   1454 N N   . LEU B 1 70  ? 6.396   61.705  41.290 1.00 49.39  ? 961  LEU B N   1 
ATOM   1455 C CA  . LEU B 1 70  ? 7.547   61.915  40.426 1.00 50.64  ? 961  LEU B CA  1 
ATOM   1456 C C   . LEU B 1 70  ? 8.744   61.187  41.010 1.00 52.64  ? 961  LEU B C   1 
ATOM   1457 O O   . LEU B 1 70  ? 9.613   60.734  40.281 1.00 54.10  ? 961  LEU B O   1 
ATOM   1458 C CB  . LEU B 1 70  ? 7.908   63.389  40.282 1.00 47.80  ? 961  LEU B CB  1 
ATOM   1459 C CG  . LEU B 1 70  ? 9.322   63.577  39.719 1.00 46.62  ? 961  LEU B CG  1 
ATOM   1460 C CD1 . LEU B 1 70  ? 9.548   62.919  38.374 1.00 46.23  ? 961  LEU B CD1 1 
ATOM   1461 C CD2 . LEU B 1 70  ? 9.667   65.049  39.603 1.00 47.91  ? 961  LEU B CD2 1 
ATOM   1462 N N   . ARG B 1 71  ? 8.781   61.123  42.335 1.00 54.14  ? 962  ARG B N   1 
ATOM   1463 C CA  . ARG B 1 71  ? 9.894   60.419  42.955 1.00 56.24  ? 962  ARG B CA  1 
ATOM   1464 C C   . ARG B 1 71  ? 9.874   58.935  42.615 1.00 53.39  ? 962  ARG B C   1 
ATOM   1465 O O   . ARG B 1 71  ? 10.844  58.363  42.151 1.00 54.54  ? 962  ARG B O   1 
ATOM   1466 C CB  . ARG B 1 71  ? 9.865   60.592  44.472 1.00 62.86  ? 962  ARG B CB  1 
ATOM   1467 C CG  . ARG B 1 71  ? 10.105  62.013  44.947 1.00 73.46  ? 962  ARG B CG  1 
ATOM   1468 C CD  . ARG B 1 71  ? 9.964   62.109  46.455 1.00 82.47  ? 962  ARG B CD  1 
ATOM   1469 N NE  . ARG B 1 71  ? 10.009  63.489  46.926 1.00 91.26  ? 962  ARG B NE  1 
ATOM   1470 C CZ  . ARG B 1 71  ? 8.969   64.314  46.909 1.00 93.21  ? 962  ARG B CZ  1 
ATOM   1471 N NH1 . ARG B 1 71  ? 7.800   63.895  46.444 1.00 95.70  ? 962  ARG B NH1 1 
ATOM   1472 N NH2 . ARG B 1 71  ? 9.099   65.554  47.359 1.00 96.47  ? 962  ARG B NH2 1 
ATOM   1473 N N   . THR B 1 72  ? 8.653   58.398  42.741 1.00 48.39  ? 963  THR B N   1 
ATOM   1474 C CA  . THR B 1 72  ? 8.404   57.049  42.284 1.00 49.47  ? 963  THR B CA  1 
ATOM   1475 C C   . THR B 1 72  ? 8.912   56.953  40.853 1.00 53.41  ? 963  THR B C   1 
ATOM   1476 O O   . THR B 1 72  ? 9.755   56.129  40.480 1.00 57.47  ? 963  THR B O   1 
ATOM   1477 C CB  . THR B 1 72  ? 6.910   56.705  42.306 1.00 44.47  ? 963  THR B CB  1 
ATOM   1478 O OG1 . THR B 1 72  ? 6.401   56.609  43.640 1.00 47.86  ? 963  THR B OG1 1 
ATOM   1479 C CG2 . THR B 1 72  ? 6.728   55.294  41.816 1.00 43.87  ? 963  THR B CG2 1 
ATOM   1480 N N   . LEU B 1 73  ? 8.379   57.801  39.994 1.00 54.24  ? 964  LEU B N   1 
ATOM   1481 C CA  . LEU B 1 73  ? 8.717   57.622  38.594 1.00 54.25  ? 964  LEU B CA  1 
ATOM   1482 C C   . LEU B 1 73  ? 10.236  57.590  38.445 1.00 53.34  ? 964  LEU B C   1 
ATOM   1483 O O   . LEU B 1 73  ? 10.734  56.760  37.687 1.00 54.78  ? 964  LEU B O   1 
ATOM   1484 C CB  . LEU B 1 73  ? 8.059   58.685  37.720 1.00 50.83  ? 964  LEU B CB  1 
ATOM   1485 C CG  . LEU B 1 73  ? 8.603   58.910  36.311 1.00 47.53  ? 964  LEU B CG  1 
ATOM   1486 C CD1 . LEU B 1 73  ? 8.207   57.742  35.467 1.00 46.87  ? 964  LEU B CD1 1 
ATOM   1487 C CD2 . LEU B 1 73  ? 8.062   60.199  35.680 1.00 43.09  ? 964  LEU B CD2 1 
ATOM   1488 N N   . LEU B 1 74  ? 10.962  58.443  39.165 1.00 50.34  ? 965  LEU B N   1 
ATOM   1489 C CA  . LEU B 1 74  ? 12.393  58.597  38.882 1.00 51.76  ? 965  LEU B CA  1 
ATOM   1490 C C   . LEU B 1 74  ? 13.219  57.392  39.356 1.00 53.46  ? 965  LEU B C   1 
ATOM   1491 O O   . LEU B 1 74  ? 14.120  56.925  38.655 1.00 53.07  ? 965  LEU B O   1 
ATOM   1492 C CB  . LEU B 1 74  ? 12.975  59.871  39.483 1.00 45.41  ? 965  LEU B CB  1 
ATOM   1493 C CG  . LEU B 1 74  ? 12.593  61.207  38.850 1.00 43.67  ? 965  LEU B CG  1 
ATOM   1494 C CD1 . LEU B 1 74  ? 12.849  62.298  39.895 1.00 33.79  ? 965  LEU B CD1 1 
ATOM   1495 C CD2 . LEU B 1 74  ? 13.289  61.474  37.531 1.00 33.98  ? 965  LEU B CD2 1 
ATOM   1496 N N   . ALA B 1 75  ? 12.861  56.870  40.525 1.00 52.28  ? 966  ALA B N   1 
ATOM   1497 C CA  . ALA B 1 75  ? 13.382  55.593  40.990 1.00 52.01  ? 966  ALA B CA  1 
ATOM   1498 C C   . ALA B 1 75  ? 13.276  54.617  39.833 1.00 56.01  ? 966  ALA B C   1 
ATOM   1499 O O   . ALA B 1 75  ? 14.280  54.163  39.308 1.00 61.63  ? 966  ALA B O   1 
ATOM   1500 C CB  . ALA B 1 75  ? 12.572  55.078  42.173 1.00 48.37  ? 966  ALA B CB  1 
ATOM   1501 N N   . THR B 1 76  ? 12.058  54.300  39.413 1.00 55.50  ? 967  THR B N   1 
ATOM   1502 C CA  . THR B 1 76  ? 11.879  53.346  38.335 1.00 53.97  ? 967  THR B CA  1 
ATOM   1503 C C   . THR B 1 76  ? 12.780  53.598  37.133 1.00 53.52  ? 967  THR B C   1 
ATOM   1504 O O   . THR B 1 76  ? 13.157  52.662  36.448 1.00 51.81  ? 967  THR B O   1 
ATOM   1505 C CB  . THR B 1 76  ? 10.419  53.404  37.912 1.00 54.28  ? 967  THR B CB  1 
ATOM   1506 O OG1 . THR B 1 76  ? 9.623   52.805  38.936 1.00 57.75  ? 967  THR B OG1 1 
ATOM   1507 C CG2 . THR B 1 76  ? 10.135  52.566  36.671 1.00 46.99  ? 967  THR B CG2 1 
ATOM   1508 N N   . VAL B 1 77  ? 13.086  54.843  36.799 1.00 53.39  ? 968  VAL B N   1 
ATOM   1509 C CA  . VAL B 1 77  ? 13.873  55.057  35.594 1.00 55.39  ? 968  VAL B CA  1 
ATOM   1510 C C   . VAL B 1 77  ? 15.314  54.702  35.940 1.00 59.13  ? 968  VAL B C   1 
ATOM   1511 O O   . VAL B 1 77  ? 16.082  54.192  35.121 1.00 60.10  ? 968  VAL B O   1 
ATOM   1512 C CB  . VAL B 1 77  ? 13.776  56.509  35.104 1.00 54.74  ? 968  VAL B CB  1 
ATOM   1513 C CG1 . VAL B 1 77  ? 14.722  56.760  33.939 1.00 45.22  ? 968  VAL B CG1 1 
ATOM   1514 C CG2 . VAL B 1 77  ? 12.348  56.797  34.693 1.00 56.85  ? 968  VAL B CG2 1 
ATOM   1515 N N   . ASP B 1 78  ? 15.665  54.964  37.192 1.00 59.06  ? 969  ASP B N   1 
ATOM   1516 C CA  . ASP B 1 78  ? 16.927  54.498  37.729 1.00 58.99  ? 969  ASP B CA  1 
ATOM   1517 C C   . ASP B 1 78  ? 17.109  53.009  37.515 1.00 60.04  ? 969  ASP B C   1 
ATOM   1518 O O   . ASP B 1 78  ? 18.138  52.587  36.999 1.00 62.32  ? 969  ASP B O   1 
ATOM   1519 C CB  . ASP B 1 78  ? 17.016  54.860  39.202 1.00 55.24  ? 969  ASP B CB  1 
ATOM   1520 C CG  . ASP B 1 78  ? 17.271  56.325  39.376 1.00 60.45  ? 969  ASP B CG  1 
ATOM   1521 O OD1 . ASP B 1 78  ? 17.665  56.963  38.371 1.00 59.00  ? 969  ASP B OD1 1 
ATOM   1522 O OD2 . ASP B 1 78  ? 17.027  56.912  40.443 1.00 58.32  ? 969  ASP B OD2 1 
ATOM   1523 N N   . GLU B 1 79  ? 16.059  52.248  37.792 1.00 59.94  ? 970  GLU B N   1 
ATOM   1524 C CA  . GLU B 1 79  ? 16.104  50.798  37.742 1.00 61.16  ? 970  GLU B CA  1 
ATOM   1525 C C   . GLU B 1 79  ? 15.891  50.267  36.341 1.00 60.72  ? 970  GLU B C   1 
ATOM   1526 O O   . GLU B 1 79  ? 15.708  49.063  36.162 1.00 62.34  ? 970  GLU B O   1 
ATOM   1527 C CB  . GLU B 1 79  ? 15.036  50.238  38.671 1.00 64.07  ? 970  GLU B CB  1 
ATOM   1528 C CG  . GLU B 1 79  ? 15.237  50.828  40.057 1.00 78.50  ? 970  GLU B CG  1 
ATOM   1529 C CD  . GLU B 1 79  ? 14.200  50.385  41.067 1.00 85.40  ? 970  GLU B CD  1 
ATOM   1530 O OE1 . GLU B 1 79  ? 13.471  49.420  40.735 1.00 88.73  ? 970  GLU B OE1 1 
ATOM   1531 O OE2 . GLU B 1 79  ? 14.146  51.007  42.161 1.00 89.01  ? 970  GLU B OE2 1 
ATOM   1532 N N   . THR B 1 80  ? 15.918  51.147  35.349 1.00 58.51  ? 971  THR B N   1 
ATOM   1533 C CA  . THR B 1 80  ? 15.609  50.723  33.993 1.00 59.14  ? 971  THR B CA  1 
ATOM   1534 C C   . THR B 1 80  ? 16.785  51.001  33.100 1.00 60.50  ? 971  THR B C   1 
ATOM   1535 O O   . THR B 1 80  ? 17.001  50.278  32.132 1.00 59.98  ? 971  THR B O   1 
ATOM   1536 C CB  . THR B 1 80  ? 14.410  51.501  33.440 1.00 58.77  ? 971  THR B CB  1 
ATOM   1537 O OG1 . THR B 1 80  ? 13.234  51.166  34.185 1.00 64.01  ? 971  THR B OG1 1 
ATOM   1538 C CG2 . THR B 1 80  ? 14.060  51.053  32.044 1.00 54.69  ? 971  THR B CG2 1 
ATOM   1539 N N   . ILE B 1 81  ? 17.512  52.067  33.421 1.00 60.34  ? 972  ILE B N   1 
ATOM   1540 C CA  . ILE B 1 81  ? 18.628  52.518  32.597 1.00 60.41  ? 972  ILE B CA  1 
ATOM   1541 C C   . ILE B 1 81  ? 19.610  51.376  32.301 1.00 57.97  ? 972  ILE B C   1 
ATOM   1542 O O   . ILE B 1 81  ? 19.951  51.139  31.144 1.00 56.83  ? 972  ILE B O   1 
ATOM   1543 C CB  . ILE B 1 81  ? 19.326  53.744  33.233 1.00 58.76  ? 972  ILE B CB  1 
ATOM   1544 C CG1 . ILE B 1 81  ? 18.498  55.015  33.056 1.00 57.14  ? 972  ILE B CG1 1 
ATOM   1545 C CG2 . ILE B 1 81  ? 20.623  54.031  32.504 1.00 60.41  ? 972  ILE B CG2 1 
ATOM   1546 C CD1 . ILE B 1 81  ? 18.978  56.162  33.905 1.00 49.54  ? 972  ILE B CD1 1 
ATOM   1547 N N   . PRO B 1 82  ? 20.012  50.629  33.327 1.00 56.52  ? 973  PRO B N   1 
ATOM   1548 C CA  . PRO B 1 82  ? 20.820  49.421  33.142 1.00 56.61  ? 973  PRO B CA  1 
ATOM   1549 C C   . PRO B 1 82  ? 20.328  48.435  32.092 1.00 59.35  ? 973  PRO B C   1 
ATOM   1550 O O   . PRO B 1 82  ? 21.206  47.774  31.554 1.00 65.79  ? 973  PRO B O   1 
ATOM   1551 C CB  . PRO B 1 82  ? 20.742  48.753  34.503 1.00 53.81  ? 973  PRO B CB  1 
ATOM   1552 C CG  . PRO B 1 82  ? 20.613  49.893  35.455 1.00 52.15  ? 973  PRO B CG  1 
ATOM   1553 C CD  . PRO B 1 82  ? 19.721  50.866  34.752 1.00 54.42  ? 973  PRO B CD  1 
ATOM   1554 N N   . LEU B 1 83  ? 19.040  48.308  31.777 1.00 57.78  ? 974  LEU B N   1 
ATOM   1555 C CA  . LEU B 1 83  ? 18.656  47.413  30.686 1.00 54.89  ? 974  LEU B CA  1 
ATOM   1556 C C   . LEU B 1 83  ? 18.808  48.058  29.331 1.00 55.99  ? 974  LEU B C   1 
ATOM   1557 O O   . LEU B 1 83  ? 18.526  47.431  28.309 1.00 54.77  ? 974  LEU B O   1 
ATOM   1558 C CB  . LEU B 1 83  ? 17.230  46.914  30.824 1.00 53.28  ? 974  LEU B CB  1 
ATOM   1559 C CG  . LEU B 1 83  ? 17.004  46.321  32.203 1.00 59.11  ? 974  LEU B CG  1 
ATOM   1560 C CD1 . LEU B 1 83  ? 15.620  45.678  32.262 1.00 62.99  ? 974  LEU B CD1 1 
ATOM   1561 C CD2 . LEU B 1 83  ? 18.091  45.320  32.531 1.00 54.42  ? 974  LEU B CD2 1 
ATOM   1562 N N   . LEU B 1 84  ? 19.263  49.306  29.317 1.00 56.99  ? 975  LEU B N   1 
ATOM   1563 C CA  . LEU B 1 84  ? 19.187  50.110  28.098 1.00 59.33  ? 975  LEU B CA  1 
ATOM   1564 C C   . LEU B 1 84  ? 20.569  50.393  27.531 1.00 59.34  ? 975  LEU B C   1 
ATOM   1565 O O   . LEU B 1 84  ? 21.543  50.487  28.260 1.00 57.64  ? 975  LEU B O   1 
ATOM   1566 C CB  . LEU B 1 84  ? 18.429  51.415  28.358 1.00 62.50  ? 975  LEU B CB  1 
ATOM   1567 C CG  . LEU B 1 84  ? 17.006  51.312  28.929 1.00 64.60  ? 975  LEU B CG  1 
ATOM   1568 C CD1 . LEU B 1 84  ? 16.452  52.666  29.434 1.00 62.53  ? 975  LEU B CD1 1 
ATOM   1569 C CD2 . LEU B 1 84  ? 16.094  50.730  27.860 1.00 61.58  ? 975  LEU B CD2 1 
ATOM   1570 N N   . PRO B 1 85  ? 20.672  50.524  26.221 1.00 60.42  ? 976  PRO B N   1 
ATOM   1571 C CA  . PRO B 1 85  ? 21.974  50.722  25.590 1.00 64.16  ? 976  PRO B CA  1 
ATOM   1572 C C   . PRO B 1 85  ? 22.626  51.866  26.320 1.00 68.61  ? 976  PRO B C   1 
ATOM   1573 O O   . PRO B 1 85  ? 21.889  52.776  26.703 1.00 73.05  ? 976  PRO B O   1 
ATOM   1574 C CB  . PRO B 1 85  ? 21.634  51.208  24.185 1.00 63.15  ? 976  PRO B CB  1 
ATOM   1575 C CG  . PRO B 1 85  ? 20.267  50.715  23.934 1.00 63.32  ? 976  PRO B CG  1 
ATOM   1576 C CD  . PRO B 1 85  ? 19.561  50.608  25.265 1.00 62.60  ? 976  PRO B CD  1 
ATOM   1577 N N   . ALA B 1 86  ? 23.947  51.869  26.461 1.00 71.49  ? 977  ALA B N   1 
ATOM   1578 C CA  . ALA B 1 86  ? 24.568  52.964  27.190 1.00 71.78  ? 977  ALA B CA  1 
ATOM   1579 C C   . ALA B 1 86  ? 24.486  54.173  26.283 1.00 72.46  ? 977  ALA B C   1 
ATOM   1580 O O   . ALA B 1 86  ? 24.445  55.296  26.764 1.00 76.74  ? 977  ALA B O   1 
ATOM   1581 C CB  . ALA B 1 86  ? 25.994  52.657  27.591 1.00 71.76  ? 977  ALA B CB  1 
ATOM   1582 N N   . SER B 1 87  ? 24.309  53.969  24.987 1.00 70.26  ? 978  SER B N   1 
ATOM   1583 C CA  . SER B 1 87  ? 24.265  55.142  24.125 1.00 71.38  ? 978  SER B CA  1 
ATOM   1584 C C   . SER B 1 87  ? 23.130  56.134  24.437 1.00 71.23  ? 978  SER B C   1 
ATOM   1585 O O   . SER B 1 87  ? 23.162  57.287  24.001 1.00 70.58  ? 978  SER B O   1 
ATOM   1586 C CB  . SER B 1 87  ? 24.272  54.747  22.650 1.00 69.14  ? 978  SER B CB  1 
ATOM   1587 O OG  . SER B 1 87  ? 22.960  54.802  22.132 1.00 72.73  ? 978  SER B OG  1 
ATOM   1588 N N   . THR B 1 88  ? 22.155  55.707  25.234 1.00 71.96  ? 979  THR B N   1 
ATOM   1589 C CA  . THR B 1 88  ? 20.966  56.507  25.527 1.00 70.85  ? 979  THR B CA  1 
ATOM   1590 C C   . THR B 1 88  ? 20.971  57.034  26.947 1.00 70.90  ? 979  THR B C   1 
ATOM   1591 O O   . THR B 1 88  ? 20.184  57.911  27.252 1.00 70.80  ? 979  THR B O   1 
ATOM   1592 C CB  . THR B 1 88  ? 19.719  55.629  25.392 1.00 70.02  ? 979  THR B CB  1 
ATOM   1593 O OG1 . THR B 1 88  ? 19.632  54.729  26.507 1.00 65.15  ? 979  THR B OG1 1 
ATOM   1594 C CG2 . THR B 1 88  ? 19.868  54.725  24.185 1.00 67.96  ? 979  THR B CG2 1 
ATOM   1595 N N   . HIS B 1 89  ? 21.794  56.469  27.825 1.00 68.97  ? 980  HIS B N   1 
ATOM   1596 C CA  . HIS B 1 89  ? 21.771  56.842  29.230 1.00 68.26  ? 980  HIS B CA  1 
ATOM   1597 C C   . HIS B 1 89  ? 21.881  58.329  29.521 1.00 67.72  ? 980  HIS B C   1 
ATOM   1598 O O   . HIS B 1 89  ? 21.496  58.755  30.596 1.00 70.20  ? 980  HIS B O   1 
ATOM   1599 C CB  . HIS B 1 89  ? 22.905  56.167  29.992 1.00 68.90  ? 980  HIS B CB  1 
ATOM   1600 C CG  . HIS B 1 89  ? 22.806  54.677  30.047 1.00 69.31  ? 980  HIS B CG  1 
ATOM   1601 N ND1 . HIS B 1 89  ? 23.559  53.920  30.919 1.00 69.66  ? 980  HIS B ND1 1 
ATOM   1602 C CD2 . HIS B 1 89  ? 22.040  53.804  29.352 1.00 69.16  ? 980  HIS B CD2 1 
ATOM   1603 C CE1 . HIS B 1 89  ? 23.287  52.641  30.736 1.00 70.04  ? 980  HIS B CE1 1 
ATOM   1604 N NE2 . HIS B 1 89  ? 22.372  52.544  29.788 1.00 70.81  ? 980  HIS B NE2 1 
ATOM   1605 N N   . ARG B 1 90  ? 22.505  59.103  28.645 1.00 66.30  ? 981  ARG B N   1 
ATOM   1606 C CA  . ARG B 1 90  ? 22.599  60.540  28.839 1.00 67.21  ? 981  ARG B CA  1 
ATOM   1607 C C   . ARG B 1 90  ? 21.280  61.289  28.589 1.00 71.77  ? 981  ARG B C   1 
ATOM   1608 O O   . ARG B 1 90  ? 20.884  62.105  29.430 1.00 74.02  ? 981  ARG B O   1 
ATOM   1609 C CB  . ARG B 1 90  ? 23.647  61.082  27.875 1.00 71.21  ? 981  ARG B CB  1 
ATOM   1610 C CG  . ARG B 1 90  ? 24.078  62.517  28.118 1.00 73.72  ? 981  ARG B CG  1 
ATOM   1611 C CD  . ARG B 1 90  ? 24.761  62.727  29.463 1.00 75.70  ? 981  ARG B CD  1 
ATOM   1612 N NE  . ARG B 1 90  ? 25.151  64.129  29.602 1.00 78.46  ? 981  ARG B NE  1 
ATOM   1613 C CZ  . ARG B 1 90  ? 25.283  64.780  30.754 1.00 78.36  ? 981  ARG B CZ  1 
ATOM   1614 N NH1 . ARG B 1 90  ? 25.133  64.148  31.918 1.00 74.60  ? 981  ARG B NH1 1 
ATOM   1615 N NH2 . ARG B 1 90  ? 25.569  66.077  30.726 1.00 73.78  ? 981  ARG B NH2 1 
ATOM   1616 N N   . GLU B 1 91  ? 20.648  61.109  27.425 1.00 69.97  ? 982  GLU B N   1 
ATOM   1617 C CA  . GLU B 1 91  ? 19.373  61.767  27.152 1.00 66.16  ? 982  GLU B CA  1 
ATOM   1618 C C   . GLU B 1 91  ? 18.469  61.516  28.357 1.00 67.17  ? 982  GLU B C   1 
ATOM   1619 O O   . GLU B 1 91  ? 17.796  62.419  28.854 1.00 67.40  ? 982  GLU B O   1 
ATOM   1620 C CB  . GLU B 1 91  ? 18.695  61.257  25.878 1.00 65.60  ? 982  GLU B CB  1 
ATOM   1621 C CG  . GLU B 1 91  ? 18.669  62.259  24.736 1.00 73.52  ? 982  GLU B CG  1 
ATOM   1622 C CD  . GLU B 1 91  ? 17.525  62.057  23.755 1.00 78.53  ? 982  GLU B CD  1 
ATOM   1623 O OE1 . GLU B 1 91  ? 17.760  61.738  22.565 1.00 80.49  ? 982  GLU B OE1 1 
ATOM   1624 O OE2 . GLU B 1 91  ? 16.365  62.278  24.156 1.00 81.62  ? 982  GLU B OE2 1 
ATOM   1625 N N   . ILE B 1 92  ? 18.480  60.298  28.881 1.00 64.46  ? 983  ILE B N   1 
ATOM   1626 C CA  . ILE B 1 92  ? 17.511  59.937  29.893 1.00 61.70  ? 983  ILE B CA  1 
ATOM   1627 C C   . ILE B 1 92  ? 17.895  60.644  31.156 1.00 65.13  ? 983  ILE B C   1 
ATOM   1628 O O   . ILE B 1 92  ? 17.064  60.956  31.989 1.00 70.99  ? 983  ILE B O   1 
ATOM   1629 C CB  . ILE B 1 92  ? 17.549  58.438  30.149 1.00 56.66  ? 983  ILE B CB  1 
ATOM   1630 C CG1 . ILE B 1 92  ? 17.120  57.713  28.881 1.00 56.33  ? 983  ILE B CG1 1 
ATOM   1631 C CG2 . ILE B 1 92  ? 16.632  58.059  31.292 1.00 52.70  ? 983  ILE B CG2 1 
ATOM   1632 C CD1 . ILE B 1 92  ? 17.318  56.241  28.980 1.00 56.83  ? 983  ILE B CD1 1 
ATOM   1633 N N   . GLU B 1 93  ? 19.187  60.809  31.359 1.00 68.59  ? 984  GLU B N   1 
ATOM   1634 C CA  . GLU B 1 93  ? 19.606  61.247  32.675 1.00 73.52  ? 984  GLU B CA  1 
ATOM   1635 C C   . GLU B 1 93  ? 19.361  62.740  32.750 1.00 73.22  ? 984  GLU B C   1 
ATOM   1636 O O   . GLU B 1 93  ? 19.198  63.259  33.854 1.00 74.07  ? 984  GLU B O   1 
ATOM   1637 C CB  . GLU B 1 93  ? 21.076  60.918  32.937 1.00 81.09  ? 984  GLU B CB  1 
ATOM   1638 C CG  . GLU B 1 93  ? 21.306  59.618  33.710 1.00 91.33  ? 984  GLU B CG  1 
ATOM   1639 C CD  . GLU B 1 93  ? 22.578  58.869  33.311 1.00 98.41  ? 984  GLU B CD  1 
ATOM   1640 O OE1 . GLU B 1 93  ? 23.378  59.449  32.529 1.00 102.64 ? 984  GLU B OE1 1 
ATOM   1641 O OE2 . GLU B 1 93  ? 22.787  57.723  33.793 1.00 99.73  ? 984  GLU B OE2 1 
ATOM   1642 N N   . MET B 1 94  ? 19.362  63.390  31.586 1.00 71.24  ? 985  MET B N   1 
ATOM   1643 C CA  . MET B 1 94  ? 19.076  64.815  31.440 1.00 71.29  ? 985  MET B CA  1 
ATOM   1644 C C   . MET B 1 94  ? 17.585  65.069  31.595 1.00 70.66  ? 985  MET B C   1 
ATOM   1645 O O   . MET B 1 94  ? 17.184  65.879  32.431 1.00 73.06  ? 985  MET B O   1 
ATOM   1646 C CB  . MET B 1 94  ? 19.481  65.317  30.053 1.00 74.90  ? 985  MET B CB  1 
ATOM   1647 C CG  . MET B 1 94  ? 20.672  66.281  30.010 1.00 77.87  ? 985  MET B CG  1 
ATOM   1648 S SD  . MET B 1 94  ? 22.123  65.887  31.015 1.00 84.42  ? 985  MET B SD  1 
ATOM   1649 C CE  . MET B 1 94  ? 21.935  66.684  32.604 1.00 80.78  ? 985  MET B CE  1 
ATOM   1650 N N   . ALA B 1 95  ? 16.765  64.390  30.794 1.00 65.17  ? 986  ALA B N   1 
ATOM   1651 C CA  . ALA B 1 95  ? 15.329  64.401  31.010 1.00 57.39  ? 986  ALA B CA  1 
ATOM   1652 C C   . ALA B 1 95  ? 14.987  64.245  32.479 1.00 56.97  ? 986  ALA B C   1 
ATOM   1653 O O   . ALA B 1 95  ? 14.099  64.915  32.989 1.00 58.64  ? 986  ALA B O   1 
ATOM   1654 C CB  . ALA B 1 95  ? 14.694  63.312  30.231 1.00 54.06  ? 986  ALA B CB  1 
ATOM   1655 N N   . GLN B 1 96  ? 15.685  63.374  33.188 1.00 55.93  ? 987  GLN B N   1 
ATOM   1656 C CA  . GLN B 1 96  ? 15.335  63.174  34.587 1.00 57.90  ? 987  GLN B CA  1 
ATOM   1657 C C   . GLN B 1 96  ? 15.605  64.444  35.384 1.00 59.92  ? 987  GLN B C   1 
ATOM   1658 O O   . GLN B 1 96  ? 14.850  64.806  36.277 1.00 63.62  ? 987  GLN B O   1 
ATOM   1659 C CB  . GLN B 1 96  ? 16.131  62.022  35.194 1.00 58.61  ? 987  GLN B CB  1 
ATOM   1660 C CG  . GLN B 1 96  ? 15.537  60.618  35.101 1.00 58.84  ? 987  GLN B CG  1 
ATOM   1661 C CD  . GLN B 1 96  ? 16.536  59.562  35.556 1.00 60.31  ? 987  GLN B CD  1 
ATOM   1662 O OE1 . GLN B 1 96  ? 17.625  59.490  34.985 1.00 65.16  ? 987  GLN B OE1 1 
ATOM   1663 N NE2 . GLN B 1 96  ? 16.214  58.800  36.601 1.00 55.02  ? 987  GLN B NE2 1 
ATOM   1664 N N   . LYS B 1 97  ? 16.704  65.119  35.080 1.00 62.36  ? 988  LYS B N   1 
ATOM   1665 C CA  . LYS B 1 97  ? 17.090  66.343  35.785 1.00 65.39  ? 988  LYS B CA  1 
ATOM   1666 C C   . LYS B 1 97  ? 16.135  67.496  35.499 1.00 65.00  ? 988  LYS B C   1 
ATOM   1667 O O   . LYS B 1 97  ? 15.796  68.273  36.389 1.00 63.25  ? 988  LYS B O   1 
ATOM   1668 C CB  . LYS B 1 97  ? 18.495  66.771  35.355 1.00 68.97  ? 988  LYS B CB  1 
ATOM   1669 C CG  . LYS B 1 97  ? 19.604  65.924  35.962 1.00 76.07  ? 988  LYS B CG  1 
ATOM   1670 C CD  . LYS B 1 97  ? 20.984  66.552  35.754 1.00 81.37  ? 988  LYS B CD  1 
ATOM   1671 C CE  . LYS B 1 97  ? 22.102  65.523  35.853 1.00 88.50  ? 988  LYS B CE  1 
ATOM   1672 N NZ  . LYS B 1 97  ? 22.244  65.092  37.284 1.00 90.69  ? 988  LYS B NZ  1 
ATOM   1673 N N   . LEU B 1 98  ? 15.751  67.615  34.234 1.00 62.59  ? 989  LEU B N   1 
ATOM   1674 C CA  . LEU B 1 98  ? 14.674  68.502  33.843 1.00 62.61  ? 989  LEU B CA  1 
ATOM   1675 C C   . LEU B 1 98  ? 13.397  68.265  34.651 1.00 63.63  ? 989  LEU B C   1 
ATOM   1676 O O   . LEU B 1 98  ? 12.767  69.224  35.075 1.00 64.84  ? 989  LEU B O   1 
ATOM   1677 C CB  . LEU B 1 98  ? 14.401  68.341  32.354 1.00 59.76  ? 989  LEU B CB  1 
ATOM   1678 C CG  . LEU B 1 98  ? 13.163  69.077  31.849 1.00 61.02  ? 989  LEU B CG  1 
ATOM   1679 C CD1 . LEU B 1 98  ? 13.392  70.571  31.907 1.00 61.76  ? 989  LEU B CD1 1 
ATOM   1680 C CD2 . LEU B 1 98  ? 12.844  68.666  30.418 1.00 62.40  ? 989  LEU B CD2 1 
ATOM   1681 N N   . LEU B 1 99  ? 12.994  67.026  34.911 1.00 62.44  ? 990  LEU B N   1 
ATOM   1682 C CA  . LEU B 1 99  ? 11.804  66.868  35.741 1.00 61.27  ? 990  LEU B CA  1 
ATOM   1683 C C   . LEU B 1 99  ? 12.053  67.367  37.155 1.00 59.32  ? 990  LEU B C   1 
ATOM   1684 O O   . LEU B 1 99  ? 11.119  67.684  37.880 1.00 64.41  ? 990  LEU B O   1 
ATOM   1685 C CB  . LEU B 1 99  ? 11.285  65.428  35.833 1.00 55.78  ? 990  LEU B CB  1 
ATOM   1686 C CG  . LEU B 1 99  ? 10.883  64.673  34.566 1.00 52.75  ? 990  LEU B CG  1 
ATOM   1687 C CD1 . LEU B 1 99  ? 10.576  63.234  34.952 1.00 47.23  ? 990  LEU B CD1 1 
ATOM   1688 C CD2 . LEU B 1 99  ? 9.747   65.295  33.770 1.00 50.52  ? 990  LEU B CD2 1 
ATOM   1689 N N   . ASN B 1 100 ? 13.289  67.340  37.620 1.00 56.81  ? 991  ASN B N   1 
ATOM   1690 C CA  . ASN B 1 100 ? 13.482  67.779  38.991 1.00 52.86  ? 991  ASN B CA  1 
ATOM   1691 C C   . ASN B 1 100 ? 13.369  69.289  39.073 1.00 53.04  ? 991  ASN B C   1 
ATOM   1692 O O   . ASN B 1 100 ? 12.816  69.809  40.034 1.00 53.77  ? 991  ASN B O   1 
ATOM   1693 C CB  . ASN B 1 100 ? 14.796  67.261  39.560 1.00 51.22  ? 991  ASN B CB  1 
ATOM   1694 C CG  . ASN B 1 100 ? 14.653  65.860  40.102 1.00 53.86  ? 991  ASN B CG  1 
ATOM   1695 O OD1 . ASN B 1 100 ? 13.919  65.626  41.060 1.00 55.30  ? 991  ASN B OD1 1 
ATOM   1696 N ND2 . ASN B 1 100 ? 15.274  64.907  39.427 1.00 54.83  ? 991  ASN B ND2 1 
ATOM   1697 N N   . SER B 1 101 ? 13.791  69.981  38.021 1.00 52.46  ? 992  SER B N   1 
ATOM   1698 C CA  . SER B 1 101 ? 13.618  71.423  37.963 1.00 53.35  ? 992  SER B CA  1 
ATOM   1699 C C   . SER B 1 101 ? 12.147  71.761  37.750 1.00 54.67  ? 992  SER B C   1 
ATOM   1700 O O   . SER B 1 101 ? 11.606  72.646  38.386 1.00 55.51  ? 992  SER B O   1 
ATOM   1701 C CB  . SER B 1 101 ? 14.473  72.013  36.849 1.00 49.41  ? 992  SER B CB  1 
ATOM   1702 O OG  . SER B 1 101 ? 13.717  72.225  35.669 1.00 58.56  ? 992  SER B OG  1 
ATOM   1703 N N   . ASP B 1 102 ? 11.466  71.032  36.881 1.00 54.23  ? 993  ASP B N   1 
ATOM   1704 C CA  . ASP B 1 102 ? 10.032  71.190  36.762 1.00 54.28  ? 993  ASP B CA  1 
ATOM   1705 C C   . ASP B 1 102 ? 9.358   71.079  38.117 1.00 54.11  ? 993  ASP B C   1 
ATOM   1706 O O   . ASP B 1 102 ? 8.554   71.927  38.485 1.00 58.29  ? 993  ASP B O   1 
ATOM   1707 C CB  . ASP B 1 102 ? 9.465   70.129  35.832 1.00 53.30  ? 993  ASP B CB  1 
ATOM   1708 C CG  . ASP B 1 102 ? 9.786   70.413  34.382 1.00 58.16  ? 993  ASP B CG  1 
ATOM   1709 O OD1 . ASP B 1 102 ? 10.371  71.479  34.078 1.00 62.23  ? 993  ASP B OD1 1 
ATOM   1710 O OD2 . ASP B 1 102 ? 9.506   69.610  33.471 1.00 57.38  ? 993  ASP B OD2 1 
ATOM   1711 N N   . LEU B 1 103 ? 9.695   70.060  38.894 1.00 53.23  ? 994  LEU B N   1 
ATOM   1712 C CA  . LEU B 1 103 ? 9.071   69.947  40.201 1.00 52.93  ? 994  LEU B CA  1 
ATOM   1713 C C   . LEU B 1 103 ? 9.482   71.150  41.034 1.00 54.91  ? 994  LEU B C   1 
ATOM   1714 O O   . LEU B 1 103 ? 8.719   71.633  41.867 1.00 57.55  ? 994  LEU B O   1 
ATOM   1715 C CB  . LEU B 1 103 ? 9.451   68.656  40.923 1.00 48.60  ? 994  LEU B CB  1 
ATOM   1716 C CG  . LEU B 1 103 ? 8.821   68.578  42.314 1.00 48.67  ? 994  LEU B CG  1 
ATOM   1717 C CD1 . LEU B 1 103 ? 7.292   68.764  42.342 1.00 46.97  ? 994  LEU B CD1 1 
ATOM   1718 C CD2 . LEU B 1 103 ? 9.180   67.253  42.941 1.00 46.36  ? 994  LEU B CD2 1 
ATOM   1719 N N   . GLY B 1 104 ? 10.690  71.650  40.823 1.00 53.74  ? 995  GLY B N   1 
ATOM   1720 C CA  . GLY B 1 104 ? 11.142  72.756  41.635 1.00 54.09  ? 995  GLY B CA  1 
ATOM   1721 C C   . GLY B 1 104 ? 10.426  74.073  41.420 1.00 54.08  ? 995  GLY B C   1 
ATOM   1722 O O   . GLY B 1 104 ? 10.176  74.799  42.382 1.00 56.53  ? 995  GLY B O   1 
ATOM   1723 N N   . GLU B 1 105 ? 10.181  74.421  40.162 1.00 52.51  ? 996  GLU B N   1 
ATOM   1724 C CA  . GLU B 1 105 ? 9.369   75.583  39.804 1.00 54.49  ? 996  GLU B CA  1 
ATOM   1725 C C   . GLU B 1 105 ? 7.942   75.385  40.336 1.00 57.55  ? 996  GLU B C   1 
ATOM   1726 O O   . GLU B 1 105 ? 7.291   76.339  40.781 1.00 60.58  ? 996  GLU B O   1 
ATOM   1727 C CB  . GLU B 1 105 ? 9.407   75.813  38.285 1.00 50.27  ? 996  GLU B CB  1 
ATOM   1728 C CG  . GLU B 1 105 ? 8.312   76.659  37.656 1.00 52.86  ? 996  GLU B CG  1 
ATOM   1729 C CD  . GLU B 1 105 ? 8.432   76.831  36.131 1.00 59.30  ? 996  GLU B CD  1 
ATOM   1730 O OE1 . GLU B 1 105 ? 9.507   76.643  35.492 1.00 61.64  ? 996  GLU B OE1 1 
ATOM   1731 O OE2 . GLU B 1 105 ? 7.396   77.184  35.517 1.00 57.83  ? 996  GLU B OE2 1 
ATOM   1732 N N   . LEU B 1 106 ? 7.470   74.143  40.390 1.00 53.80  ? 997  LEU B N   1 
ATOM   1733 C CA  . LEU B 1 106 ? 6.121   73.946  40.883 1.00 52.27  ? 997  LEU B CA  1 
ATOM   1734 C C   . LEU B 1 106 ? 6.060   74.266  42.366 1.00 53.38  ? 997  LEU B C   1 
ATOM   1735 O O   . LEU B 1 106 ? 5.035   74.729  42.855 1.00 58.14  ? 997  LEU B O   1 
ATOM   1736 C CB  . LEU B 1 106 ? 5.629   72.530  40.633 1.00 50.57  ? 997  LEU B CB  1 
ATOM   1737 C CG  . LEU B 1 106 ? 4.341   72.174  41.366 1.00 50.51  ? 997  LEU B CG  1 
ATOM   1738 C CD1 . LEU B 1 106 ? 3.215   73.109  40.973 1.00 48.18  ? 997  LEU B CD1 1 
ATOM   1739 C CD2 . LEU B 1 106 ? 3.984   70.749  41.002 1.00 39.30  ? 997  LEU B CD2 1 
ATOM   1740 N N   . ILE B 1 107 ? 7.143   74.030  43.092 1.00 51.40  ? 998  ILE B N   1 
ATOM   1741 C CA  . ILE B 1 107 ? 7.092   74.198  44.539 1.00 52.83  ? 998  ILE B CA  1 
ATOM   1742 C C   . ILE B 1 107 ? 7.232   75.677  44.844 1.00 52.72  ? 998  ILE B C   1 
ATOM   1743 O O   . ILE B 1 107 ? 6.608   76.203  45.755 1.00 50.08  ? 998  ILE B O   1 
ATOM   1744 C CB  . ILE B 1 107 ? 8.201   73.374  45.230 1.00 49.68  ? 998  ILE B CB  1 
ATOM   1745 C CG1 . ILE B 1 107 ? 8.014   71.897  44.916 1.00 48.75  ? 998  ILE B CG1 1 
ATOM   1746 C CG2 . ILE B 1 107 ? 8.107   73.480  46.731 1.00 47.19  ? 998  ILE B CG2 1 
ATOM   1747 C CD1 . ILE B 1 107 ? 8.891   70.989  45.726 1.00 41.05  ? 998  ILE B CD1 1 
ATOM   1748 N N   . ASN B 1 108 ? 8.082   76.321  44.058 1.00 54.04  ? 999  ASN B N   1 
ATOM   1749 C CA  . ASN B 1 108 ? 8.325   77.744  44.189 1.00 55.81  ? 999  ASN B CA  1 
ATOM   1750 C C   . ASN B 1 108 ? 6.969   78.442  44.176 1.00 56.59  ? 999  ASN B C   1 
ATOM   1751 O O   . ASN B 1 108 ? 6.636   79.240  45.054 1.00 56.81  ? 999  ASN B O   1 
ATOM   1752 C CB  . ASN B 1 108 ? 9.128   78.261  42.991 1.00 58.91  ? 999  ASN B CB  1 
ATOM   1753 C CG  . ASN B 1 108 ? 10.616  77.941  43.053 1.00 62.26  ? 999  ASN B CG  1 
ATOM   1754 O OD1 . ASN B 1 108 ? 11.115  77.344  44.000 1.00 65.43  ? 999  ASN B OD1 1 
ATOM   1755 N ND2 . ASN B 1 108 ? 11.335  78.365  42.018 1.00 61.87  ? 999  ASN B ND2 1 
ATOM   1756 N N   . LYS B 1 109 ? 6.213   78.155  43.125 1.00 56.13  ? 1000 LYS B N   1 
ATOM   1757 C CA  . LYS B 1 109 ? 4.914   78.779  42.933 1.00 57.96  ? 1000 LYS B CA  1 
ATOM   1758 C C   . LYS B 1 109 ? 3.910   78.364  44.029 1.00 58.02  ? 1000 LYS B C   1 
ATOM   1759 O O   . LYS B 1 109 ? 3.240   79.211  44.602 1.00 57.64  ? 1000 LYS B O   1 
ATOM   1760 C CB  . LYS B 1 109 ? 4.397   78.517  41.508 1.00 57.06  ? 1000 LYS B CB  1 
ATOM   1761 C CG  . LYS B 1 109 ? 5.373   78.768  40.349 1.00 54.86  ? 1000 LYS B CG  1 
ATOM   1762 C CD  . LYS B 1 109 ? 5.291   80.185  39.756 1.00 57.66  ? 1000 LYS B CD  1 
ATOM   1763 C CE  . LYS B 1 109 ? 6.552   80.650  39.005 1.00 60.81  ? 1000 LYS B CE  1 
ATOM   1764 N NZ  . LYS B 1 109 ? 7.738   80.706  39.913 1.00 67.97  ? 1000 LYS B NZ  1 
ATOM   1765 N N   . MET B 1 110 ? 3.829   77.088  44.394 1.00 59.85  ? 1001 MET B N   1 
ATOM   1766 C CA  . MET B 1 110 ? 3.000   76.663  45.528 1.00 62.23  ? 1001 MET B CA  1 
ATOM   1767 C C   . MET B 1 110 ? 3.187   77.593  46.733 1.00 63.75  ? 1001 MET B C   1 
ATOM   1768 O O   . MET B 1 110 ? 2.226   77.919  47.450 1.00 65.03  ? 1001 MET B O   1 
ATOM   1769 C CB  . MET B 1 110 ? 3.350   75.229  45.949 1.00 57.67  ? 1001 MET B CB  1 
ATOM   1770 C CG  . MET B 1 110 ? 2.460   74.657  47.044 1.00 62.82  ? 1001 MET B CG  1 
ATOM   1771 S SD  . MET B 1 110 ? 3.093   73.192  47.922 1.00 66.16  ? 1001 MET B SD  1 
ATOM   1772 C CE  . MET B 1 110 ? 4.760   73.794  48.342 1.00 63.46  ? 1001 MET B CE  1 
ATOM   1773 N N   . LYS B 1 111 ? 4.448   77.982  46.929 1.00 63.67  ? 1002 LYS B N   1 
ATOM   1774 C CA  . LYS B 1 111 ? 4.946   78.648  48.127 1.00 62.55  ? 1002 LYS B CA  1 
ATOM   1775 C C   . LYS B 1 111 ? 4.547   80.108  48.068 1.00 62.57  ? 1002 LYS B C   1 
ATOM   1776 O O   . LYS B 1 111 ? 4.319   80.713  49.107 1.00 66.25  ? 1002 LYS B O   1 
ATOM   1777 C CB  . LYS B 1 111 ? 6.475   78.547  48.204 1.00 64.97  ? 1002 LYS B CB  1 
ATOM   1778 C CG  . LYS B 1 111 ? 6.976   77.735  49.396 1.00 70.48  ? 1002 LYS B CG  1 
ATOM   1779 C CD  . LYS B 1 111 ? 8.382   77.172  49.215 1.00 74.90  ? 1002 LYS B CD  1 
ATOM   1780 C CE  . LYS B 1 111 ? 8.565   75.884  50.022 1.00 77.67  ? 1002 LYS B CE  1 
ATOM   1781 N NZ  . LYS B 1 111 ? 10.015  75.547  50.148 1.00 76.88  ? 1002 LYS B NZ  1 
ATOM   1782 N N   . LEU B 1 112 ? 4.498   80.663  46.862 1.00 58.80  ? 1003 LEU B N   1 
ATOM   1783 C CA  . LEU B 1 112 ? 4.028   82.022  46.647 1.00 56.64  ? 1003 LEU B CA  1 
ATOM   1784 C C   . LEU B 1 112 ? 2.533   82.047  46.849 1.00 59.88  ? 1003 LEU B C   1 
ATOM   1785 O O   . LEU B 1 112 ? 1.975   82.896  47.527 1.00 62.60  ? 1003 LEU B O   1 
ATOM   1786 C CB  . LEU B 1 112 ? 4.321   82.485  45.225 1.00 52.63  ? 1003 LEU B CB  1 
ATOM   1787 C CG  . LEU B 1 112 ? 5.820   82.720  45.080 1.00 55.15  ? 1003 LEU B CG  1 
ATOM   1788 C CD1 . LEU B 1 112 ? 6.216   82.921  43.644 1.00 53.67  ? 1003 LEU B CD1 1 
ATOM   1789 C CD2 . LEU B 1 112 ? 6.270   83.929  45.871 1.00 56.23  ? 1003 LEU B CD2 1 
ATOM   1790 N N   . ALA B 1 113 ? 1.855   81.076  46.271 1.00 61.98  ? 1004 ALA B N   1 
ATOM   1791 C CA  . ALA B 1 113 ? 0.430   80.999  46.517 1.00 64.31  ? 1004 ALA B CA  1 
ATOM   1792 C C   . ALA B 1 113 ? 0.139   80.971  48.011 1.00 67.28  ? 1004 ALA B C   1 
ATOM   1793 O O   . ALA B 1 113 ? -0.827  81.601  48.421 1.00 71.18  ? 1004 ALA B O   1 
ATOM   1794 C CB  . ALA B 1 113 ? -0.148  79.782  45.840 1.00 61.37  ? 1004 ALA B CB  1 
ATOM   1795 N N   . GLN B 1 114 ? 0.920   80.237  48.808 1.00 68.83  ? 1005 GLN B N   1 
ATOM   1796 C CA  . GLN B 1 114 ? 0.680   80.141  50.253 1.00 67.06  ? 1005 GLN B CA  1 
ATOM   1797 C C   . GLN B 1 114 ? 0.726   81.521  50.903 1.00 68.36  ? 1005 GLN B C   1 
ATOM   1798 O O   . GLN B 1 114 ? -0.217  81.922  51.595 1.00 67.93  ? 1005 GLN B O   1 
ATOM   1799 C CB  . GLN B 1 114 ? 1.712   79.254  50.951 1.00 64.09  ? 1005 GLN B CB  1 
ATOM   1800 C CG  . GLN B 1 114 ? 1.537   77.788  50.668 1.00 69.02  ? 1005 GLN B CG  1 
ATOM   1801 C CD  . GLN B 1 114 ? 2.320   76.891  51.610 1.00 69.91  ? 1005 GLN B CD  1 
ATOM   1802 O OE1 . GLN B 1 114 ? 3.449   76.448  51.325 1.00 66.69  ? 1005 GLN B OE1 1 
ATOM   1803 N NE2 . GLN B 1 114 ? 1.683   76.581  52.728 1.00 70.68  ? 1005 GLN B NE2 1 
ATOM   1804 N N   . GLN B 1 115 ? 1.871   82.175  50.718 1.00 67.12  ? 1006 GLN B N   1 
ATOM   1805 C CA  . GLN B 1 115 ? 2.160   83.526  51.187 1.00 68.04  ? 1006 GLN B CA  1 
ATOM   1806 C C   . GLN B 1 115 ? 0.992   84.473  50.891 1.00 69.48  ? 1006 GLN B C   1 
ATOM   1807 O O   . GLN B 1 115 ? 0.518   85.211  51.754 1.00 73.19  ? 1006 GLN B O   1 
ATOM   1808 C CB  . GLN B 1 115 ? 3.404   83.984  50.435 1.00 67.74  ? 1006 GLN B CB  1 
ATOM   1809 C CG  . GLN B 1 115 ? 4.290   85.065  51.026 1.00 76.63  ? 1006 GLN B CG  1 
ATOM   1810 C CD  . GLN B 1 115 ? 5.592   85.187  50.203 1.00 82.88  ? 1006 GLN B CD  1 
ATOM   1811 O OE1 . GLN B 1 115 ? 6.194   84.163  49.844 1.00 85.20  ? 1006 GLN B OE1 1 
ATOM   1812 N NE2 . GLN B 1 115 ? 5.977   86.413  49.832 1.00 82.77  ? 1006 GLN B NE2 1 
ATOM   1813 N N   . TYR B 1 116 ? 0.474   84.428  49.670 1.00 68.31  ? 1007 TYR B N   1 
ATOM   1814 C CA  . TYR B 1 116 ? -0.446  85.462  49.233 1.00 66.24  ? 1007 TYR B CA  1 
ATOM   1815 C C   . TYR B 1 116 ? -1.882  84.969  49.310 1.00 67.65  ? 1007 TYR B C   1 
ATOM   1816 O O   . TYR B 1 116 ? -2.758  85.416  48.584 1.00 68.52  ? 1007 TYR B O   1 
ATOM   1817 C CB  . TYR B 1 116 ? -0.045  85.952  47.845 1.00 61.19  ? 1007 TYR B CB  1 
ATOM   1818 C CG  . TYR B 1 116 ? 1.157   86.854  47.936 1.00 59.26  ? 1007 TYR B CG  1 
ATOM   1819 C CD1 . TYR B 1 116 ? 2.445   86.356  47.810 1.00 61.43  ? 1007 TYR B CD1 1 
ATOM   1820 C CD2 . TYR B 1 116 ? 1.011   88.182  48.280 1.00 60.06  ? 1007 TYR B CD2 1 
ATOM   1821 C CE1 . TYR B 1 116 ? 3.557   87.174  47.960 1.00 64.71  ? 1007 TYR B CE1 1 
ATOM   1822 C CE2 . TYR B 1 116 ? 2.117   89.001  48.443 1.00 65.81  ? 1007 TYR B CE2 1 
ATOM   1823 C CZ  . TYR B 1 116 ? 3.387   88.499  48.277 1.00 65.06  ? 1007 TYR B CZ  1 
ATOM   1824 O OH  . TYR B 1 116 ? 4.457   89.345  48.437 1.00 64.72  ? 1007 TYR B OH  1 
ATOM   1825 N N   . VAL B 1 117 ? -2.140  84.062  50.240 1.00 69.90  ? 1008 VAL B N   1 
ATOM   1826 C CA  . VAL B 1 117 ? -3.508  83.735  50.587 1.00 71.13  ? 1008 VAL B CA  1 
ATOM   1827 C C   . VAL B 1 117 ? -4.038  85.038  51.184 1.00 74.39  ? 1008 VAL B C   1 
ATOM   1828 O O   . VAL B 1 117 ? -3.237  85.944  51.501 1.00 73.69  ? 1008 VAL B O   1 
ATOM   1829 C CB  . VAL B 1 117 ? -3.537  82.559  51.584 1.00 71.27  ? 1008 VAL B CB  1 
ATOM   1830 C CG1 . VAL B 1 117 ? -2.877  82.936  52.901 1.00 70.99  ? 1008 VAL B CG1 1 
ATOM   1831 C CG2 . VAL B 1 117 ? -4.965  82.063  51.827 1.00 73.77  ? 1008 VAL B CG2 1 
ATOM   1832 N N   . MET B 1 118 ? -5.365  85.115  51.332 1.00 73.25  ? 1009 MET B N   1 
ATOM   1833 C CA  . MET B 1 118 ? -6.075  86.355  51.640 1.00 73.86  ? 1009 MET B CA  1 
ATOM   1834 C C   . MET B 1 118 ? -5.780  87.540  50.734 1.00 75.04  ? 1009 MET B C   1 
ATOM   1835 O O   . MET B 1 118 ? -6.129  88.659  51.103 1.00 77.14  ? 1009 MET B O   1 
ATOM   1836 C CB  . MET B 1 118 ? -5.823  86.902  53.042 1.00 74.85  ? 1009 MET B CB  1 
ATOM   1837 C CG  . MET B 1 118 ? -4.829  86.197  53.922 1.00 79.85  ? 1009 MET B CG  1 
ATOM   1838 S SD  . MET B 1 118 ? -5.316  86.357  55.648 1.00 81.42  ? 1009 MET B SD  1 
ATOM   1839 C CE  . MET B 1 118 ? -6.760  85.055  55.678 1.00 85.35  ? 1009 MET B CE  1 
ATOM   1840 N N   . THR B 1 119 ? -5.142  87.340  49.583 1.00 75.28  ? 1010 THR B N   1 
ATOM   1841 C CA  . THR B 1 119 ? -4.898  88.460  48.684 1.00 74.10  ? 1010 THR B CA  1 
ATOM   1842 C C   . THR B 1 119 ? -5.282  88.117  47.264 1.00 73.91  ? 1010 THR B C   1 
ATOM   1843 O O   . THR B 1 119 ? -5.625  86.976  46.949 1.00 74.57  ? 1010 THR B O   1 
ATOM   1844 C CB  . THR B 1 119 ? -3.435  88.943  48.690 1.00 71.72  ? 1010 THR B CB  1 
ATOM   1845 O OG1 . THR B 1 119 ? -2.677  88.238  47.698 1.00 70.69  ? 1010 THR B OG1 1 
ATOM   1846 C CG2 . THR B 1 119 ? -2.751  88.645  50.008 1.00 73.46  ? 1010 THR B CG2 1 
ATOM   1847 N N   . SER B 1 120 ? -5.213  89.157  46.436 1.00 75.06  ? 1011 SER B N   1 
ATOM   1848 C CA  . SER B 1 120 ? -5.583  89.063  45.029 1.00 73.23  ? 1011 SER B CA  1 
ATOM   1849 C C   . SER B 1 120 ? -4.748  88.012  44.302 1.00 70.54  ? 1011 SER B C   1 
ATOM   1850 O O   . SER B 1 120 ? -5.279  87.350  43.420 1.00 72.50  ? 1011 SER B O   1 
ATOM   1851 C CB  . SER B 1 120 ? -5.549  90.438  44.328 1.00 72.89  ? 1011 SER B CB  1 
ATOM   1852 O OG  . SER B 1 120 ? -4.323  91.161  44.390 1.00 71.81  ? 1011 SER B OG  1 
ATOM   1853 N N   . LEU B 1 121 ? -3.501  87.806  44.729 1.00 68.73  ? 1012 LEU B N   1 
ATOM   1854 C CA  . LEU B 1 121 ? -2.532  86.969  44.017 1.00 66.98  ? 1012 LEU B CA  1 
ATOM   1855 C C   . LEU B 1 121 ? -2.600  85.461  44.282 1.00 67.14  ? 1012 LEU B C   1 
ATOM   1856 O O   . LEU B 1 121 ? -1.984  84.676  43.563 1.00 67.15  ? 1012 LEU B O   1 
ATOM   1857 C CB  . LEU B 1 121 ? -1.109  87.467  44.267 1.00 63.24  ? 1012 LEU B CB  1 
ATOM   1858 C CG  . LEU B 1 121 ? -0.860  88.939  43.945 1.00 63.64  ? 1012 LEU B CG  1 
ATOM   1859 C CD1 . LEU B 1 121 ? 0.639   89.279  43.988 1.00 62.04  ? 1012 LEU B CD1 1 
ATOM   1860 C CD2 . LEU B 1 121 ? -1.449  89.295  42.596 1.00 60.57  ? 1012 LEU B CD2 1 
ATOM   1861 N N   . GLN B 1 122 ? -3.392  85.031  45.257 1.00 68.82  ? 1013 GLN B N   1 
ATOM   1862 C CA  . GLN B 1 122 ? -3.666  83.601  45.427 1.00 72.02  ? 1013 GLN B CA  1 
ATOM   1863 C C   . GLN B 1 122 ? -4.051  83.008  44.052 1.00 72.16  ? 1013 GLN B C   1 
ATOM   1864 O O   . GLN B 1 122 ? -3.599  81.923  43.669 1.00 71.24  ? 1013 GLN B O   1 
ATOM   1865 C CB  . GLN B 1 122 ? -4.681  83.400  46.580 1.00 74.35  ? 1013 GLN B CB  1 
ATOM   1866 C CG  . GLN B 1 122 ? -5.364  82.042  46.834 1.00 78.46  ? 1013 GLN B CG  1 
ATOM   1867 C CD  . GLN B 1 122 ? -4.591  81.147  47.802 1.00 81.03  ? 1013 GLN B CD  1 
ATOM   1868 O OE1 . GLN B 1 122 ? -3.358  81.175  47.807 1.00 85.23  ? 1013 GLN B OE1 1 
ATOM   1869 N NE2 . GLN B 1 122 ? -5.291  80.310  48.563 1.00 80.33  ? 1013 GLN B NE2 1 
ATOM   1870 N N   . GLN B 1 123 ? -4.765  83.762  43.221 1.00 71.23  ? 1014 GLN B N   1 
ATOM   1871 C CA  . GLN B 1 123 ? -5.336  83.142  42.027 1.00 71.12  ? 1014 GLN B CA  1 
ATOM   1872 C C   . GLN B 1 123 ? -4.354  83.184  40.872 1.00 67.34  ? 1014 GLN B C   1 
ATOM   1873 O O   . GLN B 1 123 ? -4.339  82.276  40.053 1.00 66.45  ? 1014 GLN B O   1 
ATOM   1874 C CB  . GLN B 1 123 ? -6.726  83.697  41.670 1.00 74.40  ? 1014 GLN B CB  1 
ATOM   1875 C CG  . GLN B 1 123 ? -7.845  83.347  42.711 1.00 83.71  ? 1014 GLN B CG  1 
ATOM   1876 C CD  . GLN B 1 123 ? -8.059  81.841  43.056 1.00 87.04  ? 1014 GLN B CD  1 
ATOM   1877 O OE1 . GLN B 1 123 ? -8.548  81.085  42.196 1.00 89.05  ? 1014 GLN B OE1 1 
ATOM   1878 N NE2 . GLN B 1 123 ? -7.785  81.432  44.318 1.00 74.80  ? 1014 GLN B NE2 1 
ATOM   1879 N N   . GLU B 1 124 ? -3.473  84.175  40.866 1.00 65.51  ? 1015 GLU B N   1 
ATOM   1880 C CA  . GLU B 1 124 ? -2.427  84.264  39.860 1.00 65.26  ? 1015 GLU B CA  1 
ATOM   1881 C C   . GLU B 1 124 ? -1.366  83.200  40.128 1.00 63.85  ? 1015 GLU B C   1 
ATOM   1882 O O   . GLU B 1 124 ? -0.882  82.531  39.217 1.00 63.99  ? 1015 GLU B O   1 
ATOM   1883 C CB  . GLU B 1 124 ? -1.795  85.659  39.895 1.00 67.02  ? 1015 GLU B CB  1 
ATOM   1884 C CG  . GLU B 1 124 ? -0.536  85.845  39.048 1.00 73.92  ? 1015 GLU B CG  1 
ATOM   1885 C CD  . GLU B 1 124 ? -0.750  85.671  37.547 1.00 79.31  ? 1015 GLU B CD  1 
ATOM   1886 O OE1 . GLU B 1 124 ? -1.919  85.852  37.112 1.00 78.85  ? 1015 GLU B OE1 1 
ATOM   1887 O OE2 . GLU B 1 124 ? 0.239   85.346  36.833 1.00 78.29  ? 1015 GLU B OE2 1 
ATOM   1888 N N   . TYR B 1 125 ? -0.969  83.036  41.384 1.00 62.28  ? 1016 TYR B N   1 
ATOM   1889 C CA  . TYR B 1 125 ? 0.102   82.091  41.683 1.00 58.64  ? 1016 TYR B CA  1 
ATOM   1890 C C   . TYR B 1 125 ? -0.417  80.655  41.492 1.00 59.01  ? 1016 TYR B C   1 
ATOM   1891 O O   . TYR B 1 125 ? 0.336   79.742  41.144 1.00 57.63  ? 1016 TYR B O   1 
ATOM   1892 C CB  . TYR B 1 125 ? 0.693   82.388  43.071 1.00 55.25  ? 1016 TYR B CB  1 
ATOM   1893 C CG  . TYR B 1 125 ? 1.573   83.638  43.107 1.00 55.97  ? 1016 TYR B CG  1 
ATOM   1894 C CD1 . TYR B 1 125 ? 2.653   83.785  42.234 1.00 54.17  ? 1016 TYR B CD1 1 
ATOM   1895 C CD2 . TYR B 1 125 ? 1.324   84.685  43.994 1.00 52.18  ? 1016 TYR B CD2 1 
ATOM   1896 C CE1 . TYR B 1 125 ? 3.453   84.927  42.233 1.00 54.81  ? 1016 TYR B CE1 1 
ATOM   1897 C CE2 . TYR B 1 125 ? 2.129   85.823  44.005 1.00 52.61  ? 1016 TYR B CE2 1 
ATOM   1898 C CZ  . TYR B 1 125 ? 3.199   85.941  43.126 1.00 56.34  ? 1016 TYR B CZ  1 
ATOM   1899 O OH  . TYR B 1 125 ? 4.038   87.041  43.109 1.00 57.57  ? 1016 TYR B OH  1 
ATOM   1900 N N   . LYS B 1 126 ? -1.731  80.484  41.627 1.00 58.81  ? 1017 LYS B N   1 
ATOM   1901 C CA  . LYS B 1 126 ? -2.371  79.207  41.366 1.00 59.02  ? 1017 LYS B CA  1 
ATOM   1902 C C   . LYS B 1 126 ? -2.314  78.982  39.861 1.00 60.38  ? 1017 LYS B C   1 
ATOM   1903 O O   . LYS B 1 126 ? -2.154  77.855  39.402 1.00 63.46  ? 1017 LYS B O   1 
ATOM   1904 C CB  . LYS B 1 126 ? -3.824  79.200  41.851 1.00 55.84  ? 1017 LYS B CB  1 
ATOM   1905 C CG  . LYS B 1 126 ? -4.084  78.915  43.333 1.00 50.76  ? 1017 LYS B CG  1 
ATOM   1906 C CD  . LYS B 1 126 ? -5.543  78.475  43.536 1.00 51.17  ? 1017 LYS B CD  1 
ATOM   1907 C CE  . LYS B 1 126 ? -6.086  78.742  44.942 1.00 53.98  ? 1017 LYS B CE  1 
ATOM   1908 N NZ  . LYS B 1 126 ? -7.322  77.981  45.301 1.00 55.28  ? 1017 LYS B NZ  1 
ATOM   1909 N N   . LYS B 1 127 ? -2.443  80.033  39.064 1.00 59.13  ? 1018 LYS B N   1 
ATOM   1910 C CA  . LYS B 1 127 ? -2.374  79.828  37.621 1.00 57.87  ? 1018 LYS B CA  1 
ATOM   1911 C C   . LYS B 1 127 ? -0.971  79.366  37.281 1.00 54.97  ? 1018 LYS B C   1 
ATOM   1912 O O   . LYS B 1 127 ? -0.820  78.426  36.510 1.00 56.08  ? 1018 LYS B O   1 
ATOM   1913 C CB  . LYS B 1 127 ? -2.795  81.052  36.788 1.00 62.78  ? 1018 LYS B CB  1 
ATOM   1914 C CG  . LYS B 1 127 ? -4.299  81.403  36.889 1.00 71.24  ? 1018 LYS B CG  1 
ATOM   1915 C CD  . LYS B 1 127 ? -5.038  81.508  35.536 1.00 83.22  ? 1018 LYS B CD  1 
ATOM   1916 C CE  . LYS B 1 127 ? -5.547  80.131  34.992 1.00 89.23  ? 1018 LYS B CE  1 
ATOM   1917 N NZ  . LYS B 1 127 ? -6.457  80.160  33.783 1.00 87.01  ? 1018 LYS B NZ  1 
ATOM   1918 N N   . GLN B 1 128 ? 0.046   79.950  37.908 1.00 53.20  ? 1019 GLN B N   1 
ATOM   1919 C CA  . GLN B 1 128 ? 1.420   79.547  37.617 1.00 51.49  ? 1019 GLN B CA  1 
ATOM   1920 C C   . GLN B 1 128 ? 1.777   78.136  38.149 1.00 49.58  ? 1019 GLN B C   1 
ATOM   1921 O O   . GLN B 1 128 ? 2.557   77.411  37.541 1.00 49.28  ? 1019 GLN B O   1 
ATOM   1922 C CB  . GLN B 1 128 ? 2.437   80.603  38.075 1.00 48.93  ? 1019 GLN B CB  1 
ATOM   1923 C CG  . GLN B 1 128 ? 2.190   82.082  37.719 1.00 52.39  ? 1019 GLN B CG  1 
ATOM   1924 C CD  . GLN B 1 128 ? 3.317   83.057  38.155 1.00 56.59  ? 1019 GLN B CD  1 
ATOM   1925 O OE1 . GLN B 1 128 ? 4.460   82.647  38.357 1.00 62.74  ? 1019 GLN B OE1 1 
ATOM   1926 N NE2 . GLN B 1 128 ? 3.003   84.347  38.271 1.00 57.19  ? 1019 GLN B NE2 1 
ATOM   1927 N N   . MET B 1 129 ? 1.179   77.684  39.244 1.00 48.74  ? 1020 MET B N   1 
ATOM   1928 C CA  . MET B 1 129 ? 1.225   76.267  39.592 1.00 48.98  ? 1020 MET B CA  1 
ATOM   1929 C C   . MET B 1 129 ? 0.759   75.335  38.469 1.00 50.98  ? 1020 MET B C   1 
ATOM   1930 O O   . MET B 1 129 ? 1.400   74.323  38.157 1.00 51.31  ? 1020 MET B O   1 
ATOM   1931 C CB  . MET B 1 129 ? 0.356   76.016  40.829 1.00 47.95  ? 1020 MET B CB  1 
ATOM   1932 C CG  . MET B 1 129 ? 0.930   76.595  42.103 1.00 48.66  ? 1020 MET B CG  1 
ATOM   1933 S SD  . MET B 1 129 ? 0.051   76.371  43.658 1.00 51.21  ? 1020 MET B SD  1 
ATOM   1934 C CE  . MET B 1 129 ? -0.352  74.708  43.667 1.00 55.60  ? 1020 MET B CE  1 
ATOM   1935 N N   . LEU B 1 130 ? -0.406  75.651  37.912 1.00 50.38  ? 1021 LEU B N   1 
ATOM   1936 C CA  . LEU B 1 130 ? -0.970  74.835  36.855 1.00 52.37  ? 1021 LEU B CA  1 
ATOM   1937 C C   . LEU B 1 130 ? -0.013  74.782  35.693 1.00 53.33  ? 1021 LEU B C   1 
ATOM   1938 O O   . LEU B 1 130 ? 0.167   73.739  35.082 1.00 59.85  ? 1021 LEU B O   1 
ATOM   1939 C CB  . LEU B 1 130 ? -2.262  75.420  36.312 1.00 52.94  ? 1021 LEU B CB  1 
ATOM   1940 C CG  . LEU B 1 130 ? -3.510  75.499  37.197 1.00 53.21  ? 1021 LEU B CG  1 
ATOM   1941 C CD1 . LEU B 1 130 ? -4.582  76.262  36.419 1.00 57.01  ? 1021 LEU B CD1 1 
ATOM   1942 C CD2 . LEU B 1 130 ? -4.009  74.133  37.612 1.00 46.18  ? 1021 LEU B CD2 1 
ATOM   1943 N N   . THR B 1 131 ? 0.567   75.918  35.348 1.00 51.81  ? 1022 THR B N   1 
ATOM   1944 C CA  . THR B 1 131 ? 1.576   75.925  34.291 1.00 52.98  ? 1022 THR B CA  1 
ATOM   1945 C C   . THR B 1 131 ? 2.754   74.986  34.542 1.00 52.30  ? 1022 THR B C   1 
ATOM   1946 O O   . THR B 1 131 ? 3.158   74.233  33.669 1.00 51.73  ? 1022 THR B O   1 
ATOM   1947 C CB  . THR B 1 131 ? 2.110   77.345  34.082 1.00 52.55  ? 1022 THR B CB  1 
ATOM   1948 O OG1 . THR B 1 131 ? 1.211   78.075  33.240 1.00 55.04  ? 1022 THR B OG1 1 
ATOM   1949 C CG2 . THR B 1 131 ? 3.402   77.328  33.270 1.00 56.01  ? 1022 THR B CG2 1 
ATOM   1950 N N   . ALA B 1 132 ? 3.323   75.057  35.735 1.00 53.50  ? 1023 ALA B N   1 
ATOM   1951 C CA  . ALA B 1 132 ? 4.473   74.231  36.079 1.00 52.67  ? 1023 ALA B CA  1 
ATOM   1952 C C   . ALA B 1 132 ? 4.083   72.761  36.046 1.00 54.36  ? 1023 ALA B C   1 
ATOM   1953 O O   . ALA B 1 132 ? 4.843   71.880  35.631 1.00 52.39  ? 1023 ALA B O   1 
ATOM   1954 C CB  . ALA B 1 132 ? 4.970   74.593  37.471 1.00 47.24  ? 1023 ALA B CB  1 
ATOM   1955 N N   . ALA B 1 133 ? 2.883   72.517  36.554 1.00 54.51  ? 1024 ALA B N   1 
ATOM   1956 C CA  . ALA B 1 133 ? 2.458   71.153  36.762 1.00 54.06  ? 1024 ALA B CA  1 
ATOM   1957 C C   . ALA B 1 133 ? 2.183   70.566  35.376 1.00 56.78  ? 1024 ALA B C   1 
ATOM   1958 O O   . ALA B 1 133 ? 2.493   69.398  35.096 1.00 59.63  ? 1024 ALA B O   1 
ATOM   1959 C CB  . ALA B 1 133 ? 1.245   71.161  37.633 1.00 50.32  ? 1024 ALA B CB  1 
ATOM   1960 N N   . HIS B 1 134 ? 1.687   71.416  34.482 1.00 55.86  ? 1025 HIS B N   1 
ATOM   1961 C CA  . HIS B 1 134 ? 1.561   71.034  33.088 1.00 55.31  ? 1025 HIS B CA  1 
ATOM   1962 C C   . HIS B 1 134 ? 2.936   70.736  32.457 1.00 52.05  ? 1025 HIS B C   1 
ATOM   1963 O O   . HIS B 1 134 ? 3.152   69.669  31.882 1.00 50.31  ? 1025 HIS B O   1 
ATOM   1964 C CB  . HIS B 1 134 ? 0.742   72.079  32.329 1.00 56.02  ? 1025 HIS B CB  1 
ATOM   1965 C CG  . HIS B 1 134 ? 0.485   71.713  30.899 1.00 62.19  ? 1025 HIS B CG  1 
ATOM   1966 N ND1 . HIS B 1 134 ? 1.442   71.832  29.913 1.00 63.69  ? 1025 HIS B ND1 1 
ATOM   1967 C CD2 . HIS B 1 134 ? -0.625  71.245  30.284 1.00 60.54  ? 1025 HIS B CD2 1 
ATOM   1968 C CE1 . HIS B 1 134 ? 0.947   71.419  28.760 1.00 58.56  ? 1025 HIS B CE1 1 
ATOM   1969 N NE2 . HIS B 1 134 ? -0.303  71.047  28.962 1.00 62.35  ? 1025 HIS B NE2 1 
ATOM   1970 N N   . ALA B 1 135 ? 3.915   71.616  32.620 1.00 50.30  ? 1026 ALA B N   1 
ATOM   1971 C CA  . ALA B 1 135 ? 5.250   71.328  32.084 1.00 51.29  ? 1026 ALA B CA  1 
ATOM   1972 C C   . ALA B 1 135 ? 5.793   69.998  32.573 1.00 53.32  ? 1026 ALA B C   1 
ATOM   1973 O O   . ALA B 1 135 ? 6.406   69.257  31.821 1.00 56.45  ? 1026 ALA B O   1 
ATOM   1974 C CB  . ALA B 1 135 ? 6.241   72.384  32.472 1.00 47.78  ? 1026 ALA B CB  1 
ATOM   1975 N N   . LEU B 1 136 ? 5.601   69.726  33.854 1.00 54.69  ? 1027 LEU B N   1 
ATOM   1976 C CA  . LEU B 1 136 ? 6.067   68.487  34.437 1.00 53.12  ? 1027 LEU B CA  1 
ATOM   1977 C C   . LEU B 1 136 ? 5.422   67.354  33.664 1.00 54.46  ? 1027 LEU B C   1 
ATOM   1978 O O   . LEU B 1 136 ? 6.127   66.466  33.194 1.00 56.18  ? 1027 LEU B O   1 
ATOM   1979 C CB  . LEU B 1 136 ? 5.673   68.462  35.911 1.00 51.80  ? 1027 LEU B CB  1 
ATOM   1980 C CG  . LEU B 1 136 ? 6.094   67.346  36.870 1.00 52.18  ? 1027 LEU B CG  1 
ATOM   1981 C CD1 . LEU B 1 136 ? 7.417   66.684  36.521 1.00 50.00  ? 1027 LEU B CD1 1 
ATOM   1982 C CD2 . LEU B 1 136 ? 6.145   67.860  38.306 1.00 44.74  ? 1027 LEU B CD2 1 
ATOM   1983 N N   . ALA B 1 137 ? 4.104   67.387  33.481 1.00 54.13  ? 1028 ALA B N   1 
ATOM   1984 C CA  . ALA B 1 137 ? 3.424   66.229  32.903 1.00 53.91  ? 1028 ALA B CA  1 
ATOM   1985 C C   . ALA B 1 137 ? 3.954   65.999  31.502 1.00 55.32  ? 1028 ALA B C   1 
ATOM   1986 O O   . ALA B 1 137 ? 4.212   64.870  31.086 1.00 56.23  ? 1028 ALA B O   1 
ATOM   1987 C CB  . ALA B 1 137 ? 1.915   66.415  32.855 1.00 49.60  ? 1028 ALA B CB  1 
ATOM   1988 N N   . VAL B 1 138 ? 4.141   67.102  30.795 1.00 54.01  ? 1029 VAL B N   1 
ATOM   1989 C CA  . VAL B 1 138 ? 4.475   67.030  29.386 1.00 54.59  ? 1029 VAL B CA  1 
ATOM   1990 C C   . VAL B 1 138 ? 5.824   66.380  29.226 1.00 55.36  ? 1029 VAL B C   1 
ATOM   1991 O O   . VAL B 1 138 ? 6.049   65.593  28.315 1.00 57.06  ? 1029 VAL B O   1 
ATOM   1992 C CB  . VAL B 1 138 ? 4.579   68.434  28.753 1.00 53.87  ? 1029 VAL B CB  1 
ATOM   1993 C CG1 . VAL B 1 138 ? 5.496   68.405  27.538 1.00 52.64  ? 1029 VAL B CG1 1 
ATOM   1994 C CG2 . VAL B 1 138 ? 3.192   68.950  28.360 1.00 50.16  ? 1029 VAL B CG2 1 
ATOM   1995 N N   . ASP B 1 139 ? 6.732   66.794  30.095 1.00 56.31  ? 1030 ASP B N   1 
ATOM   1996 C CA  . ASP B 1 139 ? 8.121   66.361  30.031 1.00 56.41  ? 1030 ASP B CA  1 
ATOM   1997 C C   . ASP B 1 139 ? 8.174   64.933  30.532 1.00 54.59  ? 1030 ASP B C   1 
ATOM   1998 O O   . ASP B 1 139 ? 8.976   64.161  30.032 1.00 55.51  ? 1030 ASP B O   1 
ATOM   1999 C CB  . ASP B 1 139 ? 9.050   67.228  30.898 1.00 54.13  ? 1030 ASP B CB  1 
ATOM   2000 C CG  . ASP B 1 139 ? 9.265   68.617  30.327 1.00 56.72  ? 1030 ASP B CG  1 
ATOM   2001 O OD1 . ASP B 1 139 ? 9.019   68.793  29.114 1.00 62.13  ? 1030 ASP B OD1 1 
ATOM   2002 O OD2 . ASP B 1 139 ? 9.620   69.597  31.021 1.00 55.91  ? 1030 ASP B OD2 1 
ATOM   2003 N N   . ALA B 1 140 ? 7.340   64.571  31.498 1.00 52.59  ? 1031 ALA B N   1 
ATOM   2004 C CA  . ALA B 1 140 ? 7.264   63.162  31.870 1.00 50.82  ? 1031 ALA B CA  1 
ATOM   2005 C C   . ALA B 1 140 ? 6.808   62.311  30.682 1.00 51.18  ? 1031 ALA B C   1 
ATOM   2006 O O   . ALA B 1 140 ? 7.286   61.199  30.483 1.00 50.92  ? 1031 ALA B O   1 
ATOM   2007 C CB  . ALA B 1 140 ? 6.370   62.962  33.079 1.00 45.93  ? 1031 ALA B CB  1 
ATOM   2008 N N   . LYS B 1 141 ? 5.927   62.826  29.837 1.00 50.88  ? 1032 LYS B N   1 
ATOM   2009 C CA  . LYS B 1 141 ? 5.565   62.035  28.679 1.00 51.98  ? 1032 LYS B CA  1 
ATOM   2010 C C   . LYS B 1 141 ? 6.691   61.992  27.664 1.00 53.50  ? 1032 LYS B C   1 
ATOM   2011 O O   . LYS B 1 141 ? 6.811   61.027  26.926 1.00 57.35  ? 1032 LYS B O   1 
ATOM   2012 C CB  . LYS B 1 141 ? 4.310   62.565  28.002 1.00 51.16  ? 1032 LYS B CB  1 
ATOM   2013 C CG  . LYS B 1 141 ? 3.068   62.399  28.835 1.00 49.84  ? 1032 LYS B CG  1 
ATOM   2014 C CD  . LYS B 1 141 ? 1.980   63.326  28.327 1.00 53.87  ? 1032 LYS B CD  1 
ATOM   2015 C CE  . LYS B 1 141 ? 0.809   62.613  27.674 1.00 55.84  ? 1032 LYS B CE  1 
ATOM   2016 N NZ  . LYS B 1 141 ? 0.175   63.628  26.778 1.00 63.38  ? 1032 LYS B NZ  1 
ATOM   2017 N N   . ASN B 1 142 ? 7.487   63.043  27.537 1.00 54.51  ? 1033 ASN B N   1 
ATOM   2018 C CA  . ASN B 1 142 ? 8.579   62.969  26.577 1.00 55.17  ? 1033 ASN B CA  1 
ATOM   2019 C C   . ASN B 1 142 ? 9.607   61.959  27.043 1.00 55.75  ? 1033 ASN B C   1 
ATOM   2020 O O   . ASN B 1 142 ? 10.255  61.301  26.252 1.00 54.70  ? 1033 ASN B O   1 
ATOM   2021 C CB  . ASN B 1 142 ? 9.206   64.339  26.384 1.00 58.67  ? 1033 ASN B CB  1 
ATOM   2022 C CG  . ASN B 1 142 ? 8.320   65.252  25.545 1.00 67.75  ? 1033 ASN B CG  1 
ATOM   2023 O OD1 . ASN B 1 142 ? 7.745   64.816  24.543 1.00 73.52  ? 1033 ASN B OD1 1 
ATOM   2024 N ND2 . ASN B 1 142 ? 8.189   66.512  25.959 1.00 68.69  ? 1033 ASN B ND2 1 
ATOM   2025 N N   . LEU B 1 143 ? 9.716   61.773  28.347 1.00 56.37  ? 1034 LEU B N   1 
ATOM   2026 C CA  . LEU B 1 143 ? 10.750  60.913  28.882 1.00 54.10  ? 1034 LEU B CA  1 
ATOM   2027 C C   . LEU B 1 143 ? 10.405  59.498  28.465 1.00 58.22  ? 1034 LEU B C   1 
ATOM   2028 O O   . LEU B 1 143 ? 11.266  58.728  28.043 1.00 61.57  ? 1034 LEU B O   1 
ATOM   2029 C CB  . LEU B 1 143 ? 10.752  61.042  30.397 1.00 52.48  ? 1034 LEU B CB  1 
ATOM   2030 C CG  . LEU B 1 143 ? 11.587  60.045  31.186 1.00 54.25  ? 1034 LEU B CG  1 
ATOM   2031 C CD1 . LEU B 1 143 ? 13.017  60.173  30.705 1.00 54.03  ? 1034 LEU B CD1 1 
ATOM   2032 C CD2 . LEU B 1 143 ? 11.487  60.333  32.681 1.00 50.48  ? 1034 LEU B CD2 1 
ATOM   2033 N N   . LEU B 1 144 ? 9.131   59.165  28.624 1.00 57.21  ? 1035 LEU B N   1 
ATOM   2034 C CA  . LEU B 1 144 ? 8.616   57.878  28.202 1.00 53.54  ? 1035 LEU B CA  1 
ATOM   2035 C C   . LEU B 1 144 ? 8.909   57.698  26.726 1.00 55.85  ? 1035 LEU B C   1 
ATOM   2036 O O   . LEU B 1 144 ? 9.295   56.616  26.299 1.00 58.10  ? 1035 LEU B O   1 
ATOM   2037 C CB  . LEU B 1 144 ? 7.120   57.825  28.461 1.00 48.40  ? 1035 LEU B CB  1 
ATOM   2038 C CG  . LEU B 1 144 ? 6.315   56.627  27.972 1.00 42.27  ? 1035 LEU B CG  1 
ATOM   2039 C CD1 . LEU B 1 144 ? 6.602   55.363  28.742 1.00 41.21  ? 1035 LEU B CD1 1 
ATOM   2040 C CD2 . LEU B 1 144 ? 4.864   57.004  28.188 1.00 47.39  ? 1035 LEU B CD2 1 
ATOM   2041 N N   . ASP B 1 145 ? 8.755   58.743  25.926 1.00 58.78  ? 1036 ASP B N   1 
ATOM   2042 C CA  . ASP B 1 145 ? 8.940   58.526  24.500 1.00 60.85  ? 1036 ASP B CA  1 
ATOM   2043 C C   . ASP B 1 145 ? 10.402  58.171  24.258 1.00 59.74  ? 1036 ASP B C   1 
ATOM   2044 O O   . ASP B 1 145 ? 10.689  57.318  23.431 1.00 62.64  ? 1036 ASP B O   1 
ATOM   2045 C CB  . ASP B 1 145 ? 8.412   59.670  23.617 1.00 65.30  ? 1036 ASP B CB  1 
ATOM   2046 C CG  . ASP B 1 145 ? 6.887   59.560  23.348 1.00 78.30  ? 1036 ASP B CG  1 
ATOM   2047 O OD1 . ASP B 1 145 ? 6.298   58.446  23.485 1.00 81.35  ? 1036 ASP B OD1 1 
ATOM   2048 O OD2 . ASP B 1 145 ? 6.176   60.552  23.031 1.00 83.22  ? 1036 ASP B OD2 1 
ATOM   2049 N N   . VAL B 1 146 ? 11.305  58.697  25.080 1.00 57.36  ? 1037 VAL B N   1 
ATOM   2050 C CA  . VAL B 1 146 ? 12.738  58.490  24.915 1.00 51.46  ? 1037 VAL B CA  1 
ATOM   2051 C C   . VAL B 1 146 ? 13.115  57.105  25.411 1.00 51.53  ? 1037 VAL B C   1 
ATOM   2052 O O   . VAL B 1 146 ? 13.676  56.311  24.665 1.00 53.22  ? 1037 VAL B O   1 
ATOM   2053 C CB  . VAL B 1 146 ? 13.527  59.553  25.696 1.00 49.78  ? 1037 VAL B CB  1 
ATOM   2054 C CG1 . VAL B 1 146 ? 14.987  59.184  25.802 1.00 52.86  ? 1037 VAL B CG1 1 
ATOM   2055 C CG2 . VAL B 1 146 ? 13.400  60.911  25.039 1.00 46.45  ? 1037 VAL B CG2 1 
ATOM   2056 N N   . ILE B 1 147 ? 12.808  56.807  26.667 1.00 48.45  ? 1038 ILE B N   1 
ATOM   2057 C CA  . ILE B 1 147 ? 12.891  55.433  27.131 1.00 46.41  ? 1038 ILE B CA  1 
ATOM   2058 C C   . ILE B 1 147 ? 12.294  54.402  26.178 1.00 50.30  ? 1038 ILE B C   1 
ATOM   2059 O O   . ILE B 1 147 ? 12.641  53.225  26.222 1.00 53.37  ? 1038 ILE B O   1 
ATOM   2060 C CB  . ILE B 1 147 ? 12.196  55.271  28.468 1.00 41.06  ? 1038 ILE B CB  1 
ATOM   2061 C CG1 . ILE B 1 147 ? 12.939  56.069  29.531 1.00 41.39  ? 1038 ILE B CG1 1 
ATOM   2062 C CG2 . ILE B 1 147 ? 12.223  53.818  28.844 1.00 38.85  ? 1038 ILE B CG2 1 
ATOM   2063 C CD1 . ILE B 1 147 ? 12.357  56.016  30.927 1.00 39.52  ? 1038 ILE B CD1 1 
ATOM   2064 N N   . ASP B 1 148 ? 11.344  54.792  25.341 1.00 52.59  ? 1039 ASP B N   1 
ATOM   2065 C CA  . ASP B 1 148 ? 10.732  53.758  24.538 1.00 57.57  ? 1039 ASP B CA  1 
ATOM   2066 C C   . ASP B 1 148 ? 11.664  53.510  23.386 1.00 59.99  ? 1039 ASP B C   1 
ATOM   2067 O O   . ASP B 1 148 ? 11.925  52.353  23.049 1.00 63.49  ? 1039 ASP B O   1 
ATOM   2068 C CB  . ASP B 1 148 ? 9.351   54.136  24.012 1.00 58.64  ? 1039 ASP B CB  1 
ATOM   2069 C CG  . ASP B 1 148 ? 8.242   53.736  24.960 1.00 63.71  ? 1039 ASP B CG  1 
ATOM   2070 O OD1 . ASP B 1 148 ? 8.554   53.105  26.004 1.00 60.63  ? 1039 ASP B OD1 1 
ATOM   2071 O OD2 . ASP B 1 148 ? 7.056   54.104  24.752 1.00 64.18  ? 1039 ASP B OD2 1 
ATOM   2072 N N   . GLN B 1 149 ? 12.126  54.596  22.773 1.00 60.72  ? 1040 GLN B N   1 
ATOM   2073 C CA  . GLN B 1 149 ? 13.020  54.505  21.623 1.00 61.79  ? 1040 GLN B CA  1 
ATOM   2074 C C   . GLN B 1 149 ? 14.235  53.669  22.015 1.00 61.61  ? 1040 GLN B C   1 
ATOM   2075 O O   . GLN B 1 149 ? 14.847  53.001  21.189 1.00 61.85  ? 1040 GLN B O   1 
ATOM   2076 C CB  . GLN B 1 149 ? 13.483  55.901  21.216 1.00 63.94  ? 1040 GLN B CB  1 
ATOM   2077 C CG  . GLN B 1 149 ? 12.692  56.573  20.102 1.00 72.13  ? 1040 GLN B CG  1 
ATOM   2078 C CD  . GLN B 1 149 ? 12.116  55.617  19.059 1.00 77.55  ? 1040 GLN B CD  1 
ATOM   2079 O OE1 . GLN B 1 149 ? 12.709  55.428  17.994 1.00 85.93  ? 1040 GLN B OE1 1 
ATOM   2080 N NE2 . GLN B 1 149 ? 10.924  55.094  19.316 1.00 73.29  ? 1040 GLN B NE2 1 
ATOM   2081 N N   . ALA B 1 150 ? 14.539  53.689  23.306 1.00 60.53  ? 1041 ALA B N   1 
ATOM   2082 C CA  . ALA B 1 150 ? 15.711  53.039  23.848 1.00 59.02  ? 1041 ALA B CA  1 
ATOM   2083 C C   . ALA B 1 150 ? 15.509  51.544  23.946 1.00 61.56  ? 1041 ALA B C   1 
ATOM   2084 O O   . ALA B 1 150 ? 16.337  50.766  23.484 1.00 66.31  ? 1041 ALA B O   1 
ATOM   2085 C CB  . ALA B 1 150 ? 15.994  53.591  25.218 1.00 60.64  ? 1041 ALA B CB  1 
ATOM   2086 N N   . ARG B 1 151 ? 14.455  51.137  24.634 1.00 59.96  ? 1042 ARG B N   1 
ATOM   2087 C CA  . ARG B 1 151 ? 14.037  49.745  24.574 1.00 59.67  ? 1042 ARG B CA  1 
ATOM   2088 C C   . ARG B 1 151 ? 13.986  49.121  23.185 1.00 60.83  ? 1042 ARG B C   1 
ATOM   2089 O O   . ARG B 1 151 ? 14.203  47.929  23.061 1.00 63.32  ? 1042 ARG B O   1 
ATOM   2090 C CB  . ARG B 1 151 ? 12.641  49.619  25.146 1.00 58.08  ? 1042 ARG B CB  1 
ATOM   2091 C CG  . ARG B 1 151 ? 12.576  49.898  26.619 1.00 58.99  ? 1042 ARG B CG  1 
ATOM   2092 C CD  . ARG B 1 151 ? 11.194  50.368  26.982 1.00 60.94  ? 1042 ARG B CD  1 
ATOM   2093 N NE  . ARG B 1 151 ? 10.820  49.963  28.326 1.00 59.08  ? 1042 ARG B NE  1 
ATOM   2094 C CZ  . ARG B 1 151 ? 9.894   50.573  29.031 1.00 56.64  ? 1042 ARG B CZ  1 
ATOM   2095 N NH1 . ARG B 1 151 ? 9.260   51.604  28.495 1.00 56.08  ? 1042 ARG B NH1 1 
ATOM   2096 N NH2 . ARG B 1 151 ? 9.645   50.158  30.266 1.00 56.47  ? 1042 ARG B NH2 1 
ATOM   2097 N N   . LEU B 1 152 ? 13.615  49.858  22.144 1.00 59.78  ? 1043 LEU B N   1 
ATOM   2098 C CA  . LEU B 1 152 ? 13.463  49.252  20.823 1.00 60.05  ? 1043 LEU B CA  1 
ATOM   2099 C C   . LEU B 1 152 ? 14.795  49.111  20.114 1.00 65.03  ? 1043 LEU B C   1 
ATOM   2100 O O   . LEU B 1 152 ? 14.876  48.363  19.124 1.00 70.33  ? 1043 LEU B O   1 
ATOM   2101 C CB  . LEU B 1 152 ? 12.594  50.114  19.909 1.00 57.16  ? 1043 LEU B CB  1 
ATOM   2102 C CG  . LEU B 1 152 ? 11.096  50.178  20.175 1.00 55.49  ? 1043 LEU B CG  1 
ATOM   2103 C CD1 . LEU B 1 152 ? 10.436  51.046  19.105 1.00 57.41  ? 1043 LEU B CD1 1 
ATOM   2104 C CD2 . LEU B 1 152 ? 10.528  48.776  20.173 1.00 46.33  ? 1043 LEU B CD2 1 
ATOM   2105 N N   . LYS B 1 153 ? 15.742  49.965  20.513 1.00 64.11  ? 1044 LYS B N   1 
ATOM   2106 C CA  . LYS B 1 153 ? 17.148  49.850  20.135 1.00 62.19  ? 1044 LYS B CA  1 
ATOM   2107 C C   . LYS B 1 153 ? 17.733  48.613  20.821 1.00 63.12  ? 1044 LYS B C   1 
ATOM   2108 O O   . LYS B 1 153 ? 18.354  47.766  20.189 1.00 64.72  ? 1044 LYS B O   1 
ATOM   2109 C CB  . LYS B 1 153 ? 17.927  51.119  20.509 1.00 61.30  ? 1044 LYS B CB  1 
ATOM   2110 C CG  . LYS B 1 153 ? 18.821  51.691  19.401 1.00 67.75  ? 1044 LYS B CG  1 
ATOM   2111 C CD  . LYS B 1 153 ? 19.948  52.583  19.953 1.00 70.95  ? 1044 LYS B CD  1 
ATOM   2112 C CE  . LYS B 1 153 ? 21.085  51.805  20.621 1.00 71.43  ? 1044 LYS B CE  1 
ATOM   2113 N NZ  . LYS B 1 153 ? 22.410  52.356  20.218 1.00 72.87  ? 1044 LYS B NZ  1 
ATOM   2114 N N   . MET B 1 154 ? 17.474  48.446  22.110 1.00 65.07  ? 1045 MET B N   1 
ATOM   2115 C CA  . MET B 1 154 ? 17.907  47.225  22.779 1.00 67.49  ? 1045 MET B CA  1 
ATOM   2116 C C   . MET B 1 154 ? 17.366  45.983  22.077 1.00 68.92  ? 1045 MET B C   1 
ATOM   2117 O O   . MET B 1 154 ? 18.073  44.997  21.927 1.00 71.38  ? 1045 MET B O   1 
ATOM   2118 C CB  . MET B 1 154 ? 17.454  47.195  24.238 1.00 66.59  ? 1045 MET B CB  1 
ATOM   2119 C CG  . MET B 1 154 ? 17.997  46.011  25.027 1.00 68.57  ? 1045 MET B CG  1 
ATOM   2120 S SD  . MET B 1 154 ? 19.698  46.260  25.617 1.00 72.31  ? 1045 MET B SD  1 
ATOM   2121 C CE  . MET B 1 154 ? 20.541  46.197  24.150 1.00 62.50  ? 1045 MET B CE  1 
ATOM   2122 N N   . LEU B 1 155 ? 16.121  46.026  21.623 1.00 68.06  ? 1046 LEU B N   1 
ATOM   2123 C CA  . LEU B 1 155 ? 15.487  44.840  21.082 1.00 66.21  ? 1046 LEU B CA  1 
ATOM   2124 C C   . LEU B 1 155 ? 15.859  44.602  19.625 1.00 67.67  ? 1046 LEU B C   1 
ATOM   2125 O O   . LEU B 1 155 ? 15.534  43.566  19.051 1.00 69.27  ? 1046 LEU B O   1 
ATOM   2126 C CB  . LEU B 1 155 ? 13.978  44.969  21.238 1.00 63.30  ? 1046 LEU B CB  1 
ATOM   2127 C CG  . LEU B 1 155 ? 13.572  45.008  22.706 1.00 61.44  ? 1046 LEU B CG  1 
ATOM   2128 C CD1 . LEU B 1 155 ? 12.075  45.162  22.846 1.00 62.07  ? 1046 LEU B CD1 1 
ATOM   2129 C CD2 . LEU B 1 155 ? 14.028  43.760  23.423 1.00 61.63  ? 1046 LEU B CD2 1 
ATOM   2130 N N   . GLY B 1 156 ? 16.560  45.552  19.025 1.00 68.55  ? 1047 GLY B N   1 
ATOM   2131 C CA  . GLY B 1 156 ? 17.068  45.363  17.680 1.00 72.67  ? 1047 GLY B CA  1 
ATOM   2132 C C   . GLY B 1 156 ? 15.981  45.459  16.627 1.00 75.32  ? 1047 GLY B C   1 
ATOM   2133 O O   . GLY B 1 156 ? 15.648  46.591  16.262 1.00 79.80  ? 1047 GLY B O   1 
ATOM   2134 N N   . PRO C 1 15  ? -5.933  83.090  24.212 1.00 128.65 ? 906  PRO C N   1 
ATOM   2135 C CA  . PRO C 1 15  ? -4.833  83.351  25.185 1.00 126.48 ? 906  PRO C CA  1 
ATOM   2136 C C   . PRO C 1 15  ? -5.472  84.396  26.118 1.00 125.28 ? 906  PRO C C   1 
ATOM   2137 O O   . PRO C 1 15  ? -4.948  84.774  27.200 1.00 127.43 ? 906  PRO C O   1 
ATOM   2138 C CB  . PRO C 1 15  ? -3.702  83.899  24.340 1.00 125.45 ? 906  PRO C CB  1 
ATOM   2139 C CG  . PRO C 1 15  ? -3.851  82.934  23.028 1.00 123.96 ? 906  PRO C CG  1 
ATOM   2140 C CD  . PRO C 1 15  ? -5.380  82.568  22.946 1.00 124.82 ? 906  PRO C CD  1 
ATOM   2141 N N   . GLN C 1 16  ? -6.723  84.634  25.700 1.00 124.84 ? 907  GLN C N   1 
ATOM   2142 C CA  . GLN C 1 16  ? -7.790  85.549  26.163 1.00 122.61 ? 907  GLN C CA  1 
ATOM   2143 C C   . GLN C 1 16  ? -7.505  86.984  26.488 1.00 122.43 ? 907  GLN C C   1 
ATOM   2144 O O   . GLN C 1 16  ? -6.990  87.706  25.649 1.00 123.86 ? 907  GLN C O   1 
ATOM   2145 C CB  . GLN C 1 16  ? -8.687  84.945  27.276 1.00 124.48 ? 907  GLN C CB  1 
ATOM   2146 C CG  . GLN C 1 16  ? -10.145 85.520  27.190 1.00 120.81 ? 907  GLN C CG  1 
ATOM   2147 C CD  . GLN C 1 16  ? -11.142 84.811  28.034 1.00 122.07 ? 907  GLN C CD  1 
ATOM   2148 O OE1 . GLN C 1 16  ? -10.838 83.764  28.658 1.00 118.62 ? 907  GLN C OE1 1 
ATOM   2149 N NE2 . GLN C 1 16  ? -12.373 85.366  28.055 1.00 122.52 ? 907  GLN C NE2 1 
ATOM   2150 N N   . GLU C 1 17  ? -7.928  87.408  27.674 1.00 119.21 ? 908  GLU C N   1 
ATOM   2151 C CA  . GLU C 1 17  ? -7.752  88.771  28.176 1.00 115.52 ? 908  GLU C CA  1 
ATOM   2152 C C   . GLU C 1 17  ? -6.740  89.676  27.467 1.00 109.18 ? 908  GLU C C   1 
ATOM   2153 O O   . GLU C 1 17  ? -5.576  89.302  27.305 1.00 107.44 ? 908  GLU C O   1 
ATOM   2154 C CB  . GLU C 1 17  ? -7.390  88.700  29.657 1.00 122.96 ? 908  GLU C CB  1 
ATOM   2155 C CG  . GLU C 1 17  ? -8.573  88.457  30.564 1.00 127.84 ? 908  GLU C CG  1 
ATOM   2156 C CD  . GLU C 1 17  ? -8.770  89.596  31.546 1.00 134.55 ? 908  GLU C CD  1 
ATOM   2157 O OE1 . GLU C 1 17  ? -8.512  90.764  31.168 1.00 140.67 ? 908  GLU C OE1 1 
ATOM   2158 O OE2 . GLU C 1 17  ? -9.199  89.328  32.688 1.00 133.89 ? 908  GLU C OE2 1 
ATOM   2159 N N   . ILE C 1 18  ? -7.168  90.883  27.095 1.00 100.31 ? 909  ILE C N   1 
ATOM   2160 C CA  . ILE C 1 18  ? -6.276  91.810  26.408 1.00 91.90  ? 909  ILE C CA  1 
ATOM   2161 C C   . ILE C 1 18  ? -6.660  93.255  26.682 1.00 86.71  ? 909  ILE C C   1 
ATOM   2162 O O   . ILE C 1 18  ? -7.838  93.569  26.798 1.00 86.03  ? 909  ILE C O   1 
ATOM   2163 C CB  . ILE C 1 18  ? -6.300  91.545  24.886 1.00 90.09  ? 909  ILE C CB  1 
ATOM   2164 C CG1 . ILE C 1 18  ? -5.388  92.541  24.162 1.00 90.93  ? 909  ILE C CG1 1 
ATOM   2165 C CG2 . ILE C 1 18  ? -7.735  91.636  24.377 1.00 82.67  ? 909  ILE C CG2 1 
ATOM   2166 C CD1 . ILE C 1 18  ? -4.771  91.997  22.897 1.00 86.65  ? 909  ILE C CD1 1 
ATOM   2167 N N   . SER C 1 19  ? -5.672  94.137  26.783 1.00 79.94  ? 910  SER C N   1 
ATOM   2168 C CA  . SER C 1 19  ? -5.978  95.531  27.050 1.00 76.52  ? 910  SER C CA  1 
ATOM   2169 C C   . SER C 1 19  ? -5.873  96.349  25.772 1.00 73.11  ? 910  SER C C   1 
ATOM   2170 O O   . SER C 1 19  ? -4.980  96.141  24.964 1.00 73.50  ? 910  SER C O   1 
ATOM   2171 C CB  . SER C 1 19  ? -5.013  96.105  28.103 1.00 77.36  ? 910  SER C CB  1 
ATOM   2172 O OG  . SER C 1 19  ? -4.925  95.272  29.251 1.00 84.31  ? 910  SER C OG  1 
ATOM   2173 N N   . PRO C 1 20  ? -6.816  97.277  25.553 1.00 70.48  ? 911  PRO C N   1 
ATOM   2174 C CA  . PRO C 1 20  ? -6.681  98.059  24.327 1.00 67.00  ? 911  PRO C CA  1 
ATOM   2175 C C   . PRO C 1 20  ? -5.503  99.013  24.599 1.00 63.06  ? 911  PRO C C   1 
ATOM   2176 O O   . PRO C 1 20  ? -5.048  99.142  25.728 1.00 65.30  ? 911  PRO C O   1 
ATOM   2177 C CB  . PRO C 1 20  ? -8.042  98.752  24.223 1.00 63.72  ? 911  PRO C CB  1 
ATOM   2178 C CG  . PRO C 1 20  ? -8.455  98.943  25.632 1.00 66.40  ? 911  PRO C CG  1 
ATOM   2179 C CD  . PRO C 1 20  ? -7.919  97.749  26.399 1.00 69.68  ? 911  PRO C CD  1 
ATOM   2180 N N   . PRO C 1 21  ? -4.984  99.681  23.566 1.00 58.59  ? 912  PRO C N   1 
ATOM   2181 C CA  . PRO C 1 21  ? -3.845  100.590 23.743 1.00 58.15  ? 912  PRO C CA  1 
ATOM   2182 C C   . PRO C 1 21  ? -3.962  101.548 24.933 1.00 54.57  ? 912  PRO C C   1 
ATOM   2183 O O   . PRO C 1 21  ? -5.055  101.959 25.286 1.00 55.96  ? 912  PRO C O   1 
ATOM   2184 C CB  . PRO C 1 21  ? -3.830  101.359 22.417 1.00 58.15  ? 912  PRO C CB  1 
ATOM   2185 C CG  . PRO C 1 21  ? -4.433  100.391 21.453 1.00 57.95  ? 912  PRO C CG  1 
ATOM   2186 C CD  . PRO C 1 21  ? -5.566  99.802  22.232 1.00 58.04  ? 912  PRO C CD  1 
ATOM   2187 N N   . PRO C 1 22  ? -2.832  101.899 25.575 1.00 50.37  ? 913  PRO C N   1 
ATOM   2188 C CA  . PRO C 1 22  ? -2.834  102.814 26.714 1.00 53.23  ? 913  PRO C CA  1 
ATOM   2189 C C   . PRO C 1 22  ? -3.772  103.974 26.399 1.00 55.59  ? 913  PRO C C   1 
ATOM   2190 O O   . PRO C 1 22  ? -3.712  104.533 25.314 1.00 59.73  ? 913  PRO C O   1 
ATOM   2191 C CB  . PRO C 1 22  ? -1.367  103.226 26.808 1.00 52.67  ? 913  PRO C CB  1 
ATOM   2192 C CG  . PRO C 1 22  ? -0.684  101.941 26.501 1.00 48.40  ? 913  PRO C CG  1 
ATOM   2193 C CD  . PRO C 1 22  ? -1.466  101.426 25.305 1.00 52.25  ? 913  PRO C CD  1 
ATOM   2194 N N   . THR C 1 23  ? -4.627  104.355 27.337 1.00 56.89  ? 914  THR C N   1 
ATOM   2195 C CA  . THR C 1 23  ? -5.574  105.417 27.043 1.00 60.15  ? 914  THR C CA  1 
ATOM   2196 C C   . THR C 1 23  ? -4.918  106.682 26.540 1.00 63.06  ? 914  THR C C   1 
ATOM   2197 O O   . THR C 1 23  ? -3.870  107.096 27.041 1.00 61.90  ? 914  THR C O   1 
ATOM   2198 C CB  . THR C 1 23  ? -6.441  105.772 28.260 1.00 61.62  ? 914  THR C CB  1 
ATOM   2199 O OG1 . THR C 1 23  ? -7.478  106.678 27.858 1.00 57.25  ? 914  THR C OG1 1 
ATOM   2200 C CG2 . THR C 1 23  ? -5.600  106.427 29.352 1.00 63.40  ? 914  THR C CG2 1 
ATOM   2201 N N   . ALA C 1 24  ? -5.547  107.275 25.530 1.00 66.92  ? 915  ALA C N   1 
ATOM   2202 C CA  . ALA C 1 24  ? -5.068  108.504 24.941 1.00 67.99  ? 915  ALA C CA  1 
ATOM   2203 C C   . ALA C 1 24  ? -5.382  109.671 25.876 1.00 71.00  ? 915  ALA C C   1 
ATOM   2204 O O   . ALA C 1 24  ? -4.625  110.637 25.918 1.00 74.85  ? 915  ALA C O   1 
ATOM   2205 C CB  . ALA C 1 24  ? -5.723  108.712 23.575 1.00 65.42  ? 915  ALA C CB  1 
ATOM   2206 N N   . ASN C 1 25  ? -6.462  109.570 26.656 1.00 73.51  ? 916  ASN C N   1 
ATOM   2207 C CA  . ASN C 1 25  ? -6.874  110.652 27.569 1.00 72.18  ? 916  ASN C CA  1 
ATOM   2208 C C   . ASN C 1 25  ? -5.905  111.137 28.652 1.00 69.94  ? 916  ASN C C   1 
ATOM   2209 O O   . ASN C 1 25  ? -6.349  111.768 29.604 1.00 65.61  ? 916  ASN C O   1 
ATOM   2210 C CB  . ASN C 1 25  ? -8.173  110.289 28.299 1.00 76.43  ? 916  ASN C CB  1 
ATOM   2211 C CG  . ASN C 1 25  ? -9.149  109.489 27.437 1.00 79.79  ? 916  ASN C CG  1 
ATOM   2212 O OD1 . ASN C 1 25  ? -9.238  109.673 26.215 1.00 82.11  ? 916  ASN C OD1 1 
ATOM   2213 N ND2 . ASN C 1 25  ? -9.900  108.598 28.082 1.00 80.06  ? 916  ASN C ND2 1 
ATOM   2214 N N   . LEU C 1 26  ? -4.613  110.854 28.543 1.00 70.86  ? 917  LEU C N   1 
ATOM   2215 C CA  . LEU C 1 26  ? -3.648  111.290 29.569 1.00 72.16  ? 917  LEU C CA  1 
ATOM   2216 C C   . LEU C 1 26  ? -2.333  111.704 28.909 1.00 73.63  ? 917  LEU C C   1 
ATOM   2217 O O   . LEU C 1 26  ? -1.750  110.932 28.154 1.00 75.76  ? 917  LEU C O   1 
ATOM   2218 C CB  . LEU C 1 26  ? -3.317  110.153 30.544 1.00 71.76  ? 917  LEU C CB  1 
ATOM   2219 C CG  . LEU C 1 26  ? -4.300  109.356 31.408 1.00 73.27  ? 917  LEU C CG  1 
ATOM   2220 C CD1 . LEU C 1 26  ? -3.574  108.099 31.823 1.00 68.94  ? 917  LEU C CD1 1 
ATOM   2221 C CD2 . LEU C 1 26  ? -4.771  110.115 32.659 1.00 70.75  ? 917  LEU C CD2 1 
ATOM   2222 N N   . ASP C 1 27  ? -1.847  112.904 29.191 1.00 74.22  ? 918  ASP C N   1 
ATOM   2223 C CA  . ASP C 1 27  ? -0.594  113.356 28.597 1.00 74.91  ? 918  ASP C CA  1 
ATOM   2224 C C   . ASP C 1 27  ? 0.522   112.453 29.115 1.00 71.15  ? 918  ASP C C   1 
ATOM   2225 O O   . ASP C 1 27  ? 0.574   112.193 30.297 1.00 70.73  ? 918  ASP C O   1 
ATOM   2226 C CB  . ASP C 1 27  ? -0.352  114.809 29.005 1.00 79.68  ? 918  ASP C CB  1 
ATOM   2227 C CG  . ASP C 1 27  ? 0.964   115.346 28.505 1.00 86.09  ? 918  ASP C CG  1 
ATOM   2228 O OD1 . ASP C 1 27  ? 2.022   114.875 28.979 1.00 88.43  ? 918  ASP C OD1 1 
ATOM   2229 O OD2 . ASP C 1 27  ? 0.947   116.240 27.630 1.00 90.98  ? 918  ASP C OD2 1 
ATOM   2230 N N   . ARG C 1 28  ? 1.399   111.973 28.236 1.00 69.22  ? 919  ARG C N   1 
ATOM   2231 C CA  . ARG C 1 28  ? 2.502   111.101 28.647 1.00 66.32  ? 919  ARG C CA  1 
ATOM   2232 C C   . ARG C 1 28  ? 3.850   111.791 28.680 1.00 66.36  ? 919  ARG C C   1 
ATOM   2233 O O   . ARG C 1 28  ? 4.859   111.124 28.870 1.00 66.47  ? 919  ARG C O   1 
ATOM   2234 C CB  . ARG C 1 28  ? 2.651   109.917 27.695 1.00 59.91  ? 919  ARG C CB  1 
ATOM   2235 C CG  . ARG C 1 28  ? 1.417   109.119 27.468 1.00 53.97  ? 919  ARG C CG  1 
ATOM   2236 C CD  . ARG C 1 28  ? 1.033   108.363 28.709 1.00 54.06  ? 919  ARG C CD  1 
ATOM   2237 N NE  . ARG C 1 28  ? -0.252  107.717 28.514 1.00 56.64  ? 919  ARG C NE  1 
ATOM   2238 C CZ  . ARG C 1 28  ? -0.780  106.840 29.352 1.00 58.02  ? 919  ARG C CZ  1 
ATOM   2239 N NH1 . ARG C 1 28  ? -0.126  106.504 30.459 1.00 57.88  ? 919  ARG C NH1 1 
ATOM   2240 N NH2 . ARG C 1 28  ? -1.961  106.302 29.075 1.00 59.22  ? 919  ARG C NH2 1 
ATOM   2241 N N   . SER C 1 29  ? 3.875   113.106 28.507 1.00 67.26  ? 920  SER C N   1 
ATOM   2242 C CA  . SER C 1 29  ? 5.125   113.873 28.471 1.00 69.34  ? 920  SER C CA  1 
ATOM   2243 C C   . SER C 1 29  ? 6.008   113.776 29.691 1.00 68.45  ? 920  SER C C   1 
ATOM   2244 O O   . SER C 1 29  ? 7.236   113.762 29.590 1.00 65.30  ? 920  SER C O   1 
ATOM   2245 C CB  . SER C 1 29  ? 4.818   115.339 28.223 1.00 67.53  ? 920  SER C CB  1 
ATOM   2246 O OG  . SER C 1 29  ? 3.758   115.458 27.290 1.00 73.55  ? 920  SER C OG  1 
ATOM   2247 N N   . ASN C 1 30  ? 5.381   113.736 30.852 1.00 70.52  ? 921  ASN C N   1 
ATOM   2248 C CA  . ASN C 1 30  ? 6.160   113.651 32.073 1.00 77.20  ? 921  ASN C CA  1 
ATOM   2249 C C   . ASN C 1 30  ? 5.730   112.420 32.868 1.00 76.27  ? 921  ASN C C   1 
ATOM   2250 O O   . ASN C 1 30  ? 5.829   112.390 34.104 1.00 80.22  ? 921  ASN C O   1 
ATOM   2251 C CB  . ASN C 1 30  ? 5.990   114.934 32.911 1.00 80.09  ? 921  ASN C CB  1 
ATOM   2252 C CG  . ASN C 1 30  ? 6.332   116.198 32.127 1.00 82.83  ? 921  ASN C CG  1 
ATOM   2253 O OD1 . ASN C 1 30  ? 7.500   116.457 31.818 1.00 84.69  ? 921  ASN C OD1 1 
ATOM   2254 N ND2 . ASN C 1 30  ? 5.307   116.979 31.779 1.00 83.12  ? 921  ASN C ND2 1 
ATOM   2255 N N   . ASP C 1 31  ? 5.258   111.406 32.146 1.00 73.28  ? 922  ASP C N   1 
ATOM   2256 C CA  . ASP C 1 31  ? 4.809   110.160 32.751 1.00 67.59  ? 922  ASP C CA  1 
ATOM   2257 C C   . ASP C 1 31  ? 5.994   109.226 32.884 1.00 68.89  ? 922  ASP C C   1 
ATOM   2258 O O   . ASP C 1 31  ? 6.304   108.492 31.953 1.00 72.66  ? 922  ASP C O   1 
ATOM   2259 C CB  . ASP C 1 31  ? 3.764   109.478 31.876 1.00 59.59  ? 922  ASP C CB  1 
ATOM   2260 C CG  . ASP C 1 31  ? 3.080   108.326 32.579 1.00 64.19  ? 922  ASP C CG  1 
ATOM   2261 O OD1 . ASP C 1 31  ? 3.643   107.779 33.549 1.00 65.81  ? 922  ASP C OD1 1 
ATOM   2262 O OD2 . ASP C 1 31  ? 1.971   107.942 32.162 1.00 65.19  ? 922  ASP C OD2 1 
ATOM   2263 N N   . LYS C 1 32  ? 6.642   109.230 34.042 1.00 70.59  ? 923  LYS C N   1 
ATOM   2264 C CA  . LYS C 1 32  ? 7.794   108.367 34.262 1.00 71.78  ? 923  LYS C CA  1 
ATOM   2265 C C   . LYS C 1 32  ? 7.436   106.881 34.434 1.00 69.48  ? 923  LYS C C   1 
ATOM   2266 O O   . LYS C 1 32  ? 8.325   106.031 34.424 1.00 69.26  ? 923  LYS C O   1 
ATOM   2267 C CB  . LYS C 1 32  ? 8.592   108.864 35.474 1.00 73.53  ? 923  LYS C CB  1 
ATOM   2268 C CG  . LYS C 1 32  ? 9.458   110.080 35.174 1.00 82.83  ? 923  LYS C CG  1 
ATOM   2269 C CD  . LYS C 1 32  ? 10.928  109.692 34.988 1.00 87.55  ? 923  LYS C CD  1 
ATOM   2270 C CE  . LYS C 1 32  ? 11.588  109.434 36.339 1.00 88.83  ? 923  LYS C CE  1 
ATOM   2271 N NZ  . LYS C 1 32  ? 12.755  108.503 36.273 1.00 89.64  ? 923  LYS C NZ  1 
ATOM   2272 N N   . VAL C 1 33  ? 6.160   106.558 34.634 1.00 66.51  ? 924  VAL C N   1 
ATOM   2273 C CA  . VAL C 1 33  ? 5.805   105.158 34.744 1.00 65.77  ? 924  VAL C CA  1 
ATOM   2274 C C   . VAL C 1 33  ? 5.895   104.613 33.309 1.00 69.78  ? 924  VAL C C   1 
ATOM   2275 O O   . VAL C 1 33  ? 6.546   103.588 33.046 1.00 76.88  ? 924  VAL C O   1 
ATOM   2276 C CB  . VAL C 1 33  ? 4.375   104.959 35.297 1.00 61.53  ? 924  VAL C CB  1 
ATOM   2277 C CG1 . VAL C 1 33  ? 3.902   103.531 35.048 1.00 57.66  ? 924  VAL C CG1 1 
ATOM   2278 C CG2 . VAL C 1 33  ? 4.376   105.197 36.775 1.00 58.06  ? 924  VAL C CG2 1 
ATOM   2279 N N   . TYR C 1 34  ? 5.245   105.324 32.384 1.00 67.44  ? 925  TYR C N   1 
ATOM   2280 C CA  . TYR C 1 34  ? 5.207   104.970 30.963 1.00 63.66  ? 925  TYR C CA  1 
ATOM   2281 C C   . TYR C 1 34  ? 6.627   104.863 30.439 1.00 66.74  ? 925  TYR C C   1 
ATOM   2282 O O   . TYR C 1 34  ? 6.921   103.976 29.659 1.00 70.45  ? 925  TYR C O   1 
ATOM   2283 C CB  . TYR C 1 34  ? 4.441   106.033 30.177 1.00 56.51  ? 925  TYR C CB  1 
ATOM   2284 C CG  . TYR C 1 34  ? 3.797   105.558 28.888 1.00 53.32  ? 925  TYR C CG  1 
ATOM   2285 C CD1 . TYR C 1 34  ? 4.497   105.561 27.683 1.00 54.70  ? 925  TYR C CD1 1 
ATOM   2286 C CD2 . TYR C 1 34  ? 2.465   105.147 28.861 1.00 55.57  ? 925  TYR C CD2 1 
ATOM   2287 C CE1 . TYR C 1 34  ? 3.891   105.160 26.478 1.00 54.23  ? 925  TYR C CE1 1 
ATOM   2288 C CE2 . TYR C 1 34  ? 1.853   104.741 27.664 1.00 58.25  ? 925  TYR C CE2 1 
ATOM   2289 C CZ  . TYR C 1 34  ? 2.571   104.756 26.485 1.00 58.65  ? 925  TYR C CZ  1 
ATOM   2290 O OH  . TYR C 1 34  ? 1.943   104.338 25.339 1.00 65.77  ? 925  TYR C OH  1 
ATOM   2291 N N   . GLU C 1 35  ? 7.513   105.739 30.897 1.00 68.19  ? 926  GLU C N   1 
ATOM   2292 C CA  . GLU C 1 35  ? 8.905   105.719 30.469 1.00 72.79  ? 926  GLU C CA  1 
ATOM   2293 C C   . GLU C 1 35  ? 9.603   104.493 31.031 1.00 73.87  ? 926  GLU C C   1 
ATOM   2294 O O   . GLU C 1 35  ? 10.264  103.766 30.294 1.00 76.50  ? 926  GLU C O   1 
ATOM   2295 C CB  . GLU C 1 35  ? 9.624   106.970 30.952 1.00 76.17  ? 926  GLU C CB  1 
ATOM   2296 C CG  . GLU C 1 35  ? 10.787  107.386 30.080 1.00 81.89  ? 926  GLU C CG  1 
ATOM   2297 C CD  . GLU C 1 35  ? 11.617  108.495 30.696 1.00 90.82  ? 926  GLU C CD  1 
ATOM   2298 O OE1 . GLU C 1 35  ? 11.174  109.117 31.691 1.00 95.15  ? 926  GLU C OE1 1 
ATOM   2299 O OE2 . GLU C 1 35  ? 12.719  108.755 30.173 1.00 95.07  ? 926  GLU C OE2 1 
ATOM   2300 N N   . ASN C 1 36  ? 9.419   104.226 32.322 1.00 72.91  ? 927  ASN C N   1 
ATOM   2301 C CA  . ASN C 1 36  ? 10.080  103.077 32.926 1.00 70.70  ? 927  ASN C CA  1 
ATOM   2302 C C   . ASN C 1 36  ? 9.557   101.742 32.447 1.00 69.49  ? 927  ASN C C   1 
ATOM   2303 O O   . ASN C 1 36  ? 10.335  100.802 32.292 1.00 70.99  ? 927  ASN C O   1 
ATOM   2304 C CB  . ASN C 1 36  ? 10.048  103.181 34.446 1.00 73.47  ? 927  ASN C CB  1 
ATOM   2305 C CG  . ASN C 1 36  ? 10.908  104.328 34.944 1.00 75.46  ? 927  ASN C CG  1 
ATOM   2306 O OD1 . ASN C 1 36  ? 11.736  104.856 34.194 1.00 70.40  ? 927  ASN C OD1 1 
ATOM   2307 N ND2 . ASN C 1 36  ? 10.735  104.711 36.204 1.00 72.56  ? 927  ASN C ND2 1 
ATOM   2308 N N   . VAL C 1 37  ? 8.253   101.637 32.219 1.00 66.16  ? 928  VAL C N   1 
ATOM   2309 C CA  . VAL C 1 37  ? 7.725   100.390 31.693 1.00 62.88  ? 928  VAL C CA  1 
ATOM   2310 C C   . VAL C 1 37  ? 8.399   100.184 30.328 1.00 63.87  ? 928  VAL C C   1 
ATOM   2311 O O   . VAL C 1 37  ? 9.009   99.134  30.055 1.00 65.43  ? 928  VAL C O   1 
ATOM   2312 C CB  . VAL C 1 37  ? 6.198   100.452 31.525 1.00 59.75  ? 928  VAL C CB  1 
ATOM   2313 C CG1 . VAL C 1 37  ? 5.713   99.276  30.688 1.00 55.97  ? 928  VAL C CG1 1 
ATOM   2314 C CG2 . VAL C 1 37  ? 5.547   100.401 32.890 1.00 59.41  ? 928  VAL C CG2 1 
ATOM   2315 N N   . THR C 1 38  ? 8.306   101.205 29.479 1.00 64.43  ? 929  THR C N   1 
ATOM   2316 C CA  . THR C 1 38  ? 8.905   101.154 28.144 1.00 62.26  ? 929  THR C CA  1 
ATOM   2317 C C   . THR C 1 38  ? 10.364  100.802 28.276 1.00 64.02  ? 929  THR C C   1 
ATOM   2318 O O   . THR C 1 38  ? 10.913  100.097 27.442 1.00 68.07  ? 929  THR C O   1 
ATOM   2319 C CB  . THR C 1 38  ? 8.802   102.493 27.392 1.00 61.28  ? 929  THR C CB  1 
ATOM   2320 O OG1 . THR C 1 38  ? 7.424   102.824 27.184 1.00 66.27  ? 929  THR C OG1 1 
ATOM   2321 C CG2 . THR C 1 38  ? 9.452   102.388 26.038 1.00 58.90  ? 929  THR C CG2 1 
ATOM   2322 N N   . GLY C 1 39  ? 10.992  101.265 29.345 1.00 63.91  ? 930  GLY C N   1 
ATOM   2323 C CA  . GLY C 1 39  ? 12.388  100.951 29.523 1.00 64.59  ? 930  GLY C CA  1 
ATOM   2324 C C   . GLY C 1 39  ? 12.581  99.489  29.845 1.00 67.88  ? 930  GLY C C   1 
ATOM   2325 O O   . GLY C 1 39  ? 13.452  98.833  29.269 1.00 69.73  ? 930  GLY C O   1 
ATOM   2326 N N   . LEU C 1 40  ? 11.764  98.978  30.764 1.00 66.69  ? 931  LEU C N   1 
ATOM   2327 C CA  . LEU C 1 40  ? 11.852  97.583  31.190 1.00 64.21  ? 931  LEU C CA  1 
ATOM   2328 C C   . LEU C 1 40  ? 11.492  96.600  30.077 1.00 64.25  ? 931  LEU C C   1 
ATOM   2329 O O   . LEU C 1 40  ? 12.109  95.534  29.947 1.00 65.87  ? 931  LEU C O   1 
ATOM   2330 C CB  . LEU C 1 40  ? 10.937  97.344  32.384 1.00 60.51  ? 931  LEU C CB  1 
ATOM   2331 C CG  . LEU C 1 40  ? 10.861  95.889  32.805 1.00 61.41  ? 931  LEU C CG  1 
ATOM   2332 C CD1 . LEU C 1 40  ? 12.235  95.430  33.225 1.00 61.13  ? 931  LEU C CD1 1 
ATOM   2333 C CD2 . LEU C 1 40  ? 9.854   95.737  33.924 1.00 64.36  ? 931  LEU C CD2 1 
ATOM   2334 N N   . VAL C 1 41  ? 10.483  96.941  29.288 1.00 60.67  ? 932  VAL C N   1 
ATOM   2335 C CA  . VAL C 1 41  ? 10.100  96.068  28.206 1.00 64.58  ? 932  VAL C CA  1 
ATOM   2336 C C   . VAL C 1 41  ? 11.256  96.039  27.218 1.00 67.93  ? 932  VAL C C   1 
ATOM   2337 O O   . VAL C 1 41  ? 11.589  94.996  26.653 1.00 69.45  ? 932  VAL C O   1 
ATOM   2338 C CB  . VAL C 1 41  ? 8.840   96.580  27.530 1.00 62.31  ? 932  VAL C CB  1 
ATOM   2339 C CG1 . VAL C 1 41  ? 8.559   95.788  26.262 1.00 60.26  ? 932  VAL C CG1 1 
ATOM   2340 C CG2 . VAL C 1 41  ? 7.690   96.461  28.494 1.00 57.42  ? 932  VAL C CG2 1 
ATOM   2341 N N   . LYS C 1 42  ? 11.895  97.187  27.038 1.00 69.41  ? 933  LYS C N   1 
ATOM   2342 C CA  . LYS C 1 42  ? 12.999  97.290  26.102 1.00 70.35  ? 933  LYS C CA  1 
ATOM   2343 C C   . LYS C 1 42  ? 14.236  96.449  26.469 1.00 73.07  ? 933  LYS C C   1 
ATOM   2344 O O   . LYS C 1 42  ? 14.905  95.893  25.588 1.00 74.09  ? 933  LYS C O   1 
ATOM   2345 C CB  . LYS C 1 42  ? 13.359  98.761  25.942 1.00 70.74  ? 933  LYS C CB  1 
ATOM   2346 C CG  . LYS C 1 42  ? 13.215  99.246  24.521 1.00 71.52  ? 933  LYS C CG  1 
ATOM   2347 C CD  . LYS C 1 42  ? 12.796  100.695 24.450 1.00 72.51  ? 933  LYS C CD  1 
ATOM   2348 C CE  . LYS C 1 42  ? 11.518  100.793 23.636 1.00 75.65  ? 933  LYS C CE  1 
ATOM   2349 N NZ  . LYS C 1 42  ? 11.469  101.996 22.751 1.00 73.72  ? 933  LYS C NZ  1 
ATOM   2350 N N   . ALA C 1 43  ? 14.532  96.345  27.762 1.00 73.07  ? 934  ALA C N   1 
ATOM   2351 C CA  . ALA C 1 43  ? 15.682  95.573  28.227 1.00 75.97  ? 934  ALA C CA  1 
ATOM   2352 C C   . ALA C 1 43  ? 15.402  94.072  28.123 1.00 78.13  ? 934  ALA C C   1 
ATOM   2353 O O   . ALA C 1 43  ? 16.329  93.264  28.056 1.00 82.14  ? 934  ALA C O   1 
ATOM   2354 C CB  . ALA C 1 43  ? 16.011  95.950  29.662 1.00 73.58  ? 934  ALA C CB  1 
ATOM   2355 N N   . VAL C 1 44  ? 14.122  93.703  28.132 1.00 75.12  ? 935  VAL C N   1 
ATOM   2356 C CA  . VAL C 1 44  ? 13.730  92.306  28.010 1.00 70.40  ? 935  VAL C CA  1 
ATOM   2357 C C   . VAL C 1 44  ? 13.913  91.950  26.546 1.00 71.39  ? 935  VAL C C   1 
ATOM   2358 O O   . VAL C 1 44  ? 14.447  90.903  26.207 1.00 74.79  ? 935  VAL C O   1 
ATOM   2359 C CB  . VAL C 1 44  ? 12.250  92.093  28.424 1.00 65.93  ? 935  VAL C CB  1 
ATOM   2360 C CG1 . VAL C 1 44  ? 11.667  90.900  27.710 1.00 60.01  ? 935  VAL C CG1 1 
ATOM   2361 C CG2 . VAL C 1 44  ? 12.157  91.888  29.918 1.00 59.96  ? 935  VAL C CG2 1 
ATOM   2362 N N   . ILE C 1 45  ? 13.479  92.845  25.676 1.00 71.69  ? 936  ILE C N   1 
ATOM   2363 C CA  . ILE C 1 45  ? 13.608  92.616  24.258 1.00 72.90  ? 936  ILE C CA  1 
ATOM   2364 C C   . ILE C 1 45  ? 15.078  92.490  23.870 1.00 77.25  ? 936  ILE C C   1 
ATOM   2365 O O   . ILE C 1 45  ? 15.411  91.752  22.941 1.00 78.99  ? 936  ILE C O   1 
ATOM   2366 C CB  . ILE C 1 45  ? 12.917  93.751  23.486 1.00 71.30  ? 936  ILE C CB  1 
ATOM   2367 C CG1 . ILE C 1 45  ? 11.409  93.647  23.713 1.00 68.59  ? 936  ILE C CG1 1 
ATOM   2368 C CG2 . ILE C 1 45  ? 13.265  93.686  22.019 1.00 68.60  ? 936  ILE C CG2 1 
ATOM   2369 C CD1 . ILE C 1 45  ? 10.594  94.633  22.941 1.00 62.67  ? 936  ILE C CD1 1 
ATOM   2370 N N   . GLU C 1 46  ? 15.952  93.195  24.586 1.00 80.85  ? 937  GLU C N   1 
ATOM   2371 C CA  . GLU C 1 46  ? 17.382  93.139  24.308 1.00 84.85  ? 937  GLU C CA  1 
ATOM   2372 C C   . GLU C 1 46  ? 17.823  91.695  24.609 1.00 85.40  ? 937  GLU C C   1 
ATOM   2373 O O   . GLU C 1 46  ? 18.392  91.012  23.748 1.00 85.45  ? 937  GLU C O   1 
ATOM   2374 C CB  . GLU C 1 46  ? 18.105  94.183  25.183 1.00 89.34  ? 937  GLU C CB  1 
ATOM   2375 C CG  . GLU C 1 46  ? 19.609  94.465  24.903 1.00 97.03  ? 937  GLU C CG  1 
ATOM   2376 C CD  . GLU C 1 46  ? 19.996  94.491  23.429 1.00 100.65 ? 937  GLU C CD  1 
ATOM   2377 O OE1 . GLU C 1 46  ? 19.384  95.244  22.639 1.00 103.23 ? 937  GLU C OE1 1 
ATOM   2378 O OE2 . GLU C 1 46  ? 20.939  93.751  23.068 1.00 102.91 ? 937  GLU C OE2 1 
ATOM   2379 N N   . MET C 1 47  ? 17.534  91.217  25.816 1.00 86.61  ? 938  MET C N   1 
ATOM   2380 C CA  . MET C 1 47  ? 17.880  89.844  26.199 1.00 88.81  ? 938  MET C CA  1 
ATOM   2381 C C   . MET C 1 47  ? 17.191  88.827  25.292 1.00 91.55  ? 938  MET C C   1 
ATOM   2382 O O   . MET C 1 47  ? 17.833  88.058  24.579 1.00 89.82  ? 938  MET C O   1 
ATOM   2383 C CB  . MET C 1 47  ? 17.452  89.567  27.641 1.00 84.18  ? 938  MET C CB  1 
ATOM   2384 C CG  . MET C 1 47  ? 17.051  88.118  27.893 1.00 79.50  ? 938  MET C CG  1 
ATOM   2385 S SD  . MET C 1 47  ? 16.712  87.754  29.612 1.00 82.62  ? 938  MET C SD  1 
ATOM   2386 C CE  . MET C 1 47  ? 17.858  88.812  30.419 1.00 74.90  ? 938  MET C CE  1 
ATOM   2387 N N   . SER C 1 48  ? 15.866  88.835  25.348 1.00 97.05  ? 939  SER C N   1 
ATOM   2388 C CA  . SER C 1 48  ? 15.037  87.929  24.577 1.00 104.32 ? 939  SER C CA  1 
ATOM   2389 C C   . SER C 1 48  ? 15.489  87.785  23.132 1.00 109.35 ? 939  SER C C   1 
ATOM   2390 O O   . SER C 1 48  ? 15.284  86.731  22.523 1.00 110.24 ? 939  SER C O   1 
ATOM   2391 C CB  . SER C 1 48  ? 13.590  88.411  24.584 1.00 104.64 ? 939  SER C CB  1 
ATOM   2392 O OG  . SER C 1 48  ? 13.366  89.296  23.499 1.00 109.93 ? 939  SER C OG  1 
ATOM   2393 N N   . SER C 1 49  ? 16.096  88.829  22.572 1.00 113.62 ? 940  SER C N   1 
ATOM   2394 C CA  . SER C 1 49  ? 16.523  88.742  21.185 1.00 116.67 ? 940  SER C CA  1 
ATOM   2395 C C   . SER C 1 49  ? 18.012  88.547  20.957 1.00 118.74 ? 940  SER C C   1 
ATOM   2396 O O   . SER C 1 49  ? 18.430  88.328  19.820 1.00 119.90 ? 940  SER C O   1 
ATOM   2397 C CB  . SER C 1 49  ? 16.036  89.960  20.398 1.00 116.08 ? 940  SER C CB  1 
ATOM   2398 O OG  . SER C 1 49  ? 15.646  89.577  19.087 1.00 117.32 ? 940  SER C OG  1 
ATOM   2399 N N   . LYS C 1 50  ? 18.824  88.645  22.004 1.00 119.52 ? 941  LYS C N   1 
ATOM   2400 C CA  . LYS C 1 50  ? 20.248  88.423  21.804 1.00 121.64 ? 941  LYS C CA  1 
ATOM   2401 C C   . LYS C 1 50  ? 20.496  86.975  22.227 1.00 122.48 ? 941  LYS C C   1 
ATOM   2402 O O   . LYS C 1 50  ? 20.477  86.060  21.395 1.00 123.30 ? 941  LYS C O   1 
ATOM   2403 C CB  . LYS C 1 50  ? 21.075  89.411  22.641 1.00 123.78 ? 941  LYS C CB  1 
ATOM   2404 C CG  . LYS C 1 50  ? 22.528  89.607  22.160 1.00 128.57 ? 941  LYS C CG  1 
ATOM   2405 C CD  . LYS C 1 50  ? 23.417  88.386  22.465 1.00 132.77 ? 941  LYS C CD  1 
ATOM   2406 C CE  . LYS C 1 50  ? 24.067  87.772  21.206 1.00 132.01 ? 941  LYS C CE  1 
ATOM   2407 N NZ  . LYS C 1 50  ? 24.892  88.738  20.416 1.00 132.40 ? 941  LYS C NZ  1 
ATOM   2408 N N   . ILE C 1 51  ? 20.672  86.778  23.532 1.00 122.34 ? 942  ILE C N   1 
ATOM   2409 C CA  . ILE C 1 51  ? 20.911  85.474  24.177 1.00 122.45 ? 942  ILE C CA  1 
ATOM   2410 C C   . ILE C 1 51  ? 21.017  84.123  23.449 1.00 123.52 ? 942  ILE C C   1 
ATOM   2411 O O   . ILE C 1 51  ? 21.979  83.400  23.696 1.00 124.43 ? 942  ILE C O   1 
ATOM   2412 C CB  . ILE C 1 51  ? 19.928  85.260  25.335 1.00 121.51 ? 942  ILE C CB  1 
ATOM   2413 C CG1 . ILE C 1 51  ? 20.596  84.345  26.360 1.00 119.49 ? 942  ILE C CG1 1 
ATOM   2414 C CG2 . ILE C 1 51  ? 18.640  84.581  24.832 1.00 118.15 ? 942  ILE C CG2 1 
ATOM   2415 C CD1 . ILE C 1 51  ? 19.848  84.240  27.648 1.00 118.35 ? 942  ILE C CD1 1 
ATOM   2416 N N   . GLN C 1 52  ? 20.084  83.768  22.570 1.00 123.07 ? 943  GLN C N   1 
ATOM   2417 C CA  . GLN C 1 52  ? 20.226  82.481  21.919 1.00 123.19 ? 943  GLN C CA  1 
ATOM   2418 C C   . GLN C 1 52  ? 21.745  82.147  21.797 1.00 122.52 ? 943  GLN C C   1 
ATOM   2419 O O   . GLN C 1 52  ? 22.199  81.097  22.305 1.00 121.13 ? 943  GLN C O   1 
ATOM   2420 C CB  . GLN C 1 52  ? 19.552  82.474  20.519 1.00 123.54 ? 943  GLN C CB  1 
ATOM   2421 C CG  . GLN C 1 52  ? 18.033  82.226  20.428 1.00 123.58 ? 943  GLN C CG  1 
ATOM   2422 C CD  . GLN C 1 52  ? 17.720  80.773  20.100 1.00 122.23 ? 943  GLN C CD  1 
ATOM   2423 O OE1 . GLN C 1 52  ? 18.490  80.095  19.403 1.00 121.77 ? 943  GLN C OE1 1 
ATOM   2424 N NE2 . GLN C 1 52  ? 16.588  80.292  20.589 1.00 118.83 ? 943  GLN C NE2 1 
ATOM   2425 N N   . PRO C 1 53  ? 22.527  82.975  21.051 1.00 121.97 ? 944  PRO C N   1 
ATOM   2426 C CA  . PRO C 1 53  ? 23.991  82.758  20.882 1.00 119.93 ? 944  PRO C CA  1 
ATOM   2427 C C   . PRO C 1 53  ? 24.881  82.666  22.153 1.00 118.17 ? 944  PRO C C   1 
ATOM   2428 O O   . PRO C 1 53  ? 25.181  81.590  22.638 1.00 118.14 ? 944  PRO C O   1 
ATOM   2429 C CB  . PRO C 1 53  ? 24.396  83.920  20.018 1.00 119.33 ? 944  PRO C CB  1 
ATOM   2430 C CG  . PRO C 1 53  ? 23.162  84.278  19.216 1.00 120.94 ? 944  PRO C CG  1 
ATOM   2431 C CD  . PRO C 1 53  ? 21.970  83.634  19.839 1.00 121.22 ? 944  PRO C CD  1 
ATOM   2432 N N   . ALA C 1 54  ? 25.208  83.822  22.732 1.00 116.38 ? 945  ALA C N   1 
ATOM   2433 C CA  . ALA C 1 54  ? 26.027  84.010  23.949 1.00 114.56 ? 945  ALA C CA  1 
ATOM   2434 C C   . ALA C 1 54  ? 25.982  83.139  25.180 1.00 113.35 ? 945  ALA C C   1 
ATOM   2435 O O   . ALA C 1 54  ? 24.945  82.640  25.537 1.00 113.46 ? 945  ALA C O   1 
ATOM   2436 C CB  . ALA C 1 54  ? 25.879  85.443  24.393 1.00 116.79 ? 945  ALA C CB  1 
ATOM   2437 N N   . PRO C 1 55  ? 27.151  82.942  25.818 1.00 113.40 ? 946  PRO C N   1 
ATOM   2438 C CA  . PRO C 1 55  ? 27.421  82.166  27.029 1.00 113.90 ? 946  PRO C CA  1 
ATOM   2439 C C   . PRO C 1 55  ? 27.167  82.981  28.301 1.00 115.25 ? 946  PRO C C   1 
ATOM   2440 O O   . PRO C 1 55  ? 26.826  84.163  28.234 1.00 115.74 ? 946  PRO C O   1 
ATOM   2441 C CB  . PRO C 1 55  ? 28.888  81.771  26.829 1.00 113.42 ? 946  PRO C CB  1 
ATOM   2442 C CG  . PRO C 1 55  ? 29.438  83.008  26.223 1.00 113.61 ? 946  PRO C CG  1 
ATOM   2443 C CD  . PRO C 1 55  ? 28.418  83.326  25.168 1.00 114.33 ? 946  PRO C CD  1 
ATOM   2444 N N   . PRO C 1 56  ? 27.356  82.363  29.474 1.00 116.97 ? 947  PRO C N   1 
ATOM   2445 C CA  . PRO C 1 56  ? 27.158  82.995  30.787 1.00 119.52 ? 947  PRO C CA  1 
ATOM   2446 C C   . PRO C 1 56  ? 27.861  84.337  31.045 1.00 122.55 ? 947  PRO C C   1 
ATOM   2447 O O   . PRO C 1 56  ? 27.545  85.035  32.005 1.00 121.50 ? 947  PRO C O   1 
ATOM   2448 C CB  . PRO C 1 56  ? 27.615  81.906  31.747 1.00 119.17 ? 947  PRO C CB  1 
ATOM   2449 C CG  . PRO C 1 56  ? 27.094  80.675  31.046 1.00 118.71 ? 947  PRO C CG  1 
ATOM   2450 C CD  . PRO C 1 56  ? 27.575  80.913  29.629 1.00 116.57 ? 947  PRO C CD  1 
ATOM   2451 N N   . GLU C 1 57  ? 28.842  84.678  30.218 1.00 126.35 ? 948  GLU C N   1 
ATOM   2452 C CA  . GLU C 1 57  ? 29.560  85.941  30.369 1.00 129.76 ? 948  GLU C CA  1 
ATOM   2453 C C   . GLU C 1 57  ? 28.773  87.013  29.650 1.00 131.02 ? 948  GLU C C   1 
ATOM   2454 O O   . GLU C 1 57  ? 29.207  88.166  29.582 1.00 132.64 ? 948  GLU C O   1 
ATOM   2455 C CB  . GLU C 1 57  ? 30.959  85.878  29.745 1.00 131.05 ? 948  GLU C CB  1 
ATOM   2456 C CG  . GLU C 1 57  ? 31.930  84.980  30.456 1.00 131.92 ? 948  GLU C CG  1 
ATOM   2457 C CD  . GLU C 1 57  ? 32.562  84.005  29.498 1.00 133.20 ? 948  GLU C CD  1 
ATOM   2458 O OE1 . GLU C 1 57  ? 33.720  84.215  29.089 1.00 134.32 ? 948  GLU C OE1 1 
ATOM   2459 O OE2 . GLU C 1 57  ? 31.877  83.031  29.130 1.00 134.43 ? 948  GLU C OE2 1 
ATOM   2460 N N   . GLU C 1 58  ? 27.613  86.646  29.116 1.00 131.59 ? 949  GLU C N   1 
ATOM   2461 C CA  . GLU C 1 58  ? 26.825  87.623  28.404 1.00 131.04 ? 949  GLU C CA  1 
ATOM   2462 C C   . GLU C 1 58  ? 25.349  87.688  28.751 1.00 129.47 ? 949  GLU C C   1 
ATOM   2463 O O   . GLU C 1 58  ? 24.725  88.711  28.483 1.00 128.78 ? 949  GLU C O   1 
ATOM   2464 C CB  . GLU C 1 58  ? 27.073  87.453  26.907 1.00 131.20 ? 949  GLU C CB  1 
ATOM   2465 C CG  . GLU C 1 58  ? 28.560  87.629  26.621 1.00 132.15 ? 949  GLU C CG  1 
ATOM   2466 C CD  . GLU C 1 58  ? 28.964  87.212  25.238 1.00 133.97 ? 949  GLU C CD  1 
ATOM   2467 O OE1 . GLU C 1 58  ? 28.217  87.499  24.278 1.00 133.03 ? 949  GLU C OE1 1 
ATOM   2468 O OE2 . GLU C 1 58  ? 30.047  86.608  25.110 1.00 135.45 ? 949  GLU C OE2 1 
ATOM   2469 N N   . TYR C 1 59  ? 24.770  86.641  29.337 1.00 127.28 ? 950  TYR C N   1 
ATOM   2470 C CA  . TYR C 1 59  ? 23.376  86.790  29.711 1.00 123.22 ? 950  TYR C CA  1 
ATOM   2471 C C   . TYR C 1 59  ? 23.275  87.237  31.165 1.00 121.10 ? 950  TYR C C   1 
ATOM   2472 O O   . TYR C 1 59  ? 22.403  88.044  31.511 1.00 121.72 ? 950  TYR C O   1 
ATOM   2473 C CB  . TYR C 1 59  ? 22.504  85.535  29.413 1.00 121.67 ? 950  TYR C CB  1 
ATOM   2474 C CG  . TYR C 1 59  ? 23.047  84.144  29.690 1.00 119.20 ? 950  TYR C CG  1 
ATOM   2475 C CD1 . TYR C 1 59  ? 23.271  83.684  30.990 1.00 118.78 ? 950  TYR C CD1 1 
ATOM   2476 C CD2 . TYR C 1 59  ? 23.253  83.251  28.638 1.00 118.03 ? 950  TYR C CD2 1 
ATOM   2477 C CE1 . TYR C 1 59  ? 23.681  82.356  31.228 1.00 118.32 ? 950  TYR C CE1 1 
ATOM   2478 C CE2 . TYR C 1 59  ? 23.659  81.932  28.862 1.00 116.97 ? 950  TYR C CE2 1 
ATOM   2479 C CZ  . TYR C 1 59  ? 23.878  81.490  30.153 1.00 118.32 ? 950  TYR C CZ  1 
ATOM   2480 O OH  . TYR C 1 59  ? 24.306  80.191  30.352 1.00 118.35 ? 950  TYR C OH  1 
ATOM   2481 N N   . VAL C 1 60  ? 24.184  86.762  32.011 1.00 117.70 ? 951  VAL C N   1 
ATOM   2482 C CA  . VAL C 1 60  ? 24.151  87.158  33.405 1.00 117.61 ? 951  VAL C CA  1 
ATOM   2483 C C   . VAL C 1 60  ? 24.018  88.678  33.599 1.00 119.37 ? 951  VAL C C   1 
ATOM   2484 O O   . VAL C 1 60  ? 23.397  89.116  34.569 1.00 120.81 ? 951  VAL C O   1 
ATOM   2485 C CB  . VAL C 1 60  ? 25.370  86.635  34.151 1.00 116.57 ? 951  VAL C CB  1 
ATOM   2486 C CG1 . VAL C 1 60  ? 25.317  87.075  35.601 1.00 113.73 ? 951  VAL C CG1 1 
ATOM   2487 C CG2 . VAL C 1 60  ? 25.402  85.117  34.065 1.00 117.35 ? 951  VAL C CG2 1 
ATOM   2488 N N   . PRO C 1 61  ? 24.610  89.505  32.702 1.00 120.04 ? 952  PRO C N   1 
ATOM   2489 C CA  . PRO C 1 61  ? 24.419  90.949  32.932 1.00 118.89 ? 952  PRO C CA  1 
ATOM   2490 C C   . PRO C 1 61  ? 23.102  91.296  32.246 1.00 116.63 ? 952  PRO C C   1 
ATOM   2491 O O   . PRO C 1 61  ? 22.266  92.001  32.795 1.00 115.84 ? 952  PRO C O   1 
ATOM   2492 C CB  . PRO C 1 61  ? 25.587  91.614  32.186 1.00 119.68 ? 952  PRO C CB  1 
ATOM   2493 C CG  . PRO C 1 61  ? 26.537  90.490  31.897 1.00 119.54 ? 952  PRO C CG  1 
ATOM   2494 C CD  . PRO C 1 61  ? 25.653  89.284  31.686 1.00 120.94 ? 952  PRO C CD  1 
ATOM   2495 N N   . MET C 1 62  ? 22.955  90.807  31.014 1.00 114.94 ? 953  MET C N   1 
ATOM   2496 C CA  . MET C 1 62  ? 21.751  91.030  30.212 1.00 113.59 ? 953  MET C CA  1 
ATOM   2497 C C   . MET C 1 62  ? 20.558  90.916  31.154 1.00 110.28 ? 953  MET C C   1 
ATOM   2498 O O   . MET C 1 62  ? 19.532  91.547  30.938 1.00 110.65 ? 953  MET C O   1 
ATOM   2499 C CB  . MET C 1 62  ? 21.618  89.978  29.090 1.00 117.41 ? 953  MET C CB  1 
ATOM   2500 C CG  . MET C 1 62  ? 22.099  90.416  27.693 1.00 122.08 ? 953  MET C CG  1 
ATOM   2501 S SD  . MET C 1 62  ? 21.579  89.236  26.379 1.00 129.32 ? 953  MET C SD  1 
ATOM   2502 C CE  . MET C 1 62  ? 23.108  88.334  26.010 1.00 127.82 ? 953  MET C CE  1 
ATOM   2503 N N   . VAL C 1 63  ? 20.718  90.112  32.205 1.00 105.78 ? 954  VAL C N   1 
ATOM   2504 C CA  . VAL C 1 63  ? 19.689  89.894  33.214 1.00 100.88 ? 954  VAL C CA  1 
ATOM   2505 C C   . VAL C 1 63  ? 19.774  90.996  34.257 1.00 101.82 ? 954  VAL C C   1 
ATOM   2506 O O   . VAL C 1 63  ? 18.775  91.648  34.556 1.00 100.72 ? 954  VAL C O   1 
ATOM   2507 C CB  . VAL C 1 63  ? 19.867  88.526  33.911 1.00 98.03  ? 954  VAL C CB  1 
ATOM   2508 C CG1 . VAL C 1 63  ? 19.083  88.487  35.209 1.00 94.18  ? 954  VAL C CG1 1 
ATOM   2509 C CG2 . VAL C 1 63  ? 19.403  87.419  32.984 1.00 93.65  ? 954  VAL C CG2 1 
ATOM   2510 N N   . LYS C 1 64  ? 20.968  91.194  34.815 1.00 102.73 ? 955  LYS C N   1 
ATOM   2511 C CA  . LYS C 1 64  ? 21.184  92.236  35.821 1.00 103.06 ? 955  LYS C CA  1 
ATOM   2512 C C   . LYS C 1 64  ? 20.620  93.560  35.273 1.00 100.68 ? 955  LYS C C   1 
ATOM   2513 O O   . LYS C 1 64  ? 20.091  94.387  36.020 1.00 97.39  ? 955  LYS C O   1 
ATOM   2514 C CB  . LYS C 1 64  ? 22.688  92.365  36.134 1.00 104.87 ? 955  LYS C CB  1 
ATOM   2515 C CG  . LYS C 1 64  ? 23.046  93.495  37.092 1.00 108.07 ? 955  LYS C CG  1 
ATOM   2516 C CD  . LYS C 1 64  ? 22.581  93.254  38.522 1.00 111.78 ? 955  LYS C CD  1 
ATOM   2517 C CE  . LYS C 1 64  ? 22.549  94.580  39.272 1.00 116.23 ? 955  LYS C CE  1 
ATOM   2518 N NZ  . LYS C 1 64  ? 22.625  94.425  40.750 1.00 119.29 ? 955  LYS C NZ  1 
ATOM   2519 N N   . GLU C 1 65  ? 20.746  93.751  33.962 1.00 98.98  ? 956  GLU C N   1 
ATOM   2520 C CA  . GLU C 1 65  ? 20.227  94.936  33.302 1.00 96.58  ? 956  GLU C CA  1 
ATOM   2521 C C   . GLU C 1 65  ? 18.711  94.958  33.527 1.00 94.10  ? 956  GLU C C   1 
ATOM   2522 O O   . GLU C 1 65  ? 18.189  95.884  34.151 1.00 95.46  ? 956  GLU C O   1 
ATOM   2523 C CB  . GLU C 1 65  ? 20.537  94.870  31.806 1.00 99.83  ? 956  GLU C CB  1 
ATOM   2524 C CG  . GLU C 1 65  ? 21.660  95.797  31.351 1.00 107.22 ? 956  GLU C CG  1 
ATOM   2525 C CD  . GLU C 1 65  ? 21.133  97.031  30.626 1.00 112.07 ? 956  GLU C CD  1 
ATOM   2526 O OE1 . GLU C 1 65  ? 20.283  96.870  29.721 1.00 113.41 ? 956  GLU C OE1 1 
ATOM   2527 O OE2 . GLU C 1 65  ? 21.569  98.159  30.949 1.00 114.62 ? 956  GLU C OE2 1 
ATOM   2528 N N   . VAL C 1 66  ? 18.013  93.938  33.020 1.00 88.49  ? 957  VAL C N   1 
ATOM   2529 C CA  . VAL C 1 66  ? 16.560  93.841  33.160 1.00 82.01  ? 957  VAL C CA  1 
ATOM   2530 C C   . VAL C 1 66  ? 16.158  94.073  34.593 1.00 81.33  ? 957  VAL C C   1 
ATOM   2531 O O   . VAL C 1 66  ? 15.163  94.729  34.854 1.00 81.11  ? 957  VAL C O   1 
ATOM   2532 C CB  . VAL C 1 66  ? 16.020  92.458  32.730 1.00 77.16  ? 957  VAL C CB  1 
ATOM   2533 C CG1 . VAL C 1 66  ? 14.694  92.183  33.415 1.00 74.21  ? 957  VAL C CG1 1 
ATOM   2534 C CG2 . VAL C 1 66  ? 15.813  92.423  31.228 1.00 75.41  ? 957  VAL C CG2 1 
ATOM   2535 N N   . GLY C 1 67  ? 16.953  93.544  35.516 1.00 82.48  ? 958  GLY C N   1 
ATOM   2536 C CA  . GLY C 1 67  ? 16.652  93.685  36.926 1.00 84.49  ? 958  GLY C CA  1 
ATOM   2537 C C   . GLY C 1 67  ? 16.887  95.067  37.479 1.00 85.83  ? 958  GLY C C   1 
ATOM   2538 O O   . GLY C 1 67  ? 16.360  95.406  38.535 1.00 87.56  ? 958  GLY C O   1 
ATOM   2539 N N   . LEU C 1 68  ? 17.723  95.850  36.805 1.00 86.39  ? 959  LEU C N   1 
ATOM   2540 C CA  . LEU C 1 68  ? 17.987  97.213  37.259 1.00 86.72  ? 959  LEU C CA  1 
ATOM   2541 C C   . LEU C 1 68  ? 16.790  98.041  36.761 1.00 82.79  ? 959  LEU C C   1 
ATOM   2542 O O   . LEU C 1 68  ? 16.155  98.798  37.501 1.00 81.06  ? 959  LEU C O   1 
ATOM   2543 C CB  . LEU C 1 68  ? 19.306  97.750  36.654 1.00 91.02  ? 959  LEU C CB  1 
ATOM   2544 C CG  . LEU C 1 68  ? 20.651  97.194  37.154 1.00 96.19  ? 959  LEU C CG  1 
ATOM   2545 C CD1 . LEU C 1 68  ? 21.740  97.448  36.094 1.00 95.13  ? 959  LEU C CD1 1 
ATOM   2546 C CD2 . LEU C 1 68  ? 21.034  97.851  38.486 1.00 94.82  ? 959  LEU C CD2 1 
ATOM   2547 N N   . ALA C 1 69  ? 16.493  97.886  35.479 1.00 78.83  ? 960  ALA C N   1 
ATOM   2548 C CA  . ALA C 1 69  ? 15.390  98.588  34.861 1.00 76.49  ? 960  ALA C CA  1 
ATOM   2549 C C   . ALA C 1 69  ? 14.097  98.347  35.638 1.00 75.88  ? 960  ALA C C   1 
ATOM   2550 O O   . ALA C 1 69  ? 13.177  99.145  35.569 1.00 81.18  ? 960  ALA C O   1 
ATOM   2551 C CB  . ALA C 1 69  ? 15.240  98.127  33.434 1.00 73.23  ? 960  ALA C CB  1 
ATOM   2552 N N   . LEU C 1 70  ? 14.024  97.260  36.392 1.00 72.79  ? 961  LEU C N   1 
ATOM   2553 C CA  . LEU C 1 70  ? 12.819  96.964  37.154 1.00 72.55  ? 961  LEU C CA  1 
ATOM   2554 C C   . LEU C 1 70  ? 12.850  97.682  38.492 1.00 76.13  ? 961  LEU C C   1 
ATOM   2555 O O   . LEU C 1 70  ? 11.823  98.170  38.976 1.00 76.39  ? 961  LEU C O   1 
ATOM   2556 C CB  . LEU C 1 70  ? 12.699  95.465  37.383 1.00 68.83  ? 961  LEU C CB  1 
ATOM   2557 C CG  . LEU C 1 70  ? 11.560  95.039  38.312 1.00 66.66  ? 961  LEU C CG  1 
ATOM   2558 C CD1 . LEU C 1 70  ? 10.189  95.340  37.700 1.00 64.11  ? 961  LEU C CD1 1 
ATOM   2559 C CD2 . LEU C 1 70  ? 11.710  93.565  38.591 1.00 65.17  ? 961  LEU C CD2 1 
ATOM   2560 N N   . ARG C 1 71  ? 14.036  97.724  39.093 1.00 78.12  ? 962  ARG C N   1 
ATOM   2561 C CA  . ARG C 1 71  ? 14.240  98.400  40.374 1.00 78.88  ? 962  ARG C CA  1 
ATOM   2562 C C   . ARG C 1 71  ? 13.709  99.813  40.209 1.00 74.60  ? 962  ARG C C   1 
ATOM   2563 O O   . ARG C 1 71  ? 12.957  100.316 41.054 1.00 71.81  ? 962  ARG C O   1 
ATOM   2564 C CB  . ARG C 1 71  ? 15.740  98.437  40.716 1.00 86.29  ? 962  ARG C CB  1 
ATOM   2565 C CG  . ARG C 1 71  ? 16.106  99.223  41.967 1.00 94.48  ? 962  ARG C CG  1 
ATOM   2566 C CD  . ARG C 1 71  ? 17.605  99.127  42.272 1.00 102.24 ? 962  ARG C CD  1 
ATOM   2567 N NE  . ARG C 1 71  ? 17.846  99.367  43.694 1.00 113.22 ? 962  ARG C NE  1 
ATOM   2568 C CZ  . ARG C 1 71  ? 19.043  99.437  44.271 1.00 116.26 ? 962  ARG C CZ  1 
ATOM   2569 N NH1 . ARG C 1 71  ? 20.145  99.288  43.546 1.00 117.32 ? 962  ARG C NH1 1 
ATOM   2570 N NH2 . ARG C 1 71  ? 19.134  99.654  45.581 1.00 116.46 ? 962  ARG C NH2 1 
ATOM   2571 N N   . THR C 1 72  ? 14.113  100.442 39.104 1.00 70.01  ? 963  THR C N   1 
ATOM   2572 C CA  . THR C 1 72  ? 13.683  101.808 38.787 1.00 67.32  ? 963  THR C CA  1 
ATOM   2573 C C   . THR C 1 72  ? 12.173  101.892 38.742 1.00 66.97  ? 963  THR C C   1 
ATOM   2574 O O   . THR C 1 72  ? 11.569  102.580 39.547 1.00 67.84  ? 963  THR C O   1 
ATOM   2575 C CB  . THR C 1 72  ? 14.171  102.311 37.404 1.00 64.85  ? 963  THR C CB  1 
ATOM   2576 O OG1 . THR C 1 72  ? 15.597  102.376 37.375 1.00 62.97  ? 963  THR C OG1 1 
ATOM   2577 C CG2 . THR C 1 72  ? 13.628  103.692 37.136 1.00 61.34  ? 963  THR C CG2 1 
ATOM   2578 N N   . LEU C 1 73  ? 11.573  101.191 37.785 1.00 66.40  ? 964  LEU C N   1 
ATOM   2579 C CA  . LEU C 1 73  ? 10.127  101.202 37.632 1.00 66.91  ? 964  LEU C CA  1 
ATOM   2580 C C   . LEU C 1 73  ? 9.413   101.019 38.948 1.00 68.38  ? 964  LEU C C   1 
ATOM   2581 O O   . LEU C 1 73  ? 8.424   101.692 39.220 1.00 68.27  ? 964  LEU C O   1 
ATOM   2582 C CB  . LEU C 1 73  ? 9.656   100.115 36.667 1.00 64.63  ? 964  LEU C CB  1 
ATOM   2583 C CG  . LEU C 1 73  ? 8.120   100.027 36.679 1.00 60.23  ? 964  LEU C CG  1 
ATOM   2584 C CD1 . LEU C 1 73  ? 7.544   101.340 36.195 1.00 53.06  ? 964  LEU C CD1 1 
ATOM   2585 C CD2 . LEU C 1 73  ? 7.611   98.876  35.830 1.00 56.72  ? 964  LEU C CD2 1 
ATOM   2586 N N   . LEU C 1 74  ? 9.906   100.111 39.772 1.00 71.41  ? 965  LEU C N   1 
ATOM   2587 C CA  . LEU C 1 74  ? 9.257   99.898  41.048 1.00 75.23  ? 965  LEU C CA  1 
ATOM   2588 C C   . LEU C 1 74  ? 9.380   101.133 41.942 1.00 75.89  ? 965  LEU C C   1 
ATOM   2589 O O   . LEU C 1 74  ? 8.426   101.487 42.654 1.00 73.85  ? 965  LEU C O   1 
ATOM   2590 C CB  . LEU C 1 74  ? 9.810   98.630  41.719 1.00 75.06  ? 965  LEU C CB  1 
ATOM   2591 C CG  . LEU C 1 74  ? 9.134   97.377  41.152 1.00 76.45  ? 965  LEU C CG  1 
ATOM   2592 C CD1 . LEU C 1 74  ? 9.794   96.131  41.689 1.00 80.19  ? 965  LEU C CD1 1 
ATOM   2593 C CD2 . LEU C 1 74  ? 7.646   97.411  41.510 1.00 72.65  ? 965  LEU C CD2 1 
ATOM   2594 N N   . ALA C 1 75  ? 10.538  101.795 41.895 1.00 76.67  ? 966  ALA C N   1 
ATOM   2595 C CA  . ALA C 1 75  ? 10.742  103.004 42.702 1.00 76.30  ? 966  ALA C CA  1 
ATOM   2596 C C   . ALA C 1 75  ? 9.755   104.072 42.232 1.00 75.72  ? 966  ALA C C   1 
ATOM   2597 O O   . ALA C 1 75  ? 8.940   104.582 43.014 1.00 76.65  ? 966  ALA C O   1 
ATOM   2598 C CB  . ALA C 1 75  ? 12.181  103.527 42.556 1.00 74.43  ? 966  ALA C CB  1 
ATOM   2599 N N   . THR C 1 76  ? 9.852   104.418 40.949 1.00 73.14  ? 967  THR C N   1 
ATOM   2600 C CA  . THR C 1 76  ? 8.963   105.399 40.360 1.00 68.64  ? 967  THR C CA  1 
ATOM   2601 C C   . THR C 1 76  ? 7.527   105.095 40.721 1.00 69.05  ? 967  THR C C   1 
ATOM   2602 O O   . THR C 1 76  ? 6.763   106.017 40.970 1.00 71.16  ? 967  THR C O   1 
ATOM   2603 C CB  . THR C 1 76  ? 9.082   105.429 38.849 1.00 67.52  ? 967  THR C CB  1 
ATOM   2604 O OG1 . THR C 1 76  ? 10.264  106.147 38.495 1.00 71.73  ? 967  THR C OG1 1 
ATOM   2605 C CG2 . THR C 1 76  ? 7.887   106.110 38.224 1.00 67.66  ? 967  THR C CG2 1 
ATOM   2606 N N   . VAL C 1 77  ? 7.140   103.823 40.767 1.00 69.87  ? 968  VAL C N   1 
ATOM   2607 C CA  . VAL C 1 77  ? 5.757   103.533 41.122 1.00 70.14  ? 968  VAL C CA  1 
ATOM   2608 C C   . VAL C 1 77  ? 5.563   103.812 42.594 1.00 71.51  ? 968  VAL C C   1 
ATOM   2609 O O   . VAL C 1 77  ? 4.473   104.181 42.998 1.00 71.92  ? 968  VAL C O   1 
ATOM   2610 C CB  . VAL C 1 77  ? 5.329   102.083 40.822 1.00 67.54  ? 968  VAL C CB  1 
ATOM   2611 C CG1 . VAL C 1 77  ? 3.939   101.832 41.397 1.00 63.17  ? 968  VAL C CG1 1 
ATOM   2612 C CG2 . VAL C 1 77  ? 5.286   101.852 39.329 1.00 63.89  ? 968  VAL C CG2 1 
ATOM   2613 N N   . ASP C 1 78  ? 6.602   103.646 43.406 1.00 74.32  ? 969  ASP C N   1 
ATOM   2614 C CA  . ASP C 1 78  ? 6.435   103.957 44.816 1.00 79.05  ? 969  ASP C CA  1 
ATOM   2615 C C   . ASP C 1 78  ? 6.146   105.457 44.932 1.00 81.44  ? 969  ASP C C   1 
ATOM   2616 O O   . ASP C 1 78  ? 5.135   105.853 45.526 1.00 82.31  ? 969  ASP C O   1 
ATOM   2617 C CB  . ASP C 1 78  ? 7.682   103.573 45.622 1.00 80.18  ? 969  ASP C CB  1 
ATOM   2618 C CG  . ASP C 1 78  ? 7.804   102.070 45.812 1.00 84.68  ? 969  ASP C CG  1 
ATOM   2619 O OD1 . ASP C 1 78  ? 6.751   101.387 45.884 1.00 82.49  ? 969  ASP C OD1 1 
ATOM   2620 O OD2 . ASP C 1 78  ? 8.948   101.569 45.894 1.00 85.41  ? 969  ASP C OD2 1 
ATOM   2621 N N   . GLU C 1 79  ? 7.021   106.288 44.364 1.00 80.61  ? 970  GLU C N   1 
ATOM   2622 C CA  . GLU C 1 79  ? 6.834   107.739 44.403 1.00 80.90  ? 970  GLU C CA  1 
ATOM   2623 C C   . GLU C 1 79  ? 5.530   108.192 43.750 1.00 80.10  ? 970  GLU C C   1 
ATOM   2624 O O   . GLU C 1 79  ? 5.162   109.358 43.851 1.00 81.52  ? 970  GLU C O   1 
ATOM   2625 C CB  . GLU C 1 79  ? 7.980   108.466 43.697 1.00 81.08  ? 970  GLU C CB  1 
ATOM   2626 C CG  . GLU C 1 79  ? 9.313   108.421 44.402 1.00 89.54  ? 970  GLU C CG  1 
ATOM   2627 C CD  . GLU C 1 79  ? 10.417  108.963 43.521 1.00 96.81  ? 970  GLU C CD  1 
ATOM   2628 O OE1 . GLU C 1 79  ? 10.463  108.542 42.348 1.00 99.64  ? 970  GLU C OE1 1 
ATOM   2629 O OE2 . GLU C 1 79  ? 11.233  109.793 43.983 1.00 101.70 ? 970  GLU C OE2 1 
ATOM   2630 N N   . THR C 1 80  ? 4.819   107.279 43.103 1.00 78.71  ? 971  THR C N   1 
ATOM   2631 C CA  . THR C 1 80  ? 3.591   107.642 42.414 1.00 78.44  ? 971  THR C CA  1 
ATOM   2632 C C   . THR C 1 80  ? 2.266   107.225 43.086 1.00 81.71  ? 971  THR C C   1 
ATOM   2633 O O   . THR C 1 80  ? 1.238   107.864 42.875 1.00 80.61  ? 971  THR C O   1 
ATOM   2634 C CB  . THR C 1 80  ? 3.659   107.124 40.937 1.00 76.91  ? 971  THR C CB  1 
ATOM   2635 O OG1 . THR C 1 80  ? 4.792   107.715 40.276 1.00 63.91  ? 971  THR C OG1 1 
ATOM   2636 C CG2 . THR C 1 80  ? 2.407   107.482 40.182 1.00 73.11  ? 971  THR C CG2 1 
ATOM   2637 N N   . ILE C 1 81  ? 2.296   106.182 43.912 1.00 85.32  ? 972  ILE C N   1 
ATOM   2638 C CA  . ILE C 1 81  ? 1.094   105.678 44.603 1.00 89.10  ? 972  ILE C CA  1 
ATOM   2639 C C   . ILE C 1 81  ? 0.453   106.626 45.628 1.00 91.13  ? 972  ILE C C   1 
ATOM   2640 O O   . ILE C 1 81  ? -0.776  106.762 45.678 1.00 89.50  ? 972  ILE C O   1 
ATOM   2641 C CB  . ILE C 1 81  ? 1.388   104.350 45.355 1.00 90.15  ? 972  ILE C CB  1 
ATOM   2642 C CG1 . ILE C 1 81  ? 1.974   103.323 44.400 1.00 88.22  ? 972  ILE C CG1 1 
ATOM   2643 C CG2 . ILE C 1 81  ? 0.120   103.786 45.961 1.00 89.19  ? 972  ILE C CG2 1 
ATOM   2644 C CD1 . ILE C 1 81  ? 3.292   102.765 44.895 1.00 88.35  ? 972  ILE C CD1 1 
ATOM   2645 N N   . PRO C 1 82  ? 1.281   107.277 46.471 1.00 92.79  ? 973  PRO C N   1 
ATOM   2646 C CA  . PRO C 1 82  ? 0.792   108.204 47.508 1.00 92.81  ? 973  PRO C CA  1 
ATOM   2647 C C   . PRO C 1 82  ? -0.313  109.116 46.980 1.00 93.13  ? 973  PRO C C   1 
ATOM   2648 O O   . PRO C 1 82  ? -1.393  109.284 47.573 1.00 93.71  ? 973  PRO C O   1 
ATOM   2649 C CB  . PRO C 1 82  ? 2.020   109.071 47.838 1.00 92.11  ? 973  PRO C CB  1 
ATOM   2650 C CG  . PRO C 1 82  ? 3.177   108.282 47.351 1.00 89.53  ? 973  PRO C CG  1 
ATOM   2651 C CD  . PRO C 1 82  ? 2.679   107.599 46.122 1.00 91.96  ? 973  PRO C CD  1 
ATOM   2652 N N   . LEU C 1 83  ? 0.032   109.747 45.867 1.00 89.71  ? 974  LEU C N   1 
ATOM   2653 C CA  . LEU C 1 83  ? -0.810  110.711 45.186 1.00 87.97  ? 974  LEU C CA  1 
ATOM   2654 C C   . LEU C 1 83  ? -2.150  110.204 44.605 1.00 84.93  ? 974  LEU C C   1 
ATOM   2655 O O   . LEU C 1 83  ? -3.081  110.975 44.386 1.00 84.74  ? 974  LEU C O   1 
ATOM   2656 C CB  . LEU C 1 83  ? 0.021   111.344 44.082 1.00 90.03  ? 974  LEU C CB  1 
ATOM   2657 C CG  . LEU C 1 83  ? -0.717  111.533 42.766 1.00 93.13  ? 974  LEU C CG  1 
ATOM   2658 C CD1 . LEU C 1 83  ? -1.278  112.921 42.743 1.00 95.80  ? 974  LEU C CD1 1 
ATOM   2659 C CD2 . LEU C 1 83  ? 0.218   111.296 41.595 1.00 95.97  ? 974  LEU C CD2 1 
ATOM   2660 N N   . LEU C 1 84  ? -2.250  108.918 44.331 1.00 81.30  ? 975  LEU C N   1 
ATOM   2661 C CA  . LEU C 1 84  ? -3.471  108.356 43.775 1.00 81.00  ? 975  LEU C CA  1 
ATOM   2662 C C   . LEU C 1 84  ? -4.495  108.145 44.870 1.00 78.64  ? 975  LEU C C   1 
ATOM   2663 O O   . LEU C 1 84  ? -4.208  108.385 46.035 1.00 80.25  ? 975  LEU C O   1 
ATOM   2664 C CB  . LEU C 1 84  ? -3.105  107.034 43.116 1.00 86.49  ? 975  LEU C CB  1 
ATOM   2665 C CG  . LEU C 1 84  ? -2.246  107.264 41.869 1.00 91.21  ? 975  LEU C CG  1 
ATOM   2666 C CD1 . LEU C 1 84  ? -1.222  106.159 41.720 1.00 91.16  ? 975  LEU C CD1 1 
ATOM   2667 C CD2 . LEU C 1 84  ? -3.159  107.376 40.643 1.00 91.18  ? 975  LEU C CD2 1 
ATOM   2668 N N   . PRO C 1 85  ? -5.707  107.722 44.503 1.00 77.51  ? 976  PRO C N   1 
ATOM   2669 C CA  . PRO C 1 85  ? -6.776  107.452 45.464 1.00 81.81  ? 976  PRO C CA  1 
ATOM   2670 C C   . PRO C 1 85  ? -6.274  106.392 46.431 1.00 87.68  ? 976  PRO C C   1 
ATOM   2671 O O   . PRO C 1 85  ? -5.632  105.434 46.022 1.00 92.52  ? 976  PRO C O   1 
ATOM   2672 C CB  . PRO C 1 85  ? -7.877  106.890 44.605 1.00 78.83  ? 976  PRO C CB  1 
ATOM   2673 C CG  . PRO C 1 85  ? -7.734  107.635 43.343 1.00 76.57  ? 976  PRO C CG  1 
ATOM   2674 C CD  . PRO C 1 85  ? -6.231  107.748 43.131 1.00 77.20  ? 976  PRO C CD  1 
ATOM   2675 N N   . ALA C 1 86  ? -6.575  106.539 47.711 1.00 91.61  ? 977  ALA C N   1 
ATOM   2676 C CA  . ALA C 1 86  ? -6.107  105.562 48.680 1.00 92.40  ? 977  ALA C CA  1 
ATOM   2677 C C   . ALA C 1 86  ? -6.611  104.176 48.293 1.00 93.03  ? 977  ALA C C   1 
ATOM   2678 O O   . ALA C 1 86  ? -5.817  103.235 48.214 1.00 92.52  ? 977  ALA C O   1 
ATOM   2679 C CB  . ALA C 1 86  ? -6.564  105.946 50.082 1.00 94.20  ? 977  ALA C CB  1 
ATOM   2680 N N   . SER C 1 87  ? -7.911  104.091 47.981 1.00 91.38  ? 978  SER C N   1 
ATOM   2681 C CA  . SER C 1 87  ? -8.597  102.860 47.617 1.00 91.83  ? 978  SER C CA  1 
ATOM   2682 C C   . SER C 1 87  ? -7.996  102.005 46.497 1.00 94.56  ? 978  SER C C   1 
ATOM   2683 O O   . SER C 1 87  ? -8.227  100.805 46.463 1.00 97.97  ? 978  SER C O   1 
ATOM   2684 C CB  . SER C 1 87  ? -10.057 103.178 47.305 1.00 90.90  ? 978  SER C CB  1 
ATOM   2685 O OG  . SER C 1 87  ? -10.282 103.172 45.922 1.00 90.34  ? 978  SER C OG  1 
ATOM   2686 N N   . THR C 1 88  ? -7.223  102.595 45.589 1.00 95.36  ? 979  THR C N   1 
ATOM   2687 C CA  . THR C 1 88  ? -6.628  101.819 44.490 1.00 93.73  ? 979  THR C CA  1 
ATOM   2688 C C   . THR C 1 88  ? -5.174  101.411 44.743 1.00 94.28  ? 979  THR C C   1 
ATOM   2689 O O   . THR C 1 88  ? -4.512  100.847 43.868 1.00 97.77  ? 979  THR C O   1 
ATOM   2690 C CB  . THR C 1 88  ? -6.618  102.617 43.195 1.00 91.74  ? 979  THR C CB  1 
ATOM   2691 O OG1 . THR C 1 88  ? -5.873  103.821 43.409 1.00 88.84  ? 979  THR C OG1 1 
ATOM   2692 C CG2 . THR C 1 88  ? -8.028  102.948 42.727 1.00 89.55  ? 979  THR C CG2 1 
ATOM   2693 N N   . HIS C 1 89  ? -4.687  101.696 45.942 1.00 93.36  ? 980  HIS C N   1 
ATOM   2694 C CA  . HIS C 1 89  ? -3.314  101.390 46.305 1.00 93.26  ? 980  HIS C CA  1 
ATOM   2695 C C   . HIS C 1 89  ? -2.976  99.907  46.422 1.00 91.89  ? 980  HIS C C   1 
ATOM   2696 O O   . HIS C 1 89  ? -1.825  99.524  46.230 1.00 90.63  ? 980  HIS C O   1 
ATOM   2697 C CB  . HIS C 1 89  ? -2.953  102.086 47.619 1.00 100.40 ? 980  HIS C CB  1 
ATOM   2698 C CG  . HIS C 1 89  ? -2.785  103.564 47.497 1.00 103.01 ? 980  HIS C CG  1 
ATOM   2699 N ND1 . HIS C 1 89  ? -1.914  104.285 48.291 1.00 106.26 ? 980  HIS C ND1 1 
ATOM   2700 C CD2 . HIS C 1 89  ? -3.380  104.469 46.687 1.00 103.37 ? 980  HIS C CD2 1 
ATOM   2701 C CE1 . HIS C 1 89  ? -1.984  105.563 47.974 1.00 105.95 ? 980  HIS C CE1 1 
ATOM   2702 N NE2 . HIS C 1 89  ? -2.871  105.700 47.000 1.00 104.06 ? 980  HIS C NE2 1 
ATOM   2703 N N   . ARG C 1 90  ? -3.974  99.083  46.731 1.00 89.80  ? 981  ARG C N   1 
ATOM   2704 C CA  . ARG C 1 90  ? -3.795  97.640  46.894 1.00 88.98  ? 981  ARG C CA  1 
ATOM   2705 C C   . ARG C 1 90  ? -3.515  96.919  45.545 1.00 89.93  ? 981  ARG C C   1 
ATOM   2706 O O   . ARG C 1 90  ? -2.524  96.186  45.440 1.00 91.67  ? 981  ARG C O   1 
ATOM   2707 C CB  . ARG C 1 90  ? -5.050  97.093  47.616 1.00 87.47  ? 981  ARG C CB  1 
ATOM   2708 C CG  . ARG C 1 90  ? -4.938  95.788  48.435 1.00 80.89  ? 981  ARG C CG  1 
ATOM   2709 C CD  . ARG C 1 90  ? -3.678  95.620  49.281 1.00 83.06  ? 981  ARG C CD  1 
ATOM   2710 N NE  . ARG C 1 90  ? -3.384  94.183  49.337 1.00 86.34  ? 981  ARG C NE  1 
ATOM   2711 C CZ  . ARG C 1 90  ? -2.866  93.514  50.370 1.00 87.77  ? 981  ARG C CZ  1 
ATOM   2712 N NH1 . ARG C 1 90  ? -2.548  94.126  51.507 1.00 85.64  ? 981  ARG C NH1 1 
ATOM   2713 N NH2 . ARG C 1 90  ? -2.695  92.200  50.270 1.00 89.10  ? 981  ARG C NH2 1 
ATOM   2714 N N   . GLU C 1 91  ? -4.354  97.127  44.520 1.00 87.68  ? 982  GLU C N   1 
ATOM   2715 C CA  . GLU C 1 91  ? -4.146  96.482  43.205 1.00 82.89  ? 982  GLU C CA  1 
ATOM   2716 C C   . GLU C 1 91  ? -2.754  96.850  42.640 1.00 77.45  ? 982  GLU C C   1 
ATOM   2717 O O   . GLU C 1 91  ? -2.073  96.025  42.044 1.00 75.63  ? 982  GLU C O   1 
ATOM   2718 C CB  . GLU C 1 91  ? -5.255  96.885  42.206 1.00 81.24  ? 982  GLU C CB  1 
ATOM   2719 C CG  . GLU C 1 91  ? -5.671  95.752  41.242 1.00 86.68  ? 982  GLU C CG  1 
ATOM   2720 C CD  . GLU C 1 91  ? -6.859  96.127  40.357 1.00 91.92  ? 982  GLU C CD  1 
ATOM   2721 O OE1 . GLU C 1 91  ? -7.845  96.675  40.896 1.00 93.52  ? 982  GLU C OE1 1 
ATOM   2722 O OE2 . GLU C 1 91  ? -6.816  95.871  39.128 1.00 93.09  ? 982  GLU C OE2 1 
ATOM   2723 N N   . ILE C 1 92  ? -2.324  98.082  42.872 1.00 70.34  ? 983  ILE C N   1 
ATOM   2724 C CA  . ILE C 1 92  ? -1.034  98.545  42.403 1.00 70.71  ? 983  ILE C CA  1 
ATOM   2725 C C   . ILE C 1 92  ? 0.101   97.955  43.225 1.00 74.84  ? 983  ILE C C   1 
ATOM   2726 O O   . ILE C 1 92  ? 1.181   97.732  42.692 1.00 77.61  ? 983  ILE C O   1 
ATOM   2727 C CB  . ILE C 1 92  ? -0.912  100.079 42.507 1.00 69.07  ? 983  ILE C CB  1 
ATOM   2728 C CG1 . ILE C 1 92  ? -2.045  100.751 41.736 1.00 67.07  ? 983  ILE C CG1 1 
ATOM   2729 C CG2 . ILE C 1 92  ? 0.457   100.539 42.003 1.00 59.56  ? 983  ILE C CG2 1 
ATOM   2730 C CD1 . ILE C 1 92  ? -1.982  102.252 41.770 1.00 63.45  ? 983  ILE C CD1 1 
ATOM   2731 N N   . GLU C 1 93  ? -0.122  97.718  44.517 1.00 75.91  ? 984  GLU C N   1 
ATOM   2732 C CA  . GLU C 1 93  ? 0.934   97.164  45.363 1.00 78.63  ? 984  GLU C CA  1 
ATOM   2733 C C   . GLU C 1 93  ? 1.121   95.688  44.983 1.00 77.71  ? 984  GLU C C   1 
ATOM   2734 O O   . GLU C 1 93  ? 2.242   95.156  44.973 1.00 74.65  ? 984  GLU C O   1 
ATOM   2735 C CB  . GLU C 1 93  ? 0.562   97.330  46.852 1.00 85.04  ? 984  GLU C CB  1 
ATOM   2736 C CG  . GLU C 1 93  ? 1.539   98.238  47.645 1.00 93.51  ? 984  GLU C CG  1 
ATOM   2737 C CD  . GLU C 1 93  ? 0.845   99.358  48.452 1.00 100.08 ? 984  GLU C CD  1 
ATOM   2738 O OE1 . GLU C 1 93  ? -0.019  99.069  49.319 1.00 105.44 ? 984  GLU C OE1 1 
ATOM   2739 O OE2 . GLU C 1 93  ? 1.170   100.545 48.220 1.00 99.12  ? 984  GLU C OE2 1 
ATOM   2740 N N   . MET C 1 94  ? 0.004   95.040  44.664 1.00 75.16  ? 985  MET C N   1 
ATOM   2741 C CA  . MET C 1 94  ? 0.008   93.648  44.255 1.00 73.78  ? 985  MET C CA  1 
ATOM   2742 C C   . MET C 1 94  ? 0.705   93.515  42.874 1.00 74.40  ? 985  MET C C   1 
ATOM   2743 O O   . MET C 1 94  ? 1.655   92.736  42.698 1.00 73.77  ? 985  MET C O   1 
ATOM   2744 C CB  . MET C 1 94  ? -1.437  93.138  44.217 1.00 72.60  ? 985  MET C CB  1 
ATOM   2745 C CG  . MET C 1 94  ? -1.759  92.102  45.317 1.00 78.25  ? 985  MET C CG  1 
ATOM   2746 S SD  . MET C 1 94  ? -1.259  92.453  47.056 1.00 83.23  ? 985  MET C SD  1 
ATOM   2747 C CE  . MET C 1 94  ? 0.577   92.669  46.934 1.00 76.01  ? 985  MET C CE  1 
ATOM   2748 N N   . ALA C 1 95  ? 0.227   94.284  41.895 1.00 71.85  ? 986  ALA C N   1 
ATOM   2749 C CA  . ALA C 1 95  ? 0.798   94.284  40.550 1.00 68.95  ? 986  ALA C CA  1 
ATOM   2750 C C   . ALA C 1 95  ? 2.320   94.410  40.636 1.00 69.07  ? 986  ALA C C   1 
ATOM   2751 O O   . ALA C 1 95  ? 3.036   93.837  39.828 1.00 70.05  ? 986  ALA C O   1 
ATOM   2752 C CB  . ALA C 1 95  ? 0.227   95.439  39.743 1.00 63.79  ? 986  ALA C CB  1 
ATOM   2753 N N   . GLN C 1 96  ? 2.805   95.171  41.612 1.00 68.46  ? 987  GLN C N   1 
ATOM   2754 C CA  . GLN C 1 96  ? 4.232   95.360  41.823 1.00 71.53  ? 987  GLN C CA  1 
ATOM   2755 C C   . GLN C 1 96  ? 4.912   94.096  42.336 1.00 73.56  ? 987  GLN C C   1 
ATOM   2756 O O   . GLN C 1 96  ? 5.956   93.692  41.820 1.00 73.72  ? 987  GLN C O   1 
ATOM   2757 C CB  . GLN C 1 96  ? 4.456   96.450  42.844 1.00 75.15  ? 987  GLN C CB  1 
ATOM   2758 C CG  . GLN C 1 96  ? 4.345   97.861  42.352 1.00 79.84  ? 987  GLN C CG  1 
ATOM   2759 C CD  . GLN C 1 96  ? 4.682   98.825  43.457 1.00 81.19  ? 987  GLN C CD  1 
ATOM   2760 O OE1 . GLN C 1 96  ? 3.912   98.969  44.408 1.00 83.98  ? 987  GLN C OE1 1 
ATOM   2761 N NE2 . GLN C 1 96  ? 5.847   99.472  43.359 1.00 76.91  ? 987  GLN C NE2 1 
ATOM   2762 N N   . LYS C 1 97  ? 4.335   93.479  43.361 1.00 73.84  ? 988  LYS C N   1 
ATOM   2763 C CA  . LYS C 1 97  ? 4.933   92.274  43.895 1.00 75.81  ? 988  LYS C CA  1 
ATOM   2764 C C   . LYS C 1 97  ? 4.974   91.206  42.811 1.00 75.18  ? 988  LYS C C   1 
ATOM   2765 O O   . LYS C 1 97  ? 5.918   90.405  42.766 1.00 78.13  ? 988  LYS C O   1 
ATOM   2766 C CB  . LYS C 1 97  ? 4.160   91.765  45.123 1.00 79.91  ? 988  LYS C CB  1 
ATOM   2767 C CG  . LYS C 1 97  ? 4.630   90.383  45.619 1.00 90.43  ? 988  LYS C CG  1 
ATOM   2768 C CD  . LYS C 1 97  ? 6.138   90.351  45.973 1.00 96.66  ? 988  LYS C CD  1 
ATOM   2769 C CE  . LYS C 1 97  ? 6.727   88.943  45.770 1.00 94.41  ? 988  LYS C CE  1 
ATOM   2770 N NZ  . LYS C 1 97  ? 7.098   88.222  47.018 1.00 98.22  ? 988  LYS C NZ  1 
ATOM   2771 N N   . LEU C 1 98  ? 3.971   91.193  41.929 1.00 69.56  ? 989  LEU C N   1 
ATOM   2772 C CA  . LEU C 1 98  ? 3.956   90.183  40.873 1.00 62.07  ? 989  LEU C CA  1 
ATOM   2773 C C   . LEU C 1 98  ? 5.200   90.311  40.009 1.00 59.82  ? 989  LEU C C   1 
ATOM   2774 O O   . LEU C 1 98  ? 5.821   89.311  39.646 1.00 58.48  ? 989  LEU C O   1 
ATOM   2775 C CB  . LEU C 1 98  ? 2.712   90.297  40.001 1.00 56.89  ? 989  LEU C CB  1 
ATOM   2776 C CG  . LEU C 1 98  ? 2.664   89.324  38.820 1.00 52.69  ? 989  LEU C CG  1 
ATOM   2777 C CD1 . LEU C 1 98  ? 2.830   87.900  39.317 1.00 52.24  ? 989  LEU C CD1 1 
ATOM   2778 C CD2 . LEU C 1 98  ? 1.353   89.490  38.081 1.00 51.69  ? 989  LEU C CD2 1 
ATOM   2779 N N   . LEU C 1 99  ? 5.569   91.543  39.685 1.00 58.16  ? 990  LEU C N   1 
ATOM   2780 C CA  . LEU C 1 99  ? 6.760   91.778  38.887 1.00 58.18  ? 990  LEU C CA  1 
ATOM   2781 C C   . LEU C 1 99  ? 8.004   91.254  39.608 1.00 59.09  ? 990  LEU C C   1 
ATOM   2782 O O   . LEU C 1 99  ? 8.955   90.816  38.960 1.00 60.73  ? 990  LEU C O   1 
ATOM   2783 C CB  . LEU C 1 99  ? 6.936   93.266  38.607 1.00 53.27  ? 990  LEU C CB  1 
ATOM   2784 C CG  . LEU C 1 99  ? 5.917   93.948  37.709 1.00 53.40  ? 990  LEU C CG  1 
ATOM   2785 C CD1 . LEU C 1 99  ? 6.285   95.411  37.589 1.00 54.23  ? 990  LEU C CD1 1 
ATOM   2786 C CD2 . LEU C 1 99  ? 5.910   93.304  36.330 1.00 57.58  ? 990  LEU C CD2 1 
ATOM   2787 N N   . ASN C 1 100 ? 7.999   91.303  40.940 1.00 60.38  ? 991  ASN C N   1 
ATOM   2788 C CA  . ASN C 1 100 ? 9.130   90.821  41.734 1.00 65.15  ? 991  ASN C CA  1 
ATOM   2789 C C   . ASN C 1 100 ? 9.396   89.341  41.574 1.00 65.50  ? 991  ASN C C   1 
ATOM   2790 O O   . ASN C 1 100 ? 10.545  88.915  41.417 1.00 63.72  ? 991  ASN C O   1 
ATOM   2791 C CB  . ASN C 1 100 ? 8.908   91.101  43.205 1.00 64.57  ? 991  ASN C CB  1 
ATOM   2792 C CG  . ASN C 1 100 ? 9.418   92.453  43.603 1.00 71.76  ? 991  ASN C CG  1 
ATOM   2793 O OD1 . ASN C 1 100 ? 10.423  92.944  43.056 1.00 70.51  ? 991  ASN C OD1 1 
ATOM   2794 N ND2 . ASN C 1 100 ? 8.749   93.067  44.577 1.00 73.55  ? 991  ASN C ND2 1 
ATOM   2795 N N   . SER C 1 101 ? 8.325   88.559  41.637 1.00 65.67  ? 992  SER C N   1 
ATOM   2796 C CA  . SER C 1 101 ? 8.430   87.123  41.489 1.00 63.92  ? 992  SER C CA  1 
ATOM   2797 C C   . SER C 1 101 ? 8.753   86.777  40.036 1.00 64.36  ? 992  SER C C   1 
ATOM   2798 O O   . SER C 1 101 ? 9.425   85.784  39.769 1.00 60.34  ? 992  SER C O   1 
ATOM   2799 C CB  . SER C 1 101 ? 7.125   86.453  41.945 1.00 61.49  ? 992  SER C CB  1 
ATOM   2800 O OG  . SER C 1 101 ? 5.987   87.057  41.357 1.00 65.14  ? 992  SER C OG  1 
ATOM   2801 N N   . ASP C 1 102 ? 8.280   87.606  39.107 1.00 65.75  ? 993  ASP C N   1 
ATOM   2802 C CA  . ASP C 1 102 ? 8.539   87.392  37.690 1.00 65.95  ? 993  ASP C CA  1 
ATOM   2803 C C   . ASP C 1 102 ? 10.030  87.472  37.515 1.00 67.36  ? 993  ASP C C   1 
ATOM   2804 O O   . ASP C 1 102 ? 10.614  86.688  36.770 1.00 70.60  ? 993  ASP C O   1 
ATOM   2805 C CB  . ASP C 1 102 ? 7.869   88.465  36.842 1.00 63.97  ? 993  ASP C CB  1 
ATOM   2806 C CG  . ASP C 1 102 ? 6.399   88.181  36.595 1.00 66.43  ? 993  ASP C CG  1 
ATOM   2807 O OD1 . ASP C 1 102 ? 5.855   87.240  37.211 1.00 69.93  ? 993  ASP C OD1 1 
ATOM   2808 O OD2 . ASP C 1 102 ? 5.779   88.901  35.782 1.00 62.90  ? 993  ASP C OD2 1 
ATOM   2809 N N   . LEU C 1 103 ? 10.646  88.428  38.203 1.00 67.59  ? 994  LEU C N   1 
ATOM   2810 C CA  . LEU C 1 103 ? 12.082  88.564  38.123 1.00 66.50  ? 994  LEU C CA  1 
ATOM   2811 C C   . LEU C 1 103 ? 12.723  87.368  38.789 1.00 67.17  ? 994  LEU C C   1 
ATOM   2812 O O   . LEU C 1 103 ? 13.754  86.881  38.320 1.00 69.64  ? 994  LEU C O   1 
ATOM   2813 C CB  . LEU C 1 103 ? 12.560  89.811  38.833 1.00 67.26  ? 994  LEU C CB  1 
ATOM   2814 C CG  . LEU C 1 103 ? 14.067  89.944  38.653 1.00 68.20  ? 994  LEU C CG  1 
ATOM   2815 C CD1 . LEU C 1 103 ? 14.363  90.389  37.225 1.00 65.29  ? 994  LEU C CD1 1 
ATOM   2816 C CD2 . LEU C 1 103 ? 14.597  90.943  39.652 1.00 68.29  ? 994  LEU C CD2 1 
ATOM   2817 N N   . GLY C 1 104 ? 12.133  86.928  39.901 1.00 64.19  ? 995  GLY C N   1 
ATOM   2818 C CA  . GLY C 1 104 ? 12.647  85.770  40.612 1.00 64.05  ? 995  GLY C CA  1 
ATOM   2819 C C   . GLY C 1 104 ? 12.716  84.524  39.731 1.00 66.04  ? 995  GLY C C   1 
ATOM   2820 O O   . GLY C 1 104 ? 13.681  83.755  39.805 1.00 67.63  ? 995  GLY C O   1 
ATOM   2821 N N   . GLU C 1 105 ? 11.706  84.332  38.883 1.00 66.63  ? 996  GLU C N   1 
ATOM   2822 C CA  . GLU C 1 105 ? 11.649  83.190  37.985 1.00 65.90  ? 996  GLU C CA  1 
ATOM   2823 C C   . GLU C 1 105 ? 12.822  83.324  37.040 1.00 65.44  ? 996  GLU C C   1 
ATOM   2824 O O   . GLU C 1 105 ? 13.624  82.403  36.918 1.00 66.29  ? 996  GLU C O   1 
ATOM   2825 C CB  . GLU C 1 105 ? 10.320  83.200  37.224 1.00 65.40  ? 996  GLU C CB  1 
ATOM   2826 C CG  . GLU C 1 105 ? 9.916   81.852  36.618 1.00 66.32  ? 996  GLU C CG  1 
ATOM   2827 C CD  . GLU C 1 105 ? 8.576   81.897  35.873 1.00 70.50  ? 996  GLU C CD  1 
ATOM   2828 O OE1 . GLU C 1 105 ? 7.517   81.956  36.534 1.00 73.43  ? 996  GLU C OE1 1 
ATOM   2829 O OE2 . GLU C 1 105 ? 8.574   81.879  34.619 1.00 71.57  ? 996  GLU C OE2 1 
ATOM   2830 N N   . LEU C 1 106 ? 12.937  84.491  36.411 1.00 65.72  ? 997  LEU C N   1 
ATOM   2831 C CA  . LEU C 1 106 ? 14.020  84.767  35.471 1.00 64.71  ? 997  LEU C CA  1 
ATOM   2832 C C   . LEU C 1 106 ? 15.372  84.396  36.056 1.00 65.49  ? 997  LEU C C   1 
ATOM   2833 O O   . LEU C 1 106 ? 16.217  83.810  35.384 1.00 66.79  ? 997  LEU C O   1 
ATOM   2834 C CB  . LEU C 1 106 ? 14.020  86.248  35.061 1.00 58.85  ? 997  LEU C CB  1 
ATOM   2835 C CG  . LEU C 1 106 ? 15.087  86.607  34.016 1.00 57.97  ? 997  LEU C CG  1 
ATOM   2836 C CD1 . LEU C 1 106 ? 14.766  85.894  32.724 1.00 53.14  ? 997  LEU C CD1 1 
ATOM   2837 C CD2 . LEU C 1 106 ? 15.175  88.107  33.785 1.00 54.12  ? 997  LEU C CD2 1 
ATOM   2838 N N   . ILE C 1 107 ? 15.567  84.727  37.320 1.00 67.16  ? 998  ILE C N   1 
ATOM   2839 C CA  . ILE C 1 107 ? 16.818  84.424  37.988 1.00 72.42  ? 998  ILE C CA  1 
ATOM   2840 C C   . ILE C 1 107 ? 17.024  82.927  38.171 1.00 74.57  ? 998  ILE C C   1 
ATOM   2841 O O   . ILE C 1 107 ? 18.088  82.400  37.826 1.00 77.77  ? 998  ILE C O   1 
ATOM   2842 C CB  . ILE C 1 107 ? 16.878  85.168  39.336 1.00 72.98  ? 998  ILE C CB  1 
ATOM   2843 C CG1 . ILE C 1 107 ? 17.023  86.673  39.050 1.00 74.14  ? 998  ILE C CG1 1 
ATOM   2844 C CG2 . ILE C 1 107 ? 18.014  84.629  40.198 1.00 70.55  ? 998  ILE C CG2 1 
ATOM   2845 C CD1 . ILE C 1 107 ? 16.435  87.567  40.107 1.00 76.79  ? 998  ILE C CD1 1 
ATOM   2846 N N   . ASN C 1 108 ? 16.005  82.254  38.704 1.00 74.03  ? 999  ASN C N   1 
ATOM   2847 C CA  . ASN C 1 108 ? 16.048  80.809  38.921 1.00 71.49  ? 999  ASN C CA  1 
ATOM   2848 C C   . ASN C 1 108 ? 16.408  80.080  37.650 1.00 71.95  ? 999  ASN C C   1 
ATOM   2849 O O   . ASN C 1 108 ? 17.184  79.129  37.670 1.00 73.99  ? 999  ASN C O   1 
ATOM   2850 C CB  . ASN C 1 108 ? 14.700  80.281  39.385 1.00 70.17  ? 999  ASN C CB  1 
ATOM   2851 C CG  . ASN C 1 108 ? 14.368  80.699  40.784 1.00 72.24  ? 999  ASN C CG  1 
ATOM   2852 O OD1 . ASN C 1 108 ? 15.244  81.114  41.531 1.00 79.06  ? 999  ASN C OD1 1 
ATOM   2853 N ND2 . ASN C 1 108 ? 13.099  80.577  41.162 1.00 71.91  ? 999  ASN C ND2 1 
ATOM   2854 N N   . LYS C 1 109 ? 15.842  80.528  36.539 1.00 70.46  ? 1000 LYS C N   1 
ATOM   2855 C CA  . LYS C 1 109 ? 16.120  79.894  35.271 1.00 71.13  ? 1000 LYS C CA  1 
ATOM   2856 C C   . LYS C 1 109 ? 17.458  80.323  34.724 1.00 73.67  ? 1000 LYS C C   1 
ATOM   2857 O O   . LYS C 1 109 ? 17.942  79.745  33.760 1.00 76.46  ? 1000 LYS C O   1 
ATOM   2858 C CB  . LYS C 1 109 ? 15.039  80.230  34.260 1.00 69.35  ? 1000 LYS C CB  1 
ATOM   2859 C CG  . LYS C 1 109 ? 13.645  79.893  34.713 1.00 65.79  ? 1000 LYS C CG  1 
ATOM   2860 C CD  . LYS C 1 109 ? 13.537  78.495  35.253 1.00 61.32  ? 1000 LYS C CD  1 
ATOM   2861 C CE  . LYS C 1 109 ? 12.084  78.089  35.271 1.00 61.78  ? 1000 LYS C CE  1 
ATOM   2862 N NZ  . LYS C 1 109 ? 11.835  77.050  36.293 1.00 64.16  ? 1000 LYS C NZ  1 
ATOM   2863 N N   . MET C 1 110 ? 18.051  81.357  35.306 1.00 77.07  ? 1001 MET C N   1 
ATOM   2864 C CA  . MET C 1 110 ? 19.355  81.783  34.833 1.00 76.75  ? 1001 MET C CA  1 
ATOM   2865 C C   . MET C 1 110 ? 20.308  80.887  35.597 1.00 77.72  ? 1001 MET C C   1 
ATOM   2866 O O   . MET C 1 110 ? 21.121  80.171  35.009 1.00 79.52  ? 1001 MET C O   1 
ATOM   2867 C CB  . MET C 1 110 ? 19.639  83.243  35.182 1.00 77.17  ? 1001 MET C CB  1 
ATOM   2868 C CG  . MET C 1 110 ? 20.998  83.715  34.703 1.00 80.15  ? 1001 MET C CG  1 
ATOM   2869 S SD  . MET C 1 110 ? 21.485  85.243  35.513 1.00 85.35  ? 1001 MET C SD  1 
ATOM   2870 C CE  . MET C 1 110 ? 21.404  84.768  37.231 1.00 78.80  ? 1001 MET C CE  1 
ATOM   2871 N N   . LYS C 1 111 ? 20.213  80.923  36.917 1.00 76.81  ? 1002 LYS C N   1 
ATOM   2872 C CA  . LYS C 1 111 ? 21.090  80.098  37.712 1.00 78.84  ? 1002 LYS C CA  1 
ATOM   2873 C C   . LYS C 1 111 ? 21.111  78.673  37.198 1.00 79.90  ? 1002 LYS C C   1 
ATOM   2874 O O   . LYS C 1 111 ? 22.076  77.951  37.422 1.00 81.40  ? 1002 LYS C O   1 
ATOM   2875 C CB  . LYS C 1 111 ? 20.641  80.076  39.156 1.00 81.32  ? 1002 LYS C CB  1 
ATOM   2876 C CG  . LYS C 1 111 ? 20.647  81.420  39.851 1.00 86.45  ? 1002 LYS C CG  1 
ATOM   2877 C CD  . LYS C 1 111 ? 20.269  81.219  41.328 1.00 94.33  ? 1002 LYS C CD  1 
ATOM   2878 C CE  . LYS C 1 111 ? 19.273  82.183  41.793 1.00 98.59  ? 1002 LYS C CE  1 
ATOM   2879 N NZ  . LYS C 1 111 ? 19.394  82.127  43.355 1.00 99.55  ? 1002 LYS C NZ  1 
ATOM   2880 N N   . LEU C 1 112 ? 20.039  78.260  36.532 1.00 79.16  ? 1003 LEU C N   1 
ATOM   2881 C CA  . LEU C 1 112 ? 19.954  76.912  36.000 1.00 78.86  ? 1003 LEU C CA  1 
ATOM   2882 C C   . LEU C 1 112 ? 20.701  76.799  34.686 1.00 81.63  ? 1003 LEU C C   1 
ATOM   2883 O O   . LEU C 1 112 ? 21.437  75.842  34.474 1.00 86.25  ? 1003 LEU C O   1 
ATOM   2884 C CB  . LEU C 1 112 ? 18.496  76.511  35.794 1.00 75.43  ? 1003 LEU C CB  1 
ATOM   2885 C CG  . LEU C 1 112 ? 17.753  75.991  37.018 1.00 71.15  ? 1003 LEU C CG  1 
ATOM   2886 C CD1 . LEU C 1 112 ? 16.335  75.636  36.640 1.00 62.29  ? 1003 LEU C CD1 1 
ATOM   2887 C CD2 . LEU C 1 112 ? 18.477  74.771  37.559 1.00 72.18  ? 1003 LEU C CD2 1 
ATOM   2888 N N   . ALA C 1 113 ? 20.502  77.762  33.795 1.00 80.50  ? 1004 ALA C N   1 
ATOM   2889 C CA  . ALA C 1 113 ? 21.195  77.745  32.516 1.00 82.27  ? 1004 ALA C CA  1 
ATOM   2890 C C   . ALA C 1 113 ? 22.700  77.757  32.765 1.00 85.27  ? 1004 ALA C C   1 
ATOM   2891 O O   . ALA C 1 113 ? 23.500  77.290  31.947 1.00 85.88  ? 1004 ALA C O   1 
ATOM   2892 C CB  . ALA C 1 113 ? 20.803  78.947  31.704 1.00 81.38  ? 1004 ALA C CB  1 
ATOM   2893 N N   . GLN C 1 114 ? 23.088  78.318  33.900 1.00 88.03  ? 1005 GLN C N   1 
ATOM   2894 C CA  . GLN C 1 114 ? 24.489  78.370  34.242 1.00 89.05  ? 1005 GLN C CA  1 
ATOM   2895 C C   . GLN C 1 114 ? 24.919  76.992  34.709 1.00 89.67  ? 1005 GLN C C   1 
ATOM   2896 O O   . GLN C 1 114 ? 25.856  76.404  34.169 1.00 91.78  ? 1005 GLN C O   1 
ATOM   2897 C CB  . GLN C 1 114 ? 24.722  79.363  35.367 1.00 89.82  ? 1005 GLN C CB  1 
ATOM   2898 C CG  . GLN C 1 114 ? 24.517  80.817  35.012 1.00 91.82  ? 1005 GLN C CG  1 
ATOM   2899 C CD  . GLN C 1 114 ? 25.138  81.721  36.053 1.00 95.50  ? 1005 GLN C CD  1 
ATOM   2900 O OE1 . GLN C 1 114 ? 24.477  82.180  36.990 1.00 94.91  ? 1005 GLN C OE1 1 
ATOM   2901 N NE2 . GLN C 1 114 ? 26.436  81.960  35.908 1.00 98.99  ? 1005 GLN C NE2 1 
ATOM   2902 N N   . GLN C 1 115 ? 24.215  76.482  35.712 1.00 86.98  ? 1006 GLN C N   1 
ATOM   2903 C CA  . GLN C 1 115 ? 24.526  75.185  36.267 1.00 86.97  ? 1006 GLN C CA  1 
ATOM   2904 C C   . GLN C 1 115 ? 24.658  74.126  35.185 1.00 87.44  ? 1006 GLN C C   1 
ATOM   2905 O O   . GLN C 1 115 ? 25.339  73.127  35.389 1.00 89.73  ? 1006 GLN C O   1 
ATOM   2906 C CB  . GLN C 1 115 ? 23.459  74.777  37.280 1.00 87.66  ? 1006 GLN C CB  1 
ATOM   2907 C CG  . GLN C 1 115 ? 23.751  73.462  37.971 1.00 92.76  ? 1006 GLN C CG  1 
ATOM   2908 C CD  . GLN C 1 115 ? 22.799  73.171  39.109 1.00 97.02  ? 1006 GLN C CD  1 
ATOM   2909 O OE1 . GLN C 1 115 ? 21.711  73.743  39.183 1.00 100.28 ? 1006 GLN C OE1 1 
ATOM   2910 N NE2 . GLN C 1 115 ? 23.196  72.265  40.002 1.00 99.89  ? 1006 GLN C NE2 1 
ATOM   2911 N N   . TYR C 1 116 ? 24.045  74.341  34.023 1.00 86.71  ? 1007 TYR C N   1 
ATOM   2912 C CA  . TYR C 1 116 ? 24.136  73.336  32.961 1.00 86.67  ? 1007 TYR C CA  1 
ATOM   2913 C C   . TYR C 1 116 ? 24.632  73.866  31.619 1.00 90.37  ? 1007 TYR C C   1 
ATOM   2914 O O   . TYR C 1 116 ? 23.879  73.907  30.642 1.00 89.59  ? 1007 TYR C O   1 
ATOM   2915 C CB  . TYR C 1 116 ? 22.779  72.619  32.762 1.00 79.64  ? 1007 TYR C CB  1 
ATOM   2916 C CG  . TYR C 1 116 ? 22.280  71.870  33.992 1.00 73.84  ? 1007 TYR C CG  1 
ATOM   2917 C CD1 . TYR C 1 116 ? 21.566  72.524  34.994 1.00 69.15  ? 1007 TYR C CD1 1 
ATOM   2918 C CD2 . TYR C 1 116 ? 22.553  70.516  34.163 1.00 71.83  ? 1007 TYR C CD2 1 
ATOM   2919 C CE1 . TYR C 1 116 ? 21.154  71.858  36.130 1.00 66.38  ? 1007 TYR C CE1 1 
ATOM   2920 C CE2 . TYR C 1 116 ? 22.147  69.840  35.297 1.00 67.77  ? 1007 TYR C CE2 1 
ATOM   2921 C CZ  . TYR C 1 116 ? 21.444  70.508  36.272 1.00 69.25  ? 1007 TYR C CZ  1 
ATOM   2922 O OH  . TYR C 1 116 ? 21.046  69.793  37.383 1.00 73.16  ? 1007 TYR C OH  1 
ATOM   2923 N N   . VAL C 1 117 ? 25.897  74.270  31.560 1.00 93.55  ? 1008 VAL C N   1 
ATOM   2924 C CA  . VAL C 1 117 ? 26.430  74.780  30.304 1.00 95.39  ? 1008 VAL C CA  1 
ATOM   2925 C C   . VAL C 1 117 ? 26.991  73.658  29.413 1.00 99.04  ? 1008 VAL C C   1 
ATOM   2926 O O   . VAL C 1 117 ? 27.517  72.636  29.906 1.00 96.76  ? 1008 VAL C O   1 
ATOM   2927 C CB  . VAL C 1 117 ? 27.518  75.848  30.548 1.00 93.17  ? 1008 VAL C CB  1 
ATOM   2928 C CG1 . VAL C 1 117 ? 27.384  76.954  29.519 1.00 94.68  ? 1008 VAL C CG1 1 
ATOM   2929 C CG2 . VAL C 1 117 ? 27.396  76.405  31.942 1.00 90.64  ? 1008 VAL C CG2 1 
ATOM   2930 N N   . MET C 1 118 ? 26.896  73.871  28.097 1.00 102.88 ? 1009 MET C N   1 
ATOM   2931 C CA  . MET C 1 118 ? 27.366  72.889  27.113 1.00 106.14 ? 1009 MET C CA  1 
ATOM   2932 C C   . MET C 1 118 ? 26.705  71.572  27.486 1.00 103.50 ? 1009 MET C C   1 
ATOM   2933 O O   . MET C 1 118 ? 27.381  70.608  27.842 1.00 102.03 ? 1009 MET C O   1 
ATOM   2934 C CB  . MET C 1 118 ? 28.885  72.706  27.180 1.00 112.97 ? 1009 MET C CB  1 
ATOM   2935 C CG  . MET C 1 118 ? 29.709  73.947  26.920 1.00 118.22 ? 1009 MET C CG  1 
ATOM   2936 S SD  . MET C 1 118 ? 31.027  74.016  28.168 1.00 127.87 ? 1009 MET C SD  1 
ATOM   2937 C CE  . MET C 1 118 ? 30.785  72.357  29.034 1.00 125.63 ? 1009 MET C CE  1 
ATOM   2938 N N   . THR C 1 119 ? 25.378  71.554  27.435 1.00 100.15 ? 1010 THR C N   1 
ATOM   2939 C CA  . THR C 1 119 ? 24.589  70.368  27.756 1.00 94.55  ? 1010 THR C CA  1 
ATOM   2940 C C   . THR C 1 119 ? 23.386  70.471  26.859 1.00 94.29  ? 1010 THR C C   1 
ATOM   2941 O O   . THR C 1 119 ? 23.196  71.480  26.167 1.00 94.51  ? 1010 THR C O   1 
ATOM   2942 C CB  . THR C 1 119 ? 24.065  70.367  29.202 1.00 91.09  ? 1010 THR C CB  1 
ATOM   2943 O OG1 . THR C 1 119 ? 25.107  70.769  30.086 1.00 90.33  ? 1010 THR C OG1 1 
ATOM   2944 C CG2 . THR C 1 119 ? 23.611  68.996  29.598 1.00 90.38  ? 1010 THR C CG2 1 
ATOM   2945 N N   . SER C 1 120 ? 22.583  69.422  26.833 1.00 92.61  ? 1011 SER C N   1 
ATOM   2946 C CA  . SER C 1 120 ? 21.392  69.472  26.021 1.00 91.90  ? 1011 SER C CA  1 
ATOM   2947 C C   . SER C 1 120 ? 20.447  70.409  26.787 1.00 92.79  ? 1011 SER C C   1 
ATOM   2948 O O   . SER C 1 120 ? 19.652  71.151  26.201 1.00 91.57  ? 1011 SER C O   1 
ATOM   2949 C CB  . SER C 1 120 ? 20.811  68.073  25.889 1.00 91.88  ? 1011 SER C CB  1 
ATOM   2950 O OG  . SER C 1 120 ? 21.160  67.281  27.010 1.00 90.49  ? 1011 SER C OG  1 
ATOM   2951 N N   . LEU C 1 121 ? 20.600  70.391  28.111 1.00 91.18  ? 1012 LEU C N   1 
ATOM   2952 C CA  . LEU C 1 121 ? 19.814  71.194  29.032 1.00 90.82  ? 1012 LEU C CA  1 
ATOM   2953 C C   . LEU C 1 121 ? 20.085  72.683  29.013 1.00 94.58  ? 1012 LEU C C   1 
ATOM   2954 O O   . LEU C 1 121 ? 19.287  73.443  29.549 1.00 96.18  ? 1012 LEU C O   1 
ATOM   2955 C CB  . LEU C 1 121 ? 20.015  70.694  30.458 1.00 86.54  ? 1012 LEU C CB  1 
ATOM   2956 C CG  . LEU C 1 121 ? 19.196  69.513  30.971 1.00 83.58  ? 1012 LEU C CG  1 
ATOM   2957 C CD1 . LEU C 1 121 ? 19.038  69.691  32.462 1.00 83.73  ? 1012 LEU C CD1 1 
ATOM   2958 C CD2 . LEU C 1 121 ? 17.827  69.457  30.324 1.00 81.61  ? 1012 LEU C CD2 1 
ATOM   2959 N N   . GLN C 1 122 ? 21.198  73.118  28.433 1.00 97.50  ? 1013 GLN C N   1 
ATOM   2960 C CA  . GLN C 1 122 ? 21.470  74.551  28.411 1.00 97.47  ? 1013 GLN C CA  1 
ATOM   2961 C C   . GLN C 1 122 ? 20.501  75.270  27.476 1.00 94.32  ? 1013 GLN C C   1 
ATOM   2962 O O   . GLN C 1 122 ? 19.989  76.336  27.808 1.00 94.80  ? 1013 GLN C O   1 
ATOM   2963 C CB  . GLN C 1 122 ? 22.913  74.831  27.978 1.00 103.52 ? 1013 GLN C CB  1 
ATOM   2964 C CG  . GLN C 1 122 ? 23.296  76.306  28.056 1.00 107.09 ? 1013 GLN C CG  1 
ATOM   2965 C CD  . GLN C 1 122 ? 24.131  76.751  26.874 1.00 107.91 ? 1013 GLN C CD  1 
ATOM   2966 O OE1 . GLN C 1 122 ? 25.352  76.886  26.977 1.00 108.57 ? 1013 GLN C OE1 1 
ATOM   2967 N NE2 . GLN C 1 122 ? 23.473  76.969  25.735 1.00 105.63 ? 1013 GLN C NE2 1 
ATOM   2968 N N   . GLN C 1 123 ? 20.244  74.684  26.311 1.00 90.18  ? 1014 GLN C N   1 
ATOM   2969 C CA  . GLN C 1 123 ? 19.334  75.304  25.355 1.00 87.72  ? 1014 GLN C CA  1 
ATOM   2970 C C   . GLN C 1 123 ? 17.924  75.393  25.939 1.00 86.13  ? 1014 GLN C C   1 
ATOM   2971 O O   . GLN C 1 123 ? 17.171  76.311  25.609 1.00 88.36  ? 1014 GLN C O   1 
ATOM   2972 C CB  . GLN C 1 123 ? 19.295  74.526  24.032 1.00 91.86  ? 1014 GLN C CB  1 
ATOM   2973 C CG  . GLN C 1 123 ? 18.472  75.220  22.938 1.00 97.17  ? 1014 GLN C CG  1 
ATOM   2974 C CD  . GLN C 1 123 ? 17.272  74.401  22.481 1.00 104.41 ? 1014 GLN C CD  1 
ATOM   2975 O OE1 . GLN C 1 123 ? 17.388  73.531  21.609 1.00 106.51 ? 1014 GLN C OE1 1 
ATOM   2976 N NE2 . GLN C 1 123 ? 16.110  74.669  23.079 1.00 106.25 ? 1014 GLN C NE2 1 
ATOM   2977 N N   . GLU C 1 124 ? 17.586  74.461  26.830 1.00 82.44  ? 1015 GLU C N   1 
ATOM   2978 C CA  . GLU C 1 124 ? 16.266  74.412  27.457 1.00 80.08  ? 1015 GLU C CA  1 
ATOM   2979 C C   . GLU C 1 124 ? 16.051  75.469  28.531 1.00 76.25  ? 1015 GLU C C   1 
ATOM   2980 O O   . GLU C 1 124 ? 15.059  76.197  28.495 1.00 76.01  ? 1015 GLU C O   1 
ATOM   2981 C CB  . GLU C 1 124 ? 16.008  73.015  28.035 1.00 81.70  ? 1015 GLU C CB  1 
ATOM   2982 C CG  . GLU C 1 124 ? 14.759  72.888  28.934 1.00 86.16  ? 1015 GLU C CG  1 
ATOM   2983 C CD  . GLU C 1 124 ? 13.420  73.044  28.197 1.00 90.11  ? 1015 GLU C CD  1 
ATOM   2984 O OE1 . GLU C 1 124 ? 13.342  72.708  26.989 1.00 92.61  ? 1015 GLU C OE1 1 
ATOM   2985 O OE2 . GLU C 1 124 ? 12.435  73.483  28.845 1.00 87.56  ? 1015 GLU C OE2 1 
ATOM   2986 N N   . TYR C 1 125 ? 16.964  75.571  29.486 1.00 72.21  ? 1016 TYR C N   1 
ATOM   2987 C CA  . TYR C 1 125 ? 16.787  76.585  30.515 1.00 69.53  ? 1016 TYR C CA  1 
ATOM   2988 C C   . TYR C 1 125 ? 16.857  78.000  29.902 1.00 69.61  ? 1016 TYR C C   1 
ATOM   2989 O O   . TYR C 1 125 ? 16.501  79.002  30.537 1.00 71.07  ? 1016 TYR C O   1 
ATOM   2990 C CB  . TYR C 1 125 ? 17.807  76.386  31.639 1.00 65.82  ? 1016 TYR C CB  1 
ATOM   2991 C CG  . TYR C 1 125 ? 17.533  75.133  32.448 1.00 69.92  ? 1016 TYR C CG  1 
ATOM   2992 C CD1 . TYR C 1 125 ? 16.282  74.913  33.012 1.00 72.49  ? 1016 TYR C CD1 1 
ATOM   2993 C CD2 . TYR C 1 125 ? 18.519  74.172  32.656 1.00 70.09  ? 1016 TYR C CD2 1 
ATOM   2994 C CE1 . TYR C 1 125 ? 16.014  73.770  33.769 1.00 73.45  ? 1016 TYR C CE1 1 
ATOM   2995 C CE2 . TYR C 1 125 ? 18.258  73.019  33.412 1.00 71.47  ? 1016 TYR C CE2 1 
ATOM   2996 C CZ  . TYR C 1 125 ? 17.002  72.828  33.966 1.00 72.08  ? 1016 TYR C CZ  1 
ATOM   2997 O OH  . TYR C 1 125 ? 16.719  71.710  34.727 1.00 73.37  ? 1016 TYR C OH  1 
ATOM   2998 N N   . LYS C 1 126 ? 17.310  78.083  28.657 1.00 68.11  ? 1017 LYS C N   1 
ATOM   2999 C CA  . LYS C 1 126 ? 17.359  79.368  27.977 1.00 66.91  ? 1017 LYS C CA  1 
ATOM   3000 C C   . LYS C 1 126 ? 15.941  79.672  27.512 1.00 67.35  ? 1017 LYS C C   1 
ATOM   3001 O O   . LYS C 1 126 ? 15.491  80.811  27.600 1.00 68.01  ? 1017 LYS C O   1 
ATOM   3002 C CB  . LYS C 1 126 ? 18.275  79.337  26.756 1.00 65.99  ? 1017 LYS C CB  1 
ATOM   3003 C CG  . LYS C 1 126 ? 19.732  79.641  27.046 1.00 68.76  ? 1017 LYS C CG  1 
ATOM   3004 C CD  . LYS C 1 126 ? 20.489  79.910  25.751 1.00 74.17  ? 1017 LYS C CD  1 
ATOM   3005 C CE  . LYS C 1 126 ? 21.993  79.951  25.965 1.00 76.13  ? 1017 LYS C CE  1 
ATOM   3006 N NZ  . LYS C 1 126 ? 22.636  80.642  24.814 1.00 79.94  ? 1017 LYS C NZ  1 
ATOM   3007 N N   . LYS C 1 127 ? 15.246  78.661  26.990 1.00 68.12  ? 1018 LYS C N   1 
ATOM   3008 C CA  . LYS C 1 127 ? 13.872  78.859  26.546 1.00 70.27  ? 1018 LYS C CA  1 
ATOM   3009 C C   . LYS C 1 127 ? 13.044  79.255  27.771 1.00 69.90  ? 1018 LYS C C   1 
ATOM   3010 O O   . LYS C 1 127 ? 12.141  80.082  27.676 1.00 69.75  ? 1018 LYS C O   1 
ATOM   3011 C CB  . LYS C 1 127 ? 13.307  77.587  25.899 1.00 69.10  ? 1018 LYS C CB  1 
ATOM   3012 C CG  . LYS C 1 127 ? 13.681  77.438  24.438 1.00 77.50  ? 1018 LYS C CG  1 
ATOM   3013 C CD  . LYS C 1 127 ? 12.742  76.475  23.692 1.00 85.17  ? 1018 LYS C CD  1 
ATOM   3014 C CE  . LYS C 1 127 ? 13.076  76.388  22.181 1.00 85.04  ? 1018 LYS C CE  1 
ATOM   3015 N NZ  . LYS C 1 127 ? 12.967  75.000  21.601 1.00 83.66  ? 1018 LYS C NZ  1 
ATOM   3016 N N   . GLN C 1 128 ? 13.374  78.684  28.926 1.00 67.13  ? 1019 GLN C N   1 
ATOM   3017 C CA  . GLN C 1 128 ? 12.645  79.003  30.133 1.00 68.24  ? 1019 GLN C CA  1 
ATOM   3018 C C   . GLN C 1 128 ? 12.912  80.425  30.585 1.00 70.51  ? 1019 GLN C C   1 
ATOM   3019 O O   . GLN C 1 128 ? 12.066  81.045  31.246 1.00 72.30  ? 1019 GLN C O   1 
ATOM   3020 C CB  . GLN C 1 128 ? 12.983  77.995  31.231 1.00 65.12  ? 1019 GLN C CB  1 
ATOM   3021 C CG  . GLN C 1 128 ? 12.098  76.773  31.122 1.00 65.87  ? 1019 GLN C CG  1 
ATOM   3022 C CD  . GLN C 1 128 ? 12.467  75.642  32.058 1.00 66.05  ? 1019 GLN C CD  1 
ATOM   3023 O OE1 . GLN C 1 128 ? 12.444  75.778  33.283 1.00 64.28  ? 1019 GLN C OE1 1 
ATOM   3024 N NE2 . GLN C 1 128 ? 12.798  74.499  31.473 1.00 73.45  ? 1019 GLN C NE2 1 
ATOM   3025 N N   . MET C 1 129 ? 14.093  80.941  30.254 1.00 70.03  ? 1020 MET C N   1 
ATOM   3026 C CA  . MET C 1 129 ? 14.409  82.316  30.611 1.00 68.67  ? 1020 MET C CA  1 
ATOM   3027 C C   . MET C 1 129 ? 13.535  83.214  29.730 1.00 67.12  ? 1020 MET C C   1 
ATOM   3028 O O   . MET C 1 129 ? 12.737  84.019  30.227 1.00 69.88  ? 1020 MET C O   1 
ATOM   3029 C CB  . MET C 1 129 ? 15.887  82.624  30.370 1.00 70.44  ? 1020 MET C CB  1 
ATOM   3030 C CG  . MET C 1 129 ? 16.737  82.651  31.641 1.00 74.93  ? 1020 MET C CG  1 
ATOM   3031 S SD  . MET C 1 129 ? 18.497  82.378  31.255 1.00 79.45  ? 1020 MET C SD  1 
ATOM   3032 C CE  . MET C 1 129 ? 18.994  83.982  30.744 1.00 70.02  ? 1020 MET C CE  1 
ATOM   3033 N N   . LEU C 1 130 ? 13.676  83.066  28.418 1.00 60.59  ? 1021 LEU C N   1 
ATOM   3034 C CA  . LEU C 1 130 ? 12.895  83.861  27.495 1.00 58.18  ? 1021 LEU C CA  1 
ATOM   3035 C C   . LEU C 1 130 ? 11.457  83.872  27.954 1.00 57.51  ? 1021 LEU C C   1 
ATOM   3036 O O   . LEU C 1 130 ? 10.810  84.911  27.940 1.00 56.89  ? 1021 LEU C O   1 
ATOM   3037 C CB  . LEU C 1 130 ? 12.988  83.290  26.085 1.00 59.81  ? 1021 LEU C CB  1 
ATOM   3038 C CG  . LEU C 1 130 ? 14.328  83.320  25.338 1.00 60.78  ? 1021 LEU C CG  1 
ATOM   3039 C CD1 . LEU C 1 130 ? 14.068  83.573  23.851 1.00 59.79  ? 1021 LEU C CD1 1 
ATOM   3040 C CD2 . LEU C 1 130 ? 15.229  84.427  25.887 1.00 63.56  ? 1021 LEU C CD2 1 
ATOM   3041 N N   . THR C 1 131 ? 10.962  82.718  28.385 1.00 58.04  ? 1022 THR C N   1 
ATOM   3042 C CA  . THR C 1 131 ? 9.582   82.635  28.862 1.00 62.96  ? 1022 THR C CA  1 
ATOM   3043 C C   . THR C 1 131 ? 9.343   83.579  30.038 1.00 67.31  ? 1022 THR C C   1 
ATOM   3044 O O   . THR C 1 131 ? 8.433   84.420  30.014 1.00 69.73  ? 1022 THR C O   1 
ATOM   3045 C CB  . THR C 1 131 ? 9.237   81.206  29.318 1.00 59.00  ? 1022 THR C CB  1 
ATOM   3046 O OG1 . THR C 1 131 ? 8.923   80.408  28.177 1.00 58.88  ? 1022 THR C OG1 1 
ATOM   3047 C CG2 . THR C 1 131 ? 8.068   81.202  30.257 1.00 58.91  ? 1022 THR C CG2 1 
ATOM   3048 N N   . ALA C 1 132 ? 10.166  83.421  31.070 1.00 67.42  ? 1023 ALA C N   1 
ATOM   3049 C CA  . ALA C 1 132 ? 10.059  84.232  32.275 1.00 67.60  ? 1023 ALA C CA  1 
ATOM   3050 C C   . ALA C 1 132 ? 10.236  85.726  32.027 1.00 67.98  ? 1023 ALA C C   1 
ATOM   3051 O O   . ALA C 1 132 ? 9.613   86.550  32.706 1.00 70.15  ? 1023 ALA C O   1 
ATOM   3052 C CB  . ALA C 1 132 ? 11.068  83.755  33.314 1.00 69.09  ? 1023 ALA C CB  1 
ATOM   3053 N N   . ALA C 1 133 ? 11.087  86.085  31.072 1.00 67.47  ? 1024 ALA C N   1 
ATOM   3054 C CA  . ALA C 1 133 ? 11.299  87.498  30.772 1.00 69.01  ? 1024 ALA C CA  1 
ATOM   3055 C C   . ALA C 1 133 ? 10.103  88.074  30.025 1.00 68.44  ? 1024 ALA C C   1 
ATOM   3056 O O   . ALA C 1 133 ? 9.783   89.256  30.172 1.00 68.76  ? 1024 ALA C O   1 
ATOM   3057 C CB  . ALA C 1 133 ? 12.542  87.681  29.944 1.00 68.62  ? 1024 ALA C CB  1 
ATOM   3058 N N   . HIS C 1 134 ? 9.451   87.240  29.217 1.00 67.30  ? 1025 HIS C N   1 
ATOM   3059 C CA  . HIS C 1 134 ? 8.290   87.684  28.460 1.00 67.56  ? 1025 HIS C CA  1 
ATOM   3060 C C   . HIS C 1 134 ? 7.170   87.997  29.465 1.00 67.12  ? 1025 HIS C C   1 
ATOM   3061 O O   . HIS C 1 134 ? 6.459   89.005  29.340 1.00 64.58  ? 1025 HIS C O   1 
ATOM   3062 C CB  . HIS C 1 134 ? 7.852   86.603  27.467 1.00 70.31  ? 1025 HIS C CB  1 
ATOM   3063 C CG  . HIS C 1 134 ? 6.683   87.011  26.625 1.00 74.28  ? 1025 HIS C CG  1 
ATOM   3064 N ND1 . HIS C 1 134 ? 5.414   87.128  27.130 1.00 75.93  ? 1025 HIS C ND1 1 
ATOM   3065 C CD2 . HIS C 1 134 ? 6.616   87.370  25.319 1.00 77.59  ? 1025 HIS C CD2 1 
ATOM   3066 C CE1 . HIS C 1 134 ? 4.599   87.546  26.170 1.00 78.46  ? 1025 HIS C CE1 1 
ATOM   3067 N NE2 . HIS C 1 134 ? 5.302   87.700  25.069 1.00 79.61  ? 1025 HIS C NE2 1 
ATOM   3068 N N   . ALA C 1 135 ? 7.036   87.129  30.468 1.00 65.03  ? 1026 ALA C N   1 
ATOM   3069 C CA  . ALA C 1 135 ? 6.049   87.292  31.523 1.00 63.56  ? 1026 ALA C CA  1 
ATOM   3070 C C   . ALA C 1 135 ? 6.286   88.655  32.135 1.00 65.70  ? 1026 ALA C C   1 
ATOM   3071 O O   . ALA C 1 135 ? 5.387   89.497  32.172 1.00 68.16  ? 1026 ALA C O   1 
ATOM   3072 C CB  . ALA C 1 135 ? 6.245   86.237  32.554 1.00 60.86  ? 1026 ALA C CB  1 
ATOM   3073 N N   . LEU C 1 136 ? 7.515   88.868  32.598 1.00 64.66  ? 1027 LEU C N   1 
ATOM   3074 C CA  . LEU C 1 136 ? 7.900   90.134  33.200 1.00 61.37  ? 1027 LEU C CA  1 
ATOM   3075 C C   . LEU C 1 136 ? 7.344   91.322  32.401 1.00 60.35  ? 1027 LEU C C   1 
ATOM   3076 O O   . LEU C 1 136 ? 6.567   92.117  32.933 1.00 62.25  ? 1027 LEU C O   1 
ATOM   3077 C CB  . LEU C 1 136 ? 9.428   90.215  33.305 1.00 59.98  ? 1027 LEU C CB  1 
ATOM   3078 C CG  . LEU C 1 136 ? 10.013  91.397  34.094 1.00 61.99  ? 1027 LEU C CG  1 
ATOM   3079 C CD1 . LEU C 1 136 ? 9.545   91.362  35.546 1.00 61.26  ? 1027 LEU C CD1 1 
ATOM   3080 C CD2 . LEU C 1 136 ? 11.528  91.341  34.050 1.00 60.02  ? 1027 LEU C CD2 1 
ATOM   3081 N N   . ALA C 1 137 ? 7.715   91.424  31.126 1.00 56.97  ? 1028 ALA C N   1 
ATOM   3082 C CA  . ALA C 1 137 ? 7.259   92.519  30.266 1.00 59.56  ? 1028 ALA C CA  1 
ATOM   3083 C C   . ALA C 1 137 ? 5.739   92.640  30.144 1.00 60.90  ? 1028 ALA C C   1 
ATOM   3084 O O   . ALA C 1 137 ? 5.198   93.744  30.215 1.00 57.57  ? 1028 ALA C O   1 
ATOM   3085 C CB  . ALA C 1 137 ? 7.884   92.382  28.873 1.00 54.51  ? 1028 ALA C CB  1 
ATOM   3086 N N   . VAL C 1 138 ? 5.056   91.511  29.948 1.00 61.92  ? 1029 VAL C N   1 
ATOM   3087 C CA  . VAL C 1 138 ? 3.604   91.524  29.819 1.00 61.55  ? 1029 VAL C CA  1 
ATOM   3088 C C   . VAL C 1 138 ? 3.010   92.167  31.051 1.00 62.18  ? 1029 VAL C C   1 
ATOM   3089 O O   . VAL C 1 138 ? 2.140   93.043  30.965 1.00 61.82  ? 1029 VAL C O   1 
ATOM   3090 C CB  . VAL C 1 138 ? 3.037   90.108  29.708 1.00 61.25  ? 1029 VAL C CB  1 
ATOM   3091 C CG1 . VAL C 1 138 ? 1.510   90.142  29.773 1.00 61.00  ? 1029 VAL C CG1 1 
ATOM   3092 C CG2 . VAL C 1 138 ? 3.498   89.491  28.420 1.00 58.16  ? 1029 VAL C CG2 1 
ATOM   3093 N N   . ASP C 1 139 ? 3.490   91.699  32.200 1.00 60.81  ? 1030 ASP C N   1 
ATOM   3094 C CA  . ASP C 1 139 ? 3.057   92.197  33.496 1.00 62.94  ? 1030 ASP C CA  1 
ATOM   3095 C C   . ASP C 1 139 ? 3.484   93.628  33.809 1.00 62.55  ? 1030 ASP C C   1 
ATOM   3096 O O   . ASP C 1 139 ? 2.815   94.315  34.579 1.00 63.20  ? 1030 ASP C O   1 
ATOM   3097 C CB  . ASP C 1 139 ? 3.551   91.264  34.600 1.00 63.44  ? 1030 ASP C CB  1 
ATOM   3098 C CG  . ASP C 1 139 ? 2.684   90.032  34.736 1.00 68.24  ? 1030 ASP C CG  1 
ATOM   3099 O OD1 . ASP C 1 139 ? 1.461   90.142  34.512 1.00 66.43  ? 1030 ASP C OD1 1 
ATOM   3100 O OD2 . ASP C 1 139 ? 3.207   88.952  35.078 1.00 72.34  ? 1030 ASP C OD2 1 
ATOM   3101 N N   . ALA C 1 140 ? 4.609   94.066  33.251 1.00 61.05  ? 1031 ALA C N   1 
ATOM   3102 C CA  . ALA C 1 140 ? 5.053   95.428  33.470 1.00 61.26  ? 1031 ALA C CA  1 
ATOM   3103 C C   . ALA C 1 140 ? 4.022   96.300  32.746 1.00 63.40  ? 1031 ALA C C   1 
ATOM   3104 O O   . ALA C 1 140 ? 3.689   97.406  33.174 1.00 65.03  ? 1031 ALA C O   1 
ATOM   3105 C CB  . ALA C 1 140 ? 6.432   95.637  32.871 1.00 58.88  ? 1031 ALA C CB  1 
ATOM   3106 N N   . LYS C 1 141 ? 3.503   95.783  31.641 1.00 62.90  ? 1032 LYS C N   1 
ATOM   3107 C CA  . LYS C 1 141 ? 2.522   96.515  30.873 1.00 62.71  ? 1032 LYS C CA  1 
ATOM   3108 C C   . LYS C 1 141 ? 1.167   96.480  31.555 1.00 63.71  ? 1032 LYS C C   1 
ATOM   3109 O O   . LYS C 1 141 ? 0.331   97.348  31.314 1.00 67.69  ? 1032 LYS C O   1 
ATOM   3110 C CB  . LYS C 1 141 ? 2.437   95.932  29.466 1.00 63.13  ? 1032 LYS C CB  1 
ATOM   3111 C CG  . LYS C 1 141 ? 3.511   96.471  28.535 1.00 61.44  ? 1032 LYS C CG  1 
ATOM   3112 C CD  . LYS C 1 141 ? 3.752   95.566  27.338 1.00 61.14  ? 1032 LYS C CD  1 
ATOM   3113 C CE  . LYS C 1 141 ? 2.863   95.891  26.167 1.00 66.83  ? 1032 LYS C CE  1 
ATOM   3114 N NZ  . LYS C 1 141 ? 3.267   95.096  24.975 1.00 71.00  ? 1032 LYS C NZ  1 
ATOM   3115 N N   . ASN C 1 142 ? 0.937   95.487  32.405 1.00 62.83  ? 1033 ASN C N   1 
ATOM   3116 C CA  . ASN C 1 142 ? -0.340  95.417  33.091 1.00 63.18  ? 1033 ASN C CA  1 
ATOM   3117 C C   . ASN C 1 142 ? -0.331  96.345  34.287 1.00 59.98  ? 1033 ASN C C   1 
ATOM   3118 O O   . ASN C 1 142 ? -1.377  96.849  34.688 1.00 59.81  ? 1033 ASN C O   1 
ATOM   3119 C CB  . ASN C 1 142 ? -0.653  93.985  33.495 1.00 67.95  ? 1033 ASN C CB  1 
ATOM   3120 C CG  . ASN C 1 142 ? -1.048  93.129  32.306 1.00 78.25  ? 1033 ASN C CG  1 
ATOM   3121 O OD1 . ASN C 1 142 ? -1.257  91.927  32.446 1.00 80.60  ? 1033 ASN C OD1 1 
ATOM   3122 N ND2 . ASN C 1 142 ? -1.161  93.749  31.119 1.00 85.79  ? 1033 ASN C ND2 1 
ATOM   3123 N N   . LEU C 1 143 ? 0.854   96.595  34.837 1.00 55.38  ? 1034 LEU C N   1 
ATOM   3124 C CA  . LEU C 1 143 ? 0.974   97.495  35.970 1.00 55.78  ? 1034 LEU C CA  1 
ATOM   3125 C C   . LEU C 1 143 ? 0.527   98.869  35.485 1.00 59.58  ? 1034 LEU C C   1 
ATOM   3126 O O   . LEU C 1 143 ? -0.331  99.526  36.092 1.00 62.91  ? 1034 LEU C O   1 
ATOM   3127 C CB  . LEU C 1 143 ? 2.428   97.575  36.447 1.00 50.66  ? 1034 LEU C CB  1 
ATOM   3128 C CG  . LEU C 1 143 ? 2.733   98.582  37.564 1.00 52.79  ? 1034 LEU C CG  1 
ATOM   3129 C CD1 . LEU C 1 143 ? 2.001   98.203  38.827 1.00 52.99  ? 1034 LEU C CD1 1 
ATOM   3130 C CD2 . LEU C 1 143 ? 4.214   98.598  37.833 1.00 52.56  ? 1034 LEU C CD2 1 
ATOM   3131 N N   . LEU C 1 144 ? 1.131   99.292  34.380 1.00 59.52  ? 1035 LEU C N   1 
ATOM   3132 C CA  . LEU C 1 144 ? 0.838   100.577 33.786 1.00 55.83  ? 1035 LEU C CA  1 
ATOM   3133 C C   . LEU C 1 144 ? -0.650  100.613 33.536 1.00 54.51  ? 1035 LEU C C   1 
ATOM   3134 O O   . LEU C 1 144 ? -1.290  101.596 33.836 1.00 55.21  ? 1035 LEU C O   1 
ATOM   3135 C CB  . LEU C 1 144 ? 1.587   100.728 32.464 1.00 56.05  ? 1035 LEU C CB  1 
ATOM   3136 C CG  . LEU C 1 144 ? 1.741   102.090 31.790 1.00 54.08  ? 1035 LEU C CG  1 
ATOM   3137 C CD1 . LEU C 1 144 ? 1.942   101.874 30.299 1.00 50.09  ? 1035 LEU C CD1 1 
ATOM   3138 C CD2 . LEU C 1 144 ? 0.519   102.939 31.997 1.00 54.26  ? 1035 LEU C CD2 1 
ATOM   3139 N N   . ASP C 1 145 ? -1.214  99.538  33.006 1.00 57.52  ? 1036 ASP C N   1 
ATOM   3140 C CA  . ASP C 1 145 ? -2.640  99.545  32.737 1.00 61.42  ? 1036 ASP C CA  1 
ATOM   3141 C C   . ASP C 1 145 ? -3.458  99.818  33.969 1.00 61.38  ? 1036 ASP C C   1 
ATOM   3142 O O   . ASP C 1 145 ? -4.426  100.562 33.899 1.00 59.91  ? 1036 ASP C O   1 
ATOM   3143 C CB  . ASP C 1 145 ? -3.141  98.240  32.160 1.00 66.77  ? 1036 ASP C CB  1 
ATOM   3144 C CG  . ASP C 1 145 ? -4.643  98.280  31.918 1.00 77.28  ? 1036 ASP C CG  1 
ATOM   3145 O OD1 . ASP C 1 145 ? -5.353  97.283  32.193 1.00 82.59  ? 1036 ASP C OD1 1 
ATOM   3146 O OD2 . ASP C 1 145 ? -5.122  99.336  31.447 1.00 78.52  ? 1036 ASP C OD2 1 
ATOM   3147 N N   . VAL C 1 146 ? -3.084  99.207  35.093 1.00 63.22  ? 1037 VAL C N   1 
ATOM   3148 C CA  . VAL C 1 146 ? -3.805  99.409  36.361 1.00 64.25  ? 1037 VAL C CA  1 
ATOM   3149 C C   . VAL C 1 146 ? -3.740  100.882 36.788 1.00 63.25  ? 1037 VAL C C   1 
ATOM   3150 O O   . VAL C 1 146 ? -4.772  101.551 36.970 1.00 64.32  ? 1037 VAL C O   1 
ATOM   3151 C CB  . VAL C 1 146 ? -3.201  98.547  37.501 1.00 64.76  ? 1037 VAL C CB  1 
ATOM   3152 C CG1 . VAL C 1 146 ? -3.935  98.800  38.801 1.00 66.04  ? 1037 VAL C CG1 1 
ATOM   3153 C CG2 . VAL C 1 146 ? -3.300  97.100  37.146 1.00 67.08  ? 1037 VAL C CG2 1 
ATOM   3154 N N   . ILE C 1 147 ? -2.516  101.366 36.970 1.00 56.80  ? 1038 ILE C N   1 
ATOM   3155 C CA  . ILE C 1 147 ? -2.279  102.745 37.344 1.00 54.25  ? 1038 ILE C CA  1 
ATOM   3156 C C   . ILE C 1 147 ? -3.048  103.756 36.463 1.00 59.42  ? 1038 ILE C C   1 
ATOM   3157 O O   . ILE C 1 147 ? -3.537  104.782 36.952 1.00 61.95  ? 1038 ILE C O   1 
ATOM   3158 C CB  . ILE C 1 147 ? -0.803  103.032 37.258 1.00 46.70  ? 1038 ILE C CB  1 
ATOM   3159 C CG1 . ILE C 1 147 ? -0.134  102.336 38.417 1.00 42.99  ? 1038 ILE C CG1 1 
ATOM   3160 C CG2 . ILE C 1 147 ? -0.528  104.546 37.201 1.00 41.66  ? 1038 ILE C CG2 1 
ATOM   3161 C CD1 . ILE C 1 147 ? 1.373   102.297 38.327 1.00 43.40  ? 1038 ILE C CD1 1 
ATOM   3162 N N   . ASP C 1 148 ? -3.149  103.500 35.165 1.00 61.97  ? 1039 ASP C N   1 
ATOM   3163 C CA  . ASP C 1 148 ? -3.890  104.427 34.333 1.00 65.46  ? 1039 ASP C CA  1 
ATOM   3164 C C   . ASP C 1 148 ? -5.319  104.445 34.829 1.00 66.79  ? 1039 ASP C C   1 
ATOM   3165 O O   . ASP C 1 148 ? -5.857  105.517 35.087 1.00 65.28  ? 1039 ASP C O   1 
ATOM   3166 C CB  . ASP C 1 148 ? -3.813  104.029 32.861 1.00 61.36  ? 1039 ASP C CB  1 
ATOM   3167 C CG  . ASP C 1 148 ? -2.553  104.566 32.180 1.00 62.80  ? 1039 ASP C CG  1 
ATOM   3168 O OD1 . ASP C 1 148 ? -1.702  105.194 32.869 1.00 56.77  ? 1039 ASP C OD1 1 
ATOM   3169 O OD2 . ASP C 1 148 ? -2.413  104.361 30.953 1.00 58.20  ? 1039 ASP C OD2 1 
ATOM   3170 N N   . GLN C 1 149 ? -5.931  103.272 34.984 1.00 71.10  ? 1040 GLN C N   1 
ATOM   3171 C CA  . GLN C 1 149 ? -7.307  103.225 35.475 1.00 76.91  ? 1040 GLN C CA  1 
ATOM   3172 C C   . GLN C 1 149 ? -7.383  104.003 36.798 1.00 77.51  ? 1040 GLN C C   1 
ATOM   3173 O O   . GLN C 1 149 ? -8.413  104.597 37.140 1.00 77.65  ? 1040 GLN C O   1 
ATOM   3174 C CB  . GLN C 1 149 ? -7.745  101.782 35.718 1.00 78.99  ? 1040 GLN C CB  1 
ATOM   3175 C CG  . GLN C 1 149 ? -7.745  100.917 34.486 1.00 90.52  ? 1040 GLN C CG  1 
ATOM   3176 C CD  . GLN C 1 149 ? -7.866  99.433  34.821 1.00 100.55 ? 1040 GLN C CD  1 
ATOM   3177 O OE1 . GLN C 1 149 ? -8.948  98.946  35.165 1.00 106.70 ? 1040 GLN C OE1 1 
ATOM   3178 N NE2 . GLN C 1 149 ? -6.747  98.709  34.732 1.00 104.39 ? 1040 GLN C NE2 1 
ATOM   3179 N N   . ALA C 1 150 ? -6.274  104.003 37.533 1.00 75.65  ? 1041 ALA C N   1 
ATOM   3180 C CA  . ALA C 1 150 ? -6.207  104.677 38.824 1.00 74.23  ? 1041 ALA C CA  1 
ATOM   3181 C C   . ALA C 1 150 ? -6.172  106.186 38.670 1.00 73.79  ? 1041 ALA C C   1 
ATOM   3182 O O   . ALA C 1 150 ? -6.602  106.913 39.560 1.00 77.81  ? 1041 ALA C O   1 
ATOM   3183 C CB  . ALA C 1 150 ? -4.985  104.206 39.603 1.00 72.43  ? 1041 ALA C CB  1 
ATOM   3184 N N   . ARG C 1 151 ? -5.654  106.675 37.554 1.00 70.94  ? 1042 ARG C N   1 
ATOM   3185 C CA  . ARG C 1 151 ? -5.629  108.112 37.376 1.00 68.31  ? 1042 ARG C CA  1 
ATOM   3186 C C   . ARG C 1 151 ? -6.994  108.473 36.810 1.00 67.66  ? 1042 ARG C C   1 
ATOM   3187 O O   . ARG C 1 151 ? -7.572  109.492 37.177 1.00 67.10  ? 1042 ARG C O   1 
ATOM   3188 C CB  . ARG C 1 151 ? -4.497  108.515 36.438 1.00 65.12  ? 1042 ARG C CB  1 
ATOM   3189 C CG  . ARG C 1 151 ? -3.117  108.260 37.026 1.00 64.34  ? 1042 ARG C CG  1 
ATOM   3190 C CD  . ARG C 1 151 ? -2.175  107.730 35.942 1.00 62.06  ? 1042 ARG C CD  1 
ATOM   3191 N NE  . ARG C 1 151 ? -0.755  107.794 36.298 1.00 53.65  ? 1042 ARG C NE  1 
ATOM   3192 C CZ  . ARG C 1 151 ? 0.231   107.565 35.431 1.00 55.23  ? 1042 ARG C CZ  1 
ATOM   3193 N NH1 . ARG C 1 151 ? -0.050  107.262 34.166 1.00 50.33  ? 1042 ARG C NH1 1 
ATOM   3194 N NH2 . ARG C 1 151 ? 1.500   107.647 35.812 1.00 50.32  ? 1042 ARG C NH2 1 
ATOM   3195 N N   . LEU C 1 152 ? -7.526  107.634 35.927 1.00 67.42  ? 1043 LEU C N   1 
ATOM   3196 C CA  . LEU C 1 152 ? -8.835  107.932 35.377 1.00 70.96  ? 1043 LEU C CA  1 
ATOM   3197 C C   . LEU C 1 152 ? -9.784  108.129 36.551 1.00 76.15  ? 1043 LEU C C   1 
ATOM   3198 O O   . LEU C 1 152 ? -10.415 109.186 36.658 1.00 76.33  ? 1043 LEU C O   1 
ATOM   3199 C CB  . LEU C 1 152 ? -9.322  106.818 34.434 1.00 68.36  ? 1043 LEU C CB  1 
ATOM   3200 C CG  . LEU C 1 152 ? -8.518  106.699 33.117 1.00 67.65  ? 1043 LEU C CG  1 
ATOM   3201 C CD1 . LEU C 1 152 ? -9.357  105.976 32.055 1.00 62.46  ? 1043 LEU C CD1 1 
ATOM   3202 C CD2 . LEU C 1 152 ? -8.112  108.088 32.599 1.00 60.62  ? 1043 LEU C CD2 1 
ATOM   3203 N N   . LYS C 1 153 ? -9.883  107.130 37.432 1.00 80.87  ? 1044 LYS C N   1 
ATOM   3204 C CA  . LYS C 1 153 ? -10.755 107.239 38.613 1.00 81.68  ? 1044 LYS C CA  1 
ATOM   3205 C C   . LYS C 1 153 ? -10.574 108.606 39.313 1.00 79.52  ? 1044 LYS C C   1 
ATOM   3206 O O   . LYS C 1 153 ? -11.504 109.417 39.372 1.00 76.81  ? 1044 LYS C O   1 
ATOM   3207 C CB  . LYS C 1 153 ? -10.462 106.115 39.626 1.00 82.92  ? 1044 LYS C CB  1 
ATOM   3208 C CG  . LYS C 1 153 ? -11.663 105.171 39.916 1.00 89.02  ? 1044 LYS C CG  1 
ATOM   3209 C CD  . LYS C 1 153 ? -11.707 104.801 41.411 1.00 91.30  ? 1044 LYS C CD  1 
ATOM   3210 C CE  . LYS C 1 153 ? -12.659 103.646 41.725 1.00 90.97  ? 1044 LYS C CE  1 
ATOM   3211 N NZ  . LYS C 1 153 ? -12.567 103.214 43.162 1.00 92.33  ? 1044 LYS C NZ  1 
ATOM   3212 N N   . MET C 1 154 ? -9.371  108.859 39.825 1.00 77.18  ? 1045 MET C N   1 
ATOM   3213 C CA  . MET C 1 154 ? -9.083  110.100 40.527 1.00 79.17  ? 1045 MET C CA  1 
ATOM   3214 C C   . MET C 1 154 ? -9.587  111.351 39.814 1.00 82.81  ? 1045 MET C C   1 
ATOM   3215 O O   . MET C 1 154 ? -9.893  112.341 40.464 1.00 86.74  ? 1045 MET C O   1 
ATOM   3216 C CB  . MET C 1 154 ? -7.585  110.218 40.786 1.00 74.88  ? 1045 MET C CB  1 
ATOM   3217 C CG  . MET C 1 154 ? -7.188  111.533 41.408 1.00 76.39  ? 1045 MET C CG  1 
ATOM   3218 S SD  . MET C 1 154 ? -5.443  111.564 41.774 1.00 86.88  ? 1045 MET C SD  1 
ATOM   3219 C CE  . MET C 1 154 ? -5.321  112.851 42.929 1.00 78.91  ? 1045 MET C CE  1 
ATOM   3220 N N   . LEU C 1 155 ? -9.703  111.297 38.487 1.00 85.88  ? 1046 LEU C N   1 
ATOM   3221 C CA  . LEU C 1 155 ? -10.169 112.444 37.705 1.00 87.15  ? 1046 LEU C CA  1 
ATOM   3222 C C   . LEU C 1 155 ? -11.662 112.592 37.579 1.00 89.21  ? 1046 LEU C C   1 
ATOM   3223 O O   . LEU C 1 155 ? -12.208 113.686 37.765 1.00 87.96  ? 1046 LEU C O   1 
ATOM   3224 C CB  . LEU C 1 155 ? -9.570  112.418 36.300 1.00 86.75  ? 1046 LEU C CB  1 
ATOM   3225 C CG  . LEU C 1 155 ? -8.071  112.684 36.229 1.00 83.61  ? 1046 LEU C CG  1 
ATOM   3226 C CD1 . LEU C 1 155 ? -7.687  112.880 34.788 1.00 82.48  ? 1046 LEU C CD1 1 
ATOM   3227 C CD2 . LEU C 1 155 ? -7.732  113.916 37.035 1.00 82.02  ? 1046 LEU C CD2 1 
ATOM   3228 N N   . GLY C 1 156 ? -12.310 111.499 37.209 1.00 91.25  ? 1047 GLY C N   1 
ATOM   3229 C CA  . GLY C 1 156 ? -13.749 111.528 37.082 1.00 97.54  ? 1047 GLY C CA  1 
ATOM   3230 C C   . GLY C 1 156 ? -14.353 110.924 38.354 1.00 101.89 ? 1047 GLY C C   1 
ATOM   3231 O O   . GLY C 1 156 ? -14.739 109.720 38.321 1.00 103.22 ? 1047 GLY C O   1 
ATOM   3232 N N   . LEU D 2 2   ? 24.552  35.626  19.704 1.00 117.66 ? 2    LEU D N   1 
ATOM   3233 C CA  . LEU D 2 2   ? 24.357  34.278  20.262 1.00 114.44 ? 2    LEU D CA  1 
ATOM   3234 C C   . LEU D 2 2   ? 24.834  33.168  19.339 1.00 113.44 ? 2    LEU D C   1 
ATOM   3235 O O   . LEU D 2 2   ? 25.095  32.074  19.842 1.00 114.68 ? 2    LEU D O   1 
ATOM   3236 C CB  . LEU D 2 2   ? 22.875  33.962  20.545 1.00 112.61 ? 2    LEU D CB  1 
ATOM   3237 C CG  . LEU D 2 2   ? 22.502  33.078  21.736 1.00 108.78 ? 2    LEU D CG  1 
ATOM   3238 C CD1 . LEU D 2 2   ? 23.556  33.273  22.797 1.00 107.88 ? 2    LEU D CD1 1 
ATOM   3239 C CD2 . LEU D 2 2   ? 21.126  33.416  22.307 1.00 108.74 ? 2    LEU D CD2 1 
ATOM   3240 N N   . SER D 2 3   ? 24.797  33.383  18.020 1.00 111.66 ? 3    SER D N   1 
ATOM   3241 C CA  . SER D 2 3   ? 25.055  32.284  17.089 1.00 109.72 ? 3    SER D CA  1 
ATOM   3242 C C   . SER D 2 3   ? 26.508  31.907  17.399 1.00 110.61 ? 3    SER D C   1 
ATOM   3243 O O   . SER D 2 3   ? 26.793  30.705  17.546 1.00 112.46 ? 3    SER D O   1 
ATOM   3244 C CB  . SER D 2 3   ? 24.680  32.576  15.611 1.00 106.97 ? 3    SER D CB  1 
ATOM   3245 O OG  . SER D 2 3   ? 25.660  32.185  14.642 1.00 98.81  ? 3    SER D OG  1 
ATOM   3246 N N   . GLU D 2 4   ? 27.319  32.884  17.819 1.00 109.82 ? 4    GLU D N   1 
ATOM   3247 C CA  . GLU D 2 4   ? 28.726  32.656  18.219 1.00 110.10 ? 4    GLU D CA  1 
ATOM   3248 C C   . GLU D 2 4   ? 28.790  31.808  19.530 1.00 107.53 ? 4    GLU D C   1 
ATOM   3249 O O   . GLU D 2 4   ? 29.558  30.837  19.639 1.00 105.89 ? 4    GLU D O   1 
ATOM   3250 C CB  . GLU D 2 4   ? 29.430  34.025  18.390 1.00 112.04 ? 4    GLU D CB  1 
ATOM   3251 C CG  . GLU D 2 4   ? 29.209  34.914  17.163 1.00 122.93 ? 4    GLU D CG  1 
ATOM   3252 C CD  . GLU D 2 4   ? 30.443  35.021  16.260 1.00 129.22 ? 4    GLU D CD  1 
ATOM   3253 O OE1 . GLU D 2 4   ? 31.498  35.488  16.749 1.00 132.56 ? 4    GLU D OE1 1 
ATOM   3254 O OE2 . GLU D 2 4   ? 30.359  34.664  15.061 1.00 130.81 ? 4    GLU D OE2 1 
ATOM   3255 N N   . LEU D 2 5   ? 27.936  32.124  20.510 1.00 102.73 ? 5    LEU D N   1 
ATOM   3256 C CA  . LEU D 2 5   ? 27.903  31.379  21.772 1.00 95.72  ? 5    LEU D CA  1 
ATOM   3257 C C   . LEU D 2 5   ? 27.481  29.948  21.395 1.00 96.06  ? 5    LEU D C   1 
ATOM   3258 O O   . LEU D 2 5   ? 27.960  28.953  21.942 1.00 94.56  ? 5    LEU D O   1 
ATOM   3259 C CB  . LEU D 2 5   ? 26.873  31.987  22.739 1.00 89.01  ? 5    LEU D CB  1 
ATOM   3260 C CG  . LEU D 2 5   ? 26.660  31.272  24.061 1.00 83.02  ? 5    LEU D CG  1 
ATOM   3261 C CD1 . LEU D 2 5   ? 27.953  31.327  24.792 1.00 79.16  ? 5    LEU D CD1 1 
ATOM   3262 C CD2 . LEU D 2 5   ? 25.577  31.932  24.872 1.00 78.33  ? 5    LEU D CD2 1 
ATOM   3263 N N   . ASP D 2 6   ? 26.550  29.856  20.437 1.00 97.00  ? 6    ASP D N   1 
ATOM   3264 C CA  . ASP D 2 6   ? 26.030  28.557  19.953 1.00 98.65  ? 6    ASP D CA  1 
ATOM   3265 C C   . ASP D 2 6   ? 27.095  27.761  19.184 1.00 97.28  ? 6    ASP D C   1 
ATOM   3266 O O   . ASP D 2 6   ? 27.108  26.522  19.201 1.00 97.33  ? 6    ASP D O   1 
ATOM   3267 C CB  . ASP D 2 6   ? 24.777  28.748  19.056 1.00 101.36 ? 6    ASP D CB  1 
ATOM   3268 C CG  . ASP D 2 6   ? 23.573  29.301  19.819 1.00 105.46 ? 6    ASP D CG  1 
ATOM   3269 O OD1 . ASP D 2 6   ? 23.125  28.665  20.822 1.00 108.48 ? 6    ASP D OD1 1 
ATOM   3270 O OD2 . ASP D 2 6   ? 23.076  30.377  19.406 1.00 104.75 ? 6    ASP D OD2 1 
ATOM   3271 N N   . ARG D 2 7   ? 27.995  28.495  18.523 1.00 95.43  ? 7    ARG D N   1 
ATOM   3272 C CA  . ARG D 2 7   ? 29.085  27.886  17.763 1.00 97.86  ? 7    ARG D CA  1 
ATOM   3273 C C   . ARG D 2 7   ? 30.114  27.263  18.706 1.00 96.41  ? 7    ARG D C   1 
ATOM   3274 O O   . ARG D 2 7   ? 30.830  26.317  18.343 1.00 96.20  ? 7    ARG D O   1 
ATOM   3275 C CB  . ARG D 2 7   ? 29.773  28.924  16.853 1.00 100.73 ? 7    ARG D CB  1 
ATOM   3276 C CG  . ARG D 2 7   ? 29.081  29.139  15.519 1.00 102.30 ? 7    ARG D CG  1 
ATOM   3277 C CD  . ARG D 2 7   ? 30.068  29.650  14.508 1.00 106.45 ? 7    ARG D CD  1 
ATOM   3278 N NE  . ARG D 2 7   ? 29.407  30.427  13.470 1.00 115.33 ? 7    ARG D NE  1 
ATOM   3279 C CZ  . ARG D 2 7   ? 29.829  31.616  13.057 1.00 121.01 ? 7    ARG D CZ  1 
ATOM   3280 N NH1 . ARG D 2 7   ? 30.928  32.156  13.585 1.00 123.73 ? 7    ARG D NH1 1 
ATOM   3281 N NH2 . ARG D 2 7   ? 29.155  32.275  12.122 1.00 122.36 ? 7    ARG D NH2 1 
ATOM   3282 N N   . LEU D 2 8   ? 30.168  27.809  19.921 1.00 93.02  ? 8    LEU D N   1 
ATOM   3283 C CA  . LEU D 2 8   ? 31.061  27.334  20.954 1.00 86.53  ? 8    LEU D CA  1 
ATOM   3284 C C   . LEU D 2 8   ? 30.362  26.078  21.418 1.00 86.26  ? 8    LEU D C   1 
ATOM   3285 O O   . LEU D 2 8   ? 30.858  24.973  21.226 1.00 87.09  ? 8    LEU D O   1 
ATOM   3286 C CB  . LEU D 2 8   ? 31.138  28.366  22.076 1.00 81.37  ? 8    LEU D CB  1 
ATOM   3287 C CG  . LEU D 2 8   ? 31.725  29.689  21.604 1.00 77.22  ? 8    LEU D CG  1 
ATOM   3288 C CD1 . LEU D 2 8   ? 31.140  30.783  22.432 1.00 76.91  ? 8    LEU D CD1 1 
ATOM   3289 C CD2 . LEU D 2 8   ? 33.248  29.666  21.713 1.00 74.08  ? 8    LEU D CD2 1 
ATOM   3290 N N   . LEU D 2 9   ? 29.179  26.253  21.999 1.00 84.01  ? 9    LEU D N   1 
ATOM   3291 C CA  . LEU D 2 9   ? 28.396  25.122  22.468 1.00 85.57  ? 9    LEU D CA  1 
ATOM   3292 C C   . LEU D 2 9   ? 28.533  23.918  21.518 1.00 88.45  ? 9    LEU D C   1 
ATOM   3293 O O   . LEU D 2 9   ? 28.688  22.769  21.961 1.00 90.90  ? 9    LEU D O   1 
ATOM   3294 C CB  . LEU D 2 9   ? 26.936  25.549  22.584 1.00 82.84  ? 9    LEU D CB  1 
ATOM   3295 C CG  . LEU D 2 9   ? 26.729  26.644  23.612 1.00 79.26  ? 9    LEU D CG  1 
ATOM   3296 C CD1 . LEU D 2 9   ? 25.370  27.226  23.462 1.00 80.14  ? 9    LEU D CD1 1 
ATOM   3297 C CD2 . LEU D 2 9   ? 26.913  26.060  24.987 1.00 74.73  ? 9    LEU D CD2 1 
ATOM   3298 N N   . LEU D 2 10  ? 28.491  24.183  20.208 1.00 88.78  ? 10   LEU D N   1 
ATOM   3299 C CA  . LEU D 2 10  ? 28.614  23.111  19.208 1.00 88.85  ? 10   LEU D CA  1 
ATOM   3300 C C   . LEU D 2 10  ? 29.962  22.360  19.346 1.00 89.73  ? 10   LEU D C   1 
ATOM   3301 O O   . LEU D 2 10  ? 29.998  21.127  19.194 1.00 90.15  ? 10   LEU D O   1 
ATOM   3302 C CB  . LEU D 2 10  ? 28.462  23.659  17.767 1.00 85.79  ? 10   LEU D CB  1 
ATOM   3303 C CG  . LEU D 2 10  ? 27.091  24.044  17.210 1.00 80.55  ? 10   LEU D CG  1 
ATOM   3304 C CD1 . LEU D 2 10  ? 27.207  24.230  15.700 1.00 75.75  ? 10   LEU D CD1 1 
ATOM   3305 C CD2 . LEU D 2 10  ? 26.090  22.930  17.516 1.00 80.97  ? 10   LEU D CD2 1 
ATOM   3306 N N   . GLU D 2 11  ? 31.035  23.087  19.616 1.00 90.40  ? 11   GLU D N   1 
ATOM   3307 C CA  . GLU D 2 11  ? 32.382  22.506  19.798 1.00 91.53  ? 11   GLU D CA  1 
ATOM   3308 C C   . GLU D 2 11  ? 32.440  21.503  20.967 1.00 91.87  ? 11   GLU D C   1 
ATOM   3309 O O   . GLU D 2 11  ? 33.305  20.614  21.000 1.00 92.82  ? 11   GLU D O   1 
ATOM   3310 C CB  . GLU D 2 11  ? 33.407  23.615  20.045 1.00 91.50  ? 11   GLU D CB  1 
ATOM   3311 C CG  . GLU D 2 11  ? 34.021  24.188  18.798 1.00 95.80  ? 11   GLU D CG  1 
ATOM   3312 C CD  . GLU D 2 11  ? 34.869  25.432  19.061 1.00 97.03  ? 11   GLU D CD  1 
ATOM   3313 O OE1 . GLU D 2 11  ? 34.828  25.958  20.192 1.00 97.35  ? 11   GLU D OE1 1 
ATOM   3314 O OE2 . GLU D 2 11  ? 35.566  25.890  18.127 1.00 102.80 ? 11   GLU D OE2 1 
ATOM   3315 N N   . LEU D 2 12  ? 31.518  21.655  21.908 1.00 90.03  ? 12   LEU D N   1 
ATOM   3316 C CA  . LEU D 2 12  ? 31.470  20.797  23.091 1.00 88.81  ? 12   LEU D CA  1 
ATOM   3317 C C   . LEU D 2 12  ? 30.842  19.416  22.937 1.00 91.10  ? 12   LEU D C   1 
ATOM   3318 O O   . LEU D 2 12  ? 31.403  18.431  23.440 1.00 91.71  ? 12   LEU D O   1 
ATOM   3319 C CB  . LEU D 2 12  ? 30.777  21.533  24.247 1.00 83.00  ? 12   LEU D CB  1 
ATOM   3320 C CG  . LEU D 2 12  ? 31.628  22.502  25.038 1.00 74.12  ? 12   LEU D CG  1 
ATOM   3321 C CD1 . LEU D 2 12  ? 30.754  23.217  25.995 1.00 74.64  ? 12   LEU D CD1 1 
ATOM   3322 C CD2 . LEU D 2 12  ? 32.718  21.746  25.753 1.00 72.87  ? 12   LEU D CD2 1 
ATOM   3323 N N   . ASN D 2 13  ? 29.710  19.334  22.258 1.00 91.98  ? 13   ASN D N   1 
ATOM   3324 C CA  . ASN D 2 13  ? 29.026  18.054  22.087 1.00 96.15  ? 13   ASN D CA  1 
ATOM   3325 C C   . ASN D 2 13  ? 29.918  16.815  21.936 1.00 99.65  ? 13   ASN D C   1 
ATOM   3326 O O   . ASN D 2 13  ? 29.757  15.860  22.767 1.00 101.60 ? 13   ASN D O   1 
ATOM   3327 C CB  . ASN D 2 13  ? 28.075  18.144  20.909 1.00 83.32  ? 13   ASN D CB  1 
ATOM   3328 C CG  . ASN D 2 13  ? 27.041  19.233  21.100 1.00 86.79  ? 13   ASN D CG  1 
ATOM   3329 O OD1 . ASN D 2 13  ? 26.483  19.386  22.204 1.00 76.70  ? 13   ASN D OD1 1 
ATOM   3330 N ND2 . ASN D 2 13  ? 26.763  19.994  20.027 1.00 66.40  ? 13   ASN D ND2 1 
ATOM   3331 O OXT . ASN D 2 13  ? 30.746  16.843  20.974 1.00 90.81  ? 13   ASN D OXT 1 
ATOM   3332 N N   . LEU E 2 2   ? 11.521  95.581  49.090 1.00 130.23 ? 2    LEU F N   1 
ATOM   3333 C CA  . LEU E 2 2   ? 12.584  95.915  48.097 1.00 134.52 ? 2    LEU F CA  1 
ATOM   3334 C C   . LEU E 2 2   ? 13.936  95.269  48.482 1.00 136.26 ? 2    LEU F C   1 
ATOM   3335 O O   . LEU E 2 2   ? 14.717  94.884  47.601 1.00 130.86 ? 2    LEU F O   1 
ATOM   3336 C CB  . LEU E 2 2   ? 12.710  97.437  47.959 1.00 133.42 ? 2    LEU F CB  1 
ATOM   3337 C CG  . LEU E 2 2   ? 13.429  97.873  46.671 1.00 136.41 ? 2    LEU F CG  1 
ATOM   3338 C CD1 . LEU E 2 2   ? 12.932  97.075  45.430 1.00 141.93 ? 2    LEU F CD1 1 
ATOM   3339 C CD2 . LEU E 2 2   ? 13.209  99.363  46.487 1.00 141.14 ? 2    LEU F CD2 1 
ATOM   3340 N N   . SER E 2 3   ? 14.197  95.139  49.783 1.00 130.26 ? 3    SER F N   1 
ATOM   3341 C CA  . SER E 2 3   ? 15.402  94.476  50.289 1.00 132.35 ? 3    SER F CA  1 
ATOM   3342 C C   . SER E 2 3   ? 15.552  93.079  49.620 1.00 133.68 ? 3    SER F C   1 
ATOM   3343 O O   . SER E 2 3   ? 16.668  92.608  49.322 1.00 133.52 ? 3    SER F O   1 
ATOM   3344 C CB  . SER E 2 3   ? 15.256  94.298  51.801 1.00 136.27 ? 3    SER F CB  1 
ATOM   3345 O OG  . SER E 2 3   ? 16.176  93.327  52.254 1.00 138.68 ? 3    SER F OG  1 
ATOM   3346 N N   . GLU E 2 4   ? 14.412  92.420  49.397 1.00 132.63 ? 4    GLU F N   1 
ATOM   3347 C CA  . GLU E 2 4   ? 14.362  91.102  48.756 1.00 131.24 ? 4    GLU F CA  1 
ATOM   3348 C C   . GLU E 2 4   ? 14.741  91.212  47.264 1.00 131.88 ? 4    GLU F C   1 
ATOM   3349 O O   . GLU E 2 4   ? 15.429  90.329  46.732 1.00 126.84 ? 4    GLU F O   1 
ATOM   3350 C CB  . GLU E 2 4   ? 12.955  90.515  48.896 1.00 131.03 ? 4    GLU F CB  1 
ATOM   3351 C CG  . GLU E 2 4   ? 12.406  90.502  50.320 1.00 136.24 ? 4    GLU F CG  1 
ATOM   3352 C CD  . GLU E 2 4   ? 12.513  89.136  50.990 1.00 140.87 ? 4    GLU F CD  1 
ATOM   3353 O OE1 . GLU E 2 4   ? 11.875  88.174  50.497 1.00 142.49 ? 4    GLU F OE1 1 
ATOM   3354 O OE2 . GLU E 2 4   ? 13.233  89.027  52.011 1.00 142.53 ? 4    GLU F OE2 1 
ATOM   3355 N N   . LEU E 2 5   ? 14.286  92.288  46.602 1.00 131.91 ? 5    LEU F N   1 
ATOM   3356 C CA  . LEU E 2 5   ? 14.598  92.548  45.181 1.00 132.61 ? 5    LEU F CA  1 
ATOM   3357 C C   . LEU E 2 5   ? 16.097  92.811  45.094 1.00 134.26 ? 5    LEU F C   1 
ATOM   3358 O O   . LEU E 2 5   ? 16.769  92.377  44.148 1.00 135.92 ? 5    LEU F O   1 
ATOM   3359 C CB  . LEU E 2 5   ? 13.843  93.785  44.641 1.00 130.79 ? 5    LEU F CB  1 
ATOM   3360 C CG  . LEU E 2 5   ? 14.112  94.181  43.173 1.00 128.51 ? 5    LEU F CG  1 
ATOM   3361 C CD1 . LEU E 2 5   ? 13.678  93.037  42.281 1.00 128.45 ? 5    LEU F CD1 1 
ATOM   3362 C CD2 . LEU E 2 5   ? 13.366  95.443  42.779 1.00 125.83 ? 5    LEU F CD2 1 
ATOM   3363 N N   . ASP E 2 6   ? 16.598  93.527  46.106 1.00 135.23 ? 6    ASP F N   1 
ATOM   3364 C CA  . ASP E 2 6   ? 18.014  93.880  46.240 1.00 136.27 ? 6    ASP F CA  1 
ATOM   3365 C C   . ASP E 2 6   ? 18.883  92.645  46.532 1.00 135.27 ? 6    ASP F C   1 
ATOM   3366 O O   . ASP E 2 6   ? 20.032  92.573  46.092 1.00 132.72 ? 6    ASP F O   1 
ATOM   3367 C CB  . ASP E 2 6   ? 18.193  94.920  47.361 1.00 134.68 ? 6    ASP F CB  1 
ATOM   3368 C CG  . ASP E 2 6   ? 17.536  96.255  47.037 1.00 135.78 ? 6    ASP F CG  1 
ATOM   3369 O OD1 . ASP E 2 6   ? 17.882  96.841  45.985 1.00 135.25 ? 6    ASP F OD1 1 
ATOM   3370 O OD2 . ASP E 2 6   ? 16.686  96.718  47.836 1.00 134.84 ? 6    ASP F OD2 1 
ATOM   3371 N N   . ARG E 2 7   ? 18.332  91.687  47.282 1.00 135.43 ? 7    ARG F N   1 
ATOM   3372 C CA  . ARG E 2 7   ? 19.037  90.443  47.608 1.00 137.29 ? 7    ARG F CA  1 
ATOM   3373 C C   . ARG E 2 7   ? 19.203  89.597  46.348 1.00 136.48 ? 7    ARG F C   1 
ATOM   3374 O O   . ARG E 2 7   ? 20.126  88.785  46.246 1.00 134.53 ? 7    ARG F O   1 
ATOM   3375 C CB  . ARG E 2 7   ? 18.263  89.620  48.643 1.00 138.85 ? 7    ARG F CB  1 
ATOM   3376 C CG  . ARG E 2 7   ? 18.383  90.106  50.073 1.00 140.74 ? 7    ARG F CG  1 
ATOM   3377 C CD  . ARG E 2 7   ? 18.089  88.967  51.033 1.00 141.04 ? 7    ARG F CD  1 
ATOM   3378 N NE  . ARG E 2 7   ? 17.752  89.456  52.365 1.00 139.48 ? 7    ARG F NE  1 
ATOM   3379 C CZ  . ARG E 2 7   ? 16.732  88.995  53.078 1.00 138.40 ? 7    ARG F CZ  1 
ATOM   3380 N NH1 . ARG E 2 7   ? 15.959  88.035  52.580 1.00 136.99 ? 7    ARG F NH1 1 
ATOM   3381 N NH2 . ARG E 2 7   ? 16.472  89.499  54.278 1.00 133.99 ? 7    ARG F NH2 1 
ATOM   3382 N N   . LEU E 2 8   ? 18.278  89.783  45.406 1.00 136.21 ? 8    LEU F N   1 
ATOM   3383 C CA  . LEU E 2 8   ? 18.293  89.085  44.124 1.00 133.97 ? 8    LEU F CA  1 
ATOM   3384 C C   . LEU E 2 8   ? 19.399  89.750  43.313 1.00 135.06 ? 8    LEU F C   1 
ATOM   3385 O O   . LEU E 2 8   ? 20.333  89.089  42.850 1.00 136.42 ? 8    LEU F O   1 
ATOM   3386 C CB  . LEU E 2 8   ? 16.943  89.269  43.423 1.00 132.71 ? 8    LEU F CB  1 
ATOM   3387 C CG  . LEU E 2 8   ? 15.722  88.649  44.116 1.00 129.71 ? 8    LEU F CG  1 
ATOM   3388 C CD1 . LEU E 2 8   ? 14.458  89.392  43.722 1.00 129.52 ? 8    LEU F CD1 1 
ATOM   3389 C CD2 . LEU E 2 8   ? 15.639  87.170  43.763 1.00 130.44 ? 8    LEU F CD2 1 
ATOM   3390 N N   . LEU E 2 9   ? 19.279  91.071  43.174 1.00 135.38 ? 9    LEU F N   1 
ATOM   3391 C CA  . LEU E 2 9   ? 20.246  91.901  42.464 1.00 134.41 ? 9    LEU F CA  1 
ATOM   3392 C C   . LEU E 2 9   ? 21.690  91.584  42.920 1.00 133.40 ? 9    LEU F C   1 
ATOM   3393 O O   . LEU E 2 9   ? 22.592  91.483  42.081 1.00 132.77 ? 9    LEU F O   1 
ATOM   3394 C CB  . LEU E 2 9   ? 19.896  93.386  42.695 1.00 132.07 ? 9    LEU F CB  1 
ATOM   3395 C CG  . LEU E 2 9   ? 18.557  93.866  42.093 1.00 129.86 ? 9    LEU F CG  1 
ATOM   3396 C CD1 . LEU E 2 9   ? 18.160  95.234  42.630 1.00 130.01 ? 9    LEU F CD1 1 
ATOM   3397 C CD2 . LEU E 2 9   ? 18.683  93.910  40.585 1.00 128.81 ? 9    LEU F CD2 1 
ATOM   3398 N N   . LEU E 2 10  ? 21.890  91.416  44.238 1.00 133.97 ? 10   LEU F N   1 
ATOM   3399 C CA  . LEU E 2 10  ? 23.202  91.081  44.832 1.00 132.74 ? 10   LEU F CA  1 
ATOM   3400 C C   . LEU E 2 10  ? 23.756  89.784  44.252 1.00 134.11 ? 10   LEU F C   1 
ATOM   3401 O O   . LEU E 2 10  ? 24.948  89.673  43.958 1.00 131.34 ? 10   LEU F O   1 
ATOM   3402 C CB  . LEU E 2 10  ? 23.092  90.901  46.355 1.00 132.40 ? 10   LEU F CB  1 
ATOM   3403 C CG  . LEU E 2 10  ? 22.989  92.140  47.245 1.00 131.60 ? 10   LEU F CG  1 
ATOM   3404 C CD1 . LEU E 2 10  ? 23.214  91.756  48.705 1.00 131.56 ? 10   LEU F CD1 1 
ATOM   3405 C CD2 . LEU E 2 10  ? 24.030  93.152  46.791 1.00 132.59 ? 10   LEU F CD2 1 
ATOM   3406 N N   . GLU E 2 11  ? 22.875  88.800  44.111 1.00 135.85 ? 11   GLU F N   1 
ATOM   3407 C CA  . GLU E 2 11  ? 23.245  87.510  43.564 1.00 138.21 ? 11   GLU F CA  1 
ATOM   3408 C C   . GLU E 2 11  ? 23.813  87.604  42.153 1.00 141.56 ? 11   GLU F C   1 
ATOM   3409 O O   . GLU E 2 11  ? 24.602  86.750  41.745 1.00 140.64 ? 11   GLU F O   1 
ATOM   3410 C CB  . GLU E 2 11  ? 22.033  86.606  43.543 1.00 136.51 ? 11   GLU F CB  1 
ATOM   3411 C CG  . GLU E 2 11  ? 22.267  85.390  42.758 1.00 135.98 ? 11   GLU F CG  1 
ATOM   3412 C CD  . GLU E 2 11  ? 21.260  84.373  43.063 1.00 134.86 ? 11   GLU F CD  1 
ATOM   3413 O OE1 . GLU E 2 11  ? 20.069  84.754  43.187 1.00 134.69 ? 11   GLU F OE1 1 
ATOM   3414 O OE2 . GLU E 2 11  ? 21.680  83.205  43.168 1.00 135.58 ? 11   GLU F OE2 1 
ATOM   3415 N N   . LEU E 2 12  ? 23.387  88.635  41.421 1.00 144.75 ? 12   LEU F N   1 
ATOM   3416 C CA  . LEU E 2 12  ? 23.814  88.885  40.041 1.00 146.13 ? 12   LEU F CA  1 
ATOM   3417 C C   . LEU E 2 12  ? 25.182  89.558  39.942 1.00 145.63 ? 12   LEU F C   1 
ATOM   3418 O O   . LEU E 2 12  ? 25.886  89.414  38.946 1.00 146.91 ? 12   LEU F O   1 
ATOM   3419 C CB  . LEU E 2 12  ? 22.781  89.764  39.321 1.00 147.74 ? 12   LEU F CB  1 
ATOM   3420 C CG  . LEU E 2 12  ? 21.527  89.111  38.744 1.00 146.34 ? 12   LEU F CG  1 
ATOM   3421 C CD1 . LEU E 2 12  ? 20.620  90.178  38.158 1.00 148.01 ? 12   LEU F CD1 1 
ATOM   3422 C CD2 . LEU E 2 12  ? 21.936  88.106  37.683 1.00 149.33 ? 12   LEU F CD2 1 
ATOM   3423 N N   . ASN E 2 13  ? 25.556  90.306  40.975 1.00 144.26 ? 13   ASN F N   1 
ATOM   3424 C CA  . ASN E 2 13  ? 26.836  90.984  40.974 1.00 134.58 ? 13   ASN F CA  1 
ATOM   3425 C C   . ASN E 2 13  ? 27.995  89.998  41.111 1.00 132.67 ? 13   ASN F C   1 
ATOM   3426 O O   . ASN E 2 13  ? 28.803  89.920  40.155 1.00 137.75 ? 13   ASN F O   1 
ATOM   3427 C CB  . ASN E 2 13  ? 26.871  92.013  42.099 1.00 118.90 ? 13   ASN F CB  1 
ATOM   3428 C CG  . ASN E 2 13  ? 25.842  93.112  41.904 1.00 109.48 ? 13   ASN F CG  1 
ATOM   3429 O OD1 . ASN E 2 13  ? 25.663  93.592  40.761 1.00 94.13  ? 13   ASN F OD1 1 
ATOM   3430 N ND2 . ASN E 2 13  ? 25.171  93.545  43.009 1.00 77.30  ? 13   ASN F ND2 1 
ATOM   3431 O OXT . ASN E 2 13  ? 28.090  89.307  42.157 1.00 108.67 ? 13   ASN F OXT 1 
HETATM 3432 O O   . HOH F 3 .   ? 44.328  -0.103  38.266 1.00 69.00  ? 1    HOH A O   1 
HETATM 3433 O O   . HOH F 3 .   ? 38.852  18.113  49.583 1.00 35.38  ? 2    HOH A O   1 
HETATM 3434 O O   . HOH F 3 .   ? 30.557  10.458  31.920 1.00 36.59  ? 3    HOH A O   1 
HETATM 3435 O O   . HOH F 3 .   ? 42.105  13.417  44.950 1.00 58.35  ? 11   HOH A O   1 
HETATM 3436 O O   . HOH F 3 .   ? 24.318  43.085  31.884 1.00 41.50  ? 14   HOH A O   1 
HETATM 3437 O O   . HOH F 3 .   ? 23.471  17.877  43.251 1.00 68.86  ? 34   HOH A O   1 
HETATM 3438 O O   . HOH F 3 .   ? 46.618  26.749  24.164 1.00 61.20  ? 38   HOH A O   1 
HETATM 3439 O O   . HOH F 3 .   ? 36.148  5.363   30.383 1.00 69.07  ? 39   HOH A O   1 
HETATM 3440 O O   . HOH F 3 .   ? 19.479  36.923  19.207 1.00 82.88  ? 51   HOH A O   1 
HETATM 3441 O O   . HOH F 3 .   ? 40.684  30.869  41.611 1.00 37.97  ? 89   HOH A O   1 
HETATM 3442 O O   . HOH F 3 .   ? 42.893  8.805   30.674 1.00 71.43  ? 99   HOH A O   1 
HETATM 3443 O O   . HOH G 3 .   ? 10.970  79.210  39.430 1.00 34.32  ? 5    HOH B O   1 
HETATM 3444 O O   . HOH G 3 .   ? 7.226   67.218  47.043 1.00 38.64  ? 9    HOH B O   1 
HETATM 3445 O O   . HOH G 3 .   ? 2.862   65.502  22.316 1.00 52.65  ? 19   HOH B O   1 
HETATM 3446 O O   . HOH G 3 .   ? 24.256  66.626  27.865 1.00 60.38  ? 25   HOH B O   1 
HETATM 3447 O O   . HOH G 3 .   ? 16.335  61.862  39.878 1.00 38.05  ? 30   HOH B O   1 
HETATM 3448 O O   . HOH G 3 .   ? 24.585  51.961  22.676 1.00 75.37  ? 35   HOH B O   1 
HETATM 3449 O O   . HOH G 3 .   ? -8.137  80.013  50.545 1.00 45.28  ? 42   HOH B O   1 
HETATM 3450 O O   . HOH G 3 .   ? 7.950   62.803  22.367 1.00 57.72  ? 46   HOH B O   1 
HETATM 3451 O O   . HOH G 3 .   ? -12.579 78.426  42.222 1.00 61.99  ? 64   HOH B O   1 
HETATM 3452 O O   . HOH G 3 .   ? 2.002   54.132  39.445 1.00 58.31  ? 68   HOH B O   1 
HETATM 3453 O O   . HOH G 3 .   ? -1.880  59.561  40.535 1.00 42.00  ? 70   HOH B O   1 
HETATM 3454 O O   . HOH G 3 .   ? 1.827   51.272  23.467 1.00 63.18  ? 75   HOH B O   1 
HETATM 3455 O O   . HOH G 3 .   ? 1.286   81.284  34.389 1.00 48.65  ? 76   HOH B O   1 
HETATM 3456 O O   . HOH G 3 .   ? -13.874 73.432  49.440 1.00 62.20  ? 87   HOH B O   1 
HETATM 3457 O O   . HOH G 3 .   ? 23.708  61.885  34.267 1.00 65.63  ? 88   HOH B O   1 
HETATM 3458 O O   . HOH G 3 .   ? 4.346   72.668  28.919 1.00 64.05  ? 92   HOH B O   1 
HETATM 3459 O O   . HOH G 3 .   ? 3.080   48.341  15.128 1.00 77.48  ? 95   HOH B O   1 
HETATM 3460 O O   . HOH G 3 .   ? 0.688   85.952  33.570 1.00 72.71  ? 98   HOH B O   1 
HETATM 3461 O O   . HOH H 3 .   ? 0.068   105.788 24.294 0.50 40.12  ? 4    HOH C O   1 
HETATM 3462 O O   . HOH H 3 .   ? 3.215   118.366 27.520 1.00 61.91  ? 13   HOH C O   1 
HETATM 3463 O O   . HOH H 3 .   ? 4.601   111.626 36.418 1.00 52.62  ? 17   HOH C O   1 
HETATM 3464 O O   . HOH H 3 .   ? 12.949  100.799 33.726 1.00 71.40  ? 26   HOH C O   1 
HETATM 3465 O O   . HOH H 3 .   ? -6.451  98.741  45.718 1.00 77.47  ? 33   HOH C O   1 
HETATM 3466 O O   . HOH H 3 .   ? 3.255   115.917 32.981 1.00 60.35  ? 53   HOH C O   1 
HETATM 3467 O O   . HOH H 3 .   ? -1.504  107.635 26.106 1.00 54.71  ? 57   HOH C O   1 
HETATM 3468 O O   . HOH H 3 .   ? -3.260  89.003  26.662 1.00 70.67  ? 79   HOH C O   1 
HETATM 3469 O O   . HOH H 3 .   ? -7.885  107.509 21.237 0.50 27.05  ? 80   HOH C O   1 
HETATM 3470 O O   . HOH H 3 .   ? 3.890   104.556 48.132 1.00 50.20  ? 82   HOH C O   1 
HETATM 3471 O O   . HOH H 3 .   ? 0.016   98.326  24.353 0.50 23.22  ? 90   HOH C O   1 
HETATM 3472 O O   . HOH I 3 .   ? 35.123  19.209  19.537 1.00 70.44  ? 111  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   892  ?    ?   ?   A . n 
A 1 2   SER 2   893  ?    ?   ?   A . n 
A 1 3   PRO 3   894  ?    ?   ?   A . n 
A 1 4   ALA 4   895  ?    ?   ?   A . n 
A 1 5   ASP 5   896  ?    ?   ?   A . n 
A 1 6   SER 6   897  ?    ?   ?   A . n 
A 1 7   TYR 7   898  ?    ?   ?   A . n 
A 1 8   ASN 8   899  ?    ?   ?   A . n 
A 1 9   GLU 9   900  ?    ?   ?   A . n 
A 1 10  GLY 10  901  ?    ?   ?   A . n 
A 1 11  VAL 11  902  ?    ?   ?   A . n 
A 1 12  LYS 12  903  ?    ?   ?   A . n 
A 1 13  LEU 13  904  ?    ?   ?   A . n 
A 1 14  GLN 14  905  ?    ?   ?   A . n 
A 1 15  PRO 15  906  ?    ?   ?   A . n 
A 1 16  GLN 16  907  ?    ?   ?   A . n 
A 1 17  GLU 17  908  ?    ?   ?   A . n 
A 1 18  ILE 18  909  ?    ?   ?   A . n 
A 1 19  SER 19  910  ?    ?   ?   A . n 
A 1 20  PRO 20  911  ?    ?   ?   A . n 
A 1 21  PRO 21  912  ?    ?   ?   A . n 
A 1 22  PRO 22  913  ?    ?   ?   A . n 
A 1 23  THR 23  914  ?    ?   ?   A . n 
A 1 24  ALA 24  915  ?    ?   ?   A . n 
A 1 25  ASN 25  916  916  ASN ASN A . n 
A 1 26  LEU 26  917  917  LEU LEU A . n 
A 1 27  ASP 27  918  918  ASP ASP A . n 
A 1 28  ARG 28  919  919  ARG ARG A . n 
A 1 29  SER 29  920  920  SER SER A . n 
A 1 30  ASN 30  921  921  ASN ASN A . n 
A 1 31  ASP 31  922  922  ASP ASP A . n 
A 1 32  LYS 32  923  923  LYS LYS A . n 
A 1 33  VAL 33  924  924  VAL VAL A . n 
A 1 34  TYR 34  925  925  TYR TYR A . n 
A 1 35  GLU 35  926  926  GLU GLU A . n 
A 1 36  ASN 36  927  927  ASN ASN A . n 
A 1 37  VAL 37  928  928  VAL VAL A . n 
A 1 38  THR 38  929  929  THR THR A . n 
A 1 39  GLY 39  930  930  GLY GLY A . n 
A 1 40  LEU 40  931  931  LEU LEU A . n 
A 1 41  VAL 41  932  932  VAL VAL A . n 
A 1 42  LYS 42  933  933  LYS LYS A . n 
A 1 43  ALA 43  934  934  ALA ALA A . n 
A 1 44  VAL 44  935  935  VAL VAL A . n 
A 1 45  ILE 45  936  936  ILE ILE A . n 
A 1 46  GLU 46  937  937  GLU GLU A . n 
A 1 47  MET 47  938  938  MET MET A . n 
A 1 48  SER 48  939  939  SER SER A . n 
A 1 49  SER 49  940  940  SER SER A . n 
A 1 50  LYS 50  941  941  LYS LYS A . n 
A 1 51  ILE 51  942  942  ILE ILE A . n 
A 1 52  GLN 52  943  943  GLN GLN A . n 
A 1 53  PRO 53  944  944  PRO PRO A . n 
A 1 54  ALA 54  945  945  ALA ALA A . n 
A 1 55  PRO 55  946  946  PRO PRO A . n 
A 1 56  PRO 56  947  947  PRO PRO A . n 
A 1 57  GLU 57  948  948  GLU GLU A . n 
A 1 58  GLU 58  949  949  GLU GLU A . n 
A 1 59  TYR 59  950  950  TYR TYR A . n 
A 1 60  VAL 60  951  951  VAL VAL A . n 
A 1 61  PRO 61  952  952  PRO PRO A . n 
A 1 62  MET 62  953  953  MET MET A . n 
A 1 63  VAL 63  954  954  VAL VAL A . n 
A 1 64  LYS 64  955  955  LYS LYS A . n 
A 1 65  GLU 65  956  956  GLU GLU A . n 
A 1 66  VAL 66  957  957  VAL VAL A . n 
A 1 67  GLY 67  958  958  GLY GLY A . n 
A 1 68  LEU 68  959  959  LEU LEU A . n 
A 1 69  ALA 69  960  960  ALA ALA A . n 
A 1 70  LEU 70  961  961  LEU LEU A . n 
A 1 71  ARG 71  962  962  ARG ARG A . n 
A 1 72  THR 72  963  963  THR THR A . n 
A 1 73  LEU 73  964  964  LEU LEU A . n 
A 1 74  LEU 74  965  965  LEU LEU A . n 
A 1 75  ALA 75  966  966  ALA ALA A . n 
A 1 76  THR 76  967  967  THR THR A . n 
A 1 77  VAL 77  968  968  VAL VAL A . n 
A 1 78  ASP 78  969  969  ASP ASP A . n 
A 1 79  GLU 79  970  970  GLU GLU A . n 
A 1 80  THR 80  971  971  THR THR A . n 
A 1 81  ILE 81  972  972  ILE ILE A . n 
A 1 82  PRO 82  973  973  PRO PRO A . n 
A 1 83  LEU 83  974  974  LEU LEU A . n 
A 1 84  LEU 84  975  975  LEU LEU A . n 
A 1 85  PRO 85  976  976  PRO PRO A . n 
A 1 86  ALA 86  977  977  ALA ALA A . n 
A 1 87  SER 87  978  978  SER SER A . n 
A 1 88  THR 88  979  979  THR THR A . n 
A 1 89  HIS 89  980  980  HIS HIS A . n 
A 1 90  ARG 90  981  981  ARG ARG A . n 
A 1 91  GLU 91  982  982  GLU GLU A . n 
A 1 92  ILE 92  983  983  ILE ILE A . n 
A 1 93  GLU 93  984  984  GLU GLU A . n 
A 1 94  MET 94  985  985  MET MET A . n 
A 1 95  ALA 95  986  986  ALA ALA A . n 
A 1 96  GLN 96  987  987  GLN GLN A . n 
A 1 97  LYS 97  988  988  LYS LYS A . n 
A 1 98  LEU 98  989  989  LEU LEU A . n 
A 1 99  LEU 99  990  990  LEU LEU A . n 
A 1 100 ASN 100 991  991  ASN ASN A . n 
A 1 101 SER 101 992  992  SER SER A . n 
A 1 102 ASP 102 993  993  ASP ASP A . n 
A 1 103 LEU 103 994  994  LEU LEU A . n 
A 1 104 GLY 104 995  995  GLY GLY A . n 
A 1 105 GLU 105 996  996  GLU GLU A . n 
A 1 106 LEU 106 997  997  LEU LEU A . n 
A 1 107 ILE 107 998  998  ILE ILE A . n 
A 1 108 ASN 108 999  999  ASN ASN A . n 
A 1 109 LYS 109 1000 1000 LYS LYS A . n 
A 1 110 MET 110 1001 1001 MET MET A . n 
A 1 111 LYS 111 1002 1002 LYS LYS A . n 
A 1 112 LEU 112 1003 1003 LEU LEU A . n 
A 1 113 ALA 113 1004 1004 ALA ALA A . n 
A 1 114 GLN 114 1005 1005 GLN GLN A . n 
A 1 115 GLN 115 1006 1006 GLN GLN A . n 
A 1 116 TYR 116 1007 1007 TYR TYR A . n 
A 1 117 VAL 117 1008 1008 VAL VAL A . n 
A 1 118 MET 118 1009 1009 MET MET A . n 
A 1 119 THR 119 1010 1010 THR THR A . n 
A 1 120 SER 120 1011 1011 SER SER A . n 
A 1 121 LEU 121 1012 1012 LEU LEU A . n 
A 1 122 GLN 122 1013 1013 GLN GLN A . n 
A 1 123 GLN 123 1014 1014 GLN GLN A . n 
A 1 124 GLU 124 1015 1015 GLU GLU A . n 
A 1 125 TYR 125 1016 1016 TYR TYR A . n 
A 1 126 LYS 126 1017 1017 LYS LYS A . n 
A 1 127 LYS 127 1018 1018 LYS LYS A . n 
A 1 128 GLN 128 1019 1019 GLN GLN A . n 
A 1 129 MET 129 1020 1020 MET MET A . n 
A 1 130 LEU 130 1021 1021 LEU LEU A . n 
A 1 131 THR 131 1022 1022 THR THR A . n 
A 1 132 ALA 132 1023 1023 ALA ALA A . n 
A 1 133 ALA 133 1024 1024 ALA ALA A . n 
A 1 134 HIS 134 1025 1025 HIS HIS A . n 
A 1 135 ALA 135 1026 1026 ALA ALA A . n 
A 1 136 LEU 136 1027 1027 LEU LEU A . n 
A 1 137 ALA 137 1028 1028 ALA ALA A . n 
A 1 138 VAL 138 1029 1029 VAL VAL A . n 
A 1 139 ASP 139 1030 1030 ASP ASP A . n 
A 1 140 ALA 140 1031 1031 ALA ALA A . n 
A 1 141 LYS 141 1032 1032 LYS LYS A . n 
A 1 142 ASN 142 1033 1033 ASN ASN A . n 
A 1 143 LEU 143 1034 1034 LEU LEU A . n 
A 1 144 LEU 144 1035 1035 LEU LEU A . n 
A 1 145 ASP 145 1036 1036 ASP ASP A . n 
A 1 146 VAL 146 1037 1037 VAL VAL A . n 
A 1 147 ILE 147 1038 1038 ILE ILE A . n 
A 1 148 ASP 148 1039 1039 ASP ASP A . n 
A 1 149 GLN 149 1040 1040 GLN GLN A . n 
A 1 150 ALA 150 1041 1041 ALA ALA A . n 
A 1 151 ARG 151 1042 1042 ARG ARG A . n 
A 1 152 LEU 152 1043 1043 LEU LEU A . n 
A 1 153 LYS 153 1044 1044 LYS LYS A . n 
A 1 154 MET 154 1045 1045 MET MET A . n 
A 1 155 LEU 155 1046 1046 LEU LEU A . n 
A 1 156 GLY 156 1047 1047 GLY GLY A . n 
A 1 157 GLN 157 1048 1048 GLN GLN A . n 
A 1 158 THR 158 1049 1049 THR THR A . n 
A 1 159 ARG 159 1050 ?    ?   ?   A . n 
A 1 160 PRO 160 1051 ?    ?   ?   A . n 
A 1 161 HIS 161 1052 ?    ?   ?   A . n 
B 1 1   SER 1   892  ?    ?   ?   B . n 
B 1 2   SER 2   893  ?    ?   ?   B . n 
B 1 3   PRO 3   894  ?    ?   ?   B . n 
B 1 4   ALA 4   895  ?    ?   ?   B . n 
B 1 5   ASP 5   896  ?    ?   ?   B . n 
B 1 6   SER 6   897  ?    ?   ?   B . n 
B 1 7   TYR 7   898  ?    ?   ?   B . n 
B 1 8   ASN 8   899  ?    ?   ?   B . n 
B 1 9   GLU 9   900  ?    ?   ?   B . n 
B 1 10  GLY 10  901  ?    ?   ?   B . n 
B 1 11  VAL 11  902  ?    ?   ?   B . n 
B 1 12  LYS 12  903  ?    ?   ?   B . n 
B 1 13  LEU 13  904  ?    ?   ?   B . n 
B 1 14  GLN 14  905  ?    ?   ?   B . n 
B 1 15  PRO 15  906  ?    ?   ?   B . n 
B 1 16  GLN 16  907  907  GLN GLN B . n 
B 1 17  GLU 17  908  908  GLU GLU B . n 
B 1 18  ILE 18  909  909  ILE ILE B . n 
B 1 19  SER 19  910  910  SER SER B . n 
B 1 20  PRO 20  911  911  PRO PRO B . n 
B 1 21  PRO 21  912  912  PRO PRO B . n 
B 1 22  PRO 22  913  913  PRO PRO B . n 
B 1 23  THR 23  914  914  THR THR B . n 
B 1 24  ALA 24  915  915  ALA ALA B . n 
B 1 25  ASN 25  916  916  ASN ASN B . n 
B 1 26  LEU 26  917  917  LEU LEU B . n 
B 1 27  ASP 27  918  918  ASP ASP B . n 
B 1 28  ARG 28  919  919  ARG ARG B . n 
B 1 29  SER 29  920  920  SER SER B . n 
B 1 30  ASN 30  921  921  ASN ASN B . n 
B 1 31  ASP 31  922  922  ASP ASP B . n 
B 1 32  LYS 32  923  923  LYS LYS B . n 
B 1 33  VAL 33  924  924  VAL VAL B . n 
B 1 34  TYR 34  925  925  TYR TYR B . n 
B 1 35  GLU 35  926  926  GLU GLU B . n 
B 1 36  ASN 36  927  927  ASN ASN B . n 
B 1 37  VAL 37  928  928  VAL VAL B . n 
B 1 38  THR 38  929  929  THR THR B . n 
B 1 39  GLY 39  930  930  GLY GLY B . n 
B 1 40  LEU 40  931  931  LEU LEU B . n 
B 1 41  VAL 41  932  932  VAL VAL B . n 
B 1 42  LYS 42  933  933  LYS LYS B . n 
B 1 43  ALA 43  934  934  ALA ALA B . n 
B 1 44  VAL 44  935  935  VAL VAL B . n 
B 1 45  ILE 45  936  936  ILE ILE B . n 
B 1 46  GLU 46  937  937  GLU GLU B . n 
B 1 47  MET 47  938  938  MET MET B . n 
B 1 48  SER 48  939  939  SER SER B . n 
B 1 49  SER 49  940  940  SER SER B . n 
B 1 50  LYS 50  941  941  LYS LYS B . n 
B 1 51  ILE 51  942  942  ILE ILE B . n 
B 1 52  GLN 52  943  943  GLN GLN B . n 
B 1 53  PRO 53  944  944  PRO PRO B . n 
B 1 54  ALA 54  945  945  ALA ALA B . n 
B 1 55  PRO 55  946  946  PRO PRO B . n 
B 1 56  PRO 56  947  947  PRO PRO B . n 
B 1 57  GLU 57  948  948  GLU GLU B . n 
B 1 58  GLU 58  949  949  GLU GLU B . n 
B 1 59  TYR 59  950  950  TYR TYR B . n 
B 1 60  VAL 60  951  951  VAL VAL B . n 
B 1 61  PRO 61  952  952  PRO PRO B . n 
B 1 62  MET 62  953  953  MET MET B . n 
B 1 63  VAL 63  954  954  VAL VAL B . n 
B 1 64  LYS 64  955  955  LYS LYS B . n 
B 1 65  GLU 65  956  956  GLU GLU B . n 
B 1 66  VAL 66  957  957  VAL VAL B . n 
B 1 67  GLY 67  958  958  GLY GLY B . n 
B 1 68  LEU 68  959  959  LEU LEU B . n 
B 1 69  ALA 69  960  960  ALA ALA B . n 
B 1 70  LEU 70  961  961  LEU LEU B . n 
B 1 71  ARG 71  962  962  ARG ARG B . n 
B 1 72  THR 72  963  963  THR THR B . n 
B 1 73  LEU 73  964  964  LEU LEU B . n 
B 1 74  LEU 74  965  965  LEU LEU B . n 
B 1 75  ALA 75  966  966  ALA ALA B . n 
B 1 76  THR 76  967  967  THR THR B . n 
B 1 77  VAL 77  968  968  VAL VAL B . n 
B 1 78  ASP 78  969  969  ASP ASP B . n 
B 1 79  GLU 79  970  970  GLU GLU B . n 
B 1 80  THR 80  971  971  THR THR B . n 
B 1 81  ILE 81  972  972  ILE ILE B . n 
B 1 82  PRO 82  973  973  PRO PRO B . n 
B 1 83  LEU 83  974  974  LEU LEU B . n 
B 1 84  LEU 84  975  975  LEU LEU B . n 
B 1 85  PRO 85  976  976  PRO PRO B . n 
B 1 86  ALA 86  977  977  ALA ALA B . n 
B 1 87  SER 87  978  978  SER SER B . n 
B 1 88  THR 88  979  979  THR THR B . n 
B 1 89  HIS 89  980  980  HIS HIS B . n 
B 1 90  ARG 90  981  981  ARG ARG B . n 
B 1 91  GLU 91  982  982  GLU GLU B . n 
B 1 92  ILE 92  983  983  ILE ILE B . n 
B 1 93  GLU 93  984  984  GLU GLU B . n 
B 1 94  MET 94  985  985  MET MET B . n 
B 1 95  ALA 95  986  986  ALA ALA B . n 
B 1 96  GLN 96  987  987  GLN GLN B . n 
B 1 97  LYS 97  988  988  LYS LYS B . n 
B 1 98  LEU 98  989  989  LEU LEU B . n 
B 1 99  LEU 99  990  990  LEU LEU B . n 
B 1 100 ASN 100 991  991  ASN ASN B . n 
B 1 101 SER 101 992  992  SER SER B . n 
B 1 102 ASP 102 993  993  ASP ASP B . n 
B 1 103 LEU 103 994  994  LEU LEU B . n 
B 1 104 GLY 104 995  995  GLY GLY B . n 
B 1 105 GLU 105 996  996  GLU GLU B . n 
B 1 106 LEU 106 997  997  LEU LEU B . n 
B 1 107 ILE 107 998  998  ILE ILE B . n 
B 1 108 ASN 108 999  999  ASN ASN B . n 
B 1 109 LYS 109 1000 1000 LYS LYS B . n 
B 1 110 MET 110 1001 1001 MET MET B . n 
B 1 111 LYS 111 1002 1002 LYS LYS B . n 
B 1 112 LEU 112 1003 1003 LEU LEU B . n 
B 1 113 ALA 113 1004 1004 ALA ALA B . n 
B 1 114 GLN 114 1005 1005 GLN GLN B . n 
B 1 115 GLN 115 1006 1006 GLN GLN B . n 
B 1 116 TYR 116 1007 1007 TYR TYR B . n 
B 1 117 VAL 117 1008 1008 VAL VAL B . n 
B 1 118 MET 118 1009 1009 MET MET B . n 
B 1 119 THR 119 1010 1010 THR THR B . n 
B 1 120 SER 120 1011 1011 SER SER B . n 
B 1 121 LEU 121 1012 1012 LEU LEU B . n 
B 1 122 GLN 122 1013 1013 GLN GLN B . n 
B 1 123 GLN 123 1014 1014 GLN GLN B . n 
B 1 124 GLU 124 1015 1015 GLU GLU B . n 
B 1 125 TYR 125 1016 1016 TYR TYR B . n 
B 1 126 LYS 126 1017 1017 LYS LYS B . n 
B 1 127 LYS 127 1018 1018 LYS LYS B . n 
B 1 128 GLN 128 1019 1019 GLN GLN B . n 
B 1 129 MET 129 1020 1020 MET MET B . n 
B 1 130 LEU 130 1021 1021 LEU LEU B . n 
B 1 131 THR 131 1022 1022 THR THR B . n 
B 1 132 ALA 132 1023 1023 ALA ALA B . n 
B 1 133 ALA 133 1024 1024 ALA ALA B . n 
B 1 134 HIS 134 1025 1025 HIS HIS B . n 
B 1 135 ALA 135 1026 1026 ALA ALA B . n 
B 1 136 LEU 136 1027 1027 LEU LEU B . n 
B 1 137 ALA 137 1028 1028 ALA ALA B . n 
B 1 138 VAL 138 1029 1029 VAL VAL B . n 
B 1 139 ASP 139 1030 1030 ASP ASP B . n 
B 1 140 ALA 140 1031 1031 ALA ALA B . n 
B 1 141 LYS 141 1032 1032 LYS LYS B . n 
B 1 142 ASN 142 1033 1033 ASN ASN B . n 
B 1 143 LEU 143 1034 1034 LEU LEU B . n 
B 1 144 LEU 144 1035 1035 LEU LEU B . n 
B 1 145 ASP 145 1036 1036 ASP ASP B . n 
B 1 146 VAL 146 1037 1037 VAL VAL B . n 
B 1 147 ILE 147 1038 1038 ILE ILE B . n 
B 1 148 ASP 148 1039 1039 ASP ASP B . n 
B 1 149 GLN 149 1040 1040 GLN GLN B . n 
B 1 150 ALA 150 1041 1041 ALA ALA B . n 
B 1 151 ARG 151 1042 1042 ARG ARG B . n 
B 1 152 LEU 152 1043 1043 LEU LEU B . n 
B 1 153 LYS 153 1044 1044 LYS LYS B . n 
B 1 154 MET 154 1045 1045 MET MET B . n 
B 1 155 LEU 155 1046 1046 LEU LEU B . n 
B 1 156 GLY 156 1047 1047 GLY GLY B . n 
B 1 157 GLN 157 1048 ?    ?   ?   B . n 
B 1 158 THR 158 1049 ?    ?   ?   B . n 
B 1 159 ARG 159 1050 ?    ?   ?   B . n 
B 1 160 PRO 160 1051 ?    ?   ?   B . n 
B 1 161 HIS 161 1052 ?    ?   ?   B . n 
C 1 1   SER 1   892  ?    ?   ?   C . n 
C 1 2   SER 2   893  ?    ?   ?   C . n 
C 1 3   PRO 3   894  ?    ?   ?   C . n 
C 1 4   ALA 4   895  ?    ?   ?   C . n 
C 1 5   ASP 5   896  ?    ?   ?   C . n 
C 1 6   SER 6   897  ?    ?   ?   C . n 
C 1 7   TYR 7   898  ?    ?   ?   C . n 
C 1 8   ASN 8   899  ?    ?   ?   C . n 
C 1 9   GLU 9   900  ?    ?   ?   C . n 
C 1 10  GLY 10  901  ?    ?   ?   C . n 
C 1 11  VAL 11  902  ?    ?   ?   C . n 
C 1 12  LYS 12  903  ?    ?   ?   C . n 
C 1 13  LEU 13  904  ?    ?   ?   C . n 
C 1 14  GLN 14  905  ?    ?   ?   C . n 
C 1 15  PRO 15  906  906  PRO PRO C . n 
C 1 16  GLN 16  907  907  GLN GLN C . n 
C 1 17  GLU 17  908  908  GLU GLU C . n 
C 1 18  ILE 18  909  909  ILE ILE C . n 
C 1 19  SER 19  910  910  SER SER C . n 
C 1 20  PRO 20  911  911  PRO PRO C . n 
C 1 21  PRO 21  912  912  PRO PRO C . n 
C 1 22  PRO 22  913  913  PRO PRO C . n 
C 1 23  THR 23  914  914  THR THR C . n 
C 1 24  ALA 24  915  915  ALA ALA C . n 
C 1 25  ASN 25  916  916  ASN ASN C . n 
C 1 26  LEU 26  917  917  LEU LEU C . n 
C 1 27  ASP 27  918  918  ASP ASP C . n 
C 1 28  ARG 28  919  919  ARG ARG C . n 
C 1 29  SER 29  920  920  SER SER C . n 
C 1 30  ASN 30  921  921  ASN ASN C . n 
C 1 31  ASP 31  922  922  ASP ASP C . n 
C 1 32  LYS 32  923  923  LYS LYS C . n 
C 1 33  VAL 33  924  924  VAL VAL C . n 
C 1 34  TYR 34  925  925  TYR TYR C . n 
C 1 35  GLU 35  926  926  GLU GLU C . n 
C 1 36  ASN 36  927  927  ASN ASN C . n 
C 1 37  VAL 37  928  928  VAL VAL C . n 
C 1 38  THR 38  929  929  THR THR C . n 
C 1 39  GLY 39  930  930  GLY GLY C . n 
C 1 40  LEU 40  931  931  LEU LEU C . n 
C 1 41  VAL 41  932  932  VAL VAL C . n 
C 1 42  LYS 42  933  933  LYS LYS C . n 
C 1 43  ALA 43  934  934  ALA ALA C . n 
C 1 44  VAL 44  935  935  VAL VAL C . n 
C 1 45  ILE 45  936  936  ILE ILE C . n 
C 1 46  GLU 46  937  937  GLU GLU C . n 
C 1 47  MET 47  938  938  MET MET C . n 
C 1 48  SER 48  939  939  SER SER C . n 
C 1 49  SER 49  940  940  SER SER C . n 
C 1 50  LYS 50  941  941  LYS LYS C . n 
C 1 51  ILE 51  942  942  ILE ILE C . n 
C 1 52  GLN 52  943  943  GLN GLN C . n 
C 1 53  PRO 53  944  944  PRO PRO C . n 
C 1 54  ALA 54  945  945  ALA ALA C . n 
C 1 55  PRO 55  946  946  PRO PRO C . n 
C 1 56  PRO 56  947  947  PRO PRO C . n 
C 1 57  GLU 57  948  948  GLU GLU C . n 
C 1 58  GLU 58  949  949  GLU GLU C . n 
C 1 59  TYR 59  950  950  TYR TYR C . n 
C 1 60  VAL 60  951  951  VAL VAL C . n 
C 1 61  PRO 61  952  952  PRO PRO C . n 
C 1 62  MET 62  953  953  MET MET C . n 
C 1 63  VAL 63  954  954  VAL VAL C . n 
C 1 64  LYS 64  955  955  LYS LYS C . n 
C 1 65  GLU 65  956  956  GLU GLU C . n 
C 1 66  VAL 66  957  957  VAL VAL C . n 
C 1 67  GLY 67  958  958  GLY GLY C . n 
C 1 68  LEU 68  959  959  LEU LEU C . n 
C 1 69  ALA 69  960  960  ALA ALA C . n 
C 1 70  LEU 70  961  961  LEU LEU C . n 
C 1 71  ARG 71  962  962  ARG ARG C . n 
C 1 72  THR 72  963  963  THR THR C . n 
C 1 73  LEU 73  964  964  LEU LEU C . n 
C 1 74  LEU 74  965  965  LEU LEU C . n 
C 1 75  ALA 75  966  966  ALA ALA C . n 
C 1 76  THR 76  967  967  THR THR C . n 
C 1 77  VAL 77  968  968  VAL VAL C . n 
C 1 78  ASP 78  969  969  ASP ASP C . n 
C 1 79  GLU 79  970  970  GLU GLU C . n 
C 1 80  THR 80  971  971  THR THR C . n 
C 1 81  ILE 81  972  972  ILE ILE C . n 
C 1 82  PRO 82  973  973  PRO PRO C . n 
C 1 83  LEU 83  974  974  LEU LEU C . n 
C 1 84  LEU 84  975  975  LEU LEU C . n 
C 1 85  PRO 85  976  976  PRO PRO C . n 
C 1 86  ALA 86  977  977  ALA ALA C . n 
C 1 87  SER 87  978  978  SER SER C . n 
C 1 88  THR 88  979  979  THR THR C . n 
C 1 89  HIS 89  980  980  HIS HIS C . n 
C 1 90  ARG 90  981  981  ARG ARG C . n 
C 1 91  GLU 91  982  982  GLU GLU C . n 
C 1 92  ILE 92  983  983  ILE ILE C . n 
C 1 93  GLU 93  984  984  GLU GLU C . n 
C 1 94  MET 94  985  985  MET MET C . n 
C 1 95  ALA 95  986  986  ALA ALA C . n 
C 1 96  GLN 96  987  987  GLN GLN C . n 
C 1 97  LYS 97  988  988  LYS LYS C . n 
C 1 98  LEU 98  989  989  LEU LEU C . n 
C 1 99  LEU 99  990  990  LEU LEU C . n 
C 1 100 ASN 100 991  991  ASN ASN C . n 
C 1 101 SER 101 992  992  SER SER C . n 
C 1 102 ASP 102 993  993  ASP ASP C . n 
C 1 103 LEU 103 994  994  LEU LEU C . n 
C 1 104 GLY 104 995  995  GLY GLY C . n 
C 1 105 GLU 105 996  996  GLU GLU C . n 
C 1 106 LEU 106 997  997  LEU LEU C . n 
C 1 107 ILE 107 998  998  ILE ILE C . n 
C 1 108 ASN 108 999  999  ASN ASN C . n 
C 1 109 LYS 109 1000 1000 LYS LYS C . n 
C 1 110 MET 110 1001 1001 MET MET C . n 
C 1 111 LYS 111 1002 1002 LYS LYS C . n 
C 1 112 LEU 112 1003 1003 LEU LEU C . n 
C 1 113 ALA 113 1004 1004 ALA ALA C . n 
C 1 114 GLN 114 1005 1005 GLN GLN C . n 
C 1 115 GLN 115 1006 1006 GLN GLN C . n 
C 1 116 TYR 116 1007 1007 TYR TYR C . n 
C 1 117 VAL 117 1008 1008 VAL VAL C . n 
C 1 118 MET 118 1009 1009 MET MET C . n 
C 1 119 THR 119 1010 1010 THR THR C . n 
C 1 120 SER 120 1011 1011 SER SER C . n 
C 1 121 LEU 121 1012 1012 LEU LEU C . n 
C 1 122 GLN 122 1013 1013 GLN GLN C . n 
C 1 123 GLN 123 1014 1014 GLN GLN C . n 
C 1 124 GLU 124 1015 1015 GLU GLU C . n 
C 1 125 TYR 125 1016 1016 TYR TYR C . n 
C 1 126 LYS 126 1017 1017 LYS LYS C . n 
C 1 127 LYS 127 1018 1018 LYS LYS C . n 
C 1 128 GLN 128 1019 1019 GLN GLN C . n 
C 1 129 MET 129 1020 1020 MET MET C . n 
C 1 130 LEU 130 1021 1021 LEU LEU C . n 
C 1 131 THR 131 1022 1022 THR THR C . n 
C 1 132 ALA 132 1023 1023 ALA ALA C . n 
C 1 133 ALA 133 1024 1024 ALA ALA C . n 
C 1 134 HIS 134 1025 1025 HIS HIS C . n 
C 1 135 ALA 135 1026 1026 ALA ALA C . n 
C 1 136 LEU 136 1027 1027 LEU LEU C . n 
C 1 137 ALA 137 1028 1028 ALA ALA C . n 
C 1 138 VAL 138 1029 1029 VAL VAL C . n 
C 1 139 ASP 139 1030 1030 ASP ASP C . n 
C 1 140 ALA 140 1031 1031 ALA ALA C . n 
C 1 141 LYS 141 1032 1032 LYS LYS C . n 
C 1 142 ASN 142 1033 1033 ASN ASN C . n 
C 1 143 LEU 143 1034 1034 LEU LEU C . n 
C 1 144 LEU 144 1035 1035 LEU LEU C . n 
C 1 145 ASP 145 1036 1036 ASP ASP C . n 
C 1 146 VAL 146 1037 1037 VAL VAL C . n 
C 1 147 ILE 147 1038 1038 ILE ILE C . n 
C 1 148 ASP 148 1039 1039 ASP ASP C . n 
C 1 149 GLN 149 1040 1040 GLN GLN C . n 
C 1 150 ALA 150 1041 1041 ALA ALA C . n 
C 1 151 ARG 151 1042 1042 ARG ARG C . n 
C 1 152 LEU 152 1043 1043 LEU LEU C . n 
C 1 153 LYS 153 1044 1044 LYS LYS C . n 
C 1 154 MET 154 1045 1045 MET MET C . n 
C 1 155 LEU 155 1046 1046 LEU LEU C . n 
C 1 156 GLY 156 1047 1047 GLY GLY C . n 
C 1 157 GLN 157 1048 ?    ?   ?   C . n 
C 1 158 THR 158 1049 ?    ?   ?   C . n 
C 1 159 ARG 159 1050 ?    ?   ?   C . n 
C 1 160 PRO 160 1051 ?    ?   ?   C . n 
C 1 161 HIS 161 1052 ?    ?   ?   C . n 
D 2 1   ASN 1   1    ?    ?   ?   D . n 
D 2 2   LEU 2   2    2    LEU LEU D . n 
D 2 3   SER 3   3    3    SER SER D . n 
D 2 4   GLU 4   4    4    GLU GLU D . n 
D 2 5   LEU 5   5    5    LEU LEU D . n 
D 2 6   ASP 6   6    6    ASP ASP D . n 
D 2 7   ARG 7   7    7    ARG ARG D . n 
D 2 8   LEU 8   8    8    LEU LEU D . n 
D 2 9   LEU 9   9    9    LEU LEU D . n 
D 2 10  LEU 10  10   10   LEU LEU D . n 
D 2 11  GLU 11  11   11   GLU GLU D . n 
D 2 12  LEU 12  12   12   LEU LEU D . n 
D 2 13  ASN 13  13   13   ASN ASN D . n 
E 2 1   ASN 1   1    ?    ?   ?   F . n 
E 2 2   LEU 2   2    2    LEU LEU F . n 
E 2 3   SER 3   3    3    SER SER F . n 
E 2 4   GLU 4   4    4    GLU GLU F . n 
E 2 5   LEU 5   5    5    LEU LEU F . n 
E 2 6   ASP 6   6    6    ASP ASP F . n 
E 2 7   ARG 7   7    7    ARG ARG F . n 
E 2 8   LEU 8   8    8    LEU LEU F . n 
E 2 9   LEU 9   9    9    LEU LEU F . n 
E 2 10  LEU 10  10   10   LEU LEU F . n 
E 2 11  GLU 11  11   11   GLU GLU F . n 
E 2 12  LEU 12  12   12   LEU LEU F . n 
E 2 13  ASN 13  13   13   ASN ASN F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 3 HOH 1  1   1   HOH HOH A . 
F 3 HOH 2  2   2   HOH HOH A . 
F 3 HOH 3  3   3   HOH HOH A . 
F 3 HOH 4  11  11  HOH HOH A . 
F 3 HOH 5  14  14  HOH HOH A . 
F 3 HOH 6  34  34  HOH HOH A . 
F 3 HOH 7  38  38  HOH HOH A . 
F 3 HOH 8  39  39  HOH HOH A . 
F 3 HOH 9  51  51  HOH HOH A . 
F 3 HOH 10 89  89  HOH HOH A . 
F 3 HOH 11 99  99  HOH HOH A . 
G 3 HOH 1  5   5   HOH HOH B . 
G 3 HOH 2  9   9   HOH HOH B . 
G 3 HOH 3  19  19  HOH HOH B . 
G 3 HOH 4  25  25  HOH HOH B . 
G 3 HOH 5  30  30  HOH HOH B . 
G 3 HOH 6  35  35  HOH HOH B . 
G 3 HOH 7  42  42  HOH HOH B . 
G 3 HOH 8  46  46  HOH HOH B . 
G 3 HOH 9  64  64  HOH HOH B . 
G 3 HOH 10 68  68  HOH HOH B . 
G 3 HOH 11 70  70  HOH HOH B . 
G 3 HOH 12 75  75  HOH HOH B . 
G 3 HOH 13 76  76  HOH HOH B . 
G 3 HOH 14 87  87  HOH HOH B . 
G 3 HOH 15 88  88  HOH HOH B . 
G 3 HOH 16 92  92  HOH HOH B . 
G 3 HOH 17 95  95  HOH HOH B . 
G 3 HOH 18 98  98  HOH HOH B . 
H 3 HOH 1  4   4   HOH HOH C . 
H 3 HOH 2  13  13  HOH HOH C . 
H 3 HOH 3  17  17  HOH HOH C . 
H 3 HOH 4  26  26  HOH HOH C . 
H 3 HOH 5  33  33  HOH HOH C . 
H 3 HOH 6  53  53  HOH HOH C . 
H 3 HOH 7  57  57  HOH HOH C . 
H 3 HOH 8  79  79  HOH HOH C . 
H 3 HOH 9  80  80  HOH HOH C . 
H 3 HOH 10 82  82  HOH HOH C . 
H 3 HOH 11 90  90  HOH HOH C . 
I 3 HOH 1  111 111 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 C HOH 4  ? H HOH . 
2 1 C HOH 90 ? H HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-21 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.24    ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
AMoRE  phasing          .         ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 922  ? ? CG A ASP 922  ? ? OD2 A ASP 922  ? ? 124.50 118.30 6.20  0.90 N 
2 1 CB A ASP 1030 ? ? CG A ASP 1030 ? ? OD2 A ASP 1030 ? ? 124.15 118.30 5.85  0.90 N 
3 1 CB A ASP 1039 ? ? CG A ASP 1039 ? ? OD2 A ASP 1039 ? ? 124.59 118.30 6.29  0.90 N 
4 1 NE A ARG 1042 ? ? CZ A ARG 1042 ? ? NH2 A ARG 1042 ? ? 116.92 120.30 -3.38 0.50 N 
5 1 CA A THR 1049 ? ? C  A THR 1049 ? ? O   A THR 1049 ? ? 134.80 120.10 14.70 2.10 N 
6 1 CB B ASP 922  ? ? CG B ASP 922  ? ? OD2 B ASP 922  ? ? 126.24 118.30 7.94  0.90 N 
7 1 C  C ALA 945  ? ? N  C PRO 946  ? ? CA  C PRO 946  ? ? 129.05 119.30 9.75  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 921  ? ? -143.11 43.72   
2  1 SER A 1011 ? ? -43.53  -17.78  
3  1 ASN B 916  ? ? -72.24  28.26   
4  1 MET B 1009 ? ? 52.17   13.77   
5  1 GLN C 907  ? ? 45.75   -128.49 
6  1 GLU C 908  ? ? -15.47  129.07  
7  1 ASN C 916  ? ? -58.50  17.97   
8  1 LYS C 941  ? ? -98.18  -83.55  
9  1 ILE C 942  ? ? 0.91    -49.67  
10 1 PRO C 944  ? ? -56.11  -79.22  
11 1 ALA C 945  ? ? -38.99  144.54  
12 1 MET C 953  ? ? -39.97  -28.99  
13 1 GLU C 970  ? ? -59.51  -7.73   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 892  ? A SER 1   
2  1 Y 1 A SER 893  ? A SER 2   
3  1 Y 1 A PRO 894  ? A PRO 3   
4  1 Y 1 A ALA 895  ? A ALA 4   
5  1 Y 1 A ASP 896  ? A ASP 5   
6  1 Y 1 A SER 897  ? A SER 6   
7  1 Y 1 A TYR 898  ? A TYR 7   
8  1 Y 1 A ASN 899  ? A ASN 8   
9  1 Y 1 A GLU 900  ? A GLU 9   
10 1 Y 1 A GLY 901  ? A GLY 10  
11 1 Y 1 A VAL 902  ? A VAL 11  
12 1 Y 1 A LYS 903  ? A LYS 12  
13 1 Y 1 A LEU 904  ? A LEU 13  
14 1 Y 1 A GLN 905  ? A GLN 14  
15 1 Y 1 A PRO 906  ? A PRO 15  
16 1 Y 1 A GLN 907  ? A GLN 16  
17 1 Y 1 A GLU 908  ? A GLU 17  
18 1 Y 1 A ILE 909  ? A ILE 18  
19 1 Y 1 A SER 910  ? A SER 19  
20 1 Y 1 A PRO 911  ? A PRO 20  
21 1 Y 1 A PRO 912  ? A PRO 21  
22 1 Y 1 A PRO 913  ? A PRO 22  
23 1 Y 1 A THR 914  ? A THR 23  
24 1 Y 1 A ALA 915  ? A ALA 24  
25 1 Y 1 A ARG 1050 ? A ARG 159 
26 1 Y 1 A PRO 1051 ? A PRO 160 
27 1 Y 1 A HIS 1052 ? A HIS 161 
28 1 Y 1 B SER 892  ? B SER 1   
29 1 Y 1 B SER 893  ? B SER 2   
30 1 Y 1 B PRO 894  ? B PRO 3   
31 1 Y 1 B ALA 895  ? B ALA 4   
32 1 Y 1 B ASP 896  ? B ASP 5   
33 1 Y 1 B SER 897  ? B SER 6   
34 1 Y 1 B TYR 898  ? B TYR 7   
35 1 Y 1 B ASN 899  ? B ASN 8   
36 1 Y 1 B GLU 900  ? B GLU 9   
37 1 Y 1 B GLY 901  ? B GLY 10  
38 1 Y 1 B VAL 902  ? B VAL 11  
39 1 Y 1 B LYS 903  ? B LYS 12  
40 1 Y 1 B LEU 904  ? B LEU 13  
41 1 Y 1 B GLN 905  ? B GLN 14  
42 1 Y 1 B PRO 906  ? B PRO 15  
43 1 Y 1 B GLN 1048 ? B GLN 157 
44 1 Y 1 B THR 1049 ? B THR 158 
45 1 Y 1 B ARG 1050 ? B ARG 159 
46 1 Y 1 B PRO 1051 ? B PRO 160 
47 1 Y 1 B HIS 1052 ? B HIS 161 
48 1 Y 1 C SER 892  ? C SER 1   
49 1 Y 1 C SER 893  ? C SER 2   
50 1 Y 1 C PRO 894  ? C PRO 3   
51 1 Y 1 C ALA 895  ? C ALA 4   
52 1 Y 1 C ASP 896  ? C ASP 5   
53 1 Y 1 C SER 897  ? C SER 6   
54 1 Y 1 C TYR 898  ? C TYR 7   
55 1 Y 1 C ASN 899  ? C ASN 8   
56 1 Y 1 C GLU 900  ? C GLU 9   
57 1 Y 1 C GLY 901  ? C GLY 10  
58 1 Y 1 C VAL 902  ? C VAL 11  
59 1 Y 1 C LYS 903  ? C LYS 12  
60 1 Y 1 C LEU 904  ? C LEU 13  
61 1 Y 1 C GLN 905  ? C GLN 14  
62 1 Y 1 C GLN 1048 ? C GLN 157 
63 1 Y 1 C THR 1049 ? C THR 158 
64 1 Y 1 C ARG 1050 ? C ARG 159 
65 1 Y 1 C PRO 1051 ? C PRO 160 
66 1 Y 1 C HIS 1052 ? C HIS 161 
67 1 Y 1 D ASN 1    ? D ASN 1   
68 1 Y 1 F ASN 1    ? E ASN 1   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#