data_1OY2
# 
_entry.id   1OY2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OY2         
RCSB  RCSB018789   
WWPDB D_1000018789 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1N3H 'Free protein structure (residues 111-317)'                   unspecified 
PDB 1SHC 'Protein (residues 127-317) complexed to TrkA phosphopeptide' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OY2 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Farooq, A.'         1 
'Zeng, L.'           2 
'Yan, K.S.'          3 
'Ravichandran, K.S.' 4 
'Zhou, M.-M.'        5 
# 
_citation.id                        primary 
_citation.title                     'Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                905 
_citation.page_last                 913 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12906822 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00134-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Farooq, A.'         1 
primary 'Zeng, L.'           2 
primary 'Yan, K.S.'          3 
primary 'Ravichandran, K.S.' 4 
primary 'Zhou, M.-M.'        5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SHC transforming protein' 
_entity.formula_weight             22657.021 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PTB Domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE
AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT
AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE
AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT
AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   LYS n 
1 4   LEU n 
1 5   SER n 
1 6   GLY n 
1 7   GLY n 
1 8   GLY n 
1 9   GLY n 
1 10  ARG n 
1 11  ARG n 
1 12  THR n 
1 13  ARG n 
1 14  VAL n 
1 15  GLU n 
1 16  GLY n 
1 17  GLY n 
1 18  GLN n 
1 19  LEU n 
1 20  GLY n 
1 21  GLY n 
1 22  GLU n 
1 23  GLU n 
1 24  TRP n 
1 25  THR n 
1 26  ARG n 
1 27  HIS n 
1 28  GLY n 
1 29  SER n 
1 30  PHE n 
1 31  VAL n 
1 32  ASN n 
1 33  LYS n 
1 34  PRO n 
1 35  THR n 
1 36  ARG n 
1 37  GLY n 
1 38  TRP n 
1 39  LEU n 
1 40  HIS n 
1 41  PRO n 
1 42  ASN n 
1 43  ASP n 
1 44  LYS n 
1 45  VAL n 
1 46  MET n 
1 47  GLY n 
1 48  PRO n 
1 49  GLY n 
1 50  VAL n 
1 51  SER n 
1 52  TYR n 
1 53  LEU n 
1 54  VAL n 
1 55  ARG n 
1 56  TYR n 
1 57  MET n 
1 58  GLY n 
1 59  CYS n 
1 60  VAL n 
1 61  GLU n 
1 62  VAL n 
1 63  LEU n 
1 64  GLN n 
1 65  SER n 
1 66  MET n 
1 67  ARG n 
1 68  ALA n 
1 69  LEU n 
1 70  ASP n 
1 71  PHE n 
1 72  ASN n 
1 73  THR n 
1 74  ARG n 
1 75  THR n 
1 76  GLN n 
1 77  VAL n 
1 78  THR n 
1 79  ARG n 
1 80  GLU n 
1 81  ALA n 
1 82  ILE n 
1 83  SER n 
1 84  LEU n 
1 85  VAL n 
1 86  CYS n 
1 87  GLU n 
1 88  ALA n 
1 89  VAL n 
1 90  PRO n 
1 91  GLY n 
1 92  ALA n 
1 93  LYS n 
1 94  GLY n 
1 95  ALA n 
1 96  THR n 
1 97  ARG n 
1 98  ARG n 
1 99  ARG n 
1 100 LYS n 
1 101 PRO n 
1 102 CYS n 
1 103 SER n 
1 104 ARG n 
1 105 PRO n 
1 106 LEU n 
1 107 SER n 
1 108 SER n 
1 109 ILE n 
1 110 LEU n 
1 111 GLY n 
1 112 ARG n 
1 113 SER n 
1 114 ASN n 
1 115 LEU n 
1 116 LYS n 
1 117 PHE n 
1 118 ALA n 
1 119 GLY n 
1 120 MET n 
1 121 PRO n 
1 122 ILE n 
1 123 THR n 
1 124 LEU n 
1 125 THR n 
1 126 VAL n 
1 127 SER n 
1 128 THR n 
1 129 SER n 
1 130 SER n 
1 131 LEU n 
1 132 ASN n 
1 133 LEU n 
1 134 MET n 
1 135 ALA n 
1 136 ALA n 
1 137 ASP n 
1 138 CYS n 
1 139 LYS n 
1 140 GLN n 
1 141 ILE n 
1 142 ILE n 
1 143 ALA n 
1 144 ASN n 
1 145 HIS n 
1 146 HIS n 
1 147 MET n 
1 148 GLN n 
1 149 SER n 
1 150 ILE n 
1 151 SER n 
1 152 PHE n 
1 153 ALA n 
1 154 SER n 
1 155 GLY n 
1 156 GLY n 
1 157 ASP n 
1 158 PRO n 
1 159 ASP n 
1 160 THR n 
1 161 ALA n 
1 162 GLU n 
1 163 TYR n 
1 164 VAL n 
1 165 ALA n 
1 166 TYR n 
1 167 VAL n 
1 168 ALA n 
1 169 LYS n 
1 170 ASP n 
1 171 PRO n 
1 172 VAL n 
1 173 ASN n 
1 174 GLN n 
1 175 ARG n 
1 176 ALA n 
1 177 CYS n 
1 178 HIS n 
1 179 ILE n 
1 180 LEU n 
1 181 GLU n 
1 182 CYS n 
1 183 PRO n 
1 184 GLU n 
1 185 GLY n 
1 186 LEU n 
1 187 ALA n 
1 188 GLN n 
1 189 ASP n 
1 190 VAL n 
1 191 ILE n 
1 192 SER n 
1 193 THR n 
1 194 ILE n 
1 195 GLY n 
1 196 GLN n 
1 197 ALA n 
1 198 PHE n 
1 199 GLU n 
1 200 LEU n 
1 201 ARG n 
1 202 PHE n 
1 203 LYS n 
1 204 GLN n 
1 205 TYR n 
1 206 LEU n 
1 207 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SHC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SHC1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTRE
AISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDT
AEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLR
;
_struct_ref.pdbx_align_begin           111 
_struct_ref.pdbx_db_accession          P29353 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1OY2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 207 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29353 
_struct_ref_seq.db_align_beg                  111 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  317 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       207 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
3 1 1 HNHA                   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      200mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '0.5mM Shc PTB Domain, 50mM Sodium phosphate, 20mM DTT-d10' 
_pdbx_nmr_sample_details.solvent_system   '90% D2O, 10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 500 
2 ? Bruker DRX 600 
# 
_pdbx_nmr_refine.entry_id           1OY2 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1OY2 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1OY2 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1OY2 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe ? processing           ? 1 
XWINNMR ? collection           ? 2 
X-PLOR  ? 'structure solution' ? 3 
ARIA    ? 'structure solution' ? 4 
NMRVIEW ? 'data analysis'      ? 5 
ARIA    ? refinement           ? 6 
# 
_exptl.entry_id          1OY2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1OY2 
_struct.title                     'Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc' 
_struct.pdbx_descriptor           'SHC transforming protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OY2 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Free Protein, Structure Disorder, Beta Sandwich, Signaling protein' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 42  ? GLY A 47  ? ASN A 42  GLY A 47  1 ? 6  
HELX_P HELX_P2 2 THR A 73  ? VAL A 89  ? THR A 73  VAL A 89  1 ? 17 
HELX_P HELX_P3 3 PRO A 90  ? LYS A 93  ? PRO A 90  LYS A 93  5 ? 4  
HELX_P HELX_P4 4 LEU A 186 ? ILE A 191 ? LEU A 186 ILE A 191 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 104 A . ? ARG 104 A PRO 105 A ? PRO 105 A 1 0.80 
2 ASP 157 A . ? ASP 157 A PRO 158 A ? PRO 158 A 1 1.76 
3 ASP 170 A . ? ASP 170 A PRO 171 A ? PRO 171 A 1 0.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 130 ? MET A 134 ? SER A 130 MET A 134 
A 2 MET A 120 ? SER A 127 ? MET A 120 SER A 127 
A 3 VAL A 50  ? GLU A 61  ? VAL A 50  GLU A 61  
A 4 ARG A 112 ? ASN A 114 ? ARG A 112 ASN A 114 
B 1 SER A 130 ? MET A 134 ? SER A 130 MET A 134 
B 2 MET A 120 ? SER A 127 ? MET A 120 SER A 127 
B 3 VAL A 50  ? GLU A 61  ? VAL A 50  GLU A 61  
B 4 ALA A 176 ? GLU A 181 ? ALA A 176 GLU A 181 
B 5 VAL A 164 ? ALA A 165 ? VAL A 164 ALA A 165 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 134 ? O MET A 134 N THR A 123 ? N THR A 123 
A 2 3 O VAL A 126 ? O VAL A 126 N VAL A 50  ? N VAL A 50  
A 3 4 N GLU A 61  ? N GLU A 61  O ARG A 112 ? O ARG A 112 
B 1 2 O MET A 134 ? O MET A 134 N THR A 123 ? N THR A 123 
B 2 3 O VAL A 126 ? O VAL A 126 N VAL A 50  ? N VAL A 50  
B 3 4 N VAL A 60  ? N VAL A 60  O CYS A 177 ? O CYS A 177 
B 4 5 O LEU A 180 ? O LEU A 180 N VAL A 164 ? N VAL A 164 
# 
_database_PDB_matrix.entry_id          1OY2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OY2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . GLY A 1 17  ? -27.930 4.625   -22.502 1.00 0.00 ? 17  GLY A N    1 
ATOM 2    C CA   . GLY A 1 17  ? -27.009 3.455   -22.523 1.00 0.00 ? 17  GLY A CA   1 
ATOM 3    C C    . GLY A 1 17  ? -27.014 2.691   -21.214 1.00 0.00 ? 17  GLY A C    1 
ATOM 4    O O    . GLY A 1 17  ? -27.409 3.225   -20.178 1.00 0.00 ? 17  GLY A O    1 
ATOM 5    H H    . GLY A 1 17  ? -27.601 5.351   -23.171 1.00 0.00 ? 17  GLY A H    1 
ATOM 6    H HA2  . GLY A 1 17  ? -27.311 2.789   -23.318 1.00 0.00 ? 17  GLY A HA2  1 
ATOM 7    H HA3  . GLY A 1 17  ? -26.006 3.803   -22.720 1.00 0.00 ? 17  GLY A HA3  1 
ATOM 8    N N    . GLN A 1 18  ? -26.576 1.437   -21.261 1.00 0.00 ? 18  GLN A N    1 
ATOM 9    C CA   . GLN A 1 18  ? -26.535 0.598   -20.070 1.00 0.00 ? 18  GLN A CA   1 
ATOM 10   C C    . GLN A 1 18  ? -27.938 0.367   -19.519 1.00 0.00 ? 18  GLN A C    1 
ATOM 11   O O    . GLN A 1 18  ? -28.856 1.142   -19.789 1.00 0.00 ? 18  GLN A O    1 
ATOM 12   C CB   . GLN A 1 18  ? -25.655 1.242   -18.996 1.00 0.00 ? 18  GLN A CB   1 
ATOM 13   C CG   . GLN A 1 18  ? -24.199 1.389   -19.410 1.00 0.00 ? 18  GLN A CG   1 
ATOM 14   C CD   . GLN A 1 18  ? -23.547 2.622   -18.817 1.00 0.00 ? 18  GLN A CD   1 
ATOM 15   O OE1  . GLN A 1 18  ? -23.964 3.749   -19.085 1.00 0.00 ? 18  GLN A OE1  1 
ATOM 16   N NE2  . GLN A 1 18  ? -22.516 2.414   -18.007 1.00 0.00 ? 18  GLN A NE2  1 
ATOM 17   H H    . GLN A 1 18  ? -26.276 1.067   -22.117 1.00 0.00 ? 18  GLN A H    1 
ATOM 18   H HA   . GLN A 1 18  ? -26.110 -0.355  -20.350 1.00 0.00 ? 18  GLN A HA   1 
ATOM 19   H HB2  . GLN A 1 18  ? -26.043 2.223   -18.770 1.00 0.00 ? 18  GLN A HB2  1 
ATOM 20   H HB3  . GLN A 1 18  ? -25.693 0.635   -18.104 1.00 0.00 ? 18  GLN A HB3  1 
ATOM 21   H HG2  . GLN A 1 18  ? -23.654 0.518   -19.080 1.00 0.00 ? 18  GLN A HG2  1 
ATOM 22   H HG3  . GLN A 1 18  ? -24.150 1.457   -20.487 1.00 0.00 ? 18  GLN A HG3  1 
ATOM 23   H HE21 . GLN A 1 18  ? -22.238 1.489   -17.839 1.00 0.00 ? 18  GLN A HE21 1 
ATOM 24   H HE22 . GLN A 1 18  ? -22.074 3.193   -17.610 1.00 0.00 ? 18  GLN A HE22 1 
ATOM 25   N N    . LEU A 1 19  ? -28.097 -0.702  -18.747 1.00 0.00 ? 19  LEU A N    1 
ATOM 26   C CA   . LEU A 1 19  ? -29.390 -1.033  -18.159 1.00 0.00 ? 19  LEU A CA   1 
ATOM 27   C C    . LEU A 1 19  ? -29.256 -1.299  -16.663 1.00 0.00 ? 19  LEU A C    1 
ATOM 28   O O    . LEU A 1 19  ? -28.600 -2.255  -16.249 1.00 0.00 ? 19  LEU A O    1 
ATOM 29   C CB   . LEU A 1 19  ? -29.992 -2.254  -18.857 1.00 0.00 ? 19  LEU A CB   1 
ATOM 30   C CG   . LEU A 1 19  ? -31.207 -1.959  -19.740 1.00 0.00 ? 19  LEU A CG   1 
ATOM 31   C CD1  . LEU A 1 19  ? -32.393 -1.533  -18.889 1.00 0.00 ? 19  LEU A CD1  1 
ATOM 32   C CD2  . LEU A 1 19  ? -30.872 -0.889  -20.767 1.00 0.00 ? 19  LEU A CD2  1 
ATOM 33   H H    . LEU A 1 19  ? -27.328 -1.283  -18.568 1.00 0.00 ? 19  LEU A H    1 
ATOM 34   H HA   . LEU A 1 19  ? -30.044 -0.186  -18.303 1.00 0.00 ? 19  LEU A HA   1 
ATOM 35   H HB2  . LEU A 1 19  ? -29.228 -2.705  -19.472 1.00 0.00 ? 19  LEU A HB2  1 
ATOM 36   H HB3  . LEU A 1 19  ? -30.288 -2.966  -18.101 1.00 0.00 ? 19  LEU A HB3  1 
ATOM 37   H HG   . LEU A 1 19  ? -31.483 -2.858  -20.272 1.00 0.00 ? 19  LEU A HG   1 
ATOM 38   H HD11 . LEU A 1 19  ? -32.141 -1.635  -17.844 1.00 0.00 ? 19  LEU A HD11 1 
ATOM 39   H HD12 . LEU A 1 19  ? -33.243 -2.160  -19.117 1.00 0.00 ? 19  LEU A HD12 1 
ATOM 40   H HD13 . LEU A 1 19  ? -32.638 -0.503  -19.102 1.00 0.00 ? 19  LEU A HD13 1 
ATOM 41   H HD21 . LEU A 1 19  ? -29.818 -0.932  -21.002 1.00 0.00 ? 19  LEU A HD21 1 
ATOM 42   H HD22 . LEU A 1 19  ? -31.112 0.084   -20.365 1.00 0.00 ? 19  LEU A HD22 1 
ATOM 43   H HD23 . LEU A 1 19  ? -31.447 -1.060  -21.665 1.00 0.00 ? 19  LEU A HD23 1 
ATOM 44   N N    . GLY A 1 20  ? -29.883 -0.448  -15.859 1.00 0.00 ? 20  GLY A N    1 
ATOM 45   C CA   . GLY A 1 20  ? -29.820 -0.606  -14.418 1.00 0.00 ? 20  GLY A CA   1 
ATOM 46   C C    . GLY A 1 20  ? -28.649 0.137   -13.807 1.00 0.00 ? 20  GLY A C    1 
ATOM 47   O O    . GLY A 1 20  ? -27.706 0.506   -14.507 1.00 0.00 ? 20  GLY A O    1 
ATOM 48   H H    . GLY A 1 20  ? -30.390 0.296   -16.246 1.00 0.00 ? 20  GLY A H    1 
ATOM 49   H HA2  . GLY A 1 20  ? -30.736 -0.232  -13.985 1.00 0.00 ? 20  GLY A HA2  1 
ATOM 50   H HA3  . GLY A 1 20  ? -29.727 -1.657  -14.186 1.00 0.00 ? 20  GLY A HA3  1 
ATOM 51   N N    . GLY A 1 21  ? -28.709 0.359   -12.498 1.00 0.00 ? 21  GLY A N    1 
ATOM 52   C CA   . GLY A 1 21  ? -27.638 1.062   -11.817 1.00 0.00 ? 21  GLY A CA   1 
ATOM 53   C C    . GLY A 1 21  ? -27.380 0.521   -10.425 1.00 0.00 ? 21  GLY A C    1 
ATOM 54   O O    . GLY A 1 21  ? -28.010 -0.449  -10.003 1.00 0.00 ? 21  GLY A O    1 
ATOM 55   H H    . GLY A 1 21  ? -29.485 0.043   -11.991 1.00 0.00 ? 21  GLY A H    1 
ATOM 56   H HA2  . GLY A 1 21  ? -26.734 0.970   -12.400 1.00 0.00 ? 21  GLY A HA2  1 
ATOM 57   H HA3  . GLY A 1 21  ? -27.900 2.108   -11.742 1.00 0.00 ? 21  GLY A HA3  1 
ATOM 58   N N    . GLU A 1 22  ? -26.452 1.149   -9.711  1.00 0.00 ? 22  GLU A N    1 
ATOM 59   C CA   . GLU A 1 22  ? -26.112 0.725   -8.358  1.00 0.00 ? 22  GLU A CA   1 
ATOM 60   C C    . GLU A 1 22  ? -25.276 1.785   -7.649  1.00 0.00 ? 22  GLU A C    1 
ATOM 61   O O    . GLU A 1 22  ? -24.365 1.462   -6.886  1.00 0.00 ? 22  GLU A O    1 
ATOM 62   C CB   . GLU A 1 22  ? -25.352 -0.602  -8.392  1.00 0.00 ? 22  GLU A CB   1 
ATOM 63   C CG   . GLU A 1 22  ? -25.490 -1.415  -7.115  1.00 0.00 ? 22  GLU A CG   1 
ATOM 64   C CD   . GLU A 1 22  ? -24.222 -1.417  -6.285  1.00 0.00 ? 22  GLU A CD   1 
ATOM 65   O OE1  . GLU A 1 22  ? -23.128 -1.558  -6.872  1.00 0.00 ? 22  GLU A OE1  1 
ATOM 66   O OE2  . GLU A 1 22  ? -24.322 -1.278  -5.047  1.00 0.00 ? 22  GLU A OE2  1 
ATOM 67   H H    . GLU A 1 22  ? -25.984 1.915   -10.103 1.00 0.00 ? 22  GLU A H    1 
ATOM 68   H HA   . GLU A 1 22  ? -27.035 0.588   -7.813  1.00 0.00 ? 22  GLU A HA   1 
ATOM 69   H HB2  . GLU A 1 22  ? -25.723 -1.196  -9.214  1.00 0.00 ? 22  GLU A HB2  1 
ATOM 70   H HB3  . GLU A 1 22  ? -24.303 -0.398  -8.552  1.00 0.00 ? 22  GLU A HB3  1 
ATOM 71   H HG2  . GLU A 1 22  ? -26.290 -0.996  -6.522  1.00 0.00 ? 22  GLU A HG2  1 
ATOM 72   H HG3  . GLU A 1 22  ? -25.733 -2.434  -7.377  1.00 0.00 ? 22  GLU A HG3  1 
ATOM 73   N N    . GLU A 1 23  ? -25.591 3.050   -7.904  1.00 0.00 ? 23  GLU A N    1 
ATOM 74   C CA   . GLU A 1 23  ? -24.867 4.157   -7.291  1.00 0.00 ? 23  GLU A CA   1 
ATOM 75   C C    . GLU A 1 23  ? -25.707 4.825   -6.207  1.00 0.00 ? 23  GLU A C    1 
ATOM 76   O O    . GLU A 1 23  ? -25.548 6.014   -5.932  1.00 0.00 ? 23  GLU A O    1 
ATOM 77   C CB   . GLU A 1 23  ? -24.474 5.187   -8.351  1.00 0.00 ? 23  GLU A CB   1 
ATOM 78   C CG   . GLU A 1 23  ? -23.471 4.663   -9.367  1.00 0.00 ? 23  GLU A CG   1 
ATOM 79   C CD   . GLU A 1 23  ? -22.502 5.732   -9.832  1.00 0.00 ? 23  GLU A CD   1 
ATOM 80   O OE1  . GLU A 1 23  ? -21.758 6.269   -8.984  1.00 0.00 ? 23  GLU A OE1  1 
ATOM 81   O OE2  . GLU A 1 23  ? -22.488 6.034   -11.043 1.00 0.00 ? 23  GLU A OE2  1 
ATOM 82   H H    . GLU A 1 23  ? -26.328 3.244   -8.521  1.00 0.00 ? 23  GLU A H    1 
ATOM 83   H HA   . GLU A 1 23  ? -23.971 3.756   -6.839  1.00 0.00 ? 23  GLU A HA   1 
ATOM 84   H HB2  . GLU A 1 23  ? -25.362 5.497   -8.882  1.00 0.00 ? 23  GLU A HB2  1 
ATOM 85   H HB3  . GLU A 1 23  ? -24.041 6.045   -7.860  1.00 0.00 ? 23  GLU A HB3  1 
ATOM 86   H HG2  . GLU A 1 23  ? -22.908 3.859   -8.916  1.00 0.00 ? 23  GLU A HG2  1 
ATOM 87   H HG3  . GLU A 1 23  ? -24.009 4.289   -10.225 1.00 0.00 ? 23  GLU A HG3  1 
ATOM 88   N N    . TRP A 1 24  ? -26.601 4.054   -5.596  1.00 0.00 ? 24  TRP A N    1 
ATOM 89   C CA   . TRP A 1 24  ? -27.464 4.574   -4.542  1.00 0.00 ? 24  TRP A CA   1 
ATOM 90   C C    . TRP A 1 24  ? -26.972 4.131   -3.168  1.00 0.00 ? 24  TRP A C    1 
ATOM 91   O O    . TRP A 1 24  ? -26.165 3.208   -3.055  1.00 0.00 ? 24  TRP A O    1 
ATOM 92   C CB   . TRP A 1 24  ? -28.905 4.109   -4.758  1.00 0.00 ? 24  TRP A CB   1 
ATOM 93   C CG   . TRP A 1 24  ? -29.808 5.191   -5.263  1.00 0.00 ? 24  TRP A CG   1 
ATOM 94   C CD1  . TRP A 1 24  ? -29.929 6.456   -4.765  1.00 0.00 ? 24  TRP A CD1  1 
ATOM 95   C CD2  . TRP A 1 24  ? -30.715 5.106   -6.368  1.00 0.00 ? 24  TRP A CD2  1 
ATOM 96   N NE1  . TRP A 1 24  ? -30.856 7.163   -5.491  1.00 0.00 ? 24  TRP A NE1  1 
ATOM 97   C CE2  . TRP A 1 24  ? -31.353 6.356   -6.481  1.00 0.00 ? 24  TRP A CE2  1 
ATOM 98   C CE3  . TRP A 1 24  ? -31.051 4.095   -7.274  1.00 0.00 ? 24  TRP A CE3  1 
ATOM 99   C CZ2  . TRP A 1 24  ? -32.306 6.620   -7.462  1.00 0.00 ? 24  TRP A CZ2  1 
ATOM 100  C CZ3  . TRP A 1 24  ? -31.997 4.358   -8.246  1.00 0.00 ? 24  TRP A CZ3  1 
ATOM 101  C CH2  . TRP A 1 24  ? -32.615 5.612   -8.334  1.00 0.00 ? 24  TRP A CH2  1 
ATOM 102  H H    . TRP A 1 24  ? -26.680 3.114   -5.860  1.00 0.00 ? 24  TRP A H    1 
ATOM 103  H HA   . TRP A 1 24  ? -27.431 5.652   -4.591  1.00 0.00 ? 24  TRP A HA   1 
ATOM 104  H HB2  . TRP A 1 24  ? -28.913 3.304   -5.478  1.00 0.00 ? 24  TRP A HB2  1 
ATOM 105  H HB3  . TRP A 1 24  ? -29.305 3.751   -3.820  1.00 0.00 ? 24  TRP A HB3  1 
ATOM 106  H HD1  . TRP A 1 24  ? -29.371 6.834   -3.920  1.00 0.00 ? 24  TRP A HD1  1 
ATOM 107  H HE1  . TRP A 1 24  ? -31.120 8.093   -5.327  1.00 0.00 ? 24  TRP A HE1  1 
ATOM 108  H HE3  . TRP A 1 24  ? -30.585 3.122   -7.222  1.00 0.00 ? 24  TRP A HE3  1 
ATOM 109  H HZ2  . TRP A 1 24  ? -32.791 7.581   -7.543  1.00 0.00 ? 24  TRP A HZ2  1 
ATOM 110  H HZ3  . TRP A 1 24  ? -32.268 3.589   -8.954  1.00 0.00 ? 24  TRP A HZ3  1 
ATOM 111  H HH2  . TRP A 1 24  ? -33.348 5.773   -9.110  1.00 0.00 ? 24  TRP A HH2  1 
ATOM 112  N N    . THR A 1 25  ? -27.460 4.797   -2.127  1.00 0.00 ? 25  THR A N    1 
ATOM 113  C CA   . THR A 1 25  ? -27.066 4.474   -0.761  1.00 0.00 ? 25  THR A CA   1 
ATOM 114  C C    . THR A 1 25  ? -28.168 4.841   0.227   1.00 0.00 ? 25  THR A C    1 
ATOM 115  O O    . THR A 1 25  ? -27.964 5.662   1.122   1.00 0.00 ? 25  THR A O    1 
ATOM 116  C CB   . THR A 1 25  ? -25.774 5.207   -0.394  1.00 0.00 ? 25  THR A CB   1 
ATOM 117  O OG1  . THR A 1 25  ? -25.684 6.438   -1.090  1.00 0.00 ? 25  THR A OG1  1 
ATOM 118  C CG2  . THR A 1 25  ? -24.524 4.413   -0.700  1.00 0.00 ? 25  THR A CG2  1 
ATOM 119  H H    . THR A 1 25  ? -28.099 5.524   -2.281  1.00 0.00 ? 25  THR A H    1 
ATOM 120  H HA   . THR A 1 25  ? -26.893 3.409   -0.709  1.00 0.00 ? 25  THR A HA   1 
ATOM 121  H HB   . THR A 1 25  ? -25.779 5.416   0.666   1.00 0.00 ? 25  THR A HB   1 
ATOM 122  H HG1  . THR A 1 25  ? -25.426 6.272   -2.000  1.00 0.00 ? 25  THR A HG1  1 
ATOM 123  H HG21 . THR A 1 25  ? -23.860 5.008   -1.310  1.00 0.00 ? 25  THR A HG21 1 
ATOM 124  H HG22 . THR A 1 25  ? -24.791 3.512   -1.232  1.00 0.00 ? 25  THR A HG22 1 
ATOM 125  H HG23 . THR A 1 25  ? -24.028 4.152   0.223   1.00 0.00 ? 25  THR A HG23 1 
ATOM 126  N N    . ARG A 1 26  ? -29.336 4.229   0.060   1.00 0.00 ? 26  ARG A N    1 
ATOM 127  C CA   . ARG A 1 26  ? -30.469 4.492   0.939   1.00 0.00 ? 26  ARG A CA   1 
ATOM 128  C C    . ARG A 1 26  ? -31.101 3.188   1.415   1.00 0.00 ? 26  ARG A C    1 
ATOM 129  O O    . ARG A 1 26  ? -32.297 3.134   1.703   1.00 0.00 ? 26  ARG A O    1 
ATOM 130  C CB   . ARG A 1 26  ? -31.514 5.347   0.219   1.00 0.00 ? 26  ARG A CB   1 
ATOM 131  C CG   . ARG A 1 26  ? -32.112 6.438   1.092   1.00 0.00 ? 26  ARG A CG   1 
ATOM 132  C CD   . ARG A 1 26  ? -33.612 6.563   0.880   1.00 0.00 ? 26  ARG A CD   1 
ATOM 133  N NE   . ARG A 1 26  ? -34.149 7.787   1.470   1.00 0.00 ? 26  ARG A NE   1 
ATOM 134  C CZ   . ARG A 1 26  ? -35.434 7.963   1.759   1.00 0.00 ? 26  ARG A CZ   1 
ATOM 135  N NH1  . ARG A 1 26  ? -36.309 6.998   1.513   1.00 0.00 ? 26  ARG A NH1  1 
ATOM 136  N NH2  . ARG A 1 26  ? -35.845 9.104   2.294   1.00 0.00 ? 26  ARG A NH2  1 
ATOM 137  H H    . ARG A 1 26  ? -29.437 3.584   -0.671  1.00 0.00 ? 26  ARG A H    1 
ATOM 138  H HA   . ARG A 1 26  ? -30.102 5.033   1.798   1.00 0.00 ? 26  ARG A HA   1 
ATOM 139  H HB2  . ARG A 1 26  ? -31.051 5.815   -0.638  1.00 0.00 ? 26  ARG A HB2  1 
ATOM 140  H HB3  . ARG A 1 26  ? -32.315 4.707   -0.121  1.00 0.00 ? 26  ARG A HB3  1 
ATOM 141  H HG2  . ARG A 1 26  ? -31.924 6.199   2.128   1.00 0.00 ? 26  ARG A HG2  1 
ATOM 142  H HG3  . ARG A 1 26  ? -31.644 7.379   0.846   1.00 0.00 ? 26  ARG A HG3  1 
ATOM 143  H HD2  . ARG A 1 26  ? -33.814 6.568   -0.181  1.00 0.00 ? 26  ARG A HD2  1 
ATOM 144  H HD3  . ARG A 1 26  ? -34.099 5.713   1.335   1.00 0.00 ? 26  ARG A HD3  1 
ATOM 145  H HE   . ARG A 1 26  ? -33.519 8.513   1.660   1.00 0.00 ? 26  ARG A HE   1 
ATOM 146  H HH11 . ARG A 1 26  ? -36.002 6.136   1.110   1.00 0.00 ? 26  ARG A HH11 1 
ATOM 147  H HH12 . ARG A 1 26  ? -37.276 7.132   1.731   1.00 0.00 ? 26  ARG A HH12 1 
ATOM 148  H HH21 . ARG A 1 26  ? -35.188 9.834   2.481   1.00 0.00 ? 26  ARG A HH21 1 
ATOM 149  H HH22 . ARG A 1 26  ? -36.813 9.235   2.511   1.00 0.00 ? 26  ARG A HH22 1 
ATOM 150  N N    . HIS A 1 27  ? -30.289 2.138   1.496   1.00 0.00 ? 27  HIS A N    1 
ATOM 151  C CA   . HIS A 1 27  ? -30.767 0.833   1.936   1.00 0.00 ? 27  HIS A CA   1 
ATOM 152  C C    . HIS A 1 27  ? -30.397 0.579   3.393   1.00 0.00 ? 27  HIS A C    1 
ATOM 153  O O    . HIS A 1 27  ? -29.556 1.277   3.961   1.00 0.00 ? 27  HIS A O    1 
ATOM 154  C CB   . HIS A 1 27  ? -30.182 -0.270  1.051   1.00 0.00 ? 27  HIS A CB   1 
ATOM 155  C CG   . HIS A 1 27  ? -30.816 -0.352  -0.302  1.00 0.00 ? 27  HIS A CG   1 
ATOM 156  N ND1  . HIS A 1 27  ? -31.365 -1.512  -0.807  1.00 0.00 ? 27  HIS A ND1  1 
ATOM 157  C CD2  . HIS A 1 27  ? -30.986 0.590   -1.260  1.00 0.00 ? 27  HIS A CD2  1 
ATOM 158  C CE1  . HIS A 1 27  ? -31.846 -1.280  -2.016  1.00 0.00 ? 27  HIS A CE1  1 
ATOM 159  N NE2  . HIS A 1 27  ? -31.628 -0.012  -2.313  1.00 0.00 ? 27  HIS A NE2  1 
ATOM 160  H H    . HIS A 1 27  ? -29.346 2.244   1.252   1.00 0.00 ? 27  HIS A H    1 
ATOM 161  H HA   . HIS A 1 27  ? -31.843 0.825   1.843   1.00 0.00 ? 27  HIS A HA   1 
ATOM 162  H HB2  . HIS A 1 27  ? -29.126 -0.088  0.913   1.00 0.00 ? 27  HIS A HB2  1 
ATOM 163  H HB3  . HIS A 1 27  ? -30.317 -1.224  1.540   1.00 0.00 ? 27  HIS A HB3  1 
ATOM 164  H HD1  . HIS A 1 27  ? -31.398 -2.377  -0.348  1.00 0.00 ? 27  HIS A HD1  1 
ATOM 165  H HD2  . HIS A 1 27  ? -30.674 1.624   -1.206  1.00 0.00 ? 27  HIS A HD2  1 
ATOM 166  H HE1  . HIS A 1 27  ? -32.334 -2.003  -2.652  1.00 0.00 ? 27  HIS A HE1  1 
ATOM 167  H HE2  . HIS A 1 27  ? -31.885 0.425   -3.152  1.00 0.00 ? 27  HIS A HE2  1 
ATOM 168  N N    . GLY A 1 28  ? -31.027 -0.425  3.994   1.00 0.00 ? 28  GLY A N    1 
ATOM 169  C CA   . GLY A 1 28  ? -30.749 -0.753  5.380   1.00 0.00 ? 28  GLY A CA   1 
ATOM 170  C C    . GLY A 1 28  ? -29.424 -1.471  5.552   1.00 0.00 ? 28  GLY A C    1 
ATOM 171  O O    . GLY A 1 28  ? -28.709 -1.709  4.579   1.00 0.00 ? 28  GLY A O    1 
ATOM 172  H H    . GLY A 1 28  ? -31.688 -0.947  3.492   1.00 0.00 ? 28  GLY A H    1 
ATOM 173  H HA2  . GLY A 1 28  ? -30.729 0.159   5.957   1.00 0.00 ? 28  GLY A HA2  1 
ATOM 174  H HA3  . GLY A 1 28  ? -31.540 -1.386  5.754   1.00 0.00 ? 28  GLY A HA3  1 
ATOM 175  N N    . SER A 1 29  ? -29.097 -1.815  6.794   1.00 0.00 ? 29  SER A N    1 
ATOM 176  C CA   . SER A 1 29  ? -27.851 -2.510  7.090   1.00 0.00 ? 29  SER A CA   1 
ATOM 177  C C    . SER A 1 29  ? -28.021 -4.018  6.943   1.00 0.00 ? 29  SER A C    1 
ATOM 178  O O    . SER A 1 29  ? -28.983 -4.487  6.334   1.00 0.00 ? 29  SER A O    1 
ATOM 179  C CB   . SER A 1 29  ? -27.379 -2.172  8.506   1.00 0.00 ? 29  SER A CB   1 
ATOM 180  O OG   . SER A 1 29  ? -26.101 -1.560  8.487   1.00 0.00 ? 29  SER A OG   1 
ATOM 181  H H    . SER A 1 29  ? -29.710 -1.597  7.527   1.00 0.00 ? 29  SER A H    1 
ATOM 182  H HA   . SER A 1 29  ? -27.108 -2.173  6.382   1.00 0.00 ? 29  SER A HA   1 
ATOM 183  H HB2  . SER A 1 29  ? -28.082 -1.493  8.965   1.00 0.00 ? 29  SER A HB2  1 
ATOM 184  H HB3  . SER A 1 29  ? -27.320 -3.079  9.090   1.00 0.00 ? 29  SER A HB3  1 
ATOM 185  H HG   . SER A 1 29  ? -26.061 -0.878  9.161   1.00 0.00 ? 29  SER A HG   1 
ATOM 186  N N    . PHE A 1 30  ? -27.082 -4.774  7.503   1.00 0.00 ? 30  PHE A N    1 
ATOM 187  C CA   . PHE A 1 30  ? -27.129 -6.230  7.429   1.00 0.00 ? 30  PHE A CA   1 
ATOM 188  C C    . PHE A 1 30  ? -28.230 -6.787  8.325   1.00 0.00 ? 30  PHE A C    1 
ATOM 189  O O    . PHE A 1 30  ? -28.853 -6.051  9.090   1.00 0.00 ? 30  PHE A O    1 
ATOM 190  C CB   . PHE A 1 30  ? -25.778 -6.825  7.828   1.00 0.00 ? 30  PHE A CB   1 
ATOM 191  C CG   . PHE A 1 30  ? -24.810 -6.928  6.685   1.00 0.00 ? 30  PHE A CG   1 
ATOM 192  C CD1  . PHE A 1 30  ? -24.487 -5.811  5.931   1.00 0.00 ? 30  PHE A CD1  1 
ATOM 193  C CD2  . PHE A 1 30  ? -24.226 -8.142  6.362   1.00 0.00 ? 30  PHE A CD2  1 
ATOM 194  C CE1  . PHE A 1 30  ? -23.599 -5.903  4.877   1.00 0.00 ? 30  PHE A CE1  1 
ATOM 195  C CE2  . PHE A 1 30  ? -23.337 -8.240  5.309   1.00 0.00 ? 30  PHE A CE2  1 
ATOM 196  C CZ   . PHE A 1 30  ? -23.022 -7.119  4.566   1.00 0.00 ? 30  PHE A CZ   1 
ATOM 197  H H    . PHE A 1 30  ? -26.339 -4.343  7.974   1.00 0.00 ? 30  PHE A H    1 
ATOM 198  H HA   . PHE A 1 30  ? -27.344 -6.501  6.406   1.00 0.00 ? 30  PHE A HA   1 
ATOM 199  H HB2  . PHE A 1 30  ? -25.329 -6.206  8.590   1.00 0.00 ? 30  PHE A HB2  1 
ATOM 200  H HB3  . PHE A 1 30  ? -25.933 -7.819  8.223   1.00 0.00 ? 30  PHE A HB3  1 
ATOM 201  H HD1  . PHE A 1 30  ? -24.937 -4.860  6.174   1.00 0.00 ? 30  PHE A HD1  1 
ATOM 202  H HD2  . PHE A 1 30  ? -24.471 -9.019  6.942   1.00 0.00 ? 30  PHE A HD2  1 
ATOM 203  H HE1  . PHE A 1 30  ? -23.355 -5.025  4.298   1.00 0.00 ? 30  PHE A HE1  1 
ATOM 204  H HE2  . PHE A 1 30  ? -22.887 -9.192  5.068   1.00 0.00 ? 30  PHE A HE2  1 
ATOM 205  H HZ   . PHE A 1 30  ? -22.327 -7.193  3.743   1.00 0.00 ? 30  PHE A HZ   1 
ATOM 206  N N    . VAL A 1 31  ? -28.464 -8.091  8.224   1.00 0.00 ? 31  VAL A N    1 
ATOM 207  C CA   . VAL A 1 31  ? -29.499 -8.744  9.019   1.00 0.00 ? 31  VAL A CA   1 
ATOM 208  C C    . VAL A 1 31  ? -29.381 -8.375  10.496  1.00 0.00 ? 31  VAL A C    1 
ATOM 209  O O    . VAL A 1 31  ? -30.319 -7.835  11.083  1.00 0.00 ? 31  VAL A O    1 
ATOM 210  C CB   . VAL A 1 31  ? -29.453 -10.280 8.872   1.00 0.00 ? 31  VAL A CB   1 
ATOM 211  C CG1  . VAL A 1 31  ? -30.146 -10.711 7.588   1.00 0.00 ? 31  VAL A CG1  1 
ATOM 212  C CG2  . VAL A 1 31  ? -28.020 -10.795 8.910   1.00 0.00 ? 31  VAL A CG2  1 
ATOM 213  H H    . VAL A 1 31  ? -27.939 -8.624  7.591   1.00 0.00 ? 31  VAL A H    1 
ATOM 214  H HA   . VAL A 1 31  ? -30.456 -8.405  8.653   1.00 0.00 ? 31  VAL A HA   1 
ATOM 215  H HB   . VAL A 1 31  ? -29.987 -10.715 9.703   1.00 0.00 ? 31  VAL A HB   1 
ATOM 216  H HG11 . VAL A 1 31  ? -31.189 -10.437 7.632   1.00 0.00 ? 31  VAL A HG11 1 
ATOM 217  H HG12 . VAL A 1 31  ? -30.059 -11.782 7.474   1.00 0.00 ? 31  VAL A HG12 1 
ATOM 218  H HG13 . VAL A 1 31  ? -29.680 -10.221 6.745   1.00 0.00 ? 31  VAL A HG13 1 
ATOM 219  H HG21 . VAL A 1 31  ? -27.856 -11.334 9.831   1.00 0.00 ? 31  VAL A HG21 1 
ATOM 220  H HG22 . VAL A 1 31  ? -27.333 -9.965  8.853   1.00 0.00 ? 31  VAL A HG22 1 
ATOM 221  H HG23 . VAL A 1 31  ? -27.853 -11.456 8.072   1.00 0.00 ? 31  VAL A HG23 1 
ATOM 222  N N    . ASN A 1 32  ? -28.230 -8.673  11.094  1.00 0.00 ? 32  ASN A N    1 
ATOM 223  C CA   . ASN A 1 32  ? -27.994 -8.370  12.503  1.00 0.00 ? 32  ASN A CA   1 
ATOM 224  C C    . ASN A 1 32  ? -26.708 -9.027  12.992  1.00 0.00 ? 32  ASN A C    1 
ATOM 225  O O    . ASN A 1 32  ? -26.739 -9.923  13.836  1.00 0.00 ? 32  ASN A O    1 
ATOM 226  C CB   . ASN A 1 32  ? -29.173 -8.838  13.363  1.00 0.00 ? 32  ASN A CB   1 
ATOM 227  C CG   . ASN A 1 32  ? -29.626 -10.244 13.020  1.00 0.00 ? 32  ASN A CG   1 
ATOM 228  O OD1  . ASN A 1 32  ? -29.571 -10.664 11.864  1.00 0.00 ? 32  ASN A OD1  1 
ATOM 229  N ND2  . ASN A 1 32  ? -30.081 -10.981 14.027  1.00 0.00 ? 32  ASN A ND2  1 
ATOM 230  H H    . ASN A 1 32  ? -27.519 -9.100  10.575  1.00 0.00 ? 32  ASN A H    1 
ATOM 231  H HA   . ASN A 1 32  ? -27.894 -7.299  12.598  1.00 0.00 ? 32  ASN A HA   1 
ATOM 232  H HB2  . ASN A 1 32  ? -28.880 -8.819  14.403  1.00 0.00 ? 32  ASN A HB2  1 
ATOM 233  H HB3  . ASN A 1 32  ? -30.006 -8.166  13.218  1.00 0.00 ? 32  ASN A HB3  1 
ATOM 234  H HD21 . ASN A 1 32  ? -30.097 -10.583 14.922  1.00 0.00 ? 32  ASN A HD21 1 
ATOM 235  H HD22 . ASN A 1 32  ? -30.381 -11.894 13.834  1.00 0.00 ? 32  ASN A HD22 1 
ATOM 236  N N    . LYS A 1 33  ? -25.578 -8.577  12.457  1.00 0.00 ? 33  LYS A N    1 
ATOM 237  C CA   . LYS A 1 33  ? -24.282 -9.123  12.841  1.00 0.00 ? 33  LYS A CA   1 
ATOM 238  C C    . LYS A 1 33  ? -23.189 -8.061  12.732  1.00 0.00 ? 33  LYS A C    1 
ATOM 239  O O    . LYS A 1 33  ? -23.149 -7.299  11.765  1.00 0.00 ? 33  LYS A O    1 
ATOM 240  C CB   . LYS A 1 33  ? -23.931 -10.323 11.960  1.00 0.00 ? 33  LYS A CB   1 
ATOM 241  C CG   . LYS A 1 33  ? -24.132 -11.663 12.648  1.00 0.00 ? 33  LYS A CG   1 
ATOM 242  C CD   . LYS A 1 33  ? -24.786 -12.673 11.719  1.00 0.00 ? 33  LYS A CD   1 
ATOM 243  C CE   . LYS A 1 33  ? -25.003 -14.009 12.412  1.00 0.00 ? 33  LYS A CE   1 
ATOM 244  N NZ   . LYS A 1 33  ? -23.835 -14.397 13.249  1.00 0.00 ? 33  LYS A NZ   1 
ATOM 245  H H    . LYS A 1 33  ? -25.617 -7.861  11.789  1.00 0.00 ? 33  LYS A H    1 
ATOM 246  H HA   . LYS A 1 33  ? -24.353 -9.448  13.868  1.00 0.00 ? 33  LYS A HA   1 
ATOM 247  H HB2  . LYS A 1 33  ? -24.552 -10.300 11.076  1.00 0.00 ? 33  LYS A HB2  1 
ATOM 248  H HB3  . LYS A 1 33  ? -22.895 -10.246 11.663  1.00 0.00 ? 33  LYS A HB3  1 
ATOM 249  H HG2  . LYS A 1 33  ? -23.170 -12.045 12.959  1.00 0.00 ? 33  LYS A HG2  1 
ATOM 250  H HG3  . LYS A 1 33  ? -24.763 -11.522 13.513  1.00 0.00 ? 33  LYS A HG3  1 
ATOM 251  H HD2  . LYS A 1 33  ? -25.742 -12.286 11.398  1.00 0.00 ? 33  LYS A HD2  1 
ATOM 252  H HD3  . LYS A 1 33  ? -24.149 -12.824 10.860  1.00 0.00 ? 33  LYS A HD3  1 
ATOM 253  H HE2  . LYS A 1 33  ? -25.878 -13.935 13.041  1.00 0.00 ? 33  LYS A HE2  1 
ATOM 254  H HE3  . LYS A 1 33  ? -25.164 -14.767 11.660  1.00 0.00 ? 33  LYS A HE3  1 
ATOM 255  H HZ1  . LYS A 1 33  ? -23.762 -13.768 14.074  1.00 0.00 ? 33  LYS A HZ1  1 
ATOM 256  H HZ2  . LYS A 1 33  ? -22.958 -14.327 12.694  1.00 0.00 ? 33  LYS A HZ2  1 
ATOM 257  H HZ3  . LYS A 1 33  ? -23.944 -15.376 13.583  1.00 0.00 ? 33  LYS A HZ3  1 
ATOM 258  N N    . PRO A 1 34  ? -22.282 -7.997  13.723  1.00 0.00 ? 34  PRO A N    1 
ATOM 259  C CA   . PRO A 1 34  ? -21.191 -7.022  13.731  1.00 0.00 ? 34  PRO A CA   1 
ATOM 260  C C    . PRO A 1 34  ? -20.047 -7.423  12.806  1.00 0.00 ? 34  PRO A C    1 
ATOM 261  O O    . PRO A 1 34  ? -20.015 -8.541  12.291  1.00 0.00 ? 34  PRO A O    1 
ATOM 262  C CB   . PRO A 1 34  ? -20.730 -7.036  15.187  1.00 0.00 ? 34  PRO A CB   1 
ATOM 263  C CG   . PRO A 1 34  ? -21.016 -8.422  15.652  1.00 0.00 ? 34  PRO A CG   1 
ATOM 264  C CD   . PRO A 1 34  ? -22.253 -8.866  14.916  1.00 0.00 ? 34  PRO A CD   1 
ATOM 265  H HA   . PRO A 1 34  ? -21.538 -6.034  13.468  1.00 0.00 ? 34  PRO A HA   1 
ATOM 266  H HB2  . PRO A 1 34  ? -19.675 -6.810  15.237  1.00 0.00 ? 34  PRO A HB2  1 
ATOM 267  H HB3  . PRO A 1 34  ? -21.289 -6.305  15.752  1.00 0.00 ? 34  PRO A HB3  1 
ATOM 268  H HG2  . PRO A 1 34  ? -20.185 -9.068  15.410  1.00 0.00 ? 34  PRO A HG2  1 
ATOM 269  H HG3  . PRO A 1 34  ? -21.193 -8.422  16.717  1.00 0.00 ? 34  PRO A HG3  1 
ATOM 270  H HD2  . PRO A 1 34  ? -22.170 -9.905  14.633  1.00 0.00 ? 34  PRO A HD2  1 
ATOM 271  H HD3  . PRO A 1 34  ? -23.131 -8.710  15.527  1.00 0.00 ? 34  PRO A HD3  1 
ATOM 272  N N    . THR A 1 35  ? -19.107 -6.505  12.602  1.00 0.00 ? 35  THR A N    1 
ATOM 273  C CA   . THR A 1 35  ? -17.958 -6.764  11.743  1.00 0.00 ? 35  THR A CA   1 
ATOM 274  C C    . THR A 1 35  ? -16.901 -5.677  11.904  1.00 0.00 ? 35  THR A C    1 
ATOM 275  O O    . THR A 1 35  ? -17.158 -4.632  12.502  1.00 0.00 ? 35  THR A O    1 
ATOM 276  C CB   . THR A 1 35  ? -18.396 -6.850  10.279  1.00 0.00 ? 35  THR A CB   1 
ATOM 277  O OG1  . THR A 1 35  ? -17.269 -6.902  9.422   1.00 0.00 ? 35  THR A OG1  1 
ATOM 278  C CG2  . THR A 1 35  ? -19.254 -5.684  9.841   1.00 0.00 ? 35  THR A CG2  1 
ATOM 279  H H    . THR A 1 35  ? -19.188 -5.634  13.043  1.00 0.00 ? 35  THR A H    1 
ATOM 280  H HA   . THR A 1 35  ? -17.531 -7.711  12.038  1.00 0.00 ? 35  THR A HA   1 
ATOM 281  H HB   . THR A 1 35  ? -18.972 -7.753  10.139  1.00 0.00 ? 35  THR A HB   1 
ATOM 282  H HG1  . THR A 1 35  ? -17.462 -7.468  8.672   1.00 0.00 ? 35  THR A HG1  1 
ATOM 283  H HG21 . THR A 1 35  ? -18.649 -4.978  9.292   1.00 0.00 ? 35  THR A HG21 1 
ATOM 284  H HG22 . THR A 1 35  ? -19.675 -5.200  10.709  1.00 0.00 ? 35  THR A HG22 1 
ATOM 285  H HG23 . THR A 1 35  ? -20.052 -6.043  9.207   1.00 0.00 ? 35  THR A HG23 1 
ATOM 286  N N    . ARG A 1 36  ? -15.712 -5.930  11.368  1.00 0.00 ? 36  ARG A N    1 
ATOM 287  C CA   . ARG A 1 36  ? -14.617 -4.971  11.454  1.00 0.00 ? 36  ARG A CA   1 
ATOM 288  C C    . ARG A 1 36  ? -13.808 -4.949  10.162  1.00 0.00 ? 36  ARG A C    1 
ATOM 289  O O    . ARG A 1 36  ? -13.376 -5.991  9.669   1.00 0.00 ? 36  ARG A O    1 
ATOM 290  C CB   . ARG A 1 36  ? -13.703 -5.314  12.632  1.00 0.00 ? 36  ARG A CB   1 
ATOM 291  C CG   . ARG A 1 36  ? -13.013 -6.662  12.496  1.00 0.00 ? 36  ARG A CG   1 
ATOM 292  C CD   . ARG A 1 36  ? -11.581 -6.508  12.010  1.00 0.00 ? 36  ARG A CD   1 
ATOM 293  N NE   . ARG A 1 36  ? -10.844 -7.766  12.077  1.00 0.00 ? 36  ARG A NE   1 
ATOM 294  C CZ   . ARG A 1 36  ? -10.475 -8.345  13.215  1.00 0.00 ? 36  ARG A CZ   1 
ATOM 295  N NH1  . ARG A 1 36  ? -10.774 -7.781  14.377  1.00 0.00 ? 36  ARG A NH1  1 
ATOM 296  N NH2  . ARG A 1 36  ? -9.807  -9.490  13.191  1.00 0.00 ? 36  ARG A NH2  1 
ATOM 297  H H    . ARG A 1 36  ? -15.568 -6.781  10.903  1.00 0.00 ? 36  ARG A H    1 
ATOM 298  H HA   . ARG A 1 36  ? -15.045 -3.993  11.613  1.00 0.00 ? 36  ARG A HA   1 
ATOM 299  H HB2  . ARG A 1 36  ? -12.942 -4.552  12.716  1.00 0.00 ? 36  ARG A HB2  1 
ATOM 300  H HB3  . ARG A 1 36  ? -14.291 -5.324  13.538  1.00 0.00 ? 36  ARG A HB3  1 
ATOM 301  H HG2  . ARG A 1 36  ? -13.006 -7.150  13.459  1.00 0.00 ? 36  ARG A HG2  1 
ATOM 302  H HG3  . ARG A 1 36  ? -13.561 -7.265  11.787  1.00 0.00 ? 36  ARG A HG3  1 
ATOM 303  H HD2  . ARG A 1 36  ? -11.597 -6.165  10.986  1.00 0.00 ? 36  ARG A HD2  1 
ATOM 304  H HD3  . ARG A 1 36  ? -11.082 -5.776  12.627  1.00 0.00 ? 36  ARG A HD3  1 
ATOM 305  H HE   . ARG A 1 36  ? -10.612 -8.202  11.230  1.00 0.00 ? 36  ARG A HE   1 
ATOM 306  H HH11 . ARG A 1 36  ? -11.279 -6.917  14.398  1.00 0.00 ? 36  ARG A HH11 1 
ATOM 307  H HH12 . ARG A 1 36  ? -10.496 -8.218  15.232  1.00 0.00 ? 36  ARG A HH12 1 
ATOM 308  H HH21 . ARG A 1 36  ? -9.579  -9.918  12.317  1.00 0.00 ? 36  ARG A HH21 1 
ATOM 309  H HH22 . ARG A 1 36  ? -9.530  -9.925  14.048  1.00 0.00 ? 36  ARG A HH22 1 
ATOM 310  N N    . GLY A 1 37  ? -13.602 -3.753  9.621   1.00 0.00 ? 37  GLY A N    1 
ATOM 311  C CA   . GLY A 1 37  ? -12.839 -3.615  8.395   1.00 0.00 ? 37  GLY A CA   1 
ATOM 312  C C    . GLY A 1 37  ? -11.659 -2.676  8.553   1.00 0.00 ? 37  GLY A C    1 
ATOM 313  O O    . GLY A 1 37  ? -11.011 -2.654  9.599   1.00 0.00 ? 37  GLY A O    1 
ATOM 314  H H    . GLY A 1 37  ? -13.968 -2.957  10.059  1.00 0.00 ? 37  GLY A H    1 
ATOM 315  H HA2  . GLY A 1 37  ? -12.474 -4.588  8.100   1.00 0.00 ? 37  GLY A HA2  1 
ATOM 316  H HA3  . GLY A 1 37  ? -13.487 -3.235  7.620   1.00 0.00 ? 37  GLY A HA3  1 
ATOM 317  N N    . TRP A 1 38  ? -11.380 -1.897  7.513   1.00 0.00 ? 38  TRP A N    1 
ATOM 318  C CA   . TRP A 1 38  ? -10.271 -0.951  7.545   1.00 0.00 ? 38  TRP A CA   1 
ATOM 319  C C    . TRP A 1 38  ? -10.485 0.104   8.620   1.00 0.00 ? 38  TRP A C    1 
ATOM 320  O O    . TRP A 1 38  ? -11.584 0.637   8.768   1.00 0.00 ? 38  TRP A O    1 
ATOM 321  C CB   . TRP A 1 38  ? -10.113 -0.272  6.189   1.00 0.00 ? 38  TRP A CB   1 
ATOM 322  C CG   . TRP A 1 38  ? -8.810  0.449   6.041   1.00 0.00 ? 38  TRP A CG   1 
ATOM 323  C CD1  . TRP A 1 38  ? -8.488  1.668   6.564   1.00 0.00 ? 38  TRP A CD1  1 
ATOM 324  C CD2  . TRP A 1 38  ? -7.648  -0.007  5.338   1.00 0.00 ? 38  TRP A CD2  1 
ATOM 325  N NE1  . TRP A 1 38  ? -7.200  2.001   6.224   1.00 0.00 ? 38  TRP A NE1  1 
ATOM 326  C CE2  . TRP A 1 38  ? -6.663  0.988   5.473   1.00 0.00 ? 38  TRP A CE2  1 
ATOM 327  C CE3  . TRP A 1 38  ? -7.347  -1.159  4.606   1.00 0.00 ? 38  TRP A CE3  1 
ATOM 328  C CZ2  . TRP A 1 38  ? -5.399  0.868   4.900   1.00 0.00 ? 38  TRP A CZ2  1 
ATOM 329  C CZ3  . TRP A 1 38  ? -6.091  -1.278  4.039   1.00 0.00 ? 38  TRP A CZ3  1 
ATOM 330  C CH2  . TRP A 1 38  ? -5.131  -0.269  4.189   1.00 0.00 ? 38  TRP A CH2  1 
ATOM 331  H H    . TRP A 1 38  ? -11.933 -1.959  6.706   1.00 0.00 ? 38  TRP A H    1 
ATOM 332  H HA   . TRP A 1 38  ? -9.371  -1.502  7.772   1.00 0.00 ? 38  TRP A HA   1 
ATOM 333  H HB2  . TRP A 1 38  ? -10.177 -1.015  5.413   1.00 0.00 ? 38  TRP A HB2  1 
ATOM 334  H HB3  . TRP A 1 38  ? -10.908 0.447   6.060   1.00 0.00 ? 38  TRP A HB3  1 
ATOM 335  H HD1  . TRP A 1 38  ? -9.161  2.272   7.155   1.00 0.00 ? 38  TRP A HD1  1 
ATOM 336  H HE1  . TRP A 1 38  ? -6.741  2.828   6.478   1.00 0.00 ? 38  TRP A HE1  1 
ATOM 337  H HE3  . TRP A 1 38  ? -8.074  -1.948  4.479   1.00 0.00 ? 38  TRP A HE3  1 
ATOM 338  H HZ2  . TRP A 1 38  ? -4.648  1.637   5.007   1.00 0.00 ? 38  TRP A HZ2  1 
ATOM 339  H HZ3  . TRP A 1 38  ? -5.840  -2.161  3.470   1.00 0.00 ? 38  TRP A HZ3  1 
ATOM 340  H HH2  . TRP A 1 38  ? -4.163  -0.404  3.729   1.00 0.00 ? 38  TRP A HH2  1 
ATOM 341  N N    . LEU A 1 39  ? -9.426  0.411   9.361   1.00 0.00 ? 39  LEU A N    1 
ATOM 342  C CA   . LEU A 1 39  ? -9.501  1.398   10.431  1.00 0.00 ? 39  LEU A CA   1 
ATOM 343  C C    . LEU A 1 39  ? -10.371 0.890   11.574  1.00 0.00 ? 39  LEU A C    1 
ATOM 344  O O    . LEU A 1 39  ? -9.894  0.712   12.694  1.00 0.00 ? 39  LEU A O    1 
ATOM 345  C CB   . LEU A 1 39  ? -10.052 2.725   9.905   1.00 0.00 ? 39  LEU A CB   1 
ATOM 346  C CG   . LEU A 1 39  ? -9.780  3.934   10.804  1.00 0.00 ? 39  LEU A CG   1 
ATOM 347  C CD1  . LEU A 1 39  ? -8.497  4.635   10.384  1.00 0.00 ? 39  LEU A CD1  1 
ATOM 348  C CD2  . LEU A 1 39  ? -10.954 4.901   10.769  1.00 0.00 ? 39  LEU A CD2  1 
ATOM 349  H H    . LEU A 1 39  ? -8.578  -0.052  9.196   1.00 0.00 ? 39  LEU A H    1 
ATOM 350  H HA   . LEU A 1 39  ? -8.499  1.557   10.803  1.00 0.00 ? 39  LEU A HA   1 
ATOM 351  H HB2  . LEU A 1 39  ? -9.612  2.916   8.938   1.00 0.00 ? 39  LEU A HB2  1 
ATOM 352  H HB3  . LEU A 1 39  ? -11.120 2.626   9.784   1.00 0.00 ? 39  LEU A HB3  1 
ATOM 353  H HG   . LEU A 1 39  ? -9.657  3.596   11.823  1.00 0.00 ? 39  LEU A HG   1 
ATOM 354  H HD11 . LEU A 1 39  ? -8.528  4.838   9.323   1.00 0.00 ? 39  LEU A HD11 1 
ATOM 355  H HD12 . LEU A 1 39  ? -7.650  4.000   10.604  1.00 0.00 ? 39  LEU A HD12 1 
ATOM 356  H HD13 . LEU A 1 39  ? -8.400  5.564   10.925  1.00 0.00 ? 39  LEU A HD13 1 
ATOM 357  H HD21 . LEU A 1 39  ? -11.563 4.760   11.650  1.00 0.00 ? 39  LEU A HD21 1 
ATOM 358  H HD22 . LEU A 1 39  ? -11.549 4.713   9.887   1.00 0.00 ? 39  LEU A HD22 1 
ATOM 359  H HD23 . LEU A 1 39  ? -10.585 5.915   10.744  1.00 0.00 ? 39  LEU A HD23 1 
ATOM 360  N N    . HIS A 1 40  ? -11.650 0.653   11.288  1.00 0.00 ? 40  HIS A N    1 
ATOM 361  C CA   . HIS A 1 40  ? -12.563 0.147   12.305  1.00 0.00 ? 40  HIS A CA   1 
ATOM 362  C C    . HIS A 1 40  ? -13.698 -0.685  11.681  1.00 0.00 ? 40  HIS A C    1 
ATOM 363  O O    . HIS A 1 40  ? -13.596 -1.912  11.649  1.00 0.00 ? 40  HIS A O    1 
ATOM 364  C CB   . HIS A 1 40  ? -13.090 1.295   13.165  1.00 0.00 ? 40  HIS A CB   1 
ATOM 365  C CG   . HIS A 1 40  ? -12.164 1.682   14.276  1.00 0.00 ? 40  HIS A CG   1 
ATOM 366  N ND1  . HIS A 1 40  ? -12.224 1.123   15.536  1.00 0.00 ? 40  HIS A ND1  1 
ATOM 367  C CD2  . HIS A 1 40  ? -11.144 2.573   14.311  1.00 0.00 ? 40  HIS A CD2  1 
ATOM 368  C CE1  . HIS A 1 40  ? -11.285 1.657   16.298  1.00 0.00 ? 40  HIS A CE1  1 
ATOM 369  N NE2  . HIS A 1 40  ? -10.617 2.538   15.578  1.00 0.00 ? 40  HIS A NE2  1 
ATOM 370  H H    . HIS A 1 40  ? -11.977 0.803   10.375  1.00 0.00 ? 40  HIS A H    1 
ATOM 371  H HA   . HIS A 1 40  ? -11.987 -0.508  12.942  1.00 0.00 ? 40  HIS A HA   1 
ATOM 372  H HB2  . HIS A 1 40  ? -13.240 2.164   12.537  1.00 0.00 ? 40  HIS A HB2  1 
ATOM 373  H HB3  . HIS A 1 40  ? -14.033 1.005   13.603  1.00 0.00 ? 40  HIS A HB3  1 
ATOM 374  H HD1  . HIS A 1 40  ? -12.862 0.439   15.829  1.00 0.00 ? 40  HIS A HD1  1 
ATOM 375  H HD2  . HIS A 1 40  ? -10.809 3.196   13.493  1.00 0.00 ? 40  HIS A HD2  1 
ATOM 376  H HE1  . HIS A 1 40  ? -11.096 1.413   17.333  1.00 0.00 ? 40  HIS A HE1  1 
ATOM 377  H HE2  . HIS A 1 40  ? -9.866  3.079   15.899  1.00 0.00 ? 40  HIS A HE2  1 
ATOM 378  N N    . PRO A 1 41  ? -14.788 -0.073  11.148  1.00 0.00 ? 41  PRO A N    1 
ATOM 379  C CA   . PRO A 1 41  ? -15.875 -0.839  10.538  1.00 0.00 ? 41  PRO A CA   1 
ATOM 380  C C    . PRO A 1 41  ? -15.647 -1.086  9.052   1.00 0.00 ? 41  PRO A C    1 
ATOM 381  O O    . PRO A 1 41  ? -14.613 -0.709  8.500   1.00 0.00 ? 41  PRO A O    1 
ATOM 382  C CB   . PRO A 1 41  ? -17.061 0.091   10.730  1.00 0.00 ? 41  PRO A CB   1 
ATOM 383  C CG   . PRO A 1 41  ? -16.471 1.436   10.498  1.00 0.00 ? 41  PRO A CG   1 
ATOM 384  C CD   . PRO A 1 41  ? -15.082 1.382   11.092  1.00 0.00 ? 41  PRO A CD   1 
ATOM 385  H HA   . PRO A 1 41  ? -16.049 -1.776  11.048  1.00 0.00 ? 41  PRO A HA   1 
ATOM 386  H HB2  . PRO A 1 41  ? -17.831 -0.139  10.008  1.00 0.00 ? 41  PRO A HB2  1 
ATOM 387  H HB3  . PRO A 1 41  ? -17.449 -0.009  11.733  1.00 0.00 ? 41  PRO A HB3  1 
ATOM 388  H HG2  . PRO A 1 41  ? -16.421 1.633   9.439   1.00 0.00 ? 41  PRO A HG2  1 
ATOM 389  H HG3  . PRO A 1 41  ? -17.064 2.189   10.995  1.00 0.00 ? 41  PRO A HG3  1 
ATOM 390  H HD2  . PRO A 1 41  ? -14.377 1.896   10.457  1.00 0.00 ? 41  PRO A HD2  1 
ATOM 391  H HD3  . PRO A 1 41  ? -15.096 1.817   12.077  1.00 0.00 ? 41  PRO A HD3  1 
ATOM 392  N N    . ASN A 1 42  ? -16.631 -1.700  8.404   1.00 0.00 ? 42  ASN A N    1 
ATOM 393  C CA   . ASN A 1 42  ? -16.559 -1.955  6.972   1.00 0.00 ? 42  ASN A CA   1 
ATOM 394  C C    . ASN A 1 42  ? -17.167 -0.793  6.195   1.00 0.00 ? 42  ASN A C    1 
ATOM 395  O O    . ASN A 1 42  ? -16.684 -0.424  5.127   1.00 0.00 ? 42  ASN A O    1 
ATOM 396  C CB   . ASN A 1 42  ? -17.291 -3.254  6.624   1.00 0.00 ? 42  ASN A CB   1 
ATOM 397  C CG   . ASN A 1 42  ? -16.340 -4.382  6.276   1.00 0.00 ? 42  ASN A CG   1 
ATOM 398  O OD1  . ASN A 1 42  ? -15.288 -4.537  6.897   1.00 0.00 ? 42  ASN A OD1  1 
ATOM 399  N ND2  . ASN A 1 42  ? -16.707 -5.179  5.279   1.00 0.00 ? 42  ASN A ND2  1 
ATOM 400  H H    . ASN A 1 42  ? -17.438 -1.957  8.895   1.00 0.00 ? 42  ASN A H    1 
ATOM 401  H HA   . ASN A 1 42  ? -15.517 -2.049  6.700   1.00 0.00 ? 42  ASN A HA   1 
ATOM 402  H HB2  . ASN A 1 42  ? -17.889 -3.559  7.469   1.00 0.00 ? 42  ASN A HB2  1 
ATOM 403  H HB3  . ASN A 1 42  ? -17.937 -3.079  5.776   1.00 0.00 ? 42  ASN A HB3  1 
ATOM 404  H HD21 . ASN A 1 42  ? -17.558 -4.997  4.830   1.00 0.00 ? 42  ASN A HD21 1 
ATOM 405  H HD22 . ASN A 1 42  ? -16.111 -5.918  5.033   1.00 0.00 ? 42  ASN A HD22 1 
ATOM 406  N N    . ASP A 1 43  ? -18.227 -0.216  6.747   1.00 0.00 ? 43  ASP A N    1 
ATOM 407  C CA   . ASP A 1 43  ? -18.908 0.901   6.106   1.00 0.00 ? 43  ASP A CA   1 
ATOM 408  C C    . ASP A 1 43  ? -17.983 2.106   5.966   1.00 0.00 ? 43  ASP A C    1 
ATOM 409  O O    . ASP A 1 43  ? -18.173 2.942   5.083   1.00 0.00 ? 43  ASP A O    1 
ATOM 410  C CB   . ASP A 1 43  ? -20.150 1.291   6.911   1.00 0.00 ? 43  ASP A CB   1 
ATOM 411  C CG   . ASP A 1 43  ? -21.397 1.377   6.053   1.00 0.00 ? 43  ASP A CG   1 
ATOM 412  O OD1  . ASP A 1 43  ? -21.621 2.439   5.436   1.00 0.00 ? 43  ASP A OD1  1 
ATOM 413  O OD2  . ASP A 1 43  ? -22.152 0.383   6.002   1.00 0.00 ? 43  ASP A OD2  1 
ATOM 414  H H    . ASP A 1 43  ? -18.566 -0.557  7.601   1.00 0.00 ? 43  ASP A H    1 
ATOM 415  H HA   . ASP A 1 43  ? -19.212 0.580   5.120   1.00 0.00 ? 43  ASP A HA   1 
ATOM 416  H HB2  . ASP A 1 43  ? -20.318 0.553   7.683   1.00 0.00 ? 43  ASP A HB2  1 
ATOM 417  H HB3  . ASP A 1 43  ? -19.986 2.254   7.370   1.00 0.00 ? 43  ASP A HB3  1 
ATOM 418  N N    . LYS A 1 44  ? -16.982 2.192   6.841   1.00 0.00 ? 44  LYS A N    1 
ATOM 419  C CA   . LYS A 1 44  ? -16.040 3.308   6.819   1.00 0.00 ? 44  LYS A CA   1 
ATOM 420  C C    . LYS A 1 44  ? -15.309 3.391   5.483   1.00 0.00 ? 44  LYS A C    1 
ATOM 421  O O    . LYS A 1 44  ? -14.865 4.463   5.081   1.00 0.00 ? 44  LYS A O    1 
ATOM 422  C CB   . LYS A 1 44  ? -15.024 3.181   7.958   1.00 0.00 ? 44  LYS A CB   1 
ATOM 423  C CG   . LYS A 1 44  ? -13.950 4.256   7.932   1.00 0.00 ? 44  LYS A CG   1 
ATOM 424  C CD   . LYS A 1 44  ? -14.518 5.616   8.306   1.00 0.00 ? 44  LYS A CD   1 
ATOM 425  C CE   . LYS A 1 44  ? -13.919 6.134   9.604   1.00 0.00 ? 44  LYS A CE   1 
ATOM 426  N NZ   . LYS A 1 44  ? -14.324 5.304   10.773  1.00 0.00 ? 44  LYS A NZ   1 
ATOM 427  H H    . LYS A 1 44  ? -16.886 1.498   7.527   1.00 0.00 ? 44  LYS A H    1 
ATOM 428  H HA   . LYS A 1 44  ? -16.607 4.217   6.958   1.00 0.00 ? 44  LYS A HA   1 
ATOM 429  H HB2  . LYS A 1 44  ? -15.543 3.249   8.902   1.00 0.00 ? 44  LYS A HB2  1 
ATOM 430  H HB3  . LYS A 1 44  ? -14.541 2.217   7.889   1.00 0.00 ? 44  LYS A HB3  1 
ATOM 431  H HG2  . LYS A 1 44  ? -13.175 3.994   8.636   1.00 0.00 ? 44  LYS A HG2  1 
ATOM 432  H HG3  . LYS A 1 44  ? -13.533 4.312   6.937   1.00 0.00 ? 44  LYS A HG3  1 
ATOM 433  H HD2  . LYS A 1 44  ? -14.298 6.318   7.514   1.00 0.00 ? 44  LYS A HD2  1 
ATOM 434  H HD3  . LYS A 1 44  ? -15.588 5.529   8.425   1.00 0.00 ? 44  LYS A HD3  1 
ATOM 435  H HE2  . LYS A 1 44  ? -12.843 6.121   9.519   1.00 0.00 ? 44  LYS A HE2  1 
ATOM 436  H HE3  . LYS A 1 44  ? -14.255 7.149   9.761   1.00 0.00 ? 44  LYS A HE3  1 
ATOM 437  H HZ1  . LYS A 1 44  ? -15.290 4.944   10.639  1.00 0.00 ? 44  LYS A HZ1  1 
ATOM 438  H HZ2  . LYS A 1 44  ? -14.294 5.873   11.643  1.00 0.00 ? 44  LYS A HZ2  1 
ATOM 439  H HZ3  . LYS A 1 44  ? -13.677 4.496   10.879  1.00 0.00 ? 44  LYS A HZ3  1 
ATOM 440  N N    . VAL A 1 45  ? -15.154 2.254   4.815   1.00 0.00 ? 45  VAL A N    1 
ATOM 441  C CA   . VAL A 1 45  ? -14.481 2.222   3.518   1.00 0.00 ? 45  VAL A CA   1 
ATOM 442  C C    . VAL A 1 45  ? -15.483 2.285   2.367   1.00 0.00 ? 45  VAL A C    1 
ATOM 443  O O    . VAL A 1 45  ? -15.239 2.945   1.357   1.00 0.00 ? 45  VAL A O    1 
ATOM 444  C CB   . VAL A 1 45  ? -13.604 0.968   3.356   1.00 0.00 ? 45  VAL A CB   1 
ATOM 445  C CG1  . VAL A 1 45  ? -12.248 1.181   4.009   1.00 0.00 ? 45  VAL A CG1  1 
ATOM 446  C CG2  . VAL A 1 45  ? -14.300 -0.250  3.934   1.00 0.00 ? 45  VAL A CG2  1 
ATOM 447  H H    . VAL A 1 45  ? -15.535 1.429   5.180   1.00 0.00 ? 45  VAL A H    1 
ATOM 448  H HA   . VAL A 1 45  ? -13.836 3.085   3.462   1.00 0.00 ? 45  VAL A HA   1 
ATOM 449  H HB   . VAL A 1 45  ? -13.448 0.798   2.301   1.00 0.00 ? 45  VAL A HB   1 
ATOM 450  H HG11 . VAL A 1 45  ? -11.604 0.345   3.782   1.00 0.00 ? 45  VAL A HG11 1 
ATOM 451  H HG12 . VAL A 1 45  ? -12.373 1.261   5.078   1.00 0.00 ? 45  VAL A HG12 1 
ATOM 452  H HG13 . VAL A 1 45  ? -11.806 2.090   3.629   1.00 0.00 ? 45  VAL A HG13 1 
ATOM 453  H HG21 . VAL A 1 45  ? -15.273 -0.355  3.479   1.00 0.00 ? 45  VAL A HG21 1 
ATOM 454  H HG22 . VAL A 1 45  ? -14.413 -0.129  5.002   1.00 0.00 ? 45  VAL A HG22 1 
ATOM 455  H HG23 . VAL A 1 45  ? -13.710 -1.131  3.732   1.00 0.00 ? 45  VAL A HG23 1 
ATOM 456  N N    . MET A 1 46  ? -16.601 1.581   2.518   1.00 0.00 ? 46  MET A N    1 
ATOM 457  C CA   . MET A 1 46  ? -17.623 1.534   1.475   1.00 0.00 ? 46  MET A CA   1 
ATOM 458  C C    . MET A 1 46  ? -18.486 2.795   1.454   1.00 0.00 ? 46  MET A C    1 
ATOM 459  O O    . MET A 1 46  ? -19.406 2.904   0.644   1.00 0.00 ? 46  MET A O    1 
ATOM 460  C CB   . MET A 1 46  ? -18.519 0.309   1.667   1.00 0.00 ? 46  MET A CB   1 
ATOM 461  C CG   . MET A 1 46  ? -17.769 -0.927  2.129   1.00 0.00 ? 46  MET A CG   1 
ATOM 462  S SD   . MET A 1 46  ? -18.681 -2.451  1.822   1.00 0.00 ? 46  MET A SD   1 
ATOM 463  C CE   . MET A 1 46  ? -19.884 -2.392  3.148   1.00 0.00 ? 46  MET A CE   1 
ATOM 464  H H    . MET A 1 46  ? -16.733 1.061   3.340   1.00 0.00 ? 46  MET A H    1 
ATOM 465  H HA   . MET A 1 46  ? -17.116 1.449   0.525   1.00 0.00 ? 46  MET A HA   1 
ATOM 466  H HB2  . MET A 1 46  ? -19.273 0.542   2.404   1.00 0.00 ? 46  MET A HB2  1 
ATOM 467  H HB3  . MET A 1 46  ? -19.003 0.081   0.729   1.00 0.00 ? 46  MET A HB3  1 
ATOM 468  H HG2  . MET A 1 46  ? -16.829 -0.975  1.604   1.00 0.00 ? 46  MET A HG2  1 
ATOM 469  H HG3  . MET A 1 46  ? -17.584 -0.843  3.189   1.00 0.00 ? 46  MET A HG3  1 
ATOM 470  H HE1  . MET A 1 46  ? -19.401 -2.068  4.058   1.00 0.00 ? 46  MET A HE1  1 
ATOM 471  H HE2  . MET A 1 46  ? -20.307 -3.375  3.295   1.00 0.00 ? 46  MET A HE2  1 
ATOM 472  H HE3  . MET A 1 46  ? -20.669 -1.698  2.890   1.00 0.00 ? 46  MET A HE3  1 
ATOM 473  N N    . GLY A 1 47  ? -18.197 3.747   2.338   1.00 0.00 ? 47  GLY A N    1 
ATOM 474  C CA   . GLY A 1 47  ? -18.990 4.961   2.383   1.00 0.00 ? 47  GLY A CA   1 
ATOM 475  C C    . GLY A 1 47  ? -18.149 6.225   2.423   1.00 0.00 ? 47  GLY A C    1 
ATOM 476  O O    . GLY A 1 47  ? -18.067 6.950   1.431   1.00 0.00 ? 47  GLY A O    1 
ATOM 477  H H    . GLY A 1 47  ? -17.464 3.616   2.974   1.00 0.00 ? 47  GLY A H    1 
ATOM 478  H HA2  . GLY A 1 47  ? -19.623 4.994   1.509   1.00 0.00 ? 47  GLY A HA2  1 
ATOM 479  H HA3  . GLY A 1 47  ? -19.615 4.934   3.264   1.00 0.00 ? 47  GLY A HA3  1 
ATOM 480  N N    . PRO A 1 48  ? -17.529 6.529   3.574   1.00 0.00 ? 48  PRO A N    1 
ATOM 481  C CA   . PRO A 1 48  ? -16.728 7.740   3.749   1.00 0.00 ? 48  PRO A CA   1 
ATOM 482  C C    . PRO A 1 48  ? -15.284 7.579   3.282   1.00 0.00 ? 48  PRO A C    1 
ATOM 483  O O    . PRO A 1 48  ? -14.682 8.521   2.766   1.00 0.00 ? 48  PRO A O    1 
ATOM 484  C CB   . PRO A 1 48  ? -16.776 7.949   5.260   1.00 0.00 ? 48  PRO A CB   1 
ATOM 485  C CG   . PRO A 1 48  ? -16.858 6.572   5.827   1.00 0.00 ? 48  PRO A CG   1 
ATOM 486  C CD   . PRO A 1 48  ? -17.595 5.731   4.812   1.00 0.00 ? 48  PRO A CD   1 
ATOM 487  H HA   . PRO A 1 48  ? -17.175 8.587   3.251   1.00 0.00 ? 48  PRO A HA   1 
ATOM 488  H HB2  . PRO A 1 48  ? -15.881 8.457   5.586   1.00 0.00 ? 48  PRO A HB2  1 
ATOM 489  H HB3  . PRO A 1 48  ? -17.645 8.537   5.519   1.00 0.00 ? 48  PRO A HB3  1 
ATOM 490  H HG2  . PRO A 1 48  ? -15.864 6.182   5.983   1.00 0.00 ? 48  PRO A HG2  1 
ATOM 491  H HG3  . PRO A 1 48  ? -17.403 6.592   6.759   1.00 0.00 ? 48  PRO A HG3  1 
ATOM 492  H HD2  . PRO A 1 48  ? -17.099 4.782   4.678   1.00 0.00 ? 48  PRO A HD2  1 
ATOM 493  H HD3  . PRO A 1 48  ? -18.619 5.582   5.119   1.00 0.00 ? 48  PRO A HD3  1 
ATOM 494  N N    . GLY A 1 49  ? -14.726 6.391   3.484   1.00 0.00 ? 49  GLY A N    1 
ATOM 495  C CA   . GLY A 1 49  ? -13.347 6.143   3.102   1.00 0.00 ? 49  GLY A CA   1 
ATOM 496  C C    . GLY A 1 49  ? -12.364 6.824   4.036   1.00 0.00 ? 49  GLY A C    1 
ATOM 497  O O    . GLY A 1 49  ? -12.585 7.961   4.454   1.00 0.00 ? 49  GLY A O    1 
ATOM 498  H H    . GLY A 1 49  ? -15.248 5.681   3.912   1.00 0.00 ? 49  GLY A H    1 
ATOM 499  H HA2  . GLY A 1 49  ? -13.164 5.079   3.117   1.00 0.00 ? 49  GLY A HA2  1 
ATOM 500  H HA3  . GLY A 1 49  ? -13.190 6.511   2.099   1.00 0.00 ? 49  GLY A HA3  1 
ATOM 501  N N    . VAL A 1 50  ? -11.284 6.127   4.379   1.00 0.00 ? 50  VAL A N    1 
ATOM 502  C CA   . VAL A 1 50  ? -10.275 6.683   5.276   1.00 0.00 ? 50  VAL A CA   1 
ATOM 503  C C    . VAL A 1 50  ? -9.309  7.590   4.512   1.00 0.00 ? 50  VAL A C    1 
ATOM 504  O O    . VAL A 1 50  ? -8.566  7.131   3.648   1.00 0.00 ? 50  VAL A O    1 
ATOM 505  C CB   . VAL A 1 50  ? -9.492  5.569   6.015   1.00 0.00 ? 50  VAL A CB   1 
ATOM 506  C CG1  . VAL A 1 50  ? -10.451 4.530   6.580   1.00 0.00 ? 50  VAL A CG1  1 
ATOM 507  C CG2  . VAL A 1 50  ? -8.467  4.902   5.108   1.00 0.00 ? 50  VAL A CG2  1 
ATOM 508  H H    . VAL A 1 50  ? -11.158 5.224   4.014   1.00 0.00 ? 50  VAL A H    1 
ATOM 509  H HA   . VAL A 1 50  ? -10.789 7.275   6.019   1.00 0.00 ? 50  VAL A HA   1 
ATOM 510  H HB   . VAL A 1 50  ? -8.963  6.020   6.839   1.00 0.00 ? 50  VAL A HB   1 
ATOM 511  H HG11 . VAL A 1 50  ? -10.356 3.611   6.018   1.00 0.00 ? 50  VAL A HG11 1 
ATOM 512  H HG12 . VAL A 1 50  ? -11.465 4.894   6.504   1.00 0.00 ? 50  VAL A HG12 1 
ATOM 513  H HG13 . VAL A 1 50  ? -10.212 4.344   7.617   1.00 0.00 ? 50  VAL A HG13 1 
ATOM 514  H HG21 . VAL A 1 50  ? -7.504  5.370   5.249   1.00 0.00 ? 50  VAL A HG21 1 
ATOM 515  H HG22 . VAL A 1 50  ? -8.772  5.010   4.079   1.00 0.00 ? 50  VAL A HG22 1 
ATOM 516  H HG23 . VAL A 1 50  ? -8.398  3.855   5.358   1.00 0.00 ? 50  VAL A HG23 1 
ATOM 517  N N    . SER A 1 51  ? -9.333  8.882   4.822   1.00 0.00 ? 51  SER A N    1 
ATOM 518  C CA   . SER A 1 51  ? -8.476  9.838   4.131   1.00 0.00 ? 51  SER A CA   1 
ATOM 519  C C    . SER A 1 51  ? -7.681  10.697  5.109   1.00 0.00 ? 51  SER A C    1 
ATOM 520  O O    . SER A 1 51  ? -8.239  11.286  6.035   1.00 0.00 ? 51  SER A O    1 
ATOM 521  C CB   . SER A 1 51  ? -9.316  10.734  3.219   1.00 0.00 ? 51  SER A CB   1 
ATOM 522  O OG   . SER A 1 51  ? -10.200 11.545  3.974   1.00 0.00 ? 51  SER A OG   1 
ATOM 523  H H    . SER A 1 51  ? -9.955  9.202   5.508   1.00 0.00 ? 51  SER A H    1 
ATOM 524  H HA   . SER A 1 51  ? -7.780  9.276   3.525   1.00 0.00 ? 51  SER A HA   1 
ATOM 525  H HB2  . SER A 1 51  ? -8.663  11.374  2.645   1.00 0.00 ? 51  SER A HB2  1 
ATOM 526  H HB3  . SER A 1 51  ? -9.897  10.118  2.549   1.00 0.00 ? 51  SER A HB3  1 
ATOM 527  H HG   . SER A 1 51  ? -11.019 11.068  4.127   1.00 0.00 ? 51  SER A HG   1 
ATOM 528  N N    . TYR A 1 52  ? -6.376  10.777  4.876   1.00 0.00 ? 52  TYR A N    1 
ATOM 529  C CA   . TYR A 1 52  ? -5.489  11.584  5.706   1.00 0.00 ? 52  TYR A CA   1 
ATOM 530  C C    . TYR A 1 52  ? -4.292  12.053  4.891   1.00 0.00 ? 52  TYR A C    1 
ATOM 531  O O    . TYR A 1 52  ? -4.168  11.726  3.711   1.00 0.00 ? 52  TYR A O    1 
ATOM 532  C CB   . TYR A 1 52  ? -5.008  10.792  6.924   1.00 0.00 ? 52  TYR A CB   1 
ATOM 533  C CG   . TYR A 1 52  ? -6.003  9.771   7.426   1.00 0.00 ? 52  TYR A CG   1 
ATOM 534  C CD1  . TYR A 1 52  ? -6.143  8.543   6.794   1.00 0.00 ? 52  TYR A CD1  1 
ATOM 535  C CD2  . TYR A 1 52  ? -6.802  10.035  8.531   1.00 0.00 ? 52  TYR A CD2  1 
ATOM 536  C CE1  . TYR A 1 52  ? -7.048  7.605   7.249   1.00 0.00 ? 52  TYR A CE1  1 
ATOM 537  C CE2  . TYR A 1 52  ? -7.712  9.103   8.992   1.00 0.00 ? 52  TYR A CE2  1 
ATOM 538  C CZ   . TYR A 1 52  ? -7.831  7.889   8.348   1.00 0.00 ? 52  TYR A CZ   1 
ATOM 539  O OH   . TYR A 1 52  ? -8.735  6.959   8.804   1.00 0.00 ? 52  TYR A OH   1 
ATOM 540  H H    . TYR A 1 52  ? -5.998  10.291  4.112   1.00 0.00 ? 52  TYR A H    1 
ATOM 541  H HA   . TYR A 1 52  ? -6.043  12.447  6.042   1.00 0.00 ? 52  TYR A HA   1 
ATOM 542  H HB2  . TYR A 1 52  ? -4.097  10.272  6.667   1.00 0.00 ? 52  TYR A HB2  1 
ATOM 543  H HB3  . TYR A 1 52  ? -4.804  11.480  7.731   1.00 0.00 ? 52  TYR A HB3  1 
ATOM 544  H HD1  . TYR A 1 52  ? -5.526  8.322   5.935   1.00 0.00 ? 52  TYR A HD1  1 
ATOM 545  H HD2  . TYR A 1 52  ? -6.707  10.987  9.033   1.00 0.00 ? 52  TYR A HD2  1 
ATOM 546  H HE1  . TYR A 1 52  ? -7.138  6.655   6.745   1.00 0.00 ? 52  TYR A HE1  1 
ATOM 547  H HE2  . TYR A 1 52  ? -8.325  9.326   9.853   1.00 0.00 ? 52  TYR A HE2  1 
ATOM 548  H HH   . TYR A 1 52  ? -9.607  7.357   8.853   1.00 0.00 ? 52  TYR A HH   1 
ATOM 549  N N    . LEU A 1 53  ? -3.418  12.828  5.518   1.00 0.00 ? 53  LEU A N    1 
ATOM 550  C CA   . LEU A 1 53  ? -2.232  13.330  4.838   1.00 0.00 ? 53  LEU A CA   1 
ATOM 551  C C    . LEU A 1 53  ? -1.081  12.343  4.962   1.00 0.00 ? 53  LEU A C    1 
ATOM 552  O O    . LEU A 1 53  ? -0.483  12.195  6.028   1.00 0.00 ? 53  LEU A O    1 
ATOM 553  C CB   . LEU A 1 53  ? -1.821  14.687  5.409   1.00 0.00 ? 53  LEU A CB   1 
ATOM 554  C CG   . LEU A 1 53  ? -2.360  15.900  4.648   1.00 0.00 ? 53  LEU A CG   1 
ATOM 555  C CD1  . LEU A 1 53  ? -2.103  17.177  5.433   1.00 0.00 ? 53  LEU A CD1  1 
ATOM 556  C CD2  . LEU A 1 53  ? -1.732  15.983  3.266   1.00 0.00 ? 53  LEU A CD2  1 
ATOM 557  H H    . LEU A 1 53  ? -3.563  13.051  6.461   1.00 0.00 ? 53  LEU A H    1 
ATOM 558  H HA   . LEU A 1 53  ? -2.477  13.447  3.792   1.00 0.00 ? 53  LEU A HA   1 
ATOM 559  H HB2  . LEU A 1 53  ? -2.170  14.743  6.426   1.00 0.00 ? 53  LEU A HB2  1 
ATOM 560  H HB3  . LEU A 1 53  ? -0.742  14.741  5.413   1.00 0.00 ? 53  LEU A HB3  1 
ATOM 561  H HG   . LEU A 1 53  ? -3.427  15.794  4.524   1.00 0.00 ? 53  LEU A HG   1 
ATOM 562  H HD11 . LEU A 1 53  ? -2.304  17.002  6.480   1.00 0.00 ? 53  LEU A HD11 1 
ATOM 563  H HD12 . LEU A 1 53  ? -2.751  17.960  5.069   1.00 0.00 ? 53  LEU A HD12 1 
ATOM 564  H HD13 . LEU A 1 53  ? -1.072  17.474  5.309   1.00 0.00 ? 53  LEU A HD13 1 
ATOM 565  H HD21 . LEU A 1 53  ? -1.259  15.042  3.027   1.00 0.00 ? 53  LEU A HD21 1 
ATOM 566  H HD22 . LEU A 1 53  ? -0.992  16.770  3.254   1.00 0.00 ? 53  LEU A HD22 1 
ATOM 567  H HD23 . LEU A 1 53  ? -2.497  16.197  2.535   1.00 0.00 ? 53  LEU A HD23 1 
ATOM 568  N N    . VAL A 1 54  ? -0.778  11.669  3.861   1.00 0.00 ? 54  VAL A N    1 
ATOM 569  C CA   . VAL A 1 54  ? 0.303   10.692  3.830   1.00 0.00 ? 54  VAL A CA   1 
ATOM 570  C C    . VAL A 1 54  ? 1.276   11.000  2.697   1.00 0.00 ? 54  VAL A C    1 
ATOM 571  O O    . VAL A 1 54  ? 0.863   11.321  1.582   1.00 0.00 ? 54  VAL A O    1 
ATOM 572  C CB   . VAL A 1 54  ? -0.231  9.254   3.658   1.00 0.00 ? 54  VAL A CB   1 
ATOM 573  C CG1  . VAL A 1 54  ? -0.570  8.640   5.007   1.00 0.00 ? 54  VAL A CG1  1 
ATOM 574  C CG2  . VAL A 1 54  ? -1.442  9.233   2.737   1.00 0.00 ? 54  VAL A CG2  1 
ATOM 575  H H    . VAL A 1 54  ? -1.293  11.838  3.045   1.00 0.00 ? 54  VAL A H    1 
ATOM 576  H HA   . VAL A 1 54  ? 0.831   10.747  4.770   1.00 0.00 ? 54  VAL A HA   1 
ATOM 577  H HB   . VAL A 1 54  ? 0.546   8.657   3.204   1.00 0.00 ? 54  VAL A HB   1 
ATOM 578  H HG11 . VAL A 1 54  ? -1.609  8.829   5.239   1.00 0.00 ? 54  VAL A HG11 1 
ATOM 579  H HG12 . VAL A 1 54  ? 0.055   9.081   5.770   1.00 0.00 ? 54  VAL A HG12 1 
ATOM 580  H HG13 . VAL A 1 54  ? -0.396  7.574   4.971   1.00 0.00 ? 54  VAL A HG13 1 
ATOM 581  H HG21 . VAL A 1 54  ? -1.447  10.124  2.128   1.00 0.00 ? 54  VAL A HG21 1 
ATOM 582  H HG22 . VAL A 1 54  ? -2.346  9.197   3.330   1.00 0.00 ? 54  VAL A HG22 1 
ATOM 583  H HG23 . VAL A 1 54  ? -1.395  8.362   2.101   1.00 0.00 ? 54  VAL A HG23 1 
ATOM 584  N N    . ARG A 1 55  ? 2.568   10.910  2.990   1.00 0.00 ? 55  ARG A N    1 
ATOM 585  C CA   . ARG A 1 55  ? 3.593   11.182  1.990   1.00 0.00 ? 55  ARG A CA   1 
ATOM 586  C C    . ARG A 1 55  ? 3.832   9.962   1.111   1.00 0.00 ? 55  ARG A C    1 
ATOM 587  O O    . ARG A 1 55  ? 4.316   8.929   1.575   1.00 0.00 ? 55  ARG A O    1 
ATOM 588  C CB   . ARG A 1 55  ? 4.900   11.597  2.662   1.00 0.00 ? 55  ARG A CB   1 
ATOM 589  C CG   . ARG A 1 55  ? 5.069   13.103  2.796   1.00 0.00 ? 55  ARG A CG   1 
ATOM 590  C CD   . ARG A 1 55  ? 5.905   13.463  4.012   1.00 0.00 ? 55  ARG A CD   1 
ATOM 591  N NE   . ARG A 1 55  ? 5.284   14.516  4.810   1.00 0.00 ? 55  ARG A NE   1 
ATOM 592  C CZ   . ARG A 1 55  ? 4.195   14.333  5.549   1.00 0.00 ? 55  ARG A CZ   1 
ATOM 593  N NH1  . ARG A 1 55  ? 3.612   13.143  5.593   1.00 0.00 ? 55  ARG A NH1  1 
ATOM 594  N NH2  . ARG A 1 55  ? 3.689   15.340  6.247   1.00 0.00 ? 55  ARG A NH2  1 
ATOM 595  H H    . ARG A 1 55  ? 2.838   10.651  3.896   1.00 0.00 ? 55  ARG A H    1 
ATOM 596  H HA   . ARG A 1 55  ? 3.243   11.994  1.370   1.00 0.00 ? 55  ARG A HA   1 
ATOM 597  H HB2  . ARG A 1 55  ? 4.933   11.163  3.646   1.00 0.00 ? 55  ARG A HB2  1 
ATOM 598  H HB3  . ARG A 1 55  ? 5.726   11.215  2.082   1.00 0.00 ? 55  ARG A HB3  1 
ATOM 599  H HG2  . ARG A 1 55  ? 5.558   13.480  1.910   1.00 0.00 ? 55  ARG A HG2  1 
ATOM 600  H HG3  . ARG A 1 55  ? 4.095   13.560  2.893   1.00 0.00 ? 55  ARG A HG3  1 
ATOM 601  H HD2  . ARG A 1 55  ? 6.023   12.582  4.625   1.00 0.00 ? 55  ARG A HD2  1 
ATOM 602  H HD3  . ARG A 1 55  ? 6.875   13.801  3.679   1.00 0.00 ? 55  ARG A HD3  1 
ATOM 603  H HE   . ARG A 1 55  ? 5.699   15.404  4.792   1.00 0.00 ? 55  ARG A HE   1 
ATOM 604  H HH11 . ARG A 1 55  ? 3.991   12.381  5.068   1.00 0.00 ? 55  ARG A HH11 1 
ATOM 605  H HH12 . ARG A 1 55  ? 2.793   13.008  6.150   1.00 0.00 ? 55  ARG A HH12 1 
ATOM 606  H HH21 . ARG A 1 55  ? 4.126   16.239  6.217   1.00 0.00 ? 55  ARG A HH21 1 
ATOM 607  H HH22 . ARG A 1 55  ? 2.870   15.201  6.803   1.00 0.00 ? 55  ARG A HH22 1 
ATOM 608  N N    . TYR A 1 56  ? 3.485   10.094  -0.160  1.00 0.00 ? 56  TYR A N    1 
ATOM 609  C CA   . TYR A 1 56  ? 3.672   9.019   -1.125  1.00 0.00 ? 56  TYR A CA   1 
ATOM 610  C C    . TYR A 1 56  ? 5.144   8.891   -1.498  1.00 0.00 ? 56  TYR A C    1 
ATOM 611  O O    . TYR A 1 56  ? 5.740   9.819   -2.046  1.00 0.00 ? 56  TYR A O    1 
ATOM 612  C CB   . TYR A 1 56  ? 2.831   9.276   -2.377  1.00 0.00 ? 56  TYR A CB   1 
ATOM 613  C CG   . TYR A 1 56  ? 2.972   8.202   -3.432  1.00 0.00 ? 56  TYR A CG   1 
ATOM 614  C CD1  . TYR A 1 56  ? 2.657   6.879   -3.150  1.00 0.00 ? 56  TYR A CD1  1 
ATOM 615  C CD2  . TYR A 1 56  ? 3.420   8.512   -4.710  1.00 0.00 ? 56  TYR A CD2  1 
ATOM 616  C CE1  . TYR A 1 56  ? 2.785   5.895   -4.112  1.00 0.00 ? 56  TYR A CE1  1 
ATOM 617  C CE2  . TYR A 1 56  ? 3.550   7.533   -5.677  1.00 0.00 ? 56  TYR A CE2  1 
ATOM 618  C CZ   . TYR A 1 56  ? 3.231   6.227   -5.373  1.00 0.00 ? 56  TYR A CZ   1 
ATOM 619  O OH   . TYR A 1 56  ? 3.359   5.250   -6.334  1.00 0.00 ? 56  TYR A OH   1 
ATOM 620  H H    . TYR A 1 56  ? 3.116   10.949  -0.462  1.00 0.00 ? 56  TYR A H    1 
ATOM 621  H HA   . TYR A 1 56  ? 3.347   8.098   -0.663  1.00 0.00 ? 56  TYR A HA   1 
ATOM 622  H HB2  . TYR A 1 56  ? 1.790   9.331   -2.097  1.00 0.00 ? 56  TYR A HB2  1 
ATOM 623  H HB3  . TYR A 1 56  ? 3.130   10.216  -2.817  1.00 0.00 ? 56  TYR A HB3  1 
ATOM 624  H HD1  . TYR A 1 56  ? 2.308   6.622   -2.161  1.00 0.00 ? 56  TYR A HD1  1 
ATOM 625  H HD2  . TYR A 1 56  ? 3.669   9.536   -4.946  1.00 0.00 ? 56  TYR A HD2  1 
ATOM 626  H HE1  . TYR A 1 56  ? 2.535   4.871   -3.873  1.00 0.00 ? 56  TYR A HE1  1 
ATOM 627  H HE2  . TYR A 1 56  ? 3.900   7.794   -6.665  1.00 0.00 ? 56  TYR A HE2  1 
ATOM 628  H HH   . TYR A 1 56  ? 4.108   4.688   -6.122  1.00 0.00 ? 56  TYR A HH   1 
ATOM 629  N N    . MET A 1 57  ? 5.730   7.744   -1.178  1.00 0.00 ? 57  MET A N    1 
ATOM 630  C CA   . MET A 1 57  ? 7.139   7.503   -1.454  1.00 0.00 ? 57  MET A CA   1 
ATOM 631  C C    . MET A 1 57  ? 7.322   6.601   -2.672  1.00 0.00 ? 57  MET A C    1 
ATOM 632  O O    . MET A 1 57  ? 6.512   5.705   -2.927  1.00 0.00 ? 57  MET A O    1 
ATOM 633  C CB   . MET A 1 57  ? 7.810   6.885   -0.227  1.00 0.00 ? 57  MET A CB   1 
ATOM 634  C CG   . MET A 1 57  ? 7.509   7.632   1.063   1.00 0.00 ? 57  MET A CG   1 
ATOM 635  S SD   . MET A 1 57  ? 8.518   9.114   1.261   1.00 0.00 ? 57  MET A SD   1 
ATOM 636  C CE   . MET A 1 57  ? 10.164  8.437   1.061   1.00 0.00 ? 57  MET A CE   1 
ATOM 637  H H    . MET A 1 57  ? 5.205   7.048   -0.731  1.00 0.00 ? 57  MET A H    1 
ATOM 638  H HA   . MET A 1 57  ? 7.601   8.458   -1.660  1.00 0.00 ? 57  MET A HA   1 
ATOM 639  H HB2  . MET A 1 57  ? 7.465   5.870   -0.116  1.00 0.00 ? 57  MET A HB2  1 
ATOM 640  H HB3  . MET A 1 57  ? 8.880   6.880   -0.378  1.00 0.00 ? 57  MET A HB3  1 
ATOM 641  H HG2  . MET A 1 57  ? 6.469   7.921   1.059   1.00 0.00 ? 57  MET A HG2  1 
ATOM 642  H HG3  . MET A 1 57  ? 7.693   6.972   1.898   1.00 0.00 ? 57  MET A HG3  1 
ATOM 643  H HE1  . MET A 1 57  ? 10.117  7.359   1.101   1.00 0.00 ? 57  MET A HE1  1 
ATOM 644  H HE2  . MET A 1 57  ? 10.800  8.799   1.855   1.00 0.00 ? 57  MET A HE2  1 
ATOM 645  H HE3  . MET A 1 57  ? 10.566  8.744   0.107   1.00 0.00 ? 57  MET A HE3  1 
ATOM 646  N N    . GLY A 1 58  ? 8.394   6.854   -3.420  1.00 0.00 ? 58  GLY A N    1 
ATOM 647  C CA   . GLY A 1 58  ? 8.680   6.092   -4.624  1.00 0.00 ? 58  GLY A CA   1 
ATOM 648  C C    . GLY A 1 58  ? 8.468   4.600   -4.460  1.00 0.00 ? 58  GLY A C    1 
ATOM 649  O O    . GLY A 1 58  ? 8.269   4.108   -3.349  1.00 0.00 ? 58  GLY A O    1 
ATOM 650  H H    . GLY A 1 58  ? 8.989   7.589   -3.162  1.00 0.00 ? 58  GLY A H    1 
ATOM 651  H HA2  . GLY A 1 58  ? 8.038   6.447   -5.418  1.00 0.00 ? 58  GLY A HA2  1 
ATOM 652  H HA3  . GLY A 1 58  ? 9.707   6.266   -4.906  1.00 0.00 ? 58  GLY A HA3  1 
ATOM 653  N N    . CYS A 1 59  ? 8.523   3.879   -5.575  1.00 0.00 ? 59  CYS A N    1 
ATOM 654  C CA   . CYS A 1 59  ? 8.333   2.434   -5.563  1.00 0.00 ? 59  CYS A CA   1 
ATOM 655  C C    . CYS A 1 59  ? 9.672   1.706   -5.570  1.00 0.00 ? 59  CYS A C    1 
ATOM 656  O O    . CYS A 1 59  ? 10.709  2.296   -5.870  1.00 0.00 ? 59  CYS A O    1 
ATOM 657  C CB   . CYS A 1 59  ? 7.499   2.000   -6.771  1.00 0.00 ? 59  CYS A CB   1 
ATOM 658  S SG   . CYS A 1 59  ? 6.029   3.014   -7.058  1.00 0.00 ? 59  CYS A SG   1 
ATOM 659  H H    . CYS A 1 59  ? 8.691   4.332   -6.429  1.00 0.00 ? 59  CYS A H    1 
ATOM 660  H HA   . CYS A 1 59  ? 7.802   2.177   -4.658  1.00 0.00 ? 59  CYS A HA   1 
ATOM 661  H HB2  . CYS A 1 59  ? 8.112   2.052   -7.658  1.00 0.00 ? 59  CYS A HB2  1 
ATOM 662  H HB3  . CYS A 1 59  ? 7.172   0.981   -6.624  1.00 0.00 ? 59  CYS A HB3  1 
ATOM 663  H HG   . CYS A 1 59  ? 6.033   3.729   -6.417  1.00 0.00 ? 59  CYS A HG   1 
ATOM 664  N N    . VAL A 1 60  ? 9.638   0.419   -5.242  1.00 0.00 ? 60  VAL A N    1 
ATOM 665  C CA   . VAL A 1 60  ? 10.845  -0.395  -5.200  1.00 0.00 ? 60  VAL A CA   1 
ATOM 666  C C    . VAL A 1 60  ? 10.718  -1.612  -6.113  1.00 0.00 ? 60  VAL A C    1 
ATOM 667  O O    . VAL A 1 60  ? 9.863   -2.472  -5.902  1.00 0.00 ? 60  VAL A O    1 
ATOM 668  C CB   . VAL A 1 60  ? 11.147  -0.871  -3.766  1.00 0.00 ? 60  VAL A CB   1 
ATOM 669  C CG1  . VAL A 1 60  ? 11.348  0.319   -2.838  1.00 0.00 ? 60  VAL A CG1  1 
ATOM 670  C CG2  . VAL A 1 60  ? 10.032  -1.771  -3.254  1.00 0.00 ? 60  VAL A CG2  1 
ATOM 671  H H    . VAL A 1 60  ? 8.778   0.009   -5.012  1.00 0.00 ? 60  VAL A H    1 
ATOM 672  H HA   . VAL A 1 60  ? 11.672  0.212   -5.538  1.00 0.00 ? 60  VAL A HA   1 
ATOM 673  H HB   . VAL A 1 60  ? 12.063  -1.444  -3.783  1.00 0.00 ? 60  VAL A HB   1 
ATOM 674  H HG11 . VAL A 1 60  ? 11.312  1.234   -3.411  1.00 0.00 ? 60  VAL A HG11 1 
ATOM 675  H HG12 . VAL A 1 60  ? 12.309  0.238   -2.351  1.00 0.00 ? 60  VAL A HG12 1 
ATOM 676  H HG13 . VAL A 1 60  ? 10.567  0.330   -2.092  1.00 0.00 ? 60  VAL A HG13 1 
ATOM 677  H HG21 . VAL A 1 60  ? 9.205   -1.749  -3.948  1.00 0.00 ? 60  VAL A HG21 1 
ATOM 678  H HG22 . VAL A 1 60  ? 9.701   -1.420  -2.288  1.00 0.00 ? 60  VAL A HG22 1 
ATOM 679  H HG23 . VAL A 1 60  ? 10.400  -2.783  -3.163  1.00 0.00 ? 60  VAL A HG23 1 
ATOM 680  N N    . GLU A 1 61  ? 11.570  -1.676  -7.131  1.00 0.00 ? 61  GLU A N    1 
ATOM 681  C CA   . GLU A 1 61  ? 11.552  -2.790  -8.073  1.00 0.00 ? 61  GLU A CA   1 
ATOM 682  C C    . GLU A 1 61  ? 12.213  -4.022  -7.466  1.00 0.00 ? 61  GLU A C    1 
ATOM 683  O O    . GLU A 1 61  ? 13.404  -4.009  -7.152  1.00 0.00 ? 61  GLU A O    1 
ATOM 684  C CB   . GLU A 1 61  ? 12.265  -2.400  -9.370  1.00 0.00 ? 61  GLU A CB   1 
ATOM 685  C CG   . GLU A 1 61  ? 11.838  -3.229  -10.570 1.00 0.00 ? 61  GLU A CG   1 
ATOM 686  C CD   . GLU A 1 61  ? 10.381  -3.021  -10.931 1.00 0.00 ? 61  GLU A CD   1 
ATOM 687  O OE1  . GLU A 1 61  ? 9.711   -2.214  -10.253 1.00 0.00 ? 61  GLU A OE1  1 
ATOM 688  O OE2  . GLU A 1 61  ? 9.910   -3.666  -11.891 1.00 0.00 ? 61  GLU A OE2  1 
ATOM 689  H H    . GLU A 1 61  ? 12.230  -0.961  -7.249  1.00 0.00 ? 61  GLU A H    1 
ATOM 690  H HA   . GLU A 1 61  ? 10.521  -3.021  -8.293  1.00 0.00 ? 61  GLU A HA   1 
ATOM 691  H HB2  . GLU A 1 61  ? 12.057  -1.362  -9.584  1.00 0.00 ? 61  GLU A HB2  1 
ATOM 692  H HB3  . GLU A 1 61  ? 13.329  -2.524  -9.233  1.00 0.00 ? 61  GLU A HB3  1 
ATOM 693  H HG2  . GLU A 1 61  ? 12.448  -2.952  -11.417 1.00 0.00 ? 61  GLU A HG2  1 
ATOM 694  H HG3  . GLU A 1 61  ? 11.992  -4.274  -10.343 1.00 0.00 ? 61  GLU A HG3  1 
ATOM 695  N N    . VAL A 1 62  ? 11.432  -5.086  -7.300  1.00 0.00 ? 62  VAL A N    1 
ATOM 696  C CA   . VAL A 1 62  ? 11.941  -6.325  -6.722  1.00 0.00 ? 62  VAL A CA   1 
ATOM 697  C C    . VAL A 1 62  ? 12.063  -7.419  -7.778  1.00 0.00 ? 62  VAL A C    1 
ATOM 698  O O    . VAL A 1 62  ? 11.274  -7.476  -8.722  1.00 0.00 ? 62  VAL A O    1 
ATOM 699  C CB   . VAL A 1 62  ? 11.037  -6.825  -5.579  1.00 0.00 ? 62  VAL A CB   1 
ATOM 700  C CG1  . VAL A 1 62  ? 11.739  -7.909  -4.775  1.00 0.00 ? 62  VAL A CG1  1 
ATOM 701  C CG2  . VAL A 1 62  ? 10.624  -5.670  -4.681  1.00 0.00 ? 62  VAL A CG2  1 
ATOM 702  H H    . VAL A 1 62  ? 10.491  -5.034  -7.566  1.00 0.00 ? 62  VAL A H    1 
ATOM 703  H HA   . VAL A 1 62  ? 12.919  -6.123  -6.314  1.00 0.00 ? 62  VAL A HA   1 
ATOM 704  H HB   . VAL A 1 62  ? 10.145  -7.251  -6.013  1.00 0.00 ? 62  VAL A HB   1 
ATOM 705  H HG11 . VAL A 1 62  ? 11.020  -8.413  -4.146  1.00 0.00 ? 62  VAL A HG11 1 
ATOM 706  H HG12 . VAL A 1 62  ? 12.505  -7.462  -4.159  1.00 0.00 ? 62  VAL A HG12 1 
ATOM 707  H HG13 . VAL A 1 62  ? 12.189  -8.622  -5.449  1.00 0.00 ? 62  VAL A HG13 1 
ATOM 708  H HG21 . VAL A 1 62  ? 9.839   -5.104  -5.160  1.00 0.00 ? 62  VAL A HG21 1 
ATOM 709  H HG22 . VAL A 1 62  ? 11.475  -5.029  -4.505  1.00 0.00 ? 62  VAL A HG22 1 
ATOM 710  H HG23 . VAL A 1 62  ? 10.264  -6.058  -3.739  1.00 0.00 ? 62  VAL A HG23 1 
ATOM 711  N N    . LEU A 1 63  ? 13.056  -8.287  -7.610  1.00 0.00 ? 63  LEU A N    1 
ATOM 712  C CA   . LEU A 1 63  ? 13.289  -9.377  -8.552  1.00 0.00 ? 63  LEU A CA   1 
ATOM 713  C C    . LEU A 1 63  ? 13.051  -10.733 -7.894  1.00 0.00 ? 63  LEU A C    1 
ATOM 714  O O    . LEU A 1 63  ? 12.749  -11.717 -8.570  1.00 0.00 ? 63  LEU A O    1 
ATOM 715  C CB   . LEU A 1 63  ? 14.717  -9.309  -9.095  1.00 0.00 ? 63  LEU A CB   1 
ATOM 716  C CG   . LEU A 1 63  ? 14.938  -8.286  -10.211 1.00 0.00 ? 63  LEU A CG   1 
ATOM 717  C CD1  . LEU A 1 63  ? 14.262  -8.744  -11.494 1.00 0.00 ? 63  LEU A CD1  1 
ATOM 718  C CD2  . LEU A 1 63  ? 14.422  -6.919  -9.791  1.00 0.00 ? 63  LEU A CD2  1 
ATOM 719  H H    . LEU A 1 63  ? 13.653  -8.186  -6.840  1.00 0.00 ? 63  LEU A H    1 
ATOM 720  H HA   . LEU A 1 63  ? 12.594  -9.261  -9.370  1.00 0.00 ? 63  LEU A HA   1 
ATOM 721  H HB2  . LEU A 1 63  ? 15.379  -9.066  -8.277  1.00 0.00 ? 63  LEU A HB2  1 
ATOM 722  H HB3  . LEU A 1 63  ? 14.983  -10.285 -9.472  1.00 0.00 ? 63  LEU A HB3  1 
ATOM 723  H HG   . LEU A 1 63  ? 15.997  -8.198  -10.405 1.00 0.00 ? 63  LEU A HG   1 
ATOM 724  H HD11 . LEU A 1 63  ? 14.771  -9.616  -11.878 1.00 0.00 ? 63  LEU A HD11 1 
ATOM 725  H HD12 . LEU A 1 63  ? 14.305  -7.952  -12.226 1.00 0.00 ? 63  LEU A HD12 1 
ATOM 726  H HD13 . LEU A 1 63  ? 13.231  -8.991  -11.290 1.00 0.00 ? 63  LEU A HD13 1 
ATOM 727  H HD21 . LEU A 1 63  ? 14.978  -6.150  -10.307 1.00 0.00 ? 63  LEU A HD21 1 
ATOM 728  H HD22 . LEU A 1 63  ? 14.547  -6.798  -8.725  1.00 0.00 ? 63  LEU A HD22 1 
ATOM 729  H HD23 . LEU A 1 63  ? 13.375  -6.836  -10.043 1.00 0.00 ? 63  LEU A HD23 1 
ATOM 730  N N    . GLN A 1 64  ? 13.187  -10.779 -6.571  1.00 0.00 ? 64  GLN A N    1 
ATOM 731  C CA   . GLN A 1 64  ? 12.997  -12.016 -5.818  1.00 0.00 ? 64  GLN A CA   1 
ATOM 732  C C    . GLN A 1 64  ? 11.743  -12.760 -6.272  1.00 0.00 ? 64  GLN A C    1 
ATOM 733  O O    . GLN A 1 64  ? 10.861  -12.182 -6.907  1.00 0.00 ? 64  GLN A O    1 
ATOM 734  C CB   . GLN A 1 64  ? 12.906  -11.713 -4.320  1.00 0.00 ? 64  GLN A CB   1 
ATOM 735  C CG   . GLN A 1 64  ? 11.623  -11.002 -3.920  1.00 0.00 ? 64  GLN A CG   1 
ATOM 736  C CD   . GLN A 1 64  ? 10.769  -11.826 -2.978  1.00 0.00 ? 64  GLN A CD   1 
ATOM 737  O OE1  . GLN A 1 64  ? 11.007  -11.856 -1.770  1.00 0.00 ? 64  GLN A OE1  1 
ATOM 738  N NE2  . GLN A 1 64  ? 9.765   -12.501 -3.526  1.00 0.00 ? 64  GLN A NE2  1 
ATOM 739  H H    . GLN A 1 64  ? 13.435  -9.963  -6.089  1.00 0.00 ? 64  GLN A H    1 
ATOM 740  H HA   . GLN A 1 64  ? 13.857  -12.645 -5.996  1.00 0.00 ? 64  GLN A HA   1 
ATOM 741  H HB2  . GLN A 1 64  ? 12.963  -12.642 -3.773  1.00 0.00 ? 64  GLN A HB2  1 
ATOM 742  H HB3  . GLN A 1 64  ? 13.741  -11.088 -4.040  1.00 0.00 ? 64  GLN A HB3  1 
ATOM 743  H HG2  . GLN A 1 64  ? 11.879  -10.074 -3.432  1.00 0.00 ? 64  GLN A HG2  1 
ATOM 744  H HG3  . GLN A 1 64  ? 11.050  -10.793 -4.812  1.00 0.00 ? 64  GLN A HG3  1 
ATOM 745  H HE21 . GLN A 1 64  ? 9.634   -12.431 -4.495  1.00 0.00 ? 64  GLN A HE21 1 
ATOM 746  H HE22 . GLN A 1 64  ? 9.196   -13.043 -2.939  1.00 0.00 ? 64  GLN A HE22 1 
ATOM 747  N N    . SER A 1 65  ? 11.677  -14.047 -5.945  1.00 0.00 ? 65  SER A N    1 
ATOM 748  C CA   . SER A 1 65  ? 10.535  -14.875 -6.316  1.00 0.00 ? 65  SER A CA   1 
ATOM 749  C C    . SER A 1 65  ? 10.634  -16.255 -5.672  1.00 0.00 ? 65  SER A C    1 
ATOM 750  O O    . SER A 1 65  ? 9.847   -16.597 -4.790  1.00 0.00 ? 65  SER A O    1 
ATOM 751  C CB   . SER A 1 65  ? 10.452  -15.015 -7.837  1.00 0.00 ? 65  SER A CB   1 
ATOM 752  O OG   . SER A 1 65  ? 11.739  -14.959 -8.426  1.00 0.00 ? 65  SER A OG   1 
ATOM 753  H H    . SER A 1 65  ? 12.413  -14.449 -5.438  1.00 0.00 ? 65  SER A H    1 
ATOM 754  H HA   . SER A 1 65  ? 9.641   -14.387 -5.957  1.00 0.00 ? 65  SER A HA   1 
ATOM 755  H HB2  . SER A 1 65  ? 9.997   -15.963 -8.085  1.00 0.00 ? 65  SER A HB2  1 
ATOM 756  H HB3  . SER A 1 65  ? 9.851   -14.212 -8.238  1.00 0.00 ? 65  SER A HB3  1 
ATOM 757  H HG   . SER A 1 65  ? 11.673  -15.166 -9.361  1.00 0.00 ? 65  SER A HG   1 
ATOM 758  N N    . MET A 1 66  ? 11.608  -17.042 -6.119  1.00 0.00 ? 66  MET A N    1 
ATOM 759  C CA   . MET A 1 66  ? 11.815  -18.382 -5.582  1.00 0.00 ? 66  MET A CA   1 
ATOM 760  C C    . MET A 1 66  ? 13.135  -18.461 -4.823  1.00 0.00 ? 66  MET A C    1 
ATOM 761  O O    . MET A 1 66  ? 13.153  -18.620 -3.602  1.00 0.00 ? 66  MET A O    1 
ATOM 762  C CB   . MET A 1 66  ? 11.800  -19.415 -6.711  1.00 0.00 ? 66  MET A CB   1 
ATOM 763  C CG   . MET A 1 66  ? 10.695  -20.449 -6.573  1.00 0.00 ? 66  MET A CG   1 
ATOM 764  S SD   . MET A 1 66  ? 10.186  -21.138 -8.160  1.00 0.00 ? 66  MET A SD   1 
ATOM 765  C CE   . MET A 1 66  ? 8.429   -20.794 -8.131  1.00 0.00 ? 66  MET A CE   1 
ATOM 766  H H    . MET A 1 66  ? 12.205  -16.711 -6.822  1.00 0.00 ? 66  MET A H    1 
ATOM 767  H HA   . MET A 1 66  ? 11.007  -18.594 -4.898  1.00 0.00 ? 66  MET A HA   1 
ATOM 768  H HB2  . MET A 1 66  ? 11.668  -18.901 -7.652  1.00 0.00 ? 66  MET A HB2  1 
ATOM 769  H HB3  . MET A 1 66  ? 12.748  -19.933 -6.723  1.00 0.00 ? 66  MET A HB3  1 
ATOM 770  H HG2  . MET A 1 66  ? 11.049  -21.253 -5.945  1.00 0.00 ? 66  MET A HG2  1 
ATOM 771  H HG3  . MET A 1 66  ? 9.839   -19.982 -6.109  1.00 0.00 ? 66  MET A HG3  1 
ATOM 772  H HE1  . MET A 1 66  ? 8.249   -19.803 -8.520  1.00 0.00 ? 66  MET A HE1  1 
ATOM 773  H HE2  . MET A 1 66  ? 8.067   -20.853 -7.115  1.00 0.00 ? 66  MET A HE2  1 
ATOM 774  H HE3  . MET A 1 66  ? 7.910   -21.520 -8.740  1.00 0.00 ? 66  MET A HE3  1 
ATOM 775  N N    . ARG A 1 67  ? 14.239  -18.347 -5.554  1.00 0.00 ? 67  ARG A N    1 
ATOM 776  C CA   . ARG A 1 67  ? 15.565  -18.397 -4.951  1.00 0.00 ? 67  ARG A CA   1 
ATOM 777  C C    . ARG A 1 67  ? 15.801  -17.181 -4.062  1.00 0.00 ? 67  ARG A C    1 
ATOM 778  O O    . ARG A 1 67  ? 16.413  -16.200 -4.485  1.00 0.00 ? 67  ARG A O    1 
ATOM 779  C CB   . ARG A 1 67  ? 16.638  -18.466 -6.040  1.00 0.00 ? 67  ARG A CB   1 
ATOM 780  C CG   . ARG A 1 67  ? 18.034  -18.738 -5.505  1.00 0.00 ? 67  ARG A CG   1 
ATOM 781  C CD   . ARG A 1 67  ? 19.082  -18.618 -6.599  1.00 0.00 ? 67  ARG A CD   1 
ATOM 782  N NE   . ARG A 1 67  ? 18.612  -19.159 -7.871  1.00 0.00 ? 67  ARG A NE   1 
ATOM 783  C CZ   . ARG A 1 67  ? 18.590  -20.457 -8.155  1.00 0.00 ? 67  ARG A CZ   1 
ATOM 784  N NH1  . ARG A 1 67  ? 19.010  -21.341 -7.260  1.00 0.00 ? 67  ARG A NH1  1 
ATOM 785  N NH2  . ARG A 1 67  ? 18.147  -20.873 -9.334  1.00 0.00 ? 67  ARG A NH2  1 
ATOM 786  H H    . ARG A 1 67  ? 14.159  -18.218 -6.523  1.00 0.00 ? 67  ARG A H    1 
ATOM 787  H HA   . ARG A 1 67  ? 15.620  -19.289 -4.344  1.00 0.00 ? 67  ARG A HA   1 
ATOM 788  H HB2  . ARG A 1 67  ? 16.382  -19.254 -6.732  1.00 0.00 ? 67  ARG A HB2  1 
ATOM 789  H HB3  . ARG A 1 67  ? 16.657  -17.525 -6.570  1.00 0.00 ? 67  ARG A HB3  1 
ATOM 790  H HG2  . ARG A 1 67  ? 18.257  -18.024 -4.726  1.00 0.00 ? 67  ARG A HG2  1 
ATOM 791  H HG3  . ARG A 1 67  ? 18.065  -19.739 -5.099  1.00 0.00 ? 67  ARG A HG3  1 
ATOM 792  H HD2  . ARG A 1 67  ? 19.327  -17.574 -6.732  1.00 0.00 ? 67  ARG A HD2  1 
ATOM 793  H HD3  . ARG A 1 67  ? 19.966  -19.158 -6.294  1.00 0.00 ? 67  ARG A HD3  1 
ATOM 794  H HE   . ARG A 1 67  ? 18.296  -18.523 -8.546  1.00 0.00 ? 67  ARG A HE   1 
ATOM 795  H HH11 . ARG A 1 67  ? 19.344  -21.031 -6.370  1.00 0.00 ? 67  ARG A HH11 1 
ATOM 796  H HH12 . ARG A 1 67  ? 18.993  -22.317 -7.475  1.00 0.00 ? 67  ARG A HH12 1 
ATOM 797  H HH21 . ARG A 1 67  ? 17.829  -20.209 -10.011 1.00 0.00 ? 67  ARG A HH21 1 
ATOM 798  H HH22 . ARG A 1 67  ? 18.131  -21.850 -9.546  1.00 0.00 ? 67  ARG A HH22 1 
ATOM 799  N N    . ALA A 1 68  ? 15.306  -17.248 -2.830  1.00 0.00 ? 68  ALA A N    1 
ATOM 800  C CA   . ALA A 1 68  ? 15.454  -16.146 -1.886  1.00 0.00 ? 68  ALA A CA   1 
ATOM 801  C C    . ALA A 1 68  ? 16.112  -16.610 -0.591  1.00 0.00 ? 68  ALA A C    1 
ATOM 802  O O    . ALA A 1 68  ? 16.720  -17.679 -0.537  1.00 0.00 ? 68  ALA A O    1 
ATOM 803  C CB   . ALA A 1 68  ? 14.099  -15.519 -1.592  1.00 0.00 ? 68  ALA A CB   1 
ATOM 804  H H    . ALA A 1 68  ? 14.822  -18.054 -2.552  1.00 0.00 ? 68  ALA A H    1 
ATOM 805  H HA   . ALA A 1 68  ? 16.078  -15.395 -2.346  1.00 0.00 ? 68  ALA A HA   1 
ATOM 806  H HB1  . ALA A 1 68  ? 14.204  -14.446 -1.534  1.00 0.00 ? 68  ALA A HB1  1 
ATOM 807  H HB2  . ALA A 1 68  ? 13.725  -15.895 -0.651  1.00 0.00 ? 68  ALA A HB2  1 
ATOM 808  H HB3  . ALA A 1 68  ? 13.407  -15.771 -2.382  1.00 0.00 ? 68  ALA A HB3  1 
ATOM 809  N N    . LEU A 1 69  ? 15.984  -15.796 0.453   1.00 0.00 ? 69  LEU A N    1 
ATOM 810  C CA   . LEU A 1 69  ? 16.563  -16.115 1.753   1.00 0.00 ? 69  LEU A CA   1 
ATOM 811  C C    . LEU A 1 69  ? 16.194  -17.532 2.181   1.00 0.00 ? 69  LEU A C    1 
ATOM 812  O O    . LEU A 1 69  ? 17.052  -18.412 2.255   1.00 0.00 ? 69  LEU A O    1 
ATOM 813  C CB   . LEU A 1 69  ? 16.083  -15.112 2.805   1.00 0.00 ? 69  LEU A CB   1 
ATOM 814  C CG   . LEU A 1 69  ? 16.689  -15.293 4.198   1.00 0.00 ? 69  LEU A CG   1 
ATOM 815  C CD1  . LEU A 1 69  ? 16.552  -14.013 5.010   1.00 0.00 ? 69  LEU A CD1  1 
ATOM 816  C CD2  . LEU A 1 69  ? 16.027  -16.457 4.919   1.00 0.00 ? 69  LEU A CD2  1 
ATOM 817  H H    . LEU A 1 69  ? 15.487  -14.958 0.346   1.00 0.00 ? 69  LEU A H    1 
ATOM 818  H HA   . LEU A 1 69  ? 17.637  -16.047 1.664   1.00 0.00 ? 69  LEU A HA   1 
ATOM 819  H HB2  . LEU A 1 69  ? 16.322  -14.118 2.458   1.00 0.00 ? 69  LEU A HB2  1 
ATOM 820  H HB3  . LEU A 1 69  ? 15.010  -15.196 2.889   1.00 0.00 ? 69  LEU A HB3  1 
ATOM 821  H HG   . LEU A 1 69  ? 17.741  -15.515 4.101   1.00 0.00 ? 69  LEU A HG   1 
ATOM 822  H HD11 . LEU A 1 69  ? 15.616  -14.025 5.548   1.00 0.00 ? 69  LEU A HD11 1 
ATOM 823  H HD12 . LEU A 1 69  ? 16.575  -13.160 4.346   1.00 0.00 ? 69  LEU A HD12 1 
ATOM 824  H HD13 . LEU A 1 69  ? 17.370  -13.943 5.712   1.00 0.00 ? 69  LEU A HD13 1 
ATOM 825  H HD21 . LEU A 1 69  ? 15.047  -16.631 4.500   1.00 0.00 ? 69  LEU A HD21 1 
ATOM 826  H HD22 . LEU A 1 69  ? 15.933  -16.224 5.969   1.00 0.00 ? 69  LEU A HD22 1 
ATOM 827  H HD23 . LEU A 1 69  ? 16.632  -17.345 4.800   1.00 0.00 ? 69  LEU A HD23 1 
ATOM 828  N N    . ASP A 1 70  ? 14.913  -17.744 2.461   1.00 0.00 ? 70  ASP A N    1 
ATOM 829  C CA   . ASP A 1 70  ? 14.428  -19.053 2.882   1.00 0.00 ? 70  ASP A CA   1 
ATOM 830  C C    . ASP A 1 70  ? 12.904  -19.075 2.930   1.00 0.00 ? 70  ASP A C    1 
ATOM 831  O O    . ASP A 1 70  ? 12.303  -18.862 3.983   1.00 0.00 ? 70  ASP A O    1 
ATOM 832  C CB   . ASP A 1 70  ? 14.999  -19.413 4.255   1.00 0.00 ? 70  ASP A CB   1 
ATOM 833  C CG   . ASP A 1 70  ? 14.595  -20.803 4.704   1.00 0.00 ? 70  ASP A CG   1 
ATOM 834  O OD1  . ASP A 1 70  ? 14.488  -21.698 3.840   1.00 0.00 ? 70  ASP A OD1  1 
ATOM 835  O OD2  . ASP A 1 70  ? 14.386  -20.996 5.920   1.00 0.00 ? 70  ASP A OD2  1 
ATOM 836  H H    . ASP A 1 70  ? 14.278  -17.002 2.383   1.00 0.00 ? 70  ASP A H    1 
ATOM 837  H HA   . ASP A 1 70  ? 14.764  -19.780 2.157   1.00 0.00 ? 70  ASP A HA   1 
ATOM 838  H HB2  . ASP A 1 70  ? 16.077  -19.368 4.212   1.00 0.00 ? 70  ASP A HB2  1 
ATOM 839  H HB3  . ASP A 1 70  ? 14.641  -18.701 4.985   1.00 0.00 ? 70  ASP A HB3  1 
ATOM 840  N N    . PHE A 1 71  ? 12.284  -19.327 1.781   1.00 0.00 ? 71  PHE A N    1 
ATOM 841  C CA   . PHE A 1 71  ? 10.829  -19.368 1.692   1.00 0.00 ? 71  PHE A CA   1 
ATOM 842  C C    . PHE A 1 71  ? 10.212  -18.108 2.289   1.00 0.00 ? 71  PHE A C    1 
ATOM 843  O O    . PHE A 1 71  ? 9.064   -18.117 2.732   1.00 0.00 ? 71  PHE A O    1 
ATOM 844  C CB   . PHE A 1 71  ? 10.287  -20.604 2.413   1.00 0.00 ? 71  PHE A CB   1 
ATOM 845  C CG   . PHE A 1 71  ? 10.811  -21.900 1.864   1.00 0.00 ? 71  PHE A CG   1 
ATOM 846  C CD1  . PHE A 1 71  ? 11.082  -22.036 0.511   1.00 0.00 ? 71  PHE A CD1  1 
ATOM 847  C CD2  . PHE A 1 71  ? 11.034  -22.983 2.700   1.00 0.00 ? 71  PHE A CD2  1 
ATOM 848  C CE1  . PHE A 1 71  ? 11.565  -23.227 0.003   1.00 0.00 ? 71  PHE A CE1  1 
ATOM 849  C CE2  . PHE A 1 71  ? 11.517  -24.176 2.197   1.00 0.00 ? 71  PHE A CE2  1 
ATOM 850  C CZ   . PHE A 1 71  ? 11.783  -24.298 0.848   1.00 0.00 ? 71  PHE A CZ   1 
ATOM 851  H H    . PHE A 1 71  ? 12.817  -19.486 0.975   1.00 0.00 ? 71  PHE A H    1 
ATOM 852  H HA   . PHE A 1 71  ? 10.563  -19.425 0.647   1.00 0.00 ? 71  PHE A HA   1 
ATOM 853  H HB2  . PHE A 1 71  ? 10.561  -20.552 3.457   1.00 0.00 ? 71  PHE A HB2  1 
ATOM 854  H HB3  . PHE A 1 71  ? 9.211   -20.619 2.329   1.00 0.00 ? 71  PHE A HB3  1 
ATOM 855  H HD1  . PHE A 1 71  ? 10.913  -21.199 -0.149  1.00 0.00 ? 71  PHE A HD1  1 
ATOM 856  H HD2  . PHE A 1 71  ? 10.826  -22.888 3.755   1.00 0.00 ? 71  PHE A HD2  1 
ATOM 857  H HE1  . PHE A 1 71  ? 11.772  -23.320 -1.053  1.00 0.00 ? 71  PHE A HE1  1 
ATOM 858  H HE2  . PHE A 1 71  ? 11.686  -25.012 2.860   1.00 0.00 ? 71  PHE A HE2  1 
ATOM 859  H HZ   . PHE A 1 71  ? 12.160  -25.230 0.453   1.00 0.00 ? 71  PHE A HZ   1 
ATOM 860  N N    . ASN A 1 72  ? 10.984  -17.024 2.302   1.00 0.00 ? 72  ASN A N    1 
ATOM 861  C CA   . ASN A 1 72  ? 10.512  -15.758 2.849   1.00 0.00 ? 72  ASN A CA   1 
ATOM 862  C C    . ASN A 1 72  ? 11.530  -14.646 2.617   1.00 0.00 ? 72  ASN A C    1 
ATOM 863  O O    . ASN A 1 72  ? 12.733  -14.896 2.546   1.00 0.00 ? 72  ASN A O    1 
ATOM 864  C CB   . ASN A 1 72  ? 10.232  -15.900 4.347   1.00 0.00 ? 72  ASN A CB   1 
ATOM 865  C CG   . ASN A 1 72  ? 11.377  -16.559 5.089   1.00 0.00 ? 72  ASN A CG   1 
ATOM 866  O OD1  . ASN A 1 72  ? 12.532  -16.152 4.959   1.00 0.00 ? 72  ASN A OD1  1 
ATOM 867  N ND2  . ASN A 1 72  ? 11.063  -17.584 5.873   1.00 0.00 ? 72  ASN A ND2  1 
ATOM 868  H H    . ASN A 1 72  ? 11.891  -17.078 1.936   1.00 0.00 ? 72  ASN A H    1 
ATOM 869  H HA   . ASN A 1 72  ? 9.594   -15.500 2.342   1.00 0.00 ? 72  ASN A HA   1 
ATOM 870  H HB2  . ASN A 1 72  ? 10.070  -14.920 4.771   1.00 0.00 ? 72  ASN A HB2  1 
ATOM 871  H HB3  . ASN A 1 72  ? 9.345   -16.499 4.485   1.00 0.00 ? 72  ASN A HB3  1 
ATOM 872  H HD21 . ASN A 1 72  ? 10.122  -17.853 5.928   1.00 0.00 ? 72  ASN A HD21 1 
ATOM 873  H HD22 . ASN A 1 72  ? 11.784  -18.029 6.365   1.00 0.00 ? 72  ASN A HD22 1 
ATOM 874  N N    . THR A 1 73  ? 11.037  -13.417 2.510   1.00 0.00 ? 73  THR A N    1 
ATOM 875  C CA   . THR A 1 73  ? 11.900  -12.261 2.290   1.00 0.00 ? 73  THR A CA   1 
ATOM 876  C C    . THR A 1 73  ? 11.124  -10.960 2.476   1.00 0.00 ? 73  THR A C    1 
ATOM 877  O O    . THR A 1 73  ? 11.419  -9.953  1.831   1.00 0.00 ? 73  THR A O    1 
ATOM 878  C CB   . THR A 1 73  ? 12.503  -12.310 0.884   1.00 0.00 ? 73  THR A CB   1 
ATOM 879  O OG1  . THR A 1 73  ? 12.058  -13.461 0.188   1.00 0.00 ? 73  THR A OG1  1 
ATOM 880  C CG2  . THR A 1 73  ? 14.016  -12.324 0.879   1.00 0.00 ? 73  THR A CG2  1 
ATOM 881  H H    . THR A 1 73  ? 10.069  -13.284 2.577   1.00 0.00 ? 73  THR A H    1 
ATOM 882  H HA   . THR A 1 73  ? 12.697  -12.299 3.018   1.00 0.00 ? 73  THR A HA   1 
ATOM 883  H HB   . THR A 1 73  ? 12.181  -11.437 0.335   1.00 0.00 ? 73  THR A HB   1 
ATOM 884  H HG1  . THR A 1 73  ? 11.325  -13.225 -0.386  1.00 0.00 ? 73  THR A HG1  1 
ATOM 885  H HG21 . THR A 1 73  ? 14.386  -11.331 1.088   1.00 0.00 ? 73  THR A HG21 1 
ATOM 886  H HG22 . THR A 1 73  ? 14.369  -12.643 -0.091  1.00 0.00 ? 73  THR A HG22 1 
ATOM 887  H HG23 . THR A 1 73  ? 14.372  -13.007 1.635   1.00 0.00 ? 73  THR A HG23 1 
ATOM 888  N N    . ARG A 1 74  ? 10.131  -10.989 3.360   1.00 0.00 ? 74  ARG A N    1 
ATOM 889  C CA   . ARG A 1 74  ? 9.306   -9.816  3.623   1.00 0.00 ? 74  ARG A CA   1 
ATOM 890  C C    . ARG A 1 74  ? 10.116  -8.713  4.297   1.00 0.00 ? 74  ARG A C    1 
ATOM 891  O O    . ARG A 1 74  ? 10.307  -7.637  3.730   1.00 0.00 ? 74  ARG A O    1 
ATOM 892  C CB   . ARG A 1 74  ? 8.113   -10.197 4.500   1.00 0.00 ? 74  ARG A CB   1 
ATOM 893  C CG   . ARG A 1 74  ? 7.181   -11.207 3.850   1.00 0.00 ? 74  ARG A CG   1 
ATOM 894  C CD   . ARG A 1 74  ? 5.883   -11.351 4.627   1.00 0.00 ? 74  ARG A CD   1 
ATOM 895  N NE   . ARG A 1 74  ? 4.741   -10.821 3.889   1.00 0.00 ? 74  ARG A NE   1 
ATOM 896  C CZ   . ARG A 1 74  ? 4.308   -11.328 2.739   1.00 0.00 ? 74  ARG A CZ   1 
ATOM 897  N NH1  . ARG A 1 74  ? 4.920   -12.373 2.199   1.00 0.00 ? 74  ARG A NH1  1 
ATOM 898  N NH2  . ARG A 1 74  ? 3.261   -10.790 2.127   1.00 0.00 ? 74  ARG A NH2  1 
ATOM 899  H H    . ARG A 1 74  ? 9.943   -11.821 3.840   1.00 0.00 ? 74  ARG A H    1 
ATOM 900  H HA   . ARG A 1 74  ? 8.942   -9.449  2.674   1.00 0.00 ? 74  ARG A HA   1 
ATOM 901  H HB2  . ARG A 1 74  ? 8.480   -10.621 5.423   1.00 0.00 ? 74  ARG A HB2  1 
ATOM 902  H HB3  . ARG A 1 74  ? 7.545   -9.306  4.723   1.00 0.00 ? 74  ARG A HB3  1 
ATOM 903  H HG2  . ARG A 1 74  ? 6.953   -10.876 2.847   1.00 0.00 ? 74  ARG A HG2  1 
ATOM 904  H HG3  . ARG A 1 74  ? 7.675   -12.166 3.812   1.00 0.00 ? 74  ARG A HG3  1 
ATOM 905  H HD2  . ARG A 1 74  ? 5.714   -12.398 4.829   1.00 0.00 ? 74  ARG A HD2  1 
ATOM 906  H HD3  . ARG A 1 74  ? 5.976   -10.815 5.561   1.00 0.00 ? 74  ARG A HD3  1 
ATOM 907  H HE   . ARG A 1 74  ? 4.273   -10.048 4.269   1.00 0.00 ? 74  ARG A HE   1 
ATOM 908  H HH11 . ARG A 1 74  ? 5.710   -12.782 2.658   1.00 0.00 ? 74  ARG A HH11 1 
ATOM 909  H HH12 . ARG A 1 74  ? 4.593   -12.753 1.334   1.00 0.00 ? 74  ARG A HH12 1 
ATOM 910  H HH21 . ARG A 1 74  ? 2.797   -10.001 2.530   1.00 0.00 ? 74  ARG A HH21 1 
ATOM 911  H HH22 . ARG A 1 74  ? 2.937   -11.172 1.261   1.00 0.00 ? 74  ARG A HH22 1 
ATOM 912  N N    . THR A 1 75  ? 10.577  -8.980  5.514   1.00 0.00 ? 75  THR A N    1 
ATOM 913  C CA   . THR A 1 75  ? 11.370  -7.999  6.256   1.00 0.00 ? 75  THR A CA   1 
ATOM 914  C C    . THR A 1 75  ? 12.629  -7.646  5.475   1.00 0.00 ? 75  THR A C    1 
ATOM 915  O O    . THR A 1 75  ? 12.834  -6.495  5.090   1.00 0.00 ? 75  THR A O    1 
ATOM 916  C CB   . THR A 1 75  ? 11.749  -8.514  7.658   1.00 0.00 ? 75  THR A CB   1 
ATOM 917  O OG1  . THR A 1 75  ? 13.039  -9.104  7.655   1.00 0.00 ? 75  THR A OG1  1 
ATOM 918  C CG2  . THR A 1 75  ? 10.789  -9.537  8.220   1.00 0.00 ? 75  THR A CG2  1 
ATOM 919  H H    . THR A 1 75  ? 10.398  -9.858  5.906   1.00 0.00 ? 75  THR A H    1 
ATOM 920  H HA   . THR A 1 75  ? 10.770  -7.107  6.363   1.00 0.00 ? 75  THR A HA   1 
ATOM 921  H HB   . THR A 1 75  ? 11.765  -7.677  8.341   1.00 0.00 ? 75  THR A HB   1 
ATOM 922  H HG1  . THR A 1 75  ? 13.305  -9.298  8.556   1.00 0.00 ? 75  THR A HG1  1 
ATOM 923  H HG21 . THR A 1 75  ? 9.776   -9.183  8.104   1.00 0.00 ? 75  THR A HG21 1 
ATOM 924  H HG22 . THR A 1 75  ? 11.000  -9.692  9.268   1.00 0.00 ? 75  THR A HG22 1 
ATOM 925  H HG23 . THR A 1 75  ? 10.911  -10.468 7.685   1.00 0.00 ? 75  THR A HG23 1 
ATOM 926  N N    . GLN A 1 76  ? 13.449  -8.661  5.216   1.00 0.00 ? 76  GLN A N    1 
ATOM 927  C CA   . GLN A 1 76  ? 14.712  -8.474  4.486   1.00 0.00 ? 76  GLN A CA   1 
ATOM 928  C C    . GLN A 1 76  ? 14.537  -7.516  3.306   1.00 0.00 ? 76  GLN A C    1 
ATOM 929  O O    . GLN A 1 76  ? 15.088  -6.412  3.296   1.00 0.00 ? 76  GLN A O    1 
ATOM 930  C CB   . GLN A 1 76  ? 15.293  -9.809  3.969   1.00 0.00 ? 76  GLN A CB   1 
ATOM 931  C CG   . GLN A 1 76  ? 14.505  -11.059 4.333   1.00 0.00 ? 76  GLN A CG   1 
ATOM 932  C CD   . GLN A 1 76  ? 14.696  -11.470 5.781   1.00 0.00 ? 76  GLN A CD   1 
ATOM 933  O OE1  . GLN A 1 76  ? 13.728  -11.685 6.510   1.00 0.00 ? 76  GLN A OE1  1 
ATOM 934  N NE2  . GLN A 1 76  ? 15.950  -11.579 6.204   1.00 0.00 ? 76  GLN A NE2  1 
ATOM 935  H H    . GLN A 1 76  ? 13.222  -9.543  5.575   1.00 0.00 ? 76  GLN A H    1 
ATOM 936  H HA   . GLN A 1 76  ? 15.420  -8.038  5.175   1.00 0.00 ? 76  GLN A HA   1 
ATOM 937  H HB2  . GLN A 1 76  ? 15.353  -9.760  2.891   1.00 0.00 ? 76  GLN A HB2  1 
ATOM 938  H HB3  . GLN A 1 76  ? 16.292  -9.918  4.363   1.00 0.00 ? 76  GLN A HB3  1 
ATOM 939  H HG2  . GLN A 1 76  ? 13.455  -10.871 4.163   1.00 0.00 ? 76  GLN A HG2  1 
ATOM 940  H HG3  . GLN A 1 76  ? 14.832  -11.871 3.699   1.00 0.00 ? 76  GLN A HG3  1 
ATOM 941  H HE21 . GLN A 1 76  ? 16.671  -11.395 5.568   1.00 0.00 ? 76  GLN A HE21 1 
ATOM 942  H HE22 . GLN A 1 76  ? 16.102  -11.844 7.136   1.00 0.00 ? 76  GLN A HE22 1 
ATOM 943  N N    . VAL A 1 77  ? 13.781  -7.957  2.308   1.00 0.00 ? 77  VAL A N    1 
ATOM 944  C CA   . VAL A 1 77  ? 13.548  -7.159  1.111   1.00 0.00 ? 77  VAL A CA   1 
ATOM 945  C C    . VAL A 1 77  ? 13.077  -5.750  1.462   1.00 0.00 ? 77  VAL A C    1 
ATOM 946  O O    . VAL A 1 77  ? 13.805  -4.777  1.270   1.00 0.00 ? 77  VAL A O    1 
ATOM 947  C CB   . VAL A 1 77  ? 12.509  -7.828  0.189   1.00 0.00 ? 77  VAL A CB   1 
ATOM 948  C CG1  . VAL A 1 77  ? 12.227  -6.963  -1.032  1.00 0.00 ? 77  VAL A CG1  1 
ATOM 949  C CG2  . VAL A 1 77  ? 12.984  -9.211  -0.227  1.00 0.00 ? 77  VAL A CG2  1 
ATOM 950  H H    . VAL A 1 77  ? 13.379  -8.849  2.372   1.00 0.00 ? 77  VAL A H    1 
ATOM 951  H HA   . VAL A 1 77  ? 14.483  -7.092  0.574   1.00 0.00 ? 77  VAL A HA   1 
ATOM 952  H HB   . VAL A 1 77  ? 11.588  -7.940  0.742   1.00 0.00 ? 77  VAL A HB   1 
ATOM 953  H HG11 . VAL A 1 77  ? 11.283  -6.454  -0.901  1.00 0.00 ? 77  VAL A HG11 1 
ATOM 954  H HG12 . VAL A 1 77  ? 12.181  -7.586  -1.913  1.00 0.00 ? 77  VAL A HG12 1 
ATOM 955  H HG13 . VAL A 1 77  ? 13.015  -6.234  -1.146  1.00 0.00 ? 77  VAL A HG13 1 
ATOM 956  H HG21 . VAL A 1 77  ? 12.161  -9.758  -0.664  1.00 0.00 ? 77  VAL A HG21 1 
ATOM 957  H HG22 . VAL A 1 77  ? 13.350  -9.741  0.639   1.00 0.00 ? 77  VAL A HG22 1 
ATOM 958  H HG23 . VAL A 1 77  ? 13.778  -9.115  -0.953  1.00 0.00 ? 77  VAL A HG23 1 
ATOM 959  N N    . THR A 1 78  ? 11.850  -5.648  1.972   1.00 0.00 ? 78  THR A N    1 
ATOM 960  C CA   . THR A 1 78  ? 11.264  -4.355  2.327   1.00 0.00 ? 78  THR A CA   1 
ATOM 961  C C    . THR A 1 78  ? 12.279  -3.443  3.016   1.00 0.00 ? 78  THR A C    1 
ATOM 962  O O    . THR A 1 78  ? 12.207  -2.220  2.897   1.00 0.00 ? 78  THR A O    1 
ATOM 963  C CB   . THR A 1 78  ? 10.046  -4.556  3.231   1.00 0.00 ? 78  THR A CB   1 
ATOM 964  O OG1  . THR A 1 78  ? 9.269   -5.655  2.787   1.00 0.00 ? 78  THR A OG1  1 
ATOM 965  C CG2  . THR A 1 78  ? 9.139   -3.347  3.289   1.00 0.00 ? 78  THR A CG2  1 
ATOM 966  H H    . THR A 1 78  ? 11.315  -6.460  2.088   1.00 0.00 ? 78  THR A H    1 
ATOM 967  H HA   . THR A 1 78  ? 10.943  -3.880  1.412   1.00 0.00 ? 78  THR A HA   1 
ATOM 968  H HB   . THR A 1 78  ? 10.384  -4.762  4.236   1.00 0.00 ? 78  THR A HB   1 
ATOM 969  H HG1  . THR A 1 78  ? 8.967   -5.493  1.891   1.00 0.00 ? 78  THR A HG1  1 
ATOM 970  H HG21 . THR A 1 78  ? 9.342   -2.787  4.189   1.00 0.00 ? 78  THR A HG21 1 
ATOM 971  H HG22 . THR A 1 78  ? 8.108   -3.670  3.290   1.00 0.00 ? 78  THR A HG22 1 
ATOM 972  H HG23 . THR A 1 78  ? 9.319   -2.721  2.427   1.00 0.00 ? 78  THR A HG23 1 
ATOM 973  N N    . ARG A 1 79  ? 13.232  -4.045  3.721   1.00 0.00 ? 79  ARG A N    1 
ATOM 974  C CA   . ARG A 1 79  ? 14.267  -3.281  4.407   1.00 0.00 ? 79  ARG A CA   1 
ATOM 975  C C    . ARG A 1 79  ? 15.138  -2.533  3.402   1.00 0.00 ? 79  ARG A C    1 
ATOM 976  O O    . ARG A 1 79  ? 15.225  -1.304  3.434   1.00 0.00 ? 79  ARG A O    1 
ATOM 977  C CB   . ARG A 1 79  ? 15.134  -4.207  5.262   1.00 0.00 ? 79  ARG A CB   1 
ATOM 978  C CG   . ARG A 1 79  ? 15.918  -3.477  6.342   1.00 0.00 ? 79  ARG A CG   1 
ATOM 979  C CD   . ARG A 1 79  ? 16.892  -4.403  7.052   1.00 0.00 ? 79  ARG A CD   1 
ATOM 980  N NE   . ARG A 1 79  ? 17.940  -3.663  7.748   1.00 0.00 ? 79  ARG A NE   1 
ATOM 981  C CZ   . ARG A 1 79  ? 18.930  -4.242  8.419   1.00 0.00 ? 79  ARG A CZ   1 
ATOM 982  N NH1  . ARG A 1 79  ? 19.006  -5.565  8.482   1.00 0.00 ? 79  ARG A NH1  1 
ATOM 983  N NH2  . ARG A 1 79  ? 19.845  -3.499  9.026   1.00 0.00 ? 79  ARG A NH2  1 
ATOM 984  H H    . ARG A 1 79  ? 13.243  -5.023  3.775   1.00 0.00 ? 79  ARG A H    1 
ATOM 985  H HA   . ARG A 1 79  ? 13.778  -2.561  5.048   1.00 0.00 ? 79  ARG A HA   1 
ATOM 986  H HB2  . ARG A 1 79  ? 14.499  -4.938  5.740   1.00 0.00 ? 79  ARG A HB2  1 
ATOM 987  H HB3  . ARG A 1 79  ? 15.837  -4.718  4.621   1.00 0.00 ? 79  ARG A HB3  1 
ATOM 988  H HG2  . ARG A 1 79  ? 16.472  -2.669  5.887   1.00 0.00 ? 79  ARG A HG2  1 
ATOM 989  H HG3  . ARG A 1 79  ? 15.224  -3.077  7.067   1.00 0.00 ? 79  ARG A HG3  1 
ATOM 990  H HD2  . ARG A 1 79  ? 16.346  -4.997  7.769   1.00 0.00 ? 79  ARG A HD2  1 
ATOM 991  H HD3  . ARG A 1 79  ? 17.349  -5.053  6.320   1.00 0.00 ? 79  ARG A HD3  1 
ATOM 992  H HE   . ARG A 1 79  ? 17.903  -2.684  7.715   1.00 0.00 ? 79  ARG A HE   1 
ATOM 993  H HH11 . ARG A 1 79  ? 18.317  -6.127  8.024   1.00 0.00 ? 79  ARG A HH11 1 
ATOM 994  H HH12 . ARG A 1 79  ? 19.752  -5.999  8.986   1.00 0.00 ? 79  ARG A HH12 1 
ATOM 995  H HH21 . ARG A 1 79  ? 19.790  -2.502  8.980   1.00 0.00 ? 79  ARG A HH21 1 
ATOM 996  H HH22 . ARG A 1 79  ? 20.590  -3.936  9.530   1.00 0.00 ? 79  ARG A HH22 1 
ATOM 997  N N    . GLU A 1 80  ? 15.771  -3.280  2.501   1.00 0.00 ? 80  GLU A N    1 
ATOM 998  C CA   . GLU A 1 80  ? 16.630  -2.680  1.483   1.00 0.00 ? 80  GLU A CA   1 
ATOM 999  C C    . GLU A 1 80  ? 15.815  -1.814  0.525   1.00 0.00 ? 80  GLU A C    1 
ATOM 1000 O O    . GLU A 1 80  ? 16.299  -0.796  0.031   1.00 0.00 ? 80  GLU A O    1 
ATOM 1001 C CB   . GLU A 1 80  ? 17.384  -3.771  0.711   1.00 0.00 ? 80  GLU A CB   1 
ATOM 1002 C CG   . GLU A 1 80  ? 18.056  -3.281  -0.564  1.00 0.00 ? 80  GLU A CG   1 
ATOM 1003 C CD   . GLU A 1 80  ? 19.479  -3.784  -0.703  1.00 0.00 ? 80  GLU A CD   1 
ATOM 1004 O OE1  . GLU A 1 80  ? 19.686  -5.013  -0.615  1.00 0.00 ? 80  GLU A OE1  1 
ATOM 1005 O OE2  . GLU A 1 80  ? 20.387  -2.950  -0.902  1.00 0.00 ? 80  GLU A OE2  1 
ATOM 1006 H H    . GLU A 1 80  ? 15.660  -4.256  2.523   1.00 0.00 ? 80  GLU A H    1 
ATOM 1007 H HA   . GLU A 1 80  ? 17.348  -2.052  1.989   1.00 0.00 ? 80  GLU A HA   1 
ATOM 1008 H HB2  . GLU A 1 80  ? 18.149  -4.180  1.353   1.00 0.00 ? 80  GLU A HB2  1 
ATOM 1009 H HB3  . GLU A 1 80  ? 16.690  -4.555  0.448   1.00 0.00 ? 80  GLU A HB3  1 
ATOM 1010 H HG2  . GLU A 1 80  ? 17.484  -3.627  -1.413  1.00 0.00 ? 80  GLU A HG2  1 
ATOM 1011 H HG3  . GLU A 1 80  ? 18.071  -2.202  -0.556  1.00 0.00 ? 80  GLU A HG3  1 
ATOM 1012 N N    . ALA A 1 81  ? 14.578  -2.224  0.264   1.00 0.00 ? 81  ALA A N    1 
ATOM 1013 C CA   . ALA A 1 81  ? 13.702  -1.477  -0.631  1.00 0.00 ? 81  ALA A CA   1 
ATOM 1014 C C    . ALA A 1 81  ? 13.498  -0.052  -0.129  1.00 0.00 ? 81  ALA A C    1 
ATOM 1015 O O    . ALA A 1 81  ? 13.828  0.913   -0.818  1.00 0.00 ? 81  ALA A O    1 
ATOM 1016 C CB   . ALA A 1 81  ? 12.363  -2.185  -0.775  1.00 0.00 ? 81  ALA A CB   1 
ATOM 1017 H H    . ALA A 1 81  ? 14.245  -3.042  0.687   1.00 0.00 ? 81  ALA A H    1 
ATOM 1018 H HA   . ALA A 1 81  ? 14.171  -1.441  -1.605  1.00 0.00 ? 81  ALA A HA   1 
ATOM 1019 H HB1  . ALA A 1 81  ? 11.564  -1.487  -0.575  1.00 0.00 ? 81  ALA A HB1  1 
ATOM 1020 H HB2  . ALA A 1 81  ? 12.311  -3.003  -0.072  1.00 0.00 ? 81  ALA A HB2  1 
ATOM 1021 H HB3  . ALA A 1 81  ? 12.264  -2.568  -1.780  1.00 0.00 ? 81  ALA A HB3  1 
ATOM 1022 N N    . ILE A 1 82  ? 12.956  0.072   1.079   1.00 0.00 ? 82  ILE A N    1 
ATOM 1023 C CA   . ILE A 1 82  ? 12.718  1.380   1.678   1.00 0.00 ? 82  ILE A CA   1 
ATOM 1024 C C    . ILE A 1 82  ? 13.978  2.238   1.621   1.00 0.00 ? 82  ILE A C    1 
ATOM 1025 O O    . ILE A 1 82  ? 13.931  3.403   1.225   1.00 0.00 ? 82  ILE A O    1 
ATOM 1026 C CB   . ILE A 1 82  ? 12.251  1.254   3.141   1.00 0.00 ? 82  ILE A CB   1 
ATOM 1027 C CG1  . ILE A 1 82  ? 10.976  0.412   3.217   1.00 0.00 ? 82  ILE A CG1  1 
ATOM 1028 C CG2  . ILE A 1 82  ? 12.020  2.630   3.748   1.00 0.00 ? 82  ILE A CG2  1 
ATOM 1029 C CD1  . ILE A 1 82  ? 10.810  -0.322  4.530   1.00 0.00 ? 82  ILE A CD1  1 
ATOM 1030 H H    . ILE A 1 82  ? 12.719  -0.735  1.582   1.00 0.00 ? 82  ILE A H    1 
ATOM 1031 H HA   . ILE A 1 82  ? 11.936  1.868   1.115   1.00 0.00 ? 82  ILE A HA   1 
ATOM 1032 H HB   . ILE A 1 82  ? 13.033  0.766   3.704   1.00 0.00 ? 82  ILE A HB   1 
ATOM 1033 H HG12 . ILE A 1 82  ? 10.119  1.057   3.088   1.00 0.00 ? 82  ILE A HG12 1 
ATOM 1034 H HG13 . ILE A 1 82  ? 10.991  -0.323  2.426   1.00 0.00 ? 82  ILE A HG13 1 
ATOM 1035 H HG21 . ILE A 1 82  ? 11.996  3.370   2.962   1.00 0.00 ? 82  ILE A HG21 1 
ATOM 1036 H HG22 . ILE A 1 82  ? 12.821  2.859   4.435   1.00 0.00 ? 82  ILE A HG22 1 
ATOM 1037 H HG23 . ILE A 1 82  ? 11.078  2.635   4.277   1.00 0.00 ? 82  ILE A HG23 1 
ATOM 1038 H HD11 . ILE A 1 82  ? 10.770  -1.385  4.344   1.00 0.00 ? 82  ILE A HD11 1 
ATOM 1039 H HD12 . ILE A 1 82  ? 9.893   -0.005  5.006   1.00 0.00 ? 82  ILE A HD12 1 
ATOM 1040 H HD13 . ILE A 1 82  ? 11.647  -0.100  5.175   1.00 0.00 ? 82  ILE A HD13 1 
ATOM 1041 N N    . SER A 1 83  ? 15.106  1.650   2.004   1.00 0.00 ? 83  SER A N    1 
ATOM 1042 C CA   . SER A 1 83  ? 16.380  2.357   1.971   1.00 0.00 ? 83  SER A CA   1 
ATOM 1043 C C    . SER A 1 83  ? 16.736  2.744   0.539   1.00 0.00 ? 83  SER A C    1 
ATOM 1044 O O    . SER A 1 83  ? 17.435  3.729   0.304   1.00 0.00 ? 83  SER A O    1 
ATOM 1045 C CB   . SER A 1 83  ? 17.487  1.487   2.568   1.00 0.00 ? 83  SER A CB   1 
ATOM 1046 O OG   . SER A 1 83  ? 16.965  0.589   3.533   1.00 0.00 ? 83  SER A OG   1 
ATOM 1047 H H    . SER A 1 83  ? 15.084  0.715   2.300   1.00 0.00 ? 83  SER A H    1 
ATOM 1048 H HA   . SER A 1 83  ? 16.277  3.256   2.561   1.00 0.00 ? 83  SER A HA   1 
ATOM 1049 H HB2  . SER A 1 83  ? 17.958  0.916   1.781   1.00 0.00 ? 83  SER A HB2  1 
ATOM 1050 H HB3  . SER A 1 83  ? 18.221  2.120   3.044   1.00 0.00 ? 83  SER A HB3  1 
ATOM 1051 H HG   . SER A 1 83  ? 17.098  0.952   4.412   1.00 0.00 ? 83  SER A HG   1 
ATOM 1052 N N    . LEU A 1 84  ? 16.240  1.960   -0.413  1.00 0.00 ? 84  LEU A N    1 
ATOM 1053 C CA   . LEU A 1 84  ? 16.491  2.214   -1.826  1.00 0.00 ? 84  LEU A CA   1 
ATOM 1054 C C    . LEU A 1 84  ? 15.825  3.511   -2.269  1.00 0.00 ? 84  LEU A C    1 
ATOM 1055 O O    . LEU A 1 84  ? 16.493  4.451   -2.702  1.00 0.00 ? 84  LEU A O    1 
ATOM 1056 C CB   . LEU A 1 84  ? 15.966  1.049   -2.667  1.00 0.00 ? 84  LEU A CB   1 
ATOM 1057 C CG   . LEU A 1 84  ? 16.890  0.592   -3.798  1.00 0.00 ? 84  LEU A CG   1 
ATOM 1058 C CD1  . LEU A 1 84  ? 17.312  1.776   -4.652  1.00 0.00 ? 84  LEU A CD1  1 
ATOM 1059 C CD2  . LEU A 1 84  ? 18.108  -0.124  -3.234  1.00 0.00 ? 84  LEU A CD2  1 
ATOM 1060 H H    . LEU A 1 84  ? 15.687  1.193   -0.159  1.00 0.00 ? 84  LEU A H    1 
ATOM 1061 H HA   . LEU A 1 84  ? 17.557  2.302   -1.965  1.00 0.00 ? 84  LEU A HA   1 
ATOM 1062 H HB2  . LEU A 1 84  ? 15.794  0.208   -2.011  1.00 0.00 ? 84  LEU A HB2  1 
ATOM 1063 H HB3  . LEU A 1 84  ? 15.023  1.344   -3.099  1.00 0.00 ? 84  LEU A HB3  1 
ATOM 1064 H HG   . LEU A 1 84  ? 16.357  -0.101  -4.432  1.00 0.00 ? 84  LEU A HG   1 
ATOM 1065 H HD11 . LEU A 1 84  ? 16.511  2.500   -4.683  1.00 0.00 ? 84  LEU A HD11 1 
ATOM 1066 H HD12 . LEU A 1 84  ? 17.530  1.437   -5.655  1.00 0.00 ? 84  LEU A HD12 1 
ATOM 1067 H HD13 . LEU A 1 84  ? 18.193  2.232   -4.226  1.00 0.00 ? 84  LEU A HD13 1 
ATOM 1068 H HD21 . LEU A 1 84  ? 18.564  0.487   -2.469  1.00 0.00 ? 84  LEU A HD21 1 
ATOM 1069 H HD22 . LEU A 1 84  ? 18.821  -0.299  -4.026  1.00 0.00 ? 84  LEU A HD22 1 
ATOM 1070 H HD23 . LEU A 1 84  ? 17.805  -1.069  -2.807  1.00 0.00 ? 84  LEU A HD23 1 
ATOM 1071 N N    . VAL A 1 85  ? 14.501  3.556   -2.153  1.00 0.00 ? 85  VAL A N    1 
ATOM 1072 C CA   . VAL A 1 85  ? 13.736  4.740   -2.528  1.00 0.00 ? 85  VAL A CA   1 
ATOM 1073 C C    . VAL A 1 85  ? 14.346  5.997   -1.914  1.00 0.00 ? 85  VAL A C    1 
ATOM 1074 O O    . VAL A 1 85  ? 14.397  7.050   -2.549  1.00 0.00 ? 85  VAL A O    1 
ATOM 1075 C CB   . VAL A 1 85  ? 12.263  4.612   -2.085  1.00 0.00 ? 85  VAL A CB   1 
ATOM 1076 C CG1  . VAL A 1 85  ? 12.182  4.274   -0.605  1.00 0.00 ? 85  VAL A CG1  1 
ATOM 1077 C CG2  . VAL A 1 85  ? 11.485  5.884   -2.394  1.00 0.00 ? 85  VAL A CG2  1 
ATOM 1078 H H    . VAL A 1 85  ? 14.027  2.776   -1.796  1.00 0.00 ? 85  VAL A H    1 
ATOM 1079 H HA   . VAL A 1 85  ? 13.759  4.827   -3.605  1.00 0.00 ? 85  VAL A HA   1 
ATOM 1080 H HB   . VAL A 1 85  ? 11.813  3.802   -2.639  1.00 0.00 ? 85  VAL A HB   1 
ATOM 1081 H HG11 . VAL A 1 85  ? 11.158  4.353   -0.273  1.00 0.00 ? 85  VAL A HG11 1 
ATOM 1082 H HG12 . VAL A 1 85  ? 12.797  4.962   -0.044  1.00 0.00 ? 85  VAL A HG12 1 
ATOM 1083 H HG13 . VAL A 1 85  ? 12.535  3.265   -0.448  1.00 0.00 ? 85  VAL A HG13 1 
ATOM 1084 H HG21 . VAL A 1 85  ? 12.030  6.739   -2.023  1.00 0.00 ? 85  VAL A HG21 1 
ATOM 1085 H HG22 . VAL A 1 85  ? 10.517  5.840   -1.915  1.00 0.00 ? 85  VAL A HG22 1 
ATOM 1086 H HG23 . VAL A 1 85  ? 11.354  5.976   -3.462  1.00 0.00 ? 85  VAL A HG23 1 
ATOM 1087 N N    . CYS A 1 86  ? 14.818  5.873   -0.677  1.00 0.00 ? 86  CYS A N    1 
ATOM 1088 C CA   . CYS A 1 86  ? 15.436  6.994   0.020   1.00 0.00 ? 86  CYS A CA   1 
ATOM 1089 C C    . CYS A 1 86  ? 16.756  7.379   -0.638  1.00 0.00 ? 86  CYS A C    1 
ATOM 1090 O O    . CYS A 1 86  ? 17.099  8.558   -0.722  1.00 0.00 ? 86  CYS A O    1 
ATOM 1091 C CB   . CYS A 1 86  ? 15.670  6.640   1.490   1.00 0.00 ? 86  CYS A CB   1 
ATOM 1092 S SG   . CYS A 1 86  ? 14.887  7.776   2.658   1.00 0.00 ? 86  CYS A SG   1 
ATOM 1093 H H    . CYS A 1 86  ? 14.752  5.005   -0.225  1.00 0.00 ? 86  CYS A H    1 
ATOM 1094 H HA   . CYS A 1 86  ? 14.759  7.834   -0.037  1.00 0.00 ? 86  CYS A HA   1 
ATOM 1095 H HB2  . CYS A 1 86  ? 15.278  5.652   1.681   1.00 0.00 ? 86  CYS A HB2  1 
ATOM 1096 H HB3  . CYS A 1 86  ? 16.731  6.645   1.689   1.00 0.00 ? 86  CYS A HB3  1 
ATOM 1097 H HG   . CYS A 1 86  ? 15.529  7.991   3.338   1.00 0.00 ? 86  CYS A HG   1 
ATOM 1098 N N    . GLU A 1 87  ? 17.492  6.376   -1.108  1.00 0.00 ? 87  GLU A N    1 
ATOM 1099 C CA   . GLU A 1 87  ? 18.773  6.609   -1.764  1.00 0.00 ? 87  GLU A CA   1 
ATOM 1100 C C    . GLU A 1 87  ? 18.610  7.560   -2.945  1.00 0.00 ? 87  GLU A C    1 
ATOM 1101 O O    . GLU A 1 87  ? 19.370  8.517   -3.094  1.00 0.00 ? 87  GLU A O    1 
ATOM 1102 C CB   . GLU A 1 87  ? 19.375  5.285   -2.240  1.00 0.00 ? 87  GLU A CB   1 
ATOM 1103 C CG   . GLU A 1 87  ? 20.894  5.297   -2.310  1.00 0.00 ? 87  GLU A CG   1 
ATOM 1104 C CD   . GLU A 1 87  ? 21.542  5.053   -0.961  1.00 0.00 ? 87  GLU A CD   1 
ATOM 1105 O OE1  . GLU A 1 87  ? 21.727  3.874   -0.596  1.00 0.00 ? 87  GLU A OE1  1 
ATOM 1106 O OE2  . GLU A 1 87  ? 21.863  6.043   -0.270  1.00 0.00 ? 87  GLU A OE2  1 
ATOM 1107 H H    . GLU A 1 87  ? 17.164  5.457   -1.013  1.00 0.00 ? 87  GLU A H    1 
ATOM 1108 H HA   . GLU A 1 87  ? 19.438  7.061   -1.042  1.00 0.00 ? 87  GLU A HA   1 
ATOM 1109 H HB2  . GLU A 1 87  ? 19.074  4.501   -1.561  1.00 0.00 ? 87  GLU A HB2  1 
ATOM 1110 H HB3  . GLU A 1 87  ? 18.993  5.063   -3.225  1.00 0.00 ? 87  GLU A HB3  1 
ATOM 1111 H HG2  . GLU A 1 87  ? 21.216  4.523   -2.992  1.00 0.00 ? 87  GLU A HG2  1 
ATOM 1112 H HG3  . GLU A 1 87  ? 21.218  6.258   -2.680  1.00 0.00 ? 87  GLU A HG3  1 
ATOM 1113 N N    . ALA A 1 88  ? 17.612  7.291   -3.781  1.00 0.00 ? 88  ALA A N    1 
ATOM 1114 C CA   . ALA A 1 88  ? 17.348  8.124   -4.948  1.00 0.00 ? 88  ALA A CA   1 
ATOM 1115 C C    . ALA A 1 88  ? 16.865  9.510   -4.534  1.00 0.00 ? 88  ALA A C    1 
ATOM 1116 O O    . ALA A 1 88  ? 17.293  10.520  -5.092  1.00 0.00 ? 88  ALA A O    1 
ATOM 1117 C CB   . ALA A 1 88  ? 16.327  7.453   -5.855  1.00 0.00 ? 88  ALA A CB   1 
ATOM 1118 H H    . ALA A 1 88  ? 17.040  6.513   -3.608  1.00 0.00 ? 88  ALA A H    1 
ATOM 1119 H HA   . ALA A 1 88  ? 18.270  8.225   -5.501  1.00 0.00 ? 88  ALA A HA   1 
ATOM 1120 H HB1  . ALA A 1 88  ? 16.626  6.432   -6.040  1.00 0.00 ? 88  ALA A HB1  1 
ATOM 1121 H HB2  . ALA A 1 88  ? 16.273  7.987   -6.792  1.00 0.00 ? 88  ALA A HB2  1 
ATOM 1122 H HB3  . ALA A 1 88  ? 15.359  7.464   -5.378  1.00 0.00 ? 88  ALA A HB3  1 
ATOM 1123 N N    . VAL A 1 89  ? 15.974  9.550   -3.548  1.00 0.00 ? 89  VAL A N    1 
ATOM 1124 C CA   . VAL A 1 89  ? 15.436  10.811  -3.052  1.00 0.00 ? 89  VAL A CA   1 
ATOM 1125 C C    . VAL A 1 89  ? 15.772  11.002  -1.573  1.00 0.00 ? 89  VAL A C    1 
ATOM 1126 O O    . VAL A 1 89  ? 14.931  10.776  -0.703  1.00 0.00 ? 89  VAL A O    1 
ATOM 1127 C CB   . VAL A 1 89  ? 13.908  10.884  -3.241  1.00 0.00 ? 89  VAL A CB   1 
ATOM 1128 C CG1  . VAL A 1 89  ? 13.229  9.702   -2.566  1.00 0.00 ? 89  VAL A CG1  1 
ATOM 1129 C CG2  . VAL A 1 89  ? 13.362  12.199  -2.706  1.00 0.00 ? 89  VAL A CG2  1 
ATOM 1130 H H    . VAL A 1 89  ? 15.673  8.710   -3.142  1.00 0.00 ? 89  VAL A H    1 
ATOM 1131 H HA   . VAL A 1 89  ? 15.886  11.612  -3.620  1.00 0.00 ? 89  VAL A HA   1 
ATOM 1132 H HB   . VAL A 1 89  ? 13.694  10.836  -4.298  1.00 0.00 ? 89  VAL A HB   1 
ATOM 1133 H HG11 . VAL A 1 89  ? 13.918  9.235   -1.879  1.00 0.00 ? 89  VAL A HG11 1 
ATOM 1134 H HG12 . VAL A 1 89  ? 12.926  8.985   -3.316  1.00 0.00 ? 89  VAL A HG12 1 
ATOM 1135 H HG13 . VAL A 1 89  ? 12.359  10.047  -2.026  1.00 0.00 ? 89  VAL A HG13 1 
ATOM 1136 H HG21 . VAL A 1 89  ? 12.578  11.998  -1.991  1.00 0.00 ? 89  VAL A HG21 1 
ATOM 1137 H HG22 . VAL A 1 89  ? 12.964  12.782  -3.523  1.00 0.00 ? 89  VAL A HG22 1 
ATOM 1138 H HG23 . VAL A 1 89  ? 14.156  12.749  -2.224  1.00 0.00 ? 89  VAL A HG23 1 
ATOM 1139 N N    . PRO A 1 90  ? 17.014  11.417  -1.270  1.00 0.00 ? 90  PRO A N    1 
ATOM 1140 C CA   . PRO A 1 90  ? 17.464  11.629  0.111   1.00 0.00 ? 90  PRO A CA   1 
ATOM 1141 C C    . PRO A 1 90  ? 16.802  12.837  0.771   1.00 0.00 ? 90  PRO A C    1 
ATOM 1142 O O    . PRO A 1 90  ? 16.934  13.042  1.978   1.00 0.00 ? 90  PRO A O    1 
ATOM 1143 C CB   . PRO A 1 90  ? 18.969  11.862  -0.037  1.00 0.00 ? 90  PRO A CB   1 
ATOM 1144 C CG   . PRO A 1 90  ? 19.135  12.386  -1.421  1.00 0.00 ? 90  PRO A CG   1 
ATOM 1145 C CD   . PRO A 1 90  ? 18.080  11.705  -2.248  1.00 0.00 ? 90  PRO A CD   1 
ATOM 1146 H HA   . PRO A 1 90  ? 17.293  10.753  0.720   1.00 0.00 ? 90  PRO A HA   1 
ATOM 1147 H HB2  . PRO A 1 90  ? 19.300  12.578  0.700   1.00 0.00 ? 90  PRO A HB2  1 
ATOM 1148 H HB3  . PRO A 1 90  ? 19.495  10.928  0.098   1.00 0.00 ? 90  PRO A HB3  1 
ATOM 1149 H HG2  . PRO A 1 90  ? 18.985  13.456  -1.429  1.00 0.00 ? 90  PRO A HG2  1 
ATOM 1150 H HG3  . PRO A 1 90  ? 20.119  12.141  -1.792  1.00 0.00 ? 90  PRO A HG3  1 
ATOM 1151 H HD2  . PRO A 1 90  ? 17.723  12.367  -3.023  1.00 0.00 ? 90  PRO A HD2  1 
ATOM 1152 H HD3  . PRO A 1 90  ? 18.467  10.793  -2.677  1.00 0.00 ? 90  PRO A HD3  1 
ATOM 1153 N N    . GLY A 1 91  ? 16.090  13.636  -0.021  1.00 0.00 ? 91  GLY A N    1 
ATOM 1154 C CA   . GLY A 1 91  ? 15.425  14.811  0.516   1.00 0.00 ? 91  GLY A CA   1 
ATOM 1155 C C    . GLY A 1 91  ? 14.627  14.506  1.769   1.00 0.00 ? 91  GLY A C    1 
ATOM 1156 O O    . GLY A 1 91  ? 14.578  15.317  2.694   1.00 0.00 ? 91  GLY A O    1 
ATOM 1157 H H    . GLY A 1 91  ? 16.017  13.430  -0.976  1.00 0.00 ? 91  GLY A H    1 
ATOM 1158 H HA2  . GLY A 1 91  ? 16.170  15.557  0.749   1.00 0.00 ? 91  GLY A HA2  1 
ATOM 1159 H HA3  . GLY A 1 91  ? 14.757  15.207  -0.235  1.00 0.00 ? 91  GLY A HA3  1 
ATOM 1160 N N    . ALA A 1 92  ? 14.005  13.332  1.800   1.00 0.00 ? 92  ALA A N    1 
ATOM 1161 C CA   . ALA A 1 92  ? 13.208  12.921  2.949   1.00 0.00 ? 92  ALA A CA   1 
ATOM 1162 C C    . ALA A 1 92  ? 14.090  12.669  4.167   1.00 0.00 ? 92  ALA A C    1 
ATOM 1163 O O    . ALA A 1 92  ? 13.698  12.954  5.299   1.00 0.00 ? 92  ALA A O    1 
ATOM 1164 C CB   . ALA A 1 92  ? 12.401  11.677  2.615   1.00 0.00 ? 92  ALA A CB   1 
ATOM 1165 H H    . ALA A 1 92  ? 14.083  12.729  1.032   1.00 0.00 ? 92  ALA A H    1 
ATOM 1166 H HA   . ALA A 1 92  ? 12.516  13.718  3.177   1.00 0.00 ? 92  ALA A HA   1 
ATOM 1167 H HB1  . ALA A 1 92  ? 12.692  10.871  3.273   1.00 0.00 ? 92  ALA A HB1  1 
ATOM 1168 H HB2  . ALA A 1 92  ? 12.588  11.390  1.591   1.00 0.00 ? 92  ALA A HB2  1 
ATOM 1169 H HB3  . ALA A 1 92  ? 11.349  11.884  2.744   1.00 0.00 ? 92  ALA A HB3  1 
ATOM 1170 N N    . LYS A 1 93  ? 15.281  12.128  3.929   1.00 0.00 ? 93  LYS A N    1 
ATOM 1171 C CA   . LYS A 1 93  ? 16.215  11.835  5.009   1.00 0.00 ? 93  LYS A CA   1 
ATOM 1172 C C    . LYS A 1 93  ? 15.579  10.910  6.040   1.00 0.00 ? 93  LYS A C    1 
ATOM 1173 O O    . LYS A 1 93  ? 14.772  11.343  6.863   1.00 0.00 ? 93  LYS A O    1 
ATOM 1174 C CB   . LYS A 1 93  ? 16.668  13.133  5.680   1.00 0.00 ? 93  LYS A CB   1 
ATOM 1175 C CG   . LYS A 1 93  ? 17.776  12.940  6.701   1.00 0.00 ? 93  LYS A CG   1 
ATOM 1176 C CD   . LYS A 1 93  ? 17.220  12.695  8.095   1.00 0.00 ? 93  LYS A CD   1 
ATOM 1177 C CE   . LYS A 1 93  ? 16.463  13.906  8.617   1.00 0.00 ? 93  LYS A CE   1 
ATOM 1178 N NZ   . LYS A 1 93  ? 15.182  13.521  9.272   1.00 0.00 ? 93  LYS A NZ   1 
ATOM 1179 H H    . LYS A 1 93  ? 15.537  11.922  3.006   1.00 0.00 ? 93  LYS A H    1 
ATOM 1180 H HA   . LYS A 1 93  ? 17.075  11.341  4.580   1.00 0.00 ? 93  LYS A HA   1 
ATOM 1181 H HB2  . LYS A 1 93  ? 17.024  13.813  4.920   1.00 0.00 ? 93  LYS A HB2  1 
ATOM 1182 H HB3  . LYS A 1 93  ? 15.823  13.579  6.181   1.00 0.00 ? 93  LYS A HB3  1 
ATOM 1183 H HG2  . LYS A 1 93  ? 18.378  12.092  6.410   1.00 0.00 ? 93  LYS A HG2  1 
ATOM 1184 H HG3  . LYS A 1 93  ? 18.388  13.829  6.721   1.00 0.00 ? 93  LYS A HG3  1 
ATOM 1185 H HD2  . LYS A 1 93  ? 16.548  11.850  8.062   1.00 0.00 ? 93  LYS A HD2  1 
ATOM 1186 H HD3  . LYS A 1 93  ? 18.038  12.479  8.766   1.00 0.00 ? 93  LYS A HD3  1 
ATOM 1187 H HE2  . LYS A 1 93  ? 17.084  14.420  9.336   1.00 0.00 ? 93  LYS A HE2  1 
ATOM 1188 H HE3  . LYS A 1 93  ? 16.250  14.566  7.790   1.00 0.00 ? 93  LYS A HE3  1 
ATOM 1189 H HZ1  . LYS A 1 93  ? 15.070  14.037  10.169  1.00 0.00 ? 93  LYS A HZ1  1 
ATOM 1190 H HZ2  . LYS A 1 93  ? 15.173  12.500  9.468   1.00 0.00 ? 93  LYS A HZ2  1 
ATOM 1191 H HZ3  . LYS A 1 93  ? 14.380  13.750  8.651   1.00 0.00 ? 93  LYS A HZ3  1 
ATOM 1192 N N    . GLY A 1 94  ? 15.945  9.633   5.991   1.00 0.00 ? 94  GLY A N    1 
ATOM 1193 C CA   . GLY A 1 94  ? 15.393  8.670   6.926   1.00 0.00 ? 94  GLY A CA   1 
ATOM 1194 C C    . GLY A 1 94  ? 16.376  7.572   7.285   1.00 0.00 ? 94  GLY A C    1 
ATOM 1195 O O    . GLY A 1 94  ? 16.523  7.222   8.456   1.00 0.00 ? 94  GLY A O    1 
ATOM 1196 H H    . GLY A 1 94  ? 16.590  9.342   5.313   1.00 0.00 ? 94  GLY A H    1 
ATOM 1197 H HA2  . GLY A 1 94  ? 15.104  9.187   7.829   1.00 0.00 ? 94  GLY A HA2  1 
ATOM 1198 H HA3  . GLY A 1 94  ? 14.515  8.221   6.485   1.00 0.00 ? 94  GLY A HA3  1 
ATOM 1199 N N    . ALA A 1 95  ? 17.045  7.022   6.276   1.00 0.00 ? 95  ALA A N    1 
ATOM 1200 C CA   . ALA A 1 95  ? 18.010  5.950   6.497   1.00 0.00 ? 95  ALA A CA   1 
ATOM 1201 C C    . ALA A 1 95  ? 19.382  6.317   5.938   1.00 0.00 ? 95  ALA A C    1 
ATOM 1202 O O    . ALA A 1 95  ? 20.405  6.094   6.585   1.00 0.00 ? 95  ALA A O    1 
ATOM 1203 C CB   . ALA A 1 95  ? 17.512  4.656   5.873   1.00 0.00 ? 95  ALA A CB   1 
ATOM 1204 H H    . ALA A 1 95  ? 16.882  7.339   5.364   1.00 0.00 ? 95  ALA A H    1 
ATOM 1205 H HA   . ALA A 1 95  ? 18.097  5.796   7.562   1.00 0.00 ? 95  ALA A HA   1 
ATOM 1206 H HB1  . ALA A 1 95  ? 18.310  3.928   5.867   1.00 0.00 ? 95  ALA A HB1  1 
ATOM 1207 H HB2  . ALA A 1 95  ? 17.190  4.844   4.859   1.00 0.00 ? 95  ALA A HB2  1 
ATOM 1208 H HB3  . ALA A 1 95  ? 16.682  4.274   6.449   1.00 0.00 ? 95  ALA A HB3  1 
ATOM 1209 N N    . THR A 1 96  ? 19.397  6.875   4.732   1.00 0.00 ? 96  THR A N    1 
ATOM 1210 C CA   . THR A 1 96  ? 20.647  7.264   4.088   1.00 0.00 ? 96  THR A CA   1 
ATOM 1211 C C    . THR A 1 96  ? 20.617  8.733   3.675   1.00 0.00 ? 96  THR A C    1 
ATOM 1212 O O    . THR A 1 96  ? 19.765  9.498   4.127   1.00 0.00 ? 96  THR A O    1 
ATOM 1213 C CB   . THR A 1 96  ? 20.906  6.385   2.863   1.00 0.00 ? 96  THR A CB   1 
ATOM 1214 O OG1  . THR A 1 96  ? 22.227  6.571   2.385   1.00 0.00 ? 96  THR A OG1  1 
ATOM 1215 C CG2  . THR A 1 96  ? 19.957  6.659   1.717   1.00 0.00 ? 96  THR A CG2  1 
ATOM 1216 H H    . THR A 1 96  ? 18.550  7.024   4.262   1.00 0.00 ? 96  THR A H    1 
ATOM 1217 H HA   . THR A 1 96  ? 21.445  7.120   4.800   1.00 0.00 ? 96  THR A HA   1 
ATOM 1218 H HB   . THR A 1 96  ? 20.790  5.349   3.145   1.00 0.00 ? 96  THR A HB   1 
ATOM 1219 H HG1  . THR A 1 96  ? 22.461  5.847   1.799   1.00 0.00 ? 96  THR A HG1  1 
ATOM 1220 H HG21 . THR A 1 96  ? 18.992  6.941   2.109   1.00 0.00 ? 96  THR A HG21 1 
ATOM 1221 H HG22 . THR A 1 96  ? 19.855  5.769   1.114   1.00 0.00 ? 96  THR A HG22 1 
ATOM 1222 H HG23 . THR A 1 96  ? 20.349  7.461   1.110   1.00 0.00 ? 96  THR A HG23 1 
ATOM 1223 N N    . ARG A 1 97  ? 21.554  9.119   2.816   1.00 0.00 ? 97  ARG A N    1 
ATOM 1224 C CA   . ARG A 1 97  ? 21.636  10.495  2.340   1.00 0.00 ? 97  ARG A CA   1 
ATOM 1225 C C    . ARG A 1 97  ? 22.606  10.608  1.169   1.00 0.00 ? 97  ARG A C    1 
ATOM 1226 O O    . ARG A 1 97  ? 23.658  9.969   1.157   1.00 0.00 ? 97  ARG A O    1 
ATOM 1227 C CB   . ARG A 1 97  ? 22.075  11.424  3.475   1.00 0.00 ? 97  ARG A CB   1 
ATOM 1228 C CG   . ARG A 1 97  ? 23.476  11.135  3.990   1.00 0.00 ? 97  ARG A CG   1 
ATOM 1229 C CD   . ARG A 1 97  ? 24.154  12.396  4.499   1.00 0.00 ? 97  ARG A CD   1 
ATOM 1230 N NE   . ARG A 1 97  ? 24.830  12.176  5.774   1.00 0.00 ? 97  ARG A NE   1 
ATOM 1231 C CZ   . ARG A 1 97  ? 25.932  11.444  5.905   1.00 0.00 ? 97  ARG A CZ   1 
ATOM 1232 N NH1  . ARG A 1 97  ? 26.477  10.867  4.843   1.00 0.00 ? 97  ARG A NH1  1 
ATOM 1233 N NH2  . ARG A 1 97  ? 26.490  11.290  7.098   1.00 0.00 ? 97  ARG A NH2  1 
ATOM 1234 H H    . ARG A 1 97  ? 22.205  8.462   2.491   1.00 0.00 ? 97  ARG A H    1 
ATOM 1235 H HA   . ARG A 1 97  ? 20.652  10.789  2.006   1.00 0.00 ? 97  ARG A HA   1 
ATOM 1236 H HB2  . ARG A 1 97  ? 22.048  12.444  3.121   1.00 0.00 ? 97  ARG A HB2  1 
ATOM 1237 H HB3  . ARG A 1 97  ? 21.384  11.319  4.298   1.00 0.00 ? 97  ARG A HB3  1 
ATOM 1238 H HG2  . ARG A 1 97  ? 23.411  10.422  4.799   1.00 0.00 ? 97  ARG A HG2  1 
ATOM 1239 H HG3  . ARG A 1 97  ? 24.066  10.719  3.187   1.00 0.00 ? 97  ARG A HG3  1 
ATOM 1240 H HD2  . ARG A 1 97  ? 24.880  12.719  3.768   1.00 0.00 ? 97  ARG A HD2  1 
ATOM 1241 H HD3  . ARG A 1 97  ? 23.406  13.165  4.627   1.00 0.00 ? 97  ARG A HD3  1 
ATOM 1242 H HE   . ARG A 1 97  ? 24.443  12.594  6.572   1.00 0.00 ? 97  ARG A HE   1 
ATOM 1243 H HH11 . ARG A 1 97  ? 26.059  10.981  3.942   1.00 0.00 ? 97  ARG A HH11 1 
ATOM 1244 H HH12 . ARG A 1 97  ? 27.306  10.317  4.944   1.00 0.00 ? 97  ARG A HH12 1 
ATOM 1245 H HH21 . ARG A 1 97  ? 26.081  11.724  7.901   1.00 0.00 ? 97  ARG A HH21 1 
ATOM 1246 H HH22 . ARG A 1 97  ? 27.319  10.739  7.195   1.00 0.00 ? 97  ARG A HH22 1 
ATOM 1247 N N    . ARG A 1 98  ? 22.242  11.421  0.182   1.00 0.00 ? 98  ARG A N    1 
ATOM 1248 C CA   . ARG A 1 98  ? 23.079  11.612  -0.996  1.00 0.00 ? 98  ARG A CA   1 
ATOM 1249 C C    . ARG A 1 98  ? 23.266  10.298  -1.748  1.00 0.00 ? 98  ARG A C    1 
ATOM 1250 O O    . ARG A 1 98  ? 22.565  10.024  -2.723  1.00 0.00 ? 98  ARG A O    1 
ATOM 1251 C CB   . ARG A 1 98  ? 24.439  12.182  -0.592  1.00 0.00 ? 98  ARG A CB   1 
ATOM 1252 C CG   . ARG A 1 98  ? 24.477  13.701  -0.558  1.00 0.00 ? 98  ARG A CG   1 
ATOM 1253 C CD   . ARG A 1 98  ? 24.901  14.278  -1.898  1.00 0.00 ? 98  ARG A CD   1 
ATOM 1254 N NE   . ARG A 1 98  ? 26.299  13.985  -2.201  1.00 0.00 ? 98  ARG A NE   1 
ATOM 1255 C CZ   . ARG A 1 98  ? 26.822  14.063  -3.420  1.00 0.00 ? 98  ARG A CZ   1 
ATOM 1256 N NH1  . ARG A 1 98  ? 26.065  14.425  -4.447  1.00 0.00 ? 98  ARG A NH1  1 
ATOM 1257 N NH2  . ARG A 1 98  ? 28.102  13.780  -3.613  1.00 0.00 ? 98  ARG A NH2  1 
ATOM 1258 H H    . ARG A 1 98  ? 21.391  11.902  0.248   1.00 0.00 ? 98  ARG A H    1 
ATOM 1259 H HA   . ARG A 1 98  ? 22.580  12.317  -1.646  1.00 0.00 ? 98  ARG A HA   1 
ATOM 1260 H HB2  . ARG A 1 98  ? 24.692  11.815  0.392   1.00 0.00 ? 98  ARG A HB2  1 
ATOM 1261 H HB3  . ARG A 1 98  ? 25.184  11.840  -1.296  1.00 0.00 ? 98  ARG A HB3  1 
ATOM 1262 H HG2  . ARG A 1 98  ? 23.492  14.071  -0.313  1.00 0.00 ? 98  ARG A HG2  1 
ATOM 1263 H HG3  . ARG A 1 98  ? 25.181  14.017  0.198   1.00 0.00 ? 98  ARG A HG3  1 
ATOM 1264 H HD2  . ARG A 1 98  ? 24.278  13.854  -2.672  1.00 0.00 ? 98  ARG A HD2  1 
ATOM 1265 H HD3  . ARG A 1 98  ? 24.765  15.349  -1.874  1.00 0.00 ? 98  ARG A HD3  1 
ATOM 1266 H HE   . ARG A 1 98  ? 26.877  13.715  -1.457  1.00 0.00 ? 98  ARG A HE   1 
ATOM 1267 H HH11 . ARG A 1 98  ? 25.099  14.640  -4.305  1.00 0.00 ? 98  ARG A HH11 1 
ATOM 1268 H HH12 . ARG A 1 98  ? 26.461  14.484  -5.363  1.00 0.00 ? 98  ARG A HH12 1 
ATOM 1269 H HH21 . ARG A 1 98  ? 28.675  13.506  -2.840  1.00 0.00 ? 98  ARG A HH21 1 
ATOM 1270 H HH22 . ARG A 1 98  ? 28.495  13.839  -4.531  1.00 0.00 ? 98  ARG A HH22 1 
ATOM 1271 N N    . ARG A 1 99  ? 24.214  9.488   -1.288  1.00 0.00 ? 99  ARG A N    1 
ATOM 1272 C CA   . ARG A 1 99  ? 24.488  8.199   -1.913  1.00 0.00 ? 99  ARG A CA   1 
ATOM 1273 C C    . ARG A 1 99  ? 25.404  7.355   -1.036  1.00 0.00 ? 99  ARG A C    1 
ATOM 1274 O O    . ARG A 1 99  ? 26.453  7.819   -0.589  1.00 0.00 ? 99  ARG A O    1 
ATOM 1275 C CB   . ARG A 1 99  ? 25.122  8.399   -3.291  1.00 0.00 ? 99  ARG A CB   1 
ATOM 1276 C CG   . ARG A 1 99  ? 25.470  7.096   -3.993  1.00 0.00 ? 99  ARG A CG   1 
ATOM 1277 C CD   . ARG A 1 99  ? 24.931  7.065   -5.415  1.00 0.00 ? 99  ARG A CD   1 
ATOM 1278 N NE   . ARG A 1 99  ? 25.813  6.330   -6.317  1.00 0.00 ? 99  ARG A NE   1 
ATOM 1279 C CZ   . ARG A 1 99  ? 25.836  5.004   -6.407  1.00 0.00 ? 99  ARG A CZ   1 
ATOM 1280 N NH1  . ARG A 1 99  ? 25.025  4.271   -5.655  1.00 0.00 ? 99  ARG A NH1  1 
ATOM 1281 N NH2  . ARG A 1 99  ? 26.668  4.409   -7.251  1.00 0.00 ? 99  ARG A NH2  1 
ATOM 1282 H H    . ARG A 1 99  ? 24.737  9.761   -0.506  1.00 0.00 ? 99  ARG A H    1 
ATOM 1283 H HA   . ARG A 1 99  ? 23.549  7.681   -2.028  1.00 0.00 ? 99  ARG A HA   1 
ATOM 1284 H HB2  . ARG A 1 99  ? 24.433  8.947   -3.916  1.00 0.00 ? 99  ARG A HB2  1 
ATOM 1285 H HB3  . ARG A 1 99  ? 26.028  8.975   -3.178  1.00 0.00 ? 99  ARG A HB3  1 
ATOM 1286 H HG2  . ARG A 1 99  ? 26.544  6.991   -4.024  1.00 0.00 ? 99  ARG A HG2  1 
ATOM 1287 H HG3  . ARG A 1 99  ? 25.041  6.274   -3.439  1.00 0.00 ? 99  ARG A HG3  1 
ATOM 1288 H HD2  . ARG A 1 99  ? 23.961  6.589   -5.408  1.00 0.00 ? 99  ARG A HD2  1 
ATOM 1289 H HD3  . ARG A 1 99  ? 24.831  8.079   -5.771  1.00 0.00 ? 99  ARG A HD3  1 
ATOM 1290 H HE   . ARG A 1 99  ? 26.421  6.851   -6.882  1.00 0.00 ? 99  ARG A HE   1 
ATOM 1291 H HH11 . ARG A 1 99  ? 24.397  4.716   -5.017  1.00 0.00 ? 99  ARG A HH11 1 
ATOM 1292 H HH12 . ARG A 1 99  ? 25.044  3.274   -5.725  1.00 0.00 ? 99  ARG A HH12 1 
ATOM 1293 H HH21 . ARG A 1 99  ? 27.280  4.958   -7.820  1.00 0.00 ? 99  ARG A HH21 1 
ATOM 1294 H HH22 . ARG A 1 99  ? 26.683  3.411   -7.319  1.00 0.00 ? 99  ARG A HH22 1 
ATOM 1295 N N    . LYS A 1 100 ? 24.999  6.114   -0.793  1.00 0.00 ? 100 LYS A N    1 
ATOM 1296 C CA   . LYS A 1 100 ? 25.777  5.209   0.042   1.00 0.00 ? 100 LYS A CA   1 
ATOM 1297 C C    . LYS A 1 100 ? 25.097  3.846   0.152   1.00 0.00 ? 100 LYS A C    1 
ATOM 1298 O O    . LYS A 1 100 ? 24.243  3.636   1.013   1.00 0.00 ? 100 LYS A O    1 
ATOM 1299 C CB   . LYS A 1 100 ? 25.961  5.813   1.434   1.00 0.00 ? 100 LYS A CB   1 
ATOM 1300 C CG   . LYS A 1 100 ? 26.804  4.956   2.365   1.00 0.00 ? 100 LYS A CG   1 
ATOM 1301 C CD   . LYS A 1 100 ? 28.177  5.567   2.595   1.00 0.00 ? 100 LYS A CD   1 
ATOM 1302 C CE   . LYS A 1 100 ? 28.217  6.382   3.877   1.00 0.00 ? 100 LYS A CE   1 
ATOM 1303 N NZ   . LYS A 1 100 ? 28.674  5.570   5.039   1.00 0.00 ? 100 LYS A NZ   1 
ATOM 1304 H H    . LYS A 1 100 ? 24.151  5.803   -1.173  1.00 0.00 ? 100 LYS A H    1 
ATOM 1305 H HA   . LYS A 1 100 ? 26.745  5.080   -0.419  1.00 0.00 ? 100 LYS A HA   1 
ATOM 1306 H HB2  . LYS A 1 100 ? 26.439  6.776   1.334   1.00 0.00 ? 100 LYS A HB2  1 
ATOM 1307 H HB3  . LYS A 1 100 ? 24.989  5.949   1.885   1.00 0.00 ? 100 LYS A HB3  1 
ATOM 1308 H HG2  . LYS A 1 100 ? 26.297  4.868   3.315   1.00 0.00 ? 100 LYS A HG2  1 
ATOM 1309 H HG3  . LYS A 1 100 ? 26.925  3.977   1.926   1.00 0.00 ? 100 LYS A HG3  1 
ATOM 1310 H HD2  . LYS A 1 100 ? 28.907  4.773   2.662   1.00 0.00 ? 100 LYS A HD2  1 
ATOM 1311 H HD3  . LYS A 1 100 ? 28.418  6.211   1.762   1.00 0.00 ? 100 LYS A HD3  1 
ATOM 1312 H HE2  . LYS A 1 100 ? 28.896  7.211   3.740   1.00 0.00 ? 100 LYS A HE2  1 
ATOM 1313 H HE3  . LYS A 1 100 ? 27.226  6.758   4.080   1.00 0.00 ? 100 LYS A HE3  1 
ATOM 1314 H HZ1  . LYS A 1 100 ? 27.896  4.975   5.387   1.00 0.00 ? 100 LYS A HZ1  1 
ATOM 1315 H HZ2  . LYS A 1 100 ? 28.991  6.193   5.808   1.00 0.00 ? 100 LYS A HZ2  1 
ATOM 1316 H HZ3  . LYS A 1 100 ? 29.465  4.956   4.757   1.00 0.00 ? 100 LYS A HZ3  1 
ATOM 1317 N N    . PRO A 1 101 ? 25.468  2.898   -0.726  1.00 0.00 ? 101 PRO A N    1 
ATOM 1318 C CA   . PRO A 1 101 ? 24.889  1.550   -0.725  1.00 0.00 ? 101 PRO A CA   1 
ATOM 1319 C C    . PRO A 1 101 ? 25.276  0.753   0.516   1.00 0.00 ? 101 PRO A C    1 
ATOM 1320 O O    . PRO A 1 101 ? 26.395  0.870   1.016   1.00 0.00 ? 101 PRO A O    1 
ATOM 1321 C CB   . PRO A 1 101 ? 25.480  0.904   -1.981  1.00 0.00 ? 101 PRO A CB   1 
ATOM 1322 C CG   . PRO A 1 101 ? 26.739  1.656   -2.239  1.00 0.00 ? 101 PRO A CG   1 
ATOM 1323 C CD   . PRO A 1 101 ? 26.479  3.065   -1.786  1.00 0.00 ? 101 PRO A CD   1 
ATOM 1324 H HA   . PRO A 1 101 ? 23.812  1.583   -0.807  1.00 0.00 ? 101 PRO A HA   1 
ATOM 1325 H HB2  . PRO A 1 101 ? 25.675  -0.141  -1.793  1.00 0.00 ? 101 PRO A HB2  1 
ATOM 1326 H HB3  . PRO A 1 101 ? 24.784  1.004   -2.801  1.00 0.00 ? 101 PRO A HB3  1 
ATOM 1327 H HG2  . PRO A 1 101 ? 27.549  1.224   -1.671  1.00 0.00 ? 101 PRO A HG2  1 
ATOM 1328 H HG3  . PRO A 1 101 ? 26.968  1.638   -3.295  1.00 0.00 ? 101 PRO A HG3  1 
ATOM 1329 H HD2  . PRO A 1 101 ? 27.381  3.509   -1.393  1.00 0.00 ? 101 PRO A HD2  1 
ATOM 1330 H HD3  . PRO A 1 101 ? 26.088  3.658   -2.600  1.00 0.00 ? 101 PRO A HD3  1 
ATOM 1331 N N    . CYS A 1 102 ? 24.345  -0.058  1.008   1.00 0.00 ? 102 CYS A N    1 
ATOM 1332 C CA   . CYS A 1 102 ? 24.592  -0.874  2.192   1.00 0.00 ? 102 CYS A CA   1 
ATOM 1333 C C    . CYS A 1 102 ? 24.279  -2.341  1.920   1.00 0.00 ? 102 CYS A C    1 
ATOM 1334 O O    . CYS A 1 102 ? 23.549  -2.669  0.984   1.00 0.00 ? 102 CYS A O    1 
ATOM 1335 C CB   . CYS A 1 102 ? 23.750  -0.371  3.366   1.00 0.00 ? 102 CYS A CB   1 
ATOM 1336 S SG   . CYS A 1 102 ? 24.450  1.066   4.212   1.00 0.00 ? 102 CYS A SG   1 
ATOM 1337 H H    . CYS A 1 102 ? 23.472  -0.108  0.567   1.00 0.00 ? 102 CYS A H    1 
ATOM 1338 H HA   . CYS A 1 102 ? 25.638  -0.783  2.444   1.00 0.00 ? 102 CYS A HA   1 
ATOM 1339 H HB2  . CYS A 1 102 ? 22.770  -0.095  3.005   1.00 0.00 ? 102 CYS A HB2  1 
ATOM 1340 H HB3  . CYS A 1 102 ? 23.651  -1.164  4.093   1.00 0.00 ? 102 CYS A HB3  1 
ATOM 1341 H HG   . CYS A 1 102 ? 23.959  1.197   5.026   1.00 0.00 ? 102 CYS A HG   1 
ATOM 1342 N N    . SER A 1 103 ? 24.838  -3.221  2.744   1.00 0.00 ? 103 SER A N    1 
ATOM 1343 C CA   . SER A 1 103 ? 24.623  -4.655  2.591   1.00 0.00 ? 103 SER A CA   1 
ATOM 1344 C C    . SER A 1 103 ? 23.235  -5.055  3.080   1.00 0.00 ? 103 SER A C    1 
ATOM 1345 O O    . SER A 1 103 ? 22.438  -4.207  3.481   1.00 0.00 ? 103 SER A O    1 
ATOM 1346 C CB   . SER A 1 103 ? 25.690  -5.435  3.361   1.00 0.00 ? 103 SER A CB   1 
ATOM 1347 O OG   . SER A 1 103 ? 25.661  -6.811  3.022   1.00 0.00 ? 103 SER A OG   1 
ATOM 1348 H H    . SER A 1 103 ? 25.412  -2.899  3.470   1.00 0.00 ? 103 SER A H    1 
ATOM 1349 H HA   . SER A 1 103 ? 24.703  -4.891  1.540   1.00 0.00 ? 103 SER A HA   1 
ATOM 1350 H HB2  . SER A 1 103 ? 26.666  -5.039  3.120   1.00 0.00 ? 103 SER A HB2  1 
ATOM 1351 H HB3  . SER A 1 103 ? 25.513  -5.334  4.421   1.00 0.00 ? 103 SER A HB3  1 
ATOM 1352 H HG   . SER A 1 103 ? 26.087  -6.941  2.172   1.00 0.00 ? 103 SER A HG   1 
ATOM 1353 N N    . ARG A 1 104 ? 22.954  -6.353  3.043   1.00 0.00 ? 104 ARG A N    1 
ATOM 1354 C CA   . ARG A 1 104 ? 21.664  -6.871  3.482   1.00 0.00 ? 104 ARG A CA   1 
ATOM 1355 C C    . ARG A 1 104 ? 20.527  -6.285  2.644   1.00 0.00 ? 104 ARG A C    1 
ATOM 1356 O O    . ARG A 1 104 ? 20.649  -5.179  2.116   1.00 0.00 ? 104 ARG A O    1 
ATOM 1357 C CB   . ARG A 1 104 ? 21.440  -6.548  4.960   1.00 0.00 ? 104 ARG A CB   1 
ATOM 1358 C CG   . ARG A 1 104 ? 22.615  -6.922  5.848   1.00 0.00 ? 104 ARG A CG   1 
ATOM 1359 C CD   . ARG A 1 104 ? 22.820  -8.427  5.900   1.00 0.00 ? 104 ARG A CD   1 
ATOM 1360 N NE   . ARG A 1 104 ? 22.109  -9.038  7.019   1.00 0.00 ? 104 ARG A NE   1 
ATOM 1361 C CZ   . ARG A 1 104 ? 22.065  -10.349 7.236   1.00 0.00 ? 104 ARG A CZ   1 
ATOM 1362 N NH1  . ARG A 1 104 ? 22.688  -11.182 6.414   1.00 0.00 ? 104 ARG A NH1  1 
ATOM 1363 N NH2  . ARG A 1 104 ? 21.398  -10.828 8.278   1.00 0.00 ? 104 ARG A NH2  1 
ATOM 1364 H H    . ARG A 1 104 ? 23.632  -6.979  2.713   1.00 0.00 ? 104 ARG A H    1 
ATOM 1365 H HA   . ARG A 1 104 ? 21.680  -7.940  3.354   1.00 0.00 ? 104 ARG A HA   1 
ATOM 1366 H HB2  . ARG A 1 104 ? 21.263  -5.487  5.062   1.00 0.00 ? 104 ARG A HB2  1 
ATOM 1367 H HB3  . ARG A 1 104 ? 20.569  -7.084  5.306   1.00 0.00 ? 104 ARG A HB3  1 
ATOM 1368 H HG2  . ARG A 1 104 ? 23.510  -6.460  5.457   1.00 0.00 ? 104 ARG A HG2  1 
ATOM 1369 H HG3  . ARG A 1 104 ? 22.428  -6.559  6.848   1.00 0.00 ? 104 ARG A HG3  1 
ATOM 1370 H HD2  . ARG A 1 104 ? 22.458  -8.859  4.978   1.00 0.00 ? 104 ARG A HD2  1 
ATOM 1371 H HD3  . ARG A 1 104 ? 23.876  -8.631  6.002   1.00 0.00 ? 104 ARG A HD3  1 
ATOM 1372 H HE   . ARG A 1 104 ? 21.642  -8.441  7.641   1.00 0.00 ? 104 ARG A HE   1 
ATOM 1373 H HH11 . ARG A 1 104 ? 23.192  -10.824 5.627   1.00 0.00 ? 104 ARG A HH11 1 
ATOM 1374 H HH12 . ARG A 1 104 ? 22.653  -12.168 6.579   1.00 0.00 ? 104 ARG A HH12 1 
ATOM 1375 H HH21 . ARG A 1 104 ? 20.927  -10.203 8.900   1.00 0.00 ? 104 ARG A HH21 1 
ATOM 1376 H HH22 . ARG A 1 104 ? 21.365  -11.814 8.440   1.00 0.00 ? 104 ARG A HH22 1 
ATOM 1377 N N    . PRO A 1 105 ? 19.399  -7.013  2.503   1.00 0.00 ? 105 PRO A N    1 
ATOM 1378 C CA   . PRO A 1 105 ? 19.192  -8.332  3.123   1.00 0.00 ? 105 PRO A CA   1 
ATOM 1379 C C    . PRO A 1 105 ? 20.019  -9.435  2.469   1.00 0.00 ? 105 PRO A C    1 
ATOM 1380 O O    . PRO A 1 105 ? 20.800  -9.183  1.552   1.00 0.00 ? 105 PRO A O    1 
ATOM 1381 C CB   . PRO A 1 105 ? 17.702  -8.590  2.899   1.00 0.00 ? 105 PRO A CB   1 
ATOM 1382 C CG   . PRO A 1 105 ? 17.374  -7.817  1.673   1.00 0.00 ? 105 PRO A CG   1 
ATOM 1383 C CD   . PRO A 1 105 ? 18.210  -6.576  1.748   1.00 0.00 ? 105 PRO A CD   1 
ATOM 1384 H HA   . PRO A 1 105 ? 19.400  -8.308  4.182   1.00 0.00 ? 105 PRO A HA   1 
ATOM 1385 H HB2  . PRO A 1 105 ? 17.531  -9.646  2.757   1.00 0.00 ? 105 PRO A HB2  1 
ATOM 1386 H HB3  . PRO A 1 105 ? 17.141  -8.238  3.751   1.00 0.00 ? 105 PRO A HB3  1 
ATOM 1387 H HG2  . PRO A 1 105 ? 17.631  -8.389  0.797   1.00 0.00 ? 105 PRO A HG2  1 
ATOM 1388 H HG3  . PRO A 1 105 ? 16.324  -7.565  1.664   1.00 0.00 ? 105 PRO A HG3  1 
ATOM 1389 H HD2  . PRO A 1 105 ? 18.481  -6.241  0.758   1.00 0.00 ? 105 PRO A HD2  1 
ATOM 1390 H HD3  . PRO A 1 105 ? 17.680  -5.802  2.281   1.00 0.00 ? 105 PRO A HD3  1 
ATOM 1391 N N    . LEU A 1 106 ? 19.843  -10.658 2.960   1.00 0.00 ? 106 LEU A N    1 
ATOM 1392 C CA   . LEU A 1 106 ? 20.579  -11.809 2.448   1.00 0.00 ? 106 LEU A CA   1 
ATOM 1393 C C    . LEU A 1 106 ? 19.956  -12.338 1.159   1.00 0.00 ? 106 LEU A C    1 
ATOM 1394 O O    . LEU A 1 106 ? 18.775  -12.118 0.893   1.00 0.00 ? 106 LEU A O    1 
ATOM 1395 C CB   . LEU A 1 106 ? 20.609  -12.917 3.502   1.00 0.00 ? 106 LEU A CB   1 
ATOM 1396 C CG   . LEU A 1 106 ? 21.618  -14.036 3.237   1.00 0.00 ? 106 LEU A CG   1 
ATOM 1397 C CD1  . LEU A 1 106 ? 23.011  -13.460 3.032   1.00 0.00 ? 106 LEU A CD1  1 
ATOM 1398 C CD2  . LEU A 1 106 ? 21.616  -15.036 4.383   1.00 0.00 ? 106 LEU A CD2  1 
ATOM 1399 H H    . LEU A 1 106 ? 19.211  -10.788 3.697   1.00 0.00 ? 106 LEU A H    1 
ATOM 1400 H HA   . LEU A 1 106 ? 21.590  -11.491 2.242   1.00 0.00 ? 106 LEU A HA   1 
ATOM 1401 H HB2  . LEU A 1 106 ? 20.841  -12.470 4.457   1.00 0.00 ? 106 LEU A HB2  1 
ATOM 1402 H HB3  . LEU A 1 106 ? 19.623  -13.356 3.560   1.00 0.00 ? 106 LEU A HB3  1 
ATOM 1403 H HG   . LEU A 1 106 ? 21.337  -14.560 2.336   1.00 0.00 ? 106 LEU A HG   1 
ATOM 1404 H HD11 . LEU A 1 106 ? 23.303  -13.585 2.000   1.00 0.00 ? 106 LEU A HD11 1 
ATOM 1405 H HD12 . LEU A 1 106 ? 23.712  -13.976 3.670   1.00 0.00 ? 106 LEU A HD12 1 
ATOM 1406 H HD13 . LEU A 1 106 ? 23.005  -12.408 3.279   1.00 0.00 ? 106 LEU A HD13 1 
ATOM 1407 H HD21 . LEU A 1 106 ? 20.762  -14.854 5.019   1.00 0.00 ? 106 LEU A HD21 1 
ATOM 1408 H HD22 . LEU A 1 106 ? 22.523  -14.926 4.959   1.00 0.00 ? 106 LEU A HD22 1 
ATOM 1409 H HD23 . LEU A 1 106 ? 21.562  -16.039 3.986   1.00 0.00 ? 106 LEU A HD23 1 
ATOM 1410 N N    . SER A 1 107 ? 20.756  -13.054 0.371   1.00 0.00 ? 107 SER A N    1 
ATOM 1411 C CA   . SER A 1 107 ? 20.289  -13.627 -0.890  1.00 0.00 ? 107 SER A CA   1 
ATOM 1412 C C    . SER A 1 107 ? 20.151  -12.552 -1.964  1.00 0.00 ? 107 SER A C    1 
ATOM 1413 O O    . SER A 1 107 ? 20.258  -11.360 -1.681  1.00 0.00 ? 107 SER A O    1 
ATOM 1414 C CB   . SER A 1 107 ? 18.949  -14.342 -0.692  1.00 0.00 ? 107 SER A CB   1 
ATOM 1415 O OG   . SER A 1 107 ? 18.956  -15.619 -1.307  1.00 0.00 ? 107 SER A OG   1 
ATOM 1416 H H    . SER A 1 107 ? 21.686  -13.198 0.644   1.00 0.00 ? 107 SER A H    1 
ATOM 1417 H HA   . SER A 1 107 ? 21.025  -14.348 -1.215  1.00 0.00 ? 107 SER A HA   1 
ATOM 1418 H HB2  . SER A 1 107 ? 18.762  -14.467 0.364   1.00 0.00 ? 107 SER A HB2  1 
ATOM 1419 H HB3  . SER A 1 107 ? 18.159  -13.750 -1.130  1.00 0.00 ? 107 SER A HB3  1 
ATOM 1420 H HG   . SER A 1 107 ? 19.425  -16.242 -0.747  1.00 0.00 ? 107 SER A HG   1 
ATOM 1421 N N    . SER A 1 108 ? 19.918  -12.986 -3.200  1.00 0.00 ? 108 SER A N    1 
ATOM 1422 C CA   . SER A 1 108 ? 19.772  -12.064 -4.321  1.00 0.00 ? 108 SER A CA   1 
ATOM 1423 C C    . SER A 1 108 ? 18.337  -11.561 -4.433  1.00 0.00 ? 108 SER A C    1 
ATOM 1424 O O    . SER A 1 108 ? 17.513  -12.152 -5.132  1.00 0.00 ? 108 SER A O    1 
ATOM 1425 C CB   . SER A 1 108 ? 20.185  -12.748 -5.626  1.00 0.00 ? 108 SER A CB   1 
ATOM 1426 O OG   . SER A 1 108 ? 20.032  -11.875 -6.731  1.00 0.00 ? 108 SER A OG   1 
ATOM 1427 H H    . SER A 1 108 ? 19.847  -13.950 -3.362  1.00 0.00 ? 108 SER A H    1 
ATOM 1428 H HA   . SER A 1 108 ? 20.423  -11.221 -4.144  1.00 0.00 ? 108 SER A HA   1 
ATOM 1429 H HB2  . SER A 1 108 ? 21.221  -13.048 -5.561  1.00 0.00 ? 108 SER A HB2  1 
ATOM 1430 H HB3  . SER A 1 108 ? 19.567  -13.620 -5.784  1.00 0.00 ? 108 SER A HB3  1 
ATOM 1431 H HG   . SER A 1 108 ? 20.872  -11.455 -6.927  1.00 0.00 ? 108 SER A HG   1 
ATOM 1432 N N    . ILE A 1 109 ? 18.041  -10.476 -3.727  1.00 0.00 ? 109 ILE A N    1 
ATOM 1433 C CA   . ILE A 1 109 ? 16.707  -9.887  -3.751  1.00 0.00 ? 109 ILE A CA   1 
ATOM 1434 C C    . ILE A 1 109 ? 16.766  -8.412  -4.136  1.00 0.00 ? 109 ILE A C    1 
ATOM 1435 O O    . ILE A 1 109 ? 17.813  -7.775  -4.032  1.00 0.00 ? 109 ILE A O    1 
ATOM 1436 C CB   . ILE A 1 109 ? 15.997  -10.023 -2.390  1.00 0.00 ? 109 ILE A CB   1 
ATOM 1437 C CG1  . ILE A 1 109 ? 16.808  -9.329  -1.292  1.00 0.00 ? 109 ILE A CG1  1 
ATOM 1438 C CG2  . ILE A 1 109 ? 15.772  -11.489 -2.048  1.00 0.00 ? 109 ILE A CG2  1 
ATOM 1439 C CD1  . ILE A 1 109 ? 18.054  -10.084 -0.880  1.00 0.00 ? 109 ILE A CD1  1 
ATOM 1440 H H    . ILE A 1 109 ? 18.743  -10.046 -3.197  1.00 0.00 ? 109 ILE A H    1 
ATOM 1441 H HA   . ILE A 1 109 ? 16.123  -10.417 -4.489  1.00 0.00 ? 109 ILE A HA   1 
ATOM 1442 H HB   . ILE A 1 109 ? 15.030  -9.548  -2.467  1.00 0.00 ? 109 ILE A HB   1 
ATOM 1443 H HG12 . ILE A 1 109 ? 17.113  -8.354  -1.642  1.00 0.00 ? 109 ILE A HG12 1 
ATOM 1444 H HG13 . ILE A 1 109 ? 16.188  -9.214  -0.416  1.00 0.00 ? 109 ILE A HG13 1 
ATOM 1445 H HG21 . ILE A 1 109 ? 15.790  -11.615 -0.975  1.00 0.00 ? 109 ILE A HG21 1 
ATOM 1446 H HG22 . ILE A 1 109 ? 16.553  -12.087 -2.495  1.00 0.00 ? 109 ILE A HG22 1 
ATOM 1447 H HG23 . ILE A 1 109 ? 14.813  -11.804 -2.432  1.00 0.00 ? 109 ILE A HG23 1 
ATOM 1448 H HD11 . ILE A 1 109 ? 18.075  -10.182 0.194   1.00 0.00 ? 109 ILE A HD11 1 
ATOM 1449 H HD12 . ILE A 1 109 ? 18.928  -9.542  -1.210  1.00 0.00 ? 109 ILE A HD12 1 
ATOM 1450 H HD13 . ILE A 1 109 ? 18.049  -11.065 -1.331  1.00 0.00 ? 109 ILE A HD13 1 
ATOM 1451 N N    . LEU A 1 110 ? 15.634  -7.878  -4.582  1.00 0.00 ? 110 LEU A N    1 
ATOM 1452 C CA   . LEU A 1 110 ? 15.549  -6.475  -4.972  1.00 0.00 ? 110 LEU A CA   1 
ATOM 1453 C C    . LEU A 1 110 ? 16.440  -6.178  -6.173  1.00 0.00 ? 110 LEU A C    1 
ATOM 1454 O O    . LEU A 1 110 ? 17.400  -6.900  -6.444  1.00 0.00 ? 110 LEU A O    1 
ATOM 1455 C CB   . LEU A 1 110 ? 15.942  -5.572  -3.801  1.00 0.00 ? 110 LEU A CB   1 
ATOM 1456 C CG   . LEU A 1 110 ? 14.986  -5.606  -2.607  1.00 0.00 ? 110 LEU A CG   1 
ATOM 1457 C CD1  . LEU A 1 110 ? 15.637  -6.301  -1.422  1.00 0.00 ? 110 LEU A CD1  1 
ATOM 1458 C CD2  . LEU A 1 110 ? 14.557  -4.196  -2.230  1.00 0.00 ? 110 LEU A CD2  1 
ATOM 1459 H H    . LEU A 1 110 ? 14.831  -8.438  -4.637  1.00 0.00 ? 110 LEU A H    1 
ATOM 1460 H HA   . LEU A 1 110 ? 14.524  -6.270  -5.243  1.00 0.00 ? 110 LEU A HA   1 
ATOM 1461 H HB2  . LEU A 1 110 ? 16.923  -5.867  -3.459  1.00 0.00 ? 110 LEU A HB2  1 
ATOM 1462 H HB3  . LEU A 1 110 ? 15.997  -4.555  -4.162  1.00 0.00 ? 110 LEU A HB3  1 
ATOM 1463 H HG   . LEU A 1 110 ? 14.101  -6.163  -2.878  1.00 0.00 ? 110 LEU A HG   1 
ATOM 1464 H HD11 . LEU A 1 110 ? 15.460  -5.726  -0.525  1.00 0.00 ? 110 LEU A HD11 1 
ATOM 1465 H HD12 . LEU A 1 110 ? 16.700  -6.384  -1.593  1.00 0.00 ? 110 LEU A HD12 1 
ATOM 1466 H HD13 . LEU A 1 110 ? 15.213  -7.288  -1.306  1.00 0.00 ? 110 LEU A HD13 1 
ATOM 1467 H HD21 . LEU A 1 110 ? 15.177  -3.480  -2.748  1.00 0.00 ? 110 LEU A HD21 1 
ATOM 1468 H HD22 . LEU A 1 110 ? 14.665  -4.061  -1.164  1.00 0.00 ? 110 LEU A HD22 1 
ATOM 1469 H HD23 . LEU A 1 110 ? 13.524  -4.047  -2.508  1.00 0.00 ? 110 LEU A HD23 1 
ATOM 1470 N N    . GLY A 1 111 ? 16.117  -5.103  -6.884  1.00 0.00 ? 111 GLY A N    1 
ATOM 1471 C CA   . GLY A 1 111 ? 16.899  -4.707  -8.040  1.00 0.00 ? 111 GLY A CA   1 
ATOM 1472 C C    . GLY A 1 111 ? 17.204  -3.222  -8.040  1.00 0.00 ? 111 GLY A C    1 
ATOM 1473 O O    . GLY A 1 111 ? 18.361  -2.819  -8.160  1.00 0.00 ? 111 GLY A O    1 
ATOM 1474 H H    . GLY A 1 111 ? 15.345  -4.564  -6.612  1.00 0.00 ? 111 GLY A H    1 
ATOM 1475 H HA2  . GLY A 1 111 ? 17.829  -5.257  -8.039  1.00 0.00 ? 111 GLY A HA2  1 
ATOM 1476 H HA3  . GLY A 1 111 ? 16.347  -4.952  -8.936  1.00 0.00 ? 111 GLY A HA3  1 
ATOM 1477 N N    . ARG A 1 112 ? 16.163  -2.409  -7.888  1.00 0.00 ? 112 ARG A N    1 
ATOM 1478 C CA   . ARG A 1 112 ? 16.318  -0.959  -7.853  1.00 0.00 ? 112 ARG A CA   1 
ATOM 1479 C C    . ARG A 1 112 ? 14.970  -0.272  -7.669  1.00 0.00 ? 112 ARG A C    1 
ATOM 1480 O O    . ARG A 1 112 ? 13.974  -0.663  -8.277  1.00 0.00 ? 112 ARG A O    1 
ATOM 1481 C CB   . ARG A 1 112 ? 16.981  -0.458  -9.136  1.00 0.00 ? 112 ARG A CB   1 
ATOM 1482 C CG   . ARG A 1 112 ? 17.594  0.926   -9.002  1.00 0.00 ? 112 ARG A CG   1 
ATOM 1483 C CD   . ARG A 1 112 ? 16.788  1.966   -9.762  1.00 0.00 ? 112 ARG A CD   1 
ATOM 1484 N NE   . ARG A 1 112 ? 17.174  2.035   -11.168 1.00 0.00 ? 112 ARG A NE   1 
ATOM 1485 C CZ   . ARG A 1 112 ? 16.602  2.847   -12.051 1.00 0.00 ? 112 ARG A CZ   1 
ATOM 1486 N NH1  . ARG A 1 112 ? 15.621  3.655   -11.673 1.00 0.00 ? 112 ARG A NH1  1 
ATOM 1487 N NH2  . ARG A 1 112 ? 17.010  2.851   -13.312 1.00 0.00 ? 112 ARG A NH2  1 
ATOM 1488 H H    . ARG A 1 112 ? 15.267  -2.795  -7.788  1.00 0.00 ? 112 ARG A H    1 
ATOM 1489 H HA   . ARG A 1 112 ? 16.950  -0.715  -7.011  1.00 0.00 ? 112 ARG A HA   1 
ATOM 1490 H HB2  . ARG A 1 112 ? 17.761  -1.148  -9.422  1.00 0.00 ? 112 ARG A HB2  1 
ATOM 1491 H HB3  . ARG A 1 112 ? 16.239  -0.422  -9.918  1.00 0.00 ? 112 ARG A HB3  1 
ATOM 1492 H HG2  . ARG A 1 112 ? 17.621  1.198   -7.957  1.00 0.00 ? 112 ARG A HG2  1 
ATOM 1493 H HG3  . ARG A 1 112 ? 18.599  0.904   -9.397  1.00 0.00 ? 112 ARG A HG3  1 
ATOM 1494 H HD2  . ARG A 1 112 ? 15.741  1.708   -9.698  1.00 0.00 ? 112 ARG A HD2  1 
ATOM 1495 H HD3  . ARG A 1 112 ? 16.949  2.932   -9.307  1.00 0.00 ? 112 ARG A HD3  1 
ATOM 1496 H HE   . ARG A 1 112 ? 17.897  1.445   -11.470 1.00 0.00 ? 112 ARG A HE   1 
ATOM 1497 H HH11 . ARG A 1 112 ? 15.311  3.655   -10.722 1.00 0.00 ? 112 ARG A HH11 1 
ATOM 1498 H HH12 . ARG A 1 112 ? 15.192  4.266   -12.339 1.00 0.00 ? 112 ARG A HH12 1 
ATOM 1499 H HH21 . ARG A 1 112 ? 17.749  2.242   -13.600 1.00 0.00 ? 112 ARG A HH21 1 
ATOM 1500 H HH22 . ARG A 1 112 ? 16.579  3.462   -13.975 1.00 0.00 ? 112 ARG A HH22 1 
ATOM 1501 N N    . SER A 1 113 ? 14.947  0.761   -6.834  1.00 0.00 ? 113 SER A N    1 
ATOM 1502 C CA   . SER A 1 113 ? 13.721  1.501   -6.563  1.00 0.00 ? 113 SER A CA   1 
ATOM 1503 C C    . SER A 1 113 ? 13.725  2.851   -7.271  1.00 0.00 ? 113 SER A C    1 
ATOM 1504 O O    . SER A 1 113 ? 14.750  3.529   -7.331  1.00 0.00 ? 113 SER A O    1 
ATOM 1505 C CB   . SER A 1 113 ? 13.557  1.702   -5.058  1.00 0.00 ? 113 SER A CB   1 
ATOM 1506 O OG   . SER A 1 113 ? 13.517  0.457   -4.384  1.00 0.00 ? 113 SER A OG   1 
ATOM 1507 H H    . SER A 1 113 ? 15.773  1.022   -6.376  1.00 0.00 ? 113 SER A H    1 
ATOM 1508 H HA   . SER A 1 113 ? 12.892  0.916   -6.933  1.00 0.00 ? 113 SER A HA   1 
ATOM 1509 H HB2  . SER A 1 113 ? 14.390  2.276   -4.681  1.00 0.00 ? 113 SER A HB2  1 
ATOM 1510 H HB3  . SER A 1 113 ? 12.638  2.232   -4.865  1.00 0.00 ? 113 SER A HB3  1 
ATOM 1511 H HG   . SER A 1 113 ? 14.157  -0.141  -4.778  1.00 0.00 ? 113 SER A HG   1 
ATOM 1512 N N    . ASN A 1 114 ? 12.569  3.238   -7.802  1.00 0.00 ? 114 ASN A N    1 
ATOM 1513 C CA   . ASN A 1 114 ? 12.440  4.509   -8.504  1.00 0.00 ? 114 ASN A CA   1 
ATOM 1514 C C    . ASN A 1 114 ? 11.769  5.555   -7.622  1.00 0.00 ? 114 ASN A C    1 
ATOM 1515 O O    . ASN A 1 114 ? 10.748  5.287   -6.986  1.00 0.00 ? 114 ASN A O    1 
ATOM 1516 C CB   . ASN A 1 114 ? 11.641  4.326   -9.796  1.00 0.00 ? 114 ASN A CB   1 
ATOM 1517 C CG   . ASN A 1 114 ? 10.424  3.443   -9.607  1.00 0.00 ? 114 ASN A CG   1 
ATOM 1518 O OD1  . ASN A 1 114 ? 9.985   3.203   -8.482  1.00 0.00 ? 114 ASN A OD1  1 
ATOM 1519 N ND2  . ASN A 1 114 ? 9.871   2.954   -10.710 1.00 0.00 ? 114 ASN A ND2  1 
ATOM 1520 H H    . ASN A 1 114 ? 11.786  2.654   -7.720  1.00 0.00 ? 114 ASN A H    1 
ATOM 1521 H HA   . ASN A 1 114 ? 13.434  4.850   -8.752  1.00 0.00 ? 114 ASN A HA   1 
ATOM 1522 H HB2  . ASN A 1 114 ? 11.310  5.293   -10.146 1.00 0.00 ? 114 ASN A HB2  1 
ATOM 1523 H HB3  . ASN A 1 114 ? 12.276  3.876   -10.544 1.00 0.00 ? 114 ASN A HB3  1 
ATOM 1524 H HD21 . ASN A 1 114 ? 10.274  3.187   -11.573 1.00 0.00 ? 114 ASN A HD21 1 
ATOM 1525 H HD22 . ASN A 1 114 ? 9.082   2.379   -10.618 1.00 0.00 ? 114 ASN A HD22 1 
ATOM 1526 N N    . LEU A 1 115 ? 12.347  6.753   -7.597  1.00 0.00 ? 115 LEU A N    1 
ATOM 1527 C CA   . LEU A 1 115 ? 11.819  7.846   -6.787  1.00 0.00 ? 115 LEU A CA   1 
ATOM 1528 C C    . LEU A 1 115 ? 10.634  8.542   -7.462  1.00 0.00 ? 115 LEU A C    1 
ATOM 1529 O O    . LEU A 1 115 ? 10.110  9.525   -6.939  1.00 0.00 ? 115 LEU A O    1 
ATOM 1530 C CB   . LEU A 1 115 ? 12.926  8.864   -6.484  1.00 0.00 ? 115 LEU A CB   1 
ATOM 1531 C CG   . LEU A 1 115 ? 13.244  9.862   -7.607  1.00 0.00 ? 115 LEU A CG   1 
ATOM 1532 C CD1  . LEU A 1 115 ? 13.306  9.163   -8.956  1.00 0.00 ? 115 LEU A CD1  1 
ATOM 1533 C CD2  . LEU A 1 115 ? 12.222  10.988  -7.632  1.00 0.00 ? 115 LEU A CD2  1 
ATOM 1534 H H    . LEU A 1 115 ? 13.162  6.897   -8.121  1.00 0.00 ? 115 LEU A H    1 
ATOM 1535 H HA   . LEU A 1 115 ? 11.477  7.421   -5.854  1.00 0.00 ? 115 LEU A HA   1 
ATOM 1536 H HB2  . LEU A 1 115 ? 12.637  9.424   -5.608  1.00 0.00 ? 115 LEU A HB2  1 
ATOM 1537 H HB3  . LEU A 1 115 ? 13.830  8.318   -6.255  1.00 0.00 ? 115 LEU A HB3  1 
ATOM 1538 H HG   . LEU A 1 115 ? 14.213  10.301  -7.419  1.00 0.00 ? 115 LEU A HG   1 
ATOM 1539 H HD11 . LEU A 1 115 ? 12.457  8.505   -9.062  1.00 0.00 ? 115 LEU A HD11 1 
ATOM 1540 H HD12 . LEU A 1 115 ? 14.217  8.588   -9.023  1.00 0.00 ? 115 LEU A HD12 1 
ATOM 1541 H HD13 . LEU A 1 115 ? 13.288  9.901   -9.745  1.00 0.00 ? 115 LEU A HD13 1 
ATOM 1542 H HD21 . LEU A 1 115 ? 11.718  11.039  -6.679  1.00 0.00 ? 115 LEU A HD21 1 
ATOM 1543 H HD22 . LEU A 1 115 ? 11.499  10.800  -8.412  1.00 0.00 ? 115 LEU A HD22 1 
ATOM 1544 H HD23 . LEU A 1 115 ? 12.724  11.925  -7.825  1.00 0.00 ? 115 LEU A HD23 1 
ATOM 1545 N N    . LYS A 1 116 ? 10.192  8.013   -8.607  1.00 0.00 ? 116 LYS A N    1 
ATOM 1546 C CA   . LYS A 1 116 ? 9.064   8.590   -9.341  1.00 0.00 ? 116 LYS A CA   1 
ATOM 1547 C C    . LYS A 1 116 ? 7.937   9.007   -8.398  1.00 0.00 ? 116 LYS A C    1 
ATOM 1548 O O    . LYS A 1 116 ? 7.149   8.174   -7.950  1.00 0.00 ? 116 LYS A O    1 
ATOM 1549 C CB   . LYS A 1 116 ? 8.536   7.585   -10.368 1.00 0.00 ? 116 LYS A CB   1 
ATOM 1550 C CG   . LYS A 1 116 ? 8.653   8.064   -11.805 1.00 0.00 ? 116 LYS A CG   1 
ATOM 1551 C CD   . LYS A 1 116 ? 7.295   8.430   -12.384 1.00 0.00 ? 116 LYS A CD   1 
ATOM 1552 C CE   . LYS A 1 116 ? 6.609   7.224   -13.007 1.00 0.00 ? 116 LYS A CE   1 
ATOM 1553 N NZ   . LYS A 1 116 ? 6.599   7.299   -14.494 1.00 0.00 ? 116 LYS A NZ   1 
ATOM 1554 H H    . LYS A 1 116 ? 10.641  7.227   -8.978  1.00 0.00 ? 116 LYS A H    1 
ATOM 1555 H HA   . LYS A 1 116 ? 9.423   9.467   -9.861  1.00 0.00 ? 116 LYS A HA   1 
ATOM 1556 H HB2  . LYS A 1 116 ? 9.094   6.665   -10.272 1.00 0.00 ? 116 LYS A HB2  1 
ATOM 1557 H HB3  . LYS A 1 116 ? 7.495   7.388   -10.160 1.00 0.00 ? 116 LYS A HB3  1 
ATOM 1558 H HG2  . LYS A 1 116 ? 9.291   8.934   -11.833 1.00 0.00 ? 116 LYS A HG2  1 
ATOM 1559 H HG3  . LYS A 1 116 ? 9.087   7.276   -12.402 1.00 0.00 ? 116 LYS A HG3  1 
ATOM 1560 H HD2  . LYS A 1 116 ? 6.670   8.817   -11.593 1.00 0.00 ? 116 LYS A HD2  1 
ATOM 1561 H HD3  . LYS A 1 116 ? 7.430   9.186   -13.142 1.00 0.00 ? 116 LYS A HD3  1 
ATOM 1562 H HE2  . LYS A 1 116 ? 7.134   6.330   -12.704 1.00 0.00 ? 116 LYS A HE2  1 
ATOM 1563 H HE3  . LYS A 1 116 ? 5.591   7.182   -12.651 1.00 0.00 ? 116 LYS A HE3  1 
ATOM 1564 H HZ1  . LYS A 1 116 ? 5.834   6.708   -14.877 1.00 0.00 ? 116 LYS A HZ1  1 
ATOM 1565 H HZ2  . LYS A 1 116 ? 7.506   6.962   -14.876 1.00 0.00 ? 116 LYS A HZ2  1 
ATOM 1566 H HZ3  . LYS A 1 116 ? 6.450   8.281   -14.802 1.00 0.00 ? 116 LYS A HZ3  1 
ATOM 1567 N N    . PHE A 1 117 ? 7.878   10.300  -8.093  1.00 0.00 ? 117 PHE A N    1 
ATOM 1568 C CA   . PHE A 1 117 ? 6.863   10.831  -7.191  1.00 0.00 ? 117 PHE A CA   1 
ATOM 1569 C C    . PHE A 1 117 ? 7.133   10.390  -5.757  1.00 0.00 ? 117 PHE A C    1 
ATOM 1570 O O    . PHE A 1 117 ? 6.265   9.816   -5.099  1.00 0.00 ? 117 PHE A O    1 
ATOM 1571 C CB   . PHE A 1 117 ? 5.470   10.375  -7.625  1.00 0.00 ? 117 PHE A CB   1 
ATOM 1572 C CG   . PHE A 1 117 ? 5.189   10.605  -9.081  1.00 0.00 ? 117 PHE A CG   1 
ATOM 1573 C CD1  . PHE A 1 117 ? 5.698   11.719  -9.731  1.00 0.00 ? 117 PHE A CD1  1 
ATOM 1574 C CD2  . PHE A 1 117 ? 4.414   9.710   -9.801  1.00 0.00 ? 117 PHE A CD2  1 
ATOM 1575 C CE1  . PHE A 1 117 ? 5.441   11.934  -11.072 1.00 0.00 ? 117 PHE A CE1  1 
ATOM 1576 C CE2  . PHE A 1 117 ? 4.152   9.920   -11.141 1.00 0.00 ? 117 PHE A CE2  1 
ATOM 1577 C CZ   . PHE A 1 117 ? 4.666   11.033  -11.777 1.00 0.00 ? 117 PHE A CZ   1 
ATOM 1578 H H    . PHE A 1 117 ? 8.542   10.911  -8.477  1.00 0.00 ? 117 PHE A H    1 
ATOM 1579 H HA   . PHE A 1 117 ? 6.911   11.909  -7.238  1.00 0.00 ? 117 PHE A HA   1 
ATOM 1580 H HB2  . PHE A 1 117 ? 5.366   9.318   -7.429  1.00 0.00 ? 117 PHE A HB2  1 
ATOM 1581 H HB3  . PHE A 1 117 ? 4.729   10.915  -7.054  1.00 0.00 ? 117 PHE A HB3  1 
ATOM 1582 H HD1  . PHE A 1 117 ? 6.304   12.423  -9.180  1.00 0.00 ? 117 PHE A HD1  1 
ATOM 1583 H HD2  . PHE A 1 117 ? 4.011   8.840   -9.304  1.00 0.00 ? 117 PHE A HD2  1 
ATOM 1584 H HE1  . PHE A 1 117 ? 5.844   12.805  -11.567 1.00 0.00 ? 117 PHE A HE1  1 
ATOM 1585 H HE2  . PHE A 1 117 ? 3.547   9.215   -11.691 1.00 0.00 ? 117 PHE A HE2  1 
ATOM 1586 H HZ   . PHE A 1 117 ? 4.463   11.199  -12.825 1.00 0.00 ? 117 PHE A HZ   1 
ATOM 1587 N N    . ALA A 1 118 ? 8.344   10.661  -5.280  1.00 0.00 ? 118 ALA A N    1 
ATOM 1588 C CA   . ALA A 1 118 ? 8.735   10.285  -3.927  1.00 0.00 ? 118 ALA A CA   1 
ATOM 1589 C C    . ALA A 1 118 ? 8.758   11.495  -3.000  1.00 0.00 ? 118 ALA A C    1 
ATOM 1590 O O    . ALA A 1 118 ? 8.881   12.634  -3.451  1.00 0.00 ? 118 ALA A O    1 
ATOM 1591 C CB   . ALA A 1 118 ? 10.097  9.607   -3.943  1.00 0.00 ? 118 ALA A CB   1 
ATOM 1592 H H    . ALA A 1 118 ? 8.993   11.117  -5.855  1.00 0.00 ? 118 ALA A H    1 
ATOM 1593 H HA   . ALA A 1 118 ? 8.012   9.574   -3.556  1.00 0.00 ? 118 ALA A HA   1 
ATOM 1594 H HB1  . ALA A 1 118 ? 10.319  9.222   -2.959  1.00 0.00 ? 118 ALA A HB1  1 
ATOM 1595 H HB2  . ALA A 1 118 ? 10.853  10.324  -4.228  1.00 0.00 ? 118 ALA A HB2  1 
ATOM 1596 H HB3  . ALA A 1 118 ? 10.086  8.794   -4.654  1.00 0.00 ? 118 ALA A HB3  1 
ATOM 1597 N N    . GLY A 1 119 ? 8.643   11.238  -1.702  1.00 0.00 ? 119 GLY A N    1 
ATOM 1598 C CA   . GLY A 1 119 ? 8.660   12.311  -0.725  1.00 0.00 ? 119 GLY A CA   1 
ATOM 1599 C C    . GLY A 1 119 ? 7.635   13.387  -1.022  1.00 0.00 ? 119 GLY A C    1 
ATOM 1600 O O    . GLY A 1 119 ? 7.889   14.572  -0.805  1.00 0.00 ? 119 GLY A O    1 
ATOM 1601 H H    . GLY A 1 119 ? 8.551   10.309  -1.403  1.00 0.00 ? 119 GLY A H    1 
ATOM 1602 H HA2  . GLY A 1 119 ? 8.457   11.896  0.251   1.00 0.00 ? 119 GLY A HA2  1 
ATOM 1603 H HA3  . GLY A 1 119 ? 9.643   12.759  -0.716  1.00 0.00 ? 119 GLY A HA3  1 
ATOM 1604 N N    . MET A 1 120 ? 6.471   12.976  -1.514  1.00 0.00 ? 120 MET A N    1 
ATOM 1605 C CA   . MET A 1 120 ? 5.401   13.916  -1.829  1.00 0.00 ? 120 MET A CA   1 
ATOM 1606 C C    . MET A 1 120 ? 4.274   13.813  -0.799  1.00 0.00 ? 120 MET A C    1 
ATOM 1607 O O    . MET A 1 120 ? 3.607   12.785  -0.707  1.00 0.00 ? 120 MET A O    1 
ATOM 1608 C CB   . MET A 1 120 ? 4.851   13.645  -3.235  1.00 0.00 ? 120 MET A CB   1 
ATOM 1609 C CG   . MET A 1 120 ? 3.533   14.354  -3.529  1.00 0.00 ? 120 MET A CG   1 
ATOM 1610 S SD   . MET A 1 120 ? 3.608   15.389  -5.002  1.00 0.00 ? 120 MET A SD   1 
ATOM 1611 C CE   . MET A 1 120 ? 1.942   15.199  -5.631  1.00 0.00 ? 120 MET A CE   1 
ATOM 1612 H H    . MET A 1 120 ? 6.324   12.018  -1.660  1.00 0.00 ? 120 MET A H    1 
ATOM 1613 H HA   . MET A 1 120 ? 5.818   14.908  -1.804  1.00 0.00 ? 120 MET A HA   1 
ATOM 1614 H HB2  . MET A 1 120 ? 5.579   13.972  -3.962  1.00 0.00 ? 120 MET A HB2  1 
ATOM 1615 H HB3  . MET A 1 120 ? 4.695   12.583  -3.348  1.00 0.00 ? 120 MET A HB3  1 
ATOM 1616 H HG2  . MET A 1 120 ? 2.764   13.609  -3.670  1.00 0.00 ? 120 MET A HG2  1 
ATOM 1617 H HG3  . MET A 1 120 ? 3.278   14.976  -2.680  1.00 0.00 ? 120 MET A HG3  1 
ATOM 1618 H HE1  . MET A 1 120 ? 1.288   15.903  -5.137  1.00 0.00 ? 120 MET A HE1  1 
ATOM 1619 H HE2  . MET A 1 120 ? 1.597   14.193  -5.439  1.00 0.00 ? 120 MET A HE2  1 
ATOM 1620 H HE3  . MET A 1 120 ? 1.935   15.385  -6.694  1.00 0.00 ? 120 MET A HE3  1 
ATOM 1621 N N    . PRO A 1 121 ? 4.012   14.889  -0.038  1.00 0.00 ? 121 PRO A N    1 
ATOM 1622 C CA   . PRO A 1 121 ? 2.946   14.902  0.951   1.00 0.00 ? 121 PRO A CA   1 
ATOM 1623 C C    . PRO A 1 121 ? 1.598   15.275  0.345   1.00 0.00 ? 121 PRO A C    1 
ATOM 1624 O O    . PRO A 1 121 ? 1.372   16.424  -0.035  1.00 0.00 ? 121 PRO A O    1 
ATOM 1625 C CB   . PRO A 1 121 ? 3.395   15.965  1.956   1.00 0.00 ? 121 PRO A CB   1 
ATOM 1626 C CG   . PRO A 1 121 ? 4.511   16.733  1.308   1.00 0.00 ? 121 PRO A CG   1 
ATOM 1627 C CD   . PRO A 1 121 ? 4.727   16.168  -0.072  1.00 0.00 ? 121 PRO A CD   1 
ATOM 1628 H HA   . PRO A 1 121 ? 2.860   13.948  1.449   1.00 0.00 ? 121 PRO A HA   1 
ATOM 1629 H HB2  . PRO A 1 121 ? 2.562   16.612  2.188   1.00 0.00 ? 121 PRO A HB2  1 
ATOM 1630 H HB3  . PRO A 1 121 ? 3.732   15.478  2.855   1.00 0.00 ? 121 PRO A HB3  1 
ATOM 1631 H HG2  . PRO A 1 121 ? 4.239   17.774  1.241   1.00 0.00 ? 121 PRO A HG2  1 
ATOM 1632 H HG3  . PRO A 1 121 ? 5.411   16.624  1.895   1.00 0.00 ? 121 PRO A HG3  1 
ATOM 1633 H HD2  . PRO A 1 121 ? 4.306   16.825  -0.819  1.00 0.00 ? 121 PRO A HD2  1 
ATOM 1634 H HD3  . PRO A 1 121 ? 5.781   16.017  -0.251  1.00 0.00 ? 121 PRO A HD3  1 
ATOM 1635 N N    . ILE A 1 122 ? 0.704   14.295  0.257   1.00 0.00 ? 122 ILE A N    1 
ATOM 1636 C CA   . ILE A 1 122 ? -0.626  14.519  -0.296  1.00 0.00 ? 122 ILE A CA   1 
ATOM 1637 C C    . ILE A 1 122 ? -1.694  13.846  0.561   1.00 0.00 ? 122 ILE A C    1 
ATOM 1638 O O    . ILE A 1 122 ? -1.379  13.117  1.502   1.00 0.00 ? 122 ILE A O    1 
ATOM 1639 C CB   . ILE A 1 122 ? -0.737  13.993  -1.740  1.00 0.00 ? 122 ILE A CB   1 
ATOM 1640 C CG1  . ILE A 1 122 ? -0.551  12.476  -1.769  1.00 0.00 ? 122 ILE A CG1  1 
ATOM 1641 C CG2  . ILE A 1 122 ? 0.284   14.674  -2.638  1.00 0.00 ? 122 ILE A CG2  1 
ATOM 1642 C CD1  . ILE A 1 122 ? -1.819  11.710  -1.468  1.00 0.00 ? 122 ILE A CD1  1 
ATOM 1643 H H    . ILE A 1 122 ? 0.943   13.400  0.580   1.00 0.00 ? 122 ILE A H    1 
ATOM 1644 H HA   . ILE A 1 122 ? -0.807  15.583  -0.310  1.00 0.00 ? 122 ILE A HA   1 
ATOM 1645 H HB   . ILE A 1 122 ? -1.722  14.234  -2.111  1.00 0.00 ? 122 ILE A HB   1 
ATOM 1646 H HG12 . ILE A 1 122 ? -0.210  12.180  -2.751  1.00 0.00 ? 122 ILE A HG12 1 
ATOM 1647 H HG13 . ILE A 1 122 ? 0.190   12.196  -1.036  1.00 0.00 ? 122 ILE A HG13 1 
ATOM 1648 H HG21 . ILE A 1 122 ? 0.220   15.744  -2.509  1.00 0.00 ? 122 ILE A HG21 1 
ATOM 1649 H HG22 . ILE A 1 122 ? 0.080   14.423  -3.669  1.00 0.00 ? 122 ILE A HG22 1 
ATOM 1650 H HG23 . ILE A 1 122 ? 1.276   14.338  -2.376  1.00 0.00 ? 122 ILE A HG23 1 
ATOM 1651 H HD11 . ILE A 1 122 ? -2.628  12.407  -1.303  1.00 0.00 ? 122 ILE A HD11 1 
ATOM 1652 H HD12 . ILE A 1 122 ? -1.674  11.109  -0.583  1.00 0.00 ? 122 ILE A HD12 1 
ATOM 1653 H HD13 . ILE A 1 122 ? -2.059  11.070  -2.303  1.00 0.00 ? 122 ILE A HD13 1 
ATOM 1654 N N    . THR A 1 123 ? -2.956  14.094  0.229   1.00 0.00 ? 123 THR A N    1 
ATOM 1655 C CA   . THR A 1 123 ? -4.068  13.506  0.966   1.00 0.00 ? 123 THR A CA   1 
ATOM 1656 C C    . THR A 1 123 ? -4.535  12.215  0.303   1.00 0.00 ? 123 THR A C    1 
ATOM 1657 O O    . THR A 1 123 ? -5.221  12.242  -0.718  1.00 0.00 ? 123 THR A O    1 
ATOM 1658 C CB   . THR A 1 123 ? -5.229  14.498  1.054   1.00 0.00 ? 123 THR A CB   1 
ATOM 1659 O OG1  . THR A 1 123 ? -5.034  15.577  0.157   1.00 0.00 ? 123 THR A OG1  1 
ATOM 1660 C CG2  . THR A 1 123 ? -5.418  15.079  2.438   1.00 0.00 ? 123 THR A CG2  1 
ATOM 1661 H H    . THR A 1 123 ? -3.144  14.682  -0.532  1.00 0.00 ? 123 THR A H    1 
ATOM 1662 H HA   . THR A 1 123 ? -3.721  13.280  1.963   1.00 0.00 ? 123 THR A HA   1 
ATOM 1663 H HB   . THR A 1 123 ? -6.144  13.992  0.783   1.00 0.00 ? 123 THR A HB   1 
ATOM 1664 H HG1  . THR A 1 123 ? -5.735  16.222  0.273   1.00 0.00 ? 123 THR A HG1  1 
ATOM 1665 H HG21 . THR A 1 123 ? -4.866  14.488  3.154   1.00 0.00 ? 123 THR A HG21 1 
ATOM 1666 H HG22 . THR A 1 123 ? -6.467  15.067  2.694   1.00 0.00 ? 123 THR A HG22 1 
ATOM 1667 H HG23 . THR A 1 123 ? -5.054  16.095  2.455   1.00 0.00 ? 123 THR A HG23 1 
ATOM 1668 N N    . LEU A 1 124 ? -4.161  11.084  0.893   1.00 0.00 ? 124 LEU A N    1 
ATOM 1669 C CA   . LEU A 1 124 ? -4.536  9.781   0.357   1.00 0.00 ? 124 LEU A CA   1 
ATOM 1670 C C    . LEU A 1 124 ? -5.830  9.285   0.990   1.00 0.00 ? 124 LEU A C    1 
ATOM 1671 O O    . LEU A 1 124 ? -6.133  9.609   2.138   1.00 0.00 ? 124 LEU A O    1 
ATOM 1672 C CB   . LEU A 1 124 ? -3.418  8.768   0.606   1.00 0.00 ? 124 LEU A CB   1 
ATOM 1673 C CG   . LEU A 1 124 ? -3.472  7.519   -0.276  1.00 0.00 ? 124 LEU A CG   1 
ATOM 1674 C CD1  . LEU A 1 124 ? -2.071  7.102   -0.697  1.00 0.00 ? 124 LEU A CD1  1 
ATOM 1675 C CD2  . LEU A 1 124 ? -4.174  6.383   0.452   1.00 0.00 ? 124 LEU A CD2  1 
ATOM 1676 H H    . LEU A 1 124 ? -3.613  11.127  1.704   1.00 0.00 ? 124 LEU A H    1 
ATOM 1677 H HA   . LEU A 1 124 ? -4.686  9.888   -0.708  1.00 0.00 ? 124 LEU A HA   1 
ATOM 1678 H HB2  . LEU A 1 124 ? -2.471  9.259   0.442   1.00 0.00 ? 124 LEU A HB2  1 
ATOM 1679 H HB3  . LEU A 1 124 ? -3.468  8.457   1.639   1.00 0.00 ? 124 LEU A HB3  1 
ATOM 1680 H HG   . LEU A 1 124 ? -4.036  7.742   -1.169  1.00 0.00 ? 124 LEU A HG   1 
ATOM 1681 H HD11 . LEU A 1 124 ? -1.369  7.360   0.082   1.00 0.00 ? 124 LEU A HD11 1 
ATOM 1682 H HD12 . LEU A 1 124 ? -1.801  7.615   -1.608  1.00 0.00 ? 124 LEU A HD12 1 
ATOM 1683 H HD13 . LEU A 1 124 ? -2.048  6.036   -0.864  1.00 0.00 ? 124 LEU A HD13 1 
ATOM 1684 H HD21 . LEU A 1 124 ? -3.438  5.748   0.923   1.00 0.00 ? 124 LEU A HD21 1 
ATOM 1685 H HD22 . LEU A 1 124 ? -4.750  5.804   -0.255  1.00 0.00 ? 124 LEU A HD22 1 
ATOM 1686 H HD23 . LEU A 1 124 ? -4.832  6.790   1.205   1.00 0.00 ? 124 LEU A HD23 1 
ATOM 1687 N N    . THR A 1 125 ? -6.587  8.493   0.237   1.00 0.00 ? 125 THR A N    1 
ATOM 1688 C CA   . THR A 1 125 ? -7.848  7.949   0.728   1.00 0.00 ? 125 THR A CA   1 
ATOM 1689 C C    . THR A 1 125 ? -7.993  6.479   0.345   1.00 0.00 ? 125 THR A C    1 
ATOM 1690 O O    . THR A 1 125 ? -7.843  6.118   -0.823  1.00 0.00 ? 125 THR A O    1 
ATOM 1691 C CB   . THR A 1 125 ? -9.023  8.750   0.164   1.00 0.00 ? 125 THR A CB   1 
ATOM 1692 O OG1  . THR A 1 125 ? -8.952  10.104  0.578   1.00 0.00 ? 125 THR A OG1  1 
ATOM 1693 C CG2  . THR A 1 125 ? -10.372 8.209   0.584   1.00 0.00 ? 125 THR A CG2  1 
ATOM 1694 H H    . THR A 1 125 ? -6.292  8.270   -0.671  1.00 0.00 ? 125 THR A H    1 
ATOM 1695 H HA   . THR A 1 125 ? -7.848  8.032   1.803   1.00 0.00 ? 125 THR A HA   1 
ATOM 1696 H HB   . THR A 1 125 ? -8.980  8.722   -0.915  1.00 0.00 ? 125 THR A HB   1 
ATOM 1697 H HG1  . THR A 1 125 ? -9.550  10.633  0.045   1.00 0.00 ? 125 THR A HG1  1 
ATOM 1698 H HG21 . THR A 1 125 ? -10.779 7.601   -0.211  1.00 0.00 ? 125 THR A HG21 1 
ATOM 1699 H HG22 . THR A 1 125 ? -11.042 9.031   0.788   1.00 0.00 ? 125 THR A HG22 1 
ATOM 1700 H HG23 . THR A 1 125 ? -10.258 7.608   1.474   1.00 0.00 ? 125 THR A HG23 1 
ATOM 1701 N N    . VAL A 1 126 ? -8.290  5.633   1.329   1.00 0.00 ? 126 VAL A N    1 
ATOM 1702 C CA   . VAL A 1 126 ? -8.449  4.202   1.076   1.00 0.00 ? 126 VAL A CA   1 
ATOM 1703 C C    . VAL A 1 126 ? -9.934  3.817   1.074   1.00 0.00 ? 126 VAL A C    1 
ATOM 1704 O O    . VAL A 1 126 ? -10.695 4.231   1.951   1.00 0.00 ? 126 VAL A O    1 
ATOM 1705 C CB   . VAL A 1 126 ? -7.625  3.321   2.082   1.00 0.00 ? 126 VAL A CB   1 
ATOM 1706 C CG1  . VAL A 1 126 ? -6.499  4.128   2.719   1.00 0.00 ? 126 VAL A CG1  1 
ATOM 1707 C CG2  . VAL A 1 126 ? -8.488  2.674   3.167   1.00 0.00 ? 126 VAL A CG2  1 
ATOM 1708 H H    . VAL A 1 126 ? -8.397  5.975   2.243   1.00 0.00 ? 126 VAL A H    1 
ATOM 1709 H HA   . VAL A 1 126 ? -8.055  4.011   0.089   1.00 0.00 ? 126 VAL A HA   1 
ATOM 1710 H HB   . VAL A 1 126 ? -7.169  2.524   1.517   1.00 0.00 ? 126 VAL A HB   1 
ATOM 1711 H HG11 . VAL A 1 126 ? -5.734  4.321   1.982   1.00 0.00 ? 126 VAL A HG11 1 
ATOM 1712 H HG12 . VAL A 1 126 ? -6.076  3.568   3.540   1.00 0.00 ? 126 VAL A HG12 1 
ATOM 1713 H HG13 . VAL A 1 126 ? -6.891  5.065   3.086   1.00 0.00 ? 126 VAL A HG13 1 
ATOM 1714 H HG21 . VAL A 1 126 ? -8.844  1.715   2.819   1.00 0.00 ? 126 VAL A HG21 1 
ATOM 1715 H HG22 . VAL A 1 126 ? -9.330  3.310   3.389   1.00 0.00 ? 126 VAL A HG22 1 
ATOM 1716 H HG23 . VAL A 1 126 ? -7.896  2.533   4.059   1.00 0.00 ? 126 VAL A HG23 1 
ATOM 1717 N N    . SER A 1 127 ? -10.331 3.023   0.085   1.00 0.00 ? 127 SER A N    1 
ATOM 1718 C CA   . SER A 1 127 ? -11.714 2.578   -0.031  1.00 0.00 ? 127 SER A CA   1 
ATOM 1719 C C    . SER A 1 127 ? -11.778 1.088   -0.350  1.00 0.00 ? 127 SER A C    1 
ATOM 1720 O O    . SER A 1 127 ? -10.787 0.490   -0.768  1.00 0.00 ? 127 SER A O    1 
ATOM 1721 C CB   . SER A 1 127 ? -12.439 3.374   -1.118  1.00 0.00 ? 127 SER A CB   1 
ATOM 1722 O OG   . SER A 1 127 ? -13.381 4.269   -0.552  1.00 0.00 ? 127 SER A OG   1 
ATOM 1723 H H    . SER A 1 127 ? -9.676  2.726   -0.580  1.00 0.00 ? 127 SER A H    1 
ATOM 1724 H HA   . SER A 1 127 ? -12.199 2.752   0.918   1.00 0.00 ? 127 SER A HA   1 
ATOM 1725 H HB2  . SER A 1 127 ? -11.719 3.941   -1.688  1.00 0.00 ? 127 SER A HB2  1 
ATOM 1726 H HB3  . SER A 1 127 ? -12.960 2.691   -1.774  1.00 0.00 ? 127 SER A HB3  1 
ATOM 1727 H HG   . SER A 1 127 ? -13.913 4.658   -1.251  1.00 0.00 ? 127 SER A HG   1 
ATOM 1728 N N    . THR A 1 128 ? -12.950 0.495   -0.151  1.00 0.00 ? 128 THR A N    1 
ATOM 1729 C CA   . THR A 1 128 ? -13.142 -0.925  -0.416  1.00 0.00 ? 128 THR A CA   1 
ATOM 1730 C C    . THR A 1 128 ? -12.732 -1.275  -1.842  1.00 0.00 ? 128 THR A C    1 
ATOM 1731 O O    . THR A 1 128 ? -13.434 -0.948  -2.799  1.00 0.00 ? 128 THR A O    1 
ATOM 1732 C CB   . THR A 1 128 ? -14.602 -1.316  -0.182  1.00 0.00 ? 128 THR A CB   1 
ATOM 1733 O OG1  . THR A 1 128 ? -15.412 -0.162  -0.037  1.00 0.00 ? 128 THR A OG1  1 
ATOM 1734 C CG2  . THR A 1 128 ? -14.799 -2.176  1.047   1.00 0.00 ? 128 THR A CG2  1 
ATOM 1735 H H    . THR A 1 128 ? -13.703 1.025   0.185   1.00 0.00 ? 128 THR A H    1 
ATOM 1736 H HA   . THR A 1 128 ? -12.516 -1.476  0.270   1.00 0.00 ? 128 THR A HA   1 
ATOM 1737 H HB   . THR A 1 128 ? -14.956 -1.875  -1.035  1.00 0.00 ? 128 THR A HB   1 
ATOM 1738 H HG1  . THR A 1 128 ? -15.762 0.094   -0.893  1.00 0.00 ? 128 THR A HG1  1 
ATOM 1739 H HG21 . THR A 1 128 ? -15.648 -2.827  0.898   1.00 0.00 ? 128 THR A HG21 1 
ATOM 1740 H HG22 . THR A 1 128 ? -14.978 -1.543  1.904   1.00 0.00 ? 128 THR A HG22 1 
ATOM 1741 H HG23 . THR A 1 128 ? -13.914 -2.771  1.216   1.00 0.00 ? 128 THR A HG23 1 
ATOM 1742 N N    . SER A 1 129 ? -11.590 -1.942  -1.975  1.00 0.00 ? 129 SER A N    1 
ATOM 1743 C CA   . SER A 1 129 ? -11.083 -2.339  -3.283  1.00 0.00 ? 129 SER A CA   1 
ATOM 1744 C C    . SER A 1 129 ? -11.002 -1.142  -4.225  1.00 0.00 ? 129 SER A C    1 
ATOM 1745 O O    . SER A 1 129 ? -11.431 -1.215  -5.376  1.00 0.00 ? 129 SER A O    1 
ATOM 1746 C CB   . SER A 1 129 ? -11.976 -3.421  -3.893  1.00 0.00 ? 129 SER A CB   1 
ATOM 1747 O OG   . SER A 1 129 ? -12.600 -4.197  -2.885  1.00 0.00 ? 129 SER A OG   1 
ATOM 1748 H H    . SER A 1 129 ? -11.076 -2.173  -1.174  1.00 0.00 ? 129 SER A H    1 
ATOM 1749 H HA   . SER A 1 129 ? -10.090 -2.739  -3.145  1.00 0.00 ? 129 SER A HA   1 
ATOM 1750 H HB2  . SER A 1 129 ? -12.741 -2.955  -4.497  1.00 0.00 ? 129 SER A HB2  1 
ATOM 1751 H HB3  . SER A 1 129 ? -11.376 -4.072  -4.512  1.00 0.00 ? 129 SER A HB3  1 
ATOM 1752 H HG   . SER A 1 129 ? -13.006 -4.971  -3.282  1.00 0.00 ? 129 SER A HG   1 
ATOM 1753 N N    . SER A 1 130 ? -10.448 -0.041  -3.728  1.00 0.00 ? 130 SER A N    1 
ATOM 1754 C CA   . SER A 1 130 ? -10.308 1.172   -4.527  1.00 0.00 ? 130 SER A CA   1 
ATOM 1755 C C    . SER A 1 130 ? -9.541  2.243   -3.760  1.00 0.00 ? 130 SER A C    1 
ATOM 1756 O O    . SER A 1 130 ? -10.006 2.741   -2.735  1.00 0.00 ? 130 SER A O    1 
ATOM 1757 C CB   . SER A 1 130 ? -11.685 1.704   -4.928  1.00 0.00 ? 130 SER A CB   1 
ATOM 1758 O OG   . SER A 1 130 ? -11.577 2.679   -5.950  1.00 0.00 ? 130 SER A OG   1 
ATOM 1759 H H    . SER A 1 130 ? -10.123 -0.044  -2.803  1.00 0.00 ? 130 SER A H    1 
ATOM 1760 H HA   . SER A 1 130 ? -9.755  0.919   -5.419  1.00 0.00 ? 130 SER A HA   1 
ATOM 1761 H HB2  . SER A 1 130 ? -12.293 0.888   -5.289  1.00 0.00 ? 130 SER A HB2  1 
ATOM 1762 H HB3  . SER A 1 130 ? -12.160 2.153   -4.068  1.00 0.00 ? 130 SER A HB3  1 
ATOM 1763 H HG   . SER A 1 130 ? -11.114 3.449   -5.611  1.00 0.00 ? 130 SER A HG   1 
ATOM 1764 N N    . LEU A 1 131 ? -8.362  2.595   -4.264  1.00 0.00 ? 131 LEU A N    1 
ATOM 1765 C CA   . LEU A 1 131 ? -7.528  3.604   -3.622  1.00 0.00 ? 131 LEU A CA   1 
ATOM 1766 C C    . LEU A 1 131 ? -7.421  4.858   -4.481  1.00 0.00 ? 131 LEU A C    1 
ATOM 1767 O O    . LEU A 1 131 ? -6.883  4.822   -5.588  1.00 0.00 ? 131 LEU A O    1 
ATOM 1768 C CB   . LEU A 1 131 ? -6.132  3.040   -3.348  1.00 0.00 ? 131 LEU A CB   1 
ATOM 1769 C CG   . LEU A 1 131 ? -5.539  3.417   -1.989  1.00 0.00 ? 131 LEU A CG   1 
ATOM 1770 C CD1  . LEU A 1 131 ? -6.038  2.469   -0.909  1.00 0.00 ? 131 LEU A CD1  1 
ATOM 1771 C CD2  . LEU A 1 131 ? -4.019  3.408   -2.051  1.00 0.00 ? 131 LEU A CD2  1 
ATOM 1772 H H    . LEU A 1 131 ? -8.043  2.161   -5.083  1.00 0.00 ? 131 LEU A H    1 
ATOM 1773 H HA   . LEU A 1 131 ? -7.991  3.866   -2.682  1.00 0.00 ? 131 LEU A HA   1 
ATOM 1774 H HB2  . LEU A 1 131 ? -6.184  1.963   -3.408  1.00 0.00 ? 131 LEU A HB2  1 
ATOM 1775 H HB3  . LEU A 1 131 ? -5.465  3.395   -4.120  1.00 0.00 ? 131 LEU A HB3  1 
ATOM 1776 H HG   . LEU A 1 131 ? -5.857  4.416   -1.730  1.00 0.00 ? 131 LEU A HG   1 
ATOM 1777 H HD11 . LEU A 1 131 ? -7.118  2.467   -0.904  1.00 0.00 ? 131 LEU A HD11 1 
ATOM 1778 H HD12 . LEU A 1 131 ? -5.674  2.796   0.053   1.00 0.00 ? 131 LEU A HD12 1 
ATOM 1779 H HD13 . LEU A 1 131 ? -5.677  1.471   -1.111  1.00 0.00 ? 131 LEU A HD13 1 
ATOM 1780 H HD21 . LEU A 1 131 ? -3.625  4.093   -1.315  1.00 0.00 ? 131 LEU A HD21 1 
ATOM 1781 H HD22 . LEU A 1 131 ? -3.696  3.712   -3.035  1.00 0.00 ? 131 LEU A HD22 1 
ATOM 1782 H HD23 . LEU A 1 131 ? -3.656  2.412   -1.845  1.00 0.00 ? 131 LEU A HD23 1 
ATOM 1783 N N    . ASN A 1 132 ? -7.933  5.969   -3.961  1.00 0.00 ? 132 ASN A N    1 
ATOM 1784 C CA   . ASN A 1 132 ? -7.882  7.241   -4.670  1.00 0.00 ? 132 ASN A CA   1 
ATOM 1785 C C    . ASN A 1 132 ? -7.100  8.271   -3.864  1.00 0.00 ? 132 ASN A C    1 
ATOM 1786 O O    . ASN A 1 132 ? -7.395  8.511   -2.692  1.00 0.00 ? 132 ASN A O    1 
ATOM 1787 C CB   . ASN A 1 132 ? -9.296  7.754   -4.950  1.00 0.00 ? 132 ASN A CB   1 
ATOM 1788 C CG   . ASN A 1 132 ? -9.973  6.998   -6.077  1.00 0.00 ? 132 ASN A CG   1 
ATOM 1789 O OD1  . ASN A 1 132 ? -9.412  6.052   -6.630  1.00 0.00 ? 132 ASN A OD1  1 
ATOM 1790 N ND2  . ASN A 1 132 ? -11.185 7.415   -6.426  1.00 0.00 ? 132 ASN A ND2  1 
ATOM 1791 H H    . ASN A 1 132 ? -8.341  5.935   -3.070  1.00 0.00 ? 132 ASN A H    1 
ATOM 1792 H HA   . ASN A 1 132 ? -7.375  7.076   -5.609  1.00 0.00 ? 132 ASN A HA   1 
ATOM 1793 H HB2  . ASN A 1 132 ? -9.895  7.646   -4.058  1.00 0.00 ? 132 ASN A HB2  1 
ATOM 1794 H HB3  . ASN A 1 132 ? -9.246  8.798   -5.221  1.00 0.00 ? 132 ASN A HB3  1 
ATOM 1795 H HD21 . ASN A 1 132 ? -11.570 8.175   -5.942  1.00 0.00 ? 132 ASN A HD21 1 
ATOM 1796 H HD22 . ASN A 1 132 ? -11.645 6.945   -7.152  1.00 0.00 ? 132 ASN A HD22 1 
ATOM 1797 N N    . LEU A 1 133 ? -6.092  8.865   -4.491  1.00 0.00 ? 133 LEU A N    1 
ATOM 1798 C CA   . LEU A 1 133 ? -5.255  9.853   -3.823  1.00 0.00 ? 133 LEU A CA   1 
ATOM 1799 C C    . LEU A 1 133 ? -5.601  11.263  -4.283  1.00 0.00 ? 133 LEU A C    1 
ATOM 1800 O O    . LEU A 1 133 ? -6.245  11.452  -5.315  1.00 0.00 ? 133 LEU A O    1 
ATOM 1801 C CB   . LEU A 1 133 ? -3.769  9.570   -4.079  1.00 0.00 ? 133 LEU A CB   1 
ATOM 1802 C CG   . LEU A 1 133 ? -3.464  8.633   -5.254  1.00 0.00 ? 133 LEU A CG   1 
ATOM 1803 C CD1  . LEU A 1 133 ? -1.981  8.665   -5.589  1.00 0.00 ? 133 LEU A CD1  1 
ATOM 1804 C CD2  . LEU A 1 133 ? -3.911  7.215   -4.931  1.00 0.00 ? 133 LEU A CD2  1 
ATOM 1805 H H    . LEU A 1 133 ? -5.898  8.626   -5.422  1.00 0.00 ? 133 LEU A H    1 
ATOM 1806 H HA   . LEU A 1 133 ? -5.446  9.780   -2.763  1.00 0.00 ? 133 LEU A HA   1 
ATOM 1807 H HB2  . LEU A 1 133 ? -3.272  10.511  -4.261  1.00 0.00 ? 133 LEU A HB2  1 
ATOM 1808 H HB3  . LEU A 1 133 ? -3.352  9.132   -3.185  1.00 0.00 ? 133 LEU A HB3  1 
ATOM 1809 H HG   . LEU A 1 133 ? -4.011  8.967   -6.124  1.00 0.00 ? 133 LEU A HG   1 
ATOM 1810 H HD11 . LEU A 1 133 ? -1.597  9.661   -5.430  1.00 0.00 ? 133 LEU A HD11 1 
ATOM 1811 H HD12 . LEU A 1 133 ? -1.840  8.385   -6.623  1.00 0.00 ? 133 LEU A HD12 1 
ATOM 1812 H HD13 . LEU A 1 133 ? -1.454  7.969   -4.953  1.00 0.00 ? 133 LEU A HD13 1 
ATOM 1813 H HD21 . LEU A 1 133 ? -3.062  6.550   -4.980  1.00 0.00 ? 133 LEU A HD21 1 
ATOM 1814 H HD22 . LEU A 1 133 ? -4.657  6.901   -5.646  1.00 0.00 ? 133 LEU A HD22 1 
ATOM 1815 H HD23 . LEU A 1 133 ? -4.333  7.189   -3.936  1.00 0.00 ? 133 LEU A HD23 1 
ATOM 1816 N N    . MET A 1 134 ? -5.175  12.250  -3.503  1.00 0.00 ? 134 MET A N    1 
ATOM 1817 C CA   . MET A 1 134 ? -5.435  13.647  -3.822  1.00 0.00 ? 134 MET A CA   1 
ATOM 1818 C C    . MET A 1 134 ? -4.210  14.503  -3.537  1.00 0.00 ? 134 MET A C    1 
ATOM 1819 O O    . MET A 1 134 ? -3.824  14.681  -2.383  1.00 0.00 ? 134 MET A O    1 
ATOM 1820 C CB   . MET A 1 134 ? -6.619  14.164  -3.006  1.00 0.00 ? 134 MET A CB   1 
ATOM 1821 C CG   . MET A 1 134 ? -7.733  13.145  -2.837  1.00 0.00 ? 134 MET A CG   1 
ATOM 1822 S SD   . MET A 1 134 ? -9.369  13.903  -2.809  1.00 0.00 ? 134 MET A SD   1 
ATOM 1823 C CE   . MET A 1 134 ? -10.075 13.130  -1.355  1.00 0.00 ? 134 MET A CE   1 
ATOM 1824 H H    . MET A 1 134 ? -4.667  12.032  -2.694  1.00 0.00 ? 134 MET A H    1 
ATOM 1825 H HA   . MET A 1 134 ? -5.672  13.711  -4.872  1.00 0.00 ? 134 MET A HA   1 
ATOM 1826 H HB2  . MET A 1 134 ? -6.265  14.447  -2.025  1.00 0.00 ? 134 MET A HB2  1 
ATOM 1827 H HB3  . MET A 1 134 ? -7.028  15.035  -3.497  1.00 0.00 ? 134 MET A HB3  1 
ATOM 1828 H HG2  . MET A 1 134 ? -7.691  12.446  -3.659  1.00 0.00 ? 134 MET A HG2  1 
ATOM 1829 H HG3  . MET A 1 134 ? -7.581  12.615  -1.908  1.00 0.00 ? 134 MET A HG3  1 
ATOM 1830 H HE1  . MET A 1 134 ? -9.748  13.659  -0.472  1.00 0.00 ? 134 MET A HE1  1 
ATOM 1831 H HE2  . MET A 1 134 ? -9.749  12.102  -1.301  1.00 0.00 ? 134 MET A HE2  1 
ATOM 1832 H HE3  . MET A 1 134 ? -11.153 13.164  -1.417  1.00 0.00 ? 134 MET A HE3  1 
ATOM 1833 N N    . ALA A 1 135 ? -3.598  15.028  -4.592  1.00 0.00 ? 135 ALA A N    1 
ATOM 1834 C CA   . ALA A 1 135 ? -2.425  15.878  -4.443  1.00 0.00 ? 135 ALA A CA   1 
ATOM 1835 C C    . ALA A 1 135 ? -2.723  17.048  -3.518  1.00 0.00 ? 135 ALA A C    1 
ATOM 1836 O O    . ALA A 1 135 ? -3.444  17.975  -3.889  1.00 0.00 ? 135 ALA A O    1 
ATOM 1837 C CB   . ALA A 1 135 ? -1.961  16.385  -5.796  1.00 0.00 ? 135 ALA A CB   1 
ATOM 1838 H H    . ALA A 1 135 ? -3.964  14.869  -5.488  1.00 0.00 ? 135 ALA A H    1 
ATOM 1839 H HA   . ALA A 1 135 ? -1.632  15.283  -4.015  1.00 0.00 ? 135 ALA A HA   1 
ATOM 1840 H HB1  . ALA A 1 135 ? -2.183  15.648  -6.554  1.00 0.00 ? 135 ALA A HB1  1 
ATOM 1841 H HB2  . ALA A 1 135 ? -0.896  16.563  -5.767  1.00 0.00 ? 135 ALA A HB2  1 
ATOM 1842 H HB3  . ALA A 1 135 ? -2.473  17.308  -6.026  1.00 0.00 ? 135 ALA A HB3  1 
ATOM 1843 N N    . ALA A 1 136 ? -2.174  17.001  -2.312  1.00 0.00 ? 136 ALA A N    1 
ATOM 1844 C CA   . ALA A 1 136 ? -2.398  18.059  -1.341  1.00 0.00 ? 136 ALA A CA   1 
ATOM 1845 C C    . ALA A 1 136 ? -1.381  19.184  -1.504  1.00 0.00 ? 136 ALA A C    1 
ATOM 1846 O O    . ALA A 1 136 ? -1.633  20.323  -1.110  1.00 0.00 ? 136 ALA A O    1 
ATOM 1847 C CB   . ALA A 1 136 ? -2.357  17.499  0.075   1.00 0.00 ? 136 ALA A CB   1 
ATOM 1848 H H    . ALA A 1 136 ? -1.612  16.236  -2.069  1.00 0.00 ? 136 ALA A H    1 
ATOM 1849 H HA   . ALA A 1 136 ? -3.386  18.454  -1.517  1.00 0.00 ? 136 ALA A HA   1 
ATOM 1850 H HB1  . ALA A 1 136 ? -1.331  17.331  0.367   1.00 0.00 ? 136 ALA A HB1  1 
ATOM 1851 H HB2  . ALA A 1 136 ? -2.899  16.565  0.109   1.00 0.00 ? 136 ALA A HB2  1 
ATOM 1852 H HB3  . ALA A 1 136 ? -2.814  18.204  0.754   1.00 0.00 ? 136 ALA A HB3  1 
ATOM 1853 N N    . ASP A 1 137 ? -0.235  18.860  -2.094  1.00 0.00 ? 137 ASP A N    1 
ATOM 1854 C CA   . ASP A 1 137 ? 0.815   19.846  -2.318  1.00 0.00 ? 137 ASP A CA   1 
ATOM 1855 C C    . ASP A 1 137 ? 0.797   20.336  -3.762  1.00 0.00 ? 137 ASP A C    1 
ATOM 1856 O O    . ASP A 1 137 ? 1.064   21.506  -4.035  1.00 0.00 ? 137 ASP A O    1 
ATOM 1857 C CB   . ASP A 1 137 ? 2.184   19.248  -1.987  1.00 0.00 ? 137 ASP A CB   1 
ATOM 1858 C CG   . ASP A 1 137 ? 3.308   20.252  -2.147  1.00 0.00 ? 137 ASP A CG   1 
ATOM 1859 O OD1  . ASP A 1 137 ? 3.352   21.224  -1.363  1.00 0.00 ? 137 ASP A OD1  1 
ATOM 1860 O OD2  . ASP A 1 137 ? 4.144   20.068  -3.057  1.00 0.00 ? 137 ASP A OD2  1 
ATOM 1861 H H    . ASP A 1 137 ? -0.093  17.937  -2.391  1.00 0.00 ? 137 ASP A H    1 
ATOM 1862 H HA   . ASP A 1 137 ? 0.629   20.685  -1.663  1.00 0.00 ? 137 ASP A HA   1 
ATOM 1863 H HB2  . ASP A 1 137 ? 2.180   18.899  -0.965  1.00 0.00 ? 137 ASP A HB2  1 
ATOM 1864 H HB3  . ASP A 1 137 ? 2.374   18.415  -2.647  1.00 0.00 ? 137 ASP A HB3  1 
ATOM 1865 N N    . CYS A 1 138 ? 0.476   19.433  -4.683  1.00 0.00 ? 138 CYS A N    1 
ATOM 1866 C CA   . CYS A 1 138 ? 0.417   19.771  -6.100  1.00 0.00 ? 138 CYS A CA   1 
ATOM 1867 C C    . CYS A 1 138 ? -0.845  20.566  -6.428  1.00 0.00 ? 138 CYS A C    1 
ATOM 1868 O O    . CYS A 1 138 ? -0.914  21.235  -7.459  1.00 0.00 ? 138 CYS A O    1 
ATOM 1869 C CB   . CYS A 1 138 ? 0.463   18.501  -6.951  1.00 0.00 ? 138 CYS A CB   1 
ATOM 1870 S SG   . CYS A 1 138 ? 1.599   18.592  -8.354  1.00 0.00 ? 138 CYS A SG   1 
ATOM 1871 H H    . CYS A 1 138 ? 0.272   18.516  -4.402  1.00 0.00 ? 138 CYS A H    1 
ATOM 1872 H HA   . CYS A 1 138 ? 1.280   20.380  -6.330  1.00 0.00 ? 138 CYS A HA   1 
ATOM 1873 H HB2  . CYS A 1 138 ? 0.772   17.672  -6.331  1.00 0.00 ? 138 CYS A HB2  1 
ATOM 1874 H HB3  . CYS A 1 138 ? -0.525  18.302  -7.341  1.00 0.00 ? 138 CYS A HB3  1 
ATOM 1875 H HG   . CYS A 1 138 ? 1.075   18.673  -9.155  1.00 0.00 ? 138 CYS A HG   1 
ATOM 1876 N N    . LYS A 1 139 ? -1.844  20.483  -5.551  1.00 0.00 ? 139 LYS A N    1 
ATOM 1877 C CA   . LYS A 1 139 ? -3.108  21.184  -5.756  1.00 0.00 ? 139 LYS A CA   1 
ATOM 1878 C C    . LYS A 1 139 ? -3.924  20.516  -6.857  1.00 0.00 ? 139 LYS A C    1 
ATOM 1879 O O    . LYS A 1 139 ? -4.203  21.118  -7.894  1.00 0.00 ? 139 LYS A O    1 
ATOM 1880 C CB   . LYS A 1 139 ? -2.861  22.654  -6.103  1.00 0.00 ? 139 LYS A CB   1 
ATOM 1881 C CG   . LYS A 1 139 ? -1.881  23.342  -5.167  1.00 0.00 ? 139 LYS A CG   1 
ATOM 1882 C CD   . LYS A 1 139 ? -2.584  24.345  -4.267  1.00 0.00 ? 139 LYS A CD   1 
ATOM 1883 C CE   . LYS A 1 139 ? -3.144  23.679  -3.021  1.00 0.00 ? 139 LYS A CE   1 
ATOM 1884 N NZ   . LYS A 1 139 ? -2.313  23.960  -1.819  1.00 0.00 ? 139 LYS A NZ   1 
ATOM 1885 H H    . LYS A 1 139 ? -1.735  19.927  -4.752  1.00 0.00 ? 139 LYS A H    1 
ATOM 1886 H HA   . LYS A 1 139 ? -3.666  21.132  -4.833  1.00 0.00 ? 139 LYS A HA   1 
ATOM 1887 H HB2  . LYS A 1 139 ? -2.471  22.715  -7.108  1.00 0.00 ? 139 LYS A HB2  1 
ATOM 1888 H HB3  . LYS A 1 139 ? -3.800  23.184  -6.059  1.00 0.00 ? 139 LYS A HB3  1 
ATOM 1889 H HG2  . LYS A 1 139 ? -1.402  22.595  -4.551  1.00 0.00 ? 139 LYS A HG2  1 
ATOM 1890 H HG3  . LYS A 1 139 ? -1.138  23.859  -5.755  1.00 0.00 ? 139 LYS A HG3  1 
ATOM 1891 H HD2  . LYS A 1 139 ? -1.877  25.105  -3.970  1.00 0.00 ? 139 LYS A HD2  1 
ATOM 1892 H HD3  . LYS A 1 139 ? -3.395  24.800  -4.816  1.00 0.00 ? 139 LYS A HD3  1 
ATOM 1893 H HE2  . LYS A 1 139 ? -4.145  24.047  -2.851  1.00 0.00 ? 139 LYS A HE2  1 
ATOM 1894 H HE3  . LYS A 1 139 ? -3.177  22.611  -3.183  1.00 0.00 ? 139 LYS A HE3  1 
ATOM 1895 H HZ1  . LYS A 1 139 ? -1.814  24.866  -1.934  1.00 0.00 ? 139 LYS A HZ1  1 
ATOM 1896 H HZ2  . LYS A 1 139 ? -1.611  23.205  -1.685  1.00 0.00 ? 139 LYS A HZ2  1 
ATOM 1897 H HZ3  . LYS A 1 139 ? -2.914  24.014  -0.973  1.00 0.00 ? 139 LYS A HZ3  1 
ATOM 1898 N N    . GLN A 1 140 ? -4.301  19.264  -6.621  1.00 0.00 ? 140 GLN A N    1 
ATOM 1899 C CA   . GLN A 1 140 ? -5.086  18.501  -7.583  1.00 0.00 ? 140 GLN A CA   1 
ATOM 1900 C C    . GLN A 1 140 ? -5.428  17.127  -7.021  1.00 0.00 ? 140 GLN A C    1 
ATOM 1901 O O    . GLN A 1 140 ? -5.205  16.856  -5.842  1.00 0.00 ? 140 GLN A O    1 
ATOM 1902 C CB   . GLN A 1 140 ? -4.319  18.350  -8.898  1.00 0.00 ? 140 GLN A CB   1 
ATOM 1903 C CG   . GLN A 1 140 ? -3.073  17.489  -8.779  1.00 0.00 ? 140 GLN A CG   1 
ATOM 1904 C CD   . GLN A 1 140 ? -2.371  17.292  -10.108 1.00 0.00 ? 140 GLN A CD   1 
ATOM 1905 O OE1  . GLN A 1 140 ? -2.759  17.875  -11.121 1.00 0.00 ? 140 GLN A OE1  1 
ATOM 1906 N NE2  . GLN A 1 140 ? -1.331  16.466  -10.110 1.00 0.00 ? 140 GLN A NE2  1 
ATOM 1907 H H    . GLN A 1 140 ? -4.046  18.842  -5.774  1.00 0.00 ? 140 GLN A H    1 
ATOM 1908 H HA   . GLN A 1 140 ? -6.003  19.042  -7.767  1.00 0.00 ? 140 GLN A HA   1 
ATOM 1909 H HB2  . GLN A 1 140 ? -4.972  17.902  -9.632  1.00 0.00 ? 140 GLN A HB2  1 
ATOM 1910 H HB3  . GLN A 1 140 ? -4.023  19.330  -9.243  1.00 0.00 ? 140 GLN A HB3  1 
ATOM 1911 H HG2  . GLN A 1 140 ? -2.387  17.963  -8.093  1.00 0.00 ? 140 GLN A HG2  1 
ATOM 1912 H HG3  . GLN A 1 140 ? -3.356  16.521  -8.392  1.00 0.00 ? 140 GLN A HG3  1 
ATOM 1913 H HE21 . GLN A 1 140 ? -1.080  16.037  -9.266  1.00 0.00 ? 140 GLN A HE21 1 
ATOM 1914 H HE22 . GLN A 1 140 ? -0.858  16.320  -10.955 1.00 0.00 ? 140 GLN A HE22 1 
ATOM 1915 N N    . ILE A 1 141 ? -5.963  16.257  -7.869  1.00 0.00 ? 141 ILE A N    1 
ATOM 1916 C CA   . ILE A 1 141 ? -6.329  14.913  -7.441  1.00 0.00 ? 141 ILE A CA   1 
ATOM 1917 C C    . ILE A 1 141 ? -5.547  13.854  -8.208  1.00 0.00 ? 141 ILE A C    1 
ATOM 1918 O O    . ILE A 1 141 ? -5.301  13.992  -9.406  1.00 0.00 ? 141 ILE A O    1 
ATOM 1919 C CB   . ILE A 1 141 ? -7.835  14.653  -7.618  1.00 0.00 ? 141 ILE A CB   1 
ATOM 1920 C CG1  . ILE A 1 141 ? -8.646  15.756  -6.934  1.00 0.00 ? 141 ILE A CG1  1 
ATOM 1921 C CG2  . ILE A 1 141 ? -8.207  13.289  -7.056  1.00 0.00 ? 141 ILE A CG2  1 
ATOM 1922 C CD1  . ILE A 1 141 ? -10.137 15.501  -6.935  1.00 0.00 ? 141 ILE A CD1  1 
ATOM 1923 H H    . ILE A 1 141 ? -6.118  16.525  -8.799  1.00 0.00 ? 141 ILE A H    1 
ATOM 1924 H HA   . ILE A 1 141 ? -6.095  14.827  -6.391  1.00 0.00 ? 141 ILE A HA   1 
ATOM 1925 H HB   . ILE A 1 141 ? -8.056  14.653  -8.675  1.00 0.00 ? 141 ILE A HB   1 
ATOM 1926 H HG12 . ILE A 1 141 ? -8.326  15.844  -5.907  1.00 0.00 ? 141 ILE A HG12 1 
ATOM 1927 H HG13 . ILE A 1 141 ? -8.469  16.692  -7.444  1.00 0.00 ? 141 ILE A HG13 1 
ATOM 1928 H HG21 . ILE A 1 141 ? -8.622  12.677  -7.843  1.00 0.00 ? 141 ILE A HG21 1 
ATOM 1929 H HG22 . ILE A 1 141 ? -8.938  13.411  -6.271  1.00 0.00 ? 141 ILE A HG22 1 
ATOM 1930 H HG23 . ILE A 1 141 ? -7.324  12.812  -6.656  1.00 0.00 ? 141 ILE A HG23 1 
ATOM 1931 H HD11 . ILE A 1 141 ? -10.659 16.421  -7.152  1.00 0.00 ? 141 ILE A HD11 1 
ATOM 1932 H HD12 . ILE A 1 141 ? -10.440 15.135  -5.965  1.00 0.00 ? 141 ILE A HD12 1 
ATOM 1933 H HD13 . ILE A 1 141 ? -10.376 14.765  -7.689  1.00 0.00 ? 141 ILE A HD13 1 
ATOM 1934 N N    . ILE A 1 142 ? -5.163  12.794  -7.506  1.00 0.00 ? 142 ILE A N    1 
ATOM 1935 C CA   . ILE A 1 142 ? -4.413  11.704  -8.115  1.00 0.00 ? 142 ILE A CA   1 
ATOM 1936 C C    . ILE A 1 142 ? -5.272  10.451  -8.232  1.00 0.00 ? 142 ILE A C    1 
ATOM 1937 O O    . ILE A 1 142 ? -5.927  10.041  -7.272  1.00 0.00 ? 142 ILE A O    1 
ATOM 1938 C CB   . ILE A 1 142 ? -3.145  11.374  -7.310  1.00 0.00 ? 142 ILE A CB   1 
ATOM 1939 C CG1  . ILE A 1 142 ? -2.373  12.656  -6.990  1.00 0.00 ? 142 ILE A CG1  1 
ATOM 1940 C CG2  . ILE A 1 142 ? -2.267  10.400  -8.081  1.00 0.00 ? 142 ILE A CG2  1 
ATOM 1941 C CD1  . ILE A 1 142 ? -1.680  12.624  -5.647  1.00 0.00 ? 142 ILE A CD1  1 
ATOM 1942 H H    . ILE A 1 142 ? -5.390  12.743  -6.555  1.00 0.00 ? 142 ILE A H    1 
ATOM 1943 H HA   . ILE A 1 142 ? -4.114  12.017  -9.104  1.00 0.00 ? 142 ILE A HA   1 
ATOM 1944 H HB   . ILE A 1 142 ? -3.443  10.899  -6.388  1.00 0.00 ? 142 ILE A HB   1 
ATOM 1945 H HG12 . ILE A 1 142 ? -1.623  12.815  -7.750  1.00 0.00 ? 142 ILE A HG12 1 
ATOM 1946 H HG13 . ILE A 1 142 ? -3.057  13.491  -6.987  1.00 0.00 ? 142 ILE A HG13 1 
ATOM 1947 H HG21 . ILE A 1 142 ? -1.419  10.120  -7.473  1.00 0.00 ? 142 ILE A HG21 1 
ATOM 1948 H HG22 . ILE A 1 142 ? -1.920  10.869  -8.990  1.00 0.00 ? 142 ILE A HG22 1 
ATOM 1949 H HG23 . ILE A 1 142 ? -2.839  9.518   -8.328  1.00 0.00 ? 142 ILE A HG23 1 
ATOM 1950 H HD11 . ILE A 1 142 ? -1.036  11.759  -5.595  1.00 0.00 ? 142 ILE A HD11 1 
ATOM 1951 H HD12 . ILE A 1 142 ? -2.421  12.570  -4.862  1.00 0.00 ? 142 ILE A HD12 1 
ATOM 1952 H HD13 . ILE A 1 142 ? -1.091  13.521  -5.525  1.00 0.00 ? 142 ILE A HD13 1 
ATOM 1953 N N    . ALA A 1 143 ? -5.271  9.853   -9.416  1.00 0.00 ? 143 ALA A N    1 
ATOM 1954 C CA   . ALA A 1 143 ? -6.064  8.655   -9.667  1.00 0.00 ? 143 ALA A CA   1 
ATOM 1955 C C    . ALA A 1 143 ? -5.176  7.450   -9.958  1.00 0.00 ? 143 ALA A C    1 
ATOM 1956 O O    . ALA A 1 143 ? -3.999  7.596   -10.288 1.00 0.00 ? 143 ALA A O    1 
ATOM 1957 C CB   . ALA A 1 143 ? -7.027  8.895   -10.820 1.00 0.00 ? 143 ALA A CB   1 
ATOM 1958 H H    . ALA A 1 143 ? -4.731  10.232  -10.141 1.00 0.00 ? 143 ALA A H    1 
ATOM 1959 H HA   . ALA A 1 143 ? -6.648  8.453   -8.781  1.00 0.00 ? 143 ALA A HA   1 
ATOM 1960 H HB1  . ALA A 1 143 ? -7.759  9.634   -10.530 1.00 0.00 ? 143 ALA A HB1  1 
ATOM 1961 H HB2  . ALA A 1 143 ? -7.528  7.971   -11.069 1.00 0.00 ? 143 ALA A HB2  1 
ATOM 1962 H HB3  . ALA A 1 143 ? -6.478  9.249   -11.680 1.00 0.00 ? 143 ALA A HB3  1 
ATOM 1963 N N    . ASN A 1 144 ? -5.754  6.259   -9.836  1.00 0.00 ? 144 ASN A N    1 
ATOM 1964 C CA   . ASN A 1 144 ? -5.026  5.021   -10.088 1.00 0.00 ? 144 ASN A CA   1 
ATOM 1965 C C    . ASN A 1 144 ? -5.979  3.921   -10.546 1.00 0.00 ? 144 ASN A C    1 
ATOM 1966 O O    . ASN A 1 144 ? -6.909  3.555   -9.827  1.00 0.00 ? 144 ASN A O    1 
ATOM 1967 C CB   . ASN A 1 144 ? -4.282  4.576   -8.828  1.00 0.00 ? 144 ASN A CB   1 
ATOM 1968 C CG   . ASN A 1 144 ? -2.865  4.125   -9.120  1.00 0.00 ? 144 ASN A CG   1 
ATOM 1969 O OD1  . ASN A 1 144 ? -1.975  4.944   -9.354  1.00 0.00 ? 144 ASN A OD1  1 
ATOM 1970 N ND2  . ASN A 1 144 ? -2.646  2.815   -9.104  1.00 0.00 ? 144 ASN A ND2  1 
ATOM 1971 H H    . ASN A 1 144 ? -6.697  6.211   -9.572  1.00 0.00 ? 144 ASN A H    1 
ATOM 1972 H HA   . ASN A 1 144 ? -4.310  5.211   -10.874 1.00 0.00 ? 144 ASN A HA   1 
ATOM 1973 H HB2  . ASN A 1 144 ? -4.241  5.401   -8.132  1.00 0.00 ? 144 ASN A HB2  1 
ATOM 1974 H HB3  . ASN A 1 144 ? -4.815  3.754   -8.374  1.00 0.00 ? 144 ASN A HB3  1 
ATOM 1975 H HD21 . ASN A 1 144 ? -3.402  2.223   -8.909  1.00 0.00 ? 144 ASN A HD21 1 
ATOM 1976 H HD22 . ASN A 1 144 ? -1.739  2.495   -9.289  1.00 0.00 ? 144 ASN A HD22 1 
ATOM 1977 N N    . HIS A 1 145 ? -5.749  3.404   -11.748 1.00 0.00 ? 145 HIS A N    1 
ATOM 1978 C CA   . HIS A 1 145 ? -6.600  2.356   -12.301 1.00 0.00 ? 145 HIS A CA   1 
ATOM 1979 C C    . HIS A 1 145 ? -5.771  1.180   -12.804 1.00 0.00 ? 145 HIS A C    1 
ATOM 1980 O O    . HIS A 1 145 ? -5.885  0.777   -13.962 1.00 0.00 ? 145 HIS A O    1 
ATOM 1981 C CB   . HIS A 1 145 ? -7.454  2.916   -13.440 1.00 0.00 ? 145 HIS A CB   1 
ATOM 1982 C CG   . HIS A 1 145 ? -8.261  4.115   -13.048 1.00 0.00 ? 145 HIS A CG   1 
ATOM 1983 N ND1  . HIS A 1 145 ? -8.201  5.316   -13.723 1.00 0.00 ? 145 HIS A ND1  1 
ATOM 1984 C CD2  . HIS A 1 145 ? -9.149  4.296   -12.041 1.00 0.00 ? 145 HIS A CD2  1 
ATOM 1985 C CE1  . HIS A 1 145 ? -9.018  6.183   -13.150 1.00 0.00 ? 145 HIS A CE1  1 
ATOM 1986 N NE2  . HIS A 1 145 ? -9.604  5.588   -12.128 1.00 0.00 ? 145 HIS A NE2  1 
ATOM 1987 H H    . HIS A 1 145 ? -4.997  3.740   -12.279 1.00 0.00 ? 145 HIS A H    1 
ATOM 1988 H HA   . HIS A 1 145 ? -7.251  2.010   -11.512 1.00 0.00 ? 145 HIS A HA   1 
ATOM 1989 H HB2  . HIS A 1 145 ? -6.809  3.203   -14.257 1.00 0.00 ? 145 HIS A HB2  1 
ATOM 1990 H HB3  . HIS A 1 145 ? -8.138  2.151   -13.777 1.00 0.00 ? 145 HIS A HB3  1 
ATOM 1991 H HD1  . HIS A 1 145 ? -7.643  5.505   -14.507 1.00 0.00 ? 145 HIS A HD1  1 
ATOM 1992 H HD2  . HIS A 1 145 ? -9.445  3.560   -11.307 1.00 0.00 ? 145 HIS A HD2  1 
ATOM 1993 H HE1  . HIS A 1 145 ? -9.178  7.204   -13.465 1.00 0.00 ? 145 HIS A HE1  1 
ATOM 1994 H HE2  . HIS A 1 145 ? -10.259 6.005   -11.530 1.00 0.00 ? 145 HIS A HE2  1 
ATOM 1995 N N    . HIS A 1 146 ? -4.937  0.632   -11.927 1.00 0.00 ? 146 HIS A N    1 
ATOM 1996 C CA   . HIS A 1 146 ? -4.098  -0.508  -12.279 1.00 0.00 ? 146 HIS A CA   1 
ATOM 1997 C C    . HIS A 1 146 ? -4.722  -1.809  -11.783 1.00 0.00 ? 146 HIS A C    1 
ATOM 1998 O O    . HIS A 1 146 ? -4.807  -2.791  -12.520 1.00 0.00 ? 146 HIS A O    1 
ATOM 1999 C CB   . HIS A 1 146 ? -2.699  -0.342  -11.683 1.00 0.00 ? 146 HIS A CB   1 
ATOM 2000 C CG   . HIS A 1 146 ? -1.620  -0.227  -12.714 1.00 0.00 ? 146 HIS A CG   1 
ATOM 2001 N ND1  . HIS A 1 146 ? -1.587  -0.996  -13.858 1.00 0.00 ? 146 HIS A ND1  1 
ATOM 2002 C CD2  . HIS A 1 146 ? -0.529  0.574   -12.769 1.00 0.00 ? 146 HIS A CD2  1 
ATOM 2003 C CE1  . HIS A 1 146 ? -0.523  -0.674  -14.572 1.00 0.00 ? 146 HIS A CE1  1 
ATOM 2004 N NE2  . HIS A 1 146 ? 0.134   0.276   -13.933 1.00 0.00 ? 146 HIS A NE2  1 
ATOM 2005 H H    . HIS A 1 146 ? -4.895  0.993   -11.017 1.00 0.00 ? 146 HIS A H    1 
ATOM 2006 H HA   . HIS A 1 146 ? -4.022  -0.545  -13.355 1.00 0.00 ? 146 HIS A HA   1 
ATOM 2007 H HB2  . HIS A 1 146 ? -2.677  0.552   -11.078 1.00 0.00 ? 146 HIS A HB2  1 
ATOM 2008 H HB3  . HIS A 1 146 ? -2.475  -1.197  -11.063 1.00 0.00 ? 146 HIS A HB3  1 
ATOM 2009 H HD1  . HIS A 1 146 ? -2.245  -1.677  -14.109 1.00 0.00 ? 146 HIS A HD1  1 
ATOM 2010 H HD2  . HIS A 1 146 ? -0.236  1.310   -12.034 1.00 0.00 ? 146 HIS A HD2  1 
ATOM 2011 H HE1  . HIS A 1 146 ? -0.240  -1.112  -15.518 1.00 0.00 ? 146 HIS A HE1  1 
ATOM 2012 H HE2  . HIS A 1 146 ? 0.963   0.698   -14.242 1.00 0.00 ? 146 HIS A HE2  1 
ATOM 2013 N N    . MET A 1 147 ? -5.157  -1.802  -10.528 1.00 0.00 ? 147 MET A N    1 
ATOM 2014 C CA   . MET A 1 147 ? -5.778  -2.974  -9.922  1.00 0.00 ? 147 MET A CA   1 
ATOM 2015 C C    . MET A 1 147 ? -6.762  -2.555  -8.834  1.00 0.00 ? 147 MET A C    1 
ATOM 2016 O O    . MET A 1 147 ? -7.017  -1.366  -8.642  1.00 0.00 ? 147 MET A O    1 
ATOM 2017 C CB   . MET A 1 147 ? -4.706  -3.894  -9.332  1.00 0.00 ? 147 MET A CB   1 
ATOM 2018 C CG   . MET A 1 147 ? -4.144  -4.894  -10.331 1.00 0.00 ? 147 MET A CG   1 
ATOM 2019 S SD   . MET A 1 147 ? -5.333  -6.173  -10.779 1.00 0.00 ? 147 MET A SD   1 
ATOM 2020 C CE   . MET A 1 147 ? -4.243  -7.569  -11.045 1.00 0.00 ? 147 MET A CE   1 
ATOM 2021 H H    . MET A 1 147 ? -5.060  -0.986  -9.995  1.00 0.00 ? 147 MET A H    1 
ATOM 2022 H HA   . MET A 1 147 ? -6.315  -3.504  -10.694 1.00 0.00 ? 147 MET A HA   1 
ATOM 2023 H HB2  . MET A 1 147 ? -3.891  -3.288  -8.965  1.00 0.00 ? 147 MET A HB2  1 
ATOM 2024 H HB3  . MET A 1 147 ? -5.133  -4.444  -8.507  1.00 0.00 ? 147 MET A HB3  1 
ATOM 2025 H HG2  . MET A 1 147 ? -3.854  -4.363  -11.225 1.00 0.00 ? 147 MET A HG2  1 
ATOM 2026 H HG3  . MET A 1 147 ? -3.276  -5.366  -9.896  1.00 0.00 ? 147 MET A HG3  1 
ATOM 2027 H HE1  . MET A 1 147 ? -3.574  -7.668  -10.203 1.00 0.00 ? 147 MET A HE1  1 
ATOM 2028 H HE2  . MET A 1 147 ? -3.668  -7.411  -11.945 1.00 0.00 ? 147 MET A HE2  1 
ATOM 2029 H HE3  . MET A 1 147 ? -4.830  -8.470  -11.146 1.00 0.00 ? 147 MET A HE3  1 
ATOM 2030 N N    . GLN A 1 148 ? -7.305  -3.535  -8.114  1.00 0.00 ? 148 GLN A N    1 
ATOM 2031 C CA   . GLN A 1 148 ? -8.257  -3.258  -7.042  1.00 0.00 ? 148 GLN A CA   1 
ATOM 2032 C C    . GLN A 1 148 ? -7.749  -2.144  -6.131  1.00 0.00 ? 148 GLN A C    1 
ATOM 2033 O O    . GLN A 1 148 ? -8.348  -1.071  -6.051  1.00 0.00 ? 148 GLN A O    1 
ATOM 2034 C CB   . GLN A 1 148 ? -8.513  -4.522  -6.216  1.00 0.00 ? 148 GLN A CB   1 
ATOM 2035 C CG   . GLN A 1 148 ? -9.107  -5.675  -7.013  1.00 0.00 ? 148 GLN A CG   1 
ATOM 2036 C CD   . GLN A 1 148 ? -10.178 -5.229  -7.990  1.00 0.00 ? 148 GLN A CD   1 
ATOM 2037 O OE1  . GLN A 1 148 ? -9.892  -4.934  -9.151  1.00 0.00 ? 148 GLN A OE1  1 
ATOM 2038 N NE2  . GLN A 1 148 ? -11.421 -5.183  -7.525  1.00 0.00 ? 148 GLN A NE2  1 
ATOM 2039 H H    . GLN A 1 148 ? -7.064  -4.464  -8.312  1.00 0.00 ? 148 GLN A H    1 
ATOM 2040 H HA   . GLN A 1 148 ? -9.184  -2.940  -7.496  1.00 0.00 ? 148 GLN A HA   1 
ATOM 2041 H HB2  . GLN A 1 148 ? -7.577  -4.853  -5.790  1.00 0.00 ? 148 GLN A HB2  1 
ATOM 2042 H HB3  . GLN A 1 148 ? -9.196  -4.280  -5.414  1.00 0.00 ? 148 GLN A HB3  1 
ATOM 2043 H HG2  . GLN A 1 148 ? -8.316  -6.159  -7.566  1.00 0.00 ? 148 GLN A HG2  1 
ATOM 2044 H HG3  . GLN A 1 148 ? -9.545  -6.380  -6.323  1.00 0.00 ? 148 GLN A HG3  1 
ATOM 2045 H HE21 . GLN A 1 148 ? -11.574 -5.434  -6.590  1.00 0.00 ? 148 GLN A HE21 1 
ATOM 2046 H HE22 . GLN A 1 148 ? -12.133 -4.900  -8.135  1.00 0.00 ? 148 GLN A HE22 1 
ATOM 2047 N N    . SER A 1 149 ? -6.639  -2.407  -5.448  1.00 0.00 ? 149 SER A N    1 
ATOM 2048 C CA   . SER A 1 149 ? -6.042  -1.430  -4.544  1.00 0.00 ? 149 SER A CA   1 
ATOM 2049 C C    . SER A 1 149 ? -4.907  -2.057  -3.741  1.00 0.00 ? 149 SER A C    1 
ATOM 2050 O O    . SER A 1 149 ? -3.785  -1.551  -3.733  1.00 0.00 ? 149 SER A O    1 
ATOM 2051 C CB   . SER A 1 149 ? -7.101  -0.865  -3.593  1.00 0.00 ? 149 SER A CB   1 
ATOM 2052 O OG   . SER A 1 149 ? -7.981  -1.882  -3.148  1.00 0.00 ? 149 SER A OG   1 
ATOM 2053 H H    . SER A 1 149 ? -6.208  -3.280  -5.557  1.00 0.00 ? 149 SER A H    1 
ATOM 2054 H HA   . SER A 1 149 ? -5.642  -0.625  -5.143  1.00 0.00 ? 149 SER A HA   1 
ATOM 2055 H HB2  . SER A 1 149 ? -6.615  -0.427  -2.735  1.00 0.00 ? 149 SER A HB2  1 
ATOM 2056 H HB3  . SER A 1 149 ? -7.676  -0.108  -4.106  1.00 0.00 ? 149 SER A HB3  1 
ATOM 2057 H HG   . SER A 1 149 ? -8.246  -1.704  -2.243  1.00 0.00 ? 149 SER A HG   1 
ATOM 2058 N N    . ILE A 1 150 ? -5.207  -3.164  -3.069  1.00 0.00 ? 150 ILE A N    1 
ATOM 2059 C CA   . ILE A 1 150 ? -4.212  -3.863  -2.262  1.00 0.00 ? 150 ILE A CA   1 
ATOM 2060 C C    . ILE A 1 150 ? -4.506  -5.359  -2.204  1.00 0.00 ? 150 ILE A C    1 
ATOM 2061 O O    . ILE A 1 150 ? -5.466  -5.837  -2.806  1.00 0.00 ? 150 ILE A O    1 
ATOM 2062 C CB   . ILE A 1 150 ? -4.152  -3.307  -0.826  1.00 0.00 ? 150 ILE A CB   1 
ATOM 2063 C CG1  . ILE A 1 150 ? -5.552  -2.930  -0.336  1.00 0.00 ? 150 ILE A CG1  1 
ATOM 2064 C CG2  . ILE A 1 150 ? -3.222  -2.105  -0.761  1.00 0.00 ? 150 ILE A CG2  1 
ATOM 2065 C CD1  . ILE A 1 150 ? -5.833  -3.364  1.085   1.00 0.00 ? 150 ILE A CD1  1 
ATOM 2066 H H    . ILE A 1 150 ? -6.119  -3.519  -3.116  1.00 0.00 ? 150 ILE A H    1 
ATOM 2067 H HA   . ILE A 1 150 ? -3.246  -3.714  -2.722  1.00 0.00 ? 150 ILE A HA   1 
ATOM 2068 H HB   . ILE A 1 150 ? -3.748  -4.076  -0.184  1.00 0.00 ? 150 ILE A HB   1 
ATOM 2069 H HG12 . ILE A 1 150 ? -5.666  -1.857  -0.384  1.00 0.00 ? 150 ILE A HG12 1 
ATOM 2070 H HG13 . ILE A 1 150 ? -6.288  -3.395  -0.976  1.00 0.00 ? 150 ILE A HG13 1 
ATOM 2071 H HG21 . ILE A 1 150 ? -3.808  -1.200  -0.701  1.00 0.00 ? 150 ILE A HG21 1 
ATOM 2072 H HG22 . ILE A 1 150 ? -2.608  -2.078  -1.649  1.00 0.00 ? 150 ILE A HG22 1 
ATOM 2073 H HG23 . ILE A 1 150 ? -2.591  -2.185  0.111   1.00 0.00 ? 150 ILE A HG23 1 
ATOM 2074 H HD11 . ILE A 1 150 ? -4.903  -3.445  1.628   1.00 0.00 ? 150 ILE A HD11 1 
ATOM 2075 H HD12 . ILE A 1 150 ? -6.330  -4.323  1.078   1.00 0.00 ? 150 ILE A HD12 1 
ATOM 2076 H HD13 . ILE A 1 150 ? -6.468  -2.634  1.566   1.00 0.00 ? 150 ILE A HD13 1 
ATOM 2077 N N    . SER A 1 151 ? -3.671  -6.092  -1.475  1.00 0.00 ? 151 SER A N    1 
ATOM 2078 C CA   . SER A 1 151 ? -3.842  -7.534  -1.336  1.00 0.00 ? 151 SER A CA   1 
ATOM 2079 C C    . SER A 1 151 ? -2.934  -8.088  -0.243  1.00 0.00 ? 151 SER A C    1 
ATOM 2080 O O    . SER A 1 151 ? -3.407  -8.540  0.800   1.00 0.00 ? 151 SER A O    1 
ATOM 2081 C CB   . SER A 1 151 ? -3.545  -8.234  -2.664  1.00 0.00 ? 151 SER A CB   1 
ATOM 2082 O OG   . SER A 1 151 ? -3.370  -9.628  -2.479  1.00 0.00 ? 151 SER A OG   1 
ATOM 2083 H H    . SER A 1 151 ? -2.924  -5.653  -1.016  1.00 0.00 ? 151 SER A H    1 
ATOM 2084 H HA   . SER A 1 151 ? -4.870  -7.720  -1.061  1.00 0.00 ? 151 SER A HA   1 
ATOM 2085 H HB2  . SER A 1 151 ? -4.369  -8.075  -3.344  1.00 0.00 ? 151 SER A HB2  1 
ATOM 2086 H HB3  . SER A 1 151 ? -2.642  -7.825  -3.091  1.00 0.00 ? 151 SER A HB3  1 
ATOM 2087 H HG   . SER A 1 151 ? -3.923  -10.107 -3.101  1.00 0.00 ? 151 SER A HG   1 
ATOM 2088 N N    . PHE A 1 152 ? -1.629  -8.051  -0.488  1.00 0.00 ? 152 PHE A N    1 
ATOM 2089 C CA   . PHE A 1 152 ? -0.657  -8.552  0.477   1.00 0.00 ? 152 PHE A CA   1 
ATOM 2090 C C    . PHE A 1 152 ? 0.397   -7.494  0.790   1.00 0.00 ? 152 PHE A C    1 
ATOM 2091 O O    . PHE A 1 152 ? 1.118   -7.040  -0.099  1.00 0.00 ? 152 PHE A O    1 
ATOM 2092 C CB   . PHE A 1 152 ? 0.018   -9.817  -0.059  1.00 0.00 ? 152 PHE A CB   1 
ATOM 2093 C CG   . PHE A 1 152 ? -0.708  -11.083 0.296   1.00 0.00 ? 152 PHE A CG   1 
ATOM 2094 C CD1  . PHE A 1 152 ? -1.140  -11.310 1.593   1.00 0.00 ? 152 PHE A CD1  1 
ATOM 2095 C CD2  . PHE A 1 152 ? -0.959  -12.046 -0.669  1.00 0.00 ? 152 PHE A CD2  1 
ATOM 2096 C CE1  . PHE A 1 152 ? -1.809  -12.475 1.921   1.00 0.00 ? 152 PHE A CE1  1 
ATOM 2097 C CE2  . PHE A 1 152 ? -1.626  -13.212 -0.346  1.00 0.00 ? 152 PHE A CE2  1 
ATOM 2098 C CZ   . PHE A 1 152 ? -2.052  -13.427 0.950   1.00 0.00 ? 152 PHE A CZ   1 
ATOM 2099 H H    . PHE A 1 152 ? -1.311  -7.680  -1.338  1.00 0.00 ? 152 PHE A H    1 
ATOM 2100 H HA   . PHE A 1 152 ? -1.187  -8.794  1.385   1.00 0.00 ? 152 PHE A HA   1 
ATOM 2101 H HB2  . PHE A 1 152 ? 0.075   -9.757  -1.136  1.00 0.00 ? 152 PHE A HB2  1 
ATOM 2102 H HB3  . PHE A 1 152 ? 1.017   -9.882  0.347   1.00 0.00 ? 152 PHE A HB3  1 
ATOM 2103 H HD1  . PHE A 1 152 ? -0.951  -10.566 2.353   1.00 0.00 ? 152 PHE A HD1  1 
ATOM 2104 H HD2  . PHE A 1 152 ? -0.626  -11.879 -1.682  1.00 0.00 ? 152 PHE A HD2  1 
ATOM 2105 H HE1  . PHE A 1 152 ? -2.140  -12.640 2.935   1.00 0.00 ? 152 PHE A HE1  1 
ATOM 2106 H HE2  . PHE A 1 152 ? -1.815  -13.955 -1.107  1.00 0.00 ? 152 PHE A HE2  1 
ATOM 2107 H HZ   . PHE A 1 152 ? -2.574  -14.338 1.204   1.00 0.00 ? 152 PHE A HZ   1 
ATOM 2108 N N    . ALA A 1 153 ? 0.480   -7.105  2.058   1.00 0.00 ? 153 ALA A N    1 
ATOM 2109 C CA   . ALA A 1 153 ? 1.448   -6.102  2.488   1.00 0.00 ? 153 ALA A CA   1 
ATOM 2110 C C    . ALA A 1 153 ? 2.670   -6.759  3.123   1.00 0.00 ? 153 ALA A C    1 
ATOM 2111 O O    . ALA A 1 153 ? 2.823   -7.979  3.078   1.00 0.00 ? 153 ALA A O    1 
ATOM 2112 C CB   . ALA A 1 153 ? 0.802   -5.128  3.461   1.00 0.00 ? 153 ALA A CB   1 
ATOM 2113 H H    . ALA A 1 153 ? -0.121  -7.504  2.721   1.00 0.00 ? 153 ALA A H    1 
ATOM 2114 H HA   . ALA A 1 153 ? 1.761   -5.547  1.616   1.00 0.00 ? 153 ALA A HA   1 
ATOM 2115 H HB1  . ALA A 1 153 ? 1.022   -5.431  4.473   1.00 0.00 ? 153 ALA A HB1  1 
ATOM 2116 H HB2  . ALA A 1 153 ? -0.267  -5.125  3.310   1.00 0.00 ? 153 ALA A HB2  1 
ATOM 2117 H HB3  . ALA A 1 153 ? 1.193   -4.136  3.289   1.00 0.00 ? 153 ALA A HB3  1 
ATOM 2118 N N    . SER A 1 154 ? 3.537   -5.942  3.713   1.00 0.00 ? 154 SER A N    1 
ATOM 2119 C CA   . SER A 1 154 ? 4.745   -6.446  4.356   1.00 0.00 ? 154 SER A CA   1 
ATOM 2120 C C    . SER A 1 154 ? 4.521   -6.651  5.850   1.00 0.00 ? 154 SER A C    1 
ATOM 2121 O O    . SER A 1 154 ? 5.092   -7.558  6.455   1.00 0.00 ? 154 SER A O    1 
ATOM 2122 C CB   . SER A 1 154 ? 5.910   -5.480  4.133   1.00 0.00 ? 154 SER A CB   1 
ATOM 2123 O OG   . SER A 1 154 ? 6.746   -5.923  3.078   1.00 0.00 ? 154 SER A OG   1 
ATOM 2124 H H    . SER A 1 154 ? 3.360   -4.978  3.715   1.00 0.00 ? 154 SER A H    1 
ATOM 2125 H HA   . SER A 1 154 ? 4.986   -7.398  3.907   1.00 0.00 ? 154 SER A HA   1 
ATOM 2126 H HB2  . SER A 1 154 ? 5.522   -4.504  3.882   1.00 0.00 ? 154 SER A HB2  1 
ATOM 2127 H HB3  . SER A 1 154 ? 6.497   -5.412  5.036   1.00 0.00 ? 154 SER A HB3  1 
ATOM 2128 H HG   . SER A 1 154 ? 6.216   -6.083  2.294   1.00 0.00 ? 154 SER A HG   1 
ATOM 2129 N N    . GLY A 1 155 ? 3.687   -5.801  6.440   1.00 0.00 ? 155 GLY A N    1 
ATOM 2130 C CA   . GLY A 1 155 ? 3.401   -5.907  7.858   1.00 0.00 ? 155 GLY A CA   1 
ATOM 2131 C C    . GLY A 1 155 ? 4.473   -5.266  8.718   1.00 0.00 ? 155 GLY A C    1 
ATOM 2132 O O    . GLY A 1 155 ? 4.229   -4.253  9.373   1.00 0.00 ? 155 GLY A O    1 
ATOM 2133 H H    . GLY A 1 155 ? 3.260   -5.099  5.906   1.00 0.00 ? 155 GLY A H    1 
ATOM 2134 H HA2  . GLY A 1 155 ? 2.457   -5.423  8.060   1.00 0.00 ? 155 GLY A HA2  1 
ATOM 2135 H HA3  . GLY A 1 155 ? 3.321   -6.951  8.120   1.00 0.00 ? 155 GLY A HA3  1 
ATOM 2136 N N    . GLY A 1 156 ? 5.662   -5.860  8.718   1.00 0.00 ? 156 GLY A N    1 
ATOM 2137 C CA   . GLY A 1 156 ? 6.754   -5.330  9.512   1.00 0.00 ? 156 GLY A CA   1 
ATOM 2138 C C    . GLY A 1 156 ? 6.442   -5.329  10.995  1.00 0.00 ? 156 GLY A C    1 
ATOM 2139 O O    . GLY A 1 156 ? 5.286   -5.478  11.393  1.00 0.00 ? 156 GLY A O    1 
ATOM 2140 H H    . GLY A 1 156 ? 5.797   -6.667  8.179   1.00 0.00 ? 156 GLY A H    1 
ATOM 2141 H HA2  . GLY A 1 156 ? 7.634   -5.932  9.341   1.00 0.00 ? 156 GLY A HA2  1 
ATOM 2142 H HA3  . GLY A 1 156 ? 6.957   -4.317  9.197   1.00 0.00 ? 156 GLY A HA3  1 
ATOM 2143 N N    . ASP A 1 157 ? 7.473   -5.164  11.817  1.00 0.00 ? 157 ASP A N    1 
ATOM 2144 C CA   . ASP A 1 157 ? 7.304   -5.143  13.261  1.00 0.00 ? 157 ASP A CA   1 
ATOM 2145 C C    . ASP A 1 157 ? 8.602   -4.709  13.930  1.00 0.00 ? 157 ASP A C    1 
ATOM 2146 O O    . ASP A 1 157 ? 9.178   -5.454  14.723  1.00 0.00 ? 157 ASP A O    1 
ATOM 2147 C CB   . ASP A 1 157 ? 6.887   -6.525  13.770  1.00 0.00 ? 157 ASP A CB   1 
ATOM 2148 C CG   . ASP A 1 157 ? 6.145   -6.456  15.090  1.00 0.00 ? 157 ASP A CG   1 
ATOM 2149 O OD1  . ASP A 1 157 ? 4.902   -6.332  15.066  1.00 0.00 ? 157 ASP A OD1  1 
ATOM 2150 O OD2  . ASP A 1 157 ? 6.805   -6.526  16.147  1.00 0.00 ? 157 ASP A OD2  1 
ATOM 2151 H H    . ASP A 1 157 ? 8.374   -5.048  11.443  1.00 0.00 ? 157 ASP A H    1 
ATOM 2152 H HA   . ASP A 1 157 ? 6.531   -4.428  13.498  1.00 0.00 ? 157 ASP A HA   1 
ATOM 2153 H HB2  . ASP A 1 157 ? 6.243   -6.992  13.039  1.00 0.00 ? 157 ASP A HB2  1 
ATOM 2154 H HB3  . ASP A 1 157 ? 7.770   -7.133  13.907  1.00 0.00 ? 157 ASP A HB3  1 
ATOM 2155 N N    . PRO A 1 158 ? 9.110   -3.509  13.589  1.00 0.00 ? 158 PRO A N    1 
ATOM 2156 C CA   . PRO A 1 158 ? 8.479   -2.587  12.651  1.00 0.00 ? 158 PRO A CA   1 
ATOM 2157 C C    . PRO A 1 158 ? 9.028   -2.725  11.235  1.00 0.00 ? 158 PRO A C    1 
ATOM 2158 O O    . PRO A 1 158 ? 10.027  -3.408  11.010  1.00 0.00 ? 158 PRO A O    1 
ATOM 2159 C CB   . PRO A 1 158 ? 8.860   -1.234  13.241  1.00 0.00 ? 158 PRO A CB   1 
ATOM 2160 C CG   . PRO A 1 158 ? 10.200  -1.454  13.879  1.00 0.00 ? 158 PRO A CG   1 
ATOM 2161 C CD   . PRO A 1 158 ? 10.353  -2.943  14.111  1.00 0.00 ? 158 PRO A CD   1 
ATOM 2162 H HA   . PRO A 1 158 ? 7.405   -2.696  12.639  1.00 0.00 ? 158 PRO A HA   1 
ATOM 2163 H HB2  . PRO A 1 158 ? 8.914   -0.497  12.454  1.00 0.00 ? 158 PRO A HB2  1 
ATOM 2164 H HB3  . PRO A 1 158 ? 8.121   -0.935  13.970  1.00 0.00 ? 158 PRO A HB3  1 
ATOM 2165 H HG2  . PRO A 1 158 ? 10.978  -1.101  13.218  1.00 0.00 ? 158 PRO A HG2  1 
ATOM 2166 H HG3  . PRO A 1 158 ? 10.245  -0.926  14.820  1.00 0.00 ? 158 PRO A HG3  1 
ATOM 2167 H HD2  . PRO A 1 158 ? 11.197  -3.326  13.559  1.00 0.00 ? 158 PRO A HD2  1 
ATOM 2168 H HD3  . PRO A 1 158 ? 10.461  -3.153  15.165  1.00 0.00 ? 158 PRO A HD3  1 
ATOM 2169 N N    . ASP A 1 159 ? 8.372   -2.070  10.283  1.00 0.00 ? 159 ASP A N    1 
ATOM 2170 C CA   . ASP A 1 159 ? 8.800   -2.118  8.891   1.00 0.00 ? 159 ASP A CA   1 
ATOM 2171 C C    . ASP A 1 159 ? 10.157  -1.444  8.719   1.00 0.00 ? 159 ASP A C    1 
ATOM 2172 O O    . ASP A 1 159 ? 11.003  -1.913  7.958   1.00 0.00 ? 159 ASP A O    1 
ATOM 2173 C CB   . ASP A 1 159 ? 7.763   -1.440  7.993   1.00 0.00 ? 159 ASP A CB   1 
ATOM 2174 C CG   . ASP A 1 159 ? 6.353   -1.915  8.283   1.00 0.00 ? 159 ASP A CG   1 
ATOM 2175 O OD1  . ASP A 1 159 ? 5.690   -1.312  9.153   1.00 0.00 ? 159 ASP A OD1  1 
ATOM 2176 O OD2  . ASP A 1 159 ? 5.912   -2.892  7.642   1.00 0.00 ? 159 ASP A OD2  1 
ATOM 2177 H H    . ASP A 1 159 ? 7.584   -1.539  10.524  1.00 0.00 ? 159 ASP A H    1 
ATOM 2178 H HA   . ASP A 1 159 ? 8.888   -3.156  8.606   1.00 0.00 ? 159 ASP A HA   1 
ATOM 2179 H HB2  . ASP A 1 159 ? 7.803   -0.372  8.149   1.00 0.00 ? 159 ASP A HB2  1 
ATOM 2180 H HB3  . ASP A 1 159 ? 7.991   -1.659  6.961   1.00 0.00 ? 159 ASP A HB3  1 
ATOM 2181 N N    . THR A 1 160 ? 10.356  -0.342  9.433   1.00 0.00 ? 160 THR A N    1 
ATOM 2182 C CA   . THR A 1 160 ? 11.609  0.400   9.365   1.00 0.00 ? 160 THR A CA   1 
ATOM 2183 C C    . THR A 1 160 ? 11.559  1.626   10.274  1.00 0.00 ? 160 THR A C    1 
ATOM 2184 O O    . THR A 1 160 ? 11.545  2.763   9.803   1.00 0.00 ? 160 THR A O    1 
ATOM 2185 C CB   . THR A 1 160 ? 11.899  0.823   7.921   1.00 0.00 ? 160 THR A CB   1 
ATOM 2186 O OG1  . THR A 1 160 ? 10.773  0.586   7.094   1.00 0.00 ? 160 THR A OG1  1 
ATOM 2187 C CG2  . THR A 1 160 ? 13.079  0.100   7.310   1.00 0.00 ? 160 THR A CG2  1 
ATOM 2188 H H    . THR A 1 160 ? 9.642   -0.019  10.022  1.00 0.00 ? 160 THR A H    1 
ATOM 2189 H HA   . THR A 1 160 ? 12.399  -0.253  9.706   1.00 0.00 ? 160 THR A HA   1 
ATOM 2190 H HB   . THR A 1 160 ? 12.117  1.880   7.902   1.00 0.00 ? 160 THR A HB   1 
ATOM 2191 H HG1  . THR A 1 160 ? 10.010  1.046   7.450   1.00 0.00 ? 160 THR A HG1  1 
ATOM 2192 H HG21 . THR A 1 160 ? 13.475  0.685   6.492   1.00 0.00 ? 160 THR A HG21 1 
ATOM 2193 H HG22 . THR A 1 160 ? 12.760  -0.864  6.942   1.00 0.00 ? 160 THR A HG22 1 
ATOM 2194 H HG23 . THR A 1 160 ? 13.845  -0.036  8.059   1.00 0.00 ? 160 THR A HG23 1 
ATOM 2195 N N    . ALA A 1 161 ? 11.521  1.383   11.580  1.00 0.00 ? 161 ALA A N    1 
ATOM 2196 C CA   . ALA A 1 161 ? 11.464  2.462   12.559  1.00 0.00 ? 161 ALA A CA   1 
ATOM 2197 C C    . ALA A 1 161 ? 10.138  3.209   12.470  1.00 0.00 ? 161 ALA A C    1 
ATOM 2198 O O    . ALA A 1 161 ? 9.290   3.097   13.356  1.00 0.00 ? 161 ALA A O    1 
ATOM 2199 C CB   . ALA A 1 161 ? 12.628  3.420   12.359  1.00 0.00 ? 161 ALA A CB   1 
ATOM 2200 H H    . ALA A 1 161 ? 11.529  0.454   11.894  1.00 0.00 ? 161 ALA A H    1 
ATOM 2201 H HA   . ALA A 1 161 ? 11.555  2.025   13.542  1.00 0.00 ? 161 ALA A HA   1 
ATOM 2202 H HB1  . ALA A 1 161 ? 13.558  2.875   12.421  1.00 0.00 ? 161 ALA A HB1  1 
ATOM 2203 H HB2  . ALA A 1 161 ? 12.605  4.180   13.126  1.00 0.00 ? 161 ALA A HB2  1 
ATOM 2204 H HB3  . ALA A 1 161 ? 12.548  3.887   11.388  1.00 0.00 ? 161 ALA A HB3  1 
ATOM 2205 N N    . GLU A 1 162 ? 9.964   3.967   11.393  1.00 0.00 ? 162 GLU A N    1 
ATOM 2206 C CA   . GLU A 1 162 ? 8.740   4.732   11.185  1.00 0.00 ? 162 GLU A CA   1 
ATOM 2207 C C    . GLU A 1 162 ? 8.422   4.851   9.698   1.00 0.00 ? 162 GLU A C    1 
ATOM 2208 O O    . GLU A 1 162 ? 8.095   5.931   9.207   1.00 0.00 ? 162 GLU A O    1 
ATOM 2209 C CB   . GLU A 1 162 ? 8.876   6.126   11.802  1.00 0.00 ? 162 GLU A CB   1 
ATOM 2210 C CG   . GLU A 1 162 ? 7.572   6.679   12.353  1.00 0.00 ? 162 GLU A CG   1 
ATOM 2211 C CD   . GLU A 1 162 ? 6.524   6.882   11.278  1.00 0.00 ? 162 GLU A CD   1 
ATOM 2212 O OE1  . GLU A 1 162 ? 6.121   5.883   10.646  1.00 0.00 ? 162 GLU A OE1  1 
ATOM 2213 O OE2  . GLU A 1 162 ? 6.105   8.039   11.068  1.00 0.00 ? 162 GLU A OE2  1 
ATOM 2214 H H    . GLU A 1 162 ? 10.676  4.014   10.722  1.00 0.00 ? 162 GLU A H    1 
ATOM 2215 H HA   . GLU A 1 162 ? 7.933   4.206   11.673  1.00 0.00 ? 162 GLU A HA   1 
ATOM 2216 H HB2  . GLU A 1 162 ? 9.593   6.082   12.609  1.00 0.00 ? 162 GLU A HB2  1 
ATOM 2217 H HB3  . GLU A 1 162 ? 9.239   6.807   11.047  1.00 0.00 ? 162 GLU A HB3  1 
ATOM 2218 H HG2  . GLU A 1 162 ? 7.184   5.987   13.087  1.00 0.00 ? 162 GLU A HG2  1 
ATOM 2219 H HG3  . GLU A 1 162 ? 7.770   7.630   12.825  1.00 0.00 ? 162 GLU A HG3  1 
ATOM 2220 N N    . TYR A 1 163 ? 8.525   3.733   8.986   1.00 0.00 ? 163 TYR A N    1 
ATOM 2221 C CA   . TYR A 1 163 ? 8.256   3.711   7.553   1.00 0.00 ? 163 TYR A CA   1 
ATOM 2222 C C    . TYR A 1 163 ? 7.175   2.688   7.214   1.00 0.00 ? 163 TYR A C    1 
ATOM 2223 O O    . TYR A 1 163 ? 6.927   1.754   7.977   1.00 0.00 ? 163 TYR A O    1 
ATOM 2224 C CB   . TYR A 1 163 ? 9.537   3.391   6.780   1.00 0.00 ? 163 TYR A CB   1 
ATOM 2225 C CG   . TYR A 1 163 ? 10.050  4.545   5.948   1.00 0.00 ? 163 TYR A CG   1 
ATOM 2226 C CD1  . TYR A 1 163 ? 10.920  5.484   6.489   1.00 0.00 ? 163 TYR A CD1  1 
ATOM 2227 C CD2  . TYR A 1 163 ? 9.665   4.694   4.622   1.00 0.00 ? 163 TYR A CD2  1 
ATOM 2228 C CE1  . TYR A 1 163 ? 11.391  6.540   5.730   1.00 0.00 ? 163 TYR A CE1  1 
ATOM 2229 C CE2  . TYR A 1 163 ? 10.132  5.747   3.858   1.00 0.00 ? 163 TYR A CE2  1 
ATOM 2230 C CZ   . TYR A 1 163 ? 10.994  6.666   4.416   1.00 0.00 ? 163 TYR A CZ   1 
ATOM 2231 O OH   . TYR A 1 163 ? 11.460  7.716   3.659   1.00 0.00 ? 163 TYR A OH   1 
ATOM 2232 H H    . TYR A 1 163 ? 8.793   2.903   9.434   1.00 0.00 ? 163 TYR A H    1 
ATOM 2233 H HA   . TYR A 1 163 ? 7.908   4.692   7.267   1.00 0.00 ? 163 TYR A HA   1 
ATOM 2234 H HB2  . TYR A 1 163 ? 10.313  3.117   7.481   1.00 0.00 ? 163 TYR A HB2  1 
ATOM 2235 H HB3  . TYR A 1 163 ? 9.350   2.561   6.115   1.00 0.00 ? 163 TYR A HB3  1 
ATOM 2236 H HD1  . TYR A 1 163 ? 11.230  5.382   7.518   1.00 0.00 ? 163 TYR A HD1  1 
ATOM 2237 H HD2  . TYR A 1 163 ? 8.989   3.973   4.188   1.00 0.00 ? 163 TYR A HD2  1 
ATOM 2238 H HE1  . TYR A 1 163 ? 12.067  7.260   6.168   1.00 0.00 ? 163 TYR A HE1  1 
ATOM 2239 H HE2  . TYR A 1 163 ? 9.820   5.846   2.828   1.00 0.00 ? 163 TYR A HE2  1 
ATOM 2240 H HH   . TYR A 1 163 ? 11.076  8.536   3.977   1.00 0.00 ? 163 TYR A HH   1 
ATOM 2241 N N    . VAL A 1 164 ? 6.535   2.875   6.065   1.00 0.00 ? 164 VAL A N    1 
ATOM 2242 C CA   . VAL A 1 164 ? 5.478   1.974   5.618   1.00 0.00 ? 164 VAL A CA   1 
ATOM 2243 C C    . VAL A 1 164 ? 5.636   1.658   4.131   1.00 0.00 ? 164 VAL A C    1 
ATOM 2244 O O    . VAL A 1 164 ? 5.997   2.527   3.339   1.00 0.00 ? 164 VAL A O    1 
ATOM 2245 C CB   . VAL A 1 164 ? 4.081   2.585   5.882   1.00 0.00 ? 164 VAL A CB   1 
ATOM 2246 C CG1  . VAL A 1 164 ? 2.978   1.749   5.244   1.00 0.00 ? 164 VAL A CG1  1 
ATOM 2247 C CG2  . VAL A 1 164 ? 3.843   2.731   7.377   1.00 0.00 ? 164 VAL A CG2  1 
ATOM 2248 H H    . VAL A 1 164 ? 6.779   3.639   5.503   1.00 0.00 ? 164 VAL A H    1 
ATOM 2249 H HA   . VAL A 1 164 ? 5.558   1.057   6.183   1.00 0.00 ? 164 VAL A HA   1 
ATOM 2250 H HB   . VAL A 1 164 ? 4.053   3.570   5.441   1.00 0.00 ? 164 VAL A HB   1 
ATOM 2251 H HG11 . VAL A 1 164 ? 3.398   0.833   4.857   1.00 0.00 ? 164 VAL A HG11 1 
ATOM 2252 H HG12 . VAL A 1 164 ? 2.527   2.307   4.436   1.00 0.00 ? 164 VAL A HG12 1 
ATOM 2253 H HG13 . VAL A 1 164 ? 2.228   1.518   5.984   1.00 0.00 ? 164 VAL A HG13 1 
ATOM 2254 H HG21 . VAL A 1 164 ? 3.105   2.010   7.696   1.00 0.00 ? 164 VAL A HG21 1 
ATOM 2255 H HG22 . VAL A 1 164 ? 3.488   3.728   7.589   1.00 0.00 ? 164 VAL A HG22 1 
ATOM 2256 H HG23 . VAL A 1 164 ? 4.768   2.557   7.907   1.00 0.00 ? 164 VAL A HG23 1 
ATOM 2257 N N    . ALA A 1 165 ? 5.370   0.408   3.761   1.00 0.00 ? 165 ALA A N    1 
ATOM 2258 C CA   . ALA A 1 165 ? 5.495   -0.018  2.371   1.00 0.00 ? 165 ALA A CA   1 
ATOM 2259 C C    . ALA A 1 165 ? 4.186   -0.603  1.845   1.00 0.00 ? 165 ALA A C    1 
ATOM 2260 O O    . ALA A 1 165 ? 3.413   -1.200  2.594   1.00 0.00 ? 165 ALA A O    1 
ATOM 2261 C CB   . ALA A 1 165 ? 6.623   -1.029  2.230   1.00 0.00 ? 165 ALA A CB   1 
ATOM 2262 H H    . ALA A 1 165 ? 5.096   -0.244  4.439   1.00 0.00 ? 165 ALA A H    1 
ATOM 2263 H HA   . ALA A 1 165 ? 5.751   0.850   1.781   1.00 0.00 ? 165 ALA A HA   1 
ATOM 2264 H HB1  . ALA A 1 165 ? 6.333   -1.796  1.527   1.00 0.00 ? 165 ALA A HB1  1 
ATOM 2265 H HB2  . ALA A 1 165 ? 6.826   -1.478  3.191   1.00 0.00 ? 165 ALA A HB2  1 
ATOM 2266 H HB3  . ALA A 1 165 ? 7.511   -0.529  1.872   1.00 0.00 ? 165 ALA A HB3  1 
ATOM 2267 N N    . TYR A 1 166 ? 3.950   -0.427  0.548   1.00 0.00 ? 166 TYR A N    1 
ATOM 2268 C CA   . TYR A 1 166 ? 2.742   -0.934  -0.093  1.00 0.00 ? 166 TYR A CA   1 
ATOM 2269 C C    . TYR A 1 166 ? 3.093   -1.870  -1.247  1.00 0.00 ? 166 TYR A C    1 
ATOM 2270 O O    . TYR A 1 166 ? 4.148   -1.737  -1.867  1.00 0.00 ? 166 TYR A O    1 
ATOM 2271 C CB   . TYR A 1 166 ? 1.891   0.228   -0.610  1.00 0.00 ? 166 TYR A CB   1 
ATOM 2272 C CG   . TYR A 1 166 ? 0.570   0.379   0.107   1.00 0.00 ? 166 TYR A CG   1 
ATOM 2273 C CD1  . TYR A 1 166 ? 0.519   0.504   1.489   1.00 0.00 ? 166 TYR A CD1  1 
ATOM 2274 C CD2  . TYR A 1 166 ? -0.627  0.400   -0.599  1.00 0.00 ? 166 TYR A CD2  1 
ATOM 2275 C CE1  . TYR A 1 166 ? -0.687  0.644   2.149   1.00 0.00 ? 166 TYR A CE1  1 
ATOM 2276 C CE2  . TYR A 1 166 ? -1.837  0.540   0.054   1.00 0.00 ? 166 TYR A CE2  1 
ATOM 2277 C CZ   . TYR A 1 166 ? -1.862  0.661   1.427   1.00 0.00 ? 166 TYR A CZ   1 
ATOM 2278 O OH   . TYR A 1 166 ? -3.064  0.800   2.082   1.00 0.00 ? 166 TYR A OH   1 
ATOM 2279 H H    . TYR A 1 166 ? 4.608   0.057   0.007   1.00 0.00 ? 166 TYR A H    1 
ATOM 2280 H HA   . TYR A 1 166 ? 2.179   -1.485  0.646   1.00 0.00 ? 166 TYR A HA   1 
ATOM 2281 H HB2  . TYR A 1 166 ? 2.442   1.149   -0.488  1.00 0.00 ? 166 TYR A HB2  1 
ATOM 2282 H HB3  . TYR A 1 166 ? 1.684   0.075   -1.659  1.00 0.00 ? 166 TYR A HB3  1 
ATOM 2283 H HD1  . TYR A 1 166 ? 1.440   0.490   2.052   1.00 0.00 ? 166 TYR A HD1  1 
ATOM 2284 H HD2  . TYR A 1 166 ? -0.604  0.305   -1.674  1.00 0.00 ? 166 TYR A HD2  1 
ATOM 2285 H HE1  . TYR A 1 166 ? -0.706  0.737   3.224   1.00 0.00 ? 166 TYR A HE1  1 
ATOM 2286 H HE2  . TYR A 1 166 ? -2.757  0.553   -0.512  1.00 0.00 ? 166 TYR A HE2  1 
ATOM 2287 H HH   . TYR A 1 166 ? -3.758  0.378   1.570   1.00 0.00 ? 166 TYR A HH   1 
ATOM 2288 N N    . VAL A 1 167 ? 2.195   -2.803  -1.544  1.00 0.00 ? 167 VAL A N    1 
ATOM 2289 C CA   . VAL A 1 167 ? 2.421   -3.761  -2.620  1.00 0.00 ? 167 VAL A CA   1 
ATOM 2290 C C    . VAL A 1 167 ? 1.768   -3.298  -3.918  1.00 0.00 ? 167 VAL A C    1 
ATOM 2291 O O    . VAL A 1 167 ? 0.714   -2.661  -3.904  1.00 0.00 ? 167 VAL A O    1 
ATOM 2292 C CB   . VAL A 1 167 ? 1.880   -5.156  -2.254  1.00 0.00 ? 167 VAL A CB   1 
ATOM 2293 C CG1  . VAL A 1 167 ? 0.370   -5.111  -2.073  1.00 0.00 ? 167 VAL A CG1  1 
ATOM 2294 C CG2  . VAL A 1 167 ? 2.268   -6.176  -3.314  1.00 0.00 ? 167 VAL A CG2  1 
ATOM 2295 H H    . VAL A 1 167 ? 1.373   -2.863  -1.015  1.00 0.00 ? 167 VAL A H    1 
ATOM 2296 H HA   . VAL A 1 167 ? 3.487   -3.844  -2.775  1.00 0.00 ? 167 VAL A HA   1 
ATOM 2297 H HB   . VAL A 1 167 ? 2.324   -5.457  -1.318  1.00 0.00 ? 167 VAL A HB   1 
ATOM 2298 H HG11 . VAL A 1 167 ? -0.096  -4.828  -3.005  1.00 0.00 ? 167 VAL A HG11 1 
ATOM 2299 H HG12 . VAL A 1 167 ? 0.121   -4.388  -1.311  1.00 0.00 ? 167 VAL A HG12 1 
ATOM 2300 H HG13 . VAL A 1 167 ? 0.015   -6.086  -1.774  1.00 0.00 ? 167 VAL A HG13 1 
ATOM 2301 H HG21 . VAL A 1 167 ? 3.334   -6.133  -3.481  1.00 0.00 ? 167 VAL A HG21 1 
ATOM 2302 H HG22 . VAL A 1 167 ? 1.750   -5.954  -4.235  1.00 0.00 ? 167 VAL A HG22 1 
ATOM 2303 H HG23 . VAL A 1 167 ? 1.996   -7.166  -2.978  1.00 0.00 ? 167 VAL A HG23 1 
ATOM 2304 N N    . ALA A 1 168 ? 2.405   -3.619  -5.040  1.00 0.00 ? 168 ALA A N    1 
ATOM 2305 C CA   . ALA A 1 168 ? 1.892   -3.235  -6.350  1.00 0.00 ? 168 ALA A CA   1 
ATOM 2306 C C    . ALA A 1 168 ? 2.060   -4.368  -7.357  1.00 0.00 ? 168 ALA A C    1 
ATOM 2307 O O    . ALA A 1 168 ? 3.169   -4.648  -7.813  1.00 0.00 ? 168 ALA A O    1 
ATOM 2308 C CB   . ALA A 1 168 ? 2.593   -1.978  -6.843  1.00 0.00 ? 168 ALA A CB   1 
ATOM 2309 H H    . ALA A 1 168 ? 3.241   -4.127  -4.985  1.00 0.00 ? 168 ALA A H    1 
ATOM 2310 H HA   . ALA A 1 168 ? 0.841   -3.013  -6.244  1.00 0.00 ? 168 ALA A HA   1 
ATOM 2311 H HB1  . ALA A 1 168 ? 2.770   -2.058  -7.905  1.00 0.00 ? 168 ALA A HB1  1 
ATOM 2312 H HB2  . ALA A 1 168 ? 3.536   -1.866  -6.328  1.00 0.00 ? 168 ALA A HB2  1 
ATOM 2313 H HB3  . ALA A 1 168 ? 1.970   -1.118  -6.646  1.00 0.00 ? 168 ALA A HB3  1 
ATOM 2314 N N    . LYS A 1 169 ? 0.952   -5.016  -7.700  1.00 0.00 ? 169 LYS A N    1 
ATOM 2315 C CA   . LYS A 1 169 ? 0.975   -6.120  -8.651  1.00 0.00 ? 169 LYS A CA   1 
ATOM 2316 C C    . LYS A 1 169 ? 0.895   -5.609  -10.085 1.00 0.00 ? 169 LYS A C    1 
ATOM 2317 O O    . LYS A 1 169 ? -0.189  -5.324  -10.594 1.00 0.00 ? 169 LYS A O    1 
ATOM 2318 C CB   . LYS A 1 169 ? -0.185  -7.079  -8.375  1.00 0.00 ? 169 LYS A CB   1 
ATOM 2319 C CG   . LYS A 1 169 ? -0.164  -7.668  -6.974  1.00 0.00 ? 169 LYS A CG   1 
ATOM 2320 C CD   . LYS A 1 169 ? -1.412  -8.489  -6.697  1.00 0.00 ? 169 LYS A CD   1 
ATOM 2321 C CE   . LYS A 1 169 ? -1.189  -9.474  -5.561  1.00 0.00 ? 169 LYS A CE   1 
ATOM 2322 N NZ   . LYS A 1 169 ? -1.485  -10.874 -5.972  1.00 0.00 ? 169 LYS A NZ   1 
ATOM 2323 H H    . LYS A 1 169 ? 0.098   -4.747  -7.301  1.00 0.00 ? 169 LYS A H    1 
ATOM 2324 H HA   . LYS A 1 169 ? 1.908   -6.650  -8.521  1.00 0.00 ? 169 LYS A HA   1 
ATOM 2325 H HB2  . LYS A 1 169 ? -1.115  -6.546  -8.505  1.00 0.00 ? 169 LYS A HB2  1 
ATOM 2326 H HB3  . LYS A 1 169 ? -0.143  -7.891  -9.085  1.00 0.00 ? 169 LYS A HB3  1 
ATOM 2327 H HG2  . LYS A 1 169 ? 0.703   -8.305  -6.875  1.00 0.00 ? 169 LYS A HG2  1 
ATOM 2328 H HG3  . LYS A 1 169 ? -0.107  -6.864  -6.256  1.00 0.00 ? 169 LYS A HG3  1 
ATOM 2329 H HD2  . LYS A 1 169 ? -2.219  -7.822  -6.430  1.00 0.00 ? 169 LYS A HD2  1 
ATOM 2330 H HD3  . LYS A 1 169 ? -1.676  -9.038  -7.589  1.00 0.00 ? 169 LYS A HD3  1 
ATOM 2331 H HE2  . LYS A 1 169 ? -0.158  -9.411  -5.245  1.00 0.00 ? 169 LYS A HE2  1 
ATOM 2332 H HE3  . LYS A 1 169 ? -1.834  -9.206  -4.737  1.00 0.00 ? 169 LYS A HE3  1 
ATOM 2333 H HZ1  . LYS A 1 169 ? -2.210  -10.882 -6.718  1.00 0.00 ? 169 LYS A HZ1  1 
ATOM 2334 H HZ2  . LYS A 1 169 ? -1.834  -11.419 -5.159  1.00 0.00 ? 169 LYS A HZ2  1 
ATOM 2335 H HZ3  . LYS A 1 169 ? -0.623  -11.329 -6.337  1.00 0.00 ? 169 LYS A HZ3  1 
ATOM 2336 N N    . ASP A 1 170 ? 2.050   -5.497  -10.732 1.00 0.00 ? 170 ASP A N    1 
ATOM 2337 C CA   . ASP A 1 170 ? 2.114   -5.021  -12.109 1.00 0.00 ? 170 ASP A CA   1 
ATOM 2338 C C    . ASP A 1 170 ? 3.552   -5.044  -12.626 1.00 0.00 ? 170 ASP A C    1 
ATOM 2339 O O    . ASP A 1 170 ? 4.313   -4.105  -12.391 1.00 0.00 ? 170 ASP A O    1 
ATOM 2340 C CB   . ASP A 1 170 ? 1.550   -3.602  -12.204 1.00 0.00 ? 170 ASP A CB   1 
ATOM 2341 C CG   . ASP A 1 170 ? 2.176   -2.663  -11.191 1.00 0.00 ? 170 ASP A CG   1 
ATOM 2342 O OD1  . ASP A 1 170 ? 2.054   -2.932  -9.978  1.00 0.00 ? 170 ASP A OD1  1 
ATOM 2343 O OD2  . ASP A 1 170 ? 2.790   -1.660  -11.612 1.00 0.00 ? 170 ASP A OD2  1 
ATOM 2344 H H    . ASP A 1 170 ? 2.881   -5.740  -10.273 1.00 0.00 ? 170 ASP A H    1 
ATOM 2345 H HA   . ASP A 1 170 ? 1.511   -5.679  -12.716 1.00 0.00 ? 170 ASP A HA   1 
ATOM 2346 H HB2  . ASP A 1 170 ? 1.739   -3.212  -13.193 1.00 0.00 ? 170 ASP A HB2  1 
ATOM 2347 H HB3  . ASP A 1 170 ? 0.485   -3.631  -12.030 1.00 0.00 ? 170 ASP A HB3  1 
ATOM 2348 N N    . PRO A 1 171 ? 3.956   -6.120  -13.333 1.00 0.00 ? 171 PRO A N    1 
ATOM 2349 C CA   . PRO A 1 171 ? 3.085   -7.266  -13.642 1.00 0.00 ? 171 PRO A CA   1 
ATOM 2350 C C    . PRO A 1 171 ? 2.553   -7.947  -12.385 1.00 0.00 ? 171 PRO A C    1 
ATOM 2351 O O    . PRO A 1 171 ? 3.071   -7.742  -11.288 1.00 0.00 ? 171 PRO A O    1 
ATOM 2352 C CB   . PRO A 1 171 ? 4.000   -8.220  -14.417 1.00 0.00 ? 171 PRO A CB   1 
ATOM 2353 C CG   . PRO A 1 171 ? 5.105   -7.363  -14.930 1.00 0.00 ? 171 PRO A CG   1 
ATOM 2354 C CD   . PRO A 1 171 ? 5.303   -6.291  -13.898 1.00 0.00 ? 171 PRO A CD   1 
ATOM 2355 H HA   . PRO A 1 171 ? 2.256   -6.973  -14.268 1.00 0.00 ? 171 PRO A HA   1 
ATOM 2356 H HB2  . PRO A 1 171 ? 4.371   -8.986  -13.752 1.00 0.00 ? 171 PRO A HB2  1 
ATOM 2357 H HB3  . PRO A 1 171 ? 3.447   -8.676  -15.225 1.00 0.00 ? 171 PRO A HB3  1 
ATOM 2358 H HG2  . PRO A 1 171 ? 6.005   -7.949  -15.040 1.00 0.00 ? 171 PRO A HG2  1 
ATOM 2359 H HG3  . PRO A 1 171 ? 4.822   -6.925  -15.876 1.00 0.00 ? 171 PRO A HG3  1 
ATOM 2360 H HD2  . PRO A 1 171 ? 6.001   -6.618  -13.141 1.00 0.00 ? 171 PRO A HD2  1 
ATOM 2361 H HD3  . PRO A 1 171 ? 5.646   -5.378  -14.362 1.00 0.00 ? 171 PRO A HD3  1 
ATOM 2362 N N    . VAL A 1 172 ? 1.517   -8.762  -12.557 1.00 0.00 ? 172 VAL A N    1 
ATOM 2363 C CA   . VAL A 1 172 ? 0.912   -9.481  -11.440 1.00 0.00 ? 172 VAL A CA   1 
ATOM 2364 C C    . VAL A 1 172 ? 1.877   -10.522 -10.878 1.00 0.00 ? 172 VAL A C    1 
ATOM 2365 O O    . VAL A 1 172 ? 2.899   -10.829 -11.492 1.00 0.00 ? 172 VAL A O    1 
ATOM 2366 C CB   . VAL A 1 172 ? -0.396  -10.184 -11.864 1.00 0.00 ? 172 VAL A CB   1 
ATOM 2367 C CG1  . VAL A 1 172 ? -1.256  -10.498 -10.649 1.00 0.00 ? 172 VAL A CG1  1 
ATOM 2368 C CG2  . VAL A 1 172 ? -1.167  -9.332  -12.863 1.00 0.00 ? 172 VAL A CG2  1 
ATOM 2369 H H    . VAL A 1 172 ? 1.152   -8.885  -13.457 1.00 0.00 ? 172 VAL A H    1 
ATOM 2370 H HA   . VAL A 1 172 ? 0.677   -8.765  -10.667 1.00 0.00 ? 172 VAL A HA   1 
ATOM 2371 H HB   . VAL A 1 172 ? -0.140  -11.116 -12.344 1.00 0.00 ? 172 VAL A HB   1 
ATOM 2372 H HG11 . VAL A 1 172 ? -1.093  -11.522 -10.348 1.00 0.00 ? 172 VAL A HG11 1 
ATOM 2373 H HG12 . VAL A 1 172 ? -2.297  -10.357 -10.900 1.00 0.00 ? 172 VAL A HG12 1 
ATOM 2374 H HG13 . VAL A 1 172 ? -0.989  -9.837  -9.838  1.00 0.00 ? 172 VAL A HG13 1 
ATOM 2375 H HG21 . VAL A 1 172 ? -0.735  -8.343  -12.903 1.00 0.00 ? 172 VAL A HG21 1 
ATOM 2376 H HG22 . VAL A 1 172 ? -2.200  -9.261  -12.554 1.00 0.00 ? 172 VAL A HG22 1 
ATOM 2377 H HG23 . VAL A 1 172 ? -1.114  -9.788  -13.840 1.00 0.00 ? 172 VAL A HG23 1 
ATOM 2378 N N    . ASN A 1 173 ? 1.541   -11.072 -9.711  1.00 0.00 ? 173 ASN A N    1 
ATOM 2379 C CA   . ASN A 1 173 ? 2.377   -12.083 -9.062  1.00 0.00 ? 173 ASN A CA   1 
ATOM 2380 C C    . ASN A 1 173 ? 3.569   -11.439 -8.361  1.00 0.00 ? 173 ASN A C    1 
ATOM 2381 O O    . ASN A 1 173 ? 4.708   -11.875 -8.524  1.00 0.00 ? 173 ASN A O    1 
ATOM 2382 C CB   . ASN A 1 173 ? 2.866   -13.121 -10.079 1.00 0.00 ? 173 ASN A CB   1 
ATOM 2383 C CG   . ASN A 1 173 ? 2.951   -14.515 -9.490  1.00 0.00 ? 173 ASN A CG   1 
ATOM 2384 O OD1  . ASN A 1 173 ? 3.764   -14.779 -8.604  1.00 0.00 ? 173 ASN A OD1  1 
ATOM 2385 N ND2  . ASN A 1 173 ? 2.109   -15.417 -9.981  1.00 0.00 ? 173 ASN A ND2  1 
ATOM 2386 H H    . ASN A 1 173 ? 0.716   -10.785 -9.269  1.00 0.00 ? 173 ASN A H    1 
ATOM 2387 H HA   . ASN A 1 173 ? 1.770   -12.582 -8.321  1.00 0.00 ? 173 ASN A HA   1 
ATOM 2388 H HB2  . ASN A 1 173 ? 2.183   -13.146 -10.915 1.00 0.00 ? 173 ASN A HB2  1 
ATOM 2389 H HB3  . ASN A 1 173 ? 3.847   -12.838 -10.429 1.00 0.00 ? 173 ASN A HB3  1 
ATOM 2390 H HD21 . ASN A 1 173 ? 1.489   -15.136 -10.686 1.00 0.00 ? 173 ASN A HD21 1 
ATOM 2391 H HD22 . ASN A 1 173 ? 2.142   -16.327 -9.619  1.00 0.00 ? 173 ASN A HD22 1 
ATOM 2392 N N    . GLN A 1 174 ? 3.294   -10.406 -7.570  1.00 0.00 ? 174 GLN A N    1 
ATOM 2393 C CA   . GLN A 1 174 ? 4.340   -9.706  -6.833  1.00 0.00 ? 174 GLN A CA   1 
ATOM 2394 C C    . GLN A 1 174 ? 5.464   -9.262  -7.763  1.00 0.00 ? 174 GLN A C    1 
ATOM 2395 O O    . GLN A 1 174 ? 6.296   -10.069 -8.177  1.00 0.00 ? 174 GLN A O    1 
ATOM 2396 C CB   . GLN A 1 174 ? 4.901   -10.605 -5.729  1.00 0.00 ? 174 GLN A CB   1 
ATOM 2397 C CG   . GLN A 1 174 ? 3.829   -11.233 -4.852  1.00 0.00 ? 174 GLN A CG   1 
ATOM 2398 C CD   . GLN A 1 174 ? 4.350   -11.633 -3.486  1.00 0.00 ? 174 GLN A CD   1 
ATOM 2399 O OE1  . GLN A 1 174 ? 5.198   -10.953 -2.909  1.00 0.00 ? 174 GLN A OE1  1 
ATOM 2400 N NE2  . GLN A 1 174 ? 3.844   -12.743 -2.961  1.00 0.00 ? 174 GLN A NE2  1 
ATOM 2401 H H    . GLN A 1 174 ? 2.365   -10.109 -7.479  1.00 0.00 ? 174 GLN A H    1 
ATOM 2402 H HA   . GLN A 1 174 ? 3.896   -8.831  -6.382  1.00 0.00 ? 174 GLN A HA   1 
ATOM 2403 H HB2  . GLN A 1 174 ? 5.474   -11.399 -6.184  1.00 0.00 ? 174 GLN A HB2  1 
ATOM 2404 H HB3  . GLN A 1 174 ? 5.552   -10.018 -5.098  1.00 0.00 ? 174 GLN A HB3  1 
ATOM 2405 H HG2  . GLN A 1 174 ? 3.027   -10.521 -4.720  1.00 0.00 ? 174 GLN A HG2  1 
ATOM 2406 H HG3  . GLN A 1 174 ? 3.448   -12.115 -5.347  1.00 0.00 ? 174 GLN A HG3  1 
ATOM 2407 H HE21 . GLN A 1 174 ? 3.172   -13.235 -3.478  1.00 0.00 ? 174 GLN A HE21 1 
ATOM 2408 H HE22 . GLN A 1 174 ? 4.163   -13.025 -2.079  1.00 0.00 ? 174 GLN A HE22 1 
ATOM 2409 N N    . ARG A 1 175 ? 5.484   -7.972  -8.085  1.00 0.00 ? 175 ARG A N    1 
ATOM 2410 C CA   . ARG A 1 175 ? 6.508   -7.421  -8.965  1.00 0.00 ? 175 ARG A CA   1 
ATOM 2411 C C    . ARG A 1 175 ? 7.090   -6.134  -8.389  1.00 0.00 ? 175 ARG A C    1 
ATOM 2412 O O    . ARG A 1 175 ? 8.285   -6.055  -8.105  1.00 0.00 ? 175 ARG A O    1 
ATOM 2413 C CB   . ARG A 1 175 ? 5.927   -7.156  -10.354 1.00 0.00 ? 175 ARG A CB   1 
ATOM 2414 C CG   . ARG A 1 175 ? 6.155   -8.295  -11.335 1.00 0.00 ? 175 ARG A CG   1 
ATOM 2415 C CD   . ARG A 1 175 ? 7.568   -8.273  -11.895 1.00 0.00 ? 175 ARG A CD   1 
ATOM 2416 N NE   . ARG A 1 175 ? 8.475   -9.125  -11.131 1.00 0.00 ? 175 ARG A NE   1 
ATOM 2417 C CZ   . ARG A 1 175 ? 8.403   -10.452 -11.120 1.00 0.00 ? 175 ARG A CZ   1 
ATOM 2418 N NH1  . ARG A 1 175 ? 7.467   -11.074 -11.824 1.00 0.00 ? 175 ARG A NH1  1 
ATOM 2419 N NH2  . ARG A 1 175 ? 9.266   -11.159 -10.402 1.00 0.00 ? 175 ARG A NH2  1 
ATOM 2420 H H    . ARG A 1 175 ? 4.794   -7.378  -7.723  1.00 0.00 ? 175 ARG A H    1 
ATOM 2421 H HA   . ARG A 1 175 ? 7.299   -8.152  -9.049  1.00 0.00 ? 175 ARG A HA   1 
ATOM 2422 H HB2  . ARG A 1 175 ? 4.862   -6.996  -10.263 1.00 0.00 ? 175 ARG A HB2  1 
ATOM 2423 H HB3  . ARG A 1 175 ? 6.383   -6.264  -10.759 1.00 0.00 ? 175 ARG A HB3  1 
ATOM 2424 H HG2  . ARG A 1 175 ? 5.996   -9.233  -10.825 1.00 0.00 ? 175 ARG A HG2  1 
ATOM 2425 H HG3  . ARG A 1 175 ? 5.454   -8.202  -12.150 1.00 0.00 ? 175 ARG A HG3  1 
ATOM 2426 H HD2  . ARG A 1 175 ? 7.542   -8.618  -12.917 1.00 0.00 ? 175 ARG A HD2  1 
ATOM 2427 H HD3  . ARG A 1 175 ? 7.937   -7.258  -11.867 1.00 0.00 ? 175 ARG A HD3  1 
ATOM 2428 H HE   . ARG A 1 175 ? 9.175   -8.687  -10.604 1.00 0.00 ? 175 ARG A HE   1 
ATOM 2429 H HH11 . ARG A 1 175 ? 6.815   -10.544 -12.367 1.00 0.00 ? 175 ARG A HH11 1 
ATOM 2430 H HH12 . ARG A 1 175 ? 7.414   -12.072 -11.814 1.00 0.00 ? 175 ARG A HH12 1 
ATOM 2431 H HH21 . ARG A 1 175 ? 9.973   -10.694 -9.870  1.00 0.00 ? 175 ARG A HH21 1 
ATOM 2432 H HH22 . ARG A 1 175 ? 9.209   -12.158 -10.394 1.00 0.00 ? 175 ARG A HH22 1 
ATOM 2433 N N    . ALA A 1 176 ? 6.239   -5.127  -8.221  1.00 0.00 ? 176 ALA A N    1 
ATOM 2434 C CA   . ALA A 1 176 ? 6.672   -3.844  -7.681  1.00 0.00 ? 176 ALA A CA   1 
ATOM 2435 C C    . ALA A 1 176 ? 6.054   -3.586  -6.312  1.00 0.00 ? 176 ALA A C    1 
ATOM 2436 O O    . ALA A 1 176 ? 4.993   -4.120  -5.988  1.00 0.00 ? 176 ALA A O    1 
ATOM 2437 C CB   . ALA A 1 176 ? 6.318   -2.719  -8.642  1.00 0.00 ? 176 ALA A CB   1 
ATOM 2438 H H    . ALA A 1 176 ? 5.298   -5.249  -8.467  1.00 0.00 ? 176 ALA A H    1 
ATOM 2439 H HA   . ALA A 1 176 ? 7.747   -3.871  -7.580  1.00 0.00 ? 176 ALA A HA   1 
ATOM 2440 H HB1  . ALA A 1 176 ? 6.662   -1.779  -8.237  1.00 0.00 ? 176 ALA A HB1  1 
ATOM 2441 H HB2  . ALA A 1 176 ? 5.247   -2.684  -8.775  1.00 0.00 ? 176 ALA A HB2  1 
ATOM 2442 H HB3  . ALA A 1 176 ? 6.794   -2.896  -9.595  1.00 0.00 ? 176 ALA A HB3  1 
ATOM 2443 N N    . CYS A 1 177 ? 6.723   -2.762  -5.513  1.00 0.00 ? 177 CYS A N    1 
ATOM 2444 C CA   . CYS A 1 177 ? 6.238   -2.428  -4.179  1.00 0.00 ? 177 CYS A CA   1 
ATOM 2445 C C    . CYS A 1 177 ? 6.373   -0.933  -3.912  1.00 0.00 ? 177 CYS A C    1 
ATOM 2446 O O    . CYS A 1 177 ? 7.478   -0.420  -3.749  1.00 0.00 ? 177 CYS A O    1 
ATOM 2447 C CB   . CYS A 1 177 ? 7.011   -3.216  -3.120  1.00 0.00 ? 177 CYS A CB   1 
ATOM 2448 S SG   . CYS A 1 177 ? 6.171   -4.714  -2.555  1.00 0.00 ? 177 CYS A SG   1 
ATOM 2449 H H    . CYS A 1 177 ? 7.563   -2.366  -5.829  1.00 0.00 ? 177 CYS A H    1 
ATOM 2450 H HA   . CYS A 1 177 ? 5.194   -2.698  -4.129  1.00 0.00 ? 177 CYS A HA   1 
ATOM 2451 H HB2  . CYS A 1 177 ? 7.968   -3.510  -3.527  1.00 0.00 ? 177 CYS A HB2  1 
ATOM 2452 H HB3  . CYS A 1 177 ? 7.171   -2.585  -2.258  1.00 0.00 ? 177 CYS A HB3  1 
ATOM 2453 H HG   . CYS A 1 177 ? 5.792   -5.148  -3.323  1.00 0.00 ? 177 CYS A HG   1 
ATOM 2454 N N    . HIS A 1 178 ? 5.243   -0.237  -3.881  1.00 0.00 ? 178 HIS A N    1 
ATOM 2455 C CA   . HIS A 1 178 ? 5.240   1.197   -3.620  1.00 0.00 ? 178 HIS A CA   1 
ATOM 2456 C C    . HIS A 1 178 ? 5.683   1.479   -2.192  1.00 0.00 ? 178 HIS A C    1 
ATOM 2457 O O    . HIS A 1 178 ? 5.696   0.581   -1.351  1.00 0.00 ? 178 HIS A O    1 
ATOM 2458 C CB   . HIS A 1 178 ? 3.845   1.779   -3.860  1.00 0.00 ? 178 HIS A CB   1 
ATOM 2459 C CG   . HIS A 1 178 ? 3.336   1.559   -5.250  1.00 0.00 ? 178 HIS A CG   1 
ATOM 2460 N ND1  . HIS A 1 178 ? 2.195   2.161   -5.739  1.00 0.00 ? 178 HIS A ND1  1 
ATOM 2461 C CD2  . HIS A 1 178 ? 3.818   0.796   -6.260  1.00 0.00 ? 178 HIS A CD2  1 
ATOM 2462 C CE1  . HIS A 1 178 ? 1.998   1.779   -6.988  1.00 0.00 ? 178 HIS A CE1  1 
ATOM 2463 N NE2  . HIS A 1 178 ? 2.969   0.951   -7.327  1.00 0.00 ? 178 HIS A NE2  1 
ATOM 2464 H H    . HIS A 1 178 ? 4.389   -0.705  -3.998  1.00 0.00 ? 178 HIS A H    1 
ATOM 2465 H HA   . HIS A 1 178 ? 5.939   1.662   -4.300  1.00 0.00 ? 178 HIS A HA   1 
ATOM 2466 H HB2  . HIS A 1 178 ? 3.148   1.320   -3.175  1.00 0.00 ? 178 HIS A HB2  1 
ATOM 2467 H HB3  . HIS A 1 178 ? 3.871   2.844   -3.681  1.00 0.00 ? 178 HIS A HB3  1 
ATOM 2468 H HD1  . HIS A 1 178 ? 1.616   2.778   -5.244  1.00 0.00 ? 178 HIS A HD1  1 
ATOM 2469 H HD2  . HIS A 1 178 ? 4.706   0.180   -6.231  1.00 0.00 ? 178 HIS A HD2  1 
ATOM 2470 H HE1  . HIS A 1 178 ? 1.183   2.091   -7.624  1.00 0.00 ? 178 HIS A HE1  1 
ATOM 2471 H HE2  . HIS A 1 178 ? 3.065   0.518   -8.201  1.00 0.00 ? 178 HIS A HE2  1 
ATOM 2472 N N    . ILE A 1 179 ? 6.055   2.723   -1.920  1.00 0.00 ? 179 ILE A N    1 
ATOM 2473 C CA   . ILE A 1 179 ? 6.489   3.105   -0.584  1.00 0.00 ? 179 ILE A CA   1 
ATOM 2474 C C    . ILE A 1 179 ? 5.645   4.257   -0.051  1.00 0.00 ? 179 ILE A C    1 
ATOM 2475 O O    . ILE A 1 179 ? 5.143   5.075   -0.819  1.00 0.00 ? 179 ILE A O    1 
ATOM 2476 C CB   . ILE A 1 179 ? 7.977   3.505   -0.566  1.00 0.00 ? 179 ILE A CB   1 
ATOM 2477 C CG1  . ILE A 1 179 ? 8.837   2.382   -1.150  1.00 0.00 ? 179 ILE A CG1  1 
ATOM 2478 C CG2  . ILE A 1 179 ? 8.421   3.833   0.852   1.00 0.00 ? 179 ILE A CG2  1 
ATOM 2479 C CD1  . ILE A 1 179 ? 8.822   1.114   -0.324  1.00 0.00 ? 179 ILE A CD1  1 
ATOM 2480 H H    . ILE A 1 179 ? 6.025   3.403   -2.629  1.00 0.00 ? 179 ILE A H    1 
ATOM 2481 H HA   . ILE A 1 179 ? 6.363   2.250   0.063   1.00 0.00 ? 179 ILE A HA   1 
ATOM 2482 H HB   . ILE A 1 179 ? 8.097   4.392   -1.170  1.00 0.00 ? 179 ILE A HB   1 
ATOM 2483 H HG12 . ILE A 1 179 ? 8.476   2.138   -2.138  1.00 0.00 ? 179 ILE A HG12 1 
ATOM 2484 H HG13 . ILE A 1 179 ? 9.860   2.720   -1.220  1.00 0.00 ? 179 ILE A HG13 1 
ATOM 2485 H HG21 . ILE A 1 179 ? 9.417   4.249   0.830   1.00 0.00 ? 179 ILE A HG21 1 
ATOM 2486 H HG22 . ILE A 1 179 ? 8.421   2.930   1.446   1.00 0.00 ? 179 ILE A HG22 1 
ATOM 2487 H HG23 . ILE A 1 179 ? 7.740   4.549   1.287   1.00 0.00 ? 179 ILE A HG23 1 
ATOM 2488 H HD11 . ILE A 1 179 ? 9.672   1.109   0.342   1.00 0.00 ? 179 ILE A HD11 1 
ATOM 2489 H HD12 . ILE A 1 179 ? 8.872   0.257   -0.979  1.00 0.00 ? 179 ILE A HD12 1 
ATOM 2490 H HD13 . ILE A 1 179 ? 7.911   1.073   0.255   1.00 0.00 ? 179 ILE A HD13 1 
ATOM 2491 N N    . LEU A 1 180 ? 5.468   4.297   1.265   1.00 0.00 ? 180 LEU A N    1 
ATOM 2492 C CA   . LEU A 1 180 ? 4.677   5.347   1.898   1.00 0.00 ? 180 LEU A CA   1 
ATOM 2493 C C    . LEU A 1 180 ? 5.267   5.734   3.249   1.00 0.00 ? 180 LEU A C    1 
ATOM 2494 O O    . LEU A 1 180 ? 6.107   5.021   3.799   1.00 0.00 ? 180 LEU A O    1 
ATOM 2495 C CB   . LEU A 1 180 ? 3.227   4.891   2.077   1.00 0.00 ? 180 LEU A CB   1 
ATOM 2496 C CG   . LEU A 1 180 ? 2.180   6.000   1.951   1.00 0.00 ? 180 LEU A CG   1 
ATOM 2497 C CD1  . LEU A 1 180 ? 1.576   6.009   0.555   1.00 0.00 ? 180 LEU A CD1  1 
ATOM 2498 C CD2  . LEU A 1 180 ? 1.095   5.827   3.003   1.00 0.00 ? 180 LEU A CD2  1 
ATOM 2499 H H    . LEU A 1 180 ? 5.889   3.613   1.826   1.00 0.00 ? 180 LEU A H    1 
ATOM 2500 H HA   . LEU A 1 180 ? 4.697   6.211   1.250   1.00 0.00 ? 180 LEU A HA   1 
ATOM 2501 H HB2  . LEU A 1 180 ? 3.013   4.137   1.334   1.00 0.00 ? 180 LEU A HB2  1 
ATOM 2502 H HB3  . LEU A 1 180 ? 3.129   4.446   3.056   1.00 0.00 ? 180 LEU A HB3  1 
ATOM 2503 H HG   . LEU A 1 180 ? 2.655   6.955   2.116   1.00 0.00 ? 180 LEU A HG   1 
ATOM 2504 H HD11 . LEU A 1 180 ? 0.511   5.849   0.623   1.00 0.00 ? 180 LEU A HD11 1 
ATOM 2505 H HD12 . LEU A 1 180 ? 2.022   5.222   -0.035  1.00 0.00 ? 180 LEU A HD12 1 
ATOM 2506 H HD13 . LEU A 1 180 ? 1.768   6.963   0.086   1.00 0.00 ? 180 LEU A HD13 1 
ATOM 2507 H HD21 . LEU A 1 180 ? 0.846   4.780   3.095   1.00 0.00 ? 180 LEU A HD21 1 
ATOM 2508 H HD22 . LEU A 1 180 ? 0.216   6.381   2.707   1.00 0.00 ? 180 LEU A HD22 1 
ATOM 2509 H HD23 . LEU A 1 180 ? 1.452   6.197   3.952   1.00 0.00 ? 180 LEU A HD23 1 
ATOM 2510 N N    . GLU A 1 181 ? 4.820   6.867   3.779   1.00 0.00 ? 181 GLU A N    1 
ATOM 2511 C CA   . GLU A 1 181 ? 5.300   7.352   5.068   1.00 0.00 ? 181 GLU A CA   1 
ATOM 2512 C C    . GLU A 1 181 ? 4.241   8.204   5.758   1.00 0.00 ? 181 GLU A C    1 
ATOM 2513 O O    . GLU A 1 181 ? 3.899   9.289   5.287   1.00 0.00 ? 181 GLU A O    1 
ATOM 2514 C CB   . GLU A 1 181 ? 6.584   8.164   4.884   1.00 0.00 ? 181 GLU A CB   1 
ATOM 2515 C CG   . GLU A 1 181 ? 7.224   8.598   6.193   1.00 0.00 ? 181 GLU A CG   1 
ATOM 2516 C CD   . GLU A 1 181 ? 8.310   9.637   5.996   1.00 0.00 ? 181 GLU A CD   1 
ATOM 2517 O OE1  . GLU A 1 181 ? 9.368   9.290   5.430   1.00 0.00 ? 181 GLU A OE1  1 
ATOM 2518 O OE2  . GLU A 1 181 ? 8.103   10.797  6.411   1.00 0.00 ? 181 GLU A OE2  1 
ATOM 2519 H H    . GLU A 1 181 ? 4.150   7.390   3.291   1.00 0.00 ? 181 GLU A H    1 
ATOM 2520 H HA   . GLU A 1 181 ? 5.512   6.492   5.686   1.00 0.00 ? 181 GLU A HA   1 
ATOM 2521 H HB2  . GLU A 1 181 ? 7.300   7.566   4.340   1.00 0.00 ? 181 GLU A HB2  1 
ATOM 2522 H HB3  . GLU A 1 181 ? 6.357   9.049   4.308   1.00 0.00 ? 181 GLU A HB3  1 
ATOM 2523 H HG2  . GLU A 1 181 ? 6.459   9.015   6.831   1.00 0.00 ? 181 GLU A HG2  1 
ATOM 2524 H HG3  . GLU A 1 181 ? 7.657   7.732   6.671   1.00 0.00 ? 181 GLU A HG3  1 
ATOM 2525 N N    . CYS A 1 182 ? 3.722   7.706   6.876   1.00 0.00 ? 182 CYS A N    1 
ATOM 2526 C CA   . CYS A 1 182 ? 2.700   8.423   7.629   1.00 0.00 ? 182 CYS A CA   1 
ATOM 2527 C C    . CYS A 1 182 ? 3.109   8.579   9.093   1.00 0.00 ? 182 CYS A C    1 
ATOM 2528 O O    . CYS A 1 182 ? 3.481   7.604   9.746   1.00 0.00 ? 182 CYS A O    1 
ATOM 2529 C CB   . CYS A 1 182 ? 1.363   7.685   7.543   1.00 0.00 ? 182 CYS A CB   1 
ATOM 2530 S SG   . CYS A 1 182 ? -0.011  8.550   8.338   1.00 0.00 ? 182 CYS A SG   1 
ATOM 2531 H H    . CYS A 1 182 ? 4.034   6.836   7.202   1.00 0.00 ? 182 CYS A H    1 
ATOM 2532 H HA   . CYS A 1 182 ? 2.591   9.400   7.185   1.00 0.00 ? 182 CYS A HA   1 
ATOM 2533 H HB2  . CYS A 1 182 ? 1.105   7.543   6.504   1.00 0.00 ? 182 CYS A HB2  1 
ATOM 2534 H HB3  . CYS A 1 182 ? 1.462   6.720   8.019   1.00 0.00 ? 182 CYS A HB3  1 
ATOM 2535 H HG   . CYS A 1 182 ? -0.825  8.261   7.920   1.00 0.00 ? 182 CYS A HG   1 
ATOM 2536 N N    . PRO A 1 183 ? 3.039   9.808   9.637   1.00 0.00 ? 183 PRO A N    1 
ATOM 2537 C CA   . PRO A 1 183 ? 3.399   10.071  11.032  1.00 0.00 ? 183 PRO A CA   1 
ATOM 2538 C C    . PRO A 1 183 ? 2.321   9.601   12.003  1.00 0.00 ? 183 PRO A C    1 
ATOM 2539 O O    . PRO A 1 183 ? 2.609   9.260   13.150  1.00 0.00 ? 183 PRO A O    1 
ATOM 2540 C CB   . PRO A 1 183 ? 3.534   11.591  11.076  1.00 0.00 ? 183 PRO A CB   1 
ATOM 2541 C CG   . PRO A 1 183 ? 2.598   12.079  10.024  1.00 0.00 ? 183 PRO A CG   1 
ATOM 2542 C CD   . PRO A 1 183 ? 2.604   11.033  8.939   1.00 0.00 ? 183 PRO A CD   1 
ATOM 2543 H HA   . PRO A 1 183 ? 4.343   9.614   11.292  1.00 0.00 ? 183 PRO A HA   1 
ATOM 2544 H HB2  . PRO A 1 183 ? 3.253   11.953  12.054  1.00 0.00 ? 183 PRO A HB2  1 
ATOM 2545 H HB3  . PRO A 1 183 ? 4.554   11.872  10.860  1.00 0.00 ? 183 PRO A HB3  1 
ATOM 2546 H HG2  . PRO A 1 183 ? 1.606   12.184  10.436  1.00 0.00 ? 183 PRO A HG2  1 
ATOM 2547 H HG3  . PRO A 1 183 ? 2.945   13.024  9.634   1.00 0.00 ? 183 PRO A HG3  1 
ATOM 2548 H HD2  . PRO A 1 183 ? 1.612   10.911  8.530   1.00 0.00 ? 183 PRO A HD2  1 
ATOM 2549 H HD3  . PRO A 1 183 ? 3.303   11.302  8.161   1.00 0.00 ? 183 PRO A HD3  1 
ATOM 2550 N N    . GLU A 1 184 ? 1.078   9.585   11.531  1.00 0.00 ? 184 GLU A N    1 
ATOM 2551 C CA   . GLU A 1 184 ? -0.048  9.153   12.351  1.00 0.00 ? 184 GLU A CA   1 
ATOM 2552 C C    . GLU A 1 184 ? -1.348  9.207   11.556  1.00 0.00 ? 184 GLU A C    1 
ATOM 2553 O O    . GLU A 1 184 ? -1.462  9.952   10.582  1.00 0.00 ? 184 GLU A O    1 
ATOM 2554 C CB   . GLU A 1 184 ? -0.164  10.029  13.599  1.00 0.00 ? 184 GLU A CB   1 
ATOM 2555 C CG   . GLU A 1 184 ? -0.130  11.520  13.303  1.00 0.00 ? 184 GLU A CG   1 
ATOM 2556 C CD   . GLU A 1 184 ? -0.904  12.334  14.321  1.00 0.00 ? 184 GLU A CD   1 
ATOM 2557 O OE1  . GLU A 1 184 ? -2.128  12.116  14.448  1.00 0.00 ? 184 GLU A OE1  1 
ATOM 2558 O OE2  . GLU A 1 184 ? -0.287  13.187  14.992  1.00 0.00 ? 184 GLU A OE2  1 
ATOM 2559 H H    . GLU A 1 184 ? 0.915   9.868   10.607  1.00 0.00 ? 184 GLU A H    1 
ATOM 2560 H HA   . GLU A 1 184 ? 0.134   8.132   12.652  1.00 0.00 ? 184 GLU A HA   1 
ATOM 2561 H HB2  . GLU A 1 184 ? -1.096  9.803   14.096  1.00 0.00 ? 184 GLU A HB2  1 
ATOM 2562 H HB3  . GLU A 1 184 ? 0.654   9.798   14.265  1.00 0.00 ? 184 GLU A HB3  1 
ATOM 2563 H HG2  . GLU A 1 184 ? 0.897   11.851  13.306  1.00 0.00 ? 184 GLU A HG2  1 
ATOM 2564 H HG3  . GLU A 1 184 ? -0.560  11.689  12.327  1.00 0.00 ? 184 GLU A HG3  1 
ATOM 2565 N N    . GLY A 1 185 ? -2.327  8.414   11.977  1.00 0.00 ? 185 GLY A N    1 
ATOM 2566 C CA   . GLY A 1 185 ? -3.605  8.385   11.290  1.00 0.00 ? 185 GLY A CA   1 
ATOM 2567 C C    . GLY A 1 185 ? -3.795  7.121   10.475  1.00 0.00 ? 185 GLY A C    1 
ATOM 2568 O O    . GLY A 1 185 ? -4.335  6.132   10.970  1.00 0.00 ? 185 GLY A O    1 
ATOM 2569 H H    . GLY A 1 185 ? -2.179  7.841   12.759  1.00 0.00 ? 185 GLY A H    1 
ATOM 2570 H HA2  . GLY A 1 185 ? -4.396  8.450   12.023  1.00 0.00 ? 185 GLY A HA2  1 
ATOM 2571 H HA3  . GLY A 1 185 ? -3.668  9.239   10.632  1.00 0.00 ? 185 GLY A HA3  1 
ATOM 2572 N N    . LEU A 1 186 ? -3.346  7.150   9.224   1.00 0.00 ? 186 LEU A N    1 
ATOM 2573 C CA   . LEU A 1 186 ? -3.467  5.992   8.346   1.00 0.00 ? 186 LEU A CA   1 
ATOM 2574 C C    . LEU A 1 186 ? -2.362  4.979   8.625   1.00 0.00 ? 186 LEU A C    1 
ATOM 2575 O O    . LEU A 1 186 ? -2.516  3.789   8.352   1.00 0.00 ? 186 LEU A O    1 
ATOM 2576 C CB   . LEU A 1 186 ? -3.424  6.425   6.874   1.00 0.00 ? 186 LEU A CB   1 
ATOM 2577 C CG   . LEU A 1 186 ? -3.845  5.357   5.849   1.00 0.00 ? 186 LEU A CG   1 
ATOM 2578 C CD1  . LEU A 1 186 ? -4.920  4.436   6.413   1.00 0.00 ? 186 LEU A CD1  1 
ATOM 2579 C CD2  . LEU A 1 186 ? -4.338  6.016   4.570   1.00 0.00 ? 186 LEU A CD2  1 
ATOM 2580 H H    . LEU A 1 186 ? -2.922  7.967   8.885   1.00 0.00 ? 186 LEU A H    1 
ATOM 2581 H HA   . LEU A 1 186 ? -4.421  5.527   8.546   1.00 0.00 ? 186 LEU A HA   1 
ATOM 2582 H HB2  . LEU A 1 186 ? -4.074  7.278   6.756   1.00 0.00 ? 186 LEU A HB2  1 
ATOM 2583 H HB3  . LEU A 1 186 ? -2.415  6.733   6.643   1.00 0.00 ? 186 LEU A HB3  1 
ATOM 2584 H HG   . LEU A 1 186 ? -2.986  4.751   5.600   1.00 0.00 ? 186 LEU A HG   1 
ATOM 2585 H HD11 . LEU A 1 186 ? -5.778  5.022   6.707   1.00 0.00 ? 186 LEU A HD11 1 
ATOM 2586 H HD12 . LEU A 1 186 ? -4.530  3.912   7.273   1.00 0.00 ? 186 LEU A HD12 1 
ATOM 2587 H HD13 . LEU A 1 186 ? -5.213  3.721   5.659   1.00 0.00 ? 186 LEU A HD13 1 
ATOM 2588 H HD21 . LEU A 1 186 ? -4.370  5.283   3.776   1.00 0.00 ? 186 LEU A HD21 1 
ATOM 2589 H HD22 . LEU A 1 186 ? -3.669  6.817   4.294   1.00 0.00 ? 186 LEU A HD22 1 
ATOM 2590 H HD23 . LEU A 1 186 ? -5.330  6.414   4.730   1.00 0.00 ? 186 LEU A HD23 1 
ATOM 2591 N N    . ALA A 1 187 ? -1.251  5.457   9.179   1.00 0.00 ? 187 ALA A N    1 
ATOM 2592 C CA   . ALA A 1 187 ? -0.123  4.590   9.499   1.00 0.00 ? 187 ALA A CA   1 
ATOM 2593 C C    . ALA A 1 187 ? -0.576  3.372   10.299  1.00 0.00 ? 187 ALA A C    1 
ATOM 2594 O O    . ALA A 1 187 ? 0.066   2.321   10.267  1.00 0.00 ? 187 ALA A O    1 
ATOM 2595 C CB   . ALA A 1 187 ? 0.937   5.365   10.266  1.00 0.00 ? 187 ALA A CB   1 
ATOM 2596 H H    . ALA A 1 187 ? -1.189  6.414   9.377   1.00 0.00 ? 187 ALA A H    1 
ATOM 2597 H HA   . ALA A 1 187 ? 0.315   4.258   8.572   1.00 0.00 ? 187 ALA A HA   1 
ATOM 2598 H HB1  . ALA A 1 187 ? 0.911   5.077   11.307  1.00 0.00 ? 187 ALA A HB1  1 
ATOM 2599 H HB2  . ALA A 1 187 ? 0.742   6.423   10.180  1.00 0.00 ? 187 ALA A HB2  1 
ATOM 2600 H HB3  . ALA A 1 187 ? 1.912   5.143   9.856   1.00 0.00 ? 187 ALA A HB3  1 
ATOM 2601 N N    . GLN A 1 188 ? -1.688  3.519   11.012  1.00 0.00 ? 188 GLN A N    1 
ATOM 2602 C CA   . GLN A 1 188 ? -2.223  2.438   11.832  1.00 0.00 ? 188 GLN A CA   1 
ATOM 2603 C C    . GLN A 1 188 ? -2.825  1.333   10.971  1.00 0.00 ? 188 GLN A C    1 
ATOM 2604 O O    . GLN A 1 188 ? -2.668  0.149   11.265  1.00 0.00 ? 188 GLN A O    1 
ATOM 2605 C CB   . GLN A 1 188 ? -3.284  2.981   12.791  1.00 0.00 ? 188 GLN A CB   1 
ATOM 2606 C CG   . GLN A 1 188 ? -2.787  4.118   13.668  1.00 0.00 ? 188 GLN A CG   1 
ATOM 2607 C CD   . GLN A 1 188 ? -1.922  3.634   14.815  1.00 0.00 ? 188 GLN A CD   1 
ATOM 2608 O OE1  . GLN A 1 188 ? -2.109  2.530   15.326  1.00 0.00 ? 188 GLN A OE1  1 
ATOM 2609 N NE2  . GLN A 1 188 ? -0.970  4.462   15.228  1.00 0.00 ? 188 GLN A NE2  1 
ATOM 2610 H H    . GLN A 1 188 ? -2.153  4.382   10.998  1.00 0.00 ? 188 GLN A H    1 
ATOM 2611 H HA   . GLN A 1 188 ? -1.407  2.025   12.407  1.00 0.00 ? 188 GLN A HA   1 
ATOM 2612 H HB2  . GLN A 1 188 ? -4.123  3.341   12.213  1.00 0.00 ? 188 GLN A HB2  1 
ATOM 2613 H HB3  . GLN A 1 188 ? -3.617  2.179   13.432  1.00 0.00 ? 188 GLN A HB3  1 
ATOM 2614 H HG2  . GLN A 1 188 ? -2.207  4.797   13.061  1.00 0.00 ? 188 GLN A HG2  1 
ATOM 2615 H HG3  . GLN A 1 188 ? -3.640  4.640   14.076  1.00 0.00 ? 188 GLN A HG3  1 
ATOM 2616 H HE21 . GLN A 1 188 ? -0.879  5.326   14.775  1.00 0.00 ? 188 GLN A HE21 1 
ATOM 2617 H HE22 . GLN A 1 188 ? -0.396  4.175   15.969  1.00 0.00 ? 188 GLN A HE22 1 
ATOM 2618 N N    . ASP A 1 189 ? -3.529  1.728   9.915   1.00 0.00 ? 189 ASP A N    1 
ATOM 2619 C CA   . ASP A 1 189 ? -4.168  0.768   9.023   1.00 0.00 ? 189 ASP A CA   1 
ATOM 2620 C C    . ASP A 1 189 ? -3.163  0.176   8.040   1.00 0.00 ? 189 ASP A C    1 
ATOM 2621 O O    . ASP A 1 189 ? -3.024  -1.043  7.940   1.00 0.00 ? 189 ASP A O    1 
ATOM 2622 C CB   . ASP A 1 189 ? -5.314  1.435   8.260   1.00 0.00 ? 189 ASP A CB   1 
ATOM 2623 C CG   . ASP A 1 189 ? -6.125  2.366   9.139   1.00 0.00 ? 189 ASP A CG   1 
ATOM 2624 O OD1  . ASP A 1 189 ? -6.121  2.172   10.372  1.00 0.00 ? 189 ASP A OD1  1 
ATOM 2625 O OD2  . ASP A 1 189 ? -6.764  3.290   8.593   1.00 0.00 ? 189 ASP A OD2  1 
ATOM 2626 H H    . ASP A 1 189 ? -3.628  2.686   9.737   1.00 0.00 ? 189 ASP A H    1 
ATOM 2627 H HA   . ASP A 1 189 ? -4.569  -0.031  9.630   1.00 0.00 ? 189 ASP A HA   1 
ATOM 2628 H HB2  . ASP A 1 189 ? -4.907  2.006   7.439   1.00 0.00 ? 189 ASP A HB2  1 
ATOM 2629 H HB3  . ASP A 1 189 ? -5.972  0.671   7.872   1.00 0.00 ? 189 ASP A HB3  1 
ATOM 2630 N N    . VAL A 1 190 ? -2.467  1.044   7.314   1.00 0.00 ? 190 VAL A N    1 
ATOM 2631 C CA   . VAL A 1 190 ? -1.479  0.599   6.338   1.00 0.00 ? 190 VAL A CA   1 
ATOM 2632 C C    . VAL A 1 190 ? -0.507  -0.400  6.958   1.00 0.00 ? 190 VAL A C    1 
ATOM 2633 O O    . VAL A 1 190 ? -0.261  -1.469  6.399   1.00 0.00 ? 190 VAL A O    1 
ATOM 2634 C CB   . VAL A 1 190 ? -0.684  1.781   5.756   1.00 0.00 ? 190 VAL A CB   1 
ATOM 2635 C CG1  . VAL A 1 190 ? -1.582  2.666   4.904   1.00 0.00 ? 190 VAL A CG1  1 
ATOM 2636 C CG2  . VAL A 1 190 ? -0.029  2.586   6.864   1.00 0.00 ? 190 VAL A CG2  1 
ATOM 2637 H H    . VAL A 1 190 ? -2.621  2.004   7.436   1.00 0.00 ? 190 VAL A H    1 
ATOM 2638 H HA   . VAL A 1 190 ? -2.007  0.116   5.528   1.00 0.00 ? 190 VAL A HA   1 
ATOM 2639 H HB   . VAL A 1 190 ? 0.096   1.386   5.125   1.00 0.00 ? 190 VAL A HB   1 
ATOM 2640 H HG11 . VAL A 1 190 ? -2.612  2.516   5.191   1.00 0.00 ? 190 VAL A HG11 1 
ATOM 2641 H HG12 . VAL A 1 190 ? -1.458  2.410   3.862   1.00 0.00 ? 190 VAL A HG12 1 
ATOM 2642 H HG13 . VAL A 1 190 ? -1.314  3.701   5.055   1.00 0.00 ? 190 VAL A HG13 1 
ATOM 2643 H HG21 . VAL A 1 190 ? 0.838   2.057   7.230   1.00 0.00 ? 190 VAL A HG21 1 
ATOM 2644 H HG22 . VAL A 1 190 ? -0.733  2.726   7.671   1.00 0.00 ? 190 VAL A HG22 1 
ATOM 2645 H HG23 . VAL A 1 190 ? 0.273   3.549   6.480   1.00 0.00 ? 190 VAL A HG23 1 
ATOM 2646 N N    . ILE A 1 191 ? 0.040   -0.048  8.117   1.00 0.00 ? 191 ILE A N    1 
ATOM 2647 C CA   . ILE A 1 191 ? 0.983   -0.918  8.812   1.00 0.00 ? 191 ILE A CA   1 
ATOM 2648 C C    . ILE A 1 191 ? 0.380   -2.298  9.064   1.00 0.00 ? 191 ILE A C    1 
ATOM 2649 O O    . ILE A 1 191 ? 1.105   -3.270  9.275   1.00 0.00 ? 191 ILE A O    1 
ATOM 2650 C CB   . ILE A 1 191 ? 1.428   -0.312  10.156  1.00 0.00 ? 191 ILE A CB   1 
ATOM 2651 C CG1  . ILE A 1 191 ? 2.550   -1.151  10.770  1.00 0.00 ? 191 ILE A CG1  1 
ATOM 2652 C CG2  . ILE A 1 191 ? 0.248   -0.215  11.112  1.00 0.00 ? 191 ILE A CG2  1 
ATOM 2653 C CD1  . ILE A 1 191 ? 3.614   -0.325  11.459  1.00 0.00 ? 191 ILE A CD1  1 
ATOM 2654 H H    . ILE A 1 191 ? -0.195  0.817   8.514   1.00 0.00 ? 191 ILE A H    1 
ATOM 2655 H HA   . ILE A 1 191 ? 1.857   -1.027  8.187   1.00 0.00 ? 191 ILE A HA   1 
ATOM 2656 H HB   . ILE A 1 191 ? 1.792   0.688   9.972   1.00 0.00 ? 191 ILE A HB   1 
ATOM 2657 H HG12 . ILE A 1 191 ? 2.129   -1.825  11.501  1.00 0.00 ? 191 ILE A HG12 1 
ATOM 2658 H HG13 . ILE A 1 191 ? 3.029   -1.725  9.991   1.00 0.00 ? 191 ILE A HG13 1 
ATOM 2659 H HG21 . ILE A 1 191 ? -0.033  -1.205  11.439  1.00 0.00 ? 191 ILE A HG21 1 
ATOM 2660 H HG22 . ILE A 1 191 ? -0.586  0.248   10.607  1.00 0.00 ? 191 ILE A HG22 1 
ATOM 2661 H HG23 . ILE A 1 191 ? 0.527   0.382   11.968  1.00 0.00 ? 191 ILE A HG23 1 
ATOM 2662 H HD11 . ILE A 1 191 ? 4.326   0.027   10.728  1.00 0.00 ? 191 ILE A HD11 1 
ATOM 2663 H HD12 . ILE A 1 191 ? 4.123   -0.934  12.193  1.00 0.00 ? 191 ILE A HD12 1 
ATOM 2664 H HD13 . ILE A 1 191 ? 3.153   0.519   11.950  1.00 0.00 ? 191 ILE A HD13 1 
ATOM 2665 N N    . SER A 1 192 ? -0.949  -2.380  9.036   1.00 0.00 ? 192 SER A N    1 
ATOM 2666 C CA   . SER A 1 192 ? -1.647  -3.645  9.260   1.00 0.00 ? 192 SER A CA   1 
ATOM 2667 C C    . SER A 1 192 ? -1.616  -4.034  10.734  1.00 0.00 ? 192 SER A C    1 
ATOM 2668 O O    . SER A 1 192 ? -0.598  -4.507  11.240  1.00 0.00 ? 192 SER A O    1 
ATOM 2669 C CB   . SER A 1 192 ? -1.024  -4.760  8.415   1.00 0.00 ? 192 SER A CB   1 
ATOM 2670 O OG   . SER A 1 192 ? -0.543  -4.258  7.180   1.00 0.00 ? 192 SER A OG   1 
ATOM 2671 H H    . SER A 1 192 ? -1.475  -1.572  8.863   1.00 0.00 ? 192 SER A H    1 
ATOM 2672 H HA   . SER A 1 192 ? -2.675  -3.511  8.959   1.00 0.00 ? 192 SER A HA   1 
ATOM 2673 H HB2  . SER A 1 192 ? -0.199  -5.199  8.956   1.00 0.00 ? 192 SER A HB2  1 
ATOM 2674 H HB3  . SER A 1 192 ? -1.768  -5.517  8.217   1.00 0.00 ? 192 SER A HB3  1 
ATOM 2675 H HG   . SER A 1 192 ? -0.789  -4.859  6.473   1.00 0.00 ? 192 SER A HG   1 
ATOM 2676 N N    . THR A 1 193 ? -2.740  -3.839  11.417  1.00 0.00 ? 193 THR A N    1 
ATOM 2677 C CA   . THR A 1 193 ? -2.843  -4.176  12.832  1.00 0.00 ? 193 THR A CA   1 
ATOM 2678 C C    . THR A 1 193 ? -4.297  -4.174  13.291  1.00 0.00 ? 193 THR A C    1 
ATOM 2679 O O    . THR A 1 193 ? -4.774  -5.146  13.877  1.00 0.00 ? 193 THR A O    1 
ATOM 2680 C CB   . THR A 1 193 ? -2.031  -3.190  13.675  1.00 0.00 ? 193 THR A CB   1 
ATOM 2681 O OG1  . THR A 1 193 ? -0.780  -2.922  13.067  1.00 0.00 ? 193 THR A OG1  1 
ATOM 2682 C CG2  . THR A 1 193 ? -1.765  -3.683  15.080  1.00 0.00 ? 193 THR A CG2  1 
ATOM 2683 H H    . THR A 1 193 ? -3.519  -3.462  10.957  1.00 0.00 ? 193 THR A H    1 
ATOM 2684 H HA   . THR A 1 193 ? -2.438  -5.168  12.965  1.00 0.00 ? 193 THR A HA   1 
ATOM 2685 H HB   . THR A 1 193 ? -2.578  -2.262  13.751  1.00 0.00 ? 193 THR A HB   1 
ATOM 2686 H HG1  . THR A 1 193 ? -0.353  -3.749  12.833  1.00 0.00 ? 193 THR A HG1  1 
ATOM 2687 H HG21 . THR A 1 193 ? -1.771  -4.763  15.090  1.00 0.00 ? 193 THR A HG21 1 
ATOM 2688 H HG22 . THR A 1 193 ? -2.532  -3.313  15.744  1.00 0.00 ? 193 THR A HG22 1 
ATOM 2689 H HG23 . THR A 1 193 ? -0.800  -3.327  15.410  1.00 0.00 ? 193 THR A HG23 1 
ATOM 2690 N N    . ILE A 1 194 ? -4.997  -3.075  13.026  1.00 0.00 ? 194 ILE A N    1 
ATOM 2691 C CA   . ILE A 1 194 ? -6.395  -2.948  13.423  1.00 0.00 ? 194 ILE A CA   1 
ATOM 2692 C C    . ILE A 1 194 ? -7.333  -3.203  12.248  1.00 0.00 ? 194 ILE A C    1 
ATOM 2693 O O    . ILE A 1 194 ? -7.438  -2.385  11.334  1.00 0.00 ? 194 ILE A O    1 
ATOM 2694 C CB   . ILE A 1 194 ? -6.690  -1.553  14.006  1.00 0.00 ? 194 ILE A CB   1 
ATOM 2695 C CG1  . ILE A 1 194 ? -6.056  -0.466  13.136  1.00 0.00 ? 194 ILE A CG1  1 
ATOM 2696 C CG2  . ILE A 1 194 ? -6.182  -1.455  15.436  1.00 0.00 ? 194 ILE A CG2  1 
ATOM 2697 C CD1  . ILE A 1 194 ? -6.674  0.901   13.331  1.00 0.00 ? 194 ILE A CD1  1 
ATOM 2698 H H    . ILE A 1 194 ? -4.562  -2.331  12.561  1.00 0.00 ? 194 ILE A H    1 
ATOM 2699 H HA   . ILE A 1 194 ? -6.590  -3.682  14.192  1.00 0.00 ? 194 ILE A HA   1 
ATOM 2700 H HB   . ILE A 1 194 ? -7.761  -1.414  14.022  1.00 0.00 ? 194 ILE A HB   1 
ATOM 2701 H HG12 . ILE A 1 194 ? -5.005  -0.392  13.373  1.00 0.00 ? 194 ILE A HG12 1 
ATOM 2702 H HG13 . ILE A 1 194 ? -6.168  -0.736  12.096  1.00 0.00 ? 194 ILE A HG13 1 
ATOM 2703 H HG21 . ILE A 1 194 ? -7.010  -1.564  16.121  1.00 0.00 ? 194 ILE A HG21 1 
ATOM 2704 H HG22 . ILE A 1 194 ? -5.714  -0.494  15.587  1.00 0.00 ? 194 ILE A HG22 1 
ATOM 2705 H HG23 . ILE A 1 194 ? -5.461  -2.239  15.617  1.00 0.00 ? 194 ILE A HG23 1 
ATOM 2706 H HD11 . ILE A 1 194 ? -7.750  0.820   13.290  1.00 0.00 ? 194 ILE A HD11 1 
ATOM 2707 H HD12 . ILE A 1 194 ? -6.333  1.565   12.550  1.00 0.00 ? 194 ILE A HD12 1 
ATOM 2708 H HD13 . ILE A 1 194 ? -6.379  1.296   14.292  1.00 0.00 ? 194 ILE A HD13 1 
ATOM 2709 N N    . GLY A 1 195 ? -8.018  -4.342  12.284  1.00 0.00 ? 195 GLY A N    1 
ATOM 2710 C CA   . GLY A 1 195 ? -8.955  -4.687  11.228  1.00 0.00 ? 195 GLY A CA   1 
ATOM 2711 C C    . GLY A 1 195 ? -8.389  -4.465  9.838   1.00 0.00 ? 195 GLY A C    1 
ATOM 2712 O O    . GLY A 1 195 ? -7.187  -4.261  9.673   1.00 0.00 ? 195 GLY A O    1 
ATOM 2713 H H    . GLY A 1 195 ? -7.897  -4.950  13.043  1.00 0.00 ? 195 GLY A H    1 
ATOM 2714 H HA2  . GLY A 1 195 ? -9.225  -5.728  11.330  1.00 0.00 ? 195 GLY A HA2  1 
ATOM 2715 H HA3  . GLY A 1 195 ? -9.843  -4.084  11.341  1.00 0.00 ? 195 GLY A HA3  1 
ATOM 2716 N N    . GLN A 1 196 ? -9.263  -4.506  8.836   1.00 0.00 ? 196 GLN A N    1 
ATOM 2717 C CA   . GLN A 1 196 ? -8.852  -4.309  7.451   1.00 0.00 ? 196 GLN A CA   1 
ATOM 2718 C C    . GLN A 1 196 ? -10.028 -4.516  6.502   1.00 0.00 ? 196 GLN A C    1 
ATOM 2719 O O    . GLN A 1 196 ? -10.776 -5.485  6.628   1.00 0.00 ? 196 GLN A O    1 
ATOM 2720 C CB   . GLN A 1 196 ? -7.718  -5.271  7.092   1.00 0.00 ? 196 GLN A CB   1 
ATOM 2721 C CG   . GLN A 1 196 ? -6.479  -4.576  6.551   1.00 0.00 ? 196 GLN A CG   1 
ATOM 2722 C CD   . GLN A 1 196 ? -5.416  -5.554  6.090   1.00 0.00 ? 196 GLN A CD   1 
ATOM 2723 O OE1  . GLN A 1 196 ? -5.095  -6.515  6.789   1.00 0.00 ? 196 GLN A OE1  1 
ATOM 2724 N NE2  . GLN A 1 196 ? -4.863  -5.311  4.908   1.00 0.00 ? 196 GLN A NE2  1 
ATOM 2725 H H    . GLN A 1 196 ? -10.208 -4.673  9.035   1.00 0.00 ? 196 GLN A H    1 
ATOM 2726 H HA   . GLN A 1 196 ? -8.499  -3.293  7.352   1.00 0.00 ? 196 GLN A HA   1 
ATOM 2727 H HB2  . GLN A 1 196 ? -7.438  -5.825  7.975   1.00 0.00 ? 196 GLN A HB2  1 
ATOM 2728 H HB3  . GLN A 1 196 ? -8.073  -5.962  6.341   1.00 0.00 ? 196 GLN A HB3  1 
ATOM 2729 H HG2  . GLN A 1 196 ? -6.765  -3.957  5.714   1.00 0.00 ? 196 GLN A HG2  1 
ATOM 2730 H HG3  . GLN A 1 196 ? -6.062  -3.955  7.331   1.00 0.00 ? 196 GLN A HG3  1 
ATOM 2731 H HE21 . GLN A 1 196 ? -5.167  -4.526  4.407   1.00 0.00 ? 196 GLN A HE21 1 
ATOM 2732 H HE22 . GLN A 1 196 ? -4.172  -5.927  4.585   1.00 0.00 ? 196 GLN A HE22 1 
ATOM 2733 N N    . ALA A 1 197 ? -10.185 -3.601  5.550   1.00 0.00 ? 197 ALA A N    1 
ATOM 2734 C CA   . ALA A 1 197 ? -11.270 -3.688  4.580   1.00 0.00 ? 197 ALA A CA   1 
ATOM 2735 C C    . ALA A 1 197 ? -11.215 -5.009  3.819   1.00 0.00 ? 197 ALA A C    1 
ATOM 2736 O O    . ALA A 1 197 ? -10.398 -5.184  2.915   1.00 0.00 ? 197 ALA A O    1 
ATOM 2737 C CB   . ALA A 1 197 ? -11.213 -2.514  3.614   1.00 0.00 ? 197 ALA A CB   1 
ATOM 2738 H H    . ALA A 1 197 ? -9.555  -2.852  5.499   1.00 0.00 ? 197 ALA A H    1 
ATOM 2739 H HA   . ALA A 1 197 ? -12.204 -3.633  5.119   1.00 0.00 ? 197 ALA A HA   1 
ATOM 2740 H HB1  . ALA A 1 197 ? -11.755 -1.677  4.031   1.00 0.00 ? 197 ALA A HB1  1 
ATOM 2741 H HB2  . ALA A 1 197 ? -11.661 -2.799  2.674   1.00 0.00 ? 197 ALA A HB2  1 
ATOM 2742 H HB3  . ALA A 1 197 ? -10.184 -2.230  3.451   1.00 0.00 ? 197 ALA A HB3  1 
ATOM 2743 N N    . PHE A 1 198 ? -12.086 -5.939  4.197   1.00 0.00 ? 198 PHE A N    1 
ATOM 2744 C CA   . PHE A 1 198 ? -12.135 -7.249  3.557   1.00 0.00 ? 198 PHE A CA   1 
ATOM 2745 C C    . PHE A 1 198 ? -12.961 -7.200  2.273   1.00 0.00 ? 198 PHE A C    1 
ATOM 2746 O O    . PHE A 1 198 ? -13.131 -6.137  1.676   1.00 0.00 ? 198 PHE A O    1 
ATOM 2747 C CB   . PHE A 1 198 ? -12.717 -8.283  4.524   1.00 0.00 ? 198 PHE A CB   1 
ATOM 2748 C CG   . PHE A 1 198 ? -12.065 -9.632  4.420   1.00 0.00 ? 198 PHE A CG   1 
ATOM 2749 C CD1  . PHE A 1 198 ? -10.694 -9.765  4.571   1.00 0.00 ? 198 PHE A CD1  1 
ATOM 2750 C CD2  . PHE A 1 198 ? -12.821 -10.765 4.167   1.00 0.00 ? 198 PHE A CD2  1 
ATOM 2751 C CE1  . PHE A 1 198 ? -10.090 -11.004 4.475   1.00 0.00 ? 198 PHE A CE1  1 
ATOM 2752 C CE2  . PHE A 1 198 ? -12.223 -12.006 4.069   1.00 0.00 ? 198 PHE A CE2  1 
ATOM 2753 C CZ   . PHE A 1 198 ? -10.855 -12.126 4.223   1.00 0.00 ? 198 PHE A CZ   1 
ATOM 2754 H H    . PHE A 1 198 ? -12.709 -5.741  4.926   1.00 0.00 ? 198 PHE A H    1 
ATOM 2755 H HA   . PHE A 1 198 ? -11.123 -7.532  3.308   1.00 0.00 ? 198 PHE A HA   1 
ATOM 2756 H HB2  . PHE A 1 198 ? -12.591 -7.929  5.537   1.00 0.00 ? 198 PHE A HB2  1 
ATOM 2757 H HB3  . PHE A 1 198 ? -13.770 -8.405  4.318   1.00 0.00 ? 198 PHE A HB3  1 
ATOM 2758 H HD1  . PHE A 1 198 ? -10.095 -8.888  4.768   1.00 0.00 ? 198 PHE A HD1  1 
ATOM 2759 H HD2  . PHE A 1 198 ? -13.890 -10.672 4.046   1.00 0.00 ? 198 PHE A HD2  1 
ATOM 2760 H HE1  . PHE A 1 198 ? -9.021  -11.095 4.596   1.00 0.00 ? 198 PHE A HE1  1 
ATOM 2761 H HE2  . PHE A 1 198 ? -12.823 -12.882 3.872   1.00 0.00 ? 198 PHE A HE2  1 
ATOM 2762 H HZ   . PHE A 1 198 ? -10.385 -13.096 4.147   1.00 0.00 ? 198 PHE A HZ   1 
ATOM 2763 N N    . GLU A 1 199 ? -13.480 -8.357  1.852   1.00 0.00 ? 199 GLU A N    1 
ATOM 2764 C CA   . GLU A 1 199 ? -14.284 -8.452  0.632   1.00 0.00 ? 199 GLU A CA   1 
ATOM 2765 C C    . GLU A 1 199 ? -13.390 -8.506  -0.604  1.00 0.00 ? 199 GLU A C    1 
ATOM 2766 O O    . GLU A 1 199 ? -13.598 -7.770  -1.568  1.00 0.00 ? 199 GLU A O    1 
ATOM 2767 C CB   . GLU A 1 199 ? -15.262 -7.275  0.526   1.00 0.00 ? 199 GLU A CB   1 
ATOM 2768 C CG   . GLU A 1 199 ? -16.701 -7.701  0.280   1.00 0.00 ? 199 GLU A CG   1 
ATOM 2769 C CD   . GLU A 1 199 ? -17.498 -7.838  1.563   1.00 0.00 ? 199 GLU A CD   1 
ATOM 2770 O OE1  . GLU A 1 199 ? -17.589 -6.844  2.314   1.00 0.00 ? 199 GLU A OE1  1 
ATOM 2771 O OE2  . GLU A 1 199 ? -18.032 -8.938  1.815   1.00 0.00 ? 199 GLU A OE2  1 
ATOM 2772 H H    . GLU A 1 199 ? -13.303 -9.173  2.365   1.00 0.00 ? 199 GLU A H    1 
ATOM 2773 H HA   . GLU A 1 199 ? -14.850 -9.370  0.686   1.00 0.00 ? 199 GLU A HA   1 
ATOM 2774 H HB2  . GLU A 1 199 ? -15.230 -6.710  1.446   1.00 0.00 ? 199 GLU A HB2  1 
ATOM 2775 H HB3  . GLU A 1 199 ? -14.955 -6.637  -0.289  1.00 0.00 ? 199 GLU A HB3  1 
ATOM 2776 H HG2  . GLU A 1 199 ? -17.180 -6.962  -0.346  1.00 0.00 ? 199 GLU A HG2  1 
ATOM 2777 H HG3  . GLU A 1 199 ? -16.699 -8.654  -0.227  1.00 0.00 ? 199 GLU A HG3  1 
ATOM 2778 N N    . LEU A 1 200 ? -12.401 -9.394  -0.568  1.00 0.00 ? 200 LEU A N    1 
ATOM 2779 C CA   . LEU A 1 200 ? -11.476 -9.560  -1.684  1.00 0.00 ? 200 LEU A CA   1 
ATOM 2780 C C    . LEU A 1 200 ? -10.432 -10.626 -1.365  1.00 0.00 ? 200 LEU A C    1 
ATOM 2781 O O    . LEU A 1 200 ? -9.525  -10.399 -0.565  1.00 0.00 ? 200 LEU A O    1 
ATOM 2782 C CB   . LEU A 1 200 ? -10.786 -8.234  -2.008  1.00 0.00 ? 200 LEU A CB   1 
ATOM 2783 C CG   . LEU A 1 200 ? -10.411 -8.044  -3.479  1.00 0.00 ? 200 LEU A CG   1 
ATOM 2784 C CD1  . LEU A 1 200 ? -11.492 -7.260  -4.208  1.00 0.00 ? 200 LEU A CD1  1 
ATOM 2785 C CD2  . LEU A 1 200 ? -9.067  -7.342  -3.601  1.00 0.00 ? 200 LEU A CD2  1 
ATOM 2786 H H    . LEU A 1 200 ? -12.292 -9.954  0.228   1.00 0.00 ? 200 LEU A H    1 
ATOM 2787 H HA   . LEU A 1 200 ? -12.048 -9.879  -2.543  1.00 0.00 ? 200 LEU A HA   1 
ATOM 2788 H HB2  . LEU A 1 200 ? -11.445 -7.428  -1.719  1.00 0.00 ? 200 LEU A HB2  1 
ATOM 2789 H HB3  . LEU A 1 200 ? -9.884  -8.167  -1.417  1.00 0.00 ? 200 LEU A HB3  1 
ATOM 2790 H HG   . LEU A 1 200 ? -10.326 -9.012  -3.950  1.00 0.00 ? 200 LEU A HG   1 
ATOM 2791 H HD11 . LEU A 1 200 ? -11.496 -6.239  -3.856  1.00 0.00 ? 200 LEU A HD11 1 
ATOM 2792 H HD12 . LEU A 1 200 ? -12.455 -7.711  -4.016  1.00 0.00 ? 200 LEU A HD12 1 
ATOM 2793 H HD13 . LEU A 1 200 ? -11.294 -7.275  -5.269  1.00 0.00 ? 200 LEU A HD13 1 
ATOM 2794 H HD21 . LEU A 1 200 ? -9.218  -6.335  -3.962  1.00 0.00 ? 200 LEU A HD21 1 
ATOM 2795 H HD22 . LEU A 1 200 ? -8.440  -7.883  -4.295  1.00 0.00 ? 200 LEU A HD22 1 
ATOM 2796 H HD23 . LEU A 1 200 ? -8.589  -7.310  -2.633  1.00 0.00 ? 200 LEU A HD23 1 
ATOM 2797 N N    . ARG A 1 201 ? -10.571 -11.791 -1.991  1.00 0.00 ? 201 ARG A N    1 
ATOM 2798 C CA   . ARG A 1 201 ? -9.642  -12.893 -1.764  1.00 0.00 ? 201 ARG A CA   1 
ATOM 2799 C C    . ARG A 1 201 ? -9.247  -13.561 -3.077  1.00 0.00 ? 201 ARG A C    1 
ATOM 2800 O O    . ARG A 1 201 ? -9.652  -14.689 -3.357  1.00 0.00 ? 201 ARG A O    1 
ATOM 2801 C CB   . ARG A 1 201 ? -10.265 -13.925 -0.822  1.00 0.00 ? 201 ARG A CB   1 
ATOM 2802 C CG   . ARG A 1 201 ? -9.244  -14.665 0.027   1.00 0.00 ? 201 ARG A CG   1 
ATOM 2803 C CD   . ARG A 1 201 ? -9.744  -16.043 0.429   1.00 0.00 ? 201 ARG A CD   1 
ATOM 2804 N NE   . ARG A 1 201 ? -10.754 -15.973 1.481   1.00 0.00 ? 201 ARG A NE   1 
ATOM 2805 C CZ   . ARG A 1 201 ? -10.474 -15.704 2.753   1.00 0.00 ? 201 ARG A CZ   1 
ATOM 2806 N NH1  . ARG A 1 201 ? -9.222  -15.479 3.126   1.00 0.00 ? 201 ARG A NH1  1 
ATOM 2807 N NH2  . ARG A 1 201 ? -11.448 -15.659 3.652   1.00 0.00 ? 201 ARG A NH2  1 
ATOM 2808 H H    . ARG A 1 201 ? -11.317 -11.915 -2.614  1.00 0.00 ? 201 ARG A H    1 
ATOM 2809 H HA   . ARG A 1 201 ? -8.755  -12.486 -1.302  1.00 0.00 ? 201 ARG A HA   1 
ATOM 2810 H HB2  . ARG A 1 201 ? -10.955 -13.423 -0.161  1.00 0.00 ? 201 ARG A HB2  1 
ATOM 2811 H HB3  . ARG A 1 201 ? -10.806 -14.651 -1.410  1.00 0.00 ? 201 ARG A HB3  1 
ATOM 2812 H HG2  . ARG A 1 201 ? -8.331  -14.775 -0.540  1.00 0.00 ? 201 ARG A HG2  1 
ATOM 2813 H HG3  . ARG A 1 201 ? -9.048  -14.090 0.920   1.00 0.00 ? 201 ARG A HG3  1 
ATOM 2814 H HD2  . ARG A 1 201 ? -10.174 -16.522 -0.438  1.00 0.00 ? 201 ARG A HD2  1 
ATOM 2815 H HD3  . ARG A 1 201 ? -8.908  -16.626 0.784   1.00 0.00 ? 201 ARG A HD3  1 
ATOM 2816 H HE   . ARG A 1 201 ? -11.686 -16.137 1.228   1.00 0.00 ? 201 ARG A HE   1 
ATOM 2817 H HH11 . ARG A 1 201 ? -8.485  -15.512 2.451   1.00 0.00 ? 201 ARG A HH11 1 
ATOM 2818 H HH12 . ARG A 1 201 ? -9.014  -15.276 4.083   1.00 0.00 ? 201 ARG A HH12 1 
ATOM 2819 H HH21 . ARG A 1 201 ? -12.393 -15.828 3.374   1.00 0.00 ? 201 ARG A HH21 1 
ATOM 2820 H HH22 . ARG A 1 201 ? -11.236 -15.456 4.608   1.00 0.00 ? 201 ARG A HH22 1 
ATOM 2821 N N    . PHE A 1 202 ? -8.444  -12.862 -3.872  1.00 0.00 ? 202 PHE A N    1 
ATOM 2822 C CA   . PHE A 1 202 ? -7.978  -13.391 -5.149  1.00 0.00 ? 202 PHE A CA   1 
ATOM 2823 C C    . PHE A 1 202 ? -9.138  -13.654 -6.108  1.00 0.00 ? 202 PHE A C    1 
ATOM 2824 O O    . PHE A 1 202 ? -8.973  -14.343 -7.115  1.00 0.00 ? 202 PHE A O    1 
ATOM 2825 C CB   . PHE A 1 202 ? -7.189  -14.682 -4.926  1.00 0.00 ? 202 PHE A CB   1 
ATOM 2826 C CG   . PHE A 1 202 ? -5.829  -14.674 -5.564  1.00 0.00 ? 202 PHE A CG   1 
ATOM 2827 C CD1  . PHE A 1 202 ? -5.613  -13.999 -6.755  1.00 0.00 ? 202 PHE A CD1  1 
ATOM 2828 C CD2  . PHE A 1 202 ? -4.768  -15.340 -4.973  1.00 0.00 ? 202 PHE A CD2  1 
ATOM 2829 C CE1  . PHE A 1 202 ? -4.363  -13.989 -7.344  1.00 0.00 ? 202 PHE A CE1  1 
ATOM 2830 C CE2  . PHE A 1 202 ? -3.516  -15.334 -5.558  1.00 0.00 ? 202 PHE A CE2  1 
ATOM 2831 C CZ   . PHE A 1 202 ? -3.314  -14.657 -6.745  1.00 0.00 ? 202 PHE A CZ   1 
ATOM 2832 H H    . PHE A 1 202 ? -8.150  -11.971 -3.589  1.00 0.00 ? 202 PHE A H    1 
ATOM 2833 H HA   . PHE A 1 202 ? -7.325  -12.653 -5.591  1.00 0.00 ? 202 PHE A HA   1 
ATOM 2834 H HB2  . PHE A 1 202 ? -7.057  -14.836 -3.865  1.00 0.00 ? 202 PHE A HB2  1 
ATOM 2835 H HB3  . PHE A 1 202 ? -7.745  -15.511 -5.339  1.00 0.00 ? 202 PHE A HB3  1 
ATOM 2836 H HD1  . PHE A 1 202 ? -6.433  -13.475 -7.224  1.00 0.00 ? 202 PHE A HD1  1 
ATOM 2837 H HD2  . PHE A 1 202 ? -4.926  -15.870 -4.045  1.00 0.00 ? 202 PHE A HD2  1 
ATOM 2838 H HE1  . PHE A 1 202 ? -4.208  -13.459 -8.272  1.00 0.00 ? 202 PHE A HE1  1 
ATOM 2839 H HE2  . PHE A 1 202 ? -2.697  -15.858 -5.088  1.00 0.00 ? 202 PHE A HE2  1 
ATOM 2840 H HZ   . PHE A 1 202 ? -2.336  -14.651 -7.204  1.00 0.00 ? 202 PHE A HZ   1 
ATOM 2841 N N    . LYS A 1 203 ? -10.308 -13.099 -5.801  1.00 0.00 ? 203 LYS A N    1 
ATOM 2842 C CA   . LYS A 1 203 ? -11.479 -13.276 -6.652  1.00 0.00 ? 203 LYS A CA   1 
ATOM 2843 C C    . LYS A 1 203 ? -11.923 -11.942 -7.243  1.00 0.00 ? 203 LYS A C    1 
ATOM 2844 O O    . LYS A 1 203 ? -12.387 -11.879 -8.381  1.00 0.00 ? 203 LYS A O    1 
ATOM 2845 C CB   . LYS A 1 203 ? -12.625 -13.903 -5.856  1.00 0.00 ? 203 LYS A CB   1 
ATOM 2846 C CG   . LYS A 1 203 ? -12.952 -13.162 -4.571  1.00 0.00 ? 203 LYS A CG   1 
ATOM 2847 C CD   . LYS A 1 203 ? -12.878 -14.083 -3.363  1.00 0.00 ? 203 LYS A CD   1 
ATOM 2848 C CE   . LYS A 1 203 ? -14.263 -14.434 -2.845  1.00 0.00 ? 203 LYS A CE   1 
ATOM 2849 N NZ   . LYS A 1 203 ? -14.739 -15.742 -3.374  1.00 0.00 ? 203 LYS A NZ   1 
ATOM 2850 H H    . LYS A 1 203 ? -10.385 -12.555 -4.991  1.00 0.00 ? 203 LYS A H    1 
ATOM 2851 H HA   . LYS A 1 203 ? -11.205 -13.939 -7.458  1.00 0.00 ? 203 LYS A HA   1 
ATOM 2852 H HB2  . LYS A 1 203 ? -13.511 -13.918 -6.474  1.00 0.00 ? 203 LYS A HB2  1 
ATOM 2853 H HB3  . LYS A 1 203 ? -12.357 -14.919 -5.603  1.00 0.00 ? 203 LYS A HB3  1 
ATOM 2854 H HG2  . LYS A 1 203 ? -12.244 -12.357 -4.441  1.00 0.00 ? 203 LYS A HG2  1 
ATOM 2855 H HG3  . LYS A 1 203 ? -13.951 -12.759 -4.643  1.00 0.00 ? 203 LYS A HG3  1 
ATOM 2856 H HD2  . LYS A 1 203 ? -12.369 -14.992 -3.646  1.00 0.00 ? 203 LYS A HD2  1 
ATOM 2857 H HD3  . LYS A 1 203 ? -12.326 -13.587 -2.579  1.00 0.00 ? 203 LYS A HD3  1 
ATOM 2858 H HE2  . LYS A 1 203 ? -14.227 -14.483 -1.767  1.00 0.00 ? 203 LYS A HE2  1 
ATOM 2859 H HE3  . LYS A 1 203 ? -14.953 -13.660 -3.148  1.00 0.00 ? 203 LYS A HE3  1 
ATOM 2860 H HZ1  . LYS A 1 203 ? -13.954 -16.252 -3.827  1.00 0.00 ? 203 LYS A HZ1  1 
ATOM 2861 H HZ2  . LYS A 1 203 ? -15.491 -15.592 -4.076  1.00 0.00 ? 203 LYS A HZ2  1 
ATOM 2862 H HZ3  . LYS A 1 203 ? -15.115 -16.325 -2.599  1.00 0.00 ? 203 LYS A HZ3  1 
ATOM 2863 N N    . GLN A 1 204 ? -11.769 -10.877 -6.464  1.00 0.00 ? 204 GLN A N    1 
ATOM 2864 C CA   . GLN A 1 204 ? -12.143 -9.542  -6.912  1.00 0.00 ? 204 GLN A CA   1 
ATOM 2865 C C    . GLN A 1 204 ? -13.581 -9.516  -7.418  1.00 0.00 ? 204 GLN A C    1 
ATOM 2866 O O    . GLN A 1 204 ? -14.235 -10.555 -7.517  1.00 0.00 ? 204 GLN A O    1 
ATOM 2867 C CB   . GLN A 1 204 ? -11.194 -9.071  -8.013  1.00 0.00 ? 204 GLN A CB   1 
ATOM 2868 C CG   . GLN A 1 204 ? -9.791  -8.770  -7.514  1.00 0.00 ? 204 GLN A CG   1 
ATOM 2869 C CD   . GLN A 1 204 ? -8.945  -10.018 -7.357  1.00 0.00 ? 204 GLN A CD   1 
ATOM 2870 O OE1  . GLN A 1 204 ? -8.499  -10.346 -6.258  1.00 0.00 ? 204 GLN A OE1  1 
ATOM 2871 N NE2  . GLN A 1 204 ? -8.718  -10.722 -8.461  1.00 0.00 ? 204 GLN A NE2  1 
ATOM 2872 H H    . GLN A 1 204 ? -11.388 -10.991 -5.568  1.00 0.00 ? 204 GLN A H    1 
ATOM 2873 H HA   . GLN A 1 204 ? -12.059 -8.875  -6.067  1.00 0.00 ? 204 GLN A HA   1 
ATOM 2874 H HB2  . GLN A 1 204 ? -11.127 -9.839  -8.769  1.00 0.00 ? 204 GLN A HB2  1 
ATOM 2875 H HB3  . GLN A 1 204 ? -11.595 -8.173  -8.458  1.00 0.00 ? 204 GLN A HB3  1 
ATOM 2876 H HG2  . GLN A 1 204 ? -9.305  -8.110  -8.218  1.00 0.00 ? 204 GLN A HG2  1 
ATOM 2877 H HG3  . GLN A 1 204 ? -9.864  -8.281  -6.554  1.00 0.00 ? 204 GLN A HG3  1 
ATOM 2878 H HE21 . GLN A 1 204 ? -9.104  -10.401 -9.302  1.00 0.00 ? 204 GLN A HE21 1 
ATOM 2879 H HE22 . GLN A 1 204 ? -8.173  -11.533 -8.388  1.00 0.00 ? 204 GLN A HE22 1 
ATOM 2880 N N    . TYR A 1 205 ? -14.069 -8.321  -7.736  1.00 0.00 ? 205 TYR A N    1 
ATOM 2881 C CA   . TYR A 1 205 ? -15.429 -8.156  -8.235  1.00 0.00 ? 205 TYR A CA   1 
ATOM 2882 C C    . TYR A 1 205 ? -16.444 -8.806  -7.300  1.00 0.00 ? 205 TYR A C    1 
ATOM 2883 O O    . TYR A 1 205 ? -17.552 -9.147  -7.713  1.00 0.00 ? 205 TYR A O    1 
ATOM 2884 C CB   . TYR A 1 205 ? -15.555 -8.760  -9.634  1.00 0.00 ? 205 TYR A CB   1 
ATOM 2885 C CG   . TYR A 1 205 ? -15.409 -7.747  -10.748 1.00 0.00 ? 205 TYR A CG   1 
ATOM 2886 C CD1  . TYR A 1 205 ? -14.529 -6.679  -10.629 1.00 0.00 ? 205 TYR A CD1  1 
ATOM 2887 C CD2  . TYR A 1 205 ? -16.151 -7.860  -11.917 1.00 0.00 ? 205 TYR A CD2  1 
ATOM 2888 C CE1  . TYR A 1 205 ? -14.393 -5.751  -11.645 1.00 0.00 ? 205 TYR A CE1  1 
ATOM 2889 C CE2  . TYR A 1 205 ? -16.020 -6.936  -12.936 1.00 0.00 ? 205 TYR A CE2  1 
ATOM 2890 C CZ   . TYR A 1 205 ? -15.140 -5.885  -12.795 1.00 0.00 ? 205 TYR A CZ   1 
ATOM 2891 O OH   . TYR A 1 205 ? -15.008 -4.963  -13.808 1.00 0.00 ? 205 TYR A OH   1 
ATOM 2892 H H    . TYR A 1 205 ? -13.498 -7.531  -7.636  1.00 0.00 ? 205 TYR A H    1 
ATOM 2893 H HA   . TYR A 1 205 ? -15.635 -7.097  -8.289  1.00 0.00 ? 205 TYR A HA   1 
ATOM 2894 H HB2  . TYR A 1 205 ? -14.789 -9.509  -9.765  1.00 0.00 ? 205 TYR A HB2  1 
ATOM 2895 H HB3  . TYR A 1 205 ? -16.525 -9.223  -9.730  1.00 0.00 ? 205 TYR A HB3  1 
ATOM 2896 H HD1  . TYR A 1 205 ? -13.945 -6.577  -9.727  1.00 0.00 ? 205 TYR A HD1  1 
ATOM 2897 H HD2  . TYR A 1 205 ? -16.840 -8.685  -12.024 1.00 0.00 ? 205 TYR A HD2  1 
ATOM 2898 H HE1  . TYR A 1 205 ? -13.703 -4.927  -11.534 1.00 0.00 ? 205 TYR A HE1  1 
ATOM 2899 H HE2  . TYR A 1 205 ? -16.606 -7.041  -13.838 1.00 0.00 ? 205 TYR A HE2  1 
ATOM 2900 H HH   . TYR A 1 205 ? -15.872 -4.762  -14.174 1.00 0.00 ? 205 TYR A HH   1 
ATOM 2901 N N    . LEU A 1 206 ? -16.059 -8.978  -6.039  1.00 0.00 ? 206 LEU A N    1 
ATOM 2902 C CA   . LEU A 1 206 ? -16.940 -9.585  -5.047  1.00 0.00 ? 206 LEU A CA   1 
ATOM 2903 C C    . LEU A 1 206 ? -17.538 -10.888 -5.568  1.00 0.00 ? 206 LEU A C    1 
ATOM 2904 O O    . LEU A 1 206 ? -18.612 -11.305 -5.136  1.00 0.00 ? 206 LEU A O    1 
ATOM 2905 C CB   . LEU A 1 206 ? -18.060 -8.613  -4.670  1.00 0.00 ? 206 LEU A CB   1 
ATOM 2906 C CG   . LEU A 1 206 ? -18.875 -9.012  -3.438  1.00 0.00 ? 206 LEU A CG   1 
ATOM 2907 C CD1  . LEU A 1 206 ? -17.953 -9.364  -2.281  1.00 0.00 ? 206 LEU A CD1  1 
ATOM 2908 C CD2  . LEU A 1 206 ? -19.828 -7.894  -3.044  1.00 0.00 ? 206 LEU A CD2  1 
ATOM 2909 H H    . LEU A 1 206 ? -15.165 -8.685  -5.768  1.00 0.00 ? 206 LEU A H    1 
ATOM 2910 H HA   . LEU A 1 206 ? -16.349 -9.800  -4.169  1.00 0.00 ? 206 LEU A HA   1 
ATOM 2911 H HB2  . LEU A 1 206 ? -17.620 -7.644  -4.487  1.00 0.00 ? 206 LEU A HB2  1 
ATOM 2912 H HB3  . LEU A 1 206 ? -18.734 -8.531  -5.510  1.00 0.00 ? 206 LEU A HB3  1 
ATOM 2913 H HG   . LEU A 1 206 ? -19.464 -9.886  -3.673  1.00 0.00 ? 206 LEU A HG   1 
ATOM 2914 H HD11 . LEU A 1 206 ? -18.521 -9.391  -1.363  1.00 0.00 ? 206 LEU A HD11 1 
ATOM 2915 H HD12 . LEU A 1 206 ? -17.175 -8.620  -2.201  1.00 0.00 ? 206 LEU A HD12 1 
ATOM 2916 H HD13 . LEU A 1 206 ? -17.508 -10.332 -2.457  1.00 0.00 ? 206 LEU A HD13 1 
ATOM 2917 H HD21 . LEU A 1 206 ? -20.845 -8.209  -3.225  1.00 0.00 ? 206 LEU A HD21 1 
ATOM 2918 H HD22 . LEU A 1 206 ? -19.613 -7.014  -3.632  1.00 0.00 ? 206 LEU A HD22 1 
ATOM 2919 H HD23 . LEU A 1 206 ? -19.703 -7.667  -1.996  1.00 0.00 ? 206 LEU A HD23 1 
ATOM 2920 N N    . ARG A 1 207 ? -16.836 -11.526 -6.499  1.00 0.00 ? 207 ARG A N    1 
ATOM 2921 C CA   . ARG A 1 207 ? -17.300 -12.782 -7.076  1.00 0.00 ? 207 ARG A CA   1 
ATOM 2922 C C    . ARG A 1 207 ? -17.136 -13.930 -6.085  1.00 0.00 ? 207 ARG A C    1 
ATOM 2923 O O    . ARG A 1 207 ? -16.030 -14.506 -6.026  1.00 0.00 ? 207 ARG A O    1 
ATOM 2924 C CB   . ARG A 1 207 ? -16.532 -13.091 -8.363  1.00 0.00 ? 207 ARG A CB   1 
ATOM 2925 C CG   . ARG A 1 207 ? -16.987 -12.266 -9.556  1.00 0.00 ? 207 ARG A CG   1 
ATOM 2926 C CD   . ARG A 1 207 ? -18.476 -12.431 -9.814  1.00 0.00 ? 207 ARG A CD   1 
ATOM 2927 N NE   . ARG A 1 207 ? -19.272 -11.458 -9.071  1.00 0.00 ? 207 ARG A NE   1 
ATOM 2928 C CZ   . ARG A 1 207 ? -20.595 -11.364 -9.165  1.00 0.00 ? 207 ARG A CZ   1 
ATOM 2929 N NH1  . ARG A 1 207 ? -21.265 -12.180 -9.967  1.00 0.00 ? 207 ARG A NH1  1 
ATOM 2930 N NH2  . ARG A 1 207 ? -21.249 -10.453 -8.457  1.00 0.00 ? 207 ARG A NH2  1 
ATOM 2931 O OXT  . ARG A 1 207 ? -18.115 -14.242 -5.374  1.00 0.00 ? 207 ARG A OXT  1 
ATOM 2932 H H    . ARG A 1 207 ? -15.987 -11.145 -6.804  1.00 0.00 ? 207 ARG A H    1 
ATOM 2933 H HA   . ARG A 1 207 ? -18.349 -12.671 -7.309  1.00 0.00 ? 207 ARG A HA   1 
ATOM 2934 H HB2  . ARG A 1 207 ? -15.483 -12.897 -8.198  1.00 0.00 ? 207 ARG A HB2  1 
ATOM 2935 H HB3  . ARG A 1 207 ? -16.663 -14.136 -8.604  1.00 0.00 ? 207 ARG A HB3  1 
ATOM 2936 H HG2  . ARG A 1 207 ? -16.779 -11.224 -9.362  1.00 0.00 ? 207 ARG A HG2  1 
ATOM 2937 H HG3  . ARG A 1 207 ? -16.443 -12.587 -10.432 1.00 0.00 ? 207 ARG A HG3  1 
ATOM 2938 H HD2  . ARG A 1 207 ? -18.662 -12.302 -10.870 1.00 0.00 ? 207 ARG A HD2  1 
ATOM 2939 H HD3  . ARG A 1 207 ? -18.772 -13.426 -9.516  1.00 0.00 ? 207 ARG A HD3  1 
ATOM 2940 H HE   . ARG A 1 207 ? -18.797 -10.845 -8.472  1.00 0.00 ? 207 ARG A HE   1 
ATOM 2941 H HH11 . ARG A 1 207 ? -20.775 -12.868 -10.502 1.00 0.00 ? 207 ARG A HH11 1 
ATOM 2942 H HH12 . ARG A 1 207 ? -22.259 -12.108 -10.037 1.00 0.00 ? 207 ARG A HH12 1 
ATOM 2943 H HH21 . ARG A 1 207 ? -20.748 -9.836  -7.851  1.00 0.00 ? 207 ARG A HH21 1 
ATOM 2944 H HH22 . ARG A 1 207 ? -22.245 -10.384 -8.530  1.00 0.00 ? 207 ARG A HH22 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASN 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLY 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  ARG 10  10  ?   ?   ?   A . n 
A 1 11  ARG 11  11  ?   ?   ?   A . n 
A 1 12  THR 12  12  ?   ?   ?   A . n 
A 1 13  ARG 13  13  ?   ?   ?   A . n 
A 1 14  VAL 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  GLN 18  18  18  GLN GLN A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  TRP 38  38  38  TRP TRP A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  MET 46  46  46  MET MET A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  MET 66  66  66  MET MET A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 CYS 138 138 138 CYS CYS A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 MET 147 147 147 MET MET A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 GLU 162 162 162 GLU GLU A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 CYS 177 177 177 CYS CYS A . n 
A 1 178 HIS 178 178 178 HIS HIS A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 GLN 196 196 196 GLN GLN A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 TYR 205 205 205 TYR TYR A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-04-06 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 18  ? ? 63.13   158.06  
2  1 GLU A 22  ? ? -166.70 37.04   
3  1 THR A 25  ? ? -152.59 60.52   
4  1 ASN A 32  ? ? 170.10  66.19   
5  1 LEU A 39  ? ? 67.88   -62.45  
6  1 HIS A 40  ? ? -151.71 -81.87  
7  1 GLN A 64  ? ? -45.25  161.39  
8  1 SER A 65  ? ? -172.97 -68.42  
9  1 ARG A 67  ? ? -67.07  82.42   
10 1 ALA A 68  ? ? -124.66 -163.15 
11 1 ASP A 70  ? ? -171.29 84.48   
12 1 THR A 73  ? ? -168.95 31.24   
13 1 VAL A 89  ? ? -119.12 78.81   
14 1 LYS A 93  ? ? 56.98   102.72  
15 1 THR A 96  ? ? -125.48 -164.92 
16 1 ARG A 98  ? ? 61.47   -82.65  
17 1 LYS A 100 ? ? -179.59 93.23   
18 1 ARG A 104 ? ? 60.65   152.60  
19 1 SER A 107 ? ? 74.83   170.72  
20 1 LEU A 110 ? ? 64.06   157.93  
21 1 ARG A 112 ? ? -179.98 138.59  
22 1 LYS A 116 ? ? -42.06  99.73   
23 1 PHE A 117 ? ? 70.95   54.04   
24 1 THR A 128 ? ? -54.42  106.37  
25 1 SER A 130 ? ? -175.33 115.07  
26 1 ALA A 135 ? ? -55.41  107.27  
27 1 LYS A 139 ? ? 72.91   62.65   
28 1 GLN A 140 ? ? -177.28 -170.05 
29 1 SER A 149 ? ? 171.60  -53.98  
30 1 SER A 151 ? ? -168.78 -67.64  
31 1 ASP A 157 ? ? -170.55 58.05   
32 1 THR A 160 ? ? 179.45  67.75   
33 1 ALA A 161 ? ? 67.04   -70.88  
34 1 GLU A 162 ? ? -148.14 45.71   
35 1 ASP A 170 ? ? -177.69 95.57   
36 1 ASN A 173 ? ? 78.45   49.14   
37 1 GLN A 174 ? ? 52.97   103.48  
38 1 ARG A 175 ? ? -133.25 -61.57  
39 1 SER A 192 ? ? 74.36   103.59  
40 1 THR A 193 ? ? -166.47 -52.75  
41 1 GLN A 196 ? ? 175.50  134.02  
42 1 ALA A 197 ? ? -57.35  102.61  
43 1 PHE A 198 ? ? -83.10  -157.00 
44 1 GLU A 199 ? ? 80.49   49.75   
45 1 LEU A 200 ? ? 179.06  106.42  
46 1 GLN A 204 ? ? 52.92   173.96  
47 1 LEU A 206 ? ? 49.57   25.61   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A ASN 2  ? A ASN 2  
3  1 Y 1 A LYS 3  ? A LYS 3  
4  1 Y 1 A LEU 4  ? A LEU 4  
5  1 Y 1 A SER 5  ? A SER 5  
6  1 Y 1 A GLY 6  ? A GLY 6  
7  1 Y 1 A GLY 7  ? A GLY 7  
8  1 Y 1 A GLY 8  ? A GLY 8  
9  1 Y 1 A GLY 9  ? A GLY 9  
10 1 Y 1 A ARG 10 ? A ARG 10 
11 1 Y 1 A ARG 11 ? A ARG 11 
12 1 Y 1 A THR 12 ? A THR 12 
13 1 Y 1 A ARG 13 ? A ARG 13 
14 1 Y 1 A VAL 14 ? A VAL 14 
15 1 Y 1 A GLU 15 ? A GLU 15 
16 1 Y 1 A GLY 16 ? A GLY 16 
#