data_1OZ7
# 
_entry.id   1OZ7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OZ7         
RCSB  RCSB018827   
WWPDB D_1000018827 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ixx 
;Crystal Structure Of Coagulation Factors Ix/X-Binding Protein (Ix/X-Bp) From Venom of Habu Snake With A Heterodimer Of C-Type Lectin Domains
;
unspecified 
PDB 1iod 
'Crystal Structure Of The Complex Between The Coagulation Factor X Binding Protein From Snake Venom and The Gla Domain Of Factor X' 
unspecified 
PDB 1bj3 
;Crystal Structure Of Coagulation Factor Ix-Binding Protein (Ix-Bp) From Venom Of Habu Snake With A Heterodimer Of C- Type Lectin Domains
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OZ7 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jasti, J.'       1 
'Paramasivam, M.' 2 
'Srinivasan, A.'  3 
'Singh, T.P.'     4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of echicetin from Echis carinatus (Indian saw-scaled viper) at 2.4A resolution.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            335 
_citation.page_first                167 
_citation.page_last                 176 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14659748 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2003.10.048 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jasti, J.'       1 
primary 'Paramasivam, M.' 2 
primary 'Srinivasan, A.'  3 
primary 'Singh, T.P.'     4 
# 
_cell.entry_id           1OZ7 
_cell.length_a           37.966 
_cell.length_b           95.258 
_cell.length_c           42.611 
_cell.angle_alpha        90.00 
_cell.angle_beta         112.58 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1OZ7 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'echicetin A-chain' 15382.630 1   ? ? ?                ? 
2 polymer nat 'echicetin B-chain' 14940.817 1   ? ? 'residues 1-123' ? 
3 water   nat water               18.015    142 ? ? ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'echicetin alpha-subunit' 
2 'echicetin beta-subunit'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENIGKMYKIWTGLSERSKEQHCSS
RWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCENTFPFMCKYPVPR
;
;MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENIGKMYKIWTGLSERSKEQHCSS
RWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCENTFPFMCKYPVPR
;
A ? 
2 'polypeptide(L)' no no 
;NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPMLKNDLVWIGLTDYWRDCNWEWS
DGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFVCKCPA
;
;NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPMLKNDLVWIGLTDYWRDCNWEWS
DGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFVCKCPA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   CYS n 
1 3   PRO n 
1 4   PRO n 
1 5   GLY n 
1 6   TRP n 
1 7   SER n 
1 8   SER n 
1 9   ASN n 
1 10  GLY n 
1 11  VAL n 
1 12  TYR n 
1 13  CYS n 
1 14  TYR n 
1 15  MET n 
1 16  LEU n 
1 17  PHE n 
1 18  LYS n 
1 19  GLU n 
1 20  PRO n 
1 21  LYS n 
1 22  THR n 
1 23  TRP n 
1 24  ASP n 
1 25  GLU n 
1 26  ALA n 
1 27  GLU n 
1 28  LYS n 
1 29  PHE n 
1 30  CYS n 
1 31  ASN n 
1 32  LYS n 
1 33  GLN n 
1 34  GLY n 
1 35  LYS n 
1 36  ASP n 
1 37  GLY n 
1 38  HIS n 
1 39  LEU n 
1 40  LEU n 
1 41  SER n 
1 42  ILE n 
1 43  GLU n 
1 44  SER n 
1 45  LYS n 
1 46  LYS n 
1 47  GLU n 
1 48  GLU n 
1 49  ILE n 
1 50  LEU n 
1 51  VAL n 
1 52  ASP n 
1 53  ILE n 
1 54  VAL n 
1 55  VAL n 
1 56  SER n 
1 57  GLU n 
1 58  ASN n 
1 59  ILE n 
1 60  GLY n 
1 61  LYS n 
1 62  MET n 
1 63  TYR n 
1 64  LYS n 
1 65  ILE n 
1 66  TRP n 
1 67  THR n 
1 68  GLY n 
1 69  LEU n 
1 70  SER n 
1 71  GLU n 
1 72  ARG n 
1 73  SER n 
1 74  LYS n 
1 75  GLU n 
1 76  GLN n 
1 77  HIS n 
1 78  CYS n 
1 79  SER n 
1 80  SER n 
1 81  ARG n 
1 82  TRP n 
1 83  SER n 
1 84  ASP n 
1 85  GLY n 
1 86  SER n 
1 87  PHE n 
1 88  PHE n 
1 89  ARG n 
1 90  SER n 
1 91  TYR n 
1 92  GLU n 
1 93  ILE n 
1 94  ALA n 
1 95  ILE n 
1 96  ARG n 
1 97  TYR n 
1 98  SER n 
1 99  GLU n 
1 100 CYS n 
1 101 PHE n 
1 102 VAL n 
1 103 LEU n 
1 104 GLU n 
1 105 LYS n 
1 106 GLN n 
1 107 SER n 
1 108 VAL n 
1 109 PHE n 
1 110 ARG n 
1 111 THR n 
1 112 TRP n 
1 113 VAL n 
1 114 ALA n 
1 115 THR n 
1 116 PRO n 
1 117 CYS n 
1 118 GLU n 
1 119 ASN n 
1 120 THR n 
1 121 PHE n 
1 122 PRO n 
1 123 PHE n 
1 124 MET n 
1 125 CYS n 
1 126 LYS n 
1 127 TYR n 
1 128 PRO n 
1 129 VAL n 
1 130 PRO n 
1 131 ARG n 
2 1   ASN n 
2 2   CYS n 
2 3   LEU n 
2 4   PRO n 
2 5   ASP n 
2 6   TRP n 
2 7   SER n 
2 8   VAL n 
2 9   TYR n 
2 10  GLU n 
2 11  GLY n 
2 12  TYR n 
2 13  CYS n 
2 14  TYR n 
2 15  LYS n 
2 16  VAL n 
2 17  PHE n 
2 18  LYS n 
2 19  GLU n 
2 20  ARG n 
2 21  MET n 
2 22  ASN n 
2 23  TRP n 
2 24  ALA n 
2 25  ASP n 
2 26  ALA n 
2 27  GLU n 
2 28  LYS n 
2 29  PHE n 
2 30  CYS n 
2 31  THR n 
2 32  LYS n 
2 33  GLN n 
2 34  HIS n 
2 35  LYS n 
2 36  ASP n 
2 37  GLY n 
2 38  HIS n 
2 39  LEU n 
2 40  VAL n 
2 41  SER n 
2 42  PHE n 
2 43  ARG n 
2 44  ASN n 
2 45  SER n 
2 46  LYS n 
2 47  GLU n 
2 48  VAL n 
2 49  ASP n 
2 50  PHE n 
2 51  VAL n 
2 52  ILE n 
2 53  SER n 
2 54  LEU n 
2 55  ALA n 
2 56  PHE n 
2 57  PRO n 
2 58  MET n 
2 59  LEU n 
2 60  LYS n 
2 61  ASN n 
2 62  ASP n 
2 63  LEU n 
2 64  VAL n 
2 65  TRP n 
2 66  ILE n 
2 67  GLY n 
2 68  LEU n 
2 69  THR n 
2 70  ASP n 
2 71  TYR n 
2 72  TRP n 
2 73  ARG n 
2 74  ASP n 
2 75  CYS n 
2 76  ASN n 
2 77  TRP n 
2 78  GLU n 
2 79  TRP n 
2 80  SER n 
2 81  ASP n 
2 82  GLY n 
2 83  ALA n 
2 84  GLN n 
2 85  LEU n 
2 86  ASP n 
2 87  TYR n 
2 88  LYS n 
2 89  ALA n 
2 90  TRP n 
2 91  ASP n 
2 92  ASN n 
2 93  GLU n 
2 94  ARG n 
2 95  HIS n 
2 96  CYS n 
2 97  PHE n 
2 98  ILE n 
2 99  TYR n 
2 100 LYS n 
2 101 ASN n 
2 102 THR n 
2 103 ASP n 
2 104 ASN n 
2 105 GLN n 
2 106 TRP n 
2 107 THR n 
2 108 ARG n 
2 109 ARG n 
2 110 ASP n 
2 111 CYS n 
2 112 THR n 
2 113 TRP n 
2 114 THR n 
2 115 PHE n 
2 116 SER n 
2 117 PHE n 
2 118 VAL n 
2 119 CYS n 
2 120 LYS n 
2 121 CYS n 
2 122 PRO n 
2 123 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'saw-scaled viper' 'Echis carinatus' 40353 Echis ? ? ? ? venom ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? 'saw-scaled viper' 'Echis carinatus' 40353 Echis ? ? ? ? venom ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 GB AAP41218 1 
;MCPPGWSSNGVYCYMLFKEPKTWDEAEKFCNKQGKDGHLLSIESKKEEILVDIVVSENIGKMYKIWTGLSERSKEQHCSS
RWSDGSFFRSYEIAIRYSECFVLEKQSVFRTWVATPCENTFPFMCKYPVPR
;
1  32452854 ? 
2 GB AAP41219 2 
;NCLPDWSVYEGYCYKVFKERMNWADAEKFCTKQHKDGHLVSFRNSKEVDFVISLAFPMLKNDLVWIGLTDYWRDCNWEWS
DGAQLDYKAWDNERHCFIYKNTDNQWTRRDCTWTFSFVCKCPA
;
24 32450776 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OZ7 A 1 ? 131 ? 32452854 1  ? 131 ? 1 131 
2 2 1OZ7 B 1 ? 123 ? 32450776 24 ? 146 ? 1 123 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1OZ7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   45.72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
'100mM Sodium acetate, 2.0M Ammonium sulphate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           283 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-06-06 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'osmic mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1OZ7 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   9776 
_reflns.number_all                   9776 
_reflns.percent_possible_obs         95 
_reflns.pdbx_Rmerge_I_obs            0.098 
_reflns.pdbx_Rsym_value              0.098 
_reflns.pdbx_netI_over_sigmaI        9.0 
_reflns.B_iso_Wilson_estimate        32.2 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.50 
_reflns_shell.percent_possible_all   83 
_reflns_shell.Rmerge_I_obs           0.21 
_reflns_shell.pdbx_Rsym_value        0.21 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1254 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OZ7 
_refine.ls_number_reflns_obs                     9372 
_refine.ls_number_reflns_all                     9372 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               375741.41 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_obs                          0.18819 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18539 
_refine.ls_R_factor_R_free                       0.24397 
_refine.ls_R_factor_R_free_error                 0.014 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  462 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.8 
_refine.aniso_B[1][1]                            13.57 
_refine.aniso_B[2][2]                            -13.08 
_refine.aniso_B[3][3]                            -0.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            5.36 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.328191 
_refine.solvent_model_param_bsol                 73.4466 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1bj3 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1OZ7 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.30 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.45 
_refine_analyze.Luzzati_sigma_a_free            0.45 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2083 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             142 
_refine_hist.number_atoms_total               2225 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.014 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      2.95  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.66  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.83  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.69  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.69  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.428 
_refine_ls_shell.d_res_low                        2.490 
_refine_ls_shell.number_reflns_R_work             443 
_refine_ls_shell.R_factor_R_work                  0.206 
_refine_ls_shell.percent_reflns_obs               88.6 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            0.048 
_refine_ls_shell.percent_reflns_R_free            5.6 
_refine_ls_shell.number_reflns_R_free             25 
_refine_ls_shell.number_reflns_obs                1254 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER.PARAM       ION.TOP     'X-RAY DIFFRACTION' 
3 ION.PARAM         WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1OZ7 
_struct.title                     
'Crystal structure of Echicetin from the venom of Indian saw-scaled viper (Echis carinatus) at 2.4 resolution' 
_struct.pdbx_descriptor           echicetin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OZ7 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'platelet aggregation, echicetin, dimer, toxin' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 22  ? GLY A 34  ? THR A 22  GLY A 34  1 ? 13 
HELX_P HELX_P2 2 SER A 44  ? ILE A 59  ? SER A 44  ILE A 59  1 ? 16 
HELX_P HELX_P3 3 LYS A 74  ? CYS A 78  ? LYS A 74  CYS A 78  5 ? 5  
HELX_P HELX_P4 4 GLN A 106 ? VAL A 108 ? GLN A 106 VAL A 108 5 ? 3  
HELX_P HELX_P5 5 ASN B 22  ? HIS B 34  ? ASN B 22  HIS B 34  1 ? 13 
HELX_P HELX_P6 6 LYS B 46  ? LEU B 54  ? LYS B 46  LEU B 54  1 ? 9  
HELX_P HELX_P7 7 ARG B 73  ? CYS B 75  ? ARG B 73  CYS B 75  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 2   SG ? ? ? 1_555 A CYS 13  SG ? ? A CYS 2   A CYS 13  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? A CYS 30  SG ? ? ? 1_555 A CYS 125 SG ? ? A CYS 30  A CYS 125 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf3 disulf ? ? A CYS 78  SG ? ? ? 1_555 B CYS 75  SG ? ? A CYS 78  B CYS 75  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf4 disulf ? ? A CYS 100 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 100 A CYS 117 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf5 disulf ? ? B CYS 2   SG ? ? ? 1_555 B CYS 13  SG ? ? B CYS 2   B CYS 13  1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf6 disulf ? ? B CYS 30  SG ? ? ? 1_555 B CYS 119 SG ? ? B CYS 30  B CYS 119 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf7 disulf ? ? B CYS 96  SG ? ? ? 1_555 B CYS 111 SG ? ? B CYS 96  B CYS 111 1_555 ? ? ? ? ? ? ? 2.025 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 7   ? ASN A 9   ? SER A 7   ASN A 9   
A 2 TYR A 12  ? LYS A 21  ? TYR A 12  LYS A 21  
A 3 PHE A 121 ? TYR A 127 ? PHE A 121 TYR A 127 
A 4 HIS A 38  ? LEU A 39  ? HIS A 38  LEU A 39  
B 1 TRP A 112 ? THR A 115 ? TRP A 112 THR A 115 
B 2 CYS A 100 ? GLU A 104 ? CYS A 100 GLU A 104 
B 3 LYS A 64  ? GLU A 71  ? LYS A 64  GLU A 71  
B 4 TRP B 77  ? TRP B 79  ? TRP B 77  TRP B 79  
C 1 SER B 7   ? TYR B 9   ? SER B 7   TYR B 9   
C 2 TYR B 12  ? MET B 21  ? TYR B 12  MET B 21  
C 3 PHE B 115 ? PRO B 122 ? PHE B 115 PRO B 122 
C 4 HIS B 38  ? LEU B 39  ? HIS B 38  LEU B 39  
D 1 LEU B 63  ? THR B 69  ? LEU B 63  THR B 69  
D 2 CYS B 96  ? LYS B 100 ? CYS B 96  LYS B 100 
D 3 GLN B 105 ? ARG B 109 ? GLN B 105 ARG B 109 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 7   ? N SER A 7   O TYR A 14  ? O TYR A 14  
A 2 3 N MET A 15  ? N MET A 15  O CYS A 125 ? O CYS A 125 
A 3 4 O LYS A 126 ? O LYS A 126 N HIS A 38  ? N HIS A 38  
B 1 2 O THR A 115 ? O THR A 115 N CYS A 100 ? N CYS A 100 
B 2 3 O LEU A 103 ? O LEU A 103 N ILE A 65  ? N ILE A 65  
B 3 4 N SER A 70  ? N SER A 70  O GLU B 78  ? O GLU B 78  
C 1 2 N SER B 7   ? N SER B 7   O TYR B 14  ? O TYR B 14  
C 2 3 N CYS B 13  ? N CYS B 13  O CYS B 121 ? O CYS B 121 
C 3 4 O LYS B 120 ? O LYS B 120 N HIS B 38  ? N HIS B 38  
D 1 2 N VAL B 64  ? N VAL B 64  O TYR B 99  ? O TYR B 99  
D 2 3 N LYS B 100 ? N LYS B 100 O GLN B 105 ? O GLN B 105 
# 
_database_PDB_matrix.entry_id          1OZ7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.0050000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OZ7 
_atom_sites.fract_transf_matrix[1][1]   0.026339 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.010953 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010498 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025416 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 22.776 51.173 45.961  1.00 48.99 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 22.431 52.579 46.322  1.00 49.18 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 21.965 53.311 45.064  1.00 47.35 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 22.713 54.075 44.454  1.00 46.61 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 23.655 53.283 46.918  1.00 51.65 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 23.346 54.543 47.729  1.00 54.20 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 22.554 55.873 46.798  1.00 57.81 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 20.842 55.679 47.310  1.00 54.25 ? 1   MET A CE  1 
ATOM   9    N N   . CYS A 1 2   ? 20.719 53.067 44.681  1.00 44.54 ? 2   CYS A N   1 
ATOM   10   C CA  . CYS A 1 2   ? 20.160 53.692 43.497  1.00 41.14 ? 2   CYS A CA  1 
ATOM   11   C C   . CYS A 1 2   ? 19.223 54.831 43.872  1.00 41.26 ? 2   CYS A C   1 
ATOM   12   O O   . CYS A 1 2   ? 18.648 54.841 44.957  1.00 42.29 ? 2   CYS A O   1 
ATOM   13   C CB  . CYS A 1 2   ? 19.420 52.644 42.666  1.00 37.84 ? 2   CYS A CB  1 
ATOM   14   S SG  . CYS A 1 2   ? 20.502 51.327 42.023  1.00 29.79 ? 2   CYS A SG  1 
ATOM   15   N N   . PRO A 1 3   ? 19.062 55.813 42.973  1.00 41.71 ? 3   PRO A N   1 
ATOM   16   C CA  . PRO A 1 3   ? 18.190 56.965 43.209  1.00 41.47 ? 3   PRO A CA  1 
ATOM   17   C C   . PRO A 1 3   ? 16.781 56.547 43.606  1.00 41.34 ? 3   PRO A C   1 
ATOM   18   O O   . PRO A 1 3   ? 16.417 55.377 43.501  1.00 39.25 ? 3   PRO A O   1 
ATOM   19   C CB  . PRO A 1 3   ? 18.210 57.691 41.866  1.00 40.69 ? 3   PRO A CB  1 
ATOM   20   C CG  . PRO A 1 3   ? 19.568 57.391 41.347  1.00 41.22 ? 3   PRO A CG  1 
ATOM   21   C CD  . PRO A 1 3   ? 19.704 55.914 41.652  1.00 41.74 ? 3   PRO A CD  1 
ATOM   22   N N   . PRO A 1 4   ? 15.970 57.504 44.078  1.00 42.72 ? 4   PRO A N   1 
ATOM   23   C CA  . PRO A 1 4   ? 14.599 57.178 44.476  1.00 43.99 ? 4   PRO A CA  1 
ATOM   24   C C   . PRO A 1 4   ? 13.768 56.740 43.276  1.00 43.14 ? 4   PRO A C   1 
ATOM   25   O O   . PRO A 1 4   ? 13.840 57.350 42.208  1.00 44.19 ? 4   PRO A O   1 
ATOM   26   C CB  . PRO A 1 4   ? 14.096 58.486 45.085  1.00 45.75 ? 4   PRO A CB  1 
ATOM   27   C CG  . PRO A 1 4   ? 15.357 59.103 45.632  1.00 46.21 ? 4   PRO A CG  1 
ATOM   28   C CD  . PRO A 1 4   ? 16.318 58.874 44.491  1.00 44.80 ? 4   PRO A CD  1 
ATOM   29   N N   . GLY A 1 5   ? 12.995 55.676 43.453  1.00 40.76 ? 5   GLY A N   1 
ATOM   30   C CA  . GLY A 1 5   ? 12.157 55.186 42.373  1.00 39.21 ? 5   GLY A CA  1 
ATOM   31   C C   . GLY A 1 5   ? 12.852 54.166 41.494  1.00 36.49 ? 5   GLY A C   1 
ATOM   32   O O   . GLY A 1 5   ? 12.200 53.443 40.743  1.00 37.35 ? 5   GLY A O   1 
ATOM   33   N N   . TRP A 1 6   ? 14.178 54.115 41.578  1.00 32.73 ? 6   TRP A N   1 
ATOM   34   C CA  . TRP A 1 6   ? 14.956 53.171 40.786  1.00 28.80 ? 6   TRP A CA  1 
ATOM   35   C C   . TRP A 1 6   ? 15.182 51.901 41.576  1.00 26.79 ? 6   TRP A C   1 
ATOM   36   O O   . TRP A 1 6   ? 15.168 51.920 42.801  1.00 27.16 ? 6   TRP A O   1 
ATOM   37   C CB  . TRP A 1 6   ? 16.310 53.766 40.408  1.00 25.75 ? 6   TRP A CB  1 
ATOM   38   C CG  . TRP A 1 6   ? 16.229 54.895 39.429  1.00 23.16 ? 6   TRP A CG  1 
ATOM   39   C CD1 . TRP A 1 6   ? 15.681 56.127 39.637  1.00 22.73 ? 6   TRP A CD1 1 
ATOM   40   C CD2 . TRP A 1 6   ? 16.751 54.906 38.097  1.00 20.11 ? 6   TRP A CD2 1 
ATOM   41   N NE1 . TRP A 1 6   ? 15.837 56.909 38.518  1.00 21.01 ? 6   TRP A NE1 1 
ATOM   42   C CE2 . TRP A 1 6   ? 16.491 56.181 37.558  1.00 19.69 ? 6   TRP A CE2 1 
ATOM   43   C CE3 . TRP A 1 6   ? 17.413 53.960 37.307  1.00 18.84 ? 6   TRP A CE3 1 
ATOM   44   C CZ2 . TRP A 1 6   ? 16.871 56.535 36.261  1.00 19.10 ? 6   TRP A CZ2 1 
ATOM   45   C CZ3 . TRP A 1 6   ? 17.790 54.312 36.012  1.00 20.00 ? 6   TRP A CZ3 1 
ATOM   46   C CH2 . TRP A 1 6   ? 17.517 55.587 35.507  1.00 19.48 ? 6   TRP A CH2 1 
ATOM   47   N N   . SER A 1 7   ? 15.391 50.796 40.869  1.00 25.30 ? 7   SER A N   1 
ATOM   48   C CA  . SER A 1 7   ? 15.628 49.513 41.521  1.00 24.53 ? 7   SER A CA  1 
ATOM   49   C C   . SER A 1 7   ? 17.034 49.000 41.251  1.00 22.11 ? 7   SER A C   1 
ATOM   50   O O   . SER A 1 7   ? 17.673 49.386 40.272  1.00 23.40 ? 7   SER A O   1 
ATOM   51   C CB  . SER A 1 7   ? 14.601 48.485 41.051  1.00 21.57 ? 7   SER A CB  1 
ATOM   52   O OG  . SER A 1 7   ? 13.311 48.851 41.489  1.00 25.77 ? 7   SER A OG  1 
ATOM   53   N N   . SER A 1 8   ? 17.505 48.115 42.119  1.00 20.70 ? 8   SER A N   1 
ATOM   54   C CA  . SER A 1 8   ? 18.846 47.561 41.985  1.00 21.63 ? 8   SER A CA  1 
ATOM   55   C C   . SER A 1 8   ? 18.920 46.050 41.749  1.00 18.75 ? 8   SER A C   1 
ATOM   56   O O   . SER A 1 8   ? 18.123 45.268 42.278  1.00 15.05 ? 8   SER A O   1 
ATOM   57   C CB  . SER A 1 8   ? 19.669 47.917 43.224  1.00 23.94 ? 8   SER A CB  1 
ATOM   58   O OG  . SER A 1 8   ? 20.973 47.364 43.135  1.00 32.41 ? 8   SER A OG  1 
ATOM   59   N N   . ASN A 1 9   ? 19.894 45.652 40.941  1.00 18.59 ? 9   ASN A N   1 
ATOM   60   C CA  . ASN A 1 9   ? 20.123 44.246 40.631  1.00 20.41 ? 9   ASN A CA  1 
ATOM   61   C C   . ASN A 1 9   ? 21.545 44.145 40.111  1.00 19.89 ? 9   ASN A C   1 
ATOM   62   O O   . ASN A 1 9   ? 21.964 44.962 39.288  1.00 19.20 ? 9   ASN A O   1 
ATOM   63   C CB  . ASN A 1 9   ? 19.150 43.742 39.559  1.00 19.54 ? 9   ASN A CB  1 
ATOM   64   C CG  . ASN A 1 9   ? 19.405 42.291 39.182  1.00 21.48 ? 9   ASN A CG  1 
ATOM   65   O OD1 . ASN A 1 9   ? 18.962 41.366 39.864  1.00 20.11 ? 9   ASN A OD1 1 
ATOM   66   N ND2 . ASN A 1 9   ? 20.150 42.086 38.101  1.00 18.89 ? 9   ASN A ND2 1 
ATOM   67   N N   . GLY A 1 10  ? 22.287 43.153 40.592  1.00 21.82 ? 10  GLY A N   1 
ATOM   68   C CA  . GLY A 1 10  ? 23.663 42.999 40.158  1.00 26.32 ? 10  GLY A CA  1 
ATOM   69   C C   . GLY A 1 10  ? 24.359 44.349 40.175  1.00 27.64 ? 10  GLY A C   1 
ATOM   70   O O   . GLY A 1 10  ? 24.934 44.772 39.180  1.00 28.42 ? 10  GLY A O   1 
ATOM   71   N N   . VAL A 1 11  ? 24.291 45.037 41.309  1.00 29.13 ? 11  VAL A N   1 
ATOM   72   C CA  . VAL A 1 11  ? 24.910 46.350 41.455  1.00 32.65 ? 11  VAL A CA  1 
ATOM   73   C C   . VAL A 1 11  ? 24.684 47.262 40.245  1.00 33.39 ? 11  VAL A C   1 
ATOM   74   O O   . VAL A 1 11  ? 25.591 47.966 39.796  1.00 34.26 ? 11  VAL A O   1 
ATOM   75   C CB  . VAL A 1 11  ? 26.434 46.234 41.723  1.00 35.82 ? 11  VAL A CB  1 
ATOM   76   C CG1 . VAL A 1 11  ? 27.173 45.764 40.466  1.00 37.64 ? 11  VAL A CG1 1 
ATOM   77   C CG2 . VAL A 1 11  ? 26.976 47.578 42.194  1.00 38.83 ? 11  VAL A CG2 1 
ATOM   78   N N   . TYR A 1 12  ? 23.464 47.232 39.717  1.00 33.22 ? 12  TYR A N   1 
ATOM   79   C CA  . TYR A 1 12  ? 23.070 48.067 38.587  1.00 29.89 ? 12  TYR A CA  1 
ATOM   80   C C   . TYR A 1 12  ? 21.748 48.699 38.985  1.00 27.28 ? 12  TYR A C   1 
ATOM   81   O O   . TYR A 1 12  ? 20.999 48.119 39.770  1.00 25.94 ? 12  TYR A O   1 
ATOM   82   C CB  . TYR A 1 12  ? 22.860 47.216 37.335  1.00 32.53 ? 12  TYR A CB  1 
ATOM   83   C CG  . TYR A 1 12  ? 24.035 47.160 36.388  1.00 35.79 ? 12  TYR A CG  1 
ATOM   84   C CD1 . TYR A 1 12  ? 24.357 48.247 35.579  1.00 37.76 ? 12  TYR A CD1 1 
ATOM   85   C CD2 . TYR A 1 12  ? 24.811 46.008 36.282  1.00 40.17 ? 12  TYR A CD2 1 
ATOM   86   C CE1 . TYR A 1 12  ? 25.425 48.189 34.682  1.00 41.16 ? 12  TYR A CE1 1 
ATOM   87   C CE2 . TYR A 1 12  ? 25.881 45.939 35.391  1.00 43.27 ? 12  TYR A CE2 1 
ATOM   88   C CZ  . TYR A 1 12  ? 26.182 47.031 34.595  1.00 43.77 ? 12  TYR A CZ  1 
ATOM   89   O OH  . TYR A 1 12  ? 27.242 46.960 33.716  1.00 46.56 ? 12  TYR A OH  1 
ATOM   90   N N   . CYS A 1 13  ? 21.462 49.881 38.452  1.00 26.03 ? 13  CYS A N   1 
ATOM   91   C CA  . CYS A 1 13  ? 20.214 50.574 38.747  1.00 24.16 ? 13  CYS A CA  1 
ATOM   92   C C   . CYS A 1 13  ? 19.329 50.483 37.521  1.00 23.84 ? 13  CYS A C   1 
ATOM   93   O O   . CYS A 1 13  ? 19.806 50.652 36.403  1.00 19.32 ? 13  CYS A O   1 
ATOM   94   C CB  . CYS A 1 13  ? 20.479 52.037 39.087  1.00 26.23 ? 13  CYS A CB  1 
ATOM   95   S SG  . CYS A 1 13  ? 21.538 52.267 40.555  1.00 29.99 ? 13  CYS A SG  1 
ATOM   96   N N   . TYR A 1 14  ? 18.041 50.219 37.738  1.00 24.48 ? 14  TYR A N   1 
ATOM   97   C CA  . TYR A 1 14  ? 17.081 50.072 36.649  1.00 24.48 ? 14  TYR A CA  1 
ATOM   98   C C   . TYR A 1 14  ? 15.776 50.792 36.908  1.00 25.17 ? 14  TYR A C   1 
ATOM   99   O O   . TYR A 1 14  ? 15.264 50.794 38.031  1.00 24.36 ? 14  TYR A O   1 
ATOM   100  C CB  . TYR A 1 14  ? 16.686 48.604 36.442  1.00 24.93 ? 14  TYR A CB  1 
ATOM   101  C CG  . TYR A 1 14  ? 17.796 47.604 36.249  1.00 24.96 ? 14  TYR A CG  1 
ATOM   102  C CD1 . TYR A 1 14  ? 18.735 47.365 37.250  1.00 24.81 ? 14  TYR A CD1 1 
ATOM   103  C CD2 . TYR A 1 14  ? 17.866 46.842 35.081  1.00 25.06 ? 14  TYR A CD2 1 
ATOM   104  C CE1 . TYR A 1 14  ? 19.712 46.384 37.093  1.00 26.10 ? 14  TYR A CE1 1 
ATOM   105  C CE2 . TYR A 1 14  ? 18.837 45.866 34.915  1.00 24.64 ? 14  TYR A CE2 1 
ATOM   106  C CZ  . TYR A 1 14  ? 19.755 45.640 35.922  1.00 25.61 ? 14  TYR A CZ  1 
ATOM   107  O OH  . TYR A 1 14  ? 20.708 44.666 35.757  1.00 23.75 ? 14  TYR A OH  1 
ATOM   108  N N   . MET A 1 15  ? 15.215 51.370 35.854  1.00 24.45 ? 15  MET A N   1 
ATOM   109  C CA  . MET A 1 15  ? 13.921 51.999 35.974  1.00 24.29 ? 15  MET A CA  1 
ATOM   110  C C   . MET A 1 15  ? 13.131 51.886 34.683  1.00 23.95 ? 15  MET A C   1 
ATOM   111  O O   . MET A 1 15  ? 13.654 52.095 33.589  1.00 24.41 ? 15  MET A O   1 
ATOM   112  C CB  . MET A 1 15  ? 14.031 53.461 36.374  1.00 26.51 ? 15  MET A CB  1 
ATOM   113  C CG  . MET A 1 15  ? 12.666 54.110 36.510  1.00 29.60 ? 15  MET A CG  1 
ATOM   114  S SD  . MET A 1 15  ? 12.696 55.602 37.502  1.00 43.03 ? 15  MET A SD  1 
ATOM   115  C CE  . MET A 1 15  ? 11.262 55.323 38.586  1.00 35.36 ? 15  MET A CE  1 
ATOM   116  N N   . LEU A 1 16  ? 11.864 51.534 34.827  1.00 22.99 ? 16  LEU A N   1 
ATOM   117  C CA  . LEU A 1 16  ? 10.965 51.416 33.698  1.00 23.17 ? 16  LEU A CA  1 
ATOM   118  C C   . LEU A 1 16  ? 10.233 52.742 33.607  1.00 22.35 ? 16  LEU A C   1 
ATOM   119  O O   . LEU A 1 16  ? 9.741  53.246 34.605  1.00 23.24 ? 16  LEU A O   1 
ATOM   120  C CB  . LEU A 1 16  ? 9.970  50.289 33.941  1.00 23.63 ? 16  LEU A CB  1 
ATOM   121  N N   . PHE A 1 17  ? 10.169 53.311 32.412  1.00 22.90 ? 17  PHE A N   1 
ATOM   122  C CA  . PHE A 1 17  ? 9.482  54.578 32.204  1.00 22.57 ? 17  PHE A CA  1 
ATOM   123  C C   . PHE A 1 17  ? 8.257  54.394 31.332  1.00 24.91 ? 17  PHE A C   1 
ATOM   124  O O   . PHE A 1 17  ? 8.351  53.912 30.203  1.00 24.40 ? 17  PHE A O   1 
ATOM   125  C CB  . PHE A 1 17  ? 10.428 55.572 31.558  1.00 20.99 ? 17  PHE A CB  1 
ATOM   126  C CG  . PHE A 1 17  ? 11.518 56.016 32.469  1.00 23.02 ? 17  PHE A CG  1 
ATOM   127  C CD1 . PHE A 1 17  ? 11.305 57.054 33.368  1.00 21.91 ? 17  PHE A CD1 1 
ATOM   128  C CD2 . PHE A 1 17  ? 12.735 55.349 32.485  1.00 22.30 ? 17  PHE A CD2 1 
ATOM   129  C CE1 . PHE A 1 17  ? 12.283 57.412 34.265  1.00 21.58 ? 17  PHE A CE1 1 
ATOM   130  C CE2 . PHE A 1 17  ? 13.716 55.701 33.380  1.00 20.23 ? 17  PHE A CE2 1 
ATOM   131  C CZ  . PHE A 1 17  ? 13.497 56.729 34.272  1.00 19.76 ? 17  PHE A CZ  1 
ATOM   132  N N   . LYS A 1 18  ? 7.107  54.780 31.874  1.00 27.30 ? 18  LYS A N   1 
ATOM   133  C CA  . LYS A 1 18  ? 5.836  54.671 31.174  1.00 28.96 ? 18  LYS A CA  1 
ATOM   134  C C   . LYS A 1 18  ? 5.645  55.887 30.270  1.00 29.89 ? 18  LYS A C   1 
ATOM   135  O O   . LYS A 1 18  ? 4.645  56.599 30.366  1.00 31.34 ? 18  LYS A O   1 
ATOM   136  C CB  . LYS A 1 18  ? 4.706  54.575 32.203  1.00 29.49 ? 18  LYS A CB  1 
ATOM   137  C CG  . LYS A 1 18  ? 3.333  54.291 31.630  1.00 33.90 ? 18  LYS A CG  1 
ATOM   138  C CD  . LYS A 1 18  ? 3.300  53.040 30.782  1.00 35.47 ? 18  LYS A CD  1 
ATOM   139  C CE  . LYS A 1 18  ? 1.951  52.925 30.060  1.00 40.48 ? 18  LYS A CE  1 
ATOM   140  N NZ  . LYS A 1 18  ? 1.862  51.759 29.133  1.00 39.96 ? 18  LYS A NZ  1 
ATOM   141  N N   . GLU A 1 19  ? 6.620  56.123 29.397  1.00 30.04 ? 19  GLU A N   1 
ATOM   142  C CA  . GLU A 1 19  ? 6.580  57.251 28.470  1.00 32.22 ? 19  GLU A CA  1 
ATOM   143  C C   . GLU A 1 19  ? 6.982  56.752 27.082  1.00 30.94 ? 19  GLU A C   1 
ATOM   144  O O   . GLU A 1 19  ? 8.162  56.593 26.781  1.00 31.12 ? 19  GLU A O   1 
ATOM   145  C CB  . GLU A 1 19  ? 7.556  58.341 28.920  1.00 34.59 ? 19  GLU A CB  1 
ATOM   146  C CG  . GLU A 1 19  ? 7.567  58.604 30.423  1.00 38.42 ? 19  GLU A CG  1 
ATOM   147  C CD  . GLU A 1 19  ? 6.904  59.918 30.805  1.00 42.18 ? 19  GLU A CD  1 
ATOM   148  O OE1 . GLU A 1 19  ? 7.239  60.957 30.191  1.00 40.86 ? 19  GLU A OE1 1 
ATOM   149  O OE2 . GLU A 1 19  ? 6.057  59.910 31.729  1.00 42.26 ? 19  GLU A OE2 1 
ATOM   150  N N   . PRO A 1 20  ? 5.995  56.500 26.215  1.00 31.32 ? 20  PRO A N   1 
ATOM   151  C CA  . PRO A 1 20  ? 6.246  56.011 24.856  1.00 29.78 ? 20  PRO A CA  1 
ATOM   152  C C   . PRO A 1 20  ? 7.210  56.848 24.019  1.00 27.03 ? 20  PRO A C   1 
ATOM   153  O O   . PRO A 1 20  ? 7.015  58.050 23.835  1.00 25.26 ? 20  PRO A O   1 
ATOM   154  C CB  . PRO A 1 20  ? 4.848  55.967 24.244  1.00 31.33 ? 20  PRO A CB  1 
ATOM   155  C CG  . PRO A 1 20  ? 3.976  55.648 25.432  1.00 32.69 ? 20  PRO A CG  1 
ATOM   156  C CD  . PRO A 1 20  ? 4.547  56.579 26.485  1.00 32.68 ? 20  PRO A CD  1 
ATOM   157  N N   . LYS A 1 21  ? 8.256  56.199 23.516  1.00 25.54 ? 21  LYS A N   1 
ATOM   158  C CA  . LYS A 1 21  ? 9.232  56.868 22.670  1.00 25.32 ? 21  LYS A CA  1 
ATOM   159  C C   . LYS A 1 21  ? 9.790  55.906 21.638  1.00 24.66 ? 21  LYS A C   1 
ATOM   160  O O   . LYS A 1 21  ? 9.527  54.699 21.668  1.00 23.21 ? 21  LYS A O   1 
ATOM   161  C CB  . LYS A 1 21  ? 10.410 57.426 23.484  1.00 24.94 ? 21  LYS A CB  1 
ATOM   162  C CG  . LYS A 1 21  ? 10.063 58.448 24.567  1.00 27.15 ? 21  LYS A CG  1 
ATOM   163  C CD  . LYS A 1 21  ? 11.345 59.113 25.083  1.00 27.52 ? 21  LYS A CD  1 
ATOM   164  C CE  . LYS A 1 21  ? 11.135 59.854 26.404  1.00 30.89 ? 21  LYS A CE  1 
ATOM   165  N NZ  . LYS A 1 21  ? 10.161 60.980 26.330  1.00 31.59 ? 21  LYS A NZ  1 
ATOM   166  N N   . THR A 1 22  ? 10.577 56.484 20.742  1.00 25.62 ? 22  THR A N   1 
ATOM   167  C CA  . THR A 1 22  ? 11.282 55.811 19.664  1.00 26.92 ? 22  THR A CA  1 
ATOM   168  C C   . THR A 1 22  ? 12.524 55.159 20.298  1.00 26.91 ? 22  THR A C   1 
ATOM   169  O O   . THR A 1 22  ? 12.976 55.622 21.345  1.00 27.25 ? 22  THR A O   1 
ATOM   170  C CB  . THR A 1 22  ? 11.730 56.887 18.630  1.00 28.91 ? 22  THR A CB  1 
ATOM   171  O OG1 . THR A 1 22  ? 10.643 57.206 17.750  1.00 30.51 ? 22  THR A OG1 1 
ATOM   172  C CG2 . THR A 1 22  ? 12.925 56.416 17.832  1.00 31.67 ? 22  THR A CG2 1 
ATOM   173  N N   . TRP A 1 23  ? 13.079 54.107 19.685  1.00 26.91 ? 23  TRP A N   1 
ATOM   174  C CA  . TRP A 1 23  ? 14.290 53.456 20.232  1.00 28.52 ? 23  TRP A CA  1 
ATOM   175  C C   . TRP A 1 23  ? 15.294 54.552 20.526  1.00 27.74 ? 23  TRP A C   1 
ATOM   176  O O   . TRP A 1 23  ? 15.740 54.703 21.660  1.00 23.00 ? 23  TRP A O   1 
ATOM   177  C CB  . TRP A 1 23  ? 14.904 52.473 19.215  1.00 30.58 ? 23  TRP A CB  1 
ATOM   178  C CG  . TRP A 1 23  ? 16.284 51.792 19.554  1.00 34.92 ? 23  TRP A CG  1 
ATOM   179  C CD1 . TRP A 1 23  ? 16.523 50.440 19.633  1.00 35.72 ? 23  TRP A CD1 1 
ATOM   180  C CD2 . TRP A 1 23  ? 17.593 52.411 19.616  1.00 33.66 ? 23  TRP A CD2 1 
ATOM   181  N NE1 . TRP A 1 23  ? 17.873 50.183 19.711  1.00 30.43 ? 23  TRP A NE1 1 
ATOM   182  C CE2 . TRP A 1 23  ? 18.550 51.372 19.703  1.00 30.49 ? 23  TRP A CE2 1 
ATOM   183  C CE3 . TRP A 1 23  ? 18.047 53.735 19.596  1.00 36.16 ? 23  TRP A CE3 1 
ATOM   184  C CZ2 . TRP A 1 23  ? 19.924 51.623 19.765  1.00 33.18 ? 23  TRP A CZ2 1 
ATOM   185  C CZ3 . TRP A 1 23  ? 19.420 53.981 19.657  1.00 34.50 ? 23  TRP A CZ3 1 
ATOM   186  C CH2 . TRP A 1 23  ? 20.336 52.931 19.739  1.00 34.34 ? 23  TRP A CH2 1 
ATOM   187  N N   . ASP A 1 24  ? 15.616 55.320 19.483  1.00 29.84 ? 24  ASP A N   1 
ATOM   188  C CA  . ASP A 1 24  ? 16.578 56.416 19.543  1.00 31.32 ? 24  ASP A CA  1 
ATOM   189  C C   . ASP A 1 24  ? 16.365 57.426 20.653  1.00 30.50 ? 24  ASP A C   1 
ATOM   190  O O   . ASP A 1 24  ? 17.308 57.786 21.361  1.00 31.58 ? 24  ASP A O   1 
ATOM   191  C CB  . ASP A 1 24  ? 16.597 57.172 18.213  1.00 37.05 ? 24  ASP A CB  1 
ATOM   192  C CG  . ASP A 1 24  ? 17.104 56.329 17.065  1.00 42.00 ? 24  ASP A CG  1 
ATOM   193  O OD1 . ASP A 1 24  ? 17.219 56.873 15.945  1.00 45.03 ? 24  ASP A OD1 1 
ATOM   194  O OD2 . ASP A 1 24  ? 17.385 55.131 17.277  1.00 43.75 ? 24  ASP A OD2 1 
ATOM   195  N N   . GLU A 1 25  ? 15.132 57.896 20.799  1.00 28.38 ? 25  GLU A N   1 
ATOM   196  C CA  . GLU A 1 25  ? 14.824 58.897 21.813  1.00 27.96 ? 25  GLU A CA  1 
ATOM   197  C C   . GLU A 1 25  ? 14.849 58.327 23.223  1.00 26.70 ? 25  GLU A C   1 
ATOM   198  O O   . GLU A 1 25  ? 15.313 58.977 24.152  1.00 28.19 ? 25  GLU A O   1 
ATOM   199  C CB  . GLU A 1 25  ? 13.465 59.540 21.508  1.00 28.98 ? 25  GLU A CB  1 
ATOM   200  C CG  . GLU A 1 25  ? 13.420 60.243 20.147  1.00 29.02 ? 25  GLU A CG  1 
ATOM   201  C CD  . GLU A 1 25  ? 12.019 60.703 19.769  1.00 34.56 ? 25  GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 25  ? 11.069 59.901 19.920  1.00 34.70 ? 25  GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 25  ? 11.867 61.860 19.310  1.00 38.71 ? 25  GLU A OE2 1 
ATOM   204  N N   . ALA A 1 26  ? 14.360 57.107 23.386  1.00 25.00 ? 26  ALA A N   1 
ATOM   205  C CA  . ALA A 1 26  ? 14.360 56.482 24.697  1.00 24.93 ? 26  ALA A CA  1 
ATOM   206  C C   . ALA A 1 26  ? 15.809 56.243 25.112  1.00 25.76 ? 26  ALA A C   1 
ATOM   207  O O   . ALA A 1 26  ? 16.189 56.488 26.261  1.00 22.08 ? 26  ALA A O   1 
ATOM   208  C CB  . ALA A 1 26  ? 13.590 55.162 24.651  1.00 24.91 ? 26  ALA A CB  1 
ATOM   209  N N   . GLU A 1 27  ? 16.611 55.768 24.163  1.00 26.25 ? 27  GLU A N   1 
ATOM   210  C CA  . GLU A 1 27  ? 18.022 55.498 24.407  1.00 28.13 ? 27  GLU A CA  1 
ATOM   211  C C   . GLU A 1 27  ? 18.667 56.798 24.849  1.00 28.77 ? 27  GLU A C   1 
ATOM   212  O O   . GLU A 1 27  ? 19.360 56.849 25.868  1.00 27.96 ? 27  GLU A O   1 
ATOM   213  C CB  . GLU A 1 27  ? 18.681 54.970 23.125  1.00 28.33 ? 27  GLU A CB  1 
ATOM   214  C CG  . GLU A 1 27  ? 20.215 54.878 23.140  1.00 30.38 ? 27  GLU A CG  1 
ATOM   215  C CD  . GLU A 1 27  ? 20.780 53.957 24.222  1.00 33.32 ? 27  GLU A CD  1 
ATOM   216  O OE1 . GLU A 1 27  ? 20.220 52.858 24.446  1.00 35.00 ? 27  GLU A OE1 1 
ATOM   217  O OE2 . GLU A 1 27  ? 21.804 54.327 24.838  1.00 29.18 ? 27  GLU A OE2 1 
ATOM   218  N N   . LYS A 1 28  ? 18.409 57.858 24.090  1.00 29.97 ? 28  LYS A N   1 
ATOM   219  C CA  . LYS A 1 28  ? 18.965 59.171 24.398  1.00 29.80 ? 28  LYS A CA  1 
ATOM   220  C C   . LYS A 1 28  ? 18.527 59.606 25.791  1.00 27.10 ? 28  LYS A C   1 
ATOM   221  O O   . LYS A 1 28  ? 19.325 60.091 26.592  1.00 27.84 ? 28  LYS A O   1 
ATOM   222  C CB  . LYS A 1 28  ? 18.507 60.193 23.351  1.00 31.71 ? 28  LYS A CB  1 
ATOM   223  C CG  . LYS A 1 28  ? 19.095 61.581 23.541  1.00 35.75 ? 28  LYS A CG  1 
ATOM   224  C CD  . LYS A 1 28  ? 20.618 61.537 23.551  1.00 40.79 ? 28  LYS A CD  1 
ATOM   225  C CE  . LYS A 1 28  ? 21.213 62.905 23.849  1.00 44.95 ? 28  LYS A CE  1 
ATOM   226  N NZ  . LYS A 1 28  ? 22.686 62.843 24.094  1.00 48.56 ? 28  LYS A NZ  1 
ATOM   227  N N   . PHE A 1 29  ? 17.247 59.419 26.074  1.00 25.17 ? 29  PHE A N   1 
ATOM   228  C CA  . PHE A 1 29  ? 16.684 59.778 27.362  1.00 23.92 ? 29  PHE A CA  1 
ATOM   229  C C   . PHE A 1 29  ? 17.433 59.101 28.514  1.00 24.13 ? 29  PHE A C   1 
ATOM   230  O O   . PHE A 1 29  ? 17.774 59.747 29.503  1.00 24.16 ? 29  PHE A O   1 
ATOM   231  C CB  . PHE A 1 29  ? 15.203 59.398 27.364  1.00 20.56 ? 29  PHE A CB  1 
ATOM   232  C CG  . PHE A 1 29  ? 14.521 59.572 28.690  1.00 21.16 ? 29  PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 29  ? 14.682 58.632 29.702  1.00 18.75 ? 29  PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 29  ? 13.697 60.666 28.922  1.00 21.78 ? 29  PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 29  ? 14.036 58.778 30.914  1.00 17.17 ? 29  PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 29  ? 13.046 60.816 30.144  1.00 20.35 ? 29  PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 29  ? 13.221 59.866 31.136  1.00 19.56 ? 29  PHE A CZ  1 
ATOM   238  N N   . CYS A 1 30  ? 17.702 57.805 28.376  1.00 26.31 ? 30  CYS A N   1 
ATOM   239  C CA  . CYS A 1 30  ? 18.393 57.044 29.414  1.00 26.42 ? 30  CYS A CA  1 
ATOM   240  C C   . CYS A 1 30  ? 19.821 57.499 29.648  1.00 28.77 ? 30  CYS A C   1 
ATOM   241  O O   . CYS A 1 30  ? 20.355 57.344 30.745  1.00 29.50 ? 30  CYS A O   1 
ATOM   242  C CB  . CYS A 1 30  ? 18.432 55.557 29.069  1.00 25.85 ? 30  CYS A CB  1 
ATOM   243  S SG  . CYS A 1 30  ? 16.850 54.663 29.084  1.00 20.43 ? 30  CYS A SG  1 
ATOM   244  N N   . ASN A 1 31  ? 20.453 58.040 28.615  1.00 30.70 ? 31  ASN A N   1 
ATOM   245  C CA  . ASN A 1 31  ? 21.830 58.482 28.751  1.00 33.48 ? 31  ASN A CA  1 
ATOM   246  C C   . ASN A 1 31  ? 21.908 59.845 29.425  1.00 34.08 ? 31  ASN A C   1 
ATOM   247  O O   . ASN A 1 31  ? 22.998 60.340 29.712  1.00 32.34 ? 31  ASN A O   1 
ATOM   248  C CB  . ASN A 1 31  ? 22.505 58.551 27.386  1.00 34.97 ? 31  ASN A CB  1 
ATOM   249  C CG  . ASN A 1 31  ? 21.986 59.685 26.544  1.00 38.87 ? 31  ASN A CG  1 
ATOM   250  O OD1 . ASN A 1 31  ? 21.935 60.832 26.984  1.00 40.88 ? 31  ASN A OD1 1 
ATOM   251  N ND2 . ASN A 1 31  ? 21.604 59.373 25.315  1.00 45.13 ? 31  ASN A ND2 1 
ATOM   252  N N   . LYS A 1 32  ? 20.751 60.450 29.676  1.00 34.65 ? 32  LYS A N   1 
ATOM   253  C CA  . LYS A 1 32  ? 20.708 61.763 30.318  1.00 35.36 ? 32  LYS A CA  1 
ATOM   254  C C   . LYS A 1 32  ? 20.425 61.671 31.813  1.00 34.54 ? 32  LYS A C   1 
ATOM   255  O O   . LYS A 1 32  ? 20.679 62.619 32.551  1.00 36.07 ? 32  LYS A O   1 
ATOM   256  C CB  . LYS A 1 32  ? 19.635 62.642 29.668  1.00 36.51 ? 32  LYS A CB  1 
ATOM   257  C CG  . LYS A 1 32  ? 19.844 62.932 28.191  1.00 39.03 ? 32  LYS A CG  1 
ATOM   258  C CD  . LYS A 1 32  ? 18.662 63.702 27.623  1.00 41.86 ? 32  LYS A CD  1 
ATOM   259  C CE  . LYS A 1 32  ? 18.789 63.892 26.116  1.00 45.27 ? 32  LYS A CE  1 
ATOM   260  N NZ  . LYS A 1 32  ? 17.579 64.548 25.529  1.00 47.18 ? 32  LYS A NZ  1 
ATOM   261  N N   . GLN A 1 33  ? 19.906 60.530 32.258  1.00 34.48 ? 33  GLN A N   1 
ATOM   262  C CA  . GLN A 1 33  ? 19.568 60.333 33.667  1.00 34.65 ? 33  GLN A CA  1 
ATOM   263  C C   . GLN A 1 33  ? 20.772 60.090 34.570  1.00 35.15 ? 33  GLN A C   1 
ATOM   264  O O   . GLN A 1 33  ? 20.712 60.343 35.772  1.00 36.47 ? 33  GLN A O   1 
ATOM   265  C CB  . GLN A 1 33  ? 18.596 59.161 33.809  1.00 35.82 ? 33  GLN A CB  1 
ATOM   266  C CG  . GLN A 1 33  ? 17.503 59.142 32.755  1.00 35.36 ? 33  GLN A CG  1 
ATOM   267  C CD  . GLN A 1 33  ? 16.840 60.485 32.602  1.00 34.10 ? 33  GLN A CD  1 
ATOM   268  O OE1 . GLN A 1 33  ? 16.285 61.027 33.555  1.00 34.75 ? 33  GLN A OE1 1 
ATOM   269  N NE2 . GLN A 1 33  ? 16.904 61.040 31.400  1.00 31.21 ? 33  GLN A NE2 1 
ATOM   270  N N   . GLY A 1 34  ? 21.857 59.590 33.991  1.00 34.85 ? 34  GLY A N   1 
ATOM   271  C CA  . GLY A 1 34  ? 23.056 59.316 34.762  1.00 35.90 ? 34  GLY A CA  1 
ATOM   272  C C   . GLY A 1 34  ? 24.177 58.936 33.818  1.00 37.27 ? 34  GLY A C   1 
ATOM   273  O O   . GLY A 1 34  ? 23.927 58.333 32.768  1.00 36.20 ? 34  GLY A O   1 
ATOM   274  N N   . LYS A 1 35  ? 25.410 59.279 34.176  1.00 37.72 ? 35  LYS A N   1 
ATOM   275  C CA  . LYS A 1 35  ? 26.536 58.971 33.312  1.00 38.55 ? 35  LYS A CA  1 
ATOM   276  C C   . LYS A 1 35  ? 26.515 57.518 32.871  1.00 39.82 ? 35  LYS A C   1 
ATOM   277  O O   . LYS A 1 35  ? 26.592 56.598 33.684  1.00 39.52 ? 35  LYS A O   1 
ATOM   278  C CB  . LYS A 1 35  ? 27.861 59.290 34.007  1.00 39.40 ? 35  LYS A CB  1 
ATOM   279  C CG  . LYS A 1 35  ? 29.070 59.185 33.082  1.00 39.99 ? 35  LYS A CG  1 
ATOM   280  C CD  . LYS A 1 35  ? 28.849 59.989 31.804  1.00 40.51 ? 35  LYS A CD  1 
ATOM   281  C CE  . LYS A 1 35  ? 30.072 59.967 30.901  1.00 40.02 ? 35  LYS A CE  1 
ATOM   282  N NZ  . LYS A 1 35  ? 31.237 60.662 31.514  1.00 39.12 ? 35  LYS A NZ  1 
ATOM   283  N N   . ASP A 1 36  ? 26.394 57.330 31.564  1.00 41.78 ? 36  ASP A N   1 
ATOM   284  C CA  . ASP A 1 36  ? 26.357 56.013 30.952  1.00 42.85 ? 36  ASP A CA  1 
ATOM   285  C C   . ASP A 1 36  ? 25.079 55.215 31.148  1.00 40.64 ? 36  ASP A C   1 
ATOM   286  O O   . ASP A 1 36  ? 25.094 53.987 31.159  1.00 38.57 ? 36  ASP A O   1 
ATOM   287  C CB  . ASP A 1 36  ? 27.570 55.189 31.377  1.00 47.95 ? 36  ASP A CB  1 
ATOM   288  C CG  . ASP A 1 36  ? 28.769 55.426 30.468  1.00 53.67 ? 36  ASP A CG  1 
ATOM   289  O OD1 . ASP A 1 36  ? 29.264 56.580 30.418  1.00 55.67 ? 36  ASP A OD1 1 
ATOM   290  O OD2 . ASP A 1 36  ? 29.203 54.463 29.793  1.00 55.22 ? 36  ASP A OD2 1 
ATOM   291  N N   . GLY A 1 37  ? 23.963 55.915 31.301  1.00 38.78 ? 37  GLY A N   1 
ATOM   292  C CA  . GLY A 1 37  ? 22.701 55.215 31.412  1.00 35.47 ? 37  GLY A CA  1 
ATOM   293  C C   . GLY A 1 37  ? 22.411 54.808 29.980  1.00 33.20 ? 37  GLY A C   1 
ATOM   294  O O   . GLY A 1 37  ? 22.925 55.434 29.052  1.00 31.98 ? 37  GLY A O   1 
ATOM   295  N N   . HIS A 1 38  ? 21.612 53.766 29.785  1.00 31.21 ? 38  HIS A N   1 
ATOM   296  C CA  . HIS A 1 38  ? 21.272 53.306 28.440  1.00 29.03 ? 38  HIS A CA  1 
ATOM   297  C C   . HIS A 1 38  ? 19.990 52.499 28.500  1.00 26.88 ? 38  HIS A C   1 
ATOM   298  O O   . HIS A 1 38  ? 19.477 52.203 29.580  1.00 25.14 ? 38  HIS A O   1 
ATOM   299  C CB  . HIS A 1 38  ? 22.347 52.366 27.889  1.00 28.33 ? 38  HIS A CB  1 
ATOM   300  C CG  . HIS A 1 38  ? 23.625 53.039 27.510  1.00 30.93 ? 38  HIS A CG  1 
ATOM   301  N ND1 . HIS A 1 38  ? 23.741 53.845 26.400  1.00 32.21 ? 38  HIS A ND1 1 
ATOM   302  C CD2 . HIS A 1 38  ? 24.853 52.999 28.078  1.00 31.17 ? 38  HIS A CD2 1 
ATOM   303  C CE1 . HIS A 1 38  ? 24.986 54.273 26.299  1.00 29.88 ? 38  HIS A CE1 1 
ATOM   304  N NE2 . HIS A 1 38  ? 25.681 53.774 27.306  1.00 29.40 ? 38  HIS A NE2 1 
ATOM   305  N N   . LEU A 1 39  ? 19.484 52.129 27.327  1.00 24.73 ? 39  LEU A N   1 
ATOM   306  C CA  . LEU A 1 39  ? 18.316 51.276 27.275  1.00 22.05 ? 39  LEU A CA  1 
ATOM   307  C C   . LEU A 1 39  ? 18.880 50.022 27.914  1.00 21.84 ? 39  LEU A C   1 
ATOM   308  O O   . LEU A 1 39  ? 20.063 49.727 27.761  1.00 19.41 ? 39  LEU A O   1 
ATOM   309  C CB  . LEU A 1 39  ? 17.908 51.008 25.832  1.00 19.63 ? 39  LEU A CB  1 
ATOM   310  C CG  . LEU A 1 39  ? 17.101 52.138 25.192  1.00 19.78 ? 39  LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 39  ? 16.932 51.874 23.713  1.00 14.43 ? 39  LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 39  ? 15.746 52.250 25.895  1.00 16.48 ? 39  LEU A CD2 1 
ATOM   313  N N   . LEU A 1 40  ? 18.049 49.294 28.643  1.00 21.46 ? 40  LEU A N   1 
ATOM   314  C CA  . LEU A 1 40  ? 18.515 48.105 29.330  1.00 19.44 ? 40  LEU A CA  1 
ATOM   315  C C   . LEU A 1 40  ? 19.055 47.010 28.433  1.00 18.62 ? 40  LEU A C   1 
ATOM   316  O O   . LEU A 1 40  ? 18.481 46.702 27.391  1.00 18.20 ? 40  LEU A O   1 
ATOM   317  C CB  . LEU A 1 40  ? 17.400 47.543 30.200  1.00 17.67 ? 40  LEU A CB  1 
ATOM   318  N N   . SER A 1 41  ? 20.187 46.445 28.840  1.00 18.13 ? 41  SER A N   1 
ATOM   319  C CA  . SER A 1 41  ? 20.774 45.314 28.137  1.00 18.08 ? 41  SER A CA  1 
ATOM   320  C C   . SER A 1 41  ? 20.408 44.161 29.080  1.00 17.07 ? 41  SER A C   1 
ATOM   321  O O   . SER A 1 41  ? 20.255 44.372 30.289  1.00 14.64 ? 41  SER A O   1 
ATOM   322  C CB  . SER A 1 41  ? 22.293 45.462 28.022  1.00 22.24 ? 41  SER A CB  1 
ATOM   323  O OG  . SER A 1 41  ? 22.907 45.525 29.298  1.00 28.57 ? 41  SER A OG  1 
ATOM   324  N N   . ILE A 1 42  ? 20.241 42.963 28.534  1.00 17.10 ? 42  ILE A N   1 
ATOM   325  C CA  . ILE A 1 42  ? 19.861 41.796 29.322  1.00 17.80 ? 42  ILE A CA  1 
ATOM   326  C C   . ILE A 1 42  ? 20.928 40.743 29.145  1.00 19.06 ? 42  ILE A C   1 
ATOM   327  O O   . ILE A 1 42  ? 21.083 40.177 28.068  1.00 20.82 ? 42  ILE A O   1 
ATOM   328  C CB  . ILE A 1 42  ? 18.507 41.238 28.847  1.00 18.55 ? 42  ILE A CB  1 
ATOM   329  C CG1 . ILE A 1 42  ? 17.463 42.355 28.868  1.00 19.57 ? 42  ILE A CG1 1 
ATOM   330  C CG2 . ILE A 1 42  ? 18.057 40.075 29.747  1.00 15.65 ? 42  ILE A CG2 1 
ATOM   331  C CD1 . ILE A 1 42  ? 17.227 42.933 30.235  1.00 23.38 ? 42  ILE A CD1 1 
ATOM   332  N N   . GLU A 1 43  ? 21.656 40.459 30.212  1.00 20.91 ? 43  GLU A N   1 
ATOM   333  C CA  . GLU A 1 43  ? 22.747 39.508 30.109  1.00 23.06 ? 43  GLU A CA  1 
ATOM   334  C C   . GLU A 1 43  ? 22.590 38.148 30.767  1.00 22.54 ? 43  GLU A C   1 
ATOM   335  O O   . GLU A 1 43  ? 23.513 37.337 30.712  1.00 23.38 ? 43  GLU A O   1 
ATOM   336  C CB  . GLU A 1 43  ? 24.026 40.182 30.587  1.00 25.07 ? 43  GLU A CB  1 
ATOM   337  C CG  . GLU A 1 43  ? 24.526 41.257 29.620  1.00 27.90 ? 43  GLU A CG  1 
ATOM   338  C CD  . GLU A 1 43  ? 25.753 41.972 30.143  1.00 34.11 ? 43  GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 43  ? 25.594 42.930 30.927  1.00 37.59 ? 43  GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 43  ? 26.879 41.563 29.784  1.00 36.01 ? 43  GLU A OE2 1 
ATOM   341  N N   . SER A 1 44  ? 21.434 37.885 31.376  1.00 20.50 ? 44  SER A N   1 
ATOM   342  C CA  . SER A 1 44  ? 21.199 36.590 31.993  1.00 17.64 ? 44  SER A CA  1 
ATOM   343  C C   . SER A 1 44  ? 19.720 36.313 32.208  1.00 17.59 ? 44  SER A C   1 
ATOM   344  O O   . SER A 1 44  ? 18.897 37.229 32.220  1.00 19.16 ? 44  SER A O   1 
ATOM   345  C CB  . SER A 1 44  ? 21.945 36.490 33.325  1.00 16.45 ? 44  SER A CB  1 
ATOM   346  O OG  . SER A 1 44  ? 21.387 37.355 34.295  1.00 16.43 ? 44  SER A OG  1 
ATOM   347  N N   . LYS A 1 45  ? 19.387 35.037 32.370  1.00 18.69 ? 45  LYS A N   1 
ATOM   348  C CA  . LYS A 1 45  ? 18.008 34.631 32.591  1.00 22.83 ? 45  LYS A CA  1 
ATOM   349  C C   . LYS A 1 45  ? 17.522 35.297 33.873  1.00 21.94 ? 45  LYS A C   1 
ATOM   350  O O   . LYS A 1 45  ? 16.364 35.710 33.982  1.00 21.75 ? 45  LYS A O   1 
ATOM   351  C CB  . LYS A 1 45  ? 17.930 33.107 32.713  1.00 27.69 ? 45  LYS A CB  1 
ATOM   352  C CG  . LYS A 1 45  ? 16.519 32.532 32.714  1.00 35.54 ? 45  LYS A CG  1 
ATOM   353  C CD  . LYS A 1 45  ? 15.772 32.825 34.009  1.00 40.49 ? 45  LYS A CD  1 
ATOM   354  C CE  . LYS A 1 45  ? 16.429 32.144 35.202  1.00 43.97 ? 45  LYS A CE  1 
ATOM   355  N NZ  . LYS A 1 45  ? 15.740 32.489 36.477  1.00 47.03 ? 45  LYS A NZ  1 
ATOM   356  N N   . LYS A 1 46  ? 18.424 35.405 34.841  1.00 18.98 ? 46  LYS A N   1 
ATOM   357  C CA  . LYS A 1 46  ? 18.102 36.032 36.114  1.00 20.66 ? 46  LYS A CA  1 
ATOM   358  C C   . LYS A 1 46  ? 17.789 37.507 35.898  1.00 19.45 ? 46  LYS A C   1 
ATOM   359  O O   . LYS A 1 46  ? 16.817 38.021 36.435  1.00 18.75 ? 46  LYS A O   1 
ATOM   360  C CB  . LYS A 1 46  ? 19.279 35.900 37.084  1.00 24.47 ? 46  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 46  ? 19.084 36.643 38.388  1.00 26.52 ? 46  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 46  ? 18.097 35.924 39.285  1.00 29.77 ? 46  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 46  ? 18.762 34.769 39.998  1.00 31.02 ? 46  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 46  ? 19.851 35.265 40.884  1.00 31.78 ? 46  LYS A NZ  1 
ATOM   365  N N   . GLU A 1 47  ? 18.616 38.192 35.114  1.00 19.49 ? 47  GLU A N   1 
ATOM   366  C CA  . GLU A 1 47  ? 18.377 39.604 34.861  1.00 19.61 ? 47  GLU A CA  1 
ATOM   367  C C   . GLU A 1 47  ? 17.092 39.769 34.037  1.00 18.97 ? 47  GLU A C   1 
ATOM   368  O O   . GLU A 1 47  ? 16.237 40.599 34.362  1.00 17.67 ? 47  GLU A O   1 
ATOM   369  C CB  . GLU A 1 47  ? 19.557 40.238 34.121  1.00 17.98 ? 47  GLU A CB  1 
ATOM   370  C CG  . GLU A 1 47  ? 19.508 41.765 34.158  1.00 15.22 ? 47  GLU A CG  1 
ATOM   371  C CD  . GLU A 1 47  ? 20.622 42.417 33.375  1.00 14.36 ? 47  GLU A CD  1 
ATOM   372  O OE1 . GLU A 1 47  ? 20.725 43.660 33.408  1.00 20.27 ? 47  GLU A OE1 1 
ATOM   373  O OE2 . GLU A 1 47  ? 21.393 41.700 32.719  1.00 9.92  ? 47  GLU A OE2 1 
ATOM   374  N N   . GLU A 1 48  ? 16.967 38.971 32.979  1.00 17.87 ? 48  GLU A N   1 
ATOM   375  C CA  . GLU A 1 48  ? 15.783 39.003 32.115  1.00 18.83 ? 48  GLU A CA  1 
ATOM   376  C C   . GLU A 1 48  ? 14.554 38.948 32.998  1.00 19.28 ? 48  GLU A C   1 
ATOM   377  O O   . GLU A 1 48  ? 13.545 39.617 32.751  1.00 16.46 ? 48  GLU A O   1 
ATOM   378  C CB  . GLU A 1 48  ? 15.790 37.803 31.178  1.00 16.19 ? 48  GLU A CB  1 
ATOM   379  N N   . ILE A 1 49  ? 14.660 38.134 34.042  1.00 20.85 ? 49  ILE A N   1 
ATOM   380  C CA  . ILE A 1 49  ? 13.582 37.958 34.991  1.00 21.59 ? 49  ILE A CA  1 
ATOM   381  C C   . ILE A 1 49  ? 13.389 39.178 35.891  1.00 21.91 ? 49  ILE A C   1 
ATOM   382  O O   . ILE A 1 49  ? 12.261 39.548 36.193  1.00 22.51 ? 49  ILE A O   1 
ATOM   383  C CB  . ILE A 1 49  ? 13.827 36.677 35.814  1.00 23.56 ? 49  ILE A CB  1 
ATOM   384  C CG1 . ILE A 1 49  ? 13.011 35.533 35.215  1.00 20.61 ? 49  ILE A CG1 1 
ATOM   385  C CG2 . ILE A 1 49  ? 13.516 36.900 37.275  1.00 27.58 ? 49  ILE A CG2 1 
ATOM   386  C CD1 . ILE A 1 49  ? 13.352 34.202 35.788  1.00 21.58 ? 49  ILE A CD1 1 
ATOM   387  N N   . LEU A 1 50  ? 14.477 39.818 36.301  1.00 21.24 ? 50  LEU A N   1 
ATOM   388  C CA  . LEU A 1 50  ? 14.366 40.999 37.164  1.00 22.18 ? 50  LEU A CA  1 
ATOM   389  C C   . LEU A 1 50  ? 13.763 42.196 36.417  1.00 23.10 ? 50  LEU A C   1 
ATOM   390  O O   . LEU A 1 50  ? 13.181 43.088 37.030  1.00 22.51 ? 50  LEU A O   1 
ATOM   391  C CB  . LEU A 1 50  ? 15.750 41.353 37.740  1.00 18.47 ? 50  LEU A CB  1 
ATOM   392  C CG  . LEU A 1 50  ? 16.083 42.662 38.469  1.00 15.42 ? 50  LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 50  ? 16.079 43.809 37.484  1.00 14.72 ? 50  LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 50  ? 15.128 42.920 39.611  1.00 14.24 ? 50  LEU A CD2 1 
ATOM   395  N N   . VAL A 1 51  ? 13.896 42.206 35.094  1.00 23.35 ? 51  VAL A N   1 
ATOM   396  C CA  . VAL A 1 51  ? 13.359 43.294 34.279  1.00 23.10 ? 51  VAL A CA  1 
ATOM   397  C C   . VAL A 1 51  ? 11.861 43.152 33.954  1.00 23.59 ? 51  VAL A C   1 
ATOM   398  O O   . VAL A 1 51  ? 11.106 44.118 34.076  1.00 23.81 ? 51  VAL A O   1 
ATOM   399  C CB  . VAL A 1 51  ? 14.124 43.424 32.945  1.00 21.27 ? 51  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 51  ? 13.507 44.539 32.105  1.00 21.66 ? 51  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 51  ? 15.583 43.718 33.210  1.00 23.04 ? 51  VAL A CG2 1 
ATOM   402  N N   . ASP A 1 52  ? 11.435 41.965 33.527  1.00 24.25 ? 52  ASP A N   1 
ATOM   403  C CA  . ASP A 1 52  ? 10.027 41.757 33.196  1.00 25.40 ? 52  ASP A CA  1 
ATOM   404  C C   . ASP A 1 52  ? 9.148  42.071 34.396  1.00 26.09 ? 52  ASP A C   1 
ATOM   405  O O   . ASP A 1 52  ? 8.062  42.644 34.249  1.00 25.00 ? 52  ASP A O   1 
ATOM   406  C CB  . ASP A 1 52  ? 9.788  40.331 32.751  1.00 25.22 ? 52  ASP A CB  1 
ATOM   407  N N   . ILE A 1 53  ? 9.639  41.699 35.579  1.00 25.56 ? 53  ILE A N   1 
ATOM   408  C CA  . ILE A 1 53  ? 8.922  41.918 36.820  1.00 27.04 ? 53  ILE A CA  1 
ATOM   409  C C   . ILE A 1 53  ? 8.912  43.393 37.192  1.00 26.39 ? 53  ILE A C   1 
ATOM   410  O O   . ILE A 1 53  ? 7.975  43.861 37.849  1.00 25.60 ? 53  ILE A O   1 
ATOM   411  C CB  . ILE A 1 53  ? 9.544  41.093 37.972  1.00 29.24 ? 53  ILE A CB  1 
ATOM   412  C CG1 . ILE A 1 53  ? 8.801  41.375 39.280  1.00 32.05 ? 53  ILE A CG1 1 
ATOM   413  C CG2 . ILE A 1 53  ? 11.024 41.421 38.110  1.00 33.24 ? 53  ILE A CG2 1 
ATOM   414  C CD1 . ILE A 1 53  ? 9.364  40.633 40.478  1.00 36.80 ? 53  ILE A CD1 1 
ATOM   415  N N   . VAL A 1 54  ? 9.945  44.132 36.790  1.00 24.83 ? 54  VAL A N   1 
ATOM   416  C CA  . VAL A 1 54  ? 9.965  45.559 37.093  1.00 25.16 ? 54  VAL A CA  1 
ATOM   417  C C   . VAL A 1 54  ? 9.038  46.224 36.073  1.00 24.88 ? 54  VAL A C   1 
ATOM   418  O O   . VAL A 1 54  ? 8.479  47.290 36.321  1.00 24.25 ? 54  VAL A O   1 
ATOM   419  C CB  . VAL A 1 54  ? 11.401 46.172 37.002  1.00 25.09 ? 54  VAL A CB  1 
ATOM   420  C CG1 . VAL A 1 54  ? 11.625 46.836 35.649  1.00 27.66 ? 54  VAL A CG1 1 
ATOM   421  C CG2 . VAL A 1 54  ? 11.605 47.190 38.121  1.00 23.03 ? 54  VAL A CG2 1 
ATOM   422  N N   . VAL A 1 55  ? 8.882  45.588 34.917  1.00 24.34 ? 55  VAL A N   1 
ATOM   423  C CA  . VAL A 1 55  ? 7.994  46.113 33.889  1.00 25.30 ? 55  VAL A CA  1 
ATOM   424  C C   . VAL A 1 55  ? 6.569  45.860 34.368  1.00 27.01 ? 55  VAL A C   1 
ATOM   425  O O   . VAL A 1 55  ? 5.731  46.758 34.377  1.00 25.42 ? 55  VAL A O   1 
ATOM   426  C CB  . VAL A 1 55  ? 8.174  45.384 32.530  1.00 25.54 ? 55  VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 55  ? 7.049  45.796 31.570  1.00 24.08 ? 55  VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 55  ? 9.530  45.719 31.920  1.00 23.61 ? 55  VAL A CG2 1 
ATOM   429  N N   . SER A 1 56  ? 6.327  44.622 34.783  1.00 27.86 ? 56  SER A N   1 
ATOM   430  C CA  . SER A 1 56  ? 5.035  44.167 35.266  1.00 30.82 ? 56  SER A CA  1 
ATOM   431  C C   . SER A 1 56  ? 4.409  44.992 36.386  1.00 33.71 ? 56  SER A C   1 
ATOM   432  O O   . SER A 1 56  ? 3.185  45.029 36.524  1.00 32.67 ? 56  SER A O   1 
ATOM   433  C CB  . SER A 1 56  ? 5.163  42.721 35.747  1.00 30.07 ? 56  SER A CB  1 
ATOM   434  O OG  . SER A 1 56  ? 5.698  41.895 34.732  1.00 31.36 ? 56  SER A OG  1 
ATOM   435  N N   . GLU A 1 57  ? 5.244  45.655 37.177  1.00 36.73 ? 57  GLU A N   1 
ATOM   436  C CA  . GLU A 1 57  ? 4.772  46.428 38.321  1.00 39.81 ? 57  GLU A CA  1 
ATOM   437  C C   . GLU A 1 57  ? 4.729  47.941 38.171  1.00 39.34 ? 57  GLU A C   1 
ATOM   438  O O   . GLU A 1 57  ? 3.958  48.609 38.862  1.00 39.58 ? 57  GLU A O   1 
ATOM   439  C CB  . GLU A 1 57  ? 5.636  46.073 39.543  1.00 43.70 ? 57  GLU A CB  1 
ATOM   440  C CG  . GLU A 1 57  ? 5.687  47.134 40.644  1.00 48.99 ? 57  GLU A CG  1 
ATOM   441  C CD  . GLU A 1 57  ? 6.743  46.835 41.703  1.00 54.21 ? 57  GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 57  ? 6.961  47.687 42.593  1.00 54.66 ? 57  GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 57  ? 7.357  45.747 41.646  1.00 54.79 ? 57  GLU A OE2 1 
ATOM   444  N N   . ASN A 1 58  ? 5.540  48.487 37.274  1.00 39.41 ? 58  ASN A N   1 
ATOM   445  C CA  . ASN A 1 58  ? 5.608  49.937 37.120  1.00 38.97 ? 58  ASN A CA  1 
ATOM   446  C C   . ASN A 1 58  ? 5.083  50.524 35.820  1.00 38.47 ? 58  ASN A C   1 
ATOM   447  O O   . ASN A 1 58  ? 4.889  51.737 35.712  1.00 37.70 ? 58  ASN A O   1 
ATOM   448  C CB  . ASN A 1 58  ? 7.053  50.380 37.349  1.00 39.31 ? 58  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 58  ? 7.539  50.046 38.750  1.00 39.66 ? 58  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 58  ? 7.266  50.777 39.703  1.00 41.75 ? 58  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 58  ? 8.236  48.923 38.884  1.00 39.20 ? 58  ASN A ND2 1 
ATOM   452  N N   . ILE A 1 59  ? 4.851  49.675 34.831  1.00 38.67 ? 59  ILE A N   1 
ATOM   453  C CA  . ILE A 1 59  ? 4.333  50.152 33.560  1.00 40.06 ? 59  ILE A CA  1 
ATOM   454  C C   . ILE A 1 59  ? 2.883  49.725 33.367  1.00 40.46 ? 59  ILE A C   1 
ATOM   455  O O   . ILE A 1 59  ? 2.569  48.534 33.344  1.00 38.71 ? 59  ILE A O   1 
ATOM   456  C CB  . ILE A 1 59  ? 5.220  49.652 32.390  1.00 40.31 ? 59  ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 59  ? 6.557  50.408 32.422  1.00 37.96 ? 59  ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 59  ? 4.506  49.840 31.053  1.00 38.62 ? 59  ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 59  ? 7.591  49.874 31.474  1.00 38.18 ? 59  ILE A CD1 1 
ATOM   460  N N   . GLY A 1 60  ? 1.911  50.716 33.240  1.00 43.13 ? 60  GLY A N   1 
ATOM   461  C CA  . GLY A 1 60  ? 0.429  50.488 32.993  1.00 44.71 ? 60  GLY A CA  1 
ATOM   462  C C   . GLY A 1 60  ? 0.310  50.005 31.534  1.00 46.30 ? 60  GLY A C   1 
ATOM   463  O O   . GLY A 1 60  ? 0.554  50.758 30.599  1.00 45.10 ? 60  GLY A O   1 
ATOM   464  N N   . LYS A 1 61  ? -0.312 48.955 31.157  1.00 47.70 ? 61  LYS A N   1 
ATOM   465  C CA  . LYS A 1 61  ? -0.071 47.929 30.122  1.00 48.74 ? 61  LYS A CA  1 
ATOM   466  C C   . LYS A 1 61  ? 0.364  48.509 28.762  1.00 48.69 ? 61  LYS A C   1 
ATOM   467  O O   . LYS A 1 61  ? -0.062 49.599 28.373  1.00 49.08 ? 61  LYS A O   1 
ATOM   468  C CB  . LYS A 1 61  ? -1.445 47.236 29.939  1.00 50.87 ? 61  LYS A CB  1 
ATOM   469  C CG  . LYS A 1 61  ? -1.769 46.221 30.922  1.00 51.45 ? 61  LYS A CG  1 
ATOM   470  C CD  . LYS A 1 61  ? -2.007 46.783 32.316  1.00 53.35 ? 61  LYS A CD  1 
ATOM   471  C CE  . LYS A 1 61  ? -2.431 45.681 33.265  1.00 54.33 ? 61  LYS A CE  1 
ATOM   472  N NZ  . LYS A 1 61  ? -2.000 44.335 32.783  1.00 54.68 ? 61  LYS A NZ  1 
ATOM   473  N N   . MET A 1 62  ? 1.063  47.833 28.029  1.00 47.18 ? 62  MET A N   1 
ATOM   474  C CA  . MET A 1 62  ? 1.569  48.138 26.707  1.00 44.22 ? 62  MET A CA  1 
ATOM   475  C C   . MET A 1 62  ? 2.066  46.802 26.139  1.00 42.62 ? 62  MET A C   1 
ATOM   476  O O   . MET A 1 62  ? 2.450  45.923 26.902  1.00 43.76 ? 62  MET A O   1 
ATOM   477  C CB  . MET A 1 62  ? 2.687  49.164 26.744  1.00 43.58 ? 62  MET A CB  1 
ATOM   478  N N   . TYR A 1 63  ? 2.075  46.643 24.818  1.00 39.93 ? 63  TYR A N   1 
ATOM   479  C CA  . TYR A 1 63  ? 2.482  45.373 24.214  1.00 38.71 ? 63  TYR A CA  1 
ATOM   480  C C   . TYR A 1 63  ? 3.983  45.156 24.051  1.00 36.25 ? 63  TYR A C   1 
ATOM   481  O O   . TYR A 1 63  ? 4.451  44.020 23.958  1.00 35.13 ? 63  TYR A O   1 
ATOM   482  C CB  . TYR A 1 63  ? 1.800  45.197 22.853  1.00 43.55 ? 63  TYR A CB  1 
ATOM   483  C CG  . TYR A 1 63  ? 0.315  45.492 22.873  1.00 48.31 ? 63  TYR A CG  1 
ATOM   484  C CD1 . TYR A 1 63  ? -0.527 44.880 23.801  1.00 51.24 ? 63  TYR A CD1 1 
ATOM   485  C CD2 . TYR A 1 63  ? -0.247 46.393 21.970  1.00 51.56 ? 63  TYR A CD2 1 
ATOM   486  C CE1 . TYR A 1 63  ? -1.891 45.160 23.830  1.00 54.85 ? 63  TYR A CE1 1 
ATOM   487  C CE2 . TYR A 1 63  ? -1.609 46.682 21.989  1.00 54.91 ? 63  TYR A CE2 1 
ATOM   488  C CZ  . TYR A 1 63  ? -2.426 46.062 22.920  1.00 56.58 ? 63  TYR A CZ  1 
ATOM   489  O OH  . TYR A 1 63  ? -3.775 46.339 22.936  1.00 59.32 ? 63  TYR A OH  1 
ATOM   490  N N   . LYS A 1 64  ? 4.741  46.240 24.016  1.00 33.61 ? 64  LYS A N   1 
ATOM   491  C CA  . LYS A 1 64  ? 6.180  46.134 23.859  1.00 29.91 ? 64  LYS A CA  1 
ATOM   492  C C   . LYS A 1 64  ? 6.915  47.134 24.740  1.00 29.06 ? 64  LYS A C   1 
ATOM   493  O O   . LYS A 1 64  ? 6.377  48.186 25.088  1.00 28.16 ? 64  LYS A O   1 
ATOM   494  C CB  . LYS A 1 64  ? 6.571  46.373 22.400  1.00 31.27 ? 64  LYS A CB  1 
ATOM   495  C CG  . LYS A 1 64  ? 6.629  45.136 21.528  1.00 31.59 ? 64  LYS A CG  1 
ATOM   496  C CD  . LYS A 1 64  ? 5.278  44.657 21.029  1.00 32.55 ? 64  LYS A CD  1 
ATOM   497  C CE  . LYS A 1 64  ? 5.471  43.386 20.194  1.00 34.27 ? 64  LYS A CE  1 
ATOM   498  N NZ  . LYS A 1 64  ? 4.201  42.805 19.664  1.00 32.23 ? 64  LYS A NZ  1 
ATOM   499  N N   . ILE A 1 65  ? 8.143  46.779 25.109  1.00 26.61 ? 65  ILE A N   1 
ATOM   500  C CA  . ILE A 1 65  ? 9.005  47.629 25.923  1.00 24.20 ? 65  ILE A CA  1 
ATOM   501  C C   . ILE A 1 65  ? 10.390 47.607 25.282  1.00 22.36 ? 65  ILE A C   1 
ATOM   502  O O   . ILE A 1 65  ? 10.917 46.553 24.958  1.00 22.70 ? 65  ILE A O   1 
ATOM   503  C CB  . ILE A 1 65  ? 9.121  47.124 27.389  1.00 24.70 ? 65  ILE A CB  1 
ATOM   504  C CG1 . ILE A 1 65  ? 7.819  47.375 28.160  1.00 26.00 ? 65  ILE A CG1 1 
ATOM   505  C CG2 . ILE A 1 65  ? 10.223 47.876 28.109  1.00 21.40 ? 65  ILE A CG2 1 
ATOM   506  C CD1 . ILE A 1 65  ? 6.617  46.636 27.642  1.00 28.46 ? 65  ILE A CD1 1 
ATOM   507  N N   . TRP A 1 66  ? 10.970 48.784 25.102  1.00 21.78 ? 66  TRP A N   1 
ATOM   508  C CA  . TRP A 1 66  ? 12.286 48.917 24.496  1.00 21.57 ? 66  TRP A CA  1 
ATOM   509  C C   . TRP A 1 66  ? 13.468 48.486 25.375  1.00 22.07 ? 66  TRP A C   1 
ATOM   510  O O   . TRP A 1 66  ? 13.563 48.855 26.554  1.00 19.99 ? 66  TRP A O   1 
ATOM   511  C CB  . TRP A 1 66  ? 12.507 50.374 24.056  1.00 20.36 ? 66  TRP A CB  1 
ATOM   512  C CG  . TRP A 1 66  ? 11.798 50.765 22.790  1.00 21.80 ? 66  TRP A CG  1 
ATOM   513  C CD1 . TRP A 1 66  ? 11.061 51.891 22.580  1.00 23.56 ? 66  TRP A CD1 1 
ATOM   514  C CD2 . TRP A 1 66  ? 11.799 50.051 21.545  1.00 21.79 ? 66  TRP A CD2 1 
ATOM   515  N NE1 . TRP A 1 66  ? 10.603 51.926 21.282  1.00 22.89 ? 66  TRP A NE1 1 
ATOM   516  C CE2 . TRP A 1 66  ? 11.043 50.808 20.627  1.00 20.84 ? 66  TRP A CE2 1 
ATOM   517  C CE3 . TRP A 1 66  ? 12.370 48.846 21.117  1.00 20.62 ? 66  TRP A CE3 1 
ATOM   518  C CZ2 . TRP A 1 66  ? 10.844 50.399 19.305  1.00 20.52 ? 66  TRP A CZ2 1 
ATOM   519  C CZ3 . TRP A 1 66  ? 12.176 48.442 19.806  1.00 21.83 ? 66  TRP A CZ3 1 
ATOM   520  C CH2 . TRP A 1 66  ? 11.418 49.218 18.914  1.00 22.54 ? 66  TRP A CH2 1 
ATOM   521  N N   . THR A 1 67  ? 14.351 47.688 24.775  1.00 21.16 ? 67  THR A N   1 
ATOM   522  C CA  . THR A 1 67  ? 15.581 47.238 25.407  1.00 21.21 ? 67  THR A CA  1 
ATOM   523  C C   . THR A 1 67  ? 16.662 47.766 24.446  1.00 22.88 ? 67  THR A C   1 
ATOM   524  O O   . THR A 1 67  ? 16.350 48.151 23.324  1.00 21.69 ? 67  THR A O   1 
ATOM   525  C CB  . THR A 1 67  ? 15.636 45.706 25.520  1.00 22.39 ? 67  THR A CB  1 
ATOM   526  O OG1 . THR A 1 67  ? 15.098 45.108 24.335  1.00 26.46 ? 67  THR A OG1 1 
ATOM   527  C CG2 . THR A 1 67  ? 14.839 45.233 26.729  1.00 21.52 ? 67  THR A CG2 1 
ATOM   528  N N   . GLY A 1 68  ? 17.921 47.802 24.862  1.00 23.92 ? 68  GLY A N   1 
ATOM   529  C CA  . GLY A 1 68  ? 18.935 48.355 23.977  1.00 22.47 ? 68  GLY A CA  1 
ATOM   530  C C   . GLY A 1 68  ? 19.568 47.448 22.942  1.00 23.32 ? 68  GLY A C   1 
ATOM   531  O O   . GLY A 1 68  ? 20.758 47.598 22.638  1.00 23.30 ? 68  GLY A O   1 
ATOM   532  N N   . LEU A 1 69  ? 18.807 46.507 22.398  1.00 22.55 ? 69  LEU A N   1 
ATOM   533  C CA  . LEU A 1 69  ? 19.362 45.615 21.389  1.00 25.01 ? 69  LEU A CA  1 
ATOM   534  C C   . LEU A 1 69  ? 19.157 46.248 20.016  1.00 26.06 ? 69  LEU A C   1 
ATOM   535  O O   . LEU A 1 69  ? 18.063 46.202 19.450  1.00 24.15 ? 69  LEU A O   1 
ATOM   536  C CB  . LEU A 1 69  ? 18.693 44.240 21.445  1.00 25.48 ? 69  LEU A CB  1 
ATOM   537  C CG  . LEU A 1 69  ? 19.363 43.164 20.579  1.00 27.02 ? 69  LEU A CG  1 
ATOM   538  C CD1 . LEU A 1 69  ? 20.829 43.029 20.959  1.00 24.76 ? 69  LEU A CD1 1 
ATOM   539  C CD2 . LEU A 1 69  ? 18.639 41.842 20.759  1.00 25.76 ? 69  LEU A CD2 1 
ATOM   540  N N   . SER A 1 70  ? 20.223 46.835 19.486  1.00 28.39 ? 70  SER A N   1 
ATOM   541  C CA  . SER A 1 70  ? 20.157 47.507 18.201  1.00 30.66 ? 70  SER A CA  1 
ATOM   542  C C   . SER A 1 70  ? 20.886 46.807 17.065  1.00 31.78 ? 70  SER A C   1 
ATOM   543  O O   . SER A 1 70  ? 21.889 46.113 17.256  1.00 31.39 ? 70  SER A O   1 
ATOM   544  C CB  . SER A 1 70  ? 20.691 48.931 18.336  1.00 32.98 ? 70  SER A CB  1 
ATOM   545  O OG  . SER A 1 70  ? 20.558 49.645 17.122  1.00 38.63 ? 70  SER A OG  1 
ATOM   546  N N   . GLU A 1 71  ? 20.350 47.004 15.869  1.00 32.37 ? 71  GLU A N   1 
ATOM   547  C CA  . GLU A 1 71  ? 20.902 46.424 14.666  1.00 31.16 ? 71  GLU A CA  1 
ATOM   548  C C   . GLU A 1 71  ? 22.197 47.174 14.378  1.00 31.18 ? 71  GLU A C   1 
ATOM   549  O O   . GLU A 1 71  ? 22.251 48.389 14.518  1.00 31.30 ? 71  GLU A O   1 
ATOM   550  C CB  . GLU A 1 71  ? 19.887 46.593 13.546  1.00 30.81 ? 71  GLU A CB  1 
ATOM   551  C CG  . GLU A 1 71  ? 20.098 45.678 12.370  1.00 33.61 ? 71  GLU A CG  1 
ATOM   552  C CD  . GLU A 1 71  ? 21.168 46.196 11.465  1.00 34.69 ? 71  GLU A CD  1 
ATOM   553  O OE1 . GLU A 1 71  ? 20.997 47.323 10.943  1.00 36.15 ? 71  GLU A OE1 1 
ATOM   554  O OE2 . GLU A 1 71  ? 22.180 45.485 11.281  1.00 38.74 ? 71  GLU A OE2 1 
ATOM   555  N N   . ARG A 1 72  ? 23.242 46.458 13.984  1.00 32.41 ? 72  ARG A N   1 
ATOM   556  C CA  . ARG A 1 72  ? 24.529 47.095 13.730  1.00 34.60 ? 72  ARG A CA  1 
ATOM   557  C C   . ARG A 1 72  ? 24.661 47.644 12.325  1.00 35.43 ? 72  ARG A C   1 
ATOM   558  O O   . ARG A 1 72  ? 25.634 48.324 12.010  1.00 33.60 ? 72  ARG A O   1 
ATOM   559  C CB  . ARG A 1 72  ? 25.663 46.108 13.989  1.00 36.98 ? 72  ARG A CB  1 
ATOM   560  C CG  . ARG A 1 72  ? 25.690 45.554 15.401  1.00 41.10 ? 72  ARG A CG  1 
ATOM   561  C CD  . ARG A 1 72  ? 26.802 44.536 15.572  1.00 44.36 ? 72  ARG A CD  1 
ATOM   562  N NE  . ARG A 1 72  ? 26.866 44.042 16.940  1.00 48.03 ? 72  ARG A NE  1 
ATOM   563  C CZ  . ARG A 1 72  ? 27.705 43.101 17.358  1.00 50.97 ? 72  ARG A CZ  1 
ATOM   564  N NH1 . ARG A 1 72  ? 28.559 42.543 16.508  1.00 50.43 ? 72  ARG A NH1 1 
ATOM   565  N NH2 . ARG A 1 72  ? 27.690 42.717 18.630  1.00 51.89 ? 72  ARG A NH2 1 
ATOM   566  N N   . SER A 1 73  ? 23.677 47.351 11.485  1.00 36.94 ? 73  SER A N   1 
ATOM   567  C CA  . SER A 1 73  ? 23.692 47.803 10.101  1.00 37.55 ? 73  SER A CA  1 
ATOM   568  C C   . SER A 1 73  ? 24.985 47.360 9.414   1.00 37.16 ? 73  SER A C   1 
ATOM   569  O O   . SER A 1 73  ? 25.682 48.165 8.809   1.00 36.69 ? 73  SER A O   1 
ATOM   570  C CB  . SER A 1 73  ? 23.557 49.320 10.054  1.00 38.53 ? 73  SER A CB  1 
ATOM   571  O OG  . SER A 1 73  ? 22.393 49.731 10.749  1.00 39.62 ? 73  SER A OG  1 
ATOM   572  N N   . LYS A 1 74  ? 25.290 46.070 9.528   1.00 37.84 ? 74  LYS A N   1 
ATOM   573  C CA  . LYS A 1 74  ? 26.483 45.476 8.929   1.00 38.38 ? 74  LYS A CA  1 
ATOM   574  C C   . LYS A 1 74  ? 26.057 44.335 8.013   1.00 38.55 ? 74  LYS A C   1 
ATOM   575  O O   . LYS A 1 74  ? 26.826 43.406 7.767   1.00 39.01 ? 74  LYS A O   1 
ATOM   576  C CB  . LYS A 1 74  ? 27.406 44.919 10.014  1.00 38.66 ? 74  LYS A CB  1 
ATOM   577  C CG  . LYS A 1 74  ? 28.230 45.951 10.769  1.00 39.76 ? 74  LYS A CG  1 
ATOM   578  C CD  . LYS A 1 74  ? 28.844 45.339 12.030  1.00 41.24 ? 74  LYS A CD  1 
ATOM   579  C CE  . LYS A 1 74  ? 29.672 44.084 11.730  1.00 42.84 ? 74  LYS A CE  1 
ATOM   580  N NZ  . LYS A 1 74  ? 30.890 44.364 10.913  1.00 44.17 ? 74  LYS A NZ  1 
ATOM   581  N N   . GLU A 1 75  ? 24.829 44.414 7.513   1.00 39.24 ? 75  GLU A N   1 
ATOM   582  C CA  . GLU A 1 75  ? 24.275 43.383 6.640   1.00 40.23 ? 75  GLU A CA  1 
ATOM   583  C C   . GLU A 1 75  ? 25.236 42.858 5.578   1.00 39.50 ? 75  GLU A C   1 
ATOM   584  O O   . GLU A 1 75  ? 25.376 41.650 5.414   1.00 39.98 ? 75  GLU A O   1 
ATOM   585  C CB  . GLU A 1 75  ? 23.001 43.892 5.956   1.00 41.05 ? 75  GLU A CB  1 
ATOM   586  C CG  . GLU A 1 75  ? 21.927 44.387 6.920   1.00 44.07 ? 75  GLU A CG  1 
ATOM   587  C CD  . GLU A 1 75  ? 22.229 45.772 7.476   1.00 45.65 ? 75  GLU A CD  1 
ATOM   588  O OE1 . GLU A 1 75  ? 21.557 46.174 8.450   1.00 45.58 ? 75  GLU A OE1 1 
ATOM   589  O OE2 . GLU A 1 75  ? 23.126 46.460 6.932   1.00 44.21 ? 75  GLU A OE2 1 
ATOM   590  N N   . GLN A 1 76  ? 25.904 43.754 4.859   1.00 38.94 ? 76  GLN A N   1 
ATOM   591  C CA  . GLN A 1 76  ? 26.815 43.319 3.806   1.00 38.99 ? 76  GLN A CA  1 
ATOM   592  C C   . GLN A 1 76  ? 27.989 42.503 4.320   1.00 37.51 ? 76  GLN A C   1 
ATOM   593  O O   . GLN A 1 76  ? 28.725 41.912 3.538   1.00 39.09 ? 76  GLN A O   1 
ATOM   594  C CB  . GLN A 1 76  ? 27.332 44.515 2.992   1.00 41.26 ? 76  GLN A CB  1 
ATOM   595  C CG  . GLN A 1 76  ? 28.110 45.567 3.771   1.00 43.98 ? 76  GLN A CG  1 
ATOM   596  C CD  . GLN A 1 76  ? 27.216 46.571 4.482   1.00 46.23 ? 76  GLN A CD  1 
ATOM   597  O OE1 . GLN A 1 76  ? 27.680 47.623 4.931   1.00 45.35 ? 76  GLN A OE1 1 
ATOM   598  N NE2 . GLN A 1 76  ? 25.928 46.251 4.592   1.00 47.06 ? 76  GLN A NE2 1 
ATOM   599  N N   . HIS A 1 77  ? 28.159 42.459 5.634   1.00 36.10 ? 77  HIS A N   1 
ATOM   600  C CA  . HIS A 1 77  ? 29.251 41.703 6.225   1.00 34.46 ? 77  HIS A CA  1 
ATOM   601  C C   . HIS A 1 77  ? 28.701 40.469 6.935   1.00 34.78 ? 77  HIS A C   1 
ATOM   602  O O   . HIS A 1 77  ? 29.454 39.574 7.336   1.00 33.16 ? 77  HIS A O   1 
ATOM   603  C CB  . HIS A 1 77  ? 30.012 42.580 7.219   1.00 34.18 ? 77  HIS A CB  1 
ATOM   604  C CG  . HIS A 1 77  ? 30.416 43.912 6.662   1.00 33.54 ? 77  HIS A CG  1 
ATOM   605  N ND1 . HIS A 1 77  ? 29.850 45.098 7.083   1.00 33.62 ? 77  HIS A ND1 1 
ATOM   606  C CD2 . HIS A 1 77  ? 31.312 44.242 5.702   1.00 31.57 ? 77  HIS A CD2 1 
ATOM   607  C CE1 . HIS A 1 77  ? 30.379 46.101 6.406   1.00 33.12 ? 77  HIS A CE1 1 
ATOM   608  N NE2 . HIS A 1 77  ? 31.269 45.610 5.561   1.00 34.77 ? 77  HIS A NE2 1 
ATOM   609  N N   . CYS A 1 78  ? 27.378 40.430 7.069   1.00 35.07 ? 78  CYS A N   1 
ATOM   610  C CA  . CYS A 1 78  ? 26.690 39.337 7.745   1.00 34.80 ? 78  CYS A CA  1 
ATOM   611  C C   . CYS A 1 78  ? 25.785 38.554 6.794   1.00 35.49 ? 78  CYS A C   1 
ATOM   612  O O   . CYS A 1 78  ? 24.687 38.140 7.168   1.00 36.03 ? 78  CYS A O   1 
ATOM   613  C CB  . CYS A 1 78  ? 25.867 39.904 8.900   1.00 33.92 ? 78  CYS A CB  1 
ATOM   614  S SG  . CYS A 1 78  ? 26.833 40.910 10.083  1.00 33.82 ? 78  CYS A SG  1 
ATOM   615  N N   . SER A 1 79  ? 26.259 38.345 5.570   1.00 35.62 ? 79  SER A N   1 
ATOM   616  C CA  . SER A 1 79  ? 25.495 37.632 4.552   1.00 36.72 ? 79  SER A CA  1 
ATOM   617  C C   . SER A 1 79  ? 25.171 36.189 4.931   1.00 36.47 ? 79  SER A C   1 
ATOM   618  O O   . SER A 1 79  ? 26.069 35.382 5.154   1.00 37.64 ? 79  SER A O   1 
ATOM   619  C CB  . SER A 1 79  ? 26.256 37.653 3.225   1.00 36.77 ? 79  SER A CB  1 
ATOM   620  O OG  . SER A 1 79  ? 25.528 36.985 2.211   1.00 37.54 ? 79  SER A OG  1 
ATOM   621  N N   . SER A 1 80  ? 23.883 35.868 4.987   1.00 35.67 ? 80  SER A N   1 
ATOM   622  C CA  . SER A 1 80  ? 23.441 34.522 5.341   1.00 35.25 ? 80  SER A CA  1 
ATOM   623  C C   . SER A 1 80  ? 23.761 33.549 4.211   1.00 36.02 ? 80  SER A C   1 
ATOM   624  O O   . SER A 1 80  ? 24.009 33.961 3.076   1.00 37.07 ? 80  SER A O   1 
ATOM   625  C CB  . SER A 1 80  ? 21.940 34.527 5.609   1.00 33.77 ? 80  SER A CB  1 
ATOM   626  O OG  . SER A 1 80  ? 21.456 35.860 5.628   1.00 34.43 ? 80  SER A OG  1 
ATOM   627  N N   . ARG A 1 81  ? 23.750 32.258 4.521   1.00 35.04 ? 81  ARG A N   1 
ATOM   628  C CA  . ARG A 1 81  ? 24.057 31.249 3.519   1.00 36.15 ? 81  ARG A CA  1 
ATOM   629  C C   . ARG A 1 81  ? 22.977 30.184 3.388   1.00 35.55 ? 81  ARG A C   1 
ATOM   630  O O   . ARG A 1 81  ? 22.410 29.726 4.379   1.00 34.09 ? 81  ARG A O   1 
ATOM   631  C CB  . ARG A 1 81  ? 25.387 30.549 3.851   1.00 37.78 ? 81  ARG A CB  1 
ATOM   632  C CG  . ARG A 1 81  ? 26.634 31.430 3.796   1.00 41.76 ? 81  ARG A CG  1 
ATOM   633  C CD  . ARG A 1 81  ? 27.888 30.636 4.196   1.00 43.70 ? 81  ARG A CD  1 
ATOM   634  N NE  . ARG A 1 81  ? 28.583 30.017 3.065   1.00 44.44 ? 81  ARG A NE  1 
ATOM   635  C CZ  . ARG A 1 81  ? 29.310 28.900 3.151   1.00 47.07 ? 81  ARG A CZ  1 
ATOM   636  N NH1 . ARG A 1 81  ? 29.433 28.270 4.314   1.00 46.15 ? 81  ARG A NH1 1 
ATOM   637  N NH2 . ARG A 1 81  ? 29.929 28.412 2.078   1.00 46.02 ? 81  ARG A NH2 1 
ATOM   638  N N   . TRP A 1 82  ? 22.685 29.798 2.153   1.00 34.61 ? 82  TRP A N   1 
ATOM   639  C CA  . TRP A 1 82  ? 21.725 28.734 1.929   1.00 32.95 ? 82  TRP A CA  1 
ATOM   640  C C   . TRP A 1 82  ? 22.507 27.508 2.369   1.00 34.54 ? 82  TRP A C   1 
ATOM   641  O O   . TRP A 1 82  ? 23.709 27.604 2.620   1.00 32.59 ? 82  TRP A O   1 
ATOM   642  C CB  . TRP A 1 82  ? 21.403 28.576 0.453   1.00 30.69 ? 82  TRP A CB  1 
ATOM   643  C CG  . TRP A 1 82  ? 20.709 29.724 -0.177  1.00 29.58 ? 82  TRP A CG  1 
ATOM   644  C CD1 . TRP A 1 82  ? 21.281 30.813 -0.774  1.00 25.67 ? 82  TRP A CD1 1 
ATOM   645  C CD2 . TRP A 1 82  ? 19.301 29.849 -0.376  1.00 28.95 ? 82  TRP A CD2 1 
ATOM   646  N NE1 . TRP A 1 82  ? 20.311 31.598 -1.347  1.00 27.84 ? 82  TRP A NE1 1 
ATOM   647  C CE2 . TRP A 1 82  ? 19.086 31.029 -1.118  1.00 27.05 ? 82  TRP A CE2 1 
ATOM   648  C CE3 . TRP A 1 82  ? 18.196 29.072 -0.002  1.00 28.21 ? 82  TRP A CE3 1 
ATOM   649  C CZ2 . TRP A 1 82  ? 17.806 31.450 -1.496  1.00 25.90 ? 82  TRP A CZ2 1 
ATOM   650  C CZ3 . TRP A 1 82  ? 16.930 29.492 -0.379  1.00 29.61 ? 82  TRP A CZ3 1 
ATOM   651  C CH2 . TRP A 1 82  ? 16.745 30.670 -1.119  1.00 27.62 ? 82  TRP A CH2 1 
ATOM   652  N N   . SER A 1 83  ? 21.847 26.359 2.449   1.00 35.99 ? 83  SER A N   1 
ATOM   653  C CA  . SER A 1 83  ? 22.533 25.139 2.848   1.00 38.96 ? 83  SER A CA  1 
ATOM   654  C C   . SER A 1 83  ? 23.639 24.821 1.840   1.00 40.45 ? 83  SER A C   1 
ATOM   655  O O   . SER A 1 83  ? 23.886 23.659 1.517   1.00 40.84 ? 83  SER A O   1 
ATOM   656  C CB  . SER A 1 83  ? 21.533 23.985 2.934   1.00 39.06 ? 83  SER A CB  1 
ATOM   657  O OG  . SER A 1 83  ? 20.583 24.225 3.962   1.00 38.31 ? 83  SER A OG  1 
ATOM   658  N N   . ASP A 1 84  ? 24.296 25.878 1.357   1.00 42.82 ? 84  ASP A N   1 
ATOM   659  C CA  . ASP A 1 84  ? 25.370 25.791 0.373   1.00 42.78 ? 84  ASP A CA  1 
ATOM   660  C C   . ASP A 1 84  ? 25.855 27.183 -0.099  1.00 44.03 ? 84  ASP A C   1 
ATOM   661  O O   . ASP A 1 84  ? 26.906 27.667 0.334   1.00 43.11 ? 84  ASP A O   1 
ATOM   662  C CB  . ASP A 1 84  ? 24.885 24.974 -0.823  1.00 42.88 ? 84  ASP A CB  1 
ATOM   663  C CG  . ASP A 1 84  ? 23.494 25.381 -1.275  1.00 43.29 ? 84  ASP A CG  1 
ATOM   664  O OD1 . ASP A 1 84  ? 22.544 25.177 -0.497  1.00 46.07 ? 84  ASP A OD1 1 
ATOM   665  O OD2 . ASP A 1 84  ? 23.342 25.907 -2.398  1.00 39.71 ? 84  ASP A OD2 1 
ATOM   666  N N   . GLY A 1 85  ? 25.080 27.828 -0.974  1.00 43.58 ? 85  GLY A N   1 
ATOM   667  C CA  . GLY A 1 85  ? 25.462 29.132 -1.503  1.00 40.53 ? 85  GLY A CA  1 
ATOM   668  C C   . GLY A 1 85  ? 25.137 30.375 -0.684  1.00 39.55 ? 85  GLY A C   1 
ATOM   669  O O   . GLY A 1 85  ? 24.674 30.293 0.451   1.00 36.56 ? 85  GLY A O   1 
ATOM   670  N N   . SER A 1 86  ? 25.379 31.541 -1.278  1.00 38.68 ? 86  SER A N   1 
ATOM   671  C CA  . SER A 1 86  ? 25.137 32.815 -0.617  1.00 39.42 ? 86  SER A CA  1 
ATOM   672  C C   . SER A 1 86  ? 23.743 33.390 -0.846  1.00 40.16 ? 86  SER A C   1 
ATOM   673  O O   . SER A 1 86  ? 23.146 33.245 -1.923  1.00 37.08 ? 86  SER A O   1 
ATOM   674  C CB  . SER A 1 86  ? 26.193 33.835 -1.045  1.00 40.57 ? 86  SER A CB  1 
ATOM   675  O OG  . SER A 1 86  ? 27.468 33.497 -0.517  1.00 43.01 ? 86  SER A OG  1 
ATOM   676  N N   . PHE A 1 87  ? 23.241 34.062 0.185   1.00 42.15 ? 87  PHE A N   1 
ATOM   677  C CA  . PHE A 1 87  ? 21.912 34.650 0.158   1.00 44.06 ? 87  PHE A CA  1 
ATOM   678  C C   . PHE A 1 87  ? 21.855 36.053 -0.432  1.00 44.10 ? 87  PHE A C   1 
ATOM   679  O O   . PHE A 1 87  ? 21.848 37.037 0.307   1.00 44.65 ? 87  PHE A O   1 
ATOM   680  C CB  . PHE A 1 87  ? 21.342 34.659 1.577   1.00 45.52 ? 87  PHE A CB  1 
ATOM   681  C CG  . PHE A 1 87  ? 19.952 35.215 1.668   1.00 47.89 ? 87  PHE A CG  1 
ATOM   682  C CD1 . PHE A 1 87  ? 18.957 34.782 0.799   1.00 48.62 ? 87  PHE A CD1 1 
ATOM   683  C CD2 . PHE A 1 87  ? 19.633 36.159 2.636   1.00 48.65 ? 87  PHE A CD2 1 
ATOM   684  C CE1 . PHE A 1 87  ? 17.665 35.283 0.895   1.00 51.25 ? 87  PHE A CE1 1 
ATOM   685  C CE2 . PHE A 1 87  ? 18.345 36.665 2.741   1.00 51.36 ? 87  PHE A CE2 1 
ATOM   686  C CZ  . PHE A 1 87  ? 17.359 36.228 1.870   1.00 51.00 ? 87  PHE A CZ  1 
ATOM   687  N N   . PHE A 1 88  ? 21.807 36.137 -1.761  1.00 44.28 ? 88  PHE A N   1 
ATOM   688  C CA  . PHE A 1 88  ? 21.734 37.420 -2.457  1.00 44.25 ? 88  PHE A CA  1 
ATOM   689  C C   . PHE A 1 88  ? 20.346 37.632 -3.009  1.00 43.26 ? 88  PHE A C   1 
ATOM   690  O O   . PHE A 1 88  ? 19.606 38.496 -2.539  1.00 43.12 ? 88  PHE A O   1 
ATOM   691  C CB  . PHE A 1 88  ? 22.733 37.474 -3.605  1.00 45.54 ? 88  PHE A CB  1 
ATOM   692  C CG  . PHE A 1 88  ? 24.138 37.257 -3.173  1.00 50.13 ? 88  PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 88  ? 24.642 37.930 -2.060  1.00 51.37 ? 88  PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 88  ? 24.963 36.383 -3.866  1.00 50.89 ? 88  PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 88  ? 25.950 37.734 -1.641  1.00 53.08 ? 88  PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 88  ? 26.271 36.180 -3.457  1.00 53.27 ? 88  PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 88  ? 26.767 36.858 -2.340  1.00 54.53 ? 88  PHE A CZ  1 
ATOM   698  N N   . ARG A 1 89  ? 19.996 36.862 -4.030  1.00 42.12 ? 89  ARG A N   1 
ATOM   699  C CA  . ARG A 1 89  ? 18.667 36.987 -4.586  1.00 42.04 ? 89  ARG A CA  1 
ATOM   700  C C   . ARG A 1 89  ? 17.731 36.614 -3.445  1.00 41.79 ? 89  ARG A C   1 
ATOM   701  O O   . ARG A 1 89  ? 17.792 35.502 -2.911  1.00 40.98 ? 89  ARG A O   1 
ATOM   702  C CB  . ARG A 1 89  ? 18.476 36.031 -5.758  1.00 42.81 ? 89  ARG A CB  1 
ATOM   703  C CG  . ARG A 1 89  ? 17.467 36.525 -6.778  1.00 43.26 ? 89  ARG A CG  1 
ATOM   704  C CD  . ARG A 1 89  ? 16.021 36.263 -6.384  1.00 43.33 ? 89  ARG A CD  1 
ATOM   705  N NE  . ARG A 1 89  ? 15.109 36.770 -7.410  1.00 44.68 ? 89  ARG A NE  1 
ATOM   706  C CZ  . ARG A 1 89  ? 13.845 36.382 -7.551  1.00 45.99 ? 89  ARG A CZ  1 
ATOM   707  N NH1 . ARG A 1 89  ? 13.332 35.474 -6.735  1.00 47.72 ? 89  ARG A NH1 1 
ATOM   708  N NH2 . ARG A 1 89  ? 13.089 36.900 -8.509  1.00 47.72 ? 89  ARG A NH2 1 
ATOM   709  N N   . SER A 1 90  ? 16.890 37.562 -3.053  1.00 40.85 ? 90  SER A N   1 
ATOM   710  C CA  . SER A 1 90  ? 15.945 37.341 -1.971  1.00 41.11 ? 90  SER A CA  1 
ATOM   711  C C   . SER A 1 90  ? 14.599 37.885 -2.417  1.00 40.51 ? 90  SER A C   1 
ATOM   712  O O   . SER A 1 90  ? 14.544 38.822 -3.211  1.00 40.52 ? 90  SER A O   1 
ATOM   713  C CB  . SER A 1 90  ? 16.414 38.063 -0.711  1.00 40.79 ? 90  SER A CB  1 
ATOM   714  O OG  . SER A 1 90  ? 15.533 37.806 0.368   1.00 44.33 ? 90  SER A OG  1 
ATOM   715  N N   . TYR A 1 91  ? 13.512 37.309 -1.917  1.00 39.73 ? 91  TYR A N   1 
ATOM   716  C CA  . TYR A 1 91  ? 12.202 37.783 -2.326  1.00 40.35 ? 91  TYR A CA  1 
ATOM   717  C C   . TYR A 1 91  ? 11.122 37.687 -1.256  1.00 40.91 ? 91  TYR A C   1 
ATOM   718  O O   . TYR A 1 91  ? 10.280 36.785 -1.277  1.00 40.40 ? 91  TYR A O   1 
ATOM   719  C CB  . TYR A 1 91  ? 11.758 37.046 -3.586  1.00 39.99 ? 91  TYR A CB  1 
ATOM   720  C CG  . TYR A 1 91  ? 10.456 37.564 -4.149  1.00 42.73 ? 91  TYR A CG  1 
ATOM   721  C CD1 . TYR A 1 91  ? 10.194 38.930 -4.192  1.00 45.10 ? 91  TYR A CD1 1 
ATOM   722  C CD2 . TYR A 1 91  ? 9.491  36.693 -4.644  1.00 43.48 ? 91  TYR A CD2 1 
ATOM   723  C CE1 . TYR A 1 91  ? 9.000  39.421 -4.711  1.00 47.87 ? 91  TYR A CE1 1 
ATOM   724  C CE2 . TYR A 1 91  ? 8.298  37.172 -5.166  1.00 47.76 ? 91  TYR A CE2 1 
ATOM   725  C CZ  . TYR A 1 91  ? 8.054  38.538 -5.196  1.00 48.95 ? 91  TYR A CZ  1 
ATOM   726  O OH  . TYR A 1 91  ? 6.863  39.021 -5.700  1.00 49.71 ? 91  TYR A OH  1 
ATOM   727  N N   . GLU A 1 92  ? 11.143 38.644 -0.336  1.00 42.73 ? 92  GLU A N   1 
ATOM   728  C CA  . GLU A 1 92  ? 10.177 38.698 0.750   1.00 46.16 ? 92  GLU A CA  1 
ATOM   729  C C   . GLU A 1 92  ? 9.468  40.037 0.737   1.00 47.33 ? 92  GLU A C   1 
ATOM   730  O O   . GLU A 1 92  ? 9.926  40.980 0.098   1.00 46.27 ? 92  GLU A O   1 
ATOM   731  C CB  . GLU A 1 92  ? 10.883 38.536 2.089   1.00 47.21 ? 92  GLU A CB  1 
ATOM   732  C CG  . GLU A 1 92  ? 11.796 37.348 2.153   1.00 50.27 ? 92  GLU A CG  1 
ATOM   733  C CD  . GLU A 1 92  ? 12.791 37.472 3.269   1.00 53.12 ? 92  GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 92  ? 12.369 37.471 4.446   1.00 55.28 ? 92  GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 92  ? 13.996 37.583 2.967   1.00 54.22 ? 92  GLU A OE2 1 
ATOM   736  N N   . ILE A 1 93  ? 8.347  40.109 1.445   1.00 50.41 ? 93  ILE A N   1 
ATOM   737  C CA  . ILE A 1 93  ? 7.585  41.344 1.538   1.00 53.67 ? 93  ILE A CA  1 
ATOM   738  C C   . ILE A 1 93  ? 8.155  42.107 2.722   1.00 56.46 ? 93  ILE A C   1 
ATOM   739  O O   . ILE A 1 93  ? 7.459  42.380 3.702   1.00 58.67 ? 93  ILE A O   1 
ATOM   740  C CB  . ILE A 1 93  ? 6.084  41.076 1.785   1.00 53.18 ? 93  ILE A CB  1 
ATOM   741  C CG1 . ILE A 1 93  ? 5.504  40.252 0.634   1.00 52.38 ? 93  ILE A CG1 1 
ATOM   742  C CG2 . ILE A 1 93  ? 5.331  42.394 1.901   1.00 52.90 ? 93  ILE A CG2 1 
ATOM   743  C CD1 . ILE A 1 93  ? 4.034  39.937 0.792   1.00 52.78 ? 93  ILE A CD1 1 
ATOM   744  N N   . ALA A 1 94  ? 9.440  42.428 2.636   1.00 58.62 ? 94  ALA A N   1 
ATOM   745  C CA  . ALA A 1 94  ? 10.100 43.164 3.698   1.00 60.86 ? 94  ALA A CA  1 
ATOM   746  C C   . ALA A 1 94  ? 9.540  44.579 3.726   1.00 62.12 ? 94  ALA A C   1 
ATOM   747  O O   . ALA A 1 94  ? 10.115 45.498 3.145   1.00 62.06 ? 94  ALA A O   1 
ATOM   748  C CB  . ALA A 1 94  ? 11.601 43.190 3.465   1.00 60.62 ? 94  ALA A CB  1 
ATOM   749  N N   . ILE A 1 95  ? 8.396  44.728 4.389   1.00 63.80 ? 95  ILE A N   1 
ATOM   750  C CA  . ILE A 1 95  ? 7.718  46.012 4.536   1.00 64.82 ? 95  ILE A CA  1 
ATOM   751  C C   . ILE A 1 95  ? 8.725  47.113 4.876   1.00 64.25 ? 95  ILE A C   1 
ATOM   752  O O   . ILE A 1 95  ? 9.518  47.530 4.029   1.00 64.93 ? 95  ILE A O   1 
ATOM   753  C CB  . ILE A 1 95  ? 6.647  45.927 5.656   1.00 65.88 ? 95  ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 95  ? 7.265  45.333 6.929   1.00 66.53 ? 95  ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 95  ? 5.487  45.050 5.203   1.00 65.95 ? 95  ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 95  ? 6.295  45.202 8.090   1.00 66.99 ? 95  ILE A CD1 1 
ATOM   757  N N   . ARG A 1 96  ? 8.680  47.595 6.112   1.00 63.14 ? 96  ARG A N   1 
ATOM   758  C CA  . ARG A 1 96  ? 9.613  48.617 6.554   1.00 60.93 ? 96  ARG A CA  1 
ATOM   759  C C   . ARG A 1 96  ? 10.725 47.880 7.284   1.00 57.17 ? 96  ARG A C   1 
ATOM   760  O O   . ARG A 1 96  ? 10.580 46.704 7.606   1.00 57.07 ? 96  ARG A O   1 
ATOM   761  C CB  . ARG A 1 96  ? 8.919  49.618 7.486   1.00 64.19 ? 96  ARG A CB  1 
ATOM   762  C CG  . ARG A 1 96  ? 8.289  49.015 8.739   1.00 67.45 ? 96  ARG A CG  1 
ATOM   763  C CD  . ARG A 1 96  ? 7.461  50.063 9.479   1.00 70.58 ? 96  ARG A CD  1 
ATOM   764  N NE  . ARG A 1 96  ? 6.798  49.525 10.664  1.00 74.46 ? 96  ARG A NE  1 
ATOM   765  C CZ  . ARG A 1 96  ? 5.888  50.185 11.375  1.00 75.86 ? 96  ARG A CZ  1 
ATOM   766  N NH1 . ARG A 1 96  ? 5.529  51.412 11.017  1.00 76.22 ? 96  ARG A NH1 1 
ATOM   767  N NH2 . ARG A 1 96  ? 5.334  49.623 12.442  1.00 75.65 ? 96  ARG A NH2 1 
ATOM   768  N N   . TYR A 1 97  ? 11.837 48.561 7.528   1.00 52.98 ? 97  TYR A N   1 
ATOM   769  C CA  . TYR A 1 97  ? 12.961 47.942 8.214   1.00 48.55 ? 97  TYR A CA  1 
ATOM   770  C C   . TYR A 1 97  ? 12.740 47.913 9.725   1.00 45.45 ? 97  TYR A C   1 
ATOM   771  O O   . TYR A 1 97  ? 12.232 48.868 10.304  1.00 45.11 ? 97  TYR A O   1 
ATOM   772  C CB  . TYR A 1 97  ? 14.243 48.690 7.885   1.00 47.86 ? 97  TYR A CB  1 
ATOM   773  N N   . SER A 1 98  ? 13.113 46.800 10.348  1.00 41.82 ? 98  SER A N   1 
ATOM   774  C CA  . SER A 1 98  ? 12.978 46.626 11.789  1.00 39.46 ? 98  SER A CA  1 
ATOM   775  C C   . SER A 1 98  ? 14.355 46.337 12.398  1.00 38.34 ? 98  SER A C   1 
ATOM   776  O O   . SER A 1 98  ? 14.743 45.182 12.551  1.00 36.83 ? 98  SER A O   1 
ATOM   777  C CB  . SER A 1 98  ? 12.026 45.467 12.087  1.00 38.28 ? 98  SER A CB  1 
ATOM   778  O OG  . SER A 1 98  ? 10.744 45.700 11.526  1.00 39.95 ? 98  SER A OG  1 
ATOM   779  N N   . GLU A 1 99  ? 15.095 47.387 12.742  1.00 37.62 ? 99  GLU A N   1 
ATOM   780  C CA  . GLU A 1 99  ? 16.422 47.207 13.317  1.00 34.97 ? 99  GLU A CA  1 
ATOM   781  C C   . GLU A 1 99  ? 16.419 47.319 14.832  1.00 32.19 ? 99  GLU A C   1 
ATOM   782  O O   . GLU A 1 99  ? 17.427 47.677 15.443  1.00 32.71 ? 99  GLU A O   1 
ATOM   783  C CB  . GLU A 1 99  ? 17.394 48.235 12.746  1.00 37.07 ? 99  GLU A CB  1 
ATOM   784  C CG  . GLU A 1 99  ? 17.724 48.051 11.283  1.00 39.69 ? 99  GLU A CG  1 
ATOM   785  C CD  . GLU A 1 99  ? 17.186 49.179 10.448  1.00 44.42 ? 99  GLU A CD  1 
ATOM   786  O OE1 . GLU A 1 99  ? 15.975 49.169 10.142  1.00 48.02 ? 99  GLU A OE1 1 
ATOM   787  O OE2 . GLU A 1 99  ? 17.970 50.091 10.111  1.00 47.93 ? 99  GLU A OE2 1 
ATOM   788  N N   . CYS A 1 100 ? 15.287 47.003 15.440  1.00 28.82 ? 100 CYS A N   1 
ATOM   789  C CA  . CYS A 1 100 ? 15.181 47.081 16.884  1.00 28.20 ? 100 CYS A CA  1 
ATOM   790  C C   . CYS A 1 100 ? 14.484 45.878 17.482  1.00 27.31 ? 100 CYS A C   1 
ATOM   791  O O   . CYS A 1 100 ? 13.789 45.137 16.793  1.00 27.43 ? 100 CYS A O   1 
ATOM   792  C CB  . CYS A 1 100 ? 14.456 48.369 17.288  1.00 28.41 ? 100 CYS A CB  1 
ATOM   793  S SG  . CYS A 1 100 ? 15.523 49.818 17.040  1.00 27.24 ? 100 CYS A SG  1 
ATOM   794  N N   . PHE A 1 101 ? 14.706 45.682 18.773  1.00 28.13 ? 101 PHE A N   1 
ATOM   795  C CA  . PHE A 1 101 ? 14.105 44.589 19.517  1.00 26.90 ? 101 PHE A CA  1 
ATOM   796  C C   . PHE A 1 101 ? 13.502 45.193 20.773  1.00 25.47 ? 101 PHE A C   1 
ATOM   797  O O   . PHE A 1 101 ? 14.007 46.179 21.302  1.00 26.56 ? 101 PHE A O   1 
ATOM   798  C CB  . PHE A 1 101 ? 15.164 43.552 19.903  1.00 23.71 ? 101 PHE A CB  1 
ATOM   799  C CG  . PHE A 1 101 ? 15.294 42.426 18.925  1.00 23.15 ? 101 PHE A CG  1 
ATOM   800  C CD1 . PHE A 1 101 ? 14.473 41.306 19.024  1.00 22.12 ? 101 PHE A CD1 1 
ATOM   801  C CD2 . PHE A 1 101 ? 16.226 42.486 17.895  1.00 21.46 ? 101 PHE A CD2 1 
ATOM   802  C CE1 . PHE A 1 101 ? 14.579 40.266 18.113  1.00 20.23 ? 101 PHE A CE1 1 
ATOM   803  C CE2 . PHE A 1 101 ? 16.337 41.448 16.980  1.00 17.75 ? 101 PHE A CE2 1 
ATOM   804  C CZ  . PHE A 1 101 ? 15.514 40.338 17.089  1.00 18.69 ? 101 PHE A CZ  1 
ATOM   805  N N   . VAL A 1 102 ? 12.420 44.597 21.243  1.00 24.69 ? 102 VAL A N   1 
ATOM   806  C CA  . VAL A 1 102 ? 11.766 45.067 22.445  1.00 25.78 ? 102 VAL A CA  1 
ATOM   807  C C   . VAL A 1 102 ? 11.256 43.841 23.167  1.00 24.36 ? 102 VAL A C   1 
ATOM   808  O O   . VAL A 1 102 ? 11.388 42.729 22.657  1.00 23.65 ? 102 VAL A O   1 
ATOM   809  C CB  . VAL A 1 102 ? 10.609 45.990 22.072  1.00 29.55 ? 102 VAL A CB  1 
ATOM   810  N N   . LEU A 1 103 ? 10.685 44.033 24.352  1.00 24.10 ? 103 LEU A N   1 
ATOM   811  C CA  . LEU A 1 103 ? 10.135 42.915 25.117  1.00 23.05 ? 103 LEU A CA  1 
ATOM   812  C C   . LEU A 1 103 ? 8.645  42.844 24.838  1.00 24.38 ? 103 LEU A C   1 
ATOM   813  O O   . LEU A 1 103 ? 7.980  43.884 24.741  1.00 21.17 ? 103 LEU A O   1 
ATOM   814  C CB  . LEU A 1 103 ? 10.363 43.117 26.615  1.00 22.09 ? 103 LEU A CB  1 
ATOM   815  C CG  . LEU A 1 103 ? 11.830 43.234 27.037  1.00 22.52 ? 103 LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 103 ? 11.918 43.403 28.545  1.00 25.82 ? 103 LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 103 ? 12.583 41.992 26.586  1.00 20.98 ? 103 LEU A CD2 1 
ATOM   818  N N   . GLU A 1 104 ? 8.125  41.622 24.714  1.00 27.46 ? 104 GLU A N   1 
ATOM   819  C CA  . GLU A 1 104 ? 6.710  41.427 24.433  1.00 30.69 ? 104 GLU A CA  1 
ATOM   820  C C   . GLU A 1 104 ? 5.886  40.996 25.645  1.00 29.75 ? 104 GLU A C   1 
ATOM   821  O O   . GLU A 1 104 ? 6.226  40.052 26.342  1.00 29.03 ? 104 GLU A O   1 
ATOM   822  C CB  . GLU A 1 104 ? 6.537  40.400 23.315  1.00 34.70 ? 104 GLU A CB  1 
ATOM   823  C CG  . GLU A 1 104 ? 6.604  38.959 23.773  1.00 39.08 ? 104 GLU A CG  1 
ATOM   824  C CD  . GLU A 1 104 ? 6.368  37.991 22.639  1.00 41.82 ? 104 GLU A CD  1 
ATOM   825  O OE1 . GLU A 1 104 ? 5.456  38.251 21.821  1.00 42.47 ? 104 GLU A OE1 1 
ATOM   826  O OE2 . GLU A 1 104 ? 7.085  36.971 22.572  1.00 42.47 ? 104 GLU A OE2 1 
ATOM   827  N N   . LYS A 1 105 ? 4.791  41.703 25.882  1.00 31.74 ? 105 LYS A N   1 
ATOM   828  C CA  . LYS A 1 105 ? 3.905  41.398 26.994  1.00 35.00 ? 105 LYS A CA  1 
ATOM   829  C C   . LYS A 1 105 ? 3.336  39.992 26.810  1.00 36.44 ? 105 LYS A C   1 
ATOM   830  O O   . LYS A 1 105 ? 3.009  39.310 27.775  1.00 36.49 ? 105 LYS A O   1 
ATOM   831  C CB  . LYS A 1 105 ? 2.768  42.423 27.029  1.00 35.30 ? 105 LYS A CB  1 
ATOM   832  C CG  . LYS A 1 105 ? 1.857  42.334 28.226  1.00 34.41 ? 105 LYS A CG  1 
ATOM   833  C CD  . LYS A 1 105 ? 0.472  42.859 27.859  1.00 38.28 ? 105 LYS A CD  1 
ATOM   834  C CE  . LYS A 1 105 ? -0.002 43.952 28.802  1.00 37.46 ? 105 LYS A CE  1 
ATOM   835  N NZ  . LYS A 1 105 ? 0.826  45.180 28.681  1.00 35.61 ? 105 LYS A NZ  1 
ATOM   836  N N   . GLN A 1 106 ? 3.228  39.561 25.559  1.00 38.64 ? 106 GLN A N   1 
ATOM   837  C CA  . GLN A 1 106 ? 2.693  38.241 25.254  1.00 41.21 ? 106 GLN A CA  1 
ATOM   838  C C   . GLN A 1 106 ? 3.404  37.149 26.044  1.00 42.22 ? 106 GLN A C   1 
ATOM   839  O O   . GLN A 1 106 ? 2.764  36.269 26.623  1.00 43.09 ? 106 GLN A O   1 
ATOM   840  C CB  . GLN A 1 106 ? 2.824  37.952 23.759  1.00 42.54 ? 106 GLN A CB  1 
ATOM   841  C CG  . GLN A 1 106 ? 1.586  37.336 23.156  1.00 44.57 ? 106 GLN A CG  1 
ATOM   842  C CD  . GLN A 1 106 ? 0.383  38.257 23.257  1.00 48.26 ? 106 GLN A CD  1 
ATOM   843  O OE1 . GLN A 1 106 ? -0.035 38.637 24.353  1.00 49.39 ? 106 GLN A OE1 1 
ATOM   844  N NE2 . GLN A 1 106 ? -0.178 38.623 22.110  1.00 49.52 ? 106 GLN A NE2 1 
ATOM   845  N N   . SER A 1 107 ? 4.731  37.205 26.054  1.00 42.33 ? 107 SER A N   1 
ATOM   846  C CA  . SER A 1 107 ? 5.537  36.225 26.767  1.00 41.13 ? 107 SER A CA  1 
ATOM   847  C C   . SER A 1 107 ? 6.030  36.853 28.063  1.00 40.56 ? 107 SER A C   1 
ATOM   848  O O   . SER A 1 107 ? 7.218  36.786 28.390  1.00 41.23 ? 107 SER A O   1 
ATOM   849  C CB  . SER A 1 107 ? 6.738  35.803 25.915  1.00 42.04 ? 107 SER A CB  1 
ATOM   850  O OG  . SER A 1 107 ? 7.663  36.869 25.790  1.00 41.46 ? 107 SER A OG  1 
ATOM   851  N N   . VAL A 1 108 ? 5.105  37.470 28.788  1.00 38.57 ? 108 VAL A N   1 
ATOM   852  C CA  . VAL A 1 108 ? 5.399  38.124 30.054  1.00 38.46 ? 108 VAL A CA  1 
ATOM   853  C C   . VAL A 1 108 ? 6.712  38.900 30.042  1.00 36.91 ? 108 VAL A C   1 
ATOM   854  O O   . VAL A 1 108 ? 7.459  38.920 31.027  1.00 35.72 ? 108 VAL A O   1 
ATOM   855  C CB  . VAL A 1 108 ? 5.409  37.108 31.222  1.00 40.44 ? 108 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 108 ? 6.605  36.182 31.112  1.00 39.67 ? 108 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 108 ? 5.405  37.858 32.554  1.00 43.02 ? 108 VAL A CG2 1 
ATOM   858  N N   . PHE A 1 109 ? 6.993  39.524 28.904  1.00 34.48 ? 109 PHE A N   1 
ATOM   859  C CA  . PHE A 1 109 ? 8.181  40.346 28.742  1.00 31.99 ? 109 PHE A CA  1 
ATOM   860  C C   . PHE A 1 109 ? 9.511  39.613 28.858  1.00 29.90 ? 109 PHE A C   1 
ATOM   861  O O   . PHE A 1 109 ? 10.544 40.240 29.058  1.00 28.92 ? 109 PHE A O   1 
ATOM   862  C CB  . PHE A 1 109 ? 8.140  41.495 29.760  1.00 29.50 ? 109 PHE A CB  1 
ATOM   863  C CG  . PHE A 1 109 ? 6.877  42.312 29.703  1.00 29.41 ? 109 PHE A CG  1 
ATOM   864  C CD1 . PHE A 1 109 ? 6.594  43.109 28.598  1.00 27.76 ? 109 PHE A CD1 1 
ATOM   865  C CD2 . PHE A 1 109 ? 5.970  42.292 30.762  1.00 28.47 ? 109 PHE A CD2 1 
ATOM   866  C CE1 . PHE A 1 109 ? 5.427  43.877 28.553  1.00 26.91 ? 109 PHE A CE1 1 
ATOM   867  C CE2 . PHE A 1 109 ? 4.800  43.059 30.721  1.00 26.11 ? 109 PHE A CE2 1 
ATOM   868  C CZ  . PHE A 1 109 ? 4.532  43.852 29.614  1.00 25.02 ? 109 PHE A CZ  1 
ATOM   869  N N   . ARG A 1 110 ? 9.505  38.297 28.723  1.00 30.66 ? 110 ARG A N   1 
ATOM   870  C CA  . ARG A 1 110 ? 10.756 37.556 28.835  1.00 31.65 ? 110 ARG A CA  1 
ATOM   871  C C   . ARG A 1 110 ? 11.459 37.327 27.502  1.00 30.88 ? 110 ARG A C   1 
ATOM   872  O O   . ARG A 1 110 ? 12.680 37.161 27.462  1.00 33.07 ? 110 ARG A O   1 
ATOM   873  C CB  . ARG A 1 110 ? 10.530 36.200 29.499  1.00 32.25 ? 110 ARG A CB  1 
ATOM   874  C CG  . ARG A 1 110 ? 10.153 36.231 30.972  1.00 35.63 ? 110 ARG A CG  1 
ATOM   875  C CD  . ARG A 1 110 ? 10.173 34.796 31.491  1.00 41.47 ? 110 ARG A CD  1 
ATOM   876  N NE  . ARG A 1 110 ? 9.838  34.662 32.903  1.00 45.64 ? 110 ARG A NE  1 
ATOM   877  C CZ  . ARG A 1 110 ? 9.832  33.499 33.547  1.00 48.51 ? 110 ARG A CZ  1 
ATOM   878  N NH1 . ARG A 1 110 ? 10.144 32.385 32.896  1.00 49.40 ? 110 ARG A NH1 1 
ATOM   879  N NH2 . ARG A 1 110 ? 9.513  33.443 34.834  1.00 48.67 ? 110 ARG A NH2 1 
ATOM   880  N N   . THR A 1 111 ? 10.705 37.317 26.410  1.00 29.99 ? 111 THR A N   1 
ATOM   881  C CA  . THR A 1 111 ? 11.312 37.079 25.106  1.00 28.02 ? 111 THR A CA  1 
ATOM   882  C C   . THR A 1 111 ? 11.455 38.354 24.275  1.00 26.75 ? 111 THR A C   1 
ATOM   883  O O   . THR A 1 111 ? 10.837 39.371 24.566  1.00 27.14 ? 111 THR A O   1 
ATOM   884  C CB  . THR A 1 111 ? 10.504 36.027 24.317  1.00 28.46 ? 111 THR A CB  1 
ATOM   885  O OG1 . THR A 1 111 ? 9.205  36.546 24.023  1.00 33.10 ? 111 THR A OG1 1 
ATOM   886  C CG2 . THR A 1 111 ? 10.350 34.740 25.143  1.00 23.73 ? 111 THR A CG2 1 
ATOM   887  N N   . TRP A 1 112 ? 12.286 38.300 23.242  1.00 25.76 ? 112 TRP A N   1 
ATOM   888  C CA  . TRP A 1 112 ? 12.499 39.463 22.391  1.00 23.62 ? 112 TRP A CA  1 
ATOM   889  C C   . TRP A 1 112 ? 11.784 39.293 21.054  1.00 23.30 ? 112 TRP A C   1 
ATOM   890  O O   . TRP A 1 112 ? 11.572 38.173 20.595  1.00 23.39 ? 112 TRP A O   1 
ATOM   891  C CB  . TRP A 1 112 ? 13.999 39.673 22.159  1.00 22.81 ? 112 TRP A CB  1 
ATOM   892  C CG  . TRP A 1 112 ? 14.806 39.620 23.424  1.00 23.92 ? 112 TRP A CG  1 
ATOM   893  C CD1 . TRP A 1 112 ? 14.364 39.891 24.690  1.00 25.60 ? 112 TRP A CD1 1 
ATOM   894  C CD2 . TRP A 1 112 ? 16.206 39.340 23.543  1.00 22.90 ? 112 TRP A CD2 1 
ATOM   895  N NE1 . TRP A 1 112 ? 15.400 39.802 25.587  1.00 24.57 ? 112 TRP A NE1 1 
ATOM   896  C CE2 . TRP A 1 112 ? 16.543 39.466 24.912  1.00 24.15 ? 112 TRP A CE2 1 
ATOM   897  C CE3 . TRP A 1 112 ? 17.209 38.998 22.628  1.00 23.14 ? 112 TRP A CE3 1 
ATOM   898  C CZ2 . TRP A 1 112 ? 17.846 39.263 25.389  1.00 23.17 ? 112 TRP A CZ2 1 
ATOM   899  C CZ3 . TRP A 1 112 ? 18.506 38.798 23.102  1.00 25.44 ? 112 TRP A CZ3 1 
ATOM   900  C CH2 . TRP A 1 112 ? 18.810 38.932 24.473  1.00 25.28 ? 112 TRP A CH2 1 
ATOM   901  N N   . VAL A 1 113 ? 11.407 40.408 20.436  1.00 23.25 ? 113 VAL A N   1 
ATOM   902  C CA  . VAL A 1 113 ? 10.725 40.370 19.154  1.00 22.32 ? 113 VAL A CA  1 
ATOM   903  C C   . VAL A 1 113 ? 11.208 41.516 18.287  1.00 21.05 ? 113 VAL A C   1 
ATOM   904  O O   . VAL A 1 113 ? 11.226 42.663 18.729  1.00 18.90 ? 113 VAL A O   1 
ATOM   905  C CB  . VAL A 1 113 ? 9.185  40.468 19.328  1.00 23.43 ? 113 VAL A CB  1 
ATOM   906  C CG1 . VAL A 1 113 ? 8.671  39.255 20.101  1.00 24.04 ? 113 VAL A CG1 1 
ATOM   907  C CG2 . VAL A 1 113 ? 8.818  41.740 20.057  1.00 23.92 ? 113 VAL A CG2 1 
ATOM   908  N N   . ALA A 1 114 ? 11.607 41.204 17.056  1.00 21.44 ? 114 ALA A N   1 
ATOM   909  C CA  . ALA A 1 114 ? 12.092 42.227 16.137  1.00 23.24 ? 114 ALA A CA  1 
ATOM   910  C C   . ALA A 1 114 ? 10.964 43.207 15.841  1.00 23.82 ? 114 ALA A C   1 
ATOM   911  O O   . ALA A 1 114 ? 9.883  42.810 15.400  1.00 23.76 ? 114 ALA A O   1 
ATOM   912  C CB  . ALA A 1 114 ? 12.593 41.588 14.834  1.00 22.35 ? 114 ALA A CB  1 
ATOM   913  N N   . THR A 1 115 ? 11.232 44.488 16.070  1.00 25.12 ? 115 THR A N   1 
ATOM   914  C CA  . THR A 1 115 ? 10.239 45.528 15.851  1.00 28.16 ? 115 THR A CA  1 
ATOM   915  C C   . THR A 1 115 ? 10.791 46.803 15.211  1.00 27.84 ? 115 THR A C   1 
ATOM   916  O O   . THR A 1 115 ? 11.997 47.039 15.206  1.00 25.59 ? 115 THR A O   1 
ATOM   917  C CB  . THR A 1 115 ? 9.560  45.892 17.185  1.00 28.54 ? 115 THR A CB  1 
ATOM   918  O OG1 . THR A 1 115 ? 8.848  47.126 17.045  1.00 33.74 ? 115 THR A OG1 1 
ATOM   919  C CG2 . THR A 1 115 ? 10.592 46.027 18.275  1.00 29.12 ? 115 THR A CG2 1 
ATOM   920  N N   . PRO A 1 116 ? 9.904  47.631 14.634  1.00 30.37 ? 116 PRO A N   1 
ATOM   921  C CA  . PRO A 1 116 ? 10.315 48.885 13.995  1.00 31.38 ? 116 PRO A CA  1 
ATOM   922  C C   . PRO A 1 116 ? 10.784 49.892 15.030  1.00 31.09 ? 116 PRO A C   1 
ATOM   923  O O   . PRO A 1 116 ? 10.044 50.238 15.953  1.00 31.87 ? 116 PRO A O   1 
ATOM   924  C CB  . PRO A 1 116 ? 9.043  49.348 13.289  1.00 32.55 ? 116 PRO A CB  1 
ATOM   925  C CG  . PRO A 1 116 ? 8.381  48.051 12.921  1.00 33.88 ? 116 PRO A CG  1 
ATOM   926  C CD  . PRO A 1 116 ? 8.543  47.254 14.204  1.00 33.60 ? 116 PRO A CD  1 
ATOM   927  N N   . CYS A 1 117 ? 12.011 50.368 14.870  1.00 30.07 ? 117 CYS A N   1 
ATOM   928  C CA  . CYS A 1 117 ? 12.571 51.327 15.805  1.00 30.27 ? 117 CYS A CA  1 
ATOM   929  C C   . CYS A 1 117 ? 11.731 52.569 16.007  1.00 33.15 ? 117 CYS A C   1 
ATOM   930  O O   . CYS A 1 117 ? 11.677 53.104 17.115  1.00 33.31 ? 117 CYS A O   1 
ATOM   931  C CB  . CYS A 1 117 ? 13.938 51.766 15.338  1.00 26.65 ? 117 CYS A CB  1 
ATOM   932  S SG  . CYS A 1 117 ? 15.127 50.425 15.145  1.00 21.03 ? 117 CYS A SG  1 
ATOM   933  N N   . GLU A 1 118 ? 11.096 53.035 14.933  1.00 35.86 ? 118 GLU A N   1 
ATOM   934  C CA  . GLU A 1 118 ? 10.276 54.241 14.981  1.00 37.40 ? 118 GLU A CA  1 
ATOM   935  C C   . GLU A 1 118 ? 9.037  54.122 15.849  1.00 35.64 ? 118 GLU A C   1 
ATOM   936  O O   . GLU A 1 118 ? 8.392  55.122 16.138  1.00 35.09 ? 118 GLU A O   1 
ATOM   937  C CB  . GLU A 1 118 ? 9.858  54.666 13.565  1.00 44.22 ? 118 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 118 ? 9.058  53.622 12.789  1.00 48.59 ? 118 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 118 ? 9.900  52.894 11.756  1.00 53.40 ? 118 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 118 ? 10.969 52.359 12.123  1.00 54.62 ? 118 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 118 ? 9.488  52.857 10.575  1.00 56.27 ? 118 GLU A OE2 1 
ATOM   942  N N   . ASN A 1 119 ? 8.691  52.910 16.264  1.00 35.69 ? 119 ASN A N   1 
ATOM   943  C CA  . ASN A 1 119 ? 7.511  52.736 17.102  1.00 36.44 ? 119 ASN A CA  1 
ATOM   944  C C   . ASN A 1 119 ? 7.722  53.320 18.489  1.00 35.18 ? 119 ASN A C   1 
ATOM   945  O O   . ASN A 1 119 ? 8.821  53.263 19.037  1.00 34.98 ? 119 ASN A O   1 
ATOM   946  C CB  . ASN A 1 119 ? 7.142  51.257 17.231  1.00 38.43 ? 119 ASN A CB  1 
ATOM   947  C CG  . ASN A 1 119 ? 6.608  50.679 15.940  1.00 41.84 ? 119 ASN A CG  1 
ATOM   948  O OD1 . ASN A 1 119 ? 5.780  51.293 15.270  1.00 42.38 ? 119 ASN A OD1 1 
ATOM   949  N ND2 . ASN A 1 119 ? 7.072  49.485 15.588  1.00 44.60 ? 119 ASN A ND2 1 
ATOM   950  N N   . THR A 1 120 ? 6.657  53.881 19.047  1.00 33.07 ? 120 THR A N   1 
ATOM   951  C CA  . THR A 1 120 ? 6.703  54.473 20.372  1.00 31.92 ? 120 THR A CA  1 
ATOM   952  C C   . THR A 1 120 ? 6.251  53.454 21.417  1.00 31.59 ? 120 THR A C   1 
ATOM   953  O O   . THR A 1 120 ? 5.107  53.004 21.407  1.00 30.97 ? 120 THR A O   1 
ATOM   954  C CB  . THR A 1 120 ? 5.785  55.709 20.460  1.00 32.68 ? 120 THR A CB  1 
ATOM   955  O OG1 . THR A 1 120 ? 4.445  55.332 20.119  1.00 33.18 ? 120 THR A OG1 1 
ATOM   956  C CG2 . THR A 1 120 ? 6.256  56.799 19.508  1.00 30.29 ? 120 THR A CG2 1 
ATOM   957  N N   . PHE A 1 121 ? 7.161  53.085 22.313  1.00 30.48 ? 121 PHE A N   1 
ATOM   958  C CA  . PHE A 1 121 ? 6.850  52.126 23.366  1.00 28.99 ? 121 PHE A CA  1 
ATOM   959  C C   . PHE A 1 121 ? 7.547  52.522 24.660  1.00 27.34 ? 121 PHE A C   1 
ATOM   960  O O   . PHE A 1 121 ? 8.583  53.195 24.641  1.00 25.72 ? 121 PHE A O   1 
ATOM   961  C CB  . PHE A 1 121 ? 7.307  50.717 22.969  1.00 29.70 ? 121 PHE A CB  1 
ATOM   962  C CG  . PHE A 1 121 ? 6.489  50.088 21.866  1.00 32.78 ? 121 PHE A CG  1 
ATOM   963  C CD1 . PHE A 1 121 ? 5.118  49.905 22.011  1.00 32.56 ? 121 PHE A CD1 1 
ATOM   964  C CD2 . PHE A 1 121 ? 7.098  49.650 20.696  1.00 34.63 ? 121 PHE A CD2 1 
ATOM   965  C CE1 . PHE A 1 121 ? 4.370  49.297 21.008  1.00 35.02 ? 121 PHE A CE1 1 
ATOM   966  C CE2 . PHE A 1 121 ? 6.351  49.036 19.683  1.00 35.60 ? 121 PHE A CE2 1 
ATOM   967  C CZ  . PHE A 1 121 ? 4.988  48.861 19.840  1.00 33.42 ? 121 PHE A CZ  1 
ATOM   968  N N   . PRO A 1 122 ? 6.978  52.127 25.810  1.00 26.13 ? 122 PRO A N   1 
ATOM   969  C CA  . PRO A 1 122 ? 7.616  52.472 27.083  1.00 24.81 ? 122 PRO A CA  1 
ATOM   970  C C   . PRO A 1 122 ? 9.018  51.868 27.050  1.00 23.37 ? 122 PRO A C   1 
ATOM   971  O O   . PRO A 1 122 ? 9.366  51.162 26.109  1.00 23.13 ? 122 PRO A O   1 
ATOM   972  C CB  . PRO A 1 122 ? 6.721  51.787 28.111  1.00 25.25 ? 122 PRO A CB  1 
ATOM   973  C CG  . PRO A 1 122 ? 5.381  51.828 27.463  1.00 27.23 ? 122 PRO A CG  1 
ATOM   974  C CD  . PRO A 1 122 ? 5.700  51.433 26.037  1.00 25.98 ? 122 PRO A CD  1 
ATOM   975  N N   . PHE A 1 123 ? 9.821  52.116 28.074  1.00 23.34 ? 123 PHE A N   1 
ATOM   976  C CA  . PHE A 1 123 ? 11.167 51.568 28.065  1.00 21.85 ? 123 PHE A CA  1 
ATOM   977  C C   . PHE A 1 123 ? 11.748 51.362 29.451  1.00 20.90 ? 123 PHE A C   1 
ATOM   978  O O   . PHE A 1 123 ? 11.153 51.766 30.447  1.00 22.60 ? 123 PHE A O   1 
ATOM   979  C CB  . PHE A 1 123 ? 12.088 52.478 27.242  1.00 22.41 ? 123 PHE A CB  1 
ATOM   980  C CG  . PHE A 1 123 ? 12.097 53.909 27.698  1.00 22.32 ? 123 PHE A CG  1 
ATOM   981  C CD1 . PHE A 1 123 ? 10.989 54.729 27.491  1.00 22.20 ? 123 PHE A CD1 1 
ATOM   982  C CD2 . PHE A 1 123 ? 13.216 54.439 28.339  1.00 24.86 ? 123 PHE A CD2 1 
ATOM   983  C CE1 . PHE A 1 123 ? 10.989 56.056 27.914  1.00 20.74 ? 123 PHE A CE1 1 
ATOM   984  C CE2 . PHE A 1 123 ? 13.232 55.761 28.767  1.00 24.07 ? 123 PHE A CE2 1 
ATOM   985  C CZ  . PHE A 1 123 ? 12.112 56.573 28.553  1.00 24.88 ? 123 PHE A CZ  1 
ATOM   986  N N   . MET A 1 124 ? 12.911 50.716 29.499  1.00 20.00 ? 124 MET A N   1 
ATOM   987  C CA  . MET A 1 124 ? 13.605 50.449 30.752  1.00 19.86 ? 124 MET A CA  1 
ATOM   988  C C   . MET A 1 124 ? 15.029 50.971 30.644  1.00 19.64 ? 124 MET A C   1 
ATOM   989  O O   . MET A 1 124 ? 15.764 50.626 29.715  1.00 18.83 ? 124 MET A O   1 
ATOM   990  C CB  . MET A 1 124 ? 13.615 48.944 31.052  1.00 18.69 ? 124 MET A CB  1 
ATOM   991  N N   . CYS A 1 125 ? 15.416 51.821 31.585  1.00 19.23 ? 125 CYS A N   1 
ATOM   992  C CA  . CYS A 1 125 ? 16.761 52.369 31.576  1.00 21.49 ? 125 CYS A CA  1 
ATOM   993  C C   . CYS A 1 125 ? 17.611 51.559 32.520  1.00 21.64 ? 125 CYS A C   1 
ATOM   994  O O   . CYS A 1 125 ? 17.100 50.823 33.365  1.00 23.22 ? 125 CYS A O   1 
ATOM   995  C CB  . CYS A 1 125 ? 16.783 53.827 32.034  1.00 22.11 ? 125 CYS A CB  1 
ATOM   996  S SG  . CYS A 1 125 ? 16.070 55.071 30.911  1.00 26.13 ? 125 CYS A SG  1 
ATOM   997  N N   . LYS A 1 126 ? 18.918 51.727 32.392  1.00 24.12 ? 126 LYS A N   1 
ATOM   998  C CA  . LYS A 1 126 ? 19.870 51.003 33.220  1.00 23.36 ? 126 LYS A CA  1 
ATOM   999  C C   . LYS A 1 126 ? 21.199 51.749 33.202  1.00 24.06 ? 126 LYS A C   1 
ATOM   1000 O O   . LYS A 1 126 ? 21.536 52.424 32.222  1.00 21.54 ? 126 LYS A O   1 
ATOM   1001 C CB  . LYS A 1 126 ? 20.031 49.587 32.664  1.00 23.50 ? 126 LYS A CB  1 
ATOM   1002 C CG  . LYS A 1 126 ? 21.141 48.735 33.266  1.00 22.09 ? 126 LYS A CG  1 
ATOM   1003 C CD  . LYS A 1 126 ? 21.169 47.377 32.566  1.00 22.98 ? 126 LYS A CD  1 
ATOM   1004 C CE  . LYS A 1 126 ? 22.415 46.575 32.888  1.00 24.40 ? 126 LYS A CE  1 
ATOM   1005 N NZ  . LYS A 1 126 ? 22.518 45.353 32.033  1.00 21.90 ? 126 LYS A NZ  1 
ATOM   1006 N N   . TYR A 1 127 ? 21.932 51.650 34.304  1.00 26.10 ? 127 TYR A N   1 
ATOM   1007 C CA  . TYR A 1 127 ? 23.236 52.284 34.414  1.00 28.90 ? 127 TYR A CA  1 
ATOM   1008 C C   . TYR A 1 127 ? 23.919 51.813 35.705  1.00 31.02 ? 127 TYR A C   1 
ATOM   1009 O O   . TYR A 1 127 ? 23.252 51.447 36.678  1.00 29.12 ? 127 TYR A O   1 
ATOM   1010 C CB  . TYR A 1 127 ? 23.086 53.808 34.403  1.00 29.63 ? 127 TYR A CB  1 
ATOM   1011 C CG  . TYR A 1 127 ? 22.595 54.394 35.702  1.00 29.80 ? 127 TYR A CG  1 
ATOM   1012 C CD1 . TYR A 1 127 ? 23.462 54.557 36.783  1.00 29.99 ? 127 TYR A CD1 1 
ATOM   1013 C CD2 . TYR A 1 127 ? 21.263 54.777 35.860  1.00 28.73 ? 127 TYR A CD2 1 
ATOM   1014 C CE1 . TYR A 1 127 ? 23.019 55.084 37.983  1.00 30.22 ? 127 TYR A CE1 1 
ATOM   1015 C CE2 . TYR A 1 127 ? 20.812 55.304 37.060  1.00 29.35 ? 127 TYR A CE2 1 
ATOM   1016 C CZ  . TYR A 1 127 ? 21.699 55.454 38.114  1.00 32.43 ? 127 TYR A CZ  1 
ATOM   1017 O OH  . TYR A 1 127 ? 21.269 55.979 39.306  1.00 38.65 ? 127 TYR A OH  1 
ATOM   1018 N N   . PRO A 1 128 ? 25.263 51.805 35.716  1.00 33.09 ? 128 PRO A N   1 
ATOM   1019 C CA  . PRO A 1 128 ? 26.074 51.384 36.864  1.00 33.98 ? 128 PRO A CA  1 
ATOM   1020 C C   . PRO A 1 128 ? 26.464 52.550 37.763  1.00 35.62 ? 128 PRO A C   1 
ATOM   1021 O O   . PRO A 1 128 ? 27.090 53.501 37.308  1.00 34.59 ? 128 PRO A O   1 
ATOM   1022 C CB  . PRO A 1 128 ? 27.284 50.756 36.199  1.00 33.57 ? 128 PRO A CB  1 
ATOM   1023 C CG  . PRO A 1 128 ? 27.514 51.695 35.040  1.00 35.09 ? 128 PRO A CG  1 
ATOM   1024 C CD  . PRO A 1 128 ? 26.102 51.966 34.511  1.00 33.45 ? 128 PRO A CD  1 
ATOM   1025 N N   . VAL A 1 129 ? 26.105 52.474 39.040  1.00 38.40 ? 129 VAL A N   1 
ATOM   1026 C CA  . VAL A 1 129 ? 26.440 53.545 39.973  1.00 43.48 ? 129 VAL A CA  1 
ATOM   1027 C C   . VAL A 1 129 ? 27.928 53.921 39.936  1.00 46.76 ? 129 VAL A C   1 
ATOM   1028 O O   . VAL A 1 129 ? 28.277 55.093 40.081  1.00 46.50 ? 129 VAL A O   1 
ATOM   1029 C CB  . VAL A 1 129 ? 26.057 53.172 41.415  1.00 44.08 ? 129 VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 129 ? 26.308 54.356 42.340  1.00 45.05 ? 129 VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 129 ? 24.602 52.750 41.469  1.00 43.56 ? 129 VAL A CG2 1 
ATOM   1032 N N   . PRO A 1 130 ? 28.823 52.931 39.758  1.00 50.30 ? 130 PRO A N   1 
ATOM   1033 C CA  . PRO A 1 130 ? 30.263 53.209 39.703  1.00 53.78 ? 130 PRO A CA  1 
ATOM   1034 C C   . PRO A 1 130 ? 30.658 53.914 38.405  1.00 56.50 ? 130 PRO A C   1 
ATOM   1035 O O   . PRO A 1 130 ? 31.825 53.885 38.004  1.00 56.95 ? 130 PRO A O   1 
ATOM   1036 C CB  . PRO A 1 130 ? 30.890 51.819 39.800  1.00 53.59 ? 130 PRO A CB  1 
ATOM   1037 C CG  . PRO A 1 130 ? 29.882 51.049 40.586  1.00 54.09 ? 130 PRO A CG  1 
ATOM   1038 C CD  . PRO A 1 130 ? 28.593 51.488 39.943  1.00 52.23 ? 130 PRO A CD  1 
ATOM   1039 N N   . ARG A 1 131 ? 29.674 54.543 37.766  1.00 59.40 ? 131 ARG A N   1 
ATOM   1040 C CA  . ARG A 1 131 ? 29.864 55.256 36.506  1.00 61.89 ? 131 ARG A CA  1 
ATOM   1041 C C   . ARG A 1 131 ? 29.884 54.276 35.336  1.00 63.33 ? 131 ARG A C   1 
ATOM   1042 O O   . ARG A 1 131 ? 29.030 54.422 34.435  1.00 64.07 ? 131 ARG A O   1 
ATOM   1043 C CB  . ARG A 1 131 ? 31.160 56.072 36.538  1.00 62.67 ? 131 ARG A CB  1 
ATOM   1044 O OXT . ARG A 1 131 ? 30.748 53.372 35.336  1.00 64.36 ? 131 ARG A OXT 1 
ATOM   1045 N N   . ASN B 2 1   ? 21.503 13.707 -17.457 1.00 62.74 ? 1   ASN B N   1 
ATOM   1046 C CA  . ASN B 2 1   ? 21.974 14.846 -16.616 1.00 63.01 ? 1   ASN B CA  1 
ATOM   1047 C C   . ASN B 2 1   ? 21.475 14.718 -15.177 1.00 61.78 ? 1   ASN B C   1 
ATOM   1048 O O   . ASN B 2 1   ? 22.066 15.281 -14.256 1.00 61.76 ? 1   ASN B O   1 
ATOM   1049 C CB  . ASN B 2 1   ? 21.505 16.176 -17.219 1.00 63.49 ? 1   ASN B CB  1 
ATOM   1050 C CG  . ASN B 2 1   ? 22.086 16.428 -18.602 1.00 64.15 ? 1   ASN B CG  1 
ATOM   1051 O OD1 . ASN B 2 1   ? 23.301 16.396 -18.793 1.00 65.19 ? 1   ASN B OD1 1 
ATOM   1052 N ND2 . ASN B 2 1   ? 21.217 16.687 -19.572 1.00 64.59 ? 1   ASN B ND2 1 
ATOM   1053 N N   . CYS B 2 2   ? 20.387 13.975 -14.991 1.00 59.91 ? 2   CYS B N   1 
ATOM   1054 C CA  . CYS B 2 2   ? 19.812 13.752 -13.668 1.00 58.02 ? 2   CYS B CA  1 
ATOM   1055 C C   . CYS B 2 2   ? 19.256 12.340 -13.584 1.00 59.25 ? 2   CYS B C   1 
ATOM   1056 O O   . CYS B 2 2   ? 19.015 11.707 -14.607 1.00 59.37 ? 2   CYS B O   1 
ATOM   1057 C CB  . CYS B 2 2   ? 18.680 14.744 -13.391 1.00 54.88 ? 2   CYS B CB  1 
ATOM   1058 S SG  . CYS B 2 2   ? 19.199 16.485 -13.353 1.00 49.22 ? 2   CYS B SG  1 
ATOM   1059 N N   . LEU B 2 3   ? 19.053 11.851 -12.364 1.00 60.96 ? 3   LEU B N   1 
ATOM   1060 C CA  . LEU B 2 3   ? 18.507 10.513 -12.169 1.00 62.44 ? 3   LEU B CA  1 
ATOM   1061 C C   . LEU B 2 3   ? 17.017 10.512 -12.486 1.00 62.37 ? 3   LEU B C   1 
ATOM   1062 O O   . LEU B 2 3   ? 16.378 11.563 -12.510 1.00 61.60 ? 3   LEU B O   1 
ATOM   1063 C CB  . LEU B 2 3   ? 18.717 10.043 -10.726 1.00 63.82 ? 3   LEU B CB  1 
ATOM   1064 C CG  . LEU B 2 3   ? 20.139 9.708  -10.270 1.00 65.99 ? 3   LEU B CG  1 
ATOM   1065 C CD1 . LEU B 2 3   ? 20.079 9.135  -8.861  1.00 66.26 ? 3   LEU B CD1 1 
ATOM   1066 C CD2 . LEU B 2 3   ? 20.776 8.700  -11.218 1.00 66.40 ? 3   LEU B CD2 1 
ATOM   1067 N N   . PRO B 2 4   ? 16.442 9.326  -12.729 1.00 62.83 ? 4   PRO B N   1 
ATOM   1068 C CA  . PRO B 2 4   ? 15.015 9.223  -13.044 1.00 62.88 ? 4   PRO B CA  1 
ATOM   1069 C C   . PRO B 2 4   ? 14.119 9.950  -12.042 1.00 61.89 ? 4   PRO B C   1 
ATOM   1070 O O   . PRO B 2 4   ? 14.297 9.825  -10.831 1.00 62.38 ? 4   PRO B O   1 
ATOM   1071 C CB  . PRO B 2 4   ? 14.775 7.715  -13.055 1.00 63.31 ? 4   PRO B CB  1 
ATOM   1072 C CG  . PRO B 2 4   ? 16.084 7.182  -13.549 1.00 64.16 ? 4   PRO B CG  1 
ATOM   1073 C CD  . PRO B 2 4   ? 17.081 7.997  -12.757 1.00 63.24 ? 4   PRO B CD  1 
ATOM   1074 N N   . ASP B 2 5   ? 13.163 10.709 -12.568 1.00 61.27 ? 5   ASP B N   1 
ATOM   1075 C CA  . ASP B 2 5   ? 12.207 11.466 -11.764 1.00 60.20 ? 5   ASP B CA  1 
ATOM   1076 C C   . ASP B 2 5   ? 12.779 12.722 -11.109 1.00 57.92 ? 5   ASP B C   1 
ATOM   1077 O O   . ASP B 2 5   ? 12.308 13.161 -10.059 1.00 56.71 ? 5   ASP B O   1 
ATOM   1078 C CB  . ASP B 2 5   ? 11.573 10.560 -10.705 1.00 62.69 ? 5   ASP B CB  1 
ATOM   1079 C CG  . ASP B 2 5   ? 10.062 10.467 -10.852 1.00 65.03 ? 5   ASP B CG  1 
ATOM   1080 O OD1 . ASP B 2 5   ? 9.592  10.128 -11.961 1.00 65.45 ? 5   ASP B OD1 1 
ATOM   1081 O OD2 . ASP B 2 5   ? 9.346  10.732 -9.861  1.00 66.77 ? 5   ASP B OD2 1 
ATOM   1082 N N   . TRP B 2 6   ? 13.792 13.297 -11.748 1.00 55.40 ? 6   TRP B N   1 
ATOM   1083 C CA  . TRP B 2 6   ? 14.431 14.517 -11.278 1.00 53.95 ? 6   TRP B CA  1 
ATOM   1084 C C   . TRP B 2 6   ? 14.542 15.437 -12.478 1.00 53.77 ? 6   TRP B C   1 
ATOM   1085 O O   . TRP B 2 6   ? 15.136 15.063 -13.486 1.00 54.48 ? 6   TRP B O   1 
ATOM   1086 C CB  . TRP B 2 6   ? 15.834 14.242 -10.752 1.00 52.80 ? 6   TRP B CB  1 
ATOM   1087 C CG  . TRP B 2 6   ? 15.879 13.459 -9.495  1.00 52.08 ? 6   TRP B CG  1 
ATOM   1088 C CD1 . TRP B 2 6   ? 15.587 12.137 -9.339  1.00 51.61 ? 6   TRP B CD1 1 
ATOM   1089 C CD2 . TRP B 2 6   ? 16.289 13.939 -8.208  1.00 51.63 ? 6   TRP B CD2 1 
ATOM   1090 N NE1 . TRP B 2 6   ? 15.797 11.760 -8.031  1.00 52.99 ? 6   TRP B NE1 1 
ATOM   1091 C CE2 . TRP B 2 6   ? 16.228 12.847 -7.317  1.00 50.56 ? 6   TRP B CE2 1 
ATOM   1092 C CE3 . TRP B 2 6   ? 16.703 15.188 -7.722  1.00 49.81 ? 6   TRP B CE3 1 
ATOM   1093 C CZ2 . TRP B 2 6   ? 16.566 12.964 -5.969  1.00 49.60 ? 6   TRP B CZ2 1 
ATOM   1094 C CZ3 . TRP B 2 6   ? 17.040 15.303 -6.376  1.00 49.48 ? 6   TRP B CZ3 1 
ATOM   1095 C CH2 . TRP B 2 6   ? 16.969 14.195 -5.517  1.00 48.82 ? 6   TRP B CH2 1 
ATOM   1096 N N   . SER B 2 7   ? 13.981 16.637 -12.366 1.00 53.33 ? 7   SER B N   1 
ATOM   1097 C CA  . SER B 2 7   ? 14.009 17.599 -13.457 1.00 52.72 ? 7   SER B CA  1 
ATOM   1098 C C   . SER B 2 7   ? 15.358 18.292 -13.590 1.00 52.76 ? 7   SER B C   1 
ATOM   1099 O O   . SER B 2 7   ? 16.093 18.448 -12.613 1.00 51.49 ? 7   SER B O   1 
ATOM   1100 C CB  . SER B 2 7   ? 12.905 18.631 -13.260 1.00 53.47 ? 7   SER B CB  1 
ATOM   1101 O OG  . SER B 2 7   ? 11.641 17.990 -13.239 1.00 54.71 ? 7   SER B OG  1 
ATOM   1102 N N   . VAL B 2 8   ? 15.676 18.708 -14.812 1.00 53.13 ? 8   VAL B N   1 
ATOM   1103 C CA  . VAL B 2 8   ? 16.945 19.369 -15.087 1.00 53.86 ? 8   VAL B CA  1 
ATOM   1104 C C   . VAL B 2 8   ? 16.762 20.848 -15.409 1.00 54.08 ? 8   VAL B C   1 
ATOM   1105 O O   . VAL B 2 8   ? 15.776 21.241 -16.040 1.00 53.22 ? 8   VAL B O   1 
ATOM   1106 C CB  . VAL B 2 8   ? 17.669 18.700 -16.276 1.00 53.36 ? 8   VAL B CB  1 
ATOM   1107 C CG1 . VAL B 2 8   ? 19.121 19.146 -16.316 1.00 53.32 ? 8   VAL B CG1 1 
ATOM   1108 C CG2 . VAL B 2 8   ? 17.572 17.190 -16.160 1.00 54.10 ? 8   VAL B CG2 1 
ATOM   1109 N N   . TYR B 2 9   ? 17.725 21.660 -14.974 1.00 54.53 ? 9   TYR B N   1 
ATOM   1110 C CA  . TYR B 2 9   ? 17.690 23.094 -15.217 1.00 55.06 ? 9   TYR B CA  1 
ATOM   1111 C C   . TYR B 2 9   ? 18.995 23.756 -14.768 1.00 55.46 ? 9   TYR B C   1 
ATOM   1112 O O   . TYR B 2 9   ? 19.450 23.553 -13.642 1.00 55.57 ? 9   TYR B O   1 
ATOM   1113 C CB  . TYR B 2 9   ? 16.492 23.710 -14.490 1.00 55.41 ? 9   TYR B CB  1 
ATOM   1114 C CG  . TYR B 2 9   ? 16.179 25.130 -14.903 1.00 56.57 ? 9   TYR B CG  1 
ATOM   1115 C CD1 . TYR B 2 9   ? 16.153 25.498 -16.251 1.00 56.11 ? 9   TYR B CD1 1 
ATOM   1116 C CD2 . TYR B 2 9   ? 15.881 26.102 -13.951 1.00 56.24 ? 9   TYR B CD2 1 
ATOM   1117 C CE1 . TYR B 2 9   ? 15.837 26.801 -16.637 1.00 55.03 ? 9   TYR B CE1 1 
ATOM   1118 C CE2 . TYR B 2 9   ? 15.563 27.405 -14.328 1.00 56.64 ? 9   TYR B CE2 1 
ATOM   1119 C CZ  . TYR B 2 9   ? 15.543 27.745 -15.668 1.00 54.72 ? 9   TYR B CZ  1 
ATOM   1120 O OH  . TYR B 2 9   ? 15.225 29.031 -16.031 1.00 54.22 ? 9   TYR B OH  1 
ATOM   1121 N N   . GLU B 2 10  ? 19.594 24.536 -15.666 1.00 55.39 ? 10  GLU B N   1 
ATOM   1122 C CA  . GLU B 2 10  ? 20.851 25.237 -15.404 1.00 55.87 ? 10  GLU B CA  1 
ATOM   1123 C C   . GLU B 2 10  ? 21.896 24.448 -14.615 1.00 55.56 ? 10  GLU B C   1 
ATOM   1124 O O   . GLU B 2 10  ? 22.538 24.988 -13.713 1.00 55.60 ? 10  GLU B O   1 
ATOM   1125 C CB  . GLU B 2 10  ? 20.586 26.564 -14.690 1.00 57.31 ? 10  GLU B CB  1 
ATOM   1126 C CG  . GLU B 2 10  ? 19.986 27.639 -15.575 1.00 60.14 ? 10  GLU B CG  1 
ATOM   1127 C CD  . GLU B 2 10  ? 20.772 27.841 -16.858 1.00 62.34 ? 10  GLU B CD  1 
ATOM   1128 O OE1 . GLU B 2 10  ? 22.017 27.948 -16.789 1.00 62.13 ? 10  GLU B OE1 1 
ATOM   1129 O OE2 . GLU B 2 10  ? 20.142 27.898 -17.936 1.00 63.78 ? 10  GLU B OE2 1 
ATOM   1130 N N   . GLY B 2 11  ? 22.068 23.176 -14.958 1.00 55.04 ? 11  GLY B N   1 
ATOM   1131 C CA  . GLY B 2 11  ? 23.057 22.354 -14.279 1.00 54.48 ? 11  GLY B CA  1 
ATOM   1132 C C   . GLY B 2 11  ? 22.663 21.854 -12.903 1.00 53.46 ? 11  GLY B C   1 
ATOM   1133 O O   . GLY B 2 11  ? 23.516 21.430 -12.123 1.00 52.75 ? 11  GLY B O   1 
ATOM   1134 N N   . TYR B 2 12  ? 21.370 21.893 -12.603 1.00 53.11 ? 12  TYR B N   1 
ATOM   1135 C CA  . TYR B 2 12  ? 20.875 21.435 -11.310 1.00 51.68 ? 12  TYR B CA  1 
ATOM   1136 C C   . TYR B 2 12  ? 19.746 20.428 -11.489 1.00 49.10 ? 12  TYR B C   1 
ATOM   1137 O O   . TYR B 2 12  ? 19.014 20.472 -12.477 1.00 48.94 ? 12  TYR B O   1 
ATOM   1138 C CB  . TYR B 2 12  ? 20.347 22.618 -10.492 1.00 53.61 ? 12  TYR B CB  1 
ATOM   1139 C CG  . TYR B 2 12  ? 21.278 23.803 -10.424 1.00 54.89 ? 12  TYR B CG  1 
ATOM   1140 C CD1 . TYR B 2 12  ? 22.542 23.691 -9.851  1.00 55.52 ? 12  TYR B CD1 1 
ATOM   1141 C CD2 . TYR B 2 12  ? 20.894 25.039 -10.943 1.00 56.16 ? 12  TYR B CD2 1 
ATOM   1142 C CE1 . TYR B 2 12  ? 23.405 24.782 -9.797  1.00 59.42 ? 12  TYR B CE1 1 
ATOM   1143 C CE2 . TYR B 2 12  ? 21.747 26.136 -10.897 1.00 59.51 ? 12  TYR B CE2 1 
ATOM   1144 C CZ  . TYR B 2 12  ? 23.003 26.002 -10.323 1.00 61.18 ? 12  TYR B CZ  1 
ATOM   1145 O OH  . TYR B 2 12  ? 23.854 27.088 -10.277 1.00 63.09 ? 12  TYR B OH  1 
ATOM   1146 N N   . CYS B 2 13  ? 19.607 19.520 -10.531 1.00 46.98 ? 13  CYS B N   1 
ATOM   1147 C CA  . CYS B 2 13  ? 18.535 18.537 -10.580 1.00 43.80 ? 13  CYS B CA  1 
ATOM   1148 C C   . CYS B 2 13  ? 17.531 18.870 -9.487  1.00 41.14 ? 13  CYS B C   1 
ATOM   1149 O O   . CYS B 2 13  ? 17.908 19.238 -8.375  1.00 38.51 ? 13  CYS B O   1 
ATOM   1150 C CB  . CYS B 2 13  ? 19.080 17.121 -10.380 1.00 45.25 ? 13  CYS B CB  1 
ATOM   1151 S SG  . CYS B 2 13  ? 20.288 16.631 -11.648 1.00 45.84 ? 13  CYS B SG  1 
ATOM   1152 N N   . TYR B 2 14  ? 16.252 18.760 -9.817  1.00 39.29 ? 14  TYR B N   1 
ATOM   1153 C CA  . TYR B 2 14  ? 15.204 19.058 -8.859  1.00 38.69 ? 14  TYR B CA  1 
ATOM   1154 C C   . TYR B 2 14  ? 14.162 17.961 -8.800  1.00 37.31 ? 14  TYR B C   1 
ATOM   1155 O O   . TYR B 2 14  ? 13.697 17.469 -9.828  1.00 36.68 ? 14  TYR B O   1 
ATOM   1156 C CB  . TYR B 2 14  ? 14.502 20.373 -9.209  1.00 40.22 ? 14  TYR B CB  1 
ATOM   1157 C CG  . TYR B 2 14  ? 15.424 21.556 -9.356  1.00 40.77 ? 14  TYR B CG  1 
ATOM   1158 C CD1 . TYR B 2 14  ? 16.169 21.739 -10.519 1.00 42.56 ? 14  TYR B CD1 1 
ATOM   1159 C CD2 . TYR B 2 14  ? 15.551 22.499 -8.336  1.00 41.46 ? 14  TYR B CD2 1 
ATOM   1160 C CE1 . TYR B 2 14  ? 17.018 22.834 -10.670 1.00 42.37 ? 14  TYR B CE1 1 
ATOM   1161 C CE2 . TYR B 2 14  ? 16.404 23.601 -8.477  1.00 41.99 ? 14  TYR B CE2 1 
ATOM   1162 C CZ  . TYR B 2 14  ? 17.128 23.758 -9.651  1.00 41.82 ? 14  TYR B CZ  1 
ATOM   1163 O OH  . TYR B 2 14  ? 17.944 24.848 -9.820  1.00 44.29 ? 14  TYR B OH  1 
ATOM   1164 N N   . LYS B 2 15  ? 13.800 17.579 -7.584  1.00 36.80 ? 15  LYS B N   1 
ATOM   1165 C CA  . LYS B 2 15  ? 12.778 16.570 -7.390  1.00 35.62 ? 15  LYS B CA  1 
ATOM   1166 C C   . LYS B 2 15  ? 11.828 17.073 -6.316  1.00 34.33 ? 15  LYS B C   1 
ATOM   1167 O O   . LYS B 2 15  ? 12.250 17.665 -5.317  1.00 32.63 ? 15  LYS B O   1 
ATOM   1168 C CB  . LYS B 2 15  ? 13.389 15.226 -6.982  1.00 34.68 ? 15  LYS B CB  1 
ATOM   1169 C CG  . LYS B 2 15  ? 12.350 14.104 -6.888  1.00 34.20 ? 15  LYS B CG  1 
ATOM   1170 C CD  . LYS B 2 15  ? 12.996 12.730 -6.763  1.00 32.73 ? 15  LYS B CD  1 
ATOM   1171 C CE  . LYS B 2 15  ? 11.944 11.648 -6.575  1.00 35.05 ? 15  LYS B CE  1 
ATOM   1172 N NZ  . LYS B 2 15  ? 10.920 11.627 -7.678  1.00 35.10 ? 15  LYS B NZ  1 
ATOM   1173 N N   . VAL B 2 16  ? 10.538 16.849 -6.537  1.00 33.59 ? 16  VAL B N   1 
ATOM   1174 C CA  . VAL B 2 16  ? 9.526  17.286 -5.595  1.00 32.47 ? 16  VAL B CA  1 
ATOM   1175 C C   . VAL B 2 16  ? 9.059  16.113 -4.766  1.00 31.85 ? 16  VAL B C   1 
ATOM   1176 O O   . VAL B 2 16  ? 8.983  14.987 -5.251  1.00 32.09 ? 16  VAL B O   1 
ATOM   1177 C CB  . VAL B 2 16  ? 8.303  17.863 -6.309  1.00 34.62 ? 16  VAL B CB  1 
ATOM   1178 C CG1 . VAL B 2 16  ? 7.503  18.709 -5.341  1.00 37.22 ? 16  VAL B CG1 1 
ATOM   1179 C CG2 . VAL B 2 16  ? 8.732  18.666 -7.529  1.00 36.66 ? 16  VAL B CG2 1 
ATOM   1180 N N   . PHE B 2 17  ? 8.736  16.384 -3.511  1.00 31.48 ? 17  PHE B N   1 
ATOM   1181 C CA  . PHE B 2 17  ? 8.262  15.353 -2.607  1.00 30.35 ? 17  PHE B CA  1 
ATOM   1182 C C   . PHE B 2 17  ? 7.004  15.880 -1.937  1.00 30.22 ? 17  PHE B C   1 
ATOM   1183 O O   . PHE B 2 17  ? 6.895  17.070 -1.661  1.00 28.68 ? 17  PHE B O   1 
ATOM   1184 C CB  . PHE B 2 17  ? 9.338  15.050 -1.563  1.00 28.67 ? 17  PHE B CB  1 
ATOM   1185 C CG  . PHE B 2 17  ? 10.616 14.555 -2.150  1.00 28.65 ? 17  PHE B CG  1 
ATOM   1186 C CD1 . PHE B 2 17  ? 10.776 13.206 -2.464  1.00 28.42 ? 17  PHE B CD1 1 
ATOM   1187 C CD2 . PHE B 2 17  ? 11.653 15.436 -2.428  1.00 29.45 ? 17  PHE B CD2 1 
ATOM   1188 C CE1 . PHE B 2 17  ? 11.956 12.745 -3.049  1.00 26.85 ? 17  PHE B CE1 1 
ATOM   1189 C CE2 . PHE B 2 17  ? 12.837 14.982 -3.014  1.00 28.73 ? 17  PHE B CE2 1 
ATOM   1190 C CZ  . PHE B 2 17  ? 12.987 13.637 -3.323  1.00 26.67 ? 17  PHE B CZ  1 
ATOM   1191 N N   . LYS B 2 18  ? 6.057  14.993 -1.670  1.00 32.79 ? 18  LYS B N   1 
ATOM   1192 C CA  . LYS B 2 18  ? 4.809  15.404 -1.045  1.00 35.98 ? 18  LYS B CA  1 
ATOM   1193 C C   . LYS B 2 18  ? 4.774  15.243 0.474   1.00 35.80 ? 18  LYS B C   1 
ATOM   1194 O O   . LYS B 2 18  ? 3.746  15.501 1.102   1.00 35.41 ? 18  LYS B O   1 
ATOM   1195 C CB  . LYS B 2 18  ? 3.648  14.643 -1.688  1.00 36.80 ? 18  LYS B CB  1 
ATOM   1196 C CG  . LYS B 2 18  ? 3.274  15.161 -3.070  1.00 38.07 ? 18  LYS B CG  1 
ATOM   1197 C CD  . LYS B 2 18  ? 2.508  14.117 -3.871  1.00 39.22 ? 18  LYS B CD  1 
ATOM   1198 C CE  . LYS B 2 18  ? 1.306  13.580 -3.107  1.00 37.30 ? 18  LYS B CE  1 
ATOM   1199 N NZ  . LYS B 2 18  ? 0.677  12.453 -3.839  1.00 36.93 ? 18  LYS B NZ  1 
ATOM   1200 N N   . GLU B 2 19  ? 5.892  14.832 1.066   1.00 36.19 ? 19  GLU B N   1 
ATOM   1201 C CA  . GLU B 2 19  ? 5.953  14.648 2.519   1.00 37.60 ? 19  GLU B CA  1 
ATOM   1202 C C   . GLU B 2 19  ? 5.837  15.975 3.252   1.00 36.22 ? 19  GLU B C   1 
ATOM   1203 O O   . GLU B 2 19  ? 6.055  17.039 2.678   1.00 35.31 ? 19  GLU B O   1 
ATOM   1204 C CB  . GLU B 2 19  ? 7.263  13.969 2.953   1.00 37.99 ? 19  GLU B CB  1 
ATOM   1205 C CG  . GLU B 2 19  ? 7.448  12.543 2.483   1.00 36.91 ? 19  GLU B CG  1 
ATOM   1206 C CD  . GLU B 2 19  ? 7.646  12.440 0.987   1.00 38.18 ? 19  GLU B CD  1 
ATOM   1207 O OE1 . GLU B 2 19  ? 7.763  11.303 0.494   1.00 40.64 ? 19  GLU B OE1 1 
ATOM   1208 O OE2 . GLU B 2 19  ? 7.688  13.483 0.304   1.00 37.89 ? 19  GLU B OE2 1 
ATOM   1209 N N   . ARG B 2 20  ? 5.501  15.887 4.533   1.00 36.66 ? 20  ARG B N   1 
ATOM   1210 C CA  . ARG B 2 20  ? 5.346  17.048 5.397   1.00 37.85 ? 20  ARG B CA  1 
ATOM   1211 C C   . ARG B 2 20  ? 6.346  16.945 6.538   1.00 37.11 ? 20  ARG B C   1 
ATOM   1212 O O   . ARG B 2 20  ? 6.193  16.104 7.432   1.00 38.10 ? 20  ARG B O   1 
ATOM   1213 C CB  . ARG B 2 20  ? 3.929  17.088 5.966   1.00 39.60 ? 20  ARG B CB  1 
ATOM   1214 C CG  . ARG B 2 20  ? 2.887  17.514 4.966   1.00 43.36 ? 20  ARG B CG  1 
ATOM   1215 C CD  . ARG B 2 20  ? 2.973  19.005 4.694   1.00 45.95 ? 20  ARG B CD  1 
ATOM   1216 N NE  . ARG B 2 20  ? 2.429  19.338 3.382   1.00 52.05 ? 20  ARG B NE  1 
ATOM   1217 C CZ  . ARG B 2 20  ? 1.208  19.016 2.967   1.00 53.73 ? 20  ARG B CZ  1 
ATOM   1218 N NH1 . ARG B 2 20  ? 0.382  18.348 3.761   1.00 55.64 ? 20  ARG B NH1 1 
ATOM   1219 N NH2 . ARG B 2 20  ? 0.815  19.352 1.747   1.00 53.50 ? 20  ARG B NH2 1 
ATOM   1220 N N   . MET B 2 21  ? 7.364  17.800 6.517   1.00 34.18 ? 21  MET B N   1 
ATOM   1221 C CA  . MET B 2 21  ? 8.376  17.773 7.564   1.00 30.99 ? 21  MET B CA  1 
ATOM   1222 C C   . MET B 2 21  ? 8.725  19.161 8.066   1.00 28.79 ? 21  MET B C   1 
ATOM   1223 O O   . MET B 2 21  ? 8.396  20.163 7.432   1.00 28.72 ? 21  MET B O   1 
ATOM   1224 C CB  . MET B 2 21  ? 9.646  17.107 7.044   1.00 32.53 ? 21  MET B CB  1 
ATOM   1225 C CG  . MET B 2 21  ? 9.439  15.724 6.462   1.00 35.07 ? 21  MET B CG  1 
ATOM   1226 S SD  . MET B 2 21  ? 11.012 15.051 5.943   1.00 37.10 ? 21  MET B SD  1 
ATOM   1227 C CE  . MET B 2 21  ? 10.514 13.607 5.065   1.00 33.97 ? 21  MET B CE  1 
ATOM   1228 N N   . ASN B 2 22  ? 9.375  19.221 9.224   1.00 25.17 ? 22  ASN B N   1 
ATOM   1229 C CA  . ASN B 2 22  ? 9.799  20.500 9.757   1.00 24.73 ? 22  ASN B CA  1 
ATOM   1230 C C   . ASN B 2 22  ? 11.074 20.808 8.989   1.00 23.49 ? 22  ASN B C   1 
ATOM   1231 O O   . ASN B 2 22  ? 11.663 19.917 8.371   1.00 21.66 ? 22  ASN B O   1 
ATOM   1232 C CB  . ASN B 2 22  ? 10.084 20.417 11.264  1.00 25.69 ? 22  ASN B CB  1 
ATOM   1233 C CG  . ASN B 2 22  ? 11.045 19.298 11.622  1.00 28.43 ? 22  ASN B CG  1 
ATOM   1234 O OD1 . ASN B 2 22  ? 12.072 19.108 10.969  1.00 27.55 ? 22  ASN B OD1 1 
ATOM   1235 N ND2 . ASN B 2 22  ? 10.718 18.555 12.678  1.00 29.44 ? 22  ASN B ND2 1 
ATOM   1236 N N   . TRP B 2 23  ? 11.502 22.062 9.020   1.00 22.93 ? 23  TRP B N   1 
ATOM   1237 C CA  . TRP B 2 23  ? 12.703 22.449 8.298   1.00 23.70 ? 23  TRP B CA  1 
ATOM   1238 C C   . TRP B 2 23  ? 13.831 21.434 8.471   1.00 24.94 ? 23  TRP B C   1 
ATOM   1239 O O   . TRP B 2 23  ? 14.257 20.802 7.507   1.00 26.29 ? 23  TRP B O   1 
ATOM   1240 C CB  . TRP B 2 23  ? 13.177 23.820 8.767   1.00 23.15 ? 23  TRP B CB  1 
ATOM   1241 C CG  . TRP B 2 23  ? 14.114 24.472 7.813   1.00 22.25 ? 23  TRP B CG  1 
ATOM   1242 C CD1 . TRP B 2 23  ? 13.791 25.055 6.627   1.00 22.21 ? 23  TRP B CD1 1 
ATOM   1243 C CD2 . TRP B 2 23  ? 15.536 24.582 7.944   1.00 21.39 ? 23  TRP B CD2 1 
ATOM   1244 N NE1 . TRP B 2 23  ? 14.922 25.522 6.004   1.00 21.37 ? 23  TRP B NE1 1 
ATOM   1245 C CE2 . TRP B 2 23  ? 16.009 25.245 6.790   1.00 22.00 ? 23  TRP B CE2 1 
ATOM   1246 C CE3 . TRP B 2 23  ? 16.458 24.182 8.924   1.00 22.20 ? 23  TRP B CE3 1 
ATOM   1247 C CZ2 . TRP B 2 23  ? 17.369 25.519 6.584   1.00 23.58 ? 23  TRP B CZ2 1 
ATOM   1248 C CZ3 . TRP B 2 23  ? 17.811 24.452 8.719   1.00 22.59 ? 23  TRP B CZ3 1 
ATOM   1249 C CH2 . TRP B 2 23  ? 18.252 25.116 7.554   1.00 22.09 ? 23  TRP B CH2 1 
ATOM   1250 N N   . ALA B 2 24  ? 14.296 21.274 9.707   1.00 24.98 ? 24  ALA B N   1 
ATOM   1251 C CA  . ALA B 2 24  ? 15.398 20.364 10.024  1.00 24.04 ? 24  ALA B CA  1 
ATOM   1252 C C   . ALA B 2 24  ? 15.305 18.988 9.367   1.00 21.73 ? 24  ALA B C   1 
ATOM   1253 O O   . ALA B 2 24  ? 16.240 18.543 8.698   1.00 19.98 ? 24  ALA B O   1 
ATOM   1254 C CB  . ALA B 2 24  ? 15.521 20.216 11.541  1.00 24.57 ? 24  ALA B CB  1 
ATOM   1255 N N   . ASP B 2 25  ? 14.188 18.305 9.564   1.00 20.80 ? 25  ASP B N   1 
ATOM   1256 C CA  . ASP B 2 25  ? 14.023 16.992 8.962   1.00 23.18 ? 25  ASP B CA  1 
ATOM   1257 C C   . ASP B 2 25  ? 14.023 17.063 7.430   1.00 23.08 ? 25  ASP B C   1 
ATOM   1258 O O   . ASP B 2 25  ? 14.547 16.167 6.754   1.00 22.56 ? 25  ASP B O   1 
ATOM   1259 C CB  . ASP B 2 25  ? 12.721 16.344 9.443   1.00 24.77 ? 25  ASP B CB  1 
ATOM   1260 C CG  . ASP B 2 25  ? 12.704 16.110 10.942  1.00 25.83 ? 25  ASP B CG  1 
ATOM   1261 O OD1 . ASP B 2 25  ? 13.790 15.969 11.544  1.00 23.45 ? 25  ASP B OD1 1 
ATOM   1262 O OD2 . ASP B 2 25  ? 11.598 16.053 11.516  1.00 30.10 ? 25  ASP B OD2 1 
ATOM   1263 N N   . ALA B 2 26  ? 13.427 18.121 6.887   1.00 23.07 ? 26  ALA B N   1 
ATOM   1264 C CA  . ALA B 2 26  ? 13.359 18.290 5.444   1.00 24.03 ? 26  ALA B CA  1 
ATOM   1265 C C   . ALA B 2 26  ? 14.759 18.320 4.860   1.00 24.80 ? 26  ALA B C   1 
ATOM   1266 O O   . ALA B 2 26  ? 15.037 17.648 3.862   1.00 23.08 ? 26  ALA B O   1 
ATOM   1267 C CB  . ALA B 2 26  ? 12.622 19.571 5.097   1.00 25.47 ? 26  ALA B CB  1 
ATOM   1268 N N   . GLU B 2 27  ? 15.637 19.105 5.481   1.00 25.44 ? 27  GLU B N   1 
ATOM   1269 C CA  . GLU B 2 27  ? 17.021 19.216 5.030   1.00 25.76 ? 27  GLU B CA  1 
ATOM   1270 C C   . GLU B 2 27  ? 17.684 17.844 5.082   1.00 26.02 ? 27  GLU B C   1 
ATOM   1271 O O   . GLU B 2 27  ? 18.284 17.397 4.103   1.00 26.39 ? 27  GLU B O   1 
ATOM   1272 C CB  . GLU B 2 27  ? 17.772 20.216 5.913   1.00 26.04 ? 27  GLU B CB  1 
ATOM   1273 C CG  . GLU B 2 27  ? 19.289 20.209 5.775   1.00 28.12 ? 27  GLU B CG  1 
ATOM   1274 C CD  . GLU B 2 27  ? 19.795 20.737 4.445   1.00 28.76 ? 27  GLU B CD  1 
ATOM   1275 O OE1 . GLU B 2 27  ? 18.968 21.135 3.594   1.00 27.75 ? 27  GLU B OE1 1 
ATOM   1276 O OE2 . GLU B 2 27  ? 21.036 20.752 4.258   1.00 27.22 ? 27  GLU B OE2 1 
ATOM   1277 N N   . LYS B 2 28  ? 17.549 17.167 6.219   1.00 26.13 ? 28  LYS B N   1 
ATOM   1278 C CA  . LYS B 2 28  ? 18.130 15.838 6.395   1.00 24.97 ? 28  LYS B CA  1 
ATOM   1279 C C   . LYS B 2 28  ? 17.617 14.870 5.317   1.00 24.72 ? 28  LYS B C   1 
ATOM   1280 O O   . LYS B 2 28  ? 18.398 14.167 4.677   1.00 22.15 ? 28  LYS B O   1 
ATOM   1281 C CB  . LYS B 2 28  ? 17.780 15.299 7.785   1.00 26.74 ? 28  LYS B CB  1 
ATOM   1282 C CG  . LYS B 2 28  ? 18.621 14.120 8.243   1.00 28.77 ? 28  LYS B CG  1 
ATOM   1283 C CD  . LYS B 2 28  ? 20.047 14.536 8.608   1.00 31.64 ? 28  LYS B CD  1 
ATOM   1284 C CE  . LYS B 2 28  ? 20.819 13.357 9.200   1.00 36.31 ? 28  LYS B CE  1 
ATOM   1285 N NZ  . LYS B 2 28  ? 22.189 13.711 9.677   1.00 36.86 ? 28  LYS B NZ  1 
ATOM   1286 N N   . PHE B 2 29  ? 16.303 14.842 5.119   1.00 23.17 ? 29  PHE B N   1 
ATOM   1287 C CA  . PHE B 2 29  ? 15.692 13.961 4.126   1.00 22.82 ? 29  PHE B CA  1 
ATOM   1288 C C   . PHE B 2 29  ? 16.291 14.247 2.762   1.00 23.09 ? 29  PHE B C   1 
ATOM   1289 O O   . PHE B 2 29  ? 16.612 13.328 2.006   1.00 24.25 ? 29  PHE B O   1 
ATOM   1290 C CB  . PHE B 2 29  ? 14.175 14.177 4.117   1.00 23.81 ? 29  PHE B CB  1 
ATOM   1291 C CG  . PHE B 2 29  ? 13.446 13.420 3.048   1.00 22.16 ? 29  PHE B CG  1 
ATOM   1292 C CD1 . PHE B 2 29  ? 12.963 14.083 1.919   1.00 23.68 ? 29  PHE B CD1 1 
ATOM   1293 C CD2 . PHE B 2 29  ? 13.215 12.056 3.174   1.00 22.71 ? 29  PHE B CD2 1 
ATOM   1294 C CE1 . PHE B 2 29  ? 12.254 13.398 0.927   1.00 22.15 ? 29  PHE B CE1 1 
ATOM   1295 C CE2 . PHE B 2 29  ? 12.507 11.357 2.188   1.00 22.78 ? 29  PHE B CE2 1 
ATOM   1296 C CZ  . PHE B 2 29  ? 12.025 12.037 1.060   1.00 22.22 ? 29  PHE B CZ  1 
ATOM   1297 N N   . CYS B 2 30  ? 16.461 15.527 2.451   1.00 22.95 ? 30  CYS B N   1 
ATOM   1298 C CA  . CYS B 2 30  ? 17.048 15.902 1.174   1.00 24.12 ? 30  CYS B CA  1 
ATOM   1299 C C   . CYS B 2 30  ? 18.460 15.357 1.035   1.00 23.90 ? 30  CYS B C   1 
ATOM   1300 O O   . CYS B 2 30  ? 18.772 14.685 0.055   1.00 23.24 ? 30  CYS B O   1 
ATOM   1301 C CB  . CYS B 2 30  ? 17.079 17.420 1.009   1.00 23.26 ? 30  CYS B CB  1 
ATOM   1302 S SG  . CYS B 2 30  ? 15.522 18.143 0.401   1.00 24.53 ? 30  CYS B SG  1 
ATOM   1303 N N   . THR B 2 31  ? 19.308 15.642 2.018   1.00 25.68 ? 31  THR B N   1 
ATOM   1304 C CA  . THR B 2 31  ? 20.691 15.180 1.978   1.00 26.89 ? 31  THR B CA  1 
ATOM   1305 C C   . THR B 2 31  ? 20.738 13.683 1.737   1.00 28.46 ? 31  THR B C   1 
ATOM   1306 O O   . THR B 2 31  ? 21.700 13.173 1.170   1.00 29.41 ? 31  THR B O   1 
ATOM   1307 C CB  . THR B 2 31  ? 21.444 15.475 3.300   1.00 26.13 ? 31  THR B CB  1 
ATOM   1308 O OG1 . THR B 2 31  ? 20.945 14.632 4.345   1.00 26.60 ? 31  THR B OG1 1 
ATOM   1309 C CG2 . THR B 2 31  ? 21.259 16.916 3.705   1.00 25.93 ? 31  THR B CG2 1 
ATOM   1310 N N   . LYS B 2 32  ? 19.690 12.984 2.160   1.00 30.16 ? 32  LYS B N   1 
ATOM   1311 C CA  . LYS B 2 32  ? 19.626 11.534 2.006   1.00 32.80 ? 32  LYS B CA  1 
ATOM   1312 C C   . LYS B 2 32  ? 19.226 11.040 0.613   1.00 34.22 ? 32  LYS B C   1 
ATOM   1313 O O   . LYS B 2 32  ? 19.583 9.936  0.219   1.00 36.60 ? 32  LYS B O   1 
ATOM   1314 C CB  . LYS B 2 32  ? 18.665 10.940 3.041   1.00 32.03 ? 32  LYS B CB  1 
ATOM   1315 C CG  . LYS B 2 32  ? 19.026 11.256 4.481   1.00 33.33 ? 32  LYS B CG  1 
ATOM   1316 C CD  . LYS B 2 32  ? 18.275 10.384 5.488   1.00 31.23 ? 32  LYS B CD  1 
ATOM   1317 C CE  . LYS B 2 32  ? 16.771 10.464 5.320   1.00 33.37 ? 32  LYS B CE  1 
ATOM   1318 N NZ  . LYS B 2 32  ? 16.278 9.713  4.126   1.00 32.71 ? 32  LYS B NZ  1 
ATOM   1319 N N   . GLN B 2 33  ? 18.493 11.855 -0.132  1.00 34.82 ? 33  GLN B N   1 
ATOM   1320 C CA  . GLN B 2 33  ? 18.037 11.463 -1.458  1.00 35.19 ? 33  GLN B CA  1 
ATOM   1321 C C   . GLN B 2 33  ? 19.136 11.254 -2.486  1.00 36.65 ? 33  GLN B C   1 
ATOM   1322 O O   . GLN B 2 33  ? 19.052 10.347 -3.309  1.00 38.48 ? 33  GLN B O   1 
ATOM   1323 C CB  . GLN B 2 33  ? 17.067 12.502 -2.014  1.00 34.32 ? 33  GLN B CB  1 
ATOM   1324 C CG  . GLN B 2 33  ? 15.824 12.714 -1.183  1.00 35.99 ? 33  GLN B CG  1 
ATOM   1325 C CD  . GLN B 2 33  ? 15.170 11.412 -0.807  1.00 36.65 ? 33  GLN B CD  1 
ATOM   1326 O OE1 . GLN B 2 33  ? 15.547 10.780 0.177   1.00 39.47 ? 33  GLN B OE1 1 
ATOM   1327 N NE2 . GLN B 2 33  ? 14.192 10.988 -1.602  1.00 38.27 ? 33  GLN B NE2 1 
ATOM   1328 N N   . HIS B 2 34  ? 20.164 12.093 -2.442  1.00 37.95 ? 34  HIS B N   1 
ATOM   1329 C CA  . HIS B 2 34  ? 21.244 12.017 -3.422  1.00 38.08 ? 34  HIS B CA  1 
ATOM   1330 C C   . HIS B 2 34  ? 22.433 12.821 -2.897  1.00 39.23 ? 34  HIS B C   1 
ATOM   1331 O O   . HIS B 2 34  ? 22.274 13.691 -2.035  1.00 37.73 ? 34  HIS B O   1 
ATOM   1332 C CB  . HIS B 2 34  ? 20.743 12.622 -4.737  1.00 36.02 ? 34  HIS B CB  1 
ATOM   1333 C CG  . HIS B 2 34  ? 21.603 12.325 -5.925  1.00 35.32 ? 34  HIS B CG  1 
ATOM   1334 N ND1 . HIS B 2 34  ? 21.255 11.391 -6.877  1.00 33.71 ? 34  HIS B ND1 1 
ATOM   1335 C CD2 . HIS B 2 34  ? 22.774 12.866 -6.338  1.00 35.76 ? 34  HIS B CD2 1 
ATOM   1336 C CE1 . HIS B 2 34  ? 22.173 11.372 -7.828  1.00 33.25 ? 34  HIS B CE1 1 
ATOM   1337 N NE2 . HIS B 2 34  ? 23.105 12.257 -7.525  1.00 33.57 ? 34  HIS B NE2 1 
ATOM   1338 N N   . LYS B 2 35  ? 23.626 12.541 -3.407  1.00 41.31 ? 35  LYS B N   1 
ATOM   1339 C CA  . LYS B 2 35  ? 24.791 13.284 -2.950  1.00 43.71 ? 35  LYS B CA  1 
ATOM   1340 C C   . LYS B 2 35  ? 24.631 14.773 -3.254  1.00 43.87 ? 35  LYS B C   1 
ATOM   1341 O O   . LYS B 2 35  ? 24.044 15.160 -4.269  1.00 43.72 ? 35  LYS B O   1 
ATOM   1342 C CB  . LYS B 2 35  ? 26.068 12.760 -3.609  1.00 45.16 ? 35  LYS B CB  1 
ATOM   1343 C CG  . LYS B 2 35  ? 26.559 11.427 -3.067  1.00 49.29 ? 35  LYS B CG  1 
ATOM   1344 C CD  . LYS B 2 35  ? 25.981 10.242 -3.828  1.00 51.20 ? 35  LYS B CD  1 
ATOM   1345 C CE  . LYS B 2 35  ? 26.630 8.942  -3.377  1.00 50.66 ? 35  LYS B CE  1 
ATOM   1346 N NZ  . LYS B 2 35  ? 26.335 7.822  -4.312  1.00 52.89 ? 35  LYS B NZ  1 
ATOM   1347 N N   . ASP B 2 36  ? 25.148 15.605 -2.358  1.00 43.90 ? 36  ASP B N   1 
ATOM   1348 C CA  . ASP B 2 36  ? 25.083 17.051 -2.523  1.00 43.73 ? 36  ASP B CA  1 
ATOM   1349 C C   . ASP B 2 36  ? 23.664 17.626 -2.631  1.00 41.14 ? 36  ASP B C   1 
ATOM   1350 O O   . ASP B 2 36  ? 23.489 18.777 -3.026  1.00 41.02 ? 36  ASP B O   1 
ATOM   1351 C CB  . ASP B 2 36  ? 25.899 17.460 -3.751  1.00 48.25 ? 36  ASP B CB  1 
ATOM   1352 C CG  . ASP B 2 36  ? 27.297 16.874 -3.741  1.00 50.53 ? 36  ASP B CG  1 
ATOM   1353 O OD1 . ASP B 2 36  ? 28.015 17.051 -2.734  1.00 52.50 ? 36  ASP B OD1 1 
ATOM   1354 O OD2 . ASP B 2 36  ? 27.677 16.236 -4.745  1.00 53.78 ? 36  ASP B OD2 1 
ATOM   1355 N N   . GLY B 2 37  ? 22.657 16.831 -2.283  1.00 39.22 ? 37  GLY B N   1 
ATOM   1356 C CA  . GLY B 2 37  ? 21.288 17.315 -2.329  1.00 35.57 ? 37  GLY B CA  1 
ATOM   1357 C C   . GLY B 2 37  ? 20.959 18.087 -1.059  1.00 33.82 ? 37  GLY B C   1 
ATOM   1358 O O   . GLY B 2 37  ? 21.427 17.733 0.026   1.00 33.80 ? 37  GLY B O   1 
ATOM   1359 N N   . HIS B 2 38  ? 20.156 19.139 -1.190  1.00 31.91 ? 38  HIS B N   1 
ATOM   1360 C CA  . HIS B 2 38  ? 19.751 19.976 -0.056  1.00 30.49 ? 38  HIS B CA  1 
ATOM   1361 C C   . HIS B 2 38  ? 18.378 20.563 -0.365  1.00 30.39 ? 38  HIS B C   1 
ATOM   1362 O O   . HIS B 2 38  ? 17.878 20.413 -1.477  1.00 31.61 ? 38  HIS B O   1 
ATOM   1363 C CB  . HIS B 2 38  ? 20.725 21.144 0.125   1.00 28.03 ? 38  HIS B CB  1 
ATOM   1364 C CG  . HIS B 2 38  ? 22.109 20.740 0.527   1.00 27.50 ? 38  HIS B CG  1 
ATOM   1365 N ND1 . HIS B 2 38  ? 22.444 20.418 1.825   1.00 27.29 ? 38  HIS B ND1 1 
ATOM   1366 C CD2 . HIS B 2 38  ? 23.257 20.667 -0.186  1.00 24.85 ? 38  HIS B CD2 1 
ATOM   1367 C CE1 . HIS B 2 38  ? 23.739 20.175 1.896   1.00 23.02 ? 38  HIS B CE1 1 
ATOM   1368 N NE2 . HIS B 2 38  ? 24.256 20.320 0.689   1.00 24.01 ? 38  HIS B NE2 1 
ATOM   1369 N N   . LEU B 2 39  ? 17.768 21.229 0.614   1.00 30.39 ? 39  LEU B N   1 
ATOM   1370 C CA  . LEU B 2 39  ? 16.480 21.872 0.380   1.00 29.15 ? 39  LEU B CA  1 
ATOM   1371 C C   . LEU B 2 39  ? 16.784 22.834 -0.744  1.00 28.62 ? 39  LEU B C   1 
ATOM   1372 O O   . LEU B 2 39  ? 17.868 23.404 -0.786  1.00 27.86 ? 39  LEU B O   1 
ATOM   1373 C CB  . LEU B 2 39  ? 16.019 22.656 1.612   1.00 28.30 ? 39  LEU B CB  1 
ATOM   1374 C CG  . LEU B 2 39  ? 15.254 21.889 2.698   1.00 29.53 ? 39  LEU B CG  1 
ATOM   1375 C CD1 . LEU B 2 39  ? 15.057 22.776 3.920   1.00 26.95 ? 39  LEU B CD1 1 
ATOM   1376 C CD2 . LEU B 2 39  ? 13.900 21.433 2.148   1.00 29.14 ? 39  LEU B CD2 1 
ATOM   1377 N N   . VAL B 2 40  ? 15.847 23.022 -1.661  1.00 28.30 ? 40  VAL B N   1 
ATOM   1378 C CA  . VAL B 2 40  ? 16.100 23.922 -2.773  1.00 28.31 ? 40  VAL B CA  1 
ATOM   1379 C C   . VAL B 2 40  ? 16.524 25.317 -2.329  1.00 29.65 ? 40  VAL B C   1 
ATOM   1380 O O   . VAL B 2 40  ? 16.060 25.829 -1.306  1.00 29.41 ? 40  VAL B O   1 
ATOM   1381 C CB  . VAL B 2 40  ? 14.866 24.062 -3.681  1.00 27.01 ? 40  VAL B CB  1 
ATOM   1382 C CG1 . VAL B 2 40  ? 13.705 24.625 -2.901  1.00 27.03 ? 40  VAL B CG1 1 
ATOM   1383 C CG2 . VAL B 2 40  ? 15.196 24.967 -4.855  1.00 27.44 ? 40  VAL B CG2 1 
ATOM   1384 N N   . SER B 2 41  ? 17.423 25.918 -3.103  1.00 31.31 ? 41  SER B N   1 
ATOM   1385 C CA  . SER B 2 41  ? 17.890 27.272 -2.840  1.00 35.29 ? 41  SER B CA  1 
ATOM   1386 C C   . SER B 2 41  ? 17.551 28.072 -4.092  1.00 38.45 ? 41  SER B C   1 
ATOM   1387 O O   . SER B 2 41  ? 17.539 27.525 -5.195  1.00 40.00 ? 41  SER B O   1 
ATOM   1388 C CB  . SER B 2 41  ? 19.401 27.296 -2.600  1.00 34.11 ? 41  SER B CB  1 
ATOM   1389 O OG  . SER B 2 41  ? 20.123 27.117 -3.806  1.00 36.20 ? 41  SER B OG  1 
ATOM   1390 N N   . PHE B 2 42  ? 17.253 29.355 -3.935  1.00 41.67 ? 42  PHE B N   1 
ATOM   1391 C CA  . PHE B 2 42  ? 16.922 30.182 -5.093  1.00 44.78 ? 42  PHE B CA  1 
ATOM   1392 C C   . PHE B 2 42  ? 17.823 31.399 -5.236  1.00 46.43 ? 42  PHE B C   1 
ATOM   1393 O O   . PHE B 2 42  ? 18.005 32.173 -4.294  1.00 46.43 ? 42  PHE B O   1 
ATOM   1394 C CB  . PHE B 2 42  ? 15.467 30.643 -5.034  1.00 45.52 ? 42  PHE B CB  1 
ATOM   1395 C CG  . PHE B 2 42  ? 14.477 29.546 -5.265  1.00 47.24 ? 42  PHE B CG  1 
ATOM   1396 C CD1 . PHE B 2 42  ? 14.626 28.678 -6.337  1.00 48.27 ? 42  PHE B CD1 1 
ATOM   1397 C CD2 . PHE B 2 42  ? 13.381 29.393 -4.423  1.00 49.90 ? 42  PHE B CD2 1 
ATOM   1398 C CE1 . PHE B 2 42  ? 13.703 27.671 -6.570  1.00 50.97 ? 42  PHE B CE1 1 
ATOM   1399 C CE2 . PHE B 2 42  ? 12.446 28.385 -4.645  1.00 51.86 ? 42  PHE B CE2 1 
ATOM   1400 C CZ  . PHE B 2 42  ? 12.607 27.520 -5.723  1.00 52.99 ? 42  PHE B CZ  1 
ATOM   1401 N N   . ARG B 2 43  ? 18.377 31.563 -6.430  1.00 48.69 ? 43  ARG B N   1 
ATOM   1402 C CA  . ARG B 2 43  ? 19.260 32.679 -6.719  1.00 51.54 ? 43  ARG B CA  1 
ATOM   1403 C C   . ARG B 2 43  ? 18.711 33.457 -7.920  1.00 52.27 ? 43  ARG B C   1 
ATOM   1404 O O   . ARG B 2 43  ? 19.275 34.461 -8.359  1.00 52.10 ? 43  ARG B O   1 
ATOM   1405 C CB  . ARG B 2 43  ? 20.668 32.134 -6.968  1.00 52.04 ? 43  ARG B CB  1 
ATOM   1406 C CG  . ARG B 2 43  ? 21.217 31.420 -5.727  1.00 54.47 ? 43  ARG B CG  1 
ATOM   1407 C CD  . ARG B 2 43  ? 22.635 30.898 -5.897  1.00 57.66 ? 43  ARG B CD  1 
ATOM   1408 N NE  . ARG B 2 43  ? 22.695 29.695 -6.721  1.00 61.40 ? 43  ARG B NE  1 
ATOM   1409 C CZ  . ARG B 2 43  ? 23.816 29.028 -6.986  1.00 63.76 ? 43  ARG B CZ  1 
ATOM   1410 N NH1 . ARG B 2 43  ? 23.777 27.942 -7.746  1.00 64.75 ? 43  ARG B NH1 1 
ATOM   1411 N NH2 . ARG B 2 43  ? 24.976 29.445 -6.492  1.00 63.57 ? 43  ARG B NH2 1 
ATOM   1412 N N   . ASN B 2 44  ? 17.575 32.974 -8.413  1.00 53.08 ? 44  ASN B N   1 
ATOM   1413 C CA  . ASN B 2 44  ? 16.849 33.539 -9.545  1.00 53.76 ? 44  ASN B CA  1 
ATOM   1414 C C   . ASN B 2 44  ? 17.436 33.279 -10.923 1.00 55.12 ? 44  ASN B C   1 
ATOM   1415 O O   . ASN B 2 44  ? 17.386 34.141 -11.804 1.00 54.77 ? 44  ASN B O   1 
ATOM   1416 C CB  . ASN B 2 44  ? 16.624 35.039 -9.380  1.00 52.88 ? 44  ASN B CB  1 
ATOM   1417 C CG  . ASN B 2 44  ? 15.571 35.574 -10.344 1.00 53.49 ? 44  ASN B CG  1 
ATOM   1418 O OD1 . ASN B 2 44  ? 14.490 34.992 -10.482 1.00 52.86 ? 44  ASN B OD1 1 
ATOM   1419 N ND2 . ASN B 2 44  ? 15.877 36.686 -11.009 1.00 53.18 ? 44  ASN B ND2 1 
ATOM   1420 N N   . SER B 2 45  ? 17.999 32.090 -11.111 1.00 55.75 ? 45  SER B N   1 
ATOM   1421 C CA  . SER B 2 45  ? 18.506 31.711 -12.422 1.00 55.93 ? 45  SER B CA  1 
ATOM   1422 C C   . SER B 2 45  ? 17.174 31.323 -13.062 1.00 55.98 ? 45  SER B C   1 
ATOM   1423 O O   . SER B 2 45  ? 17.095 30.448 -13.929 1.00 55.95 ? 45  SER B O   1 
ATOM   1424 C CB  . SER B 2 45  ? 19.425 30.483 -12.324 1.00 56.51 ? 45  SER B CB  1 
ATOM   1425 O OG  . SER B 2 45  ? 20.590 30.749 -11.554 1.00 55.43 ? 45  SER B OG  1 
ATOM   1426 N N   . LYS B 2 46  ? 16.130 32.001 -12.586 1.00 54.88 ? 46  LYS B N   1 
ATOM   1427 C CA  . LYS B 2 46  ? 14.751 31.790 -12.992 1.00 53.23 ? 46  LYS B CA  1 
ATOM   1428 C C   . LYS B 2 46  ? 14.332 30.401 -12.562 1.00 51.85 ? 46  LYS B C   1 
ATOM   1429 O O   . LYS B 2 46  ? 13.518 29.745 -13.217 1.00 51.43 ? 46  LYS B O   1 
ATOM   1430 C CB  . LYS B 2 46  ? 14.584 31.973 -14.496 1.00 53.98 ? 46  LYS B CB  1 
ATOM   1431 C CG  . LYS B 2 46  ? 14.671 33.429 -14.949 1.00 56.43 ? 46  LYS B CG  1 
ATOM   1432 C CD  . LYS B 2 46  ? 13.418 34.252 -14.622 1.00 56.73 ? 46  LYS B CD  1 
ATOM   1433 C CE  . LYS B 2 46  ? 13.314 34.666 -13.152 1.00 57.19 ? 46  LYS B CE  1 
ATOM   1434 N NZ  . LYS B 2 46  ? 12.831 33.584 -12.247 1.00 56.37 ? 46  LYS B NZ  1 
ATOM   1435 N N   . GLU B 2 47  ? 14.910 29.966 -11.444 1.00 49.90 ? 47  GLU B N   1 
ATOM   1436 C CA  . GLU B 2 47  ? 14.617 28.659 -10.878 1.00 47.55 ? 47  GLU B CA  1 
ATOM   1437 C C   . GLU B 2 47  ? 13.206 28.714 -10.333 1.00 45.90 ? 47  GLU B C   1 
ATOM   1438 O O   . GLU B 2 47  ? 12.450 27.752 -10.437 1.00 44.52 ? 47  GLU B O   1 
ATOM   1439 C CB  . GLU B 2 47  ? 15.557 28.335 -9.717  1.00 47.84 ? 47  GLU B CB  1 
ATOM   1440 C CG  . GLU B 2 47  ? 16.946 28.926 -9.809  1.00 48.79 ? 47  GLU B CG  1 
ATOM   1441 C CD  . GLU B 2 47  ? 17.805 28.533 -8.624  1.00 49.26 ? 47  GLU B CD  1 
ATOM   1442 O OE1 . GLU B 2 47  ? 18.224 27.359 -8.557  1.00 46.98 ? 47  GLU B OE1 1 
ATOM   1443 O OE2 . GLU B 2 47  ? 18.052 29.394 -7.752  1.00 52.00 ? 47  GLU B OE2 1 
ATOM   1444 N N   . VAL B 2 48  ? 12.862 29.851 -9.742  1.00 44.84 ? 48  VAL B N   1 
ATOM   1445 C CA  . VAL B 2 48  ? 11.543 30.030 -9.162  1.00 45.00 ? 48  VAL B CA  1 
ATOM   1446 C C   . VAL B 2 48  ? 10.490 29.559 -10.145 1.00 43.83 ? 48  VAL B C   1 
ATOM   1447 O O   . VAL B 2 48  ? 9.838  28.539 -9.927  1.00 43.25 ? 48  VAL B O   1 
ATOM   1448 C CB  . VAL B 2 48  ? 11.290 31.499 -8.819  1.00 46.91 ? 48  VAL B CB  1 
ATOM   1449 C CG1 . VAL B 2 48  ? 9.948  31.645 -8.121  1.00 49.00 ? 48  VAL B CG1 1 
ATOM   1450 C CG2 . VAL B 2 48  ? 12.420 32.022 -7.944  1.00 48.31 ? 48  VAL B CG2 1 
ATOM   1451 N N   . ASP B 2 49  ? 10.338 30.304 -11.234 1.00 44.10 ? 49  ASP B N   1 
ATOM   1452 C CA  . ASP B 2 49  ? 9.374  29.953 -12.265 1.00 42.39 ? 49  ASP B CA  1 
ATOM   1453 C C   . ASP B 2 49  ? 9.471  28.462 -12.560 1.00 41.54 ? 49  ASP B C   1 
ATOM   1454 O O   . ASP B 2 49  ? 8.497  27.732 -12.409 1.00 40.81 ? 49  ASP B O   1 
ATOM   1455 C CB  . ASP B 2 49  ? 9.641  30.766 -13.537 1.00 43.56 ? 49  ASP B CB  1 
ATOM   1456 C CG  . ASP B 2 49  ? 8.954  32.124 -13.517 1.00 43.46 ? 49  ASP B CG  1 
ATOM   1457 O OD1 . ASP B 2 49  ? 7.711  32.161 -13.630 1.00 44.10 ? 49  ASP B OD1 1 
ATOM   1458 O OD2 . ASP B 2 49  ? 9.651  33.152 -13.387 1.00 43.92 ? 49  ASP B OD2 1 
ATOM   1459 N N   . PHE B 2 50  ? 10.652 28.005 -12.960 1.00 40.54 ? 50  PHE B N   1 
ATOM   1460 C CA  . PHE B 2 50  ? 10.828 26.592 -13.263 1.00 40.65 ? 50  PHE B CA  1 
ATOM   1461 C C   . PHE B 2 50  ? 10.364 25.709 -12.114 1.00 41.11 ? 50  PHE B C   1 
ATOM   1462 O O   . PHE B 2 50  ? 9.447  24.899 -12.270 1.00 40.65 ? 50  PHE B O   1 
ATOM   1463 C CB  . PHE B 2 50  ? 12.291 26.267 -13.571 1.00 40.74 ? 50  PHE B CB  1 
ATOM   1464 C CG  . PHE B 2 50  ? 12.558 24.793 -13.704 1.00 42.03 ? 50  PHE B CG  1 
ATOM   1465 C CD1 . PHE B 2 50  ? 11.926 24.046 -14.696 1.00 41.79 ? 50  PHE B CD1 1 
ATOM   1466 C CD2 . PHE B 2 50  ? 13.404 24.141 -12.811 1.00 42.96 ? 50  PHE B CD2 1 
ATOM   1467 C CE1 . PHE B 2 50  ? 12.130 22.669 -14.794 1.00 42.20 ? 50  PHE B CE1 1 
ATOM   1468 C CE2 . PHE B 2 50  ? 13.616 22.763 -12.901 1.00 42.22 ? 50  PHE B CE2 1 
ATOM   1469 C CZ  . PHE B 2 50  ? 12.976 22.027 -13.894 1.00 42.83 ? 50  PHE B CZ  1 
ATOM   1470 N N   . VAL B 2 51  ? 11.009 25.867 -10.961 1.00 41.30 ? 51  VAL B N   1 
ATOM   1471 C CA  . VAL B 2 51  ? 10.674 25.078 -9.786  1.00 41.36 ? 51  VAL B CA  1 
ATOM   1472 C C   . VAL B 2 51  ? 9.180  25.079 -9.525  1.00 42.30 ? 51  VAL B C   1 
ATOM   1473 O O   . VAL B 2 51  ? 8.600  24.034 -9.264  1.00 42.05 ? 51  VAL B O   1 
ATOM   1474 C CB  . VAL B 2 51  ? 11.416 25.594 -8.530  1.00 41.03 ? 51  VAL B CB  1 
ATOM   1475 C CG1 . VAL B 2 51  ? 10.959 24.828 -7.294  1.00 39.03 ? 51  VAL B CG1 1 
ATOM   1476 C CG2 . VAL B 2 51  ? 12.915 25.431 -8.721  1.00 40.13 ? 51  VAL B CG2 1 
ATOM   1477 N N   . ILE B 2 52  ? 8.549  26.244 -9.609  1.00 43.98 ? 52  ILE B N   1 
ATOM   1478 C CA  . ILE B 2 52  ? 7.114  26.316 -9.366  1.00 47.34 ? 52  ILE B CA  1 
ATOM   1479 C C   . ILE B 2 52  ? 6.260  25.943 -10.581 1.00 50.29 ? 52  ILE B C   1 
ATOM   1480 O O   . ILE B 2 52  ? 5.125  25.484 -10.427 1.00 50.30 ? 52  ILE B O   1 
ATOM   1481 C CB  . ILE B 2 52  ? 6.696  27.719 -8.889  1.00 45.91 ? 52  ILE B CB  1 
ATOM   1482 C CG1 . ILE B 2 52  ? 7.099  28.760 -9.930  1.00 44.96 ? 52  ILE B CG1 1 
ATOM   1483 C CG2 . ILE B 2 52  ? 7.324  28.014 -7.544  1.00 46.42 ? 52  ILE B CG2 1 
ATOM   1484 C CD1 . ILE B 2 52  ? 6.710  30.171 -9.571  1.00 47.13 ? 52  ILE B CD1 1 
ATOM   1485 N N   . SER B 2 53  ? 6.798  26.129 -11.784 1.00 53.72 ? 53  SER B N   1 
ATOM   1486 C CA  . SER B 2 53  ? 6.047  25.823 -13.001 1.00 57.62 ? 53  SER B CA  1 
ATOM   1487 C C   . SER B 2 53  ? 6.279  24.423 -13.565 1.00 59.52 ? 53  SER B C   1 
ATOM   1488 O O   . SER B 2 53  ? 5.439  23.906 -14.298 1.00 59.69 ? 53  SER B O   1 
ATOM   1489 C CB  . SER B 2 53  ? 6.344  26.868 -14.081 1.00 58.20 ? 53  SER B CB  1 
ATOM   1490 O OG  . SER B 2 53  ? 7.717  26.883 -14.427 1.00 58.70 ? 53  SER B OG  1 
ATOM   1491 N N   . LEU B 2 54  ? 7.412  23.811 -13.230 1.00 62.60 ? 54  LEU B N   1 
ATOM   1492 C CA  . LEU B 2 54  ? 7.722  22.465 -13.710 1.00 65.86 ? 54  LEU B CA  1 
ATOM   1493 C C   . LEU B 2 54  ? 8.065  21.524 -12.563 1.00 68.31 ? 54  LEU B C   1 
ATOM   1494 O O   . LEU B 2 54  ? 7.570  20.399 -12.502 1.00 68.08 ? 54  LEU B O   1 
ATOM   1495 C CB  . LEU B 2 54  ? 8.888  22.494 -14.697 1.00 65.46 ? 54  LEU B CB  1 
ATOM   1496 C CG  . LEU B 2 54  ? 8.694  23.192 -16.044 1.00 66.02 ? 54  LEU B CG  1 
ATOM   1497 C CD1 . LEU B 2 54  ? 7.454  22.639 -16.730 1.00 66.07 ? 54  LEU B CD1 1 
ATOM   1498 C CD2 . LEU B 2 54  ? 8.572  24.686 -15.840 1.00 65.65 ? 54  LEU B CD2 1 
ATOM   1499 N N   . ALA B 2 55  ? 8.924  21.984 -11.660 1.00 72.02 ? 55  ALA B N   1 
ATOM   1500 C CA  . ALA B 2 55  ? 9.319  21.183 -10.507 1.00 75.58 ? 55  ALA B CA  1 
ATOM   1501 C C   . ALA B 2 55  ? 8.328  21.430 -9.369  1.00 77.97 ? 55  ALA B C   1 
ATOM   1502 O O   . ALA B 2 55  ? 8.694  21.397 -8.193  1.00 78.35 ? 55  ALA B O   1 
ATOM   1503 C CB  . ALA B 2 55  ? 10.735 21.551 -10.069 1.00 74.21 ? 55  ALA B CB  1 
ATOM   1504 N N   . PHE B 2 56  ? 7.076  21.696 -9.734  1.00 79.56 ? 56  PHE B N   1 
ATOM   1505 C CA  . PHE B 2 56  ? 6.021  21.949 -8.760  1.00 80.87 ? 56  PHE B CA  1 
ATOM   1506 C C   . PHE B 2 56  ? 4.692  21.351 -9.207  1.00 81.84 ? 56  PHE B C   1 
ATOM   1507 O O   . PHE B 2 56  ? 3.916  20.880 -8.380  1.00 82.30 ? 56  PHE B O   1 
ATOM   1508 C CB  . PHE B 2 56  ? 5.864  23.439 -8.527  1.00 81.58 ? 56  PHE B CB  1 
ATOM   1509 N N   . PRO B 2 57  ? 4.396  21.387 -10.520 1.00 82.34 ? 57  PRO B N   1 
ATOM   1510 C CA  . PRO B 2 57  ? 3.131  20.814 -10.988 1.00 81.76 ? 57  PRO B CA  1 
ATOM   1511 C C   . PRO B 2 57  ? 3.050  19.351 -10.575 1.00 81.22 ? 57  PRO B C   1 
ATOM   1512 O O   . PRO B 2 57  ? 1.987  18.732 -10.625 1.00 81.73 ? 57  PRO B O   1 
ATOM   1513 C CB  . PRO B 2 57  ? 3.217  20.992 -12.497 1.00 82.06 ? 57  PRO B CB  1 
ATOM   1514 C CG  . PRO B 2 57  ? 3.925  22.293 -12.613 1.00 82.47 ? 57  PRO B CG  1 
ATOM   1515 C CD  . PRO B 2 57  ? 5.050  22.141 -11.604 1.00 82.86 ? 57  PRO B CD  1 
ATOM   1516 N N   . MET B 2 58  ? 4.195  18.809 -10.180 1.00 80.02 ? 58  MET B N   1 
ATOM   1517 C CA  . MET B 2 58  ? 4.285  17.433 -9.720  1.00 79.32 ? 58  MET B CA  1 
ATOM   1518 C C   . MET B 2 58  ? 4.142  17.486 -8.205  1.00 78.00 ? 58  MET B C   1 
ATOM   1519 O O   . MET B 2 58  ? 4.519  16.556 -7.491  1.00 78.16 ? 58  MET B O   1 
ATOM   1520 C CB  . MET B 2 58  ? 5.640  16.834 -10.105 1.00 80.11 ? 58  MET B CB  1 
ATOM   1521 C CG  . MET B 2 58  ? 5.846  16.692 -11.607 1.00 80.95 ? 58  MET B CG  1 
ATOM   1522 S SD  . MET B 2 58  ? 7.410  15.907 -12.042 1.00 80.76 ? 58  MET B SD  1 
ATOM   1523 C CE  . MET B 2 58  ? 8.239  17.249 -12.893 1.00 80.85 ? 58  MET B CE  1 
ATOM   1524 N N   . LEU B 2 59  ? 3.584  18.595 -7.729  1.00 76.19 ? 59  LEU B N   1 
ATOM   1525 C CA  . LEU B 2 59  ? 3.386  18.822 -6.305  1.00 73.93 ? 59  LEU B CA  1 
ATOM   1526 C C   . LEU B 2 59  ? 2.077  19.544 -5.997  1.00 72.79 ? 59  LEU B C   1 
ATOM   1527 O O   . LEU B 2 59  ? 1.477  20.184 -6.861  1.00 72.33 ? 59  LEU B O   1 
ATOM   1528 C CB  . LEU B 2 59  ? 4.540  19.651 -5.746  1.00 72.44 ? 59  LEU B CB  1 
ATOM   1529 C CG  . LEU B 2 59  ? 4.448  20.012 -4.265  1.00 70.94 ? 59  LEU B CG  1 
ATOM   1530 C CD1 . LEU B 2 59  ? 4.586  18.749 -3.438  1.00 70.18 ? 59  LEU B CD1 1 
ATOM   1531 C CD2 . LEU B 2 59  ? 5.530  21.017 -3.903  1.00 70.88 ? 59  LEU B CD2 1 
ATOM   1532 N N   . LYS B 2 60  ? 1.662  19.436 -4.740  1.00 71.61 ? 60  LYS B N   1 
ATOM   1533 C CA  . LYS B 2 60  ? 0.448  20.058 -4.232  1.00 69.94 ? 60  LYS B CA  1 
ATOM   1534 C C   . LYS B 2 60  ? 0.441  21.567 -4.485  1.00 69.00 ? 60  LYS B C   1 
ATOM   1535 O O   . LYS B 2 60  ? -0.545 22.245 -4.193  1.00 69.55 ? 60  LYS B O   1 
ATOM   1536 C CB  . LYS B 2 60  ? 0.352  19.776 -2.728  1.00 69.60 ? 60  LYS B CB  1 
ATOM   1537 C CG  . LYS B 2 60  ? -0.729 20.529 -1.978  1.00 69.52 ? 60  LYS B CG  1 
ATOM   1538 C CD  . LYS B 2 60  ? -0.536 20.343 -0.483  1.00 69.11 ? 60  LYS B CD  1 
ATOM   1539 C CE  . LYS B 2 60  ? -1.553 21.121 0.336   1.00 70.10 ? 60  LYS B CE  1 
ATOM   1540 N NZ  . LYS B 2 60  ? -1.309 20.969 1.802   1.00 67.97 ? 60  LYS B NZ  1 
ATOM   1541 N N   . ASN B 2 61  ? 1.507  22.080 -5.040  1.00 67.48 ? 61  ASN B N   1 
ATOM   1542 C CA  . ASN B 2 61  ? 1.561  23.540 -5.287  1.00 65.11 ? 61  ASN B CA  1 
ATOM   1543 C C   . ASN B 2 61  ? 0.884  24.441 -4.227  1.00 62.66 ? 61  ASN B C   1 
ATOM   1544 O O   . ASN B 2 61  ? -0.245 24.901 -4.425  1.00 63.79 ? 61  ASN B O   1 
ATOM   1545 C CB  . ASN B 2 61  ? 1.008  23.881 -6.666  1.00 66.44 ? 61  ASN B CB  1 
ATOM   1546 C CG  . ASN B 2 61  ? 1.277  25.350 -7.006  1.00 67.43 ? 61  ASN B CG  1 
ATOM   1547 O OD1 . ASN B 2 61  ? 2.441  25.771 -7.052  1.00 67.96 ? 61  ASN B OD1 1 
ATOM   1548 N ND2 . ASN B 2 61  ? 0.214  26.097 -7.244  1.00 67.89 ? 61  ASN B ND2 1 
ATOM   1549 N N   . ASP B 2 62  ? 1.643  24.709 -3.093  1.00 58.79 ? 62  ASP B N   1 
ATOM   1550 C CA  . ASP B 2 62  ? 1.274  25.591 -1.946  1.00 54.01 ? 62  ASP B CA  1 
ATOM   1551 C C   . ASP B 2 62  ? 2.396  26.681 -1.511  1.00 49.73 ? 62  ASP B C   1 
ATOM   1552 O O   . ASP B 2 62  ? 2.567  27.760 -2.067  1.00 48.62 ? 62  ASP B O   1 
ATOM   1553 C CB  . ASP B 2 62  ? 0.893  24.622 -0.771  1.00 56.15 ? 62  ASP B CB  1 
ATOM   1554 C CG  . ASP B 2 62  ? 1.385  23.149 -0.939  1.00 58.20 ? 62  ASP B CG  1 
ATOM   1555 O OD1 . ASP B 2 62  ? 1.252  22.600 -2.041  1.00 58.19 ? 62  ASP B OD1 1 
ATOM   1556 O OD2 . ASP B 2 62  ? 1.905  22.563 0.034   1.00 60.45 ? 62  ASP B OD2 1 
ATOM   1557 N N   . LEU B 2 63  ? 3.073  26.212 -0.505  1.00 44.43 ? 63  LEU B N   1 
ATOM   1558 C CA  . LEU B 2 63  ? 4.080  26.081 0.515   1.00 39.76 ? 63  LEU B CA  1 
ATOM   1559 C C   . LEU B 2 63  ? 5.181  25.027 0.595   1.00 36.44 ? 63  LEU B C   1 
ATOM   1560 O O   . LEU B 2 63  ? 4.989  23.972 1.195   1.00 37.06 ? 63  LEU B O   1 
ATOM   1561 C CB  . LEU B 2 63  ? 3.688  26.510 1.932   1.00 40.29 ? 63  LEU B CB  1 
ATOM   1562 C CG  . LEU B 2 63  ? 2.672  27.640 2.106   1.00 42.26 ? 63  LEU B CG  1 
ATOM   1563 C CD1 . LEU B 2 63  ? 1.322  27.233 1.539   1.00 42.74 ? 63  LEU B CD1 1 
ATOM   1564 C CD2 . LEU B 2 63  ? 2.543  27.967 3.588   1.00 43.08 ? 63  LEU B CD2 1 
ATOM   1565 N N   . VAL B 2 64  ? 6.327  25.325 -0.013  1.00 32.52 ? 64  VAL B N   1 
ATOM   1566 C CA  . VAL B 2 64  ? 7.478  24.423 -0.019  1.00 28.17 ? 64  VAL B CA  1 
ATOM   1567 C C   . VAL B 2 64  ? 8.586  25.043 0.843   1.00 26.78 ? 64  VAL B C   1 
ATOM   1568 O O   . VAL B 2 64  ? 8.729  26.269 0.884   1.00 25.67 ? 64  VAL B O   1 
ATOM   1569 C CB  . VAL B 2 64  ? 8.026  24.220 -1.467  1.00 27.39 ? 64  VAL B CB  1 
ATOM   1570 C CG1 . VAL B 2 64  ? 6.964  24.623 -2.486  1.00 28.04 ? 64  VAL B CG1 1 
ATOM   1571 C CG2 . VAL B 2 64  ? 9.304  25.037 -1.689  1.00 24.50 ? 64  VAL B CG2 1 
ATOM   1572 N N   . TRP B 2 65  ? 9.360  24.210 1.534   1.00 24.07 ? 65  TRP B N   1 
ATOM   1573 C CA  . TRP B 2 65  ? 10.452 24.722 2.355   1.00 21.62 ? 65  TRP B CA  1 
ATOM   1574 C C   . TRP B 2 65  ? 11.546 25.260 1.449   1.00 22.38 ? 65  TRP B C   1 
ATOM   1575 O O   . TRP B 2 65  ? 11.775 24.760 0.342   1.00 23.47 ? 65  TRP B O   1 
ATOM   1576 C CB  . TRP B 2 65  ? 11.097 23.625 3.211   1.00 19.36 ? 65  TRP B CB  1 
ATOM   1577 C CG  . TRP B 2 65  ? 10.414 23.261 4.504   1.00 16.64 ? 65  TRP B CG  1 
ATOM   1578 C CD1 . TRP B 2 65  ? 9.976  22.026 4.869   1.00 13.77 ? 65  TRP B CD1 1 
ATOM   1579 C CD2 . TRP B 2 65  ? 10.140 24.127 5.615   1.00 13.78 ? 65  TRP B CD2 1 
ATOM   1580 N NE1 . TRP B 2 65  ? 9.447  22.065 6.132   1.00 13.25 ? 65  TRP B NE1 1 
ATOM   1581 C CE2 . TRP B 2 65  ? 9.534  23.342 6.613   1.00 12.70 ? 65  TRP B CE2 1 
ATOM   1582 C CE3 . TRP B 2 65  ? 10.349 25.487 5.861   1.00 14.91 ? 65  TRP B CE3 1 
ATOM   1583 C CZ2 . TRP B 2 65  ? 9.133  23.869 7.838   1.00 11.43 ? 65  TRP B CZ2 1 
ATOM   1584 C CZ3 . TRP B 2 65  ? 9.951  26.010 7.080   1.00 12.04 ? 65  TRP B CZ3 1 
ATOM   1585 C CH2 . TRP B 2 65  ? 9.350  25.201 8.052   1.00 11.29 ? 65  TRP B CH2 1 
ATOM   1586 N N   . ILE B 2 66  ? 12.233 26.274 1.945   1.00 23.90 ? 66  ILE B N   1 
ATOM   1587 C CA  . ILE B 2 66  ? 13.343 26.878 1.243   1.00 24.76 ? 66  ILE B CA  1 
ATOM   1588 C C   . ILE B 2 66  ? 14.532 26.604 2.158   1.00 23.38 ? 66  ILE B C   1 
ATOM   1589 O O   . ILE B 2 66  ? 14.418 26.721 3.374   1.00 20.42 ? 66  ILE B O   1 
ATOM   1590 C CB  . ILE B 2 66  ? 13.108 28.388 1.058   1.00 26.59 ? 66  ILE B CB  1 
ATOM   1591 C CG1 . ILE B 2 66  ? 12.382 28.637 -0.266  1.00 25.52 ? 66  ILE B CG1 1 
ATOM   1592 C CG2 . ILE B 2 66  ? 14.407 29.132 1.110   1.00 29.61 ? 66  ILE B CG2 1 
ATOM   1593 C CD1 . ILE B 2 66  ? 12.110 30.095 -0.528  1.00 27.26 ? 66  ILE B CD1 1 
ATOM   1594 N N   . GLY B 2 67  ? 15.660 26.217 1.576   1.00 25.42 ? 67  GLY B N   1 
ATOM   1595 C CA  . GLY B 2 67  ? 16.833 25.893 2.372   1.00 25.04 ? 67  GLY B CA  1 
ATOM   1596 C C   . GLY B 2 67  ? 17.588 27.046 3.005   1.00 25.61 ? 67  GLY B C   1 
ATOM   1597 O O   . GLY B 2 67  ? 18.809 27.152 2.847   1.00 22.77 ? 67  GLY B O   1 
ATOM   1598 N N   . LEU B 2 68  ? 16.877 27.895 3.739   1.00 27.68 ? 68  LEU B N   1 
ATOM   1599 C CA  . LEU B 2 68  ? 17.507 29.034 4.392   1.00 29.90 ? 68  LEU B CA  1 
ATOM   1600 C C   . LEU B 2 68  ? 16.873 29.357 5.743   1.00 30.74 ? 68  LEU B C   1 
ATOM   1601 O O   . LEU B 2 68  ? 15.705 29.737 5.809   1.00 31.42 ? 68  LEU B O   1 
ATOM   1602 C CB  . LEU B 2 68  ? 17.428 30.266 3.477   1.00 30.65 ? 68  LEU B CB  1 
ATOM   1603 C CG  . LEU B 2 68  ? 18.195 31.563 3.800   1.00 30.72 ? 68  LEU B CG  1 
ATOM   1604 C CD1 . LEU B 2 68  ? 17.744 32.143 5.129   1.00 27.47 ? 68  LEU B CD1 1 
ATOM   1605 C CD2 . LEU B 2 68  ? 19.684 31.280 3.816   1.00 29.42 ? 68  LEU B CD2 1 
ATOM   1606 N N   . THR B 2 69  ? 17.645 29.194 6.816   1.00 30.65 ? 69  THR B N   1 
ATOM   1607 C CA  . THR B 2 69  ? 17.168 29.521 8.156   1.00 32.39 ? 69  THR B CA  1 
ATOM   1608 C C   . THR B 2 69  ? 17.999 30.714 8.629   1.00 33.30 ? 69  THR B C   1 
ATOM   1609 O O   . THR B 2 69  ? 19.122 30.582 9.123   1.00 34.41 ? 69  THR B O   1 
ATOM   1610 C CB  . THR B 2 69  ? 17.330 28.349 9.137   1.00 33.59 ? 69  THR B CB  1 
ATOM   1611 O OG1 . THR B 2 69  ? 16.907 28.759 10.448  1.00 31.29 ? 69  THR B OG1 1 
ATOM   1612 C CG2 . THR B 2 69  ? 18.774 27.887 9.179   1.00 36.41 ? 69  THR B CG2 1 
ATOM   1613 N N   . ASP B 2 70  ? 17.416 31.887 8.450   1.00 31.67 ? 70  ASP B N   1 
ATOM   1614 C CA  . ASP B 2 70  ? 18.035 33.153 8.788   1.00 30.95 ? 70  ASP B CA  1 
ATOM   1615 C C   . ASP B 2 70  ? 17.945 33.461 10.298  1.00 30.05 ? 70  ASP B C   1 
ATOM   1616 O O   . ASP B 2 70  ? 17.347 34.451 10.711  1.00 29.68 ? 70  ASP B O   1 
ATOM   1617 C CB  . ASP B 2 70  ? 17.333 34.218 7.939   1.00 30.09 ? 70  ASP B CB  1 
ATOM   1618 C CG  . ASP B 2 70  ? 18.056 35.520 7.917   1.00 29.72 ? 70  ASP B CG  1 
ATOM   1619 O OD1 . ASP B 2 70  ? 19.294 35.513 8.083   1.00 30.86 ? 70  ASP B OD1 1 
ATOM   1620 O OD2 . ASP B 2 70  ? 17.375 36.550 7.717   1.00 29.32 ? 70  ASP B OD2 1 
ATOM   1621 N N   . TYR B 2 71  ? 18.551 32.606 11.116  1.00 30.21 ? 71  TYR B N   1 
ATOM   1622 C CA  . TYR B 2 71  ? 18.525 32.773 12.571  1.00 29.56 ? 71  TYR B CA  1 
ATOM   1623 C C   . TYR B 2 71  ? 19.283 34.019 13.005  1.00 29.40 ? 71  TYR B C   1 
ATOM   1624 O O   . TYR B 2 71  ? 20.326 34.347 12.446  1.00 30.15 ? 71  TYR B O   1 
ATOM   1625 C CB  . TYR B 2 71  ? 19.117 31.531 13.253  1.00 27.78 ? 71  TYR B CB  1 
ATOM   1626 N N   . TRP B 2 72  ? 18.754 34.715 14.005  1.00 28.44 ? 72  TRP B N   1 
ATOM   1627 C CA  . TRP B 2 72  ? 19.396 35.931 14.501  1.00 29.48 ? 72  TRP B CA  1 
ATOM   1628 C C   . TRP B 2 72  ? 20.843 35.621 14.843  1.00 30.11 ? 72  TRP B C   1 
ATOM   1629 O O   . TRP B 2 72  ? 21.144 34.562 15.389  1.00 30.63 ? 72  TRP B O   1 
ATOM   1630 C CB  . TRP B 2 72  ? 18.683 36.443 15.751  1.00 24.96 ? 72  TRP B CB  1 
ATOM   1631 C CG  . TRP B 2 72  ? 17.205 36.487 15.610  1.00 22.86 ? 72  TRP B CG  1 
ATOM   1632 C CD1 . TRP B 2 72  ? 16.294 35.642 16.189  1.00 21.26 ? 72  TRP B CD1 1 
ATOM   1633 C CD2 . TRP B 2 72  ? 16.449 37.434 14.853  1.00 21.00 ? 72  TRP B CD2 1 
ATOM   1634 N NE1 . TRP B 2 72  ? 15.019 36.015 15.842  1.00 17.39 ? 72  TRP B NE1 1 
ATOM   1635 C CE2 . TRP B 2 72  ? 15.083 37.112 15.024  1.00 19.67 ? 72  TRP B CE2 1 
ATOM   1636 C CE3 . TRP B 2 72  ? 16.792 38.526 14.048  1.00 21.83 ? 72  TRP B CE3 1 
ATOM   1637 C CZ2 . TRP B 2 72  ? 14.062 37.844 14.423  1.00 20.56 ? 72  TRP B CZ2 1 
ATOM   1638 C CZ3 . TRP B 2 72  ? 15.771 39.256 13.448  1.00 22.61 ? 72  TRP B CZ3 1 
ATOM   1639 C CH2 . TRP B 2 72  ? 14.423 38.911 13.640  1.00 20.21 ? 72  TRP B CH2 1 
ATOM   1640 N N   . ARG B 2 73  ? 21.734 36.547 14.520  1.00 32.91 ? 73  ARG B N   1 
ATOM   1641 C CA  . ARG B 2 73  ? 23.151 36.361 14.789  1.00 37.14 ? 73  ARG B CA  1 
ATOM   1642 C C   . ARG B 2 73  ? 23.783 37.590 15.444  1.00 36.80 ? 73  ARG B C   1 
ATOM   1643 O O   . ARG B 2 73  ? 23.255 38.699 15.355  1.00 34.76 ? 73  ARG B O   1 
ATOM   1644 C CB  . ARG B 2 73  ? 23.887 36.031 13.486  1.00 41.77 ? 73  ARG B CB  1 
ATOM   1645 C CG  . ARG B 2 73  ? 23.677 37.053 12.374  1.00 47.71 ? 73  ARG B CG  1 
ATOM   1646 C CD  . ARG B 2 73  ? 24.541 36.728 11.166  1.00 54.27 ? 73  ARG B CD  1 
ATOM   1647 N NE  . ARG B 2 73  ? 24.269 35.397 10.630  1.00 60.35 ? 73  ARG B NE  1 
ATOM   1648 C CZ  . ARG B 2 73  ? 23.150 35.054 10.000  1.00 63.65 ? 73  ARG B CZ  1 
ATOM   1649 N NH1 . ARG B 2 73  ? 22.186 35.947 9.818   1.00 64.55 ? 73  ARG B NH1 1 
ATOM   1650 N NH2 . ARG B 2 73  ? 22.991 33.815 9.555   1.00 65.00 ? 73  ARG B NH2 1 
ATOM   1651 N N   . ASP B 2 74  ? 24.927 37.373 16.087  1.00 37.55 ? 74  ASP B N   1 
ATOM   1652 C CA  . ASP B 2 74  ? 25.668 38.423 16.785  1.00 37.60 ? 74  ASP B CA  1 
ATOM   1653 C C   . ASP B 2 74  ? 26.303 39.382 15.785  1.00 35.03 ? 74  ASP B C   1 
ATOM   1654 O O   . ASP B 2 74  ? 26.591 40.539 16.102  1.00 35.13 ? 74  ASP B O   1 
ATOM   1655 C CB  . ASP B 2 74  ? 26.785 37.803 17.635  1.00 41.10 ? 74  ASP B CB  1 
ATOM   1656 C CG  . ASP B 2 74  ? 26.390 36.473 18.253  1.00 45.55 ? 74  ASP B CG  1 
ATOM   1657 O OD1 . ASP B 2 74  ? 25.992 35.557 17.499  1.00 45.72 ? 74  ASP B OD1 1 
ATOM   1658 O OD2 . ASP B 2 74  ? 26.492 36.340 19.494  1.00 48.76 ? 74  ASP B OD2 1 
ATOM   1659 N N   . CYS B 2 75  ? 26.527 38.882 14.578  1.00 32.28 ? 75  CYS B N   1 
ATOM   1660 C CA  . CYS B 2 75  ? 27.149 39.659 13.514  1.00 32.23 ? 75  CYS B CA  1 
ATOM   1661 C C   . CYS B 2 75  ? 26.444 40.969 13.188  1.00 32.65 ? 75  CYS B C   1 
ATOM   1662 O O   . CYS B 2 75  ? 27.081 41.920 12.730  1.00 33.17 ? 75  CYS B O   1 
ATOM   1663 C CB  . CYS B 2 75  ? 27.229 38.815 12.241  1.00 30.47 ? 75  CYS B CB  1 
ATOM   1664 S SG  . CYS B 2 75  ? 28.136 39.566 10.850  1.00 34.61 ? 75  CYS B SG  1 
ATOM   1665 N N   . ASN B 2 76  ? 25.137 41.040 13.422  1.00 31.73 ? 76  ASN B N   1 
ATOM   1666 C CA  . ASN B 2 76  ? 24.423 42.260 13.076  1.00 30.30 ? 76  ASN B CA  1 
ATOM   1667 C C   . ASN B 2 76  ? 23.593 42.911 14.184  1.00 28.97 ? 76  ASN B C   1 
ATOM   1668 O O   . ASN B 2 76  ? 22.862 43.860 13.928  1.00 27.04 ? 76  ASN B O   1 
ATOM   1669 C CB  . ASN B 2 76  ? 23.551 41.992 11.840  1.00 29.97 ? 76  ASN B CB  1 
ATOM   1670 C CG  . ASN B 2 76  ? 23.461 43.194 10.914  1.00 29.79 ? 76  ASN B CG  1 
ATOM   1671 O OD1 . ASN B 2 76  ? 24.283 44.113 10.977  1.00 29.76 ? 76  ASN B OD1 1 
ATOM   1672 N ND2 . ASN B 2 76  ? 22.465 43.189 10.038  1.00 30.35 ? 76  ASN B ND2 1 
ATOM   1673 N N   . TRP B 2 77  ? 23.704 42.425 15.412  1.00 27.63 ? 77  TRP B N   1 
ATOM   1674 C CA  . TRP B 2 77  ? 22.943 43.035 16.500  1.00 28.36 ? 77  TRP B CA  1 
ATOM   1675 C C   . TRP B 2 77  ? 23.815 43.199 17.736  1.00 30.40 ? 77  TRP B C   1 
ATOM   1676 O O   . TRP B 2 77  ? 24.693 42.377 17.990  1.00 29.84 ? 77  TRP B O   1 
ATOM   1677 C CB  . TRP B 2 77  ? 21.714 42.189 16.840  1.00 27.40 ? 77  TRP B CB  1 
ATOM   1678 C CG  . TRP B 2 77  ? 20.814 41.955 15.654  1.00 29.23 ? 77  TRP B CG  1 
ATOM   1679 C CD1 . TRP B 2 77  ? 20.968 41.010 14.678  1.00 28.92 ? 77  TRP B CD1 1 
ATOM   1680 C CD2 . TRP B 2 77  ? 19.655 42.714 15.297  1.00 26.67 ? 77  TRP B CD2 1 
ATOM   1681 N NE1 . TRP B 2 77  ? 19.978 41.136 13.735  1.00 27.02 ? 77  TRP B NE1 1 
ATOM   1682 C CE2 . TRP B 2 77  ? 19.158 42.174 14.090  1.00 27.03 ? 77  TRP B CE2 1 
ATOM   1683 C CE3 . TRP B 2 77  ? 18.988 43.800 15.879  1.00 25.12 ? 77  TRP B CE3 1 
ATOM   1684 C CZ2 . TRP B 2 77  ? 18.019 42.686 13.452  1.00 26.87 ? 77  TRP B CZ2 1 
ATOM   1685 C CZ3 . TRP B 2 77  ? 17.860 44.308 15.247  1.00 27.54 ? 77  TRP B CZ3 1 
ATOM   1686 C CH2 . TRP B 2 77  ? 17.387 43.750 14.044  1.00 25.06 ? 77  TRP B CH2 1 
ATOM   1687 N N   . GLU B 2 78  ? 23.582 44.270 18.492  1.00 31.32 ? 78  GLU B N   1 
ATOM   1688 C CA  . GLU B 2 78  ? 24.358 44.518 19.695  1.00 31.97 ? 78  GLU B CA  1 
ATOM   1689 C C   . GLU B 2 78  ? 23.657 45.442 20.681  1.00 28.90 ? 78  GLU B C   1 
ATOM   1690 O O   . GLU B 2 78  ? 22.703 46.138 20.334  1.00 25.72 ? 78  GLU B O   1 
ATOM   1691 C CB  . GLU B 2 78  ? 25.726 45.108 19.331  1.00 39.48 ? 78  GLU B CB  1 
ATOM   1692 C CG  . GLU B 2 78  ? 25.824 46.642 19.336  1.00 47.14 ? 78  GLU B CG  1 
ATOM   1693 C CD  . GLU B 2 78  ? 24.939 47.311 18.299  1.00 51.97 ? 78  GLU B CD  1 
ATOM   1694 O OE1 . GLU B 2 78  ? 23.710 47.385 18.513  1.00 53.86 ? 78  GLU B OE1 1 
ATOM   1695 O OE2 . GLU B 2 78  ? 25.476 47.763 17.265  1.00 53.45 ? 78  GLU B OE2 1 
ATOM   1696 N N   . TRP B 2 79  ? 24.152 45.435 21.917  1.00 25.24 ? 79  TRP B N   1 
ATOM   1697 C CA  . TRP B 2 79  ? 23.601 46.266 22.976  1.00 22.41 ? 79  TRP B CA  1 
ATOM   1698 C C   . TRP B 2 79  ? 24.110 47.702 22.823  1.00 22.41 ? 79  TRP B C   1 
ATOM   1699 O O   . TRP B 2 79  ? 25.238 47.940 22.387  1.00 20.44 ? 79  TRP B O   1 
ATOM   1700 C CB  . TRP B 2 79  ? 23.994 45.714 24.352  1.00 21.14 ? 79  TRP B CB  1 
ATOM   1701 C CG  . TRP B 2 79  ? 23.404 44.364 24.680  1.00 21.65 ? 79  TRP B CG  1 
ATOM   1702 C CD1 . TRP B 2 79  ? 24.087 43.201 24.883  1.00 21.48 ? 79  TRP B CD1 1 
ATOM   1703 C CD2 . TRP B 2 79  ? 22.014 44.041 24.850  1.00 20.77 ? 79  TRP B CD2 1 
ATOM   1704 N NE1 . TRP B 2 79  ? 23.217 42.178 25.167  1.00 21.78 ? 79  TRP B NE1 1 
ATOM   1705 C CE2 . TRP B 2 79  ? 21.938 42.666 25.153  1.00 20.50 ? 79  TRP B CE2 1 
ATOM   1706 C CE3 . TRP B 2 79  ? 20.827 44.783 24.778  1.00 17.81 ? 79  TRP B CE3 1 
ATOM   1707 C CZ2 . TRP B 2 79  ? 20.722 42.016 25.382  1.00 19.66 ? 79  TRP B CZ2 1 
ATOM   1708 C CZ3 . TRP B 2 79  ? 19.622 44.135 25.009  1.00 17.16 ? 79  TRP B CZ3 1 
ATOM   1709 C CH2 . TRP B 2 79  ? 19.580 42.766 25.307  1.00 17.21 ? 79  TRP B CH2 1 
ATOM   1710 N N   . SER B 2 80  ? 23.264 48.661 23.167  1.00 22.80 ? 80  SER B N   1 
ATOM   1711 C CA  . SER B 2 80  ? 23.651 50.054 23.064  1.00 22.97 ? 80  SER B CA  1 
ATOM   1712 C C   . SER B 2 80  ? 24.720 50.361 24.102  1.00 23.54 ? 80  SER B C   1 
ATOM   1713 O O   . SER B 2 80  ? 25.483 51.305 23.940  1.00 26.17 ? 80  SER B O   1 
ATOM   1714 C CB  . SER B 2 80  ? 22.438 50.968 23.280  1.00 23.67 ? 80  SER B CB  1 
ATOM   1715 O OG  . SER B 2 80  ? 21.939 50.861 24.603  1.00 23.22 ? 80  SER B OG  1 
ATOM   1716 N N   . ASP B 2 81  ? 24.787 49.568 25.165  1.00 21.28 ? 81  ASP B N   1 
ATOM   1717 C CA  . ASP B 2 81  ? 25.791 49.821 26.196  1.00 22.53 ? 81  ASP B CA  1 
ATOM   1718 C C   . ASP B 2 81  ? 27.080 49.046 25.946  1.00 22.46 ? 81  ASP B C   1 
ATOM   1719 O O   . ASP B 2 81  ? 27.892 48.872 26.848  1.00 22.56 ? 81  ASP B O   1 
ATOM   1720 C CB  . ASP B 2 81  ? 25.236 49.490 27.589  1.00 18.95 ? 81  ASP B CB  1 
ATOM   1721 C CG  . ASP B 2 81  ? 25.022 48.016 27.798  1.00 15.24 ? 81  ASP B CG  1 
ATOM   1722 O OD1 . ASP B 2 81  ? 24.469 47.660 28.849  1.00 16.28 ? 81  ASP B OD1 1 
ATOM   1723 O OD2 . ASP B 2 81  ? 25.409 47.208 26.925  1.00 14.21 ? 81  ASP B OD2 1 
ATOM   1724 N N   . GLY B 2 82  ? 27.241 48.571 24.715  1.00 24.78 ? 82  GLY B N   1 
ATOM   1725 C CA  . GLY B 2 82  ? 28.434 47.841 24.328  1.00 26.44 ? 82  GLY B CA  1 
ATOM   1726 C C   . GLY B 2 82  ? 28.694 46.524 25.029  1.00 30.11 ? 82  GLY B C   1 
ATOM   1727 O O   . GLY B 2 82  ? 29.751 45.933 24.837  1.00 30.82 ? 82  GLY B O   1 
ATOM   1728 N N   . ALA B 2 83  ? 27.752 46.057 25.843  1.00 31.70 ? 83  ALA B N   1 
ATOM   1729 C CA  . ALA B 2 83  ? 27.922 44.784 26.538  1.00 31.88 ? 83  ALA B CA  1 
ATOM   1730 C C   . ALA B 2 83  ? 27.802 43.660 25.517  1.00 34.20 ? 83  ALA B C   1 
ATOM   1731 O O   . ALA B 2 83  ? 27.019 43.753 24.575  1.00 35.83 ? 83  ALA B O   1 
ATOM   1732 C CB  . ALA B 2 83  ? 26.861 44.628 27.616  1.00 31.69 ? 83  ALA B CB  1 
ATOM   1733 N N   . GLN B 2 84  ? 28.579 42.600 25.699  1.00 35.62 ? 84  GLN B N   1 
ATOM   1734 C CA  . GLN B 2 84  ? 28.551 41.481 24.774  1.00 36.64 ? 84  GLN B CA  1 
ATOM   1735 C C   . GLN B 2 84  ? 27.199 40.779 24.768  1.00 36.96 ? 84  GLN B C   1 
ATOM   1736 O O   . GLN B 2 84  ? 26.527 40.710 25.793  1.00 37.54 ? 84  GLN B O   1 
ATOM   1737 C CB  . GLN B 2 84  ? 29.669 40.494 25.115  1.00 38.01 ? 84  GLN B CB  1 
ATOM   1738 C CG  . GLN B 2 84  ? 31.052 41.059 24.827  1.00 41.07 ? 84  GLN B CG  1 
ATOM   1739 C CD  . GLN B 2 84  ? 32.152 40.049 25.035  1.00 41.87 ? 84  GLN B CD  1 
ATOM   1740 O OE1 . GLN B 2 84  ? 32.114 38.956 24.476  1.00 45.10 ? 84  GLN B OE1 1 
ATOM   1741 N NE2 . GLN B 2 84  ? 33.146 40.411 25.836  1.00 42.59 ? 84  GLN B NE2 1 
ATOM   1742 N N   . LEU B 2 85  ? 26.815 40.262 23.602  1.00 36.38 ? 85  LEU B N   1 
ATOM   1743 C CA  . LEU B 2 85  ? 25.539 39.582 23.430  1.00 36.55 ? 85  LEU B CA  1 
ATOM   1744 C C   . LEU B 2 85  ? 25.629 38.077 23.668  1.00 37.05 ? 85  LEU B C   1 
ATOM   1745 O O   . LEU B 2 85  ? 25.504 37.274 22.743  1.00 38.63 ? 85  LEU B O   1 
ATOM   1746 C CB  . LEU B 2 85  ? 24.995 39.861 22.025  1.00 36.04 ? 85  LEU B CB  1 
ATOM   1747 C CG  . LEU B 2 85  ? 23.642 39.273 21.614  1.00 35.58 ? 85  LEU B CG  1 
ATOM   1748 C CD1 . LEU B 2 85  ? 22.574 39.652 22.628  1.00 33.99 ? 85  LEU B CD1 1 
ATOM   1749 C CD2 . LEU B 2 85  ? 23.276 39.790 20.229  1.00 34.84 ? 85  LEU B CD2 1 
ATOM   1750 N N   . ASP B 2 86  ? 25.850 37.701 24.919  1.00 37.90 ? 86  ASP B N   1 
ATOM   1751 C CA  . ASP B 2 86  ? 25.940 36.299 25.291  1.00 38.33 ? 86  ASP B CA  1 
ATOM   1752 C C   . ASP B 2 86  ? 24.517 35.750 25.346  1.00 35.86 ? 86  ASP B C   1 
ATOM   1753 O O   . ASP B 2 86  ? 23.984 35.272 24.347  1.00 37.51 ? 86  ASP B O   1 
ATOM   1754 C CB  . ASP B 2 86  ? 26.618 36.175 26.657  1.00 42.75 ? 86  ASP B CB  1 
ATOM   1755 C CG  . ASP B 2 86  ? 26.054 37.156 27.675  1.00 48.36 ? 86  ASP B CG  1 
ATOM   1756 O OD1 . ASP B 2 86  ? 26.087 38.378 27.409  1.00 50.49 ? 86  ASP B OD1 1 
ATOM   1757 O OD2 . ASP B 2 86  ? 25.575 36.709 28.739  1.00 51.33 ? 86  ASP B OD2 1 
ATOM   1758 N N   . TYR B 2 87  ? 23.906 35.825 26.519  1.00 31.51 ? 87  TYR B N   1 
ATOM   1759 C CA  . TYR B 2 87  ? 22.545 35.367 26.699  1.00 29.18 ? 87  TYR B CA  1 
ATOM   1760 C C   . TYR B 2 87  ? 21.625 36.060 25.682  1.00 29.24 ? 87  TYR B C   1 
ATOM   1761 O O   . TYR B 2 87  ? 21.684 37.280 25.494  1.00 30.80 ? 87  TYR B O   1 
ATOM   1762 C CB  . TYR B 2 87  ? 22.094 35.680 28.132  1.00 27.92 ? 87  TYR B CB  1 
ATOM   1763 C CG  . TYR B 2 87  ? 20.635 35.401 28.402  1.00 27.23 ? 87  TYR B CG  1 
ATOM   1764 C CD1 . TYR B 2 87  ? 19.660 36.342 28.091  1.00 26.41 ? 87  TYR B CD1 1 
ATOM   1765 C CD2 . TYR B 2 87  ? 20.224 34.177 28.932  1.00 25.08 ? 87  TYR B CD2 1 
ATOM   1766 C CE1 . TYR B 2 87  ? 18.315 36.073 28.293  1.00 25.91 ? 87  TYR B CE1 1 
ATOM   1767 C CE2 . TYR B 2 87  ? 18.879 33.902 29.140  1.00 26.02 ? 87  TYR B CE2 1 
ATOM   1768 C CZ  . TYR B 2 87  ? 17.932 34.855 28.814  1.00 25.27 ? 87  TYR B CZ  1 
ATOM   1769 O OH  . TYR B 2 87  ? 16.595 34.588 28.987  1.00 27.65 ? 87  TYR B OH  1 
ATOM   1770 N N   . LYS B 2 88  ? 20.789 35.275 25.014  1.00 27.51 ? 88  LYS B N   1 
ATOM   1771 C CA  . LYS B 2 88  ? 19.847 35.808 24.041  1.00 26.80 ? 88  LYS B CA  1 
ATOM   1772 C C   . LYS B 2 88  ? 18.493 35.147 24.265  1.00 25.29 ? 88  LYS B C   1 
ATOM   1773 O O   . LYS B 2 88  ? 18.414 33.971 24.612  1.00 24.23 ? 88  LYS B O   1 
ATOM   1774 C CB  . LYS B 2 88  ? 20.335 35.554 22.615  1.00 27.76 ? 88  LYS B CB  1 
ATOM   1775 C CG  . LYS B 2 88  ? 20.765 34.127 22.349  1.00 31.13 ? 88  LYS B CG  1 
ATOM   1776 C CD  . LYS B 2 88  ? 22.270 34.007 22.381  1.00 34.07 ? 88  LYS B CD  1 
ATOM   1777 C CE  . LYS B 2 88  ? 22.895 34.766 21.223  1.00 33.91 ? 88  LYS B CE  1 
ATOM   1778 N NZ  . LYS B 2 88  ? 24.366 34.567 21.173  1.00 33.89 ? 88  LYS B NZ  1 
ATOM   1779 N N   . ALA B 2 89  ? 17.423 35.908 24.076  1.00 24.42 ? 89  ALA B N   1 
ATOM   1780 C CA  . ALA B 2 89  ? 16.083 35.383 24.299  1.00 23.18 ? 89  ALA B CA  1 
ATOM   1781 C C   . ALA B 2 89  ? 15.172 35.592 23.099  1.00 22.53 ? 89  ALA B C   1 
ATOM   1782 O O   . ALA B 2 89  ? 13.955 35.693 23.247  1.00 23.80 ? 89  ALA B O   1 
ATOM   1783 C CB  . ALA B 2 89  ? 15.478 36.038 25.536  1.00 21.62 ? 89  ALA B CB  1 
ATOM   1784 N N   . TRP B 2 90  ? 15.767 35.685 21.916  1.00 21.88 ? 90  TRP B N   1 
ATOM   1785 C CA  . TRP B 2 90  ? 14.999 35.858 20.694  1.00 25.26 ? 90  TRP B CA  1 
ATOM   1786 C C   . TRP B 2 90  ? 14.586 34.477 20.212  1.00 27.56 ? 90  TRP B C   1 
ATOM   1787 O O   . TRP B 2 90  ? 15.209 33.480 20.571  1.00 27.92 ? 90  TRP B O   1 
ATOM   1788 C CB  . TRP B 2 90  ? 15.832 36.570 19.612  1.00 23.90 ? 90  TRP B CB  1 
ATOM   1789 C CG  . TRP B 2 90  ? 17.253 36.053 19.444  1.00 22.42 ? 90  TRP B CG  1 
ATOM   1790 C CD1 . TRP B 2 90  ? 17.694 34.774 19.630  1.00 22.59 ? 90  TRP B CD1 1 
ATOM   1791 C CD2 . TRP B 2 90  ? 18.392 36.807 19.001  1.00 20.44 ? 90  TRP B CD2 1 
ATOM   1792 N NE1 . TRP B 2 90  ? 19.031 34.684 19.330  1.00 19.04 ? 90  TRP B NE1 1 
ATOM   1793 C CE2 . TRP B 2 90  ? 19.484 35.916 18.940  1.00 18.89 ? 90  TRP B CE2 1 
ATOM   1794 C CE3 . TRP B 2 90  ? 18.594 38.153 18.647  1.00 20.17 ? 90  TRP B CE3 1 
ATOM   1795 C CZ2 . TRP B 2 90  ? 20.766 36.324 18.539  1.00 18.55 ? 90  TRP B CZ2 1 
ATOM   1796 C CZ3 . TRP B 2 90  ? 19.866 38.560 18.250  1.00 16.93 ? 90  TRP B CZ3 1 
ATOM   1797 C CH2 . TRP B 2 90  ? 20.936 37.645 18.199  1.00 16.81 ? 90  TRP B CH2 1 
ATOM   1798 N N   . ASP B 2 91  ? 13.540 34.408 19.401  1.00 31.37 ? 91  ASP B N   1 
ATOM   1799 C CA  . ASP B 2 91  ? 13.081 33.118 18.911  1.00 35.18 ? 91  ASP B CA  1 
ATOM   1800 C C   . ASP B 2 91  ? 13.958 32.602 17.779  1.00 36.37 ? 91  ASP B C   1 
ATOM   1801 O O   . ASP B 2 91  ? 14.201 33.301 16.800  1.00 36.10 ? 91  ASP B O   1 
ATOM   1802 C CB  . ASP B 2 91  ? 11.642 33.214 18.428  1.00 38.01 ? 91  ASP B CB  1 
ATOM   1803 C CG  . ASP B 2 91  ? 10.999 31.861 18.277  1.00 40.41 ? 91  ASP B CG  1 
ATOM   1804 O OD1 . ASP B 2 91  ? 11.710 30.919 17.865  1.00 38.81 ? 91  ASP B OD1 1 
ATOM   1805 O OD2 . ASP B 2 91  ? 9.788  31.744 18.566  1.00 44.00 ? 91  ASP B OD2 1 
ATOM   1806 N N   . ASN B 2 92  ? 14.423 31.367 17.928  1.00 39.34 ? 92  ASN B N   1 
ATOM   1807 C CA  . ASN B 2 92  ? 15.278 30.719 16.942  1.00 42.04 ? 92  ASN B CA  1 
ATOM   1808 C C   . ASN B 2 92  ? 14.451 29.925 15.932  1.00 43.05 ? 92  ASN B C   1 
ATOM   1809 O O   . ASN B 2 92  ? 14.839 29.787 14.774  1.00 43.61 ? 92  ASN B O   1 
ATOM   1810 C CB  . ASN B 2 92  ? 16.248 29.773 17.646  1.00 44.29 ? 92  ASN B CB  1 
ATOM   1811 C CG  . ASN B 2 92  ? 17.066 30.468 18.702  1.00 45.51 ? 92  ASN B CG  1 
ATOM   1812 O OD1 . ASN B 2 92  ? 18.015 31.190 18.396  1.00 46.08 ? 92  ASN B OD1 1 
ATOM   1813 N ND2 . ASN B 2 92  ? 16.696 30.266 19.961  1.00 48.55 ? 92  ASN B ND2 1 
ATOM   1814 N N   . GLU B 2 93  ? 13.316 29.395 16.379  1.00 43.24 ? 93  GLU B N   1 
ATOM   1815 C CA  . GLU B 2 93  ? 12.452 28.619 15.500  1.00 43.55 ? 93  GLU B CA  1 
ATOM   1816 C C   . GLU B 2 93  ? 11.814 29.497 14.441  1.00 43.26 ? 93  GLU B C   1 
ATOM   1817 O O   . GLU B 2 93  ? 11.411 29.019 13.383  1.00 43.74 ? 93  GLU B O   1 
ATOM   1818 C CB  . GLU B 2 93  ? 11.378 27.895 16.312  1.00 44.08 ? 93  GLU B CB  1 
ATOM   1819 C CG  . GLU B 2 93  ? 11.948 26.748 17.126  1.00 43.91 ? 93  GLU B CG  1 
ATOM   1820 C CD  . GLU B 2 93  ? 12.767 25.804 16.267  1.00 44.87 ? 93  GLU B CD  1 
ATOM   1821 O OE1 . GLU B 2 93  ? 12.163 25.055 15.462  1.00 44.67 ? 93  GLU B OE1 1 
ATOM   1822 O OE2 . GLU B 2 93  ? 14.013 25.825 16.384  1.00 42.36 ? 93  GLU B OE2 1 
ATOM   1823 N N   . ARG B 2 94  ? 11.715 30.786 14.726  1.00 42.72 ? 94  ARG B N   1 
ATOM   1824 C CA  . ARG B 2 94  ? 11.148 31.704 13.760  1.00 42.62 ? 94  ARG B CA  1 
ATOM   1825 C C   . ARG B 2 94  ? 12.251 31.955 12.755  1.00 40.46 ? 94  ARG B C   1 
ATOM   1826 O O   . ARG B 2 94  ? 13.428 31.884 13.105  1.00 41.87 ? 94  ARG B O   1 
ATOM   1827 C CB  . ARG B 2 94  ? 10.747 33.024 14.432  1.00 45.30 ? 94  ARG B CB  1 
ATOM   1828 C CG  . ARG B 2 94  ? 11.876 33.700 15.187  1.00 48.84 ? 94  ARG B CG  1 
ATOM   1829 C CD  . ARG B 2 94  ? 11.477 35.058 15.767  1.00 52.06 ? 94  ARG B CD  1 
ATOM   1830 N NE  . ARG B 2 94  ? 10.230 35.009 16.532  1.00 54.48 ? 94  ARG B NE  1 
ATOM   1831 C CZ  . ARG B 2 94  ? 9.948  35.800 17.565  1.00 54.70 ? 94  ARG B CZ  1 
ATOM   1832 N NH1 . ARG B 2 94  ? 10.825 36.706 17.973  1.00 55.32 ? 94  ARG B NH1 1 
ATOM   1833 N NH2 . ARG B 2 94  ? 8.781  35.693 18.186  1.00 53.39 ? 94  ARG B NH2 1 
ATOM   1834 N N   . HIS B 2 95  ? 11.869 32.218 11.510  1.00 36.94 ? 95  HIS B N   1 
ATOM   1835 C CA  . HIS B 2 95  ? 12.810 32.519 10.434  1.00 34.34 ? 95  HIS B CA  1 
ATOM   1836 C C   . HIS B 2 95  ? 13.168 31.472 9.400   1.00 32.07 ? 95  HIS B C   1 
ATOM   1837 O O   . HIS B 2 95  ? 14.069 31.695 8.586   1.00 31.50 ? 95  HIS B O   1 
ATOM   1838 C CB  . HIS B 2 95  ? 14.104 33.107 10.987  1.00 33.86 ? 95  HIS B CB  1 
ATOM   1839 C CG  . HIS B 2 95  ? 13.992 34.556 11.325  1.00 36.23 ? 95  HIS B CG  1 
ATOM   1840 N ND1 . HIS B 2 95  ? 13.072 35.384 10.720  1.00 36.26 ? 95  HIS B ND1 1 
ATOM   1841 C CD2 . HIS B 2 95  ? 14.707 35.336 12.167  1.00 37.83 ? 95  HIS B CD2 1 
ATOM   1842 C CE1 . HIS B 2 95  ? 13.226 36.614 11.173  1.00 39.43 ? 95  HIS B CE1 1 
ATOM   1843 N NE2 . HIS B 2 95  ? 14.213 36.612 12.051  1.00 43.02 ? 95  HIS B NE2 1 
ATOM   1844 N N   . CYS B 2 96  ? 12.507 30.326 9.404   1.00 29.78 ? 96  CYS B N   1 
ATOM   1845 C CA  . CYS B 2 96  ? 12.839 29.393 8.348   1.00 29.67 ? 96  CYS B CA  1 
ATOM   1846 C C   . CYS B 2 96  ? 12.162 29.926 7.099   1.00 29.73 ? 96  CYS B C   1 
ATOM   1847 O O   . CYS B 2 96  ? 10.993 30.321 7.127   1.00 30.89 ? 96  CYS B O   1 
ATOM   1848 C CB  . CYS B 2 96  ? 12.390 27.972 8.682   1.00 29.08 ? 96  CYS B CB  1 
ATOM   1849 S SG  . CYS B 2 96  ? 13.694 27.127 9.628   1.00 25.48 ? 96  CYS B SG  1 
ATOM   1850 N N   . PHE B 2 97  ? 12.920 29.990 6.014   1.00 29.72 ? 97  PHE B N   1 
ATOM   1851 C CA  . PHE B 2 97  ? 12.388 30.491 4.759   1.00 30.04 ? 97  PHE B CA  1 
ATOM   1852 C C   . PHE B 2 97  ? 11.374 29.544 4.140   1.00 29.96 ? 97  PHE B C   1 
ATOM   1853 O O   . PHE B 2 97  ? 11.426 28.325 4.326   1.00 28.04 ? 97  PHE B O   1 
ATOM   1854 C CB  . PHE B 2 97  ? 13.524 30.752 3.776   1.00 31.11 ? 97  PHE B CB  1 
ATOM   1855 C CG  . PHE B 2 97  ? 14.066 32.150 3.841   1.00 33.41 ? 97  PHE B CG  1 
ATOM   1856 C CD1 . PHE B 2 97  ? 13.875 32.932 4.976   1.00 33.63 ? 97  PHE B CD1 1 
ATOM   1857 C CD2 . PHE B 2 97  ? 14.768 32.686 2.767   1.00 33.83 ? 97  PHE B CD2 1 
ATOM   1858 C CE1 . PHE B 2 97  ? 14.369 34.225 5.041   1.00 33.24 ? 97  PHE B CE1 1 
ATOM   1859 C CE2 . PHE B 2 97  ? 15.266 33.978 2.821   1.00 33.08 ? 97  PHE B CE2 1 
ATOM   1860 C CZ  . PHE B 2 97  ? 15.068 34.752 3.959   1.00 34.31 ? 97  PHE B CZ  1 
ATOM   1861 N N   . ILE B 2 98  ? 10.449 30.129 3.394   1.00 29.50 ? 98  ILE B N   1 
ATOM   1862 C CA  . ILE B 2 98  ? 9.409  29.365 2.746   1.00 29.15 ? 98  ILE B CA  1 
ATOM   1863 C C   . ILE B 2 98  ? 8.859  30.085 1.528   1.00 29.84 ? 98  ILE B C   1 
ATOM   1864 O O   . ILE B 2 98  ? 8.870  31.315 1.441   1.00 26.26 ? 98  ILE B O   1 
ATOM   1865 C CB  . ILE B 2 98  ? 8.278  29.071 3.739   1.00 28.21 ? 98  ILE B CB  1 
ATOM   1866 C CG1 . ILE B 2 98  ? 8.306  27.594 4.088   1.00 26.33 ? 98  ILE B CG1 1 
ATOM   1867 C CG2 . ILE B 2 98  ? 6.930  29.516 3.184   1.00 29.12 ? 98  ILE B CG2 1 
ATOM   1868 C CD1 . ILE B 2 98  ? 7.379  27.234 5.183   1.00 25.05 ? 98  ILE B CD1 1 
ATOM   1869 N N   . TYR B 2 99  ? 8.389  29.295 0.575   1.00 31.18 ? 99  TYR B N   1 
ATOM   1870 C CA  . TYR B 2 99  ? 7.828  29.859 -0.632  1.00 31.35 ? 99  TYR B CA  1 
ATOM   1871 C C   . TYR B 2 99  ? 6.338  29.593 -0.613  1.00 30.75 ? 99  TYR B C   1 
ATOM   1872 O O   . TYR B 2 99  ? 5.902  28.447 -0.512  1.00 29.85 ? 99  TYR B O   1 
ATOM   1873 C CB  . TYR B 2 99  ? 8.457  29.221 -1.873  1.00 30.76 ? 99  TYR B CB  1 
ATOM   1874 C CG  . TYR B 2 99  ? 8.076  29.913 -3.155  1.00 33.08 ? 99  TYR B CG  1 
ATOM   1875 C CD1 . TYR B 2 99  ? 6.748  29.956 -3.576  1.00 32.66 ? 99  TYR B CD1 1 
ATOM   1876 C CD2 . TYR B 2 99  ? 9.038  30.559 -3.936  1.00 33.46 ? 99  TYR B CD2 1 
ATOM   1877 C CE1 . TYR B 2 99  ? 6.382  30.628 -4.737  1.00 33.86 ? 99  TYR B CE1 1 
ATOM   1878 C CE2 . TYR B 2 99  ? 8.682  31.233 -5.104  1.00 34.35 ? 99  TYR B CE2 1 
ATOM   1879 C CZ  . TYR B 2 99  ? 7.349  31.263 -5.493  1.00 35.78 ? 99  TYR B CZ  1 
ATOM   1880 O OH  . TYR B 2 99  ? 6.972  31.939 -6.626  1.00 36.45 ? 99  TYR B OH  1 
ATOM   1881 N N   . LYS B 2 100 ? 5.557  30.661 -0.672  1.00 31.25 ? 100 LYS B N   1 
ATOM   1882 C CA  . LYS B 2 100 ? 4.112  30.519 -0.704  1.00 32.23 ? 100 LYS B CA  1 
ATOM   1883 C C   . LYS B 2 100 ? 3.715  30.701 -2.161  1.00 29.67 ? 100 LYS B C   1 
ATOM   1884 O O   . LYS B 2 100 ? 3.851  31.794 -2.719  1.00 26.62 ? 100 LYS B O   1 
ATOM   1885 C CB  . LYS B 2 100 ? 3.442  31.576 0.178   1.00 34.32 ? 100 LYS B CB  1 
ATOM   1886 C CG  . LYS B 2 100 ? 3.703  31.380 1.660   1.00 38.30 ? 100 LYS B CG  1 
ATOM   1887 C CD  . LYS B 2 100 ? 2.806  32.279 2.499   1.00 42.36 ? 100 LYS B CD  1 
ATOM   1888 C CE  . LYS B 2 100 ? 2.978  32.004 3.988   1.00 43.76 ? 100 LYS B CE  1 
ATOM   1889 N NZ  . LYS B 2 100 ? 2.095  32.873 4.812   1.00 44.62 ? 100 LYS B NZ  1 
ATOM   1890 N N   . ASN B 2 101 ? 3.256  29.623 -2.788  1.00 28.92 ? 101 ASN B N   1 
ATOM   1891 C CA  . ASN B 2 101 ? 2.866  29.704 -4.186  1.00 29.85 ? 101 ASN B CA  1 
ATOM   1892 C C   . ASN B 2 101 ? 1.744  30.719 -4.406  1.00 28.55 ? 101 ASN B C   1 
ATOM   1893 O O   . ASN B 2 101 ? 1.786  31.481 -5.370  1.00 27.08 ? 101 ASN B O   1 
ATOM   1894 C CB  . ASN B 2 101 ? 2.459  28.324 -4.722  1.00 32.16 ? 101 ASN B CB  1 
ATOM   1895 C CG  . ASN B 2 101 ? 3.665  27.427 -5.019  1.00 35.22 ? 101 ASN B CG  1 
ATOM   1896 O OD1 . ASN B 2 101 ? 4.650  27.869 -5.610  1.00 37.96 ? 101 ASN B OD1 1 
ATOM   1897 N ND2 . ASN B 2 101 ? 3.579  26.160 -4.625  1.00 34.27 ? 101 ASN B ND2 1 
ATOM   1898 N N   . THR B 2 102 ? 0.766  30.757 -3.507  1.00 28.42 ? 102 THR B N   1 
ATOM   1899 C CA  . THR B 2 102 ? -0.346 31.696 -3.656  1.00 31.11 ? 102 THR B CA  1 
ATOM   1900 C C   . THR B 2 102 ? 0.043  33.161 -3.587  1.00 29.60 ? 102 THR B C   1 
ATOM   1901 O O   . THR B 2 102 ? -0.654 34.002 -4.150  1.00 28.46 ? 102 THR B O   1 
ATOM   1902 C CB  . THR B 2 102 ? -1.446 31.477 -2.602  1.00 31.75 ? 102 THR B CB  1 
ATOM   1903 O OG1 . THR B 2 102 ? -0.877 31.558 -1.291  1.00 39.17 ? 102 THR B OG1 1 
ATOM   1904 C CG2 . THR B 2 102 ? -2.110 30.127 -2.795  1.00 35.60 ? 102 THR B CG2 1 
ATOM   1905 N N   . ASP B 2 103 ? 1.142  33.468 -2.898  1.00 29.38 ? 103 ASP B N   1 
ATOM   1906 C CA  . ASP B 2 103 ? 1.597  34.847 -2.755  1.00 30.29 ? 103 ASP B CA  1 
ATOM   1907 C C   . ASP B 2 103 ? 2.739  35.124 -3.709  1.00 30.74 ? 103 ASP B C   1 
ATOM   1908 O O   . ASP B 2 103 ? 3.201  36.265 -3.837  1.00 28.04 ? 103 ASP B O   1 
ATOM   1909 C CB  . ASP B 2 103 ? 2.077  35.113 -1.328  1.00 35.70 ? 103 ASP B CB  1 
ATOM   1910 C CG  . ASP B 2 103 ? 1.012  34.828 -0.288  1.00 40.92 ? 103 ASP B CG  1 
ATOM   1911 O OD1 . ASP B 2 103 ? -0.157 34.629 -0.682  1.00 44.51 ? 103 ASP B OD1 1 
ATOM   1912 O OD2 . ASP B 2 103 ? 1.341  34.810 0.921   1.00 43.25 ? 103 ASP B OD2 1 
ATOM   1913 N N   . ASN B 2 104 ? 3.182  34.065 -4.378  1.00 31.64 ? 104 ASN B N   1 
ATOM   1914 C CA  . ASN B 2 104 ? 4.288  34.141 -5.319  1.00 32.97 ? 104 ASN B CA  1 
ATOM   1915 C C   . ASN B 2 104 ? 5.414  34.984 -4.762  1.00 31.74 ? 104 ASN B C   1 
ATOM   1916 O O   . ASN B 2 104 ? 5.816  35.984 -5.354  1.00 32.51 ? 104 ASN B O   1 
ATOM   1917 C CB  . ASN B 2 104 ? 3.819  34.685 -6.668  1.00 34.58 ? 104 ASN B CB  1 
ATOM   1918 C CG  . ASN B 2 104 ? 2.943  33.696 -7.412  1.00 38.62 ? 104 ASN B CG  1 
ATOM   1919 O OD1 . ASN B 2 104 ? 3.224  32.494 -7.429  1.00 39.78 ? 104 ASN B OD1 1 
ATOM   1920 N ND2 . ASN B 2 104 ? 1.882  34.195 -8.042  1.00 39.94 ? 104 ASN B ND2 1 
ATOM   1921 N N   . GLN B 2 105 ? 5.917  34.554 -3.611  1.00 30.49 ? 105 GLN B N   1 
ATOM   1922 C CA  . GLN B 2 105 ? 7.004  35.234 -2.926  1.00 29.09 ? 105 GLN B CA  1 
ATOM   1923 C C   . GLN B 2 105 ? 7.408  34.381 -1.721  1.00 27.31 ? 105 GLN B C   1 
ATOM   1924 O O   . GLN B 2 105 ? 6.688  33.460 -1.336  1.00 25.52 ? 105 GLN B O   1 
ATOM   1925 C CB  . GLN B 2 105 ? 6.542  36.631 -2.474  1.00 30.03 ? 105 GLN B CB  1 
ATOM   1926 C CG  . GLN B 2 105 ? 6.641  36.875 -0.975  1.00 30.85 ? 105 GLN B CG  1 
ATOM   1927 C CD  . GLN B 2 105 ? 5.312  37.227 -0.347  1.00 34.06 ? 105 GLN B CD  1 
ATOM   1928 O OE1 . GLN B 2 105 ? 5.098  37.001 0.847   1.00 37.40 ? 105 GLN B OE1 1 
ATOM   1929 N NE2 . GLN B 2 105 ? 4.411  37.797 -1.143  1.00 33.43 ? 105 GLN B NE2 1 
ATOM   1930 N N   . TRP B 2 106 ? 8.558  34.687 -1.131  1.00 25.99 ? 106 TRP B N   1 
ATOM   1931 C CA  . TRP B 2 106 ? 9.031  33.947 0.031   1.00 25.78 ? 106 TRP B CA  1 
ATOM   1932 C C   . TRP B 2 106 ? 8.377  34.473 1.309   1.00 27.14 ? 106 TRP B C   1 
ATOM   1933 O O   . TRP B 2 106 ? 7.673  35.477 1.286   1.00 26.27 ? 106 TRP B O   1 
ATOM   1934 C CB  . TRP B 2 106 ? 10.546 34.080 0.161   1.00 24.04 ? 106 TRP B CB  1 
ATOM   1935 C CG  . TRP B 2 106 ? 11.307 33.680 -1.053  1.00 22.96 ? 106 TRP B CG  1 
ATOM   1936 C CD1 . TRP B 2 106 ? 10.801 33.207 -2.229  1.00 22.37 ? 106 TRP B CD1 1 
ATOM   1937 C CD2 . TRP B 2 106 ? 12.724 33.734 -1.218  1.00 23.52 ? 106 TRP B CD2 1 
ATOM   1938 N NE1 . TRP B 2 106 ? 11.817 32.967 -3.117  1.00 22.71 ? 106 TRP B NE1 1 
ATOM   1939 C CE2 . TRP B 2 106 ? 13.010 33.283 -2.522  1.00 21.56 ? 106 TRP B CE2 1 
ATOM   1940 C CE3 . TRP B 2 106 ? 13.783 34.122 -0.388  1.00 24.99 ? 106 TRP B CE3 1 
ATOM   1941 C CZ2 . TRP B 2 106 ? 14.312 33.211 -3.021  1.00 21.63 ? 106 TRP B CZ2 1 
ATOM   1942 C CZ3 . TRP B 2 106 ? 15.078 34.050 -0.885  1.00 25.24 ? 106 TRP B CZ3 1 
ATOM   1943 C CH2 . TRP B 2 106 ? 15.329 33.597 -2.193  1.00 24.30 ? 106 TRP B CH2 1 
ATOM   1944 N N   . THR B 2 107 ? 8.634  33.788 2.421   1.00 28.39 ? 107 THR B N   1 
ATOM   1945 C CA  . THR B 2 107 ? 8.099  34.163 3.726   1.00 29.94 ? 107 THR B CA  1 
ATOM   1946 C C   . THR B 2 107 ? 8.874  33.456 4.842   1.00 30.82 ? 107 THR B C   1 
ATOM   1947 O O   . THR B 2 107 ? 9.464  32.387 4.634   1.00 27.77 ? 107 THR B O   1 
ATOM   1948 C CB  . THR B 2 107 ? 6.599  33.788 3.852   1.00 29.88 ? 107 THR B CB  1 
ATOM   1949 O OG1 . THR B 2 107 ? 5.820  34.640 3.003   1.00 36.42 ? 107 THR B OG1 1 
ATOM   1950 C CG2 . THR B 2 107 ? 6.116  33.946 5.288   1.00 29.98 ? 107 THR B CG2 1 
ATOM   1951 N N   . ARG B 2 108 ? 8.878  34.064 6.024   1.00 32.21 ? 108 ARG B N   1 
ATOM   1952 C CA  . ARG B 2 108 ? 9.562  33.485 7.173   1.00 34.84 ? 108 ARG B CA  1 
ATOM   1953 C C   . ARG B 2 108 ? 8.499  32.869 8.062   1.00 35.03 ? 108 ARG B C   1 
ATOM   1954 O O   . ARG B 2 108 ? 7.457  33.475 8.305   1.00 35.87 ? 108 ARG B O   1 
ATOM   1955 C CB  . ARG B 2 108 ? 10.329 34.561 7.949   1.00 35.90 ? 108 ARG B CB  1 
ATOM   1956 C CG  . ARG B 2 108 ? 11.342 35.310 7.098   1.00 39.60 ? 108 ARG B CG  1 
ATOM   1957 C CD  . ARG B 2 108 ? 12.385 35.994 7.952   1.00 41.23 ? 108 ARG B CD  1 
ATOM   1958 N NE  . ARG B 2 108 ? 12.210 37.440 8.063   1.00 41.27 ? 108 ARG B NE  1 
ATOM   1959 C CZ  . ARG B 2 108 ? 13.119 38.323 7.656   1.00 43.66 ? 108 ARG B CZ  1 
ATOM   1960 N NH1 . ARG B 2 108 ? 14.252 37.900 7.107   1.00 44.31 ? 108 ARG B NH1 1 
ATOM   1961 N NH2 . ARG B 2 108 ? 12.916 39.624 7.823   1.00 43.92 ? 108 ARG B NH2 1 
ATOM   1962 N N   . ARG B 2 109 ? 8.751  31.658 8.539   1.00 35.79 ? 109 ARG B N   1 
ATOM   1963 C CA  . ARG B 2 109 ? 7.780  31.000 9.388   1.00 34.75 ? 109 ARG B CA  1 
ATOM   1964 C C   . ARG B 2 109 ? 8.441  30.042 10.353  1.00 32.60 ? 109 ARG B C   1 
ATOM   1965 O O   . ARG B 2 109 ? 9.591  29.658 10.173  1.00 30.79 ? 109 ARG B O   1 
ATOM   1966 C CB  . ARG B 2 109 ? 6.751  30.254 8.531   1.00 38.34 ? 109 ARG B CB  1 
ATOM   1967 C CG  . ARG B 2 109 ? 5.351  30.300 9.119   1.00 43.59 ? 109 ARG B CG  1 
ATOM   1968 C CD  . ARG B 2 109 ? 4.954  31.746 9.413   1.00 49.10 ? 109 ARG B CD  1 
ATOM   1969 N NE  . ARG B 2 109 ? 3.743  31.859 10.219  1.00 52.96 ? 109 ARG B NE  1 
ATOM   1970 C CZ  . ARG B 2 109 ? 3.240  33.015 10.640  1.00 55.73 ? 109 ARG B CZ  1 
ATOM   1971 N NH1 . ARG B 2 109 ? 3.846  34.155 10.332  1.00 55.84 ? 109 ARG B NH1 1 
ATOM   1972 N NH2 . ARG B 2 109 ? 2.128  33.036 11.367  1.00 58.27 ? 109 ARG B NH2 1 
ATOM   1973 N N   . ASP B 2 110 ? 7.695  29.658 11.378  1.00 33.56 ? 110 ASP B N   1 
ATOM   1974 C CA  . ASP B 2 110 ? 8.189  28.743 12.387  1.00 34.16 ? 110 ASP B CA  1 
ATOM   1975 C C   . ASP B 2 110 ? 8.836  27.512 11.777  1.00 32.54 ? 110 ASP B C   1 
ATOM   1976 O O   . ASP B 2 110 ? 8.210  26.771 11.015  1.00 31.22 ? 110 ASP B O   1 
ATOM   1977 C CB  . ASP B 2 110 ? 7.047  28.329 13.313  1.00 38.86 ? 110 ASP B CB  1 
ATOM   1978 C CG  . ASP B 2 110 ? 7.459  27.258 14.297  1.00 42.61 ? 110 ASP B CG  1 
ATOM   1979 O OD1 . ASP B 2 110 ? 8.573  27.363 14.853  1.00 45.80 ? 110 ASP B OD1 1 
ATOM   1980 O OD2 . ASP B 2 110 ? 6.667  26.317 14.520  1.00 44.98 ? 110 ASP B OD2 1 
ATOM   1981 N N   . CYS B 2 111 ? 10.103 27.308 12.126  1.00 31.66 ? 111 CYS B N   1 
ATOM   1982 C CA  . CYS B 2 111 ? 10.887 26.174 11.650  1.00 29.68 ? 111 CYS B CA  1 
ATOM   1983 C C   . CYS B 2 111 ? 10.314 24.847 12.135  1.00 30.62 ? 111 CYS B C   1 
ATOM   1984 O O   . CYS B 2 111 ? 10.616 23.783 11.585  1.00 26.21 ? 111 CYS B O   1 
ATOM   1985 C CB  . CYS B 2 111 ? 12.317 26.288 12.164  1.00 27.95 ? 111 CYS B CB  1 
ATOM   1986 S SG  . CYS B 2 111 ? 13.291 27.686 11.532  1.00 25.30 ? 111 CYS B SG  1 
ATOM   1987 N N   . THR B 2 112 ? 9.488  24.924 13.173  1.00 32.91 ? 112 THR B N   1 
ATOM   1988 C CA  . THR B 2 112 ? 8.896  23.742 13.782  1.00 36.49 ? 112 THR B CA  1 
ATOM   1989 C C   . THR B 2 112 ? 7.678  23.186 13.066  1.00 36.63 ? 112 THR B C   1 
ATOM   1990 O O   . THR B 2 112 ? 7.269  22.050 13.324  1.00 36.16 ? 112 THR B O   1 
ATOM   1991 C CB  . THR B 2 112 ? 8.498  24.020 15.241  1.00 39.24 ? 112 THR B CB  1 
ATOM   1992 O OG1 . THR B 2 112 ? 9.544  24.754 15.894  1.00 44.20 ? 112 THR B OG1 1 
ATOM   1993 C CG2 . THR B 2 112 ? 8.283  22.709 15.979  1.00 42.22 ? 112 THR B CG2 1 
ATOM   1994 N N   . TRP B 2 113 ? 7.076  23.969 12.181  1.00 37.33 ? 113 TRP B N   1 
ATOM   1995 C CA  . TRP B 2 113 ? 5.914  23.460 11.481  1.00 39.11 ? 113 TRP B CA  1 
ATOM   1996 C C   . TRP B 2 113 ? 6.298  22.587 10.295  1.00 36.44 ? 113 TRP B C   1 
ATOM   1997 O O   . TRP B 2 113 ? 7.478  22.402 10.011  1.00 33.43 ? 113 TRP B O   1 
ATOM   1998 C CB  . TRP B 2 113 ? 4.982  24.601 11.071  1.00 45.93 ? 113 TRP B CB  1 
ATOM   1999 C CG  . TRP B 2 113 ? 4.113  25.044 12.217  1.00 54.03 ? 113 TRP B CG  1 
ATOM   2000 C CD1 . TRP B 2 113 ? 3.563  24.243 13.178  1.00 56.16 ? 113 TRP B CD1 1 
ATOM   2001 C CD2 . TRP B 2 113 ? 3.663  26.375 12.503  1.00 57.66 ? 113 TRP B CD2 1 
ATOM   2002 N NE1 . TRP B 2 113 ? 2.800  24.989 14.042  1.00 59.04 ? 113 TRP B NE1 1 
ATOM   2003 C CE2 . TRP B 2 113 ? 2.842  26.302 13.652  1.00 60.03 ? 113 TRP B CE2 1 
ATOM   2004 C CE3 . TRP B 2 113 ? 3.871  27.623 11.899  1.00 60.16 ? 113 TRP B CE3 1 
ATOM   2005 C CZ2 . TRP B 2 113 ? 2.228  27.430 14.211  1.00 61.87 ? 113 TRP B CZ2 1 
ATOM   2006 C CZ3 . TRP B 2 113 ? 3.259  28.746 12.456  1.00 62.53 ? 113 TRP B CZ3 1 
ATOM   2007 C CH2 . TRP B 2 113 ? 2.448  28.639 13.601  1.00 62.41 ? 113 TRP B CH2 1 
ATOM   2008 N N   . THR B 2 114 ? 5.295  22.047 9.611   1.00 34.49 ? 114 THR B N   1 
ATOM   2009 C CA  . THR B 2 114 ? 5.524  21.136 8.502   1.00 33.91 ? 114 THR B CA  1 
ATOM   2010 C C   . THR B 2 114 ? 5.212  21.680 7.114   1.00 32.78 ? 114 THR B C   1 
ATOM   2011 O O   . THR B 2 114 ? 4.264  22.436 6.931   1.00 34.00 ? 114 THR B O   1 
ATOM   2012 C CB  . THR B 2 114 ? 4.692  19.880 8.709   1.00 36.47 ? 114 THR B CB  1 
ATOM   2013 O OG1 . THR B 2 114 ? 3.305  20.216 8.588   1.00 37.75 ? 114 THR B OG1 1 
ATOM   2014 C CG2 . THR B 2 114 ? 4.936  19.307 10.106  1.00 35.90 ? 114 THR B CG2 1 
ATOM   2015 N N   . PHE B 2 115 ? 6.008  21.277 6.130   1.00 32.03 ? 115 PHE B N   1 
ATOM   2016 C CA  . PHE B 2 115 ? 5.796  21.724 4.761   1.00 29.32 ? 115 PHE B CA  1 
ATOM   2017 C C   . PHE B 2 115 ? 6.363  20.777 3.734   1.00 28.43 ? 115 PHE B C   1 
ATOM   2018 O O   . PHE B 2 115 ? 7.200  19.939 4.047   1.00 27.02 ? 115 PHE B O   1 
ATOM   2019 C CB  . PHE B 2 115 ? 6.407  23.102 4.562   1.00 30.89 ? 115 PHE B CB  1 
ATOM   2020 C CG  . PHE B 2 115 ? 5.718  24.162 5.340   1.00 30.74 ? 115 PHE B CG  1 
ATOM   2021 C CD1 . PHE B 2 115 ? 4.451  24.582 4.977   1.00 29.82 ? 115 PHE B CD1 1 
ATOM   2022 C CD2 . PHE B 2 115 ? 6.297  24.685 6.479   1.00 31.27 ? 115 PHE B CD2 1 
ATOM   2023 C CE1 . PHE B 2 115 ? 3.770  25.500 5.735   1.00 31.22 ? 115 PHE B CE1 1 
ATOM   2024 C CE2 . PHE B 2 115 ? 5.624  25.606 7.247   1.00 31.46 ? 115 PHE B CE2 1 
ATOM   2025 C CZ  . PHE B 2 115 ? 4.355  26.017 6.876   1.00 31.50 ? 115 PHE B CZ  1 
ATOM   2026 N N   . SER B 2 116 ? 5.883  20.913 2.504   1.00 29.01 ? 116 SER B N   1 
ATOM   2027 C CA  . SER B 2 116 ? 6.348  20.089 1.402   1.00 28.85 ? 116 SER B CA  1 
ATOM   2028 C C   . SER B 2 116 ? 7.782  20.507 1.136   1.00 26.97 ? 116 SER B C   1 
ATOM   2029 O O   . SER B 2 116 ? 8.277  21.456 1.741   1.00 26.94 ? 116 SER B O   1 
ATOM   2030 C CB  . SER B 2 116 ? 5.501  20.337 0.140   1.00 30.89 ? 116 SER B CB  1 
ATOM   2031 O OG  . SER B 2 116 ? 4.182  19.829 0.267   1.00 34.55 ? 116 SER B OG  1 
ATOM   2032 N N   . PHE B 2 117 ? 8.449  19.813 0.227   1.00 27.02 ? 117 PHE B N   1 
ATOM   2033 C CA  . PHE B 2 117 ? 9.818  20.169 -0.084  1.00 29.98 ? 117 PHE B CA  1 
ATOM   2034 C C   . PHE B 2 117 ? 10.314 19.797 -1.459  1.00 29.37 ? 117 PHE B C   1 
ATOM   2035 O O   . PHE B 2 117 ? 9.831  18.870 -2.105  1.00 29.93 ? 117 PHE B O   1 
ATOM   2036 C CB  . PHE B 2 117 ? 10.783 19.606 0.965   1.00 35.39 ? 117 PHE B CB  1 
ATOM   2037 C CG  . PHE B 2 117 ? 10.359 18.292 1.553   1.00 39.09 ? 117 PHE B CG  1 
ATOM   2038 C CD1 . PHE B 2 117 ? 10.821 17.919 2.803   1.00 39.88 ? 117 PHE B CD1 1 
ATOM   2039 C CD2 . PHE B 2 117 ? 9.496  17.439 0.876   1.00 43.26 ? 117 PHE B CD2 1 
ATOM   2040 C CE1 . PHE B 2 117 ? 10.439 16.733 3.375   1.00 43.99 ? 117 PHE B CE1 1 
ATOM   2041 C CE2 . PHE B 2 117 ? 9.103  16.238 1.443   1.00 46.13 ? 117 PHE B CE2 1 
ATOM   2042 C CZ  . PHE B 2 117 ? 9.578  15.886 2.699   1.00 47.72 ? 117 PHE B CZ  1 
ATOM   2043 N N   . VAL B 2 118 ? 11.306 20.556 -1.887  1.00 28.94 ? 118 VAL B N   1 
ATOM   2044 C CA  . VAL B 2 118 ? 11.928 20.376 -3.173  1.00 28.47 ? 118 VAL B CA  1 
ATOM   2045 C C   . VAL B 2 118 ? 13.423 20.311 -2.899  1.00 28.10 ? 118 VAL B C   1 
ATOM   2046 O O   . VAL B 2 118 ? 14.025 21.286 -2.450  1.00 26.12 ? 118 VAL B O   1 
ATOM   2047 C CB  . VAL B 2 118 ? 11.602 21.567 -4.088  1.00 27.94 ? 118 VAL B CB  1 
ATOM   2048 C CG1 . VAL B 2 118 ? 12.182 21.341 -5.469  1.00 31.44 ? 118 VAL B CG1 1 
ATOM   2049 C CG2 . VAL B 2 118 ? 10.097 21.749 -4.164  1.00 27.36 ? 118 VAL B CG2 1 
ATOM   2050 N N   . CYS B 2 119 ? 14.010 19.144 -3.129  1.00 27.85 ? 119 CYS B N   1 
ATOM   2051 C CA  . CYS B 2 119 ? 15.434 18.977 -2.912  1.00 29.83 ? 119 CYS B CA  1 
ATOM   2052 C C   . CYS B 2 119 ? 16.156 19.397 -4.191  1.00 32.15 ? 119 CYS B C   1 
ATOM   2053 O O   . CYS B 2 119 ? 15.572 19.380 -5.276  1.00 31.25 ? 119 CYS B O   1 
ATOM   2054 C CB  . CYS B 2 119 ? 15.755 17.522 -2.564  1.00 28.34 ? 119 CYS B CB  1 
ATOM   2055 S SG  . CYS B 2 119 ? 14.922 16.886 -1.066  1.00 25.92 ? 119 CYS B SG  1 
ATOM   2056 N N   . LYS B 2 120 ? 17.422 19.778 -4.057  1.00 34.70 ? 120 LYS B N   1 
ATOM   2057 C CA  . LYS B 2 120 ? 18.215 20.220 -5.198  1.00 37.24 ? 120 LYS B CA  1 
ATOM   2058 C C   . LYS B 2 120 ? 19.711 19.931 -5.040  1.00 39.40 ? 120 LYS B C   1 
ATOM   2059 O O   . LYS B 2 120 ? 20.297 20.185 -3.989  1.00 39.42 ? 120 LYS B O   1 
ATOM   2060 C CB  . LYS B 2 120 ? 18.003 21.720 -5.406  1.00 35.20 ? 120 LYS B CB  1 
ATOM   2061 C CG  . LYS B 2 120 ? 19.018 22.398 -6.329  1.00 33.57 ? 120 LYS B CG  1 
ATOM   2062 C CD  . LYS B 2 120 ? 18.872 23.910 -6.227  1.00 32.20 ? 120 LYS B CD  1 
ATOM   2063 C CE  . LYS B 2 120 ? 20.048 24.640 -6.842  1.00 29.91 ? 120 LYS B CE  1 
ATOM   2064 N NZ  . LYS B 2 120 ? 20.070 26.066 -6.393  1.00 30.22 ? 120 LYS B NZ  1 
ATOM   2065 N N   . CYS B 2 121 ? 20.313 19.390 -6.094  1.00 43.22 ? 121 CYS B N   1 
ATOM   2066 C CA  . CYS B 2 121 ? 21.737 19.087 -6.102  1.00 47.53 ? 121 CYS B CA  1 
ATOM   2067 C C   . CYS B 2 121 ? 22.307 19.374 -7.491  1.00 49.05 ? 121 CYS B C   1 
ATOM   2068 O O   . CYS B 2 121 ? 21.715 19.003 -8.507  1.00 48.48 ? 121 CYS B O   1 
ATOM   2069 C CB  . CYS B 2 121 ? 21.987 17.621 -5.721  1.00 49.07 ? 121 CYS B CB  1 
ATOM   2070 S SG  . CYS B 2 121 ? 21.332 16.377 -6.867  1.00 55.68 ? 121 CYS B SG  1 
ATOM   2071 N N   . PRO B 2 122 ? 23.449 20.077 -7.551  1.00 51.49 ? 122 PRO B N   1 
ATOM   2072 C CA  . PRO B 2 122 ? 24.092 20.412 -8.826  1.00 53.22 ? 122 PRO B CA  1 
ATOM   2073 C C   . PRO B 2 122 ? 24.656 19.170 -9.501  1.00 54.49 ? 122 PRO B C   1 
ATOM   2074 O O   . PRO B 2 122 ? 25.400 18.408 -8.885  1.00 54.61 ? 122 PRO B O   1 
ATOM   2075 C CB  . PRO B 2 122 ? 25.192 21.391 -8.414  1.00 53.85 ? 122 PRO B CB  1 
ATOM   2076 C CG  . PRO B 2 122 ? 24.630 22.033 -7.170  1.00 53.27 ? 122 PRO B CG  1 
ATOM   2077 C CD  . PRO B 2 122 ? 24.056 20.843 -6.447  1.00 52.70 ? 122 PRO B CD  1 
ATOM   2078 N N   . ALA B 2 123 ? 24.307 18.972 -10.767 1.00 56.53 ? 123 ALA B N   1 
ATOM   2079 C CA  . ALA B 2 123 ? 24.780 17.810 -11.517 1.00 58.31 ? 123 ALA B CA  1 
ATOM   2080 C C   . ALA B 2 123 ? 26.300 17.787 -11.630 1.00 58.96 ? 123 ALA B C   1 
ATOM   2081 O O   . ALA B 2 123 ? 26.939 18.782 -11.224 1.00 58.93 ? 123 ALA B O   1 
ATOM   2082 C CB  . ALA B 2 123 ? 24.157 17.798 -12.905 1.00 58.50 ? 123 ALA B CB  1 
ATOM   2083 O OXT . ALA B 2 123 ? 26.830 16.774 -12.131 1.00 59.72 ? 123 ALA B OXT 1 
HETATM 2084 O O   . HOH C 3 .   ? 13.317 40.786 29.946  1.00 19.32 ? 132 HOH A O   1 
HETATM 2085 O O   . HOH C 3 .   ? 10.954 34.102 -6.199  1.00 35.00 ? 133 HOH A O   1 
HETATM 2086 O O   . HOH C 3 .   ? 14.191 54.497 16.518  1.00 50.73 ? 134 HOH A O   1 
HETATM 2087 O O   . HOH C 3 .   ? 4.026  33.657 36.269  1.00 24.37 ? 135 HOH A O   1 
HETATM 2088 O O   . HOH C 3 .   ? 23.742 51.002 31.529  1.00 27.51 ? 136 HOH A O   1 
HETATM 2089 O O   . HOH C 3 .   ? 23.122 38.659 36.082  1.00 40.47 ? 137 HOH A O   1 
HETATM 2090 O O   . HOH C 3 .   ? 11.324 31.755 36.347  1.00 41.70 ? 138 HOH A O   1 
HETATM 2091 O O   . HOH C 3 .   ? 19.978 25.072 -0.184  1.00 33.09 ? 139 HOH A O   1 
HETATM 2092 O O   . HOH C 3 .   ? 15.319 52.569 11.982  1.00 46.04 ? 140 HOH A O   1 
HETATM 2093 O O   . HOH C 3 .   ? 26.288 25.639 -3.082  1.00 22.38 ? 141 HOH A O   1 
HETATM 2094 O O   . HOH C 3 .   ? 13.980 54.703 45.682  1.00 40.54 ? 142 HOH A O   1 
HETATM 2095 O O   . HOH C 3 .   ? 21.479 40.567 -0.685  1.00 53.24 ? 143 HOH A O   1 
HETATM 2096 O O   . HOH C 3 .   ? 14.832 38.947 28.040  1.00 25.50 ? 144 HOH A O   1 
HETATM 2097 O O   . HOH C 3 .   ? 13.425 50.095 12.293  1.00 16.11 ? 145 HOH A O   1 
HETATM 2098 O O   . HOH C 3 .   ? 30.854 61.642 28.296  1.00 61.01 ? 146 HOH A O   1 
HETATM 2099 O O   . HOH C 3 .   ? 9.027  53.145 37.751  1.00 23.57 ? 147 HOH A O   1 
HETATM 2100 O O   . HOH C 3 .   ? 1.887  52.152 25.555  1.00 56.59 ? 148 HOH A O   1 
HETATM 2101 O O   . HOH C 3 .   ? 12.741 51.194 39.739  1.00 32.37 ? 149 HOH A O   1 
HETATM 2102 O O   . HOH C 3 .   ? 16.887 54.916 13.978  1.00 47.04 ? 150 HOH A O   1 
HETATM 2103 O O   . HOH C 3 .   ? 25.388 59.463 29.879  1.00 40.51 ? 151 HOH A O   1 
HETATM 2104 O O   . HOH C 3 .   ? 24.828 61.938 35.990  1.00 50.14 ? 152 HOH A O   1 
HETATM 2105 O O   . HOH C 3 .   ? 28.415 51.698 29.472  1.00 46.46 ? 153 HOH A O   1 
HETATM 2106 O O   . HOH C 3 .   ? 34.285 60.244 30.763  1.00 59.55 ? 154 HOH A O   1 
HETATM 2107 O O   . HOH C 3 .   ? 12.673 26.891 32.818  1.00 67.13 ? 155 HOH A O   1 
HETATM 2108 O O   . HOH C 3 .   ? 15.553 33.997 38.756  1.00 40.22 ? 156 HOH A O   1 
HETATM 2109 O O   . HOH C 3 .   ? 12.041 29.546 34.349  1.00 40.07 ? 157 HOH A O   1 
HETATM 2110 O O   . HOH C 3 .   ? 3.317  40.147 32.552  1.00 36.66 ? 158 HOH A O   1 
HETATM 2111 O O   . HOH C 3 .   ? 1.525  46.800 36.952  1.00 33.67 ? 159 HOH A O   1 
HETATM 2112 O O   . HOH C 3 .   ? -1.841 44.777 37.378  1.00 53.73 ? 160 HOH A O   1 
HETATM 2113 O O   . HOH C 3 .   ? 3.848  52.356 38.443  1.00 39.54 ? 161 HOH A O   1 
HETATM 2114 O O   . HOH C 3 .   ? -4.257 52.467 28.576  1.00 48.44 ? 162 HOH A O   1 
HETATM 2115 O O   . HOH C 3 .   ? -1.760 41.686 20.096  1.00 36.81 ? 163 HOH A O   1 
HETATM 2116 O O   . HOH C 3 .   ? 17.946 50.233 6.166   1.00 53.48 ? 164 HOH A O   1 
HETATM 2117 O O   . HOH C 3 .   ? 23.297 53.243 5.209   1.00 59.13 ? 165 HOH A O   1 
HETATM 2118 O O   . HOH C 3 .   ? 32.167 30.135 8.325   1.00 68.98 ? 166 HOH A O   1 
HETATM 2119 O O   . HOH C 3 .   ? 25.982 33.506 6.868   1.00 37.41 ? 167 HOH A O   1 
HETATM 2120 O O   . HOH C 3 .   ? 9.142  62.250 18.109  1.00 45.43 ? 168 HOH A O   1 
HETATM 2121 O O   . HOH C 3 .   ? 2.140  57.559 23.190  1.00 32.37 ? 169 HOH A O   1 
HETATM 2122 O O   . HOH C 3 .   ? -1.753 55.389 18.117  1.00 47.75 ? 170 HOH A O   1 
HETATM 2123 O O   . HOH C 3 .   ? 30.065 55.418 42.215  1.00 53.92 ? 171 HOH A O   1 
HETATM 2124 O O   . HOH C 3 .   ? 30.199 53.377 31.864  1.00 50.90 ? 172 HOH A O   1 
HETATM 2125 O O   . HOH C 3 .   ? 15.177 48.634 21.208  1.00 20.81 ? 173 HOH A O   1 
HETATM 2126 O O   . HOH C 3 .   ? -4.098 52.419 31.641  1.00 51.98 ? 174 HOH A O   1 
HETATM 2127 O O   . HOH C 3 .   ? 34.736 50.944 34.119  1.00 38.65 ? 175 HOH A O   1 
HETATM 2128 O O   . HOH C 3 .   ? 14.405 52.571 2.437   1.00 58.32 ? 176 HOH A O   1 
HETATM 2129 O O   . HOH C 3 .   ? -0.543 40.496 31.050  1.00 41.89 ? 177 HOH A O   1 
HETATM 2130 O O   . HOH C 3 .   ? 2.412  63.896 23.074  1.00 46.71 ? 178 HOH A O   1 
HETATM 2131 O O   . HOH C 3 .   ? 33.984 49.785 37.703  1.00 59.06 ? 179 HOH A O   1 
HETATM 2132 O O   . HOH C 3 .   ? 32.800 25.637 -1.520  1.00 53.88 ? 180 HOH A O   1 
HETATM 2133 O O   . HOH C 3 .   ? -6.079 61.386 24.880  1.00 61.13 ? 181 HOH A O   1 
HETATM 2134 O O   . HOH C 3 .   ? 28.929 43.440 30.236  1.00 42.63 ? 182 HOH A O   1 
HETATM 2135 O O   . HOH C 3 .   ? 0.569  49.189 22.710  1.00 43.34 ? 183 HOH A O   1 
HETATM 2136 O O   . HOH C 3 .   ? 32.354 56.169 39.532  1.00 60.91 ? 184 HOH A O   1 
HETATM 2137 O O   . HOH C 3 .   ? 36.504 34.632 9.059   1.00 33.10 ? 185 HOH A O   1 
HETATM 2138 O O   . HOH C 3 .   ? 17.544 52.302 16.420  1.00 45.80 ? 186 HOH A O   1 
HETATM 2139 O O   . HOH C 3 .   ? -2.564 52.876 14.391  1.00 31.29 ? 187 HOH A O   1 
HETATM 2140 O O   . HOH C 3 .   ? -3.555 50.523 20.149  1.00 70.19 ? 188 HOH A O   1 
HETATM 2141 O O   . HOH C 3 .   ? 20.166 39.777 38.606  1.00 17.38 ? 189 HOH A O   1 
HETATM 2142 O O   . HOH C 3 .   ? 8.745  32.431 28.055  1.00 50.80 ? 190 HOH A O   1 
HETATM 2143 O O   . HOH C 3 .   ? 24.700 43.772 33.274  1.00 43.42 ? 191 HOH A O   1 
HETATM 2144 O O   . HOH C 3 .   ? 0.728  49.353 12.609  1.00 35.25 ? 192 HOH A O   1 
HETATM 2145 O O   . HOH C 3 .   ? 24.945 62.685 29.289  1.00 54.21 ? 193 HOH A O   1 
HETATM 2146 O O   . HOH D 3 .   ? 22.477 49.042 29.536  1.00 11.52 ? 124 HOH B O   1 
HETATM 2147 O O   . HOH D 3 .   ? 10.456 36.775 10.263  1.00 48.95 ? 125 HOH B O   1 
HETATM 2148 O O   . HOH D 3 .   ? 21.740 48.801 26.041  1.00 25.34 ? 126 HOH B O   1 
HETATM 2149 O O   . HOH D 3 .   ? 22.803 39.612 26.027  1.00 14.12 ? 127 HOH B O   1 
HETATM 2150 O O   . HOH D 3 .   ? 8.420  13.839 -7.911  1.00 45.23 ? 128 HOH B O   1 
HETATM 2151 O O   . HOH D 3 .   ? 15.512 30.686 12.640  1.00 27.85 ? 129 HOH B O   1 
HETATM 2152 O O   . HOH D 3 .   ? 1.778  23.768 3.930   1.00 44.24 ? 130 HOH B O   1 
HETATM 2153 O O   . HOH D 3 .   ? 14.776 15.423 -17.105 1.00 47.99 ? 131 HOH B O   1 
HETATM 2154 O O   . HOH D 3 .   ? 26.614 19.217 -0.107  1.00 49.21 ? 132 HOH B O   1 
HETATM 2155 O O   . HOH D 3 .   ? 13.086 22.591 12.104  1.00 31.58 ? 133 HOH B O   1 
HETATM 2156 O O   . HOH D 3 .   ? -0.175 33.135 -7.031  1.00 25.74 ? 134 HOH B O   1 
HETATM 2157 O O   . HOH D 3 .   ? 20.195 37.999 7.757   1.00 34.11 ? 135 HOH B O   1 
HETATM 2158 O O   . HOH D 3 .   ? 8.713  16.738 11.015  1.00 30.47 ? 136 HOH B O   1 
HETATM 2159 O O   . HOH D 3 .   ? 26.825 44.290 22.019  1.00 41.94 ? 137 HOH B O   1 
HETATM 2160 O O   . HOH D 3 .   ? 11.564 17.193 16.182  1.00 38.27 ? 138 HOH B O   1 
HETATM 2161 O O   . HOH D 3 .   ? 22.038 30.900 23.401  1.00 50.92 ? 139 HOH B O   1 
HETATM 2162 O O   . HOH D 3 .   ? 19.476 23.298 -3.005  1.00 30.48 ? 140 HOH B O   1 
HETATM 2163 O O   . HOH D 3 .   ? -0.026 29.104 -0.742  1.00 26.11 ? 141 HOH B O   1 
HETATM 2164 O O   . HOH D 3 .   ? 14.089 32.508 25.041  1.00 51.96 ? 142 HOH B O   1 
HETATM 2165 O O   . HOH D 3 .   ? 14.884 41.694 5.940   1.00 58.40 ? 143 HOH B O   1 
HETATM 2166 O O   . HOH D 3 .   ? 5.254  37.637 14.054  1.00 54.33 ? 144 HOH B O   1 
HETATM 2167 O O   . HOH D 3 .   ? 10.046 11.455 -20.465 1.00 69.36 ? 145 HOH B O   1 
HETATM 2168 O O   . HOH D 3 .   ? 14.360 13.074 -14.938 1.00 49.87 ? 146 HOH B O   1 
HETATM 2169 O O   . HOH D 3 .   ? 9.916  7.985  -9.346  1.00 58.68 ? 147 HOH B O   1 
HETATM 2170 O O   . HOH D 3 .   ? 7.987  19.648 16.726  1.00 81.60 ? 148 HOH B O   1 
HETATM 2171 O O   . HOH D 3 .   ? 18.927 18.687 9.546   1.00 25.32 ? 149 HOH B O   1 
HETATM 2172 O O   . HOH D 3 .   ? 28.611 21.148 -5.738  1.00 44.65 ? 150 HOH B O   1 
HETATM 2173 O O   . HOH D 3 .   ? 3.143  16.698 -13.312 1.00 37.57 ? 151 HOH B O   1 
HETATM 2174 O O   . HOH D 3 .   ? -2.100 21.918 -12.266 1.00 47.75 ? 152 HOH B O   1 
HETATM 2175 O O   . HOH D 3 .   ? 27.275 32.906 19.557  1.00 44.30 ? 153 HOH B O   1 
HETATM 2176 O O   . HOH D 3 .   ? 27.696 33.687 22.667  1.00 43.46 ? 154 HOH B O   1 
HETATM 2177 O O   . HOH D 3 .   ? 25.507 52.954 22.068  1.00 51.05 ? 155 HOH B O   1 
HETATM 2178 O O   . HOH D 3 .   ? 27.331 54.064 18.429  1.00 48.51 ? 156 HOH B O   1 
HETATM 2179 O O   . HOH D 3 .   ? 28.020 47.425 29.169  1.00 46.24 ? 157 HOH B O   1 
HETATM 2180 O O   . HOH D 3 .   ? 10.523 37.889 15.546  1.00 42.68 ? 158 HOH B O   1 
HETATM 2181 O O   . HOH D 3 .   ? 17.635 28.180 22.154  1.00 50.04 ? 159 HOH B O   1 
HETATM 2182 O O   . HOH D 3 .   ? 3.081  35.686 4.263   1.00 47.52 ? 160 HOH B O   1 
HETATM 2183 O O   . HOH D 3 .   ? 0.977  23.165 7.458   1.00 58.52 ? 161 HOH B O   1 
HETATM 2184 O O   . HOH D 3 .   ? 5.758  27.199 9.587   1.00 20.82 ? 162 HOH B O   1 
HETATM 2185 O O   . HOH D 3 .   ? 10.863 38.545 12.666  1.00 39.87 ? 163 HOH B O   1 
HETATM 2186 O O   . HOH D 3 .   ? 12.899 8.926  -0.910  1.00 24.01 ? 164 HOH B O   1 
HETATM 2187 O O   . HOH D 3 .   ? 12.913 6.591  -9.246  1.00 54.60 ? 165 HOH B O   1 
HETATM 2188 O O   . HOH D 3 .   ? 25.049 8.072  -8.055  1.00 36.70 ? 166 HOH B O   1 
HETATM 2189 O O   . HOH D 3 .   ? 21.356 14.894 -21.643 1.00 31.31 ? 167 HOH B O   1 
HETATM 2190 O O   . HOH D 3 .   ? 18.177 42.357 5.846   1.00 73.79 ? 168 HOH B O   1 
HETATM 2191 O O   . HOH D 3 .   ? 16.735 25.013 16.445  1.00 47.00 ? 169 HOH B O   1 
HETATM 2192 O O   . HOH D 3 .   ? 15.503 24.379 13.183  1.00 53.60 ? 170 HOH B O   1 
HETATM 2193 O O   . HOH D 3 .   ? 16.817 9.190  -20.402 1.00 50.87 ? 171 HOH B O   1 
HETATM 2194 O O   . HOH D 3 .   ? 18.647 23.184 13.000  1.00 37.73 ? 172 HOH B O   1 
HETATM 2195 O O   . HOH D 3 .   ? 16.378 10.731 -15.427 1.00 52.30 ? 173 HOH B O   1 
HETATM 2196 O O   . HOH D 3 .   ? -2.537 29.873 8.477   1.00 52.37 ? 174 HOH B O   1 
HETATM 2197 O O   . HOH D 3 .   ? 14.894 8.913  -7.778  1.00 46.56 ? 175 HOH B O   1 
HETATM 2198 O O   . HOH D 3 .   ? 29.538 21.455 -1.967  1.00 52.78 ? 176 HOH B O   1 
HETATM 2199 O O   . HOH D 3 .   ? 4.794  38.103 5.260   1.00 42.27 ? 177 HOH B O   1 
HETATM 2200 O O   . HOH D 3 .   ? 24.640 31.271 21.064  1.00 43.37 ? 178 HOH B O   1 
HETATM 2201 O O   . HOH D 3 .   ? 14.655 21.529 17.957  1.00 68.72 ? 179 HOH B O   1 
HETATM 2202 O O   . HOH D 3 .   ? 14.299 8.511  -18.018 1.00 38.63 ? 180 HOH B O   1 
HETATM 2203 O O   . HOH D 3 .   ? 20.587 32.366 18.514  1.00 66.66 ? 181 HOH B O   1 
HETATM 2204 O O   . HOH D 3 .   ? 11.445 40.568 10.485  1.00 42.04 ? 182 HOH B O   1 
HETATM 2205 O O   . HOH D 3 .   ? 21.579 34.766 -6.075  1.00 31.37 ? 183 HOH B O   1 
HETATM 2206 O O   . HOH D 3 .   ? 26.248 11.714 -14.366 1.00 62.05 ? 184 HOH B O   1 
HETATM 2207 O O   . HOH D 3 .   ? 22.110 11.468 -14.855 1.00 47.18 ? 185 HOH B O   1 
HETATM 2208 O O   . HOH D 3 .   ? 31.291 16.201 -4.289  1.00 67.38 ? 186 HOH B O   1 
HETATM 2209 O O   . HOH D 3 .   ? 27.526 13.184 -10.945 1.00 56.58 ? 187 HOH B O   1 
HETATM 2210 O O   . HOH D 3 .   ? 29.580 23.257 -18.385 1.00 70.87 ? 188 HOH B O   1 
HETATM 2211 O O   . HOH D 3 .   ? 11.742 20.593 15.742  1.00 60.97 ? 189 HOH B O   1 
HETATM 2212 O O   . HOH D 3 .   ? 18.249 12.555 13.100  1.00 48.61 ? 190 HOH B O   1 
HETATM 2213 O O   . HOH D 3 .   ? 8.673  26.424 -4.233  1.00 33.66 ? 191 HOH B O   1 
HETATM 2214 O O   . HOH D 3 .   ? 33.704 41.486 30.271  1.00 52.34 ? 192 HOH B O   1 
HETATM 2215 O O   . HOH D 3 .   ? 12.330 26.129 20.242  1.00 78.65 ? 193 HOH B O   1 
HETATM 2216 O O   . HOH D 3 .   ? 0.580  36.721 10.393  1.00 54.30 ? 194 HOH B O   1 
HETATM 2217 O O   . HOH D 3 .   ? -0.851 15.713 -2.856  1.00 68.75 ? 195 HOH B O   1 
HETATM 2218 O O   . HOH D 3 .   ? 25.531 25.668 -12.488 1.00 39.61 ? 196 HOH B O   1 
HETATM 2219 O O   . HOH D 3 .   ? 12.041 22.381 -18.975 1.00 32.82 ? 197 HOH B O   1 
HETATM 2220 O O   . HOH D 3 .   ? 16.140 31.692 29.605  1.00 44.68 ? 198 HOH B O   1 
HETATM 2221 O O   . HOH D 3 .   ? 18.276 15.386 -18.394 1.00 32.62 ? 199 HOH B O   1 
HETATM 2222 O O   . HOH D 3 .   ? 26.340 20.012 5.117   1.00 63.27 ? 200 HOH B O   1 
HETATM 2223 O O   . HOH D 3 .   ? 30.010 32.027 20.688  1.00 52.38 ? 201 HOH B O   1 
HETATM 2224 O O   . HOH D 3 .   ? 32.774 35.051 19.472  1.00 60.79 ? 202 HOH B O   1 
HETATM 2225 O O   . HOH D 3 .   ? -1.395 32.798 2.675   1.00 46.49 ? 203 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   CYS 2   2   2   CYS CYS A . n 
A 1 3   PRO 3   3   3   PRO PRO A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  TRP 23  23  23  TRP TRP A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  GLY 60  60  60  GLY GLY A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  MET 62  62  62  MET MET A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  TRP 66  66  66  TRP TRP A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  CYS 78  78  78  CYS CYS A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 CYS 100 100 100 CYS CYS A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 CYS 117 117 117 CYS CYS A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 MET 124 124 124 MET MET A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
B 2 1   ASN 1   1   1   ASN ASN B . n 
B 2 2   CYS 2   2   2   CYS CYS B . n 
B 2 3   LEU 3   3   3   LEU LEU B . n 
B 2 4   PRO 4   4   4   PRO PRO B . n 
B 2 5   ASP 5   5   5   ASP ASP B . n 
B 2 6   TRP 6   6   6   TRP TRP B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   TYR 9   9   9   TYR TYR B . n 
B 2 10  GLU 10  10  10  GLU GLU B . n 
B 2 11  GLY 11  11  11  GLY GLY B . n 
B 2 12  TYR 12  12  12  TYR TYR B . n 
B 2 13  CYS 13  13  13  CYS CYS B . n 
B 2 14  TYR 14  14  14  TYR TYR B . n 
B 2 15  LYS 15  15  15  LYS LYS B . n 
B 2 16  VAL 16  16  16  VAL VAL B . n 
B 2 17  PHE 17  17  17  PHE PHE B . n 
B 2 18  LYS 18  18  18  LYS LYS B . n 
B 2 19  GLU 19  19  19  GLU GLU B . n 
B 2 20  ARG 20  20  20  ARG ARG B . n 
B 2 21  MET 21  21  21  MET MET B . n 
B 2 22  ASN 22  22  22  ASN ASN B . n 
B 2 23  TRP 23  23  23  TRP TRP B . n 
B 2 24  ALA 24  24  24  ALA ALA B . n 
B 2 25  ASP 25  25  25  ASP ASP B . n 
B 2 26  ALA 26  26  26  ALA ALA B . n 
B 2 27  GLU 27  27  27  GLU GLU B . n 
B 2 28  LYS 28  28  28  LYS LYS B . n 
B 2 29  PHE 29  29  29  PHE PHE B . n 
B 2 30  CYS 30  30  30  CYS CYS B . n 
B 2 31  THR 31  31  31  THR THR B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  GLN 33  33  33  GLN GLN B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  ASP 36  36  36  ASP ASP B . n 
B 2 37  GLY 37  37  37  GLY GLY B . n 
B 2 38  HIS 38  38  38  HIS HIS B . n 
B 2 39  LEU 39  39  39  LEU LEU B . n 
B 2 40  VAL 40  40  40  VAL VAL B . n 
B 2 41  SER 41  41  41  SER SER B . n 
B 2 42  PHE 42  42  42  PHE PHE B . n 
B 2 43  ARG 43  43  43  ARG ARG B . n 
B 2 44  ASN 44  44  44  ASN ASN B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  GLU 47  47  47  GLU GLU B . n 
B 2 48  VAL 48  48  48  VAL VAL B . n 
B 2 49  ASP 49  49  49  ASP ASP B . n 
B 2 50  PHE 50  50  50  PHE PHE B . n 
B 2 51  VAL 51  51  51  VAL VAL B . n 
B 2 52  ILE 52  52  52  ILE ILE B . n 
B 2 53  SER 53  53  53  SER SER B . n 
B 2 54  LEU 54  54  54  LEU LEU B . n 
B 2 55  ALA 55  55  55  ALA ALA B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  PRO 57  57  57  PRO PRO B . n 
B 2 58  MET 58  58  58  MET MET B . n 
B 2 59  LEU 59  59  59  LEU LEU B . n 
B 2 60  LYS 60  60  60  LYS LYS B . n 
B 2 61  ASN 61  61  61  ASN ASN B . n 
B 2 62  ASP 62  62  62  ASP ASP B . n 
B 2 63  LEU 63  63  63  LEU LEU B . n 
B 2 64  VAL 64  64  64  VAL VAL B . n 
B 2 65  TRP 65  65  65  TRP TRP B . n 
B 2 66  ILE 66  66  66  ILE ILE B . n 
B 2 67  GLY 67  67  67  GLY GLY B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  ASP 70  70  70  ASP ASP B . n 
B 2 71  TYR 71  71  71  TYR TYR B . n 
B 2 72  TRP 72  72  72  TRP TRP B . n 
B 2 73  ARG 73  73  73  ARG ARG B . n 
B 2 74  ASP 74  74  74  ASP ASP B . n 
B 2 75  CYS 75  75  75  CYS CYS B . n 
B 2 76  ASN 76  76  76  ASN ASN B . n 
B 2 77  TRP 77  77  77  TRP TRP B . n 
B 2 78  GLU 78  78  78  GLU GLU B . n 
B 2 79  TRP 79  79  79  TRP TRP B . n 
B 2 80  SER 80  80  80  SER SER B . n 
B 2 81  ASP 81  81  81  ASP ASP B . n 
B 2 82  GLY 82  82  82  GLY GLY B . n 
B 2 83  ALA 83  83  83  ALA ALA B . n 
B 2 84  GLN 84  84  84  GLN GLN B . n 
B 2 85  LEU 85  85  85  LEU LEU B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  TYR 87  87  87  TYR TYR B . n 
B 2 88  LYS 88  88  88  LYS LYS B . n 
B 2 89  ALA 89  89  89  ALA ALA B . n 
B 2 90  TRP 90  90  90  TRP TRP B . n 
B 2 91  ASP 91  91  91  ASP ASP B . n 
B 2 92  ASN 92  92  92  ASN ASN B . n 
B 2 93  GLU 93  93  93  GLU GLU B . n 
B 2 94  ARG 94  94  94  ARG ARG B . n 
B 2 95  HIS 95  95  95  HIS HIS B . n 
B 2 96  CYS 96  96  96  CYS CYS B . n 
B 2 97  PHE 97  97  97  PHE PHE B . n 
B 2 98  ILE 98  98  98  ILE ILE B . n 
B 2 99  TYR 99  99  99  TYR TYR B . n 
B 2 100 LYS 100 100 100 LYS LYS B . n 
B 2 101 ASN 101 101 101 ASN ASN B . n 
B 2 102 THR 102 102 102 THR THR B . n 
B 2 103 ASP 103 103 103 ASP ASP B . n 
B 2 104 ASN 104 104 104 ASN ASN B . n 
B 2 105 GLN 105 105 105 GLN GLN B . n 
B 2 106 TRP 106 106 106 TRP TRP B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 ARG 108 108 108 ARG ARG B . n 
B 2 109 ARG 109 109 109 ARG ARG B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 CYS 111 111 111 CYS CYS B . n 
B 2 112 THR 112 112 112 THR THR B . n 
B 2 113 TRP 113 113 113 TRP TRP B . n 
B 2 114 THR 114 114 114 THR THR B . n 
B 2 115 PHE 115 115 115 PHE PHE B . n 
B 2 116 SER 116 116 116 SER SER B . n 
B 2 117 PHE 117 117 117 PHE PHE B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 CYS 119 119 119 CYS CYS B . n 
B 2 120 LYS 120 120 120 LYS LYS B . n 
B 2 121 CYS 121 121 121 CYS CYS B . n 
B 2 122 PRO 122 122 122 PRO PRO B . n 
B 2 123 ALA 123 123 123 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  132 3   HOH HOH A . 
C 3 HOH 2  133 8   HOH HOH A . 
C 3 HOH 3  134 9   HOH HOH A . 
C 3 HOH 4  135 11  HOH HOH A . 
C 3 HOH 5  136 13  HOH HOH A . 
C 3 HOH 6  137 14  HOH HOH A . 
C 3 HOH 7  138 16  HOH HOH A . 
C 3 HOH 8  139 18  HOH HOH A . 
C 3 HOH 9  140 22  HOH HOH A . 
C 3 HOH 10 141 23  HOH HOH A . 
C 3 HOH 11 142 24  HOH HOH A . 
C 3 HOH 12 143 25  HOH HOH A . 
C 3 HOH 13 144 28  HOH HOH A . 
C 3 HOH 14 145 30  HOH HOH A . 
C 3 HOH 15 146 36  HOH HOH A . 
C 3 HOH 16 147 39  HOH HOH A . 
C 3 HOH 17 148 43  HOH HOH A . 
C 3 HOH 18 149 47  HOH HOH A . 
C 3 HOH 19 150 52  HOH HOH A . 
C 3 HOH 20 151 53  HOH HOH A . 
C 3 HOH 21 152 54  HOH HOH A . 
C 3 HOH 22 153 55  HOH HOH A . 
C 3 HOH 23 154 56  HOH HOH A . 
C 3 HOH 24 155 57  HOH HOH A . 
C 3 HOH 25 156 58  HOH HOH A . 
C 3 HOH 26 157 59  HOH HOH A . 
C 3 HOH 27 158 61  HOH HOH A . 
C 3 HOH 28 159 62  HOH HOH A . 
C 3 HOH 29 160 63  HOH HOH A . 
C 3 HOH 30 161 64  HOH HOH A . 
C 3 HOH 31 162 65  HOH HOH A . 
C 3 HOH 32 163 66  HOH HOH A . 
C 3 HOH 33 164 68  HOH HOH A . 
C 3 HOH 34 165 69  HOH HOH A . 
C 3 HOH 35 166 71  HOH HOH A . 
C 3 HOH 36 167 72  HOH HOH A . 
C 3 HOH 37 168 83  HOH HOH A . 
C 3 HOH 38 169 84  HOH HOH A . 
C 3 HOH 39 170 85  HOH HOH A . 
C 3 HOH 40 171 86  HOH HOH A . 
C 3 HOH 41 172 88  HOH HOH A . 
C 3 HOH 42 173 107 HOH HOH A . 
C 3 HOH 43 174 111 HOH HOH A . 
C 3 HOH 44 175 113 HOH HOH A . 
C 3 HOH 45 176 114 HOH HOH A . 
C 3 HOH 46 177 116 HOH HOH A . 
C 3 HOH 47 178 120 HOH HOH A . 
C 3 HOH 48 179 121 HOH HOH A . 
C 3 HOH 49 180 122 HOH HOH A . 
C 3 HOH 50 181 125 HOH HOH A . 
C 3 HOH 51 182 134 HOH HOH A . 
C 3 HOH 52 183 135 HOH HOH A . 
C 3 HOH 53 184 138 HOH HOH A . 
C 3 HOH 54 185 144 HOH HOH A . 
C 3 HOH 55 186 146 HOH HOH A . 
C 3 HOH 56 187 148 HOH HOH A . 
C 3 HOH 57 188 152 HOH HOH A . 
C 3 HOH 58 189 173 HOH HOH A . 
C 3 HOH 59 190 174 HOH HOH A . 
C 3 HOH 60 191 179 HOH HOH A . 
C 3 HOH 61 192 180 HOH HOH A . 
C 3 HOH 62 193 182 HOH HOH A . 
D 3 HOH 1  124 1   HOH HOH B . 
D 3 HOH 2  125 2   HOH HOH B . 
D 3 HOH 3  126 5   HOH HOH B . 
D 3 HOH 4  127 10  HOH HOH B . 
D 3 HOH 5  128 15  HOH HOH B . 
D 3 HOH 6  129 17  HOH HOH B . 
D 3 HOH 7  130 19  HOH HOH B . 
D 3 HOH 8  131 20  HOH HOH B . 
D 3 HOH 9  132 21  HOH HOH B . 
D 3 HOH 10 133 29  HOH HOH B . 
D 3 HOH 11 134 32  HOH HOH B . 
D 3 HOH 12 135 33  HOH HOH B . 
D 3 HOH 13 136 37  HOH HOH B . 
D 3 HOH 14 137 42  HOH HOH B . 
D 3 HOH 15 138 45  HOH HOH B . 
D 3 HOH 16 139 46  HOH HOH B . 
D 3 HOH 17 140 50  HOH HOH B . 
D 3 HOH 18 141 51  HOH HOH B . 
D 3 HOH 19 142 60  HOH HOH B . 
D 3 HOH 20 143 70  HOH HOH B . 
D 3 HOH 21 144 80  HOH HOH B . 
D 3 HOH 22 145 89  HOH HOH B . 
D 3 HOH 23 146 91  HOH HOH B . 
D 3 HOH 24 147 92  HOH HOH B . 
D 3 HOH 25 148 93  HOH HOH B . 
D 3 HOH 26 149 94  HOH HOH B . 
D 3 HOH 27 150 95  HOH HOH B . 
D 3 HOH 28 151 96  HOH HOH B . 
D 3 HOH 29 152 97  HOH HOH B . 
D 3 HOH 30 153 98  HOH HOH B . 
D 3 HOH 31 154 99  HOH HOH B . 
D 3 HOH 32 155 100 HOH HOH B . 
D 3 HOH 33 156 101 HOH HOH B . 
D 3 HOH 34 157 102 HOH HOH B . 
D 3 HOH 35 158 103 HOH HOH B . 
D 3 HOH 36 159 104 HOH HOH B . 
D 3 HOH 37 160 105 HOH HOH B . 
D 3 HOH 38 161 106 HOH HOH B . 
D 3 HOH 39 162 108 HOH HOH B . 
D 3 HOH 40 163 112 HOH HOH B . 
D 3 HOH 41 164 115 HOH HOH B . 
D 3 HOH 42 165 117 HOH HOH B . 
D 3 HOH 43 166 123 HOH HOH B . 
D 3 HOH 44 167 124 HOH HOH B . 
D 3 HOH 45 168 127 HOH HOH B . 
D 3 HOH 46 169 130 HOH HOH B . 
D 3 HOH 47 170 131 HOH HOH B . 
D 3 HOH 48 171 136 HOH HOH B . 
D 3 HOH 49 172 137 HOH HOH B . 
D 3 HOH 50 173 139 HOH HOH B . 
D 3 HOH 51 174 140 HOH HOH B . 
D 3 HOH 52 175 142 HOH HOH B . 
D 3 HOH 53 176 145 HOH HOH B . 
D 3 HOH 54 177 149 HOH HOH B . 
D 3 HOH 55 178 150 HOH HOH B . 
D 3 HOH 56 179 151 HOH HOH B . 
D 3 HOH 57 180 154 HOH HOH B . 
D 3 HOH 58 181 155 HOH HOH B . 
D 3 HOH 59 182 156 HOH HOH B . 
D 3 HOH 60 183 157 HOH HOH B . 
D 3 HOH 61 184 158 HOH HOH B . 
D 3 HOH 62 185 159 HOH HOH B . 
D 3 HOH 63 186 160 HOH HOH B . 
D 3 HOH 64 187 161 HOH HOH B . 
D 3 HOH 65 188 162 HOH HOH B . 
D 3 HOH 66 189 163 HOH HOH B . 
D 3 HOH 67 190 164 HOH HOH B . 
D 3 HOH 68 191 165 HOH HOH B . 
D 3 HOH 69 192 166 HOH HOH B . 
D 3 HOH 70 193 167 HOH HOH B . 
D 3 HOH 71 194 168 HOH HOH B . 
D 3 HOH 72 195 169 HOH HOH B . 
D 3 HOH 73 196 170 HOH HOH B . 
D 3 HOH 74 197 171 HOH HOH B . 
D 3 HOH 75 198 172 HOH HOH B . 
D 3 HOH 76 199 176 HOH HOH B . 
D 3 HOH 77 200 177 HOH HOH B . 
D 3 HOH 78 201 178 HOH HOH B . 
D 3 HOH 79 202 181 HOH HOH B . 
D 3 HOH 80 203 183 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3450  ? 
1 MORE         -20   ? 
1 'SSA (A^2)'  12900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-30 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
REFMAC    refinement       5   ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    62 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    101 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 O A GLY 60 ? ? C  A GLY 60 ? ? N  A LYS 61 ? ? 112.15 122.70 -10.55 1.60 Y 
2 1 C B ASP 62 ? ? N  B LEU 63 ? ? CA B LEU 63 ? ? 161.00 121.70 39.30  2.50 Y 
3 1 N B LEU 63 ? ? CA B LEU 63 ? ? C  B LEU 63 ? ? 127.21 111.00 16.21  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 61  ? ? -44.44  151.82  
2  1 SER A 83  ? ? -61.37  37.57   
3  1 ASP A 84  ? ? 174.64  -76.86  
4  1 PHE A 88  ? ? -106.37 -70.42  
5  1 ALA A 94  ? ? -68.60  82.88   
6  1 ILE A 95  ? ? -43.74  -109.01 
7  1 SER A 107 ? ? -102.85 48.32   
8  1 PRO A 122 ? ? -58.79  176.21  
9  1 PRO A 130 ? ? -71.79  21.14   
10 1 TYR B 9   ? ? -172.83 128.50  
11 1 GLU B 10  ? ? 39.93   43.10   
12 1 ASP B 36  ? ? 59.13   14.06   
13 1 ASN B 44  ? ? 75.29   36.40   
14 1 SER B 45  ? ? -79.61  30.13   
15 1 ALA B 55  ? ? -88.11  31.75   
16 1 PHE B 56  ? ? -142.74 -36.74  
17 1 LYS B 60  ? ? -55.33  -3.09   
18 1 ASN B 61  ? ? 35.69   81.62   
19 1 ASP B 62  ? ? -130.23 -97.57  
20 1 ASP B 86  ? ? -77.45  -90.78  
21 1 HIS B 95  ? ? 102.45  7.09    
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    60 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    61 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -142.86 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 16  ? CG  ? A LEU 16  CG  
2  1 Y 1 A LEU 16  ? CD1 ? A LEU 16  CD1 
3  1 Y 1 A LEU 16  ? CD2 ? A LEU 16  CD2 
4  1 Y 1 A LEU 40  ? CG  ? A LEU 40  CG  
5  1 Y 1 A LEU 40  ? CD1 ? A LEU 40  CD1 
6  1 Y 1 A LEU 40  ? CD2 ? A LEU 40  CD2 
7  1 Y 1 A GLU 48  ? CG  ? A GLU 48  CG  
8  1 Y 1 A GLU 48  ? CD  ? A GLU 48  CD  
9  1 Y 1 A GLU 48  ? OE1 ? A GLU 48  OE1 
10 1 Y 1 A GLU 48  ? OE2 ? A GLU 48  OE2 
11 1 Y 1 A ASP 52  ? CG  ? A ASP 52  CG  
12 1 Y 1 A ASP 52  ? OD1 ? A ASP 52  OD1 
13 1 Y 1 A ASP 52  ? OD2 ? A ASP 52  OD2 
14 1 Y 1 A MET 62  ? CG  ? A MET 62  CG  
15 1 Y 1 A MET 62  ? SD  ? A MET 62  SD  
16 1 Y 1 A MET 62  ? CE  ? A MET 62  CE  
17 1 Y 1 A TYR 97  ? CG  ? A TYR 97  CG  
18 1 Y 1 A TYR 97  ? CD1 ? A TYR 97  CD1 
19 1 Y 1 A TYR 97  ? CD2 ? A TYR 97  CD2 
20 1 Y 1 A TYR 97  ? CE1 ? A TYR 97  CE1 
21 1 Y 1 A TYR 97  ? CE2 ? A TYR 97  CE2 
22 1 Y 1 A TYR 97  ? CZ  ? A TYR 97  CZ  
23 1 Y 1 A TYR 97  ? OH  ? A TYR 97  OH  
24 1 Y 1 A VAL 102 ? CG1 ? A VAL 102 CG1 
25 1 Y 1 A VAL 102 ? CG2 ? A VAL 102 CG2 
26 1 Y 1 A MET 124 ? CG  ? A MET 124 CG  
27 1 Y 1 A MET 124 ? SD  ? A MET 124 SD  
28 1 Y 1 A MET 124 ? CE  ? A MET 124 CE  
29 1 Y 1 A ARG 131 ? CG  ? A ARG 131 CG  
30 1 Y 1 A ARG 131 ? CD  ? A ARG 131 CD  
31 1 Y 1 A ARG 131 ? NE  ? A ARG 131 NE  
32 1 Y 1 A ARG 131 ? CZ  ? A ARG 131 CZ  
33 1 Y 1 A ARG 131 ? NH1 ? A ARG 131 NH1 
34 1 Y 1 A ARG 131 ? NH2 ? A ARG 131 NH2 
35 1 Y 1 B PHE 56  ? CG  ? B PHE 56  CG  
36 1 Y 1 B PHE 56  ? CD1 ? B PHE 56  CD1 
37 1 Y 1 B PHE 56  ? CD2 ? B PHE 56  CD2 
38 1 Y 1 B PHE 56  ? CE1 ? B PHE 56  CE1 
39 1 Y 1 B PHE 56  ? CE2 ? B PHE 56  CE2 
40 1 Y 1 B PHE 56  ? CZ  ? B PHE 56  CZ  
41 1 Y 1 B TYR 71  ? CG  ? B TYR 71  CG  
42 1 Y 1 B TYR 71  ? CD1 ? B TYR 71  CD1 
43 1 Y 1 B TYR 71  ? CD2 ? B TYR 71  CD2 
44 1 Y 1 B TYR 71  ? CE1 ? B TYR 71  CE1 
45 1 Y 1 B TYR 71  ? CE2 ? B TYR 71  CE2 
46 1 Y 1 B TYR 71  ? CZ  ? B TYR 71  CZ  
47 1 Y 1 B TYR 71  ? OH  ? B TYR 71  OH  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#