data_1OZJ
# 
_entry.id   1OZJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1OZJ         
NDB   PD0409       
RCSB  RCSB018839   
WWPDB D_1000018839 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1mhd 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1OZJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-04-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chai, J.'        1 
'Wu, J.-W.'       2 
'Yan, N.'         3 
'Massague, J.'    4 
'Pavletich, N.P.' 5 
'Shi, Y.'         6 
# 
_citation.id                        primary 
_citation.title                     'Features of a Smad3 MH1-DNA complex. Roles of water and zinc in DNA binding.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                20327 
_citation.page_last                 20331 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12686552 
_citation.pdbx_database_id_DOI      10.1074/jbc.C300134200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chai, J.'        1 
primary 'Wu, J.-W.'       2 
primary 'Yan, N.'         3 
primary 'Massague, J.'    4 
primary 'Pavletich, N.P.' 5 
primary 'Shi, Y.'         6 
# 
_cell.entry_id           1OZJ 
_cell.length_a           45.6 
_cell.length_b           60.4 
_cell.length_c           71.6 
_cell.angle_alpha        90 
_cell.angle_beta         102 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1OZJ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Smad binding element' 4552.986  1  ? ? ?            ? 
2 polymer     syn 'Smad binding element' 4624.021  1  ? ? ?            ? 
3 polymer     man 'SMAD 3'               16847.787 2  ? ? 'DWA DOMAIN' ? 
4 non-polymer syn 'ZINC ION'             65.409    2  ? ? ?            ? 
5 water       nat water                  18.015    47 ? ? ?            ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Mothers against DPP homolog 3, Mad3, hMAD-3, mMad3, JV15-2, hSMAD3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DG)(DT)(DC)(DT)(DA)(DG)(DA)(DC)(DA)(DT)(DA)(DC)' TCAGTCTAGACATAC C   ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DA)(DT)(DG)(DT)(DC)(DT)(DA)(DG)(DA)(DC)(DT)(DG)(DA)' GTATGTCTAGACTGA D   ? 
3 'polypeptide(L)'        no no 
;MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHT
;
;MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHT
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DC  n 
1 3   DA  n 
1 4   DG  n 
1 5   DT  n 
1 6   DC  n 
1 7   DT  n 
1 8   DA  n 
1 9   DG  n 
1 10  DA  n 
1 11  DC  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DC  n 
2 1   DG  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DG  n 
2 6   DT  n 
2 7   DC  n 
2 8   DT  n 
2 9   DA  n 
2 10  DG  n 
2 11  DA  n 
2 12  DC  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
3 1   MET n 
3 2   SER n 
3 3   SER n 
3 4   ILE n 
3 5   LEU n 
3 6   PRO n 
3 7   PHE n 
3 8   THR n 
3 9   PRO n 
3 10  PRO n 
3 11  ILE n 
3 12  VAL n 
3 13  LYS n 
3 14  ARG n 
3 15  LEU n 
3 16  LEU n 
3 17  GLY n 
3 18  TRP n 
3 19  LYS n 
3 20  LYS n 
3 21  GLY n 
3 22  GLU n 
3 23  GLN n 
3 24  ASN n 
3 25  GLY n 
3 26  GLN n 
3 27  GLU n 
3 28  GLU n 
3 29  LYS n 
3 30  TRP n 
3 31  CYS n 
3 32  GLU n 
3 33  LYS n 
3 34  ALA n 
3 35  VAL n 
3 36  LYS n 
3 37  SER n 
3 38  LEU n 
3 39  VAL n 
3 40  LYS n 
3 41  LYS n 
3 42  LEU n 
3 43  LYS n 
3 44  LYS n 
3 45  THR n 
3 46  GLY n 
3 47  GLN n 
3 48  LEU n 
3 49  ASP n 
3 50  GLU n 
3 51  LEU n 
3 52  GLU n 
3 53  LYS n 
3 54  ALA n 
3 55  ILE n 
3 56  THR n 
3 57  THR n 
3 58  GLN n 
3 59  ASN n 
3 60  VAL n 
3 61  ASN n 
3 62  THR n 
3 63  LYS n 
3 64  CYS n 
3 65  ILE n 
3 66  THR n 
3 67  ILE n 
3 68  PRO n 
3 69  ARG n 
3 70  SER n 
3 71  LEU n 
3 72  ASP n 
3 73  GLY n 
3 74  ARG n 
3 75  LEU n 
3 76  GLN n 
3 77  VAL n 
3 78  SER n 
3 79  HIS n 
3 80  ARG n 
3 81  LYS n 
3 82  GLY n 
3 83  LEU n 
3 84  PRO n 
3 85  HIS n 
3 86  VAL n 
3 87  ILE n 
3 88  TYR n 
3 89  CYS n 
3 90  ARG n 
3 91  LEU n 
3 92  TRP n 
3 93  ARG n 
3 94  TRP n 
3 95  PRO n 
3 96  ASP n 
3 97  LEU n 
3 98  HIS n 
3 99  SER n 
3 100 HIS n 
3 101 HIS n 
3 102 GLU n 
3 103 LEU n 
3 104 ARG n 
3 105 ALA n 
3 106 MET n 
3 107 GLU n 
3 108 LEU n 
3 109 CYS n 
3 110 GLU n 
3 111 PHE n 
3 112 ALA n 
3 113 PHE n 
3 114 ASN n 
3 115 MET n 
3 116 LYS n 
3 117 LYS n 
3 118 ASP n 
3 119 GLU n 
3 120 VAL n 
3 121 CYS n 
3 122 VAL n 
3 123 ASN n 
3 124 PRO n 
3 125 TYR n 
3 126 HIS n 
3 127 TYR n 
3 128 GLN n 
3 129 ARG n 
3 130 VAL n 
3 131 GLU n 
3 132 THR n 
3 133 PRO n 
3 134 VAL n 
3 135 LEU n 
3 136 PRO n 
3 137 PRO n 
3 138 VAL n 
3 139 LEU n 
3 140 VAL n 
3 141 PRO n 
3 142 ARG n 
3 143 HIS n 
3 144 THR n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'MADH3 OR SMAD3 OR MAD3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SMAD3_HUMAN P84022 3 
;MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHT
;
1 ? 
2 PDB 1OZJ        1OZJ   1 ? ? ? 
3 PDB 1OZJ        1OZJ   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1OZJ A 1 ? 144 ? P84022 1    ? 144  ? 1    144  
2 1 1OZJ B 1 ? 144 ? P84022 1    ? 144  ? 1    144  
3 2 1OZJ C 1 ? 15  ? 1OZJ   1001 ? 1015 ? 1001 1015 
4 3 1OZJ D 1 ? 15  ? 1OZJ   2001 ? 2015 ? 2001 2015 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1OZJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   44.87 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'citrate, PEG2000, ammonium acetate, spermine, magnesium chloride, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 citrate              ? ? ? 
1 2 1 PEG200               ? ? ? 
1 3 1 'ammonium acetate'   ? ? ? 
1 4 1 spermine             ? ? ? 
1 5 1 'magnesium chloride' ? ? ? 
1 6 2 'ammonium acetate'   ? ? ? 
1 7 2 'magnesium chloride' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1OZJ 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   1 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             99 
_reflns.number_all                   14974 
_reflns.number_obs                   14360 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   82.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1OZJ 
_refine.ls_d_res_high                            2.4 
_refine.ls_d_res_low                             15 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     14891 
_refine.ls_number_reflns_obs                     13219 
_refine.ls_number_reflns_R_free                  675 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.21 
_refine.ls_R_factor_R_free                       0.27 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2072 
_refine_hist.pdbx_number_atoms_nucleic_acid   609 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               2730 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.26  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1OZJ 
_struct.title                     'Crystal structure of Smad3-MH1 bound to DNA at 2.4 A resolution' 
_struct.pdbx_descriptor           'SMAD 3/Smad binding element' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1OZJ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'Smad, Mad homology domain 1, DNA recognition, TGF-beta signaling, zinc-binding module, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO C 9   ? GLY C 17  ? PRO A 9   GLY A 17  1 ? 9  
HELX_P HELX_P2  2  ASN C 24  ? THR C 45  ? ASN A 24  THR A 45  1 ? 22 
HELX_P HELX_P3  3  GLN C 47  ? GLN C 58  ? GLN A 47  GLN A 58  1 ? 12 
HELX_P HELX_P4  4  LEU C 83  ? ARG C 93  ? LEU A 83  ARG A 93  1 ? 11 
HELX_P HELX_P5  5  SER C 99  ? HIS C 101 ? SER A 99  HIS A 101 5 ? 3  
HELX_P HELX_P6  6  ALA C 112 ? LYS C 116 ? ALA A 112 LYS A 116 5 ? 5  
HELX_P HELX_P7  7  ASN C 123 ? TYR C 125 ? ASN A 123 TYR A 125 5 ? 3  
HELX_P HELX_P8  8  PRO D 9   ? TRP D 18  ? PRO B 9   TRP B 18  1 ? 10 
HELX_P HELX_P9  9  GLY D 25  ? THR D 45  ? GLY B 25  THR B 45  1 ? 21 
HELX_P HELX_P10 10 GLN D 47  ? GLN D 58  ? GLN B 47  GLN B 58  1 ? 12 
HELX_P HELX_P11 11 LEU D 83  ? ARG D 93  ? LEU B 83  ARG B 93  1 ? 11 
HELX_P HELX_P12 12 SER D 99  ? HIS D 101 ? SER B 99  HIS B 101 5 ? 3  
HELX_P HELX_P13 13 ALA D 112 ? LYS D 116 ? ALA B 112 LYS B 116 5 ? 5  
HELX_P HELX_P14 14 ASN D 123 ? TYR D 125 ? ASN B 123 TYR B 125 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN .  ZN ? ? ? 1_555 C HIS 126 ND1 ? ? A ZN 145  A HIS 126  1_555 ? ? ? ? ? ? ?            1.864 ? 
metalc2  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 121 SG  ? ? A ZN 145  A CYS 121  1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc3  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 64  SG  ? ? A ZN 145  A CYS 64   1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc4  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 109 SG  ? ? A ZN 145  A CYS 109  1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc5  metalc ? ? F ZN .  ZN ? ? ? 1_555 D CYS 121 SG  ? ? B ZN 145  B CYS 121  1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc6  metalc ? ? F ZN .  ZN ? ? ? 1_555 D HIS 126 ND1 ? ? B ZN 145  B HIS 126  1_555 ? ? ? ? ? ? ?            2.028 ? 
metalc7  metalc ? ? F ZN .  ZN ? ? ? 1_555 D CYS 64  SG  ? ? B ZN 145  B CYS 64   1_555 ? ? ? ? ? ? ?            2.277 ? 
metalc8  metalc ? ? F ZN .  ZN ? ? ? 1_555 D CYS 109 SG  ? ? B ZN 145  B CYS 109  1_555 ? ? ? ? ? ? ?            2.282 ? 
hydrog1  hydrog ? ? A DT 1  N3 ? ? ? 1_555 B DA  15  N1  ? ? C DT 1001 D DA  2015 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA  15  N6  ? ? C DT 1001 D DA  2015 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG  14  N1  ? ? C DC 1002 D DG  2014 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG  14  O6  ? ? C DC 1002 D DG  2014 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG  14  N2  ? ? C DC 1002 D DG  2014 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT  13  N3  ? ? C DA 1003 D DT  2013 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT  13  O4  ? ? C DA 1003 D DT  2013 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  12  N3  ? ? C DG 1004 D DC  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  12  O2  ? ? C DG 1004 D DC  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  12  N4  ? ? C DG 1004 D DC  2012 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA  11  N1  ? ? C DT 1005 D DA  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA  11  N6  ? ? C DT 1005 D DA  2011 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG  10  N1  ? ? C DC 1006 D DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG  10  O6  ? ? C DC 1006 D DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG  10  N2  ? ? C DC 1006 D DG  2010 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA  9   N1  ? ? C DT 1007 D DA  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA  9   N6  ? ? C DT 1007 D DA  2009 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT  8   N3  ? ? C DA 1008 D DT  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT  8   O4  ? ? C DA 1008 D DT  2008 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC  7   N3  ? ? C DG 1009 D DC  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  7   O2  ? ? C DG 1009 D DC  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC  7   N4  ? ? C DG 1009 D DC  2007 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT  6   N3  ? ? C DA 1010 D DT  2006 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT  6   O4  ? ? C DA 1010 D DT  2006 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG  5   N1  ? ? C DC 1011 D DG  2005 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG  5   O6  ? ? C DC 1011 D DG  2005 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG  5   N2  ? ? C DC 1011 D DG  2005 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT  4   N3  ? ? C DA 1012 D DT  2004 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT  4   O4  ? ? C DA 1012 D DT  2004 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA  3   N1  ? ? C DT 1013 D DA  2003 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA  3   N6  ? ? C DT 1013 D DA  2003 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT  2   N3  ? ? C DA 1014 D DT  2002 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT  2   O4  ? ? C DA 1014 D DT  2002 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG  1   O6  ? ? C DC 1015 D DG  2001 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR C 66  ? PRO C 68  ? THR A 66  PRO A 68  
A 2 GLU C 119 ? CYS C 121 ? GLU A 119 CYS A 121 
B 1 LEU C 75  ? VAL C 77  ? LEU A 75  VAL A 77  
B 2 ARG C 80  ? GLY C 82  ? ARG A 80  GLY A 82  
C 1 LEU C 103 ? ALA C 105 ? LEU A 103 ALA A 105 
C 2 TYR C 127 ? ARG C 129 ? TYR A 127 ARG A 129 
D 1 THR D 66  ? PRO D 68  ? THR B 66  PRO B 68  
D 2 GLU D 119 ? CYS D 121 ? GLU B 119 CYS B 121 
E 1 LEU D 75  ? VAL D 77  ? LEU B 75  VAL B 77  
E 2 ARG D 80  ? GLY D 82  ? ARG B 80  GLY B 82  
F 1 LEU D 103 ? ALA D 105 ? LEU B 103 ALA B 105 
F 2 TYR D 127 ? ARG D 129 ? TYR B 127 ARG B 129 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE C 67  ? N ILE A 67  O VAL C 120 ? O VAL A 120 
B 1 2 N VAL C 77  ? N VAL A 77  O ARG C 80  ? O ARG A 80  
C 1 2 N ARG C 104 ? N ARG A 104 O GLN C 128 ? O GLN A 128 
D 1 2 N ILE D 67  ? N ILE B 67  O VAL D 120 ? O VAL B 120 
E 1 2 N LEU D 75  ? N LEU B 75  O GLY D 82  ? O GLY B 82  
F 1 2 N ARG D 104 ? N ARG B 104 O GLN D 128 ? O GLN B 128 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 145' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 145' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS C 64  ? CYS A 64  . ? 1_555 ? 
2 AC1 4 CYS C 109 ? CYS A 109 . ? 1_555 ? 
3 AC1 4 CYS C 121 ? CYS A 121 . ? 1_555 ? 
4 AC1 4 HIS C 126 ? HIS A 126 . ? 1_555 ? 
5 AC2 4 CYS D 64  ? CYS B 64  . ? 1_555 ? 
6 AC2 4 CYS D 109 ? CYS B 109 . ? 1_555 ? 
7 AC2 4 CYS D 121 ? CYS B 121 . ? 1_555 ? 
8 AC2 4 HIS D 126 ? HIS B 126 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1OZJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1OZJ 
_atom_sites.fract_transf_matrix[1][1]   0.021930 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004661 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014278 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DT  A 1 1   ? 8.504  -1.052  53.618 1.00 93.89  ? 1001 DT  C "O5'" 1 
ATOM   2    C  "C5'" . DT  A 1 1   ? 7.932  -1.343  54.898 1.00 93.97  ? 1001 DT  C "C5'" 1 
ATOM   3    C  "C4'" . DT  A 1 1   ? 8.073  -2.799  55.280 1.00 93.31  ? 1001 DT  C "C4'" 1 
ATOM   4    O  "O4'" . DT  A 1 1   ? 7.441  -3.627  54.274 1.00 90.92  ? 1001 DT  C "O4'" 1 
ATOM   5    C  "C3'" . DT  A 1 1   ? 9.514  -3.297  55.386 1.00 93.71  ? 1001 DT  C "C3'" 1 
ATOM   6    O  "O3'" . DT  A 1 1   ? 9.634  -4.237  56.460 1.00 97.51  ? 1001 DT  C "O3'" 1 
ATOM   7    C  "C2'" . DT  A 1 1   ? 9.759  -3.964  54.045 1.00 90.86  ? 1001 DT  C "C2'" 1 
ATOM   8    C  "C1'" . DT  A 1 1   ? 8.389  -4.517  53.695 1.00 87.46  ? 1001 DT  C "C1'" 1 
ATOM   9    N  N1    . DT  A 1 1   ? 8.108  -4.604  52.242 1.00 83.46  ? 1001 DT  C N1    1 
ATOM   10   C  C2    . DT  A 1 1   ? 8.094  -5.853  51.651 1.00 81.71  ? 1001 DT  C C2    1 
ATOM   11   O  O2    . DT  A 1 1   ? 8.324  -6.888  52.260 1.00 80.21  ? 1001 DT  C O2    1 
ATOM   12   N  N3    . DT  A 1 1   ? 7.800  -5.845  50.308 1.00 78.05  ? 1001 DT  C N3    1 
ATOM   13   C  C4    . DT  A 1 1   ? 7.530  -4.745  49.513 1.00 78.15  ? 1001 DT  C C4    1 
ATOM   14   O  O4    . DT  A 1 1   ? 7.269  -4.899  48.320 1.00 73.48  ? 1001 DT  C O4    1 
ATOM   15   C  C5    . DT  A 1 1   ? 7.578  -3.470  50.192 1.00 77.77  ? 1001 DT  C C5    1 
ATOM   16   C  C7    . DT  A 1 1   ? 7.312  -2.221  49.411 1.00 78.27  ? 1001 DT  C C7    1 
ATOM   17   C  C6    . DT  A 1 1   ? 7.860  -3.463  51.503 1.00 80.37  ? 1001 DT  C C6    1 
ATOM   18   P  P     . DC  A 1 2   ? 11.093 -4.698  56.955 1.00 102.44 ? 1002 DC  C P     1 
ATOM   19   O  OP1   . DC  A 1 2   ? 10.933 -5.392  58.263 1.00 102.96 ? 1002 DC  C OP1   1 
ATOM   20   O  OP2   . DC  A 1 2   ? 12.031 -3.549  56.848 1.00 103.74 ? 1002 DC  C OP2   1 
ATOM   21   O  "O5'" . DC  A 1 2   ? 11.518 -5.778  55.867 1.00 99.88  ? 1002 DC  C "O5'" 1 
ATOM   22   C  "C5'" . DC  A 1 2   ? 11.032 -7.114  55.943 1.00 94.44  ? 1002 DC  C "C5'" 1 
ATOM   23   C  "C4'" . DC  A 1 2   ? 11.818 -8.009  55.015 1.00 90.01  ? 1002 DC  C "C4'" 1 
ATOM   24   O  "O4'" . DC  A 1 2   ? 11.396 -7.808  53.645 1.00 87.09  ? 1002 DC  C "O4'" 1 
ATOM   25   C  "C3'" . DC  A 1 2   ? 13.334 -7.799  55.035 1.00 87.49  ? 1002 DC  C "C3'" 1 
ATOM   26   O  "O3'" . DC  A 1 2   ? 13.982 -9.073  55.040 1.00 87.81  ? 1002 DC  C "O3'" 1 
ATOM   27   C  "C2'" . DC  A 1 2   ? 13.604 -7.045  53.741 1.00 83.94  ? 1002 DC  C "C2'" 1 
ATOM   28   C  "C1'" . DC  A 1 2   ? 12.528 -7.596  52.818 1.00 81.71  ? 1002 DC  C "C1'" 1 
ATOM   29   N  N1    . DC  A 1 2   ? 12.110 -6.735  51.689 1.00 76.63  ? 1002 DC  C N1    1 
ATOM   30   C  C2    . DC  A 1 2   ? 11.708 -7.346  50.481 1.00 74.14  ? 1002 DC  C C2    1 
ATOM   31   O  O2    . DC  A 1 2   ? 11.740 -8.587  50.384 1.00 72.93  ? 1002 DC  C O2    1 
ATOM   32   N  N3    . DC  A 1 2   ? 11.299 -6.566  49.450 1.00 70.42  ? 1002 DC  C N3    1 
ATOM   33   C  C4    . DC  A 1 2   ? 11.286 -5.237  49.582 1.00 69.53  ? 1002 DC  C C4    1 
ATOM   34   N  N4    . DC  A 1 2   ? 10.868 -4.511  48.541 1.00 67.83  ? 1002 DC  C N4    1 
ATOM   35   C  C5    . DC  A 1 2   ? 11.700 -4.593  50.786 1.00 69.73  ? 1002 DC  C C5    1 
ATOM   36   C  C6    . DC  A 1 2   ? 12.099 -5.371  51.803 1.00 74.52  ? 1002 DC  C C6    1 
ATOM   37   P  P     . DA  A 1 3   ? 15.584 -9.165  55.134 1.00 88.87  ? 1003 DA  C P     1 
ATOM   38   O  OP1   . DA  A 1 3   ? 15.919 -10.118 56.223 1.00 89.43  ? 1003 DA  C OP1   1 
ATOM   39   O  OP2   . DA  A 1 3   ? 16.175 -7.798  55.143 1.00 90.12  ? 1003 DA  C OP2   1 
ATOM   40   O  "O5'" . DA  A 1 3   ? 15.965 -9.865  53.761 1.00 85.00  ? 1003 DA  C "O5'" 1 
ATOM   41   C  "C5'" . DA  A 1 3   ? 15.288 -11.047 53.343 1.00 75.73  ? 1003 DA  C "C5'" 1 
ATOM   42   C  "C4'" . DA  A 1 3   ? 15.636 -11.359 51.910 1.00 70.83  ? 1003 DA  C "C4'" 1 
ATOM   43   O  "O4'" . DA  A 1 3   ? 15.016 -10.384 51.035 1.00 66.37  ? 1003 DA  C "O4'" 1 
ATOM   44   C  "C3'" . DA  A 1 3   ? 17.136 -11.303 51.619 1.00 69.03  ? 1003 DA  C "C3'" 1 
ATOM   45   O  "O3'" . DA  A 1 3   ? 17.493 -12.367 50.739 1.00 71.01  ? 1003 DA  C "O3'" 1 
ATOM   46   C  "C2'" . DA  A 1 3   ? 17.313 -9.955  50.944 1.00 64.16  ? 1003 DA  C "C2'" 1 
ATOM   47   C  "C1'" . DA  A 1 3   ? 16.001 -9.812  50.194 1.00 62.38  ? 1003 DA  C "C1'" 1 
ATOM   48   N  N9    . DA  A 1 3   ? 15.597 -8.439  49.871 1.00 56.86  ? 1003 DA  C N9    1 
ATOM   49   C  C8    . DA  A 1 3   ? 15.786 -7.288  50.600 1.00 51.81  ? 1003 DA  C C8    1 
ATOM   50   N  N7    . DA  A 1 3   ? 15.340 -6.209  50.006 1.00 51.98  ? 1003 DA  C N7    1 
ATOM   51   C  C5    . DA  A 1 3   ? 14.812 -6.680  48.810 1.00 52.79  ? 1003 DA  C C5    1 
ATOM   52   C  C6    . DA  A 1 3   ? 14.183 -6.031  47.725 1.00 53.04  ? 1003 DA  C C6    1 
ATOM   53   N  N6    . DA  A 1 3   ? 13.977 -4.711  47.665 1.00 55.38  ? 1003 DA  C N6    1 
ATOM   54   N  N1    . DA  A 1 3   ? 13.769 -6.794  46.691 1.00 49.62  ? 1003 DA  C N1    1 
ATOM   55   C  C2    . DA  A 1 3   ? 13.976 -8.113  46.748 1.00 50.13  ? 1003 DA  C C2    1 
ATOM   56   N  N3    . DA  A 1 3   ? 14.553 -8.836  47.706 1.00 51.81  ? 1003 DA  C N3    1 
ATOM   57   C  C4    . DA  A 1 3   ? 14.953 -8.052  48.719 1.00 52.77  ? 1003 DA  C C4    1 
ATOM   58   P  P     . DG  A 1 4   ? 19.043 -12.698 50.465 1.00 73.88  ? 1004 DG  C P     1 
ATOM   59   O  OP1   . DG  A 1 4   ? 19.334 -14.049 51.009 1.00 74.76  ? 1004 DG  C OP1   1 
ATOM   60   O  OP2   . DG  A 1 4   ? 19.876 -11.536 50.882 1.00 72.51  ? 1004 DG  C OP2   1 
ATOM   61   O  "O5'" . DG  A 1 4   ? 19.108 -12.791 48.881 1.00 68.58  ? 1004 DG  C "O5'" 1 
ATOM   62   C  "C5'" . DG  A 1 4   ? 18.149 -13.559 48.166 1.00 60.59  ? 1004 DG  C "C5'" 1 
ATOM   63   C  "C4'" . DG  A 1 4   ? 18.102 -13.116 46.725 1.00 54.47  ? 1004 DG  C "C4'" 1 
ATOM   64   O  "O4'" . DG  A 1 4   ? 17.418 -11.840 46.627 1.00 50.26  ? 1004 DG  C "O4'" 1 
ATOM   65   C  "C3'" . DG  A 1 4   ? 19.486 -12.918 46.108 1.00 52.59  ? 1004 DG  C "C3'" 1 
ATOM   66   O  "O3'" . DG  A 1 4   ? 19.563 -13.537 44.832 1.00 51.54  ? 1004 DG  C "O3'" 1 
ATOM   67   C  "C2'" . DG  A 1 4   ? 19.609 -11.413 45.974 1.00 52.10  ? 1004 DG  C "C2'" 1 
ATOM   68   C  "C1'" . DG  A 1 4   ? 18.168 -10.970 45.806 1.00 45.39  ? 1004 DG  C "C1'" 1 
ATOM   69   N  N9    . DG  A 1 4   ? 17.938 -9.597  46.249 1.00 42.15  ? 1004 DG  C N9    1 
ATOM   70   C  C8    . DG  A 1 4   ? 18.295 -9.041  47.456 1.00 38.60  ? 1004 DG  C C8    1 
ATOM   71   N  N7    . DG  A 1 4   ? 18.041 -7.762  47.525 1.00 37.36  ? 1004 DG  C N7    1 
ATOM   72   C  C5    . DG  A 1 4   ? 17.465 -7.459  46.299 1.00 33.74  ? 1004 DG  C C5    1 
ATOM   73   C  C6    . DG  A 1 4   ? 17.003 -6.223  45.787 1.00 36.49  ? 1004 DG  C C6    1 
ATOM   74   O  O6    . DG  A 1 4   ? 17.035 -5.105  46.325 1.00 35.69  ? 1004 DG  C O6    1 
ATOM   75   N  N1    . DG  A 1 4   ? 16.471 -6.367  44.507 1.00 32.24  ? 1004 DG  C N1    1 
ATOM   76   C  C2    . DG  A 1 4   ? 16.403 -7.550  43.810 1.00 32.38  ? 1004 DG  C C2    1 
ATOM   77   N  N2    . DG  A 1 4   ? 15.846 -7.494  42.596 1.00 31.38  ? 1004 DG  C N2    1 
ATOM   78   N  N3    . DG  A 1 4   ? 16.848 -8.704  44.272 1.00 34.07  ? 1004 DG  C N3    1 
ATOM   79   C  C4    . DG  A 1 4   ? 17.365 -8.586  45.513 1.00 35.67  ? 1004 DG  C C4    1 
ATOM   80   P  P     . DT  A 1 5   ? 20.946 -13.512 44.011 1.00 55.61  ? 1005 DT  C P     1 
ATOM   81   O  OP1   . DT  A 1 5   ? 21.296 -14.905 43.653 1.00 58.84  ? 1005 DT  C OP1   1 
ATOM   82   O  OP2   . DT  A 1 5   ? 21.947 -12.665 44.718 1.00 48.88  ? 1005 DT  C OP2   1 
ATOM   83   O  "O5'" . DT  A 1 5   ? 20.507 -12.777 42.673 1.00 52.95  ? 1005 DT  C "O5'" 1 
ATOM   84   C  "C5'" . DT  A 1 5   ? 19.241 -13.073 42.088 1.00 49.36  ? 1005 DT  C "C5'" 1 
ATOM   85   C  "C4'" . DT  A 1 5   ? 18.939 -12.104 40.974 1.00 48.09  ? 1005 DT  C "C4'" 1 
ATOM   86   O  "O4'" . DT  A 1 5   ? 18.619 -10.798 41.509 1.00 45.78  ? 1005 DT  C "O4'" 1 
ATOM   87   C  "C3'" . DT  A 1 5   ? 20.095 -11.897 40.000 1.00 46.22  ? 1005 DT  C "C3'" 1 
ATOM   88   O  "O3'" . DT  A 1 5   ? 19.575 -11.851 38.675 1.00 48.07  ? 1005 DT  C "O3'" 1 
ATOM   89   C  "C2'" . DT  A 1 5   ? 20.677 -10.555 40.415 1.00 43.82  ? 1005 DT  C "C2'" 1 
ATOM   90   C  "C1'" . DT  A 1 5   ? 19.451 -9.811  40.913 1.00 38.89  ? 1005 DT  C "C1'" 1 
ATOM   91   N  N1    . DT  A 1 5   ? 19.714 -8.770  41.930 1.00 39.62  ? 1005 DT  C N1    1 
ATOM   92   C  C2    . DT  A 1 5   ? 19.350 -7.472  41.647 1.00 37.71  ? 1005 DT  C C2    1 
ATOM   93   O  O2    . DT  A 1 5   ? 18.859 -7.131  40.588 1.00 39.71  ? 1005 DT  C O2    1 
ATOM   94   N  N3    . DT  A 1 5   ? 19.595 -6.578  42.655 1.00 36.28  ? 1005 DT  C N3    1 
ATOM   95   C  C4    . DT  A 1 5   ? 20.174 -6.836  43.879 1.00 37.32  ? 1005 DT  C C4    1 
ATOM   96   O  O4    . DT  A 1 5   ? 20.343 -5.921  44.681 1.00 39.91  ? 1005 DT  C O4    1 
ATOM   97   C  C5    . DT  A 1 5   ? 20.548 -8.214  44.106 1.00 38.06  ? 1005 DT  C C5    1 
ATOM   98   C  C7    . DT  A 1 5   ? 21.194 -8.590  45.403 1.00 35.85  ? 1005 DT  C C7    1 
ATOM   99   C  C6    . DT  A 1 5   ? 20.299 -9.099  43.136 1.00 36.02  ? 1005 DT  C C6    1 
ATOM   100  P  P     . DC  A 1 6   ? 20.562 -12.000 37.426 1.00 48.01  ? 1006 DC  C P     1 
ATOM   101  O  OP1   . DC  A 1 6   ? 19.801 -12.722 36.370 1.00 49.44  ? 1006 DC  C OP1   1 
ATOM   102  O  OP2   . DC  A 1 6   ? 21.858 -12.546 37.904 1.00 43.09  ? 1006 DC  C OP2   1 
ATOM   103  O  "O5'" . DC  A 1 6   ? 20.776 -10.490 36.967 1.00 44.71  ? 1006 DC  C "O5'" 1 
ATOM   104  C  "C5'" . DC  A 1 6   ? 19.655 -9.684  36.617 1.00 38.69  ? 1006 DC  C "C5'" 1 
ATOM   105  C  "C4'" . DC  A 1 6   ? 20.099 -8.288  36.259 1.00 37.38  ? 1006 DC  C "C4'" 1 
ATOM   106  O  "O4'" . DC  A 1 6   ? 20.284 -7.466  37.440 1.00 32.82  ? 1006 DC  C "O4'" 1 
ATOM   107  C  "C3'" . DC  A 1 6   ? 21.395 -8.202  35.451 1.00 35.42  ? 1006 DC  C "C3'" 1 
ATOM   108  O  "O3'" . DC  A 1 6   ? 21.167 -7.342  34.330 1.00 31.54  ? 1006 DC  C "O3'" 1 
ATOM   109  C  "C2'" . DC  A 1 6   ? 22.397 -7.616  36.437 1.00 28.69  ? 1006 DC  C "C2'" 1 
ATOM   110  C  "C1'" . DC  A 1 6   ? 21.514 -6.771  37.362 1.00 29.20  ? 1006 DC  C "C1'" 1 
ATOM   111  N  N1    . DC  A 1 6   ? 22.002 -6.545  38.755 1.00 27.53  ? 1006 DC  C N1    1 
ATOM   112  C  C2    . DC  A 1 6   ? 21.945 -5.239  39.308 1.00 22.18  ? 1006 DC  C C2    1 
ATOM   113  O  O2    . DC  A 1 6   ? 21.527 -4.302  38.625 1.00 28.59  ? 1006 DC  C O2    1 
ATOM   114  N  N3    . DC  A 1 6   ? 22.348 -5.043  40.577 1.00 25.80  ? 1006 DC  C N3    1 
ATOM   115  C  C4    . DC  A 1 6   ? 22.785 -6.071  41.307 1.00 19.68  ? 1006 DC  C C4    1 
ATOM   116  N  N4    . DC  A 1 6   ? 23.100 -5.835  42.578 1.00 17.09  ? 1006 DC  C N4    1 
ATOM   117  C  C5    . DC  A 1 6   ? 22.890 -7.389  40.772 1.00 17.24  ? 1006 DC  C C5    1 
ATOM   118  C  C6    . DC  A 1 6   ? 22.489 -7.580  39.504 1.00 18.10  ? 1006 DC  C C6    1 
ATOM   119  P  P     . DT  A 1 7   ? 22.189 -7.338  33.095 1.00 33.76  ? 1007 DT  C P     1 
ATOM   120  O  OP1   . DT  A 1 7   ? 21.376 -7.281  31.843 1.00 39.38  ? 1007 DT  C OP1   1 
ATOM   121  O  OP2   . DT  A 1 7   ? 23.182 -8.437  33.274 1.00 22.10  ? 1007 DT  C OP2   1 
ATOM   122  O  "O5'" . DT  A 1 7   ? 22.903 -5.920  33.253 1.00 35.78  ? 1007 DT  C "O5'" 1 
ATOM   123  C  "C5'" . DT  A 1 7   ? 22.112 -4.733  33.317 1.00 26.39  ? 1007 DT  C "C5'" 1 
ATOM   124  C  "C4'" . DT  A 1 7   ? 22.945 -3.553  33.759 1.00 26.90  ? 1007 DT  C "C4'" 1 
ATOM   125  O  "O4'" . DT  A 1 7   ? 23.229 -3.584  35.179 1.00 27.24  ? 1007 DT  C "O4'" 1 
ATOM   126  C  "C3'" . DT  A 1 7   ? 24.291 -3.380  33.059 1.00 22.04  ? 1007 DT  C "C3'" 1 
ATOM   127  O  "O3'" . DT  A 1 7   ? 24.465 -2.001  32.815 1.00 23.83  ? 1007 DT  C "O3'" 1 
ATOM   128  C  "C2'" . DT  A 1 7   ? 25.296 -3.800  34.116 1.00 25.76  ? 1007 DT  C "C2'" 1 
ATOM   129  C  "C1'" . DT  A 1 7   ? 24.606 -3.315  35.375 1.00 21.19  ? 1007 DT  C "C1'" 1 
ATOM   130  N  N1    . DT  A 1 7   ? 25.013 -3.918  36.661 1.00 26.40  ? 1007 DT  C N1    1 
ATOM   131  C  C2    . DT  A 1 7   ? 25.015 -3.073  37.751 1.00 25.22  ? 1007 DT  C C2    1 
ATOM   132  O  O2    . DT  A 1 7   ? 24.717 -1.895  37.673 1.00 19.86  ? 1007 DT  C O2    1 
ATOM   133  N  N3    . DT  A 1 7   ? 25.374 -3.664  38.939 1.00 24.48  ? 1007 DT  C N3    1 
ATOM   134  C  C4    . DT  A 1 7   ? 25.708 -4.989  39.145 1.00 21.29  ? 1007 DT  C C4    1 
ATOM   135  O  O4    . DT  A 1 7   ? 25.985 -5.385  40.283 1.00 22.58  ? 1007 DT  C O4    1 
ATOM   136  C  C5    . DT  A 1 7   ? 25.688 -5.821  37.956 1.00 21.67  ? 1007 DT  C C5    1 
ATOM   137  C  C7    . DT  A 1 7   ? 26.022 -7.275  38.087 1.00 18.19  ? 1007 DT  C C7    1 
ATOM   138  C  C6    . DT  A 1 7   ? 25.359 -5.250  36.787 1.00 14.85  ? 1007 DT  C C6    1 
ATOM   139  P  P     . DA  A 1 8   ? 24.720 -1.486  31.330 1.00 29.00  ? 1008 DA  C P     1 
ATOM   140  O  OP1   . DA  A 1 8   ? 23.464 -1.725  30.573 1.00 35.83  ? 1008 DA  C OP1   1 
ATOM   141  O  OP2   . DA  A 1 8   ? 25.990 -2.054  30.846 1.00 23.45  ? 1008 DA  C OP2   1 
ATOM   142  O  "O5'" . DA  A 1 8   ? 24.901 0.082   31.547 1.00 35.27  ? 1008 DA  C "O5'" 1 
ATOM   143  C  "C5'" . DA  A 1 8   ? 23.821 0.866   32.054 1.00 33.12  ? 1008 DA  C "C5'" 1 
ATOM   144  C  "C4'" . DA  A 1 8   ? 24.344 2.035   32.856 1.00 35.21  ? 1008 DA  C "C4'" 1 
ATOM   145  O  "O4'" . DA  A 1 8   ? 24.934 1.574   34.090 1.00 34.73  ? 1008 DA  C "O4'" 1 
ATOM   146  C  "C3'" . DA  A 1 8   ? 25.409 2.884   32.174 1.00 32.82  ? 1008 DA  C "C3'" 1 
ATOM   147  O  "O3'" . DA  A 1 8   ? 25.164 4.256   32.513 1.00 33.51  ? 1008 DA  C "O3'" 1 
ATOM   148  C  "C2'" . DA  A 1 8   ? 26.715 2.336   32.736 1.00 28.35  ? 1008 DA  C "C2'" 1 
ATOM   149  C  "C1'" . DA  A 1 8   ? 26.333 1.810   34.115 1.00 28.91  ? 1008 DA  C "C1'" 1 
ATOM   150  N  N9    . DA  A 1 8   ? 26.962 0.537   34.483 1.00 33.31  ? 1008 DA  C N9    1 
ATOM   151  C  C8    . DA  A 1 8   ? 27.399 -0.446  33.633 1.00 32.77  ? 1008 DA  C C8    1 
ATOM   152  N  N7    . DA  A 1 8   ? 27.871 -1.501  34.241 1.00 36.43  ? 1008 DA  C N7    1 
ATOM   153  C  C5    . DA  A 1 8   ? 27.748 -1.193  35.586 1.00 29.44  ? 1008 DA  C C5    1 
ATOM   154  C  C6    . DA  A 1 8   ? 28.068 -1.914  36.741 1.00 27.43  ? 1008 DA  C C6    1 
ATOM   155  N  N6    . DA  A 1 8   ? 28.559 -3.157  36.716 1.00 27.18  ? 1008 DA  C N6    1 
ATOM   156  N  N1    . DA  A 1 8   ? 27.849 -1.321  37.935 1.00 29.72  ? 1008 DA  C N1    1 
ATOM   157  C  C2    . DA  A 1 8   ? 27.314 -0.091  37.947 1.00 23.46  ? 1008 DA  C C2    1 
ATOM   158  N  N3    . DA  A 1 8   ? 26.953 0.681   36.919 1.00 25.45  ? 1008 DA  C N3    1 
ATOM   159  C  C4    . DA  A 1 8   ? 27.204 0.065   35.753 1.00 26.18  ? 1008 DA  C C4    1 
ATOM   160  P  P     . DG  A 1 9   ? 26.220 5.397   32.100 1.00 34.45  ? 1009 DG  C P     1 
ATOM   161  O  OP1   . DG  A 1 9   ? 25.426 6.646   31.986 1.00 37.23  ? 1009 DG  C OP1   1 
ATOM   162  O  OP2   . DG  A 1 9   ? 27.069 4.959   30.966 1.00 29.20  ? 1009 DG  C OP2   1 
ATOM   163  O  "O5'" . DG  A 1 9   ? 27.168 5.492   33.377 1.00 33.46  ? 1009 DG  C "O5'" 1 
ATOM   164  C  "C5'" . DG  A 1 9   ? 26.611 5.698   34.673 1.00 33.43  ? 1009 DG  C "C5'" 1 
ATOM   165  C  "C4'" . DG  A 1 9   ? 27.704 5.732   35.715 1.00 40.34  ? 1009 DG  C "C4'" 1 
ATOM   166  O  "O4'" . DG  A 1 9   ? 28.174 4.390   35.996 1.00 39.91  ? 1009 DG  C "O4'" 1 
ATOM   167  C  "C3'" . DG  A 1 9   ? 28.944 6.565   35.372 1.00 40.55  ? 1009 DG  C "C3'" 1 
ATOM   168  O  "O3'" . DG  A 1 9   ? 29.303 7.334   36.528 1.00 48.36  ? 1009 DG  C "O3'" 1 
ATOM   169  C  "C2'" . DG  A 1 9   ? 29.995 5.513   35.046 1.00 33.84  ? 1009 DG  C "C2'" 1 
ATOM   170  C  "C1'" . DG  A 1 9   ? 29.588 4.363   35.954 1.00 38.79  ? 1009 DG  C "C1'" 1 
ATOM   171  N  N9    . DG  A 1 9   ? 29.996 3.015   35.555 1.00 37.68  ? 1009 DG  C N9    1 
ATOM   172  C  C8    . DG  A 1 9   ? 30.091 2.507   34.278 1.00 36.79  ? 1009 DG  C C8    1 
ATOM   173  N  N7    . DG  A 1 9   ? 30.446 1.250   34.253 1.00 29.81  ? 1009 DG  C N7    1 
ATOM   174  C  C5    . DG  A 1 9   ? 30.597 0.907   35.592 1.00 30.58  ? 1009 DG  C C5    1 
ATOM   175  C  C6    . DG  A 1 9   ? 30.960 -0.334  36.191 1.00 27.25  ? 1009 DG  C C6    1 
ATOM   176  O  O6    . DG  A 1 9   ? 31.185 -1.412  35.640 1.00 27.51  ? 1009 DG  C O6    1 
ATOM   177  N  N1    . DG  A 1 9   ? 31.040 -0.235  37.575 1.00 23.75  ? 1009 DG  C N1    1 
ATOM   178  C  C2    . DG  A 1 9   ? 30.793 0.909   38.298 1.00 30.13  ? 1009 DG  C C2    1 
ATOM   179  N  N2    . DG  A 1 9   ? 30.966 0.815   39.629 1.00 17.62  ? 1009 DG  C N2    1 
ATOM   180  N  N3    . DG  A 1 9   ? 30.417 2.063   37.755 1.00 28.69  ? 1009 DG  C N3    1 
ATOM   181  C  C4    . DG  A 1 9   ? 30.345 1.989   36.408 1.00 30.34  ? 1009 DG  C C4    1 
ATOM   182  P  P     . DA  A 1 10  ? 30.482 8.437   36.457 1.00 48.52  ? 1010 DA  C P     1 
ATOM   183  O  OP1   . DA  A 1 10  ? 29.899 9.696   36.986 1.00 52.91  ? 1010 DA  C OP1   1 
ATOM   184  O  OP2   . DA  A 1 10  ? 31.164 8.436   35.136 1.00 50.46  ? 1010 DA  C OP2   1 
ATOM   185  O  "O5'" . DA  A 1 10  ? 31.526 7.888   37.522 1.00 51.53  ? 1010 DA  C "O5'" 1 
ATOM   186  C  "C5'" . DA  A 1 10  ? 31.066 7.398   38.780 1.00 50.48  ? 1010 DA  C "C5'" 1 
ATOM   187  C  "C4'" . DA  A 1 10  ? 32.137 6.565   39.436 1.00 53.66  ? 1010 DA  C "C4'" 1 
ATOM   188  O  "O4'" . DA  A 1 10  ? 32.200 5.247   38.839 1.00 52.58  ? 1010 DA  C "O4'" 1 
ATOM   189  C  "C3'" . DA  A 1 10  ? 33.538 7.161   39.311 1.00 55.38  ? 1010 DA  C "C3'" 1 
ATOM   190  O  "O3'" . DA  A 1 10  ? 34.213 7.088   40.564 1.00 64.12  ? 1010 DA  C "O3'" 1 
ATOM   191  C  "C2'" . DA  A 1 10  ? 34.210 6.275   38.277 1.00 52.97  ? 1010 DA  C "C2'" 1 
ATOM   192  C  "C1'" . DA  A 1 10  ? 33.552 4.937   38.546 1.00 47.14  ? 1010 DA  C "C1'" 1 
ATOM   193  N  N9    . DA  A 1 10  ? 33.567 4.006   37.421 1.00 42.62  ? 1010 DA  C N9    1 
ATOM   194  C  C8    . DA  A 1 10  ? 33.223 4.265   36.115 1.00 39.24  ? 1010 DA  C C8    1 
ATOM   195  N  N7    . DA  A 1 10  ? 33.347 3.232   35.323 1.00 41.06  ? 1010 DA  C N7    1 
ATOM   196  C  C5    . DA  A 1 10  ? 33.798 2.219   36.160 1.00 36.86  ? 1010 DA  C C5    1 
ATOM   197  C  C6    . DA  A 1 10  ? 34.126 0.869   35.919 1.00 32.64  ? 1010 DA  C C6    1 
ATOM   198  N  N6    . DA  A 1 10  ? 34.030 0.299   34.717 1.00 29.52  ? 1010 DA  C N6    1 
ATOM   199  N  N1    . DA  A 1 10  ? 34.556 0.123   36.966 1.00 28.94  ? 1010 DA  C N1    1 
ATOM   200  C  C2    . DA  A 1 10  ? 34.635 0.709   38.172 1.00 29.14  ? 1010 DA  C C2    1 
ATOM   201  N  N3    . DA  A 1 10  ? 34.348 1.970   38.522 1.00 33.21  ? 1010 DA  C N3    1 
ATOM   202  C  C4    . DA  A 1 10  ? 33.936 2.680   37.457 1.00 36.69  ? 1010 DA  C C4    1 
ATOM   203  P  P     . DC  A 1 11  ? 35.383 8.139   40.897 1.00 73.97  ? 1011 DC  C P     1 
ATOM   204  O  OP1   . DC  A 1 11  ? 35.222 8.536   42.321 1.00 71.67  ? 1011 DC  C OP1   1 
ATOM   205  O  OP2   . DC  A 1 11  ? 35.414 9.184   39.835 1.00 71.47  ? 1011 DC  C OP2   1 
ATOM   206  O  "O5'" . DC  A 1 11  ? 36.708 7.274   40.734 1.00 68.60  ? 1011 DC  C "O5'" 1 
ATOM   207  C  "C5'" . DC  A 1 11  ? 36.743 6.209   39.800 1.00 66.81  ? 1011 DC  C "C5'" 1 
ATOM   208  C  "C4'" . DC  A 1 11  ? 37.413 5.004   40.407 1.00 64.75  ? 1011 DC  C "C4'" 1 
ATOM   209  O  "O4'" . DC  A 1 11  ? 37.017 3.836   39.657 1.00 60.34  ? 1011 DC  C "O4'" 1 
ATOM   210  C  "C3'" . DC  A 1 11  ? 38.934 5.072   40.332 1.00 66.80  ? 1011 DC  C "C3'" 1 
ATOM   211  O  "O3'" . DC  A 1 11  ? 39.543 4.527   41.508 1.00 72.10  ? 1011 DC  C "O3'" 1 
ATOM   212  C  "C2'" . DC  A 1 11  ? 39.270 4.271   39.088 1.00 63.17  ? 1011 DC  C "C2'" 1 
ATOM   213  C  "C1'" . DC  A 1 11  ? 38.126 3.270   38.980 1.00 58.34  ? 1011 DC  C "C1'" 1 
ATOM   214  N  N1    . DC  A 1 11  ? 37.708 2.991   37.595 1.00 50.25  ? 1011 DC  C N1    1 
ATOM   215  C  C2    . DC  A 1 11  ? 37.850 1.692   37.094 1.00 48.14  ? 1011 DC  C C2    1 
ATOM   216  O  O2    . DC  A 1 11  ? 38.291 0.803   37.840 1.00 37.64  ? 1011 DC  C O2    1 
ATOM   217  N  N3    . DC  A 1 11  ? 37.501 1.437   35.809 1.00 50.07  ? 1011 DC  C N3    1 
ATOM   218  C  C4    . DC  A 1 11  ? 37.018 2.416   35.041 1.00 48.77  ? 1011 DC  C C4    1 
ATOM   219  N  N4    . DC  A 1 11  ? 36.711 2.124   33.775 1.00 45.52  ? 1011 DC  C N4    1 
ATOM   220  C  C5    . DC  A 1 11  ? 36.837 3.741   35.534 1.00 50.08  ? 1011 DC  C C5    1 
ATOM   221  C  C6    . DC  A 1 11  ? 37.195 3.983   36.803 1.00 51.18  ? 1011 DC  C C6    1 
ATOM   222  P  P     . DA  A 1 12  ? 41.076 4.887   41.846 1.00 73.19  ? 1012 DA  C P     1 
ATOM   223  O  OP1   . DA  A 1 12  ? 41.305 4.620   43.288 1.00 74.33  ? 1012 DA  C OP1   1 
ATOM   224  O  OP2   . DA  A 1 12  ? 41.374 6.236   41.292 1.00 70.84  ? 1012 DA  C OP2   1 
ATOM   225  O  "O5'" . DA  A 1 12  ? 41.892 3.816   41.001 1.00 71.37  ? 1012 DA  C "O5'" 1 
ATOM   226  C  "C5'" . DA  A 1 12  ? 41.841 2.434   41.346 1.00 71.94  ? 1012 DA  C "C5'" 1 
ATOM   227  C  "C4'" . DA  A 1 12  ? 42.696 1.630   40.397 1.00 72.11  ? 1012 DA  C "C4'" 1 
ATOM   228  O  "O4'" . DA  A 1 12  ? 41.979 1.360   39.167 1.00 69.66  ? 1012 DA  C "O4'" 1 
ATOM   229  C  "C3'" . DA  A 1 12  ? 43.998 2.325   39.998 1.00 72.62  ? 1012 DA  C "C3'" 1 
ATOM   230  O  "O3'" . DA  A 1 12  ? 45.081 1.388   40.014 1.00 77.82  ? 1012 DA  C "O3'" 1 
ATOM   231  C  "C2'" . DA  A 1 12  ? 43.714 2.814   38.588 1.00 68.96  ? 1012 DA  C "C2'" 1 
ATOM   232  C  "C1'" . DA  A 1 12  ? 42.785 1.730   38.063 1.00 65.67  ? 1012 DA  C "C1'" 1 
ATOM   233  N  N9    . DA  A 1 12  ? 41.901 2.141   36.968 1.00 59.80  ? 1012 DA  C N9    1 
ATOM   234  C  C8    . DA  A 1 12  ? 41.276 3.354   36.785 1.00 56.36  ? 1012 DA  C C8    1 
ATOM   235  N  N7    . DA  A 1 12  ? 40.589 3.432   35.674 1.00 53.67  ? 1012 DA  C N7    1 
ATOM   236  C  C5    . DA  A 1 12  ? 40.764 2.188   35.084 1.00 50.07  ? 1012 DA  C C5    1 
ATOM   237  C  C6    . DA  A 1 12  ? 40.306 1.649   33.875 1.00 45.97  ? 1012 DA  C C6    1 
ATOM   238  N  N6    . DA  A 1 12  ? 39.569 2.328   33.000 1.00 42.84  ? 1012 DA  C N6    1 
ATOM   239  N  N1    . DA  A 1 12  ? 40.644 0.374   33.586 1.00 44.84  ? 1012 DA  C N1    1 
ATOM   240  C  C2    . DA  A 1 12  ? 41.404 -0.300  34.461 1.00 47.69  ? 1012 DA  C C2    1 
ATOM   241  N  N3    . DA  A 1 12  ? 41.911 0.103   35.623 1.00 48.66  ? 1012 DA  C N3    1 
ATOM   242  C  C4    . DA  A 1 12  ? 41.552 1.374   35.879 1.00 53.24  ? 1012 DA  C C4    1 
ATOM   243  P  P     . DT  A 1 13  ? 46.602 1.917   40.067 1.00 79.49  ? 1013 DT  C P     1 
ATOM   244  O  OP1   . DT  A 1 13  ? 47.292 1.188   41.163 1.00 80.70  ? 1013 DT  C OP1   1 
ATOM   245  O  OP2   . DT  A 1 13  ? 46.605 3.407   40.056 1.00 76.79  ? 1013 DT  C OP2   1 
ATOM   246  O  "O5'" . DT  A 1 13  ? 47.204 1.424   38.680 1.00 78.84  ? 1013 DT  C "O5'" 1 
ATOM   247  C  "C5'" . DT  A 1 13  ? 46.384 1.405   37.523 1.00 78.50  ? 1013 DT  C "C5'" 1 
ATOM   248  C  "C4'" . DT  A 1 13  ? 46.542 0.098   36.786 1.00 76.08  ? 1013 DT  C "C4'" 1 
ATOM   249  O  "O4'" . DT  A 1 13  ? 45.416 -0.056  35.897 1.00 72.18  ? 1013 DT  C "O4'" 1 
ATOM   250  C  "C3'" . DT  A 1 13  ? 47.785 0.048   35.906 1.00 77.56  ? 1013 DT  C "C3'" 1 
ATOM   251  O  "O3'" . DT  A 1 13  ? 48.300 -1.285  35.823 1.00 83.52  ? 1013 DT  C "O3'" 1 
ATOM   252  C  "C2'" . DT  A 1 13  ? 47.285 0.559   34.567 1.00 73.32  ? 1013 DT  C "C2'" 1 
ATOM   253  C  "C1'" . DT  A 1 13  ? 45.801 0.186   34.551 1.00 68.17  ? 1013 DT  C "C1'" 1 
ATOM   254  N  N1    . DT  A 1 13  ? 44.927 1.266   34.026 1.00 59.16  ? 1013 DT  C N1    1 
ATOM   255  C  C2    . DT  A 1 13  ? 44.207 1.034   32.873 1.00 50.03  ? 1013 DT  C C2    1 
ATOM   256  O  O2    . DT  A 1 13  ? 44.214 -0.029  32.280 1.00 47.12  ? 1013 DT  C O2    1 
ATOM   257  N  N3    . DT  A 1 13  ? 43.467 2.105   32.438 1.00 50.19  ? 1013 DT  C N3    1 
ATOM   258  C  C4    . DT  A 1 13  ? 43.366 3.351   33.029 1.00 50.46  ? 1013 DT  C C4    1 
ATOM   259  O  O4    . DT  A 1 13  ? 42.666 4.217   32.509 1.00 54.14  ? 1013 DT  C O4    1 
ATOM   260  C  C5    . DT  A 1 13  ? 44.127 3.518   34.249 1.00 52.80  ? 1013 DT  C C5    1 
ATOM   261  C  C7    . DT  A 1 13  ? 44.068 4.829   34.973 1.00 48.76  ? 1013 DT  C C7    1 
ATOM   262  C  C6    . DT  A 1 13  ? 44.858 2.483   34.680 1.00 52.83  ? 1013 DT  C C6    1 
ATOM   263  P  P     . DA  A 1 14  ? 49.793 -1.527  35.270 1.00 90.87  ? 1014 DA  C P     1 
ATOM   264  O  OP1   . DA  A 1 14  ? 50.217 -2.908  35.635 1.00 89.35  ? 1014 DA  C OP1   1 
ATOM   265  O  OP2   . DA  A 1 14  ? 50.632 -0.369  35.683 1.00 88.89  ? 1014 DA  C OP2   1 
ATOM   266  O  "O5'" . DA  A 1 14  ? 49.624 -1.448  33.688 1.00 88.13  ? 1014 DA  C "O5'" 1 
ATOM   267  C  "C5'" . DA  A 1 14  ? 49.174 -2.578  32.945 1.00 88.10  ? 1014 DA  C "C5'" 1 
ATOM   268  C  "C4'" . DA  A 1 14  ? 49.205 -2.277  31.466 1.00 87.07  ? 1014 DA  C "C4'" 1 
ATOM   269  O  "O4'" . DA  A 1 14  ? 48.117 -1.383  31.117 1.00 84.37  ? 1014 DA  C "O4'" 1 
ATOM   270  C  "C3'" . DA  A 1 14  ? 50.492 -1.601  30.977 1.00 88.10  ? 1014 DA  C "C3'" 1 
ATOM   271  O  "O3'" . DA  A 1 14  ? 50.887 -2.158  29.722 1.00 92.85  ? 1014 DA  C "O3'" 1 
ATOM   272  C  "C2'" . DA  A 1 14  ? 50.072 -0.156  30.781 1.00 85.70  ? 1014 DA  C "C2'" 1 
ATOM   273  C  "C1'" . DA  A 1 14  ? 48.630 -0.319  30.337 1.00 82.97  ? 1014 DA  C "C1'" 1 
ATOM   274  N  N9    . DA  A 1 14  ? 47.780 0.857   30.529 1.00 78.84  ? 1014 DA  C N9    1 
ATOM   275  C  C8    . DA  A 1 14  ? 47.816 1.786   31.543 1.00 76.93  ? 1014 DA  C C8    1 
ATOM   276  N  N7    . DA  A 1 14  ? 46.970 2.774   31.385 1.00 74.59  ? 1014 DA  C N7    1 
ATOM   277  C  C5    . DA  A 1 14  ? 46.319 2.469   30.198 1.00 72.39  ? 1014 DA  C C5    1 
ATOM   278  C  C6    . DA  A 1 14  ? 45.321 3.136   29.472 1.00 71.81  ? 1014 DA  C C6    1 
ATOM   279  N  N6    . DA  A 1 14  ? 44.786 4.301   29.849 1.00 69.49  ? 1014 DA  C N6    1 
ATOM   280  N  N1    . DA  A 1 14  ? 44.890 2.563   28.326 1.00 72.31  ? 1014 DA  C N1    1 
ATOM   281  C  C2    . DA  A 1 14  ? 45.435 1.400   27.945 1.00 71.32  ? 1014 DA  C C2    1 
ATOM   282  N  N3    . DA  A 1 14  ? 46.381 0.681   28.538 1.00 72.06  ? 1014 DA  C N3    1 
ATOM   283  C  C4    . DA  A 1 14  ? 46.790 1.279   29.672 1.00 74.81  ? 1014 DA  C C4    1 
ATOM   284  P  P     . DC  A 1 15  ? 52.346 -1.841  29.120 1.00 95.48  ? 1015 DC  C P     1 
ATOM   285  O  OP1   . DC  A 1 15  ? 53.221 -3.004  29.427 1.00 94.48  ? 1015 DC  C OP1   1 
ATOM   286  O  OP2   . DC  A 1 15  ? 52.768 -0.474  29.532 1.00 92.14  ? 1015 DC  C OP2   1 
ATOM   287  O  "O5'" . DC  A 1 15  ? 52.071 -1.839  27.550 1.00 96.02  ? 1015 DC  C "O5'" 1 
ATOM   288  C  "C5'" . DC  A 1 15  ? 52.372 -0.706  26.738 1.00 95.68  ? 1015 DC  C "C5'" 1 
ATOM   289  C  "C4'" . DC  A 1 15  ? 51.322 -0.552  25.662 1.00 95.62  ? 1015 DC  C "C4'" 1 
ATOM   290  O  "O4'" . DC  A 1 15  ? 50.142 0.066   26.240 1.00 94.83  ? 1015 DC  C "O4'" 1 
ATOM   291  C  "C3'" . DC  A 1 15  ? 51.736 0.347   24.495 1.00 96.03  ? 1015 DC  C "C3'" 1 
ATOM   292  O  "O3'" . DC  A 1 15  ? 51.089 -0.062  23.285 1.00 97.59  ? 1015 DC  C "O3'" 1 
ATOM   293  C  "C2'" . DC  A 1 15  ? 51.130 1.688   24.859 1.00 95.91  ? 1015 DC  C "C2'" 1 
ATOM   294  C  "C1'" . DC  A 1 15  ? 49.838 1.268   25.539 1.00 94.50  ? 1015 DC  C "C1'" 1 
ATOM   295  N  N1    . DC  A 1 15  ? 49.329 2.266   26.500 1.00 92.41  ? 1015 DC  C N1    1 
ATOM   296  C  C2    . DC  A 1 15  ? 48.221 3.058   26.136 1.00 91.69  ? 1015 DC  C C2    1 
ATOM   297  O  O2    . DC  A 1 15  ? 47.665 2.860   25.042 1.00 91.56  ? 1015 DC  C O2    1 
ATOM   298  N  N3    . DC  A 1 15  ? 47.786 4.014   26.989 1.00 90.32  ? 1015 DC  C N3    1 
ATOM   299  C  C4    . DC  A 1 15  ? 48.396 4.187   28.164 1.00 89.53  ? 1015 DC  C C4    1 
ATOM   300  N  N4    . DC  A 1 15  ? 47.941 5.146   28.967 1.00 88.40  ? 1015 DC  C N4    1 
ATOM   301  C  C5    . DC  A 1 15  ? 49.502 3.383   28.568 1.00 89.92  ? 1015 DC  C C5    1 
ATOM   302  C  C6    . DC  A 1 15  ? 49.930 2.443   27.716 1.00 91.63  ? 1015 DC  C C6    1 
ATOM   303  O  "O5'" . DG  B 2 1   ? 42.572 12.209  24.519 1.00 104.90 ? 2001 DG  D "O5'" 1 
ATOM   304  C  "C5'" . DG  B 2 1   ? 41.705 11.070  24.464 1.00 105.75 ? 2001 DG  D "C5'" 1 
ATOM   305  C  "C4'" . DG  B 2 1   ? 41.983 10.182  23.273 1.00 105.55 ? 2001 DG  D "C4'" 1 
ATOM   306  O  "O4'" . DG  B 2 1   ? 43.329 9.657   23.377 1.00 105.92 ? 2001 DG  D "O4'" 1 
ATOM   307  C  "C3'" . DG  B 2 1   ? 41.058 8.970   23.157 1.00 106.15 ? 2001 DG  D "C3'" 1 
ATOM   308  O  "O3'" . DG  B 2 1   ? 40.692 8.713   21.797 1.00 105.40 ? 2001 DG  D "O3'" 1 
ATOM   309  C  "C2'" . DG  B 2 1   ? 41.891 7.827   23.704 1.00 106.70 ? 2001 DG  D "C2'" 1 
ATOM   310  C  "C1'" . DG  B 2 1   ? 43.319 8.234   23.383 1.00 106.49 ? 2001 DG  D "C1'" 1 
ATOM   311  N  N9    . DG  B 2 1   ? 44.267 7.784   24.400 1.00 106.58 ? 2001 DG  D N9    1 
ATOM   312  C  C8    . DG  B 2 1   ? 45.326 6.922   24.236 1.00 105.80 ? 2001 DG  D C8    1 
ATOM   313  N  N7    . DG  B 2 1   ? 45.987 6.707   25.342 1.00 105.74 ? 2001 DG  D N7    1 
ATOM   314  C  C5    . DG  B 2 1   ? 45.327 7.477   26.292 1.00 106.40 ? 2001 DG  D C5    1 
ATOM   315  C  C6    . DG  B 2 1   ? 45.584 7.652   27.675 1.00 106.63 ? 2001 DG  D C6    1 
ATOM   316  O  O6    . DG  B 2 1   ? 46.483 7.156   28.358 1.00 107.63 ? 2001 DG  D O6    1 
ATOM   317  N  N1    . DG  B 2 1   ? 44.659 8.511   28.264 1.00 107.84 ? 2001 DG  D N1    1 
ATOM   318  C  C2    . DG  B 2 1   ? 43.622 9.129   27.606 1.00 108.00 ? 2001 DG  D C2    1 
ATOM   319  N  N2    . DG  B 2 1   ? 42.827 9.919   28.348 1.00 107.53 ? 2001 DG  D N2    1 
ATOM   320  N  N3    . DG  B 2 1   ? 43.380 8.983   26.315 1.00 107.31 ? 2001 DG  D N3    1 
ATOM   321  C  C4    . DG  B 2 1   ? 44.263 8.147   25.726 1.00 106.63 ? 2001 DG  D C4    1 
ATOM   322  P  P     . DT  B 2 2   ? 39.492 7.685   21.477 1.00 105.64 ? 2002 DT  D P     1 
ATOM   323  O  OP1   . DT  B 2 2   ? 39.124 7.872   20.050 1.00 104.93 ? 2002 DT  D OP1   1 
ATOM   324  O  OP2   . DT  B 2 2   ? 38.448 7.830   22.526 1.00 104.55 ? 2002 DT  D OP2   1 
ATOM   325  O  "O5'" . DT  B 2 2   ? 40.161 6.245   21.642 1.00 101.71 ? 2002 DT  D "O5'" 1 
ATOM   326  C  "C5'" . DT  B 2 2   ? 41.076 5.751   20.663 1.00 96.95  ? 2002 DT  D "C5'" 1 
ATOM   327  C  "C4'" . DT  B 2 2   ? 41.517 4.345   21.001 1.00 94.14  ? 2002 DT  D "C4'" 1 
ATOM   328  O  "O4'" . DT  B 2 2   ? 42.351 4.357   22.185 1.00 91.79  ? 2002 DT  D "O4'" 1 
ATOM   329  C  "C3'" . DT  B 2 2   ? 40.406 3.325   21.268 1.00 92.39  ? 2002 DT  D "C3'" 1 
ATOM   330  O  "O3'" . DT  B 2 2   ? 40.738 2.079   20.632 1.00 92.81  ? 2002 DT  D "O3'" 1 
ATOM   331  C  "C2'" . DT  B 2 2   ? 40.408 3.193   22.782 1.00 90.70  ? 2002 DT  D "C2'" 1 
ATOM   332  C  "C1'" . DT  B 2 2   ? 41.875 3.406   23.123 1.00 88.79  ? 2002 DT  D "C1'" 1 
ATOM   333  N  N1    . DT  B 2 2   ? 42.148 3.933   24.478 1.00 84.74  ? 2002 DT  D N1    1 
ATOM   334  C  C2    . DT  B 2 2   ? 43.113 3.313   25.243 1.00 82.66  ? 2002 DT  D C2    1 
ATOM   335  O  O2    . DT  B 2 2   ? 43.740 2.331   24.873 1.00 79.71  ? 2002 DT  D O2    1 
ATOM   336  N  N3    . DT  B 2 2   ? 43.319 3.888   26.474 1.00 82.99  ? 2002 DT  D N3    1 
ATOM   337  C  C4    . DT  B 2 2   ? 42.668 4.988   27.008 1.00 83.87  ? 2002 DT  D C4    1 
ATOM   338  O  O4    . DT  B 2 2   ? 42.967 5.395   28.133 1.00 84.97  ? 2002 DT  D O4    1 
ATOM   339  C  C5    . DT  B 2 2   ? 41.658 5.576   26.158 1.00 84.10  ? 2002 DT  D C5    1 
ATOM   340  C  C7    . DT  B 2 2   ? 40.889 6.762   26.651 1.00 83.76  ? 2002 DT  D C7    1 
ATOM   341  C  C6    . DT  B 2 2   ? 41.454 5.026   24.954 1.00 84.18  ? 2002 DT  D C6    1 
ATOM   342  P  P     . DA  B 2 3   ? 39.759 0.806   20.778 1.00 92.08  ? 2003 DA  D P     1 
ATOM   343  O  OP1   . DA  B 2 3   ? 39.999 -0.086  19.611 1.00 91.63  ? 2003 DA  D OP1   1 
ATOM   344  O  OP2   . DA  B 2 3   ? 38.380 1.286   21.060 1.00 92.69  ? 2003 DA  D OP2   1 
ATOM   345  O  "O5'" . DA  B 2 3   ? 40.316 0.065   22.075 1.00 88.68  ? 2003 DA  D "O5'" 1 
ATOM   346  C  "C5'" . DA  B 2 3   ? 41.609 -0.543  22.059 1.00 82.31  ? 2003 DA  D "C5'" 1 
ATOM   347  C  "C4'" . DA  B 2 3   ? 41.775 -1.480  23.234 1.00 76.93  ? 2003 DA  D "C4'" 1 
ATOM   348  O  "O4'" . DA  B 2 3   ? 42.115 -0.749  24.437 1.00 73.05  ? 2003 DA  D "O4'" 1 
ATOM   349  C  "C3'" . DA  B 2 3   ? 40.549 -2.326  23.570 1.00 74.51  ? 2003 DA  D "C3'" 1 
ATOM   350  O  "O3'" . DA  B 2 3   ? 40.938 -3.682  23.788 1.00 74.16  ? 2003 DA  D "O3'" 1 
ATOM   351  C  "C2'" . DA  B 2 3   ? 40.006 -1.686  24.837 1.00 71.12  ? 2003 DA  D "C2'" 1 
ATOM   352  C  "C1'" . DA  B 2 3   ? 41.256 -1.129  25.497 1.00 67.85  ? 2003 DA  D "C1'" 1 
ATOM   353  N  N9    . DA  B 2 3   ? 41.049 0.048   26.347 1.00 62.52  ? 2003 DA  D N9    1 
ATOM   354  C  C8    . DA  B 2 3   ? 40.313 1.180   26.079 1.00 59.61  ? 2003 DA  D C8    1 
ATOM   355  N  N7    . DA  B 2 3   ? 40.341 2.072   27.044 1.00 58.77  ? 2003 DA  D N7    1 
ATOM   356  C  C5    . DA  B 2 3   ? 41.150 1.490   28.015 1.00 57.45  ? 2003 DA  D C5    1 
ATOM   357  C  C6    . DA  B 2 3   ? 41.588 1.933   29.287 1.00 55.03  ? 2003 DA  D C6    1 
ATOM   358  N  N6    . DA  B 2 3   ? 41.271 3.120   29.819 1.00 48.66  ? 2003 DA  D N6    1 
ATOM   359  N  N1    . DA  B 2 3   ? 42.379 1.102   30.000 1.00 50.71  ? 2003 DA  D N1    1 
ATOM   360  C  C2    . DA  B 2 3   ? 42.712 -0.080  29.469 1.00 53.57  ? 2003 DA  D C2    1 
ATOM   361  N  N3    . DA  B 2 3   ? 42.377 -0.603  28.290 1.00 55.31  ? 2003 DA  D N3    1 
ATOM   362  C  C4    . DA  B 2 3   ? 41.586 0.240   27.602 1.00 59.47  ? 2003 DA  D C4    1 
ATOM   363  P  P     . DT  B 2 4   ? 39.816 -4.796  24.072 1.00 78.27  ? 2004 DT  D P     1 
ATOM   364  O  OP1   . DT  B 2 4   ? 40.281 -6.094  23.506 1.00 74.73  ? 2004 DT  D OP1   1 
ATOM   365  O  OP2   . DT  B 2 4   ? 38.492 -4.255  23.671 1.00 76.52  ? 2004 DT  D OP2   1 
ATOM   366  O  "O5'" . DT  B 2 4   ? 39.835 -4.897  25.659 1.00 74.47  ? 2004 DT  D "O5'" 1 
ATOM   367  C  "C5'" . DT  B 2 4   ? 41.043 -5.224  26.342 1.00 67.25  ? 2004 DT  D "C5'" 1 
ATOM   368  C  "C4'" . DT  B 2 4   ? 40.803 -5.310  27.830 1.00 63.96  ? 2004 DT  D "C4'" 1 
ATOM   369  O  "O4'" . DT  B 2 4   ? 40.877 -3.998  28.443 1.00 61.72  ? 2004 DT  D "O4'" 1 
ATOM   370  C  "C3'" . DT  B 2 4   ? 39.451 -5.903  28.235 1.00 62.85  ? 2004 DT  D "C3'" 1 
ATOM   371  O  "O3'" . DT  B 2 4   ? 39.628 -6.911  29.231 1.00 62.33  ? 2004 DT  D "O3'" 1 
ATOM   372  C  "C2'" . DT  B 2 4   ? 38.708 -4.716  28.827 1.00 60.84  ? 2004 DT  D "C2'" 1 
ATOM   373  C  "C1'" . DT  B 2 4   ? 39.853 -3.907  29.409 1.00 58.96  ? 2004 DT  D "C1'" 1 
ATOM   374  N  N1    . DT  B 2 4   ? 39.585 -2.474  29.696 1.00 54.17  ? 2004 DT  D N1    1 
ATOM   375  C  C2    . DT  B 2 4   ? 40.111 -1.931  30.861 1.00 53.80  ? 2004 DT  D C2    1 
ATOM   376  O  O2    . DT  B 2 4   ? 40.835 -2.552  31.629 1.00 54.15  ? 2004 DT  D O2    1 
ATOM   377  N  N3    . DT  B 2 4   ? 39.757 -0.622  31.095 1.00 50.17  ? 2004 DT  D N3    1 
ATOM   378  C  C4    . DT  B 2 4   ? 38.963 0.185   30.298 1.00 50.72  ? 2004 DT  D C4    1 
ATOM   379  O  O4    . DT  B 2 4   ? 38.709 1.339   30.650 1.00 46.05  ? 2004 DT  D O4    1 
ATOM   380  C  C5    . DT  B 2 4   ? 38.482 -0.435  29.079 1.00 49.93  ? 2004 DT  D C5    1 
ATOM   381  C  C7    . DT  B 2 4   ? 37.644 0.372   28.138 1.00 53.17  ? 2004 DT  D C7    1 
ATOM   382  C  C6    . DT  B 2 4   ? 38.812 -1.713  28.844 1.00 51.57  ? 2004 DT  D C6    1 
ATOM   383  P  P     . DG  B 2 5   ? 38.468 -7.997  29.486 1.00 62.21  ? 2005 DG  D P     1 
ATOM   384  O  OP1   . DG  B 2 5   ? 38.839 -9.232  28.755 1.00 62.32  ? 2005 DG  D OP1   1 
ATOM   385  O  OP2   . DG  B 2 5   ? 37.134 -7.375  29.256 1.00 61.27  ? 2005 DG  D OP2   1 
ATOM   386  O  "O5'" . DG  B 2 5   ? 38.588 -8.295  31.042 1.00 59.19  ? 2005 DG  D "O5'" 1 
ATOM   387  C  "C5'" . DG  B 2 5   ? 39.864 -8.463  31.647 1.00 55.21  ? 2005 DG  D "C5'" 1 
ATOM   388  C  "C4'" . DG  B 2 5   ? 39.847 -7.924  33.057 1.00 48.99  ? 2005 DG  D "C4'" 1 
ATOM   389  O  "O4'" . DG  B 2 5   ? 39.833 -6.473  33.035 1.00 47.89  ? 2005 DG  D "O4'" 1 
ATOM   390  C  "C3'" . DG  B 2 5   ? 38.629 -8.363  33.872 1.00 50.50  ? 2005 DG  D "C3'" 1 
ATOM   391  O  "O3'" . DG  B 2 5   ? 39.011 -8.844  35.162 1.00 49.08  ? 2005 DG  D "O3'" 1 
ATOM   392  C  "C2'" . DG  B 2 5   ? 37.795 -7.100  33.995 1.00 49.74  ? 2005 DG  D "C2'" 1 
ATOM   393  C  "C1'" . DG  B 2 5   ? 38.829 -5.988  33.914 1.00 46.32  ? 2005 DG  D "C1'" 1 
ATOM   394  N  N9    . DG  B 2 5   ? 38.293 -4.739  33.369 1.00 42.67  ? 2005 DG  D N9    1 
ATOM   395  C  C8    . DG  B 2 5   ? 37.726 -4.547  32.127 1.00 41.63  ? 2005 DG  D C8    1 
ATOM   396  N  N7    . DG  B 2 5   ? 37.284 -3.330  31.946 1.00 39.08  ? 2005 DG  D N7    1 
ATOM   397  C  C5    . DG  B 2 5   ? 37.587 -2.673  33.133 1.00 37.79  ? 2005 DG  D C5    1 
ATOM   398  C  C6    . DG  B 2 5   ? 37.339 -1.328  33.533 1.00 38.64  ? 2005 DG  D C6    1 
ATOM   399  O  O6    . DG  B 2 5   ? 36.780 -0.426  32.900 1.00 40.48  ? 2005 DG  D O6    1 
ATOM   400  N  N1    . DG  B 2 5   ? 37.810 -1.079  34.819 1.00 38.65  ? 2005 DG  D N1    1 
ATOM   401  C  C2    . DG  B 2 5   ? 38.434 -2.006  35.623 1.00 39.02  ? 2005 DG  D C2    1 
ATOM   402  N  N2    . DG  B 2 5   ? 38.799 -1.581  36.840 1.00 35.61  ? 2005 DG  D N2    1 
ATOM   403  N  N3    . DG  B 2 5   ? 38.673 -3.260  35.264 1.00 33.68  ? 2005 DG  D N3    1 
ATOM   404  C  C4    . DG  B 2 5   ? 38.224 -3.524  34.017 1.00 37.22  ? 2005 DG  D C4    1 
ATOM   405  P  P     . DT  B 2 6   ? 37.901 -9.490  36.129 1.00 50.33  ? 2006 DT  D P     1 
ATOM   406  O  OP1   . DT  B 2 6   ? 38.450 -10.718 36.754 1.00 55.46  ? 2006 DT  D OP1   1 
ATOM   407  O  OP2   . DT  B 2 6   ? 36.613 -9.556  35.392 1.00 47.25  ? 2006 DT  D OP2   1 
ATOM   408  O  "O5'" . DT  B 2 6   ? 37.749 -8.394  37.268 1.00 44.39  ? 2006 DT  D "O5'" 1 
ATOM   409  C  "C5'" . DT  B 2 6   ? 38.896 -7.871  37.912 1.00 41.15  ? 2006 DT  D "C5'" 1 
ATOM   410  C  "C4'" . DT  B 2 6   ? 38.478 -6.945  39.026 1.00 44.51  ? 2006 DT  D "C4'" 1 
ATOM   411  O  "O4'" . DT  B 2 6   ? 38.075 -5.662  38.486 1.00 42.21  ? 2006 DT  D "O4'" 1 
ATOM   412  C  "C3'" . DT  B 2 6   ? 37.300 -7.463  39.847 1.00 40.16  ? 2006 DT  D "C3'" 1 
ATOM   413  O  "O3'" . DT  B 2 6   ? 37.555 -7.256  41.234 1.00 40.31  ? 2006 DT  D "O3'" 1 
ATOM   414  C  "C2'" . DT  B 2 6   ? 36.125 -6.637  39.347 1.00 41.35  ? 2006 DT  D "C2'" 1 
ATOM   415  C  "C1'" . DT  B 2 6   ? 36.775 -5.324  38.924 1.00 35.45  ? 2006 DT  D "C1'" 1 
ATOM   416  N  N1    . DT  B 2 6   ? 36.105 -4.605  37.812 1.00 37.03  ? 2006 DT  D N1    1 
ATOM   417  C  C2    . DT  B 2 6   ? 35.847 -3.257  37.968 1.00 34.76  ? 2006 DT  D C2    1 
ATOM   418  O  O2    . DT  B 2 6   ? 36.094 -2.642  38.993 1.00 40.11  ? 2006 DT  D O2    1 
ATOM   419  N  N3    . DT  B 2 6   ? 35.269 -2.652  36.871 1.00 32.96  ? 2006 DT  D N3    1 
ATOM   420  C  C4    . DT  B 2 6   ? 34.916 -3.249  35.673 1.00 29.02  ? 2006 DT  D C4    1 
ATOM   421  O  O4    . DT  B 2 6   ? 34.434 -2.569  34.766 1.00 23.25  ? 2006 DT  D O4    1 
ATOM   422  C  C5    . DT  B 2 6   ? 35.170 -4.671  35.596 1.00 25.79  ? 2006 DT  D C5    1 
ATOM   423  C  C7    . DT  B 2 6   ? 34.760 -5.413  34.363 1.00 26.52  ? 2006 DT  D C7    1 
ATOM   424  C  C6    . DT  B 2 6   ? 35.755 -5.266  36.645 1.00 32.08  ? 2006 DT  D C6    1 
ATOM   425  P  P     . DC  B 2 7   ? 36.544 -7.850  42.332 1.00 42.64  ? 2007 DC  D P     1 
ATOM   426  O  OP1   . DC  B 2 7   ? 37.353 -8.297  43.491 1.00 41.26  ? 2007 DC  D OP1   1 
ATOM   427  O  OP2   . DC  B 2 7   ? 35.611 -8.807  41.669 1.00 44.17  ? 2007 DC  D OP2   1 
ATOM   428  O  "O5'" . DC  B 2 7   ? 35.717 -6.560  42.759 1.00 45.85  ? 2007 DC  D "O5'" 1 
ATOM   429  C  "C5'" . DC  B 2 7   ? 36.403 -5.349  43.082 1.00 40.74  ? 2007 DC  D "C5'" 1 
ATOM   430  C  "C4'" . DC  B 2 7   ? 35.420 -4.234  43.349 1.00 34.77  ? 2007 DC  D "C4'" 1 
ATOM   431  O  "O4'" . DC  B 2 7   ? 34.946 -3.655  42.109 1.00 37.28  ? 2007 DC  D "O4'" 1 
ATOM   432  C  "C3'" . DC  B 2 7   ? 34.182 -4.622  44.155 1.00 37.14  ? 2007 DC  D "C3'" 1 
ATOM   433  O  "O3'" . DC  B 2 7   ? 34.007 -3.691  45.220 1.00 34.03  ? 2007 DC  D "O3'" 1 
ATOM   434  C  "C2'" . DC  B 2 7   ? 33.043 -4.539  43.145 1.00 37.85  ? 2007 DC  D "C2'" 1 
ATOM   435  C  "C1'" . DC  B 2 7   ? 33.536 -3.509  42.135 1.00 29.21  ? 2007 DC  D "C1'" 1 
ATOM   436  N  N1    . DC  B 2 7   ? 33.038 -3.659  40.740 1.00 27.09  ? 2007 DC  D N1    1 
ATOM   437  C  C2    . DC  B 2 7   ? 32.485 -2.530  40.078 1.00 24.73  ? 2007 DC  D C2    1 
ATOM   438  O  O2    . DC  B 2 7   ? 32.373 -1.459  40.685 1.00 28.45  ? 2007 DC  D O2    1 
ATOM   439  N  N3    . DC  B 2 7   ? 32.083 -2.647  38.792 1.00 25.96  ? 2007 DC  D N3    1 
ATOM   440  C  C4    . DC  B 2 7   ? 32.204 -3.819  38.158 1.00 27.93  ? 2007 DC  D C4    1 
ATOM   441  N  N4    . DC  B 2 7   ? 31.827 -3.871  36.871 1.00 23.29  ? 2007 DC  D N4    1 
ATOM   442  C  C5    . DC  B 2 7   ? 32.729 -4.985  38.809 1.00 19.62  ? 2007 DC  D C5    1 
ATOM   443  C  C6    . DC  B 2 7   ? 33.125 -4.860  40.086 1.00 22.34  ? 2007 DC  D C6    1 
ATOM   444  P  P     . DT  B 2 8   ? 33.075 -4.068  46.467 1.00 36.35  ? 2008 DT  D P     1 
ATOM   445  O  OP1   . DT  B 2 8   ? 33.757 -3.525  47.677 1.00 38.87  ? 2008 DT  D OP1   1 
ATOM   446  O  OP2   . DT  B 2 8   ? 32.702 -5.511  46.426 1.00 29.99  ? 2008 DT  D OP2   1 
ATOM   447  O  "O5'" . DT  B 2 8   ? 31.795 -3.154  46.201 1.00 35.82  ? 2008 DT  D "O5'" 1 
ATOM   448  C  "C5'" . DT  B 2 8   ? 31.961 -1.735  46.094 1.00 33.20  ? 2008 DT  D "C5'" 1 
ATOM   449  C  "C4'" . DT  B 2 8   ? 30.706 -1.078  45.575 1.00 31.18  ? 2008 DT  D "C4'" 1 
ATOM   450  O  "O4'" . DT  B 2 8   ? 30.511 -1.343  44.166 1.00 25.88  ? 2008 DT  D "O4'" 1 
ATOM   451  C  "C3'" . DT  B 2 8   ? 29.399 -1.465  46.265 1.00 26.81  ? 2008 DT  D "C3'" 1 
ATOM   452  O  "O3'" . DT  B 2 8   ? 28.614 -0.280  46.374 1.00 28.82  ? 2008 DT  D "O3'" 1 
ATOM   453  C  "C2'" . DT  B 2 8   ? 28.743 -2.404  45.261 1.00 25.58  ? 2008 DT  D "C2'" 1 
ATOM   454  C  "C1'" . DT  B 2 8   ? 29.172 -1.757  43.957 1.00 23.14  ? 2008 DT  D "C1'" 1 
ATOM   455  N  N1    . DT  B 2 8   ? 29.134 -2.558  42.710 1.00 29.70  ? 2008 DT  D N1    1 
ATOM   456  C  C2    . DT  B 2 8   ? 28.800 -1.879  41.551 1.00 29.49  ? 2008 DT  D C2    1 
ATOM   457  O  O2    . DT  B 2 8   ? 28.506 -0.688  41.533 1.00 26.54  ? 2008 DT  D O2    1 
ATOM   458  N  N3    . DT  B 2 8   ? 28.822 -2.642  40.411 1.00 27.64  ? 2008 DT  D N3    1 
ATOM   459  C  C4    . DT  B 2 8   ? 29.135 -3.979  40.306 1.00 25.35  ? 2008 DT  D C4    1 
ATOM   460  O  O4    . DT  B 2 8   ? 29.112 -4.519  39.203 1.00 26.76  ? 2008 DT  D O4    1 
ATOM   461  C  C5    . DT  B 2 8   ? 29.471 -4.638  41.562 1.00 28.76  ? 2008 DT  D C5    1 
ATOM   462  C  C7    . DT  B 2 8   ? 29.847 -6.089  41.547 1.00 26.23  ? 2008 DT  D C7    1 
ATOM   463  C  C6    . DT  B 2 8   ? 29.440 -3.907  42.687 1.00 24.98  ? 2008 DT  D C6    1 
ATOM   464  P  P     . DA  B 2 9   ? 28.005 0.153   47.785 1.00 31.69  ? 2009 DA  D P     1 
ATOM   465  O  OP1   . DA  B 2 9   ? 29.133 0.640   48.634 1.00 34.22  ? 2009 DA  D OP1   1 
ATOM   466  O  OP2   . DA  B 2 9   ? 27.136 -0.934  48.273 1.00 25.64  ? 2009 DA  D OP2   1 
ATOM   467  O  "O5'" . DA  B 2 9   ? 27.091 1.402   47.402 1.00 29.96  ? 2009 DA  D "O5'" 1 
ATOM   468  C  "C5'" . DA  B 2 9   ? 27.678 2.573   46.830 1.00 29.46  ? 2009 DA  D "C5'" 1 
ATOM   469  C  "C4'" . DA  B 2 9   ? 26.711 3.239   45.880 1.00 26.95  ? 2009 DA  D "C4'" 1 
ATOM   470  O  "O4'" . DA  B 2 9   ? 26.445 2.404   44.731 1.00 26.00  ? 2009 DA  D "O4'" 1 
ATOM   471  C  "C3'" . DA  B 2 9   ? 25.356 3.551   46.494 1.00 27.07  ? 2009 DA  D "C3'" 1 
ATOM   472  O  "O3'" . DA  B 2 9   ? 24.926 4.816   45.997 1.00 28.79  ? 2009 DA  D "O3'" 1 
ATOM   473  C  "C2'" . DA  B 2 9   ? 24.480 2.391   46.045 1.00 20.97  ? 2009 DA  D "C2'" 1 
ATOM   474  C  "C1'" . DA  B 2 9   ? 25.085 1.969   44.716 1.00 24.24  ? 2009 DA  D "C1'" 1 
ATOM   475  N  N9    . DA  B 2 9   ? 25.100 0.520   44.482 1.00 25.61  ? 2009 DA  D N9    1 
ATOM   476  C  C8    . DA  B 2 9   ? 25.126 -0.478  45.428 1.00 26.94  ? 2009 DA  D C8    1 
ATOM   477  N  N7    . DA  B 2 9   ? 25.246 -1.680  44.927 1.00 29.08  ? 2009 DA  D N7    1 
ATOM   478  C  C5    . DA  B 2 9   ? 25.283 -1.468  43.555 1.00 25.31  ? 2009 DA  D C5    1 
ATOM   479  C  C6    . DA  B 2 9   ? 25.441 -2.350  42.469 1.00 22.88  ? 2009 DA  D C6    1 
ATOM   480  N  N6    . DA  B 2 9   ? 25.617 -3.667  42.609 1.00 24.34  ? 2009 DA  D N6    1 
ATOM   481  N  N1    . DA  B 2 9   ? 25.425 -1.823  41.220 1.00 22.89  ? 2009 DA  D N1    1 
ATOM   482  C  C2    . DA  B 2 9   ? 25.268 -0.493  41.090 1.00 27.40  ? 2009 DA  D C2    1 
ATOM   483  N  N3    . DA  B 2 9   ? 25.130 0.441   42.042 1.00 26.37  ? 2009 DA  D N3    1 
ATOM   484  C  C4    . DA  B 2 9   ? 25.153 -0.120  43.265 1.00 25.10  ? 2009 DA  D C4    1 
ATOM   485  P  P     . DG  B 2 10  ? 23.488 5.390   46.405 1.00 30.12  ? 2010 DG  D P     1 
ATOM   486  O  OP1   . DG  B 2 10  ? 23.614 6.880   46.314 1.00 37.92  ? 2010 DG  D OP1   1 
ATOM   487  O  OP2   . DG  B 2 10  ? 23.006 4.769   47.660 1.00 26.64  ? 2010 DG  D OP2   1 
ATOM   488  O  "O5'" . DG  B 2 10  ? 22.569 4.881   45.214 1.00 34.08  ? 2010 DG  D "O5'" 1 
ATOM   489  C  "C5'" . DG  B 2 10  ? 22.915 5.206   43.871 1.00 29.78  ? 2010 DG  D "C5'" 1 
ATOM   490  C  "C4'" . DG  B 2 10  ? 21.967 4.541   42.905 1.00 34.63  ? 2010 DG  D "C4'" 1 
ATOM   491  O  "O4'" . DG  B 2 10  ? 22.268 3.129   42.811 1.00 33.57  ? 2010 DG  D "O4'" 1 
ATOM   492  C  "C3'" . DG  B 2 10  ? 20.477 4.652   43.245 1.00 34.63  ? 2010 DG  D "C3'" 1 
ATOM   493  O  "O3'" . DG  B 2 10  ? 19.771 4.969   42.038 1.00 45.10  ? 2010 DG  D "O3'" 1 
ATOM   494  C  "C2'" . DG  B 2 10  ? 20.121 3.258   43.737 1.00 29.59  ? 2010 DG  D "C2'" 1 
ATOM   495  C  "C1'" . DG  B 2 10  ? 21.063 2.395   42.912 1.00 32.25  ? 2010 DG  D "C1'" 1 
ATOM   496  N  N9    . DG  B 2 10  ? 21.388 1.071   43.437 1.00 34.14  ? 2010 DG  D N9    1 
ATOM   497  C  C8    . DG  B 2 10  ? 21.576 0.687   44.743 1.00 27.70  ? 2010 DG  D C8    1 
ATOM   498  N  N7    . DG  B 2 10  ? 21.878 -0.580  44.862 1.00 32.72  ? 2010 DG  D N7    1 
ATOM   499  C  C5    . DG  B 2 10  ? 21.881 -1.056  43.556 1.00 30.55  ? 2010 DG  D C5    1 
ATOM   500  C  C6    . DG  B 2 10  ? 22.144 -2.356  43.039 1.00 29.13  ? 2010 DG  D C6    1 
ATOM   501  O  O6    . DG  B 2 10  ? 22.443 -3.380  43.646 1.00 29.37  ? 2010 DG  D O6    1 
ATOM   502  N  N1    . DG  B 2 10  ? 22.032 -2.384  41.658 1.00 27.13  ? 2010 DG  D N1    1 
ATOM   503  C  C2    . DG  B 2 10  ? 21.710 -1.308  40.870 1.00 25.25  ? 2010 DG  D C2    1 
ATOM   504  N  N2    . DG  B 2 10  ? 21.637 -1.525  39.549 1.00 25.85  ? 2010 DG  D N2    1 
ATOM   505  N  N3    . DG  B 2 10  ? 21.476 -0.106  41.335 1.00 29.79  ? 2010 DG  D N3    1 
ATOM   506  C  C4    . DG  B 2 10  ? 21.576 -0.050  42.672 1.00 31.27  ? 2010 DG  D C4    1 
ATOM   507  P  P     . DA  B 2 11  ? 18.179 5.228   42.055 1.00 46.64  ? 2011 DA  D P     1 
ATOM   508  O  OP1   . DA  B 2 11  ? 17.984 6.573   41.451 1.00 50.01  ? 2011 DA  D OP1   1 
ATOM   509  O  OP2   . DA  B 2 11  ? 17.559 4.917   43.365 1.00 42.20  ? 2011 DA  D OP2   1 
ATOM   510  O  "O5'" . DA  B 2 11  ? 17.667 4.131   41.028 1.00 43.54  ? 2011 DA  D "O5'" 1 
ATOM   511  C  "C5'" . DA  B 2 11  ? 18.397 3.881   39.829 1.00 42.89  ? 2011 DA  D "C5'" 1 
ATOM   512  C  "C4'" . DA  B 2 11  ? 17.929 2.598   39.187 1.00 47.00  ? 2011 DA  D "C4'" 1 
ATOM   513  O  "O4'" . DA  B 2 11  ? 18.503 1.454   39.870 1.00 41.92  ? 2011 DA  D "O4'" 1 
ATOM   514  C  "C3'" . DA  B 2 11  ? 16.410 2.409   39.214 1.00 46.36  ? 2011 DA  D "C3'" 1 
ATOM   515  O  "O3'" . DA  B 2 11  ? 15.933 2.011   37.931 1.00 54.55  ? 2011 DA  D "O3'" 1 
ATOM   516  C  "C2'" . DA  B 2 11  ? 16.197 1.314   40.246 1.00 43.54  ? 2011 DA  D "C2'" 1 
ATOM   517  C  "C1'" . DA  B 2 11  ? 17.483 0.512   40.148 1.00 41.55  ? 2011 DA  D "C1'" 1 
ATOM   518  N  N9    . DA  B 2 11  ? 17.845 -0.202  41.372 1.00 37.98  ? 2011 DA  D N9    1 
ATOM   519  C  C8    . DA  B 2 11  ? 17.824 0.263   42.664 1.00 39.68  ? 2011 DA  D C8    1 
ATOM   520  N  N7    . DA  B 2 11  ? 18.186 -0.629  43.554 1.00 37.68  ? 2011 DA  D N7    1 
ATOM   521  C  C5    . DA  B 2 11  ? 18.470 -1.757  42.798 1.00 35.84  ? 2011 DA  D C5    1 
ATOM   522  C  C6    . DA  B 2 11  ? 18.914 -3.048  43.151 1.00 30.93  ? 2011 DA  D C6    1 
ATOM   523  N  N6    . DA  B 2 11  ? 19.127 -3.432  44.403 1.00 25.13  ? 2011 DA  D N6    1 
ATOM   524  N  N1    . DA  B 2 11  ? 19.120 -3.936  42.159 1.00 24.01  ? 2011 DA  D N1    1 
ATOM   525  C  C2    . DA  B 2 11  ? 18.874 -3.555  40.901 1.00 31.10  ? 2011 DA  D C2    1 
ATOM   526  N  N3    . DA  B 2 11  ? 18.447 -2.375  40.441 1.00 31.87  ? 2011 DA  D N3    1 
ATOM   527  C  C4    . DA  B 2 11  ? 18.266 -1.509  41.452 1.00 34.26  ? 2011 DA  D C4    1 
ATOM   528  P  P     . DC  B 2 12  ? 14.353 1.824   37.689 1.00 61.17  ? 2012 DC  D P     1 
ATOM   529  O  OP1   . DC  B 2 12  ? 14.109 2.164   36.266 1.00 60.82  ? 2012 DC  D OP1   1 
ATOM   530  O  OP2   . DC  B 2 12  ? 13.585 2.521   38.761 1.00 58.54  ? 2012 DC  D OP2   1 
ATOM   531  O  "O5'" . DC  B 2 12  ? 14.160 0.258   37.889 1.00 58.29  ? 2012 DC  D "O5'" 1 
ATOM   532  C  "C5'" . DC  B 2 12  ? 15.092 -0.638  37.294 1.00 59.73  ? 2012 DC  D "C5'" 1 
ATOM   533  C  "C4'" . DC  B 2 12  ? 14.839 -2.057  37.741 1.00 58.49  ? 2012 DC  D "C4'" 1 
ATOM   534  O  "O4'" . DC  B 2 12  ? 15.437 -2.344  39.032 1.00 52.04  ? 2012 DC  D "O4'" 1 
ATOM   535  C  "C3'" . DC  B 2 12  ? 13.372 -2.474  37.828 1.00 55.82  ? 2012 DC  D "C3'" 1 
ATOM   536  O  "O3'" . DC  B 2 12  ? 13.205 -3.676  37.079 1.00 62.66  ? 2012 DC  D "O3'" 1 
ATOM   537  C  "C2'" . DC  B 2 12  ? 13.160 -2.727  39.314 1.00 53.66  ? 2012 DC  D "C2'" 1 
ATOM   538  C  "C1'" . DC  B 2 12  ? 14.550 -3.160  39.766 1.00 48.18  ? 2012 DC  D "C1'" 1 
ATOM   539  N  N1    . DC  B 2 12  ? 14.842 -2.984  41.201 1.00 41.76  ? 2012 DC  D N1    1 
ATOM   540  C  C2    . DC  B 2 12  ? 15.300 -4.090  41.948 1.00 40.25  ? 2012 DC  D C2    1 
ATOM   541  O  O2    . DC  B 2 12  ? 15.459 -5.182  41.385 1.00 34.59  ? 2012 DC  D O2    1 
ATOM   542  N  N3    . DC  B 2 12  ? 15.551 -3.935  43.271 1.00 38.59  ? 2012 DC  D N3    1 
ATOM   543  C  C4    . DC  B 2 12  ? 15.350 -2.751  43.852 1.00 38.17  ? 2012 DC  D C4    1 
ATOM   544  N  N4    . DC  B 2 12  ? 15.585 -2.652  45.160 1.00 36.26  ? 2012 DC  D N4    1 
ATOM   545  C  C5    . DC  B 2 12  ? 14.893 -1.613  43.118 1.00 41.83  ? 2012 DC  D C5    1 
ATOM   546  C  C6    . DC  B 2 12  ? 14.662 -1.772  41.810 1.00 42.03  ? 2012 DC  D C6    1 
ATOM   547  P  P     . DT  B 2 13  ? 11.732 -4.201  36.719 1.00 62.71  ? 2013 DT  D P     1 
ATOM   548  O  OP1   . DT  B 2 13  ? 11.762 -4.687  35.321 1.00 63.99  ? 2013 DT  D OP1   1 
ATOM   549  O  OP2   . DT  B 2 13  ? 10.732 -3.176  37.125 1.00 61.68  ? 2013 DT  D OP2   1 
ATOM   550  O  "O5'" . DT  B 2 13  ? 11.573 -5.453  37.681 1.00 63.43  ? 2013 DT  D "O5'" 1 
ATOM   551  C  "C5'" . DT  B 2 13  ? 12.568 -6.473  37.715 1.00 64.83  ? 2013 DT  D "C5'" 1 
ATOM   552  C  "C4'" . DT  B 2 13  ? 12.234 -7.478  38.791 1.00 68.82  ? 2013 DT  D "C4'" 1 
ATOM   553  O  "O4'" . DT  B 2 13  ? 12.735 -7.049  40.081 1.00 64.61  ? 2013 DT  D "O4'" 1 
ATOM   554  C  "C3'" . DT  B 2 13  ? 10.729 -7.697  38.961 1.00 71.39  ? 2013 DT  D "C3'" 1 
ATOM   555  O  "O3'" . DT  B 2 13  ? 10.425 -9.086  39.006 1.00 80.44  ? 2013 DT  D "O3'" 1 
ATOM   556  C  "C2'" . DT  B 2 13  ? 10.407 -7.021  40.284 1.00 67.41  ? 2013 DT  D "C2'" 1 
ATOM   557  C  "C1'" . DT  B 2 13  ? 11.710 -7.178  41.051 1.00 60.74  ? 2013 DT  D "C1'" 1 
ATOM   558  N  N1    . DT  B 2 13  ? 11.956 -6.181  42.120 1.00 54.72  ? 2013 DT  D N1    1 
ATOM   559  C  C2    . DT  B 2 13  ? 12.454 -6.629  43.330 1.00 51.38  ? 2013 DT  D C2    1 
ATOM   560  O  O2    . DT  B 2 13  ? 12.715 -7.801  43.557 1.00 47.34  ? 2013 DT  D O2    1 
ATOM   561  N  N3    . DT  B 2 13  ? 12.640 -5.646  44.271 1.00 44.63  ? 2013 DT  D N3    1 
ATOM   562  C  C4    . DT  B 2 13  ? 12.386 -4.299  44.129 1.00 47.82  ? 2013 DT  D C4    1 
ATOM   563  O  O4    . DT  B 2 13  ? 12.592 -3.537  45.068 1.00 48.53  ? 2013 DT  D O4    1 
ATOM   564  C  C5    . DT  B 2 13  ? 11.875 -3.899  42.837 1.00 50.72  ? 2013 DT  D C5    1 
ATOM   565  C  C7    . DT  B 2 13  ? 11.569 -2.455  42.589 1.00 54.10  ? 2013 DT  D C7    1 
ATOM   566  C  C6    . DT  B 2 13  ? 11.693 -4.846  41.911 1.00 51.79  ? 2013 DT  D C6    1 
ATOM   567  P  P     . DG  B 2 14  ? 9.440  -9.708  37.902 1.00 84.34  ? 2014 DG  D P     1 
ATOM   568  O  OP1   . DG  B 2 14  ? 10.246 -10.070 36.707 1.00 84.58  ? 2014 DG  D OP1   1 
ATOM   569  O  OP2   . DG  B 2 14  ? 8.286  -8.778  37.757 1.00 84.41  ? 2014 DG  D OP2   1 
ATOM   570  O  "O5'" . DG  B 2 14  ? 8.932  -11.048 38.589 1.00 84.46  ? 2014 DG  D "O5'" 1 
ATOM   571  C  "C5'" . DG  B 2 14  ? 8.004  -11.009 39.669 1.00 83.16  ? 2014 DG  D "C5'" 1 
ATOM   572  C  "C4'" . DG  B 2 14  ? 8.604  -11.664 40.890 1.00 81.63  ? 2014 DG  D "C4'" 1 
ATOM   573  O  "O4'" . DG  B 2 14  ? 9.339  -10.682 41.668 1.00 77.44  ? 2014 DG  D "O4'" 1 
ATOM   574  C  "C3'" . DG  B 2 14  ? 7.561  -12.251 41.838 1.00 81.98  ? 2014 DG  D "C3'" 1 
ATOM   575  O  "O3'" . DG  B 2 14  ? 8.045  -13.487 42.365 1.00 87.35  ? 2014 DG  D "O3'" 1 
ATOM   576  C  "C2'" . DG  B 2 14  ? 7.443  -11.206 42.930 1.00 78.23  ? 2014 DG  D "C2'" 1 
ATOM   577  C  "C1'" . DG  B 2 14  ? 8.859  -10.680 43.006 1.00 73.40  ? 2014 DG  D "C1'" 1 
ATOM   578  N  N9    . DG  B 2 14  ? 8.972  -9.326  43.542 1.00 66.93  ? 2014 DG  D N9    1 
ATOM   579  C  C8    . DG  B 2 14  ? 8.552  -8.152  42.958 1.00 65.28  ? 2014 DG  D C8    1 
ATOM   580  N  N7    . DG  B 2 14  ? 8.786  -7.100  43.697 1.00 64.05  ? 2014 DG  D N7    1 
ATOM   581  C  C5    . DG  B 2 14  ? 9.399  -7.608  44.836 1.00 59.71  ? 2014 DG  D C5    1 
ATOM   582  C  C6    . DG  B 2 14  ? 9.877  -6.945  45.997 1.00 58.46  ? 2014 DG  D C6    1 
ATOM   583  O  O6    . DG  B 2 14  ? 9.854  -5.734  46.259 1.00 57.00  ? 2014 DG  D O6    1 
ATOM   584  N  N1    . DG  B 2 14  ? 10.425 -7.844  46.910 1.00 58.22  ? 2014 DG  D N1    1 
ATOM   585  C  C2    . DG  B 2 14  ? 10.505 -9.207  46.729 1.00 58.99  ? 2014 DG  D C2    1 
ATOM   586  N  N2    . DG  B 2 14  ? 11.075 -9.914  47.726 1.00 55.58  ? 2014 DG  D N2    1 
ATOM   587  N  N3    . DG  B 2 14  ? 10.062 -9.833  45.652 1.00 59.83  ? 2014 DG  D N3    1 
ATOM   588  C  C4    . DG  B 2 14  ? 9.523  -8.980  44.754 1.00 61.65  ? 2014 DG  D C4    1 
ATOM   589  P  P     . DA  B 2 15  ? 7.005  -14.631 42.798 1.00 89.98  ? 2015 DA  D P     1 
ATOM   590  O  OP1   . DA  B 2 15  ? 7.577  -15.936 42.373 1.00 90.28  ? 2015 DA  D OP1   1 
ATOM   591  O  OP2   . DA  B 2 15  ? 5.644  -14.240 42.340 1.00 89.69  ? 2015 DA  D OP2   1 
ATOM   592  O  "O5'" . DA  B 2 15  ? 7.025  -14.563 44.387 1.00 88.54  ? 2015 DA  D "O5'" 1 
ATOM   593  C  "C5'" . DA  B 2 15  ? 8.170  -14.993 45.117 1.00 85.83  ? 2015 DA  D "C5'" 1 
ATOM   594  C  "C4'" . DA  B 2 15  ? 8.033  -14.615 46.573 1.00 83.46  ? 2015 DA  D "C4'" 1 
ATOM   595  O  "O4'" . DA  B 2 15  ? 8.137  -13.175 46.705 1.00 81.90  ? 2015 DA  D "O4'" 1 
ATOM   596  C  "C3'" . DA  B 2 15  ? 6.698  -15.010 47.214 1.00 83.12  ? 2015 DA  D "C3'" 1 
ATOM   597  O  "O3'" . DA  B 2 15  ? 6.866  -15.388 48.587 1.00 84.99  ? 2015 DA  D "O3'" 1 
ATOM   598  C  "C2'" . DA  B 2 15  ? 5.903  -13.716 47.177 1.00 80.12  ? 2015 DA  D "C2'" 1 
ATOM   599  C  "C1'" . DA  B 2 15  ? 6.994  -12.671 47.380 1.00 76.02  ? 2015 DA  D "C1'" 1 
ATOM   600  N  N9    . DA  B 2 15  ? 6.695  -11.342 46.839 1.00 68.57  ? 2015 DA  D N9    1 
ATOM   601  C  C8    . DA  B 2 15  ? 6.059  -11.036 45.661 1.00 67.20  ? 2015 DA  D C8    1 
ATOM   602  N  N7    . DA  B 2 15  ? 5.915  -9.750  45.455 1.00 63.03  ? 2015 DA  D N7    1 
ATOM   603  C  C5    . DA  B 2 15  ? 6.497  -9.167  46.570 1.00 57.97  ? 2015 DA  D C5    1 
ATOM   604  C  C6    . DA  B 2 15  ? 6.660  -7.827  46.954 1.00 54.61  ? 2015 DA  D C6    1 
ATOM   605  N  N6    . DA  B 2 15  ? 6.233  -6.796  46.221 1.00 51.25  ? 2015 DA  D N6    1 
ATOM   606  N  N1    . DA  B 2 15  ? 7.281  -7.580  48.128 1.00 50.45  ? 2015 DA  D N1    1 
ATOM   607  C  C2    . DA  B 2 15  ? 7.709  -8.620  48.856 1.00 55.17  ? 2015 DA  D C2    1 
ATOM   608  N  N3    . DA  B 2 15  ? 7.616  -9.924  48.601 1.00 57.02  ? 2015 DA  D N3    1 
ATOM   609  C  C4    . DA  B 2 15  ? 6.989  -10.134 47.429 1.00 61.72  ? 2015 DA  D C4    1 
ATOM   610  N  N     . PHE C 3 7   ? 10.034 -17.314 34.811 1.00 77.04  ? 7    PHE A N     1 
ATOM   611  C  CA    . PHE C 3 7   ? 9.463  -17.241 33.441 1.00 78.08  ? 7    PHE A CA    1 
ATOM   612  C  C     . PHE C 3 7   ? 10.346 -16.371 32.514 1.00 79.05  ? 7    PHE A C     1 
ATOM   613  O  O     . PHE C 3 7   ? 10.557 -15.195 32.792 1.00 83.65  ? 7    PHE A O     1 
ATOM   614  C  CB    . PHE C 3 7   ? 8.053  -16.620 33.475 1.00 73.04  ? 7    PHE A CB    1 
ATOM   615  C  CG    . PHE C 3 7   ? 7.057  -17.336 34.360 1.00 68.76  ? 7    PHE A CG    1 
ATOM   616  C  CD1   . PHE C 3 7   ? 6.828  -16.885 35.657 1.00 66.61  ? 7    PHE A CD1   1 
ATOM   617  C  CD2   . PHE C 3 7   ? 6.308  -18.442 33.874 1.00 65.79  ? 7    PHE A CD2   1 
ATOM   618  C  CE1   . PHE C 3 7   ? 5.870  -17.515 36.477 1.00 66.92  ? 7    PHE A CE1   1 
ATOM   619  C  CE2   . PHE C 3 7   ? 5.335  -19.091 34.688 1.00 66.05  ? 7    PHE A CE2   1 
ATOM   620  C  CZ    . PHE C 3 7   ? 5.116  -18.626 35.989 1.00 62.87  ? 7    PHE A CZ    1 
ATOM   621  N  N     . THR C 3 8   ? 10.874 -16.967 31.448 1.00 81.31  ? 8    THR A N     1 
ATOM   622  C  CA    . THR C 3 8   ? 11.696 -16.273 30.478 1.00 82.01  ? 8    THR A CA    1 
ATOM   623  C  C     . THR C 3 8   ? 11.011 -16.314 29.111 1.00 81.04  ? 8    THR A C     1 
ATOM   624  O  O     . THR C 3 8   ? 11.274 -17.216 28.302 1.00 83.01  ? 8    THR A O     1 
ATOM   625  C  CB    . THR C 3 8   ? 13.065 -16.942 30.388 1.00 81.44  ? 8    THR A CB    1 
ATOM   626  O  OG1   . THR C 3 8   ? 13.756 -16.729 31.623 1.00 85.13  ? 8    THR A OG1   1 
ATOM   627  C  CG2   . THR C 3 8   ? 13.872 -16.374 29.208 1.00 74.44  ? 8    THR A CG2   1 
ATOM   628  N  N     . PRO C 3 9   ? 10.156 -15.311 28.830 1.00 79.83  ? 9    PRO A N     1 
ATOM   629  C  CA    . PRO C 3 9   ? 9.373  -15.135 27.601 1.00 76.79  ? 9    PRO A CA    1 
ATOM   630  C  C     . PRO C 3 9   ? 9.764  -15.957 26.386 1.00 73.08  ? 9    PRO A C     1 
ATOM   631  O  O     . PRO C 3 9   ? 10.919 -15.956 25.973 1.00 75.48  ? 9    PRO A O     1 
ATOM   632  C  CB    . PRO C 3 9   ? 9.435  -13.621 27.350 1.00 78.09  ? 9    PRO A CB    1 
ATOM   633  C  CG    . PRO C 3 9   ? 10.496 -13.106 28.324 1.00 81.11  ? 9    PRO A CG    1 
ATOM   634  C  CD    . PRO C 3 9   ? 10.297 -14.016 29.507 1.00 81.25  ? 9    PRO A CD    1 
ATOM   635  N  N     . PRO C 3 10  ? 8.785  -16.656 25.775 1.00 68.86  ? 10   PRO A N     1 
ATOM   636  C  CA    . PRO C 3 10  ? 9.031  -17.492 24.591 1.00 62.47  ? 10   PRO A CA    1 
ATOM   637  C  C     . PRO C 3 10  ? 9.745  -16.714 23.479 1.00 55.25  ? 10   PRO A C     1 
ATOM   638  O  O     . PRO C 3 10  ? 10.567 -17.279 22.755 1.00 52.87  ? 10   PRO A O     1 
ATOM   639  C  CB    . PRO C 3 10  ? 7.629  -17.946 24.191 1.00 62.50  ? 10   PRO A CB    1 
ATOM   640  C  CG    . PRO C 3 10  ? 6.748  -16.834 24.694 1.00 65.44  ? 10   PRO A CG    1 
ATOM   641  C  CD    . PRO C 3 10  ? 7.341  -16.568 26.051 1.00 67.51  ? 10   PRO A CD    1 
ATOM   642  N  N     . ILE C 3 11  ? 9.444  -15.420 23.361 1.00 52.54  ? 11   ILE A N     1 
ATOM   643  C  CA    . ILE C 3 11  ? 10.080 -14.570 22.355 1.00 49.72  ? 11   ILE A CA    1 
ATOM   644  C  C     . ILE C 3 11  ? 11.605 -14.779 22.437 1.00 43.55  ? 11   ILE A C     1 
ATOM   645  O  O     . ILE C 3 11  ? 12.278 -14.919 21.413 1.00 40.86  ? 11   ILE A O     1 
ATOM   646  C  CB    . ILE C 3 11  ? 9.725  -13.065 22.596 1.00 50.96  ? 11   ILE A CB    1 
ATOM   647  C  CG1   . ILE C 3 11  ? 10.222 -12.201 21.433 1.00 51.45  ? 11   ILE A CG1   1 
ATOM   648  C  CG2   . ILE C 3 11  ? 10.333 -12.580 23.906 1.00 50.66  ? 11   ILE A CG2   1 
ATOM   649  C  CD1   . ILE C 3 11  ? 9.425  -12.359 20.162 1.00 50.11  ? 11   ILE A CD1   1 
ATOM   650  N  N     . VAL C 3 12  ? 12.131 -14.827 23.661 1.00 40.36  ? 12   VAL A N     1 
ATOM   651  C  CA    . VAL C 3 12  ? 13.562 -15.042 23.890 1.00 44.55  ? 12   VAL A CA    1 
ATOM   652  C  C     . VAL C 3 12  ? 13.982 -16.451 23.459 1.00 41.39  ? 12   VAL A C     1 
ATOM   653  O  O     . VAL C 3 12  ? 15.080 -16.649 22.930 1.00 38.92  ? 12   VAL A O     1 
ATOM   654  C  CB    . VAL C 3 12  ? 13.936 -14.861 25.394 1.00 46.67  ? 12   VAL A CB    1 
ATOM   655  C  CG1   . VAL C 3 12  ? 15.427 -15.144 25.606 1.00 45.29  ? 12   VAL A CG1   1 
ATOM   656  C  CG2   . VAL C 3 12  ? 13.587 -13.464 25.857 1.00 46.16  ? 12   VAL A CG2   1 
ATOM   657  N  N     . LYS C 3 13  ? 13.111 -17.426 23.709 1.00 42.54  ? 13   LYS A N     1 
ATOM   658  C  CA    . LYS C 3 13  ? 13.381 -18.810 23.331 1.00 45.62  ? 13   LYS A CA    1 
ATOM   659  C  C     . LYS C 3 13  ? 13.381 -18.897 21.811 1.00 46.21  ? 13   LYS A C     1 
ATOM   660  O  O     . LYS C 3 13  ? 14.270 -19.506 21.205 1.00 42.89  ? 13   LYS A O     1 
ATOM   661  C  CB    . LYS C 3 13  ? 12.305 -19.744 23.896 1.00 49.80  ? 13   LYS A CB    1 
ATOM   662  C  CG    . LYS C 3 13  ? 12.192 -19.758 25.415 1.00 51.67  ? 13   LYS A CG    1 
ATOM   663  C  CD    . LYS C 3 13  ? 13.486 -20.211 26.094 1.00 60.22  ? 13   LYS A CD    1 
ATOM   664  C  CE    . LYS C 3 13  ? 13.940 -21.609 25.661 1.00 62.17  ? 13   LYS A CE    1 
ATOM   665  N  NZ    . LYS C 3 13  ? 14.448 -21.652 24.253 1.00 67.81  ? 13   LYS A NZ    1 
ATOM   666  N  N     . ARG C 3 14  ? 12.378 -18.275 21.197 1.00 45.98  ? 14   ARG A N     1 
ATOM   667  C  CA    . ARG C 3 14  ? 12.275 -18.275 19.748 1.00 48.48  ? 14   ARG A CA    1 
ATOM   668  C  C     . ARG C 3 14  ? 13.533 -17.669 19.146 1.00 48.73  ? 14   ARG A C     1 
ATOM   669  O  O     . ARG C 3 14  ? 14.190 -18.295 18.307 1.00 47.26  ? 14   ARG A O     1 
ATOM   670  C  CB    . ARG C 3 14  ? 11.045 -17.484 19.304 1.00 51.81  ? 14   ARG A CB    1 
ATOM   671  C  CG    . ARG C 3 14  ? 9.751  -18.012 19.901 1.00 62.06  ? 14   ARG A CG    1 
ATOM   672  C  CD    . ARG C 3 14  ? 8.524  -17.649 19.065 1.00 68.94  ? 14   ARG A CD    1 
ATOM   673  N  NE    . ARG C 3 14  ? 8.221  -16.220 19.069 1.00 75.39  ? 14   ARG A NE    1 
ATOM   674  C  CZ    . ARG C 3 14  ? 8.508  -15.381 18.076 1.00 78.53  ? 14   ARG A CZ    1 
ATOM   675  N  NH1   . ARG C 3 14  ? 9.114  -15.818 16.976 1.00 77.77  ? 14   ARG A NH1   1 
ATOM   676  N  NH2   . ARG C 3 14  ? 8.175  -14.100 18.180 1.00 79.81  ? 14   ARG A NH2   1 
ATOM   677  N  N     . LEU C 3 15  ? 13.877 -16.461 19.602 1.00 49.60  ? 15   LEU A N     1 
ATOM   678  C  CA    . LEU C 3 15  ? 15.054 -15.740 19.108 1.00 49.53  ? 15   LEU A CA    1 
ATOM   679  C  C     . LEU C 3 15  ? 16.360 -16.469 19.379 1.00 45.04  ? 15   LEU A C     1 
ATOM   680  O  O     . LEU C 3 15  ? 17.305 -16.365 18.601 1.00 40.17  ? 15   LEU A O     1 
ATOM   681  C  CB    . LEU C 3 15  ? 15.105 -14.335 19.715 1.00 53.35  ? 15   LEU A CB    1 
ATOM   682  C  CG    . LEU C 3 15  ? 13.977 -13.412 19.241 1.00 54.48  ? 15   LEU A CG    1 
ATOM   683  C  CD1   . LEU C 3 15  ? 14.031 -12.102 19.996 1.00 53.01  ? 15   LEU A CD1   1 
ATOM   684  C  CD2   . LEU C 3 15  ? 14.105 -13.178 17.738 1.00 55.63  ? 15   LEU A CD2   1 
ATOM   685  N  N     . LEU C 3 16  ? 16.413 -17.193 20.492 1.00 47.30  ? 16   LEU A N     1 
ATOM   686  C  CA    . LEU C 3 16  ? 17.598 -17.967 20.843 1.00 49.23  ? 16   LEU A CA    1 
ATOM   687  C  C     . LEU C 3 16  ? 17.812 -19.008 19.765 1.00 51.96  ? 16   LEU A C     1 
ATOM   688  O  O     . LEU C 3 16  ? 18.943 -19.364 19.446 1.00 53.94  ? 16   LEU A O     1 
ATOM   689  C  CB    . LEU C 3 16  ? 17.394 -18.687 22.171 1.00 48.17  ? 16   LEU A CB    1 
ATOM   690  C  CG    . LEU C 3 16  ? 17.737 -17.949 23.455 1.00 48.69  ? 16   LEU A CG    1 
ATOM   691  C  CD1   . LEU C 3 16  ? 17.573 -18.902 24.631 1.00 49.86  ? 16   LEU A CD1   1 
ATOM   692  C  CD2   . LEU C 3 16  ? 19.168 -17.434 23.381 1.00 46.73  ? 16   LEU A CD2   1 
ATOM   693  N  N     . GLY C 3 17  ? 16.701 -19.496 19.219 1.00 56.29  ? 17   GLY A N     1 
ATOM   694  C  CA    . GLY C 3 17  ? 16.743 -20.509 18.184 1.00 59.61  ? 17   GLY A CA    1 
ATOM   695  C  C     . GLY C 3 17  ? 17.633 -20.171 17.009 1.00 62.05  ? 17   GLY A C     1 
ATOM   696  O  O     . GLY C 3 17  ? 18.251 -21.059 16.429 1.00 63.13  ? 17   GLY A O     1 
ATOM   697  N  N     . TRP C 3 18  ? 17.709 -18.894 16.654 1.00 64.41  ? 18   TRP A N     1 
ATOM   698  C  CA    . TRP C 3 18  ? 18.533 -18.481 15.527 1.00 69.10  ? 18   TRP A CA    1 
ATOM   699  C  C     . TRP C 3 18  ? 19.995 -18.314 15.917 1.00 72.42  ? 18   TRP A C     1 
ATOM   700  O  O     . TRP C 3 18  ? 20.536 -17.219 15.881 1.00 73.16  ? 18   TRP A O     1 
ATOM   701  C  CB    . TRP C 3 18  ? 17.977 -17.188 14.924 1.00 68.38  ? 18   TRP A CB    1 
ATOM   702  C  CG    . TRP C 3 18  ? 16.595 -17.376 14.367 1.00 69.86  ? 18   TRP A CG    1 
ATOM   703  C  CD1   . TRP C 3 18  ? 15.431 -17.476 15.074 1.00 68.82  ? 18   TRP A CD1   1 
ATOM   704  C  CD2   . TRP C 3 18  ? 16.246 -17.573 12.991 1.00 68.87  ? 18   TRP A CD2   1 
ATOM   705  N  NE1   . TRP C 3 18  ? 14.379 -17.729 14.225 1.00 70.12  ? 18   TRP A NE1   1 
ATOM   706  C  CE2   . TRP C 3 18  ? 14.852 -17.794 12.941 1.00 69.25  ? 18   TRP A CE2   1 
ATOM   707  C  CE3   . TRP C 3 18  ? 16.978 -17.590 11.796 1.00 68.26  ? 18   TRP A CE3   1 
ATOM   708  C  CZ2   . TRP C 3 18  ? 14.174 -18.028 11.742 1.00 70.15  ? 18   TRP A CZ2   1 
ATOM   709  C  CZ3   . TRP C 3 18  ? 16.304 -17.823 10.602 1.00 69.64  ? 18   TRP A CZ3   1 
ATOM   710  C  CH2   . TRP C 3 18  ? 14.915 -18.040 10.586 1.00 70.66  ? 18   TRP A CH2   1 
ATOM   711  N  N     . LYS C 3 19  ? 20.624 -19.434 16.261 1.00 81.16  ? 19   LYS A N     1 
ATOM   712  C  CA    . LYS C 3 19  ? 22.019 -19.495 16.695 1.00 85.78  ? 19   LYS A CA    1 
ATOM   713  C  C     . LYS C 3 19  ? 22.081 -19.192 18.183 1.00 92.26  ? 19   LYS A C     1 
ATOM   714  O  O     . LYS C 3 19  ? 22.292 -18.047 18.585 1.00 92.73  ? 19   LYS A O     1 
ATOM   715  C  CB    . LYS C 3 19  ? 22.900 -18.495 15.944 1.00 83.81  ? 19   LYS A CB    1 
ATOM   716  C  CG    . LYS C 3 19  ? 24.311 -18.391 16.515 1.00 83.85  ? 19   LYS A CG    1 
ATOM   717  C  CD    . LYS C 3 19  ? 25.217 -19.510 16.041 1.00 80.70  ? 19   LYS A CD    1 
ATOM   718  C  CE    . LYS C 3 19  ? 25.951 -19.098 14.773 1.00 81.93  ? 19   LYS A CE    1 
ATOM   719  N  NZ    . LYS C 3 19  ? 25.023 -18.613 13.710 1.00 77.57  ? 19   LYS A NZ    1 
ATOM   720  N  N     . LYS C 3 20  ? 21.877 -20.226 18.993 1.00 98.65  ? 20   LYS A N     1 
ATOM   721  C  CA    . LYS C 3 20  ? 21.920 -20.095 20.445 1.00 103.91 ? 20   LYS A CA    1 
ATOM   722  C  C     . LYS C 3 20  ? 23.263 -19.506 20.869 1.00 106.23 ? 20   LYS A C     1 
ATOM   723  O  O     . LYS C 3 20  ? 23.322 -18.418 21.444 1.00 108.35 ? 20   LYS A O     1 
ATOM   724  C  CB    . LYS C 3 20  ? 21.725 -21.466 21.103 1.00 105.35 ? 20   LYS A CB    1 
ATOM   725  C  CG    . LYS C 3 20  ? 22.699 -22.531 20.611 1.00 107.09 ? 20   LYS A CG    1 
ATOM   726  C  CD    . LYS C 3 20  ? 22.569 -23.827 21.392 1.00 109.40 ? 20   LYS A CD    1 
ATOM   727  C  CE    . LYS C 3 20  ? 23.623 -24.834 20.953 1.00 110.13 ? 20   LYS A CE    1 
ATOM   728  N  NZ    . LYS C 3 20  ? 23.564 -26.091 21.747 1.00 110.65 ? 20   LYS A NZ    1 
ATOM   729  N  N     . GLY C 3 21  ? 24.338 -20.233 20.570 1.00 107.98 ? 21   GLY A N     1 
ATOM   730  C  CA    . GLY C 3 21  ? 25.675 -19.787 20.920 1.00 108.22 ? 21   GLY A CA    1 
ATOM   731  C  C     . GLY C 3 21  ? 26.610 -20.963 21.122 1.00 107.93 ? 21   GLY A C     1 
ATOM   732  O  O     . GLY C 3 21  ? 26.976 -21.280 22.252 1.00 107.35 ? 21   GLY A O     1 
ATOM   733  N  N     . GLU C 3 22  ? 26.987 -21.603 20.015 1.00 109.51 ? 22   GLU A N     1 
ATOM   734  C  CA    . GLU C 3 22  ? 27.878 -22.765 20.010 1.00 109.43 ? 22   GLU A CA    1 
ATOM   735  C  C     . GLU C 3 22  ? 28.155 -23.382 21.373 1.00 108.89 ? 22   GLU A C     1 
ATOM   736  O  O     . GLU C 3 22  ? 29.261 -23.291 21.911 1.00 108.88 ? 22   GLU A O     1 
ATOM   737  C  CB    . GLU C 3 22  ? 29.188 -22.411 19.304 1.00 109.47 ? 22   GLU A CB    1 
ATOM   738  C  CG    . GLU C 3 22  ? 29.189 -22.822 17.841 1.00 110.30 ? 22   GLU A CG    1 
ATOM   739  C  CD    . GLU C 3 22  ? 27.823 -22.665 17.189 1.00 110.00 ? 22   GLU A CD    1 
ATOM   740  O  OE1   . GLU C 3 22  ? 27.403 -21.517 16.933 1.00 109.08 ? 22   GLU A OE1   1 
ATOM   741  O  OE2   . GLU C 3 22  ? 27.164 -23.697 16.942 1.00 110.61 ? 22   GLU A OE2   1 
ATOM   742  N  N     . GLN C 3 23  ? 27.117 -24.017 21.908 1.00 108.19 ? 23   GLN A N     1 
ATOM   743  C  CA    . GLN C 3 23  ? 27.132 -24.693 23.201 1.00 106.61 ? 23   GLN A CA    1 
ATOM   744  C  C     . GLN C 3 23  ? 28.032 -24.145 24.305 1.00 102.74 ? 23   GLN A C     1 
ATOM   745  O  O     . GLN C 3 23  ? 28.268 -22.940 24.398 1.00 103.85 ? 23   GLN A O     1 
ATOM   746  C  CB    . GLN C 3 23  ? 27.425 -26.183 23.006 1.00 109.23 ? 23   GLN A CB    1 
ATOM   747  C  CG    . GLN C 3 23  ? 26.226 -27.064 23.311 1.00 112.71 ? 23   GLN A CG    1 
ATOM   748  C  CD    . GLN C 3 23  ? 25.569 -26.706 24.639 1.00 114.80 ? 23   GLN A CD    1 
ATOM   749  O  OE1   . GLN C 3 23  ? 26.220 -26.699 25.687 1.00 115.51 ? 23   GLN A OE1   1 
ATOM   750  N  NE2   . GLN C 3 23  ? 24.274 -26.405 24.599 1.00 115.62 ? 23   GLN A NE2   1 
ATOM   751  N  N     . ASN C 3 24  ? 28.517 -25.060 25.140 1.00 97.32  ? 24   ASN A N     1 
ATOM   752  C  CA    . ASN C 3 24  ? 29.365 -24.746 26.281 1.00 91.48  ? 24   ASN A CA    1 
ATOM   753  C  C     . ASN C 3 24  ? 28.440 -24.331 27.411 1.00 89.20  ? 24   ASN A C     1 
ATOM   754  O  O     . ASN C 3 24  ? 28.293 -23.149 27.698 1.00 90.65  ? 24   ASN A O     1 
ATOM   755  C  CB    . ASN C 3 24  ? 30.332 -23.607 25.960 1.00 90.18  ? 24   ASN A CB    1 
ATOM   756  C  CG    . ASN C 3 24  ? 31.301 -23.337 27.089 1.00 88.59  ? 24   ASN A CG    1 
ATOM   757  O  OD1   . ASN C 3 24  ? 30.903 -23.203 28.246 1.00 85.61  ? 24   ASN A OD1   1 
ATOM   758  N  ND2   . ASN C 3 24  ? 32.584 -23.249 26.758 1.00 88.21  ? 24   ASN A ND2   1 
ATOM   759  N  N     . GLY C 3 25  ? 27.805 -25.323 28.026 1.00 86.63  ? 25   GLY A N     1 
ATOM   760  C  CA    . GLY C 3 25  ? 26.880 -25.095 29.125 1.00 83.82  ? 25   GLY A CA    1 
ATOM   761  C  C     . GLY C 3 25  ? 26.699 -23.681 29.652 1.00 81.10  ? 25   GLY A C     1 
ATOM   762  O  O     . GLY C 3 25  ? 25.639 -23.079 29.475 1.00 81.57  ? 25   GLY A O     1 
ATOM   763  N  N     . GLN C 3 26  ? 27.727 -23.150 30.307 1.00 77.82  ? 26   GLN A N     1 
ATOM   764  C  CA    . GLN C 3 26  ? 27.666 -21.808 30.877 1.00 76.49  ? 26   GLN A CA    1 
ATOM   765  C  C     . GLN C 3 26  ? 27.446 -20.757 29.798 1.00 74.32  ? 26   GLN A C     1 
ATOM   766  O  O     . GLN C 3 26  ? 26.622 -19.853 29.950 1.00 71.30  ? 26   GLN A O     1 
ATOM   767  C  CB    . GLN C 3 26  ? 28.961 -21.504 31.637 1.00 80.04  ? 26   GLN A CB    1 
ATOM   768  C  CG    . GLN C 3 26  ? 28.857 -20.350 32.627 1.00 84.48  ? 26   GLN A CG    1 
ATOM   769  C  CD    . GLN C 3 26  ? 27.874 -20.623 33.763 1.00 86.11  ? 26   GLN A CD    1 
ATOM   770  O  OE1   . GLN C 3 26  ? 27.704 -19.796 34.659 1.00 87.79  ? 26   GLN A OE1   1 
ATOM   771  N  NE2   . GLN C 3 26  ? 27.224 -21.782 33.727 1.00 86.19  ? 26   GLN A NE2   1 
ATOM   772  N  N     . GLU C 3 27  ? 28.192 -20.886 28.708 1.00 71.05  ? 27   GLU A N     1 
ATOM   773  C  CA    . GLU C 3 27  ? 28.093 -19.961 27.593 1.00 70.54  ? 27   GLU A CA    1 
ATOM   774  C  C     . GLU C 3 27  ? 26.661 -19.906 27.069 1.00 67.22  ? 27   GLU A C     1 
ATOM   775  O  O     . GLU C 3 27  ? 26.160 -18.845 26.698 1.00 64.79  ? 27   GLU A O     1 
ATOM   776  C  CB    . GLU C 3 27  ? 29.037 -20.397 26.473 1.00 73.36  ? 27   GLU A CB    1 
ATOM   777  C  CG    . GLU C 3 27  ? 29.332 -19.294 25.482 1.00 82.09  ? 27   GLU A CG    1 
ATOM   778  C  CD    . GLU C 3 27  ? 30.050 -18.121 26.126 1.00 85.27  ? 27   GLU A CD    1 
ATOM   779  O  OE1   . GLU C 3 27  ? 30.198 -17.072 25.463 1.00 88.39  ? 27   GLU A OE1   1 
ATOM   780  O  OE2   . GLU C 3 27  ? 30.471 -18.250 27.296 1.00 87.41  ? 27   GLU A OE2   1 
ATOM   781  N  N     . GLU C 3 28  ? 26.014 -21.064 27.039 1.00 62.86  ? 28   GLU A N     1 
ATOM   782  C  CA    . GLU C 3 28  ? 24.640 -21.172 26.573 1.00 60.31  ? 28   GLU A CA    1 
ATOM   783  C  C     . GLU C 3 28  ? 23.732 -20.260 27.391 1.00 56.89  ? 28   GLU A C     1 
ATOM   784  O  O     . GLU C 3 28  ? 22.901 -19.527 26.841 1.00 53.20  ? 28   GLU A O     1 
ATOM   785  C  CB    . GLU C 3 28  ? 24.166 -22.622 26.701 1.00 64.60  ? 28   GLU A CB    1 
ATOM   786  C  CG    . GLU C 3 28  ? 22.726 -22.857 26.280 1.00 73.18  ? 28   GLU A CG    1 
ATOM   787  C  CD    . GLU C 3 28  ? 22.491 -22.572 24.806 1.00 76.70  ? 28   GLU A CD    1 
ATOM   788  O  OE1   . GLU C 3 28  ? 21.329 -22.688 24.357 1.00 79.01  ? 28   GLU A OE1   1 
ATOM   789  O  OE2   . GLU C 3 28  ? 23.465 -22.237 24.096 1.00 79.85  ? 28   GLU A OE2   1 
ATOM   790  N  N     . LYS C 3 29  ? 23.896 -20.304 28.708 1.00 52.17  ? 29   LYS A N     1 
ATOM   791  C  CA    . LYS C 3 29  ? 23.085 -19.481 29.590 1.00 51.20  ? 29   LYS A CA    1 
ATOM   792  C  C     . LYS C 3 29  ? 23.421 -17.991 29.451 1.00 46.69  ? 29   LYS A C     1 
ATOM   793  O  O     . LYS C 3 29  ? 22.584 -17.133 29.728 1.00 44.59  ? 29   LYS A O     1 
ATOM   794  C  CB    . LYS C 3 29  ? 23.265 -19.937 31.039 1.00 55.13  ? 29   LYS A CB    1 
ATOM   795  C  CG    . LYS C 3 29  ? 22.249 -19.356 32.013 1.00 61.35  ? 29   LYS A CG    1 
ATOM   796  C  CD    . LYS C 3 29  ? 20.816 -19.697 31.607 1.00 66.29  ? 29   LYS A CD    1 
ATOM   797  C  CE    . LYS C 3 29  ? 19.817 -19.344 32.706 1.00 67.34  ? 29   LYS A CE    1 
ATOM   798  N  NZ    . LYS C 3 29  ? 19.946 -17.938 33.170 1.00 69.65  ? 29   LYS A NZ    1 
ATOM   799  N  N     . TRP C 3 30  ? 24.636 -17.685 29.011 1.00 40.66  ? 30   TRP A N     1 
ATOM   800  C  CA    . TRP C 3 30  ? 25.034 -16.294 28.847 1.00 44.54  ? 30   TRP A CA    1 
ATOM   801  C  C     . TRP C 3 30  ? 24.235 -15.658 27.717 1.00 43.19  ? 30   TRP A C     1 
ATOM   802  O  O     . TRP C 3 30  ? 23.607 -14.609 27.895 1.00 39.70  ? 30   TRP A O     1 
ATOM   803  C  CB    . TRP C 3 30  ? 26.526 -16.175 28.531 1.00 45.74  ? 30   TRP A CB    1 
ATOM   804  C  CG    . TRP C 3 30  ? 26.994 -14.742 28.542 1.00 47.56  ? 30   TRP A CG    1 
ATOM   805  C  CD1   . TRP C 3 30  ? 27.301 -13.985 29.644 1.00 46.81  ? 30   TRP A CD1   1 
ATOM   806  C  CD2   . TRP C 3 30  ? 27.146 -13.874 27.408 1.00 44.18  ? 30   TRP A CD2   1 
ATOM   807  N  NE1   . TRP C 3 30  ? 27.630 -12.702 29.263 1.00 45.70  ? 30   TRP A NE1   1 
ATOM   808  C  CE2   . TRP C 3 30  ? 27.544 -12.608 27.899 1.00 43.21  ? 30   TRP A CE2   1 
ATOM   809  C  CE3   . TRP C 3 30  ? 26.980 -14.043 26.029 1.00 47.56  ? 30   TRP A CE3   1 
ATOM   810  C  CZ2   . TRP C 3 30  ? 27.783 -11.519 27.055 1.00 42.15  ? 30   TRP A CZ2   1 
ATOM   811  C  CZ3   . TRP C 3 30  ? 27.215 -12.956 25.190 1.00 46.39  ? 30   TRP A CZ3   1 
ATOM   812  C  CH2   . TRP C 3 30  ? 27.612 -11.710 25.709 1.00 43.58  ? 30   TRP A CH2   1 
ATOM   813  N  N     . CYS C 3 31  ? 24.271 -16.305 26.556 1.00 40.45  ? 31   CYS A N     1 
ATOM   814  C  CA    . CYS C 3 31  ? 23.556 -15.833 25.384 1.00 37.50  ? 31   CYS A CA    1 
ATOM   815  C  C     . CYS C 3 31  ? 22.086 -15.596 25.719 1.00 38.06  ? 31   CYS A C     1 
ATOM   816  O  O     . CYS C 3 31  ? 21.469 -14.681 25.182 1.00 40.15  ? 31   CYS A O     1 
ATOM   817  C  CB    . CYS C 3 31  ? 23.687 -16.846 24.241 1.00 36.79  ? 31   CYS A CB    1 
ATOM   818  S  SG    . CYS C 3 31  ? 25.372 -17.058 23.607 1.00 40.88  ? 31   CYS A SG    1 
ATOM   819  N  N     . GLU C 3 32  ? 21.524 -16.410 26.606 1.00 37.22  ? 32   GLU A N     1 
ATOM   820  C  CA    . GLU C 3 32  ? 20.128 -16.222 26.990 1.00 40.68  ? 32   GLU A CA    1 
ATOM   821  C  C     . GLU C 3 32  ? 19.989 -14.903 27.741 1.00 36.99  ? 32   GLU A C     1 
ATOM   822  O  O     . GLU C 3 32  ? 19.050 -14.136 27.504 1.00 36.43  ? 32   GLU A O     1 
ATOM   823  C  CB    . GLU C 3 32  ? 19.627 -17.371 27.873 1.00 44.20  ? 32   GLU A CB    1 
ATOM   824  C  CG    . GLU C 3 32  ? 18.280 -17.062 28.532 1.00 57.34  ? 32   GLU A CG    1 
ATOM   825  C  CD    . GLU C 3 32  ? 17.696 -18.229 29.302 1.00 62.32  ? 32   GLU A CD    1 
ATOM   826  O  OE1   . GLU C 3 32  ? 16.762 -17.999 30.104 1.00 64.47  ? 32   GLU A OE1   1 
ATOM   827  O  OE2   . GLU C 3 32  ? 18.157 -19.372 29.097 1.00 66.47  ? 32   GLU A OE2   1 
ATOM   828  N  N     . LYS C 3 33  ? 20.929 -14.659 28.653 1.00 38.24  ? 33   LYS A N     1 
ATOM   829  C  CA    . LYS C 3 33  ? 20.971 -13.424 29.440 1.00 33.69  ? 33   LYS A CA    1 
ATOM   830  C  C     . LYS C 3 33  ? 21.093 -12.251 28.460 1.00 29.42  ? 33   LYS A C     1 
ATOM   831  O  O     . LYS C 3 33  ? 20.401 -11.243 28.594 1.00 30.20  ? 33   LYS A O     1 
ATOM   832  C  CB    . LYS C 3 33  ? 22.202 -13.408 30.354 1.00 39.41  ? 33   LYS A CB    1 
ATOM   833  C  CG    . LYS C 3 33  ? 22.364 -14.588 31.311 1.00 44.83  ? 33   LYS A CG    1 
ATOM   834  C  CD    . LYS C 3 33  ? 21.547 -14.417 32.571 1.00 49.52  ? 33   LYS A CD    1 
ATOM   835  C  CE    . LYS C 3 33  ? 22.043 -15.340 33.685 1.00 52.47  ? 33   LYS A CE    1 
ATOM   836  N  NZ    . LYS C 3 33  ? 21.223 -15.189 34.928 1.00 54.56  ? 33   LYS A NZ    1 
ATOM   837  N  N     . ALA C 3 34  ? 21.981 -12.405 27.477 1.00 24.83  ? 34   ALA A N     1 
ATOM   838  C  CA    . ALA C 3 34  ? 22.225 -11.374 26.473 1.00 30.22  ? 34   ALA A CA    1 
ATOM   839  C  C     . ALA C 3 34  ? 20.983 -11.039 25.673 1.00 26.94  ? 34   ALA A C     1 
ATOM   840  O  O     . ALA C 3 34  ? 20.750 -9.874  25.365 1.00 26.99  ? 34   ALA A O     1 
ATOM   841  C  CB    . ALA C 3 34  ? 23.341 -11.797 25.537 1.00 25.76  ? 34   ALA A CB    1 
ATOM   842  N  N     . VAL C 3 35  ? 20.197 -12.061 25.330 1.00 32.44  ? 35   VAL A N     1 
ATOM   843  C  CA    . VAL C 3 35  ? 18.962 -11.861 24.569 1.00 30.18  ? 35   VAL A CA    1 
ATOM   844  C  C     . VAL C 3 35  ? 17.885 -11.273 25.484 1.00 32.03  ? 35   VAL A C     1 
ATOM   845  O  O     . VAL C 3 35  ? 17.138 -10.378 25.086 1.00 31.23  ? 35   VAL A O     1 
ATOM   846  C  CB    . VAL C 3 35  ? 18.429 -13.199 23.965 1.00 34.63  ? 35   VAL A CB    1 
ATOM   847  C  CG1   . VAL C 3 35  ? 17.133 -12.951 23.189 1.00 26.99  ? 35   VAL A CG1   1 
ATOM   848  C  CG2   . VAL C 3 35  ? 19.460 -13.801 23.047 1.00 29.04  ? 35   VAL A CG2   1 
ATOM   849  N  N     . LYS C 3 36  ? 17.817 -11.787 26.709 1.00 31.15  ? 36   LYS A N     1 
ATOM   850  C  CA    . LYS C 3 36  ? 16.855 -11.319 27.692 1.00 33.73  ? 36   LYS A CA    1 
ATOM   851  C  C     . LYS C 3 36  ? 17.014 -9.823  27.890 1.00 36.73  ? 36   LYS A C     1 
ATOM   852  O  O     . LYS C 3 36  ? 16.029 -9.074  27.963 1.00 38.75  ? 36   LYS A O     1 
ATOM   853  C  CB    . LYS C 3 36  ? 17.080 -12.024 29.025 1.00 41.43  ? 36   LYS A CB    1 
ATOM   854  C  CG    . LYS C 3 36  ? 16.565 -13.450 29.078 1.00 53.47  ? 36   LYS A CG    1 
ATOM   855  C  CD    . LYS C 3 36  ? 15.426 -13.569 30.084 1.00 56.58  ? 36   LYS A CD    1 
ATOM   856  C  CE    . LYS C 3 36  ? 15.903 -13.260 31.504 1.00 61.99  ? 36   LYS A CE    1 
ATOM   857  N  NZ    . LYS C 3 36  ? 16.933 -14.225 31.992 1.00 59.91  ? 36   LYS A NZ    1 
ATOM   858  N  N     . SER C 3 37  ? 18.268 -9.397  27.980 1.00 36.60  ? 37   SER A N     1 
ATOM   859  C  CA    . SER C 3 37  ? 18.596 -7.993  28.178 1.00 35.46  ? 37   SER A CA    1 
ATOM   860  C  C     . SER C 3 37  ? 18.158 -7.151  26.979 1.00 32.01  ? 37   SER A C     1 
ATOM   861  O  O     . SER C 3 37  ? 17.540 -6.093  27.140 1.00 28.57  ? 37   SER A O     1 
ATOM   862  C  CB    . SER C 3 37  ? 20.103 -7.848  28.405 1.00 33.14  ? 37   SER A CB    1 
ATOM   863  O  OG    . SER C 3 37  ? 20.485 -6.492  28.340 1.00 43.49  ? 37   SER A OG    1 
ATOM   864  N  N     . LEU C 3 38  ? 18.475 -7.623  25.777 1.00 30.05  ? 38   LEU A N     1 
ATOM   865  C  CA    . LEU C 3 38  ? 18.099 -6.892  24.580 1.00 29.04  ? 38   LEU A CA    1 
ATOM   866  C  C     . LEU C 3 38  ? 16.581 -6.782  24.437 1.00 34.74  ? 38   LEU A C     1 
ATOM   867  O  O     . LEU C 3 38  ? 16.056 -5.698  24.175 1.00 34.43  ? 38   LEU A O     1 
ATOM   868  C  CB    . LEU C 3 38  ? 18.695 -7.550  23.340 1.00 28.37  ? 38   LEU A CB    1 
ATOM   869  C  CG    . LEU C 3 38  ? 18.399 -6.784  22.045 1.00 34.79  ? 38   LEU A CG    1 
ATOM   870  C  CD1   . LEU C 3 38  ? 18.823 -5.311  22.194 1.00 30.05  ? 38   LEU A CD1   1 
ATOM   871  C  CD2   . LEU C 3 38  ? 19.132 -7.435  20.882 1.00 30.02  ? 38   LEU A CD2   1 
ATOM   872  N  N     . VAL C 3 39  ? 15.875 -7.894  24.640 1.00 37.36  ? 39   VAL A N     1 
ATOM   873  C  CA    . VAL C 3 39  ? 14.416 -7.905  24.521 1.00 39.30  ? 39   VAL A CA    1 
ATOM   874  C  C     . VAL C 3 39  ? 13.760 -6.899  25.446 1.00 39.42  ? 39   VAL A C     1 
ATOM   875  O  O     . VAL C 3 39  ? 12.885 -6.143  25.031 1.00 41.82  ? 39   VAL A O     1 
ATOM   876  C  CB    . VAL C 3 39  ? 13.825 -9.298  24.834 1.00 37.58  ? 39   VAL A CB    1 
ATOM   877  C  CG1   . VAL C 3 39  ? 12.328 -9.188  25.083 1.00 34.41  ? 39   VAL A CG1   1 
ATOM   878  C  CG2   . VAL C 3 39  ? 14.089 -10.243 23.679 1.00 36.60  ? 39   VAL A CG2   1 
ATOM   879  N  N     . LYS C 3 40  ? 14.178 -6.906  26.703 1.00 40.98  ? 40   LYS A N     1 
ATOM   880  C  CA    . LYS C 3 40  ? 13.631 -5.994  27.701 1.00 42.74  ? 40   LYS A CA    1 
ATOM   881  C  C     . LYS C 3 40  ? 13.661 -4.532  27.250 1.00 42.12  ? 40   LYS A C     1 
ATOM   882  O  O     . LYS C 3 40  ? 12.681 -3.805  27.396 1.00 40.97  ? 40   LYS A O     1 
ATOM   883  C  CB    . LYS C 3 40  ? 14.413 -6.130  29.000 1.00 46.61  ? 40   LYS A CB    1 
ATOM   884  C  CG    . LYS C 3 40  ? 14.111 -5.043  30.017 1.00 56.50  ? 40   LYS A CG    1 
ATOM   885  C  CD    . LYS C 3 40  ? 15.152 -5.028  31.127 1.00 60.48  ? 40   LYS A CD    1 
ATOM   886  C  CE    . LYS C 3 40  ? 15.042 -6.257  32.022 1.00 61.32  ? 40   LYS A CE    1 
ATOM   887  N  NZ    . LYS C 3 40  ? 13.822 -6.211  32.874 1.00 63.72  ? 40   LYS A NZ    1 
ATOM   888  N  N     . LYS C 3 41  ? 14.789 -4.105  26.702 1.00 40.18  ? 41   LYS A N     1 
ATOM   889  C  CA    . LYS C 3 41  ? 14.927 -2.727  26.267 1.00 40.69  ? 41   LYS A CA    1 
ATOM   890  C  C     . LYS C 3 41  ? 14.109 -2.384  25.026 1.00 42.90  ? 41   LYS A C     1 
ATOM   891  O  O     . LYS C 3 41  ? 13.600 -1.265  24.900 1.00 41.40  ? 41   LYS A O     1 
ATOM   892  C  CB    . LYS C 3 41  ? 16.393 -2.427  26.020 1.00 39.58  ? 41   LYS A CB    1 
ATOM   893  C  CG    . LYS C 3 41  ? 17.259 -2.718  27.211 1.00 35.71  ? 41   LYS A CG    1 
ATOM   894  C  CD    . LYS C 3 41  ? 18.718 -2.548  26.847 1.00 40.79  ? 41   LYS A CD    1 
ATOM   895  C  CE    . LYS C 3 41  ? 19.610 -2.901  28.022 1.00 41.75  ? 41   LYS A CE    1 
ATOM   896  N  NZ    . LYS C 3 41  ? 21.030 -2.973  27.622 1.00 38.51  ? 41   LYS A NZ    1 
ATOM   897  N  N     . LEU C 3 42  ? 13.985 -3.344  24.113 1.00 41.57  ? 42   LEU A N     1 
ATOM   898  C  CA    . LEU C 3 42  ? 13.235 -3.130  22.885 1.00 42.14  ? 42   LEU A CA    1 
ATOM   899  C  C     . LEU C 3 42  ? 11.743 -3.170  23.176 1.00 45.52  ? 42   LEU A C     1 
ATOM   900  O  O     . LEU C 3 42  ? 10.932 -2.613  22.437 1.00 48.46  ? 42   LEU A O     1 
ATOM   901  C  CB    . LEU C 3 42  ? 13.615 -4.187  21.846 1.00 38.21  ? 42   LEU A CB    1 
ATOM   902  C  CG    . LEU C 3 42  ? 15.106 -4.203  21.493 1.00 36.35  ? 42   LEU A CG    1 
ATOM   903  C  CD1   . LEU C 3 42  ? 15.372 -5.250  20.436 1.00 36.74  ? 42   LEU A CD1   1 
ATOM   904  C  CD2   . LEU C 3 42  ? 15.544 -2.839  21.000 1.00 34.28  ? 42   LEU A CD2   1 
ATOM   905  N  N     . LYS C 3 43  ? 11.393 -3.831  24.270 1.00 48.97  ? 43   LYS A N     1 
ATOM   906  C  CA    . LYS C 3 43  ? 10.012 -3.939  24.692 1.00 51.26  ? 43   LYS A CA    1 
ATOM   907  C  C     . LYS C 3 43  ? 9.560  -2.542  25.103 1.00 53.15  ? 43   LYS A C     1 
ATOM   908  O  O     . LYS C 3 43  ? 8.501  -2.069  24.684 1.00 54.17  ? 43   LYS A O     1 
ATOM   909  C  CB    . LYS C 3 43  ? 9.908  -4.880  25.892 1.00 56.19  ? 43   LYS A CB    1 
ATOM   910  C  CG    . LYS C 3 43  ? 8.650  -5.729  25.926 1.00 60.91  ? 43   LYS A CG    1 
ATOM   911  C  CD    . LYS C 3 43  ? 8.614  -6.599  27.177 1.00 65.85  ? 43   LYS A CD    1 
ATOM   912  C  CE    . LYS C 3 43  ? 7.612  -7.743  27.045 1.00 70.80  ? 43   LYS A CE    1 
ATOM   913  N  NZ    . LYS C 3 43  ? 8.035  -8.745  26.017 1.00 70.45  ? 43   LYS A NZ    1 
ATOM   914  N  N     . LYS C 3 44  ? 10.381 -1.887  25.918 1.00 49.49  ? 44   LYS A N     1 
ATOM   915  C  CA    . LYS C 3 44  ? 10.079 -0.550  26.413 1.00 51.26  ? 44   LYS A CA    1 
ATOM   916  C  C     . LYS C 3 44  ? 10.022 0.515   25.326 1.00 47.47  ? 44   LYS A C     1 
ATOM   917  O  O     . LYS C 3 44  ? 9.410  1.559   25.516 1.00 45.29  ? 44   LYS A O     1 
ATOM   918  C  CB    . LYS C 3 44  ? 11.104 -0.132  27.467 1.00 55.26  ? 44   LYS A CB    1 
ATOM   919  C  CG    . LYS C 3 44  ? 11.110 -1.005  28.704 1.00 62.01  ? 44   LYS A CG    1 
ATOM   920  C  CD    . LYS C 3 44  ? 12.246 -0.625  29.641 1.00 67.20  ? 44   LYS A CD    1 
ATOM   921  C  CE    . LYS C 3 44  ? 12.336 -1.590  30.819 1.00 69.29  ? 44   LYS A CE    1 
ATOM   922  N  NZ    . LYS C 3 44  ? 13.484 -1.275  31.722 1.00 72.61  ? 44   LYS A NZ    1 
ATOM   923  N  N     . THR C 3 45  ? 10.662 0.257   24.194 1.00 45.09  ? 45   THR A N     1 
ATOM   924  C  CA    . THR C 3 45  ? 10.677 1.220   23.101 1.00 44.05  ? 45   THR A CA    1 
ATOM   925  C  C     . THR C 3 45  ? 9.942  0.666   21.892 1.00 46.14  ? 45   THR A C     1 
ATOM   926  O  O     . THR C 3 45  ? 10.076 1.178   20.780 1.00 47.11  ? 45   THR A O     1 
ATOM   927  C  CB    . THR C 3 45  ? 12.121 1.571   22.699 1.00 42.80  ? 45   THR A CB    1 
ATOM   928  O  OG1   . THR C 3 45  ? 12.804 0.380   22.296 1.00 43.14  ? 45   THR A OG1   1 
ATOM   929  C  CG2   . THR C 3 45  ? 12.861 2.199   23.876 1.00 40.76  ? 45   THR A CG2   1 
ATOM   930  N  N     . GLY C 3 46  ? 9.177  -0.397  22.124 1.00 46.08  ? 46   GLY A N     1 
ATOM   931  C  CA    . GLY C 3 46  ? 8.407  -1.028  21.070 1.00 45.58  ? 46   GLY A CA    1 
ATOM   932  C  C     . GLY C 3 46  ? 9.145  -1.416  19.805 1.00 47.34  ? 46   GLY A C     1 
ATOM   933  O  O     . GLY C 3 46  ? 8.596  -1.275  18.711 1.00 51.54  ? 46   GLY A O     1 
ATOM   934  N  N     . GLN C 3 47  ? 10.371 -1.917  19.928 1.00 43.65  ? 47   GLN A N     1 
ATOM   935  C  CA    . GLN C 3 47  ? 11.130 -2.318  18.740 1.00 39.73  ? 47   GLN A CA    1 
ATOM   936  C  C     . GLN C 3 47  ? 11.232 -3.842  18.597 1.00 39.79  ? 47   GLN A C     1 
ATOM   937  O  O     . GLN C 3 47  ? 11.831 -4.342  17.642 1.00 37.56  ? 47   GLN A O     1 
ATOM   938  C  CB    . GLN C 3 47  ? 12.539 -1.717  18.787 1.00 40.89  ? 47   GLN A CB    1 
ATOM   939  C  CG    . GLN C 3 47  ? 12.568 -0.245  19.146 1.00 43.01  ? 47   GLN A CG    1 
ATOM   940  C  CD    . GLN C 3 47  ? 13.956 0.360   19.043 1.00 42.62  ? 47   GLN A CD    1 
ATOM   941  O  OE1   . GLN C 3 47  ? 14.568 0.369   17.972 1.00 36.59  ? 47   GLN A OE1   1 
ATOM   942  N  NE2   . GLN C 3 47  ? 14.455 0.877   20.156 1.00 40.05  ? 47   GLN A NE2   1 
ATOM   943  N  N     . LEU C 3 48  ? 10.647 -4.574  19.542 1.00 38.41  ? 48   LEU A N     1 
ATOM   944  C  CA    . LEU C 3 48  ? 10.688 -6.038  19.524 1.00 42.05  ? 48   LEU A CA    1 
ATOM   945  C  C     . LEU C 3 48  ? 10.391 -6.686  18.181 1.00 43.60  ? 48   LEU A C     1 
ATOM   946  O  O     . LEU C 3 48  ? 11.260 -7.322  17.584 1.00 41.11  ? 48   LEU A O     1 
ATOM   947  C  CB    . LEU C 3 48  ? 9.717  -6.608  20.552 1.00 45.54  ? 48   LEU A CB    1 
ATOM   948  C  CG    . LEU C 3 48  ? 10.371 -7.261  21.766 1.00 48.94  ? 48   LEU A CG    1 
ATOM   949  C  CD1   . LEU C 3 48  ? 9.297  -7.903  22.628 1.00 47.90  ? 48   LEU A CD1   1 
ATOM   950  C  CD2   . LEU C 3 48  ? 11.385 -8.302  21.303 1.00 52.08  ? 48   LEU A CD2   1 
ATOM   951  N  N     . ASP C 3 49  ? 9.152  -6.536  17.718 1.00 45.98  ? 49   ASP A N     1 
ATOM   952  C  CA    . ASP C 3 49  ? 8.726  -7.126  16.449 1.00 47.12  ? 49   ASP A CA    1 
ATOM   953  C  C     . ASP C 3 49  ? 9.717  -6.836  15.349 1.00 42.73  ? 49   ASP A C     1 
ATOM   954  O  O     . ASP C 3 49  ? 9.997  -7.687  14.512 1.00 42.97  ? 49   ASP A O     1 
ATOM   955  C  CB    . ASP C 3 49  ? 7.353  -6.589  16.050 1.00 52.42  ? 49   ASP A CB    1 
ATOM   956  C  CG    . ASP C 3 49  ? 6.303  -6.873  17.096 1.00 56.86  ? 49   ASP A CG    1 
ATOM   957  O  OD1   . ASP C 3 49  ? 6.038  -8.066  17.358 1.00 59.63  ? 49   ASP A OD1   1 
ATOM   958  O  OD2   . ASP C 3 49  ? 5.753  -5.906  17.663 1.00 62.38  ? 49   ASP A OD2   1 
ATOM   959  N  N     . GLU C 3 50  ? 10.253 -5.625  15.359 1.00 43.95  ? 50   GLU A N     1 
ATOM   960  C  CA    . GLU C 3 50  ? 11.215 -5.234  14.351 1.00 39.89  ? 50   GLU A CA    1 
ATOM   961  C  C     . GLU C 3 50  ? 12.460 -6.114  14.457 1.00 39.14  ? 50   GLU A C     1 
ATOM   962  O  O     . GLU C 3 50  ? 13.092 -6.412  13.450 1.00 37.75  ? 50   GLU A O     1 
ATOM   963  C  CB    . GLU C 3 50  ? 11.559 -3.752  14.517 1.00 46.80  ? 50   GLU A CB    1 
ATOM   964  C  CG    . GLU C 3 50  ? 11.206 -2.901  13.294 1.00 55.92  ? 50   GLU A CG    1 
ATOM   965  C  CD    . GLU C 3 50  ? 12.064 -3.252  12.094 1.00 59.13  ? 50   GLU A CD    1 
ATOM   966  O  OE1   . GLU C 3 50  ? 11.728 -2.846  10.957 1.00 51.67  ? 50   GLU A OE1   1 
ATOM   967  O  OE2   . GLU C 3 50  ? 13.088 -3.938  12.305 1.00 62.43  ? 50   GLU A OE2   1 
ATOM   968  N  N     . LEU C 3 51  ? 12.797 -6.540  15.675 1.00 34.94  ? 51   LEU A N     1 
ATOM   969  C  CA    . LEU C 3 51  ? 13.966 -7.402  15.898 1.00 36.08  ? 51   LEU A CA    1 
ATOM   970  C  C     . LEU C 3 51  ? 13.629 -8.800  15.389 1.00 34.24  ? 51   LEU A C     1 
ATOM   971  O  O     . LEU C 3 51  ? 14.406 -9.418  14.669 1.00 35.91  ? 51   LEU A O     1 
ATOM   972  C  CB    . LEU C 3 51  ? 14.298 -7.487  17.389 1.00 32.90  ? 51   LEU A CB    1 
ATOM   973  C  CG    . LEU C 3 51  ? 15.721 -7.799  17.878 1.00 32.72  ? 51   LEU A CG    1 
ATOM   974  C  CD1   . LEU C 3 51  ? 15.609 -8.449  19.247 1.00 30.35  ? 51   LEU A CD1   1 
ATOM   975  C  CD2   . LEU C 3 51  ? 16.472 -8.698  16.941 1.00 26.11  ? 51   LEU A CD2   1 
ATOM   976  N  N     . GLU C 3 52  ? 12.462 -9.296  15.782 1.00 39.42  ? 52   GLU A N     1 
ATOM   977  C  CA    . GLU C 3 52  ? 12.004 -10.606 15.338 1.00 44.63  ? 52   GLU A CA    1 
ATOM   978  C  C     . GLU C 3 52  ? 12.122 -10.664 13.813 1.00 44.75  ? 52   GLU A C     1 
ATOM   979  O  O     . GLU C 3 52  ? 12.714 -11.588 13.247 1.00 38.74  ? 52   GLU A O     1 
ATOM   980  C  CB    . GLU C 3 52  ? 10.546 -10.813 15.741 1.00 47.52  ? 52   GLU A CB    1 
ATOM   981  C  CG    . GLU C 3 52  ? 10.023 -12.199 15.398 1.00 58.16  ? 52   GLU A CG    1 
ATOM   982  C  CD    . GLU C 3 52  ? 8.598  -12.439 15.869 1.00 62.01  ? 52   GLU A CD    1 
ATOM   983  O  OE1   . GLU C 3 52  ? 8.061  -13.529 15.569 1.00 67.55  ? 52   GLU A OE1   1 
ATOM   984  O  OE2   . GLU C 3 52  ? 8.016  -11.548 16.531 1.00 65.16  ? 52   GLU A OE2   1 
ATOM   985  N  N     . LYS C 3 53  ? 11.567 -9.643  13.166 1.00 46.38  ? 53   LYS A N     1 
ATOM   986  C  CA    . LYS C 3 53  ? 11.577 -9.522  11.717 1.00 48.47  ? 53   LYS A CA    1 
ATOM   987  C  C     . LYS C 3 53  ? 12.975 -9.682  11.127 1.00 46.97  ? 53   LYS A C     1 
ATOM   988  O  O     . LYS C 3 53  ? 13.233 -10.628 10.384 1.00 51.14  ? 53   LYS A O     1 
ATOM   989  C  CB    . LYS C 3 53  ? 10.984 -8.163  11.326 1.00 54.19  ? 53   LYS A CB    1 
ATOM   990  C  CG    . LYS C 3 53  ? 10.784 -7.955  9.828  1.00 61.51  ? 53   LYS A CG    1 
ATOM   991  C  CD    . LYS C 3 53  ? 9.908  -6.733  9.575  1.00 66.62  ? 53   LYS A CD    1 
ATOM   992  C  CE    . LYS C 3 53  ? 9.621  -6.534  8.092  1.00 70.32  ? 53   LYS A CE    1 
ATOM   993  N  NZ    . LYS C 3 53  ? 10.858 -6.238  7.314  1.00 76.51  ? 53   LYS A NZ    1 
ATOM   994  N  N     . ALA C 3 54  ? 13.874 -8.762  11.468 1.00 46.33  ? 54   ALA A N     1 
ATOM   995  C  CA    . ALA C 3 54  ? 15.251 -8.786  10.965 1.00 43.51  ? 54   ALA A CA    1 
ATOM   996  C  C     . ALA C 3 54  ? 15.995 -10.099 11.203 1.00 41.22  ? 54   ALA A C     1 
ATOM   997  O  O     . ALA C 3 54  ? 16.712 -10.576 10.333 1.00 39.87  ? 54   ALA A O     1 
ATOM   998  C  CB    . ALA C 3 54  ? 16.051 -7.625  11.570 1.00 41.80  ? 54   ALA A CB    1 
ATOM   999  N  N     . ILE C 3 55  ? 15.851 -10.678 12.386 1.00 43.74  ? 55   ILE A N     1 
ATOM   1000 C  CA    . ILE C 3 55  ? 16.540 -11.931 12.668 1.00 46.28  ? 55   ILE A CA    1 
ATOM   1001 C  C     . ILE C 3 55  ? 15.970 -13.087 11.829 1.00 50.74  ? 55   ILE A C     1 
ATOM   1002 O  O     . ILE C 3 55  ? 16.724 -13.890 11.278 1.00 48.72  ? 55   ILE A O     1 
ATOM   1003 C  CB    . ILE C 3 55  ? 16.436 -12.312 14.167 1.00 43.07  ? 55   ILE A CB    1 
ATOM   1004 C  CG1   . ILE C 3 55  ? 17.059 -11.217 15.045 1.00 44.31  ? 55   ILE A CG1   1 
ATOM   1005 C  CG2   . ILE C 3 55  ? 17.134 -13.632 14.407 1.00 43.95  ? 55   ILE A CG2   1 
ATOM   1006 C  CD1   . ILE C 3 55  ? 18.529 -10.938 14.769 1.00 35.70  ? 55   ILE A CD1   1 
ATOM   1007 N  N     . THR C 3 56  ? 14.643 -13.161 11.730 1.00 52.14  ? 56   THR A N     1 
ATOM   1008 C  CA    . THR C 3 56  ? 13.994 -14.233 10.974 1.00 56.13  ? 56   THR A CA    1 
ATOM   1009 C  C     . THR C 3 56  ? 14.050 -14.079 9.455  1.00 58.55  ? 56   THR A C     1 
ATOM   1010 O  O     . THR C 3 56  ? 14.293 -15.056 8.744  1.00 62.53  ? 56   THR A O     1 
ATOM   1011 C  CB    . THR C 3 56  ? 12.527 -14.387 11.378 1.00 55.31  ? 56   THR A CB    1 
ATOM   1012 O  OG1   . THR C 3 56  ? 11.813 -13.184 11.064 1.00 57.39  ? 56   THR A OG1   1 
ATOM   1013 C  CG2   . THR C 3 56  ? 12.424 -14.677 12.867 1.00 53.14  ? 56   THR A CG2   1 
ATOM   1014 N  N     . THR C 3 57  ? 13.828 -12.867 8.953  1.00 56.35  ? 57   THR A N     1 
ATOM   1015 C  CA    . THR C 3 57  ? 13.872 -12.635 7.511  1.00 52.65  ? 57   THR A CA    1 
ATOM   1016 C  C     . THR C 3 57  ? 15.289 -12.314 7.052  1.00 51.40  ? 57   THR A C     1 
ATOM   1017 O  O     . THR C 3 57  ? 15.627 -12.490 5.884  1.00 49.56  ? 57   THR A O     1 
ATOM   1018 C  CB    . THR C 3 57  ? 12.950 -11.477 7.101  1.00 53.82  ? 57   THR A CB    1 
ATOM   1019 O  OG1   . THR C 3 57  ? 13.443 -10.246 7.650  1.00 53.98  ? 57   THR A OG1   1 
ATOM   1020 C  CG2   . THR C 3 57  ? 11.546 -11.728 7.617  1.00 53.34  ? 57   THR A CG2   1 
ATOM   1021 N  N     . GLN C 3 58  ? 16.117 -11.830 7.971  1.00 51.17  ? 58   GLN A N     1 
ATOM   1022 C  CA    . GLN C 3 58  ? 17.503 -11.506 7.643  1.00 50.01  ? 58   GLN A CA    1 
ATOM   1023 C  C     . GLN C 3 58  ? 17.570 -10.420 6.572  1.00 49.53  ? 58   GLN A C     1 
ATOM   1024 O  O     . GLN C 3 58  ? 18.571 -10.282 5.863  1.00 47.32  ? 58   GLN A O     1 
ATOM   1025 C  CB    . GLN C 3 58  ? 18.213 -12.765 7.159  1.00 51.75  ? 58   GLN A CB    1 
ATOM   1026 C  CG    . GLN C 3 58  ? 18.002 -13.949 8.091  1.00 60.61  ? 58   GLN A CG    1 
ATOM   1027 C  CD    . GLN C 3 58  ? 18.449 -15.265 7.484  1.00 65.76  ? 58   GLN A CD    1 
ATOM   1028 O  OE1   . GLN C 3 58  ? 19.633 -15.457 7.174  1.00 66.26  ? 58   GLN A OE1   1 
ATOM   1029 N  NE2   . GLN C 3 58  ? 17.501 -16.184 7.308  1.00 67.35  ? 58   GLN A NE2   1 
ATOM   1030 N  N     . ASN C 3 59  ? 16.490 -9.653  6.468  1.00 49.35  ? 59   ASN A N     1 
ATOM   1031 C  CA    . ASN C 3 59  ? 16.394 -8.560  5.506  1.00 47.99  ? 59   ASN A CA    1 
ATOM   1032 C  C     . ASN C 3 59  ? 17.185 -7.343  5.985  1.00 46.87  ? 59   ASN A C     1 
ATOM   1033 O  O     . ASN C 3 59  ? 16.889 -6.760  7.032  1.00 43.29  ? 59   ASN A O     1 
ATOM   1034 C  CB    . ASN C 3 59  ? 14.920 -8.170  5.292  1.00 47.85  ? 59   ASN A CB    1 
ATOM   1035 C  CG    . ASN C 3 59  ? 14.746 -7.060  4.264  1.00 47.60  ? 59   ASN A CG    1 
ATOM   1036 O  OD1   . ASN C 3 59  ? 15.588 -6.878  3.385  1.00 52.59  ? 59   ASN A OD1   1 
ATOM   1037 N  ND2   . ASN C 3 59  ? 13.644 -6.328  4.360  1.00 44.11  ? 59   ASN A ND2   1 
ATOM   1038 N  N     . VAL C 3 60  ? 18.198 -6.978  5.213  1.00 45.88  ? 60   VAL A N     1 
ATOM   1039 C  CA    . VAL C 3 60  ? 19.025 -5.825  5.524  1.00 48.02  ? 60   VAL A CA    1 
ATOM   1040 C  C     . VAL C 3 60  ? 18.176 -4.546  5.505  1.00 48.74  ? 60   VAL A C     1 
ATOM   1041 O  O     . VAL C 3 60  ? 18.526 -3.548  6.136  1.00 47.56  ? 60   VAL A O     1 
ATOM   1042 C  CB    . VAL C 3 60  ? 20.174 -5.693  4.498  1.00 48.85  ? 60   VAL A CB    1 
ATOM   1043 C  CG1   . VAL C 3 60  ? 21.055 -4.512  4.841  1.00 54.51  ? 60   VAL A CG1   1 
ATOM   1044 C  CG2   . VAL C 3 60  ? 20.995 -6.970  4.472  1.00 51.61  ? 60   VAL A CG2   1 
ATOM   1045 N  N     . ASN C 3 61  ? 17.054 -4.578  4.790  1.00 49.27  ? 61   ASN A N     1 
ATOM   1046 C  CA    . ASN C 3 61  ? 16.187 -3.407  4.698  1.00 50.97  ? 61   ASN A CA    1 
ATOM   1047 C  C     . ASN C 3 61  ? 15.318 -3.156  5.918  1.00 51.84  ? 61   ASN A C     1 
ATOM   1048 O  O     . ASN C 3 61  ? 14.438 -2.286  5.898  1.00 52.98  ? 61   ASN A O     1 
ATOM   1049 C  CB    . ASN C 3 61  ? 15.302 -3.488  3.457  1.00 54.65  ? 61   ASN A CB    1 
ATOM   1050 C  CG    . ASN C 3 61  ? 16.078 -3.256  2.190  1.00 54.37  ? 61   ASN A CG    1 
ATOM   1051 O  OD1   . ASN C 3 61  ? 16.755 -4.153  1.684  1.00 55.11  ? 61   ASN A OD1   1 
ATOM   1052 N  ND2   . ASN C 3 61  ? 16.004 -2.038  1.676  1.00 57.03  ? 61   ASN A ND2   1 
ATOM   1053 N  N     . THR C 3 62  ? 15.553 -3.918  6.981  1.00 49.21  ? 62   THR A N     1 
ATOM   1054 C  CA    . THR C 3 62  ? 14.790 -3.722  8.201  1.00 42.85  ? 62   THR A CA    1 
ATOM   1055 C  C     . THR C 3 62  ? 15.250 -2.388  8.768  1.00 41.65  ? 62   THR A C     1 
ATOM   1056 O  O     . THR C 3 62  ? 16.267 -1.851  8.339  1.00 40.92  ? 62   THR A O     1 
ATOM   1057 C  CB    . THR C 3 62  ? 15.045 -4.859  9.223  1.00 44.58  ? 62   THR A CB    1 
ATOM   1058 O  OG1   . THR C 3 62  ? 16.399 -5.328  9.109  1.00 37.46  ? 62   THR A OG1   1 
ATOM   1059 C  CG2   . THR C 3 62  ? 14.075 -6.006  8.988  1.00 41.95  ? 62   THR A CG2   1 
ATOM   1060 N  N     . LYS C 3 63  ? 14.498 -1.838  9.713  1.00 44.31  ? 63   LYS A N     1 
ATOM   1061 C  CA    . LYS C 3 63  ? 14.873 -0.556  10.301 1.00 49.18  ? 63   LYS A CA    1 
ATOM   1062 C  C     . LYS C 3 63  ? 16.006 -0.716  11.322 1.00 47.61  ? 63   LYS A C     1 
ATOM   1063 O  O     . LYS C 3 63  ? 16.415 -1.836  11.654 1.00 45.32  ? 63   LYS A O     1 
ATOM   1064 C  CB    . LYS C 3 63  ? 13.656 0.093   10.978 1.00 51.47  ? 63   LYS A CB    1 
ATOM   1065 C  CG    . LYS C 3 63  ? 12.526 0.480   10.028 1.00 55.35  ? 63   LYS A CG    1 
ATOM   1066 C  CD    . LYS C 3 63  ? 11.366 1.111   10.790 1.00 58.49  ? 63   LYS A CD    1 
ATOM   1067 C  CE    . LYS C 3 63  ? 10.298 1.649   9.845  1.00 63.20  ? 63   LYS A CE    1 
ATOM   1068 N  NZ    . LYS C 3 63  ? 9.214  2.391   10.567 1.00 65.23  ? 63   LYS A NZ    1 
ATOM   1069 N  N     . CYS C 3 64  ? 16.525 0.408   11.803 1.00 40.78  ? 64   CYS A N     1 
ATOM   1070 C  CA    . CYS C 3 64  ? 17.577 0.355   12.806 1.00 40.92  ? 64   CYS A CA    1 
ATOM   1071 C  C     . CYS C 3 64  ? 16.956 -0.105  14.100 1.00 36.77  ? 64   CYS A C     1 
ATOM   1072 O  O     . CYS C 3 64  ? 15.859 0.336   14.450 1.00 41.16  ? 64   CYS A O     1 
ATOM   1073 C  CB    . CYS C 3 64  ? 18.211 1.728   13.021 1.00 38.63  ? 64   CYS A CB    1 
ATOM   1074 S  SG    . CYS C 3 64  ? 19.580 2.067   11.921 1.00 36.22  ? 64   CYS A SG    1 
ATOM   1075 N  N     . ILE C 3 65  ? 17.631 -1.021  14.788 1.00 32.64  ? 65   ILE A N     1 
ATOM   1076 C  CA    . ILE C 3 65  ? 17.138 -1.498  16.072 1.00 33.68  ? 65   ILE A CA    1 
ATOM   1077 C  C     . ILE C 3 65  ? 18.065 -0.858  17.085 1.00 36.47  ? 65   ILE A C     1 
ATOM   1078 O  O     . ILE C 3 65  ? 19.225 -1.250  17.272 1.00 36.31  ? 65   ILE A O     1 
ATOM   1079 C  CB    . ILE C 3 65  ? 17.145 -3.024  16.149 1.00 30.31  ? 65   ILE A CB    1 
ATOM   1080 C  CG1   . ILE C 3 65  ? 16.011 -3.565  15.266 1.00 30.16  ? 65   ILE A CG1   1 
ATOM   1081 C  CG2   . ILE C 3 65  ? 16.935 -3.462  17.576 1.00 27.77  ? 65   ILE A CG2   1 
ATOM   1082 C  CD1   . ILE C 3 65  ? 16.433 -4.624  14.284 1.00 31.97  ? 65   ILE A CD1   1 
ATOM   1083 N  N     . THR C 3 66  ? 17.508 0.142   17.742 1.00 35.17  ? 66   THR A N     1 
ATOM   1084 C  CA    . THR C 3 66  ? 18.239 0.979   18.655 1.00 36.16  ? 66   THR A CA    1 
ATOM   1085 C  C     . THR C 3 66  ? 18.256 0.770   20.161 1.00 36.45  ? 66   THR A C     1 
ATOM   1086 O  O     . THR C 3 66  ? 17.237 0.539   20.820 1.00 35.79  ? 66   THR A O     1 
ATOM   1087 C  CB    . THR C 3 66  ? 17.854 2.427   18.321 1.00 38.44  ? 66   THR A CB    1 
ATOM   1088 O  OG1   . THR C 3 66  ? 18.554 2.813   17.130 1.00 43.47  ? 66   THR A OG1   1 
ATOM   1089 C  CG2   . THR C 3 66  ? 18.156 3.366   19.451 1.00 42.20  ? 66   THR A CG2   1 
ATOM   1090 N  N     . ILE C 3 67  ? 19.463 0.894   20.693 1.00 34.59  ? 67   ILE A N     1 
ATOM   1091 C  CA    . ILE C 3 67  ? 19.709 0.757   22.113 1.00 35.21  ? 67   ILE A CA    1 
ATOM   1092 C  C     . ILE C 3 67  ? 20.492 1.979   22.597 1.00 30.72  ? 67   ILE A C     1 
ATOM   1093 O  O     . ILE C 3 67  ? 21.357 2.484   21.894 1.00 29.41  ? 67   ILE A O     1 
ATOM   1094 C  CB    . ILE C 3 67  ? 20.488 -0.567  22.392 1.00 34.51  ? 67   ILE A CB    1 
ATOM   1095 C  CG1   . ILE C 3 67  ? 19.586 -1.508  23.173 1.00 31.18  ? 67   ILE A CG1   1 
ATOM   1096 C  CG2   . ILE C 3 67  ? 21.823 -0.309  23.090 1.00 34.64  ? 67   ILE A CG2   1 
ATOM   1097 C  CD1   . ILE C 3 67  ? 18.418 -2.005  22.354 1.00 28.06  ? 67   ILE A CD1   1 
ATOM   1098 N  N     . PRO C 3 68  ? 20.167 2.483   23.794 1.00 32.63  ? 68   PRO A N     1 
ATOM   1099 C  CA    . PRO C 3 68  ? 20.832 3.647   24.393 1.00 34.65  ? 68   PRO A CA    1 
ATOM   1100 C  C     . PRO C 3 68  ? 22.330 3.387   24.467 1.00 38.97  ? 68   PRO A C     1 
ATOM   1101 O  O     . PRO C 3 68  ? 22.751 2.259   24.744 1.00 40.26  ? 68   PRO A O     1 
ATOM   1102 C  CB    . PRO C 3 68  ? 20.233 3.710   25.795 1.00 35.14  ? 68   PRO A CB    1 
ATOM   1103 C  CG    . PRO C 3 68  ? 18.871 3.098   25.628 1.00 34.85  ? 68   PRO A CG    1 
ATOM   1104 C  CD    . PRO C 3 68  ? 19.120 1.948   24.687 1.00 34.78  ? 68   PRO A CD    1 
ATOM   1105 N  N     . ARG C 3 69  ? 23.147 4.400   24.214 1.00 38.29  ? 69   ARG A N     1 
ATOM   1106 C  CA    . ARG C 3 69  ? 24.573 4.171   24.331 1.00 41.63  ? 69   ARG A CA    1 
ATOM   1107 C  C     . ARG C 3 69  ? 24.994 4.622   25.723 1.00 41.09  ? 69   ARG A C     1 
ATOM   1108 O  O     . ARG C 3 69  ? 24.463 5.591   26.264 1.00 39.69  ? 69   ARG A O     1 
ATOM   1109 C  CB    . ARG C 3 69  ? 25.366 4.918   23.253 1.00 46.07  ? 69   ARG A CB    1 
ATOM   1110 C  CG    . ARG C 3 69  ? 25.891 6.285   23.629 1.00 49.89  ? 69   ARG A CG    1 
ATOM   1111 C  CD    . ARG C 3 69  ? 27.257 6.490   22.984 1.00 51.35  ? 69   ARG A CD    1 
ATOM   1112 N  NE    . ARG C 3 69  ? 27.223 6.197   21.557 1.00 55.34  ? 69   ARG A NE    1 
ATOM   1113 C  CZ    . ARG C 3 69  ? 28.281 5.807   20.854 1.00 60.91  ? 69   ARG A CZ    1 
ATOM   1114 N  NH1   . ARG C 3 69  ? 29.456 5.667   21.453 1.00 60.10  ? 69   ARG A NH1   1 
ATOM   1115 N  NH2   . ARG C 3 69  ? 28.161 5.541   19.557 1.00 60.10  ? 69   ARG A NH2   1 
ATOM   1116 N  N     . SER C 3 70  ? 25.923 3.886   26.316 1.00 40.24  ? 70   SER A N     1 
ATOM   1117 C  CA    . SER C 3 70  ? 26.404 4.224   27.640 1.00 39.04  ? 70   SER A CA    1 
ATOM   1118 C  C     . SER C 3 70  ? 27.609 5.143   27.473 1.00 36.87  ? 70   SER A C     1 
ATOM   1119 O  O     . SER C 3 70  ? 28.132 5.300   26.368 1.00 39.44  ? 70   SER A O     1 
ATOM   1120 C  CB    . SER C 3 70  ? 26.788 2.949   28.395 1.00 35.21  ? 70   SER A CB    1 
ATOM   1121 O  OG    . SER C 3 70  ? 27.795 2.238   27.702 1.00 37.94  ? 70   SER A OG    1 
ATOM   1122 N  N     . LEU C 3 71  ? 28.041 5.749   28.568 1.00 37.70  ? 71   LEU A N     1 
ATOM   1123 C  CA    . LEU C 3 71  ? 29.191 6.657   28.548 1.00 43.90  ? 71   LEU A CA    1 
ATOM   1124 C  C     . LEU C 3 71  ? 30.434 6.152   27.813 1.00 42.98  ? 71   LEU A C     1 
ATOM   1125 O  O     . LEU C 3 71  ? 30.996 6.871   26.993 1.00 48.02  ? 71   LEU A O     1 
ATOM   1126 C  CB    . LEU C 3 71  ? 29.576 7.033   29.981 1.00 46.78  ? 71   LEU A CB    1 
ATOM   1127 C  CG    . LEU C 3 71  ? 29.079 8.371   30.537 1.00 51.90  ? 71   LEU A CG    1 
ATOM   1128 C  CD1   . LEU C 3 71  ? 30.037 9.472   30.087 1.00 54.43  ? 71   LEU A CD1   1 
ATOM   1129 C  CD2   . LEU C 3 71  ? 27.645 8.653   30.085 1.00 50.27  ? 71   LEU A CD2   1 
ATOM   1130 N  N     . ASP C 3 72  ? 30.875 4.930   28.106 1.00 43.79  ? 72   ASP A N     1 
ATOM   1131 C  CA    . ASP C 3 72  ? 32.066 4.388   27.453 1.00 41.04  ? 72   ASP A CA    1 
ATOM   1132 C  C     . ASP C 3 72  ? 31.745 3.528   26.238 1.00 42.20  ? 72   ASP A C     1 
ATOM   1133 O  O     . ASP C 3 72  ? 32.644 2.966   25.599 1.00 47.84  ? 72   ASP A O     1 
ATOM   1134 C  CB    . ASP C 3 72  ? 32.911 3.602   28.464 1.00 42.48  ? 72   ASP A CB    1 
ATOM   1135 C  CG    . ASP C 3 72  ? 32.301 2.260   28.848 1.00 40.41  ? 72   ASP A CG    1 
ATOM   1136 O  OD1   . ASP C 3 72  ? 31.062 2.117   28.859 1.00 42.40  ? 72   ASP A OD1   1 
ATOM   1137 O  OD2   . ASP C 3 72  ? 33.085 1.346   29.165 1.00 39.86  ? 72   ASP A OD2   1 
ATOM   1138 N  N     . GLY C 3 73  ? 30.459 3.431   25.920 1.00 40.74  ? 73   GLY A N     1 
ATOM   1139 C  CA    . GLY C 3 73  ? 30.038 2.661   24.763 1.00 37.84  ? 73   GLY A CA    1 
ATOM   1140 C  C     . GLY C 3 73  ? 29.932 1.164   24.983 1.00 36.48  ? 73   GLY A C     1 
ATOM   1141 O  O     . GLY C 3 73  ? 29.429 0.440   24.119 1.00 36.28  ? 73   GLY A O     1 
ATOM   1142 N  N     . ARG C 3 74  ? 30.399 0.691   26.132 1.00 30.64  ? 74   ARG A N     1 
ATOM   1143 C  CA    . ARG C 3 74  ? 30.332 -0.728  26.425 1.00 30.60  ? 74   ARG A CA    1 
ATOM   1144 C  C     . ARG C 3 74  ? 28.974 -1.122  26.984 1.00 31.28  ? 74   ARG A C     1 
ATOM   1145 O  O     . ARG C 3 74  ? 28.182 -0.278  27.405 1.00 33.30  ? 74   ARG A O     1 
ATOM   1146 C  CB    . ARG C 3 74  ? 31.434 -1.129  27.405 1.00 33.51  ? 74   ARG A CB    1 
ATOM   1147 C  CG    . ARG C 3 74  ? 32.814 -1.204  26.781 1.00 28.29  ? 74   ARG A CG    1 
ATOM   1148 C  CD    . ARG C 3 74  ? 33.812 -1.813  27.738 1.00 32.62  ? 74   ARG A CD    1 
ATOM   1149 N  NE    . ARG C 3 74  ? 34.002 -0.972  28.911 1.00 32.99  ? 74   ARG A NE    1 
ATOM   1150 C  CZ    . ARG C 3 74  ? 34.825 -1.255  29.914 1.00 34.23  ? 74   ARG A CZ    1 
ATOM   1151 N  NH1   . ARG C 3 74  ? 35.544 -2.372  29.902 1.00 33.56  ? 74   ARG A NH1   1 
ATOM   1152 N  NH2   . ARG C 3 74  ? 34.943 -0.404  30.923 1.00 37.54  ? 74   ARG A NH2   1 
ATOM   1153 N  N     . LEU C 3 75  ? 28.700 -2.418  26.962 1.00 31.19  ? 75   LEU A N     1 
ATOM   1154 C  CA    . LEU C 3 75  ? 27.441 -2.948  27.474 1.00 26.84  ? 75   LEU A CA    1 
ATOM   1155 C  C     . LEU C 3 75  ? 27.808 -4.118  28.352 1.00 23.64  ? 75   LEU A C     1 
ATOM   1156 O  O     . LEU C 3 75  ? 28.638 -4.946  27.971 1.00 20.66  ? 75   LEU A O     1 
ATOM   1157 C  CB    . LEU C 3 75  ? 26.544 -3.439  26.320 1.00 30.66  ? 75   LEU A CB    1 
ATOM   1158 C  CG    . LEU C 3 75  ? 25.293 -4.284  26.641 1.00 31.18  ? 75   LEU A CG    1 
ATOM   1159 C  CD1   . LEU C 3 75  ? 24.299 -3.495  27.459 1.00 33.04  ? 75   LEU A CD1   1 
ATOM   1160 C  CD2   . LEU C 3 75  ? 24.630 -4.723  25.342 1.00 38.11  ? 75   LEU A CD2   1 
ATOM   1161 N  N     . GLN C 3 76  ? 27.229 -4.172  29.541 1.00 20.61  ? 76   GLN A N     1 
ATOM   1162 C  CA    . GLN C 3 76  ? 27.489 -5.296  30.411 1.00 23.26  ? 76   GLN A CA    1 
ATOM   1163 C  C     . GLN C 3 76  ? 26.293 -6.245  30.387 1.00 20.56  ? 76   GLN A C     1 
ATOM   1164 O  O     . GLN C 3 76  ? 25.141 -5.822  30.503 1.00 20.23  ? 76   GLN A O     1 
ATOM   1165 C  CB    . GLN C 3 76  ? 27.748 -4.856  31.861 1.00 26.38  ? 76   GLN A CB    1 
ATOM   1166 C  CG    . GLN C 3 76  ? 28.169 -6.034  32.753 1.00 26.55  ? 76   GLN A CG    1 
ATOM   1167 C  CD    . GLN C 3 76  ? 28.699 -5.619  34.112 1.00 25.69  ? 76   GLN A CD    1 
ATOM   1168 O  OE1   . GLN C 3 76  ? 29.379 -4.612  34.238 1.00 28.74  ? 76   GLN A OE1   1 
ATOM   1169 N  NE2   . GLN C 3 76  ? 28.404 -6.408  35.129 1.00 20.05  ? 76   GLN A NE2   1 
ATOM   1170 N  N     . VAL C 3 77  ? 26.591 -7.523  30.201 1.00 26.42  ? 77   VAL A N     1 
ATOM   1171 C  CA    . VAL C 3 77  ? 25.603 -8.602  30.204 1.00 31.72  ? 77   VAL A CA    1 
ATOM   1172 C  C     . VAL C 3 77  ? 26.191 -9.610  31.181 1.00 30.99  ? 77   VAL A C     1 
ATOM   1173 O  O     . VAL C 3 77  ? 27.290 -10.125 30.976 1.00 24.40  ? 77   VAL A O     1 
ATOM   1174 C  CB    . VAL C 3 77  ? 25.429 -9.266  28.812 1.00 28.91  ? 77   VAL A CB    1 
ATOM   1175 C  CG1   . VAL C 3 77  ? 24.817 -10.669 28.971 1.00 36.86  ? 77   VAL A CG1   1 
ATOM   1176 C  CG2   . VAL C 3 77  ? 24.503 -8.430  27.959 1.00 29.40  ? 77   VAL A CG2   1 
ATOM   1177 N  N     . SER C 3 78  ? 25.453 -9.878  32.248 1.00 37.04  ? 78   SER A N     1 
ATOM   1178 C  CA    . SER C 3 78  ? 25.923 -10.785 33.282 1.00 43.99  ? 78   SER A CA    1 
ATOM   1179 C  C     . SER C 3 78  ? 27.185 -10.163 33.886 1.00 43.58  ? 78   SER A C     1 
ATOM   1180 O  O     . SER C 3 78  ? 27.129 -9.093  34.489 1.00 40.17  ? 78   SER A O     1 
ATOM   1181 C  CB    . SER C 3 78  ? 26.243 -12.162 32.692 1.00 47.56  ? 78   SER A CB    1 
ATOM   1182 O  OG    . SER C 3 78  ? 26.499 -13.092 33.727 1.00 53.28  ? 78   SER A OG    1 
ATOM   1183 N  N     . HIS C 3 79  ? 28.325 -10.818 33.712 1.00 46.41  ? 79   HIS A N     1 
ATOM   1184 C  CA    . HIS C 3 79  ? 29.563 -10.290 34.269 1.00 51.49  ? 79   HIS A CA    1 
ATOM   1185 C  C     . HIS C 3 79  ? 30.555 -9.840  33.212 1.00 49.98  ? 79   HIS A C     1 
ATOM   1186 O  O     . HIS C 3 79  ? 31.643 -9.376  33.537 1.00 49.93  ? 79   HIS A O     1 
ATOM   1187 C  CB    . HIS C 3 79  ? 30.205 -11.333 35.184 1.00 58.19  ? 79   HIS A CB    1 
ATOM   1188 C  CG    . HIS C 3 79  ? 29.494 -11.501 36.493 1.00 67.68  ? 79   HIS A CG    1 
ATOM   1189 N  ND1   . HIS C 3 79  ? 29.729 -12.563 37.341 1.00 71.74  ? 79   HIS A ND1   1 
ATOM   1190 C  CD2   . HIS C 3 79  ? 28.573 -10.723 37.112 1.00 69.49  ? 79   HIS A CD2   1 
ATOM   1191 C  CE1   . HIS C 3 79  ? 28.984 -12.432 38.425 1.00 73.06  ? 79   HIS A CE1   1 
ATOM   1192 N  NE2   . HIS C 3 79  ? 28.274 -11.323 38.312 1.00 72.88  ? 79   HIS A NE2   1 
ATOM   1193 N  N     . ARG C 3 80  ? 30.169 -9.962  31.948 1.00 51.01  ? 80   ARG A N     1 
ATOM   1194 C  CA    . ARG C 3 80  ? 31.040 -9.571  30.853 1.00 48.42  ? 80   ARG A CA    1 
ATOM   1195 C  C     . ARG C 3 80  ? 30.651 -8.221  30.305 1.00 44.74  ? 80   ARG A C     1 
ATOM   1196 O  O     . ARG C 3 80  ? 29.499 -7.808  30.391 1.00 43.18  ? 80   ARG A O     1 
ATOM   1197 C  CB    . ARG C 3 80  ? 30.969 -10.592 29.712 1.00 53.96  ? 80   ARG A CB    1 
ATOM   1198 C  CG    . ARG C 3 80  ? 31.357 -12.004 30.096 1.00 63.89  ? 80   ARG A CG    1 
ATOM   1199 C  CD    . ARG C 3 80  ? 32.559 -12.491 29.295 1.00 71.16  ? 80   ARG A CD    1 
ATOM   1200 N  NE    . ARG C 3 80  ? 32.274 -13.730 28.570 1.00 75.94  ? 80   ARG A NE    1 
ATOM   1201 C  CZ    . ARG C 3 80  ? 31.489 -13.813 27.498 1.00 76.95  ? 80   ARG A CZ    1 
ATOM   1202 N  NH1   . ARG C 3 80  ? 30.903 -12.726 27.010 1.00 76.41  ? 80   ARG A NH1   1 
ATOM   1203 N  NH2   . ARG C 3 80  ? 31.287 -14.988 26.912 1.00 77.08  ? 80   ARG A NH2   1 
ATOM   1204 N  N     . LYS C 3 81  ? 31.633 -7.537  29.737 1.00 43.26  ? 81   LYS A N     1 
ATOM   1205 C  CA    . LYS C 3 81  ? 31.421 -6.245  29.114 1.00 37.98  ? 81   LYS A CA    1 
ATOM   1206 C  C     . LYS C 3 81  ? 31.863 -6.384  27.665 1.00 37.55  ? 81   LYS A C     1 
ATOM   1207 O  O     . LYS C 3 81  ? 32.712 -7.217  27.351 1.00 38.20  ? 81   LYS A O     1 
ATOM   1208 C  CB    . LYS C 3 81  ? 32.247 -5.170  29.816 1.00 38.02  ? 81   LYS A CB    1 
ATOM   1209 C  CG    . LYS C 3 81  ? 31.559 -4.583  31.014 1.00 33.35  ? 81   LYS A CG    1 
ATOM   1210 C  CD    . LYS C 3 81  ? 32.367 -3.458  31.589 1.00 32.20  ? 81   LYS A CD    1 
ATOM   1211 C  CE    . LYS C 3 81  ? 31.472 -2.352  32.107 1.00 33.65  ? 81   LYS A CE    1 
ATOM   1212 N  NZ    . LYS C 3 81  ? 30.545 -2.792  33.176 1.00 31.33  ? 81   LYS A NZ    1 
ATOM   1213 N  N     . GLY C 3 82  ? 31.281 -5.580  26.785 1.00 35.65  ? 82   GLY A N     1 
ATOM   1214 C  CA    . GLY C 3 82  ? 31.636 -5.641  25.379 1.00 33.09  ? 82   GLY A CA    1 
ATOM   1215 C  C     . GLY C 3 82  ? 30.841 -4.651  24.552 1.00 29.37  ? 82   GLY A C     1 
ATOM   1216 O  O     . GLY C 3 82  ? 29.893 -4.053  25.042 1.00 32.94  ? 82   GLY A O     1 
ATOM   1217 N  N     . LEU C 3 83  ? 31.220 -4.465  23.297 1.00 31.98  ? 83   LEU A N     1 
ATOM   1218 C  CA    . LEU C 3 83  ? 30.507 -3.529  22.445 1.00 31.92  ? 83   LEU A CA    1 
ATOM   1219 C  C     . LEU C 3 83  ? 29.199 -4.162  21.953 1.00 32.50  ? 83   LEU A C     1 
ATOM   1220 O  O     . LEU C 3 83  ? 29.189 -5.289  21.453 1.00 31.82  ? 83   LEU A O     1 
ATOM   1221 C  CB    . LEU C 3 83  ? 31.407 -3.124  21.290 1.00 34.31  ? 83   LEU A CB    1 
ATOM   1222 C  CG    . LEU C 3 83  ? 32.735 -2.556  21.800 1.00 32.21  ? 83   LEU A CG    1 
ATOM   1223 C  CD1   . LEU C 3 83  ? 33.702 -2.415  20.649 1.00 33.70  ? 83   LEU A CD1   1 
ATOM   1224 C  CD2   . LEU C 3 83  ? 32.499 -1.216  22.483 1.00 34.38  ? 83   LEU A CD2   1 
ATOM   1225 N  N     . PRO C 3 84  ? 28.080 -3.432  22.100 1.00 32.87  ? 84   PRO A N     1 
ATOM   1226 C  CA    . PRO C 3 84  ? 26.735 -3.865  21.707 1.00 34.68  ? 84   PRO A CA    1 
ATOM   1227 C  C     . PRO C 3 84  ? 26.639 -4.537  20.336 1.00 33.17  ? 84   PRO A C     1 
ATOM   1228 O  O     . PRO C 3 84  ? 26.263 -5.711  20.239 1.00 31.50  ? 84   PRO A O     1 
ATOM   1229 C  CB    . PRO C 3 84  ? 25.917 -2.569  21.780 1.00 32.10  ? 84   PRO A CB    1 
ATOM   1230 C  CG    . PRO C 3 84  ? 26.599 -1.804  22.827 1.00 32.44  ? 84   PRO A CG    1 
ATOM   1231 C  CD    . PRO C 3 84  ? 28.058 -2.012  22.494 1.00 30.51  ? 84   PRO A CD    1 
ATOM   1232 N  N     . HIS C 3 85  ? 26.984 -3.802  19.282 1.00 29.58  ? 85   HIS A N     1 
ATOM   1233 C  CA    . HIS C 3 85  ? 26.895 -4.357  17.941 1.00 31.34  ? 85   HIS A CA    1 
ATOM   1234 C  C     . HIS C 3 85  ? 27.735 -5.621  17.816 1.00 34.60  ? 85   HIS A C     1 
ATOM   1235 O  O     . HIS C 3 85  ? 27.326 -6.589  17.168 1.00 35.53  ? 85   HIS A O     1 
ATOM   1236 C  CB    . HIS C 3 85  ? 27.334 -3.327  16.898 1.00 29.49  ? 85   HIS A CB    1 
ATOM   1237 C  CG    . HIS C 3 85  ? 28.693 -2.759  17.148 1.00 30.01  ? 85   HIS A CG    1 
ATOM   1238 N  ND1   . HIS C 3 85  ? 29.595 -2.515  16.135 1.00 31.70  ? 85   HIS A ND1   1 
ATOM   1239 C  CD2   . HIS C 3 85  ? 29.311 -2.395  18.297 1.00 29.33  ? 85   HIS A CD2   1 
ATOM   1240 C  CE1   . HIS C 3 85  ? 30.711 -2.028  16.650 1.00 24.06  ? 85   HIS A CE1   1 
ATOM   1241 N  NE2   . HIS C 3 85  ? 30.565 -1.946  17.960 1.00 30.31  ? 85   HIS A NE2   1 
ATOM   1242 N  N     . VAL C 3 86  ? 28.906 -5.615  18.443 1.00 35.17  ? 86   VAL A N     1 
ATOM   1243 C  CA    . VAL C 3 86  ? 29.792 -6.765  18.392 1.00 35.18  ? 86   VAL A CA    1 
ATOM   1244 C  C     . VAL C 3 86  ? 29.141 -7.990  19.024 1.00 38.04  ? 86   VAL A C     1 
ATOM   1245 O  O     . VAL C 3 86  ? 29.197 -9.093  18.477 1.00 37.84  ? 86   VAL A O     1 
ATOM   1246 C  CB    . VAL C 3 86  ? 31.113 -6.467  19.135 1.00 41.57  ? 86   VAL A CB    1 
ATOM   1247 C  CG1   . VAL C 3 86  ? 31.967 -7.729  19.216 1.00 33.97  ? 86   VAL A CG1   1 
ATOM   1248 C  CG2   . VAL C 3 86  ? 31.869 -5.344  18.428 1.00 37.66  ? 86   VAL A CG2   1 
ATOM   1249 N  N     . ILE C 3 87  ? 28.510 -7.783  20.173 1.00 34.70  ? 87   ILE A N     1 
ATOM   1250 C  CA    . ILE C 3 87  ? 27.874 -8.870  20.899 1.00 36.84  ? 87   ILE A CA    1 
ATOM   1251 C  C     . ILE C 3 87  ? 26.712 -9.517  20.160 1.00 37.63  ? 87   ILE A C     1 
ATOM   1252 O  O     . ILE C 3 87  ? 26.552 -10.741 20.170 1.00 36.69  ? 87   ILE A O     1 
ATOM   1253 C  CB    . ILE C 3 87  ? 27.358 -8.380  22.264 1.00 37.55  ? 87   ILE A CB    1 
ATOM   1254 C  CG1   . ILE C 3 87  ? 28.536 -8.000  23.155 1.00 39.09  ? 87   ILE A CG1   1 
ATOM   1255 C  CG2   . ILE C 3 87  ? 26.508 -9.448  22.922 1.00 34.66  ? 87   ILE A CG2   1 
ATOM   1256 C  CD1   . ILE C 3 87  ? 28.104 -7.355  24.429 1.00 40.81  ? 87   ILE A CD1   1 
ATOM   1257 N  N     . TYR C 3 88  ? 25.892 -8.695  19.522 1.00 34.53  ? 88   TYR A N     1 
ATOM   1258 C  CA    . TYR C 3 88  ? 24.742 -9.224  18.832 1.00 31.79  ? 88   TYR A CA    1 
ATOM   1259 C  C     . TYR C 3 88  ? 25.008 -9.724  17.422 1.00 33.83  ? 88   TYR A C     1 
ATOM   1260 O  O     . TYR C 3 88  ? 24.250 -10.554 16.915 1.00 30.27  ? 88   TYR A O     1 
ATOM   1261 C  CB    . TYR C 3 88  ? 23.605 -8.205  18.889 1.00 34.60  ? 88   TYR A CB    1 
ATOM   1262 C  CG    . TYR C 3 88  ? 23.115 -8.056  20.313 1.00 31.18  ? 88   TYR A CG    1 
ATOM   1263 C  CD1   . TYR C 3 88  ? 23.280 -6.857  21.015 1.00 28.61  ? 88   TYR A CD1   1 
ATOM   1264 C  CD2   . TYR C 3 88  ? 22.576 -9.153  20.991 1.00 29.97  ? 88   TYR A CD2   1 
ATOM   1265 C  CE1   . TYR C 3 88  ? 22.930 -6.759  22.353 1.00 25.89  ? 88   TYR A CE1   1 
ATOM   1266 C  CE2   . TYR C 3 88  ? 22.225 -9.069  22.333 1.00 31.70  ? 88   TYR A CE2   1 
ATOM   1267 C  CZ    . TYR C 3 88  ? 22.407 -7.868  23.014 1.00 31.77  ? 88   TYR A CZ    1 
ATOM   1268 O  OH    . TYR C 3 88  ? 22.094 -7.785  24.361 1.00 28.34  ? 88   TYR A OH    1 
ATOM   1269 N  N     . CYS C 3 89  ? 26.086 -9.243  16.800 1.00 33.51  ? 89   CYS A N     1 
ATOM   1270 C  CA    . CYS C 3 89  ? 26.457 -9.710  15.468 1.00 34.43  ? 89   CYS A CA    1 
ATOM   1271 C  C     . CYS C 3 89  ? 27.113 -11.079 15.648 1.00 34.69  ? 89   CYS A C     1 
ATOM   1272 O  O     . CYS C 3 89  ? 26.961 -11.975 14.820 1.00 34.06  ? 89   CYS A O     1 
ATOM   1273 C  CB    . CYS C 3 89  ? 27.448 -8.754  14.795 1.00 32.89  ? 89   CYS A CB    1 
ATOM   1274 S  SG    . CYS C 3 89  ? 26.688 -7.257  14.100 1.00 38.83  ? 89   CYS A SG    1 
ATOM   1275 N  N     . ARG C 3 90  ? 27.847 -11.232 16.739 1.00 32.95  ? 90   ARG A N     1 
ATOM   1276 C  CA    . ARG C 3 90  ? 28.502 -12.498 17.021 1.00 38.15  ? 90   ARG A CA    1 
ATOM   1277 C  C     . ARG C 3 90  ? 27.466 -13.539 17.436 1.00 38.37  ? 90   ARG A C     1 
ATOM   1278 O  O     . ARG C 3 90  ? 27.639 -14.729 17.192 1.00 41.73  ? 90   ARG A O     1 
ATOM   1279 C  CB    . ARG C 3 90  ? 29.518 -12.338 18.150 1.00 39.19  ? 90   ARG A CB    1 
ATOM   1280 C  CG    . ARG C 3 90  ? 29.992 -13.669 18.732 1.00 45.16  ? 90   ARG A CG    1 
ATOM   1281 C  CD    . ARG C 3 90  ? 30.734 -13.464 20.041 1.00 46.82  ? 90   ARG A CD    1 
ATOM   1282 N  NE    . ARG C 3 90  ? 31.921 -12.636 19.861 1.00 50.01  ? 90   ARG A NE    1 
ATOM   1283 C  CZ    . ARG C 3 90  ? 32.354 -11.757 20.760 1.00 51.76  ? 90   ARG A CZ    1 
ATOM   1284 N  NH1   . ARG C 3 90  ? 31.687 -11.596 21.901 1.00 51.93  ? 90   ARG A NH1   1 
ATOM   1285 N  NH2   . ARG C 3 90  ? 33.446 -11.038 20.519 1.00 44.83  ? 90   ARG A NH2   1 
ATOM   1286 N  N     . LEU C 3 91  ? 26.388 -13.083 18.057 1.00 38.27  ? 91   LEU A N     1 
ATOM   1287 C  CA    . LEU C 3 91  ? 25.357 -13.993 18.522 1.00 41.57  ? 91   LEU A CA    1 
ATOM   1288 C  C     . LEU C 3 91  ? 24.420 -14.510 17.430 1.00 44.96  ? 91   LEU A C     1 
ATOM   1289 O  O     . LEU C 3 91  ? 23.968 -15.652 17.488 1.00 49.21  ? 91   LEU A O     1 
ATOM   1290 C  CB    . LEU C 3 91  ? 24.554 -13.325 19.642 1.00 41.39  ? 91   LEU A CB    1 
ATOM   1291 C  CG    . LEU C 3 91  ? 23.652 -14.218 20.500 1.00 42.57  ? 91   LEU A CG    1 
ATOM   1292 C  CD1   . LEU C 3 91  ? 23.194 -13.447 21.722 1.00 48.26  ? 91   LEU A CD1   1 
ATOM   1293 C  CD2   . LEU C 3 91  ? 22.453 -14.674 19.704 1.00 47.06  ? 91   LEU A CD2   1 
ATOM   1294 N  N     . TRP C 3 92  ? 24.132 -13.691 16.427 1.00 43.59  ? 92   TRP A N     1 
ATOM   1295 C  CA    . TRP C 3 92  ? 23.231 -14.119 15.367 1.00 43.24  ? 92   TRP A CA    1 
ATOM   1296 C  C     . TRP C 3 92  ? 23.834 -14.259 13.976 1.00 44.81  ? 92   TRP A C     1 
ATOM   1297 O  O     . TRP C 3 92  ? 23.188 -14.808 13.084 1.00 44.72  ? 92   TRP A O     1 
ATOM   1298 C  CB    . TRP C 3 92  ? 22.036 -13.174 15.289 1.00 42.06  ? 92   TRP A CB    1 
ATOM   1299 C  CG    . TRP C 3 92  ? 21.056 -13.390 16.377 1.00 42.92  ? 92   TRP A CG    1 
ATOM   1300 C  CD1   . TRP C 3 92  ? 20.368 -14.541 16.645 1.00 41.02  ? 92   TRP A CD1   1 
ATOM   1301 C  CD2   . TRP C 3 92  ? 20.627 -12.432 17.344 1.00 42.34  ? 92   TRP A CD2   1 
ATOM   1302 N  NE1   . TRP C 3 92  ? 19.535 -14.360 17.719 1.00 42.11  ? 92   TRP A NE1   1 
ATOM   1303 C  CE2   . TRP C 3 92  ? 19.673 -13.073 18.172 1.00 44.44  ? 92   TRP A CE2   1 
ATOM   1304 C  CE3   . TRP C 3 92  ? 20.956 -11.094 17.597 1.00 41.77  ? 92   TRP A CE3   1 
ATOM   1305 C  CZ2   . TRP C 3 92  ? 19.039 -12.420 19.234 1.00 45.24  ? 92   TRP A CZ2   1 
ATOM   1306 C  CZ3   . TRP C 3 92  ? 20.328 -10.445 18.653 1.00 44.51  ? 92   TRP A CZ3   1 
ATOM   1307 C  CH2   . TRP C 3 92  ? 19.379 -11.111 19.460 1.00 45.12  ? 92   TRP A CH2   1 
ATOM   1308 N  N     . ARG C 3 93  ? 25.053 -13.764 13.782 1.00 44.92  ? 93   ARG A N     1 
ATOM   1309 C  CA    . ARG C 3 93  ? 25.691 -13.846 12.470 1.00 47.99  ? 93   ARG A CA    1 
ATOM   1310 C  C     . ARG C 3 93  ? 27.019 -14.604 12.496 1.00 48.90  ? 93   ARG A C     1 
ATOM   1311 O  O     . ARG C 3 93  ? 27.092 -15.773 12.124 1.00 49.60  ? 93   ARG A O     1 
ATOM   1312 C  CB    . ARG C 3 93  ? 25.959 -12.441 11.898 1.00 50.52  ? 93   ARG A CB    1 
ATOM   1313 C  CG    . ARG C 3 93  ? 24.789 -11.470 11.894 1.00 53.43  ? 93   ARG A CG    1 
ATOM   1314 C  CD    . ARG C 3 93  ? 23.743 -11.813 10.849 1.00 56.00  ? 93   ARG A CD    1 
ATOM   1315 N  NE    . ARG C 3 93  ? 24.251 -11.787 9.475  1.00 58.25  ? 93   ARG A NE    1 
ATOM   1316 C  CZ    . ARG C 3 93  ? 24.699 -10.705 8.846  1.00 56.44  ? 93   ARG A CZ    1 
ATOM   1317 N  NH1   . ARG C 3 93  ? 24.716 -9.535  9.458  1.00 59.20  ? 93   ARG A NH1   1 
ATOM   1318 N  NH2   . ARG C 3 93  ? 25.121 -10.792 7.593  1.00 52.96  ? 93   ARG A NH2   1 
ATOM   1319 N  N     . TRP C 3 94  ? 28.062 -13.923 12.956 1.00 49.53  ? 94   TRP A N     1 
ATOM   1320 C  CA    . TRP C 3 94  ? 29.407 -14.480 12.986 1.00 52.07  ? 94   TRP A CA    1 
ATOM   1321 C  C     . TRP C 3 94  ? 29.963 -14.812 14.376 1.00 54.57  ? 94   TRP A C     1 
ATOM   1322 O  O     . TRP C 3 94  ? 30.568 -13.963 15.030 1.00 54.02  ? 94   TRP A O     1 
ATOM   1323 C  CB    . TRP C 3 94  ? 30.341 -13.497 12.275 1.00 50.65  ? 94   TRP A CB    1 
ATOM   1324 C  CG    . TRP C 3 94  ? 29.735 -12.946 11.009 1.00 53.68  ? 94   TRP A CG    1 
ATOM   1325 C  CD1   . TRP C 3 94  ? 29.445 -13.643 9.873  1.00 53.03  ? 94   TRP A CD1   1 
ATOM   1326 C  CD2   . TRP C 3 94  ? 29.287 -11.600 10.778 1.00 51.87  ? 94   TRP A CD2   1 
ATOM   1327 N  NE1   . TRP C 3 94  ? 28.840 -12.821 8.950  1.00 50.92  ? 94   TRP A NE1   1 
ATOM   1328 C  CE2   . TRP C 3 94  ? 28.729 -11.563 9.477  1.00 50.86  ? 94   TRP A CE2   1 
ATOM   1329 C  CE3   . TRP C 3 94  ? 29.299 -10.426 11.543 1.00 49.80  ? 94   TRP A CE3   1 
ATOM   1330 C  CZ2   . TRP C 3 94  ? 28.189 -10.393 8.919  1.00 50.51  ? 94   TRP A CZ2   1 
ATOM   1331 C  CZ3   . TRP C 3 94  ? 28.761 -9.258  10.989 1.00 53.61  ? 94   TRP A CZ3   1 
ATOM   1332 C  CH2   . TRP C 3 94  ? 28.213 -9.255  9.686  1.00 50.35  ? 94   TRP A CH2   1 
ATOM   1333 N  N     . PRO C 3 95  ? 29.768 -16.056 14.845 1.00 57.24  ? 95   PRO A N     1 
ATOM   1334 C  CA    . PRO C 3 95  ? 30.289 -16.419 16.168 1.00 59.70  ? 95   PRO A CA    1 
ATOM   1335 C  C     . PRO C 3 95  ? 31.816 -16.339 16.190 1.00 59.96  ? 95   PRO A C     1 
ATOM   1336 O  O     . PRO C 3 95  ? 32.441 -16.323 17.250 1.00 55.84  ? 95   PRO A O     1 
ATOM   1337 C  CB    . PRO C 3 95  ? 29.766 -17.842 16.369 1.00 59.57  ? 95   PRO A CB    1 
ATOM   1338 C  CG    . PRO C 3 95  ? 29.633 -18.361 14.974 1.00 57.88  ? 95   PRO A CG    1 
ATOM   1339 C  CD    . PRO C 3 95  ? 29.043 -17.187 14.239 1.00 58.01  ? 95   PRO A CD    1 
ATOM   1340 N  N     . ASP C 3 96  ? 32.394 -16.269 14.996 1.00 63.31  ? 96   ASP A N     1 
ATOM   1341 C  CA    . ASP C 3 96  ? 33.836 -16.180 14.801 1.00 65.07  ? 96   ASP A CA    1 
ATOM   1342 C  C     . ASP C 3 96  ? 34.328 -14.760 15.096 1.00 63.88  ? 96   ASP A C     1 
ATOM   1343 O  O     . ASP C 3 96  ? 35.480 -14.558 15.471 1.00 63.05  ? 96   ASP A O     1 
ATOM   1344 C  CB    . ASP C 3 96  ? 34.159 -16.565 13.351 1.00 69.24  ? 96   ASP A CB    1 
ATOM   1345 C  CG    . ASP C 3 96  ? 35.641 -16.531 13.046 1.00 75.75  ? 96   ASP A CG    1 
ATOM   1346 O  OD1   . ASP C 3 96  ? 36.263 -15.458 13.187 1.00 78.54  ? 96   ASP A OD1   1 
ATOM   1347 O  OD2   . ASP C 3 96  ? 36.187 -17.583 12.655 1.00 79.90  ? 96   ASP A OD2   1 
ATOM   1348 N  N     . LEU C 3 97  ? 33.437 -13.787 14.925 1.00 65.15  ? 97   LEU A N     1 
ATOM   1349 C  CA    . LEU C 3 97  ? 33.732 -12.369 15.145 1.00 65.37  ? 97   LEU A CA    1 
ATOM   1350 C  C     . LEU C 3 97  ? 34.613 -12.096 16.365 1.00 66.39  ? 97   LEU A C     1 
ATOM   1351 O  O     . LEU C 3 97  ? 34.327 -12.567 17.466 1.00 64.83  ? 97   LEU A O     1 
ATOM   1352 C  CB    . LEU C 3 97  ? 32.420 -11.595 15.277 1.00 64.35  ? 97   LEU A CB    1 
ATOM   1353 C  CG    . LEU C 3 97  ? 32.530 -10.087 15.472 1.00 63.08  ? 97   LEU A CG    1 
ATOM   1354 C  CD1   . LEU C 3 97  ? 33.231 -9.470  14.270 1.00 61.64  ? 97   LEU A CD1   1 
ATOM   1355 C  CD2   . LEU C 3 97  ? 31.138 -9.503  15.658 1.00 64.49  ? 97   LEU A CD2   1 
ATOM   1356 N  N     . HIS C 3 98  ? 35.663 -11.302 16.170 1.00 68.97  ? 98   HIS A N     1 
ATOM   1357 C  CA    . HIS C 3 98  ? 36.599 -11.001 17.249 1.00 71.27  ? 98   HIS A CA    1 
ATOM   1358 C  C     . HIS C 3 98  ? 36.483 -9.602  17.856 1.00 69.20  ? 98   HIS A C     1 
ATOM   1359 O  O     . HIS C 3 98  ? 36.229 -9.463  19.053 1.00 69.03  ? 98   HIS A O     1 
ATOM   1360 C  CB    . HIS C 3 98  ? 38.029 -11.228 16.754 1.00 78.33  ? 98   HIS A CB    1 
ATOM   1361 C  CG    . HIS C 3 98  ? 39.049 -11.259 17.847 1.00 85.99  ? 98   HIS A CG    1 
ATOM   1362 N  ND1   . HIS C 3 98  ? 39.343 -10.159 18.625 1.00 88.94  ? 98   HIS A ND1   1 
ATOM   1363 C  CD2   . HIS C 3 98  ? 39.831 -12.265 18.307 1.00 88.67  ? 98   HIS A CD2   1 
ATOM   1364 C  CE1   . HIS C 3 98  ? 40.260 -10.487 19.517 1.00 90.82  ? 98   HIS A CE1   1 
ATOM   1365 N  NE2   . HIS C 3 98  ? 40.574 -11.759 19.346 1.00 91.37  ? 98   HIS A NE2   1 
ATOM   1366 N  N     . SER C 3 99  ? 36.688 -8.568  17.043 1.00 65.76  ? 99   SER A N     1 
ATOM   1367 C  CA    . SER C 3 99  ? 36.598 -7.196  17.535 1.00 61.76  ? 99   SER A CA    1 
ATOM   1368 C  C     . SER C 3 99  ? 35.745 -6.324  16.616 1.00 59.44  ? 99   SER A C     1 
ATOM   1369 O  O     . SER C 3 99  ? 35.404 -6.727  15.504 1.00 59.39  ? 99   SER A O     1 
ATOM   1370 C  CB    . SER C 3 99  ? 37.992 -6.587  17.673 1.00 60.82  ? 99   SER A CB    1 
ATOM   1371 O  OG    . SER C 3 99  ? 38.581 -6.391  16.405 1.00 61.11  ? 99   SER A OG    1 
ATOM   1372 N  N     . HIS C 3 100 ? 35.419 -5.122  17.082 1.00 56.60  ? 100  HIS A N     1 
ATOM   1373 C  CA    . HIS C 3 100 ? 34.584 -4.195  16.325 1.00 55.88  ? 100  HIS A CA    1 
ATOM   1374 C  C     . HIS C 3 100 ? 35.190 -3.743  14.998 1.00 57.17  ? 100  HIS A C     1 
ATOM   1375 O  O     . HIS C 3 100 ? 34.516 -3.093  14.195 1.00 55.21  ? 100  HIS A O     1 
ATOM   1376 C  CB    . HIS C 3 100 ? 34.245 -2.970  17.180 1.00 53.01  ? 100  HIS A CB    1 
ATOM   1377 C  CG    . HIS C 3 100 ? 35.439 -2.167  17.596 1.00 54.45  ? 100  HIS A CG    1 
ATOM   1378 N  ND1   . HIS C 3 100 ? 35.660 -0.881  17.153 1.00 55.35  ? 100  HIS A ND1   1 
ATOM   1379 C  CD2   . HIS C 3 100 ? 36.472 -2.462  18.421 1.00 56.72  ? 100  HIS A CD2   1 
ATOM   1380 C  CE1   . HIS C 3 100 ? 36.779 -0.418  17.685 1.00 57.18  ? 100  HIS A CE1   1 
ATOM   1381 N  NE2   . HIS C 3 100 ? 37.291 -1.358  18.459 1.00 57.17  ? 100  HIS A NE2   1 
ATOM   1382 N  N     . HIS C 3 101 ? 36.455 -4.091  14.768 1.00 56.14  ? 101  HIS A N     1 
ATOM   1383 C  CA    . HIS C 3 101 ? 37.140 -3.721  13.532 1.00 55.08  ? 101  HIS A CA    1 
ATOM   1384 C  C     . HIS C 3 101 ? 36.792 -4.653  12.377 1.00 53.52  ? 101  HIS A C     1 
ATOM   1385 O  O     . HIS C 3 101 ? 36.836 -4.249  11.215 1.00 55.15  ? 101  HIS A O     1 
ATOM   1386 C  CB    . HIS C 3 101 ? 38.655 -3.691  13.758 1.00 55.78  ? 101  HIS A CB    1 
ATOM   1387 C  CG    . HIS C 3 101 ? 39.113 -2.524  14.576 1.00 58.75  ? 101  HIS A CG    1 
ATOM   1388 N  ND1   . HIS C 3 101 ? 39.925 -2.661  15.683 1.00 60.83  ? 101  HIS A ND1   1 
ATOM   1389 C  CD2   . HIS C 3 101 ? 38.842 -1.201  14.469 1.00 57.98  ? 101  HIS A CD2   1 
ATOM   1390 C  CE1   . HIS C 3 101 ? 40.131 -1.472  16.224 1.00 61.60  ? 101  HIS A CE1   1 
ATOM   1391 N  NE2   . HIS C 3 101 ? 39.485 -0.569  15.507 1.00 62.39  ? 101  HIS A NE2   1 
ATOM   1392 N  N     . GLU C 3 102 ? 36.447 -5.898  12.694 1.00 50.78  ? 102  GLU A N     1 
ATOM   1393 C  CA    . GLU C 3 102 ? 36.071 -6.860  11.666 1.00 51.32  ? 102  GLU A CA    1 
ATOM   1394 C  C     . GLU C 3 102 ? 34.665 -6.492  11.173 1.00 50.41  ? 102  GLU A C     1 
ATOM   1395 O  O     . GLU C 3 102 ? 34.025 -7.247  10.435 1.00 45.36  ? 102  GLU A O     1 
ATOM   1396 C  CB    . GLU C 3 102 ? 36.046 -8.275  12.244 1.00 51.69  ? 102  GLU A CB    1 
ATOM   1397 C  CG    . GLU C 3 102 ? 37.292 -8.678  12.996 1.00 56.31  ? 102  GLU A CG    1 
ATOM   1398 C  CD    . GLU C 3 102 ? 37.354 -10.177 13.246 1.00 62.55  ? 102  GLU A CD    1 
ATOM   1399 O  OE1   . GLU C 3 102 ? 38.282 -10.626 13.951 1.00 67.14  ? 102  GLU A OE1   1 
ATOM   1400 O  OE2   . GLU C 3 102 ? 36.484 -10.913 12.729 1.00 60.79  ? 102  GLU A OE2   1 
ATOM   1401 N  N     . LEU C 3 103 ? 34.198 -5.318  11.586 1.00 46.79  ? 103  LEU A N     1 
ATOM   1402 C  CA    . LEU C 3 103 ? 32.863 -4.850  11.235 1.00 52.71  ? 103  LEU A CA    1 
ATOM   1403 C  C     . LEU C 3 103 ? 32.863 -3.511  10.506 1.00 55.16  ? 103  LEU A C     1 
ATOM   1404 O  O     . LEU C 3 103 ? 33.853 -2.784  10.507 1.00 59.12  ? 103  LEU A O     1 
ATOM   1405 C  CB    . LEU C 3 103 ? 32.015 -4.721  12.504 1.00 46.12  ? 103  LEU A CB    1 
ATOM   1406 C  CG    . LEU C 3 103 ? 30.802 -5.613  12.764 1.00 49.63  ? 103  LEU A CG    1 
ATOM   1407 C  CD1   . LEU C 3 103 ? 31.171 -7.092  12.733 1.00 45.44  ? 103  LEU A CD1   1 
ATOM   1408 C  CD2   . LEU C 3 103 ? 30.229 -5.234  14.129 1.00 46.09  ? 103  LEU A CD2   1 
ATOM   1409 N  N     . ARG C 3 104 ? 31.732 -3.205  9.881  1.00 57.68  ? 104  ARG A N     1 
ATOM   1410 C  CA    . ARG C 3 104 ? 31.541 -1.958  9.161  1.00 59.10  ? 104  ARG A CA    1 
ATOM   1411 C  C     . ARG C 3 104 ? 30.069 -1.837  8.782  1.00 55.68  ? 104  ARG A C     1 
ATOM   1412 O  O     . ARG C 3 104 ? 29.491 -2.733  8.163  1.00 54.45  ? 104  ARG A O     1 
ATOM   1413 C  CB    . ARG C 3 104 ? 32.430 -1.909  7.915  1.00 66.47  ? 104  ARG A CB    1 
ATOM   1414 C  CG    . ARG C 3 104 ? 32.408 -0.560  7.216  1.00 74.07  ? 104  ARG A CG    1 
ATOM   1415 C  CD    . ARG C 3 104 ? 33.604 -0.378  6.292  1.00 80.99  ? 104  ARG A CD    1 
ATOM   1416 N  NE    . ARG C 3 104 ? 33.527 0.873   5.538  1.00 85.13  ? 104  ARG A NE    1 
ATOM   1417 C  CZ    . ARG C 3 104 ? 34.470 1.308   4.707  1.00 86.73  ? 104  ARG A CZ    1 
ATOM   1418 N  NH1   . ARG C 3 104 ? 35.575 0.594   4.519  1.00 87.01  ? 104  ARG A NH1   1 
ATOM   1419 N  NH2   . ARG C 3 104 ? 34.305 2.452   4.055  1.00 85.83  ? 104  ARG A NH2   1 
ATOM   1420 N  N     . ALA C 3 105 ? 29.466 -0.723  9.178  1.00 54.46  ? 105  ALA A N     1 
ATOM   1421 C  CA    . ALA C 3 105 ? 28.059 -0.472  8.914  1.00 55.87  ? 105  ALA A CA    1 
ATOM   1422 C  C     . ALA C 3 105 ? 27.782 -0.247  7.440  1.00 57.78  ? 105  ALA A C     1 
ATOM   1423 O  O     . ALA C 3 105 ? 28.674 0.117   6.679  1.00 55.74  ? 105  ALA A O     1 
ATOM   1424 C  CB    . ALA C 3 105 ? 27.590 0.731   9.712  1.00 52.24  ? 105  ALA A CB    1 
ATOM   1425 N  N     . MET C 3 106 ? 26.534 -0.471  7.047  1.00 61.99  ? 106  MET A N     1 
ATOM   1426 C  CA    . MET C 3 106 ? 26.120 -0.277  5.665  1.00 66.95  ? 106  MET A CA    1 
ATOM   1427 C  C     . MET C 3 106 ? 25.499 1.102   5.549  1.00 66.07  ? 106  MET A C     1 
ATOM   1428 O  O     . MET C 3 106 ? 24.685 1.489   6.386  1.00 64.64  ? 106  MET A O     1 
ATOM   1429 C  CB    . MET C 3 106 ? 25.089 -1.328  5.259  1.00 68.97  ? 106  MET A CB    1 
ATOM   1430 C  CG    . MET C 3 106 ? 25.595 -2.747  5.360  1.00 73.77  ? 106  MET A CG    1 
ATOM   1431 S  SD    . MET C 3 106 ? 24.367 -3.940  4.822  1.00 79.74  ? 106  MET A SD    1 
ATOM   1432 C  CE    . MET C 3 106 ? 25.065 -4.420  3.243  1.00 77.60  ? 106  MET A CE    1 
ATOM   1433 N  N     . GLU C 3 107 ? 25.893 1.850   4.524  1.00 67.32  ? 107  GLU A N     1 
ATOM   1434 C  CA    . GLU C 3 107 ? 25.337 3.176   4.333  1.00 66.71  ? 107  GLU A CA    1 
ATOM   1435 C  C     . GLU C 3 107 ? 23.840 2.950   4.219  1.00 65.87  ? 107  GLU A C     1 
ATOM   1436 O  O     . GLU C 3 107 ? 23.361 2.450   3.203  1.00 67.03  ? 107  GLU A O     1 
ATOM   1437 C  CB    . GLU C 3 107 ? 25.865 3.814   3.047  1.00 71.38  ? 107  GLU A CB    1 
ATOM   1438 C  CG    . GLU C 3 107 ? 27.355 3.641   2.817  1.00 76.85  ? 107  GLU A CG    1 
ATOM   1439 C  CD    . GLU C 3 107 ? 27.670 2.419   1.977  1.00 82.09  ? 107  GLU A CD    1 
ATOM   1440 O  OE1   . GLU C 3 107 ? 27.228 2.377   0.809  1.00 84.25  ? 107  GLU A OE1   1 
ATOM   1441 O  OE2   . GLU C 3 107 ? 28.355 1.502   2.480  1.00 85.23  ? 107  GLU A OE2   1 
ATOM   1442 N  N     . LEU C 3 108 ? 23.119 3.297   5.278  1.00 61.15  ? 108  LEU A N     1 
ATOM   1443 C  CA    . LEU C 3 108 ? 21.669 3.145   5.353  1.00 59.71  ? 108  LEU A CA    1 
ATOM   1444 C  C     . LEU C 3 108 ? 21.351 3.063   6.830  1.00 57.93  ? 108  LEU A C     1 
ATOM   1445 O  O     . LEU C 3 108 ? 20.256 3.419   7.270  1.00 57.17  ? 108  LEU A O     1 
ATOM   1446 C  CB    . LEU C 3 108 ? 21.195 1.864   4.649  1.00 62.17  ? 108  LEU A CB    1 
ATOM   1447 C  CG    . LEU C 3 108 ? 20.523 0.751   5.465  1.00 62.34  ? 108  LEU A CG    1 
ATOM   1448 C  CD1   . LEU C 3 108 ? 19.691 -0.114  4.535  1.00 64.02  ? 108  LEU A CD1   1 
ATOM   1449 C  CD2   . LEU C 3 108 ? 21.566 -0.085  6.189  1.00 63.75  ? 108  LEU A CD2   1 
ATOM   1450 N  N     . CYS C 3 109 ? 22.335 2.578   7.584  1.00 54.01  ? 109  CYS A N     1 
ATOM   1451 C  CA    . CYS C 3 109 ? 22.223 2.447   9.025  1.00 50.05  ? 109  CYS A CA    1 
ATOM   1452 C  C     . CYS C 3 109 ? 22.442 3.843   9.588  1.00 50.93  ? 109  CYS A C     1 
ATOM   1453 O  O     . CYS C 3 109 ? 23.532 4.401   9.485  1.00 46.56  ? 109  CYS A O     1 
ATOM   1454 C  CB    . CYS C 3 109 ? 23.293 1.487   9.555  1.00 48.73  ? 109  CYS A CB    1 
ATOM   1455 S  SG    . CYS C 3 109 ? 23.164 1.161   11.322 1.00 35.89  ? 109  CYS A SG    1 
ATOM   1456 N  N     . GLU C 3 110 ? 21.388 4.406   10.166 1.00 54.14  ? 110  GLU A N     1 
ATOM   1457 C  CA    . GLU C 3 110 ? 21.425 5.749   10.732 1.00 53.09  ? 110  GLU A CA    1 
ATOM   1458 C  C     . GLU C 3 110 ? 22.256 5.856   11.999 1.00 52.71  ? 110  GLU A C     1 
ATOM   1459 O  O     . GLU C 3 110 ? 23.002 6.817   12.172 1.00 51.89  ? 110  GLU A O     1 
ATOM   1460 C  CB    . GLU C 3 110 ? 20.010 6.210   11.068 1.00 56.82  ? 110  GLU A CB    1 
ATOM   1461 C  CG    . GLU C 3 110 ? 19.096 6.460   9.902  1.00 61.78  ? 110  GLU A CG    1 
ATOM   1462 C  CD    . GLU C 3 110 ? 17.646 6.508   10.348 1.00 65.80  ? 110  GLU A CD    1 
ATOM   1463 O  OE1   . GLU C 3 110 ? 16.959 5.465   10.253 1.00 64.93  ? 110  GLU A OE1   1 
ATOM   1464 O  OE2   . GLU C 3 110 ? 17.202 7.581   10.816 1.00 63.87  ? 110  GLU A OE2   1 
ATOM   1465 N  N     . PHE C 3 111 ? 22.113 4.870   12.885 1.00 52.18  ? 111  PHE A N     1 
ATOM   1466 C  CA    . PHE C 3 111 ? 22.816 4.881   14.165 1.00 48.39  ? 111  PHE A CA    1 
ATOM   1467 C  C     . PHE C 3 111 ? 23.938 3.881   14.346 1.00 43.49  ? 111  PHE A C     1 
ATOM   1468 O  O     . PHE C 3 111 ? 24.152 3.399   15.452 1.00 41.06  ? 111  PHE A O     1 
ATOM   1469 C  CB    . PHE C 3 111 ? 21.821 4.690   15.309 1.00 46.51  ? 111  PHE A CB    1 
ATOM   1470 C  CG    . PHE C 3 111 ? 20.638 5.604   15.236 1.00 47.31  ? 111  PHE A CG    1 
ATOM   1471 C  CD1   . PHE C 3 111 ? 19.594 5.338   14.354 1.00 44.95  ? 111  PHE A CD1   1 
ATOM   1472 C  CD2   . PHE C 3 111 ? 20.556 6.726   16.061 1.00 49.55  ? 111  PHE A CD2   1 
ATOM   1473 C  CE1   . PHE C 3 111 ? 18.488 6.167   14.289 1.00 46.41  ? 111  PHE A CE1   1 
ATOM   1474 C  CE2   . PHE C 3 111 ? 19.444 7.572   16.005 1.00 48.14  ? 111  PHE A CE2   1 
ATOM   1475 C  CZ    . PHE C 3 111 ? 18.407 7.288   15.118 1.00 49.21  ? 111  PHE A CZ    1 
ATOM   1476 N  N     . ALA C 3 112 ? 24.654 3.561   13.278 1.00 44.82  ? 112  ALA A N     1 
ATOM   1477 C  CA    . ALA C 3 112 ? 25.762 2.626   13.391 1.00 46.19  ? 112  ALA A CA    1 
ATOM   1478 C  C     . ALA C 3 112 ? 26.615 3.048   14.585 1.00 50.77  ? 112  ALA A C     1 
ATOM   1479 O  O     . ALA C 3 112 ? 26.620 4.218   14.977 1.00 50.20  ? 112  ALA A O     1 
ATOM   1480 C  CB    . ALA C 3 112 ? 26.594 2.647   12.128 1.00 49.44  ? 112  ALA A CB    1 
ATOM   1481 N  N     . PHE C 3 113 ? 27.331 2.091   15.161 1.00 51.63  ? 113  PHE A N     1 
ATOM   1482 C  CA    . PHE C 3 113 ? 28.175 2.358   16.316 1.00 53.10  ? 113  PHE A CA    1 
ATOM   1483 C  C     . PHE C 3 113 ? 29.205 3.457   16.053 1.00 52.32  ? 113  PHE A C     1 
ATOM   1484 O  O     . PHE C 3 113 ? 29.388 4.350   16.872 1.00 49.84  ? 113  PHE A O     1 
ATOM   1485 C  CB    . PHE C 3 113 ? 28.892 1.075   16.741 1.00 53.23  ? 113  PHE A CB    1 
ATOM   1486 C  CG    . PHE C 3 113 ? 29.775 1.245   17.936 1.00 54.07  ? 113  PHE A CG    1 
ATOM   1487 C  CD1   . PHE C 3 113 ? 29.233 1.568   19.172 1.00 55.77  ? 113  PHE A CD1   1 
ATOM   1488 C  CD2   . PHE C 3 113 ? 31.152 1.106   17.821 1.00 55.06  ? 113  PHE A CD2   1 
ATOM   1489 C  CE1   . PHE C 3 113 ? 30.046 1.730   20.287 1.00 58.22  ? 113  PHE A CE1   1 
ATOM   1490 C  CE2   . PHE C 3 113 ? 31.979 1.265   18.931 1.00 56.32  ? 113  PHE A CE2   1 
ATOM   1491 C  CZ    . PHE C 3 113 ? 31.424 1.587   20.164 1.00 57.56  ? 113  PHE A CZ    1 
ATOM   1492 N  N     . ASN C 3 114 ? 29.865 3.381   14.903 1.00 57.76  ? 114  ASN A N     1 
ATOM   1493 C  CA    . ASN C 3 114 ? 30.900 4.341   14.516 1.00 63.52  ? 114  ASN A CA    1 
ATOM   1494 C  C     . ASN C 3 114 ? 30.466 5.798   14.377 1.00 64.69  ? 114  ASN A C     1 
ATOM   1495 O  O     . ASN C 3 114 ? 31.313 6.685   14.272 1.00 64.09  ? 114  ASN A O     1 
ATOM   1496 C  CB    . ASN C 3 114 ? 31.558 3.900   13.203 1.00 65.89  ? 114  ASN A CB    1 
ATOM   1497 C  CG    . ASN C 3 114 ? 32.651 2.868   13.412 1.00 69.15  ? 114  ASN A CG    1 
ATOM   1498 O  OD1   . ASN C 3 114 ? 32.883 2.402   14.532 1.00 69.91  ? 114  ASN A OD1   1 
ATOM   1499 N  ND2   . ASN C 3 114 ? 33.333 2.506   12.328 1.00 68.57  ? 114  ASN A ND2   1 
ATOM   1500 N  N     . MET C 3 115 ? 29.162 6.053   14.372 1.00 66.29  ? 115  MET A N     1 
ATOM   1501 C  CA    . MET C 3 115 ? 28.674 7.419   14.230 1.00 69.90  ? 115  MET A CA    1 
ATOM   1502 C  C     . MET C 3 115 ? 28.348 8.058   15.566 1.00 70.78  ? 115  MET A C     1 
ATOM   1503 O  O     . MET C 3 115 ? 27.739 9.127   15.629 1.00 72.55  ? 115  MET A O     1 
ATOM   1504 C  CB    . MET C 3 115 ? 27.452 7.448   13.319 1.00 73.24  ? 115  MET A CB    1 
ATOM   1505 C  CG    . MET C 3 115 ? 27.773 7.031   11.896 1.00 77.80  ? 115  MET A CG    1 
ATOM   1506 S  SD    . MET C 3 115 ? 26.369 7.199   10.804 1.00 85.36  ? 115  MET A SD    1 
ATOM   1507 C  CE    . MET C 3 115 ? 25.497 5.706   11.164 1.00 82.07  ? 115  MET A CE    1 
ATOM   1508 N  N     . LYS C 3 116 ? 28.764 7.385   16.630 1.00 69.32  ? 116  LYS A N     1 
ATOM   1509 C  CA    . LYS C 3 116 ? 28.568 7.848   17.992 1.00 68.44  ? 116  LYS A CA    1 
ATOM   1510 C  C     . LYS C 3 116 ? 27.415 8.826   18.200 1.00 66.80  ? 116  LYS A C     1 
ATOM   1511 O  O     . LYS C 3 116 ? 27.608 10.041  18.217 1.00 64.59  ? 116  LYS A O     1 
ATOM   1512 C  CB    . LYS C 3 116 ? 29.878 8.451   18.497 1.00 70.91  ? 116  LYS A CB    1 
ATOM   1513 C  CG    . LYS C 3 116 ? 31.063 7.518   18.268 1.00 74.99  ? 116  LYS A CG    1 
ATOM   1514 C  CD    . LYS C 3 116 ? 32.384 8.087   18.769 1.00 77.44  ? 116  LYS A CD    1 
ATOM   1515 C  CE    . LYS C 3 116 ? 33.521 7.093   18.535 1.00 77.49  ? 116  LYS A CE    1 
ATOM   1516 N  NZ    . LYS C 3 116 ? 34.836 7.562   19.067 1.00 78.99  ? 116  LYS A NZ    1 
ATOM   1517 N  N     . LYS C 3 117 ? 26.212 8.276   18.352 1.00 66.08  ? 117  LYS A N     1 
ATOM   1518 C  CA    . LYS C 3 117 ? 25.005 9.062   18.592 1.00 63.36  ? 117  LYS A CA    1 
ATOM   1519 C  C     . LYS C 3 117 ? 24.388 8.564   19.893 1.00 62.90  ? 117  LYS A C     1 
ATOM   1520 O  O     . LYS C 3 117 ? 24.813 7.542   20.435 1.00 66.22  ? 117  LYS A O     1 
ATOM   1521 C  CB    . LYS C 3 117 ? 23.992 8.883   17.456 1.00 63.91  ? 117  LYS A CB    1 
ATOM   1522 C  CG    . LYS C 3 117 ? 24.436 9.425   16.111 1.00 66.50  ? 117  LYS A CG    1 
ATOM   1523 C  CD    . LYS C 3 117 ? 23.297 9.370   15.102 1.00 67.20  ? 117  LYS A CD    1 
ATOM   1524 C  CE    . LYS C 3 117 ? 23.719 9.934   13.754 1.00 68.32  ? 117  LYS A CE    1 
ATOM   1525 N  NZ    . LYS C 3 117 ? 22.586 9.957   12.781 1.00 69.03  ? 117  LYS A NZ    1 
ATOM   1526 N  N     . ASP C 3 118 ? 23.389 9.278   20.395 1.00 60.67  ? 118  ASP A N     1 
ATOM   1527 C  CA    . ASP C 3 118 ? 22.727 8.888   21.635 1.00 61.51  ? 118  ASP A CA    1 
ATOM   1528 C  C     . ASP C 3 118 ? 22.206 7.453   21.573 1.00 59.82  ? 118  ASP A C     1 
ATOM   1529 O  O     . ASP C 3 118 ? 21.961 6.832   22.606 1.00 56.48  ? 118  ASP A O     1 
ATOM   1530 C  CB    . ASP C 3 118 ? 21.563 9.839   21.929 1.00 66.18  ? 118  ASP A CB    1 
ATOM   1531 C  CG    . ASP C 3 118 ? 22.028 11.228  22.336 1.00 71.05  ? 118  ASP A CG    1 
ATOM   1532 O  OD1   . ASP C 3 118 ? 22.924 11.785  21.661 1.00 72.82  ? 118  ASP A OD1   1 
ATOM   1533 O  OD2   . ASP C 3 118 ? 21.490 11.768  23.328 1.00 71.55  ? 118  ASP A OD2   1 
ATOM   1534 N  N     . GLU C 3 119 ? 22.045 6.931   20.359 1.00 56.22  ? 119  GLU A N     1 
ATOM   1535 C  CA    . GLU C 3 119 ? 21.529 5.580   20.164 1.00 50.89  ? 119  GLU A CA    1 
ATOM   1536 C  C     . GLU C 3 119 ? 22.475 4.705   19.347 1.00 43.59  ? 119  GLU A C     1 
ATOM   1537 O  O     . GLU C 3 119 ? 23.190 5.186   18.465 1.00 42.74  ? 119  GLU A O     1 
ATOM   1538 C  CB    . GLU C 3 119 ? 20.187 5.641   19.437 1.00 57.96  ? 119  GLU A CB    1 
ATOM   1539 C  CG    . GLU C 3 119 ? 19.180 6.625   20.005 1.00 68.19  ? 119  GLU A CG    1 
ATOM   1540 C  CD    . GLU C 3 119 ? 18.723 6.257   21.394 1.00 74.26  ? 119  GLU A CD    1 
ATOM   1541 O  OE1   . GLU C 3 119 ? 18.169 5.149   21.567 1.00 77.74  ? 119  GLU A OE1   1 
ATOM   1542 O  OE2   . GLU C 3 119 ? 18.913 7.077   22.317 1.00 79.52  ? 119  GLU A OE2   1 
ATOM   1543 N  N     . VAL C 3 120 ? 22.470 3.411   19.630 1.00 34.72  ? 120  VAL A N     1 
ATOM   1544 C  CA    . VAL C 3 120 ? 23.314 2.490   18.886 1.00 32.32  ? 120  VAL A CA    1 
ATOM   1545 C  C     . VAL C 3 120 ? 22.475 1.408   18.240 1.00 32.79  ? 120  VAL A C     1 
ATOM   1546 O  O     . VAL C 3 120 ? 21.650 0.774   18.900 1.00 29.18  ? 120  VAL A O     1 
ATOM   1547 C  CB    . VAL C 3 120 ? 24.352 1.809   19.780 1.00 32.67  ? 120  VAL A CB    1 
ATOM   1548 C  CG1   . VAL C 3 120 ? 25.089 0.729   18.983 1.00 33.01  ? 120  VAL A CG1   1 
ATOM   1549 C  CG2   . VAL C 3 120 ? 25.338 2.842   20.292 1.00 36.07  ? 120  VAL A CG2   1 
ATOM   1550 N  N     . CYS C 3 121 ? 22.684 1.198   16.946 1.00 31.36  ? 121  CYS A N     1 
ATOM   1551 C  CA    . CYS C 3 121 ? 21.936 0.174   16.244 1.00 31.77  ? 121  CYS A CA    1 
ATOM   1552 C  C     . CYS C 3 121 ? 22.589 -1.194  16.447 1.00 25.82  ? 121  CYS A C     1 
ATOM   1553 O  O     . CYS C 3 121 ? 23.767 -1.378  16.182 1.00 24.63  ? 121  CYS A O     1 
ATOM   1554 C  CB    . CYS C 3 121 ? 21.862 0.476   14.749 1.00 29.87  ? 121  CYS A CB    1 
ATOM   1555 S  SG    . CYS C 3 121 ? 21.060 -0.869  13.831 1.00 32.95  ? 121  CYS A SG    1 
ATOM   1556 N  N     . VAL C 3 122 ? 21.811 -2.152  16.910 1.00 27.39  ? 122  VAL A N     1 
ATOM   1557 C  CA    . VAL C 3 122 ? 22.347 -3.480  17.115 1.00 33.33  ? 122  VAL A CA    1 
ATOM   1558 C  C     . VAL C 3 122 ? 21.682 -4.452  16.146 1.00 35.47  ? 122  VAL A C     1 
ATOM   1559 O  O     . VAL C 3 122 ? 21.639 -5.652  16.388 1.00 37.51  ? 122  VAL A O     1 
ATOM   1560 C  CB    . VAL C 3 122 ? 22.152 -3.934  18.577 1.00 29.45  ? 122  VAL A CB    1 
ATOM   1561 C  CG1   . VAL C 3 122 ? 22.927 -3.002  19.498 1.00 31.07  ? 122  VAL A CG1   1 
ATOM   1562 C  CG2   . VAL C 3 122 ? 20.679 -3.920  18.942 1.00 29.85  ? 122  VAL A CG2   1 
ATOM   1563 N  N     . ASN C 3 123 ? 21.147 -3.911  15.052 1.00 35.81  ? 123  ASN A N     1 
ATOM   1564 C  CA    . ASN C 3 123 ? 20.526 -4.730  14.025 1.00 30.64  ? 123  ASN A CA    1 
ATOM   1565 C  C     . ASN C 3 123 ? 21.709 -5.491  13.415 1.00 31.92  ? 123  ASN A C     1 
ATOM   1566 O  O     . ASN C 3 123 ? 22.578 -4.903  12.761 1.00 29.49  ? 123  ASN A O     1 
ATOM   1567 C  CB    . ASN C 3 123 ? 19.862 -3.848  12.963 1.00 34.66  ? 123  ASN A CB    1 
ATOM   1568 C  CG    . ASN C 3 123 ? 19.063 -4.656  11.942 1.00 32.20  ? 123  ASN A CG    1 
ATOM   1569 O  OD1   . ASN C 3 123 ? 19.509 -5.702  11.480 1.00 32.25  ? 123  ASN A OD1   1 
ATOM   1570 N  ND2   . ASN C 3 123 ? 17.888 -4.157  11.575 1.00 32.84  ? 123  ASN A ND2   1 
ATOM   1571 N  N     . PRO C 3 124 ? 21.770 -6.809  13.632 1.00 30.38  ? 124  PRO A N     1 
ATOM   1572 C  CA    . PRO C 3 124 ? 22.905 -7.532  13.057 1.00 31.59  ? 124  PRO A CA    1 
ATOM   1573 C  C     . PRO C 3 124 ? 22.998 -7.488  11.533 1.00 34.22  ? 124  PRO A C     1 
ATOM   1574 O  O     . PRO C 3 124 ? 24.056 -7.747  10.960 1.00 32.98  ? 124  PRO A O     1 
ATOM   1575 C  CB    . PRO C 3 124 ? 22.749 -8.940  13.631 1.00 29.23  ? 124  PRO A CB    1 
ATOM   1576 C  CG    . PRO C 3 124 ? 21.311 -9.058  13.908 1.00 34.64  ? 124  PRO A CG    1 
ATOM   1577 C  CD    . PRO C 3 124 ? 20.903 -7.701  14.417 1.00 31.70  ? 124  PRO A CD    1 
ATOM   1578 N  N     . TYR C 3 125 ? 21.906 -7.127  10.870 1.00 37.97  ? 125  TYR A N     1 
ATOM   1579 C  CA    . TYR C 3 125 ? 21.936 -7.060  9.416  1.00 40.55  ? 125  TYR A CA    1 
ATOM   1580 C  C     . TYR C 3 125 ? 22.214 -5.675  8.843  1.00 40.48  ? 125  TYR A C     1 
ATOM   1581 O  O     . TYR C 3 125 ? 21.939 -5.418  7.676  1.00 43.02  ? 125  TYR A O     1 
ATOM   1582 C  CB    . TYR C 3 125 ? 20.648 -7.649  8.836  1.00 39.12  ? 125  TYR A CB    1 
ATOM   1583 C  CG    . TYR C 3 125 ? 20.627 -9.139  9.023  1.00 37.68  ? 125  TYR A CG    1 
ATOM   1584 C  CD1   . TYR C 3 125 ? 20.111 -9.710  10.184 1.00 42.05  ? 125  TYR A CD1   1 
ATOM   1585 C  CD2   . TYR C 3 125 ? 21.258 -9.972  8.109  1.00 37.60  ? 125  TYR A CD2   1 
ATOM   1586 C  CE1   . TYR C 3 125 ? 20.236 -11.073 10.431 1.00 41.36  ? 125  TYR A CE1   1 
ATOM   1587 C  CE2   . TYR C 3 125 ? 21.392 -11.329 8.344  1.00 40.24  ? 125  TYR A CE2   1 
ATOM   1588 C  CZ    . TYR C 3 125 ? 20.887 -11.873 9.505  1.00 43.04  ? 125  TYR A CZ    1 
ATOM   1589 O  OH    . TYR C 3 125 ? 21.090 -13.205 9.762  1.00 47.12  ? 125  TYR A OH    1 
ATOM   1590 N  N     . HIS C 3 126 ? 22.775 -4.795  9.669  1.00 39.13  ? 126  HIS A N     1 
ATOM   1591 C  CA    . HIS C 3 126 ? 23.136 -3.448  9.239  1.00 38.83  ? 126  HIS A CA    1 
ATOM   1592 C  C     . HIS C 3 126 ? 24.653 -3.323  9.214  1.00 39.95  ? 126  HIS A C     1 
ATOM   1593 O  O     . HIS C 3 126 ? 25.195 -2.236  8.987  1.00 40.27  ? 126  HIS A O     1 
ATOM   1594 C  CB    . HIS C 3 126 ? 22.560 -2.390  10.182 1.00 38.48  ? 126  HIS A CB    1 
ATOM   1595 C  CG    . HIS C 3 126 ? 21.151 -2.001  9.864  1.00 39.77  ? 126  HIS A CG    1 
ATOM   1596 N  ND1   . HIS C 3 126 ? 20.460 -1.055  10.591 1.00 39.89  ? 126  HIS A ND1   1 
ATOM   1597 C  CD2   . HIS C 3 126 ? 20.304 -2.424  8.896  1.00 38.93  ? 126  HIS A CD2   1 
ATOM   1598 C  CE1   . HIS C 3 126 ? 19.247 -0.913  10.085 1.00 42.39  ? 126  HIS A CE1   1 
ATOM   1599 N  NE2   . HIS C 3 126 ? 19.127 -1.733  9.055  1.00 39.02  ? 126  HIS A NE2   1 
ATOM   1600 N  N     . TYR C 3 127 ? 25.336 -4.439  9.456  1.00 37.76  ? 127  TYR A N     1 
ATOM   1601 C  CA    . TYR C 3 127 ? 26.798 -4.450  9.457  1.00 39.14  ? 127  TYR A CA    1 
ATOM   1602 C  C     . TYR C 3 127 ? 27.348 -5.530  8.540  1.00 40.69  ? 127  TYR A C     1 
ATOM   1603 O  O     . TYR C 3 127 ? 26.701 -6.550  8.292  1.00 39.13  ? 127  TYR A O     1 
ATOM   1604 C  CB    . TYR C 3 127 ? 27.362 -4.685  10.868 1.00 32.12  ? 127  TYR A CB    1 
ATOM   1605 C  CG    . TYR C 3 127 ? 27.028 -3.614  11.894 1.00 32.36  ? 127  TYR A CG    1 
ATOM   1606 C  CD1   . TYR C 3 127 ? 25.832 -3.656  12.617 1.00 30.22  ? 127  TYR A CD1   1 
ATOM   1607 C  CD2   . TYR C 3 127 ? 27.912 -2.551  12.141 1.00 35.21  ? 127  TYR A CD2   1 
ATOM   1608 C  CE1   . TYR C 3 127 ? 25.518 -2.666  13.566 1.00 27.88  ? 127  TYR A CE1   1 
ATOM   1609 C  CE2   . TYR C 3 127 ? 27.607 -1.551  13.083 1.00 29.35  ? 127  TYR A CE2   1 
ATOM   1610 C  CZ    . TYR C 3 127 ? 26.415 -1.618  13.786 1.00 30.89  ? 127  TYR A CZ    1 
ATOM   1611 O  OH    . TYR C 3 127 ? 26.117 -0.648  14.703 1.00 32.57  ? 127  TYR A OH    1 
ATOM   1612 N  N     . GLN C 3 128 ? 28.547 -5.291  8.029  1.00 41.28  ? 128  GLN A N     1 
ATOM   1613 C  CA    . GLN C 3 128 ? 29.202 -6.256  7.172  1.00 45.47  ? 128  GLN A CA    1 
ATOM   1614 C  C     . GLN C 3 128 ? 30.522 -6.586  7.828  1.00 45.30  ? 128  GLN A C     1 
ATOM   1615 O  O     . GLN C 3 128 ? 31.108 -5.745  8.500  1.00 44.08  ? 128  GLN A O     1 
ATOM   1616 C  CB    . GLN C 3 128 ? 29.451 -5.686  5.774  1.00 48.23  ? 128  GLN A CB    1 
ATOM   1617 C  CG    . GLN C 3 128 ? 28.192 -5.410  4.977  1.00 54.91  ? 128  GLN A CG    1 
ATOM   1618 C  CD    . GLN C 3 128 ? 28.470 -5.249  3.491  1.00 60.61  ? 128  GLN A CD    1 
ATOM   1619 O  OE1   . GLN C 3 128 ? 29.286 -4.414  3.079  1.00 57.23  ? 128  GLN A OE1   1 
ATOM   1620 N  NE2   . GLN C 3 128 ? 27.790 -6.053  2.675  1.00 60.99  ? 128  GLN A NE2   1 
ATOM   1621 N  N     . ARG C 3 129 ? 30.978 -7.816  7.633  1.00 50.74  ? 129  ARG A N     1 
ATOM   1622 C  CA    . ARG C 3 129 ? 32.236 -8.263  8.198  1.00 55.91  ? 129  ARG A CA    1 
ATOM   1623 C  C     . ARG C 3 129 ? 33.357 -7.969  7.217  1.00 59.62  ? 129  ARG A C     1 
ATOM   1624 O  O     . ARG C 3 129 ? 33.155 -8.017  6.006  1.00 60.23  ? 129  ARG A O     1 
ATOM   1625 C  CB    . ARG C 3 129 ? 32.182 -9.763  8.478  1.00 58.74  ? 129  ARG A CB    1 
ATOM   1626 C  CG    . ARG C 3 129 ? 33.364 -10.271 9.283  1.00 60.48  ? 129  ARG A CG    1 
ATOM   1627 C  CD    . ARG C 3 129 ? 33.199 -11.734 9.644  1.00 62.36  ? 129  ARG A CD    1 
ATOM   1628 N  NE    . ARG C 3 129 ? 34.157 -12.135 10.670 1.00 66.31  ? 129  ARG A NE    1 
ATOM   1629 C  CZ    . ARG C 3 129 ? 34.205 -13.347 11.217 1.00 65.48  ? 129  ARG A CZ    1 
ATOM   1630 N  NH1   . ARG C 3 129 ? 33.349 -14.289 10.834 1.00 62.32  ? 129  ARG A NH1   1 
ATOM   1631 N  NH2   . ARG C 3 129 ? 35.105 -13.612 12.153 1.00 63.40  ? 129  ARG A NH2   1 
ATOM   1632 N  N     . VAL C 3 130 ? 34.535 -7.662  7.748  1.00 64.56  ? 130  VAL A N     1 
ATOM   1633 C  CA    . VAL C 3 130 ? 35.702 -7.369  6.928  1.00 69.44  ? 130  VAL A CA    1 
ATOM   1634 C  C     . VAL C 3 130 ? 36.867 -8.244  7.394  1.00 73.99  ? 130  VAL A C     1 
ATOM   1635 O  O     . VAL C 3 130 ? 36.927 -8.626  8.563  1.00 74.86  ? 130  VAL A O     1 
ATOM   1636 C  CB    . VAL C 3 130 ? 36.096 -5.882  7.056  1.00 67.95  ? 130  VAL A CB    1 
ATOM   1637 C  CG1   . VAL C 3 130 ? 34.866 -5.016  6.898  1.00 69.30  ? 130  VAL A CG1   1 
ATOM   1638 C  CG2   . VAL C 3 130 ? 36.747 -5.620  8.399  1.00 68.58  ? 130  VAL A CG2   1 
ATOM   1639 N  N     . GLU C 3 131 ? 37.783 -8.574  6.485  1.00 81.22  ? 131  GLU A N     1 
ATOM   1640 C  CA    . GLU C 3 131 ? 38.944 -9.398  6.833  1.00 86.27  ? 131  GLU A CA    1 
ATOM   1641 C  C     . GLU C 3 131 ? 40.072 -8.512  7.349  1.00 88.49  ? 131  GLU A C     1 
ATOM   1642 O  O     . GLU C 3 131 ? 41.230 -8.927  7.402  1.00 88.78  ? 131  GLU A O     1 
ATOM   1643 C  CB    . GLU C 3 131 ? 39.441 -10.189 5.618  1.00 88.37  ? 131  GLU A CB    1 
ATOM   1644 C  CG    . GLU C 3 131 ? 38.617 -11.425 5.265  1.00 91.52  ? 131  GLU A CG    1 
ATOM   1645 C  CD    . GLU C 3 131 ? 37.234 -11.095 4.723  1.00 94.27  ? 131  GLU A CD    1 
ATOM   1646 O  OE1   . GLU C 3 131 ? 36.427 -10.481 5.457  1.00 94.96  ? 131  GLU A OE1   1 
ATOM   1647 O  OE2   . GLU C 3 131 ? 36.951 -11.457 3.560  1.00 93.82  ? 131  GLU A OE2   1 
ATOM   1648 N  N     . THR C 3 132 ? 39.709 -7.290  7.734  1.00 92.47  ? 132  THR A N     1 
ATOM   1649 C  CA    . THR C 3 132 ? 40.650 -6.293  8.240  1.00 94.67  ? 132  THR A CA    1 
ATOM   1650 C  C     . THR C 3 132 ? 41.782 -6.063  7.242  1.00 96.79  ? 132  THR A C     1 
ATOM   1651 O  O     . THR C 3 132 ? 41.539 -5.869  6.047  1.00 98.65  ? 132  THR A O     1 
ATOM   1652 C  CB    . THR C 3 132 ? 41.249 -6.705  9.610  1.00 94.24  ? 132  THR A CB    1 
ATOM   1653 O  OG1   . THR C 3 132 ? 41.409 -5.535  10.419 1.00 93.45  ? 132  THR A OG1   1 
ATOM   1654 C  CG2   . THR C 3 132 ? 42.620 -7.372  9.438  1.00 93.47  ? 132  THR A CG2   1 
ATOM   1655 N  N     . PRO D 3 9   ? 47.521 -8.879  52.519 1.00 73.65  ? 9    PRO B N     1 
ATOM   1656 C  CA    . PRO D 3 9   ? 47.611 -7.514  53.049 1.00 74.43  ? 9    PRO B CA    1 
ATOM   1657 C  C     . PRO D 3 9   ? 47.936 -7.484  54.544 1.00 76.43  ? 9    PRO B C     1 
ATOM   1658 O  O     . PRO D 3 9   ? 47.684 -8.449  55.262 1.00 79.71  ? 9    PRO B O     1 
ATOM   1659 C  CB    . PRO D 3 9   ? 46.249 -6.933  52.710 1.00 74.72  ? 9    PRO B CB    1 
ATOM   1660 C  CG    . PRO D 3 9   ? 45.989 -7.560  51.360 1.00 75.28  ? 9    PRO B CG    1 
ATOM   1661 C  CD    . PRO D 3 9   ? 46.387 -9.008  51.587 1.00 72.74  ? 9    PRO B CD    1 
ATOM   1662 N  N     . PRO D 3 10  ? 48.489 -6.359  55.031 1.00 76.86  ? 10   PRO B N     1 
ATOM   1663 C  CA    . PRO D 3 10  ? 48.895 -6.122  56.423 1.00 74.12  ? 10   PRO B CA    1 
ATOM   1664 C  C     . PRO D 3 10  ? 47.806 -6.128  57.495 1.00 71.27  ? 10   PRO B C     1 
ATOM   1665 O  O     . PRO D 3 10  ? 47.342 -7.185  57.926 1.00 70.71  ? 10   PRO B O     1 
ATOM   1666 C  CB    . PRO D 3 10  ? 49.599 -4.772  56.339 1.00 76.27  ? 10   PRO B CB    1 
ATOM   1667 C  CG    . PRO D 3 10  ? 48.756 -4.051  55.334 1.00 78.84  ? 10   PRO B CG    1 
ATOM   1668 C  CD    . PRO D 3 10  ? 48.575 -5.109  54.250 1.00 78.07  ? 10   PRO B CD    1 
ATOM   1669 N  N     . ILE D 3 11  ? 47.439 -4.929  57.940 1.00 66.49  ? 11   ILE B N     1 
ATOM   1670 C  CA    . ILE D 3 11  ? 46.420 -4.730  58.964 1.00 61.82  ? 11   ILE B CA    1 
ATOM   1671 C  C     . ILE D 3 11  ? 45.197 -5.621  58.776 1.00 58.86  ? 11   ILE B C     1 
ATOM   1672 O  O     . ILE D 3 11  ? 44.580 -6.052  59.750 1.00 58.51  ? 11   ILE B O     1 
ATOM   1673 C  CB    . ILE D 3 11  ? 45.962 -3.257  58.992 1.00 61.76  ? 11   ILE B CB    1 
ATOM   1674 C  CG1   . ILE D 3 11  ? 44.788 -3.086  59.958 1.00 62.80  ? 11   ILE B CG1   1 
ATOM   1675 C  CG2   . ILE D 3 11  ? 45.580 -2.809  57.596 1.00 57.29  ? 11   ILE B CG2   1 
ATOM   1676 C  CD1   . ILE D 3 11  ? 45.117 -3.436  61.387 1.00 63.86  ? 11   ILE B CD1   1 
ATOM   1677 N  N     . VAL D 3 12  ? 44.843 -5.886  57.524 1.00 55.92  ? 12   VAL B N     1 
ATOM   1678 C  CA    . VAL D 3 12  ? 43.693 -6.730  57.229 1.00 56.12  ? 12   VAL B CA    1 
ATOM   1679 C  C     . VAL D 3 12  ? 43.805 -8.050  57.976 1.00 55.91  ? 12   VAL B C     1 
ATOM   1680 O  O     . VAL D 3 12  ? 42.841 -8.503  58.591 1.00 59.66  ? 12   VAL B O     1 
ATOM   1681 C  CB    . VAL D 3 12  ? 43.572 -7.016  55.713 1.00 55.29  ? 12   VAL B CB    1 
ATOM   1682 C  CG1   . VAL D 3 12  ? 42.522 -8.093  55.464 1.00 52.84  ? 12   VAL B CG1   1 
ATOM   1683 C  CG2   . VAL D 3 12  ? 43.197 -5.735  54.973 1.00 48.80  ? 12   VAL B CG2   1 
ATOM   1684 N  N     . LYS D 3 13  ? 44.984 -8.664  57.924 1.00 57.95  ? 13   LYS B N     1 
ATOM   1685 C  CA    . LYS D 3 13  ? 45.208 -9.931  58.606 1.00 57.42  ? 13   LYS B CA    1 
ATOM   1686 C  C     . LYS D 3 13  ? 45.088 -9.771  60.109 1.00 58.05  ? 13   LYS B C     1 
ATOM   1687 O  O     . LYS D 3 13  ? 44.518 -10.625 60.788 1.00 57.46  ? 13   LYS B O     1 
ATOM   1688 C  CB    . LYS D 3 13  ? 46.584 -10.499 58.257 1.00 60.90  ? 13   LYS B CB    1 
ATOM   1689 C  CG    . LYS D 3 13  ? 46.695 -10.995 56.827 1.00 63.87  ? 13   LYS B CG    1 
ATOM   1690 C  CD    . LYS D 3 13  ? 45.465 -11.807 56.403 1.00 68.68  ? 13   LYS B CD    1 
ATOM   1691 C  CE    . LYS D 3 13  ? 45.237 -13.067 57.253 1.00 70.51  ? 13   LYS B CE    1 
ATOM   1692 N  NZ    . LYS D 3 13  ? 44.686 -12.811 58.621 1.00 68.36  ? 13   LYS B NZ    1 
ATOM   1693 N  N     . ARG D 3 14  ? 45.633 -8.675  60.626 1.00 57.57  ? 14   ARG B N     1 
ATOM   1694 C  CA    . ARG D 3 14  ? 45.564 -8.406  62.050 1.00 60.27  ? 14   ARG B CA    1 
ATOM   1695 C  C     . ARG D 3 14  ? 44.096 -8.392  62.433 1.00 59.87  ? 14   ARG B C     1 
ATOM   1696 O  O     . ARG D 3 14  ? 43.642 -9.218  63.219 1.00 63.13  ? 14   ARG B O     1 
ATOM   1697 C  CB    . ARG D 3 14  ? 46.183 -7.047  62.370 1.00 63.30  ? 14   ARG B CB    1 
ATOM   1698 C  CG    . ARG D 3 14  ? 47.567 -6.853  61.802 1.00 67.88  ? 14   ARG B CG    1 
ATOM   1699 C  CD    . ARG D 3 14  ? 48.195 -5.571  62.317 1.00 71.76  ? 14   ARG B CD    1 
ATOM   1700 N  NE    . ARG D 3 14  ? 49.501 -5.336  61.710 1.00 78.39  ? 14   ARG B NE    1 
ATOM   1701 C  CZ    . ARG D 3 14  ? 50.487 -6.230  61.684 1.00 81.88  ? 14   ARG B CZ    1 
ATOM   1702 N  NH1   . ARG D 3 14  ? 50.317 -7.428  62.232 1.00 83.76  ? 14   ARG B NH1   1 
ATOM   1703 N  NH2   . ARG D 3 14  ? 51.650 -5.926  61.118 1.00 80.73  ? 14   ARG B NH2   1 
ATOM   1704 N  N     . LEU D 3 15  ? 43.357 -7.447  61.860 1.00 58.66  ? 15   LEU B N     1 
ATOM   1705 C  CA    . LEU D 3 15  ? 41.931 -7.314  62.129 1.00 54.80  ? 15   LEU B CA    1 
ATOM   1706 C  C     . LEU D 3 15  ? 41.220 -8.646  61.929 1.00 51.71  ? 15   LEU B C     1 
ATOM   1707 O  O     . LEU D 3 15  ? 40.278 -8.970  62.655 1.00 50.63  ? 15   LEU B O     1 
ATOM   1708 C  CB    . LEU D 3 15  ? 41.328 -6.245  61.217 1.00 52.47  ? 15   LEU B CB    1 
ATOM   1709 C  CG    . LEU D 3 15  ? 41.962 -4.873  61.447 1.00 51.18  ? 15   LEU B CG    1 
ATOM   1710 C  CD1   . LEU D 3 15  ? 41.393 -3.864  60.471 1.00 55.87  ? 15   LEU B CD1   1 
ATOM   1711 C  CD2   . LEU D 3 15  ? 41.704 -4.436  62.881 1.00 50.07  ? 15   LEU B CD2   1 
ATOM   1712 N  N     . LEU D 3 16  ? 41.666 -9.413  60.941 1.00 49.34  ? 16   LEU B N     1 
ATOM   1713 C  CA    . LEU D 3 16  ? 41.074 -10.714 60.691 1.00 49.92  ? 16   LEU B CA    1 
ATOM   1714 C  C     . LEU D 3 16  ? 41.413 -11.599 61.878 1.00 50.86  ? 16   LEU B C     1 
ATOM   1715 O  O     . LEU D 3 16  ? 40.651 -12.497 62.233 1.00 47.94  ? 16   LEU B O     1 
ATOM   1716 C  CB    . LEU D 3 16  ? 41.635 -11.324 59.407 1.00 48.14  ? 16   LEU B CB    1 
ATOM   1717 C  CG    . LEU D 3 16  ? 41.039 -10.798 58.103 1.00 50.20  ? 16   LEU B CG    1 
ATOM   1718 C  CD1   . LEU D 3 16  ? 41.632 -11.562 56.925 1.00 47.54  ? 16   LEU B CD1   1 
ATOM   1719 C  CD2   . LEU D 3 16  ? 39.513 -10.962 58.140 1.00 49.07  ? 16   LEU B CD2   1 
ATOM   1720 N  N     . GLY D 3 17  ? 42.571 -11.333 62.482 1.00 53.65  ? 17   GLY B N     1 
ATOM   1721 C  CA    . GLY D 3 17  ? 43.007 -12.087 63.645 1.00 58.21  ? 17   GLY B CA    1 
ATOM   1722 C  C     . GLY D 3 17  ? 41.918 -12.108 64.701 1.00 62.19  ? 17   GLY B C     1 
ATOM   1723 O  O     . GLY D 3 17  ? 41.785 -13.074 65.452 1.00 62.92  ? 17   GLY B O     1 
ATOM   1724 N  N     . TRP D 3 18  ? 41.147 -11.026 64.771 1.00 64.16  ? 18   TRP B N     1 
ATOM   1725 C  CA    . TRP D 3 18  ? 40.040 -10.937 65.710 1.00 67.16  ? 18   TRP B CA    1 
ATOM   1726 C  C     . TRP D 3 18  ? 38.791 -11.217 64.891 1.00 71.32  ? 18   TRP B C     1 
ATOM   1727 O  O     . TRP D 3 18  ? 38.637 -10.691 63.790 1.00 76.87  ? 18   TRP B O     1 
ATOM   1728 C  CB    . TRP D 3 18  ? 39.943 -9.541  66.317 1.00 66.04  ? 18   TRP B CB    1 
ATOM   1729 C  CG    . TRP D 3 18  ? 41.159 -9.113  67.060 1.00 66.51  ? 18   TRP B CG    1 
ATOM   1730 C  CD1   . TRP D 3 18  ? 42.367 -8.772  66.530 1.00 65.07  ? 18   TRP B CD1   1 
ATOM   1731 C  CD2   . TRP D 3 18  ? 41.281 -8.957  68.475 1.00 68.10  ? 18   TRP B CD2   1 
ATOM   1732 N  NE1   . TRP D 3 18  ? 43.234 -8.408  67.528 1.00 66.04  ? 18   TRP B NE1   1 
ATOM   1733 C  CE2   . TRP D 3 18  ? 42.593 -8.513  68.734 1.00 67.36  ? 18   TRP B CE2   1 
ATOM   1734 C  CE3   . TRP D 3 18  ? 40.406 -9.151  69.552 1.00 69.97  ? 18   TRP B CE3   1 
ATOM   1735 C  CZ2   . TRP D 3 18  ? 43.055 -8.257  70.026 1.00 66.84  ? 18   TRP B CZ2   1 
ATOM   1736 C  CZ3   . TRP D 3 18  ? 40.865 -8.898  70.836 1.00 68.62  ? 18   TRP B CZ3   1 
ATOM   1737 C  CH2   . TRP D 3 18  ? 42.179 -8.455  71.061 1.00 68.49  ? 18   TRP B CH2   1 
ATOM   1738 N  N     . LYS D 3 19  ? 37.911 -12.050 65.425 1.00 72.17  ? 19   LYS B N     1 
ATOM   1739 C  CA    . LYS D 3 19  ? 36.677 -12.425 64.752 1.00 77.72  ? 19   LYS B CA    1 
ATOM   1740 C  C     . LYS D 3 19  ? 36.285 -13.733 65.386 1.00 80.71  ? 19   LYS B C     1 
ATOM   1741 O  O     . LYS D 3 19  ? 37.095 -14.341 66.078 1.00 82.87  ? 19   LYS B O     1 
ATOM   1742 C  CB    . LYS D 3 19  ? 36.897 -12.633 63.251 1.00 78.15  ? 19   LYS B CB    1 
ATOM   1743 C  CG    . LYS D 3 19  ? 37.946 -13.676 62.910 1.00 78.65  ? 19   LYS B CG    1 
ATOM   1744 C  CD    . LYS D 3 19  ? 37.964 -13.979 61.419 1.00 79.19  ? 19   LYS B CD    1 
ATOM   1745 C  CE    . LYS D 3 19  ? 36.638 -14.568 60.968 1.00 79.89  ? 19   LYS B CE    1 
ATOM   1746 N  NZ    . LYS D 3 19  ? 36.673 -15.024 59.557 1.00 79.18  ? 19   LYS B NZ    1 
ATOM   1747 N  N     . LYS D 3 20  ? 35.063 -14.186 65.147 1.00 84.75  ? 20   LYS B N     1 
ATOM   1748 C  CA    . LYS D 3 20  ? 34.634 -15.427 65.765 1.00 90.40  ? 20   LYS B CA    1 
ATOM   1749 C  C     . LYS D 3 20  ? 33.622 -16.232 64.970 1.00 94.15  ? 20   LYS B C     1 
ATOM   1750 O  O     . LYS D 3 20  ? 32.999 -15.722 64.039 1.00 94.79  ? 20   LYS B O     1 
ATOM   1751 C  CB    . LYS D 3 20  ? 34.089 -15.115 67.157 1.00 91.10  ? 20   LYS B CB    1 
ATOM   1752 C  CG    . LYS D 3 20  ? 33.224 -13.868 67.206 1.00 89.84  ? 20   LYS B CG    1 
ATOM   1753 C  CD    . LYS D 3 20  ? 33.182 -13.298 68.612 1.00 90.79  ? 20   LYS B CD    1 
ATOM   1754 C  CE    . LYS D 3 20  ? 34.559 -12.828 69.052 1.00 89.60  ? 20   LYS B CE    1 
ATOM   1755 N  NZ    . LYS D 3 20  ? 34.534 -12.259 70.426 1.00 91.20  ? 20   LYS B NZ    1 
ATOM   1756 N  N     . GLY D 3 21  ? 33.476 -17.501 65.348 1.00 97.99  ? 21   GLY B N     1 
ATOM   1757 C  CA    . GLY D 3 21  ? 32.537 -18.387 64.683 1.00 102.22 ? 21   GLY B CA    1 
ATOM   1758 C  C     . GLY D 3 21  ? 33.187 -19.221 63.598 1.00 104.84 ? 21   GLY B C     1 
ATOM   1759 O  O     . GLY D 3 21  ? 32.558 -20.117 63.034 1.00 104.58 ? 21   GLY B O     1 
ATOM   1760 N  N     . GLU D 3 22  ? 34.451 -18.925 63.315 1.00 107.56 ? 22   GLU B N     1 
ATOM   1761 C  CA    . GLU D 3 22  ? 35.216 -19.624 62.288 1.00 111.64 ? 22   GLU B CA    1 
ATOM   1762 C  C     . GLU D 3 22  ? 34.324 -20.265 61.224 1.00 113.35 ? 22   GLU B C     1 
ATOM   1763 O  O     . GLU D 3 22  ? 34.122 -21.480 61.208 1.00 113.34 ? 22   GLU B O     1 
ATOM   1764 C  CB    . GLU D 3 22  ? 36.113 -20.688 62.924 1.00 112.03 ? 22   GLU B CB    1 
ATOM   1765 C  CG    . GLU D 3 22  ? 37.228 -21.168 62.005 1.00 112.43 ? 22   GLU B CG    1 
ATOM   1766 C  CD    . GLU D 3 22  ? 38.157 -20.041 61.579 1.00 111.90 ? 22   GLU B CD    1 
ATOM   1767 O  OE1   . GLU D 3 22  ? 38.792 -19.426 62.462 1.00 111.13 ? 22   GLU B OE1   1 
ATOM   1768 O  OE2   . GLU D 3 22  ? 38.252 -19.768 60.362 1.00 111.31 ? 22   GLU B OE2   1 
ATOM   1769 N  N     . GLN D 3 23  ? 33.787 -19.426 60.344 1.00 115.48 ? 23   GLN B N     1 
ATOM   1770 C  CA    . GLN D 3 23  ? 32.916 -19.874 59.265 1.00 116.78 ? 23   GLN B CA    1 
ATOM   1771 C  C     . GLN D 3 23  ? 33.704 -19.802 57.959 1.00 116.32 ? 23   GLN B C     1 
ATOM   1772 O  O     . GLN D 3 23  ? 33.501 -18.893 57.154 1.00 116.77 ? 23   GLN B O     1 
ATOM   1773 C  CB    . GLN D 3 23  ? 31.685 -18.962 59.182 1.00 118.52 ? 23   GLN B CB    1 
ATOM   1774 C  CG    . GLN D 3 23  ? 30.338 -19.679 59.220 1.00 120.77 ? 23   GLN B CG    1 
ATOM   1775 C  CD    . GLN D 3 23  ? 30.051 -20.477 57.961 1.00 121.73 ? 23   GLN B CD    1 
ATOM   1776 O  OE1   . GLN D 3 23  ? 30.045 -19.934 56.857 1.00 122.78 ? 23   GLN B OE1   1 
ATOM   1777 N  NE2   . GLN D 3 23  ? 29.802 -21.772 58.124 1.00 122.46 ? 23   GLN B NE2   1 
ATOM   1778 N  N     . ASN D 3 24  ? 34.610 -20.755 57.757 1.00 115.79 ? 24   ASN B N     1 
ATOM   1779 C  CA    . ASN D 3 24  ? 35.428 -20.782 56.548 1.00 115.00 ? 24   ASN B CA    1 
ATOM   1780 C  C     . ASN D 3 24  ? 34.603 -21.012 55.289 1.00 113.70 ? 24   ASN B C     1 
ATOM   1781 O  O     . ASN D 3 24  ? 33.413 -20.703 55.244 1.00 114.12 ? 24   ASN B O     1 
ATOM   1782 C  CB    . ASN D 3 24  ? 36.513 -21.861 56.644 1.00 115.26 ? 24   ASN B CB    1 
ATOM   1783 C  CG    . ASN D 3 24  ? 37.602 -21.510 57.637 1.00 115.77 ? 24   ASN B CG    1 
ATOM   1784 O  OD1   . ASN D 3 24  ? 38.195 -20.433 57.572 1.00 115.34 ? 24   ASN B OD1   1 
ATOM   1785 N  ND2   . ASN D 3 24  ? 37.880 -22.426 58.558 1.00 116.08 ? 24   ASN B ND2   1 
ATOM   1786 N  N     . GLY D 3 25  ? 35.246 -21.569 54.268 1.00 112.02 ? 25   GLY B N     1 
ATOM   1787 C  CA    . GLY D 3 25  ? 34.563 -21.807 53.012 1.00 109.25 ? 25   GLY B CA    1 
ATOM   1788 C  C     . GLY D 3 25  ? 34.585 -20.509 52.235 1.00 106.91 ? 25   GLY B C     1 
ATOM   1789 O  O     . GLY D 3 25  ? 35.607 -19.821 52.206 1.00 106.28 ? 25   GLY B O     1 
ATOM   1790 N  N     . GLN D 3 26  ? 33.468 -20.161 51.608 1.00 104.82 ? 26   GLN B N     1 
ATOM   1791 C  CA    . GLN D 3 26  ? 33.407 -18.919 50.855 1.00 102.20 ? 26   GLN B CA    1 
ATOM   1792 C  C     . GLN D 3 26  ? 33.139 -17.763 51.809 1.00 97.88  ? 26   GLN B C     1 
ATOM   1793 O  O     . GLN D 3 26  ? 33.302 -16.595 51.450 1.00 96.86  ? 26   GLN B O     1 
ATOM   1794 C  CB    . GLN D 3 26  ? 32.315 -18.987 49.782 1.00 105.29 ? 26   GLN B CB    1 
ATOM   1795 C  CG    . GLN D 3 26  ? 32.182 -17.722 48.923 1.00 109.90 ? 26   GLN B CG    1 
ATOM   1796 C  CD    . GLN D 3 26  ? 33.475 -17.317 48.210 1.00 112.31 ? 26   GLN B CD    1 
ATOM   1797 O  OE1   . GLN D 3 26  ? 33.473 -16.412 47.373 1.00 113.43 ? 26   GLN B OE1   1 
ATOM   1798 N  NE2   . GLN D 3 26  ? 34.579 -17.979 48.544 1.00 113.51 ? 26   GLN B NE2   1 
ATOM   1799 N  N     . GLU D 3 27  ? 32.730 -18.095 53.031 1.00 92.08  ? 27   GLU B N     1 
ATOM   1800 C  CA    . GLU D 3 27  ? 32.459 -17.074 54.032 1.00 86.41  ? 27   GLU B CA    1 
ATOM   1801 C  C     . GLU D 3 27  ? 33.802 -16.524 54.503 1.00 82.47  ? 27   GLU B C     1 
ATOM   1802 O  O     . GLU D 3 27  ? 33.908 -15.366 54.896 1.00 82.72  ? 27   GLU B O     1 
ATOM   1803 C  CB    . GLU D 3 27  ? 31.687 -17.665 55.216 1.00 85.28  ? 27   GLU B CB    1 
ATOM   1804 C  CG    . GLU D 3 27  ? 31.130 -16.617 56.176 1.00 84.29  ? 27   GLU B CG    1 
ATOM   1805 C  CD    . GLU D 3 27  ? 29.937 -15.864 55.603 1.00 83.81  ? 27   GLU B CD    1 
ATOM   1806 O  OE1   . GLU D 3 27  ? 29.574 -14.807 56.166 1.00 81.90  ? 27   GLU B OE1   1 
ATOM   1807 O  OE2   . GLU D 3 27  ? 29.356 -16.335 54.600 1.00 80.93  ? 27   GLU B OE2   1 
ATOM   1808 N  N     . GLU D 3 28  ? 34.829 -17.364 54.446 1.00 77.78  ? 28   GLU B N     1 
ATOM   1809 C  CA    . GLU D 3 28  ? 36.171 -16.966 54.847 1.00 75.16  ? 28   GLU B CA    1 
ATOM   1810 C  C     . GLU D 3 28  ? 36.722 -15.908 53.889 1.00 70.43  ? 28   GLU B C     1 
ATOM   1811 O  O     . GLU D 3 28  ? 37.262 -14.888 54.315 1.00 65.67  ? 28   GLU B O     1 
ATOM   1812 C  CB    . GLU D 3 28  ? 37.102 -18.182 54.852 1.00 79.21  ? 28   GLU B CB    1 
ATOM   1813 C  CG    . GLU D 3 28  ? 38.532 -17.855 55.260 1.00 84.87  ? 28   GLU B CG    1 
ATOM   1814 C  CD    . GLU D 3 28  ? 38.626 -17.334 56.685 1.00 89.51  ? 28   GLU B CD    1 
ATOM   1815 O  OE1   . GLU D 3 28  ? 39.697 -16.805 57.054 1.00 92.39  ? 28   GLU B OE1   1 
ATOM   1816 O  OE2   . GLU D 3 28  ? 37.634 -17.460 57.439 1.00 91.43  ? 28   GLU B OE2   1 
ATOM   1817 N  N     . LYS D 3 29  ? 36.590 -16.168 52.593 1.00 67.97  ? 29   LYS B N     1 
ATOM   1818 C  CA    . LYS D 3 29  ? 37.059 -15.244 51.567 1.00 64.54  ? 29   LYS B CA    1 
ATOM   1819 C  C     . LYS D 3 29  ? 36.229 -13.963 51.619 1.00 58.75  ? 29   LYS B C     1 
ATOM   1820 O  O     . LYS D 3 29  ? 36.750 -12.866 51.438 1.00 55.85  ? 29   LYS B O     1 
ATOM   1821 C  CB    . LYS D 3 29  ? 36.923 -15.881 50.179 1.00 69.65  ? 29   LYS B CB    1 
ATOM   1822 C  CG    . LYS D 3 29  ? 37.453 -15.017 49.025 1.00 75.56  ? 29   LYS B CG    1 
ATOM   1823 C  CD    . LYS D 3 29  ? 36.838 -15.445 47.688 1.00 79.76  ? 29   LYS B CD    1 
ATOM   1824 C  CE    . LYS D 3 29  ? 37.507 -14.772 46.490 1.00 80.67  ? 29   LYS B CE    1 
ATOM   1825 N  NZ    . LYS D 3 29  ? 38.911 -15.245 46.294 1.00 81.23  ? 29   LYS B NZ    1 
ATOM   1826 N  N     . TRP D 3 30  ? 34.933 -14.116 51.868 1.00 53.39  ? 30   TRP B N     1 
ATOM   1827 C  CA    . TRP D 3 30  ? 34.029 -12.978 51.937 1.00 52.66  ? 30   TRP B CA    1 
ATOM   1828 C  C     . TRP D 3 30  ? 34.366 -12.072 53.109 1.00 50.27  ? 30   TRP B C     1 
ATOM   1829 O  O     . TRP D 3 30  ? 34.402 -10.851 52.977 1.00 49.44  ? 30   TRP B O     1 
ATOM   1830 C  CB    . TRP D 3 30  ? 32.592 -13.453 52.082 1.00 52.11  ? 30   TRP B CB    1 
ATOM   1831 C  CG    . TRP D 3 30  ? 31.604 -12.327 52.045 1.00 53.86  ? 30   TRP B CG    1 
ATOM   1832 C  CD1   . TRP D 3 30  ? 31.083 -11.722 50.933 1.00 51.95  ? 30   TRP B CD1   1 
ATOM   1833 C  CD2   . TRP D 3 30  ? 31.034 -11.658 53.170 1.00 48.68  ? 30   TRP B CD2   1 
ATOM   1834 N  NE1   . TRP D 3 30  ? 30.220 -10.720 51.300 1.00 50.93  ? 30   TRP B NE1   1 
ATOM   1835 C  CE2   . TRP D 3 30  ? 30.171 -10.658 52.667 1.00 48.88  ? 30   TRP B CE2   1 
ATOM   1836 C  CE3   . TRP D 3 30  ? 31.166 -11.806 54.553 1.00 47.92  ? 30   TRP B CE3   1 
ATOM   1837 C  CZ2   . TRP D 3 30  ? 29.445 -9.810  53.500 1.00 50.07  ? 30   TRP B CZ2   1 
ATOM   1838 C  CZ3   . TRP D 3 30  ? 30.445 -10.964 55.384 1.00 53.37  ? 30   TRP B CZ3   1 
ATOM   1839 C  CH2   . TRP D 3 30  ? 29.593 -9.976  54.853 1.00 53.34  ? 30   TRP B CH2   1 
ATOM   1840 N  N     . CYS D 3 31  ? 34.602 -12.682 54.263 1.00 49.33  ? 31   CYS B N     1 
ATOM   1841 C  CA    . CYS D 3 31  ? 34.942 -11.928 55.456 1.00 48.90  ? 31   CYS B CA    1 
ATOM   1842 C  C     . CYS D 3 31  ? 36.182 -11.093 55.180 1.00 45.49  ? 31   CYS B C     1 
ATOM   1843 O  O     . CYS D 3 31  ? 36.310 -9.965  55.663 1.00 42.73  ? 31   CYS B O     1 
ATOM   1844 C  CB    . CYS D 3 31  ? 35.184 -12.883 56.632 1.00 48.83  ? 31   CYS B CB    1 
ATOM   1845 S  SG    . CYS D 3 31  ? 33.708 -13.813 57.140 1.00 55.44  ? 31   CYS B SG    1 
ATOM   1846 N  N     . GLU D 3 32  ? 37.094 -11.649 54.391 1.00 45.61  ? 32   GLU B N     1 
ATOM   1847 C  CA    . GLU D 3 32  ? 38.314 -10.935 54.057 1.00 47.88  ? 32   GLU B CA    1 
ATOM   1848 C  C     . GLU D 3 32  ? 37.975 -9.729  53.186 1.00 42.74  ? 32   GLU B C     1 
ATOM   1849 O  O     . GLU D 3 32  ? 38.433 -8.617  53.445 1.00 37.47  ? 32   GLU B O     1 
ATOM   1850 C  CB    . GLU D 3 32  ? 39.294 -11.841 53.316 1.00 47.56  ? 32   GLU B CB    1 
ATOM   1851 C  CG    . GLU D 3 32  ? 40.656 -11.182 53.135 1.00 60.03  ? 32   GLU B CG    1 
ATOM   1852 C  CD    . GLU D 3 32  ? 41.628 -12.024 52.328 1.00 66.89  ? 32   GLU B CD    1 
ATOM   1853 O  OE1   . GLU D 3 32  ? 42.808 -11.620 52.213 1.00 68.54  ? 32   GLU B OE1   1 
ATOM   1854 O  OE2   . GLU D 3 32  ? 41.210 -13.084 51.807 1.00 70.36  ? 32   GLU B OE2   1 
ATOM   1855 N  N     . LYS D 3 33  ? 37.178 -9.965  52.149 1.00 38.85  ? 33   LYS B N     1 
ATOM   1856 C  CA    . LYS D 3 33  ? 36.768 -8.889  51.255 1.00 41.25  ? 33   LYS B CA    1 
ATOM   1857 C  C     . LYS D 3 33  ? 36.109 -7.779  52.069 1.00 38.32  ? 33   LYS B C     1 
ATOM   1858 O  O     . LYS D 3 33  ? 36.488 -6.613  51.973 1.00 38.70  ? 33   LYS B O     1 
ATOM   1859 C  CB    . LYS D 3 33  ? 35.782 -9.406  50.208 1.00 40.90  ? 33   LYS B CB    1 
ATOM   1860 C  CG    . LYS D 3 33  ? 36.382 -10.383 49.211 1.00 44.43  ? 33   LYS B CG    1 
ATOM   1861 C  CD    . LYS D 3 33  ? 37.605 -9.788  48.523 1.00 53.92  ? 33   LYS B CD    1 
ATOM   1862 C  CE    . LYS D 3 33  ? 38.283 -10.800 47.585 1.00 57.86  ? 33   LYS B CE    1 
ATOM   1863 N  NZ    . LYS D 3 33  ? 39.537 -10.261 46.965 1.00 51.57  ? 33   LYS B NZ    1 
ATOM   1864 N  N     . ALA D 3 34  ? 35.139 -8.162  52.891 1.00 36.30  ? 34   ALA B N     1 
ATOM   1865 C  CA    . ALA D 3 34  ? 34.425 -7.209  53.724 1.00 37.24  ? 34   ALA B CA    1 
ATOM   1866 C  C     . ALA D 3 34  ? 35.377 -6.383  54.585 1.00 35.92  ? 34   ALA B C     1 
ATOM   1867 O  O     . ALA D 3 34  ? 35.141 -5.199  54.832 1.00 31.65  ? 34   ALA B O     1 
ATOM   1868 C  CB    . ALA D 3 34  ? 33.424 -7.940  54.608 1.00 34.42  ? 34   ALA B CB    1 
ATOM   1869 N  N     . VAL D 3 35  ? 36.456 -6.999  55.048 1.00 36.44  ? 35   VAL B N     1 
ATOM   1870 C  CA    . VAL D 3 35  ? 37.384 -6.261  55.883 1.00 37.53  ? 35   VAL B CA    1 
ATOM   1871 C  C     . VAL D 3 35  ? 38.198 -5.310  55.026 1.00 36.40  ? 35   VAL B C     1 
ATOM   1872 O  O     . VAL D 3 35  ? 38.444 -4.168  55.413 1.00 35.77  ? 35   VAL B O     1 
ATOM   1873 C  CB    . VAL D 3 35  ? 38.295 -7.214  56.693 1.00 36.16  ? 35   VAL B CB    1 
ATOM   1874 C  CG1   . VAL D 3 35  ? 39.309 -6.416  57.487 1.00 31.82  ? 35   VAL B CG1   1 
ATOM   1875 C  CG2   . VAL D 3 35  ? 37.445 -8.032  57.645 1.00 33.52  ? 35   VAL B CG2   1 
ATOM   1876 N  N     . LYS D 3 36  ? 38.596 -5.768  53.848 1.00 40.34  ? 36   LYS B N     1 
ATOM   1877 C  CA    . LYS D 3 36  ? 39.361 -4.919  52.948 1.00 43.22  ? 36   LYS B CA    1 
ATOM   1878 C  C     . LYS D 3 36  ? 38.556 -3.706  52.508 1.00 43.31  ? 36   LYS B C     1 
ATOM   1879 O  O     . LYS D 3 36  ? 39.100 -2.604  52.390 1.00 42.15  ? 36   LYS B O     1 
ATOM   1880 C  CB    . LYS D 3 36  ? 39.806 -5.697  51.708 1.00 48.49  ? 36   LYS B CB    1 
ATOM   1881 C  CG    . LYS D 3 36  ? 40.919 -6.707  51.969 1.00 55.84  ? 36   LYS B CG    1 
ATOM   1882 C  CD    . LYS D 3 36  ? 41.642 -7.083  50.677 1.00 61.15  ? 36   LYS B CD    1 
ATOM   1883 C  CE    . LYS D 3 36  ? 40.759 -7.883  49.735 1.00 64.77  ? 36   LYS B CE    1 
ATOM   1884 N  NZ    . LYS D 3 36  ? 40.449 -9.236  50.287 1.00 69.72  ? 36   LYS B NZ    1 
ATOM   1885 N  N     . SER D 3 37  ? 37.263 -3.904  52.257 1.00 39.58  ? 37   SER B N     1 
ATOM   1886 C  CA    . SER D 3 37  ? 36.425 -2.797  51.818 1.00 42.45  ? 37   SER B CA    1 
ATOM   1887 C  C     . SER D 3 37  ? 36.453 -1.724  52.881 1.00 41.16  ? 37   SER B C     1 
ATOM   1888 O  O     . SER D 3 37  ? 36.692 -0.547  52.596 1.00 42.18  ? 37   SER B O     1 
ATOM   1889 C  CB    . SER D 3 37  ? 34.984 -3.254  51.606 1.00 39.31  ? 37   SER B CB    1 
ATOM   1890 O  OG    . SER D 3 37  ? 34.950 -4.389  50.765 1.00 49.35  ? 37   SER B OG    1 
ATOM   1891 N  N     . LEU D 3 38  ? 36.224 -2.148  54.118 1.00 39.58  ? 38   LEU B N     1 
ATOM   1892 C  CA    . LEU D 3 38  ? 36.197 -1.223  55.234 1.00 40.30  ? 38   LEU B CA    1 
ATOM   1893 C  C     . LEU D 3 38  ? 37.524 -0.496  55.417 1.00 40.68  ? 38   LEU B C     1 
ATOM   1894 O  O     . LEU D 3 38  ? 37.554 0.724   55.585 1.00 39.61  ? 38   LEU B O     1 
ATOM   1895 C  CB    . LEU D 3 38  ? 35.820 -1.965  56.520 1.00 37.13  ? 38   LEU B CB    1 
ATOM   1896 C  CG    . LEU D 3 38  ? 35.641 -1.086  57.758 1.00 40.36  ? 38   LEU B CG    1 
ATOM   1897 C  CD1   . LEU D 3 38  ? 34.535 -0.073  57.516 1.00 39.96  ? 38   LEU B CD1   1 
ATOM   1898 C  CD2   . LEU D 3 38  ? 35.318 -1.955  58.952 1.00 38.25  ? 38   LEU B CD2   1 
ATOM   1899 N  N     . VAL D 3 39  ? 38.621 -1.244  55.369 1.00 42.46  ? 39   VAL B N     1 
ATOM   1900 C  CA    . VAL D 3 39  ? 39.934 -0.650  55.559 1.00 46.20  ? 39   VAL B CA    1 
ATOM   1901 C  C     . VAL D 3 39  ? 40.179 0.385   54.482 1.00 47.94  ? 39   VAL B C     1 
ATOM   1902 O  O     . VAL D 3 39  ? 40.642 1.492   54.761 1.00 47.72  ? 39   VAL B O     1 
ATOM   1903 C  CB    . VAL D 3 39  ? 41.052 -1.723  55.532 1.00 46.98  ? 39   VAL B CB    1 
ATOM   1904 C  CG1   . VAL D 3 39  ? 42.408 -1.066  55.649 1.00 48.38  ? 39   VAL B CG1   1 
ATOM   1905 C  CG2   . VAL D 3 39  ? 40.859 -2.696  56.687 1.00 45.52  ? 39   VAL B CG2   1 
ATOM   1906 N  N     . LYS D 3 40  ? 39.856 0.030   53.248 1.00 49.91  ? 40   LYS B N     1 
ATOM   1907 C  CA    . LYS D 3 40  ? 40.039 0.960   52.149 1.00 52.43  ? 40   LYS B CA    1 
ATOM   1908 C  C     . LYS D 3 40  ? 39.370 2.288   52.488 1.00 49.80  ? 40   LYS B C     1 
ATOM   1909 O  O     . LYS D 3 40  ? 39.948 3.351   52.281 1.00 44.91  ? 40   LYS B O     1 
ATOM   1910 C  CB    . LYS D 3 40  ? 39.430 0.397   50.862 1.00 57.35  ? 40   LYS B CB    1 
ATOM   1911 C  CG    . LYS D 3 40  ? 39.578 1.321   49.660 1.00 65.00  ? 40   LYS B CG    1 
ATOM   1912 C  CD    . LYS D 3 40  ? 38.797 0.824   48.443 1.00 72.06  ? 40   LYS B CD    1 
ATOM   1913 C  CE    . LYS D 3 40  ? 39.381 -0.453  47.856 1.00 74.98  ? 40   LYS B CE    1 
ATOM   1914 N  NZ    . LYS D 3 40  ? 40.704 -0.222  47.209 1.00 79.68  ? 40   LYS B NZ    1 
ATOM   1915 N  N     . LYS D 3 41  ? 38.160 2.219   53.034 1.00 48.76  ? 41   LYS B N     1 
ATOM   1916 C  CA    . LYS D 3 41  ? 37.401 3.420   53.367 1.00 48.45  ? 41   LYS B CA    1 
ATOM   1917 C  C     . LYS D 3 41  ? 37.860 4.187   54.598 1.00 51.86  ? 41   LYS B C     1 
ATOM   1918 O  O     . LYS D 3 41  ? 37.809 5.413   54.615 1.00 53.10  ? 41   LYS B O     1 
ATOM   1919 C  CB    . LYS D 3 41  ? 35.924 3.077   53.532 1.00 46.13  ? 41   LYS B CB    1 
ATOM   1920 C  CG    . LYS D 3 41  ? 35.261 2.550   52.286 1.00 42.28  ? 41   LYS B CG    1 
ATOM   1921 C  CD    . LYS D 3 41  ? 33.838 2.109   52.604 1.00 45.46  ? 41   LYS B CD    1 
ATOM   1922 C  CE    . LYS D 3 41  ? 33.248 1.264   51.487 1.00 42.59  ? 41   LYS B CE    1 
ATOM   1923 N  NZ    . LYS D 3 41  ? 32.255 0.335   52.064 1.00 46.65  ? 41   LYS B NZ    1 
ATOM   1924 N  N     . LEU D 3 42  ? 38.277 3.480   55.640 1.00 54.54  ? 42   LEU B N     1 
ATOM   1925 C  CA    . LEU D 3 42  ? 38.727 4.160   56.840 1.00 55.66  ? 42   LEU B CA    1 
ATOM   1926 C  C     . LEU D 3 42  ? 40.074 4.795   56.556 1.00 58.19  ? 42   LEU B C     1 
ATOM   1927 O  O     . LEU D 3 42  ? 40.386 5.865   57.071 1.00 58.18  ? 42   LEU B O     1 
ATOM   1928 C  CB    . LEU D 3 42  ? 38.810 3.185   58.015 1.00 53.48  ? 42   LEU B CB    1 
ATOM   1929 C  CG    . LEU D 3 42  ? 37.444 2.609   58.418 1.00 54.43  ? 42   LEU B CG    1 
ATOM   1930 C  CD1   . LEU D 3 42  ? 37.584 1.732   59.660 1.00 52.44  ? 42   LEU B CD1   1 
ATOM   1931 C  CD2   . LEU D 3 42  ? 36.469 3.745   58.683 1.00 48.77  ? 42   LEU B CD2   1 
ATOM   1932 N  N     . LYS D 3 43  ? 40.867 4.138   55.718 1.00 61.25  ? 43   LYS B N     1 
ATOM   1933 C  CA    . LYS D 3 43  ? 42.164 4.678   55.348 1.00 64.35  ? 43   LYS B CA    1 
ATOM   1934 C  C     . LYS D 3 43  ? 41.939 6.070   54.777 1.00 66.96  ? 43   LYS B C     1 
ATOM   1935 O  O     . LYS D 3 43  ? 42.527 7.046   55.239 1.00 70.63  ? 43   LYS B O     1 
ATOM   1936 C  CB    . LYS D 3 43  ? 42.831 3.812   54.284 1.00 63.00  ? 43   LYS B CB    1 
ATOM   1937 C  CG    . LYS D 3 43  ? 44.023 3.019   54.775 1.00 66.98  ? 43   LYS B CG    1 
ATOM   1938 C  CD    . LYS D 3 43  ? 44.848 2.518   53.596 1.00 69.85  ? 43   LYS B CD    1 
ATOM   1939 C  CE    . LYS D 3 43  ? 46.014 1.643   54.036 1.00 72.02  ? 43   LYS B CE    1 
ATOM   1940 N  NZ    . LYS D 3 43  ? 45.554 0.335   54.586 1.00 73.13  ? 43   LYS B NZ    1 
ATOM   1941 N  N     . LYS D 3 44  ? 41.076 6.157   53.772 1.00 66.69  ? 44   LYS B N     1 
ATOM   1942 C  CA    . LYS D 3 44  ? 40.782 7.434   53.134 1.00 68.77  ? 44   LYS B CA    1 
ATOM   1943 C  C     . LYS D 3 44  ? 40.431 8.534   54.130 1.00 66.48  ? 44   LYS B C     1 
ATOM   1944 O  O     . LYS D 3 44  ? 40.890 9.666   53.994 1.00 68.12  ? 44   LYS B O     1 
ATOM   1945 C  CB    . LYS D 3 44  ? 39.639 7.271   52.128 1.00 71.42  ? 44   LYS B CB    1 
ATOM   1946 C  CG    . LYS D 3 44  ? 39.943 6.297   51.002 1.00 76.70  ? 44   LYS B CG    1 
ATOM   1947 C  CD    . LYS D 3 44  ? 38.768 6.157   50.043 1.00 79.22  ? 44   LYS B CD    1 
ATOM   1948 C  CE    . LYS D 3 44  ? 39.043 5.088   48.991 1.00 79.75  ? 44   LYS B CE    1 
ATOM   1949 N  NZ    . LYS D 3 44  ? 37.909 4.925   48.038 1.00 82.54  ? 44   LYS B NZ    1 
ATOM   1950 N  N     . THR D 3 45  ? 39.621 8.207   55.131 1.00 63.24  ? 45   THR B N     1 
ATOM   1951 C  CA    . THR D 3 45  ? 39.216 9.197   56.123 1.00 60.17  ? 45   THR B CA    1 
ATOM   1952 C  C     . THR D 3 45  ? 40.109 9.207   57.361 1.00 56.88  ? 45   THR B C     1 
ATOM   1953 O  O     . THR D 3 45  ? 39.803 9.878   58.343 1.00 55.96  ? 45   THR B O     1 
ATOM   1954 C  CB    . THR D 3 45  ? 37.762 8.965   56.582 1.00 62.03  ? 45   THR B CB    1 
ATOM   1955 O  OG1   . THR D 3 45  ? 37.678 7.728   57.305 1.00 60.64  ? 45   THR B OG1   1 
ATOM   1956 C  CG2   . THR D 3 45  ? 36.830 8.916   55.378 1.00 61.84  ? 45   THR B CG2   1 
ATOM   1957 N  N     . GLY D 3 46  ? 41.206 8.458   57.315 1.00 53.46  ? 46   GLY B N     1 
ATOM   1958 C  CA    . GLY D 3 46  ? 42.120 8.409   58.443 1.00 52.39  ? 46   GLY B CA    1 
ATOM   1959 C  C     . GLY D 3 46  ? 41.495 7.984   59.760 1.00 51.65  ? 46   GLY B C     1 
ATOM   1960 O  O     . GLY D 3 46  ? 41.703 8.634   60.785 1.00 54.40  ? 46   GLY B O     1 
ATOM   1961 N  N     . GLN D 3 47  ? 40.728 6.896   59.731 1.00 47.89  ? 47   GLN B N     1 
ATOM   1962 C  CA    . GLN D 3 47  ? 40.069 6.365   60.920 1.00 46.40  ? 47   GLN B CA    1 
ATOM   1963 C  C     . GLN D 3 47  ? 40.527 4.927   61.178 1.00 45.74  ? 47   GLN B C     1 
ATOM   1964 O  O     . GLN D 3 47  ? 40.046 4.269   62.097 1.00 41.08  ? 47   GLN B O     1 
ATOM   1965 C  CB    . GLN D 3 47  ? 38.546 6.356   60.741 1.00 47.57  ? 47   GLN B CB    1 
ATOM   1966 C  CG    . GLN D 3 47  ? 37.918 7.695   60.460 1.00 50.39  ? 47   GLN B CG    1 
ATOM   1967 C  CD    . GLN D 3 47  ? 36.406 7.608   60.336 1.00 51.12  ? 47   GLN B CD    1 
ATOM   1968 O  OE1   . GLN D 3 47  ? 35.715 7.175   61.260 1.00 51.87  ? 47   GLN B OE1   1 
ATOM   1969 N  NE2   . GLN D 3 47  ? 35.883 8.023   59.190 1.00 52.57  ? 47   GLN B NE2   1 
ATOM   1970 N  N     . LEU D 3 48  ? 41.448 4.431   60.364 1.00 48.31  ? 48   LEU B N     1 
ATOM   1971 C  CA    . LEU D 3 48  ? 41.906 3.066   60.539 1.00 55.50  ? 48   LEU B CA    1 
ATOM   1972 C  C     . LEU D 3 48  ? 42.412 2.811   61.957 1.00 60.40  ? 48   LEU B C     1 
ATOM   1973 O  O     . LEU D 3 48  ? 42.023 1.829   62.593 1.00 61.01  ? 48   LEU B O     1 
ATOM   1974 C  CB    . LEU D 3 48  ? 42.997 2.731   59.521 1.00 56.82  ? 48   LEU B CB    1 
ATOM   1975 C  CG    . LEU D 3 48  ? 43.012 1.250   59.113 1.00 61.42  ? 48   LEU B CG    1 
ATOM   1976 C  CD1   . LEU D 3 48  ? 43.962 1.047   57.961 1.00 61.74  ? 48   LEU B CD1   1 
ATOM   1977 C  CD2   . LEU D 3 48  ? 43.412 0.375   60.291 1.00 62.49  ? 48   LEU B CD2   1 
ATOM   1978 N  N     . ASP D 3 49  ? 43.265 3.698   62.461 1.00 64.57  ? 49   ASP B N     1 
ATOM   1979 C  CA    . ASP D 3 49  ? 43.816 3.536   63.807 1.00 67.73  ? 49   ASP B CA    1 
ATOM   1980 C  C     . ASP D 3 49  ? 42.764 3.347   64.902 1.00 67.01  ? 49   ASP B C     1 
ATOM   1981 O  O     . ASP D 3 49  ? 42.866 2.424   65.715 1.00 66.26  ? 49   ASP B O     1 
ATOM   1982 C  CB    . ASP D 3 49  ? 44.716 4.729   64.163 1.00 70.59  ? 49   ASP B CB    1 
ATOM   1983 C  CG    . ASP D 3 49  ? 46.044 4.705   63.418 1.00 73.35  ? 49   ASP B CG    1 
ATOM   1984 O  OD1   . ASP D 3 49  ? 46.790 3.709   63.553 1.00 74.52  ? 49   ASP B OD1   1 
ATOM   1985 O  OD2   . ASP D 3 49  ? 46.344 5.682   62.699 1.00 75.33  ? 49   ASP B OD2   1 
ATOM   1986 N  N     . GLU D 3 50  ? 41.754 4.214   64.918 1.00 66.51  ? 50   GLU B N     1 
ATOM   1987 C  CA    . GLU D 3 50  ? 40.698 4.146   65.928 1.00 66.66  ? 50   GLU B CA    1 
ATOM   1988 C  C     . GLU D 3 50  ? 39.854 2.883   65.818 1.00 61.69  ? 50   GLU B C     1 
ATOM   1989 O  O     . GLU D 3 50  ? 39.128 2.530   66.749 1.00 63.49  ? 50   GLU B O     1 
ATOM   1990 C  CB    . GLU D 3 50  ? 39.787 5.369   65.823 1.00 72.32  ? 50   GLU B CB    1 
ATOM   1991 C  CG    . GLU D 3 50  ? 38.845 5.354   64.635 1.00 81.71  ? 50   GLU B CG    1 
ATOM   1992 C  CD    . GLU D 3 50  ? 38.038 6.638   64.513 1.00 87.15  ? 50   GLU B CD    1 
ATOM   1993 O  OE1   . GLU D 3 50  ? 37.149 6.707   63.632 1.00 88.84  ? 50   GLU B OE1   1 
ATOM   1994 O  OE2   . GLU D 3 50  ? 38.297 7.579   65.299 1.00 89.04  ? 50   GLU B OE2   1 
ATOM   1995 N  N     . LEU D 3 51  ? 39.946 2.213   64.675 1.00 56.62  ? 51   LEU B N     1 
ATOM   1996 C  CA    . LEU D 3 51  ? 39.202 0.985   64.441 1.00 52.58  ? 51   LEU B CA    1 
ATOM   1997 C  C     . LEU D 3 51  ? 39.982 -0.181  65.028 1.00 52.30  ? 51   LEU B C     1 
ATOM   1998 O  O     . LEU D 3 51  ? 39.419 -1.025  65.727 1.00 50.34  ? 51   LEU B O     1 
ATOM   1999 C  CB    . LEU D 3 51  ? 38.984 0.779   62.935 1.00 46.81  ? 51   LEU B CB    1 
ATOM   2000 C  CG    . LEU D 3 51  ? 38.174 -0.423  62.432 1.00 43.23  ? 51   LEU B CG    1 
ATOM   2001 C  CD1   . LEU D 3 51  ? 39.079 -1.604  62.218 1.00 46.05  ? 51   LEU B CD1   1 
ATOM   2002 C  CD2   . LEU D 3 51  ? 37.052 -0.750  63.406 1.00 43.02  ? 51   LEU B CD2   1 
ATOM   2003 N  N     . GLU D 3 52  ? 41.280 -0.218  64.734 1.00 52.72  ? 52   GLU B N     1 
ATOM   2004 C  CA    . GLU D 3 52  ? 42.165 -1.261  65.245 1.00 57.33  ? 52   GLU B CA    1 
ATOM   2005 C  C     . GLU D 3 52  ? 42.131 -1.165  66.762 1.00 55.17  ? 52   GLU B C     1 
ATOM   2006 O  O     . GLU D 3 52  ? 42.074 -2.168  67.470 1.00 50.08  ? 52   GLU B O     1 
ATOM   2007 C  CB    . GLU D 3 52  ? 43.596 -1.033  64.755 1.00 61.82  ? 52   GLU B CB    1 
ATOM   2008 C  CG    . GLU D 3 52  ? 44.491 -2.252  64.903 1.00 68.94  ? 52   GLU B CG    1 
ATOM   2009 C  CD    . GLU D 3 52  ? 45.937 -1.969  64.544 1.00 72.20  ? 52   GLU B CD    1 
ATOM   2010 O  OE1   . GLU D 3 52  ? 46.173 -1.202  63.586 1.00 77.84  ? 52   GLU B OE1   1 
ATOM   2011 O  OE2   . GLU D 3 52  ? 46.838 -2.523  65.209 1.00 73.32  ? 52   GLU B OE2   1 
ATOM   2012 N  N     . LYS D 3 53  ? 42.160 0.071   67.244 1.00 55.77  ? 53   LYS B N     1 
ATOM   2013 C  CA    . LYS D 3 53  ? 42.113 0.351   68.667 1.00 57.07  ? 53   LYS B CA    1 
ATOM   2014 C  C     . LYS D 3 53  ? 40.866 -0.281  69.278 1.00 56.36  ? 53   LYS B C     1 
ATOM   2015 O  O     . LYS D 3 53  ? 40.960 -1.111  70.185 1.00 58.17  ? 53   LYS B O     1 
ATOM   2016 C  CB    . LYS D 3 53  ? 42.093 1.866   68.886 1.00 60.52  ? 53   LYS B CB    1 
ATOM   2017 C  CG    . LYS D 3 53  ? 42.160 2.290   70.340 1.00 65.10  ? 53   LYS B CG    1 
ATOM   2018 C  CD    . LYS D 3 53  ? 42.291 3.800   70.466 1.00 70.11  ? 53   LYS B CD    1 
ATOM   2019 C  CE    . LYS D 3 53  ? 42.517 4.216   71.912 1.00 72.28  ? 53   LYS B CE    1 
ATOM   2020 N  NZ    . LYS D 3 53  ? 41.451 3.691   72.815 1.00 76.77  ? 53   LYS B NZ    1 
ATOM   2021 N  N     . ALA D 3 54  ? 39.704 0.116   68.768 1.00 54.81  ? 54   ALA B N     1 
ATOM   2022 C  CA    . ALA D 3 54  ? 38.422 -0.394  69.252 1.00 52.52  ? 54   ALA B CA    1 
ATOM   2023 C  C     . ALA D 3 54  ? 38.361 -1.919  69.245 1.00 47.93  ? 54   ALA B C     1 
ATOM   2024 O  O     . ALA D 3 54  ? 37.903 -2.538  70.198 1.00 50.64  ? 54   ALA B O     1 
ATOM   2025 C  CB    . ALA D 3 54  ? 37.283 0.178   68.408 1.00 51.48  ? 54   ALA B CB    1 
ATOM   2026 N  N     . ILE D 3 55  ? 38.825 -2.525  68.167 1.00 46.56  ? 55   ILE B N     1 
ATOM   2027 C  CA    . ILE D 3 55  ? 38.809 -3.973  68.069 1.00 49.02  ? 55   ILE B CA    1 
ATOM   2028 C  C     . ILE D 3 55  ? 39.679 -4.646  69.126 1.00 51.16  ? 55   ILE B C     1 
ATOM   2029 O  O     . ILE D 3 55  ? 39.231 -5.562  69.810 1.00 51.39  ? 55   ILE B O     1 
ATOM   2030 C  CB    . ILE D 3 55  ? 39.298 -4.434  66.689 1.00 47.09  ? 55   ILE B CB    1 
ATOM   2031 C  CG1   . ILE D 3 55  ? 38.426 -3.811  65.595 1.00 52.28  ? 55   ILE B CG1   1 
ATOM   2032 C  CG2   . ILE D 3 55  ? 39.244 -5.956  66.599 1.00 46.53  ? 55   ILE B CG2   1 
ATOM   2033 C  CD1   . ILE D 3 55  ? 36.957 -4.185  65.686 1.00 50.75  ? 55   ILE B CD1   1 
ATOM   2034 N  N     . THR D 3 56  ? 40.920 -4.182  69.252 1.00 53.31  ? 56   THR B N     1 
ATOM   2035 C  CA    . THR D 3 56  ? 41.873 -4.763  70.198 1.00 56.56  ? 56   THR B CA    1 
ATOM   2036 C  C     . THR D 3 56  ? 41.677 -4.446  71.677 1.00 57.43  ? 56   THR B C     1 
ATOM   2037 O  O     . THR D 3 56  ? 42.136 -5.202  72.526 1.00 56.44  ? 56   THR B O     1 
ATOM   2038 C  CB    . THR D 3 56  ? 43.325 -4.383  69.836 1.00 55.16  ? 56   THR B CB    1 
ATOM   2039 O  OG1   . THR D 3 56  ? 43.479 -2.956  69.889 1.00 55.85  ? 56   THR B OG1   1 
ATOM   2040 C  CG2   . THR D 3 56  ? 43.670 -4.885  68.448 1.00 52.98  ? 56   THR B CG2   1 
ATOM   2041 N  N     . THR D 3 57  ? 41.005 -3.345  71.996 1.00 58.54  ? 57   THR B N     1 
ATOM   2042 C  CA    . THR D 3 57  ? 40.799 -2.997  73.398 1.00 61.22  ? 57   THR B CA    1 
ATOM   2043 C  C     . THR D 3 57  ? 39.367 -3.235  73.866 1.00 62.43  ? 57   THR B C     1 
ATOM   2044 O  O     . THR D 3 57  ? 39.059 -3.072  75.050 1.00 60.87  ? 57   THR B O     1 
ATOM   2045 C  CB    . THR D 3 57  ? 41.141 -1.521  73.666 1.00 63.05  ? 57   THR B CB    1 
ATOM   2046 O  OG1   . THR D 3 57  ? 40.092 -0.688  73.154 1.00 64.12  ? 57   THR B OG1   1 
ATOM   2047 C  CG2   . THR D 3 57  ? 42.456 -1.148  72.994 1.00 60.91  ? 57   THR B CG2   1 
ATOM   2048 N  N     . GLN D 3 58  ? 38.494 -3.618  72.938 1.00 62.74  ? 58   GLN B N     1 
ATOM   2049 C  CA    . GLN D 3 58  ? 37.092 -3.864  73.258 1.00 61.01  ? 58   GLN B CA    1 
ATOM   2050 C  C     . GLN D 3 58  ? 36.552 -2.716  74.104 1.00 57.34  ? 58   GLN B C     1 
ATOM   2051 O  O     . GLN D 3 58  ? 35.612 -2.883  74.876 1.00 55.92  ? 58   GLN B O     1 
ATOM   2052 C  CB    . GLN D 3 58  ? 36.934 -5.185  74.021 1.00 62.70  ? 58   GLN B CB    1 
ATOM   2053 C  CG    . GLN D 3 58  ? 37.461 -6.408  73.288 1.00 63.46  ? 58   GLN B CG    1 
ATOM   2054 C  CD    . GLN D 3 58  ? 38.939 -6.642  73.529 1.00 65.94  ? 58   GLN B CD    1 
ATOM   2055 O  OE1   . GLN D 3 58  ? 39.358 -6.883  74.658 1.00 68.77  ? 58   GLN B OE1   1 
ATOM   2056 N  NE2   . GLN D 3 58  ? 39.737 -6.577  72.469 1.00 66.65  ? 58   GLN B NE2   1 
ATOM   2057 N  N     . ASN D 3 59  ? 37.157 -1.547  73.947 1.00 57.55  ? 59   ASN B N     1 
ATOM   2058 C  CA    . ASN D 3 59  ? 36.750 -0.376  74.705 1.00 57.83  ? 59   ASN B CA    1 
ATOM   2059 C  C     . ASN D 3 59  ? 35.593 0.377   74.068 1.00 58.50  ? 59   ASN B C     1 
ATOM   2060 O  O     . ASN D 3 59  ? 35.754 1.049   73.053 1.00 55.91  ? 59   ASN B O     1 
ATOM   2061 C  CB    . ASN D 3 59  ? 37.933 0.571   74.887 1.00 56.68  ? 59   ASN B CB    1 
ATOM   2062 C  CG    . ASN D 3 59  ? 37.556 1.804   75.658 1.00 58.71  ? 59   ASN B CG    1 
ATOM   2063 O  OD1   . ASN D 3 59  ? 36.902 1.712   76.694 1.00 60.09  ? 59   ASN B OD1   1 
ATOM   2064 N  ND2   . ASN D 3 59  ? 37.962 2.968   75.166 1.00 56.37  ? 59   ASN B ND2   1 
ATOM   2065 N  N     . VAL D 3 60  ? 34.429 0.276   74.696 1.00 61.70  ? 60   VAL B N     1 
ATOM   2066 C  CA    . VAL D 3 60  ? 33.221 0.923   74.212 1.00 64.82  ? 60   VAL B CA    1 
ATOM   2067 C  C     . VAL D 3 60  ? 33.309 2.443   74.082 1.00 66.70  ? 60   VAL B C     1 
ATOM   2068 O  O     . VAL D 3 60  ? 32.852 3.005   73.088 1.00 67.41  ? 60   VAL B O     1 
ATOM   2069 C  CB    . VAL D 3 60  ? 32.021 0.580   75.124 1.00 66.90  ? 60   VAL B CB    1 
ATOM   2070 C  CG1   . VAL D 3 60  ? 30.751 1.242   74.598 1.00 68.15  ? 60   VAL B CG1   1 
ATOM   2071 C  CG2   . VAL D 3 60  ? 31.843 -0.932  75.199 1.00 68.31  ? 60   VAL B CG2   1 
ATOM   2072 N  N     . ASN D 3 61  ? 33.896 3.114   75.066 1.00 69.11  ? 61   ASN B N     1 
ATOM   2073 C  CA    . ASN D 3 61  ? 33.969 4.568   75.002 1.00 70.64  ? 61   ASN B CA    1 
ATOM   2074 C  C     . ASN D 3 61  ? 34.914 5.113   73.932 1.00 69.37  ? 61   ASN B C     1 
ATOM   2075 O  O     . ASN D 3 61  ? 35.464 6.207   74.080 1.00 68.46  ? 61   ASN B O     1 
ATOM   2076 C  CB    . ASN D 3 61  ? 34.335 5.160   76.367 1.00 74.10  ? 61   ASN B CB    1 
ATOM   2077 C  CG    . ASN D 3 61  ? 35.802 5.008   76.693 1.00 78.88  ? 61   ASN B CG    1 
ATOM   2078 O  OD1   . ASN D 3 61  ? 36.286 3.902   76.903 1.00 81.91  ? 61   ASN B OD1   1 
ATOM   2079 N  ND2   . ASN D 3 61  ? 36.521 6.125   76.730 1.00 78.92  ? 61   ASN B ND2   1 
ATOM   2080 N  N     . THR D 3 62  ? 35.107 4.357   72.854 1.00 67.37  ? 62   THR B N     1 
ATOM   2081 C  CA    . THR D 3 62  ? 35.958 4.830   71.763 1.00 62.90  ? 62   THR B CA    1 
ATOM   2082 C  C     . THR D 3 62  ? 35.122 5.741   70.858 1.00 59.06  ? 62   THR B C     1 
ATOM   2083 O  O     . THR D 3 62  ? 33.919 5.914   71.072 1.00 54.88  ? 62   THR B O     1 
ATOM   2084 C  CB    . THR D 3 62  ? 36.541 3.667   70.918 1.00 62.54  ? 62   THR B CB    1 
ATOM   2085 O  OG1   . THR D 3 62  ? 35.497 2.761   70.548 1.00 62.63  ? 62   THR B OG1   1 
ATOM   2086 C  CG2   . THR D 3 62  ? 37.608 2.926   71.700 1.00 63.12  ? 62   THR B CG2   1 
ATOM   2087 N  N     . LYS D 3 63  ? 35.763 6.325   69.855 1.00 55.32  ? 63   LYS B N     1 
ATOM   2088 C  CA    . LYS D 3 63  ? 35.077 7.229   68.941 1.00 58.81  ? 63   LYS B CA    1 
ATOM   2089 C  C     . LYS D 3 63  ? 34.275 6.441   67.912 1.00 55.72  ? 63   LYS B C     1 
ATOM   2090 O  O     . LYS D 3 63  ? 34.486 5.244   67.728 1.00 54.35  ? 63   LYS B O     1 
ATOM   2091 C  CB    . LYS D 3 63  ? 36.088 8.116   68.197 1.00 59.37  ? 63   LYS B CB    1 
ATOM   2092 C  CG    . LYS D 3 63  ? 37.227 8.680   69.047 1.00 65.19  ? 63   LYS B CG    1 
ATOM   2093 C  CD    . LYS D 3 63  ? 38.152 7.573   69.569 1.00 66.63  ? 63   LYS B CD    1 
ATOM   2094 C  CE    . LYS D 3 63  ? 38.712 6.733   68.431 1.00 65.26  ? 63   LYS B CE    1 
ATOM   2095 N  NZ    . LYS D 3 63  ? 39.337 5.475   68.912 1.00 63.16  ? 63   LYS B NZ    1 
ATOM   2096 N  N     . CYS D 3 64  ? 33.354 7.118   67.240 1.00 55.31  ? 64   CYS B N     1 
ATOM   2097 C  CA    . CYS D 3 64  ? 32.562 6.466   66.212 1.00 51.32  ? 64   CYS B CA    1 
ATOM   2098 C  C     . CYS D 3 64  ? 33.461 6.219   65.015 1.00 49.39  ? 64   CYS B C     1 
ATOM   2099 O  O     . CYS D 3 64  ? 34.323 7.039   64.685 1.00 49.99  ? 64   CYS B O     1 
ATOM   2100 C  CB    . CYS D 3 64  ? 31.392 7.347   65.787 1.00 48.95  ? 64   CYS B CB    1 
ATOM   2101 S  SG    . CYS D 3 64  ? 29.989 7.297   66.887 1.00 49.17  ? 64   CYS B SG    1 
ATOM   2102 N  N     . ILE D 3 65  ? 33.274 5.070   64.386 1.00 46.30  ? 65   ILE B N     1 
ATOM   2103 C  CA    . ILE D 3 65  ? 34.038 4.712   63.206 1.00 44.92  ? 65   ILE B CA    1 
ATOM   2104 C  C     . ILE D 3 65  ? 32.988 4.784   62.105 1.00 47.55  ? 65   ILE B C     1 
ATOM   2105 O  O     . ILE D 3 65  ? 32.093 3.943   62.013 1.00 45.41  ? 65   ILE B O     1 
ATOM   2106 C  CB    . ILE D 3 65  ? 34.632 3.305   63.374 1.00 43.81  ? 65   ILE B CB    1 
ATOM   2107 C  CG1   . ILE D 3 65  ? 35.586 3.321   64.576 1.00 40.94  ? 65   ILE B CG1   1 
ATOM   2108 C  CG2   . ILE D 3 65  ? 35.347 2.870   62.100 1.00 39.66  ? 65   ILE B CG2   1 
ATOM   2109 C  CD1   . ILE D 3 65  ? 36.088 1.962   65.012 1.00 42.67  ? 65   ILE B CD1   1 
ATOM   2110 N  N     . THR D 3 66  ? 33.105 5.811   61.277 1.00 49.26  ? 66   THR B N     1 
ATOM   2111 C  CA    . THR D 3 66  ? 32.118 6.062   60.245 1.00 48.51  ? 66   THR B CA    1 
ATOM   2112 C  C     . THR D 3 66  ? 32.364 5.768   58.764 1.00 46.24  ? 66   THR B C     1 
ATOM   2113 O  O     . THR D 3 66  ? 33.446 5.987   58.218 1.00 45.71  ? 66   THR B O     1 
ATOM   2114 C  CB    . THR D 3 66  ? 31.651 7.512   60.373 1.00 48.48  ? 66   THR B CB    1 
ATOM   2115 O  OG1   . THR D 3 66  ? 30.866 7.647   61.563 1.00 51.58  ? 66   THR B OG1   1 
ATOM   2116 C  CG2   . THR D 3 66  ? 30.832 7.911   59.186 1.00 53.62  ? 66   THR B CG2   1 
ATOM   2117 N  N     . ILE D 3 67  ? 31.298 5.295   58.129 1.00 43.24  ? 67   ILE B N     1 
ATOM   2118 C  CA    . ILE D 3 67  ? 31.281 4.973   56.709 1.00 40.48  ? 67   ILE B CA    1 
ATOM   2119 C  C     . ILE D 3 67  ? 30.037 5.667   56.117 1.00 41.08  ? 67   ILE B C     1 
ATOM   2120 O  O     . ILE D 3 67  ? 29.011 5.839   56.802 1.00 34.65  ? 67   ILE B O     1 
ATOM   2121 C  CB    . ILE D 3 67  ? 31.229 3.428   56.514 1.00 40.64  ? 67   ILE B CB    1 
ATOM   2122 C  CG1   . ILE D 3 67  ? 32.496 2.964   55.808 1.00 45.21  ? 67   ILE B CG1   1 
ATOM   2123 C  CG2   . ILE D 3 67  ? 29.992 2.998   55.746 1.00 41.77  ? 67   ILE B CG2   1 
ATOM   2124 C  CD1   . ILE D 3 67  ? 33.762 3.225   56.588 1.00 42.68  ? 67   ILE B CD1   1 
ATOM   2125 N  N     . PRO D 3 68  ? 30.121 6.109   54.851 1.00 39.92  ? 68   PRO B N     1 
ATOM   2126 C  CA    . PRO D 3 68  ? 28.972 6.777   54.231 1.00 41.30  ? 68   PRO B CA    1 
ATOM   2127 C  C     . PRO D 3 68  ? 27.770 5.840   54.172 1.00 41.18  ? 68   PRO B C     1 
ATOM   2128 O  O     . PRO D 3 68  ? 27.929 4.640   53.958 1.00 41.77  ? 68   PRO B O     1 
ATOM   2129 C  CB    . PRO D 3 68  ? 29.482 7.123   52.835 1.00 41.29  ? 68   PRO B CB    1 
ATOM   2130 C  CG    . PRO D 3 68  ? 30.959 7.250   53.024 1.00 42.36  ? 68   PRO B CG    1 
ATOM   2131 C  CD    . PRO D 3 68  ? 31.271 6.087   53.932 1.00 42.96  ? 68   PRO B CD    1 
ATOM   2132 N  N     . ARG D 3 69  ? 26.573 6.378   54.373 1.00 40.70  ? 69   ARG B N     1 
ATOM   2133 C  CA    . ARG D 3 69  ? 25.376 5.553   54.302 1.00 42.94  ? 69   ARG B CA    1 
ATOM   2134 C  C     . ARG D 3 69  ? 24.756 5.666   52.911 1.00 42.94  ? 69   ARG B C     1 
ATOM   2135 O  O     . ARG D 3 69  ? 24.712 6.750   52.321 1.00 43.49  ? 69   ARG B O     1 
ATOM   2136 C  CB    . ARG D 3 69  ? 24.355 5.964   55.367 1.00 42.79  ? 69   ARG B CB    1 
ATOM   2137 C  CG    . ARG D 3 69  ? 23.148 6.745   54.872 1.00 48.59  ? 69   ARG B CG    1 
ATOM   2138 C  CD    . ARG D 3 69  ? 21.903 6.281   55.614 1.00 50.23  ? 69   ARG B CD    1 
ATOM   2139 N  NE    . ARG D 3 69  ? 22.151 6.168   57.051 1.00 55.09  ? 69   ARG B NE    1 
ATOM   2140 C  CZ    . ARG D 3 69  ? 21.374 5.503   57.902 1.00 57.22  ? 69   ARG B CZ    1 
ATOM   2141 N  NH1   . ARG D 3 69  ? 20.285 4.877   57.463 1.00 52.41  ? 69   ARG B NH1   1 
ATOM   2142 N  NH2   . ARG D 3 69  ? 21.685 5.469   59.195 1.00 53.47  ? 69   ARG B NH2   1 
ATOM   2143 N  N     . SER D 3 70  ? 24.301 4.533   52.388 1.00 39.43  ? 70   SER B N     1 
ATOM   2144 C  CA    . SER D 3 70  ? 23.681 4.483   51.071 1.00 37.83  ? 70   SER B CA    1 
ATOM   2145 C  C     . SER D 3 70  ? 22.230 4.914   51.226 1.00 40.70  ? 70   SER B C     1 
ATOM   2146 O  O     . SER D 3 70  ? 21.736 5.045   52.352 1.00 39.47  ? 70   SER B O     1 
ATOM   2147 C  CB    . SER D 3 70  ? 23.739 3.060   50.519 1.00 31.08  ? 70   SER B CB    1 
ATOM   2148 O  OG    . SER D 3 70  ? 22.907 2.215   51.292 1.00 26.30  ? 70   SER B OG    1 
ATOM   2149 N  N     . LEU D 3 71  ? 21.549 5.120   50.101 1.00 40.61  ? 71   LEU B N     1 
ATOM   2150 C  CA    . LEU D 3 71  ? 20.156 5.552   50.126 1.00 41.74  ? 71   LEU B CA    1 
ATOM   2151 C  C     . LEU D 3 71  ? 19.222 4.565   50.815 1.00 41.24  ? 71   LEU B C     1 
ATOM   2152 O  O     . LEU D 3 71  ? 18.353 4.974   51.587 1.00 41.22  ? 71   LEU B O     1 
ATOM   2153 C  CB    . LEU D 3 71  ? 19.653 5.842   48.699 1.00 45.78  ? 71   LEU B CB    1 
ATOM   2154 C  CG    . LEU D 3 71  ? 19.989 7.218   48.104 1.00 48.46  ? 71   LEU B CG    1 
ATOM   2155 C  CD1   . LEU D 3 71  ? 19.330 8.312   48.942 1.00 51.86  ? 71   LEU B CD1   1 
ATOM   2156 C  CD2   . LEU D 3 71  ? 21.480 7.432   48.083 1.00 52.80  ? 71   LEU B CD2   1 
ATOM   2157 N  N     . ASP D 3 72  ? 19.380 3.272   50.541 1.00 39.40  ? 72   ASP B N     1 
ATOM   2158 C  CA    . ASP D 3 72  ? 18.516 2.282   51.186 1.00 39.74  ? 72   ASP B CA    1 
ATOM   2159 C  C     . ASP D 3 72  ? 19.183 1.711   52.431 1.00 39.41  ? 72   ASP B C     1 
ATOM   2160 O  O     . ASP D 3 72  ? 18.661 0.790   53.058 1.00 43.54  ? 72   ASP B O     1 
ATOM   2161 C  CB    . ASP D 3 72  ? 18.145 1.143   50.225 1.00 38.99  ? 72   ASP B CB    1 
ATOM   2162 C  CG    . ASP D 3 72  ? 19.308 0.186   49.933 1.00 40.55  ? 72   ASP B CG    1 
ATOM   2163 O  OD1   . ASP D 3 72  ? 20.376 0.266   50.581 1.00 40.19  ? 72   ASP B OD1   1 
ATOM   2164 O  OD2   . ASP D 3 72  ? 19.133 -0.668  49.045 1.00 34.59  ? 72   ASP B OD2   1 
ATOM   2165 N  N     . GLY D 3 73  ? 20.346 2.257   52.770 1.00 38.93  ? 73   GLY B N     1 
ATOM   2166 C  CA    . GLY D 3 73  ? 21.070 1.816   53.957 1.00 41.19  ? 73   GLY B CA    1 
ATOM   2167 C  C     . GLY D 3 73  ? 21.933 0.564   53.866 1.00 38.91  ? 73   GLY B C     1 
ATOM   2168 O  O     . GLY D 3 73  ? 22.703 0.282   54.786 1.00 35.88  ? 73   GLY B O     1 
ATOM   2169 N  N     . ARG D 3 74  ? 21.825 -0.184  52.770 1.00 35.51  ? 74   ARG B N     1 
ATOM   2170 C  CA    . ARG D 3 74  ? 22.606 -1.404  52.627 1.00 32.56  ? 74   ARG B CA    1 
ATOM   2171 C  C     . ARG D 3 74  ? 23.992 -1.203  52.038 1.00 32.84  ? 74   ARG B C     1 
ATOM   2172 O  O     . ARG D 3 74  ? 24.280 -0.210  51.368 1.00 34.26  ? 74   ARG B O     1 
ATOM   2173 C  CB    . ARG D 3 74  ? 21.850 -2.445  51.792 1.00 30.35  ? 74   ARG B CB    1 
ATOM   2174 C  CG    . ARG D 3 74  ? 20.509 -2.846  52.396 1.00 36.53  ? 74   ARG B CG    1 
ATOM   2175 C  CD    . ARG D 3 74  ? 19.816 -3.932  51.603 1.00 31.67  ? 74   ARG B CD    1 
ATOM   2176 N  NE    . ARG D 3 74  ? 19.626 -3.581  50.199 1.00 35.48  ? 74   ARG B NE    1 
ATOM   2177 C  CZ    . ARG D 3 74  ? 19.014 -4.369  49.316 1.00 35.87  ? 74   ARG B CZ    1 
ATOM   2178 N  NH1   . ARG D 3 74  ? 18.537 -5.546  49.698 1.00 31.30  ? 74   ARG B NH1   1 
ATOM   2179 N  NH2   . ARG D 3 74  ? 18.884 -3.992  48.051 1.00 36.12  ? 74   ARG B NH2   1 
ATOM   2180 N  N     . LEU D 3 75  ? 24.850 -2.176  52.306 1.00 30.61  ? 75   LEU B N     1 
ATOM   2181 C  CA    . LEU D 3 75  ? 26.213 -2.168  51.822 1.00 29.09  ? 75   LEU B CA    1 
ATOM   2182 C  C     . LEU D 3 75  ? 26.414 -3.492  51.098 1.00 29.27  ? 75   LEU B C     1 
ATOM   2183 O  O     . LEU D 3 75  ? 25.916 -4.532  51.530 1.00 30.24  ? 75   LEU B O     1 
ATOM   2184 C  CB    . LEU D 3 75  ? 27.192 -2.069  52.997 1.00 22.63  ? 75   LEU B CB    1 
ATOM   2185 C  CG    . LEU D 3 75  ? 28.664 -2.185  52.615 1.00 22.13  ? 75   LEU B CG    1 
ATOM   2186 C  CD1   . LEU D 3 75  ? 29.119 -0.894  51.964 1.00 27.73  ? 75   LEU B CD1   1 
ATOM   2187 C  CD2   . LEU D 3 75  ? 29.502 -2.481  53.853 1.00 27.76  ? 75   LEU B CD2   1 
ATOM   2188 N  N     . GLN D 3 76  ? 27.134 -3.443  49.991 1.00 27.64  ? 76   GLN B N     1 
ATOM   2189 C  CA    . GLN D 3 76  ? 27.408 -4.633  49.228 1.00 30.33  ? 76   GLN B CA    1 
ATOM   2190 C  C     . GLN D 3 76  ? 28.894 -4.889  49.278 1.00 31.27  ? 76   GLN B C     1 
ATOM   2191 O  O     . GLN D 3 76  ? 29.703 -3.969  49.117 1.00 25.96  ? 76   GLN B O     1 
ATOM   2192 C  CB    . GLN D 3 76  ? 26.944 -4.484  47.768 1.00 29.17  ? 76   GLN B CB    1 
ATOM   2193 C  CG    . GLN D 3 76  ? 27.224 -5.724  46.906 1.00 26.46  ? 76   GLN B CG    1 
ATOM   2194 C  CD    . GLN D 3 76  ? 26.696 -5.598  45.467 1.00 30.02  ? 76   GLN B CD    1 
ATOM   2195 O  OE1   . GLN D 3 76  ? 25.549 -5.209  45.239 1.00 23.88  ? 76   GLN B OE1   1 
ATOM   2196 N  NE2   . GLN D 3 76  ? 27.533 -5.940  44.501 1.00 24.68  ? 76   GLN B NE2   1 
ATOM   2197 N  N     . VAL D 3 77  ? 29.232 -6.148  49.535 1.00 29.31  ? 77   VAL B N     1 
ATOM   2198 C  CA    . VAL D 3 77  ? 30.614 -6.602  49.572 1.00 33.08  ? 77   VAL B CA    1 
ATOM   2199 C  C     . VAL D 3 77  ? 30.550 -7.816  48.652 1.00 32.28  ? 77   VAL B C     1 
ATOM   2200 O  O     . VAL D 3 77  ? 29.824 -8.781  48.930 1.00 28.87  ? 77   VAL B O     1 
ATOM   2201 C  CB    . VAL D 3 77  ? 31.034 -7.004  50.989 1.00 33.49  ? 77   VAL B CB    1 
ATOM   2202 C  CG1   . VAL D 3 77  ? 32.451 -7.527  50.981 1.00 33.48  ? 77   VAL B CG1   1 
ATOM   2203 C  CG2   . VAL D 3 77  ? 30.921 -5.790  51.909 1.00 35.66  ? 77   VAL B CG2   1 
ATOM   2204 N  N     . SER D 3 78  ? 31.266 -7.737  47.534 1.00 34.65  ? 78   SER B N     1 
ATOM   2205 C  CA    . SER D 3 78  ? 31.238 -8.808  46.552 1.00 41.79  ? 78   SER B CA    1 
ATOM   2206 C  C     . SER D 3 78  ? 29.819 -8.809  45.977 1.00 44.16  ? 78   SER B C     1 
ATOM   2207 O  O     . SER D 3 78  ? 29.346 -7.790  45.465 1.00 46.01  ? 78   SER B O     1 
ATOM   2208 C  CB    . SER D 3 78  ? 31.558 -10.144 47.232 1.00 44.64  ? 78   SER B CB    1 
ATOM   2209 O  OG    . SER D 3 78  ? 31.545 -11.211 46.311 1.00 49.18  ? 78   SER B OG    1 
ATOM   2210 N  N     . HIS D 3 79  ? 29.126 -9.932  46.102 1.00 44.34  ? 79   HIS B N     1 
ATOM   2211 C  CA    . HIS D 3 79  ? 27.768 -10.042 45.575 1.00 47.15  ? 79   HIS B CA    1 
ATOM   2212 C  C     . HIS D 3 79  ? 26.690 -9.988  46.642 1.00 43.89  ? 79   HIS B C     1 
ATOM   2213 O  O     . HIS D 3 79  ? 25.501 -9.880  46.339 1.00 48.05  ? 79   HIS B O     1 
ATOM   2214 C  CB    . HIS D 3 79  ? 27.609 -11.343 44.783 1.00 56.31  ? 79   HIS B CB    1 
ATOM   2215 C  CG    . HIS D 3 79  ? 28.510 -11.442 43.593 1.00 63.88  ? 79   HIS B CG    1 
ATOM   2216 N  ND1   . HIS D 3 79  ? 28.595 -12.578 42.815 1.00 70.30  ? 79   HIS B ND1   1 
ATOM   2217 C  CD2   . HIS D 3 79  ? 29.371 -10.549 43.051 1.00 68.13  ? 79   HIS B CD2   1 
ATOM   2218 C  CE1   . HIS D 3 79  ? 29.472 -12.378 41.846 1.00 72.88  ? 79   HIS B CE1   1 
ATOM   2219 N  NE2   . HIS D 3 79  ? 29.957 -11.155 41.967 1.00 70.49  ? 79   HIS B NE2   1 
ATOM   2220 N  N     . ARG D 3 80  ? 27.111 -10.060 47.892 1.00 41.15  ? 80   ARG B N     1 
ATOM   2221 C  CA    . ARG D 3 80  ? 26.190 -10.036 49.009 1.00 41.94  ? 80   ARG B CA    1 
ATOM   2222 C  C     . ARG D 3 80  ? 25.857 -8.621  49.501 1.00 38.47  ? 80   ARG B C     1 
ATOM   2223 O  O     . ARG D 3 80  ? 26.700 -7.731  49.476 1.00 38.93  ? 80   ARG B O     1 
ATOM   2224 C  CB    . ARG D 3 80  ? 26.787 -10.870 50.146 1.00 45.80  ? 80   ARG B CB    1 
ATOM   2225 C  CG    . ARG D 3 80  ? 25.814 -11.269 51.230 1.00 49.41  ? 80   ARG B CG    1 
ATOM   2226 C  CD    . ARG D 3 80  ? 26.508 -12.154 52.249 1.00 57.03  ? 80   ARG B CD    1 
ATOM   2227 N  NE    . ARG D 3 80  ? 27.082 -13.338 51.618 1.00 60.45  ? 80   ARG B NE    1 
ATOM   2228 C  CZ    . ARG D 3 80  ? 27.782 -14.267 52.262 1.00 63.31  ? 80   ARG B CZ    1 
ATOM   2229 N  NH1   . ARG D 3 80  ? 28.003 -14.159 53.567 1.00 62.11  ? 80   ARG B NH1   1 
ATOM   2230 N  NH2   . ARG D 3 80  ? 28.254 -15.312 51.597 1.00 65.11  ? 80   ARG B NH2   1 
ATOM   2231 N  N     . LYS D 3 81  ? 24.620 -8.434  49.947 1.00 34.19  ? 81   LYS B N     1 
ATOM   2232 C  CA    . LYS D 3 81  ? 24.163 -7.152  50.478 1.00 35.21  ? 81   LYS B CA    1 
ATOM   2233 C  C     . LYS D 3 81  ? 23.735 -7.295  51.938 1.00 32.22  ? 81   LYS B C     1 
ATOM   2234 O  O     . LYS D 3 81  ? 23.220 -8.342  52.334 1.00 32.41  ? 81   LYS B O     1 
ATOM   2235 C  CB    . LYS D 3 81  ? 22.965 -6.621  49.681 1.00 35.04  ? 81   LYS B CB    1 
ATOM   2236 C  CG    . LYS D 3 81  ? 23.299 -6.020  48.343 1.00 26.37  ? 81   LYS B CG    1 
ATOM   2237 C  CD    . LYS D 3 81  ? 22.197 -5.081  47.899 1.00 31.84  ? 81   LYS B CD    1 
ATOM   2238 C  CE    . LYS D 3 81  ? 22.439 -4.535  46.493 1.00 30.61  ? 81   LYS B CE    1 
ATOM   2239 N  NZ    . LYS D 3 81  ? 23.580 -3.574  46.416 1.00 29.95  ? 81   LYS B NZ    1 
ATOM   2240 N  N     . GLY D 3 82  ? 23.946 -6.241  52.729 1.00 33.64  ? 82   GLY B N     1 
ATOM   2241 C  CA    . GLY D 3 82  ? 23.538 -6.263  54.128 1.00 30.18  ? 82   GLY B CA    1 
ATOM   2242 C  C     . GLY D 3 82  ? 23.632 -4.900  54.795 1.00 31.72  ? 82   GLY B C     1 
ATOM   2243 O  O     . GLY D 3 82  ? 24.031 -3.919  54.166 1.00 33.59  ? 82   GLY B O     1 
ATOM   2244 N  N     . LEU D 3 83  ? 23.242 -4.812  56.062 1.00 34.27  ? 83   LEU B N     1 
ATOM   2245 C  CA    . LEU D 3 83  ? 23.369 -3.544  56.773 1.00 34.04  ? 83   LEU B CA    1 
ATOM   2246 C  C     . LEU D 3 83  ? 24.800 -3.549  57.329 1.00 35.72  ? 83   LEU B C     1 
ATOM   2247 O  O     . LEU D 3 83  ? 25.263 -4.566  57.859 1.00 33.25  ? 83   LEU B O     1 
ATOM   2248 C  CB    . LEU D 3 83  ? 22.324 -3.444  57.878 1.00 36.26  ? 83   LEU B CB    1 
ATOM   2249 C  CG    . LEU D 3 83  ? 20.888 -3.464  57.327 1.00 36.42  ? 83   LEU B CG    1 
ATOM   2250 C  CD1   . LEU D 3 83  ? 19.908 -3.198  58.449 1.00 36.82  ? 83   LEU B CD1   1 
ATOM   2251 C  CD2   . LEU D 3 83  ? 20.725 -2.407  56.245 1.00 36.33  ? 83   LEU B CD2   1 
ATOM   2252 N  N     . PRO D 3 84  ? 25.526 -2.417  57.204 1.00 34.86  ? 84   PRO B N     1 
ATOM   2253 C  CA    . PRO D 3 84  ? 26.912 -2.311  57.678 1.00 30.51  ? 84   PRO B CA    1 
ATOM   2254 C  C     . PRO D 3 84  ? 27.144 -2.699  59.135 1.00 34.25  ? 84   PRO B C     1 
ATOM   2255 O  O     . PRO D 3 84  ? 27.992 -3.550  59.428 1.00 37.48  ? 84   PRO B O     1 
ATOM   2256 C  CB    . PRO D 3 84  ? 27.268 -0.841  57.422 1.00 30.64  ? 84   PRO B CB    1 
ATOM   2257 C  CG    . PRO D 3 84  ? 26.302 -0.399  56.409 1.00 33.38  ? 84   PRO B CG    1 
ATOM   2258 C  CD    . PRO D 3 84  ? 25.027 -1.096  56.794 1.00 29.46  ? 84   PRO B CD    1 
ATOM   2259 N  N     . HIS D 3 85  ? 26.409 -2.072  60.047 1.00 28.78  ? 85   HIS B N     1 
ATOM   2260 C  CA    . HIS D 3 85  ? 26.594 -2.370  61.454 1.00 34.44  ? 85   HIS B CA    1 
ATOM   2261 C  C     . HIS D 3 85  ? 26.341 -3.849  61.731 1.00 34.61  ? 85   HIS B C     1 
ATOM   2262 O  O     . HIS D 3 85  ? 27.050 -4.475  62.528 1.00 29.18  ? 85   HIS B O     1 
ATOM   2263 C  CB    . HIS D 3 85  ? 25.695 -1.487  62.328 1.00 36.46  ? 85   HIS B CB    1 
ATOM   2264 C  CG    . HIS D 3 85  ? 24.238 -1.574  61.998 1.00 40.89  ? 85   HIS B CG    1 
ATOM   2265 N  ND1   . HIS D 3 85  ? 23.256 -1.561  62.969 1.00 40.93  ? 85   HIS B ND1   1 
ATOM   2266 C  CD2   . HIS D 3 85  ? 23.593 -1.661  60.812 1.00 34.66  ? 85   HIS B CD2   1 
ATOM   2267 C  CE1   . HIS D 3 85  ? 22.072 -1.640  62.394 1.00 33.62  ? 85   HIS B CE1   1 
ATOM   2268 N  NE2   . HIS D 3 85  ? 22.248 -1.703  61.086 1.00 38.35  ? 85   HIS B NE2   1 
ATOM   2269 N  N     . VAL D 3 86  ? 25.341 -4.413  61.066 1.00 31.74  ? 86   VAL B N     1 
ATOM   2270 C  CA    . VAL D 3 86  ? 25.051 -5.822  61.248 1.00 31.26  ? 86   VAL B CA    1 
ATOM   2271 C  C     . VAL D 3 86  ? 26.216 -6.673  60.737 1.00 31.18  ? 86   VAL B C     1 
ATOM   2272 O  O     . VAL D 3 86  ? 26.587 -7.661  61.362 1.00 34.91  ? 86   VAL B O     1 
ATOM   2273 C  CB    . VAL D 3 86  ? 23.748 -6.225  60.518 1.00 31.75  ? 86   VAL B CB    1 
ATOM   2274 C  CG1   . VAL D 3 86  ? 23.632 -7.753  60.413 1.00 28.50  ? 86   VAL B CG1   1 
ATOM   2275 C  CG2   . VAL D 3 86  ? 22.565 -5.683  61.274 1.00 27.49  ? 86   VAL B CG2   1 
ATOM   2276 N  N     . ILE D 3 87  ? 26.814 -6.273  59.621 1.00 31.58  ? 87   ILE B N     1 
ATOM   2277 C  CA    . ILE D 3 87  ? 27.914 -7.035  59.043 1.00 30.85  ? 87   ILE B CA    1 
ATOM   2278 C  C     . ILE D 3 87  ? 29.157 -7.044  59.918 1.00 34.12  ? 87   ILE B C     1 
ATOM   2279 O  O     . ILE D 3 87  ? 29.764 -8.096  60.139 1.00 35.92  ? 87   ILE B O     1 
ATOM   2280 C  CB    . ILE D 3 87  ? 28.313 -6.495  57.646 1.00 31.28  ? 87   ILE B CB    1 
ATOM   2281 C  CG1   . ILE D 3 87  ? 27.182 -6.725  56.642 1.00 27.24  ? 87   ILE B CG1   1 
ATOM   2282 C  CG2   . ILE D 3 87  ? 29.577 -7.190  57.161 1.00 25.76  ? 87   ILE B CG2   1 
ATOM   2283 C  CD1   . ILE D 3 87  ? 27.480 -6.137  55.283 1.00 22.71  ? 87   ILE B CD1   1 
ATOM   2284 N  N     . TYR D 3 88  ? 29.537 -5.880  60.426 1.00 33.73  ? 88   TYR B N     1 
ATOM   2285 C  CA    . TYR D 3 88  ? 30.730 -5.811  61.253 1.00 32.03  ? 88   TYR B CA    1 
ATOM   2286 C  C     . TYR D 3 88  ? 30.566 -6.241  62.716 1.00 32.02  ? 88   TYR B C     1 
ATOM   2287 O  O     . TYR D 3 88  ? 31.549 -6.647  63.336 1.00 35.64  ? 88   TYR B O     1 
ATOM   2288 C  CB    . TYR D 3 88  ? 31.364 -4.429  61.121 1.00 27.44  ? 88   TYR B CB    1 
ATOM   2289 C  CG    . TYR D 3 88  ? 31.820 -4.187  59.696 1.00 27.55  ? 88   TYR B CG    1 
ATOM   2290 C  CD1   . TYR D 3 88  ? 31.213 -3.224  58.891 1.00 29.16  ? 88   TYR B CD1   1 
ATOM   2291 C  CD2   . TYR D 3 88  ? 32.800 -4.989  59.126 1.00 27.32  ? 88   TYR B CD2   1 
ATOM   2292 C  CE1   . TYR D 3 88  ? 31.575 -3.073  57.544 1.00 24.88  ? 88   TYR B CE1   1 
ATOM   2293 C  CE2   . TYR D 3 88  ? 33.163 -4.854  57.794 1.00 29.96  ? 88   TYR B CE2   1 
ATOM   2294 C  CZ    . TYR D 3 88  ? 32.550 -3.898  57.007 1.00 27.28  ? 88   TYR B CZ    1 
ATOM   2295 O  OH    . TYR D 3 88  ? 32.919 -3.793  55.682 1.00 29.55  ? 88   TYR B OH    1 
ATOM   2296 N  N     . CYS D 3 89  ? 29.353 -6.177  63.265 1.00 28.81  ? 89   CYS B N     1 
ATOM   2297 C  CA    . CYS D 3 89  ? 29.137 -6.646  64.634 1.00 32.04  ? 89   CYS B CA    1 
ATOM   2298 C  C     . CYS D 3 89  ? 29.123 -8.170  64.586 1.00 38.38  ? 89   CYS B C     1 
ATOM   2299 O  O     . CYS D 3 89  ? 29.571 -8.833  65.517 1.00 38.19  ? 89   CYS B O     1 
ATOM   2300 C  CB    . CYS D 3 89  ? 27.812 -6.155  65.213 1.00 24.46  ? 89   CYS B CB    1 
ATOM   2301 S  SG    . CYS D 3 89  ? 27.872 -4.440  65.748 1.00 34.36  ? 89   CYS B SG    1 
ATOM   2302 N  N     . ARG D 3 90  ? 28.600 -8.721  63.496 1.00 40.24  ? 90   ARG B N     1 
ATOM   2303 C  CA    . ARG D 3 90  ? 28.564 -10.166 63.331 1.00 45.26  ? 90   ARG B CA    1 
ATOM   2304 C  C     . ARG D 3 90  ? 29.989 -10.661 63.094 1.00 45.76  ? 90   ARG B C     1 
ATOM   2305 O  O     . ARG D 3 90  ? 30.330 -11.807 63.406 1.00 46.32  ? 90   ARG B O     1 
ATOM   2306 C  CB    . ARG D 3 90  ? 27.691 -10.545 62.138 1.00 47.11  ? 90   ARG B CB    1 
ATOM   2307 C  CG    . ARG D 3 90  ? 27.837 -11.991 61.707 1.00 53.88  ? 90   ARG B CG    1 
ATOM   2308 C  CD    . ARG D 3 90  ? 27.063 -12.241 60.432 1.00 61.60  ? 90   ARG B CD    1 
ATOM   2309 N  NE    . ARG D 3 90  ? 25.632 -12.029 60.623 1.00 66.93  ? 90   ARG B NE    1 
ATOM   2310 C  CZ    . ARG D 3 90  ? 24.823 -11.541 59.688 1.00 67.73  ? 90   ARG B CZ    1 
ATOM   2311 N  NH1   . ARG D 3 90  ? 25.313 -11.206 58.499 1.00 69.82  ? 90   ARG B NH1   1 
ATOM   2312 N  NH2   . ARG D 3 90  ? 23.526 -11.404 59.933 1.00 67.36  ? 90   ARG B NH2   1 
ATOM   2313 N  N     . LEU D 3 91  ? 30.819 -9.789  62.536 1.00 44.11  ? 91   LEU B N     1 
ATOM   2314 C  CA    . LEU D 3 91  ? 32.204 -10.142 62.263 1.00 46.09  ? 91   LEU B CA    1 
ATOM   2315 C  C     . LEU D 3 91  ? 33.019 -10.253 63.548 1.00 47.57  ? 91   LEU B C     1 
ATOM   2316 O  O     . LEU D 3 91  ? 33.466 -11.339 63.919 1.00 49.82  ? 91   LEU B O     1 
ATOM   2317 C  CB    . LEU D 3 91  ? 32.859 -9.100  61.357 1.00 46.60  ? 91   LEU B CB    1 
ATOM   2318 C  CG    . LEU D 3 91  ? 33.515 -9.601  60.067 1.00 50.31  ? 91   LEU B CG    1 
ATOM   2319 C  CD1   . LEU D 3 91  ? 34.287 -8.447  59.431 1.00 49.01  ? 91   LEU B CD1   1 
ATOM   2320 C  CD2   . LEU D 3 91  ? 34.450 -10.763 60.350 1.00 41.95  ? 91   LEU B CD2   1 
ATOM   2321 N  N     . TRP D 3 92  ? 33.195 -9.129  64.232 1.00 44.62  ? 92   TRP B N     1 
ATOM   2322 C  CA    . TRP D 3 92  ? 33.991 -9.095  65.451 1.00 45.29  ? 92   TRP B CA    1 
ATOM   2323 C  C     . TRP D 3 92  ? 33.291 -9.358  66.786 1.00 46.32  ? 92   TRP B C     1 
ATOM   2324 O  O     . TRP D 3 92  ? 33.952 -9.388  67.821 1.00 47.72  ? 92   TRP B O     1 
ATOM   2325 C  CB    . TRP D 3 92  ? 34.723 -7.750  65.525 1.00 42.55  ? 92   TRP B CB    1 
ATOM   2326 C  CG    . TRP D 3 92  ? 35.713 -7.566  64.408 1.00 45.52  ? 92   TRP B CG    1 
ATOM   2327 C  CD1   . TRP D 3 92  ? 36.761 -8.391  64.098 1.00 45.76  ? 92   TRP B CD1   1 
ATOM   2328 C  CD2   . TRP D 3 92  ? 35.716 -6.528  63.419 1.00 44.15  ? 92   TRP B CD2   1 
ATOM   2329 N  NE1   . TRP D 3 92  ? 37.416 -7.931  62.981 1.00 45.97  ? 92   TRP B NE1   1 
ATOM   2330 C  CE2   . TRP D 3 92  ? 36.802 -6.786  62.546 1.00 44.77  ? 92   TRP B CE2   1 
ATOM   2331 C  CE3   . TRP D 3 92  ? 34.921 -5.395  63.194 1.00 41.13  ? 92   TRP B CE3   1 
ATOM   2332 C  CZ2   . TRP D 3 92  ? 37.097 -5.965  61.445 1.00 45.86  ? 92   TRP B CZ2   1 
ATOM   2333 C  CZ3   . TRP D 3 92  ? 35.213 -4.576  62.103 1.00 44.25  ? 92   TRP B CZ3   1 
ATOM   2334 C  CH2   . TRP D 3 92  ? 36.301 -4.863  61.245 1.00 40.73  ? 92   TRP B CH2   1 
ATOM   2335 N  N     . ARG D 3 93  ? 31.976 -9.558  66.785 1.00 47.04  ? 93   ARG B N     1 
ATOM   2336 C  CA    . ARG D 3 93  ? 31.268 -9.765  68.052 1.00 48.35  ? 93   ARG B CA    1 
ATOM   2337 C  C     . ARG D 3 93  ? 30.328 -10.965 68.148 1.00 51.76  ? 93   ARG B C     1 
ATOM   2338 O  O     . ARG D 3 93  ? 30.489 -11.822 69.018 1.00 54.87  ? 93   ARG B O     1 
ATOM   2339 C  CB    . ARG D 3 93  ? 30.446 -8.525  68.407 1.00 45.01  ? 93   ARG B CB    1 
ATOM   2340 C  CG    . ARG D 3 93  ? 31.213 -7.229  68.523 1.00 50.50  ? 93   ARG B CG    1 
ATOM   2341 C  CD    . ARG D 3 93  ? 31.857 -7.089  69.866 1.00 48.87  ? 93   ARG B CD    1 
ATOM   2342 N  NE    . ARG D 3 93  ? 30.898 -7.146  70.968 1.00 50.96  ? 93   ARG B NE    1 
ATOM   2343 C  CZ    . ARG D 3 93  ? 30.192 -6.113  71.422 1.00 50.12  ? 93   ARG B CZ    1 
ATOM   2344 N  NH1   . ARG D 3 93  ? 30.320 -4.913  70.872 1.00 48.42  ? 93   ARG B NH1   1 
ATOM   2345 N  NH2   . ARG D 3 93  ? 29.375 -6.278  72.454 1.00 46.26  ? 93   ARG B NH2   1 
ATOM   2346 N  N     . TRP D 3 94  ? 29.335 -11.009 67.265 1.00 50.79  ? 94   TRP B N     1 
ATOM   2347 C  CA    . TRP D 3 94  ? 28.331 -12.060 67.297 1.00 49.98  ? 94   TRP B CA    1 
ATOM   2348 C  C     . TRP D 3 94  ? 28.128 -12.759 65.960 1.00 54.28  ? 94   TRP B C     1 
ATOM   2349 O  O     . TRP D 3 94  ? 27.263 -12.380 65.168 1.00 52.36  ? 94   TRP B O     1 
ATOM   2350 C  CB    . TRP D 3 94  ? 27.018 -11.447 67.769 1.00 45.31  ? 94   TRP B CB    1 
ATOM   2351 C  CG    . TRP D 3 94  ? 27.172 -10.704 69.058 1.00 44.51  ? 94   TRP B CG    1 
ATOM   2352 C  CD1   . TRP D 3 94  ? 27.439 -11.244 70.285 1.00 46.61  ? 94   TRP B CD1   1 
ATOM   2353 C  CD2   . TRP D 3 94  ? 27.070 -9.287  69.259 1.00 39.78  ? 94   TRP B CD2   1 
ATOM   2354 N  NE1   . TRP D 3 94  ? 27.502 -10.257 71.236 1.00 44.41  ? 94   TRP B NE1   1 
ATOM   2355 C  CE2   . TRP D 3 94  ? 27.276 -9.045  70.635 1.00 40.64  ? 94   TRP B CE2   1 
ATOM   2356 C  CE3   . TRP D 3 94  ? 26.813 -8.198  68.412 1.00 36.36  ? 94   TRP B CE3   1 
ATOM   2357 C  CZ2   . TRP D 3 94  ? 27.244 -7.763  71.185 1.00 33.41  ? 94   TRP B CZ2   1 
ATOM   2358 C  CZ3   . TRP D 3 94  ? 26.779 -6.917  68.960 1.00 34.50  ? 94   TRP B CZ3   1 
ATOM   2359 C  CH2   . TRP D 3 94  ? 26.989 -6.713  70.335 1.00 39.64  ? 94   TRP B CH2   1 
ATOM   2360 N  N     . PRO D 3 95  ? 28.915 -13.811 65.703 1.00 57.12  ? 95   PRO B N     1 
ATOM   2361 C  CA    . PRO D 3 95  ? 28.844 -14.587 64.460 1.00 60.26  ? 95   PRO B CA    1 
ATOM   2362 C  C     . PRO D 3 95  ? 27.481 -15.217 64.207 1.00 62.41  ? 95   PRO B C     1 
ATOM   2363 O  O     . PRO D 3 95  ? 27.175 -15.630 63.086 1.00 61.48  ? 95   PRO B O     1 
ATOM   2364 C  CB    . PRO D 3 95  ? 29.945 -15.630 64.645 1.00 60.24  ? 95   PRO B CB    1 
ATOM   2365 C  CG    . PRO D 3 95  ? 29.984 -15.818 66.135 1.00 59.81  ? 95   PRO B CG    1 
ATOM   2366 C  CD    . PRO D 3 95  ? 29.891 -14.401 66.635 1.00 57.34  ? 95   PRO B CD    1 
ATOM   2367 N  N     . ASP D 3 96  ? 26.668 -15.282 65.257 1.00 63.73  ? 96   ASP B N     1 
ATOM   2368 C  CA    . ASP D 3 96  ? 25.337 -15.865 65.170 1.00 65.09  ? 96   ASP B CA    1 
ATOM   2369 C  C     . ASP D 3 96  ? 24.267 -14.801 64.956 1.00 63.36  ? 96   ASP B C     1 
ATOM   2370 O  O     . ASP D 3 96  ? 23.107 -15.128 64.724 1.00 63.95  ? 96   ASP B O     1 
ATOM   2371 C  CB    . ASP D 3 96  ? 25.034 -16.645 66.448 1.00 68.16  ? 96   ASP B CB    1 
ATOM   2372 C  CG    . ASP D 3 96  ? 25.102 -15.777 67.679 1.00 72.44  ? 96   ASP B CG    1 
ATOM   2373 O  OD1   . ASP D 3 96  ? 26.123 -15.085 67.876 1.00 74.97  ? 96   ASP B OD1   1 
ATOM   2374 O  OD2   . ASP D 3 96  ? 24.133 -15.787 68.459 1.00 78.66  ? 96   ASP B OD2   1 
ATOM   2375 N  N     . LEU D 3 97  ? 24.663 -13.533 65.046 1.00 61.95  ? 97   LEU B N     1 
ATOM   2376 C  CA    . LEU D 3 97  ? 23.744 -12.407 64.862 1.00 61.10  ? 97   LEU B CA    1 
ATOM   2377 C  C     . LEU D 3 97  ? 22.837 -12.648 63.649 1.00 60.72  ? 97   LEU B C     1 
ATOM   2378 O  O     . LEU D 3 97  ? 23.295 -13.108 62.605 1.00 59.51  ? 97   LEU B O     1 
ATOM   2379 C  CB    . LEU D 3 97  ? 24.552 -11.117 64.680 1.00 58.02  ? 97   LEU B CB    1 
ATOM   2380 C  CG    . LEU D 3 97  ? 23.836 -9.766  64.719 1.00 57.57  ? 97   LEU B CG    1 
ATOM   2381 C  CD1   . LEU D 3 97  ? 23.046 -9.634  66.002 1.00 55.49  ? 97   LEU B CD1   1 
ATOM   2382 C  CD2   . LEU D 3 97  ? 24.860 -8.649  64.622 1.00 56.25  ? 97   LEU B CD2   1 
ATOM   2383 N  N     . HIS D 3 98  ? 21.552 -12.337 63.780 1.00 63.67  ? 98   HIS B N     1 
ATOM   2384 C  CA    . HIS D 3 98  ? 20.625 -12.570 62.678 1.00 65.91  ? 98   HIS B CA    1 
ATOM   2385 C  C     . HIS D 3 98  ? 20.159 -11.327 61.924 1.00 62.91  ? 98   HIS B C     1 
ATOM   2386 O  O     . HIS D 3 98  ? 20.215 -11.298 60.692 1.00 62.06  ? 98   HIS B O     1 
ATOM   2387 C  CB    . HIS D 3 98  ? 19.417 -13.362 63.183 1.00 74.92  ? 98   HIS B CB    1 
ATOM   2388 C  CG    . HIS D 3 98  ? 19.773 -14.718 63.715 1.00 85.14  ? 98   HIS B CG    1 
ATOM   2389 N  ND1   . HIS D 3 98  ? 20.470 -15.649 62.973 1.00 88.71  ? 98   HIS B ND1   1 
ATOM   2390 C  CD2   . HIS D 3 98  ? 19.543 -15.293 64.920 1.00 87.61  ? 98   HIS B CD2   1 
ATOM   2391 C  CE1   . HIS D 3 98  ? 20.656 -16.738 63.698 1.00 89.20  ? 98   HIS B CE1   1 
ATOM   2392 N  NE2   . HIS D 3 98  ? 20.104 -16.548 64.883 1.00 89.29  ? 98   HIS B NE2   1 
ATOM   2393 N  N     . SER D 3 99  ? 19.696 -10.310 62.649 1.00 56.17  ? 99   SER B N     1 
ATOM   2394 C  CA    . SER D 3 99  ? 19.233 -9.079  62.010 1.00 50.90  ? 99   SER B CA    1 
ATOM   2395 C  C     . SER D 3 99  ? 19.493 -7.836  62.852 1.00 48.90  ? 99   SER B C     1 
ATOM   2396 O  O     . SER D 3 99  ? 19.879 -7.923  64.017 1.00 44.29  ? 99   SER B O     1 
ATOM   2397 C  CB    . SER D 3 99  ? 17.734 -9.170  61.690 1.00 49.83  ? 99   SER B CB    1 
ATOM   2398 O  OG    . SER D 3 99  ? 16.953 -9.207  62.872 1.00 48.59  ? 99   SER B OG    1 
ATOM   2399 N  N     . HIS D 3 100 ? 19.262 -6.676  62.252 1.00 46.43  ? 100  HIS B N     1 
ATOM   2400 C  CA    . HIS D 3 100 ? 19.471 -5.408  62.928 1.00 50.31  ? 100  HIS B CA    1 
ATOM   2401 C  C     . HIS D 3 100 ? 18.493 -5.218  64.089 1.00 50.77  ? 100  HIS B C     1 
ATOM   2402 O  O     . HIS D 3 100 ? 18.650 -4.313  64.907 1.00 47.33  ? 100  HIS B O     1 
ATOM   2403 C  CB    . HIS D 3 100 ? 19.332 -4.267  61.921 1.00 50.31  ? 100  HIS B CB    1 
ATOM   2404 C  CG    . HIS D 3 100 ? 18.037 -4.286  61.172 1.00 56.18  ? 100  HIS B CG    1 
ATOM   2405 N  ND1   . HIS D 3 100 ? 16.901 -3.654  61.630 1.00 58.34  ? 100  HIS B ND1   1 
ATOM   2406 C  CD2   . HIS D 3 100 ? 17.683 -4.908  60.021 1.00 55.89  ? 100  HIS B CD2   1 
ATOM   2407 C  CE1   . HIS D 3 100 ? 15.903 -3.886  60.795 1.00 58.01  ? 100  HIS B CE1   1 
ATOM   2408 N  NE2   . HIS D 3 100 ? 16.351 -4.645  59.812 1.00 56.99  ? 100  HIS B NE2   1 
ATOM   2409 N  N     . HIS D 3 101 ? 17.486 -6.079  64.163 1.00 54.71  ? 101  HIS B N     1 
ATOM   2410 C  CA    . HIS D 3 101 ? 16.499 -5.984  65.232 1.00 59.00  ? 101  HIS B CA    1 
ATOM   2411 C  C     . HIS D 3 101 ? 17.054 -6.495  66.555 1.00 59.95  ? 101  HIS B C     1 
ATOM   2412 O  O     . HIS D 3 101 ? 16.426 -6.349  67.603 1.00 61.78  ? 101  HIS B O     1 
ATOM   2413 C  CB    . HIS D 3 101 ? 15.233 -6.750  64.842 1.00 63.89  ? 101  HIS B CB    1 
ATOM   2414 C  CG    . HIS D 3 101 ? 14.424 -6.065  63.784 1.00 66.43  ? 101  HIS B CG    1 
ATOM   2415 N  ND1   . HIS D 3 101 ? 13.688 -6.755  62.844 1.00 66.78  ? 101  HIS B ND1   1 
ATOM   2416 C  CD2   . HIS D 3 101 ? 14.240 -4.750  63.516 1.00 65.37  ? 101  HIS B CD2   1 
ATOM   2417 C  CE1   . HIS D 3 101 ? 13.089 -5.895  62.041 1.00 68.10  ? 101  HIS B CE1   1 
ATOM   2418 N  NE2   . HIS D 3 101 ? 13.408 -4.672  62.427 1.00 69.21  ? 101  HIS B NE2   1 
ATOM   2419 N  N     . GLU D 3 102 ? 18.239 -7.089  66.502 1.00 58.43  ? 102  GLU B N     1 
ATOM   2420 C  CA    . GLU D 3 102 ? 18.884 -7.593  67.700 1.00 58.08  ? 102  GLU B CA    1 
ATOM   2421 C  C     . GLU D 3 102 ? 19.921 -6.568  68.150 1.00 58.34  ? 102  GLU B C     1 
ATOM   2422 O  O     . GLU D 3 102 ? 20.577 -6.739  69.172 1.00 57.13  ? 102  GLU B O     1 
ATOM   2423 C  CB    . GLU D 3 102 ? 19.589 -8.919  67.413 1.00 59.21  ? 102  GLU B CB    1 
ATOM   2424 C  CG    . GLU D 3 102 ? 18.728 -9.986  66.759 1.00 63.31  ? 102  GLU B CG    1 
ATOM   2425 C  CD    . GLU D 3 102 ? 19.423 -11.342 66.711 1.00 67.17  ? 102  GLU B CD    1 
ATOM   2426 O  OE1   . GLU D 3 102 ? 18.943 -12.237 65.981 1.00 69.51  ? 102  GLU B OE1   1 
ATOM   2427 O  OE2   . GLU D 3 102 ? 20.445 -11.517 67.412 1.00 66.72  ? 102  GLU B OE2   1 
ATOM   2428 N  N     . LEU D 3 103 ? 20.067 -5.495  67.381 1.00 57.39  ? 103  LEU B N     1 
ATOM   2429 C  CA    . LEU D 3 103 ? 21.059 -4.479  67.700 1.00 55.87  ? 103  LEU B CA    1 
ATOM   2430 C  C     . LEU D 3 103 ? 20.486 -3.185  68.251 1.00 57.01  ? 103  LEU B C     1 
ATOM   2431 O  O     . LEU D 3 103 ? 19.483 -2.669  67.752 1.00 58.33  ? 103  LEU B O     1 
ATOM   2432 C  CB    . LEU D 3 103 ? 21.918 -4.183  66.459 1.00 52.82  ? 103  LEU B CB    1 
ATOM   2433 C  CG    . LEU D 3 103 ? 23.272 -4.900  66.308 1.00 52.05  ? 103  LEU B CG    1 
ATOM   2434 C  CD1   . LEU D 3 103 ? 23.225 -6.298  66.905 1.00 51.67  ? 103  LEU B CD1   1 
ATOM   2435 C  CD2   . LEU D 3 103 ? 23.649 -4.955  64.840 1.00 46.70  ? 103  LEU B CD2   1 
ATOM   2436 N  N     . ARG D 3 104 ? 21.138 -2.674  69.290 1.00 54.76  ? 104  ARG B N     1 
ATOM   2437 C  CA    . ARG D 3 104 ? 20.739 -1.431  69.927 1.00 58.00  ? 104  ARG B CA    1 
ATOM   2438 C  C     . ARG D 3 104 ? 21.951 -0.538  70.069 1.00 58.16  ? 104  ARG B C     1 
ATOM   2439 O  O     . ARG D 3 104 ? 22.904 -0.872  70.774 1.00 58.43  ? 104  ARG B O     1 
ATOM   2440 C  CB    . ARG D 3 104 ? 20.146 -1.693  71.309 1.00 61.15  ? 104  ARG B CB    1 
ATOM   2441 C  CG    . ARG D 3 104 ? 18.693 -1.291  71.432 1.00 67.07  ? 104  ARG B CG    1 
ATOM   2442 C  CD    . ARG D 3 104 ? 17.849 -2.073  70.451 1.00 73.24  ? 104  ARG B CD    1 
ATOM   2443 N  NE    . ARG D 3 104 ? 16.434 -1.749  70.566 1.00 78.93  ? 104  ARG B NE    1 
ATOM   2444 C  CZ    . ARG D 3 104 ? 15.475 -2.373  69.890 1.00 81.49  ? 104  ARG B CZ    1 
ATOM   2445 N  NH1   . ARG D 3 104 ? 15.786 -3.355  69.051 1.00 83.13  ? 104  ARG B NH1   1 
ATOM   2446 N  NH2   . ARG D 3 104 ? 14.205 -2.022  70.056 1.00 83.38  ? 104  ARG B NH2   1 
ATOM   2447 N  N     . ALA D 3 105 ? 21.928 0.594   69.381 1.00 60.33  ? 105  ALA B N     1 
ATOM   2448 C  CA    . ALA D 3 105 ? 23.041 1.519   69.467 1.00 64.83  ? 105  ALA B CA    1 
ATOM   2449 C  C     . ALA D 3 105 ? 22.990 2.145   70.847 1.00 66.87  ? 105  ALA B C     1 
ATOM   2450 O  O     . ALA D 3 105 ? 21.912 2.435   71.369 1.00 67.99  ? 105  ALA B O     1 
ATOM   2451 C  CB    . ALA D 3 105 ? 22.924 2.596   68.397 1.00 61.37  ? 105  ALA B CB    1 
ATOM   2452 N  N     . MET D 3 106 ? 24.152 2.328   71.455 1.00 69.81  ? 106  MET B N     1 
ATOM   2453 C  CA    . MET D 3 106 ? 24.186 2.946   72.765 1.00 72.04  ? 106  MET B CA    1 
ATOM   2454 C  C     . MET D 3 106 ? 23.967 4.434   72.547 1.00 72.52  ? 106  MET B C     1 
ATOM   2455 O  O     . MET D 3 106 ? 23.953 4.901   71.406 1.00 70.10  ? 106  MET B O     1 
ATOM   2456 C  CB    . MET D 3 106 ? 25.525 2.683   73.449 1.00 74.01  ? 106  MET B CB    1 
ATOM   2457 C  CG    . MET D 3 106 ? 25.782 1.212   73.699 1.00 77.80  ? 106  MET B CG    1 
ATOM   2458 S  SD    . MET D 3 106 ? 27.320 0.897   74.562 1.00 84.14  ? 106  MET B SD    1 
ATOM   2459 C  CE    . MET D 3 106 ? 26.745 0.899   76.265 1.00 83.53  ? 106  MET B CE    1 
ATOM   2460 N  N     . GLU D 3 107 ? 23.788 5.169   73.639 1.00 74.34  ? 107  GLU B N     1 
ATOM   2461 C  CA    . GLU D 3 107 ? 23.540 6.602   73.578 1.00 72.46  ? 107  GLU B CA    1 
ATOM   2462 C  C     . GLU D 3 107 ? 24.763 7.429   73.203 1.00 70.62  ? 107  GLU B C     1 
ATOM   2463 O  O     . GLU D 3 107 ? 24.626 8.522   72.657 1.00 70.70  ? 107  GLU B O     1 
ATOM   2464 C  CB    . GLU D 3 107 ? 22.994 7.078   74.921 1.00 75.20  ? 107  GLU B CB    1 
ATOM   2465 C  CG    . GLU D 3 107 ? 21.776 6.302   75.384 1.00 78.94  ? 107  GLU B CG    1 
ATOM   2466 C  CD    . GLU D 3 107 ? 21.407 6.601   76.822 1.00 82.24  ? 107  GLU B CD    1 
ATOM   2467 O  OE1   . GLU D 3 107 ? 21.104 7.774   77.133 1.00 84.23  ? 107  GLU B OE1   1 
ATOM   2468 O  OE2   . GLU D 3 107 ? 21.419 5.659   77.643 1.00 83.04  ? 107  GLU B OE2   1 
ATOM   2469 N  N     . LEU D 3 108 ? 25.956 6.913   73.482 1.00 68.90  ? 108  LEU B N     1 
ATOM   2470 C  CA    . LEU D 3 108 ? 27.180 7.648   73.175 1.00 68.06  ? 108  LEU B CA    1 
ATOM   2471 C  C     . LEU D 3 108 ? 27.469 7.663   71.679 1.00 67.46  ? 108  LEU B C     1 
ATOM   2472 O  O     . LEU D 3 108 ? 28.260 8.479   71.198 1.00 65.25  ? 108  LEU B O     1 
ATOM   2473 C  CB    . LEU D 3 108 ? 28.372 7.039   73.916 1.00 71.37  ? 108  LEU B CB    1 
ATOM   2474 C  CG    . LEU D 3 108 ? 29.037 5.798   73.310 1.00 72.71  ? 108  LEU B CG    1 
ATOM   2475 C  CD1   . LEU D 3 108 ? 30.173 5.341   74.208 1.00 73.51  ? 108  LEU B CD1   1 
ATOM   2476 C  CD2   . LEU D 3 108 ? 28.019 4.689   73.145 1.00 74.63  ? 108  LEU B CD2   1 
ATOM   2477 N  N     . CYS D 3 109 ? 26.824 6.754   70.951 1.00 65.70  ? 109  CYS B N     1 
ATOM   2478 C  CA    . CYS D 3 109 ? 27.001 6.643   69.504 1.00 62.18  ? 109  CYS B CA    1 
ATOM   2479 C  C     . CYS D 3 109 ? 26.207 7.743   68.796 1.00 63.97  ? 109  CYS B C     1 
ATOM   2480 O  O     . CYS D 3 109 ? 24.981 7.793   68.895 1.00 64.48  ? 109  CYS B O     1 
ATOM   2481 C  CB    . CYS D 3 109 ? 26.536 5.255   69.031 1.00 59.28  ? 109  CYS B CB    1 
ATOM   2482 S  SG    . CYS D 3 109 ? 26.923 4.838   67.307 1.00 43.46  ? 109  CYS B SG    1 
ATOM   2483 N  N     . GLU D 3 110 ? 26.910 8.626   68.090 1.00 64.66  ? 110  GLU B N     1 
ATOM   2484 C  CA    . GLU D 3 110 ? 26.259 9.728   67.383 1.00 66.53  ? 110  GLU B CA    1 
ATOM   2485 C  C     . GLU D 3 110 ? 25.761 9.374   65.988 1.00 64.73  ? 110  GLU B C     1 
ATOM   2486 O  O     . GLU D 3 110 ? 24.758 9.918   65.522 1.00 64.82  ? 110  GLU B O     1 
ATOM   2487 C  CB    . GLU D 3 110 ? 27.202 10.931  67.261 1.00 70.35  ? 110  GLU B CB    1 
ATOM   2488 C  CG    . GLU D 3 110 ? 27.160 11.906  68.424 1.00 74.66  ? 110  GLU B CG    1 
ATOM   2489 C  CD    . GLU D 3 110 ? 27.611 13.298  68.013 1.00 76.44  ? 110  GLU B CD    1 
ATOM   2490 O  OE1   . GLU D 3 110 ? 28.716 13.423  67.446 1.00 77.45  ? 110  GLU B OE1   1 
ATOM   2491 O  OE2   . GLU D 3 110 ? 26.859 14.265  68.256 1.00 77.21  ? 110  GLU B OE2   1 
ATOM   2492 N  N     . PHE D 3 111 ? 26.462 8.473   65.314 1.00 61.93  ? 111  PHE B N     1 
ATOM   2493 C  CA    . PHE D 3 111 ? 26.063 8.100   63.971 1.00 59.19  ? 111  PHE B CA    1 
ATOM   2494 C  C     . PHE D 3 111 ? 25.427 6.724   63.883 1.00 55.98  ? 111  PHE B C     1 
ATOM   2495 O  O     . PHE D 3 111 ? 25.627 6.002   62.913 1.00 54.78  ? 111  PHE B O     1 
ATOM   2496 C  CB    . PHE D 3 111 ? 27.264 8.185   63.036 1.00 60.78  ? 111  PHE B CB    1 
ATOM   2497 C  CG    . PHE D 3 111 ? 27.948 9.519   63.061 1.00 63.88  ? 111  PHE B CG    1 
ATOM   2498 C  CD1   . PHE D 3 111 ? 29.033 9.742   63.899 1.00 63.74  ? 111  PHE B CD1   1 
ATOM   2499 C  CD2   . PHE D 3 111 ? 27.498 10.560  62.253 1.00 65.56  ? 111  PHE B CD2   1 
ATOM   2500 C  CE1   . PHE D 3 111 ? 29.664 10.984  63.932 1.00 66.64  ? 111  PHE B CE1   1 
ATOM   2501 C  CE2   . PHE D 3 111 ? 28.121 11.806  62.280 1.00 65.42  ? 111  PHE B CE2   1 
ATOM   2502 C  CZ    . PHE D 3 111 ? 29.206 12.018  63.120 1.00 65.03  ? 111  PHE B CZ    1 
ATOM   2503 N  N     . ALA D 3 112 ? 24.657 6.366   64.902 1.00 55.22  ? 112  ALA B N     1 
ATOM   2504 C  CA    . ALA D 3 112 ? 23.985 5.082   64.911 1.00 57.05  ? 112  ALA B CA    1 
ATOM   2505 C  C     . ALA D 3 112 ? 23.183 4.953   63.620 1.00 59.33  ? 112  ALA B C     1 
ATOM   2506 O  O     . ALA D 3 112 ? 22.641 5.934   63.099 1.00 58.14  ? 112  ALA B O     1 
ATOM   2507 C  CB    . ALA D 3 112 ? 23.061 4.976   66.115 1.00 54.05  ? 112  ALA B CB    1 
ATOM   2508 N  N     . PHE D 3 113 ? 23.129 3.736   63.101 1.00 60.86  ? 113  PHE B N     1 
ATOM   2509 C  CA    . PHE D 3 113 ? 22.400 3.456   61.878 1.00 63.52  ? 113  PHE B CA    1 
ATOM   2510 C  C     . PHE D 3 113 ? 20.946 3.900   62.041 1.00 66.07  ? 113  PHE B C     1 
ATOM   2511 O  O     . PHE D 3 113 ? 20.326 4.397   61.105 1.00 68.65  ? 113  PHE B O     1 
ATOM   2512 C  CB    . PHE D 3 113 ? 22.453 1.956   61.598 1.00 58.99  ? 113  PHE B CB    1 
ATOM   2513 C  CG    . PHE D 3 113 ? 21.733 1.548   60.352 1.00 56.44  ? 113  PHE B CG    1 
ATOM   2514 C  CD1   . PHE D 3 113 ? 22.332 1.697   59.108 1.00 55.61  ? 113  PHE B CD1   1 
ATOM   2515 C  CD2   . PHE D 3 113 ? 20.453 1.010   60.423 1.00 54.58  ? 113  PHE B CD2   1 
ATOM   2516 C  CE1   . PHE D 3 113 ? 21.660 1.325   57.946 1.00 57.77  ? 113  PHE B CE1   1 
ATOM   2517 C  CE2   . PHE D 3 113 ? 19.772 0.636   59.268 1.00 53.94  ? 113  PHE B CE2   1 
ATOM   2518 C  CZ    . PHE D 3 113 ? 20.378 0.789   58.028 1.00 53.76  ? 113  PHE B CZ    1 
ATOM   2519 N  N     . ASN D 3 114 ? 20.424 3.728   63.250 1.00 70.29  ? 114  ASN B N     1 
ATOM   2520 C  CA    . ASN D 3 114 ? 19.042 4.068   63.573 1.00 72.04  ? 114  ASN B CA    1 
ATOM   2521 C  C     . ASN D 3 114 ? 18.694 5.552   63.471 1.00 72.19  ? 114  ASN B C     1 
ATOM   2522 O  O     . ASN D 3 114 ? 17.522 5.918   63.494 1.00 70.97  ? 114  ASN B O     1 
ATOM   2523 C  CB    . ASN D 3 114 ? 18.719 3.569   64.984 1.00 75.55  ? 114  ASN B CB    1 
ATOM   2524 C  CG    . ASN D 3 114 ? 17.261 3.189   65.148 1.00 79.42  ? 114  ASN B CG    1 
ATOM   2525 O  OD1   . ASN D 3 114 ? 16.748 2.340   64.418 1.00 81.07  ? 114  ASN B OD1   1 
ATOM   2526 N  ND2   . ASN D 3 114 ? 16.585 3.811   66.112 1.00 79.15  ? 114  ASN B ND2   1 
ATOM   2527 N  N     . MET D 3 115 ? 19.703 6.407   63.357 1.00 74.91  ? 115  MET B N     1 
ATOM   2528 C  CA    . MET D 3 115 ? 19.461 7.842   63.270 1.00 76.51  ? 115  MET B CA    1 
ATOM   2529 C  C     . MET D 3 115 ? 19.272 8.346   61.850 1.00 77.20  ? 115  MET B C     1 
ATOM   2530 O  O     . MET D 3 115 ? 18.774 9.450   61.638 1.00 77.36  ? 115  MET B O     1 
ATOM   2531 C  CB    . MET D 3 115 ? 20.600 8.608   63.936 1.00 79.18  ? 115  MET B CB    1 
ATOM   2532 C  CG    . MET D 3 115 ? 20.572 8.548   65.449 1.00 81.61  ? 115  MET B CG    1 
ATOM   2533 S  SD    . MET D 3 115 ? 21.924 9.485   66.177 1.00 86.47  ? 115  MET B SD    1 
ATOM   2534 C  CE    . MET D 3 115 ? 22.876 8.173   66.908 1.00 85.13  ? 115  MET B CE    1 
ATOM   2535 N  N     . LYS D 3 116 ? 19.679 7.541   60.877 1.00 78.78  ? 116  LYS B N     1 
ATOM   2536 C  CA    . LYS D 3 116 ? 19.531 7.906   59.471 1.00 80.15  ? 116  LYS B CA    1 
ATOM   2537 C  C     . LYS D 3 116 ? 20.324 9.133   59.024 1.00 78.81  ? 116  LYS B C     1 
ATOM   2538 O  O     . LYS D 3 116 ? 19.853 9.898   58.182 1.00 78.51  ? 116  LYS B O     1 
ATOM   2539 C  CB    . LYS D 3 116 ? 18.048 8.125   59.133 1.00 80.53  ? 116  LYS B CB    1 
ATOM   2540 C  CG    . LYS D 3 116 ? 17.200 6.858   59.126 1.00 81.90  ? 116  LYS B CG    1 
ATOM   2541 C  CD    . LYS D 3 116 ? 15.760 7.158   58.724 1.00 81.53  ? 116  LYS B CD    1 
ATOM   2542 C  CE    . LYS D 3 116 ? 14.919 5.890   58.688 1.00 82.23  ? 116  LYS B CE    1 
ATOM   2543 N  NZ    . LYS D 3 116 ? 13.492 6.163   58.356 1.00 81.15  ? 116  LYS B NZ    1 
ATOM   2544 N  N     . LYS D 3 117 ? 21.520 9.329   59.571 1.00 76.99  ? 117  LYS B N     1 
ATOM   2545 C  CA    . LYS D 3 117 ? 22.327 10.475  59.162 1.00 76.25  ? 117  LYS B CA    1 
ATOM   2546 C  C     . LYS D 3 117 ? 22.991 10.180  57.819 1.00 74.36  ? 117  LYS B C     1 
ATOM   2547 O  O     . LYS D 3 117 ? 22.608 9.233   57.132 1.00 75.61  ? 117  LYS B O     1 
ATOM   2548 C  CB    . LYS D 3 117 ? 23.383 10.804  60.223 1.00 76.70  ? 117  LYS B CB    1 
ATOM   2549 C  CG    . LYS D 3 117 ? 22.787 11.332  61.525 1.00 79.47  ? 117  LYS B CG    1 
ATOM   2550 C  CD    . LYS D 3 117 ? 23.833 11.983  62.421 1.00 80.48  ? 117  LYS B CD    1 
ATOM   2551 C  CE    . LYS D 3 117 ? 23.189 12.599  63.660 1.00 81.25  ? 117  LYS B CE    1 
ATOM   2552 N  NZ    . LYS D 3 117 ? 24.178 13.287  64.542 1.00 81.41  ? 117  LYS B NZ    1 
ATOM   2553 N  N     . ASP D 3 118 ? 23.967 10.995  57.433 1.00 71.23  ? 118  ASP B N     1 
ATOM   2554 C  CA    . ASP D 3 118 ? 24.665 10.792  56.168 1.00 69.38  ? 118  ASP B CA    1 
ATOM   2555 C  C     . ASP D 3 118 ? 25.816 9.816   56.355 1.00 66.45  ? 118  ASP B C     1 
ATOM   2556 O  O     . ASP D 3 118 ? 26.359 9.272   55.388 1.00 62.54  ? 118  ASP B O     1 
ATOM   2557 C  CB    . ASP D 3 118 ? 25.189 12.127  55.632 1.00 73.40  ? 118  ASP B CB    1 
ATOM   2558 C  CG    . ASP D 3 118 ? 24.087 12.984  55.030 1.00 77.76  ? 118  ASP B CG    1 
ATOM   2559 O  OD1   . ASP D 3 118 ? 23.072 13.231  55.721 1.00 78.99  ? 118  ASP B OD1   1 
ATOM   2560 O  OD2   . ASP D 3 118 ? 24.238 13.411  53.864 1.00 78.59  ? 118  ASP B OD2   1 
ATOM   2561 N  N     . GLU D 3 119 ? 26.177 9.601   57.614 1.00 60.79  ? 119  GLU B N     1 
ATOM   2562 C  CA    . GLU D 3 119 ? 27.254 8.695   57.969 1.00 56.86  ? 119  GLU B CA    1 
ATOM   2563 C  C     . GLU D 3 119 ? 26.703 7.628   58.913 1.00 52.24  ? 119  GLU B C     1 
ATOM   2564 O  O     . GLU D 3 119 ? 25.807 7.904   59.714 1.00 48.24  ? 119  GLU B O     1 
ATOM   2565 C  CB    . GLU D 3 119 ? 28.370 9.469   58.666 1.00 61.06  ? 119  GLU B CB    1 
ATOM   2566 C  CG    . GLU D 3 119 ? 28.996 10.578  57.836 1.00 69.56  ? 119  GLU B CG    1 
ATOM   2567 C  CD    . GLU D 3 119 ? 29.850 10.063  56.688 1.00 74.66  ? 119  GLU B CD    1 
ATOM   2568 O  OE1   . GLU D 3 119 ? 30.886 9.417   56.953 1.00 76.96  ? 119  GLU B OE1   1 
ATOM   2569 O  OE2   . GLU D 3 119 ? 29.488 10.307  55.513 1.00 79.48  ? 119  GLU B OE2   1 
ATOM   2570 N  N     . VAL D 3 120 ? 27.212 6.405   58.801 1.00 46.60  ? 120  VAL B N     1 
ATOM   2571 C  CA    . VAL D 3 120 ? 26.771 5.334   59.688 1.00 43.56  ? 120  VAL B CA    1 
ATOM   2572 C  C     . VAL D 3 120 ? 27.961 4.833   60.495 1.00 40.32  ? 120  VAL B C     1 
ATOM   2573 O  O     . VAL D 3 120 ? 29.063 4.677   59.964 1.00 39.60  ? 120  VAL B O     1 
ATOM   2574 C  CB    . VAL D 3 120 ? 26.155 4.141   58.914 1.00 41.35  ? 120  VAL B CB    1 
ATOM   2575 C  CG1   . VAL D 3 120 ? 25.778 3.017   59.888 1.00 38.66  ? 120  VAL B CG1   1 
ATOM   2576 C  CG2   . VAL D 3 120 ? 24.919 4.592   58.194 1.00 46.28  ? 120  VAL B CG2   1 
ATOM   2577 N  N     . CYS D 3 121 ? 27.739 4.597   61.781 1.00 39.90  ? 121  CYS B N     1 
ATOM   2578 C  CA    . CYS D 3 121 ? 28.800 4.109   62.648 1.00 40.74  ? 121  CYS B CA    1 
ATOM   2579 C  C     . CYS D 3 121 ? 28.822 2.595   62.672 1.00 35.98  ? 121  CYS B C     1 
ATOM   2580 O  O     . CYS D 3 121 ? 27.801 1.942   62.917 1.00 38.81  ? 121  CYS B O     1 
ATOM   2581 C  CB    . CYS D 3 121 ? 28.633 4.615   64.086 1.00 38.72  ? 121  CYS B CB    1 
ATOM   2582 S  SG    . CYS D 3 121 ? 29.882 3.896   65.207 1.00 48.28  ? 121  CYS B SG    1 
ATOM   2583 N  N     . VAL D 3 122 ? 30.003 2.040   62.445 1.00 36.23  ? 122  VAL B N     1 
ATOM   2584 C  CA    . VAL D 3 122 ? 30.168 0.601   62.435 1.00 36.10  ? 122  VAL B CA    1 
ATOM   2585 C  C     . VAL D 3 122 ? 31.117 0.101   63.512 1.00 38.16  ? 122  VAL B C     1 
ATOM   2586 O  O     . VAL D 3 122 ? 31.598 -1.027  63.434 1.00 37.92  ? 122  VAL B O     1 
ATOM   2587 C  CB    . VAL D 3 122 ? 30.652 0.129   61.068 1.00 33.32  ? 122  VAL B CB    1 
ATOM   2588 C  CG1   . VAL D 3 122 ? 29.530 0.316   60.038 1.00 38.18  ? 122  VAL B CG1   1 
ATOM   2589 C  CG2   . VAL D 3 122 ? 31.884 0.917   60.663 1.00 39.15  ? 122  VAL B CG2   1 
ATOM   2590 N  N     . ASN D 3 123 ? 31.400 0.948   64.504 1.00 40.28  ? 123  ASN B N     1 
ATOM   2591 C  CA    . ASN D 3 123 ? 32.252 0.555   65.619 1.00 35.95  ? 123  ASN B CA    1 
ATOM   2592 C  C     . ASN D 3 123 ? 31.461 -0.579  66.256 1.00 36.41  ? 123  ASN B C     1 
ATOM   2593 O  O     . ASN D 3 123 ? 30.379 -0.355  66.802 1.00 31.61  ? 123  ASN B O     1 
ATOM   2594 C  CB    . ASN D 3 123 ? 32.394 1.698   66.625 1.00 43.68  ? 123  ASN B CB    1 
ATOM   2595 C  CG    . ASN D 3 123 ? 33.312 1.345   67.795 1.00 48.16  ? 123  ASN B CG    1 
ATOM   2596 O  OD1   . ASN D 3 123 ? 33.217 0.260   68.383 1.00 46.78  ? 123  ASN B OD1   1 
ATOM   2597 N  ND2   . ASN D 3 123 ? 34.194 2.272   68.148 1.00 48.94  ? 123  ASN B ND2   1 
ATOM   2598 N  N     . PRO D 3 124 ? 31.985 -1.814  66.198 1.00 38.15  ? 124  PRO B N     1 
ATOM   2599 C  CA    . PRO D 3 124 ? 31.232 -2.919  66.796 1.00 37.65  ? 124  PRO B CA    1 
ATOM   2600 C  C     . PRO D 3 124 ? 30.964 -2.780  68.293 1.00 43.02  ? 124  PRO B C     1 
ATOM   2601 O  O     . PRO D 3 124 ? 30.080 -3.451  68.840 1.00 42.26  ? 124  PRO B O     1 
ATOM   2602 C  CB    . PRO D 3 124 ? 32.064 -4.154  66.427 1.00 35.86  ? 124  PRO B CB    1 
ATOM   2603 C  CG    . PRO D 3 124 ? 33.465 -3.612  66.351 1.00 42.55  ? 124  PRO B CG    1 
ATOM   2604 C  CD    . PRO D 3 124 ? 33.291 -2.266  65.674 1.00 34.77  ? 124  PRO B CD    1 
ATOM   2605 N  N     . TYR D 3 125 ? 31.696 -1.894  68.958 1.00 45.34  ? 125  TYR B N     1 
ATOM   2606 C  CA    . TYR D 3 125 ? 31.479 -1.712  70.385 1.00 49.79  ? 125  TYR B CA    1 
ATOM   2607 C  C     . TYR D 3 125 ? 30.537 -0.564  70.738 1.00 53.52  ? 125  TYR B C     1 
ATOM   2608 O  O     . TYR D 3 125 ? 30.474 -0.133  71.894 1.00 56.38  ? 125  TYR B O     1 
ATOM   2609 C  CB    . TYR D 3 125 ? 32.829 -1.591  71.115 1.00 48.49  ? 125  TYR B CB    1 
ATOM   2610 C  CG    . TYR D 3 125 ? 33.519 -2.939  71.153 1.00 46.11  ? 125  TYR B CG    1 
ATOM   2611 C  CD1   . TYR D 3 125 ? 34.542 -3.260  70.256 1.00 45.44  ? 125  TYR B CD1   1 
ATOM   2612 C  CD2   . TYR D 3 125 ? 33.025 -3.952  71.971 1.00 43.98  ? 125  TYR B CD2   1 
ATOM   2613 C  CE1   . TYR D 3 125 ? 35.037 -4.563  70.165 1.00 41.72  ? 125  TYR B CE1   1 
ATOM   2614 C  CE2   . TYR D 3 125 ? 33.508 -5.246  71.888 1.00 45.96  ? 125  TYR B CE2   1 
ATOM   2615 C  CZ    . TYR D 3 125 ? 34.506 -5.551  70.982 1.00 44.25  ? 125  TYR B CZ    1 
ATOM   2616 O  OH    . TYR D 3 125 ? 34.914 -6.863  70.868 1.00 44.94  ? 125  TYR B OH    1 
ATOM   2617 N  N     . HIS D 3 126 ? 29.788 -0.086  69.745 1.00 49.71  ? 126  HIS B N     1 
ATOM   2618 C  CA    . HIS D 3 126 ? 28.824 0.983   69.975 1.00 49.00  ? 126  HIS B CA    1 
ATOM   2619 C  C     . HIS D 3 126 ? 27.406 0.447   69.983 1.00 50.82  ? 126  HIS B C     1 
ATOM   2620 O  O     . HIS D 3 126 ? 26.440 1.212   70.122 1.00 52.98  ? 126  HIS B O     1 
ATOM   2621 C  CB    . HIS D 3 126 ? 28.960 2.079   68.920 1.00 45.68  ? 126  HIS B CB    1 
ATOM   2622 C  CG    . HIS D 3 126 ? 30.057 3.049   69.220 1.00 49.79  ? 126  HIS B CG    1 
ATOM   2623 N  ND1   . HIS D 3 126 ? 30.325 4.145   68.429 1.00 49.75  ? 126  HIS B ND1   1 
ATOM   2624 C  CD2   . HIS D 3 126 ? 30.949 3.092   70.238 1.00 46.14  ? 126  HIS B CD2   1 
ATOM   2625 C  CE1   . HIS D 3 126 ? 31.334 4.823   68.948 1.00 46.83  ? 126  HIS B CE1   1 
ATOM   2626 N  NE2   . HIS D 3 126 ? 31.730 4.205   70.046 1.00 49.88  ? 126  HIS B NE2   1 
ATOM   2627 N  N     . TYR D 3 127 ? 27.284 -0.870  69.840 1.00 47.82  ? 127  TYR B N     1 
ATOM   2628 C  CA    . TYR D 3 127 ? 25.981 -1.518  69.835 1.00 48.83  ? 127  TYR B CA    1 
ATOM   2629 C  C     . TYR D 3 127 ? 25.957 -2.667  70.837 1.00 49.45  ? 127  TYR B C     1 
ATOM   2630 O  O     . TYR D 3 127 ? 26.975 -3.325  71.073 1.00 45.65  ? 127  TYR B O     1 
ATOM   2631 C  CB    . TYR D 3 127 ? 25.644 -2.088  68.441 1.00 48.17  ? 127  TYR B CB    1 
ATOM   2632 C  CG    . TYR D 3 127 ? 25.582 -1.079  67.306 1.00 47.23  ? 127  TYR B CG    1 
ATOM   2633 C  CD1   . TYR D 3 127 ? 26.750 -0.616  66.685 1.00 44.38  ? 127  TYR B CD1   1 
ATOM   2634 C  CD2   . TYR D 3 127 ? 24.353 -0.584  66.858 1.00 44.65  ? 127  TYR B CD2   1 
ATOM   2635 C  CE1   . TYR D 3 127 ? 26.694 0.316   65.650 1.00 41.57  ? 127  TYR B CE1   1 
ATOM   2636 C  CE2   . TYR D 3 127 ? 24.284 0.350   65.825 1.00 42.21  ? 127  TYR B CE2   1 
ATOM   2637 C  CZ    . TYR D 3 127 ? 25.457 0.797   65.228 1.00 42.74  ? 127  TYR B CZ    1 
ATOM   2638 O  OH    . TYR D 3 127 ? 25.395 1.752   64.240 1.00 40.79  ? 127  TYR B OH    1 
ATOM   2639 N  N     . GLN D 3 128 ? 24.789 -2.904  71.425 1.00 50.39  ? 128  GLN B N     1 
ATOM   2640 C  CA    . GLN D 3 128 ? 24.629 -4.008  72.356 1.00 51.74  ? 128  GLN B CA    1 
ATOM   2641 C  C     . GLN D 3 128 ? 23.626 -4.927  71.670 1.00 51.46  ? 128  GLN B C     1 
ATOM   2642 O  O     . GLN D 3 128 ? 22.818 -4.473  70.861 1.00 47.57  ? 128  GLN B O     1 
ATOM   2643 C  CB    . GLN D 3 128 ? 24.067 -3.534  73.703 1.00 55.59  ? 128  GLN B CB    1 
ATOM   2644 C  CG    . GLN D 3 128 ? 24.144 -2.035  73.939 1.00 60.94  ? 128  GLN B CG    1 
ATOM   2645 C  CD    . GLN D 3 128 ? 23.491 -1.622  75.249 1.00 65.24  ? 128  GLN B CD    1 
ATOM   2646 O  OE1   . GLN D 3 128 ? 22.356 -2.007  75.536 1.00 66.46  ? 128  GLN B OE1   1 
ATOM   2647 N  NE2   . GLN D 3 128 ? 24.202 -0.828  76.046 1.00 63.76  ? 128  GLN B NE2   1 
ATOM   2648 N  N     . ARG D 3 129 ? 23.685 -6.215  71.976 1.00 52.99  ? 129  ARG B N     1 
ATOM   2649 C  CA    . ARG D 3 129 ? 22.763 -7.162  71.374 1.00 56.04  ? 129  ARG B CA    1 
ATOM   2650 C  C     . ARG D 3 129 ? 21.557 -7.401  72.279 1.00 59.30  ? 129  ARG B C     1 
ATOM   2651 O  O     . ARG D 3 129 ? 21.703 -7.766  73.445 1.00 59.18  ? 129  ARG B O     1 
ATOM   2652 C  CB    . ARG D 3 129 ? 23.474 -8.483  71.105 1.00 55.20  ? 129  ARG B CB    1 
ATOM   2653 C  CG    . ARG D 3 129 ? 22.617 -9.481  70.379 1.00 54.30  ? 129  ARG B CG    1 
ATOM   2654 C  CD    . ARG D 3 129 ? 23.359 -10.768 70.195 1.00 55.07  ? 129  ARG B CD    1 
ATOM   2655 N  NE    . ARG D 3 129 ? 22.620 -11.695 69.350 1.00 56.86  ? 129  ARG B NE    1 
ATOM   2656 C  CZ    . ARG D 3 129 ? 23.088 -12.878 68.971 1.00 56.65  ? 129  ARG B CZ    1 
ATOM   2657 N  NH1   . ARG D 3 129 ? 24.289 -13.271 69.371 1.00 56.24  ? 129  ARG B NH1   1 
ATOM   2658 N  NH2   . ARG D 3 129 ? 22.367 -13.656 68.178 1.00 57.69  ? 129  ARG B NH2   1 
ATOM   2659 N  N     . VAL D 3 130 ? 20.364 -7.198  71.736 1.00 63.41  ? 130  VAL B N     1 
ATOM   2660 C  CA    . VAL D 3 130 ? 19.141 -7.391  72.499 1.00 69.75  ? 130  VAL B CA    1 
ATOM   2661 C  C     . VAL D 3 130 ? 18.626 -8.814  72.375 1.00 74.44  ? 130  VAL B C     1 
ATOM   2662 O  O     . VAL D 3 130 ? 18.562 -9.376  71.281 1.00 74.93  ? 130  VAL B O     1 
ATOM   2663 C  CB    . VAL D 3 130 ? 18.039 -6.440  72.028 1.00 68.83  ? 130  VAL B CB    1 
ATOM   2664 C  CG1   . VAL D 3 130 ? 16.815 -6.603  72.900 1.00 70.06  ? 130  VAL B CG1   1 
ATOM   2665 C  CG2   . VAL D 3 130 ? 18.541 -5.010  72.073 1.00 71.35  ? 130  VAL B CG2   1 
ATOM   2666 N  N     . GLU D 3 131 ? 18.254 -9.391  73.509 1.00 81.29  ? 131  GLU B N     1 
ATOM   2667 C  CA    . GLU D 3 131 ? 17.737 -10.750 73.547 1.00 88.42  ? 131  GLU B CA    1 
ATOM   2668 C  C     . GLU D 3 131 ? 16.314 -10.726 73.002 1.00 90.96  ? 131  GLU B C     1 
ATOM   2669 O  O     . GLU D 3 131 ? 15.520 -11.626 73.274 1.00 92.21  ? 131  GLU B O     1 
ATOM   2670 C  CB    . GLU D 3 131 ? 17.735 -11.262 74.989 1.00 91.78  ? 131  GLU B CB    1 
ATOM   2671 C  CG    . GLU D 3 131 ? 17.629 -12.770 75.140 1.00 95.72  ? 131  GLU B CG    1 
ATOM   2672 C  CD    . GLU D 3 131 ? 18.897 -13.499 74.738 1.00 97.96  ? 131  GLU B CD    1 
ATOM   2673 O  OE1   . GLU D 3 131 ? 18.995 -14.713 75.021 1.00 99.59  ? 131  GLU B OE1   1 
ATOM   2674 O  OE2   . GLU D 3 131 ? 19.792 -12.864 74.137 1.00 98.81  ? 131  GLU B OE2   1 
ATOM   2675 N  N     . THR D 3 132 ? 16.013 -9.682  72.229 1.00 94.61  ? 132  THR B N     1 
ATOM   2676 C  CA    . THR D 3 132 ? 14.699 -9.474  71.619 1.00 96.77  ? 132  THR B CA    1 
ATOM   2677 C  C     . THR D 3 132 ? 13.557 -10.007 72.479 1.00 98.69  ? 132  THR B C     1 
ATOM   2678 O  O     . THR D 3 132 ? 12.723 -10.779 71.956 1.00 99.51  ? 132  THR B O     1 
ATOM   2679 C  CB    . THR D 3 132 ? 14.620 -10.120 70.210 1.00 97.21  ? 132  THR B CB    1 
ATOM   2680 O  OG1   . THR D 3 132 ? 13.296 -9.960  69.682 1.00 96.08  ? 132  THR B OG1   1 
ATOM   2681 C  CG2   . THR D 3 132 ? 14.971 -11.603 70.272 1.00 96.77  ? 132  THR B CG2   1 
HETATM 2682 ZN ZN    . ZN  E 4 .   ? 21.082 0.322   11.682 1.00 45.47  ? 145  ZN  A ZN    1 
HETATM 2683 ZN ZN    . ZN  F 4 .   ? 29.171 5.186   67.126 1.00 53.62  ? 145  ZN  B ZN    1 
HETATM 2684 O  O     . HOH G 5 .   ? 29.520 3.901   31.337 1.00 35.10  ? 8    HOH C O     1 
HETATM 2685 O  O     . HOH G 5 .   ? 39.266 -0.029  40.525 1.00 44.97  ? 15   HOH C O     1 
HETATM 2686 O  O     . HOH G 5 .   ? 23.383 -11.642 46.886 1.00 46.99  ? 21   HOH C O     1 
HETATM 2687 O  O     . HOH G 5 .   ? 38.660 4.799   32.361 1.00 34.00  ? 23   HOH C O     1 
HETATM 2688 O  O     . HOH G 5 .   ? 26.055 3.035   37.993 1.00 59.08  ? 26   HOH C O     1 
HETATM 2689 O  O     . HOH G 5 .   ? 22.312 -10.332 49.593 1.00 55.58  ? 27   HOH C O     1 
HETATM 2690 O  O     . HOH G 5 .   ? 22.569 -6.181  29.917 1.00 30.62  ? 34   HOH C O     1 
HETATM 2691 O  O     . HOH G 5 .   ? 28.736 -1.663  30.745 1.00 20.69  ? 35   HOH C O     1 
HETATM 2692 O  O     . HOH G 5 .   ? 24.441 -8.264  43.502 1.00 35.74  ? 38   HOH C O     1 
HETATM 2693 O  O     . HOH G 5 .   ? 26.405 -7.502  41.837 1.00 27.95  ? 41   HOH C O     1 
HETATM 2694 O  O     . HOH H 5 .   ? 32.163 -3.252  49.562 1.00 28.57  ? 1    HOH D O     1 
HETATM 2695 O  O     . HOH H 5 .   ? 30.912 -5.666  44.576 1.00 51.56  ? 2    HOH D O     1 
HETATM 2696 O  O     . HOH H 5 .   ? 43.766 -2.762  28.886 1.00 43.02  ? 4    HOH D O     1 
HETATM 2697 O  O     . HOH H 5 .   ? 12.609 0.748   34.281 1.00 56.16  ? 6    HOH D O     1 
HETATM 2698 O  O     . HOH H 5 .   ? 31.575 -0.336  49.348 1.00 29.68  ? 9    HOH D O     1 
HETATM 2699 O  O     . HOH H 5 .   ? 21.321 3.018   47.510 1.00 35.48  ? 10   HOH D O     1 
HETATM 2700 O  O     . HOH H 5 .   ? 3.804  -7.856  49.519 1.00 60.56  ? 11   HOH D O     1 
HETATM 2701 O  O     . HOH H 5 .   ? 24.407 2.794   41.315 1.00 41.22  ? 14   HOH D O     1 
HETATM 2702 O  O     . HOH H 5 .   ? 31.892 -6.881  36.096 1.00 39.56  ? 18   HOH D O     1 
HETATM 2703 O  O     . HOH H 5 .   ? 32.988 -7.874  43.172 1.00 45.06  ? 19   HOH D O     1 
HETATM 2704 O  O     . HOH H 5 .   ? 34.979 -3.989  24.939 1.00 49.16  ? 20   HOH D O     1 
HETATM 2705 O  O     . HOH H 5 .   ? 16.126 7.255   39.703 1.00 55.72  ? 31   HOH D O     1 
HETATM 2706 O  O     . HOH H 5 .   ? 29.688 -6.610  37.702 1.00 23.36  ? 33   HOH D O     1 
HETATM 2707 O  O     . HOH H 5 .   ? 24.492 -1.697  48.687 1.00 27.38  ? 37   HOH D O     1 
HETATM 2708 O  O     . HOH H 5 .   ? 23.064 2.359   39.222 1.00 40.83  ? 46   HOH D O     1 
HETATM 2709 O  O     . HOH I 5 .   ? 29.074 1.424   30.390 1.00 31.32  ? 146  HOH A O     1 
HETATM 2710 O  O     . HOH I 5 .   ? 31.699 0.843   3.646  1.00 56.11  ? 147  HOH A O     1 
HETATM 2711 O  O     . HOH I 5 .   ? 15.865 -21.752 21.821 1.00 58.89  ? 148  HOH A O     1 
HETATM 2712 O  O     . HOH I 5 .   ? 10.441 -3.885  29.343 1.00 58.21  ? 149  HOH A O     1 
HETATM 2713 O  O     . HOH I 5 .   ? 26.596 1.536   24.829 1.00 45.78  ? 150  HOH A O     1 
HETATM 2714 O  O     . HOH I 5 .   ? 25.367 5.815   17.126 1.00 49.88  ? 151  HOH A O     1 
HETATM 2715 O  O     . HOH I 5 .   ? 27.002 -17.278 18.678 1.00 40.72  ? 152  HOH A O     1 
HETATM 2716 O  O     . HOH I 5 .   ? 15.692 2.789   10.622 1.00 55.19  ? 153  HOH A O     1 
HETATM 2717 O  O     . HOH I 5 .   ? 19.857 -10.136 31.570 1.00 39.61  ? 154  HOH A O     1 
HETATM 2718 O  O     . HOH I 5 .   ? 20.927 -5.410  25.974 1.00 35.39  ? 155  HOH A O     1 
HETATM 2719 O  O     . HOH I 5 .   ? 34.399 -8.123  31.268 1.00 40.15  ? 156  HOH A O     1 
HETATM 2720 O  O     . HOH I 5 .   ? 25.249 -7.700  34.949 1.00 48.21  ? 157  HOH A O     1 
HETATM 2721 O  O     . HOH I 5 .   ? 16.076 2.766   22.829 1.00 56.08  ? 158  HOH A O     1 
HETATM 2722 O  O     . HOH I 5 .   ? 29.620 1.143   13.502 1.00 46.71  ? 159  HOH A O     1 
HETATM 2723 O  O     . HOH J 5 .   ? 15.496 -14.111 76.199 1.00 61.16  ? 146  HOH B O     1 
HETATM 2724 O  O     . HOH J 5 .   ? 36.034 0.158   49.640 1.00 31.94  ? 147  HOH B O     1 
HETATM 2725 O  O     . HOH J 5 .   ? 25.366 -10.048 54.276 1.00 47.67  ? 148  HOH B O     1 
HETATM 2726 O  O     . HOH J 5 .   ? 32.932 9.911   68.284 1.00 42.67  ? 149  HOH B O     1 
HETATM 2727 O  O     . HOH J 5 .   ? 36.631 3.065   49.399 1.00 47.25  ? 150  HOH B O     1 
HETATM 2728 O  O     . HOH J 5 .   ? 22.235 0.010   49.009 1.00 32.77  ? 151  HOH B O     1 
HETATM 2729 O  O     . HOH J 5 .   ? 29.509 -10.304 58.781 1.00 42.39  ? 152  HOH B O     1 
HETATM 2730 O  O     . HOH J 5 .   ? 46.521 1.914   65.563 1.00 55.91  ? 153  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1001 1001 DT  THY C . n 
A 1 2   DC  2   1002 1002 DC  CYT C . n 
A 1 3   DA  3   1003 1003 DA  ADE C . n 
A 1 4   DG  4   1004 1004 DG  GUA C . n 
A 1 5   DT  5   1005 1005 DT  THY C . n 
A 1 6   DC  6   1006 1006 DC  CYT C . n 
A 1 7   DT  7   1007 1007 DT  THY C . n 
A 1 8   DA  8   1008 1008 DA  ADE C . n 
A 1 9   DG  9   1009 1009 DG  GUA C . n 
A 1 10  DA  10  1010 1010 DA  ADE C . n 
A 1 11  DC  11  1011 1011 DC  CYT C . n 
A 1 12  DA  12  1012 1012 DA  ADE C . n 
A 1 13  DT  13  1013 1013 DT  THY C . n 
A 1 14  DA  14  1014 1014 DA  ADE C . n 
A 1 15  DC  15  1015 1015 DC  CYT C . n 
B 2 1   DG  1   2001 2001 DG  GUA D . n 
B 2 2   DT  2   2002 2002 DT  THY D . n 
B 2 3   DA  3   2003 2003 DA  ADE D . n 
B 2 4   DT  4   2004 2004 DT  THY D . n 
B 2 5   DG  5   2005 2005 DG  GUA D . n 
B 2 6   DT  6   2006 2006 DT  THY D . n 
B 2 7   DC  7   2007 2007 DC  CYT D . n 
B 2 8   DT  8   2008 2008 DT  THY D . n 
B 2 9   DA  9   2009 2009 DA  ADE D . n 
B 2 10  DG  10  2010 2010 DG  GUA D . n 
B 2 11  DA  11  2011 2011 DA  ADE D . n 
B 2 12  DC  12  2012 2012 DC  CYT D . n 
B 2 13  DT  13  2013 2013 DT  THY D . n 
B 2 14  DG  14  2014 2014 DG  GUA D . n 
B 2 15  DA  15  2015 2015 DA  ADE D . n 
C 3 1   MET 1   1    ?    ?   ?   A . n 
C 3 2   SER 2   2    ?    ?   ?   A . n 
C 3 3   SER 3   3    ?    ?   ?   A . n 
C 3 4   ILE 4   4    ?    ?   ?   A . n 
C 3 5   LEU 5   5    ?    ?   ?   A . n 
C 3 6   PRO 6   6    ?    ?   ?   A . n 
C 3 7   PHE 7   7    7    PHE PHE A . n 
C 3 8   THR 8   8    8    THR THR A . n 
C 3 9   PRO 9   9    9    PRO PRO A . n 
C 3 10  PRO 10  10   10   PRO PRO A . n 
C 3 11  ILE 11  11   11   ILE ILE A . n 
C 3 12  VAL 12  12   12   VAL VAL A . n 
C 3 13  LYS 13  13   13   LYS LYS A . n 
C 3 14  ARG 14  14   14   ARG ARG A . n 
C 3 15  LEU 15  15   15   LEU LEU A . n 
C 3 16  LEU 16  16   16   LEU LEU A . n 
C 3 17  GLY 17  17   17   GLY GLY A . n 
C 3 18  TRP 18  18   18   TRP TRP A . n 
C 3 19  LYS 19  19   19   LYS LYS A . n 
C 3 20  LYS 20  20   20   LYS LYS A . n 
C 3 21  GLY 21  21   21   GLY GLY A . n 
C 3 22  GLU 22  22   22   GLU GLU A . n 
C 3 23  GLN 23  23   23   GLN GLN A . n 
C 3 24  ASN 24  24   24   ASN ASN A . n 
C 3 25  GLY 25  25   25   GLY GLY A . n 
C 3 26  GLN 26  26   26   GLN GLN A . n 
C 3 27  GLU 27  27   27   GLU GLU A . n 
C 3 28  GLU 28  28   28   GLU GLU A . n 
C 3 29  LYS 29  29   29   LYS LYS A . n 
C 3 30  TRP 30  30   30   TRP TRP A . n 
C 3 31  CYS 31  31   31   CYS CYS A . n 
C 3 32  GLU 32  32   32   GLU GLU A . n 
C 3 33  LYS 33  33   33   LYS LYS A . n 
C 3 34  ALA 34  34   34   ALA ALA A . n 
C 3 35  VAL 35  35   35   VAL VAL A . n 
C 3 36  LYS 36  36   36   LYS LYS A . n 
C 3 37  SER 37  37   37   SER SER A . n 
C 3 38  LEU 38  38   38   LEU LEU A . n 
C 3 39  VAL 39  39   39   VAL VAL A . n 
C 3 40  LYS 40  40   40   LYS LYS A . n 
C 3 41  LYS 41  41   41   LYS LYS A . n 
C 3 42  LEU 42  42   42   LEU LEU A . n 
C 3 43  LYS 43  43   43   LYS LYS A . n 
C 3 44  LYS 44  44   44   LYS LYS A . n 
C 3 45  THR 45  45   45   THR THR A . n 
C 3 46  GLY 46  46   46   GLY GLY A . n 
C 3 47  GLN 47  47   47   GLN GLN A . n 
C 3 48  LEU 48  48   48   LEU LEU A . n 
C 3 49  ASP 49  49   49   ASP ASP A . n 
C 3 50  GLU 50  50   50   GLU GLU A . n 
C 3 51  LEU 51  51   51   LEU LEU A . n 
C 3 52  GLU 52  52   52   GLU GLU A . n 
C 3 53  LYS 53  53   53   LYS LYS A . n 
C 3 54  ALA 54  54   54   ALA ALA A . n 
C 3 55  ILE 55  55   55   ILE ILE A . n 
C 3 56  THR 56  56   56   THR THR A . n 
C 3 57  THR 57  57   57   THR THR A . n 
C 3 58  GLN 58  58   58   GLN GLN A . n 
C 3 59  ASN 59  59   59   ASN ASN A . n 
C 3 60  VAL 60  60   60   VAL VAL A . n 
C 3 61  ASN 61  61   61   ASN ASN A . n 
C 3 62  THR 62  62   62   THR THR A . n 
C 3 63  LYS 63  63   63   LYS LYS A . n 
C 3 64  CYS 64  64   64   CYS CYS A . n 
C 3 65  ILE 65  65   65   ILE ILE A . n 
C 3 66  THR 66  66   66   THR THR A . n 
C 3 67  ILE 67  67   67   ILE ILE A . n 
C 3 68  PRO 68  68   68   PRO PRO A . n 
C 3 69  ARG 69  69   69   ARG ARG A . n 
C 3 70  SER 70  70   70   SER SER A . n 
C 3 71  LEU 71  71   71   LEU LEU A . n 
C 3 72  ASP 72  72   72   ASP ASP A . n 
C 3 73  GLY 73  73   73   GLY GLY A . n 
C 3 74  ARG 74  74   74   ARG ARG A . n 
C 3 75  LEU 75  75   75   LEU LEU A . n 
C 3 76  GLN 76  76   76   GLN GLN A . n 
C 3 77  VAL 77  77   77   VAL VAL A . n 
C 3 78  SER 78  78   78   SER SER A . n 
C 3 79  HIS 79  79   79   HIS HIS A . n 
C 3 80  ARG 80  80   80   ARG ARG A . n 
C 3 81  LYS 81  81   81   LYS LYS A . n 
C 3 82  GLY 82  82   82   GLY GLY A . n 
C 3 83  LEU 83  83   83   LEU LEU A . n 
C 3 84  PRO 84  84   84   PRO PRO A . n 
C 3 85  HIS 85  85   85   HIS HIS A . n 
C 3 86  VAL 86  86   86   VAL VAL A . n 
C 3 87  ILE 87  87   87   ILE ILE A . n 
C 3 88  TYR 88  88   88   TYR TYR A . n 
C 3 89  CYS 89  89   89   CYS CYS A . n 
C 3 90  ARG 90  90   90   ARG ARG A . n 
C 3 91  LEU 91  91   91   LEU LEU A . n 
C 3 92  TRP 92  92   92   TRP TRP A . n 
C 3 93  ARG 93  93   93   ARG ARG A . n 
C 3 94  TRP 94  94   94   TRP TRP A . n 
C 3 95  PRO 95  95   95   PRO PRO A . n 
C 3 96  ASP 96  96   96   ASP ASP A . n 
C 3 97  LEU 97  97   97   LEU LEU A . n 
C 3 98  HIS 98  98   98   HIS HIS A . n 
C 3 99  SER 99  99   99   SER SER A . n 
C 3 100 HIS 100 100  100  HIS HIS A . n 
C 3 101 HIS 101 101  101  HIS HIS A . n 
C 3 102 GLU 102 102  102  GLU GLU A . n 
C 3 103 LEU 103 103  103  LEU LEU A . n 
C 3 104 ARG 104 104  104  ARG ARG A . n 
C 3 105 ALA 105 105  105  ALA ALA A . n 
C 3 106 MET 106 106  106  MET MET A . n 
C 3 107 GLU 107 107  107  GLU GLU A . n 
C 3 108 LEU 108 108  108  LEU LEU A . n 
C 3 109 CYS 109 109  109  CYS CYS A . n 
C 3 110 GLU 110 110  110  GLU GLU A . n 
C 3 111 PHE 111 111  111  PHE PHE A . n 
C 3 112 ALA 112 112  112  ALA ALA A . n 
C 3 113 PHE 113 113  113  PHE PHE A . n 
C 3 114 ASN 114 114  114  ASN ASN A . n 
C 3 115 MET 115 115  115  MET MET A . n 
C 3 116 LYS 116 116  116  LYS LYS A . n 
C 3 117 LYS 117 117  117  LYS LYS A . n 
C 3 118 ASP 118 118  118  ASP ASP A . n 
C 3 119 GLU 119 119  119  GLU GLU A . n 
C 3 120 VAL 120 120  120  VAL VAL A . n 
C 3 121 CYS 121 121  121  CYS CYS A . n 
C 3 122 VAL 122 122  122  VAL VAL A . n 
C 3 123 ASN 123 123  123  ASN ASN A . n 
C 3 124 PRO 124 124  124  PRO PRO A . n 
C 3 125 TYR 125 125  125  TYR TYR A . n 
C 3 126 HIS 126 126  126  HIS HIS A . n 
C 3 127 TYR 127 127  127  TYR TYR A . n 
C 3 128 GLN 128 128  128  GLN GLN A . n 
C 3 129 ARG 129 129  129  ARG ARG A . n 
C 3 130 VAL 130 130  130  VAL VAL A . n 
C 3 131 GLU 131 131  131  GLU GLU A . n 
C 3 132 THR 132 132  132  THR THR A . n 
C 3 133 PRO 133 133  ?    ?   ?   A . n 
C 3 134 VAL 134 134  ?    ?   ?   A . n 
C 3 135 LEU 135 135  ?    ?   ?   A . n 
C 3 136 PRO 136 136  ?    ?   ?   A . n 
C 3 137 PRO 137 137  ?    ?   ?   A . n 
C 3 138 VAL 138 138  ?    ?   ?   A . n 
C 3 139 LEU 139 139  ?    ?   ?   A . n 
C 3 140 VAL 140 140  ?    ?   ?   A . n 
C 3 141 PRO 141 141  ?    ?   ?   A . n 
C 3 142 ARG 142 142  ?    ?   ?   A . n 
C 3 143 HIS 143 143  ?    ?   ?   A . n 
C 3 144 THR 144 144  ?    ?   ?   A . n 
D 3 1   MET 1   1    ?    ?   ?   B . n 
D 3 2   SER 2   2    ?    ?   ?   B . n 
D 3 3   SER 3   3    ?    ?   ?   B . n 
D 3 4   ILE 4   4    ?    ?   ?   B . n 
D 3 5   LEU 5   5    ?    ?   ?   B . n 
D 3 6   PRO 6   6    ?    ?   ?   B . n 
D 3 7   PHE 7   7    ?    ?   ?   B . n 
D 3 8   THR 8   8    ?    ?   ?   B . n 
D 3 9   PRO 9   9    9    PRO PRO B . n 
D 3 10  PRO 10  10   10   PRO PRO B . n 
D 3 11  ILE 11  11   11   ILE ILE B . n 
D 3 12  VAL 12  12   12   VAL VAL B . n 
D 3 13  LYS 13  13   13   LYS LYS B . n 
D 3 14  ARG 14  14   14   ARG ARG B . n 
D 3 15  LEU 15  15   15   LEU LEU B . n 
D 3 16  LEU 16  16   16   LEU LEU B . n 
D 3 17  GLY 17  17   17   GLY GLY B . n 
D 3 18  TRP 18  18   18   TRP TRP B . n 
D 3 19  LYS 19  19   19   LYS LYS B . n 
D 3 20  LYS 20  20   20   LYS LYS B . n 
D 3 21  GLY 21  21   21   GLY GLY B . n 
D 3 22  GLU 22  22   22   GLU GLU B . n 
D 3 23  GLN 23  23   23   GLN GLN B . n 
D 3 24  ASN 24  24   24   ASN ASN B . n 
D 3 25  GLY 25  25   25   GLY GLY B . n 
D 3 26  GLN 26  26   26   GLN GLN B . n 
D 3 27  GLU 27  27   27   GLU GLU B . n 
D 3 28  GLU 28  28   28   GLU GLU B . n 
D 3 29  LYS 29  29   29   LYS LYS B . n 
D 3 30  TRP 30  30   30   TRP TRP B . n 
D 3 31  CYS 31  31   31   CYS CYS B . n 
D 3 32  GLU 32  32   32   GLU GLU B . n 
D 3 33  LYS 33  33   33   LYS LYS B . n 
D 3 34  ALA 34  34   34   ALA ALA B . n 
D 3 35  VAL 35  35   35   VAL VAL B . n 
D 3 36  LYS 36  36   36   LYS LYS B . n 
D 3 37  SER 37  37   37   SER SER B . n 
D 3 38  LEU 38  38   38   LEU LEU B . n 
D 3 39  VAL 39  39   39   VAL VAL B . n 
D 3 40  LYS 40  40   40   LYS LYS B . n 
D 3 41  LYS 41  41   41   LYS LYS B . n 
D 3 42  LEU 42  42   42   LEU LEU B . n 
D 3 43  LYS 43  43   43   LYS LYS B . n 
D 3 44  LYS 44  44   44   LYS LYS B . n 
D 3 45  THR 45  45   45   THR THR B . n 
D 3 46  GLY 46  46   46   GLY GLY B . n 
D 3 47  GLN 47  47   47   GLN GLN B . n 
D 3 48  LEU 48  48   48   LEU LEU B . n 
D 3 49  ASP 49  49   49   ASP ASP B . n 
D 3 50  GLU 50  50   50   GLU GLU B . n 
D 3 51  LEU 51  51   51   LEU LEU B . n 
D 3 52  GLU 52  52   52   GLU GLU B . n 
D 3 53  LYS 53  53   53   LYS LYS B . n 
D 3 54  ALA 54  54   54   ALA ALA B . n 
D 3 55  ILE 55  55   55   ILE ILE B . n 
D 3 56  THR 56  56   56   THR THR B . n 
D 3 57  THR 57  57   57   THR THR B . n 
D 3 58  GLN 58  58   58   GLN GLN B . n 
D 3 59  ASN 59  59   59   ASN ASN B . n 
D 3 60  VAL 60  60   60   VAL VAL B . n 
D 3 61  ASN 61  61   61   ASN ASN B . n 
D 3 62  THR 62  62   62   THR THR B . n 
D 3 63  LYS 63  63   63   LYS LYS B . n 
D 3 64  CYS 64  64   64   CYS CYS B . n 
D 3 65  ILE 65  65   65   ILE ILE B . n 
D 3 66  THR 66  66   66   THR THR B . n 
D 3 67  ILE 67  67   67   ILE ILE B . n 
D 3 68  PRO 68  68   68   PRO PRO B . n 
D 3 69  ARG 69  69   69   ARG ARG B . n 
D 3 70  SER 70  70   70   SER SER B . n 
D 3 71  LEU 71  71   71   LEU LEU B . n 
D 3 72  ASP 72  72   72   ASP ASP B . n 
D 3 73  GLY 73  73   73   GLY GLY B . n 
D 3 74  ARG 74  74   74   ARG ARG B . n 
D 3 75  LEU 75  75   75   LEU LEU B . n 
D 3 76  GLN 76  76   76   GLN GLN B . n 
D 3 77  VAL 77  77   77   VAL VAL B . n 
D 3 78  SER 78  78   78   SER SER B . n 
D 3 79  HIS 79  79   79   HIS HIS B . n 
D 3 80  ARG 80  80   80   ARG ARG B . n 
D 3 81  LYS 81  81   81   LYS LYS B . n 
D 3 82  GLY 82  82   82   GLY GLY B . n 
D 3 83  LEU 83  83   83   LEU LEU B . n 
D 3 84  PRO 84  84   84   PRO PRO B . n 
D 3 85  HIS 85  85   85   HIS HIS B . n 
D 3 86  VAL 86  86   86   VAL VAL B . n 
D 3 87  ILE 87  87   87   ILE ILE B . n 
D 3 88  TYR 88  88   88   TYR TYR B . n 
D 3 89  CYS 89  89   89   CYS CYS B . n 
D 3 90  ARG 90  90   90   ARG ARG B . n 
D 3 91  LEU 91  91   91   LEU LEU B . n 
D 3 92  TRP 92  92   92   TRP TRP B . n 
D 3 93  ARG 93  93   93   ARG ARG B . n 
D 3 94  TRP 94  94   94   TRP TRP B . n 
D 3 95  PRO 95  95   95   PRO PRO B . n 
D 3 96  ASP 96  96   96   ASP ASP B . n 
D 3 97  LEU 97  97   97   LEU LEU B . n 
D 3 98  HIS 98  98   98   HIS HIS B . n 
D 3 99  SER 99  99   99   SER SER B . n 
D 3 100 HIS 100 100  100  HIS HIS B . n 
D 3 101 HIS 101 101  101  HIS HIS B . n 
D 3 102 GLU 102 102  102  GLU GLU B . n 
D 3 103 LEU 103 103  103  LEU LEU B . n 
D 3 104 ARG 104 104  104  ARG ARG B . n 
D 3 105 ALA 105 105  105  ALA ALA B . n 
D 3 106 MET 106 106  106  MET MET B . n 
D 3 107 GLU 107 107  107  GLU GLU B . n 
D 3 108 LEU 108 108  108  LEU LEU B . n 
D 3 109 CYS 109 109  109  CYS CYS B . n 
D 3 110 GLU 110 110  110  GLU GLU B . n 
D 3 111 PHE 111 111  111  PHE PHE B . n 
D 3 112 ALA 112 112  112  ALA ALA B . n 
D 3 113 PHE 113 113  113  PHE PHE B . n 
D 3 114 ASN 114 114  114  ASN ASN B . n 
D 3 115 MET 115 115  115  MET MET B . n 
D 3 116 LYS 116 116  116  LYS LYS B . n 
D 3 117 LYS 117 117  117  LYS LYS B . n 
D 3 118 ASP 118 118  118  ASP ASP B . n 
D 3 119 GLU 119 119  119  GLU GLU B . n 
D 3 120 VAL 120 120  120  VAL VAL B . n 
D 3 121 CYS 121 121  121  CYS CYS B . n 
D 3 122 VAL 122 122  122  VAL VAL B . n 
D 3 123 ASN 123 123  123  ASN ASN B . n 
D 3 124 PRO 124 124  124  PRO PRO B . n 
D 3 125 TYR 125 125  125  TYR TYR B . n 
D 3 126 HIS 126 126  126  HIS HIS B . n 
D 3 127 TYR 127 127  127  TYR TYR B . n 
D 3 128 GLN 128 128  128  GLN GLN B . n 
D 3 129 ARG 129 129  129  ARG ARG B . n 
D 3 130 VAL 130 130  130  VAL VAL B . n 
D 3 131 GLU 131 131  131  GLU GLU B . n 
D 3 132 THR 132 132  132  THR THR B . n 
D 3 133 PRO 133 133  ?    ?   ?   B . n 
D 3 134 VAL 134 134  ?    ?   ?   B . n 
D 3 135 LEU 135 135  ?    ?   ?   B . n 
D 3 136 PRO 136 136  ?    ?   ?   B . n 
D 3 137 PRO 137 137  ?    ?   ?   B . n 
D 3 138 VAL 138 138  ?    ?   ?   B . n 
D 3 139 LEU 139 139  ?    ?   ?   B . n 
D 3 140 VAL 140 140  ?    ?   ?   B . n 
D 3 141 PRO 141 141  ?    ?   ?   B . n 
D 3 142 ARG 142 142  ?    ?   ?   B . n 
D 3 143 HIS 143 143  ?    ?   ?   B . n 
D 3 144 THR 144 144  ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  145 1  ZN  ZN2 A . 
F 4 ZN  1  145 2  ZN  ZN2 B . 
G 5 HOH 1  8   8  HOH TIP C . 
G 5 HOH 2  15  15 HOH TIP C . 
G 5 HOH 3  21  21 HOH TIP C . 
G 5 HOH 4  23  23 HOH TIP C . 
G 5 HOH 5  26  26 HOH TIP C . 
G 5 HOH 6  27  27 HOH TIP C . 
G 5 HOH 7  34  34 HOH TIP C . 
G 5 HOH 8  35  35 HOH TIP C . 
G 5 HOH 9  38  38 HOH TIP C . 
G 5 HOH 10 41  41 HOH TIP C . 
H 5 HOH 1  1   1  HOH TIP D . 
H 5 HOH 2  2   2  HOH TIP D . 
H 5 HOH 3  4   4  HOH TIP D . 
H 5 HOH 4  6   6  HOH TIP D . 
H 5 HOH 5  9   9  HOH TIP D . 
H 5 HOH 6  10  10 HOH TIP D . 
H 5 HOH 7  11  11 HOH TIP D . 
H 5 HOH 8  14  14 HOH TIP D . 
H 5 HOH 9  18  18 HOH TIP D . 
H 5 HOH 10 19  19 HOH TIP D . 
H 5 HOH 11 20  20 HOH TIP D . 
H 5 HOH 12 31  31 HOH TIP D . 
H 5 HOH 13 33  33 HOH TIP D . 
H 5 HOH 14 37  37 HOH TIP D . 
H 5 HOH 15 46  46 HOH TIP D . 
I 5 HOH 1  146 3  HOH TIP A . 
I 5 HOH 2  147 5  HOH TIP A . 
I 5 HOH 3  148 13 HOH TIP A . 
I 5 HOH 4  149 16 HOH TIP A . 
I 5 HOH 5  150 17 HOH TIP A . 
I 5 HOH 6  151 22 HOH TIP A . 
I 5 HOH 7  152 25 HOH TIP A . 
I 5 HOH 8  153 28 HOH TIP A . 
I 5 HOH 9  154 29 HOH TIP A . 
I 5 HOH 10 155 36 HOH TIP A . 
I 5 HOH 11 156 40 HOH TIP A . 
I 5 HOH 12 157 42 HOH TIP A . 
I 5 HOH 13 158 44 HOH TIP A . 
I 5 HOH 14 159 45 HOH TIP A . 
J 5 HOH 1  146 7  HOH TIP B . 
J 5 HOH 2  147 12 HOH TIP B . 
J 5 HOH 3  148 24 HOH TIP B . 
J 5 HOH 4  149 30 HOH TIP B . 
J 5 HOH 5  150 32 HOH TIP B . 
J 5 HOH 6  151 39 HOH TIP B . 
J 5 HOH 7  152 43 HOH TIP B . 
J 5 HOH 8  153 47 HOH TIP B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? C HIS 126 ? A HIS 126 ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 121 ? A CYS 121 ? 1_555 98.7  ? 
2  ND1 ? C HIS 126 ? A HIS 126 ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 64  ? A CYS 64  ? 1_555 113.6 ? 
3  SG  ? C CYS 121 ? A CYS 121 ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 64  ? A CYS 64  ? 1_555 105.6 ? 
4  ND1 ? C HIS 126 ? A HIS 126 ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 109 ? A CYS 109 ? 1_555 119.1 ? 
5  SG  ? C CYS 121 ? A CYS 121 ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 109 ? A CYS 109 ? 1_555 109.0 ? 
6  SG  ? C CYS 64  ? A CYS 64  ? 1_555 ZN ? E ZN . ? A ZN 145 ? 1_555 SG  ? C CYS 109 ? A CYS 109 ? 1_555 109.4 ? 
7  SG  ? D CYS 121 ? B CYS 121 ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 ND1 ? D HIS 126 ? B HIS 126 ? 1_555 93.9  ? 
8  SG  ? D CYS 121 ? B CYS 121 ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 SG  ? D CYS 64  ? B CYS 64  ? 1_555 107.8 ? 
9  ND1 ? D HIS 126 ? B HIS 126 ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 SG  ? D CYS 64  ? B CYS 64  ? 1_555 109.8 ? 
10 SG  ? D CYS 121 ? B CYS 121 ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 SG  ? D CYS 109 ? B CYS 109 ? 1_555 105.7 ? 
11 ND1 ? D HIS 126 ? B HIS 126 ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 SG  ? D CYS 109 ? B CYS 109 ? 1_555 115.6 ? 
12 SG  ? D CYS 64  ? B CYS 64  ? 1_555 ZN ? F ZN . ? B ZN 145 ? 1_555 SG  ? D CYS 109 ? B CYS 109 ? 1_555 120.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-23 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 9   ? ? -15.08  128.61  
2  1 LYS A 19  ? ? 84.41   85.09   
3  1 GLU A 22  ? ? 11.17   70.52   
4  1 GLN A 23  ? ? 31.41   -148.22 
5  1 ASN A 24  ? ? 82.59   76.57   
6  1 SER A 78  ? ? 62.60   -114.95 
7  1 ARG A 93  ? ? -121.13 -78.39  
8  1 LEU A 97  ? ? -39.78  130.67  
9  1 HIS A 98  ? ? -105.23 -60.87  
10 1 ARG A 104 ? ? -170.30 125.38  
11 1 GLU A 107 ? ? -57.89  105.47  
12 1 LEU A 108 ? ? 155.76  -27.47  
13 1 ALA A 112 ? ? -47.88  154.83  
14 1 LYS A 116 ? ? 23.42   83.57   
15 1 PRO B 10  ? ? -63.45  -103.48 
16 1 LYS B 19  ? ? 157.74  167.45  
17 1 GLU B 22  ? ? 24.00   75.08   
18 1 GLN B 23  ? ? -105.98 75.47   
19 1 ASN B 24  ? ? -64.85  -154.12 
20 1 GLN B 58  ? ? 46.89   26.36   
21 1 ASN B 61  ? ? -69.90  28.15   
22 1 SER B 78  ? ? 66.96   -121.44 
23 1 ARG B 93  ? ? -130.20 -58.60  
24 1 LYS B 117 ? ? -78.29  -166.68 
25 1 GLU B 131 ? ? -74.67  21.52   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     125 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.068 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? C MET 1   
2  1 Y 1 A SER 2   ? C SER 2   
3  1 Y 1 A SER 3   ? C SER 3   
4  1 Y 1 A ILE 4   ? C ILE 4   
5  1 Y 1 A LEU 5   ? C LEU 5   
6  1 Y 1 A PRO 6   ? C PRO 6   
7  1 Y 1 A PRO 133 ? C PRO 133 
8  1 Y 1 A VAL 134 ? C VAL 134 
9  1 Y 1 A LEU 135 ? C LEU 135 
10 1 Y 1 A PRO 136 ? C PRO 136 
11 1 Y 1 A PRO 137 ? C PRO 137 
12 1 Y 1 A VAL 138 ? C VAL 138 
13 1 Y 1 A LEU 139 ? C LEU 139 
14 1 Y 1 A VAL 140 ? C VAL 140 
15 1 Y 1 A PRO 141 ? C PRO 141 
16 1 Y 1 A ARG 142 ? C ARG 142 
17 1 Y 1 A HIS 143 ? C HIS 143 
18 1 Y 1 A THR 144 ? C THR 144 
19 1 Y 1 B MET 1   ? D MET 1   
20 1 Y 1 B SER 2   ? D SER 2   
21 1 Y 1 B SER 3   ? D SER 3   
22 1 Y 1 B ILE 4   ? D ILE 4   
23 1 Y 1 B LEU 5   ? D LEU 5   
24 1 Y 1 B PRO 6   ? D PRO 6   
25 1 Y 1 B PHE 7   ? D PHE 7   
26 1 Y 1 B THR 8   ? D THR 8   
27 1 Y 1 B PRO 133 ? D PRO 133 
28 1 Y 1 B VAL 134 ? D VAL 134 
29 1 Y 1 B LEU 135 ? D LEU 135 
30 1 Y 1 B PRO 136 ? D PRO 136 
31 1 Y 1 B PRO 137 ? D PRO 137 
32 1 Y 1 B VAL 138 ? D VAL 138 
33 1 Y 1 B LEU 139 ? D LEU 139 
34 1 Y 1 B VAL 140 ? D VAL 140 
35 1 Y 1 B PRO 141 ? D PRO 141 
36 1 Y 1 B ARG 142 ? D ARG 142 
37 1 Y 1 B HIS 143 ? D HIS 143 
38 1 Y 1 B THR 144 ? D THR 144 
# 
_ndb_struct_conf_na.entry_id   1OZJ 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 15 1_555 -1.370 -0.271 0.107  -10.956 -12.170 1.815   1  C_DT1001:DA2015_D C 1001 ? D 2015 ? 20 1 
1 A DC 2  1_555 B DG 14 1_555 0.125  -0.092 0.025  -4.664  -5.369  -4.935  2  C_DC1002:DG2014_D C 1002 ? D 2014 ? 19 1 
1 A DA 3  1_555 B DT 13 1_555 -0.191 -0.023 0.079  6.722   -2.540  4.646   3  C_DA1003:DT2013_D C 1003 ? D 2013 ? 20 1 
1 A DG 4  1_555 B DC 12 1_555 -0.364 -0.128 0.123  4.858   -10.359 3.973   4  C_DG1004:DC2012_D C 1004 ? D 2012 ? 19 1 
1 A DT 5  1_555 B DA 11 1_555 -0.133 -0.249 -0.073 -5.225  -18.104 -1.368  5  C_DT1005:DA2011_D C 1005 ? D 2011 ? 20 1 
1 A DC 6  1_555 B DG 10 1_555 0.190  -0.177 0.191  -9.055  -10.852 -3.254  6  C_DC1006:DG2010_D C 1006 ? D 2010 ? 19 1 
1 A DT 7  1_555 B DA 9  1_555 0.081  -0.065 0.022  -7.006  -11.926 -2.867  7  C_DT1007:DA2009_D C 1007 ? D 2009 ? 20 1 
1 A DA 8  1_555 B DT 8  1_555 0.001  -0.044 -0.195 2.311   -11.938 -3.945  8  C_DA1008:DT2008_D C 1008 ? D 2008 ? 20 1 
1 A DG 9  1_555 B DC 7  1_555 -0.268 -0.156 0.101  8.980   -11.643 -2.136  9  C_DG1009:DC2007_D C 1009 ? D 2007 ? 19 1 
1 A DA 10 1_555 B DT 6  1_555 0.250  -0.082 -0.007 -2.695  -11.048 -2.507  10 C_DA1010:DT2006_D C 1010 ? D 2006 ? 20 1 
1 A DC 11 1_555 B DG 5  1_555 0.058  -0.293 0.056  0.085   -5.360  -0.939  11 C_DC1011:DG2005_D C 1011 ? D 2005 ? 19 1 
1 A DA 12 1_555 B DT 4  1_555 -0.074 -0.208 -0.195 -1.710  0.805   -5.736  12 C_DA1012:DT2004_D C 1012 ? D 2004 ? 20 1 
1 A DT 13 1_555 B DA 3  1_555 0.564  -0.115 0.004  7.356   -5.178  7.969   13 C_DT1013:DA2003_D C 1013 ? D 2003 ? 20 1 
1 A DA 14 1_555 B DT 2  1_555 0.202  -0.242 -0.391 2.368   -8.611  -2.109  14 C_DA1014:DT2002_D C 1014 ? D 2002 ? 20 1 
1 A DC 15 1_555 B DG 1  1_555 -0.558 3.292  -0.758 -11.739 -7.138  -86.838 15 C_DC1015:DG2001_D C 1015 ? D 2001 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 15 1_555 A DC 2  1_555 B DG 14 1_555 -0.075 0.214  3.325 1.341  2.457  43.663 0.049  0.231  3.328 3.299   
-1.801 43.749 1  CC_DT1001DC1002:DG2014DA2015_DD C 1001 ? D 2015 ? C 1002 ? D 2014 ? 
1 A DC 2  1_555 B DG 14 1_555 A DA 3  1_555 B DT 13 1_555 0.714  0.423  3.140 0.083  3.271  29.368 0.158  -1.383 3.170 6.427   
-0.163 29.546 2  CC_DC1002DA1003:DT2013DG2014_DD C 1002 ? D 2014 ? C 1003 ? D 2013 ? 
1 A DA 3  1_555 B DT 13 1_555 A DG 4  1_555 B DC 12 1_555 -0.301 -0.462 3.254 -1.723 7.224  32.581 -1.981 0.243  3.095 12.672  
3.023  33.394 3  CC_DA1003DG1004:DC2012DT2013_DD C 1003 ? D 2013 ? C 1004 ? D 2012 ? 
1 A DG 4  1_555 B DC 12 1_555 A DT 5  1_555 B DA 11 1_555 -0.958 -0.740 3.547 -0.272 3.441  34.915 -1.782 1.546  3.468 5.717   
0.452  35.080 4  CC_DG1004DT1005:DA2011DC2012_DD C 1004 ? D 2012 ? C 1005 ? D 2011 ? 
1 A DT 5  1_555 B DA 11 1_555 A DC 6  1_555 B DG 10 1_555 -0.143 -0.266 3.385 -1.545 2.804  37.915 -0.776 0.016  3.361 4.307   
2.372  38.045 5  CC_DT1005DC1006:DG2010DA2011_DD C 1005 ? D 2011 ? C 1006 ? D 2010 ? 
1 A DC 6  1_555 B DG 10 1_555 A DT 7  1_555 B DA 9  1_555 -0.264 0.322  3.289 3.822  7.247  28.241 -0.942 1.353  3.208 14.472  
-7.632 29.383 6  CC_DC1006DT1007:DA2009DG2010_DD C 1006 ? D 2010 ? C 1007 ? D 2009 ? 
1 A DT 7  1_555 B DA 9  1_555 A DA 8  1_555 B DT 8  1_555 -0.070 2.733  3.023 0.047  -9.135 51.268 3.638  0.082  2.535 -10.462 
-0.054 52.021 7  CC_DT1007DA1008:DT2008DA2009_DD C 1007 ? D 2009 ? C 1008 ? D 2008 ? 
1 A DA 8  1_555 B DT 8  1_555 A DG 9  1_555 B DC 7  1_555 0.316  0.324  3.156 -3.146 6.461  28.638 -0.700 -1.272 3.101 12.809  
6.238  29.508 8  CC_DA1008DG1009:DC2007DT2008_DD C 1008 ? D 2008 ? C 1009 ? D 2007 ? 
1 A DG 9  1_555 B DC 7  1_555 A DA 10 1_555 B DT 6  1_555 0.026  -0.093 3.584 -0.786 5.966  37.109 -0.995 -0.153 3.526 9.299   
1.225  37.577 9  CC_DG1009DA1010:DT2006DC2007_DD C 1009 ? D 2007 ? C 1010 ? D 2006 ? 
1 A DA 10 1_555 B DT 6  1_555 A DC 11 1_555 B DG 5  1_555 0.797  -0.923 3.269 -0.380 3.389  31.881 -2.271 -1.510 3.147 6.148   
0.689  32.059 10 CC_DA1010DC1011:DG2005DT2006_DD C 1010 ? D 2006 ? C 1011 ? D 2005 ? 
1 A DC 11 1_555 B DG 5  1_555 A DA 12 1_555 B DT 4  1_555 0.212  -0.060 3.332 3.217  9.893  33.325 -1.633 0.146  3.192 16.751  
-5.448 34.867 11 CC_DC1011DA1012:DT2004DG2005_DD C 1011 ? D 2005 ? C 1012 ? D 2004 ? 
1 A DA 12 1_555 B DT 4  1_555 A DT 13 1_555 B DA 3  1_555 0.615  -0.957 3.174 -0.643 3.382  28.761 -2.626 -1.364 3.030 6.778   
1.289  28.962 12 CC_DA1012DT1013:DA2003DT2004_DD C 1012 ? D 2004 ? C 1013 ? D 2003 ? 
1 A DT 13 1_555 B DA 3  1_555 A DA 14 1_555 B DT 2  1_555 -0.524 -0.487 3.460 3.781  11.467 29.865 -2.981 1.638  2.989 21.193  
-6.988 32.162 13 CC_DT1013DA1014:DT2002DA2003_DD C 1013 ? D 2003 ? C 1014 ? D 2002 ? 
1 A DA 14 1_555 B DT 2  1_555 A DC 15 1_555 B DG 1  1_555 1.195  -1.857 3.164 9.245  9.737  77.634 -1.723 -0.699 3.056 7.713   
-7.323 78.606 14 CC_DA1014DC1015:DG2001DT2002_DD C 1014 ? D 2002 ? C 1015 ? D 2001 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#