data_1OX1
# 
_entry.id   1OX1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OX1         
RCSB  RCSB018758   
WWPDB D_1000018758 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OX1 
_pdbx_database_status.recvd_initial_deposition_date   2003-03-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, G.'       1 
'Huang, Y.'    2 
'Zhu, G.'      3 
'Huang, Q.'    4 
'Tang, Y.'     5 
'Miyake, H.'   6 
'Kusunoki, M.' 7 
# 
_citation.id                        primary 
_citation.title                     'crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, G.'       1 
primary 'Huang, Y.'    2 
primary 'Zhu, G.'      3 
primary 'Huang, Q.'    4 
primary 'Tang, Y.'     5 
primary 'Miyake, H.'   6 
primary 'Kusunoki, M.' 7 
# 
_cell.entry_id           1OX1 
_cell.length_a           63.700 
_cell.length_b           63.140 
_cell.length_c           69.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OX1 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Trypsinogen, cationic' 23324.287 1   3.4.21.4 ? ? ? 
2 polymer     syn '11-mer peptide'        1255.444  1   ?        ? ? ? 
3 non-polymer syn 'CALCIUM ION'           40.078    1   ?        ? ? ? 
4 water       nat water                   18.015    141 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 Beta-trypsin                  
2 'synthetic peptide inhibitor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
A ? 
2 'polypeptide(L)' no no SCTRSIPPQCY SCTRSIPPQCY B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
2 1   SER n 
2 2   CYS n 
2 3   THR n 
2 4   ARG n 
2 5   SER n 
2 6   ILE n 
2 7   PRO n 
2 8   PRO n 
2 9   GLN n 
2 10  CYS n 
2 11  TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TRY1_BOVIN 1 
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
21 P00760 ? 
2 PDB 1OX1       2 ? ?  1OX1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OX1 A 1 ? 223 ? P00760 21 ? 243 ? 16 245 
2 2 1OX1 B 1 ? 11  ? 1OX1   1  ? 11  ? 1  11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OX1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.71 
_exptl_crystal.density_percent_sol   54.19 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'sodium sulfate, sodium phosphate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 296K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-02-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1OX1 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   4.0 
_reflns.d_resolution_low             37.7 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   18579 
_reflns.number_all                   19424 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.0796 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.1 
_reflns.B_iso_Wilson_estimate        20.6 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   89.0 
_reflns_shell.Rmerge_I_obs           0.2698 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2839 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OX1 
_refine.ls_number_reflns_obs                     18575 
_refine.ls_number_reflns_all                     18575 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3053133.95 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.31 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    95.2 
_refine.ls_R_factor_obs                          0.162 
_refine.ls_R_factor_all                          0.165 
_refine.ls_R_factor_R_work                       0.162 
_refine.ls_R_factor_R_free                       0.185 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.0 
_refine.ls_number_reflns_R_free                  739 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.3 
_refine.aniso_B[1][1]                            -0.24 
_refine.aniso_B[2][2]                            5.33 
_refine.aniso_B[3][3]                            -5.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.367645 
_refine.solvent_model_param_bsol                 51.0329 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1SBW' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1OX1 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.14 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.22 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1702 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               1844 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        20.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.37  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.04  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.28  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.25  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.07 
_refine_ls_shell.number_reflns_R_work             1624 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               88.5 
_refine_ls_shell.R_factor_R_free                  0.264 
_refine_ls_shell.R_factor_R_free_error            0.034 
_refine_ls_shell.percent_reflns_R_free            3.6 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1OX1 
_struct.title                     'crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor' 
_struct.pdbx_descriptor           'Trypsinogen, cationic(E.C.3.4.21.4)/11-mer peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OX1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'hydrolase, Beta-trypsin' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 38  ? TYR A 42  ? ALA A 55  TYR A 59  5 ? 5  
HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 212 ? SER A 222 ? TYR A 234 SER A 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG  ? ? A CYS 22  A CYS 157 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG  ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG  ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG  ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG  ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG  ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf7 disulf ? ? B CYS 2   SG ? ? ? 1_555 B CYS 10  SG  ? ? B CYS 2   B CYS 10  1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc1 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASN 54  O   ? ? A CA  271 A ASN 72  1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc2 metalc ? ? C CA  .   CA ? ? ? 1_555 A VAL 57  O   ? ? A CA  271 A VAL 75  1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc3 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 62  OE2 ? ? A CA  271 A GLU 80  1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc4 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  271 A HOH 325 1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc5 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  271 A HOH 383 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc6 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 52  OE1 ? ? A CA  271 A GLU 70  1_555 ? ? ? ? ? ? ? 2.355 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           6 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            6 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    7 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     7 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 
A 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 
A 3 LYS A 186 ? GLY A 194 ? LYS A 204 GLY A 216 
A 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 
A 5 GLN A 115 ? GLY A 120 ? GLN A 135 GLY A 140 
A 6 LYS A 136 ? PRO A 141 ? LYS A 156 PRO A 161 
A 7 TYR A 5   ? THR A 6   ? TYR A 20  THR A 21  
B 1 MET A 160 ? ALA A 163 ? MET A 180 ALA A 183 
B 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 
B 3 LYS A 186 ? GLY A 194 ? LYS A 204 GLY A 216 
B 4 CYS B 2   ? THR B 3   ? CYS B 2   THR B 3   
C 1 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
C 2 HIS A 23  ? ASN A 31  ? HIS A 40  ASN A 48  
C 3 TRP A 34  ? SER A 37  ? TRP A 51  SER A 54  
C 4 MET A 86  ? LEU A 90  ? MET A 104 LEU A 108 
C 5 GLN A 63  ? VAL A 72  ? GLN A 81  VAL A 90  
C 6 GLN A 47  ? LEU A 50  ? GLN A 64  LEU A 67  
C 7 GLN A 15  ? ASN A 19  ? GLN A 30  ASN A 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 161 ? N PHE A 181 O TYR A 206 ? O TYR A 228 
A 2 3 O VAL A 205 ? O VAL A 227 N TRP A 193 ? N TRP A 215 
A 3 4 O LYS A 186 ? O LYS A 204 N CYS A 183 ? N CYS A 201 
A 4 5 O VAL A 182 ? O VAL A 200 N LEU A 117 ? N LEU A 137 
A 5 6 N ILE A 118 ? N ILE A 138 O LEU A 138 ? O LEU A 158 
A 6 7 O CYS A 137 ? O CYS A 157 N TYR A 5   ? N TYR A 20  
B 1 2 N PHE A 161 ? N PHE A 181 O TYR A 206 ? O TYR A 228 
B 2 3 O VAL A 205 ? O VAL A 227 N TRP A 193 ? N TRP A 215 
B 3 4 N GLY A 194 ? N GLY A 216 O CYS B 2   ? O CYS B 2   
C 1 2 N LEU A 18  ? N LEU A 33  O CYS A 25  ? O CYS A 42  
C 2 3 N SER A 28  ? N SER A 45  O VAL A 36  ? O VAL A 53  
C 3 4 N VAL A 35  ? N VAL A 52  O ILE A 88  ? O ILE A 106 
C 4 5 O LEU A 87  ? O LEU A 105 N ILE A 71  ? N ILE A 89  
C 5 6 O ILE A 65  ? O ILE A 83  N VAL A 48  ? N VAL A 65  
C 6 7 O GLN A 47  ? O GLN A 64  N ASN A 19  ? N ASN A 34  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 271' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 GLU A 52 ? GLU A 70  . ? 1_555 ? 
2 AC1 6 ASN A 54 ? ASN A 72  . ? 1_555 ? 
3 AC1 6 VAL A 57 ? VAL A 75  . ? 1_555 ? 
4 AC1 6 GLU A 62 ? GLU A 80  . ? 1_555 ? 
5 AC1 6 HOH D .  ? HOH A 325 . ? 1_555 ? 
6 AC1 6 HOH D .  ? HOH A 383 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OX1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OX1 
_atom_sites.fract_transf_matrix[1][1]   0.015699 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015838 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014395 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 1   ? 10.811 3.244   26.768 1.00 23.34 ? 16  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 1   ? 10.760 3.593   25.322 1.00 23.85 ? 16  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 1   ? 10.322 5.047   25.152 1.00 25.94 ? 16  ILE A C   1 
ATOM   4    O  O   . ILE A 1 1   ? 9.249  5.424   25.621 1.00 26.65 ? 16  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 1   ? 9.732  2.721   24.563 1.00 24.24 ? 16  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 1   ? 10.079 1.234   24.707 1.00 25.42 ? 16  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 1   ? 9.645  3.175   23.110 1.00 23.98 ? 16  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 1   ? 11.383 0.804   24.068 1.00 26.69 ? 16  ILE A CD1 1 
ATOM   9    N  N   . VAL A 1 2   ? 11.138 5.839   24.457 1.00 25.68 ? 17  VAL A N   1 
ATOM   10   C  CA  . VAL A 1 2   ? 10.848 7.251   24.199 1.00 26.24 ? 17  VAL A CA  1 
ATOM   11   C  C   . VAL A 1 2   ? 10.341 7.415   22.766 1.00 26.84 ? 17  VAL A C   1 
ATOM   12   O  O   . VAL A 1 2   ? 10.967 6.932   21.829 1.00 24.38 ? 17  VAL A O   1 
ATOM   13   C  CB  . VAL A 1 2   ? 12.115 8.123   24.331 1.00 26.67 ? 17  VAL A CB  1 
ATOM   14   C  CG1 . VAL A 1 2   ? 11.797 9.582   23.973 1.00 25.52 ? 17  VAL A CG1 1 
ATOM   15   C  CG2 . VAL A 1 2   ? 12.677 8.021   25.744 1.00 27.89 ? 17  VAL A CG2 1 
ATOM   16   N  N   . GLY A 1 3   ? 9.200  8.082   22.605 1.00 27.85 ? 18  GLY A N   1 
ATOM   17   C  CA  . GLY A 1 3   ? 8.656  8.328   21.276 1.00 26.75 ? 18  GLY A CA  1 
ATOM   18   C  C   . GLY A 1 3   ? 7.997  7.135   20.627 1.00 26.50 ? 18  GLY A C   1 
ATOM   19   O  O   . GLY A 1 3   ? 7.889  7.083   19.402 1.00 25.51 ? 18  GLY A O   1 
ATOM   20   N  N   . GLY A 1 4   ? 7.558  6.177   21.440 1.00 24.70 ? 19  GLY A N   1 
ATOM   21   C  CA  . GLY A 1 4   ? 6.913  5.001   20.894 1.00 25.24 ? 19  GLY A CA  1 
ATOM   22   C  C   . GLY A 1 4   ? 5.406  5.091   21.060 1.00 26.85 ? 19  GLY A C   1 
ATOM   23   O  O   . GLY A 1 4   ? 4.869  6.185   21.202 1.00 26.11 ? 19  GLY A O   1 
ATOM   24   N  N   . TYR A 1 5   ? 4.726  3.951   21.049 1.00 26.43 ? 20  TYR A N   1 
ATOM   25   C  CA  . TYR A 1 5   ? 3.270  3.913   21.193 1.00 27.10 ? 20  TYR A CA  1 
ATOM   26   C  C   . TYR A 1 5   ? 2.844  2.725   22.062 1.00 27.54 ? 20  TYR A C   1 
ATOM   27   O  O   . TYR A 1 5   ? 3.626  1.806   22.298 1.00 27.20 ? 20  TYR A O   1 
ATOM   28   C  CB  . TYR A 1 5   ? 2.625  3.791   19.815 1.00 25.57 ? 20  TYR A CB  1 
ATOM   29   C  CG  . TYR A 1 5   ? 3.100  2.579   19.037 1.00 26.13 ? 20  TYR A CG  1 
ATOM   30   C  CD1 . TYR A 1 5   ? 2.373  1.398   19.042 1.00 25.88 ? 20  TYR A CD1 1 
ATOM   31   C  CD2 . TYR A 1 5   ? 4.292  2.610   18.313 1.00 26.15 ? 20  TYR A CD2 1 
ATOM   32   C  CE1 . TYR A 1 5   ? 2.809  0.281   18.355 1.00 27.39 ? 20  TYR A CE1 1 
ATOM   33   C  CE2 . TYR A 1 5   ? 4.741  1.487   17.619 1.00 26.23 ? 20  TYR A CE2 1 
ATOM   34   C  CZ  . TYR A 1 5   ? 3.991  0.327   17.649 1.00 27.19 ? 20  TYR A CZ  1 
ATOM   35   O  OH  . TYR A 1 5   ? 4.424  -0.799  16.981 1.00 28.81 ? 20  TYR A OH  1 
ATOM   36   N  N   . THR A 1 6   ? 1.604  2.749   22.539 1.00 27.39 ? 21  THR A N   1 
ATOM   37   C  CA  . THR A 1 6   ? 1.088  1.665   23.355 1.00 27.09 ? 21  THR A CA  1 
ATOM   38   C  C   . THR A 1 6   ? 0.922  0.422   22.485 1.00 27.05 ? 21  THR A C   1 
ATOM   39   O  O   . THR A 1 6   ? 0.154  0.417   21.533 1.00 27.28 ? 21  THR A O   1 
ATOM   40   C  CB  . THR A 1 6   ? -0.254 2.062   23.978 1.00 28.04 ? 21  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 6   ? -0.051 3.205   24.815 1.00 27.88 ? 21  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 6   ? -0.821 0.921   24.818 1.00 27.57 ? 21  THR A CG2 1 
ATOM   43   N  N   . CYS A 1 7   ? 1.645  -0.642  22.811 1.00 25.59 ? 22  CYS A N   1 
ATOM   44   C  CA  . CYS A 1 7   ? 1.582  -1.862  22.015 1.00 24.79 ? 22  CYS A CA  1 
ATOM   45   C  C   . CYS A 1 7   ? 0.203  -2.493  21.884 1.00 25.57 ? 22  CYS A C   1 
ATOM   46   O  O   . CYS A 1 7   ? -0.176 -2.938  20.805 1.00 27.41 ? 22  CYS A O   1 
ATOM   47   C  CB  . CYS A 1 7   ? 2.472  -2.931  22.611 1.00 23.05 ? 22  CYS A CB  1 
ATOM   48   S  SG  . CYS A 1 7   ? 4.221  -2.565  22.894 1.00 22.70 ? 22  CYS A SG  1 
ATOM   49   N  N   . GLY A 1 8   ? -0.531 -2.549  22.990 1.00 25.99 ? 23  GLY A N   1 
ATOM   50   C  CA  . GLY A 1 8   ? -1.829 -3.214  23.002 1.00 26.35 ? 23  GLY A CA  1 
ATOM   51   C  C   . GLY A 1 8   ? -1.619 -4.463  23.869 1.00 27.41 ? 23  GLY A C   1 
ATOM   52   O  O   . GLY A 1 8   ? -0.609 -5.157  23.705 1.00 27.31 ? 23  GLY A O   1 
ATOM   53   N  N   . ALA A 1 9   ? -2.539 -4.766  24.783 1.00 26.29 ? 24  ALA A N   1 
ATOM   54   C  CA  . ALA A 1 9   ? -2.369 -5.919  25.665 1.00 27.32 ? 24  ALA A CA  1 
ATOM   55   C  C   . ALA A 1 9   ? -2.040 -7.241  24.981 1.00 27.85 ? 24  ALA A C   1 
ATOM   56   O  O   . ALA A 1 9   ? -2.769 -7.707  24.106 1.00 27.00 ? 24  ALA A O   1 
ATOM   57   C  CB  . ALA A 1 9   ? -3.593 -6.091  26.538 1.00 27.41 ? 24  ALA A CB  1 
ATOM   58   N  N   . ASN A 1 10  ? -0.910 -7.826  25.376 1.00 28.53 ? 25  ASN A N   1 
ATOM   59   C  CA  . ASN A 1 10  ? -0.468 -9.118  24.856 1.00 28.25 ? 25  ASN A CA  1 
ATOM   60   C  C   . ASN A 1 10  ? -0.179 -9.214  23.371 1.00 27.62 ? 25  ASN A C   1 
ATOM   61   O  O   . ASN A 1 10  ? -0.227 -10.302 22.802 1.00 27.57 ? 25  ASN A O   1 
ATOM   62   C  CB  . ASN A 1 10  ? -1.492 -10.194 25.240 1.00 32.20 ? 25  ASN A CB  1 
ATOM   63   C  CG  . ASN A 1 10  ? -1.797 -10.187 26.727 1.00 34.23 ? 25  ASN A CG  1 
ATOM   64   O  OD1 . ASN A 1 10  ? -2.866 -9.749  27.152 1.00 33.63 ? 25  ASN A OD1 1 
ATOM   65   N  ND2 . ASN A 1 10  ? -0.839 -10.652 27.530 1.00 33.35 ? 25  ASN A ND2 1 
ATOM   66   N  N   . THR A 1 11  ? 0.121  -8.087  22.738 1.00 25.79 ? 26  THR A N   1 
ATOM   67   C  CA  . THR A 1 11  ? 0.440  -8.089  21.318 1.00 25.61 ? 26  THR A CA  1 
ATOM   68   C  C   . THR A 1 11  ? 1.925  -8.439  21.112 1.00 24.31 ? 26  THR A C   1 
ATOM   69   O  O   . THR A 1 11  ? 2.377  -8.618  19.989 1.00 23.50 ? 26  THR A O   1 
ATOM   70   C  CB  . THR A 1 11  ? 0.136  -6.712  20.698 1.00 26.69 ? 26  THR A CB  1 
ATOM   71   O  OG1 . THR A 1 11  ? 0.864  -5.697  21.403 1.00 27.26 ? 26  THR A OG1 1 
ATOM   72   C  CG2 . THR A 1 11  ? -1.375 -6.399  20.819 1.00 28.18 ? 26  THR A CG2 1 
ATOM   73   N  N   . VAL A 1 12  ? 2.687  -8.527  22.199 1.00 22.98 ? 27  VAL A N   1 
ATOM   74   C  CA  . VAL A 1 12  ? 4.133  -8.881  22.128 1.00 21.28 ? 27  VAL A CA  1 
ATOM   75   C  C   . VAL A 1 12  ? 4.210  -10.000 23.178 1.00 22.49 ? 27  VAL A C   1 
ATOM   76   O  O   . VAL A 1 12  ? 4.717  -9.802  24.282 1.00 21.55 ? 27  VAL A O   1 
ATOM   77   C  CB  . VAL A 1 12  ? 5.025  -7.672  22.540 1.00 21.23 ? 27  VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 12  ? 6.507  -7.979  22.184 1.00 19.52 ? 27  VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 12  ? 4.567  -6.372  21.803 1.00 20.35 ? 27  VAL A CG2 1 
ATOM   80   N  N   . PRO A 1 13  ? 3.677  -11.191 22.839 1.00 23.63 ? 28  PRO A N   1 
ATOM   81   C  CA  . PRO A 1 13  ? 3.632  -12.350 23.732 1.00 22.23 ? 28  PRO A CA  1 
ATOM   82   C  C   . PRO A 1 13  ? 4.935  -12.936 24.269 1.00 22.21 ? 28  PRO A C   1 
ATOM   83   O  O   . PRO A 1 13  ? 4.905  -13.690 25.247 1.00 20.24 ? 28  PRO A O   1 
ATOM   84   C  CB  . PRO A 1 13  ? 2.800  -13.355 22.937 1.00 22.95 ? 28  PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 13  ? 3.197  -13.082 21.545 1.00 24.02 ? 28  PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 13  ? 3.235  -11.556 21.476 1.00 21.72 ? 28  PRO A CD  1 
ATOM   87   N  N   . TYR A 1 14  ? 6.067  -12.594 23.653 1.00 19.71 ? 29  TYR A N   1 
ATOM   88   C  CA  . TYR A 1 14  ? 7.356  -13.108 24.110 1.00 20.66 ? 29  TYR A CA  1 
ATOM   89   C  C   . TYR A 1 14  ? 8.046  -12.152 25.076 1.00 21.64 ? 29  TYR A C   1 
ATOM   90   O  O   . TYR A 1 14  ? 9.100  -12.482 25.640 1.00 21.90 ? 29  TYR A O   1 
ATOM   91   C  CB  . TYR A 1 14  ? 8.268  -13.351 22.918 1.00 20.03 ? 29  TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 14  ? 8.334  -12.178 21.967 1.00 21.09 ? 29  TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 14  ? 9.197  -11.101 22.207 1.00 19.17 ? 29  TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 14  ? 7.499  -12.121 20.850 1.00 21.43 ? 29  TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 14  ? 9.219  -9.983  21.352 1.00 21.81 ? 29  TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 14  ? 7.513  -11.015 19.989 1.00 22.72 ? 29  TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 14  ? 8.372  -9.945  20.244 1.00 21.07 ? 29  TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 14  ? 8.374  -8.838  19.407 1.00 20.23 ? 29  TYR A OH  1 
ATOM   99   N  N   . GLN A 1 15  ? 7.460  -10.971 25.266 1.00 20.69 ? 30  GLN A N   1 
ATOM   100  C  CA  . GLN A 1 15  ? 8.052  -9.976  26.159 1.00 21.02 ? 30  GLN A CA  1 
ATOM   101  C  C   . GLN A 1 15  ? 7.888  -10.342 27.629 1.00 21.70 ? 30  GLN A C   1 
ATOM   102  O  O   . GLN A 1 15  ? 6.777  -10.646 28.054 1.00 21.28 ? 30  GLN A O   1 
ATOM   103  C  CB  . GLN A 1 15  ? 7.410  -8.606  25.919 1.00 19.74 ? 30  GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 15  ? 7.778  -7.564  26.962 1.00 18.53 ? 30  GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 15  ? 9.094  -6.871  26.658 1.00 21.19 ? 30  GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 15  ? 9.978  -6.744  27.521 1.00 23.26 ? 30  GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 15  ? 9.224  -6.400  25.435 1.00 17.88 ? 30  GLN A NE2 1 
ATOM   108  N  N   . VAL A 1 16  ? 8.977  -10.333 28.409 1.00 19.29 ? 31  VAL A N   1 
ATOM   109  C  CA  . VAL A 1 16  ? 8.824  -10.594 29.850 1.00 20.37 ? 31  VAL A CA  1 
ATOM   110  C  C   . VAL A 1 16  ? 9.354  -9.396  30.646 1.00 19.52 ? 31  VAL A C   1 
ATOM   111  O  O   . VAL A 1 16  ? 10.088 -8.562  30.113 1.00 19.46 ? 31  VAL A O   1 
ATOM   112  C  CB  . VAL A 1 16  ? 9.583  -11.876 30.366 1.00 21.09 ? 31  VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 16  ? 9.223  -13.105 29.491 1.00 24.22 ? 31  VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 16  ? 11.070 -11.649 30.382 1.00 20.63 ? 31  VAL A CG2 1 
ATOM   115  N  N   . SER A 1 17  ? 8.935  -9.295  31.904 1.00 18.42 ? 32  SER A N   1 
ATOM   116  C  CA  . SER A 1 17  ? 9.418  -8.257  32.812 1.00 17.71 ? 32  SER A CA  1 
ATOM   117  C  C   . SER A 1 17  ? 10.198 -8.994  33.906 1.00 19.22 ? 32  SER A C   1 
ATOM   118  O  O   . SER A 1 17  ? 9.704  -9.987  34.440 1.00 19.74 ? 32  SER A O   1 
ATOM   119  C  CB  . SER A 1 17  ? 8.263  -7.506  33.451 1.00 15.85 ? 32  SER A CB  1 
ATOM   120  O  OG  . SER A 1 17  ? 8.706  -6.773  34.597 1.00 19.69 ? 32  SER A OG  1 
ATOM   121  N  N   . LEU A 1 18  ? 11.415 -8.539  34.220 1.00 17.88 ? 33  LEU A N   1 
ATOM   122  C  CA  . LEU A 1 18  ? 12.195 -9.164  35.288 1.00 18.46 ? 33  LEU A CA  1 
ATOM   123  C  C   . LEU A 1 18  ? 11.859 -8.307  36.522 1.00 18.06 ? 33  LEU A C   1 
ATOM   124  O  O   . LEU A 1 18  ? 11.984 -7.084  36.491 1.00 16.89 ? 33  LEU A O   1 
ATOM   125  C  CB  . LEU A 1 18  ? 13.701 -9.120  34.963 1.00 17.47 ? 33  LEU A CB  1 
ATOM   126  C  CG  . LEU A 1 18  ? 14.124 -9.818  33.652 1.00 20.45 ? 33  LEU A CG  1 
ATOM   127  C  CD1 . LEU A 1 18  ? 15.651 -9.945  33.599 1.00 17.92 ? 33  LEU A CD1 1 
ATOM   128  C  CD2 . LEU A 1 18  ? 13.479 -11.191 33.559 1.00 19.50 ? 33  LEU A CD2 1 
ATOM   129  N  N   . ASN A 1 19  ? 11.469 -8.956  37.613 1.00 18.38 ? 34  ASN A N   1 
ATOM   130  C  CA  . ASN A 1 19  ? 11.001 -8.234  38.788 1.00 19.40 ? 34  ASN A CA  1 
ATOM   131  C  C   . ASN A 1 19  ? 11.648 -8.661  40.099 1.00 19.63 ? 34  ASN A C   1 
ATOM   132  O  O   . ASN A 1 19  ? 11.828 -9.849  40.351 1.00 20.79 ? 34  ASN A O   1 
ATOM   133  C  CB  . ASN A 1 19  ? 9.469  -8.436  38.828 1.00 19.60 ? 34  ASN A CB  1 
ATOM   134  C  CG  . ASN A 1 19  ? 8.784  -7.691  39.963 1.00 21.76 ? 34  ASN A CG  1 
ATOM   135  O  OD1 . ASN A 1 19  ? 8.929  -8.042  41.135 1.00 20.72 ? 34  ASN A OD1 1 
ATOM   136  N  ND2 . ASN A 1 19  ? 8.011  -6.664  39.611 1.00 21.08 ? 34  ASN A ND2 1 
ATOM   137  N  N   . SER A 1 20  ? 12.003 -7.691  40.933 1.00 19.94 ? 37  SER A N   1 
ATOM   138  C  CA  . SER A 1 20  ? 12.593 -7.977  42.248 1.00 21.17 ? 37  SER A CA  1 
ATOM   139  C  C   . SER A 1 20  ? 11.913 -7.025  43.222 1.00 21.97 ? 37  SER A C   1 
ATOM   140  O  O   . SER A 1 20  ? 12.572 -6.355  43.996 1.00 23.28 ? 37  SER A O   1 
ATOM   141  C  CB  . SER A 1 20  ? 14.123 -7.730  42.229 1.00 22.86 ? 37  SER A CB  1 
ATOM   142  O  OG  . SER A 1 20  ? 14.429 -6.364  41.882 1.00 26.05 ? 37  SER A OG  1 
ATOM   143  N  N   . GLY A 1 21  ? 10.581 -6.984  43.182 1.00 22.06 ? 38  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 21  ? 9.855  -6.061  44.030 1.00 22.10 ? 38  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 21  ? 9.500  -4.830  43.211 1.00 22.63 ? 38  GLY A C   1 
ATOM   146  O  O   . GLY A 1 21  ? 8.821  -3.923  43.683 1.00 23.47 ? 38  GLY A O   1 
ATOM   147  N  N   . TYR A 1 22  ? 9.986  -4.807  41.976 1.00 21.19 ? 39  TYR A N   1 
ATOM   148  C  CA  . TYR A 1 22  ? 9.760  -3.717  41.014 1.00 21.91 ? 39  TYR A CA  1 
ATOM   149  C  C   . TYR A 1 22  ? 10.340 -4.178  39.662 1.00 21.07 ? 39  TYR A C   1 
ATOM   150  O  O   . TYR A 1 22  ? 11.201 -5.066  39.609 1.00 21.83 ? 39  TYR A O   1 
ATOM   151  C  CB  . TYR A 1 22  ? 10.462 -2.406  41.440 1.00 21.63 ? 39  TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 22  ? 11.970 -2.520  41.630 1.00 24.18 ? 39  TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 22  ? 12.499 -3.071  42.806 1.00 25.09 ? 39  TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 22  ? 12.863 -2.138  40.624 1.00 24.14 ? 39  TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 22  ? 13.871 -3.250  42.975 1.00 26.23 ? 39  TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 22  ? 14.254 -2.316  40.789 1.00 24.91 ? 39  TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 22  ? 14.739 -2.871  41.960 1.00 26.13 ? 39  TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 22  ? 16.090 -3.075  42.146 1.00 30.64 ? 39  TYR A OH  1 
ATOM   159  N  N   . HIS A 1 23  ? 9.872  -3.566  38.582 1.00 21.27 ? 40  HIS A N   1 
ATOM   160  C  CA  . HIS A 1 23  ? 10.355 -3.899  37.248 1.00 20.49 ? 40  HIS A CA  1 
ATOM   161  C  C   . HIS A 1 23  ? 11.739 -3.268  37.075 1.00 20.96 ? 40  HIS A C   1 
ATOM   162  O  O   . HIS A 1 23  ? 11.911 -2.079  37.330 1.00 20.27 ? 40  HIS A O   1 
ATOM   163  C  CB  . HIS A 1 23  ? 9.421  -3.323  36.190 1.00 19.21 ? 40  HIS A CB  1 
ATOM   164  C  CG  . HIS A 1 23  ? 9.993  -3.357  34.807 1.00 20.18 ? 40  HIS A CG  1 
ATOM   165  N  ND1 . HIS A 1 23  ? 9.964  -4.489  34.014 1.00 20.16 ? 40  HIS A ND1 1 
ATOM   166  C  CD2 . HIS A 1 23  ? 10.694 -2.426  34.110 1.00 20.07 ? 40  HIS A CD2 1 
ATOM   167  C  CE1 . HIS A 1 23  ? 10.629 -4.255  32.893 1.00 20.65 ? 40  HIS A CE1 1 
ATOM   168  N  NE2 . HIS A 1 23  ? 11.081 -3.013  32.925 1.00 19.52 ? 40  HIS A NE2 1 
ATOM   169  N  N   . PHE A 1 24  ? 12.723 -4.045  36.657 1.00 19.00 ? 41  PHE A N   1 
ATOM   170  C  CA  . PHE A 1 24  ? 14.058 -3.472  36.455 1.00 21.80 ? 41  PHE A CA  1 
ATOM   171  C  C   . PHE A 1 24  ? 14.690 -3.769  35.079 1.00 21.42 ? 41  PHE A C   1 
ATOM   172  O  O   . PHE A 1 24  ? 15.601 -3.063  34.651 1.00 21.75 ? 41  PHE A O   1 
ATOM   173  C  CB  . PHE A 1 24  ? 15.022 -3.873  37.591 1.00 20.01 ? 41  PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 24  ? 15.380 -5.334  37.626 1.00 21.72 ? 41  PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 24  ? 16.483 -5.818  36.920 1.00 21.88 ? 41  PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 24  ? 14.613 -6.232  38.365 1.00 21.05 ? 41  PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 24  ? 16.811 -7.182  36.941 1.00 21.98 ? 41  PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 24  ? 14.929 -7.590  38.399 1.00 21.34 ? 41  PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 24  ? 16.037 -8.075  37.681 1.00 22.47 ? 41  PHE A CZ  1 
ATOM   180  N  N   . CYS A 1 25  ? 14.202 -4.791  34.374 1.00 20.51 ? 42  CYS A N   1 
ATOM   181  C  CA  . CYS A 1 25  ? 14.738 -5.112  33.047 1.00 21.21 ? 42  CYS A CA  1 
ATOM   182  C  C   . CYS A 1 25  ? 13.715 -5.942  32.288 1.00 20.34 ? 42  CYS A C   1 
ATOM   183  O  O   . CYS A 1 25  ? 12.800 -6.496  32.882 1.00 20.30 ? 42  CYS A O   1 
ATOM   184  C  CB  . CYS A 1 25  ? 16.015 -5.935  33.158 1.00 20.62 ? 42  CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 25  ? 17.594 -5.046  33.411 1.00 20.48 ? 42  CYS A SG  1 
ATOM   186  N  N   . GLY A 1 26  ? 13.868 -6.020  30.976 1.00 19.48 ? 43  GLY A N   1 
ATOM   187  C  CA  . GLY A 1 26  ? 12.964 -6.839  30.194 1.00 18.49 ? 43  GLY A CA  1 
ATOM   188  C  C   . GLY A 1 26  ? 13.692 -8.117  29.820 1.00 17.85 ? 43  GLY A C   1 
ATOM   189  O  O   . GLY A 1 26  ? 14.812 -8.370  30.274 1.00 16.47 ? 43  GLY A O   1 
ATOM   190  N  N   . GLY A 1 27  ? 13.063 -8.925  28.973 1.00 17.39 ? 44  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 27  ? 13.695 -10.156 28.541 1.00 17.18 ? 44  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 27  ? 12.792 -10.754 27.485 1.00 17.59 ? 44  GLY A C   1 
ATOM   193  O  O   . GLY A 1 27  ? 11.685 -10.237 27.276 1.00 15.46 ? 44  GLY A O   1 
ATOM   194  N  N   . SER A 1 28  ? 13.241 -11.823 26.831 1.00 17.17 ? 45  SER A N   1 
ATOM   195  C  CA  . SER A 1 28  ? 12.450 -12.477 25.787 1.00 19.37 ? 45  SER A CA  1 
ATOM   196  C  C   . SER A 1 28  ? 12.326 -13.959 26.058 1.00 19.16 ? 45  SER A C   1 
ATOM   197  O  O   . SER A 1 28  ? 13.314 -14.618 26.347 1.00 18.10 ? 45  SER A O   1 
ATOM   198  C  CB  . SER A 1 28  ? 13.121 -12.322 24.430 1.00 19.80 ? 45  SER A CB  1 
ATOM   199  O  OG  . SER A 1 28  ? 13.317 -10.963 24.105 1.00 24.71 ? 45  SER A OG  1 
ATOM   200  N  N   . LEU A 1 29  ? 11.120 -14.493 25.935 1.00 19.32 ? 46  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 29  ? 10.895 -15.914 26.135 1.00 21.08 ? 46  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 29  ? 11.341 -16.662 24.854 1.00 22.06 ? 46  LEU A C   1 
ATOM   203  O  O   . LEU A 1 29  ? 10.817 -16.396 23.779 1.00 24.37 ? 46  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 29  ? 9.395  -16.158 26.391 1.00 20.71 ? 46  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 29  ? 8.956  -17.572 26.793 1.00 23.29 ? 46  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 29  ? 9.567  -17.922 28.128 1.00 23.54 ? 46  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 29  ? 7.398  -17.642 26.895 1.00 25.89 ? 46  LEU A CD2 1 
ATOM   208  N  N   . ILE A 1 30  ? 12.301 -17.577 24.940 1.00 21.95 ? 47  ILE A N   1 
ATOM   209  C  CA  . ILE A 1 30  ? 12.709 -18.296 23.725 1.00 23.03 ? 47  ILE A CA  1 
ATOM   210  C  C   . ILE A 1 30  ? 12.206 -19.735 23.683 1.00 24.77 ? 47  ILE A C   1 
ATOM   211  O  O   . ILE A 1 30  ? 12.357 -20.411 22.680 1.00 25.74 ? 47  ILE A O   1 
ATOM   212  C  CB  . ILE A 1 30  ? 14.245 -18.281 23.472 1.00 22.06 ? 47  ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 30  ? 14.994 -18.905 24.636 1.00 22.97 ? 47  ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 30  ? 14.720 -16.849 23.198 1.00 21.72 ? 47  ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 30  ? 16.508 -18.968 24.378 1.00 25.94 ? 47  ILE A CD1 1 
ATOM   216  N  N   . ASN A 1 31  ? 11.680 -20.227 24.799 1.00 26.76 ? 48  ASN A N   1 
ATOM   217  C  CA  . ASN A 1 31  ? 11.028 -21.541 24.847 1.00 27.64 ? 48  ASN A CA  1 
ATOM   218  C  C   . ASN A 1 31  ? 10.295 -21.618 26.170 1.00 28.07 ? 48  ASN A C   1 
ATOM   219  O  O   . ASN A 1 31  ? 10.353 -20.670 26.951 1.00 26.81 ? 48  ASN A O   1 
ATOM   220  C  CB  . ASN A 1 31  ? 11.957 -22.754 24.574 1.00 28.90 ? 48  ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 31  ? 13.007 -22.980 25.627 1.00 31.26 ? 48  ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 31  ? 12.731 -23.015 26.826 1.00 30.63 ? 48  ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 31  ? 14.240 -23.173 25.172 1.00 32.18 ? 48  ASN A ND2 1 
ATOM   224  N  N   . SER A 1 32  ? 9.588  -22.711 26.438 1.00 27.73 ? 49  SER A N   1 
ATOM   225  C  CA  . SER A 1 32  ? 8.788  -22.763 27.656 1.00 27.92 ? 49  SER A CA  1 
ATOM   226  C  C   . SER A 1 32  ? 9.547  -22.616 28.954 1.00 27.18 ? 49  SER A C   1 
ATOM   227  O  O   . SER A 1 32  ? 8.959  -22.267 29.973 1.00 25.80 ? 49  SER A O   1 
ATOM   228  C  CB  . SER A 1 32  ? 7.972  -24.051 27.699 1.00 29.55 ? 49  SER A CB  1 
ATOM   229  O  OG  . SER A 1 32  ? 8.810  -25.130 28.024 1.00 30.26 ? 49  SER A OG  1 
ATOM   230  N  N   . GLN A 1 33  ? 10.853 -22.855 28.934 1.00 26.49 ? 50  GLN A N   1 
ATOM   231  C  CA  . GLN A 1 33  ? 11.622 -22.753 30.170 1.00 26.69 ? 50  GLN A CA  1 
ATOM   232  C  C   . GLN A 1 33  ? 12.826 -21.795 30.184 1.00 24.74 ? 50  GLN A C   1 
ATOM   233  O  O   . GLN A 1 33  ? 13.555 -21.720 31.186 1.00 23.20 ? 50  GLN A O   1 
ATOM   234  C  CB  . GLN A 1 33  ? 12.095 -24.153 30.592 1.00 30.58 ? 50  GLN A CB  1 
ATOM   235  C  CG  . GLN A 1 33  ? 11.301 -24.699 31.774 1.00 37.06 ? 50  GLN A CG  1 
ATOM   236  C  CD  . GLN A 1 33  ? 11.942 -25.909 32.441 1.00 40.68 ? 50  GLN A CD  1 
ATOM   237  O  OE1 . GLN A 1 33  ? 12.264 -26.897 31.771 1.00 41.36 ? 50  GLN A OE1 1 
ATOM   238  N  NE2 . GLN A 1 33  ? 12.121 -25.841 33.778 1.00 40.38 ? 50  GLN A NE2 1 
ATOM   239  N  N   . TRP A 1 34  ? 13.035 -21.058 29.099 1.00 22.14 ? 51  TRP A N   1 
ATOM   240  C  CA  . TRP A 1 34  ? 14.180 -20.171 29.052 1.00 21.21 ? 51  TRP A CA  1 
ATOM   241  C  C   . TRP A 1 34  ? 13.906 -18.760 28.562 1.00 20.97 ? 51  TRP A C   1 
ATOM   242  O  O   . TRP A 1 34  ? 13.173 -18.556 27.597 1.00 19.66 ? 51  TRP A O   1 
ATOM   243  C  CB  . TRP A 1 34  ? 15.280 -20.792 28.181 1.00 22.00 ? 51  TRP A CB  1 
ATOM   244  C  CG  . TRP A 1 34  ? 15.936 -22.017 28.785 1.00 22.51 ? 51  TRP A CG  1 
ATOM   245  C  CD1 . TRP A 1 34  ? 15.545 -23.330 28.641 1.00 23.36 ? 51  TRP A CD1 1 
ATOM   246  C  CD2 . TRP A 1 34  ? 17.141 -22.041 29.559 1.00 22.59 ? 51  TRP A CD2 1 
ATOM   247  N  NE1 . TRP A 1 34  ? 16.448 -24.163 29.274 1.00 24.31 ? 51  TRP A NE1 1 
ATOM   248  C  CE2 . TRP A 1 34  ? 17.434 -23.400 29.844 1.00 23.76 ? 51  TRP A CE2 1 
ATOM   249  C  CE3 . TRP A 1 34  ? 18.005 -21.046 30.038 1.00 23.59 ? 51  TRP A CE3 1 
ATOM   250  C  CZ2 . TRP A 1 34  ? 18.564 -23.788 30.582 1.00 24.04 ? 51  TRP A CZ2 1 
ATOM   251  C  CZ3 . TRP A 1 34  ? 19.132 -21.428 30.776 1.00 23.16 ? 51  TRP A CZ3 1 
ATOM   252  C  CH2 . TRP A 1 34  ? 19.397 -22.792 31.041 1.00 24.10 ? 51  TRP A CH2 1 
ATOM   253  N  N   . VAL A 1 35  ? 14.527 -17.791 29.228 1.00 19.67 ? 52  VAL A N   1 
ATOM   254  C  CA  . VAL A 1 35  ? 14.392 -16.398 28.866 1.00 18.86 ? 52  VAL A CA  1 
ATOM   255  C  C   . VAL A 1 35  ? 15.782 -15.859 28.491 1.00 20.41 ? 52  VAL A C   1 
ATOM   256  O  O   . VAL A 1 35  ? 16.786 -16.277 29.072 1.00 21.16 ? 52  VAL A O   1 
ATOM   257  C  CB  . VAL A 1 35  ? 13.846 -15.594 30.060 1.00 19.60 ? 52  VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 35  ? 14.015 -14.091 29.819 1.00 17.86 ? 52  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 35  ? 12.361 -15.951 30.281 1.00 18.55 ? 52  VAL A CG2 1 
ATOM   260  N  N   . VAL A 1 36  ? 15.857 -14.966 27.507 1.00 19.05 ? 53  VAL A N   1 
ATOM   261  C  CA  . VAL A 1 36  ? 17.156 -14.361 27.159 1.00 20.23 ? 53  VAL A CA  1 
ATOM   262  C  C   . VAL A 1 36  ? 17.040 -12.901 27.620 1.00 18.72 ? 53  VAL A C   1 
ATOM   263  O  O   . VAL A 1 36  ? 15.984 -12.262 27.420 1.00 18.01 ? 53  VAL A O   1 
ATOM   264  C  CB  . VAL A 1 36  ? 17.421 -14.345 25.611 1.00 22.91 ? 53  VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 36  ? 18.651 -13.500 25.305 1.00 24.98 ? 53  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 36  ? 17.656 -15.767 25.099 1.00 23.98 ? 53  VAL A CG2 1 
ATOM   267  N  N   . SER A 1 37  ? 18.099 -12.374 28.227 1.00 15.95 ? 54  SER A N   1 
ATOM   268  C  CA  . SER A 1 37  ? 18.102 -10.991 28.681 1.00 15.01 ? 54  SER A CA  1 
ATOM   269  C  C   . SER A 1 37  ? 19.542 -10.473 28.601 1.00 15.92 ? 54  SER A C   1 
ATOM   270  O  O   . SER A 1 37  ? 20.385 -11.109 27.971 1.00 16.72 ? 54  SER A O   1 
ATOM   271  C  CB  . SER A 1 37  ? 17.569 -10.900 30.112 1.00 14.90 ? 54  SER A CB  1 
ATOM   272  O  OG  . SER A 1 37  ? 17.409 -9.539  30.494 1.00 17.31 ? 54  SER A OG  1 
ATOM   273  N  N   . ALA A 1 38  ? 19.823 -9.324  29.218 1.00 16.34 ? 55  ALA A N   1 
ATOM   274  C  CA  . ALA A 1 38  ? 21.173 -8.771  29.180 1.00 17.39 ? 55  ALA A CA  1 
ATOM   275  C  C   . ALA A 1 38  ? 21.944 -9.174  30.427 1.00 18.50 ? 55  ALA A C   1 
ATOM   276  O  O   . ALA A 1 38  ? 21.373 -9.256  31.510 1.00 17.15 ? 55  ALA A O   1 
ATOM   277  C  CB  . ALA A 1 38  ? 21.104 -7.264  29.089 1.00 18.70 ? 55  ALA A CB  1 
ATOM   278  N  N   . ALA A 1 39  ? 23.254 -9.392  30.282 1.00 18.34 ? 56  ALA A N   1 
ATOM   279  C  CA  . ALA A 1 39  ? 24.075 -9.769  31.415 1.00 16.68 ? 56  ALA A CA  1 
ATOM   280  C  C   . ALA A 1 39  ? 24.072 -8.688  32.492 1.00 17.56 ? 56  ALA A C   1 
ATOM   281  O  O   . ALA A 1 39  ? 24.129 -9.016  33.689 1.00 16.41 ? 56  ALA A O   1 
ATOM   282  C  CB  . ALA A 1 39  ? 25.529 -10.032 30.961 1.00 17.04 ? 56  ALA A CB  1 
ATOM   283  N  N   . HIS A 1 40  ? 24.004 -7.411  32.104 1.00 17.13 ? 57  HIS A N   1 
ATOM   284  C  CA  . HIS A 1 40  ? 24.045 -6.371  33.123 1.00 18.95 ? 57  HIS A CA  1 
ATOM   285  C  C   . HIS A 1 40  ? 22.765 -6.313  33.943 1.00 21.00 ? 57  HIS A C   1 
ATOM   286  O  O   . HIS A 1 40  ? 22.675 -5.562  34.900 1.00 20.62 ? 57  HIS A O   1 
ATOM   287  C  CB  . HIS A 1 40  ? 24.406 -4.972  32.541 1.00 21.32 ? 57  HIS A CB  1 
ATOM   288  C  CG  . HIS A 1 40  ? 23.306 -4.303  31.764 1.00 21.99 ? 57  HIS A CG  1 
ATOM   289  N  ND1 . HIS A 1 40  ? 23.212 -4.376  30.390 1.00 20.69 ? 57  HIS A ND1 1 
ATOM   290  C  CD2 . HIS A 1 40  ? 22.266 -3.533  32.172 1.00 23.18 ? 57  HIS A CD2 1 
ATOM   291  C  CE1 . HIS A 1 40  ? 22.160 -3.684  29.983 1.00 23.88 ? 57  HIS A CE1 1 
ATOM   292  N  NE2 . HIS A 1 40  ? 21.569 -3.161  31.047 1.00 23.29 ? 57  HIS A NE2 1 
ATOM   293  N  N   . CYS A 1 41  ? 21.775 -7.119  33.584 1.00 18.48 ? 58  CYS A N   1 
ATOM   294  C  CA  . CYS A 1 41  ? 20.536 -7.135  34.358 1.00 20.81 ? 58  CYS A CA  1 
ATOM   295  C  C   . CYS A 1 41  ? 20.652 -8.202  35.445 1.00 22.52 ? 58  CYS A C   1 
ATOM   296  O  O   . CYS A 1 41  ? 19.726 -8.414  36.216 1.00 22.99 ? 58  CYS A O   1 
ATOM   297  C  CB  . CYS A 1 41  ? 19.354 -7.493  33.454 1.00 18.72 ? 58  CYS A CB  1 
ATOM   298  S  SG  . CYS A 1 41  ? 18.901 -6.156  32.315 1.00 20.85 ? 58  CYS A SG  1 
ATOM   299  N  N   . TYR A 1 42  ? 21.779 -8.897  35.498 1.00 22.40 ? 59  TYR A N   1 
ATOM   300  C  CA  . TYR A 1 42  ? 21.912 -9.946  36.490 1.00 23.73 ? 59  TYR A CA  1 
ATOM   301  C  C   . TYR A 1 42  ? 21.787 -9.501  37.946 1.00 23.43 ? 59  TYR A C   1 
ATOM   302  O  O   . TYR A 1 42  ? 22.299 -8.467  38.330 1.00 22.06 ? 59  TYR A O   1 
ATOM   303  C  CB  . TYR A 1 42  ? 23.245 -10.688 36.328 1.00 23.57 ? 59  TYR A CB  1 
ATOM   304  C  CG  . TYR A 1 42  ? 23.485 -11.654 37.466 1.00 27.37 ? 59  TYR A CG  1 
ATOM   305  C  CD1 . TYR A 1 42  ? 24.113 -11.229 38.642 1.00 27.87 ? 59  TYR A CD1 1 
ATOM   306  C  CD2 . TYR A 1 42  ? 22.995 -12.962 37.407 1.00 26.93 ? 59  TYR A CD2 1 
ATOM   307  C  CE1 . TYR A 1 42  ? 24.239 -12.077 39.734 1.00 31.62 ? 59  TYR A CE1 1 
ATOM   308  C  CE2 . TYR A 1 42  ? 23.115 -13.822 38.496 1.00 31.33 ? 59  TYR A CE2 1 
ATOM   309  C  CZ  . TYR A 1 42  ? 23.733 -13.370 39.654 1.00 31.80 ? 59  TYR A CZ  1 
ATOM   310  O  OH  . TYR A 1 42  ? 23.827 -14.199 40.735 1.00 35.10 ? 59  TYR A OH  1 
ATOM   311  N  N   . LYS A 1 43  ? 21.084 -10.304 38.741 1.00 24.80 ? 60  LYS A N   1 
ATOM   312  C  CA  . LYS A 1 43  ? 20.966 -10.115 40.201 1.00 27.05 ? 60  LYS A CA  1 
ATOM   313  C  C   . LYS A 1 43  ? 20.320 -11.379 40.761 1.00 26.84 ? 60  LYS A C   1 
ATOM   314  O  O   . LYS A 1 43  ? 19.766 -12.171 40.010 1.00 26.36 ? 60  LYS A O   1 
ATOM   315  C  CB  . LYS A 1 43  ? 20.125 -8.891  40.563 1.00 28.20 ? 60  LYS A CB  1 
ATOM   316  C  CG  . LYS A 1 43  ? 18.668 -9.057  40.243 1.00 31.31 ? 60  LYS A CG  1 
ATOM   317  C  CD  . LYS A 1 43  ? 17.844 -7.970  40.918 1.00 32.78 ? 60  LYS A CD  1 
ATOM   318  C  CE  . LYS A 1 43  ? 18.178 -6.591  40.393 1.00 33.91 ? 60  LYS A CE  1 
ATOM   319  N  NZ  . LYS A 1 43  ? 17.317 -5.574  41.070 1.00 34.05 ? 60  LYS A NZ  1 
ATOM   320  N  N   . SER A 1 44  ? 20.406 -11.605 42.066 1.00 28.68 ? 61  SER A N   1 
ATOM   321  C  CA  . SER A 1 44  ? 19.768 -12.795 42.619 1.00 31.17 ? 61  SER A CA  1 
ATOM   322  C  C   . SER A 1 44  ? 18.318 -12.426 42.925 1.00 30.84 ? 61  SER A C   1 
ATOM   323  O  O   . SER A 1 44  ? 17.961 -11.251 42.907 1.00 32.54 ? 61  SER A O   1 
ATOM   324  C  CB  . SER A 1 44  ? 20.492 -13.264 43.895 1.00 32.63 ? 61  SER A CB  1 
ATOM   325  O  OG  . SER A 1 44  ? 20.606 -12.198 44.827 1.00 36.69 ? 61  SER A OG  1 
ATOM   326  N  N   . GLY A 1 45  ? 17.474 -13.415 43.174 1.00 31.15 ? 62  GLY A N   1 
ATOM   327  C  CA  . GLY A 1 45  ? 16.093 -13.105 43.513 1.00 31.07 ? 62  GLY A CA  1 
ATOM   328  C  C   . GLY A 1 45  ? 15.248 -12.540 42.387 1.00 30.66 ? 62  GLY A C   1 
ATOM   329  O  O   . GLY A 1 45  ? 14.451 -11.614 42.582 1.00 31.82 ? 62  GLY A O   1 
ATOM   330  N  N   . ILE A 1 46  ? 15.397 -13.104 41.201 1.00 27.67 ? 63  ILE A N   1 
ATOM   331  C  CA  . ILE A 1 46  ? 14.633 -12.629 40.060 1.00 25.85 ? 63  ILE A CA  1 
ATOM   332  C  C   . ILE A 1 46  ? 13.331 -13.397 39.881 1.00 24.16 ? 63  ILE A C   1 
ATOM   333  O  O   . ILE A 1 46  ? 13.321 -14.631 39.919 1.00 24.05 ? 63  ILE A O   1 
ATOM   334  C  CB  . ILE A 1 46  ? 15.460 -12.766 38.768 1.00 26.70 ? 63  ILE A CB  1 
ATOM   335  C  CG1 . ILE A 1 46  ? 16.606 -11.754 38.790 1.00 26.67 ? 63  ILE A CG1 1 
ATOM   336  C  CG2 . ILE A 1 46  ? 14.581 -12.566 37.543 1.00 24.29 ? 63  ILE A CG2 1 
ATOM   337  C  CD1 . ILE A 1 46  ? 17.457 -11.799 37.565 1.00 29.81 ? 63  ILE A CD1 1 
ATOM   338  N  N   . GLN A 1 47  ? 12.231 -12.667 39.716 1.00 22.22 ? 64  GLN A N   1 
ATOM   339  C  CA  . GLN A 1 47  ? 10.957 -13.315 39.436 1.00 22.55 ? 64  GLN A CA  1 
ATOM   340  C  C   . GLN A 1 47  ? 10.619 -12.914 37.993 1.00 22.63 ? 64  GLN A C   1 
ATOM   341  O  O   . GLN A 1 47  ? 10.613 -11.724 37.645 1.00 22.08 ? 64  GLN A O   1 
ATOM   342  C  CB  . GLN A 1 47  ? 9.842  -12.840 40.364 1.00 22.30 ? 64  GLN A CB  1 
ATOM   343  C  CG  . GLN A 1 47  ? 8.519  -13.545 40.090 1.00 23.57 ? 64  GLN A CG  1 
ATOM   344  C  CD  . GLN A 1 47  ? 7.383  -13.005 40.945 1.00 25.43 ? 64  GLN A CD  1 
ATOM   345  O  OE1 . GLN A 1 47  ? 6.999  -11.849 40.820 1.00 27.70 ? 64  GLN A OE1 1 
ATOM   346  N  NE2 . GLN A 1 47  ? 6.854  -13.840 41.827 1.00 23.33 ? 64  GLN A NE2 1 
ATOM   347  N  N   . VAL A 1 48  ? 10.336 -13.900 37.150 1.00 17.62 ? 65  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 48  ? 10.037 -13.600 35.760 1.00 18.71 ? 65  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 48  ? 8.530  -13.471 35.635 1.00 18.94 ? 65  VAL A C   1 
ATOM   350  O  O   . VAL A 1 48  ? 7.790  -14.349 36.108 1.00 18.71 ? 65  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 48  ? 10.562 -14.726 34.830 1.00 17.51 ? 65  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 48  ? 10.167 -14.445 33.391 1.00 19.41 ? 65  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 48  ? 12.093 -14.813 34.946 1.00 18.83 ? 65  VAL A CG2 1 
ATOM   354  N  N   . ARG A 1 49  ? 8.079  -12.368 35.044 1.00 17.60 ? 66  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 49  ? 6.640  -12.142 34.869 1.00 19.25 ? 66  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 49  ? 6.289  -12.156 33.393 1.00 19.82 ? 66  ARG A C   1 
ATOM   357  O  O   . ARG A 1 49  ? 6.756  -11.308 32.617 1.00 19.60 ? 66  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 49  ? 6.223  -10.823 35.528 1.00 21.00 ? 66  ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 49  ? 6.544  -10.805 37.030 1.00 21.03 ? 66  ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 49  ? 6.042  -9.550  37.766 1.00 21.27 ? 66  ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 49  ? 6.028  -9.815  39.205 1.00 20.00 ? 66  ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 49  ? 5.404  -9.075  40.116 1.00 22.03 ? 66  ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 49  ? 4.727  -7.991  39.752 1.00 20.28 ? 66  ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 49  ? 5.432  -9.452  41.397 1.00 21.96 ? 66  ARG A NH2 1 
ATOM   365  N  N   . LEU A 1 50  ? 5.496  -13.156 33.008 1.00 19.49 ? 67  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 50  ? 5.069  -13.344 31.614 1.00 21.92 ? 67  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 50  ? 3.600  -12.938 31.433 1.00 22.40 ? 67  LEU A C   1 
ATOM   368  O  O   . LEU A 1 50  ? 2.839  -12.886 32.408 1.00 21.58 ? 67  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 50  ? 5.205  -14.820 31.207 1.00 22.35 ? 67  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 50  ? 6.561  -15.507 31.423 1.00 26.29 ? 67  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 50  ? 6.618  -16.015 32.827 1.00 28.49 ? 67  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 50  ? 6.717  -16.683 30.479 1.00 28.94 ? 67  LEU A CD2 1 
ATOM   373  N  N   . GLY A 1 51  ? 3.221  -12.652 30.189 1.00 21.77 ? 69  GLY A N   1 
ATOM   374  C  CA  . GLY A 1 51  ? 1.849  -12.270 29.889 1.00 22.63 ? 69  GLY A CA  1 
ATOM   375  C  C   . GLY A 1 51  ? 1.436  -10.920 30.457 1.00 23.01 ? 69  GLY A C   1 
ATOM   376  O  O   . GLY A 1 51  ? 0.247  -10.648 30.575 1.00 22.12 ? 69  GLY A O   1 
ATOM   377  N  N   . GLU A 1 52  ? 2.406  -10.073 30.802 1.00 21.26 ? 70  GLU A N   1 
ATOM   378  C  CA  . GLU A 1 52  ? 2.109  -8.753  31.361 1.00 21.74 ? 70  GLU A CA  1 
ATOM   379  C  C   . GLU A 1 52  ? 1.750  -7.653  30.353 1.00 22.46 ? 70  GLU A C   1 
ATOM   380  O  O   . GLU A 1 52  ? 2.210  -7.679  29.206 1.00 21.30 ? 70  GLU A O   1 
ATOM   381  C  CB  . GLU A 1 52  ? 3.322  -8.217  32.141 1.00 22.16 ? 70  GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 52  ? 3.530  -8.842  33.500 1.00 24.05 ? 70  GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 52  ? 2.586  -8.267  34.556 1.00 26.09 ? 70  GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 52  ? 1.593  -7.632  34.170 1.00 24.79 ? 70  GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 52  ? 2.845  -8.450  35.764 1.00 28.95 ? 70  GLU A OE2 1 
ATOM   386  N  N   . ASP A 1 53  ? 0.890  -6.721  30.774 1.00 21.29 ? 71  ASP A N   1 
ATOM   387  C  CA  . ASP A 1 53  ? 0.638  -5.508  29.986 1.00 22.21 ? 71  ASP A CA  1 
ATOM   388  C  C   . ASP A 1 53  ? 0.822  -4.349  30.980 1.00 23.94 ? 71  ASP A C   1 
ATOM   389  O  O   . ASP A 1 53  ? 1.801  -3.605  30.893 1.00 26.83 ? 71  ASP A O   1 
ATOM   390  C  CB  . ASP A 1 53  ? -0.744 -5.424  29.350 1.00 23.28 ? 71  ASP A CB  1 
ATOM   391  C  CG  . ASP A 1 53  ? -0.829 -4.234  28.396 1.00 26.25 ? 71  ASP A CG  1 
ATOM   392  O  OD1 . ASP A 1 53  ? 0.139  -4.045  27.625 1.00 24.52 ? 71  ASP A OD1 1 
ATOM   393  O  OD2 . ASP A 1 53  ? -1.824 -3.485  28.422 1.00 27.28 ? 71  ASP A OD2 1 
ATOM   394  N  N   . ASN A 1 54  ? -0.100 -4.198  31.933 1.00 23.48 ? 72  ASN A N   1 
ATOM   395  C  CA  . ASN A 1 54  ? 0.018  -3.162  32.969 1.00 23.91 ? 72  ASN A CA  1 
ATOM   396  C  C   . ASN A 1 54  ? 0.810  -3.844  34.077 1.00 24.32 ? 72  ASN A C   1 
ATOM   397  O  O   . ASN A 1 54  ? 0.280  -4.742  34.726 1.00 24.62 ? 72  ASN A O   1 
ATOM   398  C  CB  . ASN A 1 54  ? -1.368 -2.777  33.513 1.00 24.29 ? 72  ASN A CB  1 
ATOM   399  C  CG  . ASN A 1 54  ? -1.310 -1.648  34.540 1.00 24.52 ? 72  ASN A CG  1 
ATOM   400  O  OD1 . ASN A 1 54  ? -0.388 -1.568  35.355 1.00 23.37 ? 72  ASN A OD1 1 
ATOM   401  N  ND2 . ASN A 1 54  ? -2.311 -0.773  34.506 1.00 24.34 ? 72  ASN A ND2 1 
ATOM   402  N  N   . ILE A 1 55  ? 2.060  -3.440  34.320 1.00 24.82 ? 73  ILE A N   1 
ATOM   403  C  CA  . ILE A 1 55  ? 2.849  -4.129  35.347 1.00 26.68 ? 73  ILE A CA  1 
ATOM   404  C  C   . ILE A 1 55  ? 2.495  -3.786  36.778 1.00 26.86 ? 73  ILE A C   1 
ATOM   405  O  O   . ILE A 1 55  ? 3.047  -4.376  37.704 1.00 24.87 ? 73  ILE A O   1 
ATOM   406  C  CB  . ILE A 1 55  ? 4.384  -3.889  35.195 1.00 27.56 ? 73  ILE A CB  1 
ATOM   407  C  CG1 . ILE A 1 55  ? 4.672  -2.388  35.191 1.00 26.84 ? 73  ILE A CG1 1 
ATOM   408  C  CG2 . ILE A 1 55  ? 4.908  -4.608  33.966 1.00 27.07 ? 73  ILE A CG2 1 
ATOM   409  C  CD1 . ILE A 1 55  ? 6.159  -2.070  35.213 1.00 32.46 ? 73  ILE A CD1 1 
ATOM   410  N  N   . ASN A 1 56  ? 1.570  -2.848  36.968 1.00 27.99 ? 74  ASN A N   1 
ATOM   411  C  CA  . ASN A 1 56  ? 1.187  -2.470  38.325 1.00 28.11 ? 74  ASN A CA  1 
ATOM   412  C  C   . ASN A 1 56  ? -0.135 -3.049  38.780 1.00 27.83 ? 74  ASN A C   1 
ATOM   413  O  O   . ASN A 1 56  ? -0.492 -2.911  39.951 1.00 26.99 ? 74  ASN A O   1 
ATOM   414  C  CB  . ASN A 1 56  ? 1.156  -0.951  38.452 1.00 29.30 ? 74  ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 56  ? 2.541  -0.357  38.363 1.00 32.66 ? 74  ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 56  ? 3.443  -0.761  39.109 1.00 34.58 ? 74  ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 56  ? 2.730  0.586   37.456 1.00 31.84 ? 74  ASN A ND2 1 
ATOM   418  N  N   . VAL A 1 57  ? -0.849 -3.708  37.871 1.00 25.13 ? 75  VAL A N   1 
ATOM   419  C  CA  . VAL A 1 57  ? -2.145 -4.274  38.205 1.00 26.39 ? 75  VAL A CA  1 
ATOM   420  C  C   . VAL A 1 57  ? -2.277 -5.692  37.683 1.00 25.81 ? 75  VAL A C   1 
ATOM   421  O  O   . VAL A 1 57  ? -1.859 -5.961  36.571 1.00 26.35 ? 75  VAL A O   1 
ATOM   422  C  CB  . VAL A 1 57  ? -3.281 -3.434  37.567 1.00 27.55 ? 75  VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 57  ? -4.624 -4.090  37.841 1.00 29.12 ? 75  VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 57  ? -3.245 -2.001  38.109 1.00 29.86 ? 75  VAL A CG2 1 
ATOM   425  N  N   . VAL A 1 58  ? -2.828 -6.603  38.484 1.00 24.94 ? 76  VAL A N   1 
ATOM   426  C  CA  . VAL A 1 58  ? -3.064 -7.968  38.009 1.00 25.37 ? 76  VAL A CA  1 
ATOM   427  C  C   . VAL A 1 58  ? -4.373 -7.860  37.196 1.00 25.98 ? 76  VAL A C   1 
ATOM   428  O  O   . VAL A 1 58  ? -5.412 -7.477  37.736 1.00 26.59 ? 76  VAL A O   1 
ATOM   429  C  CB  . VAL A 1 58  ? -3.260 -8.959  39.190 1.00 24.05 ? 76  VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 58  ? -3.688 -10.338 38.649 1.00 25.65 ? 76  VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 58  ? -1.961 -9.096  39.975 1.00 25.36 ? 76  VAL A CG2 1 
ATOM   432  N  N   . GLU A 1 59  ? -4.328 -8.193  35.910 1.00 26.15 ? 77  GLU A N   1 
ATOM   433  C  CA  . GLU A 1 59  ? -5.508 -8.066  35.036 1.00 28.34 ? 77  GLU A CA  1 
ATOM   434  C  C   . GLU A 1 59  ? -5.953 -9.383  34.431 1.00 27.58 ? 77  GLU A C   1 
ATOM   435  O  O   . GLU A 1 59  ? -7.048 -9.479  33.874 1.00 28.54 ? 77  GLU A O   1 
ATOM   436  C  CB  . GLU A 1 59  ? -5.205 -7.131  33.857 1.00 29.47 ? 77  GLU A CB  1 
ATOM   437  C  CG  . GLU A 1 59  ? -4.707 -5.764  34.218 1.00 33.15 ? 77  GLU A CG  1 
ATOM   438  C  CD  . GLU A 1 59  ? -4.370 -4.939  32.973 1.00 35.54 ? 77  GLU A CD  1 
ATOM   439  O  OE1 . GLU A 1 59  ? -3.419 -5.296  32.249 1.00 34.01 ? 77  GLU A OE1 1 
ATOM   440  O  OE2 . GLU A 1 59  ? -5.062 -3.937  32.728 1.00 38.55 ? 77  GLU A OE2 1 
ATOM   441  N  N   . GLY A 1 60  ? -5.081 -10.377 34.510 1.00 27.45 ? 78  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 60  ? -5.367 -11.673 33.936 1.00 26.23 ? 78  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 60  ? -4.307 -11.977 32.895 1.00 25.91 ? 78  GLY A C   1 
ATOM   444  O  O   . GLY A 1 60  ? -3.754 -11.060 32.292 1.00 25.05 ? 78  GLY A O   1 
ATOM   445  N  N   . ASN A 1 61  ? -4.021 -13.261 32.711 1.00 25.22 ? 79  ASN A N   1 
ATOM   446  C  CA  . ASN A 1 61  ? -3.039 -13.744 31.747 1.00 27.01 ? 79  ASN A CA  1 
ATOM   447  C  C   . ASN A 1 61  ? -1.616 -13.720 32.262 1.00 25.18 ? 79  ASN A C   1 
ATOM   448  O  O   . ASN A 1 61  ? -0.727 -14.248 31.602 1.00 24.26 ? 79  ASN A O   1 
ATOM   449  C  CB  . ASN A 1 61  ? -3.091 -12.941 30.438 1.00 28.68 ? 79  ASN A CB  1 
ATOM   450  C  CG  . ASN A 1 61  ? -4.444 -13.032 29.757 1.00 32.88 ? 79  ASN A CG  1 
ATOM   451  O  OD1 . ASN A 1 61  ? -4.983 -14.127 29.571 1.00 32.86 ? 79  ASN A OD1 1 
ATOM   452  N  ND2 . ASN A 1 61  ? -4.997 -11.877 29.372 1.00 31.52 ? 79  ASN A ND2 1 
ATOM   453  N  N   . GLU A 1 62  ? -1.380 -13.102 33.418 1.00 23.87 ? 80  GLU A N   1 
ATOM   454  C  CA  . GLU A 1 62  ? -0.013 -13.071 33.941 1.00 22.93 ? 80  GLU A CA  1 
ATOM   455  C  C   . GLU A 1 62  ? 0.400  -14.437 34.510 1.00 23.79 ? 80  GLU A C   1 
ATOM   456  O  O   . GLU A 1 62  ? -0.429 -15.198 34.988 1.00 21.71 ? 80  GLU A O   1 
ATOM   457  C  CB  . GLU A 1 62  ? 0.138  -12.038 35.070 1.00 23.06 ? 80  GLU A CB  1 
ATOM   458  C  CG  . GLU A 1 62  ? -0.167 -10.581 34.696 1.00 25.19 ? 80  GLU A CG  1 
ATOM   459  C  CD  . GLU A 1 62  ? -1.596 -10.171 35.034 1.00 25.54 ? 80  GLU A CD  1 
ATOM   460  O  OE1 . GLU A 1 62  ? -2.469 -11.064 35.104 1.00 23.57 ? 80  GLU A OE1 1 
ATOM   461  O  OE2 . GLU A 1 62  ? -1.854 -8.962  35.200 1.00 26.06 ? 80  GLU A OE2 1 
ATOM   462  N  N   . GLN A 1 63  ? 1.694  -14.732 34.438 1.00 22.10 ? 81  GLN A N   1 
ATOM   463  C  CA  . GLN A 1 63  ? 2.274  -15.937 35.015 1.00 22.44 ? 81  GLN A CA  1 
ATOM   464  C  C   . GLN A 1 63  ? 3.543  -15.406 35.675 1.00 22.38 ? 81  GLN A C   1 
ATOM   465  O  O   . GLN A 1 63  ? 4.363  -14.755 35.007 1.00 20.58 ? 81  GLN A O   1 
ATOM   466  C  CB  . GLN A 1 63  ? 2.658  -16.977 33.951 1.00 23.20 ? 81  GLN A CB  1 
ATOM   467  C  CG  . GLN A 1 63  ? 1.507  -17.794 33.421 1.00 24.83 ? 81  GLN A CG  1 
ATOM   468  C  CD  . GLN A 1 63  ? 1.920  -18.693 32.263 1.00 25.76 ? 81  GLN A CD  1 
ATOM   469  O  OE1 . GLN A 1 63  ? 2.757  -19.579 32.430 1.00 24.92 ? 81  GLN A OE1 1 
ATOM   470  N  NE2 . GLN A 1 63  ? 1.342  -18.456 31.079 1.00 25.08 ? 81  GLN A NE2 1 
ATOM   471  N  N   . PHE A 1 64  ? 3.679  -15.635 36.980 1.00 20.33 ? 82  PHE A N   1 
ATOM   472  C  CA  . PHE A 1 64  ? 4.859  -15.201 37.720 1.00 21.21 ? 82  PHE A CA  1 
ATOM   473  C  C   . PHE A 1 64  ? 5.639  -16.478 38.003 1.00 22.80 ? 82  PHE A C   1 
ATOM   474  O  O   . PHE A 1 64  ? 5.108  -17.399 38.627 1.00 21.11 ? 82  PHE A O   1 
ATOM   475  C  CB  . PHE A 1 64  ? 4.469  -14.544 39.056 1.00 20.65 ? 82  PHE A CB  1 
ATOM   476  C  CG  . PHE A 1 64  ? 3.739  -13.229 38.919 1.00 24.59 ? 82  PHE A CG  1 
ATOM   477  C  CD1 . PHE A 1 64  ? 3.207  -12.600 40.052 1.00 23.12 ? 82  PHE A CD1 1 
ATOM   478  C  CD2 . PHE A 1 64  ? 3.594  -12.602 37.678 1.00 24.83 ? 82  PHE A CD2 1 
ATOM   479  C  CE1 . PHE A 1 64  ? 2.550  -11.376 39.939 1.00 24.05 ? 82  PHE A CE1 1 
ATOM   480  C  CE2 . PHE A 1 64  ? 2.933  -11.369 37.561 1.00 24.49 ? 82  PHE A CE2 1 
ATOM   481  C  CZ  . PHE A 1 64  ? 2.414  -10.758 38.688 1.00 24.25 ? 82  PHE A CZ  1 
ATOM   482  N  N   . ILE A 1 65  ? 6.893  -16.543 37.562 1.00 22.22 ? 83  ILE A N   1 
ATOM   483  C  CA  . ILE A 1 65  ? 7.676  -17.746 37.771 1.00 21.21 ? 83  ILE A CA  1 
ATOM   484  C  C   . ILE A 1 65  ? 9.049  -17.353 38.236 1.00 21.84 ? 83  ILE A C   1 
ATOM   485  O  O   . ILE A 1 65  ? 9.656  -16.447 37.672 1.00 19.76 ? 83  ILE A O   1 
ATOM   486  C  CB  . ILE A 1 65  ? 7.804  -18.555 36.458 1.00 21.71 ? 83  ILE A CB  1 
ATOM   487  C  CG1 . ILE A 1 65  ? 6.398  -18.872 35.902 1.00 23.08 ? 83  ILE A CG1 1 
ATOM   488  C  CG2 . ILE A 1 65  ? 8.588  -19.846 36.713 1.00 21.71 ? 83  ILE A CG2 1 
ATOM   489  C  CD1 . ILE A 1 65  ? 6.417  -19.728 34.620 1.00 23.77 ? 83  ILE A CD1 1 
ATOM   490  N  N   . SER A 1 66  ? 9.544  -18.019 39.270 1.00 20.82 ? 84  SER A N   1 
ATOM   491  C  CA  . SER A 1 66  ? 10.877 -17.712 39.785 1.00 24.08 ? 84  SER A CA  1 
ATOM   492  C  C   . SER A 1 66  ? 11.975 -18.211 38.870 1.00 23.14 ? 84  SER A C   1 
ATOM   493  O  O   . SER A 1 66  ? 11.826 -19.216 38.181 1.00 21.30 ? 84  SER A O   1 
ATOM   494  C  CB  . SER A 1 66  ? 11.070 -18.336 41.175 1.00 26.58 ? 84  SER A CB  1 
ATOM   495  O  OG  . SER A 1 66  ? 10.235 -17.681 42.116 1.00 32.34 ? 84  SER A OG  1 
ATOM   496  N  N   . ALA A 1 67  ? 13.083 -17.482 38.846 1.00 24.34 ? 85  ALA A N   1 
ATOM   497  C  CA  . ALA A 1 67  ? 14.221 -17.895 38.047 1.00 24.32 ? 85  ALA A CA  1 
ATOM   498  C  C   . ALA A 1 67  ? 14.871 -19.017 38.840 1.00 26.12 ? 85  ALA A C   1 
ATOM   499  O  O   . ALA A 1 67  ? 15.031 -18.922 40.055 1.00 25.44 ? 85  ALA A O   1 
ATOM   500  C  CB  . ALA A 1 67  ? 15.210 -16.738 37.887 1.00 23.74 ? 85  ALA A CB  1 
ATOM   501  N  N   . SER A 1 68  ? 15.234 -20.082 38.154 1.00 27.58 ? 86  SER A N   1 
ATOM   502  C  CA  . SER A 1 68  ? 15.890 -21.210 38.799 1.00 29.21 ? 86  SER A CA  1 
ATOM   503  C  C   . SER A 1 68  ? 17.396 -20.922 38.776 1.00 29.19 ? 86  SER A C   1 
ATOM   504  O  O   . SER A 1 68  ? 18.122 -21.243 39.704 1.00 28.82 ? 86  SER A O   1 
ATOM   505  C  CB  . SER A 1 68  ? 15.579 -22.483 38.018 1.00 29.26 ? 86  SER A CB  1 
ATOM   506  O  OG  . SER A 1 68  ? 16.335 -23.543 38.538 1.00 36.88 ? 86  SER A OG  1 
ATOM   507  N  N   . LYS A 1 69  ? 17.867 -20.324 37.694 1.00 28.13 ? 87  LYS A N   1 
ATOM   508  C  CA  . LYS A 1 69  ? 19.283 -19.968 37.595 1.00 30.77 ? 87  LYS A CA  1 
ATOM   509  C  C   . LYS A 1 69  ? 19.462 -18.952 36.480 1.00 28.35 ? 87  LYS A C   1 
ATOM   510  O  O   . LYS A 1 69  ? 18.678 -18.899 35.529 1.00 27.10 ? 87  LYS A O   1 
ATOM   511  C  CB  . LYS A 1 69  ? 20.151 -21.199 37.321 1.00 32.47 ? 87  LYS A CB  1 
ATOM   512  C  CG  . LYS A 1 69  ? 19.662 -22.030 36.169 1.00 35.56 ? 87  LYS A CG  1 
ATOM   513  C  CD  . LYS A 1 69  ? 20.268 -23.433 36.206 1.00 40.39 ? 87  LYS A CD  1 
ATOM   514  C  CE  . LYS A 1 69  ? 21.777 -23.377 36.040 1.00 41.43 ? 87  LYS A CE  1 
ATOM   515  N  NZ  . LYS A 1 69  ? 22.358 -24.728 36.177 1.00 44.68 ? 87  LYS A NZ  1 
ATOM   516  N  N   . SER A 1 70  ? 20.497 -18.146 36.628 1.00 25.81 ? 88  SER A N   1 
ATOM   517  C  CA  . SER A 1 70  ? 20.803 -17.120 35.661 1.00 26.70 ? 88  SER A CA  1 
ATOM   518  C  C   . SER A 1 70  ? 22.213 -17.408 35.200 1.00 25.88 ? 88  SER A C   1 
ATOM   519  O  O   . SER A 1 70  ? 23.105 -17.609 36.018 1.00 25.07 ? 88  SER A O   1 
ATOM   520  C  CB  . SER A 1 70  ? 20.702 -15.751 36.329 1.00 26.61 ? 88  SER A CB  1 
ATOM   521  O  OG  . SER A 1 70  ? 19.357 -15.516 36.719 1.00 32.63 ? 88  SER A OG  1 
ATOM   522  N  N   . ILE A 1 71  ? 22.405 -17.441 33.889 1.00 23.24 ? 89  ILE A N   1 
ATOM   523  C  CA  . ILE A 1 71  ? 23.705 -17.749 33.312 1.00 22.07 ? 89  ILE A CA  1 
ATOM   524  C  C   . ILE A 1 71  ? 24.200 -16.574 32.486 1.00 22.22 ? 89  ILE A C   1 
ATOM   525  O  O   . ILE A 1 71  ? 23.748 -16.359 31.352 1.00 20.80 ? 89  ILE A O   1 
ATOM   526  C  CB  . ILE A 1 71  ? 23.608 -18.979 32.390 1.00 21.64 ? 89  ILE A CB  1 
ATOM   527  C  CG1 . ILE A 1 71  ? 23.037 -20.168 33.179 1.00 23.18 ? 89  ILE A CG1 1 
ATOM   528  C  CG2 . ILE A 1 71  ? 24.977 -19.281 31.776 1.00 21.19 ? 89  ILE A CG2 1 
ATOM   529  C  CD1 . ILE A 1 71  ? 22.952 -21.491 32.383 1.00 25.21 ? 89  ILE A CD1 1 
ATOM   530  N  N   . VAL A 1 72  ? 25.122 -15.821 33.069 1.00 22.08 ? 90  VAL A N   1 
ATOM   531  C  CA  . VAL A 1 72  ? 25.726 -14.680 32.409 1.00 23.11 ? 90  VAL A CA  1 
ATOM   532  C  C   . VAL A 1 72  ? 26.822 -15.247 31.511 1.00 23.20 ? 90  VAL A C   1 
ATOM   533  O  O   . VAL A 1 72  ? 27.511 -16.197 31.891 1.00 21.06 ? 90  VAL A O   1 
ATOM   534  C  CB  . VAL A 1 72  ? 26.360 -13.719 33.442 1.00 23.90 ? 90  VAL A CB  1 
ATOM   535  C  CG1 . VAL A 1 72  ? 27.216 -12.664 32.732 1.00 24.70 ? 90  VAL A CG1 1 
ATOM   536  C  CG2 . VAL A 1 72  ? 25.251 -13.042 34.257 1.00 24.78 ? 90  VAL A CG2 1 
ATOM   537  N  N   . HIS A 1 73  ? 26.971 -14.681 30.319 1.00 20.39 ? 91  HIS A N   1 
ATOM   538  C  CA  . HIS A 1 73  ? 27.996 -15.128 29.403 1.00 19.91 ? 91  HIS A CA  1 
ATOM   539  C  C   . HIS A 1 73  ? 29.347 -15.055 30.120 1.00 20.30 ? 91  HIS A C   1 
ATOM   540  O  O   . HIS A 1 73  ? 29.690 -14.035 30.717 1.00 20.38 ? 91  HIS A O   1 
ATOM   541  C  CB  . HIS A 1 73  ? 28.017 -14.243 28.159 1.00 20.22 ? 91  HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 73  ? 28.800 -14.837 27.035 1.00 20.31 ? 91  HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 73  ? 30.179 -14.836 27.008 1.00 20.72 ? 91  HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 73  ? 28.397 -15.510 25.929 1.00 21.59 ? 91  HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 73  ? 30.591 -15.485 25.930 1.00 22.93 ? 91  HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 73  ? 29.528 -15.903 25.259 1.00 20.45 ? 91  HIS A NE2 1 
ATOM   547  N  N   . PRO A 1 74  ? 30.120 -16.148 30.082 1.00 22.10 ? 92  PRO A N   1 
ATOM   548  C  CA  . PRO A 1 74  ? 31.438 -16.229 30.734 1.00 23.81 ? 92  PRO A CA  1 
ATOM   549  C  C   . PRO A 1 74  ? 32.392 -15.091 30.362 1.00 23.27 ? 92  PRO A C   1 
ATOM   550  O  O   . PRO A 1 74  ? 33.269 -14.743 31.147 1.00 23.43 ? 92  PRO A O   1 
ATOM   551  C  CB  . PRO A 1 74  ? 31.983 -17.585 30.260 1.00 24.04 ? 92  PRO A CB  1 
ATOM   552  C  CG  . PRO A 1 74  ? 30.720 -18.379 29.985 1.00 27.66 ? 92  PRO A CG  1 
ATOM   553  C  CD  . PRO A 1 74  ? 29.835 -17.372 29.311 1.00 22.26 ? 92  PRO A CD  1 
ATOM   554  N  N   . SER A 1 75  ? 32.230 -14.532 29.166 1.00 23.05 ? 93  SER A N   1 
ATOM   555  C  CA  . SER A 1 75  ? 33.108 -13.461 28.706 1.00 23.89 ? 93  SER A CA  1 
ATOM   556  C  C   . SER A 1 75  ? 32.508 -12.052 28.770 1.00 24.11 ? 93  SER A C   1 
ATOM   557  O  O   . SER A 1 75  ? 33.041 -11.088 28.206 1.00 23.06 ? 93  SER A O   1 
ATOM   558  C  CB  . SER A 1 75  ? 33.584 -13.778 27.294 1.00 25.24 ? 93  SER A CB  1 
ATOM   559  O  OG  . SER A 1 75  ? 34.423 -14.920 27.332 1.00 27.91 ? 93  SER A OG  1 
ATOM   560  N  N   . TYR A 1 76  ? 31.390 -11.932 29.465 1.00 23.62 ? 94  TYR A N   1 
ATOM   561  C  CA  . TYR A 1 76  ? 30.766 -10.633 29.637 1.00 23.35 ? 94  TYR A CA  1 
ATOM   562  C  C   . TYR A 1 76  ? 31.792 -9.706  30.321 1.00 24.15 ? 94  TYR A C   1 
ATOM   563  O  O   . TYR A 1 76  ? 32.413 -10.092 31.303 1.00 21.51 ? 94  TYR A O   1 
ATOM   564  C  CB  . TYR A 1 76  ? 29.538 -10.780 30.538 1.00 23.07 ? 94  TYR A CB  1 
ATOM   565  C  CG  . TYR A 1 76  ? 29.023 -9.459  31.053 1.00 22.32 ? 94  TYR A CG  1 
ATOM   566  C  CD1 . TYR A 1 76  ? 28.961 -9.199  32.418 1.00 21.38 ? 94  TYR A CD1 1 
ATOM   567  C  CD2 . TYR A 1 76  ? 28.599 -8.466  30.165 1.00 23.20 ? 94  TYR A CD2 1 
ATOM   568  C  CE1 . TYR A 1 76  ? 28.491 -7.980  32.892 1.00 22.94 ? 94  TYR A CE1 1 
ATOM   569  C  CE2 . TYR A 1 76  ? 28.118 -7.248  30.624 1.00 21.49 ? 94  TYR A CE2 1 
ATOM   570  C  CZ  . TYR A 1 76  ? 28.067 -7.008  31.981 1.00 22.98 ? 94  TYR A CZ  1 
ATOM   571  O  OH  . TYR A 1 76  ? 27.590 -5.791  32.428 1.00 25.68 ? 94  TYR A OH  1 
ATOM   572  N  N   . ASN A 1 77  ? 31.971 -8.494  29.801 1.00 23.50 ? 95  ASN A N   1 
ATOM   573  C  CA  . ASN A 1 77  ? 32.896 -7.537  30.399 1.00 26.75 ? 95  ASN A CA  1 
ATOM   574  C  C   . ASN A 1 77  ? 32.067 -6.328  30.801 1.00 26.95 ? 95  ASN A C   1 
ATOM   575  O  O   . ASN A 1 77  ? 31.571 -5.601  29.928 1.00 26.16 ? 95  ASN A O   1 
ATOM   576  C  CB  . ASN A 1 77  ? 33.963 -7.109  29.383 1.00 29.59 ? 95  ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 77  ? 34.964 -6.125  29.967 1.00 32.48 ? 95  ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 77  ? 34.593 -5.162  30.633 1.00 33.15 ? 95  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 77  ? 36.247 -6.367  29.711 1.00 35.46 ? 95  ASN A ND2 1 
ATOM   580  N  N   . SER A 1 78  ? 31.920 -6.090  32.099 1.00 27.37 ? 96  SER A N   1 
ATOM   581  C  CA  . SER A 1 78  ? 31.099 -4.965  32.550 1.00 31.36 ? 96  SER A CA  1 
ATOM   582  C  C   . SER A 1 78  ? 31.622 -3.583  32.174 1.00 32.40 ? 96  SER A C   1 
ATOM   583  O  O   . SER A 1 78  ? 30.866 -2.608  32.191 1.00 34.29 ? 96  SER A O   1 
ATOM   584  C  CB  . SER A 1 78  ? 30.899 -5.029  34.064 1.00 32.55 ? 96  SER A CB  1 
ATOM   585  O  OG  . SER A 1 78  ? 32.143 -5.012  34.741 1.00 35.23 ? 96  SER A OG  1 
ATOM   586  N  N   . ASN A 1 79  ? 32.900 -3.487  31.835 1.00 32.15 ? 97  ASN A N   1 
ATOM   587  C  CA  . ASN A 1 79  ? 33.470 -2.190  31.480 1.00 34.80 ? 97  ASN A CA  1 
ATOM   588  C  C   . ASN A 1 79  ? 33.180 -1.778  30.054 1.00 34.13 ? 97  ASN A C   1 
ATOM   589  O  O   . ASN A 1 79  ? 33.014 -0.599  29.779 1.00 35.60 ? 97  ASN A O   1 
ATOM   590  C  CB  . ASN A 1 79  ? 34.982 -2.192  31.667 1.00 38.06 ? 97  ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 79  ? 35.383 -2.325  33.115 1.00 42.89 ? 97  ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 79  ? 35.052 -1.469  33.937 1.00 45.73 ? 97  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 79  ? 36.098 -3.406  33.442 1.00 45.61 ? 97  ASN A ND2 1 
ATOM   594  N  N   . THR A 1 80  ? 33.119 -2.750  29.151 1.00 31.58 ? 98  THR A N   1 
ATOM   595  C  CA  . THR A 1 80  ? 32.884 -2.472  27.741 1.00 29.82 ? 98  THR A CA  1 
ATOM   596  C  C   . THR A 1 80  ? 31.483 -2.904  27.291 1.00 29.08 ? 98  THR A C   1 
ATOM   597  O  O   . THR A 1 80  ? 31.011 -2.482  26.239 1.00 27.66 ? 98  THR A O   1 
ATOM   598  C  CB  . THR A 1 80  ? 33.880 -3.240  26.880 1.00 30.08 ? 98  THR A CB  1 
ATOM   599  O  OG1 . THR A 1 80  ? 33.653 -4.647  27.044 1.00 27.18 ? 98  THR A OG1 1 
ATOM   600  C  CG2 . THR A 1 80  ? 35.315 -2.925  27.310 1.00 30.51 ? 98  THR A CG2 1 
ATOM   601  N  N   . LEU A 1 81  ? 30.847 -3.754  28.092 1.00 25.72 ? 99  LEU A N   1 
ATOM   602  C  CA  . LEU A 1 81  ? 29.527 -4.299  27.798 1.00 25.51 ? 99  LEU A CA  1 
ATOM   603  C  C   . LEU A 1 81  ? 29.597 -5.278  26.622 1.00 24.53 ? 99  LEU A C   1 
ATOM   604  O  O   . LEU A 1 81  ? 28.594 -5.597  25.994 1.00 24.40 ? 99  LEU A O   1 
ATOM   605  C  CB  . LEU A 1 81  ? 28.519 -3.173  27.544 1.00 26.16 ? 99  LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 81  ? 28.250 -2.349  28.815 1.00 27.63 ? 99  LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 81  ? 27.376 -1.160  28.472 1.00 31.67 ? 99  LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 81  ? 27.561 -3.207  29.877 1.00 27.22 ? 99  LEU A CD2 1 
ATOM   609  N  N   . ASN A 1 82  ? 30.793 -5.764  26.316 1.00 22.20 ? 100 ASN A N   1 
ATOM   610  C  CA  . ASN A 1 82  ? 30.919 -6.752  25.250 1.00 23.17 ? 100 ASN A CA  1 
ATOM   611  C  C   . ASN A 1 82  ? 30.309 -8.067  25.799 1.00 23.56 ? 100 ASN A C   1 
ATOM   612  O  O   . ASN A 1 82  ? 30.467 -8.374  26.983 1.00 22.17 ? 100 ASN A O   1 
ATOM   613  C  CB  . ASN A 1 82  ? 32.402 -6.958  24.884 1.00 23.63 ? 100 ASN A CB  1 
ATOM   614  C  CG  . ASN A 1 82  ? 32.580 -7.748  23.598 1.00 26.40 ? 100 ASN A CG  1 
ATOM   615  O  OD1 . ASN A 1 82  ? 31.783 -7.633  22.669 1.00 23.72 ? 100 ASN A OD1 1 
ATOM   616  N  ND2 . ASN A 1 82  ? 33.648 -8.533  23.526 1.00 27.47 ? 100 ASN A ND2 1 
ATOM   617  N  N   . ASN A 1 83  ? 29.646 -8.843  24.943 1.00 21.44 ? 101 ASN A N   1 
ATOM   618  C  CA  . ASN A 1 83  ? 28.994 -10.101 25.361 1.00 23.00 ? 101 ASN A CA  1 
ATOM   619  C  C   . ASN A 1 83  ? 27.939 -9.855  26.446 1.00 22.22 ? 101 ASN A C   1 
ATOM   620  O  O   . ASN A 1 83  ? 27.835 -10.607 27.441 1.00 20.49 ? 101 ASN A O   1 
ATOM   621  C  CB  . ASN A 1 83  ? 30.018 -11.125 25.877 1.00 21.99 ? 101 ASN A CB  1 
ATOM   622  C  CG  . ASN A 1 83  ? 31.101 -11.418 24.873 1.00 23.92 ? 101 ASN A CG  1 
ATOM   623  O  OD1 . ASN A 1 83  ? 32.281 -11.209 25.152 1.00 26.54 ? 101 ASN A OD1 1 
ATOM   624  N  ND2 . ASN A 1 83  ? 30.719 -11.904 23.704 1.00 19.21 ? 101 ASN A ND2 1 
ATOM   625  N  N   . ASP A 1 84  ? 27.138 -8.818  26.238 1.00 21.02 ? 102 ASP A N   1 
ATOM   626  C  CA  . ASP A 1 84  ? 26.107 -8.462  27.209 1.00 21.65 ? 102 ASP A CA  1 
ATOM   627  C  C   . ASP A 1 84  ? 24.857 -9.308  26.977 1.00 21.04 ? 102 ASP A C   1 
ATOM   628  O  O   . ASP A 1 84  ? 23.860 -8.837  26.412 1.00 19.67 ? 102 ASP A O   1 
ATOM   629  C  CB  . ASP A 1 84  ? 25.793 -6.966  27.086 1.00 22.68 ? 102 ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 84  ? 24.897 -6.465  28.204 1.00 23.32 ? 102 ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 84  ? 24.723 -7.173  29.207 1.00 22.24 ? 102 ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 84  ? 24.373 -5.348  28.087 1.00 23.69 ? 102 ASP A OD2 1 
ATOM   633  N  N   . ILE A 1 85  ? 24.918 -10.568 27.403 1.00 17.67 ? 103 ILE A N   1 
ATOM   634  C  CA  . ILE A 1 85  ? 23.803 -11.474 27.221 1.00 17.95 ? 103 ILE A CA  1 
ATOM   635  C  C   . ILE A 1 85  ? 23.756 -12.478 28.394 1.00 18.34 ? 103 ILE A C   1 
ATOM   636  O  O   . ILE A 1 85  ? 24.786 -12.889 28.920 1.00 19.19 ? 103 ILE A O   1 
ATOM   637  C  CB  . ILE A 1 85  ? 23.925 -12.173 25.837 1.00 18.01 ? 103 ILE A CB  1 
ATOM   638  C  CG1 . ILE A 1 85  ? 22.789 -13.180 25.630 1.00 19.53 ? 103 ILE A CG1 1 
ATOM   639  C  CG2 . ILE A 1 85  ? 25.277 -12.832 25.726 1.00 19.29 ? 103 ILE A CG2 1 
ATOM   640  C  CD1 . ILE A 1 85  ? 22.774 -13.775 24.198 1.00 20.36 ? 103 ILE A CD1 1 
ATOM   641  N  N   . MET A 1 86  ? 22.541 -12.821 28.813 1.00 17.14 ? 104 MET A N   1 
ATOM   642  C  CA  . MET A 1 86  ? 22.316 -13.735 29.918 1.00 18.98 ? 104 MET A CA  1 
ATOM   643  C  C   . MET A 1 86  ? 21.126 -14.646 29.645 1.00 19.67 ? 104 MET A C   1 
ATOM   644  O  O   . MET A 1 86  ? 20.128 -14.217 29.034 1.00 18.02 ? 104 MET A O   1 
ATOM   645  C  CB  . MET A 1 86  ? 22.056 -12.916 31.183 1.00 19.77 ? 104 MET A CB  1 
ATOM   646  C  CG  . MET A 1 86  ? 21.392 -13.648 32.319 1.00 22.72 ? 104 MET A CG  1 
ATOM   647  S  SD  . MET A 1 86  ? 21.308 -12.522 33.747 1.00 23.98 ? 104 MET A SD  1 
ATOM   648  C  CE  . MET A 1 86  ? 19.843 -11.543 33.415 1.00 20.49 ? 104 MET A CE  1 
ATOM   649  N  N   . LEU A 1 87  ? 21.224 -15.890 30.111 1.00 17.82 ? 105 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 87  ? 20.135 -16.840 29.940 1.00 20.47 ? 105 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 87  ? 19.526 -17.101 31.307 1.00 21.30 ? 105 LEU A C   1 
ATOM   652  O  O   . LEU A 1 87  ? 20.252 -17.264 32.270 1.00 22.46 ? 105 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 87  ? 20.651 -18.165 29.372 1.00 20.04 ? 105 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 87  ? 21.061 -18.173 27.904 1.00 23.82 ? 105 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 87  ? 21.621 -19.525 27.535 1.00 23.54 ? 105 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 87  ? 19.844 -17.860 27.036 1.00 24.06 ? 105 LEU A CD2 1 
ATOM   657  N  N   . ILE A 1 88  ? 18.200 -17.148 31.387 1.00 21.06 ? 106 ILE A N   1 
ATOM   658  C  CA  . ILE A 1 88  ? 17.543 -17.416 32.650 1.00 21.67 ? 106 ILE A CA  1 
ATOM   659  C  C   . ILE A 1 88  ? 16.686 -18.648 32.507 1.00 21.00 ? 106 ILE A C   1 
ATOM   660  O  O   . ILE A 1 88  ? 15.867 -18.717 31.599 1.00 20.96 ? 106 ILE A O   1 
ATOM   661  C  CB  . ILE A 1 88  ? 16.623 -16.259 33.072 1.00 22.57 ? 106 ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 88  ? 17.433 -14.986 33.255 1.00 21.83 ? 106 ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 88  ? 15.944 -16.595 34.399 1.00 24.50 ? 106 ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 88  ? 16.553 -13.761 33.462 1.00 25.54 ? 106 ILE A CD1 1 
ATOM   665  N  N   . LYS A 1 89  ? 16.887 -19.628 33.386 1.00 21.13 ? 107 LYS A N   1 
ATOM   666  C  CA  . LYS A 1 89  ? 16.073 -20.837 33.352 1.00 22.29 ? 107 LYS A CA  1 
ATOM   667  C  C   . LYS A 1 89  ? 14.927 -20.643 34.349 1.00 21.15 ? 107 LYS A C   1 
ATOM   668  O  O   . LYS A 1 89  ? 15.145 -20.190 35.472 1.00 22.40 ? 107 LYS A O   1 
ATOM   669  C  CB  . LYS A 1 89  ? 16.883 -22.077 33.757 1.00 24.53 ? 107 LYS A CB  1 
ATOM   670  C  CG  . LYS A 1 89  ? 16.123 -23.374 33.428 1.00 28.31 ? 107 LYS A CG  1 
ATOM   671  C  CD  . LYS A 1 89  ? 16.830 -24.617 33.918 1.00 30.72 ? 107 LYS A CD  1 
ATOM   672  C  CE  . LYS A 1 89  ? 16.208 -25.852 33.276 1.00 33.80 ? 107 LYS A CE  1 
ATOM   673  N  NZ  . LYS A 1 89  ? 16.852 -27.112 33.760 1.00 36.17 ? 107 LYS A NZ  1 
ATOM   674  N  N   . LEU A 1 90  ? 13.703 -20.964 33.939 1.00 21.49 ? 108 LEU A N   1 
ATOM   675  C  CA  . LEU A 1 90  ? 12.555 -20.819 34.821 1.00 21.63 ? 108 LEU A CA  1 
ATOM   676  C  C   . LEU A 1 90  ? 12.443 -22.031 35.753 1.00 23.95 ? 108 LEU A C   1 
ATOM   677  O  O   . LEU A 1 90  ? 12.770 -23.151 35.349 1.00 21.81 ? 108 LEU A O   1 
ATOM   678  C  CB  . LEU A 1 90  ? 11.269 -20.684 33.988 1.00 21.82 ? 108 LEU A CB  1 
ATOM   679  C  CG  . LEU A 1 90  ? 11.213 -19.483 33.020 1.00 24.45 ? 108 LEU A CG  1 
ATOM   680  C  CD1 . LEU A 1 90  ? 9.847  -19.422 32.336 1.00 23.42 ? 108 LEU A CD1 1 
ATOM   681  C  CD2 . LEU A 1 90  ? 11.447 -18.199 33.786 1.00 24.21 ? 108 LEU A CD2 1 
ATOM   682  N  N   . LYS A 1 91  ? 11.974 -21.811 36.983 1.00 23.83 ? 109 LYS A N   1 
ATOM   683  C  CA  . LYS A 1 91  ? 11.815 -22.906 37.960 1.00 27.30 ? 109 LYS A CA  1 
ATOM   684  C  C   . LYS A 1 91  ? 10.846 -23.979 37.444 1.00 27.43 ? 109 LYS A C   1 
ATOM   685  O  O   . LYS A 1 91  ? 11.011 -25.163 37.737 1.00 28.01 ? 109 LYS A O   1 
ATOM   686  C  CB  . LYS A 1 91  ? 11.334 -22.354 39.309 1.00 29.60 ? 109 LYS A CB  1 
ATOM   687  C  CG  . LYS A 1 91  ? 11.190 -23.407 40.418 1.00 36.03 ? 109 LYS A CG  1 
ATOM   688  C  CD  . LYS A 1 91  ? 11.107 -22.728 41.791 1.00 39.73 ? 109 LYS A CD  1 
ATOM   689  C  CE  . LYS A 1 91  ? 11.290 -23.723 42.949 1.00 43.86 ? 109 LYS A CE  1 
ATOM   690  N  NZ  . LYS A 1 91  ? 11.492 -23.017 44.272 1.00 47.30 ? 109 LYS A NZ  1 
ATOM   691  N  N   . SER A 1 92  ? 9.827  -23.557 36.704 1.00 26.50 ? 110 SER A N   1 
ATOM   692  C  CA  . SER A 1 92  ? 8.867  -24.477 36.083 1.00 27.43 ? 110 SER A CA  1 
ATOM   693  C  C   . SER A 1 92  ? 8.541  -23.889 34.707 1.00 28.80 ? 110 SER A C   1 
ATOM   694  O  O   . SER A 1 92  ? 8.714  -22.681 34.477 1.00 27.39 ? 110 SER A O   1 
ATOM   695  C  CB  . SER A 1 92  ? 7.581  -24.631 36.909 1.00 30.36 ? 110 SER A CB  1 
ATOM   696  O  OG  . SER A 1 92  ? 6.950  -23.386 37.131 1.00 31.71 ? 110 SER A OG  1 
ATOM   697  N  N   . ALA A 1 93  ? 8.094  -24.744 33.794 1.00 28.36 ? 111 ALA A N   1 
ATOM   698  C  CA  . ALA A 1 93  ? 7.769  -24.335 32.438 1.00 28.46 ? 111 ALA A CA  1 
ATOM   699  C  C   . ALA A 1 93  ? 6.580  -23.400 32.422 1.00 28.72 ? 111 ALA A C   1 
ATOM   700  O  O   . ALA A 1 93  ? 5.658  -23.553 33.211 1.00 28.72 ? 111 ALA A O   1 
ATOM   701  C  CB  . ALA A 1 93  ? 7.469  -25.566 31.589 1.00 29.76 ? 111 ALA A CB  1 
ATOM   702  N  N   . ALA A 1 94  ? 6.606  -22.417 31.529 1.00 26.19 ? 112 ALA A N   1 
ATOM   703  C  CA  . ALA A 1 94  ? 5.492  -21.495 31.406 1.00 25.93 ? 112 ALA A CA  1 
ATOM   704  C  C   . ALA A 1 94  ? 4.426  -22.189 30.575 1.00 26.45 ? 112 ALA A C   1 
ATOM   705  O  O   . ALA A 1 94  ? 4.730  -23.123 29.830 1.00 23.20 ? 112 ALA A O   1 
ATOM   706  C  CB  . ALA A 1 94  ? 5.942  -20.221 30.676 1.00 25.37 ? 112 ALA A CB  1 
ATOM   707  N  N   . SER A 1 95  ? 3.180  -21.738 30.700 1.00 26.45 ? 113 SER A N   1 
ATOM   708  C  CA  . SER A 1 95  ? 2.093  -22.293 29.895 1.00 29.18 ? 113 SER A CA  1 
ATOM   709  C  C   . SER A 1 95  ? 2.034  -21.440 28.647 1.00 29.09 ? 113 SER A C   1 
ATOM   710  O  O   . SER A 1 95  ? 1.749  -20.244 28.730 1.00 29.86 ? 113 SER A O   1 
ATOM   711  C  CB  . SER A 1 95  ? 0.749  -22.175 30.611 1.00 30.16 ? 113 SER A CB  1 
ATOM   712  O  OG  . SER A 1 95  ? 0.756  -22.941 31.800 1.00 37.36 ? 113 SER A OG  1 
ATOM   713  N  N   . LEU A 1 96  ? 2.306  -22.029 27.492 1.00 29.96 ? 114 LEU A N   1 
ATOM   714  C  CA  . LEU A 1 96  ? 2.280  -21.250 26.270 1.00 32.44 ? 114 LEU A CA  1 
ATOM   715  C  C   . LEU A 1 96  ? 0.875  -21.232 25.688 1.00 34.93 ? 114 LEU A C   1 
ATOM   716  O  O   . LEU A 1 96  ? 0.169  -22.234 25.718 1.00 34.58 ? 114 LEU A O   1 
ATOM   717  C  CB  . LEU A 1 96  ? 3.267  -21.817 25.248 1.00 32.75 ? 114 LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 96  ? 4.717  -21.881 25.728 1.00 33.97 ? 114 LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 96  ? 5.583  -22.450 24.636 1.00 36.77 ? 114 LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 96  ? 5.192  -20.503 26.119 1.00 36.04 ? 114 LEU A CD2 1 
ATOM   721  N  N   . ASN A 1 97  ? 0.477  -20.070 25.187 1.00 35.81 ? 115 ASN A N   1 
ATOM   722  C  CA  . ASN A 1 97  ? -0.831 -19.873 24.584 1.00 38.52 ? 115 ASN A CA  1 
ATOM   723  C  C   . ASN A 1 97  ? -0.761 -18.670 23.636 1.00 39.57 ? 115 ASN A C   1 
ATOM   724  O  O   . ASN A 1 97  ? 0.315  -18.286 23.172 1.00 39.91 ? 115 ASN A O   1 
ATOM   725  C  CB  . ASN A 1 97  ? -1.900 -19.652 25.675 1.00 39.44 ? 115 ASN A CB  1 
ATOM   726  C  CG  . ASN A 1 97  ? -1.531 -18.538 26.669 1.00 42.24 ? 115 ASN A CG  1 
ATOM   727  O  OD1 . ASN A 1 97  ? -1.382 -17.374 26.293 1.00 42.08 ? 115 ASN A OD1 1 
ATOM   728  N  ND2 . ASN A 1 97  ? -1.393 -18.900 27.950 1.00 42.49 ? 115 ASN A ND2 1 
ATOM   729  N  N   . SER A 1 98  ? -1.906 -18.077 23.342 1.00 40.72 ? 116 SER A N   1 
ATOM   730  C  CA  . SER A 1 98  ? -1.929 -16.930 22.453 1.00 41.22 ? 116 SER A CA  1 
ATOM   731  C  C   . SER A 1 98  ? -1.326 -15.700 23.137 1.00 39.97 ? 116 SER A C   1 
ATOM   732  O  O   . SER A 1 98  ? -0.697 -14.873 22.482 1.00 39.94 ? 116 SER A O   1 
ATOM   733  C  CB  . SER A 1 98  ? -3.367 -16.654 22.000 1.00 42.98 ? 116 SER A CB  1 
ATOM   734  O  OG  . SER A 1 98  ? -4.287 -16.891 23.058 1.00 49.10 ? 116 SER A OG  1 
ATOM   735  N  N   . ARG A 1 99  ? -1.491 -15.588 24.452 1.00 38.47 ? 117 ARG A N   1 
ATOM   736  C  CA  . ARG A 1 99  ? -0.956 -14.433 25.165 1.00 38.12 ? 117 ARG A CA  1 
ATOM   737  C  C   . ARG A 1 99  ? 0.477  -14.624 25.679 1.00 35.39 ? 117 ARG A C   1 
ATOM   738  O  O   . ARG A 1 99  ? 1.112  -13.662 26.113 1.00 34.69 ? 117 ARG A O   1 
ATOM   739  C  CB  . ARG A 1 99  ? -1.871 -14.040 26.329 1.00 41.20 ? 117 ARG A CB  1 
ATOM   740  C  CG  . ARG A 1 99  ? -3.247 -13.526 25.909 1.00 47.77 ? 117 ARG A CG  1 
ATOM   741  C  CD  . ARG A 1 99  ? -4.149 -14.666 25.467 1.00 53.98 ? 117 ARG A CD  1 
ATOM   742  N  NE  . ARG A 1 99  ? -5.379 -14.192 24.835 1.00 58.93 ? 117 ARG A NE  1 
ATOM   743  C  CZ  . ARG A 1 99  ? -6.367 -13.568 25.475 1.00 61.52 ? 117 ARG A CZ  1 
ATOM   744  N  NH1 . ARG A 1 99  ? -6.280 -13.339 26.780 1.00 62.17 ? 117 ARG A NH1 1 
ATOM   745  N  NH2 . ARG A 1 99  ? -7.444 -13.164 24.805 1.00 62.85 ? 117 ARG A NH2 1 
ATOM   746  N  N   . VAL A 1 100 ? 0.985  -15.855 25.642 1.00 31.94 ? 118 VAL A N   1 
ATOM   747  C  CA  . VAL A 1 100 ? 2.353  -16.116 26.090 1.00 29.51 ? 118 VAL A CA  1 
ATOM   748  C  C   . VAL A 1 100 ? 2.976  -17.092 25.103 1.00 29.63 ? 118 VAL A C   1 
ATOM   749  O  O   . VAL A 1 100 ? 2.591  -18.265 25.040 1.00 29.60 ? 118 VAL A O   1 
ATOM   750  C  CB  . VAL A 1 100 ? 2.380  -16.698 27.523 1.00 28.36 ? 118 VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 100 ? 3.814  -17.045 27.932 1.00 28.14 ? 118 VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 100 ? 1.820  -15.670 28.494 1.00 29.08 ? 118 VAL A CG2 1 
ATOM   753  N  N   . ALA A 1 101 ? 3.939  -16.598 24.329 1.00 26.90 ? 119 ALA A N   1 
ATOM   754  C  CA  . ALA A 1 101 ? 4.581  -17.413 23.301 1.00 25.93 ? 119 ALA A CA  1 
ATOM   755  C  C   . ALA A 1 101 ? 6.064  -17.096 23.190 1.00 25.07 ? 119 ALA A C   1 
ATOM   756  O  O   . ALA A 1 101 ? 6.507  -16.017 23.592 1.00 22.61 ? 119 ALA A O   1 
ATOM   757  C  CB  . ALA A 1 101 ? 3.907  -17.163 21.964 1.00 25.59 ? 119 ALA A CB  1 
ATOM   758  N  N   . SER A 1 102 ? 6.839  -18.024 22.637 1.00 22.70 ? 120 SER A N   1 
ATOM   759  C  CA  . SER A 1 102 ? 8.268  -17.775 22.529 1.00 24.81 ? 120 SER A CA  1 
ATOM   760  C  C   . SER A 1 102 ? 8.596  -17.121 21.195 1.00 24.62 ? 120 SER A C   1 
ATOM   761  O  O   . SER A 1 102 ? 7.775  -17.121 20.273 1.00 24.11 ? 120 SER A O   1 
ATOM   762  C  CB  . SER A 1 102 ? 9.039  -19.076 22.712 1.00 25.17 ? 120 SER A CB  1 
ATOM   763  O  OG  . SER A 1 102 ? 8.672  -19.974 21.703 1.00 30.18 ? 120 SER A OG  1 
ATOM   764  N  N   . ILE A 1 103 ? 9.779  -16.529 21.099 1.00 24.06 ? 121 ILE A N   1 
ATOM   765  C  CA  . ILE A 1 103 ? 10.200 -15.875 19.867 1.00 23.13 ? 121 ILE A CA  1 
ATOM   766  C  C   . ILE A 1 103 ? 11.344 -16.729 19.293 1.00 24.85 ? 121 ILE A C   1 
ATOM   767  O  O   . ILE A 1 103 ? 12.128 -17.298 20.054 1.00 24.03 ? 121 ILE A O   1 
ATOM   768  C  CB  . ILE A 1 103 ? 10.653 -14.400 20.153 1.00 23.49 ? 121 ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 103 ? 10.930 -13.649 18.836 1.00 23.21 ? 121 ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 103 ? 11.881 -14.375 21.052 1.00 21.86 ? 121 ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 103 ? 9.678  -13.441 18.003 1.00 24.87 ? 121 ILE A CD1 1 
ATOM   772  N  N   . SER A 1 104 ? 11.432 -16.848 17.969 1.00 24.20 ? 122 SER A N   1 
ATOM   773  C  CA  . SER A 1 104 ? 12.491 -17.657 17.360 1.00 26.76 ? 122 SER A CA  1 
ATOM   774  C  C   . SER A 1 104 ? 13.845 -16.966 17.342 1.00 26.25 ? 122 SER A C   1 
ATOM   775  O  O   . SER A 1 104 ? 13.941 -15.737 17.235 1.00 25.42 ? 122 SER A O   1 
ATOM   776  C  CB  . SER A 1 104 ? 12.158 -18.022 15.903 1.00 29.41 ? 122 SER A CB  1 
ATOM   777  O  OG  . SER A 1 104 ? 10.844 -18.526 15.765 1.00 33.96 ? 122 SER A OG  1 
ATOM   778  N  N   . LEU A 1 105 ? 14.891 -17.775 17.443 1.00 25.81 ? 123 LEU A N   1 
ATOM   779  C  CA  . LEU A 1 105 ? 16.253 -17.275 17.365 1.00 25.70 ? 123 LEU A CA  1 
ATOM   780  C  C   . LEU A 1 105 ? 16.587 -17.171 15.873 1.00 28.47 ? 123 LEU A C   1 
ATOM   781  O  O   . LEU A 1 105 ? 16.116 -17.968 15.059 1.00 27.34 ? 123 LEU A O   1 
ATOM   782  C  CB  . LEU A 1 105 ? 17.217 -18.249 18.028 1.00 26.38 ? 123 LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 105 ? 17.033 -18.435 19.534 1.00 25.94 ? 123 LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 105 ? 17.964 -19.532 20.023 1.00 28.44 ? 123 LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 105 ? 17.325 -17.104 20.229 1.00 28.85 ? 123 LEU A CD2 1 
ATOM   786  N  N   . PRO A 1 106 ? 17.432 -16.210 15.501 1.00 28.68 ? 124 PRO A N   1 
ATOM   787  C  CA  . PRO A 1 106 ? 17.821 -16.003 14.106 1.00 30.91 ? 124 PRO A CA  1 
ATOM   788  C  C   . PRO A 1 106 ? 18.732 -17.083 13.524 1.00 33.26 ? 124 PRO A C   1 
ATOM   789  O  O   . PRO A 1 106 ? 19.480 -17.735 14.243 1.00 32.58 ? 124 PRO A O   1 
ATOM   790  C  CB  . PRO A 1 106 ? 18.498 -14.639 14.147 1.00 30.04 ? 124 PRO A CB  1 
ATOM   791  C  CG  . PRO A 1 106 ? 19.200 -14.684 15.481 1.00 30.85 ? 124 PRO A CG  1 
ATOM   792  C  CD  . PRO A 1 106 ? 18.144 -15.287 16.399 1.00 29.03 ? 124 PRO A CD  1 
ATOM   793  N  N   . THR A 1 107 ? 18.653 -17.277 12.213 1.00 33.95 ? 125 THR A N   1 
ATOM   794  C  CA  . THR A 1 107 ? 19.501 -18.259 11.548 1.00 36.75 ? 125 THR A CA  1 
ATOM   795  C  C   . THR A 1 107 ? 20.616 -17.482 10.850 1.00 35.73 ? 125 THR A C   1 
ATOM   796  O  O   . THR A 1 107 ? 21.659 -18.029 10.508 1.00 39.40 ? 125 THR A O   1 
ATOM   797  C  CB  . THR A 1 107 ? 18.674 -19.095 10.522 1.00 37.46 ? 125 THR A CB  1 
ATOM   798  O  OG1 . THR A 1 107 ? 17.843 -18.220 9.735  1.00 39.04 ? 125 THR A OG1 1 
ATOM   799  C  CG2 . THR A 1 107 ? 17.772 -20.083 11.258 1.00 38.82 ? 125 THR A CG2 1 
ATOM   800  N  N   . SER A 1 108 ? 20.387 -16.194 10.653 1.00 33.99 ? 127 SER A N   1 
ATOM   801  C  CA  . SER A 1 108 ? 21.373 -15.320 10.023 1.00 33.45 ? 127 SER A CA  1 
ATOM   802  C  C   . SER A 1 108 ? 21.213 -13.918 10.599 1.00 32.05 ? 127 SER A C   1 
ATOM   803  O  O   . SER A 1 108 ? 20.145 -13.566 11.106 1.00 32.25 ? 127 SER A O   1 
ATOM   804  C  CB  . SER A 1 108 ? 21.160 -15.272 8.512  1.00 33.44 ? 127 SER A CB  1 
ATOM   805  O  OG  . SER A 1 108 ? 19.867 -14.767 8.222  1.00 38.47 ? 127 SER A OG  1 
ATOM   806  N  N   . CYS A 1 109 ? 22.272 -13.121 10.532 1.00 29.66 ? 128 CYS A N   1 
ATOM   807  C  CA  . CYS A 1 109 ? 22.202 -11.764 11.043 1.00 30.45 ? 128 CYS A CA  1 
ATOM   808  C  C   . CYS A 1 109 ? 21.358 -10.887 10.125 1.00 31.53 ? 128 CYS A C   1 
ATOM   809  O  O   . CYS A 1 109 ? 21.179 -11.204 8.946  1.00 31.86 ? 128 CYS A O   1 
ATOM   810  C  CB  . CYS A 1 109 ? 23.597 -11.172 11.161 1.00 28.50 ? 128 CYS A CB  1 
ATOM   811  S  SG  . CYS A 1 109 ? 24.701 -12.173 12.170 1.00 27.76 ? 128 CYS A SG  1 
ATOM   812  N  N   . ALA A 1 110 ? 20.833 -9.795  10.673 1.00 29.74 ? 129 ALA A N   1 
ATOM   813  C  CA  . ALA A 1 110 ? 20.019 -8.880  9.897  1.00 30.35 ? 129 ALA A CA  1 
ATOM   814  C  C   . ALA A 1 110 ? 20.929 -7.857  9.245  1.00 30.93 ? 129 ALA A C   1 
ATOM   815  O  O   . ALA A 1 110 ? 22.060 -7.663  9.678  1.00 32.73 ? 129 ALA A O   1 
ATOM   816  C  CB  . ALA A 1 110 ? 19.032 -8.192  10.783 1.00 30.31 ? 129 ALA A CB  1 
ATOM   817  N  N   . SER A 1 111 ? 20.457 -7.209  8.191  1.00 29.48 ? 130 SER A N   1 
ATOM   818  C  CA  . SER A 1 111 ? 21.283 -6.205  7.535  1.00 31.03 ? 130 SER A CA  1 
ATOM   819  C  C   . SER A 1 111 ? 20.773 -4.795  7.840  1.00 29.85 ? 130 SER A C   1 
ATOM   820  O  O   . SER A 1 111 ? 19.638 -4.609  8.302  1.00 28.66 ? 130 SER A O   1 
ATOM   821  C  CB  . SER A 1 111 ? 21.292 -6.444  6.024  1.00 31.43 ? 130 SER A CB  1 
ATOM   822  O  OG  . SER A 1 111 ? 19.966 -6.443  5.522  1.00 38.09 ? 130 SER A OG  1 
ATOM   823  N  N   . ALA A 1 112 ? 21.622 -3.806  7.585  1.00 28.84 ? 132 ALA A N   1 
ATOM   824  C  CA  . ALA A 1 112 ? 21.267 -2.407  7.804  1.00 28.09 ? 132 ALA A CA  1 
ATOM   825  C  C   . ALA A 1 112 ? 19.954 -2.103  7.067  1.00 27.91 ? 132 ALA A C   1 
ATOM   826  O  O   . ALA A 1 112 ? 19.666 -2.692  6.020  1.00 27.76 ? 132 ALA A O   1 
ATOM   827  C  CB  . ALA A 1 112 ? 22.401 -1.498  7.294  1.00 26.16 ? 132 ALA A CB  1 
ATOM   828  N  N   . GLY A 1 113 ? 19.155 -1.196  7.619  1.00 26.81 ? 133 GLY A N   1 
ATOM   829  C  CA  . GLY A 1 113 ? 17.886 -0.855  7.002  1.00 26.83 ? 133 GLY A CA  1 
ATOM   830  C  C   . GLY A 1 113 ? 16.738 -1.776  7.400  1.00 27.89 ? 133 GLY A C   1 
ATOM   831  O  O   . GLY A 1 113 ? 15.570 -1.441  7.185  1.00 28.08 ? 133 GLY A O   1 
ATOM   832  N  N   . THR A 1 114 ? 17.042 -2.939  7.972  1.00 26.04 ? 134 THR A N   1 
ATOM   833  C  CA  . THR A 1 114 ? 15.974 -3.853  8.378  1.00 27.50 ? 134 THR A CA  1 
ATOM   834  C  C   . THR A 1 114 ? 15.122 -3.207  9.473  1.00 26.13 ? 134 THR A C   1 
ATOM   835  O  O   . THR A 1 114 ? 15.658 -2.670  10.440 1.00 24.80 ? 134 THR A O   1 
ATOM   836  C  CB  . THR A 1 114 ? 16.535 -5.159  8.942  1.00 28.95 ? 134 THR A CB  1 
ATOM   837  O  OG1 . THR A 1 114 ? 17.286 -5.839  7.930  1.00 31.45 ? 134 THR A OG1 1 
ATOM   838  C  CG2 . THR A 1 114 ? 15.402 -6.042  9.405  1.00 28.90 ? 134 THR A CG2 1 
ATOM   839  N  N   . GLN A 1 115 ? 13.805 -3.267  9.325  1.00 24.97 ? 135 GLN A N   1 
ATOM   840  C  CA  . GLN A 1 115 ? 12.884 -2.672  10.298 1.00 26.85 ? 135 GLN A CA  1 
ATOM   841  C  C   . GLN A 1 115 ? 12.639 -3.637  11.467 1.00 25.46 ? 135 GLN A C   1 
ATOM   842  O  O   . GLN A 1 115 ? 12.343 -4.806  11.238 1.00 24.74 ? 135 GLN A O   1 
ATOM   843  C  CB  . GLN A 1 115 ? 11.538 -2.377  9.627  1.00 31.09 ? 135 GLN A CB  1 
ATOM   844  C  CG  . GLN A 1 115 ? 10.846 -1.164  10.194 1.00 40.69 ? 135 GLN A CG  1 
ATOM   845  C  CD  . GLN A 1 115 ? 11.614 0.112   9.856  1.00 46.02 ? 135 GLN A CD  1 
ATOM   846  O  OE1 . GLN A 1 115 ? 11.515 1.128   10.558 1.00 49.88 ? 135 GLN A OE1 1 
ATOM   847  N  NE2 . GLN A 1 115 ? 12.387 0.061   8.769  1.00 47.50 ? 135 GLN A NE2 1 
ATOM   848  N  N   . CYS A 1 116 ? 12.725 -3.161  12.704 1.00 23.05 ? 136 CYS A N   1 
ATOM   849  C  CA  . CYS A 1 116 ? 12.511 -4.052  13.854 1.00 24.37 ? 136 CYS A CA  1 
ATOM   850  C  C   . CYS A 1 116 ? 11.571 -3.443  14.884 1.00 23.44 ? 136 CYS A C   1 
ATOM   851  O  O   . CYS A 1 116 ? 11.323 -2.234  14.859 1.00 23.85 ? 136 CYS A O   1 
ATOM   852  C  CB  . CYS A 1 116 ? 13.829 -4.341  14.546 1.00 23.88 ? 136 CYS A CB  1 
ATOM   853  S  SG  . CYS A 1 116 ? 15.157 -4.918  13.466 1.00 26.14 ? 136 CYS A SG  1 
ATOM   854  N  N   . LEU A 1 117 ? 11.077 -4.282  15.794 1.00 21.15 ? 137 LEU A N   1 
ATOM   855  C  CA  . LEU A 1 117 ? 10.185 -3.841  16.853 1.00 20.00 ? 137 LEU A CA  1 
ATOM   856  C  C   . LEU A 1 117 ? 10.917 -4.003  18.174 1.00 20.35 ? 137 LEU A C   1 
ATOM   857  O  O   . LEU A 1 117 ? 11.424 -5.081  18.479 1.00 18.65 ? 137 LEU A O   1 
ATOM   858  C  CB  . LEU A 1 117 ? 8.903  -4.681  16.884 1.00 21.87 ? 137 LEU A CB  1 
ATOM   859  C  CG  . LEU A 1 117 ? 7.871  -4.284  17.965 1.00 25.29 ? 137 LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1 117 ? 7.167  -2.993  17.563 1.00 25.03 ? 137 LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1 117 ? 6.837  -5.384  18.121 1.00 25.85 ? 137 LEU A CD2 1 
ATOM   862  N  N   . ILE A 1 118 ? 10.976 -2.914  18.936 1.00 20.73 ? 138 ILE A N   1 
ATOM   863  C  CA  . ILE A 1 118 ? 11.614 -2.879  20.251 1.00 22.09 ? 138 ILE A CA  1 
ATOM   864  C  C   . ILE A 1 118 ? 10.475 -2.553  21.208 1.00 22.63 ? 138 ILE A C   1 
ATOM   865  O  O   . ILE A 1 118 ? 9.632  -1.710  20.896 1.00 24.77 ? 138 ILE A O   1 
ATOM   866  C  CB  . ILE A 1 118 ? 12.653 -1.764  20.317 1.00 21.64 ? 138 ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1 118 ? 13.642 -1.932  19.150 1.00 23.73 ? 138 ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1 118 ? 13.342 -1.767  21.676 1.00 22.17 ? 138 ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1 118 ? 14.580 -0.736  18.954 1.00 22.16 ? 138 ILE A CD1 1 
ATOM   870  N  N   . SER A 1 119 ? 10.443 -3.209  22.365 1.00 21.77 ? 139 SER A N   1 
ATOM   871  C  CA  . SER A 1 119 ? 9.360  -2.993  23.324 1.00 20.59 ? 139 SER A CA  1 
ATOM   872  C  C   . SER A 1 119 ? 9.869  -3.014  24.756 1.00 20.04 ? 139 SER A C   1 
ATOM   873  O  O   . SER A 1 119 ? 10.936 -3.553  25.032 1.00 21.68 ? 139 SER A O   1 
ATOM   874  C  CB  . SER A 1 119 ? 8.302  -4.081  23.139 1.00 19.11 ? 139 SER A CB  1 
ATOM   875  O  OG  . SER A 1 119 ? 8.924  -5.366  23.069 1.00 21.23 ? 139 SER A OG  1 
ATOM   876  N  N   . GLY A 1 120 ? 9.119  -2.406  25.668 1.00 20.40 ? 140 GLY A N   1 
ATOM   877  C  CA  . GLY A 1 120 ? 9.537  -2.385  27.055 1.00 20.32 ? 140 GLY A CA  1 
ATOM   878  C  C   . GLY A 1 120 ? 8.759  -1.413  27.922 1.00 21.50 ? 140 GLY A C   1 
ATOM   879  O  O   . GLY A 1 120 ? 7.931  -0.648  27.429 1.00 22.06 ? 140 GLY A O   1 
ATOM   880  N  N   . TRP A 1 121 ? 9.063  -1.443  29.215 1.00 19.61 ? 141 TRP A N   1 
ATOM   881  C  CA  . TRP A 1 121 ? 8.426  -0.607  30.204 1.00 20.82 ? 141 TRP A CA  1 
ATOM   882  C  C   . TRP A 1 121 ? 9.382  0.479   30.717 1.00 21.25 ? 141 TRP A C   1 
ATOM   883  O  O   . TRP A 1 121 ? 9.205  1.009   31.814 1.00 21.45 ? 141 TRP A O   1 
ATOM   884  C  CB  . TRP A 1 121 ? 7.963  -1.504  31.370 1.00 21.29 ? 141 TRP A CB  1 
ATOM   885  C  CG  . TRP A 1 121 ? 6.771  -2.359  31.048 1.00 20.29 ? 141 TRP A CG  1 
ATOM   886  C  CD1 . TRP A 1 121 ? 5.456  -1.978  31.088 1.00 20.46 ? 141 TRP A CD1 1 
ATOM   887  C  CD2 . TRP A 1 121 ? 6.776  -3.755  30.694 1.00 19.74 ? 141 TRP A CD2 1 
ATOM   888  N  NE1 . TRP A 1 121 ? 4.646  -3.046  30.796 1.00 19.80 ? 141 TRP A NE1 1 
ATOM   889  C  CE2 . TRP A 1 121 ? 5.427  -4.148  30.543 1.00 20.13 ? 141 TRP A CE2 1 
ATOM   890  C  CE3 . TRP A 1 121 ? 7.787  -4.709  30.498 1.00 18.78 ? 141 TRP A CE3 1 
ATOM   891  C  CZ2 . TRP A 1 121 ? 5.059  -5.457  30.201 1.00 18.42 ? 141 TRP A CZ2 1 
ATOM   892  C  CZ3 . TRP A 1 121 ? 7.423  -6.015  30.161 1.00 18.77 ? 141 TRP A CZ3 1 
ATOM   893  C  CH2 . TRP A 1 121 ? 6.065  -6.376  30.013 1.00 19.88 ? 141 TRP A CH2 1 
ATOM   894  N  N   . GLY A 1 122 ? 10.402 0.800   29.929 1.00 22.70 ? 142 GLY A N   1 
ATOM   895  C  CA  . GLY A 1 122 ? 11.364 1.795   30.353 1.00 23.91 ? 142 GLY A CA  1 
ATOM   896  C  C   . GLY A 1 122 ? 10.837 3.222   30.291 1.00 24.86 ? 142 GLY A C   1 
ATOM   897  O  O   . GLY A 1 122 ? 9.703  3.477   29.892 1.00 22.46 ? 142 GLY A O   1 
ATOM   898  N  N   . ASN A 1 123 ? 11.691 4.146   30.704 1.00 26.14 ? 143 ASN A N   1 
ATOM   899  C  CA  . ASN A 1 123 ? 11.395 5.571   30.733 1.00 27.01 ? 143 ASN A CA  1 
ATOM   900  C  C   . ASN A 1 123 ? 10.877 6.020   29.372 1.00 27.34 ? 143 ASN A C   1 
ATOM   901  O  O   . ASN A 1 123 ? 11.392 5.589   28.331 1.00 24.26 ? 143 ASN A O   1 
ATOM   902  C  CB  . ASN A 1 123 ? 12.679 6.320   31.083 1.00 28.70 ? 143 ASN A CB  1 
ATOM   903  C  CG  . ASN A 1 123 ? 12.435 7.770   31.427 1.00 32.22 ? 143 ASN A CG  1 
ATOM   904  O  OD1 . ASN A 1 123 ? 11.299 8.252   31.427 1.00 35.16 ? 143 ASN A OD1 1 
ATOM   905  N  ND2 . ASN A 1 123 ? 13.509 8.479   31.731 1.00 33.10 ? 143 ASN A ND2 1 
ATOM   906  N  N   . THR A 1 124 ? 9.852  6.869   29.371 1.00 27.75 ? 144 THR A N   1 
ATOM   907  C  CA  . THR A 1 124 ? 9.288  7.359   28.109 1.00 31.00 ? 144 THR A CA  1 
ATOM   908  C  C   . THR A 1 124 ? 9.702  8.812   27.810 1.00 34.23 ? 144 THR A C   1 
ATOM   909  O  O   . THR A 1 124 ? 9.216  9.414   26.843 1.00 34.52 ? 144 THR A O   1 
ATOM   910  C  CB  . THR A 1 124 ? 7.742  7.278   28.102 1.00 29.84 ? 144 THR A CB  1 
ATOM   911  O  OG1 . THR A 1 124 ? 7.236  8.035   29.200 1.00 29.64 ? 144 THR A OG1 1 
ATOM   912  C  CG2 . THR A 1 124 ? 7.253  5.829   28.247 1.00 29.17 ? 144 THR A CG2 1 
ATOM   913  N  N   . LYS A 1 125 ? 10.598 9.370   28.621 1.00 36.91 ? 145 LYS A N   1 
ATOM   914  C  CA  . LYS A 1 125 ? 11.042 10.748  28.407 1.00 42.33 ? 145 LYS A CA  1 
ATOM   915  C  C   . LYS A 1 125 ? 12.548 10.874  28.255 1.00 44.05 ? 145 LYS A C   1 
ATOM   916  O  O   . LYS A 1 125 ? 13.304 10.365  29.079 1.00 44.49 ? 145 LYS A O   1 
ATOM   917  C  CB  . LYS A 1 125 ? 10.550 11.646  29.546 1.00 43.75 ? 145 LYS A CB  1 
ATOM   918  C  CG  . LYS A 1 125 ? 9.029  11.625  29.670 1.00 48.23 ? 145 LYS A CG  1 
ATOM   919  C  CD  . LYS A 1 125 ? 8.462  12.894  30.286 1.00 52.99 ? 145 LYS A CD  1 
ATOM   920  C  CE  . LYS A 1 125 ? 8.992  13.138  31.697 1.00 54.98 ? 145 LYS A CE  1 
ATOM   921  N  NZ  . LYS A 1 125 ? 8.382  14.369  32.297 1.00 57.23 ? 145 LYS A NZ  1 
ATOM   922  N  N   . SER A 1 126 ? 12.980 11.553  27.193 1.00 47.24 ? 146 SER A N   1 
ATOM   923  C  CA  . SER A 1 126 ? 14.408 11.735  26.927 1.00 50.26 ? 146 SER A CA  1 
ATOM   924  C  C   . SER A 1 126 ? 15.017 12.667  27.959 1.00 52.79 ? 146 SER A C   1 
ATOM   925  O  O   . SER A 1 126 ? 16.232 12.676  28.168 1.00 54.07 ? 146 SER A O   1 
ATOM   926  C  CB  . SER A 1 126 ? 14.627 12.314  25.529 1.00 50.31 ? 146 SER A CB  1 
ATOM   927  O  OG  . SER A 1 126 ? 13.928 13.535  25.379 1.00 51.77 ? 146 SER A OG  1 
ATOM   928  N  N   . SER A 1 127 ? 14.163 13.455  28.603 1.00 54.58 ? 147 SER A N   1 
ATOM   929  C  CA  . SER A 1 127 ? 14.612 14.388  29.626 1.00 56.26 ? 147 SER A CA  1 
ATOM   930  C  C   . SER A 1 127 ? 13.645 14.315  30.811 1.00 56.33 ? 147 SER A C   1 
ATOM   931  O  O   . SER A 1 127 ? 12.525 14.835  30.754 1.00 57.75 ? 147 SER A O   1 
ATOM   932  C  CB  . SER A 1 127 ? 14.657 15.809  29.052 1.00 57.29 ? 147 SER A CB  1 
ATOM   933  O  OG  . SER A 1 127 ? 15.418 16.661  29.885 1.00 59.71 ? 147 SER A OG  1 
ATOM   934  N  N   . GLY A 1 128 ? 14.084 13.661  31.881 1.00 55.25 ? 148 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 128 ? 13.239 13.511  33.050 1.00 53.56 ? 148 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 128 ? 12.888 12.047  33.241 1.00 52.95 ? 148 GLY A C   1 
ATOM   937  O  O   . GLY A 1 128 ? 13.399 11.191  32.514 1.00 52.56 ? 148 GLY A O   1 
ATOM   938  N  N   . THR A 1 129 ? 12.013 11.752  34.200 1.00 51.75 ? 149 THR A N   1 
ATOM   939  C  CA  . THR A 1 129 ? 11.624 10.370  34.472 1.00 51.23 ? 149 THR A CA  1 
ATOM   940  C  C   . THR A 1 129 ? 10.116 10.137  34.485 1.00 49.74 ? 149 THR A C   1 
ATOM   941  O  O   . THR A 1 129 ? 9.383  10.762  35.250 1.00 51.63 ? 149 THR A O   1 
ATOM   942  C  CB  . THR A 1 129 ? 12.191 9.897   35.817 1.00 51.50 ? 149 THR A CB  1 
ATOM   943  O  OG1 . THR A 1 129 ? 13.620 9.894   35.748 1.00 53.48 ? 149 THR A OG1 1 
ATOM   944  C  CG2 . THR A 1 129 ? 11.703 8.495   36.142 1.00 52.31 ? 149 THR A CG2 1 
ATOM   945  N  N   . SER A 1 130 ? 9.658  9.223   33.640 1.00 46.56 ? 150 SER A N   1 
ATOM   946  C  CA  . SER A 1 130 ? 8.243  8.895   33.569 1.00 42.94 ? 150 SER A CA  1 
ATOM   947  C  C   . SER A 1 130 ? 8.081  7.451   33.098 1.00 40.64 ? 150 SER A C   1 
ATOM   948  O  O   . SER A 1 130 ? 8.189  7.161   31.903 1.00 39.28 ? 150 SER A O   1 
ATOM   949  C  CB  . SER A 1 130 ? 7.528  9.841   32.609 1.00 42.66 ? 150 SER A CB  1 
ATOM   950  O  OG  . SER A 1 130 ? 6.148  9.522   32.533 1.00 43.04 ? 150 SER A OG  1 
ATOM   951  N  N   . TYR A 1 131 ? 7.831  6.554   34.047 1.00 37.41 ? 151 TYR A N   1 
ATOM   952  C  CA  . TYR A 1 131 ? 7.657  5.140   33.739 1.00 35.92 ? 151 TYR A CA  1 
ATOM   953  C  C   . TYR A 1 131 ? 6.207  4.833   33.445 1.00 33.69 ? 151 TYR A C   1 
ATOM   954  O  O   . TYR A 1 131 ? 5.328  5.228   34.195 1.00 34.90 ? 151 TYR A O   1 
ATOM   955  C  CB  . TYR A 1 131 ? 8.131  4.305   34.907 1.00 37.72 ? 151 TYR A CB  1 
ATOM   956  C  CG  . TYR A 1 131 ? 9.595  4.475   35.161 1.00 41.13 ? 151 TYR A CG  1 
ATOM   957  C  CD1 . TYR A 1 131 ? 10.536 4.011   34.240 1.00 41.51 ? 151 TYR A CD1 1 
ATOM   958  C  CD2 . TYR A 1 131 ? 10.049 5.112   36.311 1.00 42.38 ? 151 TYR A CD2 1 
ATOM   959  C  CE1 . TYR A 1 131 ? 11.894 4.172   34.461 1.00 44.30 ? 151 TYR A CE1 1 
ATOM   960  C  CE2 . TYR A 1 131 ? 11.403 5.283   36.542 1.00 45.05 ? 151 TYR A CE2 1 
ATOM   961  C  CZ  . TYR A 1 131 ? 12.322 4.809   35.615 1.00 45.57 ? 151 TYR A CZ  1 
ATOM   962  O  OH  . TYR A 1 131 ? 13.669 4.952   35.849 1.00 48.81 ? 151 TYR A OH  1 
ATOM   963  N  N   . PRO A 1 132 ? 5.937  4.109   32.349 1.00 30.86 ? 152 PRO A N   1 
ATOM   964  C  CA  . PRO A 1 132 ? 4.559  3.776   31.986 1.00 29.49 ? 152 PRO A CA  1 
ATOM   965  C  C   . PRO A 1 132 ? 4.016  2.561   32.728 1.00 28.82 ? 152 PRO A C   1 
ATOM   966  O  O   . PRO A 1 132 ? 4.770  1.787   33.311 1.00 29.25 ? 152 PRO A O   1 
ATOM   967  C  CB  . PRO A 1 132 ? 4.661  3.541   30.486 1.00 30.10 ? 152 PRO A CB  1 
ATOM   968  C  CG  . PRO A 1 132 ? 5.994  2.832   30.365 1.00 29.02 ? 152 PRO A CG  1 
ATOM   969  C  CD  . PRO A 1 132 ? 6.893  3.564   31.369 1.00 30.43 ? 152 PRO A CD  1 
ATOM   970  N  N   . ASP A 1 133 ? 2.700  2.414   32.741 1.00 28.35 ? 153 ASP A N   1 
ATOM   971  C  CA  . ASP A 1 133 ? 2.110  1.254   33.386 1.00 29.18 ? 153 ASP A CA  1 
ATOM   972  C  C   . ASP A 1 133 ? 2.056  0.133   32.347 1.00 27.36 ? 153 ASP A C   1 
ATOM   973  O  O   . ASP A 1 133 ? 2.280  -1.035  32.671 1.00 26.38 ? 153 ASP A O   1 
ATOM   974  C  CB  . ASP A 1 133 ? 0.670  1.530   33.850 1.00 32.87 ? 153 ASP A CB  1 
ATOM   975  C  CG  . ASP A 1 133 ? 0.603  2.378   35.101 1.00 36.24 ? 153 ASP A CG  1 
ATOM   976  O  OD1 . ASP A 1 133 ? 1.422  2.180   36.027 1.00 37.60 ? 153 ASP A OD1 1 
ATOM   977  O  OD2 . ASP A 1 133 ? -0.293 3.235   35.161 1.00 40.04 ? 153 ASP A OD2 1 
ATOM   978  N  N   . VAL A 1 134 ? 1.754  0.506   31.103 1.00 25.24 ? 154 VAL A N   1 
ATOM   979  C  CA  . VAL A 1 134 ? 1.612  -0.460  30.028 1.00 25.54 ? 154 VAL A CA  1 
ATOM   980  C  C   . VAL A 1 134 ? 2.815  -0.535  29.093 1.00 23.93 ? 154 VAL A C   1 
ATOM   981  O  O   . VAL A 1 134 ? 3.634  0.395   29.019 1.00 24.22 ? 154 VAL A O   1 
ATOM   982  C  CB  . VAL A 1 134 ? 0.332  -0.191  29.207 1.00 25.90 ? 154 VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 134 ? -0.889 -0.194  30.159 1.00 27.44 ? 154 VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 134 ? 0.436  1.154   28.472 1.00 25.19 ? 154 VAL A CG2 1 
ATOM   985  N  N   . LEU A 1 135 ? 2.899  -1.651  28.378 1.00 21.22 ? 155 LEU A N   1 
ATOM   986  C  CA  . LEU A 1 135 ? 4.011  -1.931  27.466 1.00 21.70 ? 155 LEU A CA  1 
ATOM   987  C  C   . LEU A 1 135 ? 4.028  -0.981  26.277 1.00 21.03 ? 155 LEU A C   1 
ATOM   988  O  O   . LEU A 1 135 ? 3.016  -0.821  25.610 1.00 21.25 ? 155 LEU A O   1 
ATOM   989  C  CB  . LEU A 1 135 ? 3.904  -3.367  26.942 1.00 19.49 ? 155 LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 135 ? 5.061  -3.871  26.106 1.00 20.77 ? 155 LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 135 ? 6.352  -3.816  26.920 1.00 18.08 ? 155 LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 135 ? 4.747  -5.317  25.661 1.00 19.96 ? 155 LEU A CD2 1 
ATOM   993  N  N   . LYS A 1 136 ? 5.189  -0.393  26.007 1.00 20.88 ? 156 LYS A N   1 
ATOM   994  C  CA  . LYS A 1 136 ? 5.346  0.528   24.876 1.00 21.60 ? 156 LYS A CA  1 
ATOM   995  C  C   . LYS A 1 136 ? 6.124  -0.159  23.758 1.00 22.44 ? 156 LYS A C   1 
ATOM   996  O  O   . LYS A 1 136 ? 6.945  -1.038  24.021 1.00 22.18 ? 156 LYS A O   1 
ATOM   997  C  CB  . LYS A 1 136 ? 6.064  1.790   25.342 1.00 21.45 ? 156 LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 136 ? 5.282  2.538   26.402 1.00 23.69 ? 156 LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 136 ? 4.029  3.174   25.805 1.00 25.24 ? 156 LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 136 ? 3.274  3.984   26.859 1.00 31.13 ? 156 LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 136 ? 2.132  4.729   26.262 1.00 32.58 ? 156 LYS A NZ  1 
ATOM   1002 N  N   . CYS A 1 137 ? 5.845  0.246   22.517 1.00 20.96 ? 157 CYS A N   1 
ATOM   1003 C  CA  . CYS A 1 137 ? 6.453  -0.326  21.327 1.00 22.47 ? 157 CYS A CA  1 
ATOM   1004 C  C   . CYS A 1 137 ? 7.113  0.765   20.473 1.00 23.81 ? 157 CYS A C   1 
ATOM   1005 O  O   . CYS A 1 137 ? 6.732  1.930   20.567 1.00 23.56 ? 157 CYS A O   1 
ATOM   1006 C  CB  . CYS A 1 137 ? 5.369  -1.047  20.506 1.00 21.69 ? 157 CYS A CB  1 
ATOM   1007 S  SG  . CYS A 1 137 ? 5.083  -2.761  21.065 1.00 24.04 ? 157 CYS A SG  1 
ATOM   1008 N  N   . LEU A 1 138 ? 8.107  0.389   19.664 1.00 24.25 ? 158 LEU A N   1 
ATOM   1009 C  CA  . LEU A 1 138 ? 8.805  1.321   18.777 1.00 23.86 ? 158 LEU A CA  1 
ATOM   1010 C  C   . LEU A 1 138 ? 9.361  0.555   17.586 1.00 24.65 ? 158 LEU A C   1 
ATOM   1011 O  O   . LEU A 1 138 ? 10.017 -0.478  17.754 1.00 24.63 ? 158 LEU A O   1 
ATOM   1012 C  CB  . LEU A 1 138 ? 9.968  2.025   19.501 1.00 23.90 ? 158 LEU A CB  1 
ATOM   1013 C  CG  . LEU A 1 138 ? 10.919 2.939   18.678 1.00 24.97 ? 158 LEU A CG  1 
ATOM   1014 C  CD1 . LEU A 1 138 ? 10.158 4.135   18.092 1.00 24.75 ? 158 LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A 1 138 ? 12.060 3.448   19.557 1.00 25.38 ? 158 LEU A CD2 1 
ATOM   1016 N  N   . LYS A 1 139 ? 9.095  1.046   16.380 1.00 25.25 ? 159 LYS A N   1 
ATOM   1017 C  CA  . LYS A 1 139 ? 9.645  0.396   15.192 1.00 27.19 ? 159 LYS A CA  1 
ATOM   1018 C  C   . LYS A 1 139 ? 10.901 1.188   14.885 1.00 27.19 ? 159 LYS A C   1 
ATOM   1019 O  O   . LYS A 1 139 ? 10.877 2.415   14.864 1.00 28.42 ? 159 LYS A O   1 
ATOM   1020 C  CB  . LYS A 1 139 ? 8.658  0.440   14.029 1.00 29.81 ? 159 LYS A CB  1 
ATOM   1021 C  CG  . LYS A 1 139 ? 7.444  -0.450  14.264 1.00 35.54 ? 159 LYS A CG  1 
ATOM   1022 C  CD  . LYS A 1 139 ? 6.377  -0.215  13.196 1.00 41.87 ? 159 LYS A CD  1 
ATOM   1023 C  CE  . LYS A 1 139 ? 5.157  -1.113  13.395 1.00 44.41 ? 159 LYS A CE  1 
ATOM   1024 N  NZ  . LYS A 1 139 ? 4.138  -0.908  12.313 1.00 46.63 ? 159 LYS A NZ  1 
ATOM   1025 N  N   . ALA A 1 140 ? 12.008 0.494   14.672 1.00 26.24 ? 160 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 140 ? 13.275 1.178   14.440 1.00 25.90 ? 160 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 140 ? 14.115 0.369   13.486 1.00 24.35 ? 160 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 140 ? 14.073 -0.851  13.505 1.00 25.39 ? 160 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 140 ? 14.020 1.346   15.767 1.00 25.86 ? 160 ALA A CB  1 
ATOM   1030 N  N   . PRO A 1 141 ? 14.905 1.041   12.642 1.00 23.33 ? 161 PRO A N   1 
ATOM   1031 C  CA  . PRO A 1 141 ? 15.737 0.310   11.695 1.00 22.08 ? 161 PRO A CA  1 
ATOM   1032 C  C   . PRO A 1 141 ? 17.136 0.072   12.266 1.00 21.60 ? 161 PRO A C   1 
ATOM   1033 O  O   . PRO A 1 141 ? 17.604 0.834   13.126 1.00 21.38 ? 161 PRO A O   1 
ATOM   1034 C  CB  . PRO A 1 141 ? 15.778 1.261   10.493 1.00 21.80 ? 161 PRO A CB  1 
ATOM   1035 C  CG  . PRO A 1 141 ? 15.904 2.614   11.172 1.00 20.89 ? 161 PRO A CG  1 
ATOM   1036 C  CD  . PRO A 1 141 ? 14.930 2.494   12.363 1.00 22.92 ? 161 PRO A CD  1 
ATOM   1037 N  N   . ILE A 1 142 ? 17.786 -0.985  11.792 1.00 21.73 ? 162 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 142 ? 19.167 -1.291  12.175 1.00 23.13 ? 162 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 142 ? 20.039 -0.328  11.351 1.00 23.31 ? 162 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 142 ? 19.811 -0.157  10.145 1.00 22.36 ? 162 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 142 ? 19.518 -2.758  11.811 1.00 23.07 ? 162 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 142 ? 18.730 -3.704  12.733 1.00 25.08 ? 162 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 142 ? 21.046 -2.994  11.915 1.00 25.54 ? 162 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 142 ? 18.816 -5.160  12.337 1.00 26.34 ? 162 ILE A CD1 1 
ATOM   1045 N  N   . LEU A 1 143 ? 21.016 0.317   11.983 1.00 23.52 ? 163 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 143 ? 21.870 1.260   11.265 1.00 23.54 ? 163 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 143 ? 23.118 0.575   10.697 1.00 23.92 ? 163 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 143 ? 23.462 -0.529  11.105 1.00 23.42 ? 163 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 143 ? 22.279 2.420   12.189 1.00 22.00 ? 163 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 143 ? 21.128 3.149   12.906 1.00 24.23 ? 163 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 143 ? 21.705 4.321   13.687 1.00 23.91 ? 163 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 143 ? 20.069 3.639   11.904 1.00 20.55 ? 163 LEU A CD2 1 
ATOM   1053 N  N   . SER A 1 144 ? 23.781 1.220   9.739  1.00 22.42 ? 164 SER A N   1 
ATOM   1054 C  CA  . SER A 1 144 ? 24.979 0.657   9.135  1.00 24.12 ? 164 SER A CA  1 
ATOM   1055 C  C   . SER A 1 144 ? 26.076 0.667   10.177 1.00 25.15 ? 164 SER A C   1 
ATOM   1056 O  O   . SER A 1 144 ? 26.078 1.512   11.079 1.00 25.21 ? 164 SER A O   1 
ATOM   1057 C  CB  . SER A 1 144 ? 25.430 1.518   7.944  1.00 25.73 ? 164 SER A CB  1 
ATOM   1058 O  OG  . SER A 1 144 ? 25.743 2.841   8.399  1.00 26.49 ? 164 SER A OG  1 
ATOM   1059 N  N   . ASP A 1 145 ? 27.021 -0.251  10.055 1.00 26.81 ? 165 ASP A N   1 
ATOM   1060 C  CA  . ASP A 1 145 ? 28.124 -0.292  11.010 1.00 30.25 ? 165 ASP A CA  1 
ATOM   1061 C  C   . ASP A 1 145 ? 28.937 0.986   10.982 1.00 28.87 ? 165 ASP A C   1 
ATOM   1062 O  O   . ASP A 1 145 ? 29.444 1.429   12.020 1.00 26.09 ? 165 ASP A O   1 
ATOM   1063 C  CB  . ASP A 1 145 ? 29.050 -1.464  10.727 1.00 35.45 ? 165 ASP A CB  1 
ATOM   1064 C  CG  . ASP A 1 145 ? 28.379 -2.794  10.970 1.00 43.31 ? 165 ASP A CG  1 
ATOM   1065 O  OD1 . ASP A 1 145 ? 27.585 -2.897  11.947 1.00 46.81 ? 165 ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A 1 145 ? 28.657 -3.743  10.193 1.00 47.93 ? 165 ASP A OD2 1 
ATOM   1067 N  N   . SER A 1 146 ? 29.074 1.588   9.803  1.00 27.70 ? 166 SER A N   1 
ATOM   1068 C  CA  . SER A 1 146 ? 29.853 2.817   9.725  1.00 27.94 ? 166 SER A CA  1 
ATOM   1069 C  C   . SER A 1 146 ? 29.182 3.944   10.496 1.00 26.35 ? 166 SER A C   1 
ATOM   1070 O  O   . SER A 1 146 ? 29.861 4.711   11.188 1.00 26.53 ? 166 SER A O   1 
ATOM   1071 C  CB  . SER A 1 146 ? 30.109 3.227   8.261  1.00 30.89 ? 166 SER A CB  1 
ATOM   1072 O  OG  . SER A 1 146 ? 28.898 3.321   7.531  1.00 37.37 ? 166 SER A OG  1 
ATOM   1073 N  N   . SER A 1 147 ? 27.858 4.069   10.406 1.00 25.43 ? 167 SER A N   1 
ATOM   1074 C  CA  . SER A 1 147 ? 27.201 5.130   11.169 1.00 24.37 ? 167 SER A CA  1 
ATOM   1075 C  C   . SER A 1 147 ? 27.275 4.833   12.664 1.00 23.85 ? 167 SER A C   1 
ATOM   1076 O  O   . SER A 1 147 ? 27.388 5.746   13.486 1.00 23.40 ? 167 SER A O   1 
ATOM   1077 C  CB  . SER A 1 147 ? 25.733 5.274   10.772 1.00 26.75 ? 167 SER A CB  1 
ATOM   1078 O  OG  . SER A 1 147 ? 25.645 5.758   9.442  1.00 32.21 ? 167 SER A OG  1 
ATOM   1079 N  N   . CYS A 1 148 ? 27.188 3.553   13.013 1.00 23.74 ? 168 CYS A N   1 
ATOM   1080 C  CA  . CYS A 1 148 ? 27.233 3.143   14.416 1.00 24.22 ? 168 CYS A CA  1 
ATOM   1081 C  C   . CYS A 1 148 ? 28.612 3.466   15.000 1.00 24.55 ? 168 CYS A C   1 
ATOM   1082 O  O   . CYS A 1 148 ? 28.722 4.084   16.056 1.00 24.18 ? 168 CYS A O   1 
ATOM   1083 C  CB  . CYS A 1 148 ? 26.961 1.654   14.503 1.00 23.40 ? 168 CYS A CB  1 
ATOM   1084 S  SG  . CYS A 1 148 ? 26.705 0.985   16.180 1.00 25.94 ? 168 CYS A SG  1 
ATOM   1085 N  N   . LYS A 1 149 ? 29.665 3.066   14.302 1.00 25.60 ? 169 LYS A N   1 
ATOM   1086 C  CA  . LYS A 1 149 ? 31.010 3.359   14.788 1.00 28.34 ? 169 LYS A CA  1 
ATOM   1087 C  C   . LYS A 1 149 ? 31.341 4.842   14.808 1.00 28.62 ? 169 LYS A C   1 
ATOM   1088 O  O   . LYS A 1 149 ? 32.145 5.282   15.622 1.00 29.56 ? 169 LYS A O   1 
ATOM   1089 C  CB  . LYS A 1 149 ? 32.033 2.569   13.991 1.00 29.50 ? 169 LYS A CB  1 
ATOM   1090 C  CG  . LYS A 1 149 ? 31.963 1.107   14.348 1.00 32.14 ? 169 LYS A CG  1 
ATOM   1091 C  CD  . LYS A 1 149 ? 32.794 0.271   13.417 1.00 37.36 ? 169 LYS A CD  1 
ATOM   1092 C  CE  . LYS A 1 149 ? 32.657 -1.195  13.764 1.00 38.84 ? 169 LYS A CE  1 
ATOM   1093 N  NZ  . LYS A 1 149 ? 33.403 -2.005  12.758 1.00 43.71 ? 169 LYS A NZ  1 
ATOM   1094 N  N   . SER A 1 150 ? 30.716 5.630   13.939 1.00 30.06 ? 170 SER A N   1 
ATOM   1095 C  CA  . SER A 1 150 ? 30.969 7.066   13.961 1.00 31.03 ? 170 SER A CA  1 
ATOM   1096 C  C   . SER A 1 150 ? 30.318 7.721   15.164 1.00 30.71 ? 170 SER A C   1 
ATOM   1097 O  O   . SER A 1 150 ? 30.835 8.689   15.700 1.00 29.17 ? 170 SER A O   1 
ATOM   1098 C  CB  . SER A 1 150 ? 30.444 7.741   12.695 1.00 32.39 ? 170 SER A CB  1 
ATOM   1099 O  OG  . SER A 1 150 ? 31.310 7.443   11.631 1.00 39.59 ? 170 SER A OG  1 
ATOM   1100 N  N   . ALA A 1 151 ? 29.170 7.197   15.584 1.00 31.04 ? 171 ALA A N   1 
ATOM   1101 C  CA  . ALA A 1 151 ? 28.464 7.756   16.729 1.00 29.27 ? 171 ALA A CA  1 
ATOM   1102 C  C   . ALA A 1 151 ? 29.149 7.424   18.059 1.00 28.74 ? 171 ALA A C   1 
ATOM   1103 O  O   . ALA A 1 151 ? 29.113 8.222   19.003 1.00 27.30 ? 171 ALA A O   1 
ATOM   1104 C  CB  . ALA A 1 151 ? 27.024 7.236   16.745 1.00 27.89 ? 171 ALA A CB  1 
ATOM   1105 N  N   . TYR A 1 152 ? 29.763 6.247   18.125 1.00 26.37 ? 172 TYR A N   1 
ATOM   1106 C  CA  . TYR A 1 152 ? 30.429 5.783   19.343 1.00 27.27 ? 172 TYR A CA  1 
ATOM   1107 C  C   . TYR A 1 152 ? 31.816 5.250   18.997 1.00 28.53 ? 172 TYR A C   1 
ATOM   1108 O  O   . TYR A 1 152 ? 32.089 4.054   19.155 1.00 27.95 ? 172 TYR A O   1 
ATOM   1109 C  CB  . TYR A 1 152 ? 29.616 4.654   19.989 1.00 25.30 ? 172 TYR A CB  1 
ATOM   1110 C  CG  . TYR A 1 152 ? 28.223 5.064   20.417 1.00 24.45 ? 172 TYR A CG  1 
ATOM   1111 C  CD1 . TYR A 1 152 ? 27.098 4.658   19.705 1.00 23.88 ? 172 TYR A CD1 1 
ATOM   1112 C  CD2 . TYR A 1 152 ? 28.036 5.831   21.555 1.00 24.36 ? 172 TYR A CD2 1 
ATOM   1113 C  CE1 . TYR A 1 152 ? 25.812 5.012   20.136 1.00 25.92 ? 172 TYR A CE1 1 
ATOM   1114 C  CE2 . TYR A 1 152 ? 26.766 6.187   21.991 1.00 25.43 ? 172 TYR A CE2 1 
ATOM   1115 C  CZ  . TYR A 1 152 ? 25.663 5.773   21.284 1.00 23.69 ? 172 TYR A CZ  1 
ATOM   1116 O  OH  . TYR A 1 152 ? 24.418 6.118   21.748 1.00 24.84 ? 172 TYR A OH  1 
ATOM   1117 N  N   . PRO A 1 153 ? 32.716 6.127   18.522 1.00 29.50 ? 173 PRO A N   1 
ATOM   1118 C  CA  . PRO A 1 153 ? 34.066 5.663   18.162 1.00 30.55 ? 173 PRO A CA  1 
ATOM   1119 C  C   . PRO A 1 153 ? 34.786 4.856   19.244 1.00 30.50 ? 173 PRO A C   1 
ATOM   1120 O  O   . PRO A 1 153 ? 34.774 5.219   20.427 1.00 30.42 ? 173 PRO A O   1 
ATOM   1121 C  CB  . PRO A 1 153 ? 34.800 6.957   17.793 1.00 29.77 ? 173 PRO A CB  1 
ATOM   1122 C  CG  . PRO A 1 153 ? 34.063 8.016   18.550 1.00 30.69 ? 173 PRO A CG  1 
ATOM   1123 C  CD  . PRO A 1 153 ? 32.613 7.595   18.446 1.00 29.81 ? 173 PRO A CD  1 
ATOM   1124 N  N   . GLY A 1 154 ? 35.385 3.744   18.824 1.00 30.07 ? 174 GLY A N   1 
ATOM   1125 C  CA  . GLY A 1 154 ? 36.116 2.886   19.740 1.00 32.40 ? 174 GLY A CA  1 
ATOM   1126 C  C   . GLY A 1 154 ? 35.306 2.149   20.797 1.00 32.37 ? 174 GLY A C   1 
ATOM   1127 O  O   . GLY A 1 154 ? 35.893 1.503   21.663 1.00 33.41 ? 174 GLY A O   1 
ATOM   1128 N  N   . GLN A 1 155 ? 33.979 2.224   20.743 1.00 31.23 ? 175 GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 155 ? 33.141 1.549   21.741 1.00 30.86 ? 175 GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 155 ? 32.261 0.434   21.201 1.00 29.28 ? 175 GLN A C   1 
ATOM   1131 O  O   . GLN A 1 155 ? 31.609 -0.267  21.971 1.00 28.22 ? 175 GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 155 ? 32.231 2.550   22.438 1.00 31.35 ? 175 GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 155 ? 32.939 3.556   23.310 1.00 35.30 ? 175 GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 155 ? 31.956 4.528   23.955 1.00 37.43 ? 175 GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 155 ? 31.396 5.388   23.287 1.00 39.23 ? 175 GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 155 ? 31.737 4.380   25.256 1.00 41.12 ? 175 GLN A NE2 1 
ATOM   1137 N  N   . ILE A 1 156 ? 32.252 0.251   19.890 1.00 26.91 ? 176 ILE A N   1 
ATOM   1138 C  CA  . ILE A 1 156 ? 31.401 -0.752  19.275 1.00 26.77 ? 176 ILE A CA  1 
ATOM   1139 C  C   . ILE A 1 156 ? 32.201 -1.995  18.919 1.00 27.41 ? 176 ILE A C   1 
ATOM   1140 O  O   . ILE A 1 156 ? 33.171 -1.922  18.178 1.00 27.50 ? 176 ILE A O   1 
ATOM   1141 C  CB  . ILE A 1 156 ? 30.737 -0.172  17.984 1.00 24.93 ? 176 ILE A CB  1 
ATOM   1142 C  CG1 . ILE A 1 156 ? 29.962 1.115   18.316 1.00 24.37 ? 176 ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A 1 156 ? 29.857 -1.211  17.326 1.00 24.12 ? 176 ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A 1 156 ? 28.840 0.972   19.339 1.00 22.07 ? 176 ILE A CD1 1 
ATOM   1145 N  N   . THR A 1 157 ? 31.820 -3.142  19.460 1.00 25.15 ? 177 THR A N   1 
ATOM   1146 C  CA  . THR A 1 157 ? 32.540 -4.357  19.105 1.00 26.05 ? 177 THR A CA  1 
ATOM   1147 C  C   . THR A 1 157 ? 31.713 -5.076  18.061 1.00 25.81 ? 177 THR A C   1 
ATOM   1148 O  O   . THR A 1 157 ? 30.613 -4.633  17.719 1.00 24.74 ? 177 THR A O   1 
ATOM   1149 C  CB  . THR A 1 157 ? 32.725 -5.271  20.320 1.00 27.35 ? 177 THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 157 ? 31.447 -5.779  20.715 1.00 25.30 ? 177 THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 157 ? 33.336 -4.479  21.485 1.00 27.78 ? 177 THR A CG2 1 
ATOM   1152 N  N   . SER A 1 158 ? 32.218 -6.196  17.565 1.00 25.50 ? 178 SER A N   1 
ATOM   1153 C  CA  . SER A 1 158 ? 31.484 -6.948  16.557 1.00 26.80 ? 178 SER A CA  1 
ATOM   1154 C  C   . SER A 1 158 ? 30.228 -7.633  17.123 1.00 25.60 ? 178 SER A C   1 
ATOM   1155 O  O   . SER A 1 158 ? 29.438 -8.207  16.368 1.00 24.42 ? 178 SER A O   1 
ATOM   1156 C  CB  . SER A 1 158 ? 32.397 -7.998  15.940 1.00 28.77 ? 178 SER A CB  1 
ATOM   1157 O  OG  . SER A 1 158 ? 32.918 -8.827  16.974 1.00 35.54 ? 178 SER A OG  1 
ATOM   1158 N  N   . ASN A 1 159 ? 30.047 -7.563  18.442 1.00 23.65 ? 179 ASN A N   1 
ATOM   1159 C  CA  . ASN A 1 159 ? 28.893 -8.182  19.092 1.00 23.00 ? 179 ASN A CA  1 
ATOM   1160 C  C   . ASN A 1 159 ? 27.784 -7.192  19.432 1.00 22.54 ? 179 ASN A C   1 
ATOM   1161 O  O   . ASN A 1 159 ? 26.911 -7.489  20.253 1.00 20.96 ? 179 ASN A O   1 
ATOM   1162 C  CB  . ASN A 1 159 ? 29.346 -8.901  20.373 1.00 23.70 ? 179 ASN A CB  1 
ATOM   1163 C  CG  . ASN A 1 159 ? 30.313 -10.016 20.085 1.00 24.41 ? 179 ASN A CG  1 
ATOM   1164 O  OD1 . ASN A 1 159 ? 30.037 -10.875 19.262 1.00 25.79 ? 179 ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A 1 159 ? 31.457 -10.002 20.751 1.00 25.23 ? 179 ASN A ND2 1 
ATOM   1166 N  N   . MET A 1 160 ? 27.814 -6.027  18.789 1.00 21.73 ? 180 MET A N   1 
ATOM   1167 C  CA  . MET A 1 160 ? 26.823 -4.990  19.017 1.00 22.37 ? 180 MET A CA  1 
ATOM   1168 C  C   . MET A 1 160 ? 26.417 -4.378  17.690 1.00 23.07 ? 180 MET A C   1 
ATOM   1169 O  O   . MET A 1 160 ? 27.162 -4.452  16.717 1.00 22.04 ? 180 MET A O   1 
ATOM   1170 C  CB  . MET A 1 160 ? 27.418 -3.846  19.845 1.00 23.24 ? 180 MET A CB  1 
ATOM   1171 C  CG  . MET A 1 160 ? 28.307 -4.259  21.012 1.00 22.96 ? 180 MET A CG  1 
ATOM   1172 S  SD  . MET A 1 160 ? 29.114 -2.806  21.752 1.00 24.44 ? 180 MET A SD  1 
ATOM   1173 C  CE  . MET A 1 160 ? 29.826 -3.535  23.331 1.00 25.02 ? 180 MET A CE  1 
ATOM   1174 N  N   . PHE A 1 161 ? 25.237 -3.771  17.661 1.00 21.59 ? 181 PHE A N   1 
ATOM   1175 C  CA  . PHE A 1 161 ? 24.787 -3.055  16.481 1.00 22.52 ? 181 PHE A CA  1 
ATOM   1176 C  C   . PHE A 1 161 ? 23.968 -1.886  17.006 1.00 22.46 ? 181 PHE A C   1 
ATOM   1177 O  O   . PHE A 1 161 ? 23.515 -1.895  18.152 1.00 21.94 ? 181 PHE A O   1 
ATOM   1178 C  CB  . PHE A 1 161 ? 23.968 -3.943  15.525 1.00 21.65 ? 181 PHE A CB  1 
ATOM   1179 C  CG  . PHE A 1 161 ? 22.633 -4.384  16.048 1.00 22.78 ? 181 PHE A CG  1 
ATOM   1180 C  CD1 . PHE A 1 161 ? 21.508 -3.578  15.910 1.00 22.87 ? 181 PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A 1 161 ? 22.476 -5.643  16.607 1.00 22.77 ? 181 PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A 1 161 ? 20.246 -4.028  16.319 1.00 22.11 ? 181 PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A 1 161 ? 21.202 -6.095  17.018 1.00 24.91 ? 181 PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A 1 161 ? 20.094 -5.283  16.869 1.00 21.93 ? 181 PHE A CZ  1 
ATOM   1185 N  N   . CYS A 1 162 ? 23.829 -0.856  16.190 1.00 20.37 ? 182 CYS A N   1 
ATOM   1186 C  CA  . CYS A 1 162 ? 23.052 0.294   16.583 1.00 21.77 ? 182 CYS A CA  1 
ATOM   1187 C  C   . CYS A 1 162 ? 21.714 0.195   15.867 1.00 22.15 ? 182 CYS A C   1 
ATOM   1188 O  O   . CYS A 1 162 ? 21.625 -0.371  14.773 1.00 24.30 ? 182 CYS A O   1 
ATOM   1189 C  CB  . CYS A 1 162 ? 23.722 1.579   16.121 1.00 21.95 ? 182 CYS A CB  1 
ATOM   1190 S  SG  . CYS A 1 162 ? 25.245 2.128   16.950 1.00 23.56 ? 182 CYS A SG  1 
ATOM   1191 N  N   . ALA A 1 163 ? 20.680 0.749   16.466 1.00 20.95 ? 183 ALA A N   1 
ATOM   1192 C  CA  . ALA A 1 163 ? 19.378 0.758   15.826 1.00 22.26 ? 183 ALA A CA  1 
ATOM   1193 C  C   . ALA A 1 163 ? 18.706 2.024   16.311 1.00 22.57 ? 183 ALA A C   1 
ATOM   1194 O  O   . ALA A 1 163 ? 18.912 2.440   17.467 1.00 22.36 ? 183 ALA A O   1 
ATOM   1195 C  CB  . ALA A 1 163 ? 18.565 -0.455  16.234 1.00 22.53 ? 183 ALA A CB  1 
ATOM   1196 N  N   . GLY A 1 164 A 17.917 2.658   15.446 1.00 22.83 ? 184 GLY A N   1 
ATOM   1197 C  CA  . GLY A 1 164 A 17.239 3.857   15.902 1.00 22.37 ? 184 GLY A CA  1 
ATOM   1198 C  C   . GLY A 1 164 A 17.208 4.974   14.884 1.00 22.97 ? 184 GLY A C   1 
ATOM   1199 O  O   . GLY A 1 164 A 17.251 4.729   13.682 1.00 18.72 ? 184 GLY A O   1 
ATOM   1200 N  N   . TYR A 1 165 ? 17.173 6.201   15.387 1.00 23.73 ? 184 TYR A N   1 
ATOM   1201 C  CA  . TYR A 1 165 ? 17.072 7.395   14.561 1.00 26.00 ? 184 TYR A CA  1 
ATOM   1202 C  C   . TYR A 1 165 ? 18.092 8.445   14.944 1.00 27.77 ? 184 TYR A C   1 
ATOM   1203 O  O   . TYR A 1 165 ? 18.092 8.932   16.076 1.00 28.63 ? 184 TYR A O   1 
ATOM   1204 C  CB  . TYR A 1 165 ? 15.681 8.006   14.721 1.00 26.61 ? 184 TYR A CB  1 
ATOM   1205 C  CG  . TYR A 1 165 ? 14.576 7.064   14.366 1.00 25.63 ? 184 TYR A CG  1 
ATOM   1206 C  CD1 . TYR A 1 165 ? 14.120 6.107   15.278 1.00 24.75 ? 184 TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A 1 165 ? 14.023 7.085   13.094 1.00 26.09 ? 184 TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A 1 165 ? 13.128 5.189   14.916 1.00 24.99 ? 184 TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A 1 165 ? 13.036 6.174   12.721 1.00 28.93 ? 184 TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A 1 165 ? 12.594 5.229   13.637 1.00 27.37 ? 184 TYR A CZ  1 
ATOM   1211 O  OH  . TYR A 1 165 ? 11.621 4.335   13.239 1.00 27.78 ? 184 TYR A OH  1 
ATOM   1212 N  N   . LEU A 1 166 ? 18.931 8.831   13.998 1.00 27.01 ? 185 LEU A N   1 
ATOM   1213 C  CA  . LEU A 1 166 ? 19.955 9.822   14.275 1.00 29.40 ? 185 LEU A CA  1 
ATOM   1214 C  C   . LEU A 1 166 ? 19.403 11.208  14.624 1.00 30.87 ? 185 LEU A C   1 
ATOM   1215 O  O   . LEU A 1 166 ? 20.071 11.978  15.309 1.00 30.20 ? 185 LEU A O   1 
ATOM   1216 C  CB  . LEU A 1 166 ? 20.901 9.919   13.080 1.00 29.17 ? 185 LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1 166 ? 21.702 8.642   12.868 1.00 29.47 ? 185 LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1 166 ? 22.576 8.784   11.625 1.00 30.84 ? 185 LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1 166 ? 22.571 8.365   14.108 1.00 31.72 ? 185 LEU A CD2 1 
ATOM   1220 N  N   . GLU A 1 167 ? 18.187 11.515  14.173 1.00 32.46 ? 186 GLU A N   1 
ATOM   1221 C  CA  . GLU A 1 167 ? 17.581 12.823  14.440 1.00 34.57 ? 186 GLU A CA  1 
ATOM   1222 C  C   . GLU A 1 167 ? 17.076 12.977  15.880 1.00 35.61 ? 186 GLU A C   1 
ATOM   1223 O  O   . GLU A 1 167 ? 16.692 14.071  16.295 1.00 35.49 ? 186 GLU A O   1 
ATOM   1224 C  CB  . GLU A 1 167 ? 16.430 13.090  13.451 1.00 36.06 ? 186 GLU A CB  1 
ATOM   1225 C  CG  . GLU A 1 167 ? 15.239 12.116  13.547 1.00 39.26 ? 186 GLU A CG  1 
ATOM   1226 C  CD  . GLU A 1 167 ? 15.286 10.972  12.517 1.00 41.60 ? 186 GLU A CD  1 
ATOM   1227 O  OE1 . GLU A 1 167 ? 16.370 10.366  12.329 1.00 41.96 ? 186 GLU A OE1 1 
ATOM   1228 O  OE2 . GLU A 1 167 ? 14.227 10.666  11.911 1.00 42.56 ? 186 GLU A OE2 1 
ATOM   1229 N  N   . GLY A 1 168 ? 17.086 11.883  16.640 1.00 35.39 ? 187 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 168 ? 16.627 11.929  18.020 1.00 34.06 ? 187 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 168 ? 15.119 11.761  18.155 1.00 32.53 ? 187 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 168 ? 14.422 11.645  17.148 1.00 32.58 ? 187 GLY A O   1 
ATOM   1233 N  N   . GLY A 1 169 A 14.631 11.708  19.396 1.00 31.13 ? 188 GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 169 A 13.200 11.583  19.650 1.00 29.94 ? 188 GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 169 A 12.572 10.208  19.788 1.00 29.53 ? 188 GLY A C   1 
ATOM   1236 O  O   . GLY A 1 169 A 11.466 10.091  20.312 1.00 29.77 ? 188 GLY A O   1 
ATOM   1237 N  N   . LYS A 1 170 ? 13.254 9.168   19.319 1.00 29.17 ? 188 LYS A N   1 
ATOM   1238 C  CA  . LYS A 1 170 ? 12.732 7.800   19.386 1.00 27.97 ? 188 LYS A CA  1 
ATOM   1239 C  C   . LYS A 1 170 ? 13.872 6.869   19.794 1.00 26.79 ? 188 LYS A C   1 
ATOM   1240 O  O   . LYS A 1 170 ? 14.869 6.767   19.079 1.00 25.93 ? 188 LYS A O   1 
ATOM   1241 C  CB  . LYS A 1 170 ? 12.195 7.371   18.017 1.00 31.25 ? 188 LYS A CB  1 
ATOM   1242 C  CG  . LYS A 1 170 ? 10.916 8.070   17.543 1.00 35.19 ? 188 LYS A CG  1 
ATOM   1243 C  CD  . LYS A 1 170 ? 10.505 7.501   16.183 1.00 39.64 ? 188 LYS A CD  1 
ATOM   1244 C  CE  . LYS A 1 170 ? 9.143  7.988   15.730 1.00 43.51 ? 188 LYS A CE  1 
ATOM   1245 N  NZ  . LYS A 1 170 ? 9.155  9.426   15.365 1.00 47.16 ? 188 LYS A NZ  1 
ATOM   1246 N  N   . ASP A 1 171 ? 13.724 6.161   20.911 1.00 24.52 ? 189 ASP A N   1 
ATOM   1247 C  CA  . ASP A 1 171 ? 14.816 5.302   21.376 1.00 22.88 ? 189 ASP A CA  1 
ATOM   1248 C  C   . ASP A 1 171 ? 14.345 4.393   22.516 1.00 22.22 ? 189 ASP A C   1 
ATOM   1249 O  O   . ASP A 1 171 ? 13.252 4.591   23.050 1.00 22.00 ? 189 ASP A O   1 
ATOM   1250 C  CB  . ASP A 1 171 ? 15.911 6.220   21.922 1.00 21.22 ? 189 ASP A CB  1 
ATOM   1251 C  CG  . ASP A 1 171 ? 17.258 5.549   22.033 1.00 21.26 ? 189 ASP A CG  1 
ATOM   1252 O  OD1 . ASP A 1 171 ? 18.174 6.216   22.542 1.00 23.46 ? 189 ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A 1 171 ? 17.416 4.374   21.629 1.00 19.68 ? 189 ASP A OD2 1 
ATOM   1254 N  N   . SER A 1 172 ? 15.150 3.397   22.872 1.00 20.26 ? 190 SER A N   1 
ATOM   1255 C  CA  . SER A 1 172 ? 14.812 2.590   24.042 1.00 20.34 ? 190 SER A CA  1 
ATOM   1256 C  C   . SER A 1 172 ? 15.467 3.435   25.164 1.00 22.12 ? 190 SER A C   1 
ATOM   1257 O  O   . SER A 1 172 ? 16.233 4.363   24.865 1.00 22.88 ? 190 SER A O   1 
ATOM   1258 C  CB  . SER A 1 172 ? 15.419 1.184   23.960 1.00 19.81 ? 190 SER A CB  1 
ATOM   1259 O  OG  . SER A 1 172 ? 16.817 1.226   23.663 1.00 21.85 ? 190 SER A OG  1 
ATOM   1260 N  N   . CYS A 1 173 ? 15.192 3.134   26.431 1.00 21.35 ? 191 CYS A N   1 
ATOM   1261 C  CA  . CYS A 1 173 ? 15.736 3.938   27.527 1.00 22.26 ? 191 CYS A CA  1 
ATOM   1262 C  C   . CYS A 1 173 ? 15.806 3.121   28.838 1.00 23.90 ? 191 CYS A C   1 
ATOM   1263 O  O   . CYS A 1 173 ? 15.510 1.916   28.832 1.00 22.79 ? 191 CYS A O   1 
ATOM   1264 C  CB  . CYS A 1 173 ? 14.840 5.170   27.684 1.00 23.95 ? 191 CYS A CB  1 
ATOM   1265 S  SG  . CYS A 1 173 ? 15.516 6.581   28.629 1.00 27.82 ? 191 CYS A SG  1 
ATOM   1266 N  N   . GLN A 1 174 ? 16.191 3.752   29.952 1.00 23.74 ? 192 GLN A N   1 
ATOM   1267 C  CA  . GLN A 1 174 ? 16.299 3.018   31.221 1.00 24.74 ? 192 GLN A CA  1 
ATOM   1268 C  C   . GLN A 1 174 ? 15.042 2.234   31.564 1.00 24.10 ? 192 GLN A C   1 
ATOM   1269 O  O   . GLN A 1 174 ? 13.931 2.777   31.552 1.00 24.24 ? 192 GLN A O   1 
ATOM   1270 C  CB  . GLN A 1 174 ? 16.649 3.958   32.377 1.00 25.80 ? 192 GLN A CB  1 
ATOM   1271 C  CG  . GLN A 1 174 ? 18.147 4.225   32.502 1.00 30.52 ? 192 GLN A CG  1 
ATOM   1272 C  CD  . GLN A 1 174 ? 18.712 4.972   31.286 1.00 33.40 ? 192 GLN A CD  1 
ATOM   1273 O  OE1 . GLN A 1 174 ? 18.089 5.920   30.780 1.00 33.63 ? 192 GLN A OE1 1 
ATOM   1274 N  NE2 . GLN A 1 174 ? 19.905 4.564   30.828 1.00 33.83 ? 192 GLN A NE2 1 
ATOM   1275 N  N   . GLY A 1 175 ? 15.234 0.956   31.882 1.00 23.31 ? 193 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 175 ? 14.115 0.090   32.191 1.00 22.46 ? 193 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 175 ? 13.804 -0.846  31.018 1.00 23.13 ? 193 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 175 ? 13.096 -1.852  31.178 1.00 23.12 ? 193 GLY A O   1 
ATOM   1279 N  N   . ASP A 1 176 ? 14.323 -0.511  29.835 1.00 20.39 ? 194 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 176 ? 14.106 -1.327  28.644 1.00 19.82 ? 194 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 176 ? 15.196 -2.383  28.479 1.00 17.72 ? 194 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 176 ? 15.024 -3.329  27.704 1.00 18.88 ? 194 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 176 ? 14.081 -0.440  27.388 1.00 20.65 ? 194 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 176 ? 12.826 0.395   27.286 1.00 20.59 ? 194 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 176 ? 12.903 1.541   26.770 1.00 21.12 ? 194 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 176 ? 11.759 -0.092  27.717 1.00 21.96 ? 194 ASP A OD2 1 
ATOM   1287 N  N   . SER A 1 177 ? 16.330 -2.200  29.161 1.00 18.85 ? 195 SER A N   1 
ATOM   1288 C  CA  . SER A 1 177 ? 17.450 -3.150  29.071 1.00 19.09 ? 195 SER A CA  1 
ATOM   1289 C  C   . SER A 1 177 ? 17.024 -4.618  29.158 1.00 19.94 ? 195 SER A C   1 
ATOM   1290 O  O   . SER A 1 177 ? 16.177 -4.971  29.978 1.00 17.56 ? 195 SER A O   1 
ATOM   1291 C  CB  . SER A 1 177 ? 18.457 -2.912  30.204 1.00 22.67 ? 195 SER A CB  1 
ATOM   1292 O  OG  . SER A 1 177 ? 19.420 -1.962  29.835 1.00 25.77 ? 195 SER A OG  1 
ATOM   1293 N  N   . GLY A 1 178 ? 17.641 -5.468  28.336 1.00 19.13 ? 196 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 178 ? 17.332 -6.890  28.365 1.00 18.45 ? 196 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 178 ? 16.198 -7.261  27.438 1.00 20.13 ? 196 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 178 ? 16.036 -8.431  27.063 1.00 19.86 ? 196 GLY A O   1 
ATOM   1297 N  N   . GLY A 1 179 ? 15.426 -6.249  27.053 1.00 19.90 ? 197 GLY A N   1 
ATOM   1298 C  CA  . GLY A 1 179 ? 14.278 -6.456  26.179 1.00 20.80 ? 197 GLY A CA  1 
ATOM   1299 C  C   . GLY A 1 179 ? 14.612 -6.859  24.755 1.00 20.66 ? 197 GLY A C   1 
ATOM   1300 O  O   . GLY A 1 179 ? 15.761 -6.753  24.319 1.00 19.29 ? 197 GLY A O   1 
ATOM   1301 N  N   . PRO A 1 180 ? 13.601 -7.289  23.993 1.00 20.63 ? 198 PRO A N   1 
ATOM   1302 C  CA  . PRO A 1 180 ? 13.747 -7.732  22.610 1.00 19.64 ? 198 PRO A CA  1 
ATOM   1303 C  C   . PRO A 1 180 ? 13.818 -6.716  21.484 1.00 21.66 ? 198 PRO A C   1 
ATOM   1304 O  O   . PRO A 1 180 ? 13.222 -5.629  21.536 1.00 23.54 ? 198 PRO A O   1 
ATOM   1305 C  CB  . PRO A 1 180 ? 12.544 -8.640  22.429 1.00 20.22 ? 198 PRO A CB  1 
ATOM   1306 C  CG  . PRO A 1 180 ? 11.473 -7.881  23.167 1.00 19.23 ? 198 PRO A CG  1 
ATOM   1307 C  CD  . PRO A 1 180 ? 12.182 -7.328  24.414 1.00 18.72 ? 198 PRO A CD  1 
ATOM   1308 N  N   . VAL A 1 181 ? 14.610 -7.073  20.477 1.00 19.83 ? 199 VAL A N   1 
ATOM   1309 C  CA  . VAL A 1 181 ? 14.672 -6.300  19.244 1.00 20.20 ? 199 VAL A CA  1 
ATOM   1310 C  C   . VAL A 1 181 ? 14.348 -7.434  18.254 1.00 20.60 ? 199 VAL A C   1 
ATOM   1311 O  O   . VAL A 1 181 ? 15.177 -8.325  18.016 1.00 20.61 ? 199 VAL A O   1 
ATOM   1312 C  CB  . VAL A 1 181 ? 16.054 -5.721  18.920 1.00 20.43 ? 199 VAL A CB  1 
ATOM   1313 C  CG1 . VAL A 1 181 ? 15.946 -4.932  17.604 1.00 19.52 ? 199 VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A 1 181 ? 16.520 -4.777  20.048 1.00 22.94 ? 199 VAL A CG2 1 
ATOM   1315 N  N   . VAL A 1 182 ? 13.127 -7.416  17.722 1.00 19.25 ? 200 VAL A N   1 
ATOM   1316 C  CA  . VAL A 1 182 ? 12.658 -8.461  16.821 1.00 20.91 ? 200 VAL A CA  1 
ATOM   1317 C  C   . VAL A 1 182 ? 12.494 -7.958  15.404 1.00 22.18 ? 200 VAL A C   1 
ATOM   1318 O  O   . VAL A 1 182 ? 11.850 -6.939  15.182 1.00 21.28 ? 200 VAL A O   1 
ATOM   1319 C  CB  . VAL A 1 182 ? 11.314 -9.046  17.342 1.00 21.01 ? 200 VAL A CB  1 
ATOM   1320 C  CG1 . VAL A 1 182 ? 10.722 -10.013 16.335 1.00 22.56 ? 200 VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A 1 182 ? 11.565 -9.799  18.651 1.00 20.65 ? 200 VAL A CG2 1 
ATOM   1322 N  N   . CYS A 1 183 ? 13.080 -8.679  14.449 1.00 24.45 ? 201 CYS A N   1 
ATOM   1323 C  CA  . CYS A 1 183 ? 13.018 -8.277  13.041 1.00 26.08 ? 201 CYS A CA  1 
ATOM   1324 C  C   . CYS A 1 183 ? 12.626 -9.498  12.211 1.00 28.58 ? 201 CYS A C   1 
ATOM   1325 O  O   . CYS A 1 183 ? 13.274 -10.550 12.295 1.00 27.39 ? 201 CYS A O   1 
ATOM   1326 C  CB  . CYS A 1 183 ? 14.387 -7.765  12.579 1.00 24.58 ? 201 CYS A CB  1 
ATOM   1327 S  SG  . CYS A 1 183 ? 15.349 -6.893  13.861 1.00 25.86 ? 201 CYS A SG  1 
ATOM   1328 N  N   . SER A 1 184 ? 11.546 -9.365  11.444 1.00 31.45 ? 202 SER A N   1 
ATOM   1329 C  CA  . SER A 1 184 ? 11.071 -10.454 10.597 1.00 32.77 ? 202 SER A CA  1 
ATOM   1330 C  C   . SER A 1 184 ? 10.768 -11.677 11.438 1.00 31.09 ? 202 SER A C   1 
ATOM   1331 O  O   . SER A 1 184 ? 11.079 -12.782 11.030 1.00 31.11 ? 202 SER A O   1 
ATOM   1332 C  CB  . SER A 1 184 ? 12.142 -10.844 9.576  1.00 35.54 ? 202 SER A CB  1 
ATOM   1333 O  OG  . SER A 1 184 ? 12.651 -9.720  8.890  1.00 40.48 ? 202 SER A OG  1 
ATOM   1334 N  N   . GLY A 1 185 ? 10.197 -11.485 12.619 1.00 30.58 ? 203 GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 185 ? 9.871  -12.623 13.454 1.00 28.66 ? 203 GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 185 ? 11.032 -13.307 14.162 1.00 27.40 ? 203 GLY A C   1 
ATOM   1337 O  O   . GLY A 1 185 ? 10.835 -14.342 14.797 1.00 27.43 ? 203 GLY A O   1 
ATOM   1338 N  N   . LYS A 1 186 ? 12.235 -12.757 14.071 1.00 24.76 ? 204 LYS A N   1 
ATOM   1339 C  CA  . LYS A 1 186 ? 13.389 -13.371 14.756 1.00 25.00 ? 204 LYS A CA  1 
ATOM   1340 C  C   . LYS A 1 186 ? 13.989 -12.395 15.780 1.00 22.88 ? 204 LYS A C   1 
ATOM   1341 O  O   . LYS A 1 186 ? 14.046 -11.194 15.510 1.00 20.88 ? 204 LYS A O   1 
ATOM   1342 C  CB  . LYS A 1 186 ? 14.473 -13.723 13.739 1.00 26.25 ? 204 LYS A CB  1 
ATOM   1343 C  CG  . LYS A 1 186 ? 14.023 -14.633 12.619 1.00 30.87 ? 204 LYS A CG  1 
ATOM   1344 C  CD  . LYS A 1 186 ? 13.695 -16.008 13.156 1.00 35.59 ? 204 LYS A CD  1 
ATOM   1345 C  CE  . LYS A 1 186 ? 13.512 -16.988 12.017 1.00 39.22 ? 204 LYS A CE  1 
ATOM   1346 N  NZ  . LYS A 1 186 ? 12.511 -16.435 11.069 1.00 42.00 ? 204 LYS A NZ  1 
ATOM   1347 N  N   . LEU A 1 187 ? 14.444 -12.906 16.929 1.00 21.60 ? 209 LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 187 ? 15.075 -12.064 17.962 1.00 21.02 ? 209 LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 187 ? 16.484 -11.692 17.488 1.00 22.33 ? 209 LEU A C   1 
ATOM   1350 O  O   . LEU A 1 187 ? 17.397 -12.519 17.565 1.00 23.04 ? 209 LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 187 ? 15.204 -12.838 19.286 1.00 20.03 ? 209 LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 187 ? 15.857 -12.104 20.481 1.00 21.43 ? 209 LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 187 ? 14.979 -10.925 20.890 1.00 18.01 ? 209 LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 187 ? 16.045 -13.072 21.666 1.00 20.06 ? 209 LEU A CD2 1 
ATOM   1355 N  N   . GLN A 1 188 ? 16.690 -10.465 17.010 1.00 21.69 ? 210 GLN A N   1 
ATOM   1356 C  CA  . GLN A 1 188 ? 18.026 -10.084 16.544 1.00 21.27 ? 210 GLN A CA  1 
ATOM   1357 C  C   . GLN A 1 188 ? 18.838 -9.293  17.564 1.00 20.61 ? 210 GLN A C   1 
ATOM   1358 O  O   . GLN A 1 188 ? 20.077 -9.231  17.486 1.00 18.53 ? 210 GLN A O   1 
ATOM   1359 C  CB  . GLN A 1 188 ? 17.936 -9.250  15.244 1.00 22.84 ? 210 GLN A CB  1 
ATOM   1360 C  CG  . GLN A 1 188 ? 17.411 -10.014 14.026 1.00 25.27 ? 210 GLN A CG  1 
ATOM   1361 C  CD  . GLN A 1 188 ? 18.407 -11.008 13.422 1.00 27.80 ? 210 GLN A CD  1 
ATOM   1362 O  OE1 . GLN A 1 188 ? 18.089 -11.714 12.447 1.00 31.59 ? 210 GLN A OE1 1 
ATOM   1363 N  NE2 . GLN A 1 188 ? 19.601 -11.068 13.981 1.00 25.79 ? 210 GLN A NE2 1 
ATOM   1364 N  N   . GLY A 1 189 ? 18.162 -8.653  18.503 1.00 19.99 ? 211 GLY A N   1 
ATOM   1365 C  CA  . GLY A 1 189 ? 18.915 -7.875  19.468 1.00 19.68 ? 211 GLY A CA  1 
ATOM   1366 C  C   . GLY A 1 189 ? 18.389 -7.879  20.884 1.00 19.52 ? 211 GLY A C   1 
ATOM   1367 O  O   . GLY A 1 189 ? 17.259 -8.299  21.152 1.00 18.27 ? 211 GLY A O   1 
ATOM   1368 N  N   . ILE A 1 190 ? 19.239 -7.407  21.791 1.00 18.90 ? 212 ILE A N   1 
ATOM   1369 C  CA  . ILE A 1 190 ? 18.893 -7.270  23.198 1.00 18.79 ? 212 ILE A CA  1 
ATOM   1370 C  C   . ILE A 1 190 ? 19.244 -5.837  23.594 1.00 18.45 ? 212 ILE A C   1 
ATOM   1371 O  O   . ILE A 1 190 ? 20.373 -5.375  23.348 1.00 18.17 ? 212 ILE A O   1 
ATOM   1372 C  CB  . ILE A 1 190 ? 19.719 -8.218  24.087 1.00 19.50 ? 212 ILE A CB  1 
ATOM   1373 C  CG1 . ILE A 1 190 ? 19.464 -9.677  23.688 1.00 18.19 ? 212 ILE A CG1 1 
ATOM   1374 C  CG2 . ILE A 1 190 ? 19.340 -7.997  25.577 1.00 19.56 ? 212 ILE A CG2 1 
ATOM   1375 C  CD1 . ILE A 1 190 ? 20.564 -10.619 24.198 1.00 21.41 ? 212 ILE A CD1 1 
ATOM   1376 N  N   . VAL A 1 191 ? 18.296 -5.136  24.202 1.00 17.45 ? 213 VAL A N   1 
ATOM   1377 C  CA  . VAL A 1 191 ? 18.524 -3.750  24.624 1.00 19.22 ? 213 VAL A CA  1 
ATOM   1378 C  C   . VAL A 1 191 ? 19.721 -3.702  25.595 1.00 20.17 ? 213 VAL A C   1 
ATOM   1379 O  O   . VAL A 1 191 ? 19.717 -4.331  26.665 1.00 19.80 ? 213 VAL A O   1 
ATOM   1380 C  CB  . VAL A 1 191 ? 17.260 -3.156  25.297 1.00 19.96 ? 213 VAL A CB  1 
ATOM   1381 C  CG1 . VAL A 1 191 ? 17.524 -1.721  25.752 1.00 18.26 ? 213 VAL A CG1 1 
ATOM   1382 C  CG2 . VAL A 1 191 ? 16.088 -3.183  24.313 1.00 17.29 ? 213 VAL A CG2 1 
ATOM   1383 N  N   . SER A 1 192 ? 20.753 -2.956  25.226 1.00 19.14 ? 214 SER A N   1 
ATOM   1384 C  CA  . SER A 1 192 ? 21.946 -2.920  26.070 1.00 18.83 ? 214 SER A CA  1 
ATOM   1385 C  C   . SER A 1 192 ? 22.337 -1.549  26.621 1.00 20.60 ? 214 SER A C   1 
ATOM   1386 O  O   . SER A 1 192 ? 22.212 -1.314  27.828 1.00 20.72 ? 214 SER A O   1 
ATOM   1387 C  CB  . SER A 1 192 ? 23.123 -3.551  25.293 1.00 19.97 ? 214 SER A CB  1 
ATOM   1388 O  OG  . SER A 1 192 ? 24.300 -3.626  26.083 1.00 19.66 ? 214 SER A OG  1 
ATOM   1389 N  N   . TRP A 1 193 ? 22.788 -0.628  25.764 1.00 20.85 ? 215 TRP A N   1 
ATOM   1390 C  CA  . TRP A 1 193 ? 23.217 0.672   26.266 1.00 21.26 ? 215 TRP A CA  1 
ATOM   1391 C  C   . TRP A 1 193 ? 23.092 1.796   25.245 1.00 22.86 ? 215 TRP A C   1 
ATOM   1392 O  O   . TRP A 1 193 ? 22.692 1.572   24.104 1.00 21.56 ? 215 TRP A O   1 
ATOM   1393 C  CB  . TRP A 1 193 ? 24.677 0.592   26.763 1.00 21.09 ? 215 TRP A CB  1 
ATOM   1394 C  CG  . TRP A 1 193 ? 25.695 0.222   25.705 1.00 23.80 ? 215 TRP A CG  1 
ATOM   1395 C  CD1 . TRP A 1 193 ? 25.972 -1.031  25.221 1.00 24.04 ? 215 TRP A CD1 1 
ATOM   1396 C  CD2 . TRP A 1 193 ? 26.565 1.120   25.002 1.00 23.40 ? 215 TRP A CD2 1 
ATOM   1397 N  NE1 . TRP A 1 193 ? 26.967 -0.965  24.257 1.00 23.12 ? 215 TRP A NE1 1 
ATOM   1398 C  CE2 . TRP A 1 193 ? 27.338 0.346   24.103 1.00 23.82 ? 215 TRP A CE2 1 
ATOM   1399 C  CE3 . TRP A 1 193 ? 26.761 2.507   25.040 1.00 25.66 ? 215 TRP A CE3 1 
ATOM   1400 C  CZ2 . TRP A 1 193 ? 28.296 0.919   23.248 1.00 24.29 ? 215 TRP A CZ2 1 
ATOM   1401 C  CZ3 . TRP A 1 193 ? 27.722 3.080   24.185 1.00 24.04 ? 215 TRP A CZ3 1 
ATOM   1402 C  CH2 . TRP A 1 193 ? 28.467 2.288   23.304 1.00 24.64 ? 215 TRP A CH2 1 
ATOM   1403 N  N   . GLY A 1 194 ? 23.429 3.005   25.675 1.00 22.60 ? 216 GLY A N   1 
ATOM   1404 C  CA  . GLY A 1 194 ? 23.365 4.155   24.801 1.00 25.22 ? 216 GLY A CA  1 
ATOM   1405 C  C   . GLY A 1 194 ? 23.781 5.364   25.610 1.00 27.87 ? 216 GLY A C   1 
ATOM   1406 O  O   . GLY A 1 194 ? 23.947 5.278   26.841 1.00 27.45 ? 216 GLY A O   1 
ATOM   1407 N  N   . SER A 1 195 ? 23.961 6.490   24.931 1.00 29.27 ? 217 SER A N   1 
ATOM   1408 C  CA  . SER A 1 195 ? 24.344 7.722   25.609 1.00 30.64 ? 217 SER A CA  1 
ATOM   1409 C  C   . SER A 1 195 ? 23.057 8.510   25.780 1.00 30.40 ? 217 SER A C   1 
ATOM   1410 O  O   . SER A 1 195 ? 22.532 9.077   24.813 1.00 30.41 ? 217 SER A O   1 
ATOM   1411 C  CB  . SER A 1 195 ? 25.351 8.487   24.760 1.00 32.07 ? 217 SER A CB  1 
ATOM   1412 O  OG  . SER A 1 195 ? 25.814 9.604   25.474 1.00 36.71 ? 217 SER A OG  1 
ATOM   1413 N  N   . GLY A 1 196 ? 22.538 8.529   27.008 1.00 29.29 ? 219 GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 196 ? 21.278 9.204   27.272 1.00 30.04 ? 219 GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 196 ? 20.178 8.425   26.561 1.00 29.45 ? 219 GLY A C   1 
ATOM   1416 O  O   . GLY A 1 196 ? 20.333 7.224   26.312 1.00 30.81 ? 219 GLY A O   1 
ATOM   1417 N  N   . CYS A 1 197 ? 19.072 9.081   26.233 1.00 28.72 ? 220 CYS A N   1 
ATOM   1418 C  CA  . CYS A 1 197 ? 17.991 8.427   25.493 1.00 27.48 ? 220 CYS A CA  1 
ATOM   1419 C  C   . CYS A 1 197 ? 17.432 9.397   24.468 1.00 28.78 ? 220 CYS A C   1 
ATOM   1420 O  O   . CYS A 1 197 ? 17.185 10.561  24.780 1.00 28.16 ? 220 CYS A O   1 
ATOM   1421 C  CB  . CYS A 1 197 ? 16.843 8.027   26.404 1.00 27.93 ? 220 CYS A CB  1 
ATOM   1422 S  SG  . CYS A 1 197 ? 17.314 6.927   27.758 1.00 29.96 ? 220 CYS A SG  1 
ATOM   1423 N  N   . ALA A 1 198 A 17.214 8.896   23.258 1.00 27.84 ? 221 ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 198 A 16.652 9.668   22.168 1.00 28.98 ? 221 ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 198 A 17.405 10.953  21.852 1.00 30.24 ? 221 ALA A C   1 
ATOM   1426 O  O   . ALA A 1 198 A 16.818 11.905  21.357 1.00 32.80 ? 221 ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 198 A 15.190 9.966   22.448 1.00 28.64 ? 221 ALA A CB  1 
ATOM   1428 N  N   . GLN A 1 199 ? 18.705 10.971  22.132 1.00 31.74 ? 221 GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 199 ? 19.555 12.119  21.831 1.00 32.07 ? 221 GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 199 ? 20.022 12.058  20.376 1.00 32.03 ? 221 GLN A C   1 
ATOM   1431 O  O   . GLN A 1 199 ? 20.274 10.981  19.823 1.00 28.89 ? 221 GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 199 ? 20.777 12.138  22.748 1.00 34.58 ? 221 GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 199 ? 20.428 12.334  24.213 1.00 38.87 ? 221 GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 199 ? 19.532 13.538  24.423 1.00 43.29 ? 221 GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 199 ? 19.925 14.670  24.133 1.00 45.75 ? 221 GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 199 ? 18.313 13.304  24.918 1.00 44.47 ? 221 GLN A NE2 1 
ATOM   1437 N  N   . LYS A 1 200 ? 20.132 13.228  19.754 1.00 32.28 ? 222 LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 200 ? 20.567 13.321  18.367 1.00 33.14 ? 222 LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 200 ? 21.958 12.715  18.210 1.00 31.46 ? 222 LYS A C   1 
ATOM   1440 O  O   . LYS A 1 200 ? 22.820 12.922  19.056 1.00 30.35 ? 222 LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 200 ? 20.575 14.795  17.945 1.00 37.51 ? 222 LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 200 ? 21.007 15.030  16.516 1.00 44.09 ? 222 LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 200 ? 20.805 16.488  16.103 1.00 47.87 ? 222 LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 200 ? 21.390 16.736  14.705 1.00 51.31 ? 222 LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 200 ? 21.162 18.137  14.217 1.00 53.44 ? 222 LYS A NZ  1 
ATOM   1446 N  N   . ASN A 1 201 ? 22.155 11.950  17.136 1.00 30.96 ? 223 ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 201 ? 23.429 11.308  16.832 1.00 32.21 ? 223 ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 201 ? 23.890 10.298  17.879 1.00 30.91 ? 223 ASN A C   1 
ATOM   1449 O  O   . ASN A 1 201 ? 25.056 9.910   17.893 1.00 30.83 ? 223 ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 201 ? 24.522 12.373  16.632 1.00 35.26 ? 223 ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 201 ? 24.197 13.337  15.495 1.00 39.70 ? 223 ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 201 ? 24.417 14.546  15.609 1.00 44.71 ? 223 ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 201 ? 23.677 12.806  14.397 1.00 40.47 ? 223 ASN A ND2 1 
ATOM   1454 N  N   . LYS A 1 202 ? 22.990 9.876   18.761 1.00 28.13 ? 224 LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 202 ? 23.352 8.902   19.778 1.00 28.59 ? 224 LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 202 ? 22.300 7.808   19.770 1.00 27.59 ? 224 LYS A C   1 
ATOM   1457 O  O   . LYS A 1 202 ? 21.399 7.777   20.619 1.00 27.71 ? 224 LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 202 ? 23.417 9.561   21.168 1.00 31.98 ? 224 LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 202 ? 24.543 10.571  21.322 1.00 34.79 ? 224 LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 202 ? 25.887 9.889   21.097 1.00 40.53 ? 224 LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 202 ? 27.036 10.885  20.997 1.00 44.13 ? 224 LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 202 ? 28.337 10.163  20.794 1.00 48.46 ? 224 LYS A NZ  1 
ATOM   1463 N  N   . PRO A 1 203 ? 22.379 6.902   18.787 1.00 25.36 ? 225 PRO A N   1 
ATOM   1464 C  CA  . PRO A 1 203 ? 21.389 5.824   18.732 1.00 24.73 ? 225 PRO A CA  1 
ATOM   1465 C  C   . PRO A 1 203 ? 21.591 4.754   19.817 1.00 23.21 ? 225 PRO A C   1 
ATOM   1466 O  O   . PRO A 1 203 ? 22.635 4.694   20.471 1.00 22.56 ? 225 PRO A O   1 
ATOM   1467 C  CB  . PRO A 1 203 ? 21.562 5.274   17.313 1.00 24.90 ? 225 PRO A CB  1 
ATOM   1468 C  CG  . PRO A 1 203 ? 23.046 5.442   17.077 1.00 22.99 ? 225 PRO A CG  1 
ATOM   1469 C  CD  . PRO A 1 203 ? 23.337 6.823   17.672 1.00 24.58 ? 225 PRO A CD  1 
ATOM   1470 N  N   . GLY A 1 204 ? 20.576 3.922   20.020 1.00 22.34 ? 226 GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 204 ? 20.701 2.851   20.998 1.00 19.60 ? 226 GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 204 ? 21.657 1.781   20.501 1.00 19.47 ? 226 GLY A C   1 
ATOM   1473 O  O   . GLY A 1 204 ? 21.816 1.589   19.296 1.00 17.91 ? 226 GLY A O   1 
ATOM   1474 N  N   . VAL A 1 205 ? 22.325 1.094   21.427 1.00 18.66 ? 227 VAL A N   1 
ATOM   1475 C  CA  . VAL A 1 205 ? 23.245 0.024   21.066 1.00 19.38 ? 227 VAL A CA  1 
ATOM   1476 C  C   . VAL A 1 205 ? 22.674 -1.287  21.609 1.00 20.56 ? 227 VAL A C   1 
ATOM   1477 O  O   . VAL A 1 205 ? 22.185 -1.356  22.748 1.00 20.36 ? 227 VAL A O   1 
ATOM   1478 C  CB  . VAL A 1 205 ? 24.666 0.281   21.621 1.00 20.26 ? 227 VAL A CB  1 
ATOM   1479 C  CG1 . VAL A 1 205 ? 25.635 -0.763  21.069 1.00 20.46 ? 227 VAL A CG1 1 
ATOM   1480 C  CG2 . VAL A 1 205 ? 25.128 1.667   21.228 1.00 22.56 ? 227 VAL A CG2 1 
ATOM   1481 N  N   . TYR A 1 206 ? 22.731 -2.324  20.783 1.00 20.16 ? 228 TYR A N   1 
ATOM   1482 C  CA  . TYR A 1 206 ? 22.137 -3.599  21.137 1.00 21.69 ? 228 TYR A CA  1 
ATOM   1483 C  C   . TYR A 1 206 ? 23.060 -4.783  20.958 1.00 20.72 ? 228 TYR A C   1 
ATOM   1484 O  O   . TYR A 1 206 ? 23.880 -4.789  20.046 1.00 20.58 ? 228 TYR A O   1 
ATOM   1485 C  CB  . TYR A 1 206 ? 20.886 -3.806  20.260 1.00 20.55 ? 228 TYR A CB  1 
ATOM   1486 C  CG  . TYR A 1 206 ? 19.896 -2.667  20.365 1.00 19.15 ? 228 TYR A CG  1 
ATOM   1487 C  CD1 . TYR A 1 206 ? 18.851 -2.729  21.267 1.00 19.47 ? 228 TYR A CD1 1 
ATOM   1488 C  CD2 . TYR A 1 206 ? 20.053 -1.495  19.609 1.00 19.60 ? 228 TYR A CD2 1 
ATOM   1489 C  CE1 . TYR A 1 206 ? 17.972 -1.661  21.437 1.00 20.38 ? 228 TYR A CE1 1 
ATOM   1490 C  CE2 . TYR A 1 206 ? 19.187 -0.407  19.764 1.00 19.36 ? 228 TYR A CE2 1 
ATOM   1491 C  CZ  . TYR A 1 206 ? 18.142 -0.503  20.691 1.00 22.97 ? 228 TYR A CZ  1 
ATOM   1492 O  OH  . TYR A 1 206 ? 17.283 0.544   20.920 1.00 22.10 ? 228 TYR A OH  1 
ATOM   1493 N  N   . THR A 1 207 ? 22.897 -5.787  21.822 1.00 19.45 ? 229 THR A N   1 
ATOM   1494 C  CA  . THR A 1 207 ? 23.678 -7.006  21.748 1.00 19.18 ? 229 THR A CA  1 
ATOM   1495 C  C   . THR A 1 207 ? 23.232 -7.744  20.476 1.00 19.87 ? 229 THR A C   1 
ATOM   1496 O  O   . THR A 1 207 ? 22.021 -7.944  20.240 1.00 19.21 ? 229 THR A O   1 
ATOM   1497 C  CB  . THR A 1 207 ? 23.439 -7.899  23.014 1.00 19.34 ? 229 THR A CB  1 
ATOM   1498 O  OG1 . THR A 1 207 ? 23.837 -7.169  24.182 1.00 18.70 ? 229 THR A OG1 1 
ATOM   1499 C  CG2 . THR A 1 207 ? 24.271 -9.199  22.936 1.00 17.82 ? 229 THR A CG2 1 
ATOM   1500 N  N   . LYS A 1 208 ? 24.202 -8.140  19.656 1.00 18.50 ? 230 LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 208 ? 23.910 -8.824  18.381 1.00 21.06 ? 230 LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 208 ? 23.686 -10.338 18.580 1.00 21.38 ? 230 LYS A C   1 
ATOM   1503 O  O   . LYS A 1 208 ? 24.618 -11.133 18.508 1.00 21.66 ? 230 LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 208 ? 25.072 -8.554  17.416 1.00 21.06 ? 230 LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 208 ? 24.869 -9.013  15.962 1.00 25.60 ? 230 LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 208 ? 26.001 -8.460  15.086 1.00 27.65 ? 230 LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 208 ? 25.771 -8.713  13.613 1.00 34.51 ? 230 LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 208 ? 26.884 -8.151  12.778 1.00 37.42 ? 230 LYS A NZ  1 
ATOM   1509 N  N   . VAL A 1 209 ? 22.430 -10.723 18.784 1.00 19.48 ? 231 VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 209 ? 22.059 -12.106 19.055 1.00 20.64 ? 231 VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 209 ? 22.506 -13.180 18.050 1.00 21.72 ? 231 VAL A C   1 
ATOM   1512 O  O   . VAL A 1 209 ? 22.795 -14.325 18.451 1.00 19.79 ? 231 VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 209 ? 20.509 -12.231 19.247 1.00 19.44 ? 231 VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 209 ? 20.127 -13.680 19.523 1.00 17.42 ? 231 VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 209 ? 20.065 -11.344 20.406 1.00 17.50 ? 231 VAL A CG2 1 
ATOM   1516 N  N   . CYS A 1 210 ? 22.541 -12.845 16.758 1.00 19.99 ? 232 CYS A N   1 
ATOM   1517 C  CA  . CYS A 1 210 ? 22.955 -13.846 15.763 1.00 21.92 ? 232 CYS A CA  1 
ATOM   1518 C  C   . CYS A 1 210 ? 24.376 -14.373 16.043 1.00 23.64 ? 232 CYS A C   1 
ATOM   1519 O  O   . CYS A 1 210 ? 24.727 -15.466 15.595 1.00 25.53 ? 232 CYS A O   1 
ATOM   1520 C  CB  . CYS A 1 210 ? 22.868 -13.265 14.340 1.00 22.53 ? 232 CYS A CB  1 
ATOM   1521 S  SG  . CYS A 1 210 ? 23.970 -11.855 14.038 1.00 24.70 ? 232 CYS A SG  1 
ATOM   1522 N  N   . ASN A 1 211 ? 25.190 -13.629 16.790 1.00 22.33 ? 233 ASN A N   1 
ATOM   1523 C  CA  . ASN A 1 211 ? 26.543 -14.114 17.091 1.00 23.12 ? 233 ASN A CA  1 
ATOM   1524 C  C   . ASN A 1 211 ? 26.550 -15.127 18.236 1.00 24.28 ? 233 ASN A C   1 
ATOM   1525 O  O   . ASN A 1 211 ? 27.580 -15.747 18.490 1.00 23.10 ? 233 ASN A O   1 
ATOM   1526 C  CB  . ASN A 1 211 ? 27.471 -12.969 17.509 1.00 23.97 ? 233 ASN A CB  1 
ATOM   1527 C  CG  . ASN A 1 211 ? 27.889 -12.096 16.345 1.00 24.77 ? 233 ASN A CG  1 
ATOM   1528 O  OD1 . ASN A 1 211 ? 27.483 -12.320 15.206 1.00 24.29 ? 233 ASN A OD1 1 
ATOM   1529 N  ND2 . ASN A 1 211 ? 28.717 -11.093 16.630 1.00 26.69 ? 233 ASN A ND2 1 
ATOM   1530 N  N   . TYR A 1 212 ? 25.415 -15.281 18.924 1.00 21.23 ? 234 TYR A N   1 
ATOM   1531 C  CA  . TYR A 1 212 ? 25.336 -16.167 20.084 1.00 22.72 ? 234 TYR A CA  1 
ATOM   1532 C  C   . TYR A 1 212 ? 24.437 -17.372 19.937 1.00 24.00 ? 234 TYR A C   1 
ATOM   1533 O  O   . TYR A 1 212 ? 24.287 -18.145 20.882 1.00 24.26 ? 234 TYR A O   1 
ATOM   1534 C  CB  . TYR A 1 212 ? 24.866 -15.361 21.304 1.00 21.39 ? 234 TYR A CB  1 
ATOM   1535 C  CG  . TYR A 1 212 ? 25.802 -14.230 21.654 1.00 22.58 ? 234 TYR A CG  1 
ATOM   1536 C  CD1 . TYR A 1 212 ? 26.973 -14.472 22.405 1.00 21.12 ? 234 TYR A CD1 1 
ATOM   1537 C  CD2 . TYR A 1 212 ? 25.577 -12.940 21.180 1.00 20.77 ? 234 TYR A CD2 1 
ATOM   1538 C  CE1 . TYR A 1 212 ? 27.886 -13.460 22.666 1.00 20.96 ? 234 TYR A CE1 1 
ATOM   1539 C  CE2 . TYR A 1 212 ? 26.502 -11.917 21.442 1.00 20.98 ? 234 TYR A CE2 1 
ATOM   1540 C  CZ  . TYR A 1 212 ? 27.647 -12.190 22.178 1.00 20.42 ? 234 TYR A CZ  1 
ATOM   1541 O  OH  . TYR A 1 212 ? 28.577 -11.202 22.418 1.00 21.20 ? 234 TYR A OH  1 
ATOM   1542 N  N   . VAL A 1 213 ? 23.841 -17.561 18.767 1.00 24.75 ? 235 VAL A N   1 
ATOM   1543 C  CA  . VAL A 1 213 ? 22.932 -18.696 18.610 1.00 24.52 ? 235 VAL A CA  1 
ATOM   1544 C  C   . VAL A 1 213 ? 23.551 -20.031 19.028 1.00 24.77 ? 235 VAL A C   1 
ATOM   1545 O  O   . VAL A 1 213 ? 22.912 -20.826 19.711 1.00 23.59 ? 235 VAL A O   1 
ATOM   1546 C  CB  . VAL A 1 213 ? 22.426 -18.778 17.174 1.00 26.94 ? 235 VAL A CB  1 
ATOM   1547 C  CG1 . VAL A 1 213 ? 21.568 -20.037 16.986 1.00 26.54 ? 235 VAL A CG1 1 
ATOM   1548 C  CG2 . VAL A 1 213 ? 21.608 -17.510 16.860 1.00 26.09 ? 235 VAL A CG2 1 
ATOM   1549 N  N   . SER A 1 214 ? 24.796 -20.276 18.633 1.00 24.65 ? 236 SER A N   1 
ATOM   1550 C  CA  . SER A 1 214 ? 25.460 -21.526 18.997 1.00 26.43 ? 236 SER A CA  1 
ATOM   1551 C  C   . SER A 1 214 ? 25.654 -21.693 20.495 1.00 25.50 ? 236 SER A C   1 
ATOM   1552 O  O   . SER A 1 214 ? 25.432 -22.777 21.053 1.00 24.90 ? 236 SER A O   1 
ATOM   1553 C  CB  . SER A 1 214 ? 26.819 -21.616 18.320 1.00 26.67 ? 236 SER A CB  1 
ATOM   1554 O  OG  . SER A 1 214 ? 26.598 -22.025 16.985 1.00 34.35 ? 236 SER A OG  1 
ATOM   1555 N  N   . TRP A 1 215 ? 26.091 -20.614 21.133 1.00 25.67 ? 237 TRP A N   1 
ATOM   1556 C  CA  . TRP A 1 215 ? 26.335 -20.616 22.562 1.00 24.81 ? 237 TRP A CA  1 
ATOM   1557 C  C   . TRP A 1 215 ? 25.020 -20.842 23.302 1.00 25.07 ? 237 TRP A C   1 
ATOM   1558 O  O   . TRP A 1 215 ? 24.955 -21.633 24.253 1.00 27.05 ? 237 TRP A O   1 
ATOM   1559 C  CB  . TRP A 1 215 ? 26.952 -19.285 22.980 1.00 26.26 ? 237 TRP A CB  1 
ATOM   1560 C  CG  . TRP A 1 215 ? 27.176 -19.190 24.451 1.00 27.54 ? 237 TRP A CG  1 
ATOM   1561 C  CD1 . TRP A 1 215 ? 28.165 -19.810 25.177 1.00 28.95 ? 237 TRP A CD1 1 
ATOM   1562 C  CD2 . TRP A 1 215 ? 26.369 -18.482 25.393 1.00 27.48 ? 237 TRP A CD2 1 
ATOM   1563 N  NE1 . TRP A 1 215 ? 28.018 -19.527 26.514 1.00 29.57 ? 237 TRP A NE1 1 
ATOM   1564 C  CE2 . TRP A 1 215 ? 26.924 -18.712 26.676 1.00 29.42 ? 237 TRP A CE2 1 
ATOM   1565 C  CE3 . TRP A 1 215 ? 25.225 -17.671 25.283 1.00 28.86 ? 237 TRP A CE3 1 
ATOM   1566 C  CZ2 . TRP A 1 215 ? 26.372 -18.160 27.842 1.00 27.95 ? 237 TRP A CZ2 1 
ATOM   1567 C  CZ3 . TRP A 1 215 ? 24.674 -17.120 26.439 1.00 26.39 ? 237 TRP A CZ3 1 
ATOM   1568 C  CH2 . TRP A 1 215 ? 25.248 -17.367 27.703 1.00 29.25 ? 237 TRP A CH2 1 
ATOM   1569 N  N   . ILE A 1 216 ? 23.969 -20.157 22.869 1.00 23.57 ? 238 ILE A N   1 
ATOM   1570 C  CA  . ILE A 1 216 ? 22.669 -20.317 23.518 1.00 23.40 ? 238 ILE A CA  1 
ATOM   1571 C  C   . ILE A 1 216 ? 22.207 -21.766 23.449 1.00 23.54 ? 238 ILE A C   1 
ATOM   1572 O  O   . ILE A 1 216 ? 21.843 -22.364 24.471 1.00 23.44 ? 238 ILE A O   1 
ATOM   1573 C  CB  . ILE A 1 216 ? 21.614 -19.409 22.868 1.00 21.88 ? 238 ILE A CB  1 
ATOM   1574 C  CG1 . ILE A 1 216 ? 21.911 -17.948 23.234 1.00 21.90 ? 238 ILE A CG1 1 
ATOM   1575 C  CG2 . ILE A 1 216 ? 20.206 -19.811 23.331 1.00 23.71 ? 238 ILE A CG2 1 
ATOM   1576 C  CD1 . ILE A 1 216 ? 21.182 -16.950 22.348 1.00 21.00 ? 238 ILE A CD1 1 
ATOM   1577 N  N   . LYS A 1 217 ? 22.240 -22.342 22.250 1.00 23.91 ? 239 LYS A N   1 
ATOM   1578 C  CA  . LYS A 1 217 ? 21.795 -23.712 22.098 1.00 25.56 ? 239 LYS A CA  1 
ATOM   1579 C  C   . LYS A 1 217 ? 22.615 -24.714 22.910 1.00 23.80 ? 239 LYS A C   1 
ATOM   1580 O  O   . LYS A 1 217 ? 22.044 -25.583 23.576 1.00 22.25 ? 239 LYS A O   1 
ATOM   1581 C  CB  . LYS A 1 217 ? 21.768 -24.094 20.617 1.00 27.72 ? 239 LYS A CB  1 
ATOM   1582 C  CG  . LYS A 1 217 ? 20.662 -23.371 19.846 1.00 34.23 ? 239 LYS A CG  1 
ATOM   1583 C  CD  . LYS A 1 217 ? 20.695 -23.773 18.372 1.00 40.59 ? 239 LYS A CD  1 
ATOM   1584 C  CE  . LYS A 1 217 ? 19.614 -23.075 17.551 1.00 45.21 ? 239 LYS A CE  1 
ATOM   1585 N  NZ  . LYS A 1 217 ? 18.241 -23.258 18.136 1.00 48.41 ? 239 LYS A NZ  1 
ATOM   1586 N  N   . GLN A 1 218 ? 23.941 -24.589 22.885 1.00 23.39 ? 240 GLN A N   1 
ATOM   1587 C  CA  . GLN A 1 218 ? 24.773 -25.524 23.640 1.00 25.01 ? 240 GLN A CA  1 
ATOM   1588 C  C   . GLN A 1 218 ? 24.557 -25.376 25.127 1.00 25.03 ? 240 GLN A C   1 
ATOM   1589 O  O   . GLN A 1 218 ? 24.548 -26.369 25.862 1.00 27.43 ? 240 GLN A O   1 
ATOM   1590 C  CB  . GLN A 1 218 ? 26.261 -25.334 23.309 1.00 24.97 ? 240 GLN A CB  1 
ATOM   1591 C  CG  . GLN A 1 218 ? 26.584 -25.698 21.863 1.00 32.26 ? 240 GLN A CG  1 
ATOM   1592 C  CD  . GLN A 1 218 ? 28.052 -25.485 21.495 1.00 35.29 ? 240 GLN A CD  1 
ATOM   1593 O  OE1 . GLN A 1 218 ? 28.741 -24.635 22.076 1.00 37.86 ? 240 GLN A OE1 1 
ATOM   1594 N  NE2 . GLN A 1 218 ? 28.528 -26.239 20.505 1.00 35.23 ? 240 GLN A NE2 1 
ATOM   1595 N  N   . THR A 1 219 ? 24.385 -24.139 25.583 1.00 23.86 ? 241 THR A N   1 
ATOM   1596 C  CA  . THR A 1 219 ? 24.163 -23.900 26.999 1.00 23.37 ? 241 THR A CA  1 
ATOM   1597 C  C   . THR A 1 219 ? 22.828 -24.466 27.482 1.00 25.39 ? 241 THR A C   1 
ATOM   1598 O  O   . THR A 1 219 ? 22.739 -25.101 28.540 1.00 23.58 ? 241 THR A O   1 
ATOM   1599 C  CB  . THR A 1 219 ? 24.208 -22.416 27.302 1.00 23.66 ? 241 THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 219 ? 25.483 -21.906 26.893 1.00 25.14 ? 241 THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 219 ? 23.997 -22.174 28.813 1.00 24.64 ? 241 THR A CG2 1 
ATOM   1602 N  N   . ILE A 1 220 ? 21.781 -24.229 26.710 1.00 25.91 ? 242 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 220 ? 20.475 -24.738 27.077 1.00 27.86 ? 242 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 220 ? 20.489 -26.272 27.100 1.00 28.26 ? 242 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 220 ? 19.928 -26.895 28.006 1.00 28.75 ? 242 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 220 ? 19.406 -24.227 26.082 1.00 28.02 ? 242 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 220 ? 19.144 -22.748 26.343 1.00 28.90 ? 242 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 220 ? 18.117 -25.011 26.239 1.00 30.63 ? 242 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 220 ? 18.021 -22.178 25.498 1.00 30.89 ? 242 ILE A CD1 1 
ATOM   1610 N  N   . ALA A 1 221 ? 21.158 -26.871 26.114 1.00 28.73 ? 243 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 221 ? 21.223 -28.330 26.004 1.00 30.93 ? 243 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 221 ? 21.909 -29.013 27.184 1.00 31.02 ? 243 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 221 ? 21.554 -30.127 27.545 1.00 30.54 ? 243 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 221 ? 21.906 -28.726 24.719 1.00 28.70 ? 243 ALA A CB  1 
ATOM   1615 N  N   . SER A 1 222 ? 22.867 -28.340 27.802 1.00 31.34 ? 244 SER A N   1 
ATOM   1616 C  CA  . SER A 1 222 ? 23.561 -28.942 28.924 1.00 31.96 ? 244 SER A CA  1 
ATOM   1617 C  C   . SER A 1 222 ? 23.045 -28.521 30.294 1.00 31.35 ? 244 SER A C   1 
ATOM   1618 O  O   . SER A 1 222 ? 23.648 -28.868 31.308 1.00 31.42 ? 244 SER A O   1 
ATOM   1619 C  CB  . SER A 1 222 ? 25.056 -28.658 28.808 1.00 33.93 ? 244 SER A CB  1 
ATOM   1620 O  OG  . SER A 1 222 ? 25.277 -27.293 28.573 1.00 37.36 ? 244 SER A OG  1 
ATOM   1621 N  N   . ASN A 1 223 ? 21.929 -27.794 30.345 1.00 28.83 ? 245 ASN A N   1 
ATOM   1622 C  CA  . ASN A 1 223 ? 21.383 -27.364 31.634 1.00 29.33 ? 245 ASN A CA  1 
ATOM   1623 C  C   . ASN A 1 223 ? 19.898 -27.717 31.780 1.00 30.90 ? 245 ASN A C   1 
ATOM   1624 O  O   . ASN A 1 223 ? 19.243 -27.162 32.688 1.00 30.31 ? 245 ASN A O   1 
ATOM   1625 C  CB  . ASN A 1 223 ? 21.562 -25.850 31.811 1.00 26.83 ? 245 ASN A CB  1 
ATOM   1626 C  CG  . ASN A 1 223 ? 22.998 -25.464 32.148 1.00 29.31 ? 245 ASN A CG  1 
ATOM   1627 O  OD1 . ASN A 1 223 ? 23.434 -25.549 33.298 1.00 27.87 ? 245 ASN A OD1 1 
ATOM   1628 N  ND2 . ASN A 1 223 ? 23.740 -25.044 31.140 1.00 25.48 ? 245 ASN A ND2 1 
ATOM   1629 O  OXT . ASN A 1 223 ? 19.410 -28.554 30.993 1.00 33.93 ? 245 ASN A OXT 1 
ATOM   1630 N  N   . SER B 2 1   ? 27.864 7.392   28.827 1.00 49.80 ? 1   SER B N   1 
ATOM   1631 C  CA  . SER B 2 1   ? 26.933 6.330   28.343 1.00 49.10 ? 1   SER B CA  1 
ATOM   1632 C  C   . SER B 2 1   ? 26.542 5.397   29.490 1.00 47.06 ? 1   SER B C   1 
ATOM   1633 O  O   . SER B 2 1   ? 27.368 5.040   30.330 1.00 47.30 ? 1   SER B O   1 
ATOM   1634 C  CB  . SER B 2 1   ? 27.589 5.534   27.209 1.00 49.90 ? 1   SER B CB  1 
ATOM   1635 O  OG  . SER B 2 1   ? 28.890 5.111   27.576 1.00 53.10 ? 1   SER B OG  1 
ATOM   1636 N  N   . CYS B 2 2   ? 25.275 5.010   29.515 1.00 44.49 ? 2   CYS B N   1 
ATOM   1637 C  CA  . CYS B 2 2   ? 24.768 4.141   30.563 1.00 42.55 ? 2   CYS B CA  1 
ATOM   1638 C  C   . CYS B 2 2   ? 23.972 2.973   29.994 1.00 39.63 ? 2   CYS B C   1 
ATOM   1639 O  O   . CYS B 2 2   ? 23.403 3.074   28.901 1.00 37.40 ? 2   CYS B O   1 
ATOM   1640 C  CB  . CYS B 2 2   ? 23.837 4.923   31.488 1.00 44.40 ? 2   CYS B CB  1 
ATOM   1641 S  SG  . CYS B 2 2   ? 24.487 6.477   32.190 1.00 47.96 ? 2   CYS B SG  1 
ATOM   1642 N  N   . THR B 2 3   ? 23.930 1.873   30.744 1.00 36.04 ? 3   THR B N   1 
ATOM   1643 C  CA  . THR B 2 3   ? 23.146 0.720   30.334 1.00 33.34 ? 3   THR B CA  1 
ATOM   1644 C  C   . THR B 2 3   ? 21.710 1.198   30.557 1.00 34.15 ? 3   THR B C   1 
ATOM   1645 O  O   . THR B 2 3   ? 21.479 2.169   31.301 1.00 34.09 ? 3   THR B O   1 
ATOM   1646 C  CB  . THR B 2 3   ? 23.423 -0.515  31.229 1.00 32.37 ? 3   THR B CB  1 
ATOM   1647 O  OG1 . THR B 2 3   ? 23.170 -0.189  32.603 1.00 29.77 ? 3   THR B OG1 1 
ATOM   1648 C  CG2 . THR B 2 3   ? 24.873 -0.986  31.069 1.00 31.98 ? 3   THR B CG2 1 
ATOM   1649 N  N   . ARG B 2 4   ? 20.746 0.533   29.932 1.00 32.69 ? 4   ARG B N   1 
ATOM   1650 C  CA  . ARG B 2 4   ? 19.356 0.947   30.072 1.00 33.97 ? 4   ARG B CA  1 
ATOM   1651 C  C   . ARG B 2 4   ? 18.514 0.127   31.053 1.00 34.14 ? 4   ARG B C   1 
ATOM   1652 O  O   . ARG B 2 4   ? 17.349 -0.219  30.798 1.00 34.34 ? 4   ARG B O   1 
ATOM   1653 C  CB  . ARG B 2 4   ? 18.730 1.015   28.678 1.00 33.20 ? 4   ARG B CB  1 
ATOM   1654 C  CG  . ARG B 2 4   ? 19.219 2.272   27.992 1.00 33.94 ? 4   ARG B CG  1 
ATOM   1655 C  CD  . ARG B 2 4   ? 19.313 2.212   26.481 1.00 31.28 ? 4   ARG B CD  1 
ATOM   1656 N  NE  . ARG B 2 4   ? 19.717 3.533   25.977 1.00 32.26 ? 4   ARG B NE  1 
ATOM   1657 C  CZ  . ARG B 2 4   ? 19.471 3.966   24.743 1.00 32.73 ? 4   ARG B CZ  1 
ATOM   1658 N  NH1 . ARG B 2 4   ? 18.826 3.176   23.892 1.00 30.66 ? 4   ARG B NH1 1 
ATOM   1659 N  NH2 . ARG B 2 4   ? 19.855 5.187   24.360 1.00 33.08 ? 4   ARG B NH2 1 
ATOM   1660 N  N   . SER B 2 5   ? 19.127 -0.157  32.198 1.00 33.98 ? 5   SER B N   1 
ATOM   1661 C  CA  . SER B 2 5   ? 18.495 -0.908  33.274 1.00 34.68 ? 5   SER B CA  1 
ATOM   1662 C  C   . SER B 2 5   ? 18.056 0.066   34.373 1.00 35.37 ? 5   SER B C   1 
ATOM   1663 O  O   . SER B 2 5   ? 18.341 1.263   34.298 1.00 35.37 ? 5   SER B O   1 
ATOM   1664 C  CB  . SER B 2 5   ? 19.516 -1.870  33.863 1.00 34.14 ? 5   SER B CB  1 
ATOM   1665 O  OG  . SER B 2 5   ? 20.683 -1.137  34.258 1.00 34.96 ? 5   SER B OG  1 
ATOM   1666 N  N   . ILE B 2 6   ? 17.371 -0.455  35.386 1.00 35.68 ? 6   ILE B N   1 
ATOM   1667 C  CA  . ILE B 2 6   ? 16.933 0.343   36.535 1.00 37.83 ? 6   ILE B CA  1 
ATOM   1668 C  C   . ILE B 2 6   ? 17.566 -0.249  37.807 1.00 40.50 ? 6   ILE B C   1 
ATOM   1669 O  O   . ILE B 2 6   ? 17.191 -1.342  38.241 1.00 39.99 ? 6   ILE B O   1 
ATOM   1670 C  CB  . ILE B 2 6   ? 15.390 0.312   36.707 1.00 37.16 ? 6   ILE B CB  1 
ATOM   1671 C  CG1 . ILE B 2 6   ? 14.717 0.959   35.499 1.00 35.66 ? 6   ILE B CG1 1 
ATOM   1672 C  CG2 . ILE B 2 6   ? 14.986 1.047   37.991 1.00 36.53 ? 6   ILE B CG2 1 
ATOM   1673 C  CD1 . ILE B 2 6   ? 13.202 1.003   35.591 1.00 34.08 ? 6   ILE B CD1 1 
ATOM   1674 N  N   . PRO B 2 7   ? 18.559 0.447   38.397 1.00 42.42 ? 7   PRO B N   1 
ATOM   1675 C  CA  . PRO B 2 7   ? 19.099 1.731   37.930 1.00 43.09 ? 7   PRO B CA  1 
ATOM   1676 C  C   . PRO B 2 7   ? 20.158 1.536   36.828 1.00 43.52 ? 7   PRO B C   1 
ATOM   1677 O  O   . PRO B 2 7   ? 20.713 0.440   36.663 1.00 42.54 ? 7   PRO B O   1 
ATOM   1678 C  CB  . PRO B 2 7   ? 19.692 2.334   39.209 1.00 43.38 ? 7   PRO B CB  1 
ATOM   1679 C  CG  . PRO B 2 7   ? 20.242 1.113   39.895 1.00 43.95 ? 7   PRO B CG  1 
ATOM   1680 C  CD  . PRO B 2 7   ? 19.123 0.089   39.716 1.00 42.80 ? 7   PRO B CD  1 
ATOM   1681 N  N   . PRO B 2 8   ? 20.456 2.601   36.065 1.00 43.37 ? 8   PRO B N   1 
ATOM   1682 C  CA  . PRO B 2 8   ? 21.455 2.488   34.997 1.00 44.29 ? 8   PRO B CA  1 
ATOM   1683 C  C   . PRO B 2 8   ? 22.870 2.347   35.558 1.00 45.77 ? 8   PRO B C   1 
ATOM   1684 O  O   . PRO B 2 8   ? 23.142 2.752   36.693 1.00 45.08 ? 8   PRO B O   1 
ATOM   1685 C  CB  . PRO B 2 8   ? 21.277 3.786   34.218 1.00 43.11 ? 8   PRO B CB  1 
ATOM   1686 C  CG  . PRO B 2 8   ? 20.936 4.759   35.295 1.00 43.26 ? 8   PRO B CG  1 
ATOM   1687 C  CD  . PRO B 2 8   ? 19.952 3.981   36.176 1.00 43.38 ? 8   PRO B CD  1 
ATOM   1688 N  N   . GLN B 2 9   ? 23.754 1.747   34.766 1.00 46.65 ? 9   GLN B N   1 
ATOM   1689 C  CA  . GLN B 2 9   ? 25.159 1.581   35.142 1.00 48.74 ? 9   GLN B CA  1 
ATOM   1690 C  C   . GLN B 2 9   ? 25.934 2.392   34.119 1.00 49.13 ? 9   GLN B C   1 
ATOM   1691 O  O   . GLN B 2 9   ? 25.878 2.103   32.917 1.00 49.12 ? 9   GLN B O   1 
ATOM   1692 C  CB  . GLN B 2 9   ? 25.574 0.113   35.064 1.00 49.06 ? 9   GLN B CB  1 
ATOM   1693 C  CG  . GLN B 2 9   ? 24.880 -0.756  36.092 1.00 50.48 ? 9   GLN B CG  1 
ATOM   1694 C  CD  . GLN B 2 9   ? 24.820 -2.209  35.673 1.00 51.40 ? 9   GLN B CD  1 
ATOM   1695 O  OE1 . GLN B 2 9   ? 25.834 -2.806  35.283 1.00 50.70 ? 9   GLN B OE1 1 
ATOM   1696 N  NE2 . GLN B 2 9   ? 23.626 -2.796  35.758 1.00 50.77 ? 9   GLN B NE2 1 
ATOM   1697 N  N   . CYS B 2 10  ? 26.632 3.418   34.595 1.00 49.76 ? 10  CYS B N   1 
ATOM   1698 C  CA  . CYS B 2 10  ? 27.398 4.290   33.710 1.00 51.19 ? 10  CYS B CA  1 
ATOM   1699 C  C   . CYS B 2 10  ? 28.893 4.263   34.029 1.00 52.44 ? 10  CYS B C   1 
ATOM   1700 O  O   . CYS B 2 10  ? 29.242 3.783   35.133 1.00 53.73 ? 10  CYS B O   1 
ATOM   1701 C  CB  . CYS B 2 10  ? 26.902 5.718   33.848 1.00 49.60 ? 10  CYS B CB  1 
ATOM   1702 S  SG  . CYS B 2 10  ? 25.103 5.936   34.054 1.00 49.41 ? 10  CYS B SG  1 
HETATM 1703 CA CA  . CA  C 3 .   ? -0.483 -6.962  35.058 1.00 33.07 ? 271 CA  A CA  1 
HETATM 1704 O  O   . HOH D 4 .   ? 17.157 2.766   19.644 1.00 21.10 ? 301 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 9.709  -6.680  20.403 1.00 19.34 ? 302 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? 24.987 -0.952  13.560 1.00 20.60 ? 303 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? 21.392 -10.465 15.601 1.00 22.16 ? 304 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? 4.498  -6.805  37.114 1.00 22.05 ? 305 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? 8.474  2.149   27.828 1.00 22.50 ? 306 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 17.407 6.135   18.409 1.00 23.38 ? 307 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? 7.270  -6.279  36.899 1.00 21.04 ? 308 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 12.250 -4.370  27.372 1.00 20.79 ? 309 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 5.239  -10.117 30.436 1.00 21.71 ? 310 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? 4.998  -12.756 27.982 1.00 24.92 ? 311 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? 15.759 -10.094 24.989 1.00 22.13 ? 312 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? -2.178 -1.599  26.713 1.00 23.16 ? 313 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 20.398 8.789   23.082 1.00 25.55 ? 314 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 2.521  -7.991  24.931 1.00 24.37 ? 315 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? -1.800 -9.013  31.567 1.00 25.91 ? 316 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? -6.096 -15.152 33.455 1.00 23.49 ? 317 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? 11.296 -3.407  29.795 1.00 19.22 ? 318 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? 7.257  3.339   15.933 1.00 29.31 ? 319 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 27.779 -7.340  23.268 1.00 27.31 ? 320 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 3.848  -9.317  27.463 1.00 24.64 ? 321 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? 25.696 4.909   6.561  1.00 27.37 ? 322 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 6.949  5.658   24.221 1.00 30.46 ? 323 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? 1.215  -6.627  26.865 1.00 26.48 ? 324 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? -1.628 -6.755  32.818 1.00 27.73 ? 325 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? 21.232 5.130   28.089 1.00 31.53 ? 326 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? 14.214 8.952   9.813  1.00 43.95 ? 327 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 26.218 -8.646  35.580 1.00 31.05 ? 328 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? -3.868 -5.856  41.138 1.00 31.53 ? 329 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? 0.438  -2.167  25.784 1.00 25.15 ? 330 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? 1.692  -11.036 26.743 1.00 34.50 ? 331 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? -1.019 -16.879 30.781 1.00 33.36 ? 332 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 18.702 8.071   19.981 1.00 30.22 ? 333 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 26.524 -2.163  8.068  1.00 37.58 ? 334 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? 19.963 -0.103  23.550 1.00 37.27 ? 335 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 7.956  -19.930 40.854 1.00 32.89 ? 336 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 7.688  -1.459  38.961 1.00 32.09 ? 337 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 26.323 -4.781  24.176 1.00 35.69 ? 338 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? -3.773 -3.151  30.239 1.00 31.41 ? 339 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? 24.478 -3.056  10.531 1.00 34.48 ? 340 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? 16.918 -6.315  44.146 1.00 36.10 ? 341 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 15.563 -11.213 11.114 1.00 33.05 ? 342 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 6.728  -9.051  17.114 1.00 40.06 ? 343 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 27.666 -23.617 26.645 1.00 36.84 ? 344 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 27.698 -18.551 19.462 1.00 41.35 ? 345 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 7.538  1.081   34.168 1.00 36.77 ? 346 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? 14.533 -5.889  45.878 1.00 35.98 ? 347 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? -3.050 -15.614 34.641 1.00 35.02 ? 348 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 16.297 7.545   31.887 1.00 41.28 ? 349 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 27.103 -5.435  34.982 1.00 39.66 ? 350 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? 19.620 -26.794 22.587 1.00 37.16 ? 351 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? 14.484 -20.747 17.761 1.00 41.01 ? 352 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? -0.096 5.195   22.097 1.00 41.47 ? 353 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? 33.810 -17.318 25.959 1.00 47.60 ? 354 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 30.042 -16.923 22.577 1.00 35.86 ? 355 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? 7.550  9.254   24.680 1.00 35.05 ? 356 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 2.775  -20.779 34.740 1.00 36.58 ? 357 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? 12.271 -4.536  7.303  1.00 40.45 ? 358 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 17.910 8.481   11.376 1.00 43.06 ? 359 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? 8.985  -25.140 24.555 1.00 45.82 ? 360 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? 22.068 -8.979  13.210 1.00 33.36 ? 361 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? 32.892 -7.854  33.969 1.00 49.60 ? 362 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 4.681  -12.905 43.662 1.00 48.31 ? 363 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 26.565 8.190   12.909 1.00 38.53 ? 364 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 32.379 -0.933  24.420 1.00 37.76 ? 365 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? 13.475 -19.752 20.198 1.00 42.61 ? 366 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? 11.266 -22.453 20.716 1.00 53.17 ? 367 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? -3.825 -8.701  29.564 1.00 43.37 ? 368 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 7.043  9.421   18.184 1.00 49.99 ? 369 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? -0.845 -17.848 36.139 1.00 34.30 ? 370 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 34.198 -12.160 32.409 1.00 43.27 ? 371 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 3.007  -0.362  41.631 1.00 48.66 ? 372 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 4.922  7.726   25.158 1.00 45.60 ? 373 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? 6.597  5.850   17.393 1.00 40.42 ? 374 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? 3.027  -2.883  16.955 1.00 48.97 ? 375 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? -4.319 -2.251  25.428 1.00 44.02 ? 376 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? -4.965 -6.649  22.933 1.00 52.62 ? 377 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? -5.211 -10.178 25.855 1.00 50.51 ? 378 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? 5.789  -3.101  39.144 1.00 49.45 ? 379 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? 17.016 -27.166 29.727 1.00 46.55 ? 380 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? 22.368 -9.491  43.312 1.00 45.97 ? 381 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? 13.038 -10.570 44.368 1.00 43.43 ? 382 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? 0.847  -7.745  37.279 1.00 26.35 ? 383 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? 1.129  -6.824  39.756 1.00 39.31 ? 384 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? -2.699 -17.506 33.073 1.00 38.56 ? 385 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? -3.855 -13.527 35.831 1.00 48.59 ? 386 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? 14.278 -25.603 36.547 1.00 50.00 ? 387 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? 30.931 -20.044 26.701 1.00 52.52 ? 388 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? 34.496 -12.062 23.325 1.00 54.35 ? 389 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? 4.620  -22.827 35.611 1.00 47.59 ? 390 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? 5.026  -20.332 21.530 1.00 37.08 ? 391 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? 17.189 -15.121 10.517 1.00 41.97 ? 392 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? 24.700 -13.954 9.042  1.00 42.24 ? 393 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? 17.893 -4.321  4.516  1.00 46.61 ? 394 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 6.837  7.492   36.684 1.00 45.62 ? 395 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 0.933  4.018   30.464 1.00 48.07 ? 396 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? 8.800  5.087   13.931 1.00 44.28 ? 397 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 25.997 -1.072  5.447  1.00 47.62 ? 398 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? 36.715 1.645   15.515 1.00 35.36 ? 399 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 28.266 -10.693 13.135 1.00 51.16 ? 400 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 23.863 14.627  21.213 1.00 46.74 ? 401 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 29.822 12.503  21.843 1.00 53.18 ? 402 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? 29.573 -23.003 24.524 1.00 52.08 ? 403 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? 8.483  -10.209 42.826 1.00 48.92 ? 404 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? 10.341 -0.096  38.262 1.00 47.44 ? 405 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? 8.077  0.500   36.904 1.00 41.44 ? 406 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? 7.790  -27.575 34.606 1.00 53.51 ? 407 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? 19.421 -14.755 39.433 1.00 39.97 ? 408 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? -5.328 -17.160 31.827 1.00 36.72 ? 409 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? 8.521  -20.207 43.641 1.00 54.55 ? 410 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? 35.849 -9.990  27.980 1.00 50.60 ? 411 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? 35.869 -6.858  26.197 1.00 46.51 ? 412 HOH A O   1 
HETATM 1816 O  O   . HOH D 4 .   ? 37.909 -4.182  30.838 1.00 50.09 ? 413 HOH A O   1 
HETATM 1817 O  O   . HOH D 4 .   ? 2.132  -20.152 22.177 1.00 48.01 ? 414 HOH A O   1 
HETATM 1818 O  O   . HOH D 4 .   ? 5.890  -19.449 19.461 1.00 42.44 ? 415 HOH A O   1 
HETATM 1819 O  O   . HOH D 4 .   ? 28.024 7.146   8.120  1.00 47.02 ? 416 HOH A O   1 
HETATM 1820 O  O   . HOH D 4 .   ? 25.639 8.596   9.901  1.00 43.47 ? 417 HOH A O   1 
HETATM 1821 O  O   . HOH D 4 .   ? 35.732 3.286   16.263 1.00 43.83 ? 418 HOH A O   1 
HETATM 1822 O  O   . HOH D 4 .   ? 35.674 -1.214  20.760 1.00 47.59 ? 419 HOH A O   1 
HETATM 1823 O  O   . HOH D 4 .   ? 24.190 -28.040 34.758 1.00 53.51 ? 420 HOH A O   1 
HETATM 1824 O  O   . HOH D 4 .   ? -3.511 0.642   27.149 1.00 52.21 ? 421 HOH A O   1 
HETATM 1825 O  O   . HOH D 4 .   ? 1.830  -4.518  18.845 1.00 49.92 ? 422 HOH A O   1 
HETATM 1826 O  O   . HOH D 4 .   ? 4.039  -24.898 27.898 1.00 51.58 ? 424 HOH A O   1 
HETATM 1827 O  O   . HOH D 4 .   ? 10.987 -25.926 26.715 1.00 51.21 ? 425 HOH A O   1 
HETATM 1828 O  O   . HOH D 4 .   ? 17.269 -14.967 40.991 1.00 50.18 ? 426 HOH A O   1 
HETATM 1829 O  O   . HOH D 4 .   ? 18.457 -15.996 42.990 1.00 48.91 ? 427 HOH A O   1 
HETATM 1830 O  O   . HOH D 4 .   ? 3.340  -5.099  40.377 1.00 48.61 ? 428 HOH A O   1 
HETATM 1831 O  O   . HOH D 4 .   ? -4.202 -1.082  32.396 1.00 43.61 ? 429 HOH A O   1 
HETATM 1832 O  O   . HOH D 4 .   ? 3.318  2.724   39.553 1.00 53.33 ? 430 HOH A O   1 
HETATM 1833 O  O   . HOH D 4 .   ? -0.831 -5.643  41.648 1.00 49.40 ? 431 HOH A O   1 
HETATM 1834 O  O   . HOH D 4 .   ? 33.207 1.290   26.017 1.00 49.28 ? 432 HOH A O   1 
HETATM 1835 O  O   . HOH D 4 .   ? 33.963 -12.075 20.548 1.00 53.95 ? 433 HOH A O   1 
HETATM 1836 O  O   . HOH D 4 .   ? 17.858 -8.233  7.268  1.00 47.41 ? 434 HOH A O   1 
HETATM 1837 O  O   . HOH D 4 .   ? 14.205 0.997   7.457  1.00 55.00 ? 435 HOH A O   1 
HETATM 1838 O  O   . HOH D 4 .   ? 11.485 -6.952  9.321  1.00 50.08 ? 436 HOH A O   1 
HETATM 1839 O  O   . HOH D 4 .   ? 29.831 -4.178  14.897 1.00 47.88 ? 437 HOH A O   1 
HETATM 1840 O  O   . HOH D 4 .   ? 33.300 1.804   17.567 1.00 43.46 ? 438 HOH A O   1 
HETATM 1841 O  O   . HOH D 4 .   ? 30.886 10.932  17.506 1.00 47.89 ? 439 HOH A O   1 
HETATM 1842 O  O   . HOH D 4 .   ? 35.271 -6.816  18.030 1.00 47.78 ? 440 HOH A O   1 
HETATM 1843 O  O   . HOH D 4 .   ? 25.939 -18.473 16.466 1.00 48.86 ? 441 HOH A O   1 
HETATM 1844 O  O   . HOH E 4 .   ? 18.202 -3.428  39.564 1.00 42.32 ? 423 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   VAL 2   17  17  VAL VAL A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   TYR 5   20  20  TYR TYR A . n 
A 1 6   THR 6   21  21  THR THR A . n 
A 1 7   CYS 7   22  22  CYS CYS A . n 
A 1 8   GLY 8   23  23  GLY GLY A . n 
A 1 9   ALA 9   24  24  ALA ALA A . n 
A 1 10  ASN 10  25  25  ASN ASN A . n 
A 1 11  THR 11  26  26  THR THR A . n 
A 1 12  VAL 12  27  27  VAL VAL A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  TYR 14  29  29  TYR TYR A . n 
A 1 15  GLN 15  30  30  GLN GLN A . n 
A 1 16  VAL 16  31  31  VAL VAL A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  LEU 18  33  33  LEU LEU A . n 
A 1 19  ASN 19  34  34  ASN ASN A . n 
A 1 20  SER 20  37  37  SER SER A . n 
A 1 21  GLY 21  38  38  GLY GLY A . n 
A 1 22  TYR 22  39  39  TYR TYR A . n 
A 1 23  HIS 23  40  40  HIS HIS A . n 
A 1 24  PHE 24  41  41  PHE PHE A . n 
A 1 25  CYS 25  42  42  CYS CYS A . n 
A 1 26  GLY 26  43  43  GLY GLY A . n 
A 1 27  GLY 27  44  44  GLY GLY A . n 
A 1 28  SER 28  45  45  SER SER A . n 
A 1 29  LEU 29  46  46  LEU LEU A . n 
A 1 30  ILE 30  47  47  ILE ILE A . n 
A 1 31  ASN 31  48  48  ASN ASN A . n 
A 1 32  SER 32  49  49  SER SER A . n 
A 1 33  GLN 33  50  50  GLN GLN A . n 
A 1 34  TRP 34  51  51  TRP TRP A . n 
A 1 35  VAL 35  52  52  VAL VAL A . n 
A 1 36  VAL 36  53  53  VAL VAL A . n 
A 1 37  SER 37  54  54  SER SER A . n 
A 1 38  ALA 38  55  55  ALA ALA A . n 
A 1 39  ALA 39  56  56  ALA ALA A . n 
A 1 40  HIS 40  57  57  HIS HIS A . n 
A 1 41  CYS 41  58  58  CYS CYS A . n 
A 1 42  TYR 42  59  59  TYR TYR A . n 
A 1 43  LYS 43  60  60  LYS LYS A . n 
A 1 44  SER 44  61  61  SER SER A . n 
A 1 45  GLY 45  62  62  GLY GLY A . n 
A 1 46  ILE 46  63  63  ILE ILE A . n 
A 1 47  GLN 47  64  64  GLN GLN A . n 
A 1 48  VAL 48  65  65  VAL VAL A . n 
A 1 49  ARG 49  66  66  ARG ARG A . n 
A 1 50  LEU 50  67  67  LEU LEU A . n 
A 1 51  GLY 51  69  69  GLY GLY A . n 
A 1 52  GLU 52  70  70  GLU GLU A . n 
A 1 53  ASP 53  71  71  ASP ASP A . n 
A 1 54  ASN 54  72  72  ASN ASN A . n 
A 1 55  ILE 55  73  73  ILE ILE A . n 
A 1 56  ASN 56  74  74  ASN ASN A . n 
A 1 57  VAL 57  75  75  VAL VAL A . n 
A 1 58  VAL 58  76  76  VAL VAL A . n 
A 1 59  GLU 59  77  77  GLU GLU A . n 
A 1 60  GLY 60  78  78  GLY GLY A . n 
A 1 61  ASN 61  79  79  ASN ASN A . n 
A 1 62  GLU 62  80  80  GLU GLU A . n 
A 1 63  GLN 63  81  81  GLN GLN A . n 
A 1 64  PHE 64  82  82  PHE PHE A . n 
A 1 65  ILE 65  83  83  ILE ILE A . n 
A 1 66  SER 66  84  84  SER SER A . n 
A 1 67  ALA 67  85  85  ALA ALA A . n 
A 1 68  SER 68  86  86  SER SER A . n 
A 1 69  LYS 69  87  87  LYS LYS A . n 
A 1 70  SER 70  88  88  SER SER A . n 
A 1 71  ILE 71  89  89  ILE ILE A . n 
A 1 72  VAL 72  90  90  VAL VAL A . n 
A 1 73  HIS 73  91  91  HIS HIS A . n 
A 1 74  PRO 74  92  92  PRO PRO A . n 
A 1 75  SER 75  93  93  SER SER A . n 
A 1 76  TYR 76  94  94  TYR TYR A . n 
A 1 77  ASN 77  95  95  ASN ASN A . n 
A 1 78  SER 78  96  96  SER SER A . n 
A 1 79  ASN 79  97  97  ASN ASN A . n 
A 1 80  THR 80  98  98  THR THR A . n 
A 1 81  LEU 81  99  99  LEU LEU A . n 
A 1 82  ASN 82  100 100 ASN ASN A . n 
A 1 83  ASN 83  101 101 ASN ASN A . n 
A 1 84  ASP 84  102 102 ASP ASP A . n 
A 1 85  ILE 85  103 103 ILE ILE A . n 
A 1 86  MET 86  104 104 MET MET A . n 
A 1 87  LEU 87  105 105 LEU LEU A . n 
A 1 88  ILE 88  106 106 ILE ILE A . n 
A 1 89  LYS 89  107 107 LYS LYS A . n 
A 1 90  LEU 90  108 108 LEU LEU A . n 
A 1 91  LYS 91  109 109 LYS LYS A . n 
A 1 92  SER 92  110 110 SER SER A . n 
A 1 93  ALA 93  111 111 ALA ALA A . n 
A 1 94  ALA 94  112 112 ALA ALA A . n 
A 1 95  SER 95  113 113 SER SER A . n 
A 1 96  LEU 96  114 114 LEU LEU A . n 
A 1 97  ASN 97  115 115 ASN ASN A . n 
A 1 98  SER 98  116 116 SER SER A . n 
A 1 99  ARG 99  117 117 ARG ARG A . n 
A 1 100 VAL 100 118 118 VAL VAL A . n 
A 1 101 ALA 101 119 119 ALA ALA A . n 
A 1 102 SER 102 120 120 SER SER A . n 
A 1 103 ILE 103 121 121 ILE ILE A . n 
A 1 104 SER 104 122 122 SER SER A . n 
A 1 105 LEU 105 123 123 LEU LEU A . n 
A 1 106 PRO 106 124 124 PRO PRO A . n 
A 1 107 THR 107 125 125 THR THR A . n 
A 1 108 SER 108 127 127 SER SER A . n 
A 1 109 CYS 109 128 128 CYS CYS A . n 
A 1 110 ALA 110 129 129 ALA ALA A . n 
A 1 111 SER 111 130 130 SER SER A . n 
A 1 112 ALA 112 132 132 ALA ALA A . n 
A 1 113 GLY 113 133 133 GLY GLY A . n 
A 1 114 THR 114 134 134 THR THR A . n 
A 1 115 GLN 115 135 135 GLN GLN A . n 
A 1 116 CYS 116 136 136 CYS CYS A . n 
A 1 117 LEU 117 137 137 LEU LEU A . n 
A 1 118 ILE 118 138 138 ILE ILE A . n 
A 1 119 SER 119 139 139 SER SER A . n 
A 1 120 GLY 120 140 140 GLY GLY A . n 
A 1 121 TRP 121 141 141 TRP TRP A . n 
A 1 122 GLY 122 142 142 GLY GLY A . n 
A 1 123 ASN 123 143 143 ASN ASN A . n 
A 1 124 THR 124 144 144 THR THR A . n 
A 1 125 LYS 125 145 145 LYS LYS A . n 
A 1 126 SER 126 146 146 SER SER A . n 
A 1 127 SER 127 147 147 SER SER A . n 
A 1 128 GLY 128 148 148 GLY GLY A . n 
A 1 129 THR 129 149 149 THR THR A . n 
A 1 130 SER 130 150 150 SER SER A . n 
A 1 131 TYR 131 151 151 TYR TYR A . n 
A 1 132 PRO 132 152 152 PRO PRO A . n 
A 1 133 ASP 133 153 153 ASP ASP A . n 
A 1 134 VAL 134 154 154 VAL VAL A . n 
A 1 135 LEU 135 155 155 LEU LEU A . n 
A 1 136 LYS 136 156 156 LYS LYS A . n 
A 1 137 CYS 137 157 157 CYS CYS A . n 
A 1 138 LEU 138 158 158 LEU LEU A . n 
A 1 139 LYS 139 159 159 LYS LYS A . n 
A 1 140 ALA 140 160 160 ALA ALA A . n 
A 1 141 PRO 141 161 161 PRO PRO A . n 
A 1 142 ILE 142 162 162 ILE ILE A . n 
A 1 143 LEU 143 163 163 LEU LEU A . n 
A 1 144 SER 144 164 164 SER SER A . n 
A 1 145 ASP 145 165 165 ASP ASP A . n 
A 1 146 SER 146 166 166 SER SER A . n 
A 1 147 SER 147 167 167 SER SER A . n 
A 1 148 CYS 148 168 168 CYS CYS A . n 
A 1 149 LYS 149 169 169 LYS LYS A . n 
A 1 150 SER 150 170 170 SER SER A . n 
A 1 151 ALA 151 171 171 ALA ALA A . n 
A 1 152 TYR 152 172 172 TYR TYR A . n 
A 1 153 PRO 153 173 173 PRO PRO A . n 
A 1 154 GLY 154 174 174 GLY GLY A . n 
A 1 155 GLN 155 175 175 GLN GLN A . n 
A 1 156 ILE 156 176 176 ILE ILE A . n 
A 1 157 THR 157 177 177 THR THR A . n 
A 1 158 SER 158 178 178 SER SER A . n 
A 1 159 ASN 159 179 179 ASN ASN A . n 
A 1 160 MET 160 180 180 MET MET A . n 
A 1 161 PHE 161 181 181 PHE PHE A . n 
A 1 162 CYS 162 182 182 CYS CYS A . n 
A 1 163 ALA 163 183 183 ALA ALA A . n 
A 1 164 GLY 164 184 184 GLY GLY A A n 
A 1 165 TYR 165 184 184 TYR TYR A . n 
A 1 166 LEU 166 185 185 LEU LEU A . n 
A 1 167 GLU 167 186 186 GLU GLU A . n 
A 1 168 GLY 168 187 187 GLY GLY A . n 
A 1 169 GLY 169 188 188 GLY GLY A A n 
A 1 170 LYS 170 188 188 LYS LYS A . n 
A 1 171 ASP 171 189 189 ASP ASP A . n 
A 1 172 SER 172 190 190 SER SER A . n 
A 1 173 CYS 173 191 191 CYS CYS A . n 
A 1 174 GLN 174 192 192 GLN GLN A . n 
A 1 175 GLY 175 193 193 GLY GLY A . n 
A 1 176 ASP 176 194 194 ASP ASP A . n 
A 1 177 SER 177 195 195 SER SER A . n 
A 1 178 GLY 178 196 196 GLY GLY A . n 
A 1 179 GLY 179 197 197 GLY GLY A . n 
A 1 180 PRO 180 198 198 PRO PRO A . n 
A 1 181 VAL 181 199 199 VAL VAL A . n 
A 1 182 VAL 182 200 200 VAL VAL A . n 
A 1 183 CYS 183 201 201 CYS CYS A . n 
A 1 184 SER 184 202 202 SER SER A . n 
A 1 185 GLY 185 203 203 GLY GLY A . n 
A 1 186 LYS 186 204 204 LYS LYS A . n 
A 1 187 LEU 187 209 209 LEU LEU A . n 
A 1 188 GLN 188 210 210 GLN GLN A . n 
A 1 189 GLY 189 211 211 GLY GLY A . n 
A 1 190 ILE 190 212 212 ILE ILE A . n 
A 1 191 VAL 191 213 213 VAL VAL A . n 
A 1 192 SER 192 214 214 SER SER A . n 
A 1 193 TRP 193 215 215 TRP TRP A . n 
A 1 194 GLY 194 216 216 GLY GLY A . n 
A 1 195 SER 195 217 217 SER SER A . n 
A 1 196 GLY 196 219 219 GLY GLY A . n 
A 1 197 CYS 197 220 220 CYS CYS A . n 
A 1 198 ALA 198 221 221 ALA ALA A A n 
A 1 199 GLN 199 221 221 GLN GLN A . n 
A 1 200 LYS 200 222 222 LYS LYS A . n 
A 1 201 ASN 201 223 223 ASN ASN A . n 
A 1 202 LYS 202 224 224 LYS LYS A . n 
A 1 203 PRO 203 225 225 PRO PRO A . n 
A 1 204 GLY 204 226 226 GLY GLY A . n 
A 1 205 VAL 205 227 227 VAL VAL A . n 
A 1 206 TYR 206 228 228 TYR TYR A . n 
A 1 207 THR 207 229 229 THR THR A . n 
A 1 208 LYS 208 230 230 LYS LYS A . n 
A 1 209 VAL 209 231 231 VAL VAL A . n 
A 1 210 CYS 210 232 232 CYS CYS A . n 
A 1 211 ASN 211 233 233 ASN ASN A . n 
A 1 212 TYR 212 234 234 TYR TYR A . n 
A 1 213 VAL 213 235 235 VAL VAL A . n 
A 1 214 SER 214 236 236 SER SER A . n 
A 1 215 TRP 215 237 237 TRP TRP A . n 
A 1 216 ILE 216 238 238 ILE ILE A . n 
A 1 217 LYS 217 239 239 LYS LYS A . n 
A 1 218 GLN 218 240 240 GLN GLN A . n 
A 1 219 THR 219 241 241 THR THR A . n 
A 1 220 ILE 220 242 242 ILE ILE A . n 
A 1 221 ALA 221 243 243 ALA ALA A . n 
A 1 222 SER 222 244 244 SER SER A . n 
A 1 223 ASN 223 245 245 ASN ASN A . n 
B 2 1   SER 1   1   1   SER SER B . n 
B 2 2   CYS 2   2   2   CYS CYS B . n 
B 2 3   THR 3   3   3   THR THR B . n 
B 2 4   ARG 4   4   4   ARG ARG B . n 
B 2 5   SER 5   5   5   SER SER B . n 
B 2 6   ILE 6   6   6   ILE ILE B . n 
B 2 7   PRO 7   7   7   PRO PRO B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   GLN 9   9   9   GLN GLN B . n 
B 2 10  CYS 10  10  10  CYS CYS B . n 
B 2 11  TYR 11  11  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CA  1   271 271 CA  CA2 A . 
D 4 HOH 1   301 301 HOH WAT A . 
D 4 HOH 2   302 302 HOH WAT A . 
D 4 HOH 3   303 303 HOH WAT A . 
D 4 HOH 4   304 304 HOH WAT A . 
D 4 HOH 5   305 305 HOH WAT A . 
D 4 HOH 6   306 306 HOH WAT A . 
D 4 HOH 7   307 307 HOH WAT A . 
D 4 HOH 8   308 308 HOH WAT A . 
D 4 HOH 9   309 309 HOH WAT A . 
D 4 HOH 10  310 310 HOH WAT A . 
D 4 HOH 11  311 311 HOH WAT A . 
D 4 HOH 12  312 312 HOH WAT A . 
D 4 HOH 13  313 313 HOH WAT A . 
D 4 HOH 14  314 314 HOH WAT A . 
D 4 HOH 15  315 315 HOH WAT A . 
D 4 HOH 16  316 316 HOH WAT A . 
D 4 HOH 17  317 317 HOH WAT A . 
D 4 HOH 18  318 318 HOH WAT A . 
D 4 HOH 19  319 319 HOH WAT A . 
D 4 HOH 20  320 320 HOH WAT A . 
D 4 HOH 21  321 321 HOH WAT A . 
D 4 HOH 22  322 322 HOH WAT A . 
D 4 HOH 23  323 323 HOH WAT A . 
D 4 HOH 24  324 324 HOH WAT A . 
D 4 HOH 25  325 325 HOH WAT A . 
D 4 HOH 26  326 326 HOH WAT A . 
D 4 HOH 27  327 327 HOH WAT A . 
D 4 HOH 28  328 328 HOH WAT A . 
D 4 HOH 29  329 329 HOH WAT A . 
D 4 HOH 30  330 330 HOH WAT A . 
D 4 HOH 31  331 331 HOH WAT A . 
D 4 HOH 32  332 332 HOH WAT A . 
D 4 HOH 33  333 333 HOH WAT A . 
D 4 HOH 34  334 334 HOH WAT A . 
D 4 HOH 35  335 335 HOH WAT A . 
D 4 HOH 36  336 336 HOH WAT A . 
D 4 HOH 37  337 337 HOH WAT A . 
D 4 HOH 38  338 338 HOH WAT A . 
D 4 HOH 39  339 339 HOH WAT A . 
D 4 HOH 40  340 340 HOH WAT A . 
D 4 HOH 41  341 341 HOH WAT A . 
D 4 HOH 42  342 342 HOH WAT A . 
D 4 HOH 43  343 343 HOH WAT A . 
D 4 HOH 44  344 344 HOH WAT A . 
D 4 HOH 45  345 345 HOH WAT A . 
D 4 HOH 46  346 346 HOH WAT A . 
D 4 HOH 47  347 347 HOH WAT A . 
D 4 HOH 48  348 348 HOH WAT A . 
D 4 HOH 49  349 349 HOH WAT A . 
D 4 HOH 50  350 350 HOH WAT A . 
D 4 HOH 51  351 351 HOH WAT A . 
D 4 HOH 52  352 352 HOH WAT A . 
D 4 HOH 53  353 353 HOH WAT A . 
D 4 HOH 54  354 354 HOH WAT A . 
D 4 HOH 55  355 355 HOH WAT A . 
D 4 HOH 56  356 356 HOH WAT A . 
D 4 HOH 57  357 357 HOH WAT A . 
D 4 HOH 58  358 358 HOH WAT A . 
D 4 HOH 59  359 359 HOH WAT A . 
D 4 HOH 60  360 360 HOH WAT A . 
D 4 HOH 61  361 361 HOH WAT A . 
D 4 HOH 62  362 362 HOH WAT A . 
D 4 HOH 63  363 363 HOH WAT A . 
D 4 HOH 64  364 364 HOH WAT A . 
D 4 HOH 65  365 365 HOH WAT A . 
D 4 HOH 66  366 366 HOH WAT A . 
D 4 HOH 67  367 367 HOH WAT A . 
D 4 HOH 68  368 368 HOH WAT A . 
D 4 HOH 69  369 369 HOH WAT A . 
D 4 HOH 70  370 370 HOH WAT A . 
D 4 HOH 71  371 371 HOH WAT A . 
D 4 HOH 72  372 372 HOH WAT A . 
D 4 HOH 73  373 373 HOH WAT A . 
D 4 HOH 74  374 374 HOH WAT A . 
D 4 HOH 75  375 375 HOH WAT A . 
D 4 HOH 76  376 376 HOH WAT A . 
D 4 HOH 77  377 377 HOH WAT A . 
D 4 HOH 78  378 378 HOH WAT A . 
D 4 HOH 79  379 379 HOH WAT A . 
D 4 HOH 80  380 380 HOH WAT A . 
D 4 HOH 81  381 381 HOH WAT A . 
D 4 HOH 82  382 382 HOH WAT A . 
D 4 HOH 83  383 383 HOH WAT A . 
D 4 HOH 84  384 384 HOH WAT A . 
D 4 HOH 85  385 385 HOH WAT A . 
D 4 HOH 86  386 386 HOH WAT A . 
D 4 HOH 87  387 387 HOH WAT A . 
D 4 HOH 88  388 388 HOH WAT A . 
D 4 HOH 89  389 389 HOH WAT A . 
D 4 HOH 90  390 390 HOH WAT A . 
D 4 HOH 91  391 391 HOH WAT A . 
D 4 HOH 92  392 392 HOH WAT A . 
D 4 HOH 93  393 393 HOH WAT A . 
D 4 HOH 94  394 394 HOH WAT A . 
D 4 HOH 95  395 395 HOH WAT A . 
D 4 HOH 96  396 396 HOH WAT A . 
D 4 HOH 97  397 397 HOH WAT A . 
D 4 HOH 98  398 398 HOH WAT A . 
D 4 HOH 99  399 399 HOH WAT A . 
D 4 HOH 100 400 400 HOH WAT A . 
D 4 HOH 101 401 401 HOH WAT A . 
D 4 HOH 102 402 402 HOH WAT A . 
D 4 HOH 103 403 403 HOH WAT A . 
D 4 HOH 104 404 404 HOH WAT A . 
D 4 HOH 105 405 405 HOH WAT A . 
D 4 HOH 106 406 406 HOH WAT A . 
D 4 HOH 107 407 407 HOH WAT A . 
D 4 HOH 108 408 408 HOH WAT A . 
D 4 HOH 109 409 409 HOH WAT A . 
D 4 HOH 110 410 410 HOH WAT A . 
D 4 HOH 111 411 411 HOH WAT A . 
D 4 HOH 112 412 412 HOH WAT A . 
D 4 HOH 113 413 413 HOH WAT A . 
D 4 HOH 114 414 414 HOH WAT A . 
D 4 HOH 115 415 415 HOH WAT A . 
D 4 HOH 116 416 416 HOH WAT A . 
D 4 HOH 117 417 417 HOH WAT A . 
D 4 HOH 118 418 418 HOH WAT A . 
D 4 HOH 119 419 419 HOH WAT A . 
D 4 HOH 120 420 420 HOH WAT A . 
D 4 HOH 121 421 421 HOH WAT A . 
D 4 HOH 122 422 422 HOH WAT A . 
D 4 HOH 123 424 424 HOH WAT A . 
D 4 HOH 124 425 425 HOH WAT A . 
D 4 HOH 125 426 426 HOH WAT A . 
D 4 HOH 126 427 427 HOH WAT A . 
D 4 HOH 127 428 428 HOH WAT A . 
D 4 HOH 128 429 429 HOH WAT A . 
D 4 HOH 129 430 430 HOH WAT A . 
D 4 HOH 130 431 431 HOH WAT A . 
D 4 HOH 131 432 432 HOH WAT A . 
D 4 HOH 132 433 433 HOH WAT A . 
D 4 HOH 133 434 434 HOH WAT A . 
D 4 HOH 134 435 435 HOH WAT A . 
D 4 HOH 135 436 436 HOH WAT A . 
D 4 HOH 136 437 437 HOH WAT A . 
D 4 HOH 137 438 438 HOH WAT A . 
D 4 HOH 138 439 439 HOH WAT A . 
D 4 HOH 139 440 440 HOH WAT A . 
D 4 HOH 140 441 441 HOH WAT A . 
E 4 HOH 1   423 423 HOH WAT B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1240 ? 
1 MORE         -17  ? 
1 'SSA (A^2)'  9290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? A VAL 57 ? A VAL 75  ? 1_555 82.9  ? 
2  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 163.9 ? 
3  O   ? A VAL 57 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 89.0  ? 
4  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 325 ? 1_555 86.8  ? 
5  O   ? A VAL 57 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 325 ? 1_555 106.2 ? 
6  OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 325 ? 1_555 82.1  ? 
7  O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 383 ? 1_555 103.2 ? 
8  O   ? A VAL 57 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 383 ? 1_555 83.0  ? 
9  OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 383 ? 1_555 89.5  ? 
10 O   ? D HOH .  ? A HOH 325 ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 O   ? D HOH .  ? A HOH 383 ? 1_555 167.3 ? 
11 O   ? A ASN 54 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE1 ? A GLU 52 ? A GLU 70  ? 1_555 86.0  ? 
12 O   ? A VAL 57 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE1 ? A GLU 52 ? A GLU 70  ? 1_555 155.3 ? 
13 OE2 ? A GLU 62 ? A GLU 80  ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE1 ? A GLU 52 ? A GLU 70  ? 1_555 106.6 ? 
14 O   ? D HOH .  ? A HOH 325 ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE1 ? A GLU 52 ? A GLU 70  ? 1_555 95.1  ? 
15 O   ? D HOH .  ? A HOH 383 ? 1_555 CA ? C CA . ? A CA 271 ? 1_555 OE1 ? A GLU 52 ? A GLU 70  ? 1_555 78.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-05-18 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS  refinement     1.1       ? 1 
CCP4 'data scaling' '(SCALA)' ? 2 
CNS  phasing        .         ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    399 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    418 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.05 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 71  ? ? -128.96 -70.23  
2 1 ASN A 79  ? ? 83.63   -9.49   
3 1 ASN A 115 ? ? -157.21 -158.58 
4 1 ARG B 4   ? ? -100.88 43.33   
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     TYR 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      11 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    TYR 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     11 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
#